3EHBB

A d-pathway mutation decouples the paracoccus denitrificans cytochrome c oxidase by altering the side chain orientation of a distant, conserved glutamate
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
252
structure length
252
Chain Sequence
QDVLGDLPVIGKPVNGGMNFQPASSPLAHDQQWLDHFVLYIITAVTIFVCLLLLICIVRFNRRANPVPARFTHNTPIEVIWTLVPVLILVAIGAFSLPILFRSQEMPNDPDLVIKAIGHQWYWSYEYPNDGVAFDALMLEKEALADAGYSEDEYLLATDNPVVVPVGKKVLVQVTATDVIHAWTIPAFAVKQDAVPGRIAQLWFSVDQEGVYFGQCSELCGINHAYMPIVVKAVSQEKYEAWLAGAKEEFAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A d-pathway mutation decouples the paracoccusdenitrificans cytochrome C oxidase by altering the side-chain orientation of a distant conserved glutamate
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/immune system
molecule keywords Cytochrome c oxidase subunit 1-beta
total genus 74
structure length 252
sequence length 252
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2008-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ehbB02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ehbB01
1WS7A 3D12B 1JOIA 4KO5A 4W9ZA 2IH9A 1ET5A 1XB6A 3IBOA 3QJRB 8PAZA 3ABLB 1ZDSA 1SDDA 1PMYA 5I5IA 2ZONA 4E9SA 4YSTA 2RACA 2VM3A 3FQYA 5AZUA 1F56A 2IDSA 2XU9A 5D4IA 3NJNA 1GY1A 3IE9A 4MFHA 3H56A 1T5KA 4KO6A 1BQKA 4N4YB 2VSMB 2VW7A 1IBYA 2PP9A 4E9RA 2YAMA 2Q5BA 1OCZB 1NTDA 4BXSV 4BWUA 2XVBA 3SBPA 1OCCB 1ET8A 4ENZA 1ZV2A 3ZBMA 3ZX1A 2AANA 2H3XC 2HXAA 3FSAA 1RZPA 1E5ZA 1BYPA 2GBAA 4DPBX 5PAZA 1PAZA 1KCWA 4BDVB 3QQXA 4A2FA 4NERA 1ETJA 2ZWNA 3X1NA 2J57A 1OE2A 2Y1AA 4G72B 1FA4A 2B08A 2IDUA 2YQBA 3T9WA 3EF4A 1M57B 1WA1X 3NSYA 2BZCA 3QJUB 1NIFA 1JXGA 2J55A 3NJMA 1W8EA 2XUWA 6PAZA 1L9RA 1E5YA 3TASA 3S8FB 2DYRB 1SF5A 4E9WA 1OE3A 2BP0A 1KBWA 1V10A 4A66A 4YSAA 2QDWA 4P5RA 5B7FA 2HX9A 2UXGA 2BHFA 3CDZA 