3K04A

Crystal structure of cng mimicking nak mutant, nak-dtpp, na+ complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
90
structure length
90
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDTPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein NaK
publication title Structural studies of ion permeation and Ca2+ blockage of a bacterial channel mimicking the cyclic nucleotide-gated channel pore.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transport protein
total genus 30
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3k04A00
3BEHA 2EIMC 4WFHA 4RUFA 4PDMA 3ABMC 3SYQA 2NLJC 3F5WC 2ZD9A 2A0LA 2HG5C 3LDDA 3AG1C 3SPCA 3T1CA 1KKDA 2A79B 2HFEC 4I9WA 3TETA 4HYOA 1V55C 4MSWC 3AG4C 3ASOC 3T2MA 4P2ZA 3UKMA 5KUMA 4LP8A 1OCZC 4RAIA 2AHZA 4G27B 3SJQC 4XDJA 3SYAA 4PDRA 4PA4A 4X89A 5CBFA 2WLIA 3K06A 1P7BA 3E8HA 3EFFK 3FB8C 4GX1A 3RVYA 4MVOA 4HZ3A 4GX2A 3K08A 4XDLA 4WFFA 4DXWA 1LNQA 3SPJA 4QE7A 4BW5A 3E8GA 3F7YC 1S5HC 3IFXA 5E1AC 4X88A 2WLHA 3X2QC 3OGCC 1QLEC 4R6ZA 3TCUA 2P7TC 2H8PC 2IH3C 4GX5A 5BZBA 1OCRC 3LDEA 4J9YB 3KG2A 3PJSK 5CBGA 2DYSC 5EC1C 4MTFA 4TWKA 3SPGA 4R50A 4WFGA 5EC2C 3K04A 4X8AA 3STZC 2A9HA 4GX0A 4MW8A 4RUEA 2AHYA 3T4DA 4EKWA 5CBHA 4PA6A 4UUJC 2WLLA 4H33A 5IY5C 4PA9A 2QKSA 1OCCC 4H37A 5EBMC 2Q68A 2OCCC 2QTOA 1J95A 1V54C 3F7VC 5EBWC 1XL6A 1BL8A 2IH1C 3ZRSA 4P30A 3UM7A 2WLKA 2X6AA 4MVQA 3SPIA 3ABKC 3AG2C 5B1BC 4MVMA 2WLJA 3LUTB 4P9PA 4XDKA 2ITDC 3ZJZA 4R8CA 2BOBC 4CBCA 4ZBMA 3E8BA 3HPLC 2YEVA 3STLC 2DYRC 3SYCA 3WG7C 1R3IC 2ZXWC 4JTDB 1R3KC 4PA3A 3R65A 1K4CC 2WLLB 2WLIB 3E83A 4MTGA 2KB1A 3RVZA 2R9RB 3OUSA 4MW3A 4KFMA 4MTOA 3OR7C 1JVMA 2Q67A 1ZWIC 1XL4A 3ASNC 2Y69C 3ABLC 3RW0A 2DWEC 4JTCB 4QNHB 3K0GA 3FB7C 4R7CA 2EINC 5KUKA 2K1EA 4J9ZB 2WLMA 4MVRA 3K03A 2EILC 4PDVA 5EBLC 3SYOA 3E8FA 2ATKC 2HVKC 4WFEA 2WLNA 3SPHA 2DWDC 1R3LC 2X6CA 2EIJC 4LCUC 4G28B 4P9OA 2Q69A 2X6BA 2Q6AA 1ORQC 1R3JC 3FB5C 3GB7C 3FB6C 3OR6C 4JTAB 4MVSA 4MVUA 4QE9A 4RO2A 2BOCC 1K4DC 2EIKC 4PA7A 3E89A 3RBZA 4MS2A 1OCOC 5B3SC 3LNMB 4F4LA 3IGAC 2HVJC 3JYCA 4PDLA 3T4ZA 5EK0A 3OUFA 4LBEC 3E86A 2HJFC 3AG3C 2ITCC 5J9PC 3K0DA 4OXSA 1M57C 3SYPA 2W0FC 1M56C 2JK5C 4MVZA 3LDCA 1G4YB 5B1AC 3VOUA
chains in the Genus database with same CATH superfamily
4RUFA 4LH6A 1H2NA 3BRCA 4JGSA 2OCCB 1RM1B 2HG5C 4J7ZA 5JQGB 1S72V 1NZ6A 5AG2A 1R6NA 1I5XA 5EIBC 2Q8VA 1S3JA 3BHPA 2WA4A 4LH7A 5DECA 1QVFU 3CP1A 1QU7A 2QWPB 3ETEA 4DK1A 3ZEDA 1XOUA 3D3QA 2GBOA 4BW5A 2ETNA 5J2TA 2FKXA 1EZJA 1H2KA 2ZM6B 5GTHZ 4YY3O 5LYJB 2H8PC 3E22B 2JS5A 3ABMB 3UCSC 1DTOA 4ZHQB 3I55V 3QTCA 3ETQA 4EFBA 5EC2C 3U0ZA 4I0XA 2GTSA 2PF4E 2Q4PA 3FX7A 2AHYA 3GWOA 3T4DA 4K0KB 5JCOA 3ZHUA 1H38A 4GUNA 4H33A 1OV9A 4X1YB 4JI2B 2RDCA 2ZIMA 3OTOB 2XHBA 1OJHA 1VF7A 1TVKB 1Z5WA 1SC5B 2ITDC 4PI2A 1FXKC 4JI0B 3GVMA 4Z1VA 3HPLC 3WG7C 3H1JH 3LSSA 1IXBA 2RMKB 2WLLB 2P4VA 2YC0A 3M7MX 3DSQA 4JV5B 2OIGA 1Q8IA 2YDEA 4IL6Z 3B40A 1SS3A 1R1BA 1K5SA 3OEHG 2HVKC 2X6CA 2EZPA 3CRMA 1J5EB 4MVSA 4AQYB 4BWAA 2EIKC 4PA7A 1VQ5V 4LF6B 5LMUB 3IJ4A 2HVJC 2UUAB 4DV4B 4OXSA 4UV9A 3B8NA 4MVZA 3BPZA 4X62O 4DR7B 5H9CA 2OTLV 5JCOC 1K5QA 1FJGB 2BCCH 4U3JA 3AG2B 1NTZH 1BHBA 2CK3G 4FM0A 3APQA 3UO2A 4JYBA 2ZE8A 4MVOA 4HZ3A 4DR4B 3K08A 3J7AU 2WWWA 1OCOB 3UQ8A 3TGUH 5LP6B 4NTXA 4UB8Z 4QGPA 3RT3C 5L3DA 4FLVA 3ABLB 4BAYA 4DV5B 3CRCA 4JF3A 2ZDIA 1EFRG 4O4JA 1SQBH 4LF9B 2PZSA 3H9VA 2E74B 2KSDA 1L0NH 4PD4F 3P3NA 1AP5A 1SQVH 4O4IA 5KA5A 2YIBD 1NJIW 4IIJB 5L3GA 3ZHQA 3A8TA 3PN1A 4JAAA 5KHHA 4BR6A 3FD9A 4GKJO 2LP7A 2Q7HA 4XBFA 4LF7B 3E83A 4NYKA 5IYDO 3M8AA 4UCVA 4JTCB 4Z2WA 3Q4HA 2GHYA 5KUKA 1XMOB 4J9ZB 4DUYB 1DK1A 4BIUA 4LF5O 3K58A 1ORQC 3FB5C 3W7WA 4NB5A 3P3PA 4UCOA 2DMXA 1IBKB 1HP8A 3RYCA 5L3FA 3B4SA 2V4DA 4GYCB 1PNMA 3SYQA 3L70H 4DV0B 2Y48A 4I9WA 4X66O 3JAMN 2A7WA 2OYQA 4BW9A 3ZN0A 1N33B 1NR1A 3CCLV 3RVYA 5A2QN 3HKEA 4I9QA 1SQFA 1HNWB 3BA8A 1LNQA 1M5IA 4KHPO 1S0VA 4B3RB 4J80A 4FIPC 1IX9A 5B1OA 4DV7B 2FMLA 3OE7G 4WBNA 1WN7A 3L74H 4I55A 3G6EV 1AI7A 3STZC 2Q5ZA 1GN4A 2PI5A 1Z2GA 1SETA 2ZINA 5EBMC 4UFZA 4JI2O 1NR7A 1MSWD 4LFCO 4LF8B 5LXTA 2JVDA 3CRAA 4P9PA 4DV2B 3UT5A 1X4TA 3JALA 3ZHRA 2B1GA 4U3JB 4LFAO 1S5JA 2P67A 1Y74A 4DV6O 4FLWA 1XMQO 1Q3EA 4NKGB 2HKOA 3ASOB 3APOA 3AEIA 1AR4A 5KAFZ 5IYZB 3K5LA 5EYPB 5IJ0B 1ZX3A 2YIBA 4JV5O 1QBZA 1US6A 1AB3A 4LCUC 2X6BA 3X2QB 4O4JB 4DV1B 2QE7G 1FD9A 3AK1A 4F4LA 4PDLA 1UFIA 1BE3H 4EFEA 5LMUO 1VF5B 2UUAO 2P5OA 2E3CA 4PDMA 1SESA 2ZD9A 5CA3A 5LL6Y 1DLBA 3TETA 2HLDG 4DR7O 3CPWU 5KUMA 3H1KH 3ICXA 1U97A 1ZUQA 2K9PA 4GKKO 5EZYA 3T1YB 3GWKC 1WAZA 3I56V 3EFFK 2FYUH 1JMKC 3OTFA 1E79G 4B3SB 3Q4HB 2RN9A 3IFXA 1TUEB 2WLHA 1CPYA 1WPXA 1HNZB 1JPXA 3ZMSA 1VQKV 2LFSA 2WPDG 5KHIA 3L75H 2VQFO 3HR0A 1VARA 1ZL8A 2R72A 2UXDB 4TUYB 3J80N 3DC6A 4LF9O 5KMGA 3RYCB 1HR0B 5B3SB 2EZOA 2NR5A 5IE9A 4MVQA 3ABKC 4LWSA 1K9MW 2N74A 3NR7A 3E8BA 3W7SA 1Y66A 4J41A 2UXBB 3SYCA 2Z3YA 2CTRA 1GKFA 3K59A 4ZKIA 4ABMA 2ZIOA 4ZOLB 1Y4MA 4IHJA 1F23A 1ZWIC 3ASNC 5JH7A 3CRQA 1IBLB 1HW7A 5LOVA 5EBLC 1L0LH 4I50A 1XMOO 4DUYO 3L72H 1YJ9V 4I55B 5JQGA 4B7EA 3HKBA 4DR1O 2PYJA 3JCUZ 3T1HO 2ZE7A 4D7TA 5H2FZ 1P7GA 3CCVV 4TSFG 5LXTB 5K1PA 3UT5B 4JI3B 3C3SA 3JALB 1V54B 2A79B 2CH7A 5LYJA 4HYOA 1AI5A 4ZHQA 4G27B 1PL0A 4O4LB 4U7OA 4DW1A 2W0XA 1GO3F 3E8HA 2FTKA 4LNUA 5JWPA 1N33O 1I5YA 3HKCB 1N34B 4LF4B 2GDSA 1KMIZ 1IZ3A 2ADQB 1YSCA 3RN4A 2EIMB 1TGOA 1CEZA 4TQFA 2MK3A 5JJJB 2N04A 2DYSC 2CTQA 2GTAA 1XNQO 2HHHO 1AJNA 3JAWB 1YJNV 1KD1W 1KU9A 2WLLA 4PI0A 2QKSA 4L87A 2OCCC 1RM1C 2ADPA 2KG7A 5IDJA 4DV2O 2YEVA 2D2CB 2ODMA 5KA6A 5E79Z 5EZYB 3E2EA 4PA3A 4UVAA 2KB1A 4EEQA 1K7DA 1XILA 1GM8A 2L6LA 4IYHA 2A06H 1NKDA 1JVMA 1W2BU 3R66A 1NH2D 1F7YA 4AHCA 5JVDB 4J7JA 4R7CA 2E5LB 4WF9V 1RFYA 3WFVA 