3K04A

Crystal structure of cng mimicking nak mutant, nak-dtpp, na+ complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
90
structure length
90
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDTPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies of ion permeation and Ca2+ blockage of a bacterial channel mimicking the cyclic nucleotide-gated channel pore.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transport protein
molecule keywords Potassium channel protein NaK
total genus 30
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3k04A00
5EBMC 4MTGA 4G28B 4MW8A 3RBZA 3STZC 4P9PA 1ZWIC 5BZBA 4GX1A 4MVRA 1R3IC 4MVSA 4G27B 3SPJA 3E83A 2YEVA 4R7CA 3IFXA 4H33A 1V55C 4MW3A 4P2ZA 3OR7C 2Q6AA 3AG3C 3LDDA 3SYCA 5KUMA 3SJQC 3K08A 3T4DA 4GX0A 5B1BC 4MVQA 3SPCA 2H8PC 2R9RB 3TETA 4DXWA 2DWDC 4XDKA 2DWEC 2KB1A 3F5WC 4MS2A 3RW0A 2A9HA 2WLMA 2JK5C 4R50A 5B3SC 4RO2A 1R3KC 2Q68A 3ZJZA 1OCOC 4MVOA 4BW5A 2K1EA 4LP8A 1R3LC 4WFFA 5J9PC 2WLIB 4QE7A 2WLJA 3RVYA 2HJFC 3FB8C 4MTFA 4PDMA 4OXSA 2X6AA 3K03A 3F7VC 4J9ZB 2WLHA 3LDCA 2BOBC 2NLJC 3ZRSA 3EFFK 5CBGA 3T1CA 2WLLB 4F4LA 4HYOA 3TCUA 2Q67A 2HVJC 3PJSK 2BOCC 4LBEC 4PDLA 2ZD9A 2P7TC 3OUFA 3SPIA 3K06A 4GX5A 3E8HA 3ABLC 2W0FC 3FB5C 4MTOA 4MVZA 5EK0A 3ASNC 3E86A 3STLC 4CBCA 4JTCB 3T4ZA 4QE9A 3HPLC 1G4YB 4P30A 4X88A 2EILC 3FB6C 5EBLC 1P7BA 5EC1C 5CBFA 2X6CA 3SYPA 3OUSA 2ZXWC 2Q69A 4JTDB 2A0LA 3AG1C 3K0DA 1OCRC 3LNMB 3AG2C 1XL4A 3E8BA 3ASOC 3LUTB 4HZ3A 4I9WA 4J9YB 4MVMA 4RUEA 4WFGA 5E1AC 1OCCC 1QLEC 3AG4C 4KFMA 2Y69C 4X89A 3SPGA 3SYOA 1J95A 1KKDA 2HFEC 3F7YC 4PDRA 3VOUA 2DYSC 3ABKC 3R65A 2DYRC 5B1AC 1OCZC 2WLNA 3K0GA 1V54C 4ZBMA 1XL6A 4MVUA 2AHYA 4MSWC 2ATKC 4UUJC 2WLIA 2QKSA 4EKWA 1M56C 5EC2C 2ITDC 4JTAB 2HG5C 3FB7C 2IH3C 4TWKA 1S5HC 3OR6C 1ORQC 2ITCC 4QNHB 2EINC 3RVZA 3E8FA 4P9OA 4XDLA 4PA9A 3K04A 3LDEA 3OGCC 3X2QC 3UM7A 4R6ZA 4PA4A 4X8AA 4WFEA 4PA7A 2EIMC 2WLKA 1R3JC 4XDJA 5KUKA 4PA6A 4H37A 3T2MA 4GX2A 3UKMA 3E8GA 3SYAA 1M57C 3IGAC 2A79B 2EIJC 5CBHA 3SPHA 2X6BA 5EBWC 3E89A 4R8CA 2IH1C 2EIKC 3SYQA 4WFHA 3WG7C 3ABMC 4LCUC 1BL8A 2AHZA 3KG2A 3JYCA 5IY5C 3BEHA 2OCCC 4RUFA 1JVMA 4PDVA 4RAIA 2QTOA 2WLLA 1K4CC 2HVKC 1K4DC 1LNQA 4PA3A 3GB7C
chains in the Genus database with same CATH superfamily
2BE3A 4X1IA 1HNZO 1PNLA 3STZC 4JYAO 1NR7A 1GK9A 3I5DA 1S77D 3U11A 5JJEB 2BTQA 3P3PA 4PHZA 2OIEA 2ADQB 2G38A 5IYDO 1OJHA 1HDJA 4FM1A 4GX0A 1HW7A 2JS3A 1VQ9V 5LBQA 5AG2A 4D7TA 3K59A 3CCVV 1GN3A 3GWOA 2UU9O 5IYZB 5IYZA 1D5AA 1XQ8A 3H1LH 2Q68A 1J5EB 4QPKA 2CTRA 3X2QB 4NXMB 3DXRB 1QVGU 3QO7A 2PGGA 4DV6O 4YHHO 4LF9O 2L35A 1QCEA 3CCEV 2WLLB 4F4LA 1HNZB 3UT5B 2H94A 2PYLA 1PP9H 4LBEC 1VQNV 1YVWA 4MVZA 4JI0B 2XUMA 3SYPA 4Z1MG 2GUZA 3AG2C 1F4NA 4JI8B 4U7NA 1AROP 1PNKA 4OGQB 2N04A 2JJ1G 1XNRB 2QWOB 4ZOLA 3O65A 1G1XB 1DF5A 4DK0A 1YHQV 4DV4O 2CGNA 2MK3A 3IC9A 4LF6O 4X65B 2IW5A 1BQ0A 1PKXA 3CE2A 5FNVB 5LHIA 2P90A 3HKBA 3QO5A 1Q82W 1KQSU 3CRCA 2PY5A 2UXBB 4OX9B 2DOSA 2B5UA 3OGCC 2ZIMA 3UM7A 4FK5C 4DUZB 1SRYA 3JD4A 4PA4A 2UUCO 1ROPA 4JI0O 1SESA 1YTFD 4CC6A 3CD6V 1M57C 2R72A 2F1MA 2ZNIA 2QKCA 1O9GA 1YXBA 4RAIA 2ZE7A 4W4KA 2P6JA 1FFXB 4PA3A 4MTGA 2OWOA 4IYHA 4MW8A 1PNMA 5J2UB 4X1YA 3RYFB 1BMFG 3RYFA 3KZIZ 1LR1A 3AG1B 3OR7C 4NTYA 3AG3C 2NR5A 4TV8A 2GSMB 2A3QA 5B1BC 4MVQA 1VQPV 1FPOA 4H0LB 1D5NA 1VQ4V 2WA3A 1KP3A 2JK5C 2QGNA 1VMGA 2IJJA 4JI4B 4RO2A 2RQ6A 3IC7A 4PDMA 5KHGA 2UUAB 2BOBC 3WFVA 3T1HB 2B9ZA 1IBMB 1AI5A 3EVKA 4HYOA 1MSWD 3Q4HB 2A06H 1B3QA 1R73A 1Q6UA 1SKVA 2ZE8A 5KHKA 3HPLC 2QWNB 4DR6O 2ZXWC 2ARHA 3E8BA 4HZ3A 3MHSC 4TUYA 2EIJB 2HHHO 2HFEC 4AHCA 3ABKC 4MT8A 4YY3B 3K0GA 4AILC 3JCUZ 2ZQMA 3L73H 3RYCA 3L74H 1F4MA 2PZSA 2XOKG 1YCIA 5BY1A 2R70A 2H3OA 1GTOA 3UQ8A 4LF5O 4TWKA 2UXBO 3RYIA 4QGPA 1VQ5V 3AG7A 4KUMA 1R6NA 2DQ3A 1XBLA 4J11A 4X62B 4H37A 4CH3A 1GMGA 1I94B 1N33O 1QLNA 4MTXA 3M99B 4JZ2A 1F51A 2B1IA 4FJCC 3BRCA 2DW4A 3ZN1A 4TSFG 2KQXA 2CTPA 5GW7A 2XAQA 2Q9LA 3SGIA 1JX9A 2E74B 4O4JB 2E5LB 4LH7A 2P4KA 5IJ0B 4NTXA 4B3TB 4P2ZA 1EZVH 1KUQA 4FM2A 4B7KA 2HKOA 4J41A 3ZHSA 1S76D 3RFRA 1ZSPA 2GV9A 2R9RB 3B2EE 5JWPA 2RDCA 3QVNA 1HNWO 3R66A 5B1NA 2DJVA 4LP8A 4UV8A 3I56V 1RM1C 3JAWA 2HJFC 1I5XA 4OXSA 2JGUA 4DR1O 1XHZA 1EFRG 1Y76A 3T1CA 1FD9A 1TUEB 2Q67A 2B1GA 4F6RB 3OD4A 4JYCA 3OTOO 1FXKC 3E86A 3ZMSA 1QBZA 3G6BA 5CA0B 1G4YB 4DYLA 5IYCO 3LUTB 2EINB 3TXSA 1XL4A 2QM7A 2UXNA 4I4TA 4RUEA 4CZZA 1K8AW 4X89A 3SPGA 1M5IA 3S3WA 2KSDA 3R65A 3ZN0A 3W7XA 3L70H 3ZS8C 4EKWA 4J7JA 5CA1A 5FPRA 4FLUA 1THZA 1N0JA 3WB1A 5GONA 3OR6C 2ITCC 1WN7A 2YIBD 4LH6A 3QNEA 3CXCU 1BT8A 3J80N 1L8DA 5KUKA 5KAFZ 2CK3G 4ZIBA 1K7DA 4EB6A 2A79B 2EIJC 4O4HB 1HR0B 2IH1C 5BMVB 3BEHA 5CA3A 4LFAB 3CXHF 3OW2U 4HNAA 4EFBA 3CPWU 5JVDA 2EIMB 2FB5A 3SPJA 3DSQA 2CH7B 3D36A 2CH7A 4G2KA 4ZHQA 2LGQA 2QWPB 5HFMA 1FYJA 3A0BZ 3ASNB 3ABLB 3F5WC 3L9DA 3LSQA 2Y4UA 2ZE5A 4UXNA 1M9NA 1PV0A 1EBOA 4B7EA 5B3SC 3QTCA 5J9PC 1H2MA 4TV8B 4WFBV 1ZUQA 1SQVH 3FAVB 2HLDG 4O2AA 2PI4A 1WJZA 4U3JB 3CEIA 2UXDO 2X0LA 2NLJC 5JQGA 2M6YA 1MZEA 1IVSA 4K8XA 3SDLA 1VF7A 4PI2A 3PJSK 1FJGO 3ABLC 4MTOA 1H8HG 3ASNC 1FFXA 1XMOB 4U7OA 1SA0B 1FXVA 1WP7A 1AP6A 3B8NA 4LWSA 2UXCO 2XHBA 4I9QA 3ASOC 1MOFA 1QQCA 1KKDA 1DF4A 3CB2A 1F23A 4Q6GA 4GT1A 5J2TA 3JAKB 1XNQO 5FPOA 4JV5B 1NT2B 5IT9N 2ITDC 4B3RB 2IH3C 3DTUB 4DR2B 2VRZA 3LDEA 3FAVA 1XHXA 3SYQA 1VQKV 1O9HA 4LCUC 2AHZA 2ILMA 3ASOB 1KECA 4DV3B 4WBNB 4GKJB 1K33A 1MMMA 3MD0A 4GKJO 1XMQO 3ETEA 1Y74B 2Y0IA 4NXMO 2R9IA 1SQXH 5JH7A 4GKKB 4UFZA 1F7YA 1TVKB 5IJ9B 4FLVA 2HJDA 4CH5A 4TT3G 1KC8W 1BCCH 4UCVA 1MZFA 1SS3A 2KB1A 3T1YB 2WLMA 1VQMV 4LFAO 4DV5B 1H8EG 4IHJA 1OCOC 1HNXO 3U0ZA 2EX3A 3ZRVA 4Z1VA 2Q8VA 1YJWV 2ZINA 2RN9A 4B3TO 4KHPO 1SQFA 4JI8O 1YJNV 2XAHA 3FB5C 4YJ2B 4ZKIA 