1BXVA 2FQFA 3WG7B 4DP7X 1OE1A 1BAWA 3NJLA 2XV2A 3BQVA 4Q8BA 2PPAA 3OMIB 3PAZA 1JVOA 3FQ2A 5TK2A 2BWIA 3SBRA 4KNUA 1AZBA 1PY0A 1NPJA 2IWFA 2PP7A 1L9QA 3QJVB 1GSKA 4QKTA 3JTBA 2CALA 3AG1B 4AKOA 3MBWB 2YXVA 1X9UA 2XX0A 2PPCA 3WI9A 2CCWA 3N55A 2FT6A 2VN3A 3FT0A 1PNCA 3QJQB 4HIPA 4YSOA 4G70B 2GHZA 2GSMB 1AR1B 2AVFA 4BWTA 1SHWA 2ZOOA 4YSDA 1L9PA 2YXWA 3FU7B 5B1AB 3ASNB 1E30A 2CAKA 4GP8B 2PP8A 1AZNA 1MG3C 3NSCA 3UAAA 2OCCB 2YEVB 3NYKA 1NPNA 1AG6A 3FSZA 5D4JA 1JXFA 2EIMB 1IC0A 1UATA 4G7QB 3NP3A 2QPEB 4W1TA 5B1JA 3AZUA 2VSKB 1PCSA 3CVCA 1IBZA 1RCYA 1ZPUA 2BWDA 2IWKA 2UXTA 4DP4X 4E9TA 1N70A 4NB7A 1BEXA 1J9SA 1PZAA 3AG3B 3TU6A 2I85A 1R1CA 1SDDB 1OOWA 4A2DA 2QT6A 1CUOA 3AY2A 3JT2A 4AI7A 5E9NA 3T71A 3S3CB 4GP5B 4JHVA 3UACA 3AG2B 4YSCA 3AW5A 1NWPA 1FFTB 2MTAA 4PCYA 4AX3A 1E65A 1NINA 1CYXA 3QJSB 3PCYA 2BO0A 2DWSA 2WO3B 2AZUA 5IY5B 3FYEB 4M3HA 3MX0B 1A4CA 2YAPA 3ZDWA 3PAVA 2FNWA 2H5UA 4GYBA 3NJGA 4RH4A 2R7EB 3OMNB 4JHUA 4HALA 1WS8A 1RZQA 1PLCA 4YSSA 2OV0A 2HRHA 3UADA 4UF7C 1MZYA 1AS8A 1J9TA 1DZ0A 5EHFA 1JZGA 2HRGA 3KW8A 4DPCX 3DKHA 3N2JA 3PAUA 3FSVA 1W6LA 1SFHA 1QHQA 4YL4A 3FYIB 1SNRA 3X1BA 3HB3B 3CZUB 2P80A 3QPKA 4KOCA 1AZCA 4HZ1A 1DYZA 2XXFA 2FWLB 1AQ8A 2JFCA 2J56A 2GB2A 4YSEA 5I6PA 3TBCA 4BXVA 3GDCA 4G7RB 2XWZA 1GS6X 4WTQA 4A2GA 4DP2X 2PPFA 2Q9OA 3ZIYA 4AKPA 4GP4B 5I5JA 4GY4A 4K9JA 1TU2A 3V9EA 4DPAX 5PCYA 5LDUA 1NICA 1I53A 5I6OA 3L45A 2PPDA 2XYBA 4AZUA 3CG8A 3WKPA 3NT0A 2YAFA 4JKNA 4Q89A 4BK5C 7PAZA 4YSUA 4F2FA 5F7AA 1KCBA 1J5CA 2YARA 3PPSA 2IWEA 3V9CA 2UXFA 2J5WA 5AFAA 4E9VA 1ILSA 3OD3A 4KO9A 5B1JC 2IDTA 1KDIA 4HHGA 4M4RB 1PLBA 3FU7A 3C75A 1EZLA 3NSDA 3DIVA 3FQ1A 4YSPA 4DP8X 4E9QA 1TEFA 5I6NA 3S8GB 4N8UA 1BXAA 1PZCA 1AAJA 3FPXA 2A3TA 3NSFA 2QDVA 4G71B 2FQDA 1JERA 1NIEA 1WA0X 1YLBB 4E9YA 1CYWA 3SBQA 1CC3A 1ILUA 1GW0A 1ET7A 3CVDA 1AS6A 2UX6A 3GYRA 