4RUEA

Human k2p4.1 (traak) potassium channel, g124i mutant
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
259
structure length
251
Chain Sequence
PGRAMRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPEHSAWDLGSAFFFSITIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel subfamily K member 4
publication title Transmembrane Helix Straightening and Buckling Underlies Activation of Mechanosensitive and Thermosensitive K2P Channels.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 74
structure length 251
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4rueA00
4JTDB 5EBLC 2HG5C 4LCUC 4MVZA 1JVMA 2EINC 3F5WC 5CBFA 4H37A 3BEHA 4QNHB 4R8CA 2K1EA 4HYOA 3ABMC 3R65A 4MTGA 1V54C 2WLLA 3K04A 4X8AA 2ITDC 3SPHA 4F4LA 2IH1C 2DWEC 3RVYA 2X6AA 3ABKC 3JYCA 3OUFA 4BW5A 3T4DA 2Q67A 2WLLB 4MTFA 5EK0A 3E86A 2EIKC 3STLC 1R3IC 3SYPA 2DYSC 2WLIA 5J9PC 3SPJA 3KG2A 2A79B 3AG4C 1K4CC 2QKSA 5CBHA 3SPIA 1M56C 1LNQA 2QTOA 4ZBMA 4P2ZA 2Q68A 2X6CA 3SYOA 3X2QC 1QLEC 3SPGA 3SYAA 4MVRA 4WFFA 2BOBC 2Q69A 4MW8A 5EBWC 4RO2A 4I9WA 4P9PA 2DWDC 3E8HA 3K06A 2HVJC 3GB7C 3HPLC 4G27B 3SYCA 2WLHA 4DXWA 4GX2A 4XDKA 3SPCA 3RVZA 3WG7C 2Y69C 4P30A 2WLMA 1M57C 2A9HA 4X88A 3UKMA 2Q6AA 4PA4A 4RUFA 5B1AC 4LP8A 3E8FA 4RUEA 2HVKC 3IFXA 4PDMA 4QE7A 4UUJC 2EIMC 1P7BA 2DYRC 5B1BC 4CBCA 2X6BA 3FB8C 5IY5C 3T2MA 4R50A 4GX1A 1K4DC 1J95A 2WLIB 4GX5A 4MVOA 3ABLC 3AG1C 4PA3A 4PDVA 4OXSA 5KUMA 4MTOA 3UM7A 3FB7C 4PA6A 1KKDA 2H8PC 4KFMA 3IGAC 4X89A 1G4YB 1OCRC 1ZWIC 2AHYA 3E8BA 3T1CA 3E8GA 4G28B 2ATKC 2HFEC 3K0GA 4J9YB 1OCCC 2HJFC 3LDEA 4XDLA 1OCOC 1R3LC 3K03A 4JTCB 3FB6C 4P9OA 2W0FC 3F7YC 3OR7C 4MVSA 5KUKA 4RAIA 4TWKA 4QE9A 3STZC 3ASOC 2R9RB 3FB5C 4GX0A 3ZRSA 3F7VC 4R7CA 4JTAB 4LBEC 3RBZA 2ZD9A 4MVUA 2ZXWC 4WFEA 2WLNA 4J9ZB 2WLJA 2AHZA 3K0DA 1R3JC 4WFGA 2IH3C 2BOCC 5BZBA 4PA9A 2A0LA 1ORQC 2KB1A 3LDDA 3TETA 1OCZC 1S5HC 3E83A 3E89A 5EC1C 5B3SC 5CBGA 1BL8A 4XDJA 2P7TC 4MVMA 4MW3A 3LUTB 5EBMC 2JK5C 3PJSK 2WLKA 3AG2C 2EIJC 4MS2A 2OCCC 4PDLA 4R6ZA 2EILC 4PDRA 3SJQC 2YEVA 5E1AC 3OR6C 4MSWC 3LDCA 4WFHA 2NLJC 3SYQA 3K08A 3VOUA 2ITCC 4H33A 3OUSA 1XL6A 4HZ3A 3AG3C 1XL4A 3EFFK 3TCUA 3OGCC 3ASNC 3T4ZA 4PA7A 4MVQA 5EC2C 1V55C 3RW0A 1R3KC 3LNMB 4EKWA 3ZJZA
chains in the Genus database with same CATH superfamily
5GONA 5EYPB 4TT3G 1F7YA 1K5QA 2YXHA 4DRXB 2K1EA 3ABMC 1AROP 1YF2A 3K58A 3FYIB 3HB3B 4KL1A 5CA0B 1GN2A 3MDSA 2UXCB 1PL0A 1NR7A 1E1QG 5BMVB 4GUNA 1QLEC 3CXCU 4NTYA 4K0KB 5FPRA 1XNRB 4JV5O 2O57A 1Y76B 1KD1W 4DR1B 1AI7A 3DXRA 5BY1A 2CH7A 5CB4A 4JI5B 5FNVB 2WA3A 1JQ0A 3LSSA 2EJRA 3T2MA 1VF6C 2KG7A 5CA1A 3ZHSA 2DQ0A 3CCLV 3C3SA 1J5EO 4NXMB 3WG7B 2LFSA 4YJ3B 4JI1O 3Q4HB 4X64O 2ZE7A 1CPYA 2Q5ZA 1R6KA 4I4TB 4W4LA 1HNZO 1VIBA 4LNUB 4FLUA 4O4HB 3STZC 1VQ9V 1ZTEA 3ASOC 3OTFA 4GX0A 1COWG 3E89A 3SJBC 2HHHO 4TV8A 3WB2A 2QEXV 3CYOA 4MS2A 4JYCA 1SQBH 3JALB 4HAMA 3JAKB 4UVBA 4YJ2B 1KC8W 2Z5UA 1WP7A 1M90W 2OWOA 4PELA 1NS1A 4MVOA 5EIBC 3ZJZA 2LFRA 2GDSA 1WLEA 4J7KA 2E3CA 3JASA 4WFAV 3B8MA 4FZ0A 4IHJA 4JAVA 2QM7A 3AG4B 2JIZG 2QA4V 4JI1B 3SYPA 2N74A 1SZTA 5LOVA 3AG4C 3MAQA 1KQSU 2Q69A 1V54B 2QWPB 1K92A 5B5EZ 1OV9A 1FFXA 1HNWO 3W7SA 4LF8O 3AK2A 3TXQA 2XT9A 1NVPB 4PHZA 1F4NA 4XDKA 1US6A 2HKOA 4XBFA 1XI1A 2D2CB 3X2QB 2KQXA 4LP8A 2V4DA 1IXMA 4LFBO 5B1BC 2X6BA 4BW9A 4TSFG 2P90A 4NYKA 4PA3A 1AVMA 1XMQB 2IW5A 1MZFA 2IJJA 4KFMA 3ZMVA 2NR5A 4FFBA 1IXBA 1F51A 5D5PA 4CS3A 1GN3A 2ATKC 1AR5A 1TUBB 2IBZH 1Y4MA 4CH3A 1OCOC 2DW4A 1XUQA 4DV4O 2ZNJA 3UO3A 2YIBA 4OX9O 2OT5A 3ZHVA 1SQXH 3FB5C 2CGOA 1NH2B 3JSLA 3LDDA 2BTQA 4JI2B 1HP8A 3L73H 3L74H 1NTZH 2Q7GA 5D5QA 1AR1B 2OYQA 4H13B 4DR5O 1HNWB 1GKFA 5LYJA 4LF8B 3SYQA 1WA8A 2NLJC 3FYEB 1K33A 3LSUA 1KB9F 1TA8A 2UXBB 3A0BZ 1F4MA 2L6LA 2ZE6A 3OEEG 1VQLV 1HNXB 3U11A 2JS5A 5LXTA 1K97A 3W7XA 4OPHA 2QJ1A 5HFMA 4LF6B 4FLYA 3ABKB 2WSSG 3CEIA 1AJQA 1GAXA 1H8EG 1Q43A 4QNHB 2JVDA 3OT7A 4FPPA 4BW5A 3ABKC 3B8NA 3T4DA 3E86A 2EIKC 4AQYO 1L0NH 1PNMA 1SQVH 1FS0G 4B3SO 3KG2A 1NKDA 3JAWB 1K4CC 1GM9A 2XAJA 5LOVB 4DV4B 4DV7O 4ICGA 4OX9B 2BOBC 5L3BA 4FIPC 4P9PA 3JD4A 4U7OA 1XHXA 4LR3A 4G27B 4H44B 1Y66A 4UVAA 1W0JG 4IYHA 4DR2O 4AHCA 4FLZA 1O9HA 1SQPH 3W7WA 4TUYB 2M7WA 3A0RA 1SA0A 5F2VO 2YUAA 1QQCA 3JAMN 1JPXA 1CP9A 5ITZA 2D3OW 2N05A 1RPOA 4U3FH 2DMXA 5DN6G 2JEUA 3THOA 2RMKB 5EZYB 2IM9A 3RYCB 3KZIZ 1IDSA 5L3GA 1SKVA 5LHGA 2Y48A 4AQYB 1N34O 4R7CA 4B3SB 4NTWA 1I5YA 2WLJA 5BZBA 3TETA 5CBGA 1YI2V 3QO8A 1Q3EA 3SJAC 1BQZA 2BTQB 3ZMSA 2UUAO 2GTSA 2P22C 3CCUV 4F6RA 4DR6O 5BXZA 4J10A 1XL4A 1ZL8B 2OTJV 4MVQA 1V55C 3RYIB 4FLVA 4JTDB 5EBLC 2PI4A 1RM1C 1WNSA 1YCIA 3TXSA 2CTPA 3K04A 4YY3B 1WPBA 1W59A 2IH1C 4GT1A 1VQMV 2H3OA 3H1JH 2Q67A 5LP6A 5J9PC 4WBNA 2UXNA 2GUZB 3SYOA 4QPJA 3U0ZA 2WPDG 2CDYA 1FYJA 5LGTA 3H1HH 4AI8A 1VQ8V 1KU9A 5IE9A 4GKJO 4UV8A 3CCQV 3JATA 1J95A 3DSQA 3CCMV 4DR6B 4LF5O 1FAFA 4DV2B 1D5NA 2XOKG 2JEXA 2Q7HA 5JVDB 1I0HA 2AZ2A 3CCRV 1B3QA 2YXLA 4TV9A 1S77D 1BQ0A 4CH6A 3HKCB 2LO1A 2ZXWC 1PD3A 4X1YA 1ORQC 3HKBB 2P7TC 4MVMA 5KA6A 4FFKA 1R1BA 4R6ZA 4B3MO 4EB6A 4OGQB 3AG3B 1VQ6V 1W0KG 1XL6A 1VARA 1AILA 3AG3C 1I7FA 3SDLA 3ZIAG 2ARHA 4KHPO 3L75H 3QNEA 1XNQB 1Y74B 4MVZA 4UCVA 3WU2Z 1V9PA 5IJ9B 2OTLV 3CRQA 2KSDA 4UCUA 1TAEA 5GTHZ 3OGIB 4DYLA 5DECA 3CMAV 1H2GA 2A79B 4L87A 2E75B 1N36O 1TVKA 4DR4B 3SPGA 4WBNB 5LP6C 1THZA 2UXXA 4O4JB 2PGGA 1H8HG 2B1IA 2Y0PA 3E8HA 3K06A 5C8YA 3TGUH 3R66A 2A9HA 1BSMA 2YSUB 2RQ6A 4DK0A 3SGIA 4PDMA 4Q20A 2IJIA 2EIMC 1VP7A 1YVWA 1AI5A 2ETNA 2FKXA 3P30A 1NTMH 1QBZA 3JATB 3JD2A 3FB7C 5J2UB 1FD9A 2Y4UA 1BT8A 4X89A 1ZUQA 3H01A 4E2LA 3ZMZA 3DTUB 2ZT9B 4N21A 4XDLA 1S76D 1TGOA 1MMMA 3ZN1A 1L1FA 3RBZA 3ZHTA 4TV9B 3QVNA 5KAFZ 4Q6GA 5B3SC 3CC2V 1OHHG 2JK5C 4FVMA 2UU9B 5LHHA 1H2KA 4HNAB 3ZMTA 