3EHBB

A d-pathway mutation decouples the paracoccus denitrificans cytochrome c oxidase by altering the side chain orientation of a distant, conserved glutamate
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
252
structure length
252
Chain Sequence
b'QDVLGDLPVIGKPVNGGMNFQPASSPLAHDQQWLDHFVLYIITAVTIFVCLLLLICIVRFNRRANPVPARFTHNTPIEVIWTLVPVLILVAIGAFSLPILFRSQEMPNDPDLVIKAIGHQWYWSYEYPNDGVAFDALMLEKEALADAGYSEDEYLLATDNPVVVPVGKKVLVQVTATDVIHAWTIPAFAVKQDAVPGRIAQLWFSVDQEGVYFGQCSELCGINHAYMPIVVKAVSQEKYEAWLAGAKEEFAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1-beta
publication title A d-pathway mutation decouples the paracoccusdenitrificans cytochrome C oxidase by altering the side-chain orientation of a distant conserved glutamate
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/immune system
total genus 74
structure length 252
sequence length 252
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2008-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ehbB02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ehbB01
1GS8A 2UXFA 1CUOA 6PCYA 2OV0A 2GB2A 4YVUA 3NT0A 1PLBA 4E9QA 1WA2X 2YXVA 5I26A 2VW4A 2XUWA 3HB3B 2ZONA 1OCOB 4GXFA 3OMNB 3TA4D 3BVDB 1BEXA 2PPDA 4YSPA 2UXVA 1W8EA 1OCCB 4YSDA 4BWWA 3H4FA 4EF3A 3FU8A 4ZK8A 3IE9A 4A2HA 1OF0A 1KCBA 3T6VA 2FNWA 2X88A 1IBZA 2HRHA 2X87A 1WA1X 3AG2B 2BP8B 1L9RA 3TASA 3IN2A 1IUZA 3FS9A 3CVBA 3QJUB 5FC9A 2JXMA 2NRDA 2IH8A 1AQ8A 2CUAA 1SNRA 3AG3B 1XMEB 2H3XC 1PZAA 2YAOA 4DP2X 4A2EA 2HXAA 2UX7A 3NYKA 4BXVA 1A65A 3QJTB 2GC7C 3QJVB 2XYBA 5I6LA 1V55B 2IDUA 1BXVA 1E30A 4F2FA 1JERA 3T71A 4KO6A 4TXVB 5I6PA 3X1NA 1OOWA 2AVFA 1JZJA 1BXUA 3G5WA 5I5IA 1E5ZA 2IDFA 2YAPA 1RKRA 5F7BA 1OE2A 4KO5A 2EILB 2HX7A 5TK2A 5I5MA 4P5SA 4BWTA 5I6OA 3ABMB 3FYEB 1NIDA 3PAVA 3NSDA 1FFTB 1V10A 1PAZA 1NIEA 2I85A 1GYCA 1J9TA 3FSVA 5IY5B 3QQXA 4HIPA 2YAHA 2ZWNA 1GY1A 3UGEA 1JZGA 1X9UA 3FQYA 4GY4A 2XV2A 3WNJA 4YSOA 2DYSB 2J57A 3OMAB 3CG8A 3FQ1A 3UAAA 1T5KA 4BK5C 3DIVA 3EH5B 1JZIA 4KO7A 4KNSA 1ZDSA 3UAEA 4GYBA 4W1TA 1JVLA 3FSAA 5B1JA 2BO0A 1RCYA 1JXFA 1AZUA 1GY2A 1L9OA 1J9QA 3SBQA 1BQKA 1HAUA 3PAZA 1NINA 4AKPA 4YSUA 2MRYA 3NP3A 4HHGA 1OV8A 1HAWA 2BHFA 1RZPA 1SF3A 2B08A 2IH9A 5B3SB 7PCYA 2P80D 1KGYE 2DWSA 2QT6A 3S3BB 1YLBB 2TSBA 3WKPA 4DP0X 2GC4C 1ZIAA 3OM3B 3PAUA 5I5JA 3WIAA 1ASPA 4ENZA 1DYZA 3NJHA 2PPAA 1KDIA 3ABLB 1L9QA 3NJGA 4KO9A 4DPCX 3FYIB 3S3CB 4CSPA 7PAZA 3X1BA 2LLNA 3QJRB 5LDUA 3NP4A 2E86A 4GP8B 3ABKB 1OE1A 1AAJA 1XB8A 2GIMA 2UXGA 3WKQA 3ZBMA 4UANA 1A3ZA 2DY2A 2XU9A 4G70B 3PCYA 4BDVA 4K9JA 3V9EA 1HFUA 1IKOP 2XV3A 2GHZA 1WS8A 3ZX1A 4DP9X 1M56B 4UF7C 1V54B 1XB3A 4NB7A 4Q89A 3SQRA 3FPYA 2A3TA 1PNCA 5I6NA 2HX9A 2QDWA 1ID2A 5AZUA 5PCYA 4DP7X 1SFDA 4HCIA 2FQDA 2GBAA 1E5YA 5I28A 4E9TA 1NIFA 1QHQA 2WO2B 2BZCA 3SBPA 4M3HA 2BWIA 3QJQB 4QKTA 3T9WA 1JVOA 1PMYA 2J5WA 5B1JC 2GI0A 4G7RB 1JZFA 1PCSA 1AS7A 1BQRA 2AFNA 2Y69B 1NWPA 4AKQA 2BZ7A 2OJ1A 4UAHA 4PCYA 4DPAX 1A4CA 3ZDWA 1ET7A 4E9XA 4GP5B 1TKWA 1AS6A 3AY2A 1AZCA 2EIJB 4BXSV 3AG1B 2VMJA 1AG6A 2PPEA 1WS7A 1UATA 1ADWA 4BDVB 2VSMB 4A67A 2R7EB 2IWEA 4YSQA 2PP7A 2AZUA 1SHXA 3C75A 3MBWB 2FWLB 3FSWA 5TK4A 3AG4B 1SDDA 4YSAA 2PP8A 1NIAA 3FU9A 1AG0A 2J56A 3GDCA 5E9NA 3TBCA 3OMIB 2J55A 3N55A 1TEGA 4YVNA 1A8ZA 1CYXA 2XXFA 2BW4A 4P5RA 2TSAA 2PLTA 1JXGA 4HCGA 4HZ1A 2DV6A 4G7QB 1JZEA 4YSCA 1PLCA 2HZHA 4DP1X 1GS6X 5D4HA 3UABA 4NERA 4DP6X 3DTUB 4JHUA 1M9WA 1AS8A 5B1BB 1JXDA 1E65A 1MZZA 1SHWA 2FQGA 2W8CA 2WO3B 4AZUA 4A2FA 3CVDA 3EH4B 2PPFA 4JHVA 4M4RB 1QNIA 1PY0A 4AKOA 3S8GB 1JZHA 3NSYA 2PCYA 1R1CA 8PAZA 1W6LA 4PAZA 1JOIA 1RZQA 3QPKA 2HX8A 2FT6A 3PXLA 1SJMA 4WTQA 1KBVA 2RACA 3X1EA 4E9VA 2B3IA 9PCYA 3OD3A 1CYWA 3JTBA 2XV0A 1NWOA 3FPXA 2YQBA 1SDDB 5AFAA 3FQ2A 4E9WA 2XWZA 1W6WA 4BWUA 4QLWA 1AZRA 1F56A 1BQ5A 2H47C 2YAQA 4GP4B 5AKRA 1GR7A 5B1KA 2UXTA 2IDSA 5D4JA 1PZCA 3UACA 1WA0X 2YXWA 1GSKA 2XVBA 1MZYA 2IWFA 1VLXA 1CURA 4A68A 4AX3A 2MTAA 2I7OA 3ERXA 5F7AA 3PLYA 3CDZA 4CSZA 1E67A 2CBPA 3NJJA 1NDTA 4FAAB 2VSKB 2VW6A 3FSZA 1I53A 3ZIYA 4E9SA 2BW5A 2EIKB 1QLEB 2YAEA 2R7EA 4KNTA 2FT8A 4DP4X 3WI9A 2FTAA 3FU7A 1J9RA 1KCWA 2PP9A 2PPCA 1J5DA 1ET5A 4RH4A 1ET8A 2OCCB 1PLAA 1PNDA 5I6MA 1AZNA 1AR1B 2QDVA 1MG2C 3T6WA 1ZV2A 1B3IA 2IAAC 1A4BA 3D12B 4HALA 2XXGA 4KOBA 4DP5X 1AZBA 1ASQA 4F7KA 1A4AA 4A66A 3V9CA 2YAFA 4N4YB 2Y1AA 1AOZA 2IDQA 1ZPUA 1X9RA 2DWTA 1TEFA 3DKHA 3MX0B 3X1GA 2VW7A 4HAKA 4YSEA 3CDZB 2FJSA 4X4KA 4DPBX 2XX1A 1OE3A 4G72B 3NSFA 2GSMB 3GYRA 5EHFA 4A2DA 3ASOB 2IDTA 2CALA 3U25A 2W88A 2YAMA 2XLLA 4YSSA 4DP8X 1BXAA 3FU7B 3WG7B 2VM4A 1J5CA 4G71B 2I7SA 3H4HA 4E9YA 3CVCA 1ILUA 3N2JA 4F2EA 4G7SB 2Q5BA 1IBYA 4MFHA 4JKNA 2XX0A 1ETJA 1FA4A 3EF4A 1OCRB 2YARA 3IBOA 3L45A 3S8FB 1XB6A 3AZUA 4YL4A 1BYPA 2JFCA 3SBRA 2EINB 2WSDA 3GXUB 3X2QB 4N8UA 3CZUB 5ANHA 4FA7B 1NPNA 3WNIA 3S3DB 2IWKA 1J9SA 2PCFA 3X1FA 1MG3C 1BAWA 3NJMA 2ZOOA 1L9SA 1NPJA 5B1AB 1GW0A 5D4IA 2BP0A 4YSTA 1ZDQA 2HRGA 3T6XA 1IC0A 3RYMA 1AANA 1WAEA 1PZBA 1NTDA 3EHBB 1SFHA 5PAZA 2VN3A 3AW5A 6PAZA 2HLEB 4NAJA 3QJSB 3NJNA 2AANA 3KW7A 2CCWA 2H5UA 3TBBA 1L9PA 3ASNB 1KDJA 1AACA 2YEVB 1ZIBA 4E9RA 1M57B 1NIBA 3JT2A 1AIZA 1PF3A 2AZAA 2FQEA 5A7EA 2QPDB 1N68A 4WKXA 4KOCA 1OCZB 1KYAA 2FQFA 4W9ZA 2FT7A 3T6ZA 2CJ3A 3NJLA 1N70A 2VM3A 1FWXA 4YSRA 1DZ0A 4A2GA 5B7FA 4AI7A 5I6KA 3OQRA 1BYOA 1URIA 3NJIA 2N0MA 4Q8BA 1MDAA 2Q9OA 4HHWA 1ASOA 3HEIB 3UADA 1GS7A 2UX6A 3NJFA 2QPEB 1EHKB 3KW8A 5B7EA 4L0PB 3ABGA 2JKWA 3NSCA 2P80A 2CAKA 3EH3B 3BQVA 1CC3A 3FT0A 1NICA 2BWDA 5B7MA 1ILSA 2BP0B 3IEAA 4HCFA 3PPSA 2BP8A 2ZXWB 3IN0A 2EIMB 3NJKA 1L9TA 2DYRB 1EZLA 3H56A 1TU2A 4KNUA 1NZRA 1KBWA 3TU6A 1SF5A 1KV7A