5KMGA 2IU0A 3HKEA 2DYRB 4QE9A 3WU2Z 2Q69A 4IT5A 1Q8IA 2C2AA 4PDRA 2R9AA 1BHBA 3VOUA 1VF6C 3K5LA 2DYSC 1GN6A 3HKDA 2UXCB 1I94O 4FLXA 3IAYA 3UO3A 1IBLB 2ZDIC 2JGDB 2WLIA 4FLZA 1GAXA 4UB8Z 1M56C 2GHYA 5LMNO 4ZI7A 4NXNO 4DR3O 1KD1W 1P84F 3DC5A 3JAWB 4R6ZA 3B4SA 1AR4A 1RPRA 3K5MA 3JD2A 4PA6A 5JCOA 4YIOA 4CH6A 1GM7A 5KLVH 2FL4A 3W7TA 1AR5A 4DK1A 1SERA 4O4IB 3TJTA 3CCQV 4LC1A 5D5PA 3JASB 1Q3EA 2JVDA 3TK1A 2OCCB 1TGOA 3EXAA 4UV9A 3E2EA 1VIBA 5KX5A 4JI6O 1G8MA 1W0KG 2YS8A 1WB8A 4CS4A 3ZHRA 5EIBC 4JZGA 3LSSA 4JI4O 3ZMVA 1RSOA 2P06A 4K35A 2BTOA 3SJBC 3ZHUA 1JFFA 2XAJA 4JAUA 2IU3A 4UB6Z 2UU9B 4B3RO 2WLHA 1AJPA 3RYIB 2AXTZ 2YIDA 1E79G 1AJNA 4IHJB 2P7TC 3SPIA 1YSCA 4GX5A 2M7WA 4E4EA 4LNUA 4I0XA 3HKCA 2L6LA 4RQFA 4ICGA 2CDYA 1A32A 4FZ0A 1N4CA 1D2DA 2YEVB 3F5TA 2YXYA 2A0LA 1VQOV 4I55A 2OCHA 3AK2A 3AG4C 4JI3O 1AVMA 4YY3O 3HB3B 1GN4A 4X64O 2EULA 4BIZA 3ZRWB 4LF7O 5KA6A 2JEUA 4FLWA 4DUZO 1TAEA 5L3CA 1R6TA 4JTAB 3APOA 2D2CB 3LSUA 5EIBD 4K3AA 5J2TB 4GYCB 2WA4A 4W4LA 1HR0O 4CH4A 3VQVA 1QR9A 4X1YB 2AZ0A 5BR8B 1YF2A 1W0JG 2GTAA 2ZR3A 3CC2V 3D8CA 1DK1A 5F2VO 4B3SB 1SQGA 3ABUA 5IWAB 4DV2B 1XNRO 2QTOA 1UJWB 3GB7C 3JSNA 1VEWA 4JI2O 1XI1A 3DGEA 2Z5UA 3N2GB 5ITZB 3FYEB 1Q43A 4G27B 4UVBA 4RQEA 4IL6Z 4PD4F 5H9CA 3M8AA 1GO3F 4JAAA 2V1DA 4JYYA 1MABG 5L3FA 2QE7G 1MG1A 2XASA 2GDSA 2YIBA 2KKWA 4DR4B 3FKSG 4MVOA 3ZHQA 3N2KA 1Y6XA 1S5JA 3RVYA 4JF3A 5B1BB 4FLTA 3MHHC 3NR7A 1TA8A 3F7VC 4IGGA 5GTIZ 3BA8A 2VQFO 1FAFA 5B3SB 4X1KA 1WB7A 4KHPB 2EZPA 5LMNB 4WBNA 1VQ6V 4IIJA 2YIAA 4FM0A 4DR6B 2ZIOA 3JD3A 3G4SV 4QE7A 3K5OA 3LNMB 5JH7B 3QO8A 4U3FH 5H6QA 3CC4V 4KFMA 4I7ZB 1GN2A 1NTMH 2LGWA 4DV3O 5KAIZ 1V55B 3HKEB 1V54C 2XAFA 2ZR2A 4X64B 2P5OA 2XAGA 4TUYB 1WAZA 4I5SA 3CJHA 3CMEV 2W0XA 2QR4A 5LXTA 2EINC 1XMOO 3SJCC 2P22C 4DV7O 1Z2GA 1YTFB 3CWBH 2WAMA 5B1OA 5J2UA 4DV1B 4JI5O 1PL0A 2YI9A 4X62O 2ZM6O 1IXBA 3ZEDA 2E3CA 1Y66A 4Z2WA 1B6QA 1J5EO 1GM8A 2W6IG 4DV0O 1QHTA 4K0KB 2Y4TA 4RUFA 3K9AA 2E5LO 4PDVA 1RM1B 2WLLA 1K4CC 2Y0PA 4LF7B 4P9PA 1PD3A 4GX1A 2K9PA 3RYHA 3HKDB 1I0HA 1TVKA 1KBHA 3IFXA 4JI7O 1OCRB 3BHPA 1Y76B 3K79A 1NVPD 3Q4HA 1Q90D 4DXWA 1JCHA 1N36B 1V54B 1Z5VA 2K1EA 4WFFA 2F43G 2Y48A 5FLXN 1NKDA 1ENVA 3ZBHA 3CMAV 1R6KA 2PTMA 4UCRA 2PYJA 3J7AU 1W59A 2BCCH 1VQLV 1LUWA 1YITV 1OCOB 4U3JA 2HHHB 3BAAA 4P30A 3PN1A 4CS2A 5BR8O 1L1FA 2KG7B 5L3GA 1WLEA 5BMVA 4J9YB 1QLEC 2FMLA 2QSAA 1J95A 4UCUA 4DW1A 5LOVA 2DYRC 4JGSA 1WP8A 1SQQH 2LFRA 3CC7V 5CB4A 4FFBB 1S3JA 4B08A 1K92A 3H9VA 3JATA 4QNHB 3K3WA 1NZ6A 2WWWA 2BSKB 4FIPC 1BGYH 4DV0B 1IURA 5B66Z 1XDCA 4YIPA 3UKMA 3JSLA 1S0VA 3HKCB 4K0KO 5IY5C 2ADPA 4AQYO 4GUNA 2FYUH 4DR2O 1WPXA 2N05A 2EJ7A 1XILA 1T5EA 2HR3A 2Q0AA 1N8RW 1PL4A 4O2AB 1WA8B 1JA8A 3W7UA 3P30A 1BQZA 4MW3A 1V55C 1WPBA 1IDSA 2JS5A 2YUAA 1P7GA 2DWEC 5ITZA 1NR1A 4TV9B 4TV9A 3AK1A 3JARA 4R50A 4L8JA 1KYOF 1R3KC 2JGDA 2WLIB 5KHJA 1CEZA 4LF8O 4FZ1A 2UUAO 2XNDG 2BTQB 4DR5O 3N27A 4YHHB 4LF9B 2CTQA 3C3SA 1N34B 1M57B 4LF6B 2VQFB 3UCSC 5LHGA 3K06A 4LNUB 3OGIB 4CS3A 3STLC 2OYQA 4O2BA 1MSDA 5FNVA 5EBLC 5CBFA 2X6CA 5JQGB 5L3EA 2OT5A 2AW9A 3QF7A 3AG1C 2XTAA 4D7SA 1KKCA 5GTHZ 4J7KA 5E1AC 3AG2B 1V9PA 4NR1A 3FX7A 1ZX3A 4DR7O 3QG5A 1IXMA 2ZNJA 3JASA 4OPHA 1KP2A 3ZHTA 2KG7A 4QJFB 4CC5A 4DR5B 2RMKB 3OE7G 4EEQA 4BIOA 2EIKB 3D3IA 2RJZA 3CRRA 1N32B 1QR8A 1AP5A 3X2QC 5JVDB 3ZIAG 1Q7YW 3CYOA 4PI0A 1IZ3A 1ZTEA 1K9MW 4OX9O 1K73W 4YXWG 2ODMA 3SR2C 3E89A 1W2BU 3H1HH 1PM9A 4B3SO 4O4LA 1UPGA 2UXDB 1RPOA 1LNQA 1DGSA 4P9OA 3C90A 3D3QA 3RBZA 5KMGB 4YJ2A 1B04A 3E83A 1OCCB 1GKFA 1NBMG 2LFSA 3BY6A 1SQBH 3JCZA 4FPPA 5KUMA 3SJQC 2H8PC 2JIZG 1M56B 1BHAA 1CP9A 4MS2A 1EN5A 2YXHA 5C93A 1NH2B 5H2FZ 2DYSB 5LP6C 3ZCCA 3BCCH 4QIWF 4ASUG 1HP8A 2YI8A 4J9ZB 4DO2A 1U96A 5IDJA 1GM9A 3EFFK 5CBGA 4DR1B 3CCJV 3GVMA 1Q86W 4PJ0Z 4UCOA 2BOCC 4IIJB 2NN4A 4JTCB 1XUQA 3VQYA 3T4ZA 5LGUA 2IJHA 1AILA 3K5NA 4WFGA 1L0LH 5JJNB 2YC0A 3ABMB 5A9GA 2AGAA 4GCZA 3B09A 2DMXA 3FD9A 4HNAB 1Y67A 4J7ZA 4LFBB 1OCZC 4FFKA 3CCSV 1LUVA 4UUJC 2QDOA 5EC2C 3OAAG 4C7UA 3FB7C 1I08A 1H38A 4QPJA 4JASA 1OZ0A 3VBBA 3H01A 2DE0X 2IM9A 4F6EA 2YICA 1ZL8B 4N21A 2DQ0A 3E22B 5A2QN 5LYJA 3RWRD 3A8TA 3O9OA 3ZMZA 2VWJA 1RSOB 3C3TA 4DV2O 3T2MA 4ZI7B 3K9SA 4R8CA 3WG7C 1JJ2U 2F4VO 1KMIZ 2MW2B 4TQDA 2E76B 1H2SB 2NNUA 4I50B 4I50A 2ZT9B 4DR3B 3BABA 4BWAA 3RN4A 3RYCB 4JAVA 2JEXA 2F23A 1KU9A 1S72V 2FKXA 4WF9V 1JPXA 2WPDG 3H1IH 1SZXA 1N34O 1N32O 2LJ2A 3JAMN 1NQTA 1XREA 3H1KH 1CPYA 4YJ3A 3OEEG 3K08A 4JI5B 3WB0A 3RW0A 1X59A 4JI7B 2F93B 2QJ1A 5CN0A 2Z3YA 3ZHVA 2QWRB 4LFCB 5IJ0A 3M7MX 3ETGA 1COWG 3VQXA 5LXTB 5LYJB 1UFIA 2LO1A 4UCTA 2ZD9A 2LW1A 1S5LZ 5GONB 1P7BA 1YIJV 3OTFA 4JTDB 1EN6A 4E2LA 1R1BA 2Y69B 4CBCA 3B8MA 1QVFU 2QTSA 5LOVB 1NH2D 1N0NA 2WLNA 2EJRA 2D3OW 5C8YB 1WNSA 1GH6A 1JQ0A 4I55B 4J42A 3ZRXA 1G6UA 2GTSA 4LR3A 2RCVA 2HG5C 4FLYA 2OTLV 4O4IA 1S5HC 3RT3C 4ZHQB 4PA9A 4JYAB 1NTKH 4WCEV 3OMNB 5JJJB 2P67A 1QU7A 4TQFA 2YDEA 2EIMC 3N2GA 2WLKA 5DECA 4BW9A 2HEPA 3H1JH 3SPHA 5EBWC 2ZCEA 1K34A 4WFHA 3ABMC 3JYCA 4IYIA 3CCLV 2XT9A 2UXXA 1Q5OA 5KHHA 1ZWIC 1YJ9V 1AI7A 1R3IC 1K5QA 3OFNG 4LWSB 3BVOA 3WG7B 1Y4MA 1HNWB 2A7WA 3T4DA 1BSMA 5KA5A 3DXRA 1Z5WA 5EZYB 5LP6A 4LF4B 2UUBB 1SQPH 2W6JG 4NB5A 3ZMTA 2JJ2G 3G67A 2WLJA 4UVAA 1U97A 1AI4A 5FL7G 3AG4B 1M90W 3CRMA 4RWUA 4DUYO 3JATB 3DC6A 3L72H 3N2KB 3ZX6A 1P4RA 1FXKB 4JI3B 1FJGB 4B3MB 4X88A 2EILC 1I5YA 1NJIW 4MVMA 2YSUB 3F7YC 4DV5O 4H13B 1M4UA 1VQ7V 1Y74A 1XL6A 4X65O 4MVUA 4NVPA 2AHYA 4DV4B 1K97A 2PUSA 1EM1A 2IJIA 2GUZB 4EFEA 4GLXA 3L71H 1URFA 3CSXA 2LP7A 2CGOA 5IE9A 3CCMV 4PELA 1YZBA 1L0NH 3WB2A 4JI2B 5LGNA 2Q7GA 3MDSA 4O4LB 1I7FA 3B40A 1AI6A 2DN9A 3U10A 5JCOC 2EILB 2HVKC 1KB9F 3T1HO 1XEQA 4G28B 3BFRA 3JAKA 4K8ZA 5BZBA 4I0XB 4MVRA 4DRXA 1FXHA 1Q6IA 2QEXV 