4WFEA 4JI7B 3FAVB 2Q73A 3BCCH 1KYOF 3KCXA 1AR1B 1OCRB 3CYOA 4DV1O 2IM9A 1EZVH 1WJZA 2HJFC 2JJ1G 2Q7EA 1H2GA 3K5MA 2CGNA 2HJDA 1ZAUA 1W0KG 4LWSB 5J2UA 3JARB 1KP3A 4YHHB 3RGBA 1BQ0A 2BTQA 4DV3O 5B1BB 1N32B 4X89A 1GTOA 4IHJB 1GN6A 2ZXWB 5JH7B 1XI1A 1HNXO 3ML0A 4DXWA 2AXTZ 3SPJA 1FYJA 2F4VB 3CS5A 3C90A 1YDXA 5LOVB 2QM7A 4IIJA 3H1IH 2PGGA 4I50B 2IH3C 1I0HA 3OEEG 5LGUA 2EINB 4DR2B 3HKBB 1HNZO 4X20A 2V1DA 1N4CA 3AG4B 4EKWA 2CTWA 5C93A 1G8MA 4FM2A 2UXDO 5LHHA 2LO1A 1QVGU 3AG2C 2CH7B 1THZA 4E4EA 4TQDA 3L71H 1ZTEA 5CN0A 1FKAO 4DUZB 5LP6C 1MABG 4LNUB 5KLVH 3OUSA 4NVPA 4B7KA 1OCZB 3CXCU 2ZE6A 3ABLC 4KXRA 1YVWA 4J11A 3FB7C 3KKYA 4YJ3B 2ZNIA 2WLMA 3E8FA 4TOIA 3SPHA 1V9PA 1COWG 2Q69A 3CXHF 4JTAB 3QO7A 4RO2A 2IJIA 1B06A 3D36C 2ZE5A 1JOYA 1VQMV 2IU0A 1XHXA 3HKDA 2BE3A 2O57A 2X0LA 3FFQA 1GAXA 4JPRA 3LDCA 3STLC 1G4YB 3ABUA 1KUQA 3CJHB 2A0LA 2KG7B 1IBMB 4KUMA 2ZKOA 3LSUA 2YEVB 3WB1A 3A2FA 1R6KA 1Q5OA 4OGQB 2DOSA 2UU9O 5IJ9B 1SA0B 3CMEV 3CCMV 4U3FH 4X64B 4BIOA 4WFFA 3L73H 3D8CA 3F7YC 2XAHA 1N34O 4X88A 3BAAA 2YXYA 5B5EZ 1I08A 1SQPH 2UUBB 1JJ2U 4JI4O 4UVBA 5LA6A 3W7XA 4OX9B 3JAKB 1ZLZA 2EILB 1IXMA 4FMTA 3RYHA 4TV9A 4PA6A 2XOKG 4NXNB 4UV8A 1OCCC 4N23A 1U96A 1JX9A 2JIZG 4FVMA 1BS3A 4DR5B 5BR8O 3AK2A 3EHBB 4JI6O 4P30A 5J2UB 5IYZA 3SPIA 5EYPA 5IJ0A 2BTQB 2CAZC 5DN6G 1O9GA 1G1XB 2Q9LA 1N0NA 3ZHSA 2DW4A 1VMGA 1ENVA 3OT7A 4C7UA 2R9RB 2QDOA 2Y0PA 1YJWV 3DXRA 3ETDA 4CS3A 3B8MA 1D5NA 3ZS8C 2M6YA 1SQXH 2VQEB 2XAGA 2GUZA 1R3LC 1IDSA 4CH3A 4G28B 1TAEA 3OR6C 4X20B 4B3MB 1MG1A 2UUCO 1K4DC 3E89A 1VQ9V 1G6UA 1PNKA 2E75B 1FFTB 2OWOA 4LC1A 1NVPB 4HAMA 1KB9F 2QEXV 1F51A 1I7FA 3EXAA 4JAUA 5IY5B 1H8HG 4DW0A 1GM9A 3F5WC 3A0RA 1K8AW 3ASOC 4JI1B 4YHHO 2IJKA 4DR3B 4LP8A 1URFA 4YXWG 2C2AA 3BVOA 4UCSA 3FB8C 4K8ZA 4CC6A 2ZR2A 4JI8O 2P22C 4TUYA 4FLUA 4IT5A 2X7RB 4JYAO 1Q81W 2ZDIC 2FB5A 1KP2A 1JA8A 4JYCA 2EX3A 3X2QC 1VF6A 2R9AA 3KG2A 3DTUB 3SPGA 4R50A 4FJCC 3CRRA 1IVSA 2PY5A 5CBHA 2HR3A 3HKDB 5B66Z 1FPOA 2EJ7A 1GM7A 5DEDA 4ZOLA 2B9ZA 1BL8A 2IH1C 5BMVB 5D5QA 1NS1A 4PJ0Z 1NH2B 2HP8A 3QO8A 2QA4V 1M56B 5FNVA 2ZM6O 1TA8A 1YIJV 1VQNV 2IBZH 3TXQA 1QCEA 1NQTA 3SGIA 1SZXA 3OR7C 2Q67A 1Y6XA 4O4HA 3QVNA 4K0KO 1PPJH 1PV0A 2ZR3A 5B1NA 1P84F 2K1EA 5A9GA 1N8RW 3OTOO 5LA6B 1K73W 1YHQV 3GB7C 3MD0A 3S3XA 4JI0O 3RYHB 4TV9B 1H2LA 5CMUA 5B3SC 1FS0G 4O4LA 2XT9A 2LJ2A 3HKCA 1ROPA 4WFHA 4PHZA 5BXZA 4B3TB 3VQWA 4FLYA 4DR6B 3LSQA 1VQ7V 3SJAC 4W4KA 2AHZA 3SJQC 3N27A 2Y0IA 4XDJA 4FM1A 1GK9A 4CH6A 2DE0X 2PUSA 4AQYO 3K06A 2WLIA 1P7BA 3JAWA 4TV8A 1J5EO 1MZEA 3DXRB 1Q6UA 4LF6O 5IYCO 2JS3A 3G4SV 3OFNG 3B2EE 3N2GB 4WCEV 1NI8A 1P4RA 1AJPA 4DV4O 2PYLA 3K3WA 2GUZB 3CEIA 2JEXA 1R73A 4AILC 3OAAG 2IU3A 2UUBO 4LR3A 4JI5B 4WFGA 2ILMA 1E1RG 4RUEA 2AZ2A 1FJGO 1RPOA 4FFKA 1H8EG 3OD4A 2G38A 2QTOA 1V54C 3F7VC 3ZRSA 4DR4O 2F43G 2LW1A 5JVDA 2GV9A 1T5EA 4J10A 1XNRB 3ZJZA 4MTXA 5GONB 2JDIG 4X1KA 3I5DA 3IC7A 3AG1B 2R9IA 3FAVA 3FKSG 5KHGA 4DV5O 1NT2B 1VQ4V 1XQ8A 2WA3A 3UO3A 2QR4A 3ETGA 5H5NA 1ZSPA 4MTOA 1AROP 3N2KA 4WFBV 3JD4A 1Q6HA 2DQ3A 2YS8A 2WLNA 3ZMUA 4FLTA 3JARA 3K57A 4DO2A 1R3JC 1QLEB 3SR2C 3G6BA 3HB3B 1SF9A 2ARHA 5EK0A 4PELA 1GH6A 3E86A 3M99B 4LF7O 3RFRA 4NTYA 4YY3B 4TT3G 4QPKA 2Q0OC 3KZIZ 2IW5A 2QWQB 4CC5A 5FNVB 4JZGA 1L8DA 4F6EA 1BGYH 4CS2A 3VQXA 3AK3A 4GX1A 1UPGA 4GLXA 4O4HB 3E8GA 2CGOA 5LMNB 3JASB 2Y69B 1IBKO 2P7TC 2E76B 2FL4A 1OCRC 3LDEA 3EVKA 2JEUA 5L3EA 1I94B 1KC8W 2YI9A 4J42A 4DV0O 4UVCA 5DM6V 4H44B 1Y76A 1WB7A 2QKCA 4LFBB 1CP9A 1NVPD 5EBWC 3ZIAG 3CSXA 4OPAA 4CH5A 1HNWO 4WFAV 5B1BC 2LGWA 4YJ3A 3TK1A 4CBCA 4O2AB 2XASA 4B3RO 5FPRA 1H2MA 1KKCA 2ZXWC 2N05A 4DV7O 2WLIB 4TV8B 4GT1A 1OZ0A 1SQQH 1WLEA 4NXMB 4X62B 1NTKH 3BFRA 3E35A 2EINC 1UJWB 5GW7A 4X9QA 1YZBA 3CJHA 4P9OA 2B1IA 4LF8O 2Q0AA 3K79A 2UXXA 2ZT9B 5LHGA 2IJHA 3ZRVA 5IJ9A 1SA0A 4Z1MG 3BABA 4RQFA 2W0FC 1BMFG 2F95B 2H3OA 3ABMC 1WPBA 2KKWA 3RYIA 5FLXN 4X1KB 3W7UA 2XUMA 4A5UB 4DR6O 1AILA 4I4TA 3UKMA 3CB2A 3JAKA 1SKVA 1OCZC 4UCUA 2LW7A 1MA1A 1QR9A 2VRZA 1XREA 2JGDB 1YTFB 2DYRB 4HNAA 2A3QA 4NTWA 1XUQA 5CB4A 1SQGA 3N2KB 3FYEB 4R6ZA 3TCUA 5LBQA 4GKJB 1BT8A 3CX5F 3ZMZA 5GTIZ 2EIJB 3DC5A 1VIBA 4JI5O 5FL7G 3ZMTA 2CTPA 1Q7YW 1O9HA 2Q68A 3T1YO 2OTJV 1AI6A 4K3AA 4YJ2B 4LF5B 2X6AA 3AG3B 4B3SO 3ZX6A 5B1AB 4FFBB 2Z5UA 1D5AA 5F2VO 3WU2Z 1BZKA 4JTDB 1E1QG 3R65A 2DYSB 1FXKA 1V55B 3RVZA 1YCIA 4KFMA 1XHZA 4RQEA 2BSKA 2P06A 2EBOA 2DWEC 4X66B 3K0GA 3K03A 4FZ1A 2EILC 2Y4TA 3SYOA 1HR0O 3ABTA 1K92A 4MVUA 2F93B 1WA8A 1Y76B 1OCOC 2P6JA 3CCRV 2UXBO 4LBEC 4KHPB 4FPPA 3D3IA 1FAFA 4QPJA 2UXCB 3SYPA 2IJJA 4DRXB 3SDLA 2F66C 4DYLA 5CA0B 3BEHA 5CA1B 2AZ0A 5LGTA 1IBLO 2GSMB 3SPCA 1RSOA 1MMMA 4CZZA 4MSWC 5H6RA 1PNLA 3OM3B 5JJNB 3JCZA 1PD3A 1XBLA 1IURA 5CBFA 2P4KA 3B09A 1LUWA 4LFCB 2EJRA 2BTOA 2XAQA 4LFAB 5BMVA 3IAYA 5BY1A 1TUBA 5L3BA 4DV6B 1XMQB 1YEWA 5LMNO 1SERA 4FK5C 4JI3O 4TWKA 3CMAV 3A0BZ 1I94O 1W59A 4GX0A 5IT9N 1AJQA 2Z0AA 4O2BB 5IY5C 4EB6A 4PA9A 3ZHTA 2LGQA 4JYYA 1XL6A 2W6IG 2YXHA 4LFBO 4FLXA 2WLKA 1S76D 1M57B 3H1HH 4Q20A 4ICGA 3RYIB 4LF4O 3CD6V 4R8CA 5HFMA 4IYIA 2V7QG 1SRYA 4I4TB 4ZIBA 2QM8A 4UXNA 1JQ0A 3JSNA 1VP7A 2CE4A 2Q7GA 1MOFA 3P30A 4HNAB 1DF5A 5CB4B 2WSSG 1S5LZ 4NXMO 2XAJA 4Q6GA 1BQZA 3MAQA 1EN5A 1X59A 4GKKB 1RPRA 3FB6C 5LHIA 2Y4UA 4KP4A 4F6RA 3LNNA 1FXHA 2ZCEA 1PP9H 3IGAC 1MZFA 2QM4A 2R70A 1VQ8V 2P90A 2XNDG 4K35A 2ITCC 4HBNA 3CWBH 4KL1A 1M56C 1B04A 1NTMH 5C8YA 3CC4V 3CCEV 2OCHA 2RJZA 3N2GA 2VQFB 2E5LO 1WB8A 3OGIB 1GRJA 3O65A 1XDCA 2PTMA 2B5UA 4JI7O 1FXKB 4PDRA 2VS0A 2JJ2G 3G80A 5TISZ 4PA4A 3ZBHA 1VQ6V 3WG7B 2BSKB 1YF2A 4GX2A 1N36B 4XDLA 2M7WA 4I7ZB 3G67A 3JD1A 2L35A 3OMIB 5EC1C 5GONA 1WA8B 1QQCA 3CE2A 1CXZB 3THOA 1K3EA 1NU1H 4X8AA 4ASUG 4MW8A 1BHAA 1N32O 3K5OA 2KQXA 2EIKB 4H37A 3B77A 