4JI8O 4WFHA 4JYAO 3VOUA 3CD6V 4JPRA 3OUSA 3RT3C 3HKDA 5IT9N 2P6JA 3IC9A 4X1KB 3T4ZA 3CP1A 1IX9A 2XUMA 4B7KA 2UUBB 4I9QA 4H37A 3T1HB 3C90A 3CHXA 2WA4A 3P3NA 3VQVA 4DR3O 2PZSA 5A2QN 2FTKA 1FKAO 1SQFA 3FFQA 1Q6IA 4ZIBA 2PYJA 2ZE8A 4DUYO 3K9SA 3ABMB 3K5MA 4RO2A 5KA5A 4PI0A 1JOYA 3K59A 4QIWF 3CMEV 2M6YA 3BFRA 3UKMA 4ZOLB 4I50A 5BR8O 1QLEB 4CBCA 1MSWD 3ABLC 4JYAB 4PI2A 3W7TA 4H0LB 3J7AU 3CE2A 2LGWA 1P49A 2KKWA 2PI5A 1URFA 4MTXA 4DV5O 4B3TO 2BTOA 3N2KA 2JJ2G 4NB5A 3I5DA 3A8TA 4DV0O 2DE0X 5CN0A 3WB1A 4JTCB 5JH7B 3ZRWB 4ZI7A 4GCZA 3ZRSA 1VQPV 3W7UA 3LNNA 1L0LH 2BCCH 2AW9A 4U3JA 1JA8A 1SF9A 3CCVV 2OCCC 1RPRA 3MHSC 4TQFA 1EBOA 2CTWA 3ASOB 4CS4A 1MG1A 2BSKB 3CRRA 4JI3O 5BR8B 2OCHA 5H6RA 3HKDB 3K57A 5JQGB 3M99B 5KHGA 1XMOO 1Z5VA 2IU3A 5IJ0B 4FMTA 4PJ0Z 3DGEA 1QHTA 4FK5C 4DUZO 1SZXA 2JGUA 1PPJH 4LF7O 3CX5F 4DV5B 4B3TB 4JV5B 2QTSA 4JYYA 4DV0B 2CE4A 5JWPA 2P67A 2Q68A 4ASUG 1BE3H 1PNLA 2CUGA 2EULA 4O2AA 5KMGA 3OW2U 2GSMB 2QKAA 5GONB 2A3QA 3HPLC 1XQ8A 3H1KH 3ETDA 2F1MA 1XDCA 2F93B 5LGNA 1J5EB 1N4CA 5LGUA 3CSXA 3ZMUA 3C3TA 2XAQA 4IL6Z 4QE7A 4X64B 1R6NA 4Z2WA 1B6QA 4I50B 2LGQA 4PDVA 5CA3A 1HNZB 1JMKC 3G6BA 1VQ7V 2QWOB 3ETEA 2XNDG 4CH5A 4JGSA 1I5XA 4O4LA 4G28B 1XMOB 3OMIB 2W6IG 2HHHB 5B1BB 2LW7A 2W0FC 3DXRB 1GM8A 2UXDO 4LF7B 2CH7B 5CB4B 3IJ4A 1JR9A 3ML0A 4MVUA 1Q6UA 3ZHQA 2F66C 4BIUA 2PTMA 4JI7O 2XAFA 3ABTA 2KG7B 5CA1B 2AZ0A 1ENVA 5B66Z 3WB0A 1OCOB 1SESA 2EILC 4UXNA 3SJQC 5E1AC 4X62O 3CRAA 1K5SA 2ZCEA 2LW1A 4HZ3A 5HFLA 4EFBA 4I7ZB 3JD0A 2Q0AA 1FXHA 1R3KC 1B06A 3EHBB 1JX9A 3BAAA 1EZJA 4HYOA 1UJWB 2ITDC 4K3AA 4TV8B 3QO7A 2G38A 3A2FA 3BY6A 1TUEB 1S5LZ 1NTKH 3TK1A 4WFBV 4LFBB 4LFAO 3ZHRA 2GHYA 4O2AB 5KMGB 4RQEA 1WPXA 3UO2A 1FFTB 2EIKB 3AG7A 3OAAG 4NTXA 3JASB 2VQEO 1KP3A 4JI7B 2R9IA 1YTFD 4J42A 4IHJB 2L35A 4NKGB 2YI9A 1BGYH 1NBMG 4BWAA 3FB8C 3E35A 4JI4O 2B5UA 3B09A 3SJCC 5H5NA 1KBHA 5DM6V 2ZM6O 4J80A 1FFXB 2HFEC 1N33O 5LMUO 3PN1A 1QNMA 4O4LB 4P9OA 2QM8A 1XBLA 4DR5B 1Q5OA 2R9RB 3O9OA 1ZSPA 1T5EA 4X1IA 4J9ZB 2A06H 5KHIA 1JJOA 1IBLO 1VF7A 1N32O 3OEHG 3E83A 3APOA 2W6JG 2WLKA 4DW1A 3T1YO 1FXKA 3O65A 4JAAA 4N23A 4MSWC 4FFBB 3M7MX 1I08A 2C2AA 2VQEB 5IYZA 1LUVA 2RCVA 1BZKA 3NXSA 4CH4A 3ASNC 4UV9A 2LJ2A 3K9AA 2Q8VA 4JI4B 4K8XA 1P7GA 4Z1MG 4DV7B 2WLLA 3RVYA 5E79Z 1FPOA 2X6AA 1WB7A 2N04A 2E5LO 3SPJA 1V55B 4FM2A 1N33B 1HW7A 5LYJB 1WA8B 1RM1B 4P2ZA 4DR2B 3SYAA 1NI8A 1GH6A 5KHKA 5LXTB 4MW8A 1NJIW 1ZX3A 4I9WA 4JI0O 2W0XA 3SYCA 2CGNA 2WLHA 4GX2A 1D2DA 4X20A 1YIJV 3D3IA 4K8ZA 3IFXA 3RYFA 3ZS8C 1MOFA 3ZRVA 2V7QG 1E79G 1GO3F 4D7SA 3MHHC 4OXSA 1KKDA 1SRYA 1N34B 2FMLA 2JDIG 2IJHA 1VQ4V 1PKXA 4LFCO 2EZPA 5KX5A 1M9NA 5B1AB 2UUAB 4RAIA 4TWKA 4IIJA 1S72V 4GYCB 5B1AC 4WFEA 3D36A 3FAVA 1MABG 4UFZA 1GK9A 1SA0B 1LUWA 4U7NA 4X1IB 2X0LA 4O4IA 3LDCA 3N2GA 3ZCCA 5ITZB 2ZXWB 1U97A 2JRIA 5IYZB 1FXKC 1RSOA 2QM4A 3OMAB 1JVMA 2EX3A 1NR1A 3OD4A 4I0XA 3ZRXA 1X59A 4FLTA 1Q81W 2DYSB 1ROPA 2QKCA 2JGDA 2R9AA 2WLLB 4MTFA 2DYSC 2WLIA 5C93A 4F6RB 4FM0A 3UQ8A 4GKJB 2VRZA 1YZBA 1VQ5V 1JJ2U 2YC0A 2AGAA 2ZIOA 4LF5B 2B1GA 4GKKO 2VS0A 4K35A 3RVZA 2JS3A 3JD3A 1M57C 5IDJA 4X88A 1CXZB 3MD0A 2Q73A 4Z1VA 2Y0IA 2YICA 4X20B 2HVKC 1P7BA 2DYRC 4UCSA 5LP6B 3QTCA 1M1KW 3RYFB 1Q82W 1FXVA 2WWWA 2E74B 3ZEDA 4WF9V 3AK3A 1OCCB 2FB5A 2QWRB 2E76B 4O2BA 2EIMB 4CS2A 1OCCC 2LP7A 5J2TA 1JFFA 1M93A 5KX5B 3VQWA 4B3MB 5EYPA 3QO5A 3K5NA 1HR0O 3ZX6A 4W4KA 2WLNA 2AHZA 1VQKV 1S5HC 5EBMC 4KHPB 2Z3YA 4PDRA 3D36C 1DGSA 2MK3A 1MSDA 2Q9LA 1AR4A 4DR7O 3RGBA 4GKKB 5BMVA 4IGGA 4UB6Z 4DV1O 2EINB 5B3SB 4J7ZA 3LNMB 2XHBA 1N36B 3OM3B 4LCUC 1Y76A 1R6TA 2EINC 1RSOB 2XASA 4X1YB 3R65A 4X8AA 3KCYA 3SPHA 4I0XB 4ZHQA 3J80N 3BRCA 3CCSV 2JGDB 4EB6B 3OTOO 2B9ZA 1N0NA 3OE7G 1LNQA 4FZ1A 3B2EE 3CWBH 2EBOA 2XAHA 1YITV 3JARA 1HR0B 2DOSA 2YXYA 3GB7C 1L8DA 1DLBA 1EN6A 4LH6A 1K8AW 4DXWA 2Y69C 4LNUA 4O4HA 5IY5B 4LF9O 1H2SB 5GTIZ 1AJNA 5FL7G 5IY5C 1XEQA 1XREA 4DR7B 4GX5A 4DV1B 1JCHA 1TVKB 3UM7A 2GBOA 2EZOA 3IGAC 2HEPA 2YIDA 1ZWIC 3JAKA 3ETQA 2PYLA 4JI5O 1NT2B 2FYUH 5L3EA 3CC4V 2JJ1G 1LR1A 5C8YB 1M4UA 2HJFC 3SR2C 1AB3A 4I55A 3KKYA 4OPAA 1Y67A 3H1IH 4O2BB 4TQDA 3ABLB 4JI8B 4B3RO 4JTAB 2DN9A 1KYOF 1NVPD 3M8AA 3OTOB 1XHZA 2BOCC 4PA9A 3B40A 3BCCH 3S3XA 4MW3A 1P84F 2ADPA 4PDLA 2YI8A 3OR6C 4AILC 2QR4A 2RN9A 3G67A 3I55V 1IURA 1BMFG 5LHIA 3EFFK 4LF9B 4DR3B 5EC2C 1IVSA 1X4TA 4J7JA 2OCCB 5L3CA 4R8CA 1K9MW 4MTGA 4DUYB 5B1NA 4E4EA 3OUFA 4LC1A 1NH2D 1DK1A 1U96A 2QKSA 3BVOA 4ZHQB 2X6CA 1EN4A 3D8CA 5JJNB 4JI6O 3EXAA 1IBKO 4B3RB 2XAGA 1A32A 4JZ2A 1TUBA 4D6TH 3JARB 3N27A 5CMUA 3H1LH 5LA6A 1QCEA 2R70A 3WG7C 1WAZA 1AJPA 1O9GA 3B77A 3AK1A 3P3PA 2CTQA 4NVPA 1MZEA 4FLWA 3TJTA 2PY5A 5DEDA 1GTOA 3J81N 1E1RG 1BHAA 3T1CA 2P5OA 2R72A 3K5LA 2Q0OC 4MT8A 3K5OA 1R3LC 2QDOA 3B4SA 1RFYA 1XMQO 3F7YC 4IYIA 4I55B 3IAYA 4BIZA 2ZNIA 1QR8A 2QWQB 1I94O 2QSAA 4I5SA 1KMIZ 1YHQV 1BL8A 4XDJA 4JI3B 1XOUA 1EFRG 4JI6B 1Q90D 1IBKB 1IBMO 5H9CA 3JAWA 2FL4A 1BS3A 1H2MA 4DO2A 4EEQA 2H94A 3K08A 3N2KB 2NNUA 4DUZB 4C7UA 1WP8A 3TCUA 5KLVH 5JCOA 4JI2O 3LSQA 4EKWA 4ZI7B 1PM9A 4BIOA 3F5WC 2LQTA 3ETGA 2EILB 1ZAUA 1V54C 3ABUA 4A5UB 2UXBO 2F95B 2HJDA 4TUYA 1HNXO 4U3JB 3GWKC 5LL6Y 5EK0A 2YIBD 1K7DA 4LF6O 3ZBHA 2RNBA 2F43G 3X2QC 2QTOA 2OIEA 1PL4A 1PP9H 4TOIA 2DQ3A 3K79A 2F4VO 5IYDO 3DC6A 2ODMA 1FJGO 2QWNB 3G6EV 1HWYA 3K3WA 1KKCA 3ICXA 3S3WA 1I94B 2ILMA 1Q86W 1VF5B 1K34A 5EZYA 3RYCA 2CAZC 3OFNG 1G6UA 2WLMA 1GN6A 2YS8A 5LA6B 4RUFA 3CC7V 3E8FA 4WCEV 1PV0A 1IBMB 2GV9A 4GLXA 2ZIMA 2EJ7A 5KUMA 2UXDB 1KUQA 2IU0A 3D3QA 1B04A 3G71V 3VQXA 5JJEB 4PV1B 1WJZA 3E8GA 4L8JA 5KAIZ 3CCEV 4J41A 2X7RB 4JAUA 2F23A 3LDEA 1ZL8A 1KECA 3CPWU 3RYIA 1OCZB 4X62B 3RWRD 1M5IA 3F7VC 4YXWG 3K0DA 2EIJB 4NR1A 5K1XA 1OCZC 1MA1A 2F4VB 3IC7A 2EIJC 1FJGB 1BHBA 1HDJA 