3K04A

Crystal structure of cng mimicking nak mutant, nak-dtpp, na+ complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
90
structure length
90
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDTPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Potassium channel protein NaK
publication title Structural studies of ion permeation and Ca2+ blockage of a bacterial channel mimicking the cyclic nucleotide-gated channel pore.
pubmed doi rcsb
source organism Bacillus cereus
total genus 30
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3k04A00
2DYRC 4JTDB 2ITDC 2R9RB 4WFEA 3ZJZA 2HVJC 4PA6A 3K0DA 4RAIA 3ASOC 3FB5C 4WFFA 3WG7C 2WLLB 3T1CA 4P9OA 2WLMA 2JK5C 4HYOA 4H33A 1M57C 3SYOA 3KG2A 2HJFC 4GX1A 2EILC 1OCRC 4LBEC 4WFHA 2Y69C 3STZC 2WLKA 4LCUC 1JVMA 4J9ZB 2BOBC 4MVOA 3SPGA 4MVQA 2EINC 1R3JC 4X89A 3OUFA 3T4ZA 4PDRA 4XDLA 2YEVA 2P7TC 4H37A 4XDJA 3STLC 4MVUA 5B3SC 1J95A 5E1AC 4BW5A 2NLJC 2Q68A 5KUMA 4MTFA 5IY5C 4QE7A 4MVZA 4QE9A 1M56C 2AHZA 1LNQA 4G28B 2WLLA 4PA3A 3ABKC 3T4DA 1XL6A 2QTOA 3SYAA 5J9PC 4G27B 1V54C 2IH3C 2AHYA 1XL4A 3HPLC 1R3IC 3IFXA 3OR6C 4MS2A 4PA9A 2KB1A 2WLIA 3GB7C 4UUJC 3FB7C 3SYCA 2HVKC 4RO2A 4EKWA 4RUEA 3K06A 3AG1C 3E89A 4RUFA 3LUTB 4OXSA 5EBWC 2WLIB 3TETA 4P2ZA 3AG4C 1OCCC 2A0LA 2EIMC 2X6CA 3ABMC 4X8AA 4GX0A 3SPIA 1R3KC 2Q6AA 3AG3C 1BL8A 3RVYA 3ASNC 3X2QC 1OCOC 4MTOA 4MVMA 2A9HA 5EBLC 4P30A 3E83A 1QLEC 3SYQA 2ITCC 1K4CC 5CBGA 2WLHA 2WLJA 1KKDA 3R65A 3IGAC 4I9WA 3LDEA 3SYPA 3LDDA 5EK0A 5EBMC 4R50A 2BOCC 3VOUA 4PA7A 4MVSA 3AG2C 4PDMA 2HFEC 3LNMB 3BEHA 4R6ZA 2ZD9A 4X88A 4PDLA 2K1EA 5B1BC 1K4DC 3JYCA 5CBFA 1ZWIC 4GX5A 2OCCC 3OGCC 3SPHA 3F7VC 1R3LC 2Q69A 4WFGA 3F5WC 4GX2A 4PA4A 3SJQC 3K08A 4JTCB 3LDCA 2DWDC 4F4LA 4TWKA 5KUKA 1OCZC 4R8CA 2IH1C 3FB8C 2QKSA 2ZXWC 4MTGA 4P9PA 3RBZA 3RW0A 2DWEC 3FB6C 3T2MA 3RVZA 2HG5C 3TCUA 4J9YB 3UM7A 3OR7C 1V55C 2X6BA 3E8FA 4MVRA 1ORQC 4ZBMA 5CBHA 4MW3A 3UKMA 3ZRSA 4QNHB 1G4YB 2H8PC 3SPJA 3E8BA 3E86A 3E8HA 2EIKC 3EFFK 2A79B 2DYSC 4LP8A 4MW8A 5EC1C 3K04A 3PJSK 2EIJC 3SPCA 4CBCA 4JTAB 5EC2C 1P7BA 3K03A 2ATKC 3K0GA 4HZ3A 4MSWC 1S5HC 3ABLC 5BZBA 2WLNA 3E8GA 4PDVA 4XDKA 4KFMA 2W0FC 5B1AC 4DXWA 2X6AA 3OUSA 4R7CA 3F7YC 2Q67A
chains in the Genus database with same CATH superfamily
1QHTA 2ITDC 2LP7A 2ZDIA 2HLDG 2OT5A 1S5LZ 3CD6V 1Q5OA 3RFRA 4J9ZB 1BHBA 4BWAA 4X1YA 2OIEA 3OUFA 3BA9A 2GSMB 1K5SA 5DM6V 4FPPA 5JJJB 1RSOB 2ZM6B 3RYHA 2OTJV 1IX9A 3ZEDA 5LGUA 4DR2B 2FL4A 2QKCA 4LF5O 4J7KA 5B1AB 2UXNA 3CCMV 4EKWA 4LFBB 2LW1A 4RUEA 3LUTB 3A0BZ 2F1MA 1VQ5V 3HKCB 1M1KW 4XBFA 1KB9F 2N05A 4TUYB 5KAFZ 3G80A 2UXCB 1NT2B 3CYOA 5LGTA 3FYIB 4LF6O 3CCRV 2BOCC 3JCUZ 4DR7B 1IBKB 5JJEB 4DV1B 3LNMB 1Z5WA 2LQTA 5J2UB 1K4DC 3U11A 2P4VA 5ITZA 5HFLA 4GX2A 3QNEA 2YIBD 2BTQB 1VQ4V 5FNVA 5GONA 4JYBA 4DV0O 5KA6A 1IBMO 1Q6IA 3AG4B 4FLXA 1S0VA 1I5YA 3JARB 2HG5C 3K59A 2Z5UA 1V9PA 3ASNB 2F4VB 2R70A 4WFAV 1XQ8A 3OE7G 5LBQA 1FFXB 1CP9A 3VQXA 5KHGA 4DV3B 2EBOA 4UCUA 5H5NA 3N2GA 3S3XA 5F2VO 3SJCC 1SERA 4XDKA 5H6QA 4BAYA 3UO2A 1T5EA 2A06H 3B8MA 3P30A 3OMAB 4JYAO 4RAIA 5LMUO 2ZT9B 1JMKC 2MK3A 3K58A 2ZXWB 2Y4UA 4KHPB 1Q82W 3LSUA 2P6JA 3H1JH 3AK3A 2F95B 4OX9B 1NJIW 4X1YB 1YCIA 4TSFG 2DYSB 5CA3A 5J9PC 1FXVA 2A3QA 3IFXA 1EN6A 1XDCA 1VQ8V 3NXSA 4JAVA 4D7SA 1QR9A 4P2ZA 3VQYA 1D2DA 1B06A 2UUAO 3J81N 5D5PA 2IJHA 3ABTA 1R3KC 3L74H 2EILB 2WWWA 4NVPA 1WLEA 5LHIA 1GM7A 1H2MA 2GHYA 1K4CC 4AQYO 1VF6C 4DUYO 3L75H 3MDSA 1XNQB 1AR5A 2IU0A 5IY5B 2L35A 3N27A 4PA7A 3AG2C 4GKKB 1XI1A 2BSKA 4FJCC 4DV5B 1SRYA 4RQEA 2OCCC 2XNDG 4JZ2A 3CCUV 4WCEV 1EN5A 5ITZB 3UCSC 5FNVB 3BPZA 5GONB 2X0LA 2F66C 5FPOA 2P5OA 1KD1W 4LF7O 2EIKC 4FLUA 5A2QN 4DV7B 1NTKH 1NH2D 2A7WA 2UUCO 3D36C 3EXAA 4YJ2A 3OUSA 5AG2A 1SQXH 3D3QA 4JTDB 1MZEA 4PA6A 3BVOA 3BA8A 4HYOA 4UCVA 3SYOA 5J2TA 1P4RA 1DTOA 4CS2A 1YJ9V 1IBLB 4LF8B 2Y0PA 4O2AA 2JJ1G 1BSMA 3M8AA 4NTWA 5TISZ 3VQVA 1GM9A 4CS4A 3VBBA 2QTOA 3L71H 1H2SB 1R3IC 3HKBA 3SJAC 2XHBA 4WF9V 2OTLV 4OXSA 4I9QA 2VQEO 1NVPB 3O65A 1V55B 4IL6Z 1VIBA 2EULA 2Y69B 1OCOC 3MHSC 1I94O 1PL0A 5A9GA 1QLEC 3ZMVA 1NZ6A 5IE9A 4I0XA 1AI6A 1YIJV 3AEIA 4RQFA 1ZX3A 3ML0A 2IJJA 3K5OA 4KL1A 1Q86W 1AJPA 2HFEC 1GN2A 5B1BC 5KLVH 1I0HA 1Q43A 5LGNA 5C93A 4JTCB 1XREA 1CEZA 5DN6G 5BR8B 4O4IA 2LFSA 4TQDA 3B2EE 3UKMA 4JAUA 1U97A 3K04A 5B66Z 4ZIBA 5BMVB 1LUWA 4NTXA 4HZ3A 3RYIA 3E22A 2OIGA 4WFBV 2YI9A 2CGNA 1XUQA 4B7EA 5FPRA 4FLWA 1M4UA 5HFMA 3FB5C 2WLLB 4YJ2B 5L3FA 4PI2A 2GV9A 1BQZA 5IJ9A 2BOBC 5J2TB 2GBOA 2N74A 4AILC 1IXMA 1MZFA 3CRQA 4EEQA 3JD1A 4LC1A 4O2AB 1PP9H 3HR0A 3HPLC 1HNWO 4LFAB 3ABLB 4JI1O 4B3MO 1FJGO 2HVKC 4Z2WA 2ODMA 2JRIA 3AG1C 3E89A 3HKBB 1XNRB 2DQ3A 1WA8A 3HB3B 3OEHG 3TXQA 1OCCC 4GYCB 1BL8A 3ZRVA 3CS5A 3X2QC 4P30A 3UT5A 1H2NA 4LF9O 3TGUH 4N23A 2BTOA 1GAXA 1KKDA 3JD3A 2NR5A 4UCRA 2NN4A 4I0XB 3JAWB 2QWRB 4D7TA 3W7UA 1XBLA 1I7FA 3ZMSA 3VQWA 1GN4A 1Q3EA 2QTSA 4QIWF 3RWRD 3LDCA 4BR6A 4LFCO 3CEIA 1JFFA 5IWAO 4MTGA 2E5LO 4IYIA 3GWKC 1K73W 1BHAA 3D8CA 3UM7A 4JI4B 3M7MX 2Q73A 4O4IB 4KP4A 3ZHRA 4FVMA 2K9PA 2EIJC 1NI8A 2UUBO 1SS3A 1N0NA 1Y76A 5BZBA 4X66B 3ZHUA 2LGWA 5KHKA 4JI0B 3L72H 3GWOA 4ZHQA 5LP6C 3T1HB 2P90A 3A0HZ 3RYIB 3ZJZA 3E22B 3CJHA 1EZVH 3G6BA 3ZRXA 2JEUA 3T1CA 3K9AA 4FLTA 1M57C 3K5LA 4KXRA 4DV2O 2PYJA 1OCZB 4WFHA 1EBOA 1JPXA 3OT7A 1MNGA 4X89A 2F93B 2KKWA 1B3QA 2ZR2A 3WB0A 3R66A 4MTFA 1LNQA 1XL6A 3KCYA 1SQBH 1KBHA 4L87A 3OR6C 3W7SA 5LYJA 5KAIZ 4F6RA 3SYCA 2PY5A 2HHHO 3APQA 2Y0IA 2Q7GA 4CH6A 4DR3B 4TV9A 2WAMA 2Q5ZA 1ZLZA 4IT5A 2Q6AA 1RSOA 1N36B 2E76B 1M9NA 1VQ9V 4RWUA 4JPRA 5KHJA 1RPRA 4X1KA 4IGGA 4I9WA 3UT5B 3OFNG 2M7WA 3LDDA 4UVAA 4PELA 4EFEA 4R6ZA 2K1EA 3UQ8A 3CMEV 4TUYA 3G6EV 4JI5B 1XMQB 1O9HA 1ROPA 1WJZA 2DWDC 4TWKA 4B7KA 4R8CA 4GLXA 2XAGA 4X62O 