4HCFA 3FSWA 1PZBA 3RYMA 3UAEA 1BYOA 2UX7A 1XB8A 4A68A 1MZZA 2OJ1A 1V54B 2X88A 1A8ZA 5D4HA 1TEGA 3OM3B 1WAEA 1JZIA 3X2QB 2XX1A 2P80D 4DP5X 2YAOA 3QJTB 5F7BA 5A7EA 3CVBA 1A4AA 9PCYA 4A2EA 4HCIA 5I6MA 4QLWA 4YVUA 2YAHA 4A2HA 1GY2A 5FC9A 4F2EA 2BP8A 4YSRA 1JXDA 2E86A 2PCFA 1ASOA 2ZXWB 2IDQA 1IUZA 3FPYA 1SJMA 1FWXA 4UANA 2YAQA 1GS7A 1J9RA 3T6ZA 5I5MA 2XV0A 1ZDQA 3ABKB 2CUAA 1EHKB 2Y69B 3X1FA 4HAKA 1HAWA 1J5DA 1BXUA 1ASPA 2PCYA 2GIMA 1GS8A 2BP0B 3EH5B 2HX7A 1X9RA 1KBVA 4HHWA 3IN2A 3WNIA 1E67A 5TK4A 1NDTA 3ERXA 2NRDA 2N0MA 3S3DB 1AIZA 1ZIBA 1HAUA 2IH8A 1M56B 5AKRA 1JZJA 4CSPA 2GC4C 1AZRA 3FU9A 2WO2B 4HCGA 3KW7A 2TSAA 2IAAC 1N68A 4BDVA 2TSBA 1GR7A 1QNIA 1KYAA 3UABA 3FS9A 1A3ZA 3CDZB 4CSZA 4DP6X 3IEAA 1V55B 3EHBB 3OMAB 4GXFA 2VM4A 3NJKA 2VW4A 2AZAA 1JVLA 1IKOP 1W6WA 2DY2A 4KNTA 2DWTA 1L9SA 3WIAA 1NIAA 3WNJA 1VLXA 5I6KA 2R7EA 1HFUA 3DTUB 3T6VA 1GYCA 4NAJA 1OF0A 5B7MA 2HZHA 4AKQA 3ABGA 5B3SB 4DP0X 4FAAB 3HEIB 3S3BB 3H4HA 1ASQA 4WKXA 1TKWA 1NIDA 2LLNA 3ABMB 1PF3A 3NJFA 5B7EA 2GI0A 1PNDA 2CJ3A 3U25A 1B3IA 4KO7A 4FA7B 3PXLA 2UXVA 1ADWA 1J9QA 1JZHA 2FJSA 3NJIA 2JKWA 1WA2X 1AOZA 3FU8A 1KDJA 1BQRA 3NJHA 1OCRB 3IN0A 5B1KA 2EILB 2I7SA 4G7SB 2VW6A 4F7KA 1SHXA 3WKQA 2JXMA 3T6XA 1QLEB 1ID2A 3TBBA 6PCYA 3UGEA 3NJJA 4KOBA 2YAEA 4P5SA 5I28A 2AFNA 2I7OA 1L9OA 4EF3A 2HLEB 4DP1X 4DP9X 2BW5A 1ZIAA 1A65A 1MG2C 1KGYE 5I26A 1BQ5A 2XXGA 2H47C 1NZRA 3EH3B 1L9TA 4A67A 2BZ7A 1NWOA 1OCOB 2EIJB 5B1BB 2FTAA 2HX8A 3NP4A 4ZK8A 4E9XA 3AG4B 4YVNA 2FT8A 5ANHA 3OQRA 4PAZA 1A4BA 1RKRA 4YSQA 1SFDA 4KNSA 1AACA 1CURA 1AG0A 2IDFA 4UAHA 3EH4B 2FQGA 1M9WA 2FT7A 2CBPA 2QPDB 2X87A 4X4KA 2XLLA 3X1GA 2GC7C 1PLAA 5I6LA 3G5WA 3BVDB 2VMJA 4BWWA 2DV6A 2XV3A 1MDAA 3ASOB 2DYSB 1XB3A 1OV8A 1AANA 1URIA 1SF3A 2EINB 3H4FA 4L0PB 3GXUB 1AS7A 3X1EA 2PLTA 1KV7A 2W88A 2MRYA 2W8CA 2EIKB 2B3IA 1NIBA 4TXVB 1JZEA 3SQRA 7PCYA 2BW4A 3PLYA 3T6WA 1JZFA 2FQEA 1XMEB 2PPEA 2BP8B 1AZUA 3TA4D 2WSDA
