4RUEA

Human k2p4.1 (traak) potassium channel, g124i mutant
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
259
structure length
251
Chain Sequence
PGRAMRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPEHSAWDLGSAFFFSITIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Potassium channel subfamily K member 4
publication title Transmembrane Helix Straightening and Buckling Underlies Activation of Mechanosensitive and Thermosensitive K2P Channels.
pubmed doi rcsb
source organism Homo sapiens
total genus 74
structure length 251
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4rueA00
1K4DC 2DWEC 4JTAB 3ABMC 4R7CA 2A9HA 3TETA 4PA6A 2BOCC 2X6AA 3OR7C 3E8HA 3VOUA 2HJFC 5E1AC 4MSWC 2QKSA 1G4YB 2QTOA 2DYRC 2DYSC 3LUTB 5CBFA 5EC2C 4MW3A 3ZRSA 4LBEC 3T1CA 2EIKC 4XDJA 5EBLC 5IY5C 2Q69A 4RUFA 1JVMA 2HFEC 4WFGA 2AHYA 3E8FA 2NLJC 3UKMA 3RVZA 3FB5C 4HZ3A 4MW8A 3ASOC 4PA9A 2A0LA 3F7YC 2JK5C 4XDKA 1R3JC 2HVKC 3ABKC 4JTDB 4QNHB 1K4CC 5CBGA 5J9PC 4GX0A 1LNQA 4MVMA 5B1BC 3E8GA 4MVRA 3WG7C 4MVOA 4PDMA 4RAIA 3RVYA 4LP8A 4PDRA 4GX1A 3AG2C 4LCUC 4MS2A 4OXSA 3ASNC 3OR6C 5KUMA 3FB7C 4MVQA 3E86A 2Q67A 4H37A 3RBZA 2KB1A 3IGAC 4PDVA 5EBMC 3SYCA 5KUKA 4MVSA 2HVJC 3BEHA 3AG4C 3K03A 2WLNA 4WFEA 2WLJA 1OCRC 4P2ZA 5EC1C 3T2MA 3SPGA 2IH1C 3AG1C 1J95A 4WFHA 1OCZC 2Q6AA 2WLMA 4R6ZA 3K04A 4MTGA 4ZBMA 1XL4A 4G28B 3SYAA 2WLIA 4I9WA 3UM7A 2R9RB 5BZBA 3OGCC 3JYCA 1P7BA 2DWDC 4PA3A 4X8AA 1ZWIC 4P9PA 3ABLC 1R3IC 4PDLA 3HPLC 3OUFA 4QE7A 2YEVA 3OUSA 4X89A 3LDEA 5B3SC 3E83A 4BW5A 3PJSK 3RW0A 1M57C 1R3KC 3SJQC 1V55C 1QLEC 3SYPA 4EKWA 4PA4A 4G27B 1OCCC 2ZD9A 3LDCA 3LNMB 4KFMA 3SPHA 3SPJA 1R3LC 1KKDA 4HYOA 3K08A 5CBHA 2ATKC 2BOBC 3F5WC 4P30A 1OCOC 4TWKA 2WLHA 3SPIA 1M56C 3FB6C 3X2QC 4J9ZB 3EFFK 4GX5A 3FB8C 2OCCC 1S5HC 3R65A 4QE9A 4DXWA 3K0DA 3ZJZA 2EINC 1ORQC 4P9OA 3STLC 4MVZA 2WLLA 2HG5C 3K06A 4H33A 3KG2A 2P7TC 4JTCB 3STZC 3E89A 5EBWC 4MTOA 3T4DA 2K1EA 2WLIB 4R8CA 4F4LA 4XDLA 1V54C 2WLLB 4UUJC 3F7VC 4J9YB 3E8BA 4RO2A 2WLKA 2AHZA 4CBCA 2ZXWC 3IFXA 3SYOA 2Q68A 4R50A 5EK0A 4PA7A 5B1AC 2W0FC 3T4ZA 3SYQA 3GB7C 2H8PC 3TCUA 3AG3C 4RUEA 2X6BA 2X6CA 4MVUA 2ITDC 4GX2A 2EIMC 3K0GA 1XL6A 2IH3C 4WFFA 3LDDA 2ITCC 2Y69C 4MTFA 2A79B 1BL8A 4X88A 2EIJC 2EILC 3SPCA
chains in the Genus database with same CATH superfamily
1TUEB 1OCOB 4JAUA 4FFBB 4NR1A 4LF7O 3JATB 3SJCC 1EM1A 5BR8O 4UCUA 3TJTA 4HNAA 4RWUA 3T1CA 4ZKIA 5IYZA 2Q69A 1E79G 1L1FA 1QVFU 3UKMA 5DM6V 1Q5OA 4PA9A 3UO2A 4CS2A 3DSQA 1EZJA 1K8AW 5J9PC 3N2KA 4MVMA 4CH6A 4GX1A 1K34A 1GN2A 2PY5A 5LMUB 4W4KA 3RBZA 2UXCO 5LGUA 2UUBB 2OIEA 2XAJA 4IT5A 3F5TA 1SA0B 1K73W 3CSXA 3JYCA 1P7BA 5BMVA 3P30A 4DR2O 1AR1B 1KQSU 4G2KA 3P32A 4BW5A 2ZDIA 1PD3A 1RM1C 1M57C 1JQ0A 1DF4A 2JS3A 3CRRA 3HKBB 2F1MA 2JJ2G 2ATKC 3ETDA 3CX5F 3H1IH 1KP3A 2NN4A 4TV8B 4X9QA 2JVDA 2RCVA 2UXDO 1B6QA 3STZC 1MABG 1MZEA 1SZXA 2IBZH 1PL4A 3SDLA 2NR5A 1VQPV 1RSOB 4CBCA 1VQLV 2EULA 1URFA 3K9SA 5B3SB 4AILC 3AG3C 3C3TA 3K57A 1HR0B 1WPXA 4H44B 1YDXA 4Z1VA 2YIBA 3J80N 5J2UA 3CMEV 3G4SV 2YXHA 2X6AA 2D2CB 5EIBD 3FKSG 3ZMZA 3CCSV 4LBEC 2CUGA 5IJ0A 4QPJA 2FYUH 3E8FA 2AXTZ 3CD6V 1JCHA 4CS3A 1ENVA 2RMKB 4GX0A 2GHYA 1AR4A 3B8NA 1SQQH 1YXBA 2UU9B 1TA8A 3N27A 2PTMA 2QA4V 1H2NA 1BCCH 2Q67A 1BSMA 1N32B 1Y66A 5H6RA 1L0NH 4PDVA 3IJ4A 1F4MA 2HVJC 1F7YA 4WFHA 1KBHA 4R6ZA 4DR1O 3K04A 2YI9A 2QKAA 4FLWA 4PA3A 3Q4HA 1ZWIC 4YJ3A 1FXKA 3T1YO 2CE4A 1Y6XA 3SYPA 1WLEA 1W0JG 3OFNG 3FX7A 1P7GA 4HYOA 1HNWO 1XNRB 3IC7A 3OT7A 1I94O 1RPRA 3ZN1A 4Q6GA 5CMUA 4JI7B 2LO1A 3AG4B 3CB2A 2Q5ZA 1QCEA 3RWRD 1AI6A 3G80A 5JCOA 5LOVA 3KG2A 5JH7B 2Z5UA 4TUYA 3C90A 4J11A 3VBBA 1S72V 2R70A 1NU1H 4IL6Z 3L74H 3K3WA 3IAYA 3OW2U 4LF4B 2EZOA 2RNBA 3MAQA 4FLZA 1I5YA 2JGDB 2R9AA 1K97A 4MVUA 4ZOLB 5KAFZ 5LHHA 1XL6A 2V1DA 1IBKO 2P90A 2WWWA 4CH4A 5LA6A 1JFFB 3OTFA 5CN0A 2ADPA 3K5OA 1GH6A 2HJFC 4X1YA 5JQGB 1NS1A 4DV0O 2IU0A 3RVZA 1IBMO 4I50A 1HNZB 1TAEA 4DV1B 5CBGA 1PV0A 1XOUA 4JI8O 3DXRA 2JS5A 3AG2C 4JI3B 2EIJB 3WB0A 5F2VO 1BQZA 2ZDIC 3HKEA 4FM1A 1SQPH 3DC5A 5KUKA 1Q3EA 1S77D 4LF8O 1MA1A 1J5EB 2XTAA 5KX5B 4DR7O 3ASOB 5GTIZ 1XI1A 1YHQV 1SC5B 1THZA 2ZIMA 2Q4PA 3HPLC 4GZRB 1BHBA 3QNEA 1KKCA 4H13B 1ZUQA 3WG7B 4B3MO 1FFTB 2Y4TA 2L6LA 4WF9V 1AVMA 2AW9A 2WLHA 4BR6A 2HKOA 1VQKV 1YITV 4U7NA 1JA8A 2JGUA 3K06A 3QO7A 1TVKB 4PI0A 1Y74A 3LSUA 5LL6Y 5FNVA 4HBNA 5JJNB 3OD4A 1NR7A 2P6JA 3T4ZA 4N21A 3CCLV 3TCUA 1AP6A 1YJ9V 3K0GA 4WFFA 1WN7A 5D5PA 2GUZB 5AG2A 1EFRG 4X1IA 1WAZA 3M7MX 5ITZB 3NXSA 4R7CA 4PA6A 3CE2A 4MSWC 3ABUA 3N2GB 3SJAC 1JJOA 4K8XA 3I5DA 2QM7A 2Q9LA 3ZIAG 1DF5A 3DTUB 3FAVA 5IE9A 4KL1A 2QR4A 4X64B 2CGOA 3E22A 1YJNV 2WA3A 1US6A 3QO8A 1FXKC 2LGWA 4AQYO 2UXXA 3JD2A 5FPRA 2UUAO 4DO2A 4O4LA 1QLNA 4MVQA 2XT9A 3IGAC 1R73A 1F23A 4WFEA 4JI6B 4L8JA 2PYLA 3HKDA 4JI2O 2IH1C 3CCVV 1DGSA 3JAWA 5KA5A 4DRXA 3OTOO 5IJ9B 2R9RB 3HKCB 3JCUZ 2ZNIA 5JCOC 4WCEV 3JAKB 2V7QG 1V9PA 1KP2A 5JJJB 4TQDA 2DW4A 4CH5A 3F5WC 1Q6IA 4FFBA 3X2QC 1Y67A 2Q7EA 3FB6C 5GONB 4LWSB 2BTOA 1B3QA 2OCCC 4UCSA 4BIUA 2LW7A 5LMNO 3RYIB 1K7DA 4FZ0A 1WB7A 3ZJZA 2ZT9B 5L3DA 1B04A 1OCZB 1KUQA 1JX9A 2CAZC 3QO5A 3I55V 4MTOA 1HNXO 4UUJC 1VQNV 1YJWV 4PHZA 2YEVB 3GB7C 5EYPB 2B1GA 2X6BA 4GX2A 2Y69C 4MTFA 3SPCA 3JD4A 3ABMC 1SQGA 1AJNA 5JVDB 4X65B 1SA0A 2QDOA 2W6IG 4IYIA 4NXNO 4MW8A 4YJ2B 1NVPB 2JK5C 4KHPB 4FLXA 2HVKC 3RYFA 3TGUH 1VQ8V 4JI1O 1Z2GA 1I7FA 3TXQA 4FM0A 4DR4O 2EIMB 2C2AA 2DN9A 1G1XB 2OT5A 3AG7A 4I4TB 5DN6G 5LXTB 3I56V 4TV8A 2F4VB 1BS3A 5CA3A 1GN6A 2CTRA 2DOSA 1IXBA 2PGGA 2WSSG 2Y0IA 4O4IB 1M90W 1I08A 4X62O 4I0XA 4I9WA 3UM7A 4UVCA 1XHZA 1EN6A 3JASB 4PDLA 3B2EE 2Q7HA 3UT5B 1U96A 1WA8B 4X1KA 1EN4A 1VQ5V 5CBHA 3RYHA 3AK2A 3CJHB 2CDYA 5LP6C 4FLUA 1MG1A 4DXWA 1ORQC 4EEQA 3EHBB 1GRJA 2WLLA 