1VEWA 3DGEA 3ZHTA 4JI8O 5K1PA 2AW9A 2KG7A 1VF6A 1JFFB 5IT9N 4QPJA 1FD9A 4UV8A 5L3EA 3SPJA 2W6JG 4J41A 3JD2A 1YITV 1RFYA 3ZMTA 1M93A 1QBZA 4DR5O 3A0RA 2X6AA 4O4LA 4L8JA 1WB7A 1Y76B 5LA6A 3BHPA 5E79Z 3K0DA 2FMLA 3LSSA 2HKOA 1N0JA 1GTOA 4ZHQB 1SF9A 4GX1A 3CJHB 2PGGA 5IYDO 5IDJA 1YHQV 4PDRA 3STLC 1WPXA 1VF7A 2Q9LA 3THOA 1WPBA 1JX9A 3D36A 4LR3A 1Y6XA 1IZ3A 1FXKC 1XMOB 3ZBHA 1WAZA 2Z0AA 1QQCA 2ZM6O 4UUJC 1YJNV 1FYJA 2Z3YA 1PD3A 1GKFA 2QWOB 1B6QA 3ETGA 2E74B 5LYJB 4F6RB 2ARHA 4U3FH 2EIMC 4GX0A 3I56V 1L0LH 2QDOA 4TV9B 1J5EB 2NNUA 1NVPD 4AI8A 4FZ1A 4ASUG 4DV6B 3FFQA 1CPYA 4FIPC 2UXCO 2QGNA 1XHXA 1G8MA 4X1KB 4DR6B 1IXBA 1TUBA 2JVDA 4JF3A 3CB2A 2ZD9A 5H2FZ 3H1LH 1JJOA 2QA4V 4DR7O 3JYCA 2DE0X 1VQPV 1QVFU 4DV1O 2Q8VA 5KUKA 5LMNB 3C90A 2VWKA 1AP6A 5L3BA 3ABUA 2RN9A 2ZE8A 1Q7YW 4BW9A 2KG7B 2LO1A 4I55A 1W2BU 2F4VO 5EC1C 4J10A 1RP3B 4JI3B 3AG2B 1FXHA 2R9IA 2VRZA 4PDVA 3DC6A 1A32A 1N34O 4JI2B 4I4TA 2ZE6A 2OCCB 5EIBC 3ASOC 3I55V 4WFFA 1Y66A 1I5XA 3OW2U 3JD0A 4O4LB 3CXCU 2D3OW 5LA6B 1WN7A 3U0ZA 4AHCA 4JI6B 4K0KB 1BMFG 3SPGA 1YEWA 2X7RB 2YUAA 4U7NA 1SQFA 1AI7A 3ICXA 4KHPO 3RN4A 3QTCA 3T1YB 2EIKB 3RT3C 4LWSA 4JGSA 4LF6B 3T4DA 2JGDB 1KYOF 5D5QA 4FM2A 1WP8A 2YI8A 4ZOLA 1V54C 4MS2A 2KB1A 4YXWG 3CCSV 1JOYA 4DW0A 1WP7A 4X20B 2BE3A 4LF4B 2RNBA 1IBMB 3B8NA 3AG3C 3ZHSA 3RYCA 1YTFB 4DV4O 4CH3A 4YIPA 1BGYH 2QR4A 4DK1A 3LDEA 4FZ0A 1PM9A 4JV5O 3FX7A 3ETDA 4U7OA 1XNQO 1SC5B 2MW2B 3QF7A 4PDLA 5CBFA 1ZWIC 2DJVA 2Q69A 1TUBB 4DV5O 4DR1B 3JAKA 5LMUB 5C8YA 4DK0A 3ZN1A 3RGBA 2IH1C 1TUEB 3RW0A 2DWEC 5KMGA 4J9YB 3OR7C 1HNZB 1ORQC 2PYLA 1QLEB 3RYFA 4B3SB 4QPKA 3CRMA 1Q90D 2E3CA 4I50A 4D6TH 1DK1A 4I55B 3K03A 2G38A 4DV7O 2XT9A 2DYRC 1R6NA 2R9RB 2OYQA 4YHHB 1JJ2U 4LH7A 1GMGA 4I4TB 1URFA 2CAZC 4N21A 4NXMO 2HR3A 1YI2V 4O2BB 2UUAB 5BMVA 1H8EG 1M5IA 2L6LA 2PF4E 4DUYB 4QE9A 1XOUA 3OMNB 1M56C 2Q7EA 2AHZA 2WLLA 2ADQB 1KP2A 3H1IH 4PD4F 3K57A 1TGOA 2GTSA 5LP6A 2AZ2A 4LWSB 4YIOA 1E79G 3ZHVA 4H13B 4ZOLB 4PV1B 4DR4B 1JCHA 3P3NA 3CC2V 3RVYA 1AB3A 4MVMA 4MTOA 2ADPA 1K9MW 1VP7A 3QO7A 4J11A 2ZIMA 3K5MA 1R1BA 3RYCB 2XTAA 2LFRA 3SYPA 1F4MA 4J80A 3H01A 1MSDA 1D5NA 2BCCH 2YSUB 4FLZA 3JD4A 3EVKA 2DN9A 2UXDO 2Y4TA 2H94A 2RQ6A 1NS1A 3SPHA 1K92A 4HAMA 2YIDA 3K08A 3AG1B 4NB5A 2Q0AA 1OCCB 4A5UB 4FFBA 3JAKB 3A2FA 2IW5A 5C8YB 1NTMH 3JAWA 2H3OA 3X2QB 4J7JA 3KZIZ 2YIAA 2H8PC 5BR8O 5KMGB 1Y67A 2QM4A 3RYFB 4CH5A 2LGQA 3JATB 2DQ0A 1BS3A 4I50B 3CC7V 1PKXA 2V1DA 4WBNA 2HVJC 3DXRA 4ICGA 4DUZB 4OGQB 2B1IA 3LSQA 1SZTA 2B9ZA 2HJFC 1OCRC 3I5DA 1JVMA 3CHXA 3CCQV 2PUSA 1SKVA 4UV9A 3T4ZA 1B04A 4XDLA 4XDJA 4MVUA 2NLJC 1PV0A 1AVMA 1Q8IA 4G27B 2FKXA 1NBMG 4K8XA 5H9CA 3ZCCA 2WLIA 1EZJA 2CTRA 1NR7A 5LP6B 4LFAO 1PNKA 5JCOC 4NKGB 3GVMA 2D2CB 1K5QA 1M57B 4FMTA 1XNRO 2FTKA 1QNMA 3O9OA 5IYBO 2P22C 1R6KA 5BY1A 2CE4A 4X64B 4Z1VA 2YXLA 3OTOB 1FXKA 1YZBA 2JJ2G 3CWBH 3CP1A 1AI5A 4X88A 1VMGA 3M99B 2XAFA 3F7VC 2VWJA 3D3IA 5B1OA 4YY3O 1GM8A 4OPHA 2QKSA 3JCZA 3BCCH 3TCUA 1V55C 2W6IG 1L1FA 4FFBB 2GTAA 4GT1A 3E35A 1FAFA 5EZYA 4JI4O 4LP8A 3SGIA 1HNXO 1NR1A 2DMXA 5IJ0A 3CX5F 2QM8A 1DF4A 1Z2GA 3OGIB 3K0GA 4MSWC 3DSQA 3E8GA 2QWQB 5CA1A 1HNWB 2ZE7A 4B3MB 4R7CA 1SESA 1SZXA 2XUMA 5FLXN 1SA0A 4X66O 4JI0O 1AI4A 3T1HO 4H33A 4WBNB 3DXRB 4NTYA 3BABA 2UXBO 2EINC 1N33B 1N32B 4JI7B 4B3TO 1DGSA 4B3RB 2PZSA 2JEXA 2GUZA 4BW5A 1S77D 1SQGA 1NTZH 3ABKC 1FKAO 2PTMA 3L9DA 3MAQA 2UU9B 4UVCA 3SYAA 2XASA 2IH3C 2AHYA 2CTQA 3C3TA 3CCEV 5KA5A 3CMAV 1BT8A 2RCVA 2Q0OC 3IJ4A 4RUFA 2YC0A 2WLIB 1VQNV 4GZRB 4NXNB 2PI5A 2E5LB 5KHHA 2A9HA 5EBLC 2IBZH 1HP8A 4ZKIA 5CBGA 3JSLA 1N36O 1K7DA 2WLHA 3E2EA 1YTFD 2WLJA 1MMMA 1GRJA 4O4JA 4DRXA 4PJ0Z 1PL4A 1AROP 1O9GA 4E4EA 1VQ7V 2CK3G 3TJTA 1PNMA 1FXKB 3ZHQA 3B77A 1NKDA 1S76D 1JA8A 1KU9A 3ETEA 4U3JA 3G71V 2LW7A 3RBZA 4JI5O 1SQPH 2EIMB 3RVZA 3N2KA 4Q20A 3FYEB 4ZBMA 1HWYA 1S5JA 3FD9A 4G2KA 5BXZA 4GKJO 1XEQA 4IYHA 2JGUA 3SR2C 4FM0A 4JTAB 1H2KA 1ZAUA 5EZYB 1RM1C 3G67A 3AG7A 1YVWA 3J80N 3B09A 1FS0G 2W0FC 5IJ0B 2W0XA 4UCTA 4WFEA 3IC9A 2UXXA 5CA1B 1QVGU 1KECA 4P9OA 1MSWD 2EX3A 3DTUB 1Q6UA 1G1XB 1SA0B 1VQOV 2JS3A 4FFKA 2EJRA 5B3SC 5E1AC 3CCLV 2IJIA 4PA3A 4JZGA 2GUZB 1OV9A 1TA8A 4PA9A 4X65B 1XMOO 5LOVB 5IYZA 3ASOB 2CGOA 1XILA 3OMIB 3C3SA 4X8AA 1F7YA 2VQFB 2AXTZ 4JI8B 2JGDA 5DEDA 1KP3A 3E83A 4EB6A 3HKDA 4I7ZB 1MA1A 1J5EO 5EK0A 4X20A 1EM1A 1HR0B 1ZL8A 4DV6O 2ZIOA 4DR2O 4O4JB 4DRXB 3BEHA 4GUNA 2V7QG 4DR5B 1V54B 3IAYA 2E75B 4LFBO 1L0NH 3F5WC 2JS5A 1YF2A 2XOKG 4BIOA 4Q6GA 2CTPA 3K9SA 3FB6C 1W0JG 3AG3B 4U3JB 3JALA 1N8RW 5LMNO 3N2KB 3E8HA 2A79B 4MW8A 1K97A 3SPCA 4DO2A 2ZINA 1IBKO 1P7BA 2QWPB 2ZNJA 1BCCH 2HJDA 4J42A 4JI3O 1YJWV 3WG7C 4JI2O 2RMKB 2RDCA 2FB5A 4LBEC 3JSNA 2OCHA 3ZRWA 3STZC 1JQ0A 1UFIA 4MVOA 4H44B 2Q7HA 5CA0A 2QEXV 4W4KA 3FAVA 4JI6O 2YEVA 2O57A 2P7TC 4H37A 4K0KO 1J95A 4DW1A 4MVZA 4DV3O 4LF5B 3CXHF 1SQVH 5EYPA 4O2BA 2N04A 3K3WA 3T1YO 1D5AA 1OZ0A 4Z1MG 1K34A 3H1KH 2DYRB 1FFTB 1Y74A 2LJ2A 5EBWC 2YDEA 3ABMC 3SPIA 2HEPA 1YSCA 5KX5A 5IYZB 1OJHA 1LR1A 4LF4O 3ZMZA 2ITCC 3BAAA 4OX9O 1UPGA 3NR7A 3IGAC 4EB6B 3HKDB 2CH7A 3CC4V 4R50A 1M56B 4PDMA 3CE2A 4TV8A 2IM9A 1ZSPA 1N34B 2ZKOA 4DV0B 1ZL8B 5JCOA 1R3LC 4LNUA 1AR4A 1AR1B 3FB8C 4DR1O 2CDYA 3E8FA 3DC5A 2ZNIA 2YXHA 5GTHZ 3JALB 1AP5A 1HNZO 1DLBA 4CBCA 1QU7A 1NU1H 3CCJV 2QSAA 5EC2C 3OM3B 4B3SO 4GKKO 5LHHA 3OTFA 1S5HC 4JYAB 2WLNA 5GW7A 5B1AC 2OWOA 3F7YC 2FYUH 2Y48A 3BRCA 3QG5A 5B1NA 3WU2Z 1AJNA 3RYHB 1OCOB 4YHHO 4CC6A 2WLKA 4MT8A 5JQGA 4DV4B 3JATA 1EN4A 3ZRWB 5CA0B 3BFRA 4QE7A 5LXTA 2ZE5A 4G28B 3FAVB 4JV5B 2YEVB 5B1BB 5LL6Y 3PN1A 3APOA 1XL4A 2KQXA 5EYPB 2WSSG 3ZN0A 3AK2A 5CB4A 3AG4C 1EFRG 2JDIG 1Y74B 1MOFA 4AQYB 2ZCEA 1OCRB 1P49A 3ASNC 1Q81W 2R72A 3LNNA 4CZZA 1IBLO 4LF8O 5KX5B 4DR4O 3R65A 2YIBA 4JASA 