1YEWA 2E75B 2Q7HA 3LDDA 1OV9A 2CTWA 4BIUA 3TETA 2VS0A 5LL6Y 3CHXA 2A9HA 5DN6G 2N74A 1NI8A 1VF6A 2OIGA 1TUBB 3ABKB 1VARA 4JI1B 4MTFA 3THOA 1FFTB 5IJ9A 4DV6B 3ZRSA 3G71V 2Z0AA 1XMQB 3TGUH 4PDLA 1PPJH 3OUFA 3J81N 3E8HA 3CX5F 3NXSA 3OMIB 5EK0A 3FB6C 4KXRA 4I9WA 2EBOA 4JYBA 3K58A 2UUCB 3I55V 2F95B 5B1AC 4DR4O 5EYPB 5H5NA 1EZJA 2ATKC 2F4VB 4DV7B 1IBLO 5CA0A 2EZOA 5TISZ 5LHHA 1MNGA 5KX5B 1ORQC 3HR0A 3GWKC 3K04A 4JI6B 1VP7A 3UT5A 3E22A 3CS5A 3RGBA 1TUBA 2IJKA 3EHBB 2Q7EA 4TOIA 2Q0OC 5LMUO 2CE4A 2UUBO 2LW7A 3CP1A 4XBFA 3IGAC 5CBHA 3FYIB 2PF4E 2JDIG 4KP4A 4AQYB 2V4DA 1ZAUA 1OCZB 4BR6A 1JFFB 2YEVA 3T1YO 1NVPB 3S3XA 4EB6B 1JJOA 1GRJA 2Q6AA 3LNNA 1JMKC 3SYCA 1M93A 2DWDC 4XDKA 5H6RA 2WSSG 3BA9A 4NYKA 4BAYA 4BW5A 1R3LC 2AZ2A 3P3NA 3FB8C 4JI1O 3VQWA 5KHIA 3L75H 3W7SA 3P32A 1EN4A 5B5EZ 1BZKA 3AK3A 3AEIA 5HFLA 3ZRWA 1DTOA 3A0RA 4FFBA 1IBKO 4LF4O 3CRQA 5EC1C 1IBMO 3E35A 5L3BA 4UCSA 3K0DA 1NTZH 4DV1O 1OCCC 1H2KA 1RFYA 1AB3A 4X66B 1H2LA 3AG3B 3KCYA 2P4VA 2OTJV 5C8YA 1VQ8V 3OMAB 4GZRB 5D5QA 1HNXB 4JV5O 4MSWC 4HAMA 3SJAC 2FTKA 4JPRA 3A0HZ 1RP3B 3HKBB 3RVZA 5IYBO 1US6A 4FVMA 4HBNA 3D36C 5EYPA 1NS1A 4KL1A 1K3EA 5BXZA 4X8AA 2VQEO 4X1IB 3E8GA 3SYAA 3G80A 1JOYA 2EIKC 1BL8A 1Q81W 1BE3H 3BPZA 2QWQB 1H2GA 4XDJA 2YXLA 4X1KB 5EBMC 1Q6HA 2IBZH 3JD0A 1K5SA 4MVSA 3CCUV 5CA1B 4R7CA 2ZM6B 2JRIA 4ZOLB 3SPCA 4LF8B 4OPAA 1SETA 1SZTA 1SC5B 4J10A 5LA6A 4PV1B 1VF5B 1XNQB 5K1PA 4NKGB 4YJ3B 1P49A 1M1KW 4A5UB 3ETQA 4I4TB 4FMTA 1B06A 1ZL8A 5L3DA 3TCUA 2HVJC 3KKYA 2RNBA 4X9QA 1FXKA 4GKKO 3OEHG 2W0FC 4NTWA 4J80A 4LFBO 1NU1H 3CRAA 1E1QG 5CMUA 1N33B 4DRXB 3OTOB 2Y69C 4X20B 4DR7B 2V7QG 4ZBMA 5E79Z 4UVCA 3K57A 3JD1A 2VWKA 1SF9A 1WA8A 2HP8A 3UO2A 4LF5B 1SA0A 2QM4A 1FKAO 3E8FA 4N23A 4XDLA 1E1RG 5DM6V 5EZYA 4PA7A 2ZXWB 2GBOA 1CXZB 3JARB 1IX9A 5LMUB 2LQTA 4H44B 2Q4PA 2X7RB 3KG2A 3JALA 3CJHB 1OHHG 1YDXA 5IWAO 1K4DC 2BSKA 4DW0A 4WFAV 2QA4V 1QLEB 4B3MO 3B77A 1X4TA 2QM8A 3FFQA 4X20A 4H33A 2O57A 2ZKOA 3APQA 4L87A 1IBKB 5LGTA 1DLBA 1N36O 1H2NA 1FS0G 3G6EV 4Q20A 3ZJZA 1YI2V 4O4HA 1JR9A 1QNMA 2CUGA 2X6AA 3K03A 4ABMA 3LDCA 1XOUA 4LFCO 3ABTA 2ETNA 5K1XA 5LA6B 4F6RA 2VQEB 2ZE6A 4DUYB 3JALB 1BS3A 5B1AB 5CB4B 2QKAA 3OUSA 3CCRV 3MAQA 1OCRC 5IY5B 3SYOA 1AJQA 3ML0A 4NXNB 3OM3B 3ETDA 4AI8A 2PI5A 2QKSA 3OT7A 4X66O 1MA1A 4O2BB 3IJ4A 1HWYA 1AR1B 2ZDIA 4WFEA 2F66C 5DEDA 3RYHB 4D6TH 1R3JC 2Q73A 3KCXA 4GX2A 2CAZC 2X6BA 3A2FA 4O4JA 3TXQA 2OCCC 3ICXA 2Q5ZA 1JVMA 5LP6B 3W7WA 3ZMUA 1ZLZA
chains in the Genus database with same CATH topology
1WPXA 4G28B 3ETEA 1PNLA 3STZC 1NR7A 1GK9A 5BZBA 2HR3A 2R9IA 4MVRA 1N8RW 1S77D 1FXHA 2QEXV 3W7UA 3P30A 4MW3A 1V55C 5IYDO 3LDDA 4TT3G 4BIUA 1KC8W 4GX0A 3TETA 5LBQA 1VQ9V 2DWEC 2KB1A 3CCVV 3GWOA 1NR1A 2A9HA 2WLMA 1VQMV 1H8EG 4R50A 5DN6G 1R3KC 2Q68A 1OCOC 4QPKA 2WLIB 3ABKB 4QE7A 3ZRVA 1CEZA 2XNDG 3X2QB 4MTFA 1QVGU 3QO7A 1FFTB 3ZRSA 1YJWV 1QCEA 3G71V 3CCEV 2WLLB 4F4LA 1M57B 2H94A 5LHGA 4LBEC 1VQNV 4PDLA 3OUFA 3K06A 1YJNV 3E8HA 2XAHA 3NXSA 3FB5C 4MVZA 3STLC 3OMIB 5EK0A 2IU0A 4ZKIA 2DYRB 4QE9A 5EBLC 5CBFA 3FB6C 2X6CA 3SYPA 5L3EA 2OT5A 2Q69A 3AG1C 4Z1MG 4I9WA 2EBOA 3AG2C 1F4NA 4JYBA 4U7NA 5E1AC 1AROP 3I55V 1PNKA 3AG2B 2C2AA 4PDRA 1BHBA 3VOUA 2DYSC 5B1AC 2JJ1G 1IXMA 1DF5A 1YHQV 1EZJA 1KP2A 2ATKC 2MK3A 2IW5A 2ZDIC 4QJFB 2WLIA 1PKXA 1M56C 3OE7G 2GHYA 5LHIA 2EZOA 5LHHA 2P90A 2EIKB 3D3IA 3QO5A 1Q82W 1KQSU 1ORQC 1KD1W 2B5UA 1QR8A 3K04A 3OGCC 3X2QC 3UM7A 4R6ZA 4FK5C 1SRYA 3JD4A 4PA4A 2IJKA 1RPRA 3ZIAG 1Q7YW 3CYOA 1ROPA 3EHBB 1SESA 3JD2A 1YTFD 4PA6A 3CP1A 3CD6V 1K9MW 1M57C 1K73W 4XBFA 3IGAC 4YXWG 5CBHA 3E89A 1GM7A 1W2BU 3FYIB 3W7TA 2JDIG 1SERA 4KP4A 4RAIA 1RPOA 3CCQV 2P6JA 4LC1A 1LNQA 4PA3A 4P9OA 4MTGA 1OCZB 4MW8A 1PNMA 3RBZA 3TK1A 2OCCB 3E83A 1BMFG 1OCCB 4UV9A 2YEVA 1NVPB 1GKFA 3E2EA 3AG1B 1NBMG 3OR7C 2Q6AA 3AG3C 2LFSA 3BY6A 1G8MA 1W0KG 3JCZA 4FPPA 3SYCA 5KUMA 3SJQC 2GSMB 5B1BC 4MVQA 2H8PC 2JIZG 1VQPV 1M56B 2DWDC 4XDKA 1BHAA 1CP9A 1VQ4V 4MS2A 5H6RA 1KP3A 2JK5C 2WSSG 3LSSA 3ZMVA 5C93A 2IJJA 4BAYA 4RO2A 4BW5A 1NH2B 1R3LC 2DYSB 3IC7A 3ZCCA 4QIWF 4ASUG 2XAJA 3FB8C 4JAUA 4PDMA 2IU3A 4J9ZB 4DO2A 2WLHA 1AJPA 2BOBC 3WFVA 5IDJA 1GM9A 3EFFK 5CBGA 3W7SA 3P32A 1AI5A 3CCJV 1E79G 4HYOA 1Q86W 1AJNA 1MSWD 2BOCC 2P7TC 1YSCA 3AEIA 4GX5A 2M7WA 5HFLA 3SPIA 1R73A 3ZRWA 1DTOA 3A0RA 4RQFA 4JTCB 3T4ZA 3HPLC 5EC1C 5LGUA 2YEVB 3E35A 2IJHA 5L3BA 2ZXWC 2A0LA 1VQOV 3K0DA 3E8BA 4HZ3A 4WFGA 3MHSC 1OCCC 3ABMB 3AG4C 2EIJB 4GCZA 2HFEC 3AG3B 3ABKC 4MT8A 1OCZC 3K0GA 2OTJV 2ZQMA 1VQ8V 3HB3B 3OMAB 4BIZA 3CCSV 4MSWC 3ZRWB 4HAMA 4UUJC 5KA6A 2JEUA 1F4MA 2XOKG 2FTKA 5EC2C 5L3CA 3OAAG 4JTAB 4JPRA 3FB7C 1GTOA 4TWKA 4QPJA 1H38A 4JASA 1OZ0A 3VBBA 3RVZA 5IYBO 3H01A 1VQ5V 4KUMA 4N21A 2DQ0A 1K3EA 4X8AA 1R6NA 1QR9A 3ZMZA 2DQ3A 4H37A 3T2MA 3E8GA 1GMGA 1W0JG 2ZR3A 3SYAA 1QLNA 1JOYA 4R8CA 2EIKC 3CC2V 3WG7C 1BL8A 4MTXA 3M99B 1Q81W 1JJ2U 3ABUA 1F51A 2B1IA 4FJCC 1H2GA 2NNUA 2DW4A 2QTOA 4XDJA 3ZN1A 1UJWB 3GB7C 4TSFG 5EBMC 3JD0A 2XAQA 4JAVA 1K5SA 3DGEA 5GW7A 2JEXA 1JX9A 4MVSA 2Z5UA 3CCUV 3FYEB 1S72V 4G27B 4UVBA 4RQEA 5H9CA 4R7CA 4WF9V 1JPXA 1GO3F 2WPDG 4P2ZA 1NQTA 2V1DA 1CPYA 2HKOA 1MABG 3OEEG 5L3FA 3K08A 2QE7G 1MG1A 1S76D 3SPCA 2R9RB 2XASA 3RW0A 1SETA 1SZTA 5CN0A 2Z3YA 3FKSG 5B1NA 4MVOA 4UV8A 4LP8A 3RVYA 3I56V 4JF3A 1RM1C 5B1BB 2HJFC 3ETGA 1COWG 1I5XA 3MHHC 4OXSA 1M1KW 3F7VC 1EFRG 3T1CA 4FMTA 5B3SB 1TUEB 5L3DA 2Q67A 3TCUA 2B1GA 2HVJC 2ZD9A 2EZPA 1FXKA 3OEHG 4JYCA 2W0FC 1VQ6V 1FXKC 3E86A 3ZMSA 1QBZA 1G4YB 1P7BA 3JD3A 5IYCO 1YIJV 4JTDB 3G4SV 4E2LA 1E1QG 3LNMB 3LUTB 2EINB 2Y69B 1XL4A 2QM7A 2UXNA 3B8MA 3QO8A 4RUEA 5CMUA 5H6QA 4CBCA 4CZZA 3CC4V 1QVFU 4KFMA 1K8AW 2Y69C 4X89A 3SPGA 1NH2D 2V7QG 3R65A 1V55B 2WLNA 2EJRA 3ZN0A 1V54C 4ZBMA 3W7XA 2D3OW 2XAFA 