3K04A

Crystal structure of cng mimicking nak mutant, nak-dtpp, na+ complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
90
structure length
90
Chain Sequence
b'EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDTPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein NaK
publication title Structural studies of ion permeation and Ca2+ blockage of a bacterial channel mimicking the cyclic nucleotide-gated channel pore.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transport protein
total genus 30
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3k04A00
5CBHA 5IY5C 5B3SC 4RUFA 2DYSC 3WG7C 1P7BA 5B1BC 4LP8A 4MS2A 3SJQC 5EBLC 4JTAB 4RO2A 4P9OA 3ZJZA 4JTCB 3T4ZA 3LNMB 4P30A 2A79B 3SYQA 4ZBMA 4HZ3A 4MVUA 5EBMC 3RBZA 3AG4C 1OCRC 2Q69A 2QKSA 4R7CA 3F7YC 4BW5A 2X6AA 3LDDA 2EIJC 4GX2A 3R65A 4J9ZB 3T4DA 1BL8A 4CBCA 3KG2A 3RW0A 3X2QC 4I9WA 2A9HA 3F7VC 4MTGA 5EC2C 3TCUA 3UM7A 3AG1C 2IH1C 4LCUC 2WLMA 2Q68A 3ASOC 2ZXWC 4UUJC 4DXWA 1LNQA 4WFHA 1S5HC 3BEHA 2Y69C 2DWEC 3SPHA 4GX1A 1OCOC 2EILC 3FB6C 4H33A 1OCCC 4GX0A 3EFFK 2W0FC 2WLKA 1G4YB 4PA6A 5BZBA 3OUFA 3LDEA 4PDVA 3JYCA 3OR6C 1V55C 2X6BA 3SYCA 4G27B 2Q6AA 2WLIA 4PDLA 2WLIB 4H37A 2WLHA 4XDKA 1ZWIC 3OGCC 1XL4A 2AHZA 3SYOA 2ITCC 1R3LC 3K03A 2DYRC 4X8AA 5EBWC 3E83A 5EC1C 5KUMA 5J9PC 4QE7A 1K4CC 3F5WC 3IGAC 1K4DC 4RAIA 1M57C 4PA7A 2HFEC 2HJFC 3ABKC 2K1EA 3GB7C 3AG2C 4J9YB 2BOCC 4XDLA 3ASNC 4EKWA 1ORQC 3K08A 4WFGA 4MSWC 2NLJC 4P2ZA 1JVMA 4MVQA 4PA3A 5EK0A 4PDMA 3RVYA 3SPIA 3SYPA 5B1AC 4MTFA 2X6CA 3K0DA 1OCZC 2DWDC 4QE9A 2ATKC 2WLLA 5E1AC 3SPCA 2BOBC 3K0GA 4R50A 2Q67A 3PJSK 4OXSA 4MVSA 1R3KC 2P7TC 3E86A 2YEVA 4X88A 2HG5C 3STZC 5KUKA 3STLC 2JK5C 3SPGA 3RVZA 1XL6A 2ITDC 1R3IC 4MVMA 3LDCA 2KB1A 3T2MA 3UKMA 2AHYA 3FB5C 3SPJA 3E8FA 4MVRA 4WFEA 3E89A 2WLJA 4TWKA 4XDJA 3E8HA 3K06A 4LBEC 3T1CA 3OUSA 4RUEA 3LUTB 5CBGA 2IH3C 3K04A 2ZD9A 2EIKC 4R6ZA 4GX5A 4MVOA 4MVZA 3IFXA 4HYOA 3FB8C 1QLEC 4MW8A 4X89A 2QTOA 2OCCC 3ABLC 1R3JC 3E8BA 2A0LA 2HVJC 3OR7C 4MTOA 4P9PA 3ABMC 4F4LA 4QNHB 2EIMC 1KKDA 2H8PC 1V54C 3E8GA 4PA9A 3ZRSA 2WLLB 3SYAA 3VOUA 2EINC 3FB7C 4R8CA 1J95A 1M56C 2WLNA 3AG3C 3TETA 3HPLC 4KFMA 4JTDB 4MW3A 4G28B 5CBFA 2R9RB 2HVKC 4PA4A 4PDRA 4WFFA
chains in the Genus database with same CATH superfamily
4JAAA 4FK5C 1M90W 4RUFA 2AGAA 2Y69B 2EILB 1ZL8B 1ROPA 1U96A 2DJVA 1PKXA 3MDSA 1YJNV 1QCEA 1SQVH 3UCSC 3U10A 5B66Z 1KECA 3LDDA 4E2LA 4UCVA 3TXQA 1QHTA 1Y67A 2LW7A 4DV7B 1FXKA 1JMKC 2Z3YA 1L1FA 2ZIMA 4DRXA 2GUZA 4H44B 1JFFA 3CSXA 1OCCC 3H1KH 4CC6A 2ZKOA 1G4YB 2Q0AA 3G6BA 2YICA 1MNGA 4KL1A 5IYZB 4UV9A 1WP8A 5EIBD 5HFLA 1V55C 1HWYA 1ENVA 3OTOB 4K3AA 2OT5A 3OGIB 3BHPA 4LF6B 4ZKIA 1JR9A 1XMQO 4FLTA 1Y74B 1IBKO 1NI8A 2HP8A 3ZS8C 4YY3B 3GB7C 3HKDA 3CEIA 1QQCA 3MHHC 3B2EE 4MT8A 1JVMA 2RMKB 3QVNA 4X20B 4GKJB 2WLLA 5D5QA 1QVGU 4LFAO 1IXMA 4ZHQB 2Z0AA 4DK0A 2EZOA 4EB6A 5K1XA 3AG3B 2LFSA 3E8FA 1B3QA 1US6A 1VQ5V 5CBGA 3N2GB 2ZD9A 4YJ2A 3DC6A 3FB8C 5KAIZ 3RT3C 2UXBB 4JI8B 5FL7G 3JSLA 4QNHB 1KUQA 1ZTEA 1VP7A 2VWKA 5JQGA 1W59A 1UJWB 5H2FZ 1B6QA 2W6IG 4TOIA 1S0VA 5KA6A 5J2UB 1N36O 3GVMA 1JX9A 4DR5O 3WG7C 4I5SA 5JJEB 3ZEDA 2JJ1G 2YIBD 1J5EO 1XOUA 1OCCB 3CE2A 4LF9B 3ZHTA 5FPOA 2Q7EA 1V55B 4IHJA 4K0KB 4DV4B 2AXTZ 4H0LB 4CZZA 4KHPB 3BCCH 4BR6A 4HNAB 1B04A 2A9HA 4JI6B 5C8YB 3CB2A 4FFBA 4UB6Z 1WN7A 5L3FA 1OCOC 3QF7A 5CA1B 1DTOA 4B3SO 3UO3A 2CTQA 2W0FC 2WLKA 2O57A 4YXWG 2D3OW 4X1KB 3CXHF 2H3OA 3JD1A 4LFCO 1Z2GA 3UT5A 1NZ6A 3CC4V 3JARB 5BMVA 1B06A 1XBLA 2DQ3A 4LR3A 2NLJC 4DR7B 2KG7A 3L74H 2YXLA 4BIUA 1QU7A 1F51A 3SPCA 1FAFA 1WB7A 2QM4A 4DV0O 5IJ0B 3ZRWA 5FLXN 2QJ1A 2ZM6O 2YIDA 2WLJA 4DUYO 2Q7HA 3WG7B 3CRCA 1YHQV 3OUSA 2CTRA 4NXMO 3TXSA 2GTAA 3J7AU 1V54C 2QGNA 1W2BU 4I4TB 3RN4A 1Z5WA 4DV2O 4K8ZA 4N23A 2HLDG 5E79Z 2MW2B 2UUCB 1Q90D 2ZDIA 4FIPC 1NTKH 2OCHA 5KLVH 5LYJA 3CPWU 4FLXA 2XT9A 4GKKB 1OCOB 1HNWB 3SJQC 4CS2A 1PP9H 2HHHB 5EIBC 1YTFD 1OCRC 3SGIA 2B1IA 4JGSA 1BL8A 1Y74A 5BR8B 5FNVB 4PELA 1YEWA 4O4HB 1N8RW 1XILA 4X20A 4PA6A 1BZKA 5JJJB 1TVKB 2XAQA 1AI4A 3KCXA 4JYBA 2X6BA 4ZHQA 2M7WA 5LHHA 2UUBO 2HJDA 1EFRG 2WLHA 2WSSG 2EINB 3JAWB 4J41A 3G4SV 4EEQA 2BE3A 4DR3B 2CK3G 1K3EA 1RPRA 4I50B 1M57C 1Y76A 3ABKC 3FAVB 1WPBA 3CRQA 1IBLB 2A3QA 4P2ZA 3SYPA 4QJFB 3ZMSA 1NR7A 2F43G 2ATKC 4R50A 3LNNA 1V54B 4X88A 2YEVA 2YI8A 4GT1A 5IT9N 4X1YB 2CUGA 4UV8A 4JI3B 2ZINA 4FLUA 1XL6A 3OEEG 4MVMA 4IGGA 3ZHUA 2HKOA 1KMIZ 3JALB 3IFXA 3AEIA 1AI6A 2LQTA 4FLWA 2IJKA 1I0HA 2RNBA 3I56V 4HNAA 1L0LH 5C8YA 2EJRA 4KFMA 1JA8A 4JTDB 2N05A 2N74A 4LF6O 3T1HB 5CA1A 2CDYA 5LMNB 4JZ2A 4YY3O 3G6EV 1K7DA 1R6NA 2BTQB 4LP8A 4O2BB 4WF9V 2FYUH 4X1KA 2CE4A 3Q4HB 4W4LA 2L6LA 5EBMC 1I5XA 1I5YA 4GKJO 4Q20A 1AI5A 4I55B 4BW5A 3CCUV 3X2QC 3JARA 3D36C 1FFXB 2WAMA 1SETA 2QA4V 1M57B 2DW4A 4GX1A 1QR9A 3FB6C 1F4NA 1XREA 2R9IA 3RYHA 3ABTA 1R73A 5BZBA 2IJJA 4LF4B 2CH7B 3M7MX 1MG1A 5LOVB 3BAAA 4FJCC 1N34O 4PDLA 2UXBO 1PD3A 1XI1A 4D6TH 3CRAA 5IJ0A 3SYOA 4NYKA 1YITV 3E83A 4LFBB 4QE7A 3IGAC 1QVFU 4LWSB 1VQNV 2HJFC 1S72V 2BOCC 4PD4F 3MAQA 1ORQC 3K08A 1FJGB 3I55V 2JVDA 3C90A 1VF6C 2W0XA 4MVQA 4O2AB 1OHHG 4JI4B 2X6CA 1UPGA 2BOBC 4LF9O 1GN4A 3NR7A 4MVSA 2JEUA 5KMGB 1X59A 4NB5A 3CRMA 1L8DA 1VIBA 4I9QA 2JK5C 1MSDA 2ITDC 3LSQA 4YJ3A 3CCJV 3UKMA 4OGQB 3HKBA 4B3MB 4JI6O 4K35A 2Y0PA 1EM1A 3JSNA 3OE7G 4IYHA 4MVZA 4HYOA 3E8BA 3BABA 1YDXA 1JQ0A 4DR2B 2G38A 5IYBO 1WNSA 3JCUZ 3KKYA 2AW9A 3SR2C 3OMAB 2RQ6A 1QBZA 1NH2B 3QTCA 3X2QB 5A9GA 2Q0OC 3THOA 1D2DA 2PY5A 3H1JH 4QIWF 5CBHA 1CEZA 3SJCC 2KQXA 1TVKA 2ZE7A 1SZTA 4BAYA 4DUZB 1T5EA 1GM8A 2ZCEA 2Q7GA 3JAWA 1TUEB 2PZSA 1YXBA 4BWAA 1GM9A 5LMUB 1AJPA 3P30A 4IT5A 4UXNA 3JAKB 2UXXA 3FAVA 2ZXWC 4ZOLB 5LXTA 1SQBH 1WPXA 1Q3EA 3LSSA 3FX7A 3OUFA 5KX5B 4PDVA 