2P7TC 2QTSA 3L72H 4LNUB 2ARHA 3OMIB 2WLIB 3RT3C 3J7AU 4NKGB 5C8YB 4DYLA 2ZXWC 4U7OA 1AP5A 2XUMA 3SYQA 1XEQA 4QIWF 2H8PC 2ZM6B 2Z3YA 2FKXA 4GUNA 2QM4A 4ASUG 2OTJV 5B66Z 5IT9N 2ITCC 2UXBO 1VF7A 1UPGA 1SKVA 2EILC 4WFAV 3JARB 2A9HA 1BE3H 1D5AA 4TT3G 3B4SA 3AK1A 4I9QA 1X59A 2EIKC 1JVMA 3E2EA 2AHYA 4JYBA 3F7YC 3TXSA 1R3JC 4YY3B 1VQ9V 4UCRA 5B1AB 2GDSA 2HP8A 4K0KB 1GMGA 4RQFA 4CC6A 1AROP 1EN5A 1EZVH 3QG5A 5CA0B 5CA1A 1Y76A 3ASNC 1M4UA 1FJGB 4O2BA 1VARA 3U0ZA 3ZS8C 1R6NA 2ZR3A 3H01A 3CCEV 2UUCB 5DECA 3CCUV 3ZMSA 2UUBO 4XBFA 3AG1C 3S3XA 2Q6AA 2E75B 2ODMA 1MZFA 1ZL8A 2FMLA 2HHHO 4LF5B 4BIZA 3H1LH 1FXHA 1JR9A 4PJ0Z 4ZOLA 1V55C 1YSCA 1NT2B 4KFMA 1LUWA 3SPJA 1YEWA 3JALA 3W7SA 2VS0A 1JFFA 2BSKA 1I0HA 4GX5A 4YHHB 4NB5A 4CC5A 2B9ZA 2HG5C 5JQGA 4DV6B 1Q43A 2AZ2A 4NTXA 4OPHA 2YI8A 5EZYB 3T4DA 3OAAG 2GBOA 1GN3A 1ROPA 4J9YB 2JRIA 3HB3B 3ZMVA 3BABA 3APOA 2AZ0A 1RM1B 4EFEA 1M57B 4JV5B 1H2LA 1VF6A 2BTQA 2RQ6A 1HR0O 2A79B 1BL8A 3ZHRA 1NBMG 4I7ZB 1PP9H 4IGGA 3E8HA 2XHBA 3LUTB 2UXNA 1U97A 5KX5A 4KP4A 4ZI7B 4O4HB 1FFXB 3JD3A 1COWG 1N33B 1QR8A 1K4CC 3D3QA 3CP1A 3AG3B 5B1BC 2V4DA 4DV2B 3FFQA 4B7KA 2E5LB 3IC9A 3E86A 4DR6B 4AI8A 4MVSA 3LSQA 1X4TA 3K03A 2WLNA 2WLJA 3T2MA 3SPGA 4AHCA 1PNLA 1TVKA 2WLMA 2UXDB 1VIBA 5KHKA 1BQ0A 1YTFB 5HFLA 4FMTA 4B3RB 4U3FH 2F23A 2GV9A 1R3KC 3VQYA 1ZSPA 2R72A 3BRCA 3ZRWA 1QHTA 3WFVA 4NXMB 1S5JA 2Z0AA 1M56C 1TGOA 3LNNA 3ZMUA 4JI7O 2EINC 3STLC 3N2GA 2EJRA 5B5EZ 1H2MA 2B1IA 1N36O 2LP7A 3M99B 3RN4A 3F7VC 4O2AA 3SYOA 4R50A 5EK0A 4ZHQB 5EIBC 1KU9A 4LF4O 5CB4B 2XAHA 1MSWD 3LDDA 1AI7A 4X88A 2W0XA 1K4DC 1JPXA 4JI0O 4U3JB 1XHXA 1HP8A 5E1AC 4DK0A 2DYRC 3A0RA 4MW3A 5J2TA 5IY5C 1BHAA 2O57A 5IJ9A 3HKCA 3FB5C 1XNQO 2LJ2A 1SQFA 5IYZB 3JAKA 4QNHB 1W59A 4JPRA 1DK1A 2E3CA 4JYAO 4MVRA 3ZRXA 2CGNA 4PDRA 1S5LZ 1QNMA 2ZCEA 4LCUC 3N2KB 2ILMA 1HNWB 2WPDG 4CZZA 3CCMV 2YDEA 5H2FZ 4LF6O 2DMXA 1VQMV 4FFKA 4MTGA 2VQEB 1J5EO 3QTCA 3RFRA 4UB8Z 1S76D 3FD9A 3B8MA 3APQA 1DLBA 1D5NA 5B1NA 3OUFA 4B08A 2YEVA 3LDEA 3CWBH 2IW5A 4IIJB 3PJSK 3AK3A 1QLEC 1K9MW 3LNMB 4BIOA 1R3LC 3AG2B 5KLVH 4JI4B 4X66B 1FYJA 1IURA 4FPPA 2BOBC 3EFFK 1XILA 3A0HZ 1VF6C 3R65A 2QWOB 1Q82W 5JVDA 3OMNB 2XOKG 1B06A 1Q90D 4JTCB 1K5QA 1VF5B 4O4JB 4YJ2A 4DV0B 1IBMB 2AHZA 1LUVA 3ZX6A 2Q68A 3L71H 4PA7A 4E4EA 2W0FC 4IHJB 1SQVH 5KHIA 1FS0G 4I4TA 2X0LA 2GSMB 3KCYA 5LXTA 3TETA 4DV3O 3HR0A 4J7ZA 4FVMA 2IM9A 4BAYA 4K3AA 4LF8B 1SESA 3CXCU 4BW9A 4IYHA 3W7WA 3RGBA 2YIDA 4GKJB 2EBOA 3J81N 3D3IA 1AILA 4I55A 1QU7A 2QWQB 4JASA 4TV9B 2YXLA 1EBOA 4MTXA 3E8GA 4X64O 1L8DA 2L35A 1MSDA 1CXZB 5IWAB 3CJHA 5KUMA 2ZE8A 1JOYA 2ZQMA 1NTKH 4BWAA 4EB6B 2YIAA 3ZBHA 1VQ4V 1XMQB 2FB5A 4JI6O 2OYQA 4DR3B 3CCRV 1XL4A 2WLIA 1O9GA 4DV7O 1Z5WA 2DE0X 5C8YA 4P9PA 3ABLC 1R3IC 1GM7A 5K1XA 2Q8VA 4FLYA 3E83A 4B3SB 4ICGA 5KMGB 1SQXH 2ZNJA 4YXWG 2RN9A 1OCCC 1P49A 1FXKB 1TUBA 3SJBC 2D3OW 2HJDA 4DV4O 3OM3B 5LYJB 1NJIW 2NNUA 2OWOA 3BA8A 4LFAO 5H9CA 1F51A 2F93B 1XMOB 2IJKA 3GWKC 2LFSA 2K1EA 4F4LA 5LOVB 1V54C 2ZINA 2PZSA 3CC2V 3OEHG 3E8BA 2P4KA 4LFCO 3DC6A 1SF9A 2IH3C 4TOIA 2BE3A 1SRYA 2E76B 2KG7B 3T1HO 2DWEC 3JATA 3X2QB 5TISZ 4AQYB 2UUAB 1GM8A 5FPOA 1NVPD 2QEXV 2YS8A 2OCCB 3S3WA 5LA6B 5A2QN 2EJ7A 5KHGA 2DYSC 5L3FA 4I5SA 4OX9B 4DW0A 3VQXA 4JI2B 3CRAA 4X65O 5L3CA 4X1YB 4DK1A 4DR5O 4QGPA 4OPAA 3JD0A 2CTWA 4LP8A 4QJFB 2Y69B 1H2KA 1FAFA 2Y4UA 3ABMB 2P67A 4KXRA 1VQOV 4GKKB 1OHHG 3KCXA 3P3PA 1OCRC 2F4VO 3HKEB 5BY1A 4K8ZA 5EZYA 4Z1MG 4DV5B 3SGIA 5D5QA 1Q6HA 1CPYA 1FPOA 4LFBB 3M8AA 3HKBA 1Q86W 3MD0A 3MDSA 4GLXA 2ZD9A 3H1KH 3OGIB 4WBNB 1PL0A 4DW1A 4WFBV 2QWRB 1IBLB 2QWPB 4P9OA 5IDJA 4F6RB 2ETNA 1RSOA 3E89A 2AGAA 1KYOF 3CC4V 4O4HA 4JI5O 5BXZA 3K79A 4NXNB 2A06H 3IFXA 1Y74B 2F43G 4K35A 3GVMA 2B5UA 3K58A 4RUEA 2X6CA 5FNVB 2ITDC 2IJIA 3ZHTA 1Q81W 2ZM6O 1GTOA 1Q6UA 1YCIA 2N74A 5LP6B 1GAXA 4PI2A 4X1IB 2IU3A 3ZHVA 5E79Z 4UCOA 5EBLC 2P5OA 4N23A 4KUMA 1N34O 4X62B 4LC1A 2ZXWB 3ABKC 4JTDB 1GKFA 3QVNA 1VQ6V 4C7UA 5KAIZ 3FAVB 4K0KO 1K92A 2EILB 3E22B 4JYYA 4GT1A 2MK3A 4H37A 4J10A 1KC8W 5EBMC 1UFIA 1FJGO 3ETGA 3CYOA 4DUZB 3OE7G 2K9PA 4F6EA 3L73H 5C93A 2BCCH 4LH7A 1R6TA 2EIKB 5H6QA 4L87A 4ZBMA 3CHXA 3JAMN 3P3NA 1VQ7V 4DUYB 5IYCO 3JAWB 3H1JH 4DRXB 1GN4A 1M93A 4X89A 4ZHQA 3C3SA 2ADQB 2IJJA 3CC7V 4LF5O 3CRMA 3SJQC 1SZTA 1K3EA 1Y4MA 3CRQA 4J7JA 4JYCA 4UXNA 3ASNB 5LMUO 3SPIA 1OCOC 2XASA 4U3JA 3CMAV 5JH7A 2ZE7A 1OJHA 1L0LH 1ZX3A 1PPJH 4YHHO 1KMIZ 3AG1B 4LF9B 2H3OA 2VQFB 1LR1A 1BT8A 4J80A 3BA9A 4DV6O 4XDLA 3BY6A 2JGDA 4B3TB 5GW7A 1CP9A 2KSDA 5GTHZ 1V55B 1P4RA 4E2LA 2ZR2A 3G6EV 1QVGU 4NYKA 1KD1W 2FL4A 1QBZA 1FKAO 2PYJA 4LF7B 4JV5O 3JCZA 2XNDG 5BR8B 1T5EA 2EX3A 1K5SA 4FLTA 2H94A 2HEPA 4UCVA 1H2GA 4XDJA 1AI4A 1BMFG 2NLJC 2A0LA 3D8CA 2WAMA 2Q0OC 2OTLV 2HHHB 4IIJA 2QWNB 1K33A 1N33O 3ETQA 4MVOA 2WA4A 4PDMA 3RYFB 4DV2O 1YTFD 3ZHUA 2UXCB 1P84F 2QE7G 3FB7C 3ZHQA 2E5LO 1H8EG 1YI2V 2KB1A 4DR6O 5DEDA 1HWYA 3RYCB 1R1BA 1J95A 4DR2B 5BZBA 2JDIG 4O4JA 4EFBA 4FZ1A 4GYCB 4I0XB 5B3SC 4IHJA 4JAAA 5B1BB 3RW0A 4B3RO 1N4CA 4OGQB 2UU9O 2CH7B 3LDCA 3JSNA 2CK3G 1N32O 4X1KB 4NXMO 2IJHA 1VP7A 1VMGA 1XDCA 4ZIBA 2PI4A 3K0DA 3RYHB 3D36A 3CEIA 4UCTA 5K1PA 3E35A 1NR1A 5EBWC 1R6KA 1ZTEA 4R8CA 2WLLB 1I5XA 1A32A 3CXHF 2GUZA 4TV9A 3BAAA 4D7TA 4HAMA 5ITZA 3U11A 2YSUB 5LBQA 2VRZA 1XNRO 4LR3A 3G71V 1M56B 5HFMA 1IVSA 4EB6A 3VOUA 3OMAB 2EINB 1G4YB 4X20B 3VQWA 2HFEC 4UFZA 2F95B 3W7UA 2EZPA 2PUSA 2P4VA 3BVOA 3UQ8A 5KMGA 1Z5VA 2XAFA 3KZIZ 3L70H 1FXVA 4JF3A 2KQXA 2Q0AA 2QM8A 3K9AA 4PELA 5LYJA 5JJEB 1E1RG 1F4NA 3SYCA 2LFRA 4UVBA 5CA1B 3AG4C 1Y76B 1GM9A 4O2BB 2DYRB 4DR1B 4ABMA 4J42A 4HNAB 5IY5B 4J7KA 1D2DA 3SYAA 3THOA 1XREA 2F66C 4YIPA 1HNZO 2KKWA 4DV1O 1N36B 3T1YB 2VQEO 1PNKA 1AJPA 4QE7A 1O9HA 2GTSA 1ZL8B 2VWKA 2JEUA 2M6YA 4JI3O 5GONA 