chains in the Genus database with same CATH superfamily
2P5EB 2E9IA 4L2LA 3V0GA 4KKZA 3MUUA 4OBRA 1Y07A 3CU7A 2Q7YA 3WO4C 2NY5H 3II3A 2JQZA 3B7SA 4OLYL 3C08L 1ZVSA 1JFFA 1I7TA 2Y5TB 4Q74A 3DETD 4PS8A 5IIEA 2JV6A 4PBWD 4L8SC 2ENSA 3X3GH 3MBEA 5B1NA 4PLKC 4R90H 3U10A 2DQJL 2XSKA 2PPDA 2WZ6A 1E4XL 2GJ6E 2PW1A 4DWHA 2JTDA 5J9PB 4DV0O 2OTPA 3DUUB 3FUIA 4FQHA 2IIJA 3RB5A 2VWKA 1P5UA 4O2EB 3L75H 2FL4A 4Z78B 2D73A 1QA9A 1XTMA 2BOCC 2WGXA 3GSXB 4BW9A 1OV9A 3MNDA 3ZKNC 3CE1A 2X7RB 3VB8A 3SDYL 1A6UH 3I3DA 1JUFA 1P9MC 3VGBA 2X88A 1Z5LA 2IGFH 4XC3L 2OCFD 1FFNB 1FVEB 4LDEB 1ZTXE 4OZFB 5FC9A 2OCHA 4NIKB 2IH8A 1TU2B 4OIFA 4D94A 4NKDA 5FKPA 2NT0A 2ZTBA 4WHCA 4F7TB 1KCKA 4DV2O 2NUTB 2Z8VC 4P23A 5HHPA 4GCZA 1AO7A 2R56L 3V4VA 2X89D 1O5PA 4KMTL 2OYMA 1XIWC 1YEEH 2LU3A 4RFEB 1UVQA 4C83A 4PU2A 2HFFB 1M1XA 2PCXA 2UZPA 1D6VH 2HKHH 3K6FA 1VF6C 1NPUA 3BYTA 5E6RB 2PYEA 2EDWA 4PV8A 4ENEC 1OOWA 5E2TL 3KWXA 1WBXB 4JFDE 5IFAL 4JI1O 2VR4A 3ILDA 5ICZB 3MLRH 2GK2A 1UXWB 3EW3B 3EO9L 2R0ZH 3R7RA 3P0VL 5F7BA 4JZNA 1UXSA 1UD4A 5I8KH 4KH2A 1BM7A 1VZHA 3JARA 5KBNC 4GSXA 5CLWA 4A37A 3ARTA 2J6EL 3DPDA 3L7FB 1JV5A 1VFBB 5KVMC 3CLEL 1AQDB 4LSVH 1U3HC 3UTQA 3JD4A 1EUTA 3FTWA 1U30A 1RK1B 5DJDB 4OCXL 3TURA 4FXGC 4W9JC 2HG5B 4NZRL 3GM0A 5IB1A 4GUPA 5DS8B 3L70H 1IEBA 3J2PA 3QDAA 4N6QA 3ZKMD 5DJXA 1RHHB 2YMXL 4PA6A 1ZXQA 4I0PB 1CE1H 4GY4A 4OCNC 2AHIA 4X83A 1R3LC 2VUKA 5FYJH 4IGBB 3VSTA 5E1AB 2J57A 2BE3A 3PDOB 1NDGA 1X4TA 1OARH 1CICA 3E9UA 2XRAH 1JK9A 2MQCA 5EC1A 4AZ8B 2Y0IA 4L3CA 3WDHA 1MUJA 5GGVY 3DVGA 4R26L 3GLZA 5E4EB 1X5XA 4HUWB 4OD2B 3R7QA 1U95A 4LSDA 4AL8L 3D3QA 3CSYA 1DVFB 5AL0A 3VQVA 1X6NA 1A6VH 1RZ7L 2ICES 2A3QA 3MRQA 1YPZA 2HTLD 3D85B 3PAZA 3RY6A 4LIQE 3G6DH 4UV4H 4ANKA 4LOEA 3F5WC 1MJ8L 1P7QA 1TZAA 2H32B 5C08D 5JXEC 2KPNA 2WAMA 3FFDB 3UTZA 5E00B 2NY3D 1QKZH 2NUPB 2WY3B 4NQTA 4PP2A 3K57A 1KGYE 2DBLL 2DWSA 3O4LB 1YLBB 1RULL 1BBJA 3GEWB 3FRUA 4MJ5B 2LFRA 3NZUA 5GRJH 2GDSA 5AVSB 3VWKD 1ZEAL 5I5JA 4M7JH 3VGGA 1E1RG 2OULB 1PQZB 4UQ3B 2XZCH 3TBSA 4IYHA 2VC2B 3EO0A 1ETZA 4RGMC 4XZ4A 1QWNA 2KS0A 3SE4A 5ITFB 1K33A 1LK2B 1NVPB 2MOVA 4DKEH 2KDGA 1S7VA 4MVBC 1ONQB 4HWBA 2R2HB 4S1DD 4JM4L 5EOTA 1CFQB 1V7ML 2IW5A 4YEEA 3UAJD 5CMUA 1ZHLB 3WKQA 3FHAA 4MS6A 1JF1B 3ZHVA 4G70B 3LRKA 2DYRC 3PCYA 4XVOA 3TO4A 2FO8A 2J8HA 5EPMA 3D06A 3ZX1A 1YYMH 2ZIOA 1C12A 3F7PC 5HHQA 3T0DA 3QXWA 1H3PL 1BZEA 5LHHA 2QKSA 4C7UA 3ZZQA 1XGYH 5BW7C 2IBZX 1TVBA 3N27A 4BUQA 1F58L 1JJUA 4ZRGA 4KV5E 3L9DA 4NWUH 4WUUD 3O3AB 5I0YA 3T9WA 2Q6WA 1T2QH 1I8IB 1A7PH 1F4NA 5TH2A 4U4BA 2YKLL 2A9ML 2A9HA 4HCRH 1OPOA 2YR3A 1JZ5A 2ZCHL 3UIZA 1RV6X 4PJFE 5E8NB 3VVVA 1S7RA 2CNYA 1N5AB 4WTZG 1IB5A 5ESAA 3DOHA 2J88H 4WU7B 2CO2A 2Y07H 1VACA 2VXTL 4QTIL 5DDHB 5AL8A 1U9KA 5CD3B 1JJOA 3AG1B 3BYYA 5KX5B 2HPTA 4KI5D 3RU8L 3S37X 4AGLA 1PKQB 4IGBD 1G9EA 3L5WB 3THMH 2BH0A 2YS8A 1JPXA 4QHLB 2NXZB 4P30A 2VSDA 1QSFE 3GHEL 2EH8H 5LOVB 4DGVH 1EEYA 4KK8C 1XF3A 5F0JB 4Z7OB 1GXEA 2YPVL 3GLAA 3E89A 5F9DC 3TCLA 2YQ2A 5IQ7L 3WFEL 1DVFD 1NIAA 1E7UA 2P47B 3VE0A 4LQFH 1LO4L 3JUZA 3BH4A 1O9WA 4TQIA 2IAMA 2F93B 4LKCB 1ZLUK 4HF5L 2ICWB 5D6CB 4UDTA 3TBYA 5EOCL 2BW4A 2P6JA 2YUVA 1JPEA 1KPUA 2WJ5A 2H2PC 4LOFA 4NX0A 3CSTA 2JWYA 4Z18A 1CBVH 4N28A 1XXFC 4XMPH 3LN5B 3O4LD 3RVYA 2IJKA 3LKPA 1E3ZA 4GKJB 1TSHA 5C2BH 3KPSA 3SCMA 2ENQA 1P4IL 1JI2A 4ALAC 1TJGH 1W0KG 5HI5C 2FQGA 3JV4A 1NTMH 1MXGA 3QHTC 4OGYL 2XTJC 5EIIG 2EE9A 3KH4A 4LCWB 4OZHF 1NKGA 3WXWH 1ZLUH 1FXKB 1UHVA 4M9OA 4M4RB 1JK8B 1QNMA 1O75A 2WXOA 1JZHA 5JIKA 4CC6A 1IVSA 3JASA 5MP6H 1W6LA 4M1GH 4LCCA 4M5TA 1ACYH 4CC4A 2OXGA 2NY1C 2Z7YA 1FNLA 2NY4B 1JHKH 2PO6C 2YEQA 1KBVA 4Z0BL 3X1EA 4GUQA 9PCYA 1RZIB 3AGWA 1JV2A 2XV0A 3IFLL 1AP5A 3LZNA 2HPOA 1N8RW 4DVRH 5CCKH 2L3BA 3FQRB 1OGSA 4PGDA 5EU7E 5L88H 1W6WA 4XO9A 2ED6A 5AZEH 4Y7OC 1DTUA 1D5RA 2UXCB 2WKOA 4IKJA 3MRRB 5EUKB 2PGGA 4MQXD 3GNML 4M7ZC 4DO5A 4U1KB 5D4JA 1TYJA 5JR1H 1HEZA 4JKWA 5CJ5A 5K1NA 4OXSA 1DLHB 1MIEH 1A6AA 1F45A 3U0ZA 4UDUA 4WHYG 5KYWA 3MQIA 4ETQA 1FI8C 3OR7C 2OSLB 3LNGA 5MEPB 4YIOA 3SKNA 1JNJA 4I1PA 2YK1L 1SM3L 2YO3A 4U7SA 3SJVB 3VFWA 1ROPA 2NQ3A 2E27H 2PXYC 3BUYA 2A9CA 4KKLC 1XCTB 4FFVC 5CILL 5D8JL 4IK7A 3BRGC 1QFWM 4TVSa 5F72S 3L16A 5KSBE 4ATWA 4PRPD 2GABA 2H1PL 3D87B 4J9YB 1I1AC 1LK3H 3MRPB 2G0KA 4BIOA 3V4VH 2LW3A 3ZU8A 2W60B 3AUWB 2CNZA 3MBED 4AH2A 4JI5B 1IAKB 5KWYC 1YEJL 5HHOE 4DRXB 2C1PA 1B6DA 4DK0A 2PP9A 1AXSA 1WC7B 3NN8A 1CG9B 4QRUA 2BDNH 1ET8A 1YEKH 3NH7L 4LF4B 2OJEA 4O4HA 2BFVH 5E8DL 5IW6A 3SQOL 5DZ9A 4ZTPL 5CP7B 1KBPA 4LGRB 2Q20A 3H54A 2BSSB 4P06A 3H53A 3L3OC 2VRQA 1UOWA 1EFQA 3PYCA 1H3VA 4TTDD 4JKMA 2F19H 3DV6B 1R3KC 3ILQD 3QEHB 2VW7A 