2YIAA 2Y4TA 1YDXA 1Y6XA 3HR0A 1DF4A 2GUZA 1Q7YW 2P4KA 1BCCH 1AP5A 1VQOV 1WB8A 1K73W 1Z2GA 4UVCA 3GWOA 5KHJA 2CTRA 5L3FA 1NZ6A 1G1XB 4DV6O 3CRMA 5JCOC 2CK3G 4LFAB 3JYCA 3KCXA 1R3IC 1QVGU 3ASNB 3WFVA 5CBHA 3CJHA 1YJNV 4MVRA 3ZHUA 4YY3O 4WFFA 1H2LA 1S0VA 4IT5A 2BE3A 1W2BU 1DF5A 5EBWC 1H2NA 4JF3A 3CXHF 5L3DA 2PUSA 5JVDA 2DWDC 4QJFB 3RYHA 3CS5A 3VQYA 1NU1H 3UT5A 1SETA 2ZM6B 2ADQB 1EM1A 5IWAO 3AG1B 3HKCA 3E22A 1SQQH 4CZZA 5K1PA 5LMUB 3HKBA 3CB2A 3AG1C 4DW0A 1Q8IA 2UUCO 1F23A 4PA6A 4G2KA 2H8PC 2VQFO 1AI6A 1G4YB 3EVKA 1SERA 3G4SV 4UCRA 5IYCO 1CEZA 1IBLB 1N32B 1WN7A 4DV6B 4J9YB 1N8RW 1UFIA 4MVSA 5KUKA 5A9GA 4QE9A 3T1YB 1Y74A 4DV2O 1H38A 1QLNA 2ZD9A 4F4LA 1S3JA 3L70H 5IJ9A 4CC5A 3RN4A 1IZ3A 3LUTB 4QPKA 4KXRA 1OJHA 2ZINA 1VMGA 3RFRA 2Q4PA 3QF7A 2YEVA 4GZRB 1EN5A 1PNKA 5H2FZ 4BAYA 2P06A 3OGCC 1YTFB 4PA7A 4O4JA 5IWAB 2E5LB 1MNGA 2QE7G 4UB8Z 4RQFA 3FX7A 2HG5C 4HBNA 2K9PA 4KP4A 3U10A 3BEHA 5B1OA 2UUCB 1AP6A 5JJJB 2DWEC 4LH7A 2VQFB 1M56B 4JI0B 3HKEA 1QR9A 1N0JA 1XNQO 1FXKB 2WAMA 1Q6HA 4UCTA 1M56C 5J2UA 1G8MA 1P4RA 3CRCA 2ZDIA 2ZR2A 4YIOA 4DV3O 3CJHB 3ZN0A 2AXTZ 1EZVH 1S5JA 1Z5WA 2HVJC 3L72H 3E2EA 3SPCA 5GW7A 4PD4F 4P30A 3RYHB 4DR4O 4FLXA 5LBQA 4PA4A 2IJKA 4KUMA 1NQTA 4RUEA 2ZQMA 3UT5B 4UUJC 4LFCB 5KHHA 3JCZA 1K4DC 3E22B 4B7EA 1OCRB 3L71H 4RWUA 4LWSA 3L9DA 4HNAA 1KP2A 1OCRC 4FJCC 1OZ0A 1M57B 1RP3B 2AHYA 3FKSG 2RDCA 2GTAA 3K0GA 3G80A 2DYRB 5IYBO 3K03A 3JSNA 4X1KA 3FB6C 3UCSC 3A0HZ 4ZKIA 3OR7C 5H6QA 4NXNO 1UPGA 1K3EA 4ABMA 1R73A 2RJZA 1GMGA 4WFGA 1YJWV 4X66O 3AG2B 4X65O 2A0LA 5EC1C 4J11A 4BR6A 2QGNA 4DV3B 3AG2C 3OMNB 4UCOA 1YSCA 2VWJA 5FPOA 1VEWA 2OIGA 5LMNO 4B08A 3GVMA 4YHHO 2HLDG 3BA8A 2YEVB 4H33A 1VQNV 3BHPA 2UU9O 4D7TA 4IIJB 4DRXA 3BABA 5CBFA 3FAVB 1YXBA 3BA9A 4ZOLA 3F5TA 4EFEA 1ZLZA 2Q7EA 1GRJA 1YEWA 4JYBA 5CA0A 3JCUZ 5AG2A 1GM7A 3STLC 2HP8A 4O4IB 1QU7A 2YDEA 2UUBO 2VWKA 3HKEB 3SPIA 2ZKOA 4ZBMA 3N2GB 3T1HO 1QVFU 4NXNB 3VBBA 3APQA 4LF4O 3DC5A 3BPZA 4F6EA 3QG5A 4X66B 4YIPA 1SQGA 4X65B 3I56V 2ZDIC 5JH7A 1VF6A 5FNVA 3ZRWA 2Q6AA 2Z0AA 1XILA 3H9VA 4R50A 5LMNB 4GX1A 2WLIB 4YHHB 1AI4A 2XTAA 1D5AA 4MTOA 2ZR3A 4YJ3A 4X9QA 4DK1A 3Q4HA 2Y69B 4CC6A 1YJ9V 2P4VA 4LWSB 3E8BA 4I4TA 5EIBD 3P32A 2NN4A 2UXCO 3AEIA 2A7WA 2BSKA 1DTOA 4JZGA 4JASA 5JQGA 4LBEC 4K0KO 3CCJV 1R3JC 5IJ0A 2IH3C 1XNRO 5FLXN 2KB1A 2DJVA 4DR1O 1SS3A 3PJSK 2MW2B 3JALA 4YJ2A 4LF4B 2ZE5A 3JD1A 2HR3A 2V1DA 4FM1A 3NR7A 3FD9A 2ITCC 1GN4A 5TISZ 4QGPA 5J2TB 1JFFB 2PF4E 4NXMO 1SC5B 3RW0A
chains in the Genus database with same CATH topology
4TT3G 4MVZA 3F5WC 1K5QA 3ETGA 2EILB 4Z1MG 2K1EA 3ABMC 1AROP 1V54C 2WLLA 3ABUA 3FYIB 3RVYA 2OTLV 3HB3B 2X6AA 5EK0A 3CMAV 1K7DA 1H2GA 3SPJA 2A79B 4L87A 1V55B 2F43G 1PL0A 3X2QC 1NR7A 2QTOA 4P2ZA 1RM1B 1E1QG 1QLEC 3CXCU 3SPGA 2DQ3A 3K79A 3SYAA 5IYDO 1THZA 4MW8A 3G6EV 1HWYA 3K3WA 1NJIW 2UXXA 1H8HG 2B1IA 4I9WA 3E8HA 3K06A 1Q86W 1K34A 3SYCA 2WLHA 4GX2A 3OFNG 1KD1W 1AI7A 2WLMA 2A9HA 1YIJV 2YSUB 3D3IA 4RUFA 3CC7V 3E8FA 4WCEV 3IFXA 1JQ0A 3LSSA 2IJIA 4PDMA 2EIMC 4Q20A 2EJRA 1AI5A 3T2MA 1MOFA 3P30A 3ZRVA 2V7QG 1E79G 1GO3F 1QBZA 2DQ0A 3MHHC 3JD2A 4OXSA 5KUMA 3CCLV 3FB7C 1KKDA 1SRYA 2IU0A 4X89A 3G71V 3WG7B 2LFSA 2JDIG 3H01A 2IJHA 4E2LA 3ZMZA 3E8GA 1VQ4V 3CCEV 1PKXA 3DTUB 2EZPA 1CPYA 2X7RB 4JAUA 1R6KA 3LDEA 4N21A 4XDLA 1M9NA 1S76D 1KECA 5B1AB 3CPWU 4RAIA 4TWKA 3STZC 1S72V 1VQ9V 3ASOC 1OCZB 3ZN1A 4GX0A 1L1FA 3F7VC 1COWG 3RBZA 4YXWG 5B1AC 4WFEA 3D36A 3K0DA 1MABG 2EIJB 1GK9A 1OCZC 4U7NA 3E89A 5B3SC 3CC2V 1OHHG 2X0LA 2JK5C 2QEXV 3CYOA 3IC7A 2EIJC 4MS2A 5LHHA 1BHBA 3ZMTA 4JYCA 4HAMA 4UVBA 3LDCA 1DF4A 4WFHA 1KC8W 1Q7YW 3ZCCA 2Z5UA 1VQOV 3VOUA 3CD6V 2ZXWB 4JPRA 3OUSA 1K73W 4UVCA 2P6JA 1M90W 3T4ZA 3GWOA 4PELA 1FXKC 3CP1A 4MVOA 5L3FA 3ZJZA 2LFRA 1WLEA 3OMAB 1JVMA 4WFAV 4H37A 1NR1A 3B8MA 3ZRXA 4JAVA 1Q81W 2CK3G 2DYSB 1ROPA 2QM7A 3AG4B 2JIZG 2QA4V 3JYCA 2WLLB 4MTFA 1R3IC 1QVGU 3SYPA 3ASNB 1SZTA 2DYSC 2WLIA 2FTKA 3AG4C 3WFVA 5C93A 5CBHA 1YJNV 4MVRA 4WFFA 1S0VA 1KQSU 3ABMB 2Q69A 1V54B 1W2BU 1DF5A 5EBWC 1K92A 4RO2A 4JF3A 5L3DA 5KA5A 1VQ5V 3W7SA 1JJ2U 1JOYA 2DWDC 4QJFB 2B1GA 4QIWF 1NVPB 1F4NA 3CMEV 4XDKA 3RVZA 2HKOA 3JD3A 1M57C 4XBFA 5IDJA 4X88A 1SETA 3MD0A 3UKMA 3X2QB 4LP8A 3AG1B 1QLEB 2HVKC 1IXMA 4CZZA 1P7BA 2DYRC 5B1BC 4CBCA 2X6BA 1M1KW 4TSFG 1MSWD 2P90A 4PA3A 1Q82W 1FXVA 3ABLC 3AG1C 3W7TA 2WWWA 1F23A 2IW5A 4PA6A 4G2KA 4WF9V 2IJJA 2H8PC 4KFMA 3ZMVA 1AI6A 2PI5A 1G4YB 1OCCB 1SERA 3G4SV 4MTXA 1F51A 5IYCO 1CEZA 2JJ2G 2ATKC 4J9YB 2EIMB 1Y4MA 1OCCC 1N8RW 2LP7A 1OCOC 2DW4A 5CN0A 4JTCB 4MVSA 5KUKA 3ZRWB 4QE9A 2OT5A 3FB5C 1H38A 1QLNA 3QO5A 4GCZA 3ZRSA 2ZD9A 4F4LA 1S3JA 2WLNA 3W7UA 2AHZA 1VQPV 1VQKV 1NH2B 3LDDA 1S5HC 3LUTB 5EBMC 4QPKA 1AR1B 2Z3YA 3CCVV 2OCCC 1RPRA 4PDRA 1GKFA 2MK3A 3MHSC 2YEVA 1EBOA 3SYQA 2NLJC 3FYEB 3ASOB 1K33A 1PNKA 1MG1A 1F4MA 3OEEG 1VQLV 4BAYA 1K97A 3OGCC 1YTFB 2EINB 3W7XA 5B3SB 4PA7A 5HFMA 5H6RA 2QE7G 3LNMB 4RQFA 2HG5C 3OM3B 4LCUC 4KP4A 3M99B 2EINC 3ABKB 2WSSG 2IU3A 1AJQA 3BEHA 5B1OA 1H8EG 4QNHB 2XASA 4FMTA 3R65A 4X8AA 3DGEA 4FK5C 3SPHA 2DWEC 4FPPA 4BW5A 3ABKC 3B8NA 3T4DA 1M56B 3E86A 2EIKC 1PNMA 1QR9A 1FS0G 3CCSV 3KG2A 1NKDA 1FXKB 2WAMA 1K4CC 1GM9A 3OE7G 1M56C 1LNQA 2XAJA 1G8MA 1P4RA 2P67A 2Q68A 4ASUG 1PNLA 2ZDIA 2ZR2A 2EBOA 2XAHA 2BOBC 5L3BA 3ZN0A 1YITV 3OW2U 2GSMB 4FIPC 4P9PA 3JD4A 4U7OA 2HVJC 3GB7C 3HPLC 4G27B 1DLBA 3E2EA 1K8AW 4DXWA 3SPCA 5GW7A 2Y69C 3ETDA 1Y66A 4UVAA 4P30A 5LGNA 1W0JG 5IY5B 5LBQA 5LGUA 4PA4A 2IJKA 4KUMA 3ZMUA 1NQTA 4RUEA 3W7WA 2M7WA 2ZQMA 2XAQA 3A0RA 4QE7A 4UUJC 1R6NA 1AJNA 1B6QA 5FL7G 5IY5C 3JCZA 1K4DC 4GX5A 4PDVA 5CA3A 1OCRB 1JCHA 3UM7A 2EZOA 3IGAC 1KP2A 1VQ7V 3ETEA 1OCRC 1OZ0A 1M57B 1ZWIC 2AHYA 1JPXA 2XNDG 3FKSG 1CP9A 4FJCC 4JGSA 1I5XA 2D3OW 1RPOA 4G28B 