3K5MA 4LWSA 2KG7A 1I94B 3RYIA 5A9GA 3FYEB 4TWKA 4JI4O 1QQCA 4X66O 1MNGA 3JALB 4JI0B 1S5HC 3WB2A 1IZ3A 4UB6Z 1WB8A 3VQVA 3ABTA 2BSKB 2QSAA 2JIZG 4UV8A 5FL7G 5KA6A 2M7WA 1XQ8A 3EVKA 5EYPA 5BMVB 1NZ6A 2WLKA 1XNQB 3A0BZ 1IBKB 2YICA 2YIBD 1QLEB 1WP7A 4JYAB 3ZHSA 1GK9A 2VWJA 2EIJC 5IYBO 2W6JG 2BTQB 3ZMTA 1WNSA 1SQBH 1S3JA 2HLDG 3O65A 4FJCC 1AB3A 1PKXA 2QKSA 2MW2B 2QTOA 5CBFA 5EC2C 3K5NA 4LF6B 4RUFA 3JSLA 3ASOC 3A8TA 2N04A 2A7WA 4JI8B 2LGQA 4GKJO 3WU2Z 2ZIOA 3WG7C 3RVYA 2LW1A 3MHSC 1NKDA 4WBNA 1IDSA 5IWAO 3H1HH 5H5NA 1NTZH 4O4IA 5J2UB 1AR5A 5EC1C 1XUQA 5LHIA 3SR2C 4B7EA 4F6RA 1KECA 2QJ1A 4DR7B 1W2BU 3JASA 1W0KG 5IJ0B 1XMQO 4QPKA 3OGCC 1NH2D 1NQTA 3D36C 3UT5A 4DR3O 3CCJV 1CEZA 4MT8A 5LGNA 1WA8A 5IYDO 3G6BA 1AI5A 2QGNA 1JMKC 2ZE6A 4B3MB 4RQEA 3K59A 3GWOA 4GCZA 1FD9A 2JJ1G 4B3SO 3TK1A 3K08A 3BCCH 4J9ZB 3ZRWB 5LP6A 2CTQA 4LNUA 4PV1B 3FB8C 2G38A 3AEIA 4DV3B 1M9NA 3QF7A 4H33A 4JAVA 1NI8A 3BFRA 1XMOO 3Q4HB 1OZ0A 1SS3A 4RO2A 3ABLB 4NTWA 4YJ3B 1SETA 1NH2B 3JARA 1OCCB 1IX9A 4O2AB 5FLXN 4FM2A 1S0VA 4JTAB 3CPWU 1GO3F 2BOCC 3OR7C 4YIOA 1N0NA 2DQ0A 4JZ2A 4TUYB 5L3BA 3JD1A 4WFGA 3R66A 4OX9O 4CH3A 1DTOA 1V54B 4HZ3A 5J2TB 4DV7B 1PNMA 2E74B 5CA0A 3DGEA 3L75H 2P22C 1WJZA 1LNQA 3EXAA 3L9DA 2DQ3A 2XAQA 4RAIA 4Z2WA 2ZE5A 4MS2A 3OR6C 3B09A 2YC0A 5L3GA 4DV4B 2YUAA 3ZRVA 3ML0A 4P2ZA 3OTOB 4LFAB 1MMMA 4GKKO 2DYSB 1RPOA 3FYIB 1OCZC 2P06A 4JZGA 4UV9A 2Y48A 4G28B 2DWDC 4KHPO 4I50B 4NTYA 4DV5O 1H2SB 4TQFA 4LFBO 3OUSA 1M5IA 1NTMH 4LFCB 3CRCA 1YF2A 3UCSC 2OIGA 4PA4A 1G8MA 1RP3B 3DXRB 2LQTA 3BPZA 1KKDA 1H8HG 2PF4E 3UO3A 2ZKOA 3T1HB 2X7RB 5LMNB 3W7TA 1AJQA 2A3QA 2DJVA 1OCRB 3KKYA 5KHJA 1WPBA 4MVZA 1HNXB 1IBLO 4Q20A 2XAGA 4D6TH 2FTKA 1Q7YW 1IXMA 4UVAA 4DR5B 1XBLA 2QKCA 3CCQV 4D7SA 1SERA 2EIMC 1JJ2U 1M1KW 3H9VA 4J41A 3W7XA 2Q7GA 4LH6A 1MOFA 2RJZA 1Q8IA 3RYCA 4ZI7A 1FFXA 2Y0PA 3ZRSA 3ETEA 3ZEDA 3WB1A 3LSSA 4A5UB 4JI1B 2Q73A 4XDKA 2HR3A 4DR4B 1KB9F 2R9IA 2JEXA 2CH7A 4I55B 3ZCCA 4TSFG 4FLVA 4OXSA 4CS4A 1QR9A 1UJWB 3A2FA 1HDJA 3OEEG 3B77A 3BEHA 1N8RW 1H38A 1RFYA 3PN1A 4PD4F 4DUZO 1ZAUA 2YXYA 5KHHA 1HW7A 1N0JA 4X8AA 3MHHC 4YY3O 3B40A 4JI5B 3ABKB 2GTAA 3BHPA 4DUYO 4H0LB 5L3EA 3ZN0A 4EKWA 3CS5A 4G27B 3SPHA 1ZLZA 2OCHA 1WP8A 1VEWA 4O4LB 4P30A 1G6UA 2UUCO 1TUBB 2CTPA 2PI5A 5LGTA 4QE9A 5LHGA 3U10A 4X20A 3HKDB 3ICXA 1E1QG 3NR7A 1YVWA 4FK5C 1BGYH 2RDCA 5B1OA 2VQFO 4LF9O 1YZBA 4NVPA 1N34B 5CB4A 1YIJV 4B3TO 5B1AC 1PM9A 3K5LA 3G67A 1OV9A 4W4LA 5JWPA 2UXBB 3O9OA 2N05A 4FIPC 4JGSA 1BZKA
chains in the Genus database with same CATH topology
1TUEB 1OCOB 3JD4A 1M56B 4JAUA 5HFMA 3ABMC 3TETA 3VOUA 3OMAB 1AJNA 2EINB 1G4YB 4BAYA 1SESA 3T1CA 4ZKIA 2W6IG 3CXCU 2Q69A 1E79G 1L1FA 2HFEC 3W7WA 1QVFU 3UKMA 5DM6V 3W7UA 2EZPA 4MW8A 4PA9A 2EBOA 1NVPB 2JK5C 3D3IA 2HVKC 1VQ8V 1EZJA 1K8AW 5J9PC 4JASA 4MVMA 1EBOA 2XAFA 4MTXA 3E8GA 2EIMB 2C2AA 2OT5A 1FXVA 4GX1A 4JF3A 2QM8A 1K34A 3K9AA 4PELA 5KUMA 5DN6G 1JOYA 3I56V 3RBZA 1E1RG 1F4NA 2ZQMA 3SYCA 2LFRA 5CA3A 4UVBA 5LGUA 3AG4C 1GM9A 2WSSG 2XAJA 2DYRB 1VQ4V 1K73W 5IY5B 1M90W 3CCRV 3SYAA 1XL4A 2WLIA 4I9WA 3UM7A 3JYCA 1P7BA 3P30A 4UVCA 4P9PA 3ABLC 1AR1B 1GM7A 1R3IC 1PNKA 1AJPA 4PDLA 4QE7A 1KQSU 4G2KA 3P32A 3E83A 4BW5A 2ZDIA 1PD3A 1RM1C 1M57C 4YXWG 1JQ0A 2JEUA 1DF4A 1OCCC 1FXKB 2JJ2G 2D3OW 1VQ5V 5CBHA 2ATKC 3ETDA 3FYEB 4TWKA 3OM3B 1KP3A 1NJIW 2NNUA 1S5HC 1MG1A 5H9CA 4DXWA 3ABTA 1ORQC 2JIZG 3EHBB 2WLLA 1F51A 1B6QA 4UV8A 5FL7G 2P7TC 5KA6A 3STZC 2M7WA 1MABG 2IJKA 2LFSA 3OMIB 2K1EA 2WLIB 4F4LA 1V54C 1VQPV 3CC2V 3OEHG 3E8BA 2WLKA 4CBCA 2ZXWC 4U7OA 1VQLV 5B3SB 3SYQA 4QIWF 2H8PC 3AG3C 2Z3YA 1QLEB 1WPXA 4ASUG 2IH3C 2OTJV 1SRYA 1GK9A 2ITCC 2EIJC 2EILC 4WFAV 2DWEC 3X2QB 1GM8A 5IYBO 2W6JG 2A9HA 1NVPD 2QEXV 3CMEV 3G4SV 2OCCB 3ZMTA 2X6AA 4TT3G 4FJCC 1S3JA 2HLDG 3FKSG 1PKXA 2QKSA 3ZMZA 2QTOA 2DYSC 3CCSV 5L3FA 4I5SA 5EC2C 5CBFA 4LBEC 2EIKC 4QPJA 1JVMA 4RUFA 3E2EA 2AHYA 3E8FA 4JYBA 5L3CA 3CD6V 3ASOC 1JCHA 3F7YC 1R3JC 1VQ9V 1ENVA 5B1AB 3JD0A 4GX0A 2GHYA 3B8NA 3WG7C 1GMGA 4RQFA 3RVYA 1AROP 4LP8A 4QJFB 2Y69B 3MHSC 1NKDA 2QA4V 3ASNC 2Q67A 3ABMB 2P67A 1Y66A 1VQOV 1R6NA 5H6RA 2ZR3A 3H01A 4PDVA 3CCEV 1OHHG 1F4MA 2HVJC 1OCRC 5EC1C 3CCUV 5LHIA 3ZMSA 1KECA 4XBFA 3AG1C 4WFHA 1W2BU 2Q6AA 4R6ZA 1W0KG 3K04A 4Z1MG 4QPKA 3OGCC 4PA3A 1NH2D 1CPYA 1NQTA 1ZWIC 3CCJV 1CEZA 4MT8A 5LGNA 5IYDO 1FXKA 1AI5A 4BIZA 1FXHA 4RQEA 1Q86W 3GWOA 4GCZA 1V55C 3MD0A 3SYPA 1YSCA 2ZD9A 2JJ1G 4KFMA 3SPCA 1WLEA 3SPJA 1W0JG 3OFNG 3W7SA 4HYOA 3TK1A 3K08A 3IC7A 1PL0A 1RPRA 3ZN1A 4WFBV 4J9ZB 3ZRWB 5CMUA 4GX5A 3FB8C 3AG4B 3AEIA 1QCEA 1M9NA 1AI6A 4P9OA 5IDJA 2HG5C 4H33A 3KG2A 4JAVA 3E89A 2Z5UA 3T4DA 3CC4V 3OAAG 3VBBA 1S72V 1OZ0A 1ROPA 3K79A 4J9YB 3HB3B 4RO2A 3ABLB 3ZMVA 3K3WA 3IFXA 3OW2U 2F43G 2EZOA 1SETA 1I5YA 1RM1B 2B5UA 1M57B 1NH2B 4RUEA 1K97A 2X6CA 4MVUA 2ITDC 1OCCB 5LHHA 1XL6A 2IJIA 2V1DA 1Q81W 2P90A 2WWWA 2A79B 1BL8A 1S0VA 1GTOA 4JTAB 5CN0A 3CPWU 1NBMG 1GO3F 2BOCC 3OR7C 3E8HA 2HJFC 2IU3A 3LUTB 2UXNA 2DQ0A 5EBLC 5L3BA 3JD1A 4WFGA 4N23A 4KP4A 2IU0A 4KUMA 1DTOA 1V54B 3RVZA 4HZ3A 4LC1A 3JD3A 1COWG 2ZXWB 1PNMA 3ABKC 4JTDB 1GKFA 1QR8A 3DGEA 1K4CC 1VQ6V 3CP1A 5CBGA 3AG3B 1LNQA 5B1BC 2DQ3A 2XAQA 4RAIA 3AG2C 1K92A 2EIJB 4MS2A 2EILB 2ZDIC 3OR6C 3E86A 4GT1A 2MK3A 4H37A 1KC8W 5L3GA 5EBMC 5KUKA 4MVSA 3LSQA 1S77D 3ZRVA 3ML0A 3K03A 2WLNA 2WLJA 4P2ZA 3ETGA 3T2MA 3CYOA 3SPGA 2DYSB 3OE7G 1RPOA 3FYIB 5C93A 1PNLA 1OCZC 2EIKB 5H6QA 2WLMA 4L87A 4UV9A 4ZBMA 2Y48A 4G28B 1YTFB 2DWDC 5HFLA 1VQ7V 3ASOB 5IYCO 4FMTA 1YHQV 1THZA 3HPLC 4X89A 3OUSA 2IJJA 3CC7V 1BHBA 3QNEA 1R3KC 3SJQC 3WG7B 1SZTA 1K3EA 4PA4A 1FFTB 1G8MA 1Y4MA 3ZRWA 1KKDA 4JYCA 1H8HG 3WFVA 4UXNA 3ASNB 4WF9V 3SPIA 1OCOC 2WLHA 2X7RB 1M56C 3W7TA 2XASA 2HKOA 1VQKV 3CMAV 1AJQA 1OCRB 4U7NA 3ZMUA 1YITV 