3JYCA 3WB0A 3ZRXA 2OCCB 4ASUG 4X1YA 1JJOA 2DE0X 2RCVA 1SQPH 4EFEA 3B8NA 1NTZH 3DXRA 4FLYA 3QO8A 4J80A 2EJ7A 1LUVA 1LUWA 2DWDC 3A0HZ 4WCEV 1RM1C 4Z1MG 2OYQA 2JDIG 1MA1A 1DK1A 1KP3A 3CCRV 3P32A 2Q9LA 3C3SA 4CH3A 5IWAB 1VARA 3ASOB 5BR8O 4FM0A 2XAGA 1S3JA 2YC0A 1BHAA 4O2BA 1GAXA 1NU1H 3K04A 1HP8A 1ZUQA 3ABUA 2CTPA 4J7JA 5TISZ 3Q4HA 3CCEV 4R6ZA 1MSWD 4MW8A 1GK9A 1TUBA 3H1LH 3ABLC 3L72H 1M4UA 1XMOO 4I55A 3B8MA 3FFQA 3E35A 3D3QA 2OTLV 4LH6A 3F5TA 3CS5A 3ZRVA 2ZXWB 5IYCO 4NKGB 2FL4A 1SF9A 3J81N 4GYCB 5CN0A 1GN3A 2CH7A 1KB9F 2QR4A 1YZBA 3K57A 3T4ZA 1N33O 1K92A 2V1DA 5AG2A 1WA8A 4AI8A 1IZ3A 2K9PA 4J9ZB 4UCSA 3R65A 4O4JB 3RW0A 4I9WA 4FPPA 2P4VA 4GZRB 2P6JA 3L73H 4JF3A 4J7ZA 2DWEC 2YIBA 4QPKA 3H01A 4O2AA 1SQXH 2UU9O 4KUMA 1M5IA 2UUAB 1RM1B 1MOFA 1XL4A 4X8AA 5EBWC 3JD4A 2JS5A 5J9PC 1NT2B 1O9HA 5DN6G 2RDCA 1IBMO 3K5NA 4XDLA 4J9YB 5KHHA 1SA0A 5EK0A 2ILMA 2BSKA 5LBQA 3ABLB 3ICXA 3OEHG 4D7SA 4PV1B 1PL4A 1AP5A 4TQDA 2QWNB 2JGDA 1H8EG 4JI5O 3O65A 3D36A 2KB1A 4NXNO 4LF7O 5H5NA 4GCZA 5J2TA 4TWKA 2YSUB 3E8HA 2E76B 4BIZA 5H6QA 4DYLA 3HKEA 4MTOA 1XUQA 3ABMC 5D5PA 4ABMA 2IBZH 1HNZB 2E5LB 3FB7C 3U0ZA 1SQGA 2Y4UA 3ZHRA 2UXCO 2F4VB 3JAKA 4JI0B 1P49A 4X66B 1OZ0A 3K3WA 4X62O 3RYCB 4QGPA 3VQWA 3ZN0A 4JASA 5KX5A 1VF6A 4DO2A 5JVDB 1K5QA 3HKCA 3H1HH 3IC7A 4I0XB 4ZIBA 4DV1B 4JI4O 1NVPB 4GX2A 4UCTA 3F7VC 3E2EA 4MTXA 5KAFZ 4X9QA 4ZI7B 1YVWA 1VQMV 4UCOA 2YUAA 2DMXA 1Q8IA 2GTSA 4RWUA 2M6YA 2WLIA 4FM1A 2EIMB 3OT7A 4RQEA 1XEQA 4DW1A 3H1IH 2AHZA 2XAHA 1VQ8V 2ITCC 5KHIA 4PI0A 2DYRC 4AQYO 5IJ9B 5EC1C 2UXDB 2QWOB 2ZNJA 1Z5VA 4L87A 1W0JG 4CH6A 4LF5O 4JZGA 5DECA 5KHJA 2ETNA 5LP6C 2LFRA 3CHXA 1XNRB 4B3TO 3RVYA 1Q43A 4DUZO 1BGYH 1HW7A 3ABMB 2VQFB 2VQEB 1NH2D 4YIOA 3FD9A 4B3RB 4JPRA 4DV6B 2AHYA 5DEDA 1H2LA 3CCVV 3JATB 3T1CA 4DR4B 3K58A 1BE3H 2A06H 1QLEC 3VOUA 2QKAA 4P9PA 4X65B 3BA9A 4J10A 3EXAA 3ZRSA 3IAYA 2OTJV 2EINC 4R8CA 3MHSC 4O4JA 2F66C 4DR6B 5EYPB 3VQXA 1QR8A 3JAMN 1Q6HA 1ZL8A 4OPAA 2R9AA 4TSFG 4DR1B 5EBLC 2YXYA 4JTCB 3ZX6A 4MVUA 5EZYB 3CCLV 3AK2A 3JCZA 2KSDA 4JYAB 1WLEA 5EC2C 3S3XA 3TCUA 2DYRB 4LCUC 2AZ2A 1VEWA 4JI1O 1RSOB 1VQ4V 3BEHA 1F7YA 5IWAO 2P90A 4U3JB 4O4LB 2YXHA 5LP6B 2PGGA 5IYZA 1XNQO 2E3CA 4PI2A 1QNMA 1H38A 4UVBA 1E79G 1FPOA 2ODMA 3OMNB 2WWWA 2NNUA 4X64B 4LNUB 4NR1A 2GBOA 3K5LA 5BXZA 5B1NA 1XDCA 4YHHB 2JIZG 1N32B 4X1IB 3APQA 4OPHA 4QE9A 1QLEB 2Q4PA 3L9DA 4IIJB 4CS3A 1DF4A 4DV3B 4TT3G 4JI7B 3W7XA 5FPRA 3RYCA 4J7KA 4TQFA 1XQ8A 1HDJA 3RWRD 2PUSA 2F95B 3D8CA 4RQFA 3G67A 3N2GA 5JVDA 2XHBA 3W7UA 1Q7YW 4GLXA 3VBBA 2F1MA 4I0XA 1VQOV 3ZHVA 5LHGA 1KKDA 5LA6B 2AZ0A 1R6TA 2P06A 2ZE8A 4JAUA 4OX9B 5J2UA 3ZHQA 4MW3A 4Z2WA 5CBFA 3ZN1A 4ZI7A 4NTWA 3JD3A 1NS1A 4U3FH 4DV7O 5B3SC 2X7RB 3AG2B 1BQ0A 2CGNA 3CCQV 1URFA 4NVPA 5LHIA 2WA3A 1KBHA 3L70H 3R66A 2QKSA 3CRRA 5IJ9A 3BA8A 3W7WA 3OTOO 4C7UA 4FFKA 3CD6V 4DXWA 3M8AA 2EIKB 1ZX3A 3B77A 3TJTA 3CJHB 2LGWA 3D3IA 1GMGA 5LL6Y 1K33A 4J42A 4DV5B 4IL6Z 3ZMZA 4RAIA 4X66O 2HFEC 1PNKA 2C2AA 2XUMA 2EBOA 1S76D 3ZIAG 4PDMA 3FYIB 1BMFG 3K0DA 5KHKA 1H8HG 4O4IB 3OAAG 4JI8O 4DV1O 1XMQB 2JGUA 4XBFA 4J11A 3FB5C 1S77D 1Q6IA 5B3SB 1Y66A 4LFAB 2B1GA 4MVOA 3TETA 1MZEA 2OCCC 5L3DA 3ZMTA 2HVJC 4I4TA 1NVPD 4E4EA 4IYIA 1NKDA 3JD0A 4FLVA 2IJHA 4K0KO 4DV4O 4G28B 4KHPO 4UVAA 3B40A 4K8XA 1IXBA 3K59A 4XDJA 4FLZA 3T1YB 1BS3A 1GO3F 4UCRA 2GV9A 1AI7A 4JTAB 4P9OA 1N4CA 2ZNIA 4JV5B 4P30A 1XNRO 1GN2A 2GHYA 2Q69A 1N36B 1AB3A 4CBCA 3KG2A 3SDLA 5KUKA 1THZA 2VQFO 2F23A 4N21A 2IH1C 2VQEO 4LNUA 4DW0A 1N0NA 1FXKB 2PI5A 3ASOC 5FNVA 3JASB 4DV6O 2GUZB 4O4HA 4FMTA 1JFFB 1Q6UA 4GX0A 3VQVA 4IIJA 3CYOA 2XOKG 4DR7O 4H37A 2E75B 4XDKA 1EN4A 1I08A 3ZHSA 5KA5A 1AR5A 1K34A 4LF8B 1H2NA 5L3GA 3K5OA 4UB8Z 4I50A 1ZAUA 1FYJA 1PPJH 1ZSPA 3CMAV 1P84F 4DR6O 3HKDB 1WB8A 3ETQA 3C3TA 5E1AC 4DR1O 5LA6A 4LFCB 5JCOC 2FMLA 1KD1W 1KU9A 2NN4A 2RN9A 4EB6B 1JPXA 1EZVH 1YCIA 1G8MA 3G80A 4JYAO 4B7KA 4BW9A 1COWG 2UUCO 4RUEA 2ZR3A 1F4MA 3JALA 3W7SA 2Q5ZA 3OR7C 4GKKO 1HNWO 4UVCA 4PA9A 2HHHO 2LP7A 3KZIZ 4A5UB 2ZM6B 1U97A 1A32A 1RPOA 4DUYB 2XAJA 1RP3B 1Q86W 1JJ2U 2R9RB 1VQPV 4X64O 1JCHA 2ZQMA 2BTQA 2ADPA 1XHZA 3O9OA 2X0LA 1G1XB 3N2KB 2IM9A 4DV2B 4YHHO 3CJHA 2FB5A 2QTSA 3IJ4A 1VQ7V 1EZJA 4FZ1A 4IHJB 3CXCU 3T4DA 2P22C 4DV3O 3UM7A 2DOSA 4JI7O 1FFXA 2WLMA 2ZE6A 2Y4TA 4UUJC 1GTOA 2UXNA 4DR3O 1S5HC 4CC5A 1PL0A 1SKVA 4H33A 5CB4B 1IVSA 5LOVA 4CH4A 1H2SB 1Y4MA 1IBLO 3BY6A 3IC9A 2VRZA 3ETDA 1X4TA 2V4DA 1KC8W 4OX9O 4LWSA 4JI3O 1AVMA 5BY1A 1S5JA 4WBNB 4TUYB 5GTIZ 2DN9A 2KG7B 5B1AC 2LJ2A 4MTFA 3CC7V 4PHZA 2V7QG 2KKWA 3RYFB 1VF7A 5KMGA 1FFTB 4YIPA 3STLC 1TA8A 4JYCA 1H2KA 1R3IC 1EBOA 3ZRWB 3CP1A 4MVRA 4TV8B 4G2KA 3WFVA 3WB2A 1I94B 5LGNA 1FD9A 3T1HO 3HB3B 1PNMA 4HAMA 5LMNO 2P5OA 2QWRB 4CH5A 2EIMC 3FYEB 1OV9A 2RJZA 3OMIB 2LO1A 1SS3A 1H2MA 4DV5O 1K9MW 3JASA 1K5SA 1P4RA 3E22B 5ITZB 1SESA 2DYSC 5LYJB 4I7ZB 5B1BC 3J80N 4TV9B 1E1RG 2ZT9B 4HZ3A 4LF4O 5HFMA 3AG1C 3CWBH 2R70A 4ZOLA 3TGUH 2WA4A 3SPHA 4LFBO 2QWQB 2PYLA 1MZFA 2ZE5A 3LSUA 3BVOA 4QPJA 4H13B 1FJGO 3EHBB 5B1AB 2Q6AA 2Y48A 3ETEA 1S5LZ 2Z5UA 1R3LC 3K03A 1BT8A 1I7FA 3OM3B 1K97A 1WAZA 5L3EA 1CP9A 1FS0G 4GUNA 1Y76B 5IYDO 3G71V 4B3MO 4UFZA 4DK1A 1N34B 1M1KW 3ZBHA 3T1YO 1N0JA 1CXZB 1OCZC 2PF4E 1GKFA 3RGBA 4JV5O 1BSMA 3OTFA 2YEVB 4DR2O 3CMEV 3QG5A 1D5AA 1VQ6V 4WFAV 2Y0IA 2BCCH 3U11A 4WFEA 3E89A 3QO7A 1SZXA 3K06A 2LGQA 3CC2V 5GONB 1GN6A 3ZMUA 2DYSB 2IH3C 4FVMA 3N2KA 1P7GA 5B1BB 5DM6V 1BHBA 2ZR2A 1V9PA 2H8PC 3OD4A 1UFIA 2ARHA 2YDEA 1H2GA 5IE9A 4D7TA 5JH7B 2EX3A 1K73W 1K8AW 1Q81W 4LF8O 3AG1B 1OJHA 5LMUO 4PA4A 1O9GA 5CB4A 1ZLZA 4RO2A 2HR3A 5JCOA 2PYJA 1Q5OA 2XTAA 5CMUA 1WP7A 1SERA 4MTGA 4B7EA 1E1QG 3K9SA 2Q68A 1LNQA 1KQSU 4WBNA 3RYIB 1DGSA 2L35A 4TUYA 3AK1A 2ZIOA 3RYHB 1SQQH 3RYFA 3OR6C 3SYCA 