chains in the Genus database with same CATH superfamily
3IC9A 4X5QA 3K3WA 4MQXD 2WSPA 2XHBA 5KX5A 4ERSL 2Q8AL 4P2RB 4G80A 3U7WL 3QJRB 5I19H 4Y2DB 2VLJD 3SQBA 4Y16D 3IGUA 4QOKB 1WV7T 4MHHI 3TTSA 4HXAL 4ZX3A 1YJ9V 4UV8A 4OF0A 2HTLD 1VFBB 4WFAV 1F56A 2IDSA 5I1LB 3OAAG 4XCYA 4RMUA 4MFHA 2C4XA 1C08A 4JRYE 3FU6A 2Z7UA 3QWOB 2ZQKA 4ELMB 1IGMH 3PWNA 1G9EA 3E1ZA 3OV6A 4BW9A 3Q2WA 3ML9A 1CPYA 4KJYA 4DGIH 1NFDA 1PSKL 1RZJL 4L3CB 2A1WL 1LEGB 1B4JH 5KVDE 1YHQV 5KBNC 1UJTA 3ROLA 4YXWG 3C3SA 4ENZA 1DUZA 1UWFA 4HX1B 4OIBA 1S5JA 4L8DA 1S9XA 4WDIA 1MJUH 3MX0A 1ZHKA 2NXZB 2X4RA 2QQKL 1NGQH 1T2QL 2X4OB 3BPNC 1CFNA 5BXFA 1LE5A 1BAGA 5GS2D 4XI5D 3O4LB 1VFAA 4HJJL 5TE7L 4LHUB 4YDKL 3GMMA 2Q9LA 3G6JE 3E86A 3FBQA 4AYFA 6FABH 2MWCA 1PKQE 4Q0XH 3KXFD 3M8OH 1SJXA 1NLBL 2VXQA 3GSNA 3PP4L 1ES0B 4DO5A 2XKSA 2F53D 2H45A 3U46A 4Z7QB 1T5WB 3T3MF 4ZFZA 1V05A 4K73A 3G6JB 3WAKA 4GAFB 2CO6A 3QUXB 3T3PE 1LEIA 1SMDA 3FB6C 2OJEA 2DYRB 5L4MA 1QBMH 2JB5L 3E89A 2F66C 1HHGB 2CRYA 4N22A 5SWSB 4EUPB 1A1OB 1R3JC 1NSNL 1XF5B 2L7JA 4JFXB 1FJ1A 2GT9B 3DJRA 1KXQE 1BAWA 4UUJA 3KPQB 4RRPG 5L2KA 1OQOA 2MKLC 3AGWA 4WBNA 3NTCH 4W9IC 2ZOLA 3HJEA 3MV7D 5TK2A 4MXQC 2OKMA 4LNRB 1OIOA 4KNUA 2OZ4A 3G7TA 4QRPE 4OZHA 4N1EA 3U10A 3W56A 3ABUA 1N10A 4JUTA 3NCFB 2L7UA 5L3CA 2IGFH 3AREC 4NKQB 4PLOB 1AP6A 2N4IA 4WHYH 3MNWA 1TLKA 4V1DA 3RPBA 1MFNA 2IH1B 4IDJH 1D2OA 1X9UA 4NSKA 4BIZA 5DO2D 1UT2A 4KK6C 3L3KA 1LO4H 1SN5A 5DUBA 2WNGA 2VAAA 8FABB 1CFSA 1T0MB 1FDLH 1RURL 2I60L 5LP6B 4HIPA 2X41A 3HCVA 4X1KA 1E8ZA 1FL5A 2GHZA 2ZWLT 3MRFA 1LM8V 2ADIA 3G6DL 3O4OC 3QRBA 1CDIA 1P7BA 4G59C 3EYQD 4QRRE 4U05A 2RH0A 5I71B 4FLTA 3ZDYE 1E30A 3ASNB 4YHHO 2JDIG 3UQ8A 3X13B 2I9TB 3NSCA 2DI7A 5JZ7D 3W7TA 3DC6A 4J42A 4Y5XC 2X4NA 4OZGA 2YGVA 