2EINC 3STLC 4MVZA 3AG1B 3K06A 2EJRA 4Q20A 3QO7A 2XAGA 2B1IA 2LP7A 3M99B 2FTKA 4XDLA 3BY6A 1Q7YW 3F7VC 5GW7A 1IXMA 4UVAA 3SYOA 1CP9A 4R50A 1NR7A 5EK0A 2P6JA 3T4ZA 4N21A 3CCLV 3TCUA 3CCQV 1V55B 1SERA 1P4RA 4E2LA 2ZR2A 3G6EV 1YJ9V 1QVGU 2EIMC 2XAHA 3K0GA 4WFFA 1KD1W 1JJ2U 1M1KW 1MSWD 3LDDA 1AI7A 1QBZA 1EFRG 4X88A 1K4DC 3W7XA 3NXSA 1JPXA 3JCZA 4R7CA 2XNDG 4PA6A 1MOFA 5E1AC 4MSWC 1K5SA 3ABUA 2DYRC 3A0RA 2H94A 4MW3A 3ZRSA 3ETEA 1H2GA 4XDJA 5IY5C 1BHAA 1AI4A 1BMFG 2NLJC 2QM7A 3FB5C 3LSSA 3ZIAG 1DF5A 2A0LA 3DTUB 4XDKA 2HR3A 2WAMA 2R9IA 2OTLV 4QNHB 1K33A 2JEXA 4JPRA 1YJNV 4MVRA 3ZRXA 3QO8A 4MVOA 4PDMA 3ZCCA 4TSFG 1FXKC 4PDRA 2UXXA 3JD2A 4LCUC 4OXSA 1YTFD 4DO2A 1QLNA 2QE7G 1QR9A 3FB7C 4MVQA 1H8EG 1UJWB 1YI2V 2KB1A 3IGAC 1R73A 3OEEG 3B77A 1F23A 2WPDG 3BEHA 4CZZA 3CCMV 4WFEA 1N8RW 1H38A 1HWYA 2IH1C 3CCVV 1VQMV 1J95A 5KA5A 4MTGA 5BZBA 2JDIG 2R9RB 4X8AA 3MHHC 1S76D 3B8MA 3ABKB 4WCEV 1DLBA 5B1NA 3OUFA 2YEVA 3LDEA 5B3SC 5L3EA 2IW5A 3PJSK 5B1BB 2V7QG 3RW0A 3ZN0A 1QLEC 4EKWA 1K9MW 4G27B 3LDCA 3SPHA 3LNMB 1R3LC 3AG2B 1KP2A 2DW4A 2CK3G 4FPPA 2BOBC 3F5WC 4P30A 3X2QC 3FB6C 3EFFK 2PI5A 2IJHA 2OCCC 4BIUA 3R65A 5LGTA 4QE9A 1K7DA 1Q82W 2PI4A 5LHGA 3OMNB 2XOKG 3K0DA 3ZJZA 3D36A 5L3DA 1OCZB 1E1QG 1JX9A 4JTCB 3E35A 3QO5A 1K5QA 1NR1A 3I55V 5EBWC 4MTOA 1R6KA 4FK5C 4R8CA 5B1OA 2WLLB 4UUJC 1VQNV 1I5XA 2AHZA 1YIJV 2Q68A 1YJWV 4PA7A 2YEVB 5B1AC 2W0FC 3GB7C 2B1GA 2X6BA 4GX2A 4HAMA 2YSUB 5LBQA 4FIPC 4JGSA 1FS0G 2Y69C 4MTFA 2X0LA 3G71V 2GSMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K4D C;  2DWE C;  4JTA B;  3ABM C;  4R7C A;  2A9H A;  3TET A;  4PA6 A;  2BOC C;  2X6A A;  3OR7 C;  3E8H A;  3VOU A;  2HJF C;  5E1A C;  4MSW C;  2QKS A;  1G4Y B;  2QTO A;  2DYR C;  2DYS C;  3LUT B;  5CBF A;  5EC2 C;  4MW3 A;  3ZRS A;  4LBE C;  3T1C A;  2EIK C;  4XDJ A;  5EBL C;  5IY5 C;  2Q69 A;  4RUF A;  1JVM A;  2HFE C;  4WFG A;  2AHY A;  3E8F A;  2NLJ C;  3UKM A;  3RVZ A;  3FB5 C;  4HZ3 A;  4MW8 A;  3ASO C;  4PA9 A;  2A0L A;  3F7Y C;  2JK5 C;  4XDK A;  1R3J C;  2HVK C;  3ABK C;  4JTD B;  4QNH B;  1K4C C;  5CBG A;  5J9P C;  4GX0 A;  1LNQ A;  4MVM A;  5B1B C;  3E8G A;  4MVR A;  3WG7 C;  4MVO A;  4PDM A;  4RAI A;  3RVY A;  4LP8 A;  4PDR A;  4GX1 A;  3AG2 C;  4LCU C;  4MS2 A;  4OXS A;  3ASN C;  3OR6 C;  5KUM A;  3FB7 C;  4MVQ A;  3E86 A;  2Q67 A;  4H37 A;  3RBZ A;  2KB1 A;  3IGA C;  4PDV A;  5EBM C;  3SYC A;  5KUK A;  4MVS A;  2HVJ C;  3BEH A;  3AG4 C;  3K03 A;  2WLN A;  4WFE A;  2WLJ A;  1OCR C;  4P2Z A;  5EC1 C;  3T2M A;  3SPG A;  2IH1 C;  3AG1 C;  1J95 A;  4WFH A;  1OCZ C;  2Q6A A;  2WLM A;  4R6Z A;  3K04 A;  4MTG A;  4ZBM A;  1XL4 A;  4G28 B;  3SYA A;  2WLI A;  4I9W A;  3UM7 A;  2R9R B;  5BZB A;  3OGC C;  3JYC A;  1P7B A;  2DWD C;  4PA3 A;  4X8A A;  1ZWI C;  4P9P A;  3ABL C;  1R3I C;  4PDL A;  3HPL C;  3OUF A;  4QE7 A;  2YEV A;  3OUS A;  4X89 A;  3LDE A;  5B3S C;  3E83 A;  4BW5 A;  3PJS K;  3RW0 A;  1M57 C;  1R3K C;  3SJQ C;  1V55 C;  1QLE C;  3SYP A;  4EKW A;  4PA4 A;  4G27 B;  1OCC C;  2ZD9 A;  3LDC A;  3LNM B;  4KFM A;  3SPH A;  3SPJ A;  1R3L C;  1KKD A;  4HYO A;  3K08 A;  5CBH A;  2ATK C;  2BOB C;  3F5W C;  4P30 A;  1OCO C;  4TWK A;  2WLH A;  3SPI A;  1M56 C;  3FB6 C;  3X2Q C;  4J9Z B;  3EFF K;  4GX5 A;  3FB8 C;  2OCC C;  1S5H C;  3R65 A;  4QE9 A;  4DXW A;  3K0D A;  3ZJZ A;  2EIN C;  1ORQ C;  4P9O A;  3STL C;  4MVZ A;  2WLL A;  2HG5 C;  3K06 A;  4H33 A;  3KG2 A;  2P7T C;  4JTC B;  3STZ C;  3E89 A;  5EBW C;  4MTO A;  3T4D A;  2K1E A;  2WLI B;  4R8C A;  4F4L A;  4XDL A;  1V54 C;  2WLL B;  4UUJ C;  3F7V C;  4J9Y B;  3E8B A;  4RO2 A;  2WLK A;  2AHZ A;  4CBC A;  2ZXW C;  3IFX A;  3SYO A;  2Q68 A;  4R50 A;  5EK0 A;  4PA7 A;  5B1A C;  2W0F C;  3T4Z A;  3SYQ A;  3GB7 C;  2H8P C;  3TCU A;  3AG3 C;  4RUE A;  2X6B A;  2X6C A;  4MVU A;  2ITD C;  4GX2 A;  2EIM C;  3K0G A;  1XL6 A;  2IH3 C;  4WFF A;  3LDD A;  2ITC C;  2Y69 C;  4MTF A;  2A79 B;  1BL8 A;  4X88 A;  2EIJ C;  2EIL C;  3SPC A; 
#chains in the Genus database with same CATH topology
 1TUE B;  1OCO B;  4JAU A;  4FFB B;  4NR1 A;  4LF7 O;  3JAT B;  3SJC C;  1EM1 A;  5BR8 O;  4UCU A;  3TJT A;  4HNA A;  4RWU A;  3T1C A;  4ZKI A;  5IYZ A;  2Q69 A;  1E79 G;  1L1F A;  1QVF U;  3UKM A;  5DM6 V;  1Q5O A;  4PA9 A;  3UO2 A;  4CS2 A;  3DSQ A;  1EZJ A;  1K8A W;  5J9P C;  3N2K A;  4MVM A;  4CH6 A;  4GX1 A;  1K34 A;  1GN2 A;  2PY5 A;  5LMU B;  4W4K A;  3RBZ A;  2UXC O;  5LGU A;  2UUB B;  2OIE A;  2XAJ A;  4IT5 A;  3F5T A;  1SA0 B;  1K73 W;  3CSX A;  3JYC A;  1P7B A;  5BMV A;  3P30 A;  4DR2 O;  1AR1 B;  1KQS U;  4G2K A;  3P32 A;  4BW5 A;  2ZDI A;  1PD3 A;  1RM1 C;  1M57 C;  1JQ0 A;  1DF4 A;  2JS3 A;  3CRR A;  3HKB B;  2F1M A;  2JJ2 G;  2ATK C;  3ETD A;  3CX5 F;  3H1I H;  1KP3 A;  2NN4 A;  4TV8 B;  4X9Q A;  2JVD A;  2RCV A;  2UXD O;  1B6Q A;  3STZ C;  1MAB G;  1MZE A;  1SZX A;  2IBZ H;  1PL4 A;  3SDL A;  2NR5 A;  1VQP V;  1RSO B;  4CBC A;  1VQL V;  2EUL A;  1URF A;  3K9S A;  5B3S B;  4AIL C;  3AG3 C;  3C3T A;  3K57 A;  1HR0 B;  1WPX A;  4H44 B;  1YDX A;  4Z1V A;  2YIB A;  3J80 N;  5J2U A;  3CME V;  3G4S V;  2YXH A;  2X6A A;  2D2C B;  5EIB D;  3FKS G;  3ZMZ A;  3CCS V;  4LBE C;  2CUG A;  5IJ0 A;  4QPJ A;  2FYU H;  3E8F A;  2AXT Z;  3CD6 V;  1JCH A;  4CS3 A;  1ENV A;  2RMK B;  4GX0 A;  2GHY A;  1AR4 A;  3B8N A;  1SQQ H;  1YXB A;  2UU9 B;  1TA8 A;  3N27 A;  2PTM A;  2QA4 V;  1H2N A;  1BCC H;  2Q67 A;  1BSM A;  1N32 B;  1Y66 A;  5H6R A;  1L0N H;  4PDV A;  3IJ4 A;  1F4M A;  2HVJ C;  1F7Y A;  4WFH A;  1KBH A;  4R6Z A;  4DR1 O;  3K04 A;  2YI9 A;  2QKA A;  4FLW A;  4PA3 A;  3Q4H A;  1ZWI C;  4YJ3 A;  1FXK A;  3T1Y O;  2CE4 A;  1Y6X A;  3SYP A;  1WLE A;  