1OCZB 5CA3A 3RFRA 1R6KA 3OGCC 2CAZC 1GH6A 1FXHA 1TAEA 1RFYA 1L0NH 3M99B 3F5WC 4TV8A 1HNXB 5L3CA 3AG2C 1YIJV 3ZCCA 4EKWA 4WFGA 5L3BA 1TGOA 2Q67A 5IDJA 1R3KC 2XNDG 2NR5A 1NJIW 3EVKA 1D5NA 3LDCA 4U7OA 4YJ3B 3SPJA 3E22A 5ITZA 3HKBB 1WJZA 3S3WA 5CA0B 1YI2V 2E74B 4TV9A 1G6UA 3K9AA 1Q82W 2EIKC 4JI2B 5A2QN 2QSAA 1SC5B 3P3NA 2A0LA 3E8GA 1AR1B 1AJNA 1HR0B 2IU3A 3NXSA 5KHGA 4BIOA 3W7TA 2JS3A 2QWPB 4CS4A 1PNLA 1XMOB 2B5UA 5JWPA 1GM7A 4ZBMA 3CX5F 1EN6A 3RBZA 3AG4C 4R7CA 1SRYA 3F7YC 2UUAO 1YSCA 2P67A 1MABG 5LXTB 3GWKC 4FZ0A 1N33B 1NTMH 2R72A 1FXVA 3H9VA 1I94O 3FKSG 1JOYA 3L71H 2PTMA 4KP4A 1NR1A 3SJBC 2GSMB 3B09A 3BFRA 1MMMA 1K4CC 3L75H 1K4DC 2UU9B 5GONA 3ASNC 3DXRB 5H9CA 4PA3A 1XHXA 1PM9A 2VWJA 4JAVA 2CGOA 2YS8A 3K0GA 3PJSK 2P7TC 1OCRB 5JH7A 4NTYA 3JD2A 1AJQA 4WFBV 1YJWV 2P4KA 1W0KG 1IBMB 1HNZO 2E5LO 2BTOA 1FXKC 3T2MA 4HBNA 2F4VO 2EULA 4JI0O 1AROP 2QDOA 3JATA 3QNEA 3ZMVA 4UCUA 4LBEC 3LUTB 1VQKV 2IW5A 3SPIA 2QTOA 5F2VO 1R3JC 1TUBB 2QM7A 1F23A 3SYAA 1DF5A 4JI5B 1J95A 3AG4B 2WLNA 2QEXV 4LC1A 4NXNB 3HPLC 4LF7B 4F6RB 2LW1A 1IBKB 1AP6A 2CTWA 5EYPA 1KYOF 2IU0A 3RYIA 3GWOA 4KXRA 2N04A 4PDRA 3ABKB 2QKCA 3P3PA 5K1PA 1CPYA 4ICGA 4MS2A 2D2CB 4B08A 4AHCA 3OFNG 3B4SA 3ZJZA 3LNMB 2A79B 3SYQA 5EZYA 3VQYA 1IDSA 1M93A 2UXCB 1WA8B 2OIEA 3CCSV 1GRJA 2X6AA 2EIJC 4X62B 3A8TA 1RSOA 4AILC 4WFHA 5GW7A 4U3JA 5JJNB 3BPZA 2UXDO 4O4LA 3ASNB 5LP6A 2OWOA 1VMGA 3DTUB 3CCMV 1FKAO 3ETGA 2EZPA 3LDEA 5B1OA 2IJIA 2YIAA 2QE7G 1ZWIC 3I5DA 5LGTA 4DR5B 3APOA 5CA0A 1VQLV 1J5EB 1QLNA 1DLBA 4PA7A 2K1EA 4B3RO 3UQ8A 2W6JG 4DRXB 3A2FA 1SA0B 4X1IA 2F93B 5LGUA 2A7WA 3WB1A 5C93A 4DR4O 2BSKB 4AQYB 4OXSA 3E86A 3STZC 1IURA 2HG5C 4X65O 2JGDB 4LF5B 3RVZA 1IX9A 2H94A 1M9NA 4U7NA 4B3SB 4B3TB 1SQFA 5B5EZ 3N27A 5J2TB 4GX5A 4X89A 2DQ0A 3HKEB 1PV0A 5GTHZ 1EN5A 2WLLB 1M56C 1Y6XA 3BRCA 4NTXA 4W4KA 2EIJB 4FM2A 3KCYA 2FKXA 5IY5C 1HNXO 1P7BA 2WPDG 2ADQB 4F4LA 4L8JA 4YJ2B 3HKCB 3SJAC 1R1BA 2QM8A 2PI4A 4DV0B 4JYYA 5JQGB 1NQTA 1VQ9V 2JEXA 2JJ2G 3AK3A 2FTKA 4Z1VA 2YI9A 2Y69C 3DSQA 3OW2U 4NXMB 2EILC 3DGEA 3TK1A 3ML0A 3EFFK 4LH7A 4PJ0Z 4G27B 4JI2O 1N32O 2WLIB 3A0RA 1YTFB 3AG7A 1AILA 2OIGA 4JI1B 5KUMA 2B9ZA 3QO5A 2ZDIC 1HR0O 4FFBB 3MD0A 3A0BZ 1XNQB 2Q8VA 4MSWC 2MK3A 1KP2A 4O4IA 1BQZA 1AR4A 3WU2Z 3K5MA 3HR0A 4F6RA 1BCCH 2VS0A 5H6RA 1M56B 2XASA 3SPGA 1NBMG 2JRIA 1YF2A 3UT5B 3DC5A 3PN1A 5BMVB 2Q73A 1YJ9V 5IY5B 2XAFA 4F6EA 3K79A 2UUBB 2GDSA 1LR1A 1KKCA 3AG3C 2HEPA 4EFBA 1VF5B 4Q6GA 3UO2A 2HVKC 4WFFA
chains in the Genus database with same CATH topology
5CBHA 4FK5C 1M90W 5B3SC 2X7RB 3AG2B 4RUFA 1CEZA 2Y69B 2EILB 3CCQV 1ROPA 1SZTA 4BAYA 4RO2A 5LHIA 2HR3A 1PKXA 1YJNV 1GM8A 1QCEA 1TUEB 2QKSA 1KECA 3LDDA 5CMUA 4E2LA 1SERA 1GM9A 1AJPA 4MTGA 3W7WA 3P30A 1E1QG 1FXKA 4UXNA 2UXXA 2Q68A 3CD6V 2ZXWC 2Z3YA 1LNQA 4DXWA 1L1FA 1KQSU 1WPXA 1OCCC 3LSSA 1G4YB 2EIKB 3OUFA 4PDVA 3JYCA 3B77A 4UV9A 3OR6C 3ZRXA 2OCCB 1V55C 5HFLA 3SYCA 4ASUG 1OCZB 1HWYA 5CA3A 1ENVA 1R6KA 3OGCC 3D3IA 1GMGA 1K33A 2OT5A 1FXHA 4ZKIA 3M99B 3F5WC 3ZMZA 4RAIA 5L3CA 3B8NA 2HFEC 3GB7C 3AG2C 1YIJV 3ZCCA 1PNKA 3MHHC 4EKWA 2C2AA 4WFGA 3QO8A 4MT8A 2EBOA 1S76D 1JVMA 3ZIAG 4PDMA 3FYIB 5L3BA 1BMFG 3K0DA 2DWDC 4WCEV 2WLLA 1RM1C 1QVGU 4Z1MG 1IXMA 2Q67A 1H8HG 5IDJA 1R3KC 2XNDG 3OAAG 2EZOA 2JDIG 1NJIW 3AG3B 1KP3A 4XBFA 3CCRV 3P32A 3LDCA 2LFSA 4U7OA 3FB5C 3SPJA 3E8FA 3ASOB 1S77D 2XAGA 1S3JA 1YI2V 1VQ5V 1BHAA 5B3SB 1Y66A 3K9AA 5CBGA 3K04A 3ABUA 1Q82W 2ZD9A 2EIKC 3CCEV 1MSWD 2B1GA 4MVOA 4R6ZA 4MW8A 3FB8C 1GK9A 3TETA 3ABLC 2OCCC 5L3DA 3ZMTA 5FL7G 2A0LA 2HVJC 4QNHB 3E8GA 1NVPD 3B8MA 1AR1B 3E35A 1UJWB 1NKDA 3JD0A 2OTLV 1B6QA 1AJNA 2IJHA 2W6IG 1S0VA 5KA6A 4G28B 2IU3A 3NXSA 1JX9A 3ZRVA 3W7TA 4UVAA 4WFFA 4XDJA 2ZXWB 3WG7C 5IYCO 4I5SA 2JJ1G 1PNLA 5CN0A 1GO3F 1OCCB 2B5UA 1AI7A 4JTAB 4P9OA 3T4ZA 4P30A 1GM7A 1K92A 4ZBMA 2V1DA 1V55B 3RBZA 2GHYA 3AG4C 2Q69A 4R7CA 1SRYA 3F7YC 4CZZA 4J9ZB 3R65A 4CBCA 3KG2A 3RW0A 5KUKA 4I9WA 1THZA 2A9HA 1YSCA 2P67A 2IH1C 4FPPA 2P6JA 4N21A 1FXKB 2PI5A 3ASOC 4JF3A 1MABG 5L3FA 2DWEC 1OCOC 1DTOA 4FMTA 4QPKA 4GX0A 3H01A 2W0FC 1FXVA 2WLKA 3FKSG 1JOYA 4YXWG 4KUMA 2D3OW 4KP4A 1NR1A 3CYOA 2XOKG 1RM1B 4H37A 1MOFA 4XDKA 3JD1A 5KA5A 1XL4A 2GSMB 1K34A 4X8AA 5EBWC 3JD4A 5L3GA 3CC4V 5J9PC 1K4CC 1K4DC 5DN6G 4XDLA 4J9YB 3CMAV 2DQ3A 3ASNC 2NLJC 5H9CA 4PA3A 5EK0A 4JAVA 4BIUA 5LBQA 5E1AC 1F51A 3ABLB 3SPCA 3K0GA 3OEHG 1KD1W 3PJSK 2P7TC 1OCRB 3JD2A 1AJQA 4WFBV 1YJWV 1W0KG 3ZRWA 1JPXA 1H8EG 1G8MA 3D36A 1FXKC 2KB1A 3T2MA 1COWG 1AROP 2WLJA 4GCZA 3QNEA 3ZMVA 4TWKA 2YSUB 3WG7B 3E8HA 4LBEC 1YHQV 3OUSA 4RUEA 2ZR3A 3LUTB 4BIZA 1F4MA 1VQKV 5H6QA 3W7SA 2IW5A 3SPIA 2QTOA 4MTOA 1R3JC 3OR7C 3ABMC 1V54C 4UVCA 2QM7A 1W2BU 4PA9A 1F23A 3SYAA 1DF5A 3FB7C 2LP7A 1J95A 3AG4B 2WLNA 2QEXV 4LC1A 3HPLC 4N23A 1RPOA 2HLDG 1OZ0A 3K3WA 2XAJA 1Q86W 2ZDIA 4FIPC 2IU0A 1JJ2U 2R9RB 3GWOA 4PDRA 3ABKB 3CPWU 1VQPV 1JCHA 2ZQMA 1OCOB 1CPYA 3ZN0A 4JASA 3SJQC 4MS2A 4DO2A 2X0LA 1K5QA 3OFNG 3ZJZA 3LNMB 2A79B 3SYQA 3IC7A 1VQ7V 1EZJA 1NVPB 1YTFD 1OCRC 3CCSV 2X6AA 3CXCU 2EIJC 4GX2A 2B1IA 4JGSA 1BL8A 3T4DA 3F7VC 3UM7A 3E2EA 4MTXA 2WLMA 4UUJC 1GTOA 2UXNA 4WFHA 1S5HC 4PELA 5GW7A 1PL0A 4H33A 1N8RW 1VQMV 3ASNB 3DTUB 4PA6A 3CCMV 3ETGA 2EZPA 3LDEA 5B1OA 2XAQA 1AI4A 1Y4MA 2IJIA 2X6BA 4JYBA 2WLIA 3BY6A 2M7WA 2QE7G 5LHHA 2EIMB 4RQEA 1EFRG 2WLHA 1ZWIC 2WSSG 2AHZA 2EINB 2XAHA 3G4SV 1VQ8V 2ITCC 5LGTA 2DYRC 3ETDA 5EC1C 2CK3G 1K3EA 1RPRA 1KC8W 1VQLV 4L87A 1M57C 1DLBA 1W0JG 4PA7A 1QLNA 3ABKC 2K1EA 2W6JG 2LFRA 5LGUA 4P2ZA 3RVYA 3SYPA 4QJFB 3ZMSA 5B1AC 4MTFA 3CC7V 1NR7A 2V7QG 2F43G 5C93A 2ATKC 4R50A 3ABMB 4OXSA 1V54B 4X88A 1FFTB 2YEVA 3E86A 2HG5C 4GT1A 3STZC 3STLC 4UV8A 1NH2D 3RVZA 1XL6A 3OEEG 4JYCA 3ZRWB 1R3IC 1EBOA 4MVMA 2H94A 1M9NA 4JPRA 4U7NA 