3BVWA 4EQ3A 2W0FC 2UUCO 2AJXL 3BIBX 35C8L 4JM0A 4PCSA 4C59B 4MT8A 1SXBA 3T4YA 3QWOA 1UJTA 3V6ZA 5CBAA 4AGMA 4DPBX 1XFPA 1AO7D 3CS5A 5LWYL 2BHZA 1OE3A 3DOSA 3JWDH 1MCOH 1RUPH 4FG0A 3ZS8C 4BUGA 4NPKA 3KG2A 1CZ8L 3KYKL 2CPCA 5D1QC 4I5SA 3QUKA 3B8YA 3IAQA 3LMJL 2AGAA 2PYED 1DSWA 1UEMA 2AJ3B 1U4EA 5HPOA 1X4ZA 1OCWL 1OZ0A 3SPVA 4G6MH 5LXGL 3K6SB 4N2NA 4L1HA 4JTDB 3H4HA 4U3SA 2NY4D 4HWZA 4GUCA 2DM4A 3QA3A 2VS0A 1TVKB 5FCUH 1EHLL 5D71H 1NGQH 4X65O 2YD6A 4G1EB 3U0WL 1CBJA 3TYGL 1UH3A 2CLVB 3RPKA 5TDNB 3VNZA 2JKXA 4LOVA 4IOFD 2C9SA 4J4PC 4YAQB 1B9ZA 4ZMWA 5LA6B 4V11A 5FW8A 4KP4A 2YD7A 5KSAD 3Q13A 1K8IA 4YLQT 4ZI7A 1F1GA 1CWVA 1PCXA 3CFBB 1BZQK 4LFCB 1JPGA 3L6FA 2YDEA 1JWMA 2CIKA 2XQYG 4JI7B 5DO8A 3WNIA 2ICEA 1M7IA 4M6ML 4PREB 2EAEA 1Q38A 1J9SA 2IWKA 3ME0A 3SKOA 4LDOB 5B39B 4DV6B 1G9NH 4K71B 4O02B 2VLRA 3U9WA 4RGNB 1FS0G 1CGSL 4HZLB 3WU1A 4B3MB 5L2JA 2X2HA 3ZKXC 4X6CB 1JF6A 4HX1A 4KVCH 3TNNB 1SXAA 3CVHA 1AANA 2E56A 4M02A 3AQDA 4DZBA 4POZC 1P84J 1S7XB 3GGWA 3MLWH 6PAZA 3MLZH 3PJLA 5FGCE 1KBKA 4OZHE 2UYLA 2P46B 2IMNA 4L05A 1G8MA 4K5MA 1SJEB 1A9EA 4I9WE 4KVPA 3TL5A 1KDJA 2VN6A 3LNIA 4HWBH 2B2XH 5IWAB 3HBPA 2WQWA 4MTXA 1KD1W 3QJHA 3ZGHA 5KJRL 5H35A 4J1UB 5DVOA 4PG2A 3HNVH 1O9GA 4LBEA 4L9LA 5FDYA 5DHMC 1EXUB 4I2XA 1D5IH 1QR4A 1L0XA 2DWDC 3FUJA 4F6EA 2BRRL 5BZDA 1SZNA 2HEPA 2FT7A 1FWXA 2ZOKA 3ZHDA 1P7QD 1VHPA 3UTTA 1G9ML 4EAEA 4PJGB 4N3UA 4YNYA 5E8OA 1CFVH 1QFWI 3P4NB 5ILTH 4PLOB 5FL7G 3GBDA 4YDLB 4MYWB 3V5DA 1M1SA 5I0ZA 5K9JL 5HXMA 5IM7B 4GAYA 5F7FA 2FWSA 3PHQB 4DK5A 3SBWA 3FTGB 2JKWA 1RURL 3NSCA 4HK0A 4WI0B 1XF2B 3BQVA 5LMNO 4FFZA 3ZDZF 3QIUB 2A6DA 3IS1X 3IU4L 1BQZA 1J1OH 3KS0J 5DD6A 1KU9A 3RZWA 4Z3GA 2E74B 3FFOA 1VEOA 4LCYB 1PZUB 1JNHA 1WHOA 2ZQMA 2E9WA 4OLWL 1VF5C 4X7DC 1TO4A 3SPIA 3UERA 2X6VA 2A6IB 3QZMA 3Q43A 5JOPD 3NEEA 1RL1A 5K9KB 4KHTL 3U7YL 2N04A 3LKNA 3TO4D 3P3SA 3RWEA 1GZHC 2PTVA 5KHGA 2W0PA 1FN4B 2Y1ZA 4HIJB 1CXIA 2R2EA 3DX2A 3RPIB 1GH6A 2PNDA 1QFWL 2DQIH 3REWA 3KS0H 4OIIH 4D9LH 3CSGA 4JGMA 4JI8B 4G5AA 3K3WA 1N3NB 3I6LD 3FD9A 2BERA 4A6YB 1IO4C 1A14L 1PG7L 4GX0A 1M4UA 1VA9A 1TUPA 1DBMH 4RDQF 5SWZB 2B7DT 3EDEA 1OCCB 2F7OA 4U6YA 3GSNA 5E0QA 1RJYB 4TUYB 3MBXL 2J2ZA 1KTDB 3ZYZA 5CEZE 3EYQC 1KIQA 2AEQH 1OF0A 1OQOA 4ODHH 1K4DB 4FQXD 4LAQH 3SGEI 5IGXH 5CEYA 4JE0A 4UNUA 3EFDL 4I7ZC 4K8ZA 1AP2A 3HZMA 2KZ1B 1LWHA 3COOA 3MRBB 1QUPA 3U30B 4LLMA 2QSAA 1L9RA 1UD2A 2J5LC 3LQAC 3VH8B 1XZ0B 2JXMA 3VWJC 4D7PA 3IDXH 3QAZC 3WNMA 3ZMTA 3DMMD 2YPLB 1AQ8A 1SNRA 1KJ3H 4P46C 1NH2D 5FDWB 1LMKA 5DQDH 3SKMB 3MJ6A 2GFBA 2UX7A 1NMCB 4R7CA 2MCPH 1KYOK 2QTOA 2WXFA 2KT6A 3HW7A 3QEUA 4NRZB 1BFOB 4RZCA 5FV1L 4U3CA 3UC0L 1OL0A 3ZLQC 4RQQA 3TC9A 3BH8A 3LB6C 4X6DF 4F80A 5CLXA 2CTPA 2HVBA 3X1NA 3GQFA 4NN5B 1C8QA 5CD5C 2A7WA 2IADA 2R83A 3INUL 3LVEA 2RN9A 4Z7VA 1Z5YD 4LFHG 4PI0A 3AS2A 1DO5A 5EO0B 2CA3A 3JWNC 3P11H 3BGFB 3VCLB 2QV2A 2ZAIA 4IMKA 3QR0A 1I0HA 4JCMA 1OAYL 2ZCLH 3ECBB 3VBBA 3LD8B 2BMKB 4M43L 3ETTA 1SRYA 3ABMB 3I85A 4NHCH 5HY9B 4UVCA 1FZOB 4PJHA 5AVWB 1QX1A 1H9DA 3KPSD 1V10A 1HOEA 1D7DA 5HI4C 12E8L 3H1LH 2JJVA 3QG6B 4KY1H 1J9TA 2QZ5A 3HUJF 3J07A 4GUOA 4L3EB 5LNEA 1T0NB 1DQVA 3T4AB 4GG6F 3OKNA 3X14A 3HE7D 3LZFH 4ZW6A 5ISZB 1XGRB 1J1PL 1JMZA 3DGDA 1N2RB 3J7AU 3HMWL 4Y19E 1W72B 3SDXF 3BUDA 1IBHA 1L7TH 3DIVA 4PTTA 3MN8A 4NCDA 5DFAA 1EAJA 3KL5A 4X7FC 4FLTA 1FZKA 4JM2A 4XB3A 1QLFB 2APWA 5B1JA 3C5ZA 1P6WA 2V5TA 1PS3A 2DMKA 5ETUB 1BOGA 3CZFA 5TE4H 4F7EA 2KMWA 3HRZA 4YWGL 3O9WB 1UWEH 1XTLA 2EC9T 4AKPA 3OKMB 3WS6A 2HLDG 5FAAA 3TT1H 5SWZD 2EDQA 4MAYC 4ZXBB 5I1JH 1JPSL 2EYSB 2UXBO 4UIKH 5DZAA 1ZE3C 3WEXA 2V17L 1M4KA 4RSYA 4ONGL 3W5NA 1OD7A 3DYOA 2Y2TA 1ZGLB 4I3SL 2Q73A 1V05A 1WIPA 2XWBB 4M7KH 2ZSWA 4H26A 5GS1B 4PJCB 5E2VH 3STLB 2AKRA 3MHHC 3ZDZE 3DROB 3BESR 2F7RA 4I1NB 4JI2O 3KNBA 4ZMNA 3C8HA 3QCTH 5EZJA 4F2MB 4OJAA 1NC2D 1V3JA 4F7CB 2A6KA 4NQQA 2F43G 1UM4L 3F7YB 3ALXA 4AQYB 2DTMH 2VDMH 3LN4B 4X99A 2F9BT 1IGYA 3IC9A 4XWOD 3BAJA 2DQGL 2NY2D 5CLTA 4BFKA 1U8QA 2F5AH 2ICWI 3CRMA 1XB8A 4TULL 3GWOA 3CLFL 2VKWA 4WHDA 4BDVA 3EJRA 5BVPH 3OKOA 1MLCB 1NEUA 1J48A 4DR3O 4KXRA 2LABA 1FZMA 3S5LB 3R4DA 5I9QC 3I9AA 4UYPA 5J1SC 3B9KC 4I3GA 3ABLC 5CHNB 1MDTA 4DV4B 5IJCC 4IHJB 1TQWA 1R5VA 4PJ7B 4LR3A 3II1A 3A6BH 2VKXA 5C0AE 2A38A 2XIBA 3FT2B 5BXZA 2G60L 3MRCB 4L18A 3D3VB 1JDCA 1NA8A 1LUVA 3P9MA 1J8KA 4L3FA 4K35A 1G5GA 1ED3B 1JZFA 3CXDH 4PV9A 3RBSA 4YS4A 1R5WB 5B8CC 5JQHC 4ZQKA 1X5FA 1NSNH 2FECI 5KS9E 4YHIA 1TG8A 5LYJA 4UT9L 4KJQD 2OJ1A 3GO1L 1C5DA 4NI6A 4DPAX 1GGCL 4OIBA 3WB1A 4JFUA 3B2VH 3BMWA 4HPOL 3AG2C 3CVHH 1YNLH 3UZEA 2G4GA 5BNXD 4WTZA 1FV1B 4RMWA 3S2CA 3BLKA 1HYSD 1JXKA 2Q7EA 3DTXA 3TBBA 1INEH 2R4SH 2R70A 1OAXL 2QWRB 2KH2B 5C3IA 3TESA 1BYNA 3GZOA 1XGQA 2FX7L 5I66B 3RFZA 4ZS6C 2AABH 2OP4L 5LB1A 4XPBL 1P4BL 3ESMA 4X6DE 3PAYA 3VXNB 3RGVC 2PP8A 2Y7OA 4P9HL 4ZAKC 3JV5A 4PD4F 1SQGA 2O6DA 4LHQB 4GAAA 3ROLB 43CAA 3QXUA 5DRXA 3GDCA 3PV6B 3O9WD 3OMIB 2FECL 1IBDA 3BDBA 1K8DA 3L9YA 1KY7A 4JFEA 1A02N 4HIXH 3NIFF 1MVFA 4O2FB 4WI7A 5LO7A 4NXMB 1K97A 2VLRD 5LGHH 1MEXL 1RVFH 3DDGA 4O51B 5C07A 2YGOA 2N05A 3DGGA 1AR2A 1INQB 4C4KO 5T1LD 1FL6A 1HXYA 5GPRA 4X7EC 