1S72V 3ZS8C 2VS0A 1YXBA 3S3WA 2EZPA 3CCVV 5JWPA 3CSXA 2CH7B 4X1IA 2ILMA 2P06A 3OGCC 4WFGA 4TV8B 4PA4A 3SJQC 1BQ0A 3H1HH 3N2GB 4NXMB 3JAMN 2ZDIC 4IHJA 4O4HA 2DOSA 2ZXWC 4LF7B 3T2MA 4LNUB 4UCOA 3U10A 1S3JA 2P67A 2ZQMA 3ZRSA 4QNHB 1TAEA 4F6EA 3KCXA 3E8BA 4UB6Z 2M6YA 3E86A 2B1GA 2DYSC 1PPJH 3W7WA 2UUCB 3PJSK 2WA4A 1LUVA 1M90W 2P4KA 3ZIAG 4UB8Z 1ENVA 4KFMA 1MG1A 1VQMV 5L3DA 4GCZA 4NR1A 1KQSU 3KG2A 1SETA 2EILC 4DUZO 2Q4PA 4JYCA 4MVQA 2IJKA 2B5UA 5JQGB 1MABG 5KUMA 2Q68A 5IY5C 4TQFA 3QVNA 4EFBA 1VQKV 3L73H 1ZTEA 4C7UA 2WA3A 1H38A 5LXTB 1OHHG 2UXDB 4K3AA 1N4CA 3FB7C 2VQEB 2YICA 2F23A 4LH6A 1I94B 4K35A 4CS3A 2A0LA 2BSKB 2XAHA 4TT3G 3CRRA 5EIBD 1CXZB 1U96A 4CH4A 5CB4B 3UO3A 3P32A 2EINB 1AILA 1GN6A 4FLYA 1WB8A 2EIJB 4BIZA 1VF5B 1I08A 3IC7A 4X64O 5JJNB 5KHIA 3ABKB 3JASA 4IIJA 4UXNA 3TK1A 3OTOO 1GN3A 4X1IB 4F4LA 3K5NA 3AK1A 4B08A 5DECA 5L3GA 2JIZG 2X6BA 2C2AA 5LHGA 4IHJB 4O4HB 4MW3A 1G4YB 5CMUA 1K33A 2CTWA 1COWG 1E1QG 2DW4A 1US6A 1GH6A 5JH7A 4PHZA 1F4NA 2QE7G 3ETQA 1H8HG 3Q4HA 1VQLV 4DXWA 1GO3F 1R73A 3KKYA 1P84F 3OEEG 3W7TA 1Z5VA 4NYKA 3CRAA 1K8AW 2Y69C 1X59A 4X9QA 2YXYA 1AJQA 1R3JC 2IU3A 3OAAG 5CN0A 5FL7G 4ZI7A 3HKEA 1N33O 1N32O 4CC5A 3K79A 4FLVA 4JI7O 1Y4MA 4QJFB 4B3RO 5H6RA 4JI1B 3SJBC 1GK9A 2ZR3A 3FKSG 1FJGB 3L70H 1TVKA 3WB1A 3A8TA 3P3PA 1RM1B 3F5TA 1SQQH 2ETNA 2UU9O 4HBNA 1HDJA 2QKAA 4YY3B 1VQ6V 4LF9B 3B4SA 2XAQA 4NXNO 1JR9A 3B40A 3BY6A 1IURA 5B3SB 1HNXB 5LOVA 5JVDA 4MVSA 4MTXA 3W7XA 4HNAA 4FK5C 4JAAA 2AGAA 4LFCB 1H2LA 5IWAB 2YS8A 3JASB 4IIJB 3ZMUA 4W4LA 1X4TA 4DR3O 1H2GA 2WPDG 4DYLA 2UXBB 1UJWB 4MVRA 2QM7A 5K1XA 1BZKA 1K3EA 4YJ3A 4B3TB 1NH2B 2UUBB 4UCSA 1HW7A 5IJ9B 2ATKC 4E2LA 1IVSA 2V4DA 3ABLC 3EHBB 4K8ZA 5JH7B 2EJ7A 2AZ0A 4DV2B 2KSDA 1XMQO 2HP8A 3Q4HB 4I5SA 2WLMA 2JK5C 3ZX6A 1KC8W 1KKCA 1IDSA 2R9AA 1DF5A 4LCUC 3OD4A 3QO5A 4KUMA 1XHZA 1FPOA 4FM1A 4BIUA 3WFVA 1WA8B 1KUQA 4UFZA 1P7GA 1VARA 1BE3H 4ZI7B 1NQTA 3HKEB 2HHHB 2PI4A 3MD0A 1ZUQA 3GB7C 3MHHC 3CPWU 1TVKB 4RO2A 3WB2A 3K06A 5GTIZ 1THZA 2GDSA 1R6TA 3HKCA 3TETA 4OPAA 3WG7B 1E1RG 4X65O 2XAJA 2X6CA 3QO8A 4JYYA 1F23A 1WNSA 2RJZA 3SYQA 4UVBA 2VQFO 3J7AU 4H0LB 4GKJB 3H9VA 5J2UA 2CUGA 5EBMC 3VOUA 4PI0A 4QGPA 1PNLA 5JVDB 2BTQA 3G4SV 1QCEA 4GX5A 1HR0O 1W0KG 2EZOA 4X62B 4HNAB 1G6UA 1KMIZ 3JARA 4J7ZA 4TOIA 5L3CA 1OCZC 1F51A 1L8DA 4P9PA 5B5EZ 1FFXA 3ABMB 5CBHA 2QWNB 5IYCO 1Q6HA 1QR8A 3EFFK 3SDLA 2F43G 3CRCA 4YJ3B 1QLNA 1RPOA 4DR6O 3TXSA 4ABMA 2QJ1A 1YDXA 1W59A 2Q67A
chains in the Genus database with same CATH topology
2ITDC 3ZJZA 2HVJC 2LP7A 5B1NA 2ZDIA 2HLDG 3ZRXA 1AJNA 2JEUA 2B1IA 3T1CA 3K9AA 2OT5A 3LSQA 1M57C 1OCOB 1SZTA 2HJFC 1OCRC 1OCZB 4WFHA 3CD6V 1EBOA 1JPXA 2WLKA 1JVMA 4J9ZB 4MT8A 3CCQV 1BHBA 4UV9A 4X89A 3OUFA 3T4ZA 2GSMB 4XDLA 3ZRWB 4XDJA 2ZR2A 1K5SA 4MVUA 5DM6V 2NLJC 4FPPA 4MTFA 4QE7A 1LNQA 4G28B 1XL6A 2YEVB 5B1BB 2OTJV 5LGUA 4L87A 4G27B 1NBMG 1XL4A 3OR6C 3W7SA 5H9CA 3ZCCA 2WLIA 3SYCA 1EZJA 1NR7A 2UXNA 5B1AB 2WSSG 3CCMV 4EKWA 4RUEA 3ZN0A 1PNKA 3LUTB 3AG4C 1EFRG 2JDIG 2WAMA 1K5QA 1M57B 4FMTA 1MOFA 2Q6AA 1VQ5V 1OCRB 2FTKA 3ASNC 4XBFA 5IYBO 1Q81W 1M9NA 1M1KW 1VQ9V 4JPRA 1R6KA 4CZZA 1RPRA 3R65A 3CYOA 4I9WA 3OFNG 2M7WA 3LDDA 3FYIB 4JASA 5LGTA 1S72V 3CCRV 1FXKA 2BOCC 4UVAA 2JJ2G 2EZPA 4PELA 3CCVV 3CP1A 3LNMB 4R6ZA 1AI5A 4X88A 2K1EA 1K4DC 3OGCC 3M99B 3CMEV 2XAFA 3F7VC 4WFGA 5HFLA 4GX2A 3QNEA 3G6EV 4PA4A 3SJQC 3D3IA 1VQ4V 1ROPA 2DWDC 4TWKA 4JYBA 5B1OA 5KA6A 1GM8A 4R8CA 2ZDIC 2XAGA 3AG4B 2QKSA 2ZXWC 3JCZA 1S0VA 1I5YA 3DGEA 3T2MA 3TCUA 2HG5C 2Z5UA 1V55C 2W6IG 3ASNB 1S3JA 4WFAV 2P67A 2ZQMA 3OE7G 4QPJA 4UV8A 3ZRSA 4QNHB 5L3EA 1L1FA 5LBQA 3SPJA 4GT1A 3E35A 3E8BA 1CP9A 2W6JG 3E86A 2B1GA 2DYSC 3JD2A 4LP8A 3W7WA 1YITV 1NR1A 3PJSK 2EBOA 1M90W 3ZMTA 2QM8A 1DF4A 3K0GA 4MSWC 1SERA 3E8GA 3ZIAG 1ENVA 4XDKA 4KFMA 1QBZA 5H6QA 4BAYA 3A0RA 2X6AA 1MG1A 4R7CA 1VQMV 3B8MA 3P30A 1SESA 5L3DA 3OMAB 4GCZA 3K0DA 4RAIA 1AI4A 3LSSA 2HKOA 1GTOA 1KQSU 4H33A 3KG2A 2MK3A 1SETA 2EILC 4GX1A 2ZXWB 4JYCA 5IYDO 1Q82W 5IDJA 4MVQA 1YHQV 2EINC 2P6JA 2IJKA 4PDRA 2B5UA 3STLC 1WPXA 1MABG 2JEXA 4BW5A 1NJIW 5KUMA 2Q68A 5IY5C 4TSFG 2DYSB 1S77D 1JX9A 3D36A 3ABKC 1VQKV 5CA3A 4UVCA 3SYAA 5J9PC 2XASA 1FXKC 1FXVA 1OHHG 2AHYA 2IH3C 3IFXA 1H38A 3CCEV 1VQ8V 4UUJC 5KA5A 3CMAV 3NXSA 2Z3YA 3FB7C 1YJNV 1PD3A 1GKFA 1B6QA 3ETGA 4RUFA 4JAVA 2WLIB 1QR9A 4P2ZA 1VQNV 2A0LA 2EIMC 2IJHA 3ABTA 4GX0A 2XAHA 1R3KC 2PI5A 4TT3G 2EILB 2WWWA 3I56V 2A9HA 5EBLC 1WLEA 5LHIA 1GM7A 3P32A 2NNUA 1NVPD 4ZKIA 2GHYA 1K4CC 2EINB 5CBGA 1K7DA 2WLHA 2EIJB 3E2EA 4ASUG 2WLJA 1YTFD 4BIZA 1CPYA 2IU0A 5IY5B 4FIPC 3IC7A 4PA7A 3AG2C 1G8MA 3ABKB 1AROP 1VQ7V 4FJCC 1SRYA 4JF3A 2CK3G 4UXNA 3TK1A 2ZD9A 1PNMA 1FXKB 2QA4V 3JYCA 4RQEA 2OCCC 1VQPV 3B77A 1QVFU 2XNDG 3CCUV 1NKDA 1S76D 4F4LA 3ETEA 3G71V 5KUKA 4WCEV 3RBZA 5L3GA 2EIMB 3RVZA 2JIZG 2X0LA 2X6BA 4Q20A 3FYEB 2C2AA 5LHGA 4ZBMA 1KD1W 4MW3A 5L3BA 1HWYA 3ABUA 1G4YB 5CMUA 1Q7YW 1K33A 2EIKC 1W2BU 1COWG 4G2KA 1E1QG 2DW4A 5EC1C 4JTAB 1F4NA 2QE7G 1NH2D 1RM1C 3AG2B 1FXHA 1H8HG 2R9IA 4PDVA 1FS0G 2W0FC 1VQLV 4DXWA 3OUSA 1GO3F 4JTDB 1R73A 4WFEA 2OCCB 4PA6A 2UXXA 3ASOC 3OEEG 4WFFA 1Y66A 3W7TA 1I5XA 1KECA 3I55V 4P9OA 3OW2U 1QVGU 3JD0A 1MSWD 4HYOA 3CXCU 3DTUB 3SYOA 2D3OW 1K8AW 1P4RA 2Y69C 1VQOV 1DTOA 1YJ9V 1BMFG 3SPGA 1AJQA 1R3JC 2X7RB 4U7NA 2IU3A 3OAAG 5CN0A 5FL7G 1AI7A 2EJRA 2JJ1G 5B3SC 5E1AC 3CCLV 2EIKB 3K79A 1GM9A 2IJIA 4JGSA 1Y4MA 4PA3A 4QJFB 5H6RA 3T4DA 3VBBA 1GK9A 2ZR3A 3FKSG 2QTOA 1RM1B 1V54C 1R3IC 4MS2A 4PA9A 2KB1A 4YXWG 3CCSV 4WF9V 2OTLV 1JOYA 4OXSA 3ASOB 1NVPB 1V55B 3OMIB 1VQ6V 4X8AA 3B8NA 3AG3C 1YTFB 2XAQA 2Y69B 1OCOC 3MHSC 1KP3A 1PL0A 3E83A 2Q67A 1QLEC 3ZMVA 3BY6A 1YIJV 1AI6A 3AEIA 4RQFA 3LDEA 5B3SB 5EK0A 3ML0A 2IJJA 1Q86W 4MVSA 3ETDA 4MTXA 