5J2TB 3ZHVA 1QNMA 3SJCC 2RNBA 1XEQA 1W0JG 4JZ2A 2QWRB 1PL4A 4MVMA 5FPOA 1RSOB 2F4VO 4DR1B 2QJ1A 4X65B 3VQYA 3T1HB 4I0XB 4X1IA 3SJBC 3JD3A 1K4CC 4DR2O 4DK0A 1YTFD 3IC9A 4QIWF 4MW3A 4H0LB 3KCYA 4YIPA 1JFFA 1OCCB 1WP8A 2MW2B 2QTSA 1TUBB 2YUAA 3CCSV 2LQTA 4J7KA 3MHSC 5ITZA 2YSUB 1KQSU 1OHHG 3ZRXA 3F5TA 4IGGA 1AVMA 4EB6B 2QWNB 2F1MA 1EBOA 4MT8A 1KBHA 3ZRWA 4DUZO 1M93A 3CCUV 1LR1A 1K34A 2UXCO 3LDDA 3AG1C 4GCZA 1EM1A 1Q6IA 1KKDA 3JASA 1XNQB 2HHHB 4NR1A 2YIAA 3T2MA 2OIEA 4P2ZA 5IWAB 5JJEB 3ZCCA 5K1XA 3H01A 2F23A 2ZNJA 4YIOA 3C3TA 1VF6C 3J81N 4W4LA 1YXBA 1QLEC 3RYFA 5BZBA 2NN4A 2VWKA 3W7TA 1M90W 1QLNA 4F6RB 1Q90D 1DGSA 4O2AA 1IBMO 1DF4A 1EN6A 1M4UA 1QR8A 4D6TH 5C8YB 3K5NA 3AG7A 5L3CA 1M9NA 3UM7A 4X64O 3K9SA 1PM9A 4ZBMA 1VQLV 2XTAA 3CHXA 1EN4A 2RQ6A 4OX9O 3ZN1A 2QWOB 4CS4A 4L8JA 1B3QA 2YI8A 1S77D 4O4IB 1VEWA 2Y69C 4AI8A 2ZQMA 3RW0A 4NXNO 4DV3B 3WB2A 4DR5O 3QG5A 3VQVA 3CCQV 3OMAB 4MS2A 1HNXB 2W6JG 4ZI7A 2UXNA 1GMGA 3OUFA 5KX5A 2JGDA 1AP6A 4GZRB 3CC7V 4I5SA 2EIMC 4UCTA 3TJTA 4CH4A 1VQPV 3T1CA 2QSAA 1FXVA 1HDJA 2HFEC 4N21A 1Q43A 1Y67A 4X1IB 2VQEO 3SYAA 4B3MO 1YI2V 5EIBD 2JGUA 5KAIZ 3OW2U 1A32A 1JFFB 1HWYA 4G2KA 2CDYA 1N36O 4YJ2A 4J9YB 3CCJV 3JD0A 3PJSK 2CUGA 5CBGA 5ITZB 4FFBA 3K04A 1F4NA 2A9HA 1GN2A 3JATA 3HKEB 4JI1O 4DR3O 4UUJC 5HFLA 3ZRWB 2QGNA 4QJFB 1FFXA 1J95A 2WLJA 4XDKA 1N0JA 1PKXA 2H94A 4WBNB 1L1FA 2AGAA 3P32A 2DYRC 3BA9A 4X65O 1M1KW 1BSMA 1VQOV 2PI4A 1JCHA 4QNHB 4DRXA 5CA0A 3RYFB 5CA1A 4PDVA 1WNSA 2ATKC 1KECA 1Y74B 2DWDC 2JRIA 1NBMG 2EIJC 4UCRA 3DGEA 3E22A 3RWRD 2UU9B 4FZ0A 2BOCC 5KHJA 1R6TA 4RWUA 2LFRA 3A0HZ 1RP3B 3JYCA 3K9AA 3VBBA 3AG3C 4X1YA 3K0DA 1P49A 1D2DA 2JK5C 5KHKA 5B1AC 3VOUA 3H1LH 4JI4B 4B08A 1QHTA 2NLJC 1TVKA 3WB0A 5IYBO 3ZMVA 4D7SA 2WAMA 3FYIB 1V55C 4PV1B 1YITV 3ABKB 3AG4C 3O9OA 1H2SB 4UB6Z 4RAIA 2AW9A 5IWAO 5BR8B 2D3OW 4JI6B 3JSLA 4O2BA 1Q82W 3JD2A 3MHHC 4QE7A 1S5HC 2DQ0A 5E1AC 3ASNB 3OGCC 1K97A 4GX5A 4B3TO 4U7NA 1LUVA 3MDSA 1B6QA 4MTFA 5LGNA 1WP7A 3NXSA 4BIZA 2HEPA 4ZI7B 2RCVA 1MNGA 5KX5B 4JAVA 4E2LA 2DN9A 2DJVA 3S3WA 4OPHA 2YIDA 3LUTB 3U10A 2UUCB 2VWJA 1AR5A 2BOBC 1SZTA 1Z5VA 3CC2V 3QNEA 5D5PA 1R3IC 1ZL8B 4K8XA 1R3KC 3TXSA 4MTGA 1Q86W 5H6QA 5KMGB 4JASA 2XAFA 1XL4A 3OMNB 3U11A 3QF7A 3QO5A 3L9DA 5LP6A 1AI4A 1MSDA 3G71V 4MVRA 1BCCH 2QKAA 3BY6A 1GN3A 1JR9A 2Q6AA 4QE9A 1XNRO 4H13B 4FLZA 4JI8B 3RBZA 3JATB 2YICA 3LNMB 2OT5A 4JYAB 2EULA 3T4ZA 2NNUA 2YXLA 1FFXB 3D36A 5J9PC 1F4MA 1M57C 1JJOA 1K33A
chains in the Genus database with same CATH topology
1ROPA 4WFHA 3CCVV 4RUFA 4TSFG 3CC4V 3CCEV 4JGSA 2OCCB 1RM1B 2HG5C 1V54B 2A79B 1S72V 3LSQA 1VQ7V 4HYOA 1R6NA 1I5XA 1S3JA 1AI5A 2B5UA 2AHZA 4G27B 1PL0A 4XDJA 1FXKB 3SJQC 4PDRA 2JJ2G 4PA4A 1GK9A 1QVFU 3CP1A 4U7OA 1VQ6V 2WLIA 3K06A 1P7BA 1GO3F 3E8HA 3ETEA 3WG7B 2FTKA 1I5YA 4GX2A 5IYCO 4XDLA 3G4SV 3OFNG 4WCEV 4BW5A 1P4RA 2M7WA 1AJPA 1EZJA 1YSCA 3K3WA 2H8PC 2JEXA 2EIMB 3JD1A 1CEZA 2MK3A 3ABMB 1DTOA 1R73A 3OAAG 3OMIB 2DYSC 5EC1C 2IU3A 3I55V 4WFGA 1K3EA 5EC2C 4X8AA 4ASUG 1AJNA 4MW8A 1E1RG 4RUEA 2AHYA 3GWOA 3T4DA 1RPOA 1YJNV 1KD1W 1H38A 1H8EG 1BHAA 2WLLA 4H33A 2EIKB 2QKSA 4H37A 4L87A 3B77A 2OCCC 2QTOA 1RM1C 1V54C 3F7VC 3ZRSA 2F43G 1W0JG 4MVMA 2ITDC 3ZJZA 4MTXA 1FXKC 2JDIG 3HPLC 5IDJA 2YEVA 3WG7C 5KA6A 3IC7A 3AG1B 2R9IA 3FKSG 3LSSA 3E2EA 4PA3A 3JD3A 1K4CC 1VQ4V 2WLLB 4UVAA 1YTFD 2KB1A 1K7DA 1GM8A 3ETGA 4QIWF 4MW3A 4MTOA 1NKDA 1JVMA 1W2BU 1NH2D 1AROP 1OCCB 4R7CA 4WFBV 4WF9V 3JD4A 3CCSV 2DQ3A 3WFVA 1K5SA 3OEHG 2HVKC 4WFEA 2WLNA 3ZMUA 2X6CA 2EZPA 4DO2A 1R3JC 3MHSC 1QLEB 4MVSA 2YSUB 1KQSU 1OHHG 3ZRXA 2EIKC 4PA7A 1AR1B 1OCRB 3CYOA 3HB3B 1VQ5V 2HVJC 5EK0A 4PELA 1EBOA 4MT8A 3E86A 2HJFC 3M99B 2JJ1G 4OXSA 3ZRWA 4UV9A 1H2GA 3B8NA 4MVZA 4TT3G 4QPKA 3CCUV 1W0KG 1K34A 3LDDA 2IW5A 5H9CA 1KP3A 3AG1C 4GCZA 2OTLV 1KKDA 1K5QA 1BHBA 3AG2B 5B1BB 3T2MA 2CK3G 4P2ZA 3ZCCA 4JYBA 4X89A 3H01A 1GTOA 4GX1A 4MVOA 4HZ3A 2ZXWB 3K08A 2WWWA 1OCOB 3ML0A 4DXWA 3SPJA 3E8GA 5L3DA 2QM7A 1QLEC 2Y69B 2P7TC 3ABLB 2IH3C 4BAYA 5BZBA 1OCRC 3LDEA 4JF3A 2JEUA 2ZDIA 3OEEG 5L3EA 5LGUA 1KC8W 2EINB 3W7TA 1EFRG 1M90W 1QLNA 4UVCA 5DM6V 2V1DA 1DF4A 1QR8A 3AG4B 4EKWA 5C93A 1G8MA 1CP9A 1NVPD 5EBWC 5KA5A 5L3CA 3ZIAG 1M9NA 5LHHA 1NJIW 1QVGU 3UM7A 3AG2C 4WFAV 5B1BC 5L3GA 3TK1A 1THZA 4CBCA 4ZBMA 1VQLV 2XASA 5CN0A 2ZXWC 2LP7A 4XBFA 3ZN1A 2WLIB 3E83A 1MABG 4GT1A 3OUSA 1OZ0A 1WLEA 1S77D 1OCZB 3CXCU 5IYDO 2Y69C 3ABLC 2ZQMA 3RW0A 4JTCB 3E35A 3FB7C 2EINC 2GHYA 5KUKA 4J9ZB 2WLMA 1UJWB 3E8FA 5GW7A 4BIUA 3SPHA 4P9OA 1COWG 2Q69A 4JTAB 1ORQC 2B1IA 3FB5C 3QO7A 3W7WA 4RO2A 2IJIA 3K79A 2UXXA 3CCQV 1JOYA 1VQMV 3OMAB 2IU0A 4MS2A 5LHGA 2W6JG 2IJHA 2UXNA 1GMGA 3ZRVA 3OUFA 4Z1MG 2X0LA 4RQFA 3CC7V 2W0FC 4I5SA 4JPRA 3LDCA 3STLC 1G4YB 5L3FA 3ABUA 1BMFG 2EIMC 1PNMA 3ABMC 3SYQA 1VQPV 2A0LA 3T1CA 4KUMA 1FXVA 2Y48A 2HFEC 4I9WA 4N21A 2YEVB 3W7UA 3UKMA 1R6KA 1OCZC 3ZN0A 3SYAA 1QR9A 1YI2V 3CMEV 1NR1A 3CCMV 1YTFB 2DYRB 3CCLV 3OW2U 3RVYA 1HWYA 4G2KA 4WFFA 1LNQA 3F7YC 2XAHA 3FYEB 1S0VA 4X88A 4R6ZA 3TCUA 5LBQA 4FIPC 5B1OA 1JJ2U 4J9YB 3CCJV 3JD0A 4UVBA 3ZMZA 3W7XA 3PJSK 3OE7G 5CBGA 2EILB 3G6EV 1IXMA 1AI7A 3K04A 1F4NA 4FMTA 2EIJB 2A9HA 3STZC 5FL7G 4PA6A 4UUJC 3ZMTA 2XOKG 2PI5A 5HFLA 3ZRWB 1SETA 4UV8A 1OCCC 4N23A 5EBMC 4QJFB 1Q7YW 2Q68A 2OTJV 1J95A 1AI6A 1JX9A 2JIZG 1NR7A 3EHBB 4P30A 1MSWD 2X6AA 3SPIA 3AG3B 2WLJA 4P9PA 4XDKA 1PKXA 2H94A 5B1AB 2B1GA 2Z5UA 1L1FA 3P32A 2P67A 2DYRC 5DN6G 2DW4A 4JTDB 1E1QG 3R65A 2DYSB 1ENVA 1FXKA 1V55B 3RVZA 1M1KW 2HKOA 2R9RB 3ASOB 3AEIA 4KFMA 1YJWV 4RQEA 1VQOV 2PI4A 1JCHA 3ETDA 3B8MA 2EBOA 2DWEC 4QNHB 3K0GA 3K03A 2EILC 1QBZA 4PDVA 3SYOA 2ATKC 2XAGA 1KECA 3ABTA 2DWDC 1R3LC 3DGEA 1NBMG 2EIJC 1K92A 4G28B 4LCUC 2X6BA 4MVUA 3OR6C 1MG1A 3X2QB 2BOCC 2QE7G 1K4DC 