5DI8B 4HWEL 1USQA 2O72A 2O61B 3M7MX 2OLDA 1NJ9B 1QHPA 3N85H 4GAJH 1WB8A 1JPGB 1K4CB 3AU0A 4NO0D 5IB2B 4NX0A 2X4TB 4BWAA 1KCUH 2CDGA 3AZUA 3T4AB 3F12B 1IBGH 1TO5A 2BWDA 3HC3L 4DP4X 5HDRA 3VFMB 1Z5LB 3TIEB 1F1DA 3AC0A 3QEQD 3H85A 3DURB 3IWVA 1J9SA 5SX5K 3RUGB 3ZO9A 2F53A 1S7SB 1A64A 3FB6B 3FB7C 5DRXB 3VH8B 3DC0A 1XSIA 1ZHLB 4YSCA 1YPZB 1GMIA 1BE3H 4WNJA 2HKAA 1A2YB 4XNQB 3TWCH 1BQHB 5FA3A 5LGJA 1FNFA 1A3LL 5I1CL 2HYMA 3IAQA 1HE7A 3K0WA 4MMYB 3GKWL 1FHNA 3QCTL 1UKSA 4LLMB 1NU1H 4X6FB 5CIPB 5DJXA 4NQDB 3IGKA 2ALWA 1OAZL 1ACCA 1J10A 3DXRA 5CILL 4DZ8A 4WUUB 4NQSB 4JI5B 4U6YB 3RPKA 3US0A 2X1XR 4IU3A 1AR1C 3QR1A 3VGFA 1ERNA 1U8CB 2OTPA 3EF7A 3L6FB 3PGFH 4RH4A 4QMEA 3UBXB 3VX1A 1GRJA 3WV0A 4DKAA 1QYGH 3KLQA 5IOPB 4XPHL 4B9GA 2A9AA 1IMHC 1HR0O 4MKTA 3UADA 2OMUA 4PJ8A 2VUKA 1W8OA 4XMTA 1N5YH 3BLBA 4HWBL 4FFBB 4FOMA 3N44F 3RUGF 2ADYA 5E8DL 5TF0A 2YJQA 4OD1H 4AEEA 4CC4A 1N8ZB 4JPSA 1HWGB 4ZMWA 3V95A 3VD2A 1AZCA 5K39B 2H2SC 2VR8A 3ULVH 4QY8A 1TYEB 4P9HH 3ZE1B 1KB3A 2G38A 1BD2B 3BD4A 3T0AA 2LFEA 1WBYA 4L1LA 1I9RH 1Z9SB 3K6DA 3O3EB 43C9A 5DJDB 3JAWB 4XBEH 4UTAA 3LRGA 4Z1VA 1JV5A 3O2VL 3V9EA 1G9HA 2E9IA 1WP8A 1BD2E 5ANMA 3FB8A 2BXYA 3BKYH 2DQFB 2WGXA 5BMVA 5TE7H 1Q38A 4N1CA 3T4AC 1R5WA 4YUEL 3V10A 2WGNB 3EOAB 5I6OA 2X89D 3K5NA 1N2RB 4JFED 2Y2WA 3M8OL 4UIKL 1PX4A 2FIKA 2ZSVB 1ZAGA 4JM2D 4U0QB 1B9KA 4PJIA 1UQSB 1DJXA 1MIMH 3TH3T 4DQAA 4NSKB 3FB5C 3L3OB 5BRZB 4QXVA 3QVAA 4JB9H 15C8L 1MWAA 4F20A 3T8XA 2YARA 3CFTA 4H20L 4FLRA 3IXTB 1E2ZA 3BUDA 1QEWA 3FB5A 4NNXA 1OAQL 4XN5A 3Q1SL 2CTWA 3EH1A 5JPMB 2XAQA 5T1KD 2CHNA 4M62H 1ZL8A 3O11B 4U1SB 5GS0C 3CV5A 4GAYA 5DK2B 3WJLA 3KPTA 3C5JB 3LN5A 3IDGB 4FFZL 2L0DA 3LQZA 2VLLA 3ZMUA 4JL2A 4MTMA 4PGDA 1A25A 4DUXA 5JW4N 1A4JA 3BN3B 3CSXA 2JGDA 1RV6X 2GIYA 2KDGA 2YMXH 3I9IA 4P06A 4S10A 5AYTA 4KRMB 5HI3C 5IREA 1IC7H 4HPYH 