3CP1A 2AHYA 4MVRA 4G2KA 3WFVA 3CCVV 5LGNA 3T1CA 3HB3B 2HKOA 1PNMA 4HAMA 4GX5A 2DQ0A 3IFXA 4X89A 3AEIA 1QLEC 1AI6A 3VOUA 4P9PA 2IJKA 2EIMC 3FYEB 3ZRSA 2WLLB 2OTJV 3I56V 2EINC 4R8CA 3MHSC 3OMIB 1M56C 2EJRA 4KFMA 2EIJB 4JTDB 1K9MW 1K5SA 1P4RA 5IY5C 1QR8A 1SESA 2DYSC 1P7BA 3G6EV 5B1BC 1K7DA 1R6NA 2WPDG 4LP8A 4TSFG 4WF9V 1E1RG 5EBLC 4F4LA 4JTCB 4HZ3A 4MVUA 5EBMC 2QM8A 3CCLV 2PI4A 1I5XA 1I5YA 3JCZA 4Q20A 1AI5A 3CCUV 4BW5A 1NQTA 1VQ9V 5HFMA 1WLEA 2JEXA 3X2QC 5EC2C 3TCUA 2DYRB 3AG1C 4LCUC 2JJ2G 2WAMA 1SETA 2FTKA 2QA4V 1VQ4V 3BEHA 2Y69C 1M57B 2DW4A 4GX1A 3SPHA 1QR9A 2EILC 2P90A 3OW2U 3DGEA 1F4NA 3FB6C 2R9IA 3TK1A 3ABTA 3EFFK 3ML0A 1R73A 5BZBA 2IJJA 4QPJA 1MG1A 3EHBB 4FJCC 5B1AB 4G27B 2Y48A 2Q6AA 3ETEA 4PDLA 2WLIB 1PD3A 3A0RA 1H38A 1YTFB 2Z5UA 4UVBA 1E79G 3SYOA 1R3LC 3K03A 3OMNB 1YITV 2WWWA 3E83A 3OM3B 5KUMA 1K97A 4QE7A 3QO5A 3IGAC 2NNUA 2ZDIC 5L3EA 1QVFU 1VQNV 2HJFC 1S72V 3MD0A 1CP9A 1FS0G 2BOCC 5IYDO 3G71V 1ORQC 3K08A 5B1NA 1M1KW 4MSWC 3I55V 2JIZG 2MK3A 4MVQA 1OHHG 2X6CA 1OCZC 4QE9A 1QLEB 1GKFA 1DF4A 1KP2A 2BOBC 4MVSA 2JEUA 4TT3G 2YEVB 3W7XA 5H6RA 1M56B 2JK5C 2XASA 3SPGA 2ITDC 3CMEV 1NBMG 3LSQA 3CCJV 1VQ6V 3UKMA 4WFAV 4WFEA 3E89A 3QO7A 4RQFA 3K06A 5IY5B 1YJ9V 3CC2V 3ZMUA 3OE7G 2DYSB 2IH3C 1Q7YW 3W7UA 2XAFA 5B1BB 3K79A 3VBBA 4MVZA 4HYOA 1VQOV 5DM6V 1BHBA 2ZR2A 3E8BA 1JQ0A 5LHGA 1KKDA 2H8PC 5IYBO 3OMAB 3AG3C 1H2GA 4JAUA 1QBZA 1K73W 4MW3A 1NH2B 5CBFA 3ZN1A 3X2QB 1K8AW 1Q81W 3JD3A 3AG1B 2HVKC 4PA4A 4QIWF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CBH A;  5IY5 C;  5B3S C;  4RUF A;  2DYS C;  3WG7 C;  1P7B A;  5B1B C;  4LP8 A;  4MS2 A;  3SJQ C;  5EBL C;  4JTA B;  4RO2 A;  4P9O A;  3ZJZ A;  4JTC B;  3T4Z A;  3LNM B;  4P30 A;  2A79 B;  3SYQ A;  4ZBM A;  4HZ3 A;  4MVU A;  5EBM C;  3RBZ A;  3AG4 C;  1OCR C;  2Q69 A;  2QKS A;  4R7C A;  3F7Y C;  4BW5 A;  2X6A A;  3LDD A;  2EIJ C;  4GX2 A;  3R65 A;  4J9Z B;  3T4D A;  1BL8 A;  4CBC A;  3KG2 A;  3RW0 A;  3X2Q C;  4I9W A;  2A9H A;  3F7V C;  4MTG A;  5EC2 C;  3TCU A;  3UM7 A;  3AG1 C;  2IH1 C;  4LCU C;  2WLM A;  2Q68 A;  3ASO C;  2ZXW C;  4UUJ C;  4DXW A;  1LNQ A;  4WFH A;  1S5H C;  3BEH A;  2Y69 C;  2DWE C;  3SPH A;  4GX1 A;  1OCO C;  2EIL C;  3FB6 C;  4H33 A;  1OCC C;  4GX0 A;  3EFF K;  2W0F C;  2WLK A;  1G4Y B;  4PA6 A;  5BZB A;  3OUF A;  3LDE A;  4PDV A;  3JYC A;  3OR6 C;  1V55 C;  2X6B A;  3SYC A;  4G27 B;  2Q6A A;  2WLI A;  4PDL A;  2WLI B;  4H37 A;  2WLH A;  4XDK A;  1ZWI C;  3OGC C;  1XL4 A;  2AHZ A;  3SYO A;  2ITC C;  1R3L C;  3K03 A;  2DYR C;  4X8A A;  5EBW C;  3E83 A;  5EC1 C;  5KUM A;  5J9P C;  4QE7 A;  1K4C C;  3F5W C;  3IGA C;  1K4D C;  4RAI A;  1M57 C;  4PA7 A;  2HFE C;  2HJF C;  3ABK C;  2K1E A;  3GB7 C;  3AG2 C;  4J9Y B;  2BOC C;  4XDL A;  3ASN C;  4EKW A;  1ORQ C;  3K08 A;  4WFG A;  4MSW C;  2NLJ C;  4P2Z A;  1JVM A;  4MVQ A;  4PA3 A;  5EK0 A;  4PDM A;  3RVY A;  3SPI A;  3SYP A;  5B1A C;  4MTF A;  2X6C A;  3K0D A;  1OCZ C;  2DWD C;  4QE9 A;  2ATK C;  2WLL A;  5E1A C;  3SPC A;  2BOB C;  3K0G A;  4R50 A;  2Q67 A;  3PJS K;  4OXS A;  4MVS A;  1R3K C;  2P7T C;  3E86 A;  2YEV A;  4X88 A;  2HG5 C;  3STZ C;  5KUK A;  3STL C;  2JK5 C;  3SPG A;  3RVZ A;  1XL6 A;  2ITD C;  1R3I C;  4MVM A;  3LDC A;  2KB1 A;  3T2M A;  3UKM A;  2AHY A;  3FB5 C;  3SPJ A;  3E8F A;  4MVR A;  4WFE A;  3E89 A;  2WLJ A;  4TWK A;  4XDJ A;  3E8H A;  3K06 A;  4LBE C;  3T1C A;  3OUS A;  4RUE A;  3LUT B;  5CBG A;  2IH3 C;  3K04 A;  2ZD9 A;  2EIK C;  4R6Z A;  4GX5 A;  4MVO A;  4MVZ A;  3IFX A;  4HYO A;  3FB8 C;  1QLE C;  4MW8 A;  4X89 A;  2QTO A;  2OCC C;  3ABL C;  1R3J C;  3E8B A;  2A0L A;  2HVJ C;  3OR7 C;  4MTO A;  4P9P A;  3ABM C;  4F4L A;  4QNH B;  2EIM C;  1KKD A;  2H8P C;  1V54 C;  3E8G A;  4PA9 A;  3ZRS A;  2WLL B;  3SYA A;  3VOU A;  2EIN C;  3FB7 C;  4R8C A;  1J95 A;  1M56 C;  2WLN A;  3AG3 C;  3TET A;  3HPL C;  4KFM A;  4JTD B;  4MW3 A;  4G28 B;  5CBF A;  2R9R B;  2HVK C;  4PA4 A;  4PDR A;  4WFF A; 
#chains in the Genus database with same CATH topology
 4JAA A;  4FK5 C;  1M90 W;  4RUF A;  2AGA A;  2Y69 B;  2EIL B;  1ZL8 B;  1ROP A;  1U96 A;  2DJV A;  1PKX A;  3MDS A;  1YJN V;  1QCE A;  1SQV H;  3UCS C;  3U10 A;  5B66 Z;  1KEC A;  3LDD A;  4E2L A;  4UCV A;  3TXQ A;  1QHT A;  1Y67 A;  2LW7 A;  4DV7 B;  1FXK A;  1JMK C;  2Z3Y A;  1L1F A;  2ZIM A;  4DRX A;  2GUZ A;  4H44 B;  1JFF A;  3CSX A;  1OCC C;  3H1K H;  4CC6 A;  2ZKO A;  1G4Y B;  2Q0A A;  3G6B A;  2YIC A;  1MNG A;  4KL1 A;  5IYZ B;  4UV9 A;  1WP8 A;  5EIB D;  5HFL A;  1V55 C;  1HWY A;  1ENV A;  3OTO B;  4K3A A;  2OT5 A;  3OGI B;  3BHP A;  4LF6 B;  4ZKI A;  1JR9 A;  1XMQ O;  4FLT A;  1Y74 B;  1IBK O;  1NI8 A;  2HP8 A;  3ZS8 C;  4YY3 B;  3GB7 C;  3HKD A;  3CEI A;  1QQC A;  3MHH C;  3B2E E;  4MT8 A;  1JVM A;  2RMK B;  3QVN A;  4X20 B;  4GKJ B;  2WLL A;  5D5Q A;  1QVG U;  4LFA O;  1IXM A;  4ZHQ B;  2Z0A A;  4DK0 A;  2EZO A;  4EB6 A;  5K1X A;  3AG3 B;  2LFS A;  3E8F A;  1B3Q A;  1US6 A;  1VQ5 V;  5CBG A;  3N2G B;  2ZD9 A;  4YJ2 A;  3DC6 A;  3FB8 C;  5KAI Z;  3RT3 C;  2UXB B;  4JI8 B;  5FL7 G;  3JSL A;  4QNH B;  1KUQ A;  1ZTE A;  1VP7 A;  2VWK A;  5JQG A;  1W59 A;  1UJW B;  5H2F Z;  1B6Q A;  2W6I G;  4TOI A;  1S0V A;  5KA6 A;  5J2U B;  1N36 O;  3GVM A;  1JX9 A;  4DR5 O;  3WG7 C;  4I5S A;  5JJE B;  3ZED A;  2JJ1 G;  2YIB D;  1J5E O;  1XOU A;  1OCC B;  3CE2 A;  4LF9 B;  3ZHT A;  5FPO A;  2Q7E A;  1V55 B;  4IHJ A;  4K0K B;  4DV4 B;  2AXT Z;  4H0L B;  4CZZ A;  4KHP B;  3BCC H;  4BR6 A;  4HNA B;  1B04 A;  2A9H A;  4JI6 B;  5C8Y B;  3CB2 A;  4FFB A;  4UB6 Z;  1WN7 A;  5L3F A;  1OCO C;  3QF7 A;  5CA1 B;  1DTO A;  4B3S O;  3UO3 A;  2CTQ A;  2W0F C;  2WLK A;  2O57 A;  4YXW