3W7XA 4U7OA 1AJPA 2HFEC 4FK5C 3BEHA 2V7QG 5B1BC 4PDLA 1V54B 5CBFA 1ZWIC 2Q69A 3F5WC 5LGNA 3ZMUA 5C93A 2XOKG 4JTCB 1H2GA 3ZN1A 1CEZA 2WPDG 2IH1C 5DN6G 1TUEB 3RW0A 2DWEC 3FB6C 1W0JG 2LFSA 4J9YB 3AG3B 3OR7C 1UJWB 4MVRA 1N8RW 1ORQC 2QM7A 3UKMA 1K3EA 1QLEB 4JAUA 1NH2B 3E8HA 4QPKA 2A79B 4MW8A 1K97A 3K04A 3SPCA 4DO2A 1P7BA 3K03A 2ATKC 4HZ3A 4E2LA 3ABLC 3EHBB 4WFBV 2DYRC 1R6NA 2R9RB 5HFMA 1JJ2U 1YJWV 3FB5C 1GMGA 2WLLB 4I5SA 3WG7C 2WLMA 2JK5C 4N21A 2HR3A 1YI2V 5L3FA 1KC8W 4LBEC 3ZRWA 3STZC 1DF5A 1JQ0A 4LCUC 4MVOA 1H8EG 2BOBC 3QO5A 2QEXV 4KUMA 4BIUA 2YEVA 2P7TC 4H37A 3WFVA 1J95A 1IXMA 4QE9A 4MVZA 3OMNB 1M56C 2AHZA 3JD1A 2WLLA 4LC1A 1NQTA 1KP2A 2PI4A 3K3WA 3HPLC 1OZ0A 3ABLB 3MD0A 4Z1MG 1E79G 3GB7C 3MHHC 3CPWU 2HVKC 1K34A 4RO2A 2DYRB 3K06A 1FFTB 3AG1C 1THZA 3E89A 5EBWC 3TETA 2DQ3A 3WG7B 3HB3B 3OEHG 1E1RG 1OCCC 2XAJA 2X6CA 3ABMC 3QO8A 3SPIA 1YSCA 1JCHA 1F23A 1BL8A 3ZRVA 3CC2V 3RVYA 3X2QC 4MVMA 4MTOA 3ZMZA 4P30A 1K9MW 3QO7A 3SYQA 2ITCC 4UVBA 4N23A 1KKDA 3JD3A 2LFRA 3IGAC 3SYPA 1F4MA 3H01A 3CC4V 5EBMC 4R50A 1M56B 3VOUA 2YSUB 4PDMA 3W7UA 3JD4A 1PNLA 2H94A 3G4SV 1QCEA 4GX5A 3SPHA 3ZMSA 1W0KG 2EZOA 1R3LC 1K92A 4HAMA 4QIWF 3K08A 3LDCA 3AG1B 5L3CA 1AR1B 1OCZC 1F51A 3FB8C 4P9PA 4MTGA 1OCCB 3ABMB 1K73W 1BHAA 2IW5A 3UM7A 3E8FA 3X2QB 5CBHA 2H8PC 5IYCO 1QR8A 3EFFK 4KP4A 2F43G 2EIJC 1DLBA 4CBCA 3CCJV 5EC2C 1QLNA 3OM3B 1RPOA 5LHHA 1S5HC 5BZBA 2DQ0A 2WLNA 5GW7A 3CC7V 1PKXA 2V1DA 5B1AC 3GWOA 3F7YC 2Y48A 2P90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYR C;  4JTD B;  2ITD C;  2R9R B;  4WFE A;  3ZJZ A;  2HVJ C;  4PA6 A;  3K0D A;  4RAI A;  3ASO C;  3FB5 C;  4WFF A;  3WG7 C;  2WLL B;  3T1C A;  4P9O A;  2WLM A;  2JK5 C;  4HYO A;  4H33 A;  1M57 C;  3SYO A;  3KG2 A;  2HJF C;  4GX1 A;  2EIL C;  1OCR C;  4LBE C;  4WFH A;  2Y69 C;  3STZ C;  2WLK A;  4LCU C;  1JVM A;  4J9Z B;  2BOB C;  4MVO A;  3SPG A;  4MVQ A;  2EIN C;  1R3J C;  4X89 A;  3OUF A;  3T4Z A;  4PDR A;  4XDL A;  2YEV A;  2P7T C;  4H37 A;  4XDJ A;  3STL C;  4MVU A;  5B3S C;  1J95 A;  5E1A C;  4BW5 A;  2NLJ C;  2Q68 A;  5KUM A;  4MTF A;  5IY5 C;  4QE7 A;  4MVZ A;  4QE9 A;  1M56 C;  2AHZ A;  1LNQ A;  4G28 B;  2WLL A;  4PA3 A;  3ABK C;  3T4D A;  1XL6 A;  2QTO A;  3SYA A;  5J9P C;  4G27 B;  1V54 C;  2IH3 C;  2AHY A;  1XL4 A;  3HPL C;  1R3I C;  3IFX A;  3OR6 C;  4MS2 A;  4PA9 A;  2KB1 A;  2WLI A;  3GB7 C;  4UUJ C;  3FB7 C;  3SYC A;  2HVK C;  4RO2 A;  4EKW A;  4RUE A;  3K06 A;  3AG1 C;  3E89 A;  4RUF A;  3LUT B;  4OXS A;  5EBW C;  2WLI B;  3TET A;  4P2Z A;  3AG4 C;  1OCC C;  2A0L A;  2EIM C;  2X6C A;  3ABM C;  4X8A A;  4GX0 A;  3SPI A;  1R3K C;  2Q6A A;  3AG3 C;  1BL8 A;  3RVY A;  3ASN C;  3X2Q C;  1OCO C;  4MTO A;  4MVM A;  2A9H A;  5EBL C;  4P30 A;  3E83 A;  1QLE C;  3SYQ A;  2ITC C;  1K4C C;  5CBG A;  2WLH A;  2WLJ A;  1KKD A;  3R65 A;  3IGA C;  4I9W A;  3LDE A;  3SYP A;  3LDD A;  5EK0 A;  5EBM C;  4R50 A;  2BOC C;  3VOU A;  4PA7 A;  4MVS A;  3AG2 C;  4PDM A;  2HFE C;  3LNM B;  3BEH A;  4R6Z A;  2ZD9 A;  4X88 A;  4PDL A;  2K1E A;  5B1B C;  1K4D C;  3JYC A;  5CBF A;  1ZWI C;  4GX5 A;  2OCC C;  3OGC C;  3SPH A;  3F7V C;  1R3L C;  2Q69 A;  4WFG A;  3F5W C;  4GX2 A;  4PA4 A;  3SJQ C;  3K08 A;  4JTC B;  3LDC A;  2DWD C;  4F4L A;  4TWK A;  5KUK A;  1OCZ C;  4R8C A;  2IH1 C;  3FB8 C;  2QKS A;  2ZXW C;  4MTG A;  4P9P A;  3RBZ A;  3RW0 A;  2DWE C;  3FB6 C;  3T2M A;  3RVZ A;  2HG5 C;  3TCU A;  4J9Y B;  3UM7 A;  3OR7 C;  1V55 C;  2X6B A;  3E8F A;  4MVR A;  1ORQ C;  4ZBM A;  5CBH A;  4MW3 A;  3UKM A;  3ZRS A;  4QNH B;  1G4Y B;  2H8P C;  3SPJ A;  3E8B A;  3E86 A;  3E8H A;  2EIK C;  3EFF K;  2A79 B;  2DYS C;  4LP8 A;  4MW8 A;  5EC1 C;  3K04 A;  3PJS K;  2EIJ C;  3SPC A;  4CBC A;  4JTA B;  5EC2 C;  1P7B A;  3K03 A;  2ATK C;  3K0G A;  4HZ3 A;  4MSW C;  1S5H C;  3ABL C;  5BZB A;  2WLN A;  3E8G A;  4PDV A;  4XDK A;  4KFM A;  2W0F C;  5B1A C;  4DXW A;  2X6A A;  3OUS A;  4R7C A;  3F7Y C;  2Q67 A; 
#chains in the Genus database with same CATH topology
 1QHT A;  2ITD C;  2LP7 A;  2ZDI A;  2HLD G;  2OT5 A;  1S5L Z;  3CD6 V;  1Q5O A;  3RFR A;  4J9Z B;  1BHB A;  4BWA A;  4X1Y A;  2OIE A;  3OUF A;  3BA9 A;  2GSM B;  1K5S A;  5DM6 V;  4FPP A;  5JJJ B;  1RSO B;  2ZM6 B;  3RYH A;  2OTJ V;  1IX9 A;  3ZED A;  5LGU A;  4DR2 B;  2FL4 A;  2QKC A;  4LF5 O;  4J7K A;  5B1A B;  2UXN A;  3CCM V;  4EKW A;  4LFB B;  2LW1 A;  4RUE A;  3LUT B;  3A0B Z;  2F1M A;  1VQ5 V;  3HKC B;  1M1K W;  4XBF A;  1KB9 F;  2N05 A;  4TUY B;  5KAF Z;  3G80 A;  2UXC B;  1NT2 B;  3CYO A;  5LGT A;  3FYI B;  4LF6 O;  3CCR V;  2BOC C;  3JCU Z;  4DR7 B;  1IBK B;  5JJE B;  4DV1 B;  3LNM B;  1Z5W A;  2LQT A;  5J2U B;  1K4D C;  3U11 A;  2P4V A;  5ITZ A;  5HFL A;  4GX2 A;  3QNE A;  2YIB D;  2BTQ B;  1VQ4 V;  5FNV A;  5GON A;  4JYB A;  4DV0 O;  5KA6 A;  1IBM O;  1Q6I A;  3AG4 B;  4FLX A;  1S0V A;  1I5Y A;  3JAR B;  2HG5 C;  3K59 A;  2Z5U A;  1V9P A;  3ASN B;  2F4V B;  2R70 A;  4WFA V;  1XQ8 A;  3OE7 G;  5LBQ A;  1FFX B;  1CP9 A;  3VQX A;  5KHG A;  4DV3 B;  2EBO A;  4UCU A;  5H5N A;  3N2G A;  3S3X A;  5F2V O;  3SJC C;  1SER A;  4XDK A;  5H6Q A;  4BAY A;  3UO2 A;  1T5E A;  2A06 H;  3B8M A;  3P30 A;  3OMA B;  4JYA O;  4RAI A;  5LMU O;  2ZT9 B;  1JMK C;  2MK3 A;  3K58 A;  2ZXW B;  2Y4U A;  4KHP B;  1Q82 W;  3LSU A;  2P6J A;  3H1J H;  3AK3 A;  2F95 B;  4OX9 B;  1NJI W;  4X1Y B;  1YCI A;  4TSF G;  2DYS B;  5CA3 A;  5J9P C;  1FXV A;  2A3Q A;  3IFX A;  1EN6 A;  1XDC A;  1VQ8 V;  3NXS A;  4JAV A;  4D7S A;  1QR9 A;  4P2Z A;  3VQY A;  1D2D A;  1B06 A;  2UUA O;  3J81 N;  5D5P A;  2IJH A;  3ABT A;  1R3K C;  3L74 H;  2EIL B;  2WWW A;  4NVP A;  1WLE A;  5LHI A;  1GM7 A;  1H2M A;  2GHY