3E89A 2LFRA 1VQ9V 1OCOC 2P6JA 3CCRV 4F4LA 3JYCA 4PDLA 1PNKA 3K9AA 4LBEC 4FPPA 1FFTB 3AG3C 3VBBA 3D3IA 3K0DA 4LC1A 4QPJA 4HAMA 1NVPB 3SYPA 2IJJA 2JK5C 2QEXV 1F51A 5B1AC 4JAUA 3VOUA 5IY5B 3BEHA 4PDMA 1SESA 5LGTA 1H8HG 1GM9A 2NLJC 2ZD9A 3F5WC 2GSMB 3SPCA 5CA3A 5IYBO 1DLBA 3ZMVA 3A0RA 2WAMA 3TETA 3FYIB 2HLDG 4CZZA 1K8AW 1V55C 1YITV 3ABKB 3AG4C 4MSWC 3ASOC 1PNLA 3OM3B 5H6RA 2IJKA 3CPWU 5KUMA 4LP8A 3JCZA 4RAIA 1PD3A 4YXWG 2C2AA 5CBFA 3FB8C 3EFFK 3I56V 2D3OW 2ZR2A 1Q82W 2EJRA 1E79G 2X7RB 1Q81W 2ZDIC 3JD2A 3MHHC 4QE7A 2XAQA 1S5HC 2DQ0A 1KP2A 3IFXA 5E1AC 1TUEB 4JYCA 2WLHA 3X2QC 3ASNB 3OGCC 1K97A 5L3BA 1CPYA 1WPXA 4GX5A 1JPXA 3ZMSA 1VQKV 2LFSA 2WPDG 3KG2A 4U7NA 1SERA 3DTUB 4FK5C 1B6QA 4MTFA 4TWKA 5LGNA 3CMAV 3NXSA 3SPGA 4R50A 4BIZA 4FJCC 4GX0A 1AJQA 5CBHA 2HR3A 5IY5C 4PA9A 4JAVA 1GM7A 4E2LA 5B3SB 2EZOA 1XL6A 1BL8A 2W6IG 2IH1C 1NH2B 2WLKA 4MVQA 3ABKC 3QO8A 1S76D 1M57B 3LUTB 4Q20A 2QA4V 1M56B 3CD6V 1K9MW 4R8CA 2BOBC 1SZTA 5HFMA 2V7QG 3E8BA 1SRYA 3W7SA 3CC2V 1Y66A 3QNEA 2QM8A 1YIJV 4UXNA 3SYCA 1VQNV 1R3IC 2Z3YA 1GKFA 1JQ0A 1R3KC 1MOFA 3P30A 4MTGA 1Q86W 5H6QA 1QCEA 4ZKIA 1NQTA 4JASA 2XAFA 1Y4MA 1F23A 1DF5A 2Q67A 1ZWIC 1XL4A 3ASNC 3OMNB 3OR7C 2WSSG 3QO5A 1AI4A 2XAJA 2ZR3A 5B1NA 3G71V 2K1EA 4MVRA 5EBLC 1N8RW 3BY6A 1K73W 1YHQV 2Q6AA 3GB7C 1YJ9V 1RPRA 3FB6C 4QE9A 5LHIA 4KP4A 3MD0A 3RBZA 1FXHA 5CMUA 5B3SC 1FS0G 2OT5A 3LNMB 3IGAC 3T4ZA 2NNUA 1VQ8V 2P90A 2XNDG 2ITCC 3D36A 5J9PC 1F4MA 1M57C 1M56C 1K33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BEH A;  2EIM C;  4WFH A;  4RUF A;  4PDM A;  3ABM C;  3SYQ A;  2NLJ C;  3F5W C;  2ZD9 A;  2A0L A;  2HG5 C;  3LDD A;  3AG1 C;  3SPC A;  3T1C A;  1KKD A;  2A79 B;  2HFE C;  4I9W A;  3TET A;  4HYO A;  1V55 C;  4MSW C;  3AG4 C;  3ASO C;  3T2M A;  4P2Z A;  3UKM A;  5KUM A;  4LP8 A;  1OCZ C;  4RAI A;  2AHZ A;  4G27 B;  3SJQ C;  4XDJ A;  3SYA A;  4PDR A;  4PA4 A;  4X89 A;  5CBF A;  2WLI A;  3K06 A;  1P7B A;  3E8H A;  3EFF K;  3FB8 C;  4GX1 A;  3RVY A;  4MVO A;  4HZ3 A;  4GX2 A;  3K08 A;  4XDL A;  4WFF A;  4DXW A;  1LNQ A;  3SPJ A;  4QE7 A;  4BW5 A;  3E8G A;  3F7Y C;  1S5H C;  3IFX A;  5E1A C;  4X88 A;  2WLH A;  3X2Q C;  3OGC C;  1QLE C;  4R6Z A;  3TCU A;  2P7T C;  2H8P C;  2IH3 C;  4GX5 A;  5BZB A;  1OCR C;  3LDE A;  4J9Y B;  3KG2 A;  3PJS K;  5CBG A;  2DYS C;  5EC1 C;  4MTF A;  4TWK A;  3SPG A;  4R50 A;  4WFG A;  5EC2 C;  3K04 A;  4X8A A;  3STZ C;  2A9H A;  4GX0 A;  4MW8 A;  4RUE A;  2AHY A;  3T4D A;  4EKW A;  5CBH A;  4PA6 A;  4UUJ C;  2WLL A;  4H33 A;  5IY5 C;  4PA9 A;  2QKS A;  1OCC C;  4H37 A;  5EBM C;  2Q68 A;  2OCC C;  2QTO A;  1J95 A;  1V54 C;  3F7V C;  5EBW C;  1XL6 A;  1BL8 A;  2IH1 C;  3ZRS A;  4P30 A;  3UM7 A;  2WLK A;  2X6A A;  4MVQ A;  3SPI A;  3ABK C;  3AG2 C;  5B1B C;  4MVM A;  2WLJ A;  3LUT B;  4P9P A;  4XDK A;  2ITD C;  3ZJZ A;  4R8C A;  2BOB C;  4CBC A;  4ZBM A;  3E8B A;  3HPL C;  2YEV A;  3STL C;  2DYR C;  3SYC A;  3WG7 C;  1R3I C;  2ZXW C;  4JTD B;  1R3K C;  4PA3 A;  3R65 A;  1K4C C;  2WLL B;  2WLI B;  3E83 A;  4MTG A;  2KB1 A;  3RVZ A;  2R9R B;  3OUS A;  4MW3 A;  4KFM A;  4MTO A;  3OR7 C;  1JVM A;  2Q67 A;  1ZWI C;  1XL4 A;  3ASN C;  2Y69 C;  3ABL C;  3RW0 A;  2DWE C;  4JTC B;  4QNH B;  3K0G A;  3FB7 C;  4R7C A;  2EIN C;  5KUK A;  2K1E A;  4J9Z B;  2WLM A;  4MVR A;  3K03 A;  2EIL C;  4PDV A;  5EBL C;  3SYO A;  3E8F A;  2ATK C;  2HVK C;  4WFE A;  2WLN A;  3SPH A;  2DWD C;  1R3L C;  2X6C A;  2EIJ C;  4LCU C;  4G28 B;  4P9O A;  2Q69 A;  2X6B A;  2Q6A A;  1ORQ C;  1R3J C;  3FB5 C;  3GB7 C;  3FB6 C;  3OR6 C;  4JTA B;  4MVS A;  4MVU A;  4QE9 A;  4RO2 A;  2BOC C;  1K4D C;  2EIK C;  4PA7 A;  3E89 A;  3RBZ A;  4MS2 A;  1OCO C;  5B3S C;  3LNM B;  4F4L A;  3IGA C;  2HVJ C;  3JYC A;  4PDL A;  3T4Z A;  5EK0 A;  3OUF A;  4LBE C;  3E86 A;  2HJF C;  3AG3 C;  2ITC C;  5J9P C;  3K0D A;  4OXS A;  1M57 C;  3SYP A;  2W0F C;  1M56 C;  2JK5 C;  4MVZ A;  3LDC A;  1G4Y B;  5B1A C;  3VOU A; 
#chains in the Genus database with same CATH topology
 4RUF A;  4LH6 A;  1H2N A;  3BRC A;  4JGS A;  2OCC B;  1RM1 B;  2HG5 C;  4J7Z A;  5JQG B;  1S72 V;  1NZ6 A;  5AG2 A;  1R6N A;  1I5X A;  5EIB C;  2Q8V A;  1S3J A;  3BHP A;  2WA4 A;  4LH7 A;  5DEC A;  1QVF U;  3CP1 A;  1QU7 A;  2QWP B;  3ETE A;  4DK1 A;  3ZED A;  1XOU A;  3D3Q A;  2GBO A;  4BW5 A;  2ETN A;  5J2T A;  2FKX A;  1EZJ A;  1H2K A;  2ZM6 B;  5GTH Z;  4YY3 O;  5LYJ B;  2H8P C;  3E22 B;  2JS5 A;  3ABM B;  3UCS C;  1DTO A;  4ZHQ B;  3I55 V;  3QTC A;  3ETQ A;  4EFB A;  5EC2 C;  3U0Z A;  4I0X A;  2GTS A;  2PF4 E;  2Q4P A;  3FX7 A;  2AHY A;  3GWO A;  3T4D A;  4K0K B;  5JCO A;  3ZHU A;  1H38 A;  4GUN A;  4H33 A;  1OV9 A;  4X1Y B;  4JI2 B;  2RDC A;  2ZIM A;  3OTO B;  2XHB A;  1OJH A;  1VF7 A;  1TVK B;  1Z5W A;  1SC5 B;  2ITD C;  4PI2 A;  1FXK C;  4JI0 B;  3GVM A;  4Z1V A;  3HPL C;  3WG7 C;  3H1J H;  3LSS A;  1IXB A;  2RMK B;  2WLL B;  2P4V A;  2YC0 A;  3M7M X;  3DSQ A;  4JV5 B;  2OIG A;  1Q8I A;  2YDE A;  4IL6 Z;  3B40 A;  1SS3 A;  1R1B A;  1K5S A;  3OEH G;  2HVK C;  2X6C A;  2EZP A;  3CRM A;  1J5E B;  4MVS A;  4AQY B;  4BWA A;  2EIK C;  4PA7 A;  1VQ5 V;  4LF6 B;  5LMU B;  3IJ4 A;  2HVJ C;  2UUA B;  4DV4 B;  4OXS A;  4UV9 A;  3B8N A;  4MVZ A;  3BPZ A;  4X62 O;  4DR7 B;  5H9C A;  2OTL V;  5JCO C;  1K5Q A;  1FJG B;  2BCC H;  4U3J A;  3AG2 B;  1NTZ H;  1BHB A;  2CK3 G;  4FM0 A;  3APQ A;  3UO2 A;  4JYB A;  2ZE8 A;  4MVO A;  4HZ3 A;  4DR4 B;  3K08 A;  3J7A U;  2WWW A;  1OCO B;  3UQ8 A;  3TGU H;  5LP6 B;  4NTX A;  4UB8 Z;  4QGP A;  3RT3 C;  5L3D A;  4FLV A;  3ABL B;  4BAY A;  4DV5 B;  3CRC A;  4JF3 A;  2ZDI A;  1EFR G;  4O4J A;  1SQB H;  4LF9 B;  2PZS A;  3H9V A;  2E74 B;  2KSD