G;  2D3O W;  4X1K B;  3CXH F;  2H3O A;  3JD1 A;  4LFC O;  1Z2G A;  3UT5 A;  1NZ6 A;  3CC4 V;  3JAR B;  5BMV A;  1B06 A;  1XBL A;  2DQ3 A;  4LR3 A;  2NLJ C;  4DR7 B;  2KG7 A;  3L74 H;  2YXL A;  4BIU A;  1QU7 A;  1F51 A;  3SPC A;  1FAF A;  1WB7 A;  2QM4 A;  4DV0 O;  5IJ0 B;  3ZRW A;  5FLX N;  2QJ1 A;  2ZM6 O;  2YID A;  2WLJ A;  4DUY O;  2Q7H A;  3WG7 B;  3CRC A;  1YHQ V;  3OUS A;  2CTR A;  4NXM O;  3TXS A;  2GTA A;  3J7A U;  1V54 C;  2QGN A;  1W2B U;  4I4T B;  3RN4 A;  1Z5W A;  4DV2 O;  4K8Z A;  4N23 A;  2HLD G;  5E79 Z;  2MW2 B;  2UUC B;  1Q90 D;  2ZDI A;  4FIP C;  1NTK H;  2OCH A;  5KLV H;  5LYJ A;  3CPW U;  4FLX A;  2XT9 A;  4GKK B;  1OCO B;  1HNW B;  3SJQ C;  4CS2 A;  1PP9 H;  2HHH B;  5EIB C;  1YTF D;  1OCR C;  3SGI A;  2B1I A;  4JGS A;  1BL8 A;  1Y74 A;  5BR8 B;  5FNV B;  4PEL A;  1YEW A;  4O4H B;  1N8R W;  1XIL A;  4X20 A;  4PA6 A;  1BZK A;  5JJJ B;  1TVK B;  2XAQ A;  1AI4 A;  3KCX A;  4JYB A;  2X6B A;  4ZHQ A;  2M7W A;  5LHH A;  2UUB O;  2HJD A;  1EFR G;  2WLH A;  2WSS G;  2EIN B;  3JAW B;  4J41 A;  3G4S V;  4EEQ A;  2BE3 A;  4DR3 B;  2CK3 G;  1K3E A;  1RPR A;  4I50 B;  1M57 C;  1Y76 A;  3ABK C;  3FAV B;  1WPB A;  3CRQ A;  1IBL B;  2A3Q A;  4P2Z A;  3SYP A;  4QJF B;  3ZMS A;  1NR7 A;  2F43 G;  2ATK C;  4R50 A;  3LNN A;  1V54 B;  4X88 A;  2YEV A;  2YI8 A;  4GT1 A;  5IT9 N;  4X1Y B;  2CUG A;  4UV8 A;  4JI3 B;  2ZIN A;  4FLU A;  1XL6 A;  3OEE G;  4MVM A;  4IGG A;  3ZHU A;  2HKO A;  1KMI Z;  3JAL B;  3IFX A;  3AEI A;  1AI6 A;  2LQT A;  4FLW A;  2IJK A;  1I0H A;  2RNB A;  3I56 V;  4HNA A;  1L0L H;  5C8Y A;  2EJR A;  4KFM A;  1JA8 A;  4JTD B;  2N05 A;  2N74 A;  4LF6 O;  3T1H B;  5CA1 A;  2CDY A;  5LMN B;  4JZ2 A;  4YY3 O;  3G6E V;  1K7D A;  1R6N A;  2BTQ B;  4LP8 A;  4O2B B;  4WF9 V;  2FYU H;  4X1K A;  2CE4 A;  3Q4H B;  4W4L A;  2L6L A;  5EBM C;  1I5X A;  1I5Y A;  4GKJ O;  4Q20 A;  1AI5 A;  4I55 B;  4BW5 A;  3CCU V;  3X2Q C;  3JAR A;  3D36 C;  1FFX B;  2WAM A;  1SET A;  2QA4 V;  1M57 B;  2DW4 A;  4GX1 A;  1QR9 A;  3FB6 C;  1F4N A;  1XRE A;  2R9I A;  3RYH A;  3ABT A;  1R73 A;  5BZB A;  2IJJ A;  4LF4 B;  2CH7 B;  3M7M X;  1MG1 A;  5LOV B;  3BAA A;  4FJC C;  1N34 O;  4PDL A;  2UXB O;  1PD3 A;  1XI1 A;  4D6T H;  3CRA A;  5IJ0 A;  3SYO A;  4NYK A;  1YIT V;  3E83 A;  4LFB B;  4QE7 A;  3IGA C;  1QVF U;  4LWS B;  1VQN V;  2HJF C;  1S72 V;  2BOC C;  4PD4 F;  3MAQ A;  1ORQ C;  3K08 A;  1FJG B;  3I55 V;  2JVD A;  3C90 A;  1VF6 C;  2W0X A;  4MVQ A;  4O2A B;  1OHH G;  4JI4 B;  2X6C A;  1UPG A;  2BOB C;  4LF9 O;  1GN4 A;  3NR7 A;  4MVS A;  2JEU A;  5KMG B;  1X59 A;  4NB5 A;  3CRM A;  1L8D A;  1VIB A;  4I9Q A;  2JK5 C;  1MSD A;  2ITD C;  3LSQ A;  4YJ3 A;  3CCJ V;  3UKM A;  4OGQ B;  3HKB A;  4B3M B;  4JI6 O;  4K35 A;  2Y0P A;  1EM1 A;  3JSN A;  3OE7 G;  4IYH A;  4MVZ A;  4HYO A;  3E8B A;  3BAB A;  1YDX A;  1JQ0 A;  4DR2 B;  2G38 A;  5IYB O;  1WNS A;  3JCU Z;  3KKY A;  2AW9 A;  3SR2 C;  3OMA B;  2RQ6 A;  1QBZ A;  1NH2 B;  3QTC A;  3X2Q B;  5A9G A;  2Q0O C;  3THO A;  1D2D A;  2PY5 A;  3H1J H;  4QIW F;  5CBH A;  1CEZ A;  3SJC C;  2KQX A;  1TVK A;  2ZE7 A;  1SZT A;  4BAY A;  4DUZ B;  1T5E A;  1GM8 A;  2ZCE A;  2Q7G A;  3JAW A;  1TUE B;  2PZS A;  1YXB A;  4BWA A;  1GM9 A;  5LMU B;  1AJP A;  3P30 A;  4IT5 A;  4UXN A;  3JAK B;  2UXX A;  3FAV A;  2ZXW C;  4ZOL B;  5LXT A;  1SQB H;  1WPX A;  1Q3E A;  3LSS A;  3FX7 A;  3OUF A;  5KX5 B;  4PDV A;  3JYC A;  3WB0 A;  3ZRX A;  2OCC B;  4ASU G;  4X1Y A;  1JJO A;  2DE0 X;  2RCV A;  1SQP H;  4EFE A;  3B8N A;  1NTZ H;  3DXR A;  4FLY A;  3QO8 A;  4J80 A;  2EJ7 A;  1LUV A;  1LUW A;  2DWD C;  3A0H Z;  4WCE V;  1RM1 C;  4Z1M G;  2OYQ A;  2JDI G;  1MA1 A;  1DK1 A;  1KP3 A;  3CCR V;  3P32 A;  2Q9L A;  3C3S A;  4CH3 A;  5IWA B;  1VAR A;  3ASO B;  5BR8 O;  4FM0 A;  2XAG A;  1S3J A;  2YC0 A;  1BHA A;  4O2B A;  1GAX A;  1NU1 H;  3K04 A;  1HP8 A;  1ZUQ A;  3ABU A;  2CTP A;  4J7J A;  5TIS Z;  3Q4H A;  3CCE V;  4R6Z A;  1MSW D;  4MW8 A;  1GK9 A;  1TUB A;  3H1L H;  3ABL C;  3L72 H;  1M4U A;  1XMO O;  4I55 A;  3B8M A;  3FFQ A;  3E35 A;  3D3Q A;  2OTL V;  4LH6 A;  3F5T A;  3CS5 A;  3ZRV A;  2ZXW B;  5IYC O;  4NKG B;  2FL4 A;  1SF9 A;  3J81 N;  4GYC B;  5CN0 A;  1GN3 A;  2CH7 A;  1KB9 F;  2QR4 A;  1YZB A;  3K57 A;  3T4Z A;  1N33 O;  1K92 A;  2V1D A;  5AG2 A;  1WA8 A;  4AI8 A;  1IZ3 A;  2K9P A;  4J9Z B;  4UCS A;  3R65 A;  4O4J B;  3RW0 A;  4I9W A;  4FPP A;  2P4V A;  4GZR B;  2P6J A;  3L73 H;  4JF3 A;  4J7Z A;  2DWE C;  2YIB A;  4QPK A;  3H01 A;  4O2A A;  1SQX H;  2UU9 O;  4KUM A;  1M5I A;  2UUA B;  1RM1 B;  1MOF A;  1XL4 A;  4X8A A;  5EBW C;  3JD4 A;  2JS5 A;  5J9P C;  1NT2 B;  1O9H A;  5DN6 G;  2RDC A;  1IBM O;  3K5N A;  4XDL A;  4J9Y B;  5KHH A;  1SA0 A;  5EK0 A;  2ILM A;  2BSK A;  5LBQ A;  3ABL B;  3ICX A;  3OEH G;  4D7S A;  4PV1 B;  1PL4 A;  1AP5 A;  4TQD A;  2QWN B;  2JGD A;  1H8E G;  4JI5 O;  3O65 A;  3D36 A;  2KB1 A;  4NXN O;  4LF7 O;  5H5N A;  4GCZ A;  5J2T A;  4TWK A;  2YSU B;  3E8H A;  2E76 B;  4BIZ A;  5H6Q A;  4DYL A;  3HKE A;  4MTO A;  1XUQ A;  3ABM C;  5D5P A;  4ABM A;  2IBZ H;  1HNZ B;  2E5L B;  3FB7 C;  3U0Z A;  1SQG A;  2Y4U A;  3ZHR A;  2UXC O;  2F4V B;  3JAK A;  4JI0 B;  1P49 A;  4X66 B;  1OZ0 A;  3K3W A;  4X62 O;  3RYC B;  4QGP A;  3VQW A;  3ZN0 A;  4JAS A;  5KX5 A;  1VF6 A;  4DO2 A;  5JVD B;  1K5Q A;  3HKC A;  3H1H H;  3IC7 A;  4I0X B;  4ZIB A;  4DV1 B;  4JI4 O;  1NVP B;  4GX2 A;  4UCT A;  3F7V C;  3E2E A;  4MTX A;  5KAF Z;  4X9Q A;  4ZI7 B;  1YVW A;  1VQM V;  4UCO A;  2YUA A;  2DMX A;  1Q8I A;  2GTS A;  4RWU A;  2M6Y A;  2WLI A;  4FM1 A;  2EIM B;  3OT7 A;  4RQE A;  1XEQ A;  4DW1 A;  3H1I H;  2AHZ A;  2XAH A;  