5L3EA 3CC4V 3OMIB 2JJ1G 2W6IG 3K0GA 2DYRB 2HJFC 5B1BB 5DN6G 2JEUA 5IYBO 3K03A 3FB6C 4ZKIA 2W0FC 3OR7C 5H6QA 3ABLB 1GM8A 5L3GA 5LHGA 2Y48A 1K3EA 4R7CA 1R73A 3ML0A 4JTAB 4MVUA 1NVPD 1I5YA 1GMGA 2WLJA 4WFGA 1YJWV 2BOCC 3AG2B 5BZBA 4PA9A 2A0LA 4BIUA 3TETA 5EC1C 5CBGA 1YI2V 2XAFA 3QO8A 3ABTA 4MW3A 1ENVA 3AG2C 1OCOB 1SESA 3OMNB 3ZMSA 4PDLA 1YSCA 2EILC 4UXNA 3SJQC 5E1AC 3OR6C 3CCUV 2HLDG 3I55V 2YEVB 1K5SA 4H33A 4HZ3A 1VQNV 1BMFG 5LHIA 5HFLA 1XL4A 3EFFK 3JD0A 2OTJV 4MVQA 1FXHA 5EC2C 1V55C 1R3KC 4JTDB 5EBLC 2PI4A 1RM1C 3EHBB 1JX9A 2OCCB 5CBFA 1EZJA 5L3CA 4R8CA 1K9MW 4HYOA 1UJWB 4MTGA 3K04A 2ITDC 1VQMV 2IH1C 4GT1A 5B1NA 3OUFA 4JYBA 3QO7A 2Q67A 3BY6A 4LC1A 1GM7A 3STLC 5J9PC 1NH2D 1TUEB 2QKSA 2UXNA 3SPIA 4ZBMA 2X6CA 3SYOA 1QVFU 3TK1A 4QPJA 3VBBA 4WFBV 2WPDG 2GHYA 4RQEA 2XAGA 1WPXA 1FFTB 2EIKB 5LGTA 3OAAG 5CMUA 1KP3A 3I56V 1QCEA 3WG7C 2R9IA 2ZDIC 1YTFD 3ZRWA 1AJPA 2Q6AA 1VQ8V 3B77A 4UV8A 3CCQV 1NBMG 3FB8C 3E35A 4R50A 4GX1A 2WLIB 1J95A 2B5UA 1AI4A 3CCMV 4MTOA 2ZR3A 1GTOA 1E1RG 2Y69B 1BHAA 1YJ9V 2XOKG 5DM6V 2JEXA 3E8BA 3T1CA 3P32A 2HFEC 4MT8A 3AEIA 1R3LC 3CCRV 4P9OA 3F7YC 1DTOA 2QM8A 1S77D 4JASA 4BIZA 2R9RB 1QR8A 4LBEC 2ZXWC 3CCJV 4J9ZB 1PD3A 1R3JC 2IH3C 2KB1A 1ORQC 4I5SA 3OEHG 3E83A 1YHQV 1BL8A 4XDJA 2P7TC 4MVMA 2W6JG 5KA6A 1EFRG 3PJSK 2WLKA 4R6ZA 5H9CA 1FXKA 3AG3B 3JD1A 4N23A 4MSWC 2HR3A 4DO2A 2V1DA 2H94A 3K08A 2C2AA 1VQ6V 1W0KG 2ITCC 2NNUA 1XL6A 3AG3C 3NXSA 3TCUA 3ASNC 3LSQA 4UV9A 3ZIAG 3RW0A 3K9AA 4EKWA 3QNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JTD B;  5EBL C;  2HG5 C;  4LCU C;  4MVZ A;  1JVM A;  2EIN C;  3F5W C;  5CBF A;  4H37 A;  3BEH A;  4QNH B;  4R8C A;  2K1E A;  4HYO A;  3ABM C;  3R65 A;  4MTG A;  1V54 C;  2WLL A;  3K04 A;  4X8A A;  2ITD C;  3SPH A;  4F4L A;  2IH1 C;  2DWE C;  3RVY A;  2X6A A;  3ABK C;  3JYC A;  3OUF A;  4BW5 A;  3T4D A;  2Q67 A;  2WLL B;  4MTF A;  5EK0 A;  3E86 A;  2EIK C;  3STL C;  1R3I C;  3SYP A;  2DYS C;  2WLI A;  5J9P C;  3SPJ A;  3KG2 A;  2A79 B;  3AG4 C;  1K4C C;  2QKS A;  5CBH A;  3SPI A;  1M56 C;  1LNQ A;  2QTO A;  4ZBM A;  4P2Z A;  2Q68 A;  2X6C A;  3SYO A;  3X2Q C;  1QLE C;  3SPG A;  3SYA A;  4MVR A;  4WFF A;  2BOB C;  2Q69 A;  4MW8 A;  5EBW C;  4RO2 A;  4I9W A;  4P9P A;  2DWD C;  3E8H A;  3K06 A;  2HVJ C;  3GB7 C;  3HPL C;  4G27 B;  3SYC A;  2WLH A;  4DXW A;  4GX2 A;  4XDK A;  3SPC A;  3RVZ A;  3WG7 C;  2Y69 C;  4P30 A;  2WLM A;  1M57 C;  2A9H A;  4X88 A;  3UKM A;  2Q6A A;  4PA4 A;  4RUF A;  5B1A C;  4LP8 A;  3E8F A;  4RUE A;  2HVK C;  3IFX A;  4PDM A;  4QE7 A;  4UUJ C;  2EIM C;  1P7B A;  2DYR C;  5B1B C;  4CBC A;  2X6B A;  3FB8 C;  5IY5 C;  3T2M A;  4R50 A;  4GX1 A;  1K4D C;  1J95 A;  2WLI B;  4GX5 A;  4MVO A;  3ABL C;  3AG1 C;  4PA3 A;  4PDV A;  4OXS A;  5KUM A;  4MTO A;  3UM7 A;  3FB7 C;  4PA6 A;  1KKD A;  2H8P C;  4KFM A;  3IGA C;  4X89 A;  1G4Y B;  1OCR C;  1ZWI C;  2AHY A;  3E8B A;  3T1C A;  3E8G A;  4G28 B;  2ATK C;  2HFE C;  3K0G A;  4J9Y B;  1OCC C;  2HJF C;  3LDE A;  4XDL A;  1OCO C;  1R3L C;  3K03 A;  4JTC B;  3FB6 C;  4P9O A;  2W0F C;  3F7Y C;  3OR7 C;  4MVS A;  5KUK A;  4RAI A;  4TWK A;  4QE9 A;  3STZ C;  3ASO C;  2R9R B;  3FB5 C;  4GX0 A;  3ZRS A;  3F7V C;  4R7C A;  4JTA B;  4LBE C;  3RBZ A;  2ZD9 A;  4MVU A;  2ZXW C;  4WFE A;  2WLN A;  4J9Z B;  2WLJ A;  2AHZ A;  3K0D A;  1R3J C;  4WFG A;  2IH3 C;  2BOC C;  5BZB A;  4PA9 A;  2A0L A;  1ORQ C;  2KB1 A;  3LDD A;  3TET A;  1OCZ C;  1S5H C;  3E83 A;  3E89 A;  5EC1 C;  5B3S C;  5CBG A;  1BL8 A;  4XDJ A;  2P7T C;  4MVM A;  4MW3 A;  3LUT B;  5EBM C;  2JK5 C;  3PJS K;  2WLK A;  3AG2 C;  2EIJ C;  4MS2 A;  2OCC C;  4PDL A;  4R6Z A;  2EIL C;  4PDR A;  3SJQ C;  2YEV A;  5E1A C;  3OR6 C;  4MSW C;  3LDC A;  4WFH A;  2NLJ C;  3SYQ A;  3K08 A;  3VOU A;  2ITC C;  4H33 A;  3OUS A;  1XL6 A;  4HZ3 A;  3AG3 C;  1XL4 A;  3EFF K;  3TCU A;  3OGC C;  3ASN C;  3T4Z A;  4PA7 A;  4MVQ A;  5EC2 C;  1V55 C;  3RW0 A;  1R3K C;  3LNM B;  4EKW A;  3ZJZ A; 
#chains in the Genus database with same CATH topology
 5GON A;  5EYP B;  4TT3 G;  1F7Y A;  1K5Q A;  2YXH A;  4DRX B;  2K1E A;  3ABM C;  1ARO P;  1YF2 A;  3K58 A;  3FYI B;  3HB3 B;  4KL1 A;  5CA0 B;  1GN2 A;  3MDS A;  2UXC B;  1PL0 A;  1NR7 A;  1E1Q G;  5BMV B;  4GUN A;  1QLE C;  3CXC U;  4NTY A;  4K0K B;  5FPR A;  1XNR B;  4JV5 O;  2O57 A;  1Y76 B;  1KD1 W;  4DR1 B;  1AI7 A;  3DXR A;  5BY1 A;  2CH7 A;  5CB4 A;  4JI5 B;  5FNV B;  2WA3 A;  1JQ0 A;  3LSS A;  2EJR A;  3T2M A;  1VF6 C;  2KG7 A;  5CA1 A;  3ZHS A;  2DQ0 A;  3CCL V;  3C3S A;  1J5E O;  4NXM B;  3WG7 B;  2LFS A;  4YJ3 B;  4JI1 O;  3Q4H B;  4X64 O;  2ZE7 A;  1CPY A;  2Q5Z A;  1R6K A;  4I4T B;  4W4L A;  1HNZ O;  1VIB A;  4LNU B;  4FLU A;  4O4H B;  3STZ C;  1VQ9 V;  1ZTE A;  3ASO C;  3OTF A;  4GX0 A;  1COW G;  3E89 A;  3SJB C;  2HHH O;  4TV8 A;  3WB2 A;  2QEX V;  3CYO A;  4MS2 A;  4JYC A;  1SQB H;  3JAL B;  4HAM A;  3JAK B;  4UVB A;  4YJ2 B;  1KC8 W;  2Z5U A;  1WP7 A;  1M90 W;  2OWO A;  4PEL A;  1NS1 A;  4MVO A;  5EIB C;  3ZJZ A;  2LFR A;  2GDS A;  1WLE A;  4J7K A;  2E3C A;  3JAS A;  4WFA V;  3B8M A;  4FZ0 A;  4IHJ A;  4JAV A;  2QM7 A;  3AG4 B;  2JIZ G;  2QA4 V;  4JI1 B;  3SYP A;  2N74 A;  1SZT A;  5LOV A;  3AG4 C;  3MAQ A;  1KQS U;  2Q69 A;  1V54 B;  2QWP B;  1K92 A;  5B5E Z;  1OV9 A;  1FFX A;  1HNW O;  3W7S A;  4LF8 O;  3AK2 A;  3TXQ A;  2XT9 A;  1NVP B;  4PHZ A;  1F4N A;  4XDK A;  1US6 A;  2HKO A;  4XBF A;  1XI1 A;  2D2C B;  3X2Q B;  2KQX A;  4LP8 A;  2V4D A;  1IXM A;  4LFB O;  5B1B C;  2X6B A;  4BW9 A;  4TSF G;  2P90 A;  4NYK A;  4PA3 A;  1AVM A;  1XMQ B;  2IW5 A;  1MZF A;  2IJJ A;  4KFM A;  3ZMV A;  2NR5 A;  4FFB A;  1IXB A;  1F51 A;  5D5P A;  4CS3 A;  