A;  1K4C C;  4AQY O;  1VF6 C;  4DUY O;  3L75 H;  3MDS A;  1XNQ B;  1AR5 A;  2IU0 A;  5IY5 B;  2L35 A;  3N27 A;  4PA7 A;  3AG2 C;  4GKK B;  1XI1 A;  2BSK A;  4FJC C;  4DV5 B;  1SRY A;  4RQE A;  2OCC C;  2XND G;  4JZ2 A;  3CCU V;  4WCE V;  1EN5 A;  5ITZ B;  3UCS C;  5FNV B;  3BPZ A;  5GON B;  2X0L A;  2F66 C;  5FPO A;  2P5O A;  1KD1 W;  4LF7 O;  2EIK C;  4FLU A;  5A2Q N;  4DV7 B;  1NTK H;  1NH2 D;  2A7W A;  2UUC O;  3D36 C;  3EXA A;  4YJ2 A;  3OUS A;  5AG2 A;  1SQX H;  3D3Q A;  4JTD B;  1MZE A;  4PA6 A;  3BVO A;  3BA8 A;  4HYO A;  4UCV A;  3SYO A;  5J2T A;  1P4R A;  1DTO A;  4CS2 A;  1YJ9 V;  1IBL B;  4LF8 B;  2Y0P A;  4O2A A;  2JJ1 G;  1BSM A;  3M8A A;  4NTW A;  5TIS Z;  3VQV A;  1GM9 A;  4CS4 A;  3VBB A;  2QTO A;  3L71 H;  1H2S B;  1R3I C;  3HKB A;  3SJA C;  2XHB A;  4WF9 V;  2OTL V;  4OXS A;  4I9Q A;  2VQE O;  1NVP B;  3O65 A;  1V55 B;  4IL6 Z;  1VIB A;  2EUL A;  2Y69 B;  1OCO C;  3MHS C;  1I94 O;  1PL0 A;  5A9G A;  1QLE C;  3ZMV A;  1NZ6 A;  5IE9 A;  4I0X A;  1AI6 A;  1YIJ V;  3AEI A;  4RQF A;  1ZX3 A;  3ML0 A;  2IJJ A;  3K5O A;  4KL1 A;  1Q86 W;  1AJP A;  2HFE C;  1GN2 A;  5B1B C;  5KLV H;  1I0H A;  1Q43 A;  5LGN A;  5C93 A;  4JTC B;  1XRE A;  1CEZ A;  5DN6 G;  5BR8 B;  4O4I A;  2LFS A;  4TQD A;  3B2E E;  3UKM A;  4JAU A;  1U97 A;  3K04 A;  5B66 Z;  4ZIB A;  5BMV B;  1LUW A;  4NTX A;  4HZ3 A;  3RYI A;  3E22 A;  2OIG A;  4WFB V;  2YI9 A;  2CGN A;  1XUQ A;  4B7E A;  5FPR A;  4FLW A;  1M4U A;  5HFM A;  3FB5 C;  2WLL B;  4YJ2 B;  5L3F A;  4PI2 A;  2GV9 A;  1BQZ A;  5IJ9 A;  2BOB C;  5J2T B;  2GBO A;  2N74 A;  4AIL C;  1IXM A;  1MZF A;  3CRQ A;  4EEQ A;  3JD1 A;  4LC1 A;  4O2A B;  1PP9 H;  3HR0 A;  3HPL C;  1HNW O;  4LFA B;  3ABL B;  4JI1 O;  4B3M O;  1FJG O;  2HVK C;  4Z2W A;  2ODM A;  2JRI A;  3AG1 C;  3E89 A;  3HKB B;  1XNR B;  2DQ3 A;  1WA8 A;  3HB3 B;  3OEH G;  3TXQ A;  1OCC C;  4GYC B;  1BL8 A;  3ZRV A;  3CS5 A;  3X2Q C;  4P30 A;  3UT5 A;  1H2N A;  4LF9 O;  3TGU H;  4N23 A;  2BTO A;  1GAX A;  1KKD A;  3JD3 A;  2NR5 A;  4UCR A;  2NN4 A;  4I0X B;  3JAW B;  2QWR B;  4D7T A;  3W7U A;  1XBL A;  1I7F A;  3ZMS A;  3VQW A;  1GN4 A;  1Q3E A;  2QTS A;  4QIW F;  3RWR D;  3LDC A;  4BR6 A;  4LFC O;  3CEI A;  1JFF A;  5IWA O;  4MTG A;  2E5L O;  4IYI A;  3GWK C;  1K73 W;  1BHA A;  3D8C A;  3UM7 A;  4JI4 B;  3M7M X;  2Q73 A;  4O4I B;  4KP4 A;  3ZHR A;  4FVM A;  2K9P A;  2EIJ C;  1NI8 A;  2UUB O;  1SS3 A;  1N0N A;  1Y76 A;  5BZB A;  4X66 B;  3ZHU A;  2LGW A;  5KHK A;  4JI0 B;  3L72 H;  3GWO A;  4ZHQ A;  5LP6 C;  3T1H B;  2P90 A;  3A0H Z;  3RYI B;  3ZJZ A;  3E22 B;  3CJH A;  1EZV H;  3G6B A;  3ZRX A;  2JEU A;  3T1C A;  3K9A A;  4FLT A;  1M57 C;  3K5L A;  4KXR A;  4DV2 O;  2PYJ A;  1OCZ B;  4WFH A;  1EBO A;  1JPX A;  3OT7 A;  1MNG A;  4X89 A;  2F93 B;  2KKW A;  1B3Q A;  2ZR2 A;  3WB0 A;  3R66 A;  4MTF A;  1LNQ A;  1XL6 A;  3KCY A;  1SQB H;  1KBH A;  4L87 A;  3OR6 C;  3W7S A;  5LYJ A;  5KAI Z;  4F6R A;  3SYC A;  2PY5 A;  2HHH O;  3APQ A;  2Y0I A;  2Q7G A;  4CH6 A;  4DR3 B;  4TV9 A;  2WAM A;  2Q5Z A;  1ZLZ A;  4IT5 A;  2Q6A A;  1RSO A;  1N36 B;  2E76 B;  1M9N A;  1VQ9 V;  4RWU A;  4JPR A;  5KHJ A;  1RPR A;  4X1K A;  4IGG A;  4I9W A;  3UT5 B;  3OFN G;  2M7W A;  3LDD A;  4UVA A;  4PEL A;  4EFE A;  4R6Z A;  2K1E A;  3UQ8 A;  3CME V;  4TUY A;  3G6E V;  4JI5 B;  1XMQ B;  1O9H A;  1ROP A;  1WJZ A;  2DWD C;  4TWK A;  4B7K A;  4R8C A;  4GLX A;  2XAG A;  4X62 O;  1VEW A;  3DGE A;  3ZHT A;  4JI8 O;  5K1P A;  2AW9 A;  2KG7 A;  1VF6 A;  1JFF B;  5IT9 N;  4QPJ A;  1FD9 A;  4UV8 A;  5L3E A;  3SPJ A;  2W6J G;  4J41 A;  3JD2 A;  1YIT V;  1RFY A;  3ZMT A;  1M93 A;  1QBZ A;  4DR5 O;  3A0R A;  2X6A A;  4O4L A;  4L8J A;  1WB7 A;  1Y76 B;  5LA6 A;  3BHP A;  5E79 Z;  3K0D A;  2FML A;  3LSS A;  2HKO A;  1N0J A;  1GTO A;  4ZHQ B;  1SF9 A;  4GX1 A;  3CJH B;  2PGG A;  5IYD O;  5IDJ A;  1YHQ V;  4PDR A;  3STL C;  1WPX A;  1VF7 A;  2Q9L A;  3THO A;  1WPB A;  1JX9 A;  3D36 A;  4LR3 A;  1Y6X A;  1IZ3 A;  1FXK C;  1XMO B;  3ZBH A;  1WAZ A;  2Z0A A;  1QQC A;  2ZM6 O;  4UUJ C;  1YJN V;  1FYJ A;  2Z3Y A;  1PD3 A;  1GKF A;  2QWO B;  1B6Q A;  3ETG A;  2E74 B;  5LYJ B;  4F6R B;  2ARH A;  4U3F H;  2EIM C;  4GX0 A;  3I56 V;  1L0L H;  2QDO A;  4TV9 B;  1J5E B;  2NNU A;  1NVP D;  4AI8 A;  4FZ1 A;  4ASU G;  4DV6 B;  3FFQ A;  1CPY A;  4FIP C;  2UXC O;  2QGN A;  1XHX A;  1G8M A;  4X1K B;  4DR6 B;  1IXB A;  1TUB A;  2JVD A;  4JF3 A;  3CB2 A;  2ZD9 A;  5H2F Z;  3H1L H;  1JJO A;  2QA4 V;  4DR7 O;  3JYC A;  2DE0 X;  1VQP V;  1QVF U;  4DV1 O;  2Q8V A;  5KUK A;  5LMN B;  3C90 A;  2VWK A;  1AP6 A;  5L3B A;  3ABU A;  2RN9 A;  2ZE8 A;  1Q7Y W;  4BW9 A;  2KG7 B;  2LO1 A;  4I55 A;  1W2B U;  2F4V O;  5EC1 C;  4J10 A;  1RP3 B;  4JI3 B;  3AG2 B;  1FXH A;  2R9I A;  2VRZ A;  4PDV A;  3DC6 A;  1A32 A;  1N34 O;  4JI2 B;  4I4T A;  2ZE6 A;  2OCC B;  5EIB C;  3ASO C;  3I55 V;  4WFF A;  1Y66 A;  1I5X A;  3OW2 U;  3JD0 A;  4O4L B;  3CXC U;  2D3O W;  5LA6 B;  1WN7 A;  3U0Z A;  4AHC A;  4JI6 B;  4K0K B;  1BMF G;  3SPG A;  1YEW A;  2X7R B;  2YUA A;  4U7N A;  1SQF A;  1AI7 A;  3ICX A;  4KHP O;  3RN4 A;  3QTC A;  3T1Y B;  2EIK B;  3RT3 C;  4LWS A;  4JGS A;  4LF6 B;  3T4D A;  2JGD B;  1KYO F;  5D5Q A;  4FM2 A;  1WP8 A;  2YI8 A;  4ZOL A;  1V54 C;  4MS2 A;  2KB1 A;  4YXW G;  3CCS V;  1JOY A;  4DW0 A;  1WP7 A;  4X20 B;  2BE3 A;  4LF4 B;  2RNB A;  1IBM B;  3B8N A;  3AG3 C;  3ZHS A;  3RYC A;  1YTF B;  4DV4 O;  4CH3 A;  4YIP A;  1BGY H;  2QR4 A;  4DK1 A;  3LDE A;  4FZ0 A;  1PM9 A;  4JV5 O;  3FX7 A;  3ETD A;  4U7O A;  1XNQ O;  1SC5 B;  2MW2 B;  3QF7 A;  4PDL A;  5CBF A;  1ZWI C;  2DJV A;  2Q69 A;  1TUB B;  4DV5 O;  4DR1 