A;  1L0N H;  4PD4 F;  3P3N A;  1AP5 A;  1SQV H;  4O4I A;  5KA5 A;  2YIB D;  1NJI W;  4IIJ B;  5L3G A;  3ZHQ A;  3A8T A;  3PN1 A;  4JAA A;  5KHH A;  4BR6 A;  3FD9 A;  4GKJ O;  2LP7 A;  2Q7H A;  4XBF A;  4LF7 B;  3E83 A;  4NYK A;  5IYD O;  3M8A A;  4UCV A;  4JTC B;  4Z2W A;  3Q4H A;  2GHY A;  5KUK A;  1XMO B;  4J9Z B;  4DUY B;  1DK1 A;  4BIU A;  4LF5 O;  3K58 A;  1ORQ C;  3FB5 C;  3W7W A;  4NB5 A;  3P3P A;  4UCO A;  2DMX A;  1IBK B;  1HP8 A;  3RYC A;  5L3F A;  3B4S A;  2V4D A;  4GYC B;  1PNM A;  3SYQ A;  3L70 H;  4DV0 B;  2Y48 A;  4I9W A;  4X66 O;  3JAM N;  2A7W A;  2OYQ A;  4BW9 A;  3ZN0 A;  1N33 B;  1NR1 A;  3CCL V;  3RVY A;  5A2Q N;  3HKE A;  4I9Q A;  1SQF A;  1HNW B;  3BA8 A;  1LNQ A;  1M5I A;  4KHP O;  1S0V A;  4B3R B;  4J80 A;  4FIP C;  1IX9 A;  5B1O A;  4DV7 B;  2FML A;  3OE7 G;  4WBN A;  1WN7 A;  3L74 H;  4I55 A;  3G6E V;  1AI7 A;  3STZ C;  2Q5Z A;  1GN4 A;  2PI5 A;  1Z2G A;  1SET A;  2ZIN A;  5EBM C;  4UFZ A;  4JI2 O;  1NR7 A;  1MSW D;  4LFC O;  4LF8 B;  5LXT A;  2JVD A;  3CRA A;  4P9P A;  4DV2 B;  3UT5 A;  1X4T A;  3JAL A;  3ZHR A;  2B1G A;  4U3J B;  4LFA O;  1S5J A;  2P67 A;  1Y74 A;  4DV6 O;  4FLW A;  1XMQ O;  1Q3E A;  4NKG B;  2HKO A;  3ASO B;  3APO A;  3AEI A;  1AR4 A;  5KAF Z;  5IYZ B;  3K5L A;  5EYP B;  5IJ0 B;  1ZX3 A;  2YIB A;  4JV5 O;  1QBZ A;  1US6 A;  1AB3 A;  4LCU C;  2X6B A;  3X2Q B;  4O4J B;  4DV1 B;  2QE7 G;  1FD9 A;  3AK1 A;  4F4L A;  4PDL A;  1UFI A;  1BE3 H;  4EFE A;  5LMU O;  1VF5 B;  2UUA O;  2P5O A;  2E3C A;  4PDM A;  1SES A;  2ZD9 A;  5CA3 A;  5LL6 Y;  1DLB A;  3TET A;  2HLD G;  4DR7 O;  3CPW U;  5KUM A;  3H1K H;  3ICX A;  1U97 A;  1ZUQ A;  2K9P A;  4GKK O;  5EZY A;  3T1Y B;  3GWK C;  1WAZ A;  3I56 V;  3EFF K;  2FYU H;  1JMK C;  3OTF A;  1E79 G;  4B3S B;  3Q4H B;  2RN9 A;  3IFX A;  1TUE B;  2WLH A;  1CPY A;  1WPX A;  1HNZ B;  1JPX A;  3ZMS A;  1VQK V;  2LFS A;  2WPD G;  5KHI A;  3L75 H;  2VQF O;  3HR0 A;  1VAR A;  1ZL8 A;  2R72 A;  2UXD B;  4TUY B;  3J80 N;  3DC6 A;  4LF9 O;  5KMG A;  3RYC B;  1HR0 B;  5B3S B;  2EZO A;  2NR5 A;  5IE9 A;  4MVQ A;  3ABK C;  4LWS A;  1K9M W;  2N74 A;  3NR7 A;  3E8B A;  3W7S A;  1Y66 A;  4J41 A;  2UXB B;  3SYC A;  2Z3Y A;  2CTR A;  1GKF A;  3K59 A;  4ZKI A;  4ABM A;  2ZIO A;  4ZOL B;  1Y4M A;  4IHJ A;  1F23 A;  1ZWI C;  3ASN C;  5JH7 A;  3CRQ A;  1IBL B;  1HW7 A;  5LOV A;  5EBL C;  1L0L H;  4I50 A;  1XMO O;  4DUY O;  3L72 H;  1YJ9 V;  4I55 B;  5JQG A;  4B7E A;  3HKB A;  4DR1 O;  2PYJ A;  3JCU Z;  3T1H O;  2ZE7 A;  4D7T A;  5H2F Z;  1P7G A;  3CCV V;  4TSF G;  5LXT B;  5K1P A;  3UT5 B;  4JI3 B;  3C3S A;  3JAL B;  1V54 B;  2A79 B;  2CH7 A;  5LYJ A;  4HYO A;  1AI5 A;  4ZHQ A;  4G27 B;  1PL0 A;  4O4L B;  4U7O A;  4DW1 A;  2W0X A;  1GO3 F;  3E8H A;  2FTK A;  4LNU A;  5JWP A;  1N33 O;  1I5Y A;  3HKC B;  1N34 B;  4LF4 B;  2GDS A;  1KMI Z;  1IZ3 A;  2ADQ B;  1YSC A;  3RN4 A;  2EIM B;  1TGO A;  1CEZ A;  4TQF A;  2MK3 A;  5JJJ B;  2N04 A;  2DYS C;  2CTQ A;  2GTA A;  1XNQ O;  2HHH O;  1AJN A;  3JAW B;  1YJN V;  1KD1 W;  1KU9 A;  2WLL A;  4PI0 A;  2QKS A;  4L87 A;  2OCC C;  1RM1 C;  2ADP A;  2KG7 A;  5IDJ A;  4DV2 O;  2YEV A;  2D2C B;  2ODM A;  5KA6 A;  5E79 Z;  5EZY B;  3E2E A;  4PA3 A;  4UVA A;  2KB1 A;  4EEQ A;  1K7D A;  1XIL A;  1GM8 A;  2L6L A;  4IYH A;  2A06 H;  1NKD A;  1JVM A;  1W2B U;  3R66 A;  1NH2 D;  1F7Y A;  4AHC A;  5JVD B;  4J7J A;  4R7C A;  2E5L B;  4WF9 V;  1RFY A;  3WFV A;  4WFE A;  4JI7 B;  3FAV B;  2Q73 A;  3BCC H;  1KYO F;  3KCX A;  1AR1 B;  1OCR B;  3CYO A;  4DV1 O;  2IM9 A;  1EZV H;  1WJZ A;  2HJF C;  2JJ1 G;  2Q7E A;  1H2G A;  3K5M A;  2CGN A;  2HJD A;  1ZAU A;  1W0K G;  4LWS B;  5J2U A;  3JAR B;  1KP3 A;  4YHH B;  3RGB A;  1BQ0 A;  2BTQ A;  4DV3 O;  5B1B B;  1N32 B;  4X89 A;  1GTO A;  4IHJ B;  1GN6 A;  2ZXW B;  5JH7 B;  1XI1 A;  1HNX O;  3ML0 A;  4DXW A;  2AXT Z;  3SPJ A;  1FYJ A;  2F4V B;  3CS5 A;  3C90 A;  1YDX A;  5LOV B;  2QM7 A;  4IIJ A;  3H1I H;  2PGG A;  4I50 B;  2IH3 C;  1I0H A;  3OEE G;  5LGU A;  2EIN B;  4DR2 B;  3HKB B;  1HNZ O;  4X20 A;  2V1D A;  1N4C A;  3AG4 B;  4EKW A;  2CTW A;  5C93 A;  1G8M A;  4FM2 A;  2UXD O;  5LHH A;  2LO1 A;  1QVG U;  3AG2 C;  2CH7 B;  1THZ A;  4E4E A;  4TQD A;  3L71 H;  1ZTE A;  5CN0 A;  1FKA O;  4DUZ B;  5LP6 C;  1MAB G;  4LNU B;  5KLV H;  3OUS A;  4NVP A;  4B7K A;  1OCZ B;  3CXC U;  2ZE6 A;  3ABL C;  4KXR A;  1YVW A;  4J11 A;  3FB7 C;  3KKY A;  4YJ3 B;  2ZNI A;  2WLM A;  3E8F A;  4TOI A;  3SPH A;  1V9P A;  1COW G;  2Q69 A;  3CXH F;  4JTA B;  3QO7 A;  4RO2 A;  2IJI A;  1B06 A;  3D36 C;  2ZE5 A;  1JOY A;  1VQM V;  2IU0 A;  1XHX A;  3HKD A;  2BE3 A;  2O57 A;  2X0L A;  3FFQ A;  1GAX A;  4JPR A;  3LDC A;  3STL C;  1G4Y B;  3ABU A;  1KUQ A;  3CJH B;  2A0L A;  2KG7 B;  1IBM B;  4KUM A;  2ZKO A;  3LSU A;  2YEV B;  3WB1 A;  3A2F A;  1R6K A;  1Q5O A;  4OGQ B;  2DOS A;  2UU9 O;  5IJ9 B;  1SA0 B;  3CME V;  3CCM V;  4U3F H;  4X64 B;  4BIO A;  4WFF A;  3L73 H;  3D8C A;  3F7Y C;  2XAH A;  1N34 O;  4X88 A;  3BAA A;  2YXY A;  5B5E Z;  1I08 A;  1SQP H;  2UUB B;  1JJ2 U;  4JI4 O;  4UVB A;  5LA6 A;  3W7X A;  4OX9 B;  3JAK B;  1ZLZ A;  2EIL B;  1IXM A;  4FMT A;  3RYH A;  4TV9 A;  4PA6 A;  2XOK G;  4NXN B;  4UV8 A;  1OCC C;  4N23 A;  1U96 A;  1JX9 A;  2JIZ G;  4FVM A;  1BS3 A;  4DR5 B;  5BR8 O;  3AK2 A;  3EHB B;  4JI6 O;  4P30 A;  5J2U B;  5IYZ A;  3SPI A;  5EYP A;  5IJ0 A;  2BTQ B;  2CAZ C;  5DN6 G;  1O9G A;  1G1X B;  2Q9L A;  1N0N A;  3ZHS A;  2DW4 A;  1VMG A;  1ENV A;  3OT7 A;  4C7U A;  2R9R B;  2QDO A;  2Y0P A;  1YJW V;  3DXR A;  3ETD A;  4CS3 A;  3B8M A;  1D5N A;  3ZS8 C;  2M6Y A;  1SQX H;  2VQE B;  2XAG A;  2GUZ A;  1R3L C;  1IDS