1VQ8 V;  2ITC C;  5KHI A;  4PI0 A;  2DYR C;  4AQY O;  5IJ9 B;  5EC1 C;  2UXD B;  2QWO B;  2ZNJ A;  1Z5V A;  4L87 A;  1W0J G;  4CH6 A;  4LF5 O;  4JZG A;  5DEC A;  5KHJ A;  2ETN A;  5LP6 C;  2LFR A;  3CHX A;  1XNR B;  4B3T O;  3RVY A;  1Q43 A;  4DUZ O;  1BGY H;  1HW7 A;  3ABM B;  2VQF B;  2VQE B;  1NH2 D;  4YIO A;  3FD9 A;  4B3R B;  4JPR A;  4DV6 B;  2AHY A;  5DED A;  1H2L A;  3CCV V;  3JAT B;  3T1C A;  4DR4 B;  3K58 A;  1BE3 H;  2A06 H;  1QLE C;  3VOU A;  2QKA A;  4P9P A;  4X65 B;  3BA9 A;  4J10 A;  3EXA A;  3ZRS A;  3IAY A;  2OTJ V;  2EIN C;  4R8C A;  3MHS C;  4O4J A;  2F66 C;  4DR6 B;  5EYP B;  3VQX A;  1QR8 A;  3JAM N;  1Q6H A;  1ZL8 A;  4OPA A;  2R9A A;  4TSF G;  4DR1 B;  5EBL C;  2YXY A;  4JTC B;  3ZX6 A;  4MVU A;  5EZY B;  3CCL V;  3AK2 A;  3JCZ A;  2KSD A;  4JYA B;  1WLE A;  5EC2 C;  3S3X A;  3TCU A;  2DYR B;  4LCU C;  2AZ2 A;  1VEW A;  4JI1 O;  1RSO B;  1VQ4 V;  3BEH A;  1F7Y A;  5IWA O;  2P90 A;  4U3J B;  4O4L B;  2YXH A;  5LP6 B;  2PGG A;  5IYZ A;  1XNQ O;  2E3C A;  4PI2 A;  1QNM A;  1H38 A;  4UVB A;  1E79 G;  1FPO A;  2ODM A;  3OMN B;  2WWW A;  2NNU A;  4X64 B;  4LNU B;  4NR1 A;  2GBO A;  3K5L A;  5BXZ A;  5B1N A;  1XDC A;  4YHH B;  2JIZ G;  1N32 B;  4X1I B;  3APQ A;  4OPH A;  4QE9 A;  1QLE B;  2Q4P A;  3L9D A;  4IIJ B;  4CS3 A;  1DF4 A;  4DV3 B;  4TT3 G;  4JI7 B;  3W7X A;  5FPR A;  3RYC A;  4J7K A;  4TQF A;  1XQ8 A;  1HDJ A;  3RWR D;  2PUS A;  2F95 B;  3D8C A;  4RQF A;  3G67 A;  3N2G A;  5JVD A;  2XHB A;  3W7U A;  1Q7Y W;  4GLX A;  3VBB A;  2F1M A;  4I0X A;  1VQO V;  3ZHV A;  5LHG A;  1KKD A;  5LA6 B;  2AZ0 A;  1R6T A;  2P06 A;  2ZE8 A;  4JAU A;  4OX9 B;  5J2U A;  3ZHQ A;  4MW3 A;  4Z2W A;  5CBF A;  3ZN1 A;  4ZI7 A;  4NTW A;  3JD3 A;  1NS1 A;  4U3F H;  4DV7 O;  5B3S C;  2X7R B;  3AG2 B;  1BQ0 A;  2CGN A;  3CCQ V;  1URF A;  4NVP A;  5LHI A;  2WA3 A;  1KBH A;  3L70 H;  3R66 A;  2QKS A;  3CRR A;  5IJ9 A;  3BA8 A;  3W7W A;  3OTO O;  4C7U A;  4FFK A;  3CD6 V;  4DXW A;  3M8A A;  2EIK B;  1ZX3 A;  3B77 A;  3TJT A;  3CJH B;  2LGW A;  3D3I A;  1GMG A;  5LL6 Y;  1K33 A;  4J42 A;  4DV5 B;  4IL6 Z;  3ZMZ A;  4RAI A;  4X66 O;  2HFE C;  1PNK A;  2C2A A;  2XUM A;  2EBO A;  1S76 D;  3ZIA G;  4PDM A;  3FYI B;  1BMF G;  3K0D A;  5KHK A;  1H8H G;  4O4I B;  3OAA G;  4JI8 O;  4DV1 O;  1XMQ B;  2JGU A;  4XBF A;  4J11 A;  3FB5 C;  1S77 D;  1Q6I A;  5B3S B;  1Y66 A;  4LFA B;  2B1G A;  4MVO A;  3TET A;  1MZE A;  2OCC C;  5L3D A;  3ZMT A;  2HVJ C;  4I4T A;  1NVP D;  4E4E A;  4IYI A;  1NKD A;  3JD0 A;  4FLV A;  2IJH A;  4K0K O;  4DV4 O;  4G28 B;  4KHP O;  4UVA A;  3B40 A;  4K8X A;  1IXB A;  3K59 A;  4XDJ A;  4FLZ A;  3T1Y B;  1BS3 A;  1GO3 F;  4UCR A;  2GV9 A;  1AI7 A;  4JTA B;  4P9O A;  1N4C A;  2ZNI A;  4JV5 B;  4P30 A;  1XNR O;  1GN2 A;  2GHY A;  2Q69 A;  1N36 B;  1AB3 A;  4CBC A;  3KG2 A;  3SDL A;  5KUK A;  1THZ A;  2VQF O;  2F23 A;  4N21 A;  2IH1 C;  2VQE O;  4LNU A;  4DW0 A;  1N0N A;  1FXK B;  2PI5 A;  3ASO C;  5FNV A;  3JAS B;  4DV6 O;  2GUZ B;  4O4H A;  4FMT A;  1JFF B;  1Q6U A;  4GX0 A;  3VQV A;  4IIJ A;  3CYO A;  2XOK G;  4DR7 O;  4H37 A;  2E75 B;  4XDK A;  1EN4 A;  1I08 A;  3ZHS A;  5KA5 A;  1AR5 A;  1K34 A;  4LF8 B;  1H2N A;  5L3G A;  3K5O A;  4UB8 Z;  4I50 A;  1ZAU A;  1FYJ A;  1PPJ H;  1ZSP A;  3CMA V;  1P84 F;  4DR6 O;  3HKD B;  1WB8 A;  3ETQ A;  3C3T A;  5E1A C;  4DR1 O;  5LA6 A;  4LFC B;  5JCO C;  2FML A;  1KD1 W;  1KU9 A;  2NN4 A;  2RN9 A;  4EB6 B;  1JPX A;  1EZV H;  1YCI A;  1G8M A;  3G80 A;  4JYA O;  4B7K A;  4BW9 A;  1COW G;  2UUC O;  4RUE A;  2ZR3 A;  1F4M A;  3JAL A;  3W7S A;  2Q5Z A;  3OR7 C;  4GKK O;  1HNW O;  4UVC A;  4PA9 A;  2HHH O;  2LP7 A;  3KZI Z;  4A5U B;  2ZM6 B;  1U97 A;  1A32 A;  1RPO A;  4DUY B;  2XAJ A;  1RP3 B;  1Q86 W;  1JJ2 U;  2R9R B;  1VQP V;  4X64 O;  1JCH A;  2ZQM A;  2BTQ A;  2ADP A;  1XHZ A;  3O9O A;  2X0L A;  1G1X B;  3N2K B;  2IM9 A;  4DV2 B;  4YHH O;  3CJH A;  2FB5 A;  2QTS A;  3IJ4 A;  1VQ7 V;  1EZJ A;  4FZ1 A;  4IHJ B;  3CXC U;  3T4D A;  2P22 C;  4DV3 O;  3UM7 A;  2DOS A;  4JI7 O;  1FFX A;  2WLM A;  2ZE6 A;  2Y4T A;  4UUJ C;  1GTO A;  2UXN A;  4DR3 O;  1S5H C;  4CC5 A;  1PL0 A;  1SKV A;  4H33 A;  5CB4 B;  1IVS A;  5LOV A;  4CH4 A;  1H2S B;  1Y4M A;  1IBL O;  3BY6 A;  3IC9 A;  2VRZ A;  3ETD A;  1X4T A;  2V4D A;  1KC8 W;  4OX9 O;  4LWS A;  4JI3 O;  1AVM A;  5BY1 A;  1S5J A;  4WBN B;  4TUY B;  5GTI Z;  2DN9 A;  2KG7 B;  5B1A C;  2LJ2 A;  4MTF A;  3CC7 V;  4PHZ A;  2V7Q G;  2KKW A;  3RYF B;  1VF7 A;  5KMG A;  1FFT B;  4YIP A;  3STL C;  1TA8 A;  4JYC A;  1H2K A;  1R3I C;  1EBO A;  3ZRW B;  3CP1 A;  4MVR A;  4TV8 B;  4G2K A;  3WFV A;  3WB2 A;  1I94 B;  5LGN A;  1FD9 A;  3T1H O;  3HB3 B;  1PNM A;  4HAM A;  5LMN O;  2P5O A;  2QWR B;  4CH5 A;  2EIM C;  3FYE B;  1OV9 A;  2RJZ A;  3OMI B;  2LO1 A;  1SS3 A;  1H2M A;  4DV5 O;  1K9M W;  3JAS A;  1K5S A;  1P4R A;  3E22 B;  5ITZ B;  1SES A;  2DYS C;  5LYJ B;  4I7Z B;  5B1B C;  3J80 N;  4TV9 B;  1E1R G;  2ZT9 B;  4HZ3 A;  4LF4 O;  5HFM A;  3AG1 C;  3CWB H;  2R70 A;  4ZOL A;  3TGU H;  2WA4 A;  3SPH A;  4LFB O;  2QWQ B;  2PYL A;  1MZF A;  2ZE5 A;  3LSU A;  3BVO A;  4QPJ A;  4H13 B;  1FJG O;  3EHB B;  5B1A B;  2Q6A A;  2Y48 A;  3ETE A;  1S5L Z;  2Z5U A;  1R3L C;  3K03 A;  1BT8 A;  1I7F A;  3OM3 B;  1K97 A;  1WAZ A;  5L3E A;  1CP9 A;  1FS0 G;  4GUN A;  1Y76 B;  5IYD O;  3G71 V;  4B3M O;  4UFZ A;  4DK1 A;  1N34 B;  1M1K W;  3ZBH A;  3T1Y O;  1N0J A;  1CXZ B;  1OCZ C;  2PF4 E;  1GKF A;  3RGB A;  4JV5 O;  1BSM A;  3OTF A;  2YEV B;  4DR2 O;  3CME V;  3QG5 A;  1D5A A;  1VQ6 V;  4WFA V;  2Y0I A;  2BCC H;  3U11 A;  4WFE A;  3E89 A;  3QO7 A;  1SZX A;  3K06 A;  2LGQ A;  