1GN3 A;  2ATK C;  1AR5 A;  1TUB B;  2IBZ H;  1Y4M A;  4CH3 A;  1OCO C;  2DW4 A;  1XUQ A;  4DV4 O;  2ZNJ A;  3UO3 A;  2YIB A;  4OX9 O;  2OT5 A;  3ZHV A;  1SQX H;  3FB5 C;  2CGO A;  1NH2 B;  3JSL A;  3LDD A;  2BTQ A;  4JI2 B;  1HP8 A;  3L73 H;  3L74 H;  1NTZ H;  2Q7G A;  5D5Q A;  1AR1 B;  2OYQ A;  4H13 B;  4DR5 O;  1HNW B;  1GKF A;  5LYJ A;  4LF8 B;  3SYQ A;  1WA8 A;  2NLJ C;  3FYE B;  1K33 A;  3LSU A;  1KB9 F;  1TA8 A;  2UXB B;  3A0B Z;  1F4M A;  2L6L A;  2ZE6 A;  3OEE G;  1VQL V;  1HNX B;  3U11 A;  2JS5 A;  5LXT A;  1K97 A;  3W7X A;  4OPH A;  2QJ1 A;  5HFM A;  4LF6 B;  4FLY A;  3ABK B;  2WSS G;  3CEI A;  1AJQ A;  1GAX A;  1H8E G;  1Q43 A;  4QNH B;  2JVD A;  3OT7 A;  4FPP A;  4BW5 A;  3ABK C;  3B8N A;  3T4D A;  3E86 A;  2EIK C;  4AQY O;  1L0N H;  1PNM A;  1SQV H;  1FS0 G;  4B3S O;  3KG2 A;  1NKD A;  3JAW B;  1K4C C;  1GM9 A;  2XAJ A;  5LOV B;  4DV4 B;  4DV7 O;  4ICG A;  4OX9 B;  2BOB C;  5L3B A;  4FIP C;  4P9P A;  3JD4 A;  4U7O A;  1XHX A;  4LR3 A;  4G27 B;  4H44 B;  1Y66 A;  4UVA A;  1W0J G;  4IYH A;  4DR2 O;  4AHC A;  4FLZ A;  1O9H A;  1SQP H;  3W7W A;  4TUY B;  2M7W A;  3A0R A;  1SA0 A;  5F2V O;  2YUA A;  1QQC A;  3JAM N;  1JPX A;  1CP9 A;  5ITZ A;  2D3O W;  2N05 A;  1RPO A;  4U3F H;  2DMX A;  5DN6 G;  2JEU A;  3THO A;  2RMK B;  5EZY B;  2IM9 A;  3RYC B;  3KZI Z;  1IDS A;  5L3G A;  1SKV A;  5LHG A;  2Y48 A;  4AQY B;  1N34 O;  4R7C A;  4B3S B;  4NTW A;  1I5Y A;  2WLJ A;  5BZB A;  3TET A;  5CBG A;  1YI2 V;  3QO8 A;  1Q3E A;  3SJA C;  1BQZ A;  2BTQ B;  3ZMS A;  2UUA O;  2GTS A;  2P22 C;  3CCU V;  4F6R A;  4DR6 O;  5BXZ A;  4J10 A;  1XL4 A;  1ZL8 B;  2OTJ V;  4MVQ A;  1V55 C;  3RYI B;  4FLV A;  4JTD B;  5EBL C;  2PI4 A;  1RM1 C;  1WNS A;  1YCI A;  3TXS A;  2CTP A;  3K04 A;  4YY3 B;  1WPB A;  1W59 A;  2IH1 C;  4GT1 A;  1VQM V;  2H3O A;  3H1J H;  2Q67 A;  5LP6 A;  5J9P C;  4WBN A;  2UXN A;  2GUZ B;  3SYO A;  4QPJ A;  3U0Z A;  2WPD G;  2CDY A;  1FYJ A;  5LGT A;  3H1H H;  4AI8 A;  1VQ8 V;  1KU9 A;  5IE9 A;  4GKJ O;  4UV8 A;  3CCQ V;  3JAT A;  1J95 A;  3DSQ A;  3CCM V;  4DR6 B;  4LF5 O;  1FAF A;  4DV2 B;  1D5N A;  2XOK G;  2JEX A;  2Q7H A;  5JVD B;  1I0H A;  2AZ2 A;  3CCR V;  1B3Q A;  2YXL A;  4TV9 A;  1S77 D;  1BQ0 A;  4CH6 A;  3HKC B;  2LO1 A;  2ZXW C;  1PD3 A;  4X1Y A;  1ORQ C;  3HKB B;  2P7T C;  4MVM A;  5KA6 A;  4FFK A;  1R1B A;  4R6Z A;  4B3M O;  4EB6 A;  4OGQ B;  3AG3 B;  1VQ6 V;  1W0K G;  1XL6 A;  1VAR A;  1AIL A;  3AG3 C;  1I7F A;  3SDL A;  3ZIA G;  2ARH A;  4KHP O;  3L75 H;  3QNE A;  1XNQ B;  1Y74 B;  4MVZ A;  4UCV A;  3WU2 Z;  1V9P A;  5IJ9 B;  2OTL V;  3CRQ A;  2KSD A;  4UCU A;  1TAE A;  5GTH Z;  3OGI B;  4DYL A;  5DEC A;  3CMA V;  1H2G A;  2A79 B;  4L87 A;  2E75 B;  1N36 O;  1TVK A;  4DR4 B;  3SPG A;  4WBN B;  5LP6 C;  1THZ A;  2UXX A;  4O4J B;  2PGG A;  1H8H G;  2B1I A;  2Y0P A;  3E8H A;  3K06 A;  5C8Y A;  3TGU H;  3R66 A;  2A9H A;  1BSM A;  2YSU B;  2RQ6 A;  4DK0 A;  3SGI A;  4PDM A;  4Q20 A;  2IJI A;  2EIM C;  1VP7 A;  1YVW A;  1AI5 A;  2ETN A;  2FKX A;  3P30 A;  1NTM H;  1QBZ A;  3JAT B;  3JD2 A;  3FB7 C;  5J2U B;  1FD9 A;  2Y4U A;  1BT8 A;  4X89 A;  1ZUQ A;  3H01 A;  4E2L A;  3ZMZ A;  3DTU B;  2ZT9 B;  4N21 A;  4XDL A;  1S76 D;  1TGO A;  1MMM A;  3ZN1 A;  1L1F A;  3RBZ A;  3ZHT A;  4TV9 B;  3QVN A;  5KAF Z;  4Q6G A;  5B3S C;  3CC2 V;  1OHH G;  2JK5 C;  4FVM A;  2UU9 B;  5LHH A;  1H2K A;  4HNA B;  3ZMT A;  4JI8 O;  4WFH A;  4JYA O;  3VOU A;  3CD6 V;  4JPR A;  3OUS A;  3RT3 C;  3HKD A;  5IT9 N;  2P6J A;  3IC9 A;  4X1K B;  3T4Z A;  3CP1 A;  1IX9 A;  2XUM A;  4B7K A;  2UUB B;  4I9Q A;  4H37 A;  3T1H B;  3C90 A;  3CHX A;  2WA4 A;  3P3N A;  3VQV A;  4DR3 O;  2PZS A;  5A2Q N;  2FTK A;  1FKA O;  1SQF A;  3FFQ A;  1Q6I A;  4ZIB A;  2PYJ A;  2ZE8 A;  4DUY O;  3K9S A;  3ABM B;  3K5M A;  4RO2 A;  5KA5 A;  4PI0 A;  1JOY A;  3K59 A;  4QIW F;  3CME V;  2M6Y A;  3BFR A;  3UKM A;  4ZOL B;  4I50 A;  5BR8 O;  1QLE B;  4CBC A;  1MSW D;  3ABL C;  4JYA B;  4PI2 A;  3W7T A;  4H0L B;  3J7A U;  3CE2 A;  2LGW A;  1P49 A;  2KKW A;  2PI5 A;  1URF A;  4MTX A;  4DV5 O;  4B3T O;  2BTO A;  3N2K A;  2JJ2 G;  4NB5 A;  3I5D A;  3A8T A;  4DV0 O;  2DE0 X;  5CN0 A;  3WB1 A;  4JTC B;  5JH7 B;  3ZRW B;  4ZI7 A;  4GCZ A;  3ZRS A;  1VQP V;  3W7U A;  3LNN A;  1L0L H;  2BCC H;  2AW9 A;  4U3J A;  1JA8 A;  1SF9 A;  3CCV V;  2OCC C;  1RPR A;  3MHS C;  4TQF A;  1EBO A;  2CTW A;  3ASO B;  4CS4 A;  1MG1 A;  2BSK B;  3CRR A;  4JI3 O;  5BR8 B;  2OCH A;  5H6R A;  3HKD B;  3K57 A;  5JQG B;  3M99 B;  5KHG A;  1XMO O;  1Z5V A;  2IU3 A;  5IJ0 B;  4FMT A;  4PJ0 Z;  3DGE A;  1QHT A;  4FK5 C;  4DUZ O;  1SZX A;  2JGU A;  1PPJ H;  4LF7 O;  3CX5 F;  4DV5 B;  4B3T B;  4JV5 B;  2QTS A;  4JYY A;  4DV0 B;  2CE4 A;  5JWP A;  2P67 A;  2Q68 A;  4ASU G;  1BE3 H;  1PNL A;  2CUG A;  2EUL A;  4O2A A;  5KMG A;  3OW2 U;  2GSM B;  2QKA A;  5GON B;  2A3Q A;  3HPL C;  1XQ8 A;  3H1K H;  3ETD A;  2F1M A;  1XDC A;  2F93 B;  5LGN A;  1J5E B;  1N4C A;  5LGU A;  3CSX A;  3ZMU A;  3C3T A;  2XAQ A;  4IL6 Z;  4QE7 A;  4X64 B;  1R6N A;  4Z2W A;  1B6Q A;  4I50 B;  2LGQ A;  4PDV A;  5CA3 A;  1HNZ B;  1JMK C;  3G6B A;  1VQ7 V;  2QWO B;  3ETE A;  2XND G;  4CH5 A;  4JGS A;  1I5X A;  4O4L A;  4G28 B;  1XMO B;  3OMI B;  2W6I G;  2HHH B;  5B1B B;  2LW7 A;  2W0F C;  3DXR B;  1GM8 A;  2UXD O;  4LF7 B;  2CH7 B;  5CB4 B;  3IJ4 A;  1JR9 A;  3ML0 A;  4MVU A;  1Q6U A;  3ZHQ A;  2F66 C;  4BIU A;  2PTM A;  4JI7 O;  2XAF A;  3ABT A;  2KG7 B;  5CA1 B;  2AZ0 A;  1ENV A;  5B66 Z;  3WB0 A;  1OCO B;  1SES A;  2EIL C;  4UXN A;  3SJQ C;  5E1A C;  4X62 O;  3CRA A;  1K5S A;  2ZCE A;  2LW1 A;  4HZ3 A;  5HFL A;  4EFB A;  4I7Z B;  3JD0 