1W0J G;  3OFN G;  3FX7 A;  1P7G A;  4HYO A;  1HNW O;  1XNR B;  3IC7 A;  3OT7 A;  1I94 O;  1RPR A;  3ZN1 A;  4Q6G A;  5CMU A;  4JI7 B;  2LO1 A;  3AG4 B;  3CB2 A;  2Q5Z A;  1QCE A;  3RWR D;  1AI6 A;  3G80 A;  5JCO A;  5LOV A;  3KG2 A;  5JH7 B;  2Z5U A;  4TUY A;  3C90 A;  4J11 A;  3VBB A;  1S72 V;  2R70 A;  1NU1 H;  4IL6 Z;  3L74 H;  3K3W A;  3IAY A;  3OW2 U;  4LF4 B;  2EZO A;  2RNB A;  3MAQ A;  4FLZ A;  1I5Y A;  2JGD B;  2R9A A;  1K97 A;  4MVU A;  4ZOL B;  5KAF Z;  5LHH A;  1XL6 A;  2V1D A;  1IBK O;  2P90 A;  2WWW A;  4CH4 A;  5LA6 A;  1JFF B;  3OTF A;  5CN0 A;  2ADP A;  3K5O A;  1GH6 A;  2HJF C;  4X1Y A;  5JQG B;  1NS1 A;  4DV0 O;  2IU0 A;  3RVZ A;  1IBM O;  4I50 A;  1HNZ B;  1TAE A;  4DV1 B;  5CBG A;  1PV0 A;  1XOU A;  4JI8 O;  3DXR A;  2JS5 A;  3AG2 C;  4JI3 B;  2EIJ B;  3WB0 A;  5F2V O;  1BQZ A;  2ZDI C;  3HKE A;  4FM1 A;  1SQP H;  3DC5 A;  5KUK A;  1Q3E A;  1S77 D;  4LF8 O;  1MA1 A;  1J5E B;  2XTA A;  5KX5 B;  4DR7 O;  3ASO B;  5GTI Z;  1XI1 A;  1YHQ V;  1SC5 B;  1THZ A;  2ZIM A;  2Q4P A;  3HPL C;  4GZR B;  1BHB A;  3QNE A;  1KKC A;  4H13 B;  1ZUQ A;  3WG7 B;  4B3M O;  1FFT B;  2Y4T A;  2L6L A;  4WF9 V;  1AVM A;  2AW9 A;  2WLH A;  4BR6 A;  2HKO A;  1VQK V;  1YIT V;  4U7N A;  1JA8 A;  2JGU A;  3K06 A;  3QO7 A;  1TVK B;  4PI0 A;  1Y74 A;  3LSU A;  5LL6 Y;  5FNV A;  4HBN A;  5JJN B;  3OD4 A;  1NR7 A;  2P6J A;  3T4Z A;  4N21 A;  3CCL V;  3TCU A;  1AP6 A;  1YJ9 V;  3K0G A;  4WFF A;  1WN7 A;  5D5P A;  2GUZ B;  5AG2 A;  1EFR G;  4X1I A;  1WAZ A;  3M7M X;  5ITZ B;  3NXS A;  4R7C A;  4PA6 A;  3CE2 A;  4MSW C;  3ABU A;  3N2G B;  3SJA C;  1JJO A;  4K8X A;  3I5D A;  2QM7 A;  2Q9L A;  3ZIA G;  1DF5 A;  3DTU B;  3FAV A;  5IE9 A;  4KL1 A;  2QR4 A;  4X64 B;  2CGO A;  3E22 A;  1YJN V;  2WA3 A;  1US6 A;  3QO8 A;  1FXK C;  2LGW A;  4AQY O;  2UXX A;  3JD2 A;  5FPR A;  2UUA O;  4DO2 A;  4O4L A;  1QLN A;  4MVQ A;  2XT9 A;  3IGA C;  1R73 A;  1F23 A;  4WFE A;  4JI6 B;  4L8J A;  2PYL A;  3HKD A;  4JI2 O;  2IH1 C;  3CCV V;  1DGS A;  3JAW A;  5KA5 A;  4DRX A;  3OTO O;  5IJ9 B;  2R9R B;  3HKC B;  3JCU Z;  2ZNI A;  5JCO C;  4WCE V;  3JAK B;  2V7Q G;  1V9P A;  1KP2 A;  5JJJ B;  4TQD A;  2DW4 A;  4CH5 A;  3F5W C;  1Q6I A;  4FFB A;  3X2Q C;  1Y67 A;  2Q7E A;  3FB6 C;  5GON B;  4LWS B;  2BTO A;  1B3Q A;  2OCC C;  4UCS A;  4BIU A;  2LW7 A;  5LMN O;  3RYI B;  1K7D A;  4FZ0 A;  1WB7 A;  3ZJZ A;  2ZT9 B;  5L3D A;  1B04 A;  1OCZ B;  1KUQ A;  1JX9 A;  2CAZ C;  3QO5 A;  3I55 V;  4MTO A;  1HNX O;  4UUJ C;  1VQN V;  1YJW V;  4PHZ A;  2YEV B;  3GB7 C;  5EYP B;  2B1G A;  2X6B A;  4GX2 A;  2Y69 C;  4MTF A;  3SPC A;  3JD4 A;  3ABM C;  1SQG A;  1AJN A;  5JVD B;  4X65 B;  1SA0 A;  2QDO A;  2W6I G;  4IYI A;  4NXN O;  4MW8 A;  4YJ2 B;  1NVP B;  2JK5 C;  4KHP B;  4FLX A;  2HVK C;  3RYF A;  3TGU H;  1VQ8 V;  4JI1 O;  1Z2G A;  1I7F A;  3TXQ A;  4FM0 A;  4DR4 O;  2EIM B;  2C2A A;  2DN9 A;  1G1X B;  2OT5 A;  3AG7 A;  4I4T B;  5DN6 G;  5LXT B;  3I56 V;  4TV8 A;  2F4V B;  1BS3 A;  5CA3 A;  1GN6 A;  2CTR A;  2DOS A;  1IXB A;  2PGG A;  2WSS G;  2Y0I A;  4O4I B;  1M90 W;  1I08 A;  4X62 O;  4I0X A;  4I9W A;  3UM7 A;  4UVC A;  1XHZ A;  1EN6 A;  3JAS B;  4PDL A;  3B2E E;  2Q7H A;  3UT5 B;  1U96 A;  1WA8 B;  4X1K A;  1EN4 A;  1VQ5 V;  5CBH A;  3RYH A;  3AK2 A;  3CJH B;  2CDY A;  5LP6 C;  4FLU A;  1MG1 A;  4DXW A;  1ORQ C;  4EEQ A;  3EHB B;  1GRJ A;  2WLL A;  2P7T C;  2QTS A;  3L72 H;  4LNU B;  2ARH A;  3OMI B;  2WLI B;  3RT3 C;  3J7A U;  4NKG B;  5C8Y B;  4DYL A;  2ZXW C;  4U7O A;  1AP5 A;  2XUM A;  3SYQ A;  1XEQ A;  4QIW F;  2H8P C;  2ZM6 B;  2Z3Y A;  2FKX A;  4GUN A;  2QM4 A;  4ASU G;  2OTJ V;  5B66 Z;  5IT9 N;  2ITC C;  2UXB O;  1VF7 A;  1UPG A;  1SKV A;  2EIL C;  4WFA V;  3JAR B;  2A9H A;  1BE3 H;  1D5A A;  4TT3 G;  3B4S A;  3AK1 A;  4I9Q A;  1X59 A;  2EIK C;  1JVM A;  3E2E A;  2AHY A;  4JYB A;  3F7Y C;  3TXS A;  1R3J C;  4YY3 B;  1VQ9 V;  4UCR A;  5B1A B;  2GDS A;  2HP8 A;  4K0K B;  1GMG A;  4RQF A;  4CC6 A;  1ARO P;  1EN5 A;  1EZV H;  3QG5 A;  5CA0 B;  5CA1 A;  1Y76 A;  3ASN C;  1M4U A;  1FJG B;  4O2B A;  1VAR A;  3U0Z A;  3ZS8 C;  1R6N A;  2ZR3 A;  3H01 A;  3CCE V;  2UUC B;  5DEC A;  3CCU V;  3ZMS A;  2UUB O;  4XBF A;  3AG1 C;  3S3X A;  2Q6A A;  2E75 B;  2ODM A;  1MZF A;  1ZL8 A;  2FML A;  2HHH O;  4LF5 B;  4BIZ A;  3H1L H;  1FXH A;  1JR9 A;  4PJ0 Z;  4ZOL A;  1V55 C;  1YSC A;  1NT2 B;  4KFM A;  1LUW A;  3SPJ A;  1YEW A;  3JAL A;  3W7S A;  2VS0 A;  1JFF A;  2BSK A;  1I0H A;  4GX5 A;  4YHH B;  4NB5 A;  4CC5 A;  2B9Z A;  2HG5 C;  5JQG A;  4DV6 B;  1Q43 A;  2AZ2 A;  4NTX A;  4OPH A;  2YI8 A;  5EZY B;  3T4D A;  3OAA G;  2GBO A;  1GN3 A;  1ROP A;  4J9Y B;  2JRI A;  3HB3 B;  3ZMV A;  3BAB A;  3APO A;  2AZ0 A;  1RM1 B;  4EFE A;  1M57 B;  4JV5 B;  1H2L A;  1VF6 A;  2BTQ A;  2RQ6 A;  1HR0 O;  2A79 B;  1BL8 A;  3ZHR A;  1NBM G;  4I7Z B;  1PP9 H;  4IGG A;  3E8H A;  2XHB A;  3LUT B;  2UXN A;  1U97 A;  5KX5 A;  4KP4 A;  4ZI7 B;  4O4H B;  1FFX B;  3JD3 A;  1COW G;  1N33 B;  1QR8 A;  1K4C C;  3D3Q A;  3CP1 A;  3AG3 B;  5B1B C;  2V4D A;  4DV2 B;  3FFQ A;  4B7K A;  2E5L B;  3IC9 A;  3E86 A;  4DR6 B;  4AI8 A;  4MVS A;  3LSQ A;  1X4T A;  3K03 A;  2WLN A;  2WLJ A;  3T2M A;  3SPG A;  4AHC A;  1PNL A;  1TVK A;  2WLM A;  2UXD B;  1VIB A;  5KHK A;  1BQ0 A;  1YTF B;  5HFL A;  4FMT A;  4B3R B;  4U3F H;  2F23 A;  2GV9 A;  1R3K C;  3VQY A;  1ZSP A;  2R72 A;  3BRC A;  3ZRW A;  1QHT A;  3WFV A;  4NXM B;  1S5J A;  2Z0A A;  1M56 C;  1TGO A;  3LNN A;  3ZMU A;  4JI7 O;  2EIN C;  3STL C;  3N2G A;  2EJR A;  5B5E Z;  1H2M A;  2B1I A;  1N36 O;  2LP7 A;  3M99 B;  3RN4 A;  3F7V C;  4O2A A;  3SYO A;  4R50 A;  5EK0 A;  4ZHQ B;  5EIB C;  1KU9 A;  4LF4 O;  5CB4 B;  2XAH A;  1MSW D;  3LDD A;  1AI7 A;  4X88 A;  2W0X A;  1K4D C;  1JPX A;  4JI0 O;  4U3J B;  1XHX A;  1HP8 A;  5E1A C;  4DK0 A;  2DYR C;  3A0R A;  4MW3 A;  5J2T A;  5IY5 C;  1BHA A;  2O57 A;  5IJ9 A;  3HKC A;  3FB5 C;  1XNQ O;  2LJ2 A;  1SQF A;  5IYZ B;  3JAK A;  4QNH B;  1W59 A;  4JPR A;  1DK1 A;  2E3C A;  4JYA O;  4MVR A;  3ZRX A;  2CGN A;  4PDR A;  1S5L Z;  1QNM A;  2ZCE A;  4LCU C;  3N2K B;  2ILM A;  1HNW B;  2WPD G;  4CZZ A;  3CCM V;  2YDE A;  5H2F Z;  4LF6 O;  2DMX A;  1VQM V;  4FFK A;  4MTG A;  2VQE B;  1J5E O;  3QTC A;  3RFR A;  4UB8 Z;  1S76 D;  3FD9 A;  3B8M A;  3APQ A;  1DLB A;  1D5N A;  5B1N A;  3OUF A;  4B08 A;  2YEV A;  3LDE A;  3CWB H;  2IW5 A;  4IIJ B;  3PJS K;  3AK3 A;  1QLE C;  1K9M W;  3LNM B;  4BIO A;  1R3L C;  3AG2 B;  5KLV H;  4JI4 B;  4X66 B;  1FYJ A;  1IUR A;  4FPP A;  2BOB C;  3EFF K;  1XIL A;  3A0H Z;  1VF6 C;  3R65 A;  2QWO B;  1Q82 W;  5JVD A;  3OMN B;  2XOK G;  1B06 A;  1Q90 D;  4JTC B;  1K5Q A;  1VF5 B;  4O4J B;  4YJ2 A;  4DV0 B;  1IBM B;  2AHZ A;  1LUV A;  3ZX6 A;  2Q68 A;  3L71 H;  4PA7 A;  4E4E A;  2W0F C;  4IHJ B;  1SQV H;  5KHI A;  1FS0 G;  4I4T A;  2X0L A;  2GSM B;  3KCY A;  5LXT A;  3TET A;  4DV3 O;  3HR0 A;  4J7Z A;  4FVM A;  2IM9 A;  4BAY A;  4K3A A;  4LF8 B;  1SES A;  3CXC U;  4BW9 A;  4IYH A;  3W7W A;  3RGB A;  2YID A;  4GKJ B;  2EBO A;  3J81 N;  3D3I A;  1AIL A;  4I55 A;  1QU7 A;  2QWQ B;  4JAS A;  4TV9 B;  2YXL A;  1EBO A;  4MTX A;  3E8G A;  4X64 O;  1L8D A;  2L35 A;  1MSD A;  1CXZ B;  5IWA B;  3CJH A;  5KUM A;  2ZE8 A;  1JOY A;  2ZQM A;  1NTK H;  4BWA A;  4EB6 B;  2YIA A;  3ZBH A;  1VQ4 V;  1XMQ B;  2FB5 A;  4JI6 O;  2OYQ A;  4DR3 B;  3CCR V;  1XL4 A;  2WLI A;  1O9G A;  4DV7 O;  1Z5W A;  2DE0 X;  5C8Y A;  4P9P A;  3ABL C;  1R3I C;  1GM7 A;  5K1X A;  2Q8V A;  4FLY A;  3E83 A;  4B3S B;  4ICG A;  5KMG B;  1SQX H;  2ZNJ A;  4YXW G;  2RN9 A;  1OCC C;  1P49 A;  1FXK B;  1TUB A;  3SJB C;  2D3O W;  2HJD A;  4DV4 O;  3OM3 B;  5LYJ B;  1NJI W;  2NNU A;  2OWO A;  3BA8 A;  4LFA O;  5H9C A;  1F51 A;  2F93 B;  1XMO B;  2IJK A;  3GWK C;  2LFS A;  2K1E A;  4F4L A;  5LOV B;  1V54 C;  2ZIN A;  2PZS A;  3CC2 V;  3OEH G;  3E8B A;  2P4K A;  4LFC O;  3DC6 A;  1SF9 A;  2IH3 C;  4TOI A;  2BE3 A;  1SRY A;  2E76 B;  2KG7 B;  3T1H O;  2DWE C;  3JAT A;  3X2Q B;  5TIS Z;  4AQY B;  2UUA B;  1GM8 A;  5FPO A;  1NVP D;  2QEX V;  2YS8 A;  2OCC B;  3S3W A;  5LA6 B;  5A2Q N;  2EJ7 A;  5KHG A;  2DYS C;  5L3F A;  4I5S A;  4OX9 B;  4DW0 A;  3VQX A;  4JI2 B;  3CRA A;  4X65 O;  5L3C A;  4X1Y B;  4DK1 A;  4DR5 O;  4QGP A;  4OPA A;  3JD0 A;  2CTW A;  4LP8 A;  4QJF B;  2Y69 B;  1H2K A;  1FAF A;  2Y4U A;  3ABM B;  2P67 A;  4KXR A;  1VQO V;  4GKK B;  1OHH G;  3KCX A;  3P3P A;  1OCR C;  2F4V O;  3HKE B;  5BY1 A;  4K8Z A;  5EZY A;  4Z1M G;  4DV5 B;  3SGI A;  5D5Q A;  1Q6H A;  1CPY A;  1FPO A;  4LFB B;  3M8A A;  3HKB A;  1Q86 W;  3MD0 A;  3MDS A;  4GLX A;  2ZD9 A;  3H1K H;  3OGI B;  4WBN B;  1PL0 A;  4DW1 A;  4WFB V;  2QWR B;  1IBL B;  2QWP B;  4P9O A;  5IDJ A;  4F6R B;  2ETN A;  1RSO A;  3E89 A;  2AGA A;  1KYO F;  3CC4 V;  4O4H A;  4JI5 O;  5BXZ A;  3K79 A;  4NXN B;  2A06 H;  3IFX A;  1Y74 B;  2F43 G;  4K35 A;  3GVM A;  2B5U A;  3K58 A;  4RUE A;  2X6C A;  5FNV B;  2ITD C;  2IJI A;  3ZHT A;  1Q81 W;  2ZM6 O;  1GTO A;  1Q6U A;  1YCI A;  2N74 A;  5LP6 B;  1GAX A;  4PI2 A;  4X1I B;  2IU3 A;  3ZHV A;  5E79 Z;  4UCO A;  5EBL C;  2P5O A;  4N23 A;  4KUM A;  1N34 O;  4X62 B;  4LC1 A;  2ZXW B;  3ABK C;  4JTD B;  1GKF A;  3QVN A;  1VQ6 V;  4C7U A;  5KAI Z;  3FAV B;  4K0K O;  1K92 A;  2EIL B;  3E22 B;  4JYY A;  4GT1 A;  2MK3 A;  4H37 A;  4J10 A;  1KC8 W;  5EBM C;  1UFI A;  1FJG O;  3ETG A;  3CYO A;  4DUZ B;  3OE7 G;  2K9P A;  4F6E A;  3L73 H;  5C93 A;  2BCC H;  4LH7 A;  1R6T A;  2EIK B;  5H6Q A;  4L87 A;  4ZBM A;  3CHX A;  3JAM N;  3P3N A;  1VQ7 V;  4DUY B;  5IYC O;  3JAW B;  3H1J H;  4DRX B;  1GN4 A;  1M93 A;  4X89 A;  4ZHQ A;  3C3S A;  2ADQ B;  2IJJ A;  3CC7 V;  4LF5 O;  3CRM A;  3SJQ C;  1SZT A;  1K3E A;  1Y4M A;  3CRQ A;  4J7J A;  4JYC A;  4UXN A;  3ASN B;  5LMU O;  3SPI A;  1OCO C;  2XAS A;  4U3J A;  3CMA V;  5JH7 A;  2ZE7 A;  1OJH A;  1L0L H;  1ZX3 A;  1PPJ H;  4YHH O;  1KMI Z;  3AG1 B;  4LF9 B;  2H3O A;  2VQF B;  1LR1 A;  1BT8 A;  4J80 A;  3BA9 A;  4DV6 O;  4XDL A;  3BY6 A;  2JGD A;  4B3T B;  5GW7 A;  1CP9 A;  2KSD A;  5GTH Z;  1V55 B;  1P4R A;  4E2L A;  2ZR2 A;  3G6E V;  1QVG U;  4NYK A;  1KD1 W;  2FL4 A;  1QBZ A;  1FKA O;  2PYJ A;  4LF7 B;  4JV5 O;  3JCZ A;  2XND G;  5BR8 B;  1T5E A;  2EX3 A;  1K5S A;  4FLT A;  2H94 A;  2HEP A;  4UCV A;  1H2G A;  4XDJ A;  1AI4 A;  1BMF G;  2NLJ C;  2A0L A;  3D8C A;  2WAM A;  2Q0O C;  2OTL V;  2HHH B;  4IIJ A;  2QWN B;  1K33 A;  1N33 O;  3ETQ A;  4MVO A;  2WA4 A;  4PDM A;  3RYF B;  4DV2 O;  1YTF D;  3ZHU A;  2UXC B;  1P84 F;  2QE7 G;  3FB7 C;  3ZHQ A;  2E5L O;  1H8E G;  1YI2 V;  2KB1 A;  4DR6 O;  5DED A;  1HWY A;  3RYC B;  1R1B A;  1J95 A;  4DR2 B;  5BZB A;  2JDI G;  4O4J A;  4EFB A;  4FZ1 A;  4GYC B;  4I0X B;  5B3S C;  4IHJ A;  4JAA A;  5B1B B;  3RW0 A;  4B3R O;  1N4C A;  4OGQ B;  2UU9 O;  2CH7 B;  3LDC A;  3JSN A;  2CK3 G;  1N32 O;  4X1K B;  4NXM O;  2IJH A;  1VP7 A;  1VMG A;  1XDC A;  4ZIB A;  2PI4 A;  3K0D A;  3RYH B;  3D36 A;  3CEI A;  4UCT A;  5K1P A;  3E35 A;  1NR1 A;  5EBW C;  1R6K A;  1ZTE A;  4R8C A;  2WLL B;  1I5X A;  1A32 A;  3CXH F;  2GUZ A;  4TV9 A;  3BAA A;  4D7T A;  4HAM A;  5ITZ A;  3U11 A;  2YSU B;  5LBQ A;  2VRZ A;  1XNR O;  4LR3 A;  3G71 V;  1M56 B;  5HFM A;  1IVS A;  4EB6 A;  3VOU A;  3OMA B;  2EIN B;  1G4Y B;  4X20 B;  3VQW A;  2HFE C;  4UFZ A;  2F95 