B;  3JAK A;  5LMU B;  5C8Y A;  4DK0 A;  3ZN1 A;  3RGB A;  2IH1 C;  1TUE B;  3RW0 A;  2DWE C;  5KMG A;  4J9Y B;  3OR7 C;  1HNZ B;  1ORQ C;  2PYL A;  1QLE B;  3RYF A;  4B3S B;  4QPK A;  3CRM A;  1Q90 D;  2E3C A;  4I50 A;  4D6T H;  1DK1 A;  4I55 B;  3K03 A;  2G38 A;  4DV7 O;  2XT9 A;  2DYR C;  1R6N A;  2R9R B;  2OYQ A;  4YHH B;  1JJ2 U;  4LH7 A;  1GMG A;  4I4T B;  1URF A;  2CAZ C;  4N21 A;  4NXM O;  2HR3 A;  1YI2 V;  4O2B B;  2UUA B;  5BMV A;  1H8E G;  1M5I A;  2L6L A;  2PF4 E;  4DUY B;  4QE9 A;  1XOU A;  3OMN B;  1M56 C;  2Q7E A;  2AHZ A;  2WLL A;  2ADQ B;  1KP2 A;  3H1I H;  4PD4 F;  3K57 A;  1TGO A;  2GTS A;  5LP6 A;  2AZ2 A;  4LWS B;  4YIO A;  1E79 G;  3ZHV A;  4H13 B;  4ZOL B;  4PV1 B;  4DR4 B;  1JCH A;  3P3N A;  3CC2 V;  3RVY A;  1AB3 A;  4MVM A;  4MTO A;  2ADP A;  1K9M W;  1VP7 A;  3QO7 A;  4J11 A;  2ZIM A;  3K5M A;  1R1B A;  3RYC B;  2XTA A;  2LFR A;  3SYP A;  1F4M A;  4J80 A;  3H01 A;  1MSD A;  1D5N A;  2BCC H;  2YSU B;  4FLZ A;  3JD4 A;  3EVK A;  2DN9 A;  2UXD O;  2Y4T A;  2H94 A;  2RQ6 A;  1NS1 A;  3SPH A;  1K92 A;  4HAM A;  2YID A;  3K08 A;  3AG1 B;  4NB5 A;  2Q0A A;  1OCC B;  4A5U B;  4FFB A;  3JAK B;  3A2F A;  2IW5 A;  5C8Y B;  1NTM H;  3JAW A;  2H3O A;  3X2Q B;  4J7J A;  3KZI Z;  2YIA A;  2H8P C;  5BR8 O;  5KMG B;  1Y67 A;  2QM4 A;  3RYF B;  4CH5 A;  2LGQ A;  3JAT B;  2DQ0 A;  1BS3 A;  4I50 B;  3CC7 V;  1PKX A;  2V1D A;  4WBN A;  2HVJ C;  3DXR A;  4ICG A;  4DUZ B;  4OGQ B;  2B1I A;  3LSQ A;  1SZT A;  2B9Z A;  2HJF C;  1OCR C;  3I5D A;  1JVM A;  3CHX A;  3CCQ V;  2PUS A;  1SKV A;  4UV9 A;  3T4Z A;  1B04 A;  4XDL A;  4XDJ A;  4MVU A;  2NLJ C;  1PV0 A;  1AVM A;  1Q8I A;  4G27 B;  2FKX A;  1NBM G;  4K8X A;  5H9C A;  3ZCC A;  2WLI A;  1EZJ A;  2CTR A;  1NR7 A;  5LP6 B;  4LFA O;  1PNK A;  5JCO C;  4NKG B;  3GVM A;  2D2C B;  1K5Q A;  1M57 B;  4FMT A;  1XNR O;  2FTK A;  1QNM A;  3O9O A;  5IYB O;  2P22 C;  1R6K A;  5BY1 A;  2CE4 A;  4X64 B;  4Z1V A;  2YXL A;  3OTO B;  1FXK A;  1YZB A;  2JJ2 G;  3CWB H;  3CP1 A;  1AI5 A;  4X88 A;  1VMG A;  3M99 B;  2XAF A;  3F7V C;  2VWJ A;  3D3I A;  5B1O A;  4YY3 O;  1GM8 A;  4OPH A;  2QKS A;  3JCZ A;  3BCC H;  3TCU A;  1V55 C;  2W6I G;  1L1F A;  4FFB B;  2GTA A;  4GT1 A;  3E35 A;  1FAF A;  5EZY A;  4JI4 O;  4LP8 A;  3SGI A;  1HNX O;  1NR1 A;  2DMX A;  5IJ0 A;  3CX5 F;  2QM8 A;  1DF4 A;  1Z2G A;  3OGI B;  3K0G A;  4MSW C;  3DSQ A;  3E8G A;  2QWQ B;  5CA1 A;  1HNW B;  2ZE7 A;  4B3M B;  4R7C A;  1SES A;  1SZX A;  2XUM A;  5FLX N;  1SA0 A;  4X66 O;  4JI0 O;  1AI4 A;  3T1H O;  4H33 A;  4WBN B;  3DXR B;  4NTY A;  3BAB A;  2UXB O;  2EIN C;  1N33 B;  1N32 B;  4JI7 B;  4B3T O;  1DGS A;  4B3R B;  2PZS A;  2JEX A;  2GUZ A;  4BW5 A;  1S77 D;  1SQG A;  1NTZ H;  3ABK C;  1FKA O;  2PTM A;  3L9D A;  3MAQ A;  2UU9 B;  4UVC A;  3SYA A;  2XAS A;  2IH3 C;  2AHY A;  2CTQ A;  3C3T A;  3CCE V;  5KA5 A;  3CMA V;  1BT8 A;  2RCV A;  2Q0O C;  3IJ4 A;  4RUF A;  2YC0 A;  2WLI B;  1VQN V;  4GZR B;  4NXN B;  2PI5 A;  2E5L B;  5KHH A;  2A9H A;  5EBL C;  2IBZ H;  1HP8 A;  4ZKI A;  5CBG A;  3JSL A;  1N36 O;  1K7D A;  2WLH A;  3E2E A;  1YTF D;  2WLJ A;  1MMM A;  1GRJ A;  4O4J A;  4DRX A;  4PJ0 Z;  1PL4 A;  1ARO P;  1O9G A;  4E4E A;  1VQ7 V;  2CK3 G;  3TJT A;  1PNM A;  1FXK B;  3ZHQ A;  3B77 A;  1NKD A;  1S76 D;  1JA8 A;  1KU9 A;  3ETE A;  4U3J A;  3G71 V;  2LW7 A;  3RBZ A;  4JI5 O;  1SQP H;  2EIM B;  3RVZ A;  3N2K A;  4Q20 A;  3FYE B;  4ZBM A;  1HWY A;  1S5J A;  3FD9 A;  4G2K A;  5BXZ A;  4GKJ O;  1XEQ A;  4IYH A;  2JGU A;  3SR2 C;  4FM0 A;  4JTA B;  1H2K A;  1ZAU A;  5EZY B;  1RM1 C;  3G67 A;  3AG7 A;  1YVW A;  3J80 N;  3B09 A;  1FS0 G;  2W0F C;  5IJ0 B;  2W0X A;  4UCT A;  4WFE A;  3IC9 A;  2UXX A;  5CA1 B;  1QVG U;  1KEC A;  4P9O A;  1MSW D;  2EX3 A;  3DTU B;  1Q6U A;  1G1X B;  1SA0 B;  1VQO V;  2JS3 A;  4FFK A;  2EJR A;  5B3S C;  5E1A C;  3CCL V;  2IJI A;  4PA3 A;  4JZG A;  2GUZ B;  1OV9 A;  1TA8 A;  4PA9 A;  4X65 B;  1XMO O;  5LOV B;  5IYZ A;  3ASO B;  2CGO A;  1XIL A;  3OMI B;  3C3S A;  4X8A A;  1F7Y A;  2VQF B;  2AXT Z;  4JI8 B;  2JGD A;  5DED A;  1KP3 A;  3E83 A;  4EB6 A;  3HKD A;  4I7Z B;  1MA1 A;  1J5E O;  5EK0 A;  4X20 A;  1EM1 A;  1HR0 B;  1ZL8 A;  4DV6 O;  2ZIO A;  4DR2 O;  4O4J B;  4DRX B;  3BEH A;  4GUN A;  2V7Q G;  4DR5 B;  1V54 B;  3IAY A;  2E75 B;  4LFB O;  1L0N H;  3F5W C;  2JS5 A;  1YF2 A;  2XOK G;  4BIO A;  4Q6G A;  2CTP A;  3K9S A;  3FB6 C;  1W0J G;  3AG3 B;  4U3J B;  3JAL A;  1N8R W;  5LMN O;  3N2K B;  3E8H A;  2A79 B;  4MW8 A;  1K97 A;  3SPC A;  4DO2 A;  2ZIN A;  1IBK O;  1P7B A;  2QWP B;  2ZNJ A;  1BCC H;  2HJD A;  4J42 A;  4JI3 O;  1YJW V;  3WG7 C;  4JI2 O;  2RMK B;  2RDC A;  2FB5 A;  4LBE C;  3JSN A;  2OCH A;  3ZRW A;  3STZ C;  1JQ0 A;  1UFI A;  4MVO A;  4H44 B;  2Q7H A;  5CA0 A;  2QEX V;  4W4K A;  3FAV A;  4JI6 O;  2YEV A;  2O57 A;  2P7T C;  4H37 A;  4K0K O;  1J95 A;  4DW1 A;  4MVZ A;  4DV3 O;  4LF5 B;  3CXH F;  1SQV H;  5EYP A;  4O2B A;  2N04 A;  3K3W A;  3T1Y O;  1D5A A;  1OZ0 A;  4Z1M G;  1K34 A;  3H1K H;  2DYR B;  1FFT B;  1Y74 A;  2LJ2 A;  5EBW C;  2YDE A;  3ABM C;  3SPI A;  2HEP A;  1YSC A;  5KX5 A;  5IYZ B;  1OJH A;  1LR1 A;  4LF4 O;  3ZMZ A;  2ITC C;  3BAA A;  4OX9 O;  1UPG A;  3NR7 A;  3IGA C;  4EB6 B;  3HKD B;  2CH7 A;  3CC4 V;  4R50 A;  1M56 B;  4PDM A;  3CE2 A;  4TV8 A;  2IM9 A;  1ZSP A;  1N34 B;  2ZKO A;  4DV0 B;  1ZL8 B;  5JCO A;  1R3L C;  4LNU A;  1AR4 A;  1AR1 B;  3FB8 C;  4DR1 O;  2CDY A;  3E8F A;  3DC5 A;  2ZNI A;  2YXH A;  5GTH Z;  3JAL B;  1AP5 A;  1HNZ O;  1DLB A;  4CBC A;  1QU7 A;  1NU1 H;  3CCJ V;  2QSA A;  5EC2 C;  3OM3 B;  4B3S O;  4GKK O;  5LHH A;  3OTF A;  1S5H C;  4JYA