4FK5C 4EUPA 4FFZH 2WO3B 3CN3A 4AZUA 2HJLA 1QQDB 2YGNA 4LLQA 1NR1A 5AB2A 1QLNA 1OZTG 5CJ8A 3O4OC 4LF9B 2F15A 1T6BX 4GINA 5KMGB 2DQCH 4LPCA 3EGDB 5GGRB 1S7TB 1YN6B 3PWPB 1U41A 3QPKA 4S2SB 4LEEA 3N9GL 1T1ZB 3PF2A 4R7LA 4K8RL 4N2EA 3SDXE 4KI1A 1BMZA 2BNQA 4L8BB 5FB8A 3O8XC 3UTTD 4J8RA 1ZHBA 1OAQL 5D7KE 4AHCA 1I9JH 2G75B 3T5WA 1U8NB 4TSAL 4F33A 3UJIH 3BPOB 4H0HB 2BC4B 4FMKA 3H55A 4KUZH 3BDXA 4MSWC 4RRPM 3GKWH 5D7HA 1CU4L 3DUHA 1DQQB 1N64H 1P6FA 5KYXA 4G8IA 3GSNH 3VDAA 4IHOB 4TNGA 2UUBO 4ISVA 4QHNB 5D96B 1FORL 2YI8A 1JRHI 2X4UB 3GBNH 3ZTDC 1Y18B 2A4EA 3SDDB 3D3VD 3OAZK 3VRLF 1Y1UA 4LF7B 1E90A 1HHJA 5DFVC 4HMCA 4HSCX 4N9GB 2EZOA 2PCFB 4E2LA 2QJDA 2XXMB 3WO4B 1VDGA 2IBGA 2QMJA 2VZ3A 2GUZB 2P8PB 1IEHA 4OZ4A 4NZ8A 5F1NB 4ZFFA 3KLLA 2V2WA 3ZIYA 4IDLA 3GRWL 4G8GA 4PWHA 3ZK0A 4UVBA 2AQTA 3DBSA 4ZOBA 1U36A 5I6XB 1G7LB 2PCPB 5CN1A 2R7EA 3GSQB 4PJIF 1Z1WA 2OMNA 3VFSA 4WTXA 2JS5A 3WI9A 3ZMZA 3OAZH 3JVFC 2H3NB 1A66A 4TSBH 1J5DA 1ET5A 2BOCB 2X41A 4LGSB 4U2YA 1UM5L 4GEJA 1QI5A 2D31B 4F6RB 1ZCRA 1DVTA 3BSZL 4QE7A 4I5BA 3AM8C 1Q1PA 2R1YA 1BX2B 1J8HB 3PWJB 4F7MA 4KK6D 4AW7A 2YRBA 2KDYA 2XXGA 4OH2A 4P2OA 4L4TA 1AJ7H 1K7DA 3O3BB 1ASQA 5F9JB 2VR7A 2YUXA 4A66A 3OUSA 3KPRE 4ZZKA 1AOZA 3TN0C 1JDDA 3OD4A 3K8LA 2LV4A 2OKMA 5K1XA 3RILA 3FN0L 4YDNA 3UBGA 1TEFA 3DKHA 1S7SB 5CIPB 4XAKE 4OGAC 2QSCH 2PN5A 2XPGA 3RJOA 3UJJH 4DO2A 3KAAA 1XIWB 2R29L 3G6JA 3KPMA 1PL4A 4OUUB 4YGVB 1CE6A 2WB7A 3WNKA 3H42H 4R97C 4K9EH 2F5BH 1SHSA 4JZOA 3EFFA 5ALBH 2HFGH 3BIKB 2J43A 2AK4E 2VIRB 5I74B 2YPVA 3KJ6H 4KAQH 1WWCA 3WTUA 5FYKD 2OYLA 4OB5H 1FIGL 1RPUA 3LDDA 3OPUA 4Z77B 2MCAA 2C7UB 3FU7B 1WAPA 2DE0X 3M99B 4C56E 4Q9RL 4Z7UB 1EANA 2QE7G 3US1A 1B0GA 4P59H 4ZTEA 5C0NC 3HPJA 5IEHA 2ETWA 4W9DC 4TVPL 1IE5A 4ZOAA 5EF1A 4TV3A 1D6EA 5KOMC 3ZL4H 5D1ZC 1OT4A 1PNMA 1YO4A 5GJTH 5EU4A 4E41B 2H4EA 3RWRD 1BEYL 5LL6Y 2BTOA 2EDDA 3K80A 1U3HB 4CVWA 1NMAH 2WBWB 1FYTE 4QYOA 4QYAA 3MZGB 1S6NA 1FCGA 4N2FA 1B90A 3BKCH 5DFTA 3DX7A 4FXGB 5HGAA 4PJ8A 3HVDA 5E08H 2XY1A 3Q2CA 1J1XH 4AGQA 3AWGA 4EIGB 3L4YA 3NIFE 3F04A 1R3LB 3EOAB 1G7JB 2VAAB 3PJSA 4JN1H 4Q0XL 3Q8FA 1WFJA 2DQHL 4ZS7L 4ZYKA 3SDDD 3TEWA 5F88B 5L6YL 5E5LA 2WNXA 4X8CA 4Y2DC 1W15A 4OLYH 1KENL 3TH4T 3KR3L 1KBHA 4HFUL 1BZ7A 1OSPL 2EKJA 3WTXA 1A7OL 1BJMA 1SEQL 1SFHA 4NAMA 2F58L 1TTFA 2QADD 4PJ9A 1U2YA 5LP6A 3F6JA 3N44B 1Q6UA 2DQJH 3TS8A 1J87A 3IMTA 3QQ9D 4M93B 4DKFL 4JANB 4LF5B 3QUXA 4Q4EA 1OANA 4NXNB 1I8UA 2WXMA 3W0WA 5FA3B 1Y6NR 3NCCB 3VXMB 4LEBA 3F5WB 3AB0C 3IPBA 4GKSA 3A22A 1U8JB 1BF8A 3N41B 2W65A 3QQDA 3C5SA 7TAAA 3EYSL 5J11C 1LHZA 2EIZA 1NGPL 3IS0X 2APVA 2G5BB 1Z9MA 4XC3H 5ESQB 2NR6C 4LLAA 1LP9A 4OZGA 2H8PA 2WBJC 1A1NA 1ASOA 3MV9E 2I69A 4GIAA 2FATL 3FCUB 5IHWA 2LHAA 3W9DB 3IGKA 2DQTL 1JE6A 2DM7A 2Z92A 3WJMB 4YO0A 1BG9A 1SLWA 2X70A 5DRWB 4N0RA 4A6YL 4JHZA 4AXWA 1T22B 2XIIA 2R56H 4DEUA 4MMYB 1SOXA 3ARFA 4XBFA 4EZKA 1EJOL 3GK8L 4ZNEA 4FMTA 4KMTH 3HKEA 1G7HB 4WGWB 5EIIB 3DX8B 1H8LA 5DVKA 5E2WH 2WCGA 1HR0O 1YDPA 3T3ME 3VRLE 1RSFA 3ML9A 3OLGA 2DYRB 4NNXB 5HI3C 5KVFE 1K4CA 4FIPC 5DVPA 1TFHA 2NYYC 4H8VA 5E2TH 4MJJA 4FLZA 2WWMD 1J95A 3FQTA 1MY7A 5TD4A 3TZVA 4HXAL 2NDFA 4FQJL 2OV0A 3VFVA 3EO9H 4DUZO 4P5KA 1QQCA 3H0TB 5FW7A 4E9QA 4AGOA 2XNAB 3PXJA 2DDQL 1XGPA 4KKBC 4P3DB 1GC1L 4LESA 3KWTA 3K08A 2O5YL 3OPZL 4M62H 1KWGA 3VD1A 2CK3G 1DK1A 3HA0A 3MFFB 5F6HI 4N0FB 2PYJA 1O0VA 3FL7A 1VQNV 3LRLA 3CLEH 1RIHL 4TLKA 5C9JB 4YLCA 3MU3A 3P30L 1S5IH 1RUQL 2YWZA 3GI9H 4PJ5D 4QGTA 2VDQB 4DETA 2NY0B 3ESPA 4OCXH 4WJG3 3TETA 5EN2B 2P24B 1IV8A 3P40A 2RQ6A 1XF1A 1YN7A 2DWEC 1KCBA 3LHAA 3TFKD 3F12A 2YMXH 1R5IA 3KL3A 4K07A 4DCQB 5F7DB 3MJGX 1AGEA 1X7SA 4MWFA 5CGYC 3TASA 4P57B 4QRTA 5SX5K 3QDGB 3PY9A 4MNGA 4PRIA 2HVKA 2FO4B 1IM9B 2Q0ZX 4GG6B 2CUAA 3MRIA 3IM1A 5G55A 4EUPH 2PABA 3FO9B 4Y9FA 1ACXA 2D3NA 1Y76B 4YXWG 1ZL8B 1UQSB 2C9QA 2XZZA 3F01A 4CC1A 4FJCC 2OR9H 1CT8A 2EIBA 1N19A 1RZ7H 1DSFL 3IDJB 3N40P 3QJTB 4N90E 4AYGA 1US6A 3KZ8A 4XCNA 4OZIE 4LCVA 2P22C 1TTRA 4JFHE 4EKWA 5SX5H 1X4XA 3CD6V 1YSCA 1ZS2A 3K71B 1T6VN 3VXMD 2E5EA 1MJ8H 4DR4O 4NNPL 1S7QA 4QRFA 4XT1C 5D7LB 1AD0B 3ARDA 3L81A 4CBZA 1HIML 1W72L 2NW3B 3NRFA 3T0EC 3AK2A 2DBLH 1LILA 1BCCH 1RULH 1WFUA 1PZSA 1CTMA 3VMNA 3DV4B 1IAIM 3N1PC 4PG9B 1ZEAH 2PYFA 1YECH 2HLFD 1LR1A 5C07D 4BAYA 3GJFB 4IEFB 1KUQA 1V55C 4GYCB 1QRKA 3DHMA 3S37L 3A67L 2NY1B 3X11B 3KYNA 2PO6B 3QFGA 5G4OA 3ZE0E 3NVQA 4KKAD 4XOEA 4P2ZA 1DQDL 3GKZA 2YAHA 4ELMA 1E3XA 1GY1A 2EDYA 5H4ZA 5IWLC 1PX3A 1IURA 1UD8A 3VTAA 1QEWB 1X9UA 4UBDD 4YHLH 3KWVA 1IL1B 4P2RA 3WNJA 1SPDA 3SR2C 1CQKA 1XX9C 1EZVY 2OJZL 3FUMA 2BNQD 3OMAB 4K7PY 1Y74B 1H3PH 1JZIA 4WV1C 5IYZB 2Y1VA 4G9FD 2A9DA 2EC8A 2PWGA 3CZLA 1AQKL 4P48A 1FPTH 3KCPB 4Q9QL 1F58H 5L3BA 1L9OA 3O0RL 2B77A 3CPWU 4LQ1A 2FUTA 2AJUL 3OR7B 3JV0A 4XO3A 2FTKA 3HC0B 1WZKA 5LXTA 4HHGA 3ASNC 2A9MH 2Z8WC 4GQRA 3ULUH 4MTGA 1R34A 3LZLA 4LFBO 4N86A 4QKXB 3EFFK 4TF4A 2ZCHH 3RURA 3BZEA 5CEXB 1OLLA 2CO1A 4GW5A 3V0FA 4IU3B 3IU3B 3WL9B 4CMHC 1T1YB 5DLLA 1FFNA 1FVEA 3O3DA 1KQSU 1I1AB 4QTIH 2VXTH 4N2BA 3JTSB 1VGKB 3S0PA 1T5WB 2W38A 2B1OA 3NJHA 3RU8H 3WSQL 4F7TA 3CX5F 3L72H 2YSUB 4V1DE 4FM1A 1CPYA 4U1GC 1KDIA 