4UVCA 1JQ0A 2ZR2A 3JD1A 3ZRXA 4EKWA 2XAGA 1THZA 2HG5C 2OTLV 1S5HC 4I5SA 3OR6C 3CMEV 2ITCC 2EINC 3E8FA 4N23A 4PA9A 4XDLA 4WCEV 1YTFB 1E1RG 2WAMA 3QNEA 3OMNB 5DM6V 2P67A 5B1OA 3CXCU 1PL0A 2ZXWB 4PA7A 2EIMC 2WLKA 5KUKA 1Y66A 2CK3G 1K7DA 2A79B 2EIJC 1B6QA 3SPHA 5EBWC 2IH1C 2X7RB 1K34A 4WFHA 3ABMC 3KG2A 1GM8A 2W6IG 3JYCA 3BEHA 5CA3A 4RUFA 1OHHG 3K9AA 4PDVA 1RM1B 2WLLA 1K4CC 3OW2U 3CCLV 1K4DC 3CPWU 4WFAV 2UXXA 4P9PA 1ZWIC 1PD3A 1AI7A 4GX1A 1R3IC 2EIMB 1YJ9V 2QA4V 3SPJA 1K5QA 1QLEB 3D36A 3OFNG 3B77A 2QM8A 3IFXA 4G2KA 3WG7B 1Y4MA 1OCRB 4H33A 3K79A 3T4DA 5HFMA 5KA5A 1NVPD 3ASNB 4DXWA 4L87A 3ABLB 3F5WC 3LSQA 5LGTA 1DLBA 4UXNA 1M9NA 1JCHA 1EBOA 1FS0G 5B3SC 4Q20A 1V54B 3G6EV 3ZJZA 1YI2V 5J9PC 2W6JG 2K1EA 4WFFA 3ZMTA 2F43G 2JJ2G 4WFBV 2Y48A 2HLDG 2WLJA 4UVAA 2PI4A 1AI4A 5FL7G 1NKDA 2X6AA 1ENVA 3AG4B 3K03A 1M90W 3CMAV 1R6KA 2X0LA 3LDCA 2NLJC 3ABTA 1VQLV 3PJSK 3ABLC 1P4RA 1FXKB 4MTOA 1YITV 1H8HG 1OCOB 3ASNC 4U7OA 5B1AB 4X88A 4P30A 1FXVA 2EILC 3B8NA 3OUSA 1L1FA 3CCRV 5L3GA 1I5YA 1OCRC 1WLEA 1NJIW 3ASOC 5IY5B 4J9YB 1MOFA 4MVMA 1QLEC 3SYOA 2YSUB 1J95A 1KKDA 1AJQA 3F7YC 1DF4A 1F23A 2DYRC 4GT1A 1VQ7V 3ML0A 4JGSA 3OM3B 1XL6A 3ETDA 4MVUA 2AHYA 2PI5A 2LFRA 1K97A 2QKSA 3CC7V 2ITDC 1S3JA 2IH3C 3DTUB 1K92A 2IJIA 4QNHB 3K3WA 2WWWA 3LDEA 4FIPC 2LP7A 1HWYA 3CCMV 1AR1B 2ZDIA 4WFEA 4PELA 1R3JC 4GX2A 3UKMA 2X6BA 3SYQA 5LGNA 1VQKV 1S0VA 4LCUC 2AHZA 3ASOB 5IY5C 2OCCC 1KECA 3W7WA 1AI6A 1JVMA 2EILB 1K33A 2HVKC 3MD0A 3ZMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EBM C;  4MTG A;  4G28 B;  4MW8 A;  3RBZ A;  3STZ C;  4P9P A;  1ZWI C;  5BZB A;  4GX1 A;  4MVR A;  1R3I C;  4MVS A;  4G27 B;  3SPJ A;  3E83 A;  2YEV A;  4R7C A;  3IFX A;  4H33 A;  1V55 C;  4MW3 A;  4P2Z A;  3OR7 C;  2Q6A A;  3AG3 C;  3LDD A;  3SYC A;  5KUM A;  3SJQ C;  3K08 A;  3T4D A;  4GX0 A;  5B1B C;  4MVQ A;  3SPC A;  2H8P C;  2R9R B;  3TET A;  4DXW A;  2DWD C;  4XDK A;  2DWE C;  2KB1 A;  3F5W C;  4MS2 A;  3RW0 A;  2A9H A;  2WLM A;  2JK5 C;  4R50 A;  5B3S C;  4RO2 A;  1R3K C;  2Q68 A;  3ZJZ A;  1OCO C;  4MVO A;  4BW5 A;  2K1E A;  4LP8 A;  1R3L C;  4WFF A;  5J9P C;  2WLI B;  4QE7 A;  2WLJ A;  3RVY A;  2HJF C;  3FB8 C;  4MTF A;  4PDM A;  4OXS A;  2X6A A;  3K03 A;  3F7V C;  4J9Z B;  2WLH A;  3LDC A;  2BOB C;  2NLJ C;  3ZRS A;  3EFF K;  5CBG A;  3T1C A;  2WLL B;  4F4L A;  4HYO A;  3TCU A;  2Q67 A;  2HVJ C;  3PJS K;  2BOC C;  4LBE C;  4PDL A;  2ZD9 A;  2P7T C;  3OUF A;  3SPI A;  3K06 A;  4GX5 A;  3E8H A;  3ABL C;  2W0F C;  3FB5 C;  4MTO A;  4MVZ A;  5EK0 A;  3ASN C;  3E86 A;  3STL C;  4CBC A;  4JTC B;  3T4Z A;  4QE9 A;  3HPL C;  1G4Y B;  4P30 A;  4X88 A;  2EIL C;  3FB6 C;  5EBL C;  1P7B A;  5EC1 C;  5CBF A;  2X6C A;  3SYP A;  3OUS A;  2ZXW C;  2Q69 A;  4JTD B;  2A0L A;  3AG1 C;  3K0D A;  1OCR C;  3LNM B;  3AG2 C;  1XL4 A;  3E8B A;  3ASO C;  3LUT B;  4HZ3 A;  4I9W A;  4J9Y B;  4MVM A;  4RUE A;  4WFG A;  5E1A C;  1OCC C;  1QLE C;  3AG4 C;  4KFM A;  2Y69 C;  4X89 A;  3SPG A;  3SYO A;  1J95 A;  1KKD A;  2HFE C;  3F7Y C;  4PDR A;  3VOU A;  2DYS C;  3ABK C;  3R65 A;  2DYR C;  5B1A C;  1OCZ C;  2WLN A;  3K0G A;  1V54 C;  4ZBM A;  1XL6 A;  4MVU A;  2AHY A;  4MSW C;  2ATK C;  4UUJ C;  2WLI A;  2QKS A;  4EKW A;  1M56 C;  5EC2 C;  2ITD C;  4JTA B;  2HG5 C;  3FB7 C;  2IH3 C;  4TWK A;  1S5H C;  3OR6 C;  1ORQ C;  2ITC C;  4QNH B;  2EIN C;  3RVZ A;  3E8F A;  4P9O A;  4XDL A;  4PA9 A;  3K04 A;  3LDE A;  3OGC C;  3X2Q C;  3UM7 A;  4R6Z A;  4PA4 A;  4X8A A;  4WFE A;  4PA7 A;  2EIM C;  2WLK A;  1R3J C;  4XDJ A;  5KUK A;  4PA6 A;  4H37 A;  3T2M A;  4GX2 A;  3UKM A;  3E8G A;  3SYA A;  1M57 C;  3IGA C;  2A79 B;  2EIJ C;  5CBH A;  3SPH A;  2X6B A;  5EBW C;  3E89 A;  4R8C A;  2IH1 C;  2EIK C;  3SYQ A;  4WFH A;  3WG7 C;  3ABM C;  4LCU C;  1BL8 A;  2AHZ A;  3KG2 A;  3JYC A;  5IY5 C;  3BEH A;  2OCC C;  4RUF A;  1JVM A;  4PDV A;  4RAI A;  2QTO A;  2WLL A;  1K4C C;  2HVK C;  1K4D C;  1LNQ A;  4PA3 A;  3GB7 C; 
#chains in the Genus database with same CATH topology
 2BE3 A;  4X1I A;  1HNZ O;  1PNL A;  3STZ C;  4JYA O;  1NR7 A;  1GK9 A;  3I5D A;  1S77 D;  3U11 A;  5JJE B;  2BTQ A;  3P3P A;  4PHZ A;  2OIE A;  2ADQ B;  2G38 A;  5IYD O;  1OJH A;  1HDJ A;  4FM1 A;  4GX0 A;  1HW7 A;  2JS3 A;  1VQ9 V;  5LBQ A;  5AG2 A;  4D7T A;  3K59 A;  3CCV V;  1GN3 A;  3GWO A;  2UU9 O;  5IYZ B;  5IYZ A;  1D5A A;  1XQ8 A;  3H1L H;  2Q68 A;  1J5E B;  4QPK A;  2CTR A;  3X2Q B;  4NXM B;  3DXR B;  1QVG U;  3QO7 A;  2PGG A;  4DV6 O;  4YHH O;  4LF9 O;  2L35 A;  1QCE A;  3CCE V;  2WLL B;  4F4L A;  1HNZ B;  3UT5 B;  2H94 A;  2PYL A;  1PP9 H;  4LBE C;  1VQN V;  1YVW A;  4MVZ A;  4JI0 B;  2XUM A;  3SYP A;  4Z1M G;  2GUZ A;  3AG2 C;  1F4N A;  4JI8 B;  4U7N A;  1ARO P;  1PNK A;  4OGQ B;  2N04 A;  2JJ1 G;  1XNR B;  2QWO B;  4ZOL A;  3O65 A;  1G1X B;  1DF5 A;  4DK0 A;  1YHQ V;  4DV4 O;  2CGN A;  2MK3 A;  3IC9 A;  4LF6 O;  4X65 B;  2IW5 A;  1BQ0 A;  1PKX A;  3CE2 A;  5FNV B;  5LHI A;  2P90 A;  3HKB A;  3QO5 A;  1Q82 W;  1KQS U;  3CRC A;  2PY5 A;  2UXB B;  4OX9 B;  2DOS A;  2B5U A;  3OGC C;  2ZIM A;  3UM7 A;  4FK5 C;  4DUZ B;  1SRY A;  3JD4 A;  4PA4 A;  2UUC O;  1ROP A;  4JI0 O;  1SES A;  1YTF D;  4CC6 A;  3CD6 V;  1M57 C;  2R72 A;  2F1M A;  2ZNI A;  2QKC A;  1O9G A;  1YXB A;  4RAI A;  2ZE7 A;  4W4K A;  2P6J A;  1FFX B;  4PA3 A;  4MTG A;  2OWO A;  4IYH A;  4MW8 A;  1PNM A;  5J2U B;  4X1Y A;  3RYF B;  1BMF G;  3RYF A;  3KZI Z;  1LR1 A;  3AG1 B;  3OR7 C;  4NTY A;  3AG3 C;  2NR5 A;  4TV8 A;  2GSM B;  2A3Q A;  5B1B C;  4MVQ A;  1VQP V;  1FPO A;  4H0L B;  1D5N A;  1VQ4 V;  2WA3 A;  1KP3 A;  2JK5 C;  2QGN A;  1VMG A;  2IJJ A;  4JI4 B;  4RO2 A;  2RQ6 A;  3IC7 A;  4PDM A;  5KHG A;  2UUA B;  2BOB C;  3WFV A;  3T1H B;  2B9Z A;  1IBM B;  1AI5 A;  3EVK A;  4HYO A;  1MSW D;  3Q4H B;  2A06 H;  1B3Q A;  1R73 A;  1Q6U A;  1SKV A;  2ZE8 A;  5KHK A;  3HPL C;  2QWN B;  4DR6 O;  2ZXW C;  2ARH A;  3E8B A;  4HZ3 A;  3MHS C;  4TUY A;  2EIJ B;  2HHH O;  2HFE C;  4AHC A;  3ABK C;  4MT8 A;  4YY3 B;  3K0G A;  4AIL C;  3JCU Z;  2ZQM A;  3L73 H;  3RYC A;  3L74 H;  1F4M A;  2PZS A;  2XOK G;  1YCI A;  5BY1 A;  2R70 A;  2H3O A;  1GTO A;  3UQ8 A;  4LF5 O;  4TWK A;  2UXB O;  3RYI A;  4QGP A;  1VQ5 V;  3AG7 A;  4KUM A;  1R6N A;  2DQ3 A;  1XBL A;  4J11 A;  4X62 B;  4H37 A;  4CH3 A;  1GMG A;  1I94 B;  1N33 O;  1QLN A;  4MTX A;  3M99 B;  4JZ2 A;  1F51 A;  2B1I A;  4FJC C;  3BRC A;  2DW4 A;  3ZN1 A;  4TSF G;  2KQX A;  2CTP A;  5GW7 A;  2XAQ A;  2Q9L A;  3SGI A;  1JX9 A;  2E74 B;  4O4J B;  2E5L B;  4LH7 A;  2P4K A;  5IJ0 B;  4NTX A;  4B3T B;  4P2Z A;  1EZV H;  1KUQ A;  4FM2 A;  4B7K A;  2HKO A;  4J41 A;  3ZHS A;  1S76 D;  3RFR A;  1ZSP A;  2GV9 A;  2R9R B;  3B2E E;  5JWP A;  2RDC A;  3QVN A;  1HNW O;  3R66 A;  5B1N A;  2DJV A;  4LP8 A;  4UV8 A;  3I56 V;  1RM1 C;  3JAW A;  2HJF C;  1I5X A;  4OXS A;  2JGU A;  4DR1 O;  1XHZ A;  1EFR G;  1Y76 A;  3T1C A;  1FD9 A;  1TUE B;  2Q67 A;  2B1G A;  4F6R B;  3OD4 A;  4JYC A;  3OTO O;  1FXK C;  3E86 A;  3ZMS A;  1QBZ A;  3G6B A;  5CA0 B;  1G4Y B;  4DYL A;  5IYC O;  3LUT B;  2EIN B;  3TXS A;  1XL4 A;  2QM7 A;  2UXN A;  4I4T A;  4RUE A;  4CZZ A;  1K8A W;  4X89 A;  3SPG A;  1M5I A;  3S3W A;  2KSD A;  3R65 A;  3ZN0 A;  3W7X A;  3L70 H;  3ZS8 C;  4EKW A;  4J7J A;  5CA1 A;  5FPR A;  4FLU A;  1THZ A;  1N0J A;  3WB1 A;  5GON A;  3OR6 C;  2ITC C;  1WN7 A;  2YIB D;  4LH6 A;  3QNE A;  3CXC U;  1BT8 A;  3J80 N;  1L8D A;  5KUK A;  5KAF Z;  2CK3 G;  4ZIB A;  1K7D A;  4EB6 A;  2A79 B;  2EIJ C;  4O4H B;  1HR0 B;  2IH1 C;  5BMV B;  3BEH A;  5CA3 A;  4LFA B;  3CXH F;  3OW2 U;  4HNA A;  4EFB A;  3CPW U;  5JVD A;  2EIM B;  2FB5 A;  3SPJ A;  3DSQ A;  2CH7 B;  3D36 A;  2CH7 A;  4G2K A;  4ZHQ A;  2LGQ A;  2QWP B;  5HFM A;  1FYJ A;  3A0B Z;  3ASN B;  3ABL B;  3F5W C;  3L9D A;  3LSQ A;  2Y4U A;  2ZE5 A;  4UXN A;  1M9N A;  1PV0 A;  1EBO A;  4B7E A;  5B3S C;  3QTC A;  5J9P C;  1H2M A;  4TV8 B;  4WFB V;  1ZUQ A;  1SQV H;  3FAV B;  2HLD G;  4O2A A;  2PI4 A;  1WJZ A;  4U3J B;  3CEI A;  2UXD O;  2X0L A;  2NLJ C;  5JQG A;  2M6Y A;  1MZE A;  1IVS A;  4K8X A;  3SDL A;  1VF7 A;  4PI2 A;  3PJS K;  1FJG O;  3ABL C;  4MTO A;  1H8H G;  3ASN C;  1FFX A;  1XMO B;  4U7O A;  1SA0 B;  1FXV A;  1WP7 A;  1AP6 A;  3B8N A;  4LWS A;  2UXC O;  2XHB A;  4I9Q A;  3ASO C;  1MOF A;  1QQC A;  1KKD A;  1DF4 A;  3CB2 A;  1F23 A;  4Q6G A;  4GT1 A;  5J2T A;  3JAK B;  1XNQ O;  5FPO A;  4JV5 B;  1NT2 B;  5IT9 N;  2ITD C;  4B3R B;  2IH3 C;  3DTU B;  4DR2 B;  2VRZ A;  3LDE A;  3FAV A;  1XHX A;  3SYQ A;  1VQK V;  1O9H A;  4LCU C;  2AHZ A;  2ILM A;  3ASO B;  1KEC A;  4DV3 B;  4WBN B;  4GKJ B;  1K33 A;  1MMM A;  3MD0 A;  4GKJ O;  1XMQ O;  3ETE A;  1Y74 B;  2Y0I A;  4NXM O;  2R9I A;  1SQX H;  5JH7 A;  4GKK B;  4UFZ A;  1F7Y A;  1TVK B;  5IJ9 B;  4FLV A;  2HJD A;  4CH5 A;  4TT3 G;  1KC8 W;  1BCC H;  4UCV A;  1MZF A;  1SS3 A;  2KB1 A;  3T1Y B;  2WLM A;  1VQM V;  4LFA O;  4DV5 B;  1H8E G;  4IHJ A;  1OCO C;  1HNX O;  3U0Z A;  2EX3 A;  3ZRV A;  4Z1V A;  2Q8V A;  1YJW V;  2ZIN A;  2RN9 A;  4B3T O;  4KHP O;  1SQF A;  4JI8 O;  1YJN V;  2XAH A;  3FB5 C;  4YJ2 B;  4ZKI A;  5KMG A;  2IU0 A;  3HKE A;  2DYR B;  4QE9 A;  3WU2 Z;  2Q69 A;  4IT5 A;  1Q8I A;  2C2A A;  4PDR A;  2R9A A;  1BHB A;  3VOU A;  1VF6 C;  3K5L A;  2DYS C;  1GN6 A;  3HKD A;  2UXC B;  1I94 O;  4FLX A;  3IAY A;  3UO3 A;  1IBL B;  2ZDI C;  2JGD B;  2WLI A;  4FLZ A;  1GAX A;  4UB8 Z;  1M56 C;  2GHY A;  5LMN O;  4ZI7 A;  4NXN O;  4DR3 O;  1KD1 W;  1P84 F;  3DC5 A;  3JAW B;  4R6Z A;  3B4S A;  1AR4 A;  1RPR A;  3K5M A;  3JD2 A;  4PA6 A;  5JCO A;  4YIO A;  4CH6 A;  1GM7 A;  5KLV H;  2FL4 A;  3W7T A;  1AR5 A;  4DK1 A;  1SER A;  4O4I B;  3TJT A;  3CCQ V;  4LC1 A;  5D5P A;  3JAS B;  1Q3E A;  2JVD A;  3TK1 A;  2OCC B;  1TGO A;  3EXA A;  4UV9 A;  3E2E A;  1VIB A;  5KX5 A;  4JI6 O;  1G8M A;  1W0K G;  2YS8 A;  1WB8 A;  4CS4 A;  3ZHR A;  5EIB C;  4JZG A;  3LSS A;  4JI4 O;  3ZMV A;  1RSO A;  2P06 A;  4K35 A;  2BTO A;  3SJB C;  3ZHU A;  1JFF A;  2XAJ A;  4JAU A;  2IU3 A;  4UB6 Z;  2UU9 B;  4B3R O;  2WLH A;  1AJP A;  3RYI B;  2AXT Z;  2YID A;  1E79 G;  1AJN A;  4IHJ B;  2P7T C;  3SPI A;  1YSC A;  4GX5 A;  2M7W A;  4E4E A;  4LNU A;  4I0X A;  3HKC A;  2L6L A;  4RQF A;  4ICG A;  2CDY A;  1A32 A;  4FZ0 A;  1N4C A;  1D2D A;  2YEV B;  3F5T A;  2YXY A;  2A0L A;  1VQO V;  4I55 A;  2OCH A;  3AK2 A;  3AG4 C;  4JI3 O;  1AVM A;  4YY3 O;  3HB3 B;  1GN4 A;  4X64 O;  2EUL A;  4BIZ A;  3ZRW B;  4LF7 O;  5KA6 A;  2JEU A;  4FLW A;  4DUZ O;  1TAE A;  5L3C A;  1R6T A;  4JTA B;  3APO A;  2D2C B;  3LSU A;  5EIB D;  4K3A A;  5J2T B;  4GYC B;  2WA4 A;  4W4L A;  1HR0 O;  4CH4 A;  3VQV A;  1QR9 A;  4X1Y B;  2AZ0 A;  5BR8 B;  1YF2 A;  1W0J G;  2GTA A;  2ZR3 A;  3CC2 V;  3D8C A;  1DK1 A;  5F2V O;  4B3S B;  1SQG A;  3ABU A;  5IWA B;  4DV2 B;  1XNR O;  2QTO A;  1UJW B;  3GB7 C;  3JSN A;  1VEW A;  4JI2 O;  1XI1 A;  3DGE A;  2Z5U A;  3N2G B;  5ITZ B;  3FYE B;  1Q43 A;  4G27 B;  4UVB A;  4RQE A;  4IL6 Z;  4PD4 F;  5H9C A;  3M8A A;  1GO3 F;  4JAA A;  2V1D A;  4JYY A;  1MAB G;  5L3F A;  2QE7 G;  1MG1 A;  2XAS A;  2GDS A;  2YIB A;  2KKW A;  4DR4 B;  3FKS G;  4MVO A;  3ZHQ A;  3N2K A;  1Y6X A;  1S5J A;  3RVY A;  4JF3 A;  5B1B B;  4FLT A;  3MHH C;  3NR7 A;  1TA8 A;  3F7V C;  4IGG A;  5GTI Z;  3BA8 A;  2VQF O;  1FAF A;  5B3S B;  4X1K A;  1WB7 A;  4KHP B;  