A;  2Q0A A;  1FXH A;  1R3K C;  1B06 A;  3EHB B;  1JX9 A;  3BAA A;  1EZJ A;  4HYO A;  1UJW B;  2ITD C;  4K3A A;  4TV8 B;  3QO7 A;  2G38 A;  3A2F A;  3BY6 A;  1TUE B;  1S5L Z;  1NTK H;  3TK1 A;  4WFB V;  4LFB B;  4LFA O;  3ZHR A;  2GHY A;  4O2A B;  5KMG B;  4RQE A;  1WPX A;  3UO2 A;  1FFT B;  2EIK B;  3AG7 A;  3OAA G;  4NTX A;  3JAS B;  2VQE O;  1KP3 A;  4JI7 B;  2R9I A;  1YTF D;  4J42 A;  4IHJ B;  2L35 A;  4NKG B;  2YI9 A;  1BGY H;  1NBM G;  4BWA A;  3FB8 C;  3E35 A;  4JI4 O;  2B5U A;  3B09 A;  3SJC C;  5H5N A;  1KBH A;  5DM6 V;  2ZM6 O;  4J80 A;  1FFX B;  2HFE C;  1N33 O;  5LMU O;  3PN1 A;  1QNM A;  4O4L B;  4P9O A;  2QM8 A;  1XBL A;  4DR5 B;  1Q5O A;  2R9R B;  3O9O A;  1ZSP A;  1T5E A;  4X1I A;  4J9Z B;  2A06 H;  5KHI A;  1JJO A;  1IBL O;  1VF7 A;  1N32 O;  3OEH G;  3E83 A;  3APO A;  2W6J G;  2WLK A;  4DW1 A;  3T1Y O;  1FXK A;  3O65 A;  4JAA A;  4N23 A;  4MSW C;  4FFB B;  3M7M X;  1I08 A;  2C2A A;  2VQE B;  5IYZ A;  1LUV A;  2RCV A;  1BZK A;  3NXS A;  4CH4 A;  3ASN C;  4UV9 A;  2LJ2 A;  3K9A A;  2Q8V A;  4JI4 B;  4K8X A;  1P7G A;  4Z1M G;  4DV7 B;  2WLL A;  3RVY A;  5E79 Z;  1FPO A;  2X6A A;  1WB7 A;  2N04 A;  2E5L O;  3SPJ A;  1V55 B;  4FM2 A;  1N33 B;  1HW7 A;  5LYJ B;  1WA8 B;  1RM1 B;  4P2Z A;  4DR2 B;  3SYA A;  1NI8 A;  1GH6 A;  5KHK A;  5LXT B;  4MW8 A;  1NJI W;  1ZX3 A;  4I9W A;  4JI0 O;  2W0X A;  3SYC A;  2CGN A;  2WLH A;  4GX2 A;  1D2D A;  4X20 A;  1YIJ V;  3D3I A;  4K8Z A;  3IFX A;  3RYF A;  3ZS8 C;  1MOF A;  3ZRV A;  2V7Q G;  1E79 G;  1GO3 F;  4D7S A;  3MHH C;  4OXS A;  1KKD A;  1SRY A;  1N34 B;  2FML A;  2JDI G;  2IJH A;  1VQ4 V;  1PKX A;  4LFC O;  2EZP A;  5KX5 A;  1M9N A;  5B1A B;  2UUA B;  4RAI A;  4TWK A;  4IIJ A;  1S72 V;  4GYC B;  5B1A C;  4WFE A;  3D36 A;  3FAV A;  1MAB G;  4UFZ A;  1GK9 A;  1SA0 B;  1LUW A;  4U7N A;  4X1I B;  2X0L A;  4O4I A;  3LDC A;  3N2G A;  3ZCC A;  5ITZ B;  2ZXW B;  1U97 A;  2JRI A;  5IYZ B;  1FXK C;  1RSO A;  2QM4 A;  3OMA B;  1JVM A;  2EX3 A;  1NR1 A;  3OD4 A;  4I0X A;  3ZRX A;  1X59 A;  4FLT A;  1Q81 W;  2DYS B;  1ROP A;  2QKC A;  2JGD A;  2R9A A;  2WLL B;  4MTF A;  2DYS C;  2WLI A;  5C93 A;  4F6R B;  4FM0 A;  3UQ8 A;  4GKJ B;  2VRZ A;  1YZB A;  1VQ5 V;  1JJ2 U;  2YC0 A;  2AGA A;  2ZIO A;  4LF5 B;  2B1G A;  4GKK O;  2VS0 A;  4K35 A;  3RVZ A;  2JS3 A;  3JD3 A;  1M57 C;  5IDJ A;  4X88 A;  1CXZ B;  3MD0 A;  2Q73 A;  4Z1V A;  2Y0I A;  2YIC A;  4X20 B;  2HVK C;  1P7B A;  2DYR C;  4UCS A;  5LP6 B;  3QTC A;  1M1K W;  3RYF B;  1Q82 W;  1FXV A;  2WWW A;  2E74 B;  3ZED A;  4WF9 V;  3AK3 A;  1OCC B;  2FB5 A;  2QWR B;  2E76 B;  4O2B A;  2EIM B;  4CS2 A;  1OCC C;  2LP7 A;  5J2T A;  1JFF A;  1M93 A;  5KX5 B;  3VQW A;  4B3M B;  5EYP A;  3QO5 A;  3K5N A;  1HR0 O;  3ZX6 A;  4W4K A;  2WLN A;  2AHZ A;  1VQK V;  1S5H C;  5EBM C;  4KHP B;  2Z3Y A;  4PDR A;  3D36 C;  1DGS A;  2MK3 A;  1MSD A;  2Q9L A;  1AR4 A;  4DR7 O;  3RGB A;  4GKK B;  5BMV A;  4IGG A;  4UB6 Z;  4DV1 O;  2EIN B;  5B3S B;  4J7Z A;  3LNM B;  2XHB A;  1N36 B;  3OM3 B;  4LCU C;  1Y76 A;  1R6T A;  2EIN C;  1RSO B;  2XAS A;  4X1Y B;  3R65 A;  4X8A A;  3KCY A;  3SPH A;  4I0X B;  4ZHQ A;  3J80 N;  3BRC A;  3CCS V;  2JGD B;  4EB6 B;  3OTO O;  2B9Z A;  1N0N A;  3OE7 G;  1LNQ A;  4FZ1 A;  3B2E E;  3CWB H;  2EBO A;  2XAH A;  1YIT V;  3JAR A;  1HR0 B;  2DOS A;  2YXY A;  3GB7 C;  1L8D A;  1DLB A;  1EN6 A;  4LH6 A;  1K8A W;  4DXW A;  2Y69 C;  4LNU A;  4O4H A;  5IY5 B;  4LF9 O;  1H2S B;  5GTI Z;  1AJN A;  5FL7 G;  5IY5 C;  1XEQ A;  1XRE A;  4DR7 B;  4GX5 A;  4DV1 B;  1JCH A;  1TVK B;  3UM7 A;  2GBO A;  2EZO A;  3IGA C;  2HEP A;  2YID A;  1ZWI C;  3JAK A;  3ETQ A;  2PYL A;  4JI5 O;  1NT2 B;  2FYU H;  5L3E A;  3CC4 V;  2JJ1 G;  1LR1 A;  5C8Y B;  1M4U A;  2HJF C;  3SR2 C;  1AB3 A;  4I55 A;  3KKY A;  4OPA A;  1Y67 A;  3H1I H;  4O2B B;  4TQD A;  3ABL B;  4JI8 B;  4B3R O;  4JTA B;  2DN9 A;  1KYO F;  1NVP D;  3M8A A;  3OTO B;  1XHZ A;  2BOC C;  4PA9 A;  3B40 A;  3BCC H;  3S3X A;  4MW3 A;  1P84 F;  2ADP A;  4PDL A;  2YI8 A;  3OR6 C;  4AIL C;  2QR4 A;  2RN9 A;  3G67 A;  3I55 V;  1IUR A;  1BMF G;  5LHI A;  3EFF K;  4LF9 B;  4DR3 B;  5EC2 C;  1IVS A;  1X4T A;  4J7J A;  2OCC B;  5L3C A;  4R8C A;  1K9M W;  4MTG A;  4DUY B;  5B1N A;  4E4E A;  3OUF A;  4LC1 A;  1NH2 D;  1DK1 A;  1U96 A;  2QKS A;  3BVO A;  4ZHQ B;  2X6C A;  1EN4 A;  3D8C A;  5JJN B;  4JI6 O;  3EXA A;  1IBK O;  4B3R B;  2XAG A;  1A32 A;  4JZ2 A;  1TUB A;  4D6T H;  3JAR B;  3N27 A;  5CMU A;  3H1L H;  5LA6 A;  1QCE A;  2R70 A;  3WG7 C;  1WAZ A;  1AJP A;  1O9G A;  3B77 A;  3AK1 A;  3P3P A;  2CTQ A;  4NVP A;  1MZE A;  4FLW A;  3TJT A;  2PY5 A;  5DED A;  1GTO A;  3J81 N;  1E1R G;  1BHA A;  3T1C A;  2P5O A;  2R72 A;  3K5L A;  2Q0O C;  4MT8 A;  3K5O A;  1R3L C;  2QDO A;  3B4S A;  1RFY A;  1XMQ O;  3F7Y C;  4IYI A;  4I55 B;  3IAY A;  4BIZ A;  2ZNI A;  1QR8 A;  2QWQ B;  1I94 O;  2QSA A;  4I5S A;  1KMI Z;  1YHQ V;  1BL8 A;  4XDJ A;  4JI3 B;  1XOU A;  1EFR G;  4JI6 B;  1Q90 D;  1IBK B;  1IBM O;  5H9C A;  3JAW A;  2FL4 A;  1BS3 A;  1H2M A;  4DO2 A;  4EEQ A;  2H94 A;  3K08 A;  3N2K B;  2NNU A;  4DUZ B;  4C7U A;  1WP8 A;  3TCU A;  5KLV H;  5JCO A;  4JI2 O;  3LSQ A;  4EKW A;  4ZI7 B;  1PM9 A;  4BIO A;  3F5W C;  2LQT A;  3ETG A;  2EIL B;  1ZAU A;  1V54 C;  3ABU A;  4A5U B;  2UXB O;  2F95 B;  2HJD A;  4TUY A;  1HNX O;  4U3J B;  3GWK C;  5LL6 Y;  5EK0 A;  2YIB D;  1K7D A;  4LF6 O;  3ZBH A;  2RNB A;  2F43 G;  3X2Q C;  2QTO A;  2OIE A;  1PL4 A;  1PP9 H;  4TOI A;  2DQ3 A;  3K79 A;  2F4V O;  5IYD O;  3DC6 A;  2ODM A;  1FJG O;  2QWN B;  3G6E V;  1HWY A;  3K3W A;  1KKC A;  3ICX A;  3S3W A;  1I94 B;  2ILM A;  1Q86 W;  1VF5 B;  