4K0OA 5AG9A 5FYJU 4EZJA 4FG6C 2X4SB 4L4VE 4U3XA 4IIQC 4DPCX 2YPVH 3Q48A 4XN5A 2DF3A 5IQ7H 3FT3B 1HCVA 3C6LD 1NUFA 3L3OB 3N43F 2UXGA 4YPGB 4ZW8A 2KSDA 5EF2A 4PVLA 3ULUD 4Z8FH 4JG5A 2YC0A 3HG5A 4LHUA 2XV3A 5ICZA 2DW4A 1V3MA 2XWXA 4P2OD 3RVWC 1MWAB 4L4TD 1UASA 1D5ZB 4UF7C 5EO9A 1D2PA 3NXSA 4Z7AA 3PJSK 2MKLC 2W0FB 4UNTA 2QELA 4G43B 5DQJB 3NK3A 1Q9WA 3AXIA 2MWCA 1NBVL 1XUQA 5D70H 3L7FA 1P4IH 3RWJA 1LO5A 2VDKB 2BZCA 4M3HA 2BWQA 3TCUA 5E4OA 2FL5B 2Z4TA 5D1QB 1KUMA 2J5WA 4H33A 1J7VR 5DJDA 3U82B 2OMVB 3AQYA 1C5CL 1VKXB 5CUSL 2NT1A 4QJ4B 2VMFA 3BJ91 5T3ZE 2QFPA 4Y4HA 4M61A 4Z0BH 1HDJA 2R2CA 5EBGA 1F02I 1RHHA 3I50L 2WLLA 3VD7A 1I3UA 4N26A 4UMSA 5CN2A 1QI4A 3LH8A 5A3IC 1A4CA 4ODXA 2DYPA 4JFFA 2AEWA 3PDOA 1UFGA 1IAII 3ZHTA 2BSBA 1WZAA 4C4BA 4U33A 2MW2B 4I8DA 4N0UE 2P44B 5E94A 4AZ8A 4UB6Z 3CZGA 2D3LA 4PBDA 1DN0B 1UACL 1UATA 2VOTA 1QLRB 2YJLA 3LS5L 2K9FB 3GNMH 4H25A 4HJGA 1U8OB 1ANUA 4OD2A 4YSQA 1MSDA 1B0WA 3W11C 5IVNA 3C75A 4YHZH 2FWLB 4CADB 2IFFL 5L8LB 4RLDA 5CZXD 2MQ0A 1JCHA 4JY5L 3D85A 1NANI 1DCEA 4BQCA 1K3IA 1LE5A 4PJ8D 3AU0A 3KGUA 4MTFA 4WI4A 4AVKA 3OTFA 1IEAB 4HS3A 2FB4L 5GRUL 2YK1H 5LHDA 1CMOA 1SM3H 3KLSA 5JUEL 3RRQA 4PJBF 2YFNA 3QULA 4ADIA 3V7MA 4YJ3A 5D5ME 1XNRO 1MI5E 1TTBA 1YZZA 4MJ5A 5E8EB 5CILH 3U4BL 2VLJA 5D8JH 3I02B 4JGJA 5IR1B 2HMID 1HSAB 3FAXA 1NLBL 2PWDA 1VPOL 4ABVA 3DBXA 1IAIL 1SMAA 2GPZA 4UQ3A 4XNDA 2H1PH 3CQQA 4DP1X 3OW2U 3QDME 4LOUD 4WW2A 4ZOLA 2RH0A 2HYMA 4PJ9D 1YEJH 1LK2A 3CN2A 3ZQ9A 4D0DB 4FD0A 2Q9LA 3EBHA 1ONQA 3NH7H 4DOHE 2YLKA 4TQEL 2DWDB 3NSYA 4GUNA 3DXAB 4NN7B 3ZO0A 5K59F 3SQOH 2JCCE 1PIGA 3WN5A 4JYYA 4PJDB 3EJYD 4YK4C 3OHXC 3VG9C 1AD9B 5MEND 4FXKC 4D9RE 2B3IA 2IG2L 4JREC 3OD3A 1CYWA 2CRYA 2WNGA 4GMSH 5DC0A 5BS0E 1FGVL 1Q81W 5JH7A 5DTFB 4LNUA 1WPXA 3GMOB 3ULSA 2ODIA 1BQ5A 4B3VA 1N32O 3N1QC 1R6TA 2WA3A 3G67A 1UJ3A 3F83A 3OTOO 3FO2A 2CTWA 3H6JA 2AJXH 4G3YL 2UXTA 1RIVL 35C8H 4KX8A 5ABDE 1IGTB 2Y25A 1VADA 3J7HA 3BH9A 3ARRA 3G5YB 3JTTA 3LKQB 4FM0A 5LWYH 5C0CE 1JVMA 1BF2A 1IX9A 1KB5A 1CURA 5KZCD 3U11A 1YCSA 4DPRA 1CZ8H 3KYKH 2E6JA 1Y6XA 2AF2A 5FYLL 2YA1A 3LMJH 5ERWA 3U9UA 1P4LA 3LH9A 4MQTB 4ODTL 5E8NA 3WMPA 1OCWH 5ES4B 3TH2T 1NGWB 3PU7A 1N5AA 4DR7B 3CDGA 5JYMA 5IB4B 4W9EC 4CILA 1CPUA 3CB2A 3H1IH 1XDCA 3H9HA 4MX7B 1EHLH 3NIDE 5GGSY 5HYJB 3U0WH 1PKQA 4DAGL 5TE6H 1OP4A 3TYGH 2BOBB 1KGCD 4WW1B 4M6OH 1OAZL 3S3PA 4ZX4A 1LQSR 1S76D 5LOVA 3FZUD 2D2CC 1IKNA 4EN3C 3UTSA 1M2OA 4X42A 1ZJBA 2WSSG 4AL8H 4I7ZB 3CCRV 2IAND 1A4BA 4P2QB 2J5LB 2Y4TA 2ICWA 3H3PL 5AB0A 2VQEB 3VWJB 1TCRB 4JKLA 3QAZB 1KXTB 4JHBA 2A0LD 1KCVL 4QRQA 1CGSH 4MKMA 5FO8B 3RE0A 1AIFB 2YAFA 1AP6A 3BQUD 4FNTA 4P46B 4PRID 3LN5A 3GPEA 2E75C 1BZ9B 5J2UB 4AG4L 4D7SA 4HA1A 2EJ1A 4LCWA 4DEPB 3OGIB 5AAPA 1OK8A 3L8QA 1FXKA 4WHTB 4B0MB 3NSFA 3EG9B 1HSBB 4L5FL 3DGEA 2I60H 3HCVB 2RA1A 4EXKA 4PGJA 4N0YL 5KJRH 4RMSA 3ZMUA 1IC5L 1SLXA 3MV8E 1NGZB 1U8MB 4X80H 2IJIA 2BRRH 1BXAA 3RJDA 5I8CA 3DXAD 2Y69C 5FHAL 2ZE6A 4I13B 2YUZA 1G9MH 3CVCA 3I6GB 1FDLL 5ACZA 1WF5A 4NN6B 4GKKB 2GJ6A 3VRIB 3LY6A 3OJMB 2YEVA 5K9JH 3ILPB 2FK9A 5EUKA 4LFHD 4B9IA 3M1OA 1DQJB 2DQMA 4P5TA 4ZDHA 5AWNL 4GZRB 4U1KA 5AG8A 2CDEA 3GXMA 2XCMC 4DV3O 2X42A 3IU4H 5E6YA 3FCTA 5FO9A 1BWWA 2SEBB 2NX5A 3CGTA 3KDMA 3T65A 5AD0B 3IC7A 1BYPA 1HNYA 3GXUB 4OLWH 1QFPA 4XBPA 5DEFA 3QIBC 4PJBE 2OSLA 2X40A 4PS3A 5MEPA 4GX5A 3L08A 2X6MA 4P8QA 3R4RA 1GPOL 2LW1A 3VTTA 1BD2B 1L4IA 4KHTH 1O9ZA 3MV7D 1XMWA 1EQWA 3RVUC 2JJTC 3KCWA 3WHXB 5J13C 1QFWH 2HRGA 3CWBH 1N6QL 3MRPA 2QVIA 2ZXDA 4NJ9H 5FEBA 2NY6C 2GITA 4X9QA 1IAKA 3DURA 5IB5B 1ZAUA 4G59C 4WO4A 2CCWA 3PWUB 1WC7A 5CA1A 2YN3A 5FECB 5K59E 1CG9A 2LP7A 2P4KA 1KJVA 4RESB 4YN3A 3U6RA 5B1BC 3MBXH 4OF0A 2VB5A 3D2TA 5IVXE 3ULVD 2FQEA 5IJ9A 2AJVH 5CP7A 5KVDE 5CA0B 1NFDB 2PKDA 3GHBL 1JG9A 5MERA 1Z2GA 2N1KA 3HS0A 3EFDH 4TV9B 3KXFA 1N12A 4R50A 3EHBC 3E2EA 4GO6B 3LKSA 2ZNXA 5TISZ 2NNCA 3A24A 4JV5B 3DV6A 2UU9O 3HZKA 3GRWA 2UX6A 1ECYA 1EGJA 2Y3AA 1T83A 2ZAGA 5J6GB 3DPBB 2YXHA 1R3JC 1KULA 3BCDA 3BP6B 4HHAA 1DJHA 2P80A 1BBDL 3F62A 4MHHG 3BAAA 3IFOB 4DV1B 3IEAA 2R1WA 1DLFL 3UC0H 2GSIA 1NCUA 2NSQA 1I94B 3V0VA 3QG5A 4JZJC 3TYFA 4PGBB 4GEIA 5D93C 3N1MC 3FQ2A 2YQGA 4WSGA 3SGEH 3K6SA 1T0PB 2HJFC 3INUH 4PRDB 3TIDB 5HVHC 2KZKA 1NC4B 3B9KB 4JYAB 4KRPD 3JXAA 4LHUD 1NGXA 2LVCA 4XCFL 2W81C 5I26A 3B6SA 3KDPB 2YD5A 1OAYH 4PR5B 3VQYA 4M43H 3MRGB 3ASWA 1WAAF 3QO7A 5C6TL 1UGNA 4PJXF 1GMIA 3OB0K 2DMCA 5GISL 4YAQA 2GUOA 2PI4A 1Y66A 5LA6A 2R29A 3MAWA 5TQ0L 5K39A 1U42A 4JI3B 3UYPB 5CCGE 1MVYA 1KY6A 1NZ6A 4CVXB 1N10A 1JFHA 2AQ3A 1NFIB 2P9RA 4PGZA 1E3FA 2YZ1A 2ARWA 3O6FD 1ZVYA 2MNWA 4PREA 4EB6A 1RFYA 1H5BA 5ALCL 1BQLL 2CKBB 1ZT7B 2QLYA 3B9DA 4LCUC 4XTRC 1WCBB 3AG2B 3BO8B 4FLUA 1PD3A 1BVNP 4BCZA 4F37F 3HMWH 2R9HC 5IV2A 3OB0H 1MPAL 1Z7JA 5KBDA 4JQVC 1E4HA 2DYPD 4ALAL 5GSVB 3TNNA 1GKOA 2NRDA 4YIQB 4U6VH 2DTSA 5DZPA 2GSGB 3HG1B 1XMEB 3QYCA 1EWHA 4FEMA 3SDAC 2Z31A 4MMZC 1UCTA 3GDBA 1ACCA 1SJEA 3RGVB 3FB8C 4PRNB 5E2UL 1BFSA 4ZAKB 1B2WH 2ID5A 4XVUD 4YWGH 1IC7L 4J1UA 1M9NA 2GI7A 3QPQC 1EXUA 1BXVA 2G2RA 1TLKA 2L7QA 4FERA 1PVHA 2BVTA 3EIFA 1SQQH 1JPSH 4QF1B 4X7TB 5DFWH 4AIXA 3C12A 1YJWV 4IBYA 