3CC2 V;  5GON B;  1GN6 A;  3ZMU A;  2DYS B;  2IH3 C;  4FVM A;  3N2K A;  1P7G A;  5B1B B;  5DM6 V;  1BHB A;  2ZR2 A;  1V9P A;  2H8P C;  3OD4 A;  1UFI A;  2ARH A;  2YDE A;  1H2G A;  5IE9 A;  4D7T A;  5JH7 B;  2EX3 A;  1K73 W;  1K8A W;  1Q81 W;  4LF8 O;  3AG1 B;  1OJH A;  5LMU O;  4PA4 A;  1O9G A;  5CB4 A;  1ZLZ A;  4RO2 A;  2HR3 A;  5JCO A;  2PYJ A;  1Q5O A;  2XTA A;  5CMU A;  1WP7 A;  1SER A;  4MTG A;  4B7E A;  1E1Q G;  3K9S A;  2Q68 A;  1LNQ A;  1KQS U;  4WBN A;  3RYI B;  1DGS A;  2L35 A;  4TUY A;  3AK1 A;  2ZIO A;  3RYH B;  1SQQ H;  3RYF A;  3OR6 C;  3SYC A;  1OCZ B;  5CA3 A;  3RFR A;  1R6K A;  3OGC C;  2CAZ C;  1GH6 A;  1FXH A;  1TAE A;  1RFY A;  1L0N H;  3M99 B;  3F5W C;  4TV8 A;  1HNX B;  5L3C A;  3AG2 C;  1YIJ V;  3ZCC A;  4EKW A;  4WFG A;  5L3B A;  1TGO A;  2Q67 A;  5IDJ A;  1R3K C;  2XND G;  2NR5 A;  1NJI W;  3EVK A;  1D5N A;  3LDC A;  4U7O A;  4YJ3 B;  3SPJ A;  3E22 A;  5ITZ A;  3HKB B;  1WJZ A;  3S3W A;  5CA0 B;  1YI2 V;  2E74 B;  4TV9 A;  1G6U A;  3K9A A;  1Q82 W;  2EIK C;  4JI2 B;  5A2Q N;  2QSA A;  1SC5 B;  3P3N A;  2A0L A;  3E8G A;  1AR1 B;  1AJN A;  1HR0 B;  2IU3 A;  3NXS A;  5KHG A;  4BIO A;  3W7T A;  2JS3 A;  2QWP B;  4CS4 A;  1PNL A;  1XMO B;  2B5U A;  5JWP A;  1GM7 A;  4ZBM A;  3CX5 F;  1EN6 A;  3RBZ A;  3AG4 C;  4R7C A;  1SRY A;  3F7Y C;  2UUA O;  1YSC A;  2P67 A;  1MAB G;  5LXT B;  3GWK C;  4FZ0 A;  1N33 B;  1NTM H;  2R72 A;  1FXV A;  3H9V A;  1I94 O;  3FKS G;  1JOY A;  3L71 H;  2PTM A;  4KP4 A;  1NR1 A;  3SJB C;  2GSM B;  3B09 A;  3BFR A;  1MMM A;  1K4C C;  3L75 H;  1K4D C;  2UU9 B;  5GON A;  3ASN C;  3DXR B;  5H9C A;  4PA3 A;  1XHX A;  1PM9 A;  2VWJ A;  4JAV A;  2CGO A;  2YS8 A;  3K0G A;  3PJS K;  2P7T C;  1OCR B;  5JH7 A;  4NTY A;  3JD2 A;  1AJQ A;  4WFB V;  1YJW V;  2P4K A;  1W0K G;  1IBM B;  1HNZ O;  2E5L O;  2BTO A;  1FXK C;  3T2M A;  4HBN A;  2F4V O;  2EUL A;  4JI0 O;  1ARO P;  2QDO A;  3JAT A;  3QNE A;  3ZMV A;  4UCU A;  4LBE C;  3LUT B;  1VQK V;  2IW5 A;  3SPI A;  2QTO A;  5F2V O;  1R3J C;  1TUB B;  2QM7 A;  1F23 A;  3SYA A;  1DF5 A;  4JI5 B;  1J95 A;  3AG4 B;  2WLN A;  2QEX V;  4LC1 A;  4NXN B;  3HPL C;  4LF7 B;  4F6R B;  2LW1 A;  1IBK B;  1AP6 A;  2CTW A;  5EYP A;  1KYO F;  2IU0 A;  3RYI A;  3GWO A;  4KXR A;  2N04 A;  4PDR A;  3ABK B;  2QKC A;  3P3P A;  5K1P A;  1CPY A;  4ICG A;  4MS2 A;  2D2C B;  4B08 A;  4AHC A;  3OFN G;  3B4S A;  3ZJZ A;  3LNM B;  2A79 B;  3SYQ A;  5EZY A;  3VQY A;  1IDS A;  1M93 A;  2UXC B;  1WA8 B;  2OIE A;  3CCS V;  1GRJ A;  2X6A A;  2EIJ C;  4X62 B;  3A8T A;  1RSO A;  4AIL C;  4WFH A;  5GW7 A;  4U3J A;  5JJN B;  3BPZ A;  2UXD O;  4O4L A;  3ASN B;  5LP6 A;  2OWO A;  1VMG A;  3DTU B;  3CCM V;  1FKA O;  3ETG A;  2EZP A;  3LDE A;  5B1O A;  2IJI A;  2YIA A;  2QE7 G;  1ZWI C;  3I5D A;  5LGT A;  4DR5 B;  3APO A;  5CA0 A;  1VQL V;  1J5E B;  1QLN A;  1DLB A;  4PA7 A;  2K1E A;  4B3R O;  3UQ8 A;  2W6J G;  4DRX B;  3A2F A;  1SA0 B;  4X1I A;  2F93 B;  5LGU A;  2A7W A;  3WB1 A;  5C93 A;  4DR4 O;  2BSK B;  4AQY B;  4OXS A;  3E86 A;  3STZ C;  1IUR A;  2HG5 C;  4X65 O;  2JGD B;  4LF5 B;  3RVZ A;  1IX9 A;  2H94 A;  1M9N A;  4U7N A;  4B3S B;  4B3T B;  1SQF A;  5B5E Z;  3N27 A;  5J2T B;  4GX5 A;  4X89 A;  2DQ0 A;  3HKE B;  1PV0 A;  5GTH Z;  1EN5 A;  2WLL B;  1M56 C;  1Y6X A;  3BRC A;  4NTX A;  4W4K A;  2EIJ B;  4FM2 A;  3KCY A;  2FKX A;  5IY5 C;  1HNX O;  1P7B A;  2WPD G;  2ADQ B;  4F4L A;  4L8J A;  4YJ2 B;  3HKC B;  3SJA C;  1R1B A;  2QM8 A;  2PI4 A;  4DV0 B;  4JYY A;  5JQG B;  1NQT A;  1VQ9 V;  2JEX A;  2JJ2 G;  3AK3 A;  2FTK A;  4Z1V A;  2YI9 A;  2Y69 C;  3DSQ A;  3OW2 U;  4NXM B;  2EIL C;  3DGE A;  3TK1 A;  3ML0 A;  3EFF K;  4LH7 A;  4PJ0 Z;  4G27 B;  4JI2 O;  1N32 O;  2WLI B;  3A0R A;  1YTF B;  3AG7 A;  1AIL A;  2OIG A;  4JI1 B;  5KUM A;  2B9Z A;  3QO5 A;  2ZDI C;  1HR0 O;  4FFB B;  3MD0 A;  3A0B Z;  1XNQ B;  2Q8V A;  4MSW C;  2MK3 A;  1KP2 A;  4O4I A;  1BQZ A;  1AR4 A;  3WU2 Z;  3K5M A;  3HR0 A;  4F6R A;  1BCC H;  2VS0 A;  5H6R A;  1M56 B;  2XAS A;  3SPG A;  1NBM G;  2JRI A;  1YF2 A;  3UT5 B;  3DC5 A;  3PN1 A;  5BMV B;  2Q73 A;  1YJ9 V;  5IY5 B;  2XAF A;  4F6E A;  3K79 A;  2UUB B;  2GDS A;  1LR1 A;  1KKC A;  3AG3 C;  2HEP A;  4EFB A;  1VF5 B;  4Q6G A;  3UO2 A;  2HVK C;  4WFF A; 
#chains in the Genus database with same CATH homology
 5CBH A;  4FK5 C;  1M90 W;  5B3S C;  2X7R B;  3AG2 B;  4RUF A;  1CEZ A;  2Y69 B;  2EIL B;  3CCQ V;  1ROP A;  1SZT A;  4BAY A;  4RO2 A;  5LHI A;  2HR3 A;  1PKX A;  1YJN V;  1GM8 A;  1QCE A;  1TUE B;  2QKS A;  1KEC A;  3LDD A;  5CMU A;  4E2L A;  1SER A;  1GM9 A;  1AJP A;  4MTG A;  3W7W A;  3P30 A;  1E1Q G;  1FXK A;  4UXN A;  2UXX A;  2Q68 A;  3CD6 V;  2ZXW C;  2Z3Y A;  1LNQ A;  4DXW A;  1L1F A;  1KQS U;  1WPX A;  1OCC C;  3LSS A;  1G4Y B;  2EIK B;  3OUF A;  4PDV A;  3JYC A;  3B77 A;  4UV9 A;  3OR6 C;  3ZRX A;  2OCC B;  1V55 C;  5HFL A;  3SYC A;  4ASU G;  1OCZ B;  1HWY A;  5CA3 A;  1ENV A;  1R6K A;  3OGC C;  3D3I A;  1GMG A;  1K33 A;  2OT5 A;  1FXH A;  4ZKI A;  3M99 B;  3F5W C;  3ZMZ A;  4RAI A;  5L3C A;  3B8N A;  2HFE C;  3GB7 C;  3AG2 C;  1YIJ V;  3ZCC A;  1PNK A;  3MHH C;  4EKW A;  2C2A A;  4WFG A;  3QO8 A;  4MT8 A;  2EBO A;  1S76 D;  1JVM A;  3ZIA G;  4PDM A;  3FYI B;  5L3B A;  1BMF G;  3K0D A;  2DWD C;  4WCE V;  2WLL A;  1RM1 C;  1QVG U;  4Z1M G;  1IXM A;  2Q67 A;  1H8H G;  5IDJ A;  1R3K C;  2XND G;  3OAA G;  2EZO A;  2JDI G;  1NJI W;  3AG3 B;  1KP3 A;  4XBF A;  3CCR V;  3P32 A;  3LDC A;  2LFS A;  4U7O A;  3FB5 C;  3SPJ A;  3E8F A;  3ASO B;  1S77 D;  2XAG A;  1S3J A;  1YI2 V;  1VQ5 V;  1BHA A;  5B3S B;  1Y66 A;  3K9A A;  5CBG A;  3K04 A;  3ABU A;  1Q82 W;  2ZD9 