A;  4CH3 A;  4G28 B;  1TAE A;  3OR6 C;  4X20 B;  4B3M B;  1MG1 A;  2UUC O;  1K4D C;  3E89 A;  1VQ9 V;  1G6U A;  1PNK A;  2E75 B;  1FFT B;  2OWO A;  4LC1 A;  1NVP B;  4HAM A;  1KB9 F;  2QEX V;  1F51 A;  1I7F A;  3EXA A;  4JAU A;  5IY5 B;  1H8H G;  4DW0 A;  1GM9 A;  3F5W C;  3A0R A;  1K8A W;  3ASO C;  4JI1 B;  4YHH O;  2IJK A;  4DR3 B;  4LP8 A;  1URF A;  4YXW G;  2C2A A;  3BVO A;  4UCS A;  3FB8 C;  4K8Z A;  4CC6 A;  2ZR2 A;  4JI8 O;  2P22 C;  4TUY A;  4FLU A;  4IT5 A;  2X7R B;  4JYA O;  1Q81 W;  2ZDI C;  2FB5 A;  1KP2 A;  1JA8 A;  4JYC A;  2EX3 A;  3X2Q C;  1VF6 A;  2R9A A;  3KG2 A;  3DTU B;  3SPG A;  4R50 A;  4FJC C;  3CRR A;  1IVS A;  2PY5 A;  5CBH A;  2HR3 A;  3HKD B;  5B66 Z;  1FPO A;  2EJ7 A;  1GM7 A;  5DED A;  4ZOL A;  2B9Z A;  1BL8 A;  2IH1 C;  5BMV B;  5D5Q A;  1NS1 A;  4PJ0 Z;  1NH2 B;  2HP8 A;  3QO8 A;  2QA4 V;  1M56 B;  5FNV A;  2ZM6 O;  1TA8 A;  1YIJ V;  1VQN V;  2IBZ H;  3TXQ A;  1QCE A;  1NQT A;  3SGI A;  1SZX A;  3OR7 C;  2Q67 A;  1Y6X A;  4O4H A;  3QVN A;  4K0K O;  1PPJ H;  1PV0 A;  2ZR3 A;  5B1N A;  1P84 F;  2K1E A;  5A9G A;  1N8R W;  3OTO O;  5LA6 B;  1K73 W;  1YHQ V;  3GB7 C;  3MD0 A;  3S3X A;  4JI0 O;  3RYH B;  4TV9 B;  1H2L A;  5CMU A;  5B3S C;  1FS0 G;  4O4L A;  2XT9 A;  2LJ2 A;  3HKC A;  1ROP A;  4WFH A;  4PHZ A;  5BXZ A;  4B3T B;  3VQW A;  4FLY A;  4DR6 B;  3LSQ A;  1VQ7 V;  3SJA C;  4W4K A;  2AHZ A;  3SJQ C;  3N27 A;  2Y0I A;  4XDJ A;  4FM1 A;  1GK9 A;  4CH6 A;  2DE0 X;  2PUS A;  4AQY O;  3K06 A;  2WLI A;  1P7B A;  3JAW A;  4TV8 A;  1J5E O;  1MZE A;  3DXR B;  1Q6U A;  4LF6 O;  5IYC O;  2JS3 A;  3G4S V;  3OFN G;  3B2E E;  3N2G B;  4WCE V;  1NI8 A;  1P4R A;  1AJP A;  4DV4 O;  2PYL A;  3K3W A;  2GUZ B;  3CEI A;  2JEX A;  1R73 A;  4AIL C;  3OAA G;  2IU3 A;  2UUB O;  4LR3 A;  4JI5 B;  4WFG A;  2ILM A;  1E1R G;  4RUE A;  2AZ2 A;  1FJG O;  1RPO A;  4FFK A;  1H8E G;  3OD4 A;  2G38 A;  2QTO A;  1V54 C;  3F7V C;  3ZRS A;  4DR4 O;  2F43 G;  2LW1 A;  5JVD A;  2GV9 A;  1T5E A;  4J10 A;  1XNR B;  3ZJZ A;  4MTX A;  5GON B;  2JDI G;  4X1K A;  3I5D A;  3IC7 A;  3AG1 B;  2R9I A;  3FAV A;  3FKS G;  5KHG A;  4DV5 O;  1NT2 B;  1VQ4 V;  1XQ8 A;  2WA3 A;  3UO3 A;  2QR4 A;  3ETG A;  5H5N A;  1ZSP A;  4MTO A;  1ARO P;  3N2K A;  4WFB V;  3JD4 A;  1Q6H A;  2DQ3 A;  2YS8 A;  2WLN A;  3ZMU A;  4FLT A;  3JAR A;  3K57 A;  4DO2 A;  1R3J C;  1QLE B;  3SR2 C;  3G6B A;  3HB3 B;  1SF9 A;  2ARH A;  5EK0 A;  4PEL A;  1GH6 A;  3E86 A;  3M99 B;  4LF7 O;  3RFR A;  4NTY A;  4YY3 B;  4TT3 G;  4QPK A;  2Q0O C;  3KZI Z;  2IW5 A;  2QWQ B;  4CC5 A;  5FNV B;  4JZG A;  1L8D A;  4F6E A;  1BGY H;  4CS2 A;  3VQX A;  3AK3 A;  4GX1 A;  1UPG A;  4GLX A;  4O4H B;  3E8G A;  2CGO A;  5LMN B;  3JAS B;  2Y69 B;  1IBK O;  2P7T C;  2E76 B;  2FL4 A;  1OCR C;  3LDE A;  3EVK A;  2JEU A;  5L3E A;  1I94 B;  1KC8 W;  2YI9 A;  4J42 A;  4DV0 O;  4UVC A;  5DM6 V;  4H44 B;  1Y76 A;  1WB7 A;  2QKC A;  4LFB B;  1CP9 A;  1NVP D;  5EBW C;  3ZIA G;  3CSX A;  4OPA A;  4CH5 A;  1HNW O;  4WFA V;  5B1B C;  2LGW A;  4YJ3 A;  3TK1 A;  4CBC A;  4O2A B;  2XAS A;  4B3R O;  5FPR A;  1H2M A;  1KKC A;  2ZXW C;  2N05 A;  4DV7 O;  2WLI B;  4TV8 B;  4GT1 A;  1OZ0 A;  1SQQ H;  1WLE A;  4NXM B;  4X62 B;  1NTK H;  3BFR A;  3E35 A;  2EIN C;  1UJW B;  5GW7 A;  4X9Q A;  1YZB A;  3CJH A;  4P9O A;  2B1I A;  4LF8 O;  2Q0A A;  3K79 A;  2UXX A;  2ZT9 B;  5LHG A;  2IJH A;  3ZRV A;  5IJ9 A;  1SA0 A;  4Z1M G;  3BAB A;  4RQF A;  2W0F C;  1BMF G;  2F95 B;  2H3O A;  3ABM C;  1WPB A;  2KKW A;  3RYI A;  5FLX N;  4X1K B;  3W7U A;  2XUM A;  4A5U B;  4DR6 O;  1AIL A;  4I4T A;  3UKM A;  3CB2 A;  3JAK A;  1SKV A;  1OCZ C;  4UCU A;  2LW7 A;  1MA1 A;  1QR9 A;  2VRZ A;  1XRE A;  2JGD B;  1YTF B;  2DYR B;  4HNA A;  2A3Q A;  4NTW A;  1XUQ A;  5CB4 A;  1SQG A;  3N2K B;  3FYE B;  4R6Z A;  3TCU A;  5LBQ A;  4GKJ B;  1BT8 A;  3CX5 F;  3ZMZ A;  5GTI Z;  2EIJ B;  3DC5 A;  1VIB A;  4JI5 O;  5FL7 G;  3ZMT A;  2CTP A;  1Q7Y W;  1O9H A;  2Q68 A;  3T1Y O;  2OTJ V;  1AI6 A;  4K3A A;  4YJ2 B;  4LF5 B;  2X6A A;  3AG3 B;  4B3S O;  3ZX6 A;  5B1A B;  4FFB B;  2Z5U A;  1D5A A;  5F2V O;  3WU2 Z;  1BZK A;  4JTD B;  1E1Q G;  3R65 A;  2DYS B;  1FXK A;  1V55 B;  3RVZ A;  1YCI A;  4KFM A;  1XHZ A;  4RQE A;  2BSK A;  2P06 A;  2EBO A;  2DWE C;  4X66 B;  3K0G A;  3K03 A;  4FZ1 A;  2EIL C;  2Y4T A;  3SYO A;  1HR0 O;  3ABT A;  1K92 A;  4MVU A;  2F93 B;  1WA8 A;  1Y76 B;  1OCO C;  2P6J A;  3CCR V;  2UXB O;  4LBE C;  4KHP B;  4FPP A;  3D3I A;  1FAF A;  4QPJ A;  2UXC B;  3SYP A;  2IJJ A;  4DRX B;  3SDL A;  2F66 C;  4DYL A;  5CA0 B;  3BEH A;  5CA1 B;  2AZ0 A;  5LGT A;  1IBL O;  2GSM B;  3SPC A;  1RSO A;  1MMM A;  4CZZ A;  4MSW C;  5H6R A;  1PNL A;  3OM3 B;  5JJN B;  3JCZ A;  1PD3 A;  1XBL A;  1IUR A;  5CBF A;  2P4K A;  3B09 A;  1LUW A;  4LFC B;  2EJR A;  2BTO A;  2XAQ A;  4LFA B;  5BMV A;  3IAY A;  5BY1 A;  1TUB A;  5L3B A;  4DV6 B;  1XMQ B;  1YEW A;  5LMN O;  1SER A;  4FK5 C;  4JI3 O;  4TWK A;  3CMA V;  3A0B Z;  1I94 O;  1W59 A;  4GX0 A;  5IT9 N;  1AJQ A;  2Z0A A;  4O2B B;  5IY5 C;  4EB6 A;  4PA9 A;  3ZHT A;  2LGQ A;  4JYY A;  1XL6 A;  2W6I G;  2YXH A;  4LFB O;  4FLX A;  2WLK A;  1S76 D;  1M57 B;  3H1H H;  4Q20 A;  4ICG A;  3RYI B;  4LF4 O;  3CD6 V;  4R8C A;  5HFM A;  4IYI A;  2V7Q G;  1SRY A;  4I4T B;  4ZIB A;  2QM8 A;  4UXN A;  1JQ0 A;  3JSN A;  1VP7 A;  2CE4 A;  2Q7G A;  1MOF A;  3P30 A;  4HNA B;  1DF5 A;  5CB4 B;  2WSS G;  1S5L Z;  4NXM O;  2XAJ A;  4Q6G A;  1BQZ A;  3MAQ A;  1EN5 A;  1X59 A;  4GKK B;  1RPR A;  3FB6 C;  5LHI A;  2Y4U A;  4KP4 A;  4F6R A;  3LNN A;  1FXH A;  2ZCE A;  1PP9 H;  3IGA C;  1MZF A;  2QM4 A;  2R70 A;  1VQ8 V;  2P90 A;  2XND