4JRXD 4FL4C 5C70A 1H8NA 4Y5XA 3G5WA 2V17H 1PZDA 3PQYE 4PJGA 4ONGH 2JLPA 1IGFH 1HNFA 3K6IA 4I3SH 2HUEA 4JDZB 4XR8C 4HISA 4M8VA 1XF5A 4MYPA 4JPKL 3UG3A 3FTGA 2G5RA 3MLTB 5ENWB 3O4OB 4WI0A 4L48A 4GG8A 1MRDL 4NRYB 4R5TA 3G4SV 4Z7WB 1KB5H 5HPMB 4OQTL 1GYCA 1UM4H 2Y72A 4LCYA 1USZA 3U6XS 2BIIA 3BEWB 2DQGH 4QD2E 1PSKH 3NA4A 3GI8L 1ZANL 1HTYA 4TULH 3CLFH 3VI4F 2V2XB 1JZGA 3V9FA 3EYVB 3QJFB 1FN4A 1QSFA 3RPIA 3IJSA 5IUSA 5L7XL 1D5NA 1MNGA 2ICWJ 4NQVA 2K8QA 4MSWB 1NC4D 1QUNB 1I7ZB 1RJCA 1I8KA 4XOBA 1MXDA 6CGTA 4MAZA 1N3NA 5EIVA 3T3PF 2O5XL 4A6YA 1EHXA 2BO0A 1OPGL 1RCYA 4JO2L 2G60H 4RRPA 3ARZA 3BKYL 5GZNC 3OJDA 1BQKA 1E5BA 1AJQA 4MA7L 1ZVNA 5SV4A 2N7AA 2Y7MA 2NNUA 1E27B 1K4DA 2XPZA 3MOBH 4XP1L 5DHYB 1M57C 2H1LM 5CWSB 1UPGA 1SF3A 4DW1A 1RFDL 1D9KD 4UT9H 2AV1A 5A1AA 1H3TA 2I07B 5IROD 1MWAL 3OX8B 5JIIA 3O6ML 1GGCH 3EJTA 3IDNA 2Z0BA 2E7DA 5AEAA 1WWAX 3D36C 3GINA 2R9RB 4FA8A 4HPOH 4UQBA 3VH8A 4XN1A 1XZ0A 2GC4C 1ZT1A 3L95B 5HYFA 3EBGA 4NBXB 5BZWB 4HOMA 4IIJB 5FDWA 3SKMA 2BNUA 2H6OA 3B5GA 1OAXH 5AG2A 2XI9A 3GF8A 4YLBA 2AXJA 2ZP0T 2XTAA 2FX7H 4GH7B 3U2SA 1IRAY 2OP4H 4XPBH 1NCAH 2BIPA 1P4BH 2JGUA 1JCVA 3WUWG 2B9AA 4XNQB 7PAZA 3VFOB 4PA4A 4P9HH 3CRRA 3LNFA 1AGBB 3VB9A 1X7QB 4N0CD 2F2HA 4ESKA 3BZDA 2O6CA 3B1UA 4W68A 3P77B 3MFGB 4OFKA 2DI9A 5TPWL 2UUAB 4M29A 3DO7B 2IFGA 3S96B 4G7YL 4W6XB 1GMEA 1WS8A 2FWOB 4HIHA 4WWPA 4NKQB 3EDKA 1MEXH 4HP5A 4NB7A 3VCLA 2HLAA 1WAAE 3VXTB 1PNCA 3EYFA 4PJXE 3ECBA 1QHTA 2ZKOA 4X20A 4TLSA 5HY9A 2FR4B 1HHKB 4ZT1A 4XRCB 2VQFO 4X6EA 2GTWA 2BXYA 2ZNJA 3UL4A 4BFOA 1YCIA 3QG6A 4I4TB 2ZKMX 4O4JB 1F0LA 1FNEB 2WUCL 4L3EA 4NWTH 1Q0YL 3VXUB 4AIZB 2M1KA 2ZX7A 5I1LB 3N9GH 4TV8B 1G1XB 4K8RH 4OX9O 4M1CD 1L0QA 2OZ4A 3OEHG 1XGRA 3ZYOA 4NUPA 1N2RA 1DEEB 1Q0XL 3LQZB 2OIGA 2AV7B 1W72A 3C2AL 5D1ZB 4KZCA 4PGCB 3B2XA 1OAQH 1EPFA 1E4JA 1OGAB 3CVIL 4K3JH 3T1FB 1EV2E 2GJ6D 4TSAH 3K7UA 5HHVL 1T7ZA 1MFCL 3US0A 3QIWB 5GTHZ 4P5TD 3Q2LA 5GGTA 2XTSA 2EDKA 3MXWL 4KDTC 2DICA 5GSRB 2XPYA 4FLHA 4BGLA 2EUWA 1VSCA 1Q90D 1JD7A 2X6BA 1XF4B 1PZ3A 2BY0A 2EYSA 1UZ6F 3OZKA 4Y2DB 4UM8B 1AKJD 1CYXA 5DLML 3JWOH 4NZJA 1CGWA 3ZBHA 1KBGL 4BA0A 2PLTA 5EZLB 2UV3A 3AACA 3WFDL 1ZGLA 1VMGA 3GRWH 4FFWC 1LMIA 2EZ0D 4AJWA 3CFTA 3STLA 4NZUL 4XPFH 3IK2A 1KP3A 3MVSA 1JGVL 4NENA 4IU2B 4MNQE 3GIVA 1I85C 3RAJL 2GJRA 2PUQT 3CIAA 1R0AH 4UINL 1CLZL 4WO4D 5CGMA 3F7YA 4LSUH 3LN4A 1UM5H 3FB6C 3C60C 4JFDD 3KPTA 5EDSA 3SJCC 3O2DL 1MJUL 4MCYB 2VZOA 5F0LB 3Q6FA 1TFPA 1BOYA 1JRHH 3BHBB 5B22A 5C08E 3O11B 4P49A 4HKXB 4QO1B 1MLCA 1XVSA 2X28A 1XGUA 4GMTL 5JPNA 5IBUG 4GRLD 2IDCA 3T2PA 2APSA 1XMOO 4XN2A 5F7MC 5FYJE 2W59A 3UYOD 3SO3B 3KYAA 3TV8A 5JQGA 5CHNA 3FN0H 3T3PE 3MHSC 2VQTA 3GB7A 3EXJA 5AKRA 2JJSA 4TTGA 4IHJA 4LPXA 4QXVA 5D7JC 4F15C 2BOLA 1XMQB 2R29H 5E79Z 5JZ7D 1INDL 1F11A 1FBIL 1BQHA 2LGWA 4J3OH 1JZ7A 5ICXB 2VITB 4IRJC 3M17A 4L8DB 1HQ4A 3BCCH 1R5WA 5I2IA 2OW7A 3L4WA 3LQAL 1P7KB 3UTPE 2DMHA 3PP3K 1G0XA 3Q7JA 3ESOA 4Q6IC 4OZHA 5F1KC 3VJ6A 3FTUA 1OSYA 3FSZA 3SKJL 3FRPG 4JDVB 4TVPH 4D7BA 3F84A 1H2NA 3CFDB 1EH9A 4BJLA 3HAEB 4PRHE 5EU5A 5DK3A 1BEYH 1B9KA 1I5YA 3RTLA 3S4SB 3ZRXA 1KCWA 1E9OB 3PP3H 1EVTC 4TNVF 3O2VL 4L23A 3QIWD 5DJ2A 4B41A 1A6TB 5I6MA 4R0LC 1AR1B 4MLSA 3CP1A 3S9DB 3PV6A 5EA0H 4Q0XH 3AU1B 4OGQB 4JPVL 1VQ6V 5K9QG 2EIKC 2DQHH 4KMLB 4XMLL 4ZS7H 2OAAA 2V9TA 5L6YH 3TEXA 3UBXG 4P4KC 5DJYB 1YTFB 1KENH 3PGCB 4RMRA 4DNLA 3KR3H 1DN2A 4B95C 1R3HB 2CRZA 4HFUH 4ICXA 1OSPH 1TZHA 5IB2A 1A7OH 1SEQH 2AC0A 3RWHB 4JI6O 2F58H 5EO1A 4JVUA 3AREC 2CBOA 1LO2L 1UWXH 4FNUA 5AW1B 4DKFH 1A7BA 1Z9LA 4QLRA 4UTAA 4XODA 1KBBA 3ETGA 4HIEB 2ESVE 1LNQA 5FWRA 3ZYIA 1HVXA 2LU7A 3QORD 2OYQA 4X5QA 3EGDA 5GGRA 2VDOL 5DHVB 3PWPA 2P67A 4W4OA 3MDSA 2J8UF 4S2SA 1T1ZA 2A74A 3EYSH 3V6BR 4YSSA 1NGPH 3T0EB 1GRWA 4KX9A 3U6XA 3VFGH 3UGXA 4O2AA 1JGDB 3QFJE 1TMQA 4E9YA 4GT7A 1DQKA 3EAKA 1HESA 5IFHL 4JR9L 2FATH 1F4WL 2DQTH 2CBQA 4DR1B 4ZUTB 2BC4A 5HYQA 1IIKA 4ZMAT 5M94B 1H6TA 1QR8A 2BSEA 2WXQA 3VUAA 1HU8A 1EX0A 1QHPA 1ESOA 1PIFA 4A6YH 4QIRA 3T77A 1EJOH 1Q8MA 3GK8H 2YD9A 3QUZA 2KQMA 2E0PA 5E95B 3UO2A 1KJMB 4QHNA 1WA8A 4P05A 5B38G 3RKPA 3VFNB 5KUMA 5EIBD 5KSBB 4LKXA 5HYIA 4M9PA 5H94B 1UZ6E 4FA7B 4QGYA 5IOKA 2B15A 2YI9A 1W0VA 4N9GA 3S3WA 2PCFA 2NW2B 5HHOB 3V8OA 4HXAH 1T6WA 4FQJH 3AGVA 5DURD 5F1NA 1VGEL 2BVUA 5EBWB 4L8SA 1QR1B 1CXZB 4MDIB 2DDQH 1QSFD 4S0TD 4DV0B 3MNMA 2X1XR 1GC1H 4B7KA 3L3DB 2O5YH 1OGPA 1G7LA 1HL5A 2Y06H 5T3ZL 2WP3T 4R4BB 4Y4FC 3CHPA 4QOKE 4PBXA 3KW7A 5BCAA 1RIHH 3ASNB 4LASL 1TJIL 1AACA 1NAMB 2YN5A 1RUQH 2BNRB 2YD0A 3W1ZA 5A2JH 3CMOL 4JO1L 3DYPA 2AMGA 1BSMA 1ODUA 3CSXA 1P9MA 2ARJA 1I1YB 3EH1A 1JZ2A 5D9SB 4WWNA 1N68A 1A7NL 3PWJA 3VDBA 5F6HJ 1MW0A 4QPJA 1OLZA 1KYAA 1X5GA 3FCBA 1L8DA 1F3JA 3KYMA 4DV2B 1AZZC 4DXWA 3T1HO 2N0MA 5CINL 2GIXA 5IYCO 3D7PA 3MCKB 2DD8L 4K4KA 4Y1SA 1E9QB 5EU6B 1UZ8B 4U1GB 5CIPA 4Z5RA 3ECVA 4MJ2A 1VEMA 3IDYC 1T04B 5DJCA 3OKDA 4N5EC 4IIQB 4OUUA 3ROOA 4YGVA 1M42A 3O3UN 4H1LG 5INDB 4J2XA 3J8F7 1GW6A 4PLNC 1ILSA 4PELA 1T20A 1FLRL 1BXXA 1DSFH 3CE2A 4JI1B 2I5YL 2WQVA 4H8PA 2VIRA 4Y19A 4BH7A 3IN0A 2ZOTA 1S5HC 2IBZH 3EDFA 3VMPA 3PWNB 3KCYA 4CC0A 4NNPH 4HUMB 3Q44A 5B3NA 4APQC 