1K34 A;  5EZY A;  3RYC A;  2CAZ C;  3OFN G;  1G6U A;  2WLM A;  1GN6 A;  2YS8 A;  5LA6 B;  4RUF A;  3CC7 V;  3E8F A;  4WCE V;  1PV0 A;  1IBM B;  2GV9 A;  4GLX A;  2ZIM A;  2EJ7 A;  5KUM A;  2UXD B;  1KUQ A;  2IU0 A;  3D3Q A;  1B04 A;  3G71 V;  3VQX A;  5JJE B;  4PV1 B;  1WJZ A;  3E8G A;  4L8J A;  5KAI Z;  3CCE V;  4J41 A;  2X7R B;  4JAU A;  2F23 A;  3LDE A;  1ZL8 A;  1KEC A;  3CPW U;  3RYI A;  1OCZ B;  4X62 B;  3RWR D;  1M5I A;  3F7V C;  4YXW G;  3K0D A;  2EIJ B;  4NR1 A;  5K1X A;  1OCZ C;  1MA1 A;  2F4V B;  3IC7 A;  2EIJ C;  1FJG B;  1BHB A;  1HDJ A;  2YIA A;  2Y4T A;  1YDX A;  1Y6X A;  3HR0 A;  1DF4 A;  2GUZ A;  1Q7Y W;  2P4K A;  1BCC H;  1AP5 A;  1VQO V;  1WB8 A;  1K73 W;  1Z2G A;  4UVC A;  3GWO A;  5KHJ A;  2CTR A;  5L3F A;  1NZ6 A;  1G1X B;  4DV6 O;  3CRM A;  5JCO C;  2CK3 G;  4LFA B;  3JYC A;  3KCX A;  1R3I C;  1QVG U;  3ASN B;  3WFV A;  5CBH A;  3CJH A;  1YJN V;  4MVR A;  3ZHU A;  4YY3 O;  4WFF A;  1H2L A;  1S0V A;  4IT5 A;  2BE3 A;  1W2B U;  1DF5 A;  5EBW C;  1H2N A;  4JF3 A;  3CXH F;  5L3D A;  2PUS A;  5JVD A;  2DWD C;  4QJF B;  3RYH A;  3CS5 A;  3VQY A;  1NU1 H;  3UT5 A;  1SET A;  2ZM6 B;  2ADQ B;  1EM1 A;  5IWA O;  3AG1 B;  3HKC A;  3E22 A;  1SQQ H;  4CZZ A;  5K1P A;  5LMU B;  3HKB A;  3CB2 A;  3AG1 C;  4DW0 A;  1Q8I A;  2UUC O;  1F23 A;  4PA6 A;  4G2K A;  2H8P C;  2VQF O;  1AI6 A;  1G4Y B;  3EVK A;  1SER A;  3G4S V;  4UCR A;  5IYC O;  1CEZ A;  1IBL B;  1N32 B;  1WN7 A;  4DV6 B;  4J9Y B;  1N8R W;  1UFI A;  4MVS A;  5KUK A;  5A9G A;  4QE9 A;  3T1Y B;  1Y74 A;  4DV2 O;  1H38 A;  1QLN A;  2ZD9 A;  4F4L A;  1S3J A;  3L70 H;  5IJ9 A;  4CC5 A;  3RN4 A;  1IZ3 A;  3LUT B;  4QPK A;  4KXR A;  1OJH A;  2ZIN A;  1VMG A;  3RFR A;  2Q4P A;  3QF7 A;  2YEV A;  4GZR B;  1EN5 A;  1PNK A;  5H2F Z;  4BAY A;  2P06 A;  3OGC C;  1YTF B;  4PA7 A;  4O4J A;  5IWA B;  2E5L B;  1MNG A;  2QE7 G;  4UB8 Z;  4RQF A;  3FX7 A;  2HG5 C;  4HBN A;  2K9P A;  4KP4 A;  3U10 A;  3BEH A;  5B1O A;  2UUC B;  1AP6 A;  5JJJ B;  2DWE C;  4LH7 A;  2VQF B;  1M56 B;  4JI0 B;  3HKE A;  1QR9 A;  1N0J A;  1XNQ O;  1FXK B;  2WAM A;  1Q6H A;  4UCT A;  1M56 C;  5J2U A;  1G8M A;  1P4R A;  3CRC A;  2ZDI A;  2ZR2 A;  4YIO A;  4DV3 O;  3CJH B;  3ZN0 A;  2AXT Z;  1EZV H;  1S5J A;  1Z5W A;  2HVJ C;  3L72 H;  3E2E A;  3SPC A;  5GW7 A;  4PD4 F;  4P30 A;  3RYH B;  4DR4 O;  4FLX A;  5LBQ A;  4PA4 A;  2IJK A;  4KUM A;  1NQT A;  4RUE A;  2ZQM A;  3UT5 B;  4UUJ C;  4LFC B;  5KHH A;  3JCZ A;  1K4D C;  3E22 B;  4B7E A;  1OCR B;  3L71 H;  4RWU A;  4LWS A;  3L9D A;  4HNA A;  1KP2 A;  1OCR C;  4FJC C;  1OZ0 A;  1M57 B;  1RP3 B;  2AHY A;  3FKS G;  2RDC A;  2GTA A;  3K0G A;  3G80 A;  2DYR B;  5IYB O;  3K03 A;  3JSN A;  4X1K A;  3FB6 C;  3UCS C;  3A0H Z;  4ZKI A;  3OR7 C;  5H6Q A;  4NXN O;  1UPG A;  1K3E A;  4ABM A;  1R73 A;  2RJZ A;  1GMG A;  4WFG A;  1YJW V;  4X66 O;  3AG2 B;  4X65 O;  2A0L A;  5EC1 C;  4J11 A;  4BR6 A;  2QGN A;  4DV3 B;  3AG2 C;  3OMN B;  4UCO A;  1YSC A;  2VWJ A;  5FPO A;  1VEW A;  2OIG A;  5LMN O;  4B08 A;  3GVM A;  4YHH O;  2HLD G;  3BA8 A;  2YEV B;  4H33 A;  1VQN V;  3BHP A;  2UU9 O;  4D7T A;  4IIJ B;  4DRX A;  3BAB A;  5CBF A;  3FAV B;  1YXB A;  3BA9 A;  4ZOL A;  3F5T A;  4EFE A;  1ZLZ A;  2Q7E A;  1GRJ A;  1YEW A;  4JYB A;  5CA0 A;  3JCU Z;  5AG2 A;  1GM7 A;  3STL C;  2HP8 A;  4O4I B;  1QU7 A;  2YDE A;  2UUB O;  2VWK A;  3HKE B;  3SPI A;  2ZKO A;  4ZBM A;  3N2G B;  3T1H O;  1QVF U;  4NXN B;  3VBB A;  3APQ A;  4LF4 O;  3DC5 A;  3BPZ A;  4F6E A;  3QG5 A;  4X66 B;  4YIP A;  1SQG A;  4X65 B;  3I56 V;  2ZDI C;  5JH7 A;  1VF6 A;  5FNV A;  3ZRW A;  2Q6A A;  2Z0A A;  1XIL A;  3H9V A;  4R50 A;  5LMN B;  4GX1 A;  2WLI B;  4YHH B;  1AI4 A;  2XTA A;  1D5A A;  4MTO A;  2ZR3 A;  4YJ3 A;  4X9Q A;  4DK1 A;  3Q4H A;  2Y69 B;  4CC6 A;  1YJ9 V;  2P4V A;  4LWS B;  3E8B A;  4I4T A;  5EIB D;  3P32 A;  2NN4 A;  2UXC O;  3AEI A;  2A7W A;  2BSK A;  1DTO A;  4JZG A;  4JAS A;  5JQG A;  4LBE C;  4K0K O;  3CCJ V;  1R3J C;  5IJ0 A;  2IH3 C;  1XNR O;  5FLX N;  2KB1 A;  2DJV A;  4DR1 O;  1SS3 A;  3PJS K;  2MW2 B;  3JAL A;  4YJ2 A;  4LF4 B;  2ZE5 A;  3JD1 A;  2HR3 A;  2V1D A;  4FM1 A;  3NR7 A;  3FD9 A;  2ITC C;  1GN4 A;  5TIS Z;  4QGP A;  5J2T B;  1JFF B;  2PF4 E;  4NXM O;  1SC5 B;  3RW0 A; 
#chains in the Genus database with same CATH homology
 4TT3 G;  4MVZ A;  3F5W C;  1K5Q A;  3ETG A;  2EIL B;  4Z1M G;  2K1E A;  3ABM C;  1ARO P;  1V54 C;  2WLL A;  3ABU A;  3FYI B;  3RVY A;  2OTL V;  3HB3 B;  2X6A A;  5EK0 A;  3CMA V;  1K7D A;  1H2G A;  3SPJ A;  2A79 B;  4L87 A;  1V55 B;  2F43 G;  1PL0 A;  3X2Q C;  1NR7 A;  2QTO A;  4P2Z A;  1RM1 B;  1E1Q G;  1QLE C;  3CXC U;  3SPG A;  2DQ3 A;  3K79 A;  3SYA A;  5IYD O;  1THZ A;  4MW8 A;  3G6E V;  1HWY A;  3K3W A;  1NJI W;  2UXX A;  1H8H G;  2B1I A;  4I9W A;  3E8H A;  3K06 A;  1Q86 W;  1K34 A;  3SYC A;  2WLH A;  4GX2 A;  3OFN G;  1KD1 W;  1AI7 A;  2WLM A;  2A9H A;  1YIJ V;  2YSU B;  3D3I A;  4RUF A;  3CC7 V;  3E8F A;  4WCE V;  3IFX A;  1JQ0 A;  3LSS A;  2IJI A;  4PDM A;  2EIM C;  4Q20 A;  2EJR A;  1AI5 A;  3T2M A;  1MOF A;  3P30 A;  3ZRV A;  2V7Q G;  1E79 G;  1GO3 F;  1QBZ A;  2DQ0 A;  3MHH C;  3JD2 A;  4OXS A;  5KUM A;  3CCL V;  3FB7 C;  1KKD A;  1SRY A;  2IU0 A;  4X89 A;  3G71 V;  3WG7 B;  2LFS A;  2JDI G;  3H01 A;  2IJH A;  4E2L A;  3ZMZ A;  3E8G A;  1VQ4 V;  3CCE V;  1PKX A;  3DTU B;  2EZP A;  1CPY A;  2X7R B;  4JAU A;  1R6K A;  3LDE A;  4N21 A;  4XDL A;  1M9N A;  1S76 D;  1KEC A;  5B1A B;  3CPW U;  4RAI A;  4TWK A;  3STZ C;  1S72 V;  1VQ9 V;  3ASO C;  1OCZ B;  3ZN1 A;  4GX0 A;  1L1F A;  3F7V C;  1COW G;  3RBZ A;  4YXW G;  5B1A C;  4WFE A;  3D36 A;  3K0D A;  