G;  4K35 A;  2ITC C;  4HBN A;  3CWB H;  4KL1 A;  1M56 C;  1B04 A;  1NTM H;  5C8Y A;  3CC4 V;  3CCE V;  2OCH A;  2RJZ A;  3N2G A;  2VQF B;  2E5L O;  1WB8 A;  3OGI B;  1GRJ A;  3O65 A;  1XDC A;  2PTM A;  2B5U A;  4JI7 O;  1FXK B;  4PDR A;  2VS0 A;  2JJ2 G;  3G80 A;  5TIS Z;  4PA4 A;  3ZBH A;  1VQ6 V;  3WG7 B;  2BSK B;  1YF2 A;  4GX2 A;  1N36 B;  4XDL A;  2M7W A;  4I7Z B;  3G67 A;  3JD1 A;  2L35 A;  3OMI B;  5EC1 C;  5GON A;  1WA8 B;  1QQC A;  3CE2 A;  1CXZ B;  3THO A;  1K3E A;  1NU1 H;  4X8A A;  4ASU G;  4MW8 A;  1BHA A;  1N32 O;  3K5O A;  2KQX A;  2EIK B;  4H37 A;  3B77 A;  5J2T B;  3ZHV A;  1QNM A;  3SJC C;  2RNB A;  1XEQ A;  1W0J G;  4JZ2 A;  2QWR B;  1PL4 A;  4MVM A;  5FPO A;  1RSO B;  2F4V O;  4DR1 B;  2QJ1 A;  4X65 B;  3VQY A;  3T1H B;  4I0X B;  4X1I A;  3SJB C;  3JD3 A;  1K4C C;  4DR2 O;  4DK0 A;  1YTF D;  3IC9 A;  4QIW F;  4MW3 A;  4H0L B;  3KCY A;  4YIP A;  1JFF A;  1OCC B;  1WP8 A;  2MW2 B;  2QTS A;  1TUB B;  2YUA A;  3CCS V;  2LQT A;  4J7K A;  3MHS C;  5ITZ A;  2YSU B;  1KQS U;  1OHH G;  3ZRX A;  3F5T A;  4IGG A;  1AVM A;  4EB6 B;  2QWN B;  2F1M A;  1EBO A;  4MT8 A;  1KBH A;  3ZRW A;  4DUZ O;  1M93 A;  3CCU V;  1LR1 A;  1K34 A;  2UXC O;  3LDD A;  3AG1 C;  4GCZ A;  1EM1 A;  1Q6I A;  1KKD A;  3JAS A;  1XNQ B;  2HHH B;  4NR1 A;  2YIA A;  3T2M A;  2OIE A;  4P2Z A;  5IWA B;  5JJE B;  3ZCC A;  5K1X A;  3H01 A;  2F23 A;  2ZNJ A;  4YIO A;  3C3T A;  1VF6 C;  3J81 N;  4W4L A;  1YXB A;  1QLE C;  3RYF A;  5BZB A;  2NN4 A;  2VWK A;  3W7T A;  1M90 W;  1QLN A;  4F6R B;  1Q90 D;  1DGS A;  4O2A A;  1IBM O;  1DF4 A;  1EN6 A;  1M4U A;  1QR8 A;  4D6T H;  5C8Y B;  3K5N A;  3AG7 A;  5L3C A;  1M9N A;  3UM7 A;  4X64 O;  3K9S A;  1PM9 A;  4ZBM A;  1VQL V;  2XTA A;  3CHX A;  1EN4 A;  2RQ6 A;  4OX9 O;  3ZN1 A;  2QWO B;  4CS4 A;  4L8J A;  1B3Q A;  2YI8 A;  1S77 D;  4O4I B;  1VEW A;  2Y69 C;  4AI8 A;  2ZQM A;  3RW0 A;  4NXN O;  4DV3 B;  3WB2 A;  4DR5 O;  3QG5 A;  3VQV A;  3CCQ V;  3OMA B;  4MS2 A;  1HNX B;  2W6J G;  4ZI7 A;  2UXN A;  1GMG A;  3OUF A;  5KX5 A;  2JGD A;  1AP6 A;  4GZR B;  3CC7 V;  4I5S A;  2EIM C;  4UCT A;  3TJT A;  4CH4 A;  1VQP V;  3T1C A;  2QSA A;  1FXV A;  1HDJ A;  2HFE C;  4N21 A;  1Q43 A;  1Y67 A;  4X1I B;  2VQE O;  3SYA A;  4B3M O;  1YI2 V;  5EIB D;  2JGU A;  5KAI Z;  3OW2 U;  1A32 A;  1JFF B;  1HWY A;  4G2K A;  2CDY A;  1N36 O;  4YJ2 A;  4J9Y B;  3CCJ V;  3JD0 A;  3PJS K;  2CUG A;  5CBG A;  5ITZ B;  4FFB A;  3K04 A;  1F4N A;  2A9H A;  1GN2 A;  3JAT A;  3HKE B;  4JI1 O;  4DR3 O;  4UUJ C;  5HFL A;  3ZRW B;  2QGN A;  4QJF B;  1FFX A;  1J95 A;  2WLJ A;  4XDK A;  1N0J A;  1PKX A;  2H94 A;  4WBN B;  1L1F A;  2AGA A;  3P32 A;  2DYR C;  3BA9 A;  4X65 O;  1M1K W;  1BSM A;  1VQO V;  2PI4 A;  1JCH A;  4QNH B;  4DRX A;  5CA0 A;  3RYF B;  5CA1 A;  4PDV A;  1WNS A;  2ATK C;  1KEC A;  1Y74 B;  2DWD C;  2JRI A;  1NBM G;  2EIJ C;  4UCR A;  3DGE A;  3E22 A;  3RWR D;  2UU9 B;  4FZ0 A;  2BOC C;  5KHJ A;  1R6T A;  4RWU A;  2LFR A;  3A0H Z;  1RP3 B;  3JYC A;  3K9A A;  3VBB A;  3AG3 C;  4X1Y A;  3K0D A;  1P49 A;  1D2D A;  2JK5 C;  5KHK A;  5B1A C;  3VOU A;  3H1L H;  4JI4 B;  4B08 A;  1QHT A;  2NLJ C;  1TVK A;  3WB0 A;  5IYB O;  3ZMV A;  4D7S A;  2WAM A;  3FYI B;  1V55 C;  4PV1 B;  1YIT V;  3ABK B;  3AG4 C;  3O9O A;  1H2S B;  4UB6 Z;  4RAI A;  2AW9 A;  5IWA O;  5BR8 B;  2D3O W;  4JI6 B;  3JSL A;  4O2B A;  1Q82 W;  3JD2 A;  3MHH C;  4QE7 A;  1S5H C;  2DQ0 A;  5E1A C;  3ASN B;  3OGC C;  1K97 A;  4GX5 A;  4B3T O;  4U7N A;  1LUV A;  3MDS A;  1B6Q A;  4MTF A;  5LGN A;  1WP7 A;  3NXS A;  4BIZ A;  2HEP A;  4ZI7 B;  2RCV A;  1MNG A;  5KX5 B;  4JAV A;  4E2L A;  2DN9 A;  2DJV A;  3S3W A;  4OPH A;  2YID A;  3LUT B;  3U10 A;  2UUC B;  2VWJ A;  1AR5 A;  2BOB C;  1SZT A;  1Z5V A;  3CC2 V;  3QNE A;  5D5P A;  1R3I C;  1ZL8 B;  4K8X A;  1R3K C;  3TXS A;  4MTG A;  1Q86 W;  5H6Q A;  5KMG B;  4JAS A;  2XAF A;  1XL4 A;  3OMN B;  3U11 A;  3QF7 A;  3QO5 A;  3L9D A;  5LP6 A;  1AI4 A;  1MSD A;  3G71 V;  4MVR A;  1BCC H;  2QKA A;  3BY6 A;  1GN3 A;  1JR9 A;  2Q6A A;  4QE9 A;  1XNR O;  4H13 B;  4FLZ A;  4JI8 B;  3RBZ A;  3JAT B;  2YIC A;  3LNM B;  2OT5 A;  4JYA B;  2EUL A;  3T4Z A;  2NNU A;  2YXL A;  1FFX B;  3D36 A;  5J9P C;  1F4M A;  1M57 C;  1JJO A;  1K33 A; 
#chains in the Genus database with same CATH homology
 1ROP A;  4WFH A;  3CCV V;  4RUF A;  4TSF G;  3CC4 V;  3CCE V;  4JGS A;  2OCC B;  1RM1 B;  2HG5 C;  1V54 B;  2A79 B;  1S72 V;  3LSQ A;  1VQ7 V;  4HYO A;  1R6N A;  1I5X A;  1S3J A;  1AI5 A;  2B5U A;  2AHZ A;  4G27 B;  1PL0 A;  4XDJ A;  1FXK B;  3SJQ C;  4PDR A;  2JJ2 G;  4PA4 A;  1GK9 A;  1QVF U;  3CP1 A;  4U7O A;  1VQ6 V;  2WLI A;  3K06 A;  1P7B A;  1GO3 F;  3E8H A;  3ETE A;  3WG7 B;  2FTK A;  1I5Y A;  4GX2 A;  5IYC O;  4XDL A;  3G4S V;  3OFN G;  4WCE V;  4BW5 A;  1P4R A;  2M7W A;  1AJP A;  1EZJ A;  1YSC A;  3K3W A;  2H8P C;  2JEX A;  2EIM B;  3JD1 A;  1CEZ A;  2MK3 A;  3ABM B;  1DTO A;  1R73 A;  3OAA G;  3OMI B;  2DYS C;  5EC1 C;  2IU3 A;  3I55 V;  4WFG A;  1K3E A;  5EC2 C;  4X8A A;  4ASU G;  1AJN A;  4MW8 A;  1E1R G;  4RUE A;  2AHY A;  3GWO A;  3T4D A;  1RPO A;  1YJN V;  1KD1 W;  1H38 A;  1H8E G;  1BHA A;  2WLL A;  4H33 A;  2EIK B;  2QKS A;  4H37 A;  4L87 A;  3B77 A;  2OCC C;  2QTO A;  1RM1 C;  1V54 C;  3F7V C;  3ZRS A;  2F43 G;  1W0J G;  4MVM A;  2ITD C;  3ZJZ A;  4MTX A;  1FXK C;  2JDI G;  3HPL C;  5IDJ A;  2YEV A;  3WG7 C;  5KA6 A;  3IC7 A;  3AG1 B;  2R9I A;  3FKS G;  3LSS A;  3E2E A;  4PA3 A;  3JD3 A;  1K4C C;  1VQ4 V;  2WLL B;  4UVA A;  1YTF D;  2KB1 A;  1K7D A;  1GM8 A;  3ETG A;  4QIW F;  4MW3 A;  4MTO A;  1NKD A;  1JVM A;  1W2B U;  1NH2 D;  1ARO P;  1OCC