1THZA 4ONFH 4IBQA 4GKLA 3GS0A 1HIMH 1W72H 4NKOA 2FEJA 2XN9B 5GW7A 5H2BA 3D6GA 2QM8A 2X4PB 4MXVF 1RUML 4NQSB 2K6ZA 4GBXC 4Y9GA 3ZOAA 2GCYB 1UT1A 2YIBA 3WLWD 3MRJB 2DEYX 3C3TA 5D5QA 3HG2A 1CLYL 5HJBA 2Q10A 4JFQB 3MA7B 4N9OB 1U3HA 4GXFA 3HNSL 3K0WA 1ZLSL 3P02A 5GGTH 1WFNA 1S9WB 3MUGA 4NQDB 4YSPA 2XACC 4I9XA 3VD4A 4MVMA 1WWBX 3IGUA 3S37H 1G0DA 3A67H 1QR9A 4JRFA 2OMTA 2AHYA 2Y2YA 3LRSA 2EICA 1QATA 1QZNA 4PLJC 3ZT7A 1SDYA 3VA2C 4ZK8A 1DQDH 4YMPA 2CPUA 3TXSA 2RB8A 3CZSA 2Z0AA 5H5NA 1R3LA 3EOAA 4NC2B 2HB0A 4NKMA 3ZHFA 3TONA 4FFBB 2X87A 4MZ2A 4B08A 1C7TA 2HTKD 2QSVA 4RIRA 5F88A 3HB3C 5AW3B 2OJZH 3D39B 1SN0A 3CFKB 2MNJB 3CVBA 3ETBF 3VXRE 3EO1B 1AHWC 3D0LB 5HHOD 1CFSB 3FB7C 3VSVA 2AAVA 2B0SL 4X9BA 4XB7A 2F68X 2PWHA 3VI4B 1AQKH 2HJDA 2G9HB 1NJ9B 3SDCA 4JG9A 2ADGB 4Q9QH 4HGWB 2P5WE 5G5DA 2LE9A 4UQEA 3NYKA 3O0RH 5D7SH 3TPUA 4WKZB 2AJUH 3F5WA 2J8UE 3LDBC 2IU3A 4B50A 5JW5B 1U8JA 1O9HA 2BVOB 4XXCA 1W91A 2ORBL 2IOMA 5JXEA 1MHEB 4YOKA 4MJ6B 2N59A 5DQ9B 2FIKB 4LZKA 2GW5A 3TT3L 2B9BA 4HOWA 2Y9RT 5I6PA 3EOBB 2GG1A 2G5BA 4DUWA 1JZJA 1JXJA 3KPLA 3LCYA 5LJYH 2VN4A 3IKCA 4ODUB 1AI4A 1SZTA 2X44D 5C0BB 3MMEB 5FKAA 1XOUA 5C0AA 3I3BA 4HZAA 4PWJA 1KLFB 5DN6G 3QW9A 5CCJA 5I5MA 3M88A 3SJAC 3WSQH 1MHPL 3CFEB 4JO3L 2R0LL 5DRWA 3PL6D 1KYOF 1T22A 3QG7L 3POCA 4JN2A 1NIEA 4LAJH 1TDQA 5LBGA 1YPZE 1G7QA 2CHZA 5DMIH 4YK4B 2AGJH 3OHXB 3VG9B 4GLRI 2J8OA 1MABG 3DI2B 3DXRB 1HXKA 4NIYE 4CNIA 3N2KB 1VQ9V 1YEIL 1CI5A 3OXRA 3MRLB 3L4ZA 5FIEA 2CLRA 4H8UA 4FZ0A 2MNUA 5DU7A 3H0TA 2XHBA 4ZMXA 4D0BA 3CHOA 4DQAA 3FQ1A 4KJPC 2X0LA 5IREA 5BW7A 2VQ4A 3MGAA 2X6CA 4OPAA 3IF1B 4G8FA 1PFCA 5DK0B 5F6IC 5EIQA 4AEIL 4YEFA 2IXQA 3N5AA 1A3LL 4DO4A 4IKIA 1T89A 1J8SA 4BBWA 5C0FA 1JGLL 2F53E 2VLKA 4UCSA 2P24A 3GVMA 1C5CH 2EUZA 5CUSH 1ZSHA 5BRZE 4ZQTA 5I30L 1FAFA 3QQ3A 5D1ZI 4X88A 2GT9B 2OTUA 3I50H 1LYQA 5CBHA 1FIEA 4QTHA 3HPLC 4FLYA 4N68A 3QDGA 2TSBA 3HUJA 2LAGB 3Q5TA 2FO4A 4CRPA 2EUXA 2AQQA 2K6YA 2J72A 3K91A 4MDJB 4DGWC 3CSFA 4I9WD 4X0KB 4ENZA 4GG6A 4JFYA 3TA3C 5C86A 4XVJL 1UACH 4N2MA 4JAUA 4KH9A 3V4UL 4UTAH 1F6LL 2UZIL 3BPCA 4WRLA 2F54B 2G3NA 2IFFH 1S9YA 5F96L 3SDXA 5L4FA 1UC6A 1NGYB 2UVEA 2WBXA 1KELL 2AMUA 4ZJ9A 2HN7A 3UX9B 4QXWA 3X1BA 3TBTB 4MW3A 2DQFB 5F89B 2NCMA 2QPFA 1RZJC 2GIMA 5GRUH 4M00A 5BVJB 1SEBA 5JO5B 5LBQA 1AD0A 3MV11 4MXVE 2NW3A 1AHMA 2GV9A 1ZV9A 1TJMA 2OTWB 5ID0A 3I74A 2E75B 1NLBH 2ZQKA 2AJZA 4CVZA 1IAIH 5CEZH 3DRTA 4G6KL 3H9VA 3K6NA 4UTBL 1UWGL 2BSTA 3MYJB 4N8PA 1AR4A 2OMBA 1DBAL 1EO7A 2DLFH 2DQ6A 3I75B 4QKTA 1B88A 1RK0B 3X11A 1SZXA 3H8NA 1CO1A 4TQEH 2PO6A 1NANH 1AS7A 1X3DA 2Y69B 1XCQA 4MBRA 3C87A 4AKQA 1KJ2B 2YBRA 1Q94A 2IG2H 1H0DB 4LWSB 2WYHA 1G7PB 3X3FL 2I9LA 1Q7YW 1JPTL 5JVDB 3POHA 4MJHA 4MS8C 4WLCA 5D5PA 1YUHB 1Y74A 2ED9A 1B04A 2ITCB 2ZR2A 4K15A 3IBEA 5JW4N 1FL5A 1ZV5A 3FKSG 4FTVB 3L74H 3RYFB 1B0RB 1RIVH 2XWRA 4M5YL 4R4FH 3E1F1 4LFAB 4X7SL 5CSZA 5CGTA 2QKIC 1RZ8A 5CEZD 3RNKA 3L4UA 3FSWA 2ZSVA 3BSHA 3CHSA 1GYWA 4HEMA 3QIBB 3OR7A 3FBQA 5HFLA 1R33A 1V7NL 3QUZD 2ATKC 1UXLA 4LVNC 2G3ZA 3HC0A 4OQTA 5CZVL 3UIYA 3V0DA 3L9EA 4XWGL 5FYLH 2HG0A 4K2UL 2PXYA 4BZ2A 1HP8A 4ODTH 4R83A 4ANXA 4F1ZA 1PYWB 5CEXA 2VJXA 2QR0B 4PMEA 4YVNA 2ZXAA 3IU3A 1F8TH 1T1YA 5J13B 5F71A 3I3EA 1GM8A 1WP8A 1I7UB 4WENB 1I1AA 2HT4C 3FFCB 4PDMA 2ZJSL 2JELL 4W6YB 2NY6B 4N25A 2AK4A 1VGKA 5CIPH 1T5WA 2OMXB 1HNXB 4DAGH 3LRMA 1G6RA 4WFGA 2EDRA 2Y36L 3UABA 3HKZA 2EJ7A 3WE1A 4S0SD 2KBGA 4J3SA 5E6ZA 3IJ8A 1O7DC 1OAZH 4BE6A 5B1BB 1D2DA 4C56A 2X4SA 2BLFA 3BWSA 1DJGA 3FTZA 4ORZC 8PAZA 3QDJB 1JOIA 2UXXA 2J71A 3CPLB 2QQQA 3WB2A 4HUXB 5DD5L 1V3LA 3EGSA 4LP4A 1N5YL 1FNFA 3BP5A 3NIGF 4NO5A 3OZ9L 5T1DL 3BN9C 3H3PH 3K9SA 2VDPB 3D4CA 3QZWG 1BLIA 2EULA 1GGBL 1MWAA 1FYTA 1R3KA 2D8KA 2YOAA 2YQBA 1SDDB 1KCVH 5FWQA 4AVHA 1N0LB 4E9WA 3RFRA 4MXQC 2W0FA 4PJ0Z 1CGVA 2WGNB 1AZRA 5DQJA 1DDHA 2X3CA 3SE3C 4RNRA 5KS9B 2EE6A 1TNNA 1Q4NX 2IDSA 4AG4H 1HEHC 1GO3F 2Q0OC 3R06A 4NRXB 4K7FA 1F1DA 2OYKA 1E50A 1WA0X 1WSST 4JZJB 4M8UA 3VD0A 4N2LA 1XI1A 3LUTB 1PEWA 2FHFA 2JK5C 1LD9A 4L5FH 1LNUA 1ORQC 2MTAA 4Y19D 5D93B 4HUUA 5EBMC 4N20A 4ENED 1FZJA 1IC5H 4Y8DC 5K5YA 4X65B 4NNYA 1XWVA 5FHAH 3K4AA 4TQ8A 1KEML 5AOKA 3G71V 1S9VB 1FDLH 1JYNA 4MCNA 2V3FA 1P7GA 3AROA 4TUUA 5DEZA 1JZ3A 4E9SA 3QEGL 1B4LA 1KTBA 2ARJQ 2BW5A 5ITBL 1D5MA 3FRPA 3MC0A 4J4PA 1PG7W 2NLJC 4I55B 3UCSC 2LT9A 2YIBD 3A0BZ 3HKFA 1QLEB 2W0KA 4Z0XB 3WNNA 2JIXB 4H8QA 2WTPA 5AWNH 3CC4V 2F1MA 5TQ2L 3FT9A 2VABB 43C9B 1U8LB 4N2DA 2VXVH 5E8PB 3CNKA 5DJ0B 5E5RB 5L9DH 4YPJA 1WAZA 1PLAA 4DR6O 4AYEC 3QVNA 3MV9A 5HVWA 2R39A 1IEAA 4LCUB 1H15A 1U91B 5JIMA 1VERA 4JQXA 4ZUUA 3M07A 4HALA 3MNVB 5I0XA 2PW2B 5L8KB 4DJMA 2FJHB 4WSJA 1N8ZB 5D1XC 1KPRA 5KAFZ 3FONA 3I02A 2CE6A 4GRWB 1SQPH 4YX2L 1U8KB 1AJPA 3GMLB 3NCMA 4MQ7B 5AUMB 2IGLA 4OBSA 3SDAB 1N6QH 4MMZB 4GAGL 2DH2A 5K1JA 3TCTA 3FB8B 4FQLL 1VP7A 4NGHL 5JIPA 3E80A 5C92A 4IRSA 1RPQA 1A6WH 3SDCD 1JD9A 2FEDC 3GS4A 4L2YA 4YDZA 5DJZA 4O4LA 2YSSA 3VFPB 2YD8A 4RA0C 1E4KC 4OVUA 3WUWB 1ZX3A 4J7ZA 2DWDA 4XPHL 4FL4B 5BPPA 2LVEA 1BLNB 3WUZA 2C3XA 3DA0A 2IOIA 2VR6A 4PJIA 4YBQC 3F6IA 3V0WL 5IMMA 4RFNC 4XVTL 2FLMA 4JY4B 3IXAB 3K59A 2VLRE 