2EZP A;  5LMN B;  4WBN A;  1VQ6 V;  4IIJ A;  2YIA A;  4FM0 A;  4DR6 B;  2ZIO A;  3JD3 A;  3G4S V;  4QE7 A;  3K5O A;  3LNM B;  5JH7 B;  3QO8 A;  4U3F H;  5H6Q A;  3CC4 V;  4KFM A;  4I7Z B;  1GN2 A;  1NTM H;  2LGW A;  4DV3 O;  5KAI Z;  1V55 B;  3HKE B;  1V54 C;  2XAF A;  2ZR2 A;  4X64 B;  2P5O A;  2XAG A;  4TUY B;  1WAZ A;  4I5S A;  3CJH A;  3CME V;  2W0X A;  2QR4 A;  5LXT A;  2EIN C;  1XMO O;  3SJC C;  2P22 C;  4DV7 O;  1Z2G A;  1YTF B;  3CWB H;  2WAM A;  5B1O A;  5J2U A;  4DV1 B;  4JI5 O;  1PL0 A;  2YI9 A;  4X62 O;  2ZM6 O;  1IXB A;  3ZED A;  2E3C A;  1Y66 A;  4Z2W A;  1B6Q A;  1J5E O;  1GM8 A;  2W6I G;  4DV0 O;  1QHT A;  4K0K B;  2Y4T A;  4RUF A;  3K9A A;  2E5L O;  4PDV A;  1RM1 B;  2WLL A;  1K4C C;  2Y0P A;  4LF7 B;  4P9P A;  1PD3 A;  4GX1 A;  2K9P A;  3RYH A;  3HKD B;  1I0H A;  1TVK A;  1KBH A;  3IFX A;  4JI7 O;  1OCR B;  3BHP A;  1Y76 B;  3K79 A;  1NVP D;  3Q4H A;  1Q90 D;  4DXW A;  1JCH A;  1N36 B;  1V54 B;  1Z5V A;  2K1E A;  4WFF A;  2F43 G;  2Y48 A;  5FLX N;  1NKD A;  1ENV A;  3ZBH A;  3CMA V;  1R6K A;  2PTM A;  4UCR A;  2PYJ A;  3J7A U;  1W59 A;  2BCC H;  1VQL V;  1LUW A;  1YIT V;  1OCO B;  4U3J A;  2HHH B;  3BAA A;  4P30 A;  3PN1 A;  4CS2 A;  5BR8 O;  1L1F A;  2KG7 B;  5L3G A;  1WLE A;  5BMV A;  4J9Y B;  1QLE C;  2FML A;  2QSA A;  1J95 A;  4UCU A;  4DW1 A;  5LOV A;  2DYR C;  4JGS A;  1WP8 A;  1SQQ H;  2LFR A;  3CC7 V;  5CB4 A;  4FFB B;  1S3J A;  4B08 A;  1K92 A;  3H9V A;  3JAT A;  4QNH B;  3K3W A;  1NZ6 A;  2WWW A;  2BSK B;  4FIP C;  1BGY H;  4DV0 B;  1IUR A;  5B66 Z;  1XDC A;  4YIP A;  3UKM A;  3JSL A;  1S0V A;  3HKC B;  4K0K O;  5IY5 C;  2ADP A;  4AQY O;  4GUN A;  2FYU H;  4DR2 O;  1WPX A;  2N05 A;  2EJ7 A;  1XIL A;  1T5E A;  2HR3 A;  2Q0A A;  1N8R W;  1PL4 A;  4O2A B;  1WA8 B;  1JA8 A;  3W7U A;  3P30 A;  1BQZ A;  4MW3 A;  1V55 C;  1WPB A;  1IDS A;  2JS5 A;  2YUA A;  1P7G A;  2DWE C;  5ITZ A;  1NR1 A;  4TV9 B;  4TV9 A;  3AK1 A;  3JAR A;  4R50 A;  4L8J A;  1KYO F;  1R3K C;  2JGD A;  2WLI B;  5KHJ A;  1CEZ A;  4LF8 O;  4FZ1 A;  2UUA O;  2XND G;  2BTQ B;  4DR5 O;  3N27 A;  4YHH B;  4LF9 B;  2CTQ A;  3C3S A;  1N34 B;  1M57 B;  4LF6 B;  2VQF B;  3UCS C;  5LHG A;  3K06 A;  4LNU B;  3OGI B;  4CS3 A;  3STL C;  2OYQ A;  4O2B A;  1MSD A;  5FNV A;  5EBL C;  5CBF A;  2X6C A;  5JQG B;  5L3E A;  2OT5 A;  2AW9 A;  3QF7 A;  3AG1 C;  2XTA A;  4D7S A;  1KKC A;  5GTH Z;  4J7K A;  5E1A C;  3AG2 B;  1V9P A;  4NR1 A;  3FX7 A;  1ZX3 A;  4DR7 O;  3QG5 A;  1IXM A;  2ZNJ A;  3JAS A;  4OPH A;  1KP2 A;  3ZHT A;  2KG7 A;  4QJF B;  4CC5 A;  4DR5 B;  2RMK B;  3OE7 G;  4EEQ A;  4BIO A;  2EIK B;  3D3I A;  2RJZ A;  3CRR A;  1N32 B;  1QR8 A;  1AP5 A;  3X2Q C;  5JVD B;  3ZIA G;  1Q7Y W;  3CYO A;  4PI0 A;  1IZ3 A;  1ZTE A;  1K9M W;  4OX9 O;  1K73 W;  4YXW G;  2ODM A;  3SR2 C;  3E89 A;  1W2B U;  3H1H H;  1PM9 A;  4B3S O;  4O4L A;  1UPG A;  2UXD B;  1RPO A;  1LNQ A;  1DGS A;  4P9O A;  3C90 A;  3D3Q A;  3RBZ A;  5KMG B;  4YJ2 A;  1B04 A;  3E83 A;  1OCC B;  1GKF A;  1NBM G;  2LFS A;  3BY6 A;  1SQB H;  3JCZ A;  4FPP A;  5KUM A;  3SJQ C;  2H8P C;  2JIZ G;  1M56 B;  1BHA A;  1CP9 A;  4MS2 A;  1EN5 A;  2YXH A;  5C93 A;  1NH2 B;  5H2F Z;  2DYS B;  5LP6 C;  3ZCC A;  3BCC H;  4QIW F;  4ASU G;  1HP8 A;  2YI8 A;  4J9Z B;  4DO2 A;  1U96 A;  5IDJ A;  1GM9 A;  3EFF K;  5CBG A;  4DR1 B;  3CCJ V;  3GVM A;  1Q86 W;  4PJ0 Z;  4UCO A;  2BOC C;  4IIJ B;  2NN4 A;  4JTC B;  1XUQ A;  3VQY A;  3T4Z A;  5LGU A;  2IJH A;  1AIL A;  3K5N A;  4WFG A;  1L0L H;  5JJN B;  2YC0 A;  3ABM B;  5A9G A;  2AGA A;  4GCZ A;  3B09 A;  2DMX A;  3FD9 A;  4HNA B;  1Y67 A;  4J7Z A;  4LFB B;  1OCZ C;  4FFK A;  3CCS V;  1LUV A;  4UUJ C;  2QDO A;  5EC2 C;  3OAA G;  4C7U A;  3FB7 C;  1I08 A;  1H38 A;  4QPJ A;  4JAS A;  1OZ0 A;  3VBB A;  3H01 A;  2DE0 X;  2IM9 A;  4F6E A;  2YIC A;  1ZL8 B;  4N21 A;  2DQ0 A;  3E22 B;  5A2Q N;  5LYJ A;  3RWR D;  3A8T A;  3O9O A;  3ZMZ A;  2VWJ A;  1RSO B;  3C3T A;  4DV2 O;  3T2M A;  4ZI7 B;  3K9S A;  4R8C A;  3WG7 C;  1JJ2 U;  2F4V O;  1KMI Z;  2MW2 B;  4TQD A;  2E76 B;  1H2S B;  2NNU A;  4I50 B;  4I50 A;  2ZT9 B;  4DR3 B;  3BAB A;  4BWA A;  3RN4 A;  3RYC B;  4JAV A;  2JEX A;  2F23 A;  1KU9 A;  1S72 V;  2FKX A;  4WF9 V;  1JPX A;  2WPD G;  3H1I H;  1SZX A;  1N34 O;  1N32 O;  2LJ2 A;  3JAM N;  1NQT A;  1XRE A;  3H1K H;  1CPY A;  4YJ3 A;  3OEE G;  3K08 A;  4JI5 B;  3WB0 A;  3RW0 A;  1X59 A;  4JI7 B;  2F93 B;  2QJ1 A;  5CN0 A;  2Z3Y A;  3ZHV A;  2QWR B;  4LFC B;  5IJ0 A;  3M7M X;  3ETG A;  1COW G;  3VQX A;  5LXT B;  5LYJ B;  1UFI A;  2LO1 A;  4UCT A;  2ZD9 A;  2LW1 A;  1S5L Z;  5GON B;  1P7B A;  1YIJ V;  3OTF A;  4JTD B;  1EN6 A;  4E2L A;  1R1B A;  2Y69 B;  4CBC A;  3B8M A;  1QVF U;  2QTS A;  5LOV B;  1NH2 D;  1N0N A;  2WLN A;  2EJR A;  2D3O W;  5C8Y B;  1WNS A;  1GH6 A;  1JQ0 A;  4I55 B;  4J42 A;  3ZRX A;  1G6U A;  2GTS A;  4LR3 A;  2RCV A;  2HG5 C;  4FLY A;  2OTL V;  4O4I A;  1S5H C;  3RT3 C;  4ZHQ B;  4PA9 A;  4JYA B;  1NTK H;  4WCE V;  3OMN B;  5JJJ B;  2P67 A;  1QU7 A;  4TQF A;  2YDE A;  2EIM C;  3N2G A;  2WLK A;  5DEC A;  4BW9 A;  2HEP A;  3H1J H;  3SPH A;  5EBW C;  2ZCE A;  1K34 A;  4WFH A;  3ABM C;  3JYC A;  4IYI A;  3CCL V;  2XT9 A;  2UXX A;  1Q5O A;  5KHH A;  1ZWI C;  1YJ9 V;  1AI7 A;  1R3I C;  1K5Q A;  3OFN G;  4LWS B;  3BVO A;  3WG7 B;  1Y4M A;  1HNW B;  2A7W A;  3T4D A;  1BSM A;  5KA5 A;  3DXR A;  1Z5W A;  5EZY B;  5LP6 A;  4LF4 B;  2UUB B;  1SQP H;  2W6J G;  4NB5 A;  3ZMT A;  2JJ2 G;  3G67 A;  2WLJ A;  4UVA A;  1U97 A;  1AI4 A;  5FL7 G;  3AG4 B;  1M90 W;  3CRM A;  4RWU A;  4DUY O;  3JAT B;  3DC6 A;  3L72 H;  3N2K B;  3ZX6 A;  1P4R A;  1FXK B;  4JI3 B;  1FJG B;  4B3M