B;  4R7C A;  4WFB V;  4WF9 V;  3JD4 A;  3CCS V;  2DQ3 A;  3WFV A;  1K5S A;  3OEH G;  2HVK C;  4WFE A;  2WLN A;  3ZMU A;  2X6C A;  2EZP A;  4DO2 A;  1R3J C;  3MHS C;  1QLE B;  4MVS A;  2YSU B;  1KQS U;  1OHH G;  3ZRX A;  2EIK C;  4PA7 A;  1AR1 B;  1OCR B;  3CYO A;  3HB3 B;  1VQ5 V;  2HVJ C;  5EK0 A;  4PEL A;  1EBO A;  4MT8 A;  3E86 A;  2HJF C;  3M99 B;  2JJ1 G;  4OXS A;  3ZRW A;  4UV9 A;  1H2G A;  3B8N A;  4MVZ A;  4TT3 G;  4QPK A;  3CCU V;  1W0K G;  1K34 A;  3LDD A;  2IW5 A;  5H9C A;  1KP3 A;  3AG1 C;  4GCZ A;  2OTL V;  1KKD A;  1K5Q A;  1BHB A;  3AG2 B;  5B1B B;  3T2M A;  2CK3 G;  4P2Z A;  3ZCC A;  4JYB A;  4X89 A;  3H01 A;  1GTO A;  4GX1 A;  4MVO A;  4HZ3 A;  2ZXW B;  3K08 A;  2WWW A;  1OCO B;  3ML0 A;  4DXW A;  3SPJ A;  3E8G A;  5L3D A;  2QM7 A;  1QLE C;  2Y69 B;  2P7T C;  3ABL B;  2IH3 C;  4BAY A;  5BZB A;  1OCR C;  3LDE A;  4JF3 A;  2JEU A;  2ZDI A;  3OEE G;  5L3E A;  5LGU A;  1KC8 W;  2EIN B;  3W7T A;  1EFR G;  1M90 W;  1QLN A;  4UVC A;  5DM6 V;  2V1D A;  1DF4 A;  1QR8 A;  3AG4 B;  4EKW A;  5C93 A;  1G8M A;  1CP9 A;  1NVP D;  5EBW C;  5KA5 A;  5L3C A;  3ZIA G;  1M9N A;  5LHH A;  1NJI W;  1QVG U;  3UM7 A;  3AG2 C;  4WFA V;  5B1B C;  5L3G A;  3TK1 A;  1THZ A;  4CBC A;  4ZBM A;  1VQL V;  2XAS A;  5CN0 A;  2ZXW C;  2LP7 A;  4XBF A;  3ZN1 A;  2WLI B;  3E83 A;  1MAB G;  4GT1 A;  3OUS A;  1OZ0 A;  1WLE A;  1S77 D;  1OCZ B;  3CXC U;  5IYD O;  2Y69 C;  3ABL C;  2ZQM A;  3RW0 A;  4JTC B;  3E35 A;  3FB7 C;  2EIN C;  2GHY A;  5KUK A;  4J9Z B;  2WLM A;  1UJW B;  3E8F A;  5GW7 A;  4BIU A;  3SPH A;  4P9O A;  1COW G;  2Q69 A;  4JTA B;  1ORQ C;  2B1I A;  3FB5 C;  3QO7 A;  3W7W A;  4RO2 A;  2IJI A;  3K79 A;  2UXX A;  3CCQ V;  1JOY A;  1VQM V;  3OMA B;  2IU0 A;  4MS2 A;  5LHG A;  2W6J G;  2IJH A;  2UXN A;  1GMG A;  3ZRV A;  3OUF A;  4Z1M G;  2X0L A;  4RQF A;  3CC7 V;  2W0F C;  4I5S A;  4JPR A;  3LDC A;  3STL C;  1G4Y B;  5L3F A;  3ABU A;  1BMF G;  2EIM C;  1PNM A;  3ABM C;  3SYQ A;  1VQP V;  2A0L A;  3T1C A;  4KUM A;  1FXV A;  2Y48 A;  2HFE C;  4I9W A;  4N21 A;  2YEV B;  3W7U A;  3UKM A;  1R6K A;  1OCZ C;  3ZN0 A;  3SYA A;  1QR9 A;  1YI2 V;  3CME V;  1NR1 A;  3CCM V;  1YTF B;  2DYR B;  3CCL V;  3OW2 U;  3RVY A;  1HWY A;  4G2K A;  4WFF A;  1LNQ A;  3F7Y C;  2XAH A;  3FYE B;  1S0V A;  4X88 A;  4R6Z A;  3TCU A;  5LBQ A;  4FIP C;  5B1O A;  1JJ2 U;  4J9Y B;  3CCJ V;  3JD0 A;  4UVB A;  3ZMZ A;  3W7X A;  3PJS K;  3OE7 G;  5CBG A;  2EIL B;  3G6E V;  1IXM A;  1AI7 A;  3K04 A;  1F4N A;  4FMT A;  2EIJ B;  2A9H A;  3STZ C;  5FL7 G;  4PA6 A;  4UUJ C;  3ZMT A;  2XOK G;  2PI5 A;  5HFL A;  3ZRW B;  1SET A;  4UV8 A;  1OCC C;  4N23 A;  5EBM C;  4QJF B;  1Q7Y W;  2Q68 A;  2OTJ V;  1J95 A;  1AI6 A;  1JX9 A;  2JIZ G;  1NR7 A;  3EHB B;  4P30 A;  1MSW D;  2X6A A;  3SPI A;  3AG3 B;  2WLJ A;  4P9P A;  4XDK A;  1PKX A;  2H94 A;  5B1A B;  2B1G A;  2Z5U A;  1L1F A;  3P32 A;  2P67 A;  2DYR C;  5DN6 G;  2DW4 A;  4JTD B;  1E1Q G;  3R65 A;  2DYS B;  1ENV A;  1FXK A;  1V55 B;  3RVZ A;  1M1K W;  2HKO A;  2R9R B;  3ASO B;  3AEI A;  4KFM A;  1YJW V;  4RQE A;  1VQO V;  2PI4 A;  1JCH A;  3ETD A;  3B8M A;  2EBO A;  2DWE C;  4QNH B;  3K0G A;  3K03 A;  2EIL C;  1QBZ A;  4PDV A;  3SYO A;  2ATK C;  2XAG A;  1KEC A;  3ABT A;  2DWD C;  1R3L C;  3DGE A;  1NBM G;  2EIJ C;  1K92 A;  4G28 B;  4LCU C;  2X6B A;  4MVU A;  3OR6 C;  1MG1 A;  3X2Q B;  2BOC C;  2QE7 G;  1K4D C;  3E89 A;  2LFR A;  1VQ9 V;  1OCO C;  2P6J A;  3CCR V;  4F4L A;  3JYC A;  4PDL A;  1PNK A;  3K9A A;  4LBE C;  4FPP A;  1FFT B;  3AG3 C;  3VBB A;  3D3I A;  3K0D A;  4LC1 A;  4QPJ A;  4HAM A;  1NVP B;  3SYP A;  2IJJ A;  2JK5 C;  2QEX V;  1F51 A;  5B1A C;  4JAU A;  3VOU A;  5IY5 B;  3BEH A;  4PDM A;  1SES A;  5LGT A;  1H8H G;  1GM9 A;  2NLJ C;  2ZD9 A;  3F5W C;  2GSM B;  3SPC A;  5CA3 A;  5IYB O;  1DLB A;  3ZMV A;  3A0R A;  2WAM A;  3TET A;  3FYI B;  2HLD G;  4CZZ A;  1K8A W;  1V55 C;  1YIT V;  3ABK B;  3AG4 C;  4MSW C;  3ASO C;  1PNL A;  3OM3 B;  5H6R A;  2IJK A;  3CPW U;  5KUM A;  4LP8 A;  3JCZ A;  4RAI A;  1PD3 A;  4YXW G;  2C2A A;  5CBF A;  3FB8 C;  3EFF K;  3I56 V;  2D3O W;  2ZR2 A;  1Q82 W;  2EJR A;  1E79 G;  2X7R B;  1Q81 W;  2ZDI C;  3JD2 A;  3MHH C;  4QE7 A;  2XAQ A;  1S5H C;  2DQ0 A;  1KP2 A;  3IFX A;  5E1A C;  1TUE B;  4JYC A;  2WLH A;  3X2Q C;  3ASN B;  3OGC C;  1K97 A;  5L3B A;  1CPY A;  1WPX A;  4GX5 A;  1JPX A;  3ZMS A;  1VQK V;  2LFS A;  2WPD G;  3KG2 A;  4U7N A;  1SER A;  3DTU B;  4FK5 C;  1B6Q A;  4MTF A;  4TWK A;  5LGN A;  3CMA V;  3NXS A;  3SPG A;  4R50 A;  4BIZ A;  4FJC C;  4GX0 A;  1AJQ A;  5CBH A;  2HR3 A;  5IY5 C;  4PA9 A;  4JAV A;  1GM7 A;  4E2L A;  5B3S B;  2EZO A;  1XL6 A;  1BL8 A;  2W6I G;  2IH1 C;  1NH2 B;  2WLK A;  4MVQ A;  3ABK C;  3QO8 A;  1S76 D;  1M57 B;  3LUT B;  4Q20 A;  2QA4 V;  1M56 B;  3CD6 V;  1K9M W;  4R8C A;  2BOB C;  1SZT A;  5HFM A;  2V7Q G;  3E8B A;  1SRY A;  3W7S A;  3CC2 V;  1Y66 A;  3QNE A;  2QM8 A;  1YIJ V;  4UXN A;  3SYC A;  1VQN V;  1R3I C;  2Z3Y A;  1GKF A;  1JQ0 A;  1R3K C;  1MOF A;  3P30 A;  4MTG A;  1Q86 W;  5H6Q A;  1QCE A;  4ZKI A;  1NQT A;  4JAS A;  2XAF A;  1Y4M A;  1F23 A;  1DF5 A;  2Q67 A;  1ZWI C;  1XL4 A;  3ASN C;  3OMN B;  3OR7 C;  2WSS G;  3QO5 A;  1AI4 A;  2XAJ A;  2ZR3 A;  5B1N A;  3G71 V;  2K1E A;  4MVR A;  5EBL C;  1N8R W;  3BY6 A;  1K73 W;  1YHQ V;  2Q6A A;  3GB7 C;  1YJ9 V;  1RPR A;  3FB6 C;  4QE9 A;  5LHI A;  4KP4 A;  3MD0 A;  3RBZ A;  1FXH A;  5CMU A;  5B3S C;  1FS0 G;  2OT5 A;  3LNM B;  3IGA C;  3T4Z A;  2NNU A;  1VQ8 V;  2P90 A;  2XND G;  2ITC C;  3D36 A;  5J9P C;  1F4M A;  1M57 C;  1M56 C;  1K33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...