B;  2WLN A;  5GW7 A;  5B1A C;  2OWO A;  3F7Y C;  2FYU H;  2Y48 A;  3BRC A;  3QG5 A;  5B1N A;  3WU2 Z;  1AJN A;  3RYH B;  1OCO B;  4YHH O;  4CC6 A;  2WLK A;  4MT8 A;  5JQG A;  4DV4 B;  3JAT A;  1EN4 A;  3ZRW B;  5CA0 B;  3BFR A;  4QE7 A;  5LXT A;  2ZE5 A;  4G28 B;  3FAV B;  4JV5 B;  2YEV B;  5B1B B;  5LL6 Y;  3PN1 A;  3APO A;  1XL4 A;  2KQX A;  5EYP B;  2WSS G;  3ZN0 A;  3AK2 A;  5CB4 A;  3AG4 C;  1EFR G;  2JDI G;  1Y74 B;  1MOF A;  4AQY B;  2ZCE A;  1OCR B;  1P49 A;  3ASN C;  1Q81 W;  2R72 A;  3LNN A;  4CZZ A;  1IBL O;  4LF8 O;  5KX5 B;  4DR4 O;  3R65 A;  2YIB A;  4JAS A;  1S72 V;  3ZS8 C;  2VS0 A;  1YXB A;  3S3W A;  2EZP A;  3CCV V;  5JWP A;  3CSX A;  2CH7 B;  4X1I A;  2ILM A;  2P06 A;  3OGC C;  4WFG A;  4TV8 B;  4PA4 A;  3SJQ C;  1BQ0 A;  3H1H H;  3N2G B;  4NXM B;  3JAM N;  2ZDI C;  4IHJ A;  4O4H A;  2DOS A;  2ZXW C;  4LF7 B;  3T2M A;  4LNU B;  4UCO A;  3U10 A;  1S3J A;  2P67 A;  2ZQM A;  3ZRS A;  4QNH B;  1TAE A;  4F6E A;  3KCX A;  3E8B A;  4UB6 Z;  2M6Y A;  3E86 A;  2B1G A;  2DYS C;  1PPJ H;  3W7W A;  2UUC B;  3PJS K;  2WA4 A;  1LUV A;  1M90 W;  2P4K A;  3ZIA G;  4UB8 Z;  1ENV A;  4KFM A;  1MG1 A;  1VQM V;  5L3D A;  4GCZ A;  4NR1 A;  1KQS U;  3KG2 A;  1SET A;  2EIL C;  4DUZ O;  2Q4P A;  4JYC A;  4MVQ A;  2IJK A;  2B5U A;  5JQG B;  1MAB G;  5KUM A;  2Q68 A;  5IY5 C;  4TQF A;  3QVN A;  4EFB A;  1VQK V;  3L73 H;  1ZTE A;  4C7U A;  2WA3 A;  1H38 A;  5LXT B;  1OHH G;  2UXD B;  4K3A A;  1N4C A;  3FB7 C;  2VQE B;  2YIC A;  2F23 A;  4LH6 A;  1I94 B;  4K35 A;  4CS3 A;  2A0L A;  2BSK B;  2XAH A;  4TT3 G;  3CRR A;  5EIB D;  1CXZ B;  1U96 A;  4CH4 A;  5CB4 B;  3UO3 A;  3P32 A;  2EIN B;  1AIL A;  1GN6 A;  4FLY A;  1WB8 A;  2EIJ B;  4BIZ A;  1VF5 B;  1I08 A;  3IC7 A;  4X64 O;  5JJN B;  5KHI A;  3ABK B;  3JAS A;  4IIJ A;  4UXN A;  3TK1 A;  3OTO O;  1GN3 A;  4X1I B;  4F4L A;  3K5N A;  3AK1 A;  4B08 A;  5DEC A;  5L3G A;  2JIZ G;  2X6B A;  2C2A A;  5LHG A;  4IHJ B;  4O4H B;  4MW3 A;  1G4Y B;  5CMU A;  1K33 A;  2CTW A;  1COW G;  1E1Q G;  2DW4 A;  1US6 A;  1GH6 A;  5JH7 A;  4PHZ A;  1F4N A;  2QE7 G;  3ETQ A;  1H8H G;  3Q4H A;  1VQL V;  4DXW A;  1GO3 F;  1R73 A;  3KKY A;  1P84 F;  3OEE G;  3W7T A;  1Z5V A;  4NYK A;  3CRA A;  1K8A W;  2Y69 C;  1X59 A;  4X9Q A;  2YXY A;  1AJQ A;  1R3J C;  2IU3 A;  3OAA G;  5CN0 A;  5FL7 G;  4ZI7 A;  3HKE A;  1N33 O;  1N32 O;  4CC5 A;  3K79 A;  4FLV A;  4JI7 O;  1Y4M A;  4QJF B;  4B3R O;  5H6R A;  4JI1 B;  3SJB C;  1GK9 A;  2ZR3 A;  3FKS G;  1FJG B;  3L70 H;  1TVK A;  3WB1 A;  3A8T A;  3P3P A;  1RM1 B;  3F5T A;  1SQQ H;  2ETN A;  2UU9 O;  4HBN A;  1HDJ A;  2QKA A;  4YY3 B;  1VQ6 V;  4LF9 B;  3B4S A;  2XAQ A;  4NXN O;  1JR9 A;  3B40 A;  3BY6 A;  1IUR A;  5B3S B;  1HNX B;  5LOV A;  5JVD A;  4MVS A;  4MTX A;  3W7X A;  4HNA A;  4FK5 C;  4JAA A;  2AGA A;  4LFC B;  1H2L A;  5IWA B;  2YS8 A;  3JAS B;  4IIJ B;  3ZMU A;  4W4L A;  1X4T A;  4DR3 O;  1H2G A;  2WPD G;  4DYL A;  2UXB B;  1UJW B;  4MVR A;  2QM7 A;  5K1X A;  1BZK A;  1K3E A;  4YJ3 A;  4B3T B;  1NH2 B;  2UUB B;  4UCS A;  1HW7 A;  5IJ9 B;  2ATK C;  4E2L A;  1IVS A;  2V4D A;  3ABL C;  3EHB B;  4K8Z A;  5JH7 B;  2EJ7 A;  2AZ0 A;  4DV2 B;  2KSD A;  1XMQ O;  2HP8 A;  3Q4H B;  4I5S A;  2WLM A;  2JK5 C;  3ZX6 A;  1KC8 W;  1KKC A;  1IDS A;  2R9A A;  1DF5 A;  4LCU C;  3OD4 A;  3QO5 A;  4KUM A;  1XHZ A;  1FPO A;  4FM1 A;  4BIU A;  3WFV A;  1WA8 B;  1KUQ A;  4UFZ A;  1P7G A;  1VAR A;  1BE3 H;  4ZI7 B;  1NQT A;  3HKE B;  2HHH B;  2PI4 A;  3MD0 A;  1ZUQ A;  3GB7 C;  3MHH C;  3CPW U;  1TVK B;  4RO2 A;  3WB2 A;  3K06 A;  5GTI Z;  1THZ A;  2GDS A;  1R6T A;  3HKC A;  3TET A;  4OPA A;  3WG7 B;  1E1R G;  4X65 O;  2XAJ A;  2X6C A;  3QO8 A;  4JYY A;  1F23 A;  1WNS A;  2RJZ A;  3SYQ A;  4UVB A;  2VQF O;  3J7A U;  4H0L B;  4GKJ B;  3H9V A;  5J2U A;  2CUG A;  5EBM C;  3VOU A;  4PI0 A;  4QGP A;  1PNL A;  5JVD B;  2BTQ A;  3G4S V;  1QCE A;  4GX5 A;  1HR0 O;  1W0K G;  2EZO A;  4X62 B;  4HNA B;  1G6U A;  1KMI Z;  3JAR A;  4J7Z A;  4TOI A;  5L3C A;  1OCZ C;  1F51 A;  1L8D A;  4P9P A;  5B5E Z;  1FFX A;  3ABM B;  5CBH A;  2QWN B;  5IYC O;  1Q6H A;  1QR8 A;  3EFF K;  3SDL A;  2F43 G;  3CRC A;  4YJ3 B;  1QLN A;  1RPO A;  4DR6 O;  3TXS A;  4ABM A;  2QJ1 A;  1YDX A;  1W59 A;  2Q67 A; 
#chains in the Genus database with same CATH homology
 2ITD C;  3ZJZ A;  2HVJ C;  2LP7 A;  5B1N A;  2ZDI A;  2HLD G;  3ZRX A;  1AJN A;  2JEU A;  2B1I A;  3T1C A;  3K9A A;  2OT5 A;  3LSQ A;  1M57 C;  1OCO B;  1SZT A;  2HJF C;  1OCR C;  1OCZ B;  4WFH A;  3CD6 V;  1EBO A;  1JPX A;  2WLK A;  1JVM A;  4J9Z B;  4MT8 A;  3CCQ V;  1BHB A;  4UV9 A;  4X89 A;  3OUF A;  3T4Z A;  2GSM B;  4XDL A;  3ZRW B;  4XDJ A;  2ZR2 A;  1K5S A;  4MVU A;  5DM6 V;  2NLJ C;  4FPP A;  4MTF A;  4QE7 A;  1LNQ A;  4G28 B;  1XL6 A;  2YEV B;  5B1B B;  2OTJ V;  5LGU A;  4L87 A;  4G27 B;  1NBM G;  1XL4 A;  3OR6 C;  3W7S A;  5H9C A;  3ZCC A;  2WLI A;  3SYC A;  1EZJ A;  1NR7 A;  2UXN A;  5B1A B;  2WSS G;  3CCM V;  4EKW A;  4RUE A;  3ZN0 A;  1PNK A;  3LUT B;  3AG4 C;  1EFR G;  2JDI G;  2WAM A;  1K5Q A;  1M57 B;  4FMT A;  1MOF A;  2Q6A A;  1VQ5 V;  1OCR B;  2FTK A;  3ASN C;  4XBF A;  5IYB O;  1Q81 W;  1M9N A;  1M1K W;  1VQ9 V;  4JPR A;  1R6K A;  4CZZ A;  1RPR A;  3R65 A;  3CYO A;  4I9W A;  3OFN G;  2M7W A;  3LDD A;  3FYI B;  4JAS A;  5LGT A;  1S72 V;  3CCR V;  1FXK A;  2BOC C;  4UVA A;  2JJ2 G;  2EZP A;  4PEL A;  3CCV V;  3CP1 A;  3LNM B;  4R6Z A;  1AI5 A;  4X88 A;  2K1E A;  1K4D C;  3OGC C;  3M99 B;  3CME V;  2XAF A;  3F7V C;  4WFG A;  5HFL A;  4GX2 A;  3QNE A;  3G6E V;  4PA4 A;  3SJQ C;  3D3I A;  1VQ4 V;  1ROP A;  2DWD C;  4TWK A;  4JYB A;  5B1O A;  5KA6 