B;  3W7U A;  2EZP A;  2PUS A;  2P4V A;  3BVO A;  3UQ8 A;  5KMG A;  1Z5V A;  2XAF A;  3KZI Z;  3L70 H;  1FXV A;  4JF3 A;  2KQX A;  2Q0A A;  2QM8 A;  3K9A A;  4PEL A;  5LYJ A;  5JJE B;  1E1R G;  1F4N A;  3SYC A;  2LFR A;  4UVB A;  5CA1 B;  3AG4 C;  1Y76 B;  1GM9 A;  4O2B B;  2DYR B;  4DR1 B;  4ABM A;  4J42 A;  4HNA B;  5IY5 B;  4J7K A;  1D2D A;  3SYA A;  3THO A;  1XRE A;  2F66 C;  4YIP A;  1HNZ O;  2KKW A;  4DV1 O;  1N36 B;  3T1Y B;  2VQE O;  1PNK A;  1AJP A;  4QE7 A;  1O9H A;  2GTS A;  1ZL8 B;  2VWK A;  2JEU A;  2M6Y A;  4JI3 O;  5GON A;  3K5M A;  4LWS A;  2KG7 A;  1I94 B;  3RYI A;  5A9G A;  3FYE B;  4TWK A;  4JI4 O;  1QQC A;  4X66 O;  1MNG A;  3JAL B;  4JI0 B;  1S5H C;  3WB2 A;  1IZ3 A;  4UB6 Z;  1WB8 A;  3VQV A;  3ABT A;  2BSK B;  2QSA A;  2JIZ G;  4UV8 A;  5FL7 G;  5KA6 A;  2M7W A;  1XQ8 A;  3EVK A;  5EYP A;  5BMV B;  1NZ6 A;  2WLK A;  1XNQ B;  3A0B Z;  1IBK B;  2YIC A;  2YIB D;  1QLE B;  1WP7 A;  4JYA B;  3ZHS A;  1GK9 A;  2VWJ A;  2EIJ C;  5IYB O;  2W6J G;  2BTQ B;  3ZMT A;  1WNS A;  1SQB H;  1S3J A;  2HLD G;  3O65 A;  4FJC C;  1AB3 A;  1PKX A;  2QKS A;  2MW2 B;  2QTO A;  5CBF A;  5EC2 C;  3K5N A;  4LF6 B;  4RUF A;  3JSL A;  3ASO C;  3A8T A;  2N04 A;  2A7W A;  4JI8 B;  2LGQ A;  4GKJ O;  3WU2 Z;  2ZIO A;  3WG7 C;  3RVY A;  2LW1 A;  3MHS C;  1NKD A;  4WBN A;  1IDS A;  5IWA O;  3H1H H;  5H5N A;  1NTZ H;  4O4I A;  5J2U B;  1AR5 A;  5EC1 C;  1XUQ A;  5LHI A;  3SR2 C;  4B7E A;  4F6R A;  1KEC A;  2QJ1 A;  4DR7 B;  1W2B U;  3JAS A;  1W0K G;  5IJ0 B;  1XMQ O;  4QPK A;  3OGC C;  1NH2 D;  1NQT A;  3D36 C;  3UT5 A;  4DR3 O;  3CCJ V;  1CEZ A;  4MT8 A;  5LGN A;  1WA8 A;  5IYD O;  3G6B A;  1AI5 A;  2QGN A;  1JMK C;  2ZE6 A;  4B3M B;  4RQE A;  3K59 A;  3GWO A;  4GCZ A;  1FD9 A;  2JJ1 G;  4B3S O;  3TK1 A;  3K08 A;  3BCC H;  4J9Z B;  3ZRW B;  5LP6 A;  2CTQ A;  4LNU A;  4PV1 B;  3FB8 C;  2G38 A;  3AEI A;  4DV3 B;  1M9N A;  3QF7 A;  4H33 A;  4JAV A;  1NI8 A;  3BFR A;  1XMO O;  3Q4H B;  1OZ0 A;  1SS3 A;  4RO2 A;  3ABL B;  4NTW A;  4YJ3 B;  1SET A;  1NH2 B;  3JAR A;  1OCC B;  1IX9 A;  4O2A B;  5FLX N;  4FM2 A;  1S0V A;  4JTA B;  3CPW U;  1GO3 F;  2BOC C;  3OR7 C;  4YIO A;  1N0N A;  2DQ0 A;  4JZ2 A;  4TUY B;  5L3B A;  3JD1 A;  4WFG A;  3R66 A;  4OX9 O;  4CH3 A;  1DTO A;  1V54 B;  4HZ3 A;  5J2T B;  4DV7 B;  1PNM A;  2E74 B;  5CA0 A;  3DGE A;  3L75 H;  2P22 C;  1WJZ A;  1LNQ A;  3EXA A;  3L9D A;  2DQ3 A;  2XAQ A;  4RAI A;  4Z2W A;  2ZE5 A;  4MS2 A;  3OR6 C;  3B09 A;  2YC0 A;  5L3G A;  4DV4 B;  2YUA A;  3ZRV A;  3ML0 A;  4P2Z A;  3OTO B;  4LFA B;  1MMM A;  4GKK O;  2DYS B;  1RPO A;  3FYI B;  1OCZ C;  2P06 A;  4JZG A;  4UV9 A;  2Y48 A;  4G28 B;  2DWD C;  4KHP O;  4I50 B;  4NTY A;  4DV5 O;  1H2S B;  4TQF A;  4LFB O;  3OUS A;  1M5I A;  1NTM H;  4LFC B;  3CRC A;  1YF2 A;  3UCS C;  2OIG A;  4PA4 A;  1G8M A;  1RP3 B;  3DXR B;  2LQT A;  3BPZ A;  1KKD A;  1H8H G;  2PF4 E;  3UO3 A;  2ZKO A;  3T1H B;  2X7R B;  5LMN B;  3W7T A;  1AJQ A;  2A3Q A;  2DJV A;  1OCR B;  3KKY A;  5KHJ A;  1WPB A;  4MVZ A;  1HNX B;  1IBL O;  4Q20 A;  2XAG A;  4D6T H;  2FTK A;  1Q7Y W;  1IXM A;  4UVA A;  4DR5 B;  1XBL A;  2QKC A;  3CCQ V;  4D7S A;  1SER A;  2EIM C;  1JJ2 U;  1M1K W;  3H9V A;  4J41 A;  3W7X A;  2Q7G A;  4LH6 A;  1MOF A;  2RJZ A;  1Q8I A;  3RYC A;  4ZI7 A;  1FFX A;  2Y0P A;  3ZRS A;  3ETE A;  3ZED A;  3WB1 A;  3LSS A;  4A5U B;  4JI1 B;  2Q73 A;  4XDK A;  2HR3 A;  4DR4 B;  1KB9 F;  2R9I A;  2JEX A;  2CH7 A;  4I55 B;  3ZCC A;  4TSF G;  4FLV A;  4OXS A;  4CS4 A;  1QR9 A;  1UJW B;  3A2F A;  1HDJ A;  3OEE G;  3B77 A;  3BEH A;  1N8R W;  1H38 A;  1RFY A;  3PN1 A;  4PD4 F;  4DUZ O;  1ZAU A;  2YXY A;  5KHH A;  1HW7 A;  1N0J A;  4X8A A;  3MHH C;  4YY3 O;  3B40 A;  4JI5 B;  3ABK B;  2GTA A;  3BHP A;  4DUY O;  4H0L B;  5L3E A;  3ZN0 A;  4EKW A;  3CS5 A;  4G27 B;  3SPH A;  1ZLZ A;  2OCH A;  1WP8 A;  1VEW A;  4O4L B;  4P30 A;  1G6U A;  2UUC O;  1TUB B;  2CTP A;  2PI5 A;  5LGT A;  4QE9 A;  5LHG A;  3U10 A;  4X20 A;  3HKD B;  3ICX A;  1E1Q G;  3NR7 A;  1YVW A;  4FK5 C;  1BGY H;  2RDC A;  5B1O A;  2VQF O;  4LF9 O;  1YZB A;  4NVP A;  1N34 B;  5CB4 A;  1YIJ V;  4B3T O;  5B1A C;  1PM9 A;  3K5L A;  3G67 A;  1OV9 A;  4W4L A;  5JWP A;  2UXB B;  3O9O A;  2N05 A;  4FIP C;  4JGS A;  1BZK A; 
#chains in the Genus database with same CATH homology
 1TUE B;  1OCO B;  3JD4 A;  1M56 B;  4JAU A;  5HFM A;  3ABM C;  3TET A;  3VOU A;  3OMA B;  1AJN A;  2EIN B;  1G4Y B;  4BAY A;  1SES A;  3T1C A;  4ZKI A;  2W6I G;  3CXC U;  2Q69 A;  1E79 G;  1L1F A;  2HFE C;  3W7W A;  1QVF U;  3UKM A;  5DM6 V;  3W7U A;  2EZP A;  4MW8 A;  4PA9 A;  2EBO A;  1NVP B;  2JK5 C;  3D3I A;  2HVK C;  1VQ8 V;  1EZJ A;  1K8A W;  5J9P C;  4JAS A;  4MVM A;  1EBO A;  2XAF A;  4MTX A;  3E8G A;  2EIM B;  2C2A A;  2OT5 A;  1FXV A;  4GX1 A;  4JF3 A;  2QM8 A;  1K34 A;  3K9A A;  4PEL A;  5KUM A;  5DN6 G;  1JOY A;  3I56 V;  3RBZ A;  1E1R G;  1F4N A;  2ZQM A;  3SYC A;  2LFR A;  5CA3 A;  4UVB A;  5LGU A;  3AG4 C;  1GM9 A;  2WSS G;  2XAJ A;  2DYR B;  1VQ4 V;  1K73 W;  5IY5 B;  1M90 W;  3CCR V;  3SYA A;  1XL4 A;  2WLI A;  4I9W A;  3UM7 A;  3JYC A;  1P7B A;  3P30 A;  4UVC A;  4P9P A;  3ABL C;  1AR1 B;  1GM7 A;  1R3I C;  1PNK A;  1AJP A;  4PDL A;  4QE7 A;  1KQS U;  4G2K A;  3P32 A;  3E83 A;  4BW5 A;  2ZDI A;  1PD3 A;  1RM1 C;  1M57 C;  4YXW G;  1JQ0 A;  2JEU A;  1DF4 A;  1OCC C;  1FXK B;  2JJ2 G;  2D3O W;  1VQ5 V;  5CBH A;  2ATK C;  3ETD A;  3FYE B;  4TWK A;  3OM3 B;  1KP3 A;  1NJI W;  2NNU A;  1S5H C;  1MG1 A;  5H9C A;  4DXW A;  3ABT A;  1ORQ C;  2JIZ G;  3EHB B;  2WLL A;  1F51 A;  1B6Q A;  4UV8 A;  5FL7 G;  2P7T C;  5KA6 A;  3STZ C;  2M7W A;  1MAB G;  