1MAB G;  2EIJ B;  1GK9 A;  1OCZ C;  4U7N A;  3E89 A;  5B3S C;  3CC2 V;  1OHH G;  2X0L A;  2JK5 C;  2QEX V;  3CYO A;  3IC7 A;  2EIJ C;  4MS2 A;  5LHH A;  1BHB A;  3ZMT A;  4JYC A;  4HAM A;  4UVB A;  3LDC A;  1DF4 A;  4WFH A;  1KC8 W;  1Q7Y W;  3ZCC A;  2Z5U A;  1VQO V;  3VOU A;  3CD6 V;  2ZXW B;  4JPR A;  3OUS A;  1K73 W;  4UVC A;  2P6J A;  1M90 W;  3T4Z A;  3GWO A;  4PEL A;  1FXK C;  3CP1 A;  4MVO A;  5L3F A;  3ZJZ A;  2LFR A;  1WLE A;  3OMA B;  1JVM A;  4WFA V;  4H37 A;  1NR1 A;  3B8M A;  3ZRX A;  4JAV A;  1Q81 W;  2CK3 G;  2DYS B;  1ROP A;  2QM7 A;  3AG4 B;  2JIZ G;  2QA4 V;  3JYC A;  2WLL B;  4MTF A;  1R3I C;  1QVG U;  3SYP A;  3ASN B;  1SZT A;  2DYS C;  2WLI A;  2FTK A;  3AG4 C;  3WFV A;  5C93 A;  5CBH A;  1YJN V;  4MVR A;  4WFF A;  1S0V A;  1KQS U;  3ABM B;  2Q69 A;  1V54 B;  1W2B U;  1DF5 A;  5EBW C;  1K92 A;  4RO2 A;  4JF3 A;  5L3D A;  5KA5 A;  1VQ5 V;  3W7S A;  1JJ2 U;  1JOY A;  2DWD C;  4QJF B;  2B1G A;  4QIW F;  1NVP B;  1F4N A;  3CME V;  4XDK A;  3RVZ A;  2HKO A;  3JD3 A;  1M57 C;  4XBF A;  5IDJ A;  4X88 A;  1SET A;  3MD0 A;  3UKM A;  3X2Q B;  4LP8 A;  3AG1 B;  1QLE B;  2HVK C;  1IXM A;  4CZZ A;  1P7B A;  2DYR C;  5B1B C;  4CBC A;  2X6B A;  1M1K W;  4TSF G;  1MSW D;  2P90 A;  4PA3 A;  1Q82 W;  1FXV A;  3ABL C;  3AG1 C;  3W7T A;  2WWW A;  1F23 A;  2IW5 A;  4PA6 A;  4G2K A;  4WF9 V;  2IJJ A;  2H8P C;  4KFM A;  3ZMV A;  1AI6 A;  2PI5 A;  1G4Y B;  1OCC B;  1SER A;  3G4S V;  4MTX A;  1F51 A;  5IYC O;  1CEZ A;  2JJ2 G;  2ATK C;  4J9Y B;  2EIM B;  1Y4M A;  1OCC C;  1N8R W;  2LP7 A;  1OCO C;  2DW4 A;  5CN0 A;  4JTC B;  4MVS A;  5KUK A;  3ZRW B;  4QE9 A;  2OT5 A;  3FB5 C;  1H38 A;  1QLN A;  3QO5 A;  4GCZ A;  3ZRS A;  2ZD9 A;  4F4L A;  1S3J A;  2WLN A;  3W7U A;  2AHZ A;  1VQP V;  1VQK V;  1NH2 B;  3LDD A;  1S5H C;  3LUT B;  5EBM C;  4QPK A;  1AR1 B;  2Z3Y A;  3CCV V;  2OCC C;  1RPR A;  4PDR A;  1GKF A;  2MK3 A;  3MHS C;  2YEV A;  1EBO A;  3SYQ A;  2NLJ C;  3FYE B;  3ASO B;  1K33 A;  1PNK A;  1MG1 A;  1F4M A;  3OEE G;  1VQL V;  4BAY A;  1K97 A;  3OGC C;  1YTF B;  2EIN B;  3W7X A;  5B3S B;  4PA7 A;  5HFM A;  5H6R A;  2QE7 G;  3LNM B;  4RQF A;  2HG5 C;  3OM3 B;  4LCU C;  4KP4 A;  3M99 B;  2EIN C;  3ABK B;  2WSS G;  2IU3 A;  1AJQ A;  3BEH A;  5B1O A;  1H8E G;  4QNH B;  2XAS A;  4FMT A;  3R65 A;  4X8A A;  3DGE A;  4FK5 C;  3SPH A;  2DWE C;  4FPP A;  4BW5 A;  3ABK C;  3B8N A;  3T4D A;  1M56 B;  3E86 A;  2EIK C;  1PNM A;  1QR9 A;  1FS0 G;  3CCS V;  3KG2 A;  1NKD A;  1FXK B;  2WAM A;  1K4C C;  1GM9 A;  3OE7 G;  1M56 C;  1LNQ A;  2XAJ A;  1G8M A;  1P4R A;  2P67 A;  2Q68 A;  4ASU G;  1PNL A;  2ZDI A;  2ZR2 A;  2EBO A;  2XAH A;  2BOB C;  5L3B A;  3ZN0 A;  1YIT V;  3OW2 U;  2GSM B;  4FIP C;  4P9P A;  3JD4 A;  4U7O A;  2HVJ C;  3GB7 C;  3HPL C;  4G27 B;  1DLB A;  3E2E A;  1K8A W;  4DXW A;  3SPC A;  5GW7 A;  2Y69 C;  3ETD A;  1Y66 A;  4UVA A;  4P30 A;  5LGN A;  1W0J G;  5IY5 B;  5LBQ A;  5LGU A;  4PA4 A;  2IJK A;  4KUM A;  3ZMU A;  1NQT A;  4RUE A;  3W7W A;  2M7W A;  2ZQM A;  2XAQ A;  3A0R A;  4QE7 A;  4UUJ C;  1R6N A;  1AJN A;  1B6Q A;  5FL7 G;  5IY5 C;  3JCZ A;  1K4D C;  4GX5 A;  4PDV A;  5CA3 A;  1OCR B;  1JCH A;  3UM7 A;  2EZO A;  3IGA C;  1KP2 A;  1VQ7 V;  3ETE A;  1OCR C;  1OZ0 A;  1M57 B;  1ZWI C;  2AHY A;  1JPX A;  2XND G;  3FKS G;  1CP9 A;  4FJC C;  4JGS A;  1I5X A;  2D3O W;  1RPO A;  4G28 B;  5L3E A;  3CC4 V;  3OMI B;  2JJ1 G;  2W6I G;  3K0G A;  2DYR B;  2HJF C;  5B1B B;  5DN6 G;  2JEU A;  5IYB O;  3K03 A;  3FB6 C;  4ZKI A;  2W0F C;  3OR7 C;  5H6Q A;  3ABL B;  1GM8 A;  5L3G A;  5LHG A;  2Y48 A;  1K3E A;  4R7C A;  1R73 A;  3ML0 A;  4JTA B;  4MVU A;  1NVP D;  1I5Y A;  1GMG A;  2WLJ A;  4WFG A;  1YJW V;  2BOC C;  3AG2 B;  5BZB A;  4PA9 A;  2A0L A;  4BIU A;  3TET A;  5EC1 C;  5CBG A;  1YI2 V;  2XAF A;  3QO8 A;  3ABT A;  4MW3 A;  1ENV A;  3AG2 C;  1OCO B;  1SES A;  3OMN B;  3ZMS A;  4PDL A;  1YSC A;  2EIL C;  4UXN A;  3SJQ C;  5E1A C;  3OR6 C;  3CCU V;  2HLD G;  3I55 V;  2YEV B;  1K5S A;  4H33 A;  4HZ3 A;  1VQN V;  1BMF G;  5LHI A;  5HFL A;  1XL4 A;  3EFF K;  3JD0 A;  2OTJ V;  4MVQ A;  1FXH A;  5EC2 C;  1V55 C;  1R3K C;  4JTD B;  5EBL C;  2PI4 A;  1RM1 C;  3EHB B;  1JX9 A;  2OCC B;  5CBF A;  1EZJ A;  5L3C A;  4R8C A;  1K9M W;  4HYO A;  1UJW B;  4MTG A;  3K04 A;  2ITD C;  1VQM V;  2IH1 C;  4GT1 A;  5B1N A;  3OUF A;  4JYB A;  3QO7 A;  2Q67 A;  3BY6 A;  4LC1 A;  1GM7 A;  3STL C;  5J9P C;  1NH2 D;  1TUE B;  2QKS A;  2UXN A;  3SPI A;  4ZBM A;  2X6C A;  3SYO A;  1QVF U;  3TK1 A;  4QPJ A;  3VBB A;  4WFB V;  2WPD G;  2GHY A;  4RQE A;  2XAG A;  1WPX A;  1FFT B;  2EIK B;  5LGT A;  3OAA G;  5CMU A;  1KP3 A;  3I56 V;  1QCE A;  3WG7 C;  2R9I A;  2ZDI C;  1YTF D;  3ZRW A;  1AJP A;  2Q6A A;  1VQ8 V;  3B77 A;  4UV8 A;  3CCQ V;  1NBM G;  3FB8 C;  3E35 A;  4R50 A;  4GX1 A;  2WLI B;  1J95 A;  2B5U A;  1AI4 A;  3CCM V;  4MTO A;  2ZR3 A;  1GTO A;  1E1R G;  2Y69 B;  1BHA A;  1YJ9 V;  2XOK G;  5DM6 V;  2JEX A;  3E8B A;  3T1C A;  3P32 A;  2HFE C;  4MT8 A;  3AEI A;  1R3L C;  3CCR V;  4P9O A;  3F7Y C;  1DTO A;  2QM8 A;  1S77 D;  4JAS A;  4BIZ A;  2R9R B;  1QR8 A;  4LBE C;  2ZXW C;  3CCJ V;  4J9Z B;  1PD3 A;  1R3J C;  2IH3 C;  2KB1 A;  1ORQ C;  4I5S A;  3OEH G;  3E83 A;  1YHQ V;  1BL8 A;  4XDJ A;  2P7T C;  4MVM A;  2W6J G;  5KA6 A;  1EFR G;  3PJS K;  2WLK A;  4R6Z A;  5H9C A;  1FXK A;  3AG3 B;  3JD1 A;  4N23 A;  4MSW C;  2HR3 A;  4DO2 A;  2V1D A;  2H94 A;  3K08 A;  2C2A A;  1VQ6 V;  1W0K G;  2ITC C;  2NNU A;  1XL6 A;  3AG3 C;  3NXS A;  3TCU A;  3ASN C;  3LSQ A;  4UV9 A;  3ZIA G;  3RW0 A;  3K9A A;  4EKW A;  3QNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...