B;  4X88 A;  2EIL C;  1I5Y A;  1NJI W;  4MVM A;  2YSU B;  3F7Y C;  4DV5 O;  4H13 B;  1M4U A;  1VQ7 V;  1Y74 A;  1XL6 A;  4X65 O;  4MVU A;  4NVP A;  2AHY A;  4DV4 B;  1K97 A;  2PUS A;  1EM1 A;  2IJI A;  2GUZ B;  4EFE A;  4GLX A;  3L71 H;  1URF A;  3CSX A;  2LP7 A;  2CGO A;  5IE9 A;  3CCM V;  4PEL A;  1YZB A;  1L0N H;  3WB2 A;  4JI2 B;  5LGN A;  2Q7G A;  3MDS A;  4O4L B;  1I7F A;  3B40 A;  1AI6 A;  2DN9 A;  3U10 A;  5JCO C;  2EIL B;  2HVK C;  1KB9 F;  3T1H O;  1XEQ A;  4G28 B;  3BFR A;  3JAK A;  4K8Z A;  5BZB A;  4I0X B;  4MVR A;  4DRX A;  1FXH A;  1Q6I A;  2QEX V;  1YEW A;  2E75 B;  2Q7H A;  3LDD A;  1OV9 A;  2CTW A;  4BIU A;  3TET A;  2VS0 A;  5LL6 Y;  3CHX A;  2A9H A;  5DN6 G;  2N74 A;  1NI8 A;  1VF6 A;  2OIG A;  1TUB B;  3ABK B;  1VAR A;  4JI1 B;  4MTF A;  3THO A;  1FFT B;  5IJ9 A;  4DV6 B;  3ZRS A;  3G71 V;  2Z0A A;  1XMQ B;  3TGU H;  4PDL A;  1PPJ H;  3OUF A;  3J81 N;  3E8H A;  3CX5 F;  3NXS A;  3OMI B;  5EK0 A;  3FB6 C;  4KXR A;  4I9W A;  2EBO A;  4JYB A;  3K58 A;  2UUC B;  3I55 V;  2F95 B;  5B1A C;  4DR4 O;  5EYP B;  5H5N A;  1EZJ A;  2ATK C;  2F4V B;  4DV7 B;  1IBL O;  5CA0 A;  2EZO A;  5TIS Z;  5LHH A;  1MNG A;  5KX5 B;  1ORQ C;  3HR0 A;  3GWK C;  3K04 A;  4JI6 B;  1VP7 A;  3UT5 A;  3E22 A;  3CS5 A;  3RGB A;  1TUB A;  2IJK A;  3EHB B;  2Q7E A;  4TOI A;  2Q0O C;  5LMU O;  2CE4 A;  2UUB O;  2LW7 A;  3CP1 A;  4XBF A;  3IGA C;  5CBH A;  3FYI B;  2PF4 E;  2JDI G;  4KP4 A;  4AQY B;  2V4D A;  1ZAU A;  1OCZ B;  4BR6 A;  1JFF B;  2YEV A;  3T1Y O;  1NVP B;  3S3X A;  4EB6 B;  1JJO A;  1GRJ A;  2Q6A A;  3LNN A;  1JMK C;  3SYC A;  1M93 A;  2DWD C;  4XDK A;  5H6R A;  2WSS G;  3BA9 A;  4NYK A;  4BAY A;  4BW5 A;  1R3L C;  2AZ2 A;  3P3N A;  3FB8 C;  4JI1 O;  3VQW A;  5KHI A;  3L75 H;  3W7S A;  3P32 A;  1EN4 A;  5B5E Z;  1BZK A;  3AK3 A;  3AEI A;  5HFL A;  3ZRW A;  1DTO A;  3A0R A;  4FFB A;  1IBK O;  4LF4 O;  3CRQ A;  5EC1 C;  1IBM O;  3E35 A;  5L3B A;  4UCS A;  3K0D A;  1NTZ H;  4DV1 O;  1OCC C;  1H2K A;  1RFY A;  1AB3 A;  4X66 B;  1H2L A;  3AG3 B;  3KCY A;  2P4V A;  2OTJ V;  5C8Y A;  1VQ8 V;  3OMA B;  4GZR B;  5D5Q A;  1HNX B;  4JV5 O;  4MSW C;  4HAM A;  3SJA C;  2FTK A;  4JPR A;  3A0H Z;  1RP3 B;  3HKB B;  3RVZ A;  5IYB O;  1US6 A;  4FVM A;  4HBN A;  3D36 C;  5EYP A;  1NS1 A;  4KL1 A;  1K3E A;  5BXZ A;  4X8A A;  2VQE O;  4X1I B;  3E8G A;  3SYA A;  3G80 A;  1JOY A;  2EIK C;  1BL8 A;  1Q81 W;  1BE3 H;  3BPZ A;  2QWQ B;  1H2G A;  4XDJ A;  2YXL A;  4X1K B;  5EBM C;  1Q6H A;  2IBZ H;  3JD0 A;  1K5S A;  4MVS A;  3CCU V;  5CA1 B;  4R7C A;  2ZM6 B;  2JRI A;  4ZOL B;  3SPC A;  4LF8 B;  4OPA A;  1SET A;  1SZT A;  1SC5 B;  4J10 A;  5LA6 A;  4PV1 B;  1VF5 B;  1XNQ B;  5K1P A;  4NKG B;  4YJ3 B;  1P49 A;  1M1K W;  4A5U B;  3ETQ A;  4I4T B;  4FMT A;  1B06 A;  1ZL8 A;  5L3D A;  3TCU A;  2HVJ C;  3KKY A;  2RNB A;  4X9Q A;  1FXK A;  4GKK O;  3OEH G;  2W0F C;  4NTW A;  4J80 A;  4LFB O;  1NU1 H;  3CRA A;  1E1Q G;  5CMU A;  1N33 B;  4DRX B;  3OTO B;  2Y69 C;  4X20 B;  4DR7 B;  2V7Q G;  4ZBM A;  5E79 Z;  4UVC A;  3K57 A;  3JD1 A;  2VWK A;  1SF9 A;  1WA8 A;  2HP8 A;  3UO2 A;  4LF5 B;  1SA0 A;  2QM4 A;  1FKA O;  3E8F A;  4N23 A;  4XDL A;  1E1R G;  5DM6 V;  5EZY A;  4PA7 A;  2ZXW B;  2GBO A;  1CXZ B;  3JAR B;  1IX9 A;  5LMU B;  2LQT A;  4H44 B;  2Q4P A;  2X7R B;  3KG2 A;  3JAL A;  3CJH B;  1OHH G;  1YDX A;  5IWA O;  1K4D C;  2BSK A;  4DW0 A;  4WFA V;  2QA4 V;  1QLE B;  4B3M O;  3B77 A;  1X4T A;  2QM8 A;  3FFQ A;  4X20 A;  4H33 A;  2O57 A;  2ZKO A;  3APQ A;  4L87 A;  1IBK B;  5LGT A;  1DLB A;  1N36 O;  1H2N A;  1FS0 G;  3G6E V;  4Q20 A;  3ZJZ A;  1YI2 V;  4O4H A;  1JR9 A;  1QNM A;  2CUG A;  2X6A A;  3K03 A;  4ABM A;  3LDC A;  1XOU A;  4LFC O;  3ABT A;  2ETN A;  5K1X A;  5LA6 B;  4F6R A;  2VQE B;  2ZE6 A;  4DUY B;  3JAL B;  1BS3 A;  5B1A B;  5CB4 B;  2QKA A;  3OUS A;  3CCR V;  3MAQ A;  1OCR C;  5IY5 B;  3SYO A;  1AJQ A;  3ML0 A;  4NXN B;  3OM3 B;  3ETD A;  4AI8 A;  2PI5 A;  2QKS A;  3OT7 A;  4X66 O;  1MA1 A;  4O2B B;  3IJ4 A;  1HWY A;  1AR1 B;  2ZDI A;  4WFE A;  2F66 C;  5DED A;  3RYH B;  4D6T H;  1R3J C;  2Q73 A;  3KCX A;  4GX2 A;  2CAZ C;  2X6B A;  3A2F A;  4O4J A;  3TXQ A;  2OCC C;  3ICX A;  2Q5Z A;  1JVM A;  5LP6 B;  3W7W A;  3ZMU A;  1ZLZ A; 
#chains in the Genus database with same CATH homology
 1WPX A;  4G28 B;  3ETE A;  1PNL A;  3STZ C;  1NR7 A;  1GK9 A;  5BZB A;  2HR3 A;  2R9I A;  4MVR A;  1N8R W;  1S77 D;  1FXH A;  2QEX V;  3W7U A;  3P30 A;  4MW3 A;  1V55 C;  5IYD O;  3LDD A;  4TT3 G;  4BIU A;  1KC8 W;  4GX0 A;  3TET A;  5LBQ A;  1VQ9 V;  2DWE C;  2KB1 A;  3CCV V;  3GWO A;  1NR1 A;  2A9H A;  2WLM A;  1VQM V;  1H8E G;  4R50 A;  5DN6 G;  1R3K C;  2Q68 A;  1OCO C;  4QPK A;  2WLI B;  3ABK B;  4QE7 A;  3ZRV A;  1CEZ A;  2XND G;  3X2Q B;  4MTF A;  1QVG U;  3QO7 A;  1FFT B;  3ZRS A;  1YJW V;  1QCE A;  3G71 V;  3CCE V;  2WLL B;  4F4L A;  1M57 B;  2H94 A;  5LHG A;  4LBE C;  1VQN V;  4PDL A;  3OUF A;  3K06 A;  1YJN V;  3E8H A;  2XAH A;  3NXS A;  3FB5 C;  4MVZ A;  3STL C;  3OMI B;  5EK0 A;  2IU0 A;  4ZKI A;  2DYR B;  4QE9 A;  5EBL C;  5CBF A;  3FB6 C;  2X6C A;  3SYP A;  5L3E A;  2OT5 A;  2Q69 A;  3AG1 C;  4Z1M G;  4I9W A;  2EBO A;  3AG2 C;  1F4N A;  4JYB A;  4U7N A;  5E1A C;  1ARO P;  3I55 V;  1PNK A;  3AG2 B;  2C2A A;  4PDR A;  1BHB A;  3VOU A;  2DYS C;  5B1A C;  2JJ1 G;  1IXM A;  1DF5 A;  1YHQ V;  1EZJ A;  1KP2 A;  2ATK C;  2MK3 A;  2IW5 A;  2ZDI C;  4QJF B;  2WLI A;  1PKX A;  1M56 C;  3OE7 G;  2GHY A;  5LHI A;  2EZO A;  5LHH A;  2P90 A;  2EIK B;  3D3I A;  3QO5 A;  1Q82 W;  1KQS U;  1ORQ C;  1KD1 W;  2B5U A;  1QR8 A;  3K04 A;  3OGC C;  3X2Q C;  3UM7 A;  4R6Z