4XPTH 1S4IA 2EKSB 5DTFA 5F2FA 4YBLC 5LMNB 1ILUA 3SY0B 4ECNA 5HSFA 3G5ZA 5C0AD 5JHLL 4W6WB 1GIGL 2Y4SA 4AQZA 3BPLC 3APQA 2QGNA 2LU5A 1BBDH 3TJHC 4MJIB 3PNWB 1NAML 2QEXV 4H13B 2ZNIA 5DO2D 1XB6A 1DLFH 1QU7A 2JFCA 2VO8A 1FJ1B 5E23A 4OI8A 3DETC 4PHXA 4G6AD 4UVAA 4K5PA 4FHBD 1IGJA 3SYOA 1WIUA 4QRPB 3RTQD 3F7VB 3EBIA 1Q86W 3FO0L 3RWGA 3UH8A 2B5UA 1G7IB 1BAWA 1NGWA 3C6SB 3NJMA 1JYXA 2FZ3A 1A7RH 4XCFH 3QWNA 4N8VB 3WO3B 2B20A 1KTKE 4IHBA 1AI7A 5E6ID 3T6XA 4G28B 3ZT5A 3LAFA 1I4FA 4D3CL 2JCWA 4GRMB 3FMGL 5HDQL 4FFYL 1JMKC 5C6TH 1JI1A 2HLEB 4Y5YC 3CZKA 3FCSA 3QR1A 5GISH 1XH2A 1IX2A 3EUDA 5TQ0H 3CBRA 4FZ1A 3GJFK 1BZOA 4CS2A 4PFEA 3L2LA 3P54A 1UKQA 5C09A 1ZIBA 4BK8A 1M57B 1AIZA 2AZAA 3NIGE 2NN4A 4NDMB 5SWSB 3VFMB 5IF0A 2DQDH 3MROA 1BQLH 3GSVA 4FP8L 1W0YT 2ZYHA 2OR7A 4GAFB 4W9ZA 1W2BU 4GT0A 2WLMA 2CO4A 2YD2A 3ISYA 3MODL 1MPAH 5KSUA 4H5SA 1DFXA 4P46A 3JZ7A 4NTXA 1AGCB 2QPEB 4MVZA 4TPRL 4XO4A 4CN1A 5GZOD 4FC3E 3EH3B 4HXBL 3MRFA 4TUJA 5JDSB 1P2CB 1L6XA 5E2UH 1WJ3A 3GBML 5L3CA 1N34B 1K8AW 1FQ9C 3GSRB 4WHTA 3EG9A 1IC7H 4JFWA 1HSBA 3CCMV 5HJ3B 4OR1A 4UV9A 4LC1A 4CW1A 5D7IB 1DSYA 3L2NA 1SJHB 4KRNA 1NGZA 5D7KD 1NEZG 3LKOA 2VQUA 4HLZH 5I1EL 1EAPB 5J3HD 1KN4L 3L3HA 1UH4A 4ZX3A 5IBUB 1KTRL 3OHMB 4D7TA 4UILL 4Z7NE 3VXPA 2OZNA 4WBNA 5KSVA 1E28B 2COVD 1BVNT 4AMXA 4UM9A 4JPKH 5KG9A 2DWXA 3EZ8A 3G5VB 3ZKMC 4FTDA 2UXDO 2QWPB 3LV3B 1OGTA 3ZYJA 2WWWA 4L1TA 4BFBD 1F4AA 4PJEF 1TMCB 1DQIA 5I1DA 1MRDH 4QTFA 4U6TA 5SWQB 1MCKA 4ZSOB 4OQTH 1JNLL 2SEBA 2QV4A 3WOVA 1ZUQA 3UG4A 4MS2A 1Q9LB 3FO1A 3W2DH 2MSPA 5JXAH 4EZLA 4FLOA 4EKJA 3GI8H 1CD8A 2OCCC 4X6BB 3LKRB 5KYYA 4J27A 4QCIB 1PAMA 1BD2A 4MCZA 4EPSA 2ZP9A 2H1XA 4Z7VE 4Z95L 1T5XA 1T4WA 3IN2A 1I8AA 3TJEL 3WHXA 4ZUVB 5L7XH 2HTLC 4NAQA 4XMXA 4N2CA 1G6RH 3GXNA 4YGAB 1R24A 2H3XC 3AG3B 3I56V 2J20A 4MD5A 4PJAB 4OT1L 3QS3A 3BVOA 1XL6A 2O5XH 1OW0C 3JD2A 4PJHE 4PD4K 4PD4J 1J0KA 1OPGH 4B9GA 2UXBB 3PWUA 2NY3C 4JO2H 3F65A 3BKYH 4I48A 3VX1A 4FS0A 5DYOB 4MAYA 3BA9A 4X62O 3QJVB 2F1EA 2XYBA 1J0ZA 4MA7H 4NT6A 3VWKC 2VRKA 2O61A 3IDGA 4XP1H 3ZIAG 3KPRD 1MFDL 5F3BB 3QDHA 1RFDH 5JORB 4TV9A 2VLME 1MWAH 3MRHB 5IHZA 4XAKD 3O6MH 1I7RA 1XNQO 4R7DB 2IDFA 3EYUL 4JO8A 4JI2B 4IOSA 1N33B 4S1DC 3OXSA 2WW8A 3I5DA 2BHYA 5HD8D 3UAJC 2AK4D 4F9LC 1KXHA 3BP6A 3X13A 3QS2A 4Y1TA 4F93B 1HE7A 4HU8A 4BW5A 3FB6B 3ZX6A 3IFOA 3MNZA 1IBLB 4C47A 5C0EA 4FXLA 4C56D 4DR3B 3FSVA 1II4E 4B3TO 4O4YL 4XP4L 2K4WA 3BKML 1B4TA 4UZGA 4NVPA 1EBPA 1GN2A 3IJHA 4PGBA 3ZDXF 3RVTD 3FQYA 3JYBA 1E1QG 5TPWH 2JKTM 2X4RB 2J1KA 4X64O 4G7YH 3B9KA 4NKIL 5LN4A 3K3QA 4PB9L 2HVJC 4X1YB 1FYTD 4C57C 1FFPB 2A9NL 5D7JB 4BK5C 3EJJX 2VJ0A 4PR5A 4F15B 2OYPA 4DN3L 1YMMB 4TQHA 3MRGA 4U1MB 4HZ3A 1MW2A 5TF0A 4YFLF 4RZKA 3MTRA 5B8CA 4CVXA 2WPGA 4AV4A 2WUCH 4Y2OA 4X4ZA 1MHCA 3FK3A 4ERSL 4I0PC 2MRYA 1U3NA 2DBJA 2FEEI 1OAUL 1Q0YH 3BGMB 3O3EA 4KI5C 1NJIW 4Q6IB 4IGBC 4FVMA 3DC5A 1ZT7A 1MCFA 1F18A 3QDMA 2G3MA 3IVKA 1GRJA 3KGRA 2HFEA 2BSKA 4H0LC 2BVPB 5E1QA 4BELD 3C2AH 2PTTA 1MJ7L 4OZIB 3CVIH 5GSVA 5EK0A 1T7WA 1FGNL 1DVFC 3CCHA 5INCB 3DHJA 3RL1A 4RUFA 3HZVB 4ZO9A 2R27A 4JFTA 5FR3A 4RAVB 1MOEA 4XP5L 1MFCH 2YWYA 1Q9KA 5EMYA 2WTOA 2B59A 1L9QA 5DK2A 4PRNA 4ZAKA 3AY4C 3CLWA 4R0LB 1G6VK 3G6JF 4HKBA 3FYIB 4UV8A 4JI0B 4B9YA 5J57B 3QO1A 4Y4KB 1IJNA 1OSZB 5A9GA 3CSBA 1AAJA 2FEEL 4RDBA 4ODSL 4QF1A 4UOW0 3MV9D 1MCIA 3LOWA 1IQDB 4NUJA 5GGVL 4BIZA 2IPTL 3D4GA 2DM2A 1RUKL 3P4MB 4P4RA 4W93A 4QHUB 4WI6A 1EN5A 1E9PA 5IK3A 4JG0L 1CL7I 1KBGH 3G08A 5DUBB 4HSQA 4UQ2B 3WFDH 2EYTB 1KGIA 2AITA 5C0CA 3HC2A 1C1EL 3DJRA 2M83A 1UCBL 4DN4L 4QJFB 2Q69A 4NOBA 3KHQA 4NZUH 4WWKD 4PJEE 3KLAA 3QBTB 2XBZA 5ENWA 1XILA 4BCXA 3SPHA 3RAJH 4NRYA 2LLLA 2UY7A 4H1LB 3QJQB 4IRSD 4K5LA 1CLZH 4RWHA 4UINH 4AENA 3GSUB 1OM3L 4BK4A 5C6PB 2WNWA 3OVUB 1CN4A 2WOYA 3BEWA 3O2DH 4JHAL 5CO1A 4GKNA 4WF7A 4NM8H 2GBOA 1BDYA 3L2MA 1KLUB 1SVZA 4MQXC 2N01B 3O8XA 2F61A 2OL3A 2Q76A 1XQ4A 3U1SH 2AXTZ 1G5AA 4JFEE 4O4IB 3MACL 3BUBA 1ICTA 1LEGB 3S7GA 1S3KL 1MY5A 4IMLA 1F13A 4NXKA 5IQOA 2ZF8A 3BKJL 1CL7L 4U1SB 3UDWC 2UUBB 4MSWA 1VZIA 5J1AA 4JFSA 3P2BA 2JS3A 1JGUL 1H3UA 2B3RA 2WO4A 4KKCD 5E1IA 1INDH 2X4TA 1FBIH 4XN4A 5HHMB 4LSPL 1KG0B 4UUJB 1I8MB 3WDIA 2C9VA 3DX6B 2H0EA 2QGDA 3NA9H 5DHYA 4V1DB 3LQAH 3F7KA 4XC1L 5CWSA 2JB5L 3R66A 2VDPL 4OLUL 2I07A 2FDBP 3MBEC 3N42F 3WY1A 4L0YA 3K58A 2ZXEB 4NI3A 1ZWIA 4AM0B 3QI9A 2V9UA 1HCYA 1JXGA 5J6HB 3N2GA 3F58L 4XNBA 3A0RA 5BZWA 2RJMA 1FH2A 4N90D 1P5UC 3WS3A 4JRYB 4IIJA 4ETYA 1PZ5B 4NQCB 2EILC 4WQOA 4DW0A 4QNPE 3MV8A 4DP6X 4TRPL 4JFHD 1DJYA 3UPRB 4URTB 1HNWB 3V6FA 1KB9F 2C3VB 1F5WA 2IC2A 2YIHA 3LIZL 5DJ6A 3SE9H 1N26A 2NQDA 4W4KA 4XDLA 4TUOA 3O2VH 5J6SA 4F1SA 4XNQA 2GTSA 3QQNA 4TTDC 4V33A 3ZDXE 1AGBA 1QVGU 1X7QA 3FUDA 3ILQC 5C09D 2DAVA 4E5XG 1WN7A 1BZDA 3HE6D 1SJMA 3P77A 3LEXB 2KQXA 3JWNH 4LNRA 3L13A 4Y4KD 2BXZA 4JPVH 2YEZA 1RZKC 3TN0A 1AYRA 3VXQB 4JQIL 4XMLH 3U36B 4QXTB 4ZX5A 4XX5A 2VMCA 4G8GE 3IDYB 4JMXA 3SB3A 4HNAB 3VXTA 5JIQA 2JRIA 4UXNA 2JIZG 1NU1H 1VRSA 4V2CB 1EZVX 2X4OB 4KXDA 4D8OA 1EFXB 1MFAL 2QPUA 3BFOA 4K7PX 4PJBA 2K3HA 1JFQL 5CS7A 5J12B 1S5HB 1VFAA 4I4TA 2VLLA 3NCXA 4U1HB 2NY4C 4O4JA 1MZYA 2JKRM 5B4MD