2IJK A;  2LFS A;  3OMI B;  2K1E A;  2WLI B;  4F4L A;  1V54 C;  1VQP V;  3CC2 V;  3OEH G;  3E8B A;  2WLK A;  4CBC A;  2ZXW C;  4U7O A;  1VQL V;  5B3S B;  3SYQ A;  4QIW F;  2H8P C;  3AG3 C;  2Z3Y A;  1QLE B;  1WPX A;  4ASU G;  2IH3 C;  2OTJ V;  1SRY A;  1GK9 A;  2ITC C;  2EIJ C;  2EIL C;  4WFA V;  2DWE C;  3X2Q B;  1GM8 A;  5IYB O;  2W6J G;  2A9H A;  1NVP D;  2QEX V;  3CME V;  3G4S V;  2OCC B;  3ZMT A;  2X6A A;  4TT3 G;  4FJC C;  1S3J A;  2HLD G;  3FKS G;  1PKX A;  2QKS A;  3ZMZ A;  2QTO A;  2DYS C;  3CCS V;  5L3F A;  4I5S A;  5EC2 C;  5CBF A;  4LBE C;  2EIK C;  4QPJ A;  1JVM A;  4RUF A;  3E2E A;  2AHY A;  3E8F A;  4JYB A;  5L3C A;  3CD6 V;  3ASO C;  1JCH A;  3F7Y C;  1R3J C;  1VQ9 V;  1ENV A;  5B1A B;  3JD0 A;  4GX0 A;  2GHY A;  3B8N A;  3WG7 C;  1GMG A;  4RQF A;  3RVY A;  1ARO P;  4LP8 A;  4QJF B;  2Y69 B;  3MHS C;  1NKD A;  2QA4 V;  3ASN C;  2Q67 A;  3ABM B;  2P67 A;  1Y66 A;  1VQO V;  1R6N A;  5H6R A;  2ZR3 A;  3H01 A;  4PDV A;  3CCE V;  1OHH G;  1F4M A;  2HVJ C;  1OCR C;  5EC1 C;  3CCU V;  5LHI A;  3ZMS A;  1KEC A;  4XBF A;  3AG1 C;  4WFH A;  1W2B U;  2Q6A A;  4R6Z A;  1W0K G;  3K04 A;  4Z1M G;  4QPK A;  3OGC C;  4PA3 A;  1NH2 D;  1CPY A;  1NQT A;  1ZWI C;  3CCJ V;  1CEZ A;  4MT8 A;  5LGN A;  5IYD O;  1FXK A;  1AI5 A;  4BIZ A;  1FXH A;  4RQE A;  1Q86 W;  3GWO A;  4GCZ A;  1V55 C;  3MD0 A;  3SYP A;  1YSC A;  2ZD9 A;  2JJ1 G;  4KFM A;  3SPC A;  1WLE A;  3SPJ A;  1W0J G;  3OFN G;  3W7S A;  4HYO A;  3TK1 A;  3K08 A;  3IC7 A;  1PL0 A;  1RPR A;  3ZN1 A;  4WFB V;  4J9Z B;  3ZRW B;  5CMU A;  4GX5 A;  3FB8 C;  3AG4 B;  3AEI A;  1QCE A;  1M9N A;  1AI6 A;  4P9O A;  5IDJ A;  2HG5 C;  4H33 A;  3KG2 A;  4JAV A;  3E89 A;  2Z5U A;  3T4D A;  3CC4 V;  3OAA G;  3VBB A;  1S72 V;  1OZ0 A;  1ROP A;  3K79 A;  4J9Y B;  3HB3 B;  4RO2 A;  3ABL B;  3ZMV A;  3K3W A;  3IFX A;  3OW2 U;  2F43 G;  2EZO A;  1SET A;  1I5Y A;  1RM1 B;  2B5U A;  1M57 B;  1NH2 B;  4RUE A;  1K97 A;  2X6C A;  4MVU A;  2ITD C;  1OCC B;  5LHH A;  1XL6 A;  2IJI A;  2V1D A;  1Q81 W;  2P90 A;  2WWW A;  2A79 B;  1BL8 A;  1S0V A;  1GTO A;  4JTA B;  5CN0 A;  3CPW U;  1NBM G;  1GO3 F;  2BOC C;  3OR7 C;  3E8H A;  2HJF C;  2IU3 A;  3LUT B;  2UXN A;  2DQ0 A;  5EBL C;  5L3B A;  3JD1 A;  4WFG A;  4N23 A;  4KP4 A;  2IU0 A;  4KUM A;  1DTO A;  1V54 B;  3RVZ A;  4HZ3 A;  4LC1 A;  3JD3 A;  1COW G;  2ZXW B;  1PNM A;  3ABK C;  4JTD B;  1GKF A;  1QR8 A;  3DGE A;  1K4C C;  1VQ6 V;  3CP1 A;  5CBG A;  3AG3 B;  1LNQ A;  5B1B C;  2DQ3 A;  2XAQ A;  4RAI A;  3AG2 C;  1K92 A;  2EIJ B;  4MS2 A;  2EIL B;  2ZDI C;  3OR6 C;  3E86 A;  4GT1 A;  2MK3 A;  4H37 A;  1KC8 W;  5L3G A;  5EBM C;  5KUK A;  4MVS A;  3LSQ A;  1S77 D;  3ZRV A;  3ML0 A;  3K03 A;  2WLN A;  2WLJ A;  4P2Z A;  3ETG A;  3T2M A;  3CYO A;  3SPG A;  2DYS B;  3OE7 G;  1RPO A;  3FYI B;  5C93 A;  1PNL A;  1OCZ C;  2EIK B;  5H6Q A;  2WLM A;  4L87 A;  4UV9 A;  4ZBM A;  2Y48 A;  4G28 B;  1YTF B;  2DWD C;  5HFL A;  1VQ7 V;  3ASO B;  5IYC O;  4FMT A;  1YHQ V;  1THZ A;  3HPL C;  4X89 A;  3OUS A;  2IJJ A;  3CC7 V;  1BHB A;  3QNE A;  1R3K C;  3SJQ C;  3WG7 B;  1SZT A;  1K3E A;  4PA4 A;  1FFT B;  1G8M A;  1Y4M A;  3ZRW A;  1KKD A;  4JYC A;  1H8H G;  3WFV A;  4UXN A;  3ASN B;  4WF9 V;  3SPI A;  1OCO C;  2WLH A;  2X7R B;  1M56 C;  3W7T A;  2XAS A;  2HKO A;  1VQK V;  3CMA V;  1AJQ A;  1OCR B;  4U7N A;  3ZMU A;  1YIT V;  2EIN C;  3STL C;  4MVZ A;  3AG1 B;  3K06 A;  2EJR A;  4Q20 A;  3QO7 A;  2XAG A;  2B1I A;  2LP7 A;  3M99 B;  2FTK A;  4XDL A;  3BY6 A;  1Q7Y W;  3F7V C;  5GW7 A;  1IXM A;  4UVA A;  3SYO A;  1CP9 A;  4R50 A;  1NR7 A;  5EK0 A;  2P6J A;  3T4Z A;  4N21 A;  3CCL V;  3TCU A;  3CCQ V;  1V55 B;  1SER A;  1P4R A;  4E2L A;  2ZR2 A;  3G6E V;  1YJ9 V;  1QVG U;  2EIM C;  2XAH A;  3K0G A;  4WFF A;  1KD1 W;  1JJ2 U;  1M1K W;  1MSW D;  3LDD A;  1AI7 A;  1QBZ A;  1EFR G;  4X88 A;  1K4D C;  3W7X A;  3NXS A;  1JPX A;  3JCZ A;  4R7C A;  2XND G;  4PA6 A;  1MOF A;  5E1A C;  4MSW C;  1K5S A;  3ABU A;  2DYR C;  3A0R A;  2H94 A;  4MW3 A;  3ZRS A;  3ETE A;  1H2G A;  4XDJ A;  5IY5 C;  1BHA A;  1AI4 A;  1BMF G;  2NLJ C;  2QM7 A;  3FB5 C;  3LSS A;  3ZIA G;  1DF5 A;  2A0L A;  3DTU B;  4XDK A;  2HR3 A;  2WAM A;  2R9I A;  2OTL V;  4QNH B;  1K33 A;  2JEX A;  4JPR A;  1YJN V;  4MVR A;  3ZRX A;  3QO8 A;  4MVO A;  4PDM A;  3ZCC A;  4TSF G;  1FXK C;  4PDR A;  2UXX A;  3JD2 A;  4LCU C;  4OXS A;  1YTF D;  4DO2 A;  1QLN A;  2QE7 G;  1QR9 A;  3FB7 C;  4MVQ A;  1H8E G;  1UJW B;  1YI2 V;  2KB1 A;  3IGA C;  1R73 A;  3OEE G;  3B77 A;  1F23 A;  2WPD G;  3BEH A;  4CZZ A;  3CCM V;  4WFE A;  1N8R W;  1H38 A;  1HWY A;  2IH1 C;  3CCV V;  1VQM V;  1J95 A;  5KA5 A;  4MTG A;  5BZB A;  2JDI G;  2R9R B;  4X8A A;  3MHH C;  1S76 D;  3B8M A;  3ABK B;  4WCE V;  1DLB A;  5B1N A;  3OUF A;  2YEV A;  3LDE A;  5B3S C;  5L3E A;  2IW5 A;  3PJS K;  5B1B B;  2V7Q G;  3RW0 A;  3ZN0 A;  1QLE C;  4EKW A;  1K9M W;  4G27 B;  3LDC A;  3SPH A;  3LNM B;  1R3L C;  3AG2 B;  1KP2 A;  2DW4 A;  2CK3 G;  4FPP A;  2BOB C;  3F5W C;  4P30 A;  3X2Q C;  3FB6 C;  3EFF K;  2PI5 A;  2IJH A;  2OCC C;  4BIU A;  3R65 A;  5LGT A;  4QE9 A;  1K7D A;  1Q82 W;  2PI4 A;  5LHG A;  3OMN B;  2XOK G;  3K0D A;  3ZJZ A;  3D36 A;  5L3D A;  1OCZ B;  1E1Q G;  1JX9 A;  4JTC B;  3E35 A;  3QO5 A;  1K5Q A;  1NR1 A;  3I55 V;  5EBW C;  4MTO A;  1R6K A;  4FK5 C;  4R8C A;  5B1O A;  2WLL B;  4UUJ C;  1VQN V;  1I5X A;  2AHZ A;  1YIJ V;  2Q68 A;  1YJW V;  4PA7 A;  2YEV B;  5B1A C;  2W0F C;  3GB7 C;  2B1G A;  2X6B A;  4GX2 A;  4HAM A;  2YSU B;  5LBQ A;  4FIP C;  4JGS A;  1FS0 G;  2Y69 C;  4MTF A;  2X0L A;  3G71 V;  2GSM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...