A;  2EIK C;  3CCE V;  1MSW D;  2B1G A;  4MVO A;  4R6Z A;  4MW8 A;  3FB8 C;  1GK9 A;  3TET A;  3ABL C;  2OCC C;  5L3D A;  3ZMT A;  5FL7 G;  2A0L A;  2HVJ C;  4QNH B;  3E8G A;  1NVP D;  3B8M A;  1AR1 B;  3E35 A;  1UJW B;  1NKD A;  3JD0 A;  2OTL V;  1B6Q A;  1AJN A;  2IJH A;  2W6I G;  1S0V A;  5KA6 A;  4G28 B;  2IU3 A;  3NXS A;  1JX9 A;  3ZRV A;  3W7T A;  4UVA A;  4WFF A;  4XDJ A;  2ZXW B;  3WG7 C;  5IYC O;  4I5S A;  2JJ1 G;  1PNL A;  5CN0 A;  1GO3 F;  1OCC B;  2B5U A;  1AI7 A;  4JTA B;  4P9O A;  3T4Z A;  4P30 A;  1GM7 A;  1K92 A;  4ZBM A;  2V1D A;  1V55 B;  3RBZ A;  2GHY A;  3AG4 C;  2Q69 A;  4R7C A;  1SRY A;  3F7Y C;  4CZZ A;  4J9Z B;  3R65 A;  4CBC A;  3KG2 A;  3RW0 A;  5KUK A;  4I9W A;  1THZ A;  2A9H A;  1YSC A;  2P67 A;  2IH1 C;  4FPP A;  2P6J A;  4N21 A;  1FXK B;  2PI5 A;  3ASO C;  4JF3 A;  1MAB G;  5L3F A;  2DWE C;  1OCO C;  1DTO A;  4FMT A;  4QPK A;  4GX0 A;  3H01 A;  2W0F C;  1FXV A;  2WLK A;  3FKS G;  1JOY A;  4YXW G;  4KUM A;  2D3O W;  4KP4 A;  1NR1 A;  3CYO A;  2XOK G;  1RM1 B;  4H37 A;  1MOF A;  4XDK A;  3JD1 A;  5KA5 A;  1XL4 A;  2GSM B;  1K34 A;  4X8A A;  5EBW C;  3JD4 A;  5L3G A;  3CC4 V;  5J9P C;  1K4C C;  1K4D C;  5DN6 G;  4XDL A;  4J9Y B;  3CMA V;  2DQ3 A;  3ASN C;  2NLJ C;  5H9C A;  4PA3 A;  5EK0 A;  4JAV A;  4BIU A;  5LBQ A;  5E1A C;  1F51 A;  3ABL B;  3SPC A;  3K0G A;  3OEH G;  1KD1 W;  3PJS K;  2P7T C;  1OCR B;  3JD2 A;  1AJQ A;  4WFB V;  1YJW V;  1W0K G;  3ZRW A;  1JPX A;  1H8E G;  1G8M A;  3D36 A;  1FXK C;  2KB1 A;  3T2M A;  1COW G;  1ARO P;  2WLJ A;  4GCZ A;  3QNE A;  3ZMV A;  4TWK A;  2YSU B;  3WG7 B;  3E8H A;  4LBE C;  1YHQ V;  3OUS A;  4RUE A;  2ZR3 A;  3LUT B;  4BIZ A;  1F4M A;  1VQK V;  5H6Q A;  3W7S A;  2IW5 A;  3SPI A;  2QTO A;  4MTO A;  1R3J C;  3OR7 C;  3ABM C;  1V54 C;  4UVC A;  2QM7 A;  1W2B U;  4PA9 A;  1F23 A;  3SYA A;  1DF5 A;  3FB7 C;  2LP7 A;  1J95 A;  3AG4 B;  2WLN A;  2QEX V;  4LC1 A;  3HPL C;  4N23 A;  1RPO A;  2HLD G;  1OZ0 A;  3K3W A;  2XAJ A;  1Q86 W;  2ZDI A;  4FIP C;  2IU0 A;  1JJ2 U;  2R9R B;  3GWO A;  4PDR A;  3ABK B;  3CPW U;  1VQP V;  1JCH A;  2ZQM A;  1OCO B;  1CPY A;  3ZN0 A;  4JAS A;  3SJQ C;  4MS2 A;  4DO2 A;  2X0L A;  1K5Q A;  3OFN G;  3ZJZ A;  3LNM B;  2A79 B;  3SYQ A;  3IC7 A;  1VQ7 V;  1EZJ A;  1NVP B;  1YTF D;  1OCR C;  3CCS V;  2X6A A;  3CXC U;  2EIJ C;  4GX2 A;  2B1I A;  4JGS A;  1BL8 A;  3T4D A;  3F7V C;  3UM7 A;  3E2E A;  4MTX A;  2WLM A;  4UUJ C;  1GTO A;  2UXN A;  4WFH A;  1S5H C;  4PEL A;  5GW7 A;  1PL0 A;  4H33 A;  1N8R W;  1VQM V;  3ASN B;  3DTU B;  4PA6 A;  3CCM V;  3ETG A;  2EZP A;  3LDE A;  5B1O A;  2XAQ A;  1AI4 A;  1Y4M A;  2IJI A;  2X6B A;  4JYB A;  2WLI A;  3BY6 A;  2M7W A;  2QE7 G;  5LHH A;  2EIM B;  4RQE A;  1EFR G;  2WLH A;  1ZWI C;  2WSS G;  2AHZ A;  2EIN B;  2XAH A;  3G4S V;  1VQ8 V;  2ITC C;  5LGT A;  2DYR C;  3ETD A;  5EC1 C;  2CK3 G;  1K3E A;  1RPR A;  1KC8 W;  1VQL V;  4L87 A;  1M57 C;  1DLB A;  1W0J G;  4PA7 A;  1QLN A;  3ABK C;  2K1E A;  2W6J G;  2LFR A;  5LGU A;  4P2Z A;  3RVY A;  3SYP A;  4QJF B;  3ZMS A;  5B1A C;  4MTF A;  3CC7 V;  1NR7 A;  2V7Q G;  2F43 G;  5C93 A;  2ATK C;  4R50 A;  3ABM B;  4OXS A;  1V54 B;  4X88 A;  1FFT B;  2YEV A;  3E86 A;  2HG5 C;  4GT1 A;  3STZ C;  3STL C;  4UV8 A;  1NH2 D;  3RVZ A;  1XL6 A;  3OEE G;  4JYC A;  3ZRW B;  1R3I C;  1EBO A;  4MVM A;  2H94 A;  1M9N A;  4JPR A;  4U7N A;  3CP1 A;  2AHY A;  4MVR A;  4G2K A;  3WFV A;  3CCV V;  5LGN A;  3T1C A;  3HB3 B;  2HKO A;  1PNM A;  4HAM A;  4GX5 A;  2DQ0 A;  3IFX A;  4X89 A;  3AEI A;  1QLE C;  1AI6 A;  3VOU A;  4P9P A;  2IJK A;  2EIM C;  3FYE B;  3ZRS A;  2WLL B;  2OTJ V;  3I56 V;  2EIN C;  4R8C A;  3MHS C;  3OMI B;  1M56 C;  2EJR A;  4KFM A;  2EIJ B;  4JTD B;  1K9M W;  1K5S A;  1P4R A;  5IY5 C;  1QR8 A;  1SES A;  2DYS C;  1P7B A;  3G6E V;  5B1B C;  1K7D A;  1R6N A;  2WPD G;  4LP8 A;  4TSF G;  4WF9 V;  1E1R G;  5EBL C;  4F4L A;  4JTC B;  4HZ3 A;  4MVU A;  5EBM C;  2QM8 A;  3CCL V;  2PI4 A;  1I5X A;  1I5Y A;  3JCZ A;  4Q20 A;  1AI5 A;  3CCU V;  4BW5 A;  1NQT A;  1VQ9 V;  5HFM A;  1WLE A;  2JEX A;  3X2Q C;  5EC2 C;  3TCU A;  2DYR B;  3AG1 C;  4LCU C;  2JJ2 G;  2WAM A;  1SET A;  2FTK A;  2QA4 V;  1VQ4 V;  3BEH A;  2Y69 C;  1M57 B;  2DW4 A;  4GX1 A;  3SPH A;  1QR9 A;  2EIL C;  2P90 A;  3OW2 U;  3DGE A;  1F4N A;  3FB6 C;  2R9I A;  3TK1 A;  3ABT A;  3EFF K;  3ML0 A;  1R73 A;  5BZB A;  2IJJ A;  4QPJ A;  1MG1 A;  3EHB B;  4FJC C;  5B1A B;  4G27 B;  2Y48 A;  2Q6A A;  3ETE A;  4PDL A;  2WLI B;  1PD3 A;  3A0R A;  1H38 A;  1YTF B;  2Z5U A;  4UVB A;  1E79 G;  3SYO A;  1R3L C;  3K03 A;  3OMN B;  1YIT V;  2WWW A;  3E83 A;  3OM3 B;  5KUM A;  1K97 A;  4QE7 A;  3QO5 A;  3IGA C;  2NNU A;  2ZDI C;  5L3E A;  1QVF U;  1VQN V;  2HJF C;  1S72 V;  3MD0 A;  1CP9 A;  1FS0 G;  2BOC C;  5IYD O;  3G71 V;  1ORQ C;  3K08 A;  5B1N A;  1M1K W;  4MSW C;  3I55 V;  2JIZ G;  2MK3 A;  4MVQ A;  1OHH G;  2X6C A;  1OCZ C;  4QE9 A;  1QLE B;  1GKF A;  1DF4 A;  1KP2 A;  2BOB C;  4MVS A;  2JEU A;  4TT3 G;  2YEV B;  3W7X A;  5H6R A;  1M56 B;  2JK5 C;  2XAS A;  3SPG A;  2ITD C;  3CME V;  1NBM G;  3LSQ A;  3CCJ V;  1VQ6 V;  3UKM A;  4WFA V;  4WFE A;  3E89 A;  3QO7 A;  4RQF A;  3K06 A;  5IY5 B;  1YJ9 V;  3CC2 V;  3ZMU A;  3OE7 G;  2DYS B;  2IH3 C;  1Q7Y W;  3W7U A;  2XAF A;  5B1B B;  3K79 A;  3VBB A;  4MVZ A;  4HYO A;  1VQO V;  5DM6 V;  1BHB A;  2ZR2 A;  3E8B A;  1JQ0 A;  5LHG A;  1KKD A;  2H8P C;  5IYB O;  3OMA B;  3AG3 C;  1H2G A;  4JAU A;  1QBZ A;  1K73 W;  4MW3 A;  1NH2 B;  5CBF A;  3ZN1 A;  3X2Q B;  1K8A W;  1Q81 W;  3JD3 A;  3AG1 B;  2HVK C;  4PA4 A;  4QIW F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...