A;  1GM8 A;  4R8C A;  2ZDI C;  2XAG A;  3AG4 B;  2QKS A;  2ZXW C;  3JCZ A;  1S0V A;  1I5Y A;  3DGE A;  3T2M A;  3TCU A;  2HG5 C;  2Z5U A;  1V55 C;  2W6I G;  3ASN B;  1S3J A;  4WFA V;  2P67 A;  2ZQM A;  3OE7 G;  4QPJ A;  4UV8 A;  3ZRS A;  4QNH B;  5L3E A;  1L1F A;  5LBQ A;  3SPJ A;  4GT1 A;  3E35 A;  3E8B A;  1CP9 A;  2W6J G;  3E86 A;  2B1G A;  2DYS C;  3JD2 A;  4LP8 A;  3W7W A;  1YIT V;  1NR1 A;  3PJS K;  2EBO A;  1M90 W;  3ZMT A;  2QM8 A;  1DF4 A;  3K0G A;  4MSW C;  1SER A;  3E8G A;  3ZIA G;  1ENV A;  4XDK A;  4KFM A;  1QBZ A;  5H6Q A;  4BAY A;  3A0R A;  2X6A A;  1MG1 A;  4R7C A;  1VQM V;  3B8M A;  3P30 A;  1SES A;  5L3D A;  3OMA B;  4GCZ A;  3K0D A;  4RAI A;  1AI4 A;  3LSS A;  2HKO A;  1GTO A;  1KQS U;  4H33 A;  3KG2 A;  2MK3 A;  1SET A;  2EIL C;  4GX1 A;  2ZXW B;  4JYC A;  5IYD O;  1Q82 W;  5IDJ A;  4MVQ A;  1YHQ V;  2EIN C;  2P6J A;  2IJK A;  4PDR A;  2B5U A;  3STL C;  1WPX A;  1MAB G;  2JEX A;  4BW5 A;  1NJI W;  5KUM A;  2Q68 A;  5IY5 C;  4TSF G;  2DYS B;  1S77 D;  1JX9 A;  3D36 A;  3ABK C;  1VQK V;  5CA3 A;  4UVC A;  3SYA A;  5J9P C;  2XAS A;  1FXK C;  1FXV A;  1OHH G;  2AHY A;  2IH3 C;  3IFX A;  1H38 A;  3CCE V;  1VQ8 V;  4UUJ C;  5KA5 A;  3CMA V;  3NXS A;  2Z3Y A;  3FB7 C;  1YJN V;  1PD3 A;  1GKF A;  1B6Q A;  3ETG A;  4RUF A;  4JAV A;  2WLI B;  1QR9 A;  4P2Z A;  1VQN V;  2A0L A;  2EIM C;  2IJH A;  3ABT A;  4GX0 A;  2XAH A;  1R3K C;  2PI5 A;  4TT3 G;  2EIL B;  2WWW A;  3I56 V;  2A9H A;  5EBL C;  1WLE A;  5LHI A;  1GM7 A;  3P32 A;  2NNU A;  1NVP D;  4ZKI A;  2GHY A;  1K4C C;  2EIN B;  5CBG A;  1K7D A;  2WLH A;  2EIJ B;  3E2E A;  4ASU G;  2WLJ A;  1YTF D;  4BIZ A;  1CPY A;  2IU0 A;  5IY5 B;  4FIP C;  3IC7 A;  4PA7 A;  3AG2 C;  1G8M A;  3ABK B;  1ARO P;  1VQ7 V;  4FJC C;  1SRY A;  4JF3 A;  2CK3 G;  4UXN A;  3TK1 A;  2ZD9 A;  1PNM A;  1FXK B;  2QA4 V;  3JYC A;  4RQE A;  2OCC C;  1VQP V;  3B77 A;  1QVF U;  2XND G;  3CCU V;  1NKD A;  1S76 D;  4F4L A;  3ETE A;  3G71 V;  5KUK A;  4WCE V;  3RBZ A;  5L3G A;  2EIM B;  3RVZ A;  2JIZ G;  2X0L A;  2X6B A;  4Q20 A;  3FYE B;  2C2A A;  5LHG A;  4ZBM A;  1KD1 W;  4MW3 A;  5L3B A;  1HWY A;  3ABU A;  1G4Y B;  5CMU A;  1Q7Y W;  1K33 A;  2EIK C;  1W2B U;  1COW G;  4G2K A;  1E1Q G;  2DW4 A;  5EC1 C;  4JTA B;  1F4N A;  2QE7 G;  1NH2 D;  1RM1 C;  3AG2 B;  1FXH A;  1H8H G;  2R9I A;  4PDV A;  1FS0 G;  2W0F C;  1VQL V;  4DXW A;  3OUS A;  1GO3 F;  4JTD B;  1R73 A;  4WFE A;  2OCC B;  4PA6 A;  2UXX A;  3ASO C;  3OEE G;  4WFF A;  1Y66 A;  3W7T A;  1I5X A;  1KEC A;  3I55 V;  4P9O A;  3OW2 U;  1QVG U;  3JD0 A;  1MSW D;  4HYO A;  3CXC U;  3DTU B;  3SYO A;  2D3O W;  1K8A W;  1P4R A;  2Y69 C;  1VQO V;  1DTO A;  1YJ9 V;  1BMF G;  3SPG A;  1AJQ A;  1R3J C;  2X7R B;  4U7N A;  2IU3 A;  3OAA G;  5CN0 A;  5FL7 G;  1AI7 A;  2EJR A;  2JJ1 G;  5B3S C;  5E1A C;  3CCL V;  2EIK B;  3K79 A;  1GM9 A;  2IJI A;  4JGS A;  1Y4M A;  4PA3 A;  4QJF B;  5H6R A;  3T4D A;  3VBB A;  1GK9 A;  2ZR3 A;  3FKS G;  2QTO A;  1RM1 B;  1V54 C;  1R3I C;  4MS2 A;  4PA9 A;  2KB1 A;  4YXW G;  3CCS V;  4WF9 V;  2OTL V;  1JOY A;  4OXS A;  3ASO B;  1NVP B;  1V55 B;  3OMI B;  1VQ6 V;  4X8A A;  3B8N A;  3AG3 C;  1YTF B;  2XAQ A;  2Y69 B;  1OCO C;  3MHS C;  1KP3 A;  1PL0 A;  3E83 A;  2Q67 A;  1QLE C;  3ZMV A;  3BY6 A;  1YIJ V;  1AI6 A;  3AEI A;  4RQF A;  3LDE A;  5B3S B;  5EK0 A;  3ML0 A;  2IJJ A;  1Q86 W;  4MVS A;  3ETD A;  4MTX A;  3W7X A;  4U7O A;  1AJP A;  2HFE C;  4FK5 C;  3BEH A;  2V7Q G;  5B1B C;  4PDL A;  1V54 B;  5CBF A;  1ZWI C;  2Q69 A;  3F5W C;  5LGN A;  3ZMU A;  5C93 A;  2XOK G;  4JTC B;  1H2G A;  3ZN1 A;  1CEZ A;  2WPD G;  2IH1 C;  5DN6 G;  1TUE B;  3RW0 A;  2DWE C;  3FB6 C;  1W0J G;  2LFS A;  4J9Y B;  3AG3 B;  3OR7 C;  1UJW B;  4MVR A;  1N8R W;  1ORQ C;  2QM7 A;  3UKM A;  1K3E A;  1QLE B;  4JAU A;  1NH2 B;  3E8H A;  4QPK A;  2A79 B;  4MW8 A;  1K97 A;  3K04 A;  3SPC A;  4DO2 A;  1P7B A;  3K03 A;  2ATK C;  4HZ3 A;  4E2L A;  3ABL C;  3EHB B;  4WFB V;  2DYR C;  1R6N A;  2R9R B;  5HFM A;  1JJ2 U;  1YJW V;  3FB5 C;  1GMG A;  2WLL B;  4I5S A;  3WG7 C;  2WLM A;  2JK5 C;  4N21 A;  2HR3 A;  1YI2 V;  5L3F A;  1KC8 W;  4LBE C;  3ZRW A;  3STZ C;  1DF5 A;  1JQ0 A;  4LCU C;  4MVO A;  1H8E G;  2BOB C;  3QO5 A;  2QEX V;  4KUM A;  4BIU A;  2YEV A;  2P7T C;  4H37 A;  3WFV A;  1J95 A;  1IXM A;  4QE9 A;  4MVZ A;  3OMN B;  1M56 C;  2AHZ A;  3JD1 A;  2WLL A;  4LC1 A;  1NQT A;  1KP2 A;  2PI4 A;  3K3W A;  3HPL C;  1OZ0 A;  3ABL B;  3MD0 A;  4Z1M G;  1E79 G;  3GB7 C;  3MHH C;  3CPW U;  2HVK C;  1K34 A;  4RO2 A;  2DYR B;  3K06 A;  1FFT B;  3AG1 C;  1THZ A;  3E89 A;  5EBW C;  3TET A;  2DQ3 A;  3WG7 B;  3HB3 B;  3OEH G;  1E1R G;  1OCC C;  2XAJ A;  2X6C A;  3ABM C;  3QO8 A;  3SPI A;  1YSC A;  1JCH A;  1F23 A;  1BL8 A;  3ZRV A;  3CC2 V;  3RVY A;  3X2Q C;  4MVM A;  4MTO A;  3ZMZ A;  4P30 A;  1K9M W;  3QO7 A;  3SYQ A;  2ITC C;  4UVB A;  4N23 A;  1KKD A;  3JD3 A;  2LFR A;  3IGA C;  3SYP A;  1F4M A;  3H01 A;  3CC4 V;  5EBM C;  4R50 A;  1M56 B;  3VOU A;  2YSU B;  4PDM A;  3W7U A;  3JD4 A;  1PNL A;  2H94 A;  3G4S V;  1QCE A;  4GX5 A;  3SPH A;  3ZMS A;  1W0K G;  2EZO A;  1R3L C;  1K92 A;  4HAM A;  4QIW F;  3K08 A;  3LDC A;  3AG1 B;  5L3C A;  1AR1 B;  1OCZ C;  1F51 A;  3FB8 C;  4P9P A;  4MTG A;  1OCC B;  3ABM B;  1K73 W;  1BHA A;  2IW5 A;  3UM7 A;  3E8F A;  3X2Q B;  5CBH A;  2H8P C;  5IYC O;  1QR8 A;  3EFF K;  4KP4 A;  2F43 G;  2EIJ C;  1DLB A;  4CBC A;  3CCJ V;  5EC2 C;  1QLN A;  3OM3 B;  1RPO A;  5LHH A;  1S5H C;  5BZB A;  2DQ0 A;  2WLN A;  5GW7 A;  3CC7 V;  1PKX A;  2V1D A;  5B1A C;  3GWO A;  3F7Y C;  2Y48 A;  2P90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...