4G5AA 2VDKB 2PWGA 3GSNB 3ZMVA 2I26N 5EU4A 2AK1L 1TJGH 3CVDA 1VEOA 4AEIH 4M3KB 1EBOA 5HVHB 2X4TA 3TT3L 3L08A 3ZE2E 1RUKL 4J6IA 4MDRA 4ZFZB 5H4ZA 2AV7A 5D5PA 1IO4C 3UBXI 1H6EA 1TOXA 1WZ1H 3INUL 1JFFB 2R2EB 1GJIA 4TLSA 3BPLB 3MZTA 3UZEA 4OGAD 3FCGA 4ZUWB 2FYYA 1TMCB 2CBMA 1RH8A 3B6SB 5DUBB 2WXGA 2XX1A 4NPYA 4FFVC 1YMMA 2YD8A 1XTMA 1XGYH 4NENB 2N1TE 1A4AA 3BCFA 2C7FA 1LO0L 2LFRA 4NP4L 1M9NA 4JR9H 5JHLA 4NCC1 1OF2B 4H26B 2X12A 2IBZX 4HU2A 2L7QA 3QIWD 1DLHA 3S3PA 1TVKA 1JDCA 2IH3A 4MA7H 1OT1A 2A5UA 2IU0A 3RB7A 3UKMA 3P77A 5ELIA 5IB5A 5FX3A 4X20B 4I18A 4JFEA 4H1LG 4LF3B 4RFOH 5LCVA 3R7QA 5C09B 1L0NH 2AQNA 2XN1A 5JQ6H 5JTWA 1JGUL 5C93A 2VQFB 3OX8B 1BV8A 3AG3C 1XFPA 2CBTA 3K59A 1G1YA 1JZ2A 4XI5C 1DQDL 1TVDA 2PWEA 1CZ8L 1GMGA 4HIJB 4Z3IA 3FQWB 1OTUD 2QSTA 3U1SH 3RWCA 3TBTA 4LLVA 1HHIB 2MMXA 3A0OA 4XVUC 1PL3A 1MY7A 2ZUXA 3DWTA 4LIQH 3ULUE 4HCGA 1WAPA 4J6RH 1JPGA 1K4CA 2KI6A 2XN0A 4X88A 1A6WL 5GGRY 1NCHA 3CFUA 3ET9F 3MU3A 3H53A 2GUZB 4JI4B 1IAMA 5JW4M 2X4NB 3SOBL 4JFOB 4FPPA 2OXHA 4JRWA 2QGCA 4Z77B 5AD0A 2ENSA 1OGAA 2DM4A 4PYHA 4RA0C 5IGXH 1VQ5V 1JVLA 3A22A 1KB9J 3DYMA 3RTQA 5EULV 2DQIL 1V7NL 3GZOA 4OLUH 3PUUA 5ITBH 3B83A 4GO6B 1U30A 3BFWA 3LZRA 3QWOA 4J5VA 3QO8A 5HHQA 2VLJB 3OEEG 3IFXA 4MTFA 2AERT 1LEGA 1IC4H 1YPZF 1HL4A 4XPBH 4ZS6D 3NOIA 1YVLA 1J0HA 5CIPA 2DLGA 5HY9A 1V7ML 2BERA 5LJYH 2CJ3A 2PI5A 2ZWSA 2FECL 3OAWA 3CFBA 1VRSA 3J07A 4G42B 4KO7A 1CD8A 1L0YA 4FLHA 4OZHB 4OFPA 1E40A 2B4CC 3QQ9D 1WA2X 3KYAA 2EUVA 3OHXA 1KDJA 4FQXB 5DJXB 3AT8A 4K23H 3QWRD 4NQUA 3TZVC 3BCDA 2FL5B 3CFKB 5A3IC 5L4JA 5DCCA 4GMTL 2WWOA 5KSVB 3U4AA 4P2ZA 2EE3A 2APFA 1ZLZA 4AITA 3WOVA 1FVDA 5IQ7H 3F12A 4GX2A 4BFBD 2YAEA 2EIZA 2HEPA 2F1AA 3WENA 3CYOA 2ZUQC 2WBJC 4D7SA 1RZIA 4OCYL 5CGTA 4F8PA 5AVXB 3O2WL 4BSWB 5LWYL 1XILA 4LC1A 1TIUA 4PQXA 1LILA 1A65A 4IHJA 2W6IG 3CX2A 4FXKB 3