A;  4FK5 C;  1SRY A;  3JD4 A;  4PA4 A;  2IJK A;  1RPR A;  3ZIA G;  1Q7Y W;  3CYO A;  1ROP A;  3EHB B;  1SES A;  3JD2 A;  1YTF D;  4PA6 A;  3CP1 A;  3CD6 V;  1K9M W;  1M57 C;  1K73 W;  4XBF A;  3IGA C;  4YXW G;  5CBH A;  3E89 A;  1GM7 A;  1W2B U;  3FYI B;  3W7T A;  2JDI G;  1SER A;  4KP4 A;  4RAI A;  1RPO A;  3CCQ V;  2P6J A;  4LC1 A;  1LNQ A;  4PA3 A;  4P9O A;  4MTG A;  1OCZ B;  4MW8 A;  1PNM A;  3RBZ A;  3TK1 A;  2OCC B;  3E83 A;  1BMF G;  1OCC B;  4UV9 A;  2YEV A;  1NVP B;  1GKF A;  3E2E A;  3AG1 B;  1NBM G;  3OR7 C;  2Q6A A;  3AG3 C;  2LFS A;  3BY6 A;  1G8M A;  1W0K G;  3JCZ A;  4FPP A;  3SYC A;  5KUM A;  3SJQ C;  2GSM B;  5B1B C;  4MVQ A;  2H8P C;  2JIZ G;  1VQP V;  1M56 B;  2DWD C;  4XDK A;  1BHA A;  1CP9 A;  1VQ4 V;  4MS2 A;  5H6R A;  1KP3 A;  2JK5 C;  2WSS G;  3LSS A;  3ZMV A;  5C93 A;  2IJJ A;  4BAY A;  4RO2 A;  4BW5 A;  1NH2 B;  1R3L C;  2DYS B;  3IC7 A;  3ZCC A;  4QIW F;  4ASU G;  2XAJ A;  3FB8 C;  4JAU A;  4PDM A;  2IU3 A;  4J9Z B;  4DO2 A;  2WLH A;  1AJP A;  2BOB C;  3WFV A;  5IDJ A;  1GM9 A;  3EFF K;  5CBG A;  3W7S A;  3P32 A;  1AI5 A;  3CCJ V;  1E79 G;  4HYO A;  1Q86 W;  1AJN A;  1MSW D;  2BOC C;  2P7T C;  1YSC A;  3AEI A;  4GX5 A;  2M7W A;  5HFL A;  3SPI A;  1R73 A;  3ZRW A;  1DTO A;  3A0R A;  4RQF A;  4JTC B;  3T4Z A;  3HPL C;  5EC1 C;  5LGU A;  2YEV B;  3E35 A;  2IJH A;  5L3B A;  2ZXW C;  2A0L A;  1VQO V;  3K0D A;  3E8B A;  4HZ3 A;  4WFG A;  3MHS C;  1OCC C;  3ABM B;  3AG4 C;  2EIJ B;  4GCZ A;  2HFE C;  3AG3 B;  3ABK C;  4MT8 A;  1OCZ C;  3K0G A;  2OTJ V;  2ZQM A;  1VQ8 V;  3HB3 B;  3OMA B;  4BIZ A;  3CCS V;  4MSW C;  3ZRW B;  4HAM A;  4UUJ C;  5KA6 A;  2JEU A;  1F4M A;  2XOK G;  2FTK A;  5EC2 C;  5L3C A;  3OAA G;  4JTA B;  4JPR A;  3FB7 C;  1GTO A;  4TWK A;  4QPJ A;  1H38 A;  4JAS A;  1OZ0 A;  3VBB A;  3RVZ A;  5IYB O;  3H01 A;  1VQ5 V;  4KUM A;  4N21 A;  2DQ0 A;  1K3E A;  4X8A A;  1R6N A;  1QR9 A;  3ZMZ A;  2DQ3 A;  4H37 A;  3T2M A;  3E8G A;  1GMG A;  1W0J G;  2ZR3 A;  3SYA A;  1QLN A;  1JOY A;  4R8C A;  2EIK C;  3CC2 V;  3WG7 C;  1BL8 A;  4MTX A;  3M99 B;  1Q81 W;  1JJ2 U;  3ABU A;  1F51 A;  2B1I A;  4FJC C;  1H2G A;  2NNU A;  2DW4 A;  2QTO A;  4XDJ A;  3ZN1 A;  1UJW B;  3GB7 C;  4TSF G;  5EBM C;  3JD0 A;  2XAQ A;  4JAV A;  1K5S A;  3DGE A;  5GW7 A;  2JEX A;  1JX9 A;  4MVS A;  2Z5U A;  3CCU V;  3FYE B;  1S72 V;  4G27 B;  4UVB A;  4RQE A;  5H9C A;  4R7C A;  4WF9 V;  1JPX A;  1GO3 F;  2WPD G;  4P2Z A;  1NQT A;  2V1D A;  1CPY A;  2HKO A;  1MAB G;  3OEE G;  5L3F A;  3K08 A;  2QE7 G;  1MG1 A;  1S76 D;  3SPC A;  2R9R B;  2XAS A;  3RW0 A;  1SET A;  1SZT A;  5CN0 A;  2Z3Y A;  3FKS G;  5B1N A;  4MVO A;  4UV8 A;  4LP8 A;  3RVY A;  3I56 V;  4JF3 A;  1RM1 C;  5B1B B;  2HJF C;  3ETG A;  1COW G;  1I5X A;  3MHH C;  4OXS A;  1M1K W;  3F7V C;  1EFR G;  3T1C A;  4FMT A;  5B3S B;  1TUE B;  5L3D A;  2Q67 A;  3TCU A;  2B1G A;  2HVJ C;  2ZD9 A;  2EZP A;  1FXK A;  3OEH G;  4JYC A;  2W0F C;  1VQ6 V;  1FXK C;  3E86 A;  3ZMS A;  1QBZ A;  1G4Y B;  1P7B A;  3JD3 A;  5IYC O;  1YIJ V;  4JTD B;  3G4S V;  4E2L A;  1E1Q G;  3LNM B;  3LUT B;  2EIN B;  2Y69 B;  1XL4 A;  2QM7 A;  2UXN A;  3B8M A;  3QO8 A;  4RUE A;  5CMU A;  5H6Q A;  4CBC A;  4CZZ A;  3CC4 V;  1QVF U;  4KFM A;  1K8A W;  2Y69 C;  4X89 A;  3SPG A;  1NH2 D;  2V7Q G;  3R65 A;  1V55 B;  2WLN A;  2EJR A;  3ZN0 A;  1V54 C;  4ZBM A;  3W7X A;  2D3O W;  2XAF A;  4UVC A;  1JQ0 A;  2ZR2 A;  3JD1 A;  3ZRX A;  4EKW A;  2XAG A;  1THZ A;  2HG5 C;  2OTL V;  1S5H C;  4I5S A;  3OR6 C;  3CME V;  2ITC C;  2EIN C;  3E8F A;  4N23 A;  4PA9 A;  4XDL A;  4WCE V;  1YTF B;  1E1R G;  2WAM A;  3QNE A;  3OMN B;  5DM6 V;  2P67 A;  5B1O A;  3CXC U;  1PL0 A;  2ZXW B;  4PA7 A;  2EIM C;  2WLK A;  5KUK A;  1Y66 A;  2CK3 G;  1K7D A;  2A79 B;  2EIJ C;  1B6Q A;  3SPH A;  5EBW C;  2IH1 C;  2X7R B;  1K34 A;  4WFH A;  3ABM C;  3KG2 A;  1GM8 A;  2W6I G;  3JYC A;  3BEH A;  5CA3 A;  4RUF A;  1OHH G;  3K9A A;  4PDV A;  1RM1 B;  2WLL A;  1K4C C;  3OW2 U;  3CCL V;  1K4D C;  3CPW U;  4WFA V;  2UXX A;  4P9P A;  1ZWI C;  1PD3 A;  1AI7 A;  4GX1 A;  1R3I C;  2EIM B;  1YJ9 V;  2QA4 V;  3SPJ A;  1K5Q A;  1QLE B;  3D36 A;  3OFN G;  3B77 A;  2QM8 A;  3IFX A;  4G2K A;  3WG7 B;  1Y4M A;  1OCR B;  4H33 A;  3K79 A;  3T4D A;  5HFM A;  5KA5 A;  1NVP D;  3ASN B;  4DXW A;  4L87 A;  3ABL B;  3F5W C;  3LSQ A;  5LGT A;  1DLB A;  4UXN A;  1M9N A;  1JCH A;  1EBO A;  1FS0 G;  5B3S C;  4Q20 A;  1V54 B;  3G6E V;  3ZJZ A;  1YI2 V;  5J9P C;  2W6J G;  2K1E A;  4WFF A;  3ZMT A;  2F43 G;  2JJ2 G;  4WFB V;  2Y48 A;  2HLD G;  2WLJ A;  4UVA A;  2PI4 A;  1AI4 A;  5FL7 G;  1NKD A;  2X6A A;  1ENV A;  3AG4 B;  3K03 A;  1M90 W;  3CMA V;  1R6K A;  2X0L A;  3LDC A;  2NLJ C;  3ABT A;  1VQL V;  3PJS K;  3ABL C;  1P4R A;  1FXK B;  4MTO A;  1YIT V;  1H8H G;  1OCO B;  3ASN C;  4U7O A;  5B1A B;  4X88 A;  4P30 A;  1FXV A;  2EIL C;  3B8N A;  3OUS A;  1L1F A;  3CCR V;  5L3G A;  1I5Y A;  1OCR C;  1WLE A;  1NJI W;  3ASO C;  5IY5 B;  4J9Y B;  1MOF A;  4MVM A;  1QLE C;  3SYO A;  2YSU B;  1J95 A;  1KKD A;  1AJQ A;  3F7Y C;  1DF4 A;  1F23 A;  2DYR C;  4GT1 A;  1VQ7 V;  3ML0 A;  4JGS A;  3OM3 B;  1XL6 A;  3ETD A;  4MVU A;  2AHY A;  2PI5 A;  2LFR A;  1K97 A;  2QKS A;  3CC7 V;  2ITD C;  1S3J A;  2IH3 C;  3DTU B;  1K92 A;  2IJI A;  4QNH B;  3K3W A;  2WWW A;  3LDE A;  4FIP C;  2LP7 A;  1HWY A;  3CCM V;  1AR1 B;  2ZDI A;  4WFE A;  4PEL A;  1R3J C;  4GX2 A;  3UKM A;  2X6B A;  3SYQ A;  5LGN A;  1VQK V;  1S0V A;  4LCU C;  2AHZ A;  3ASO B;  5IY5 C;  2OCC C;  1KEC A;  3W7W A;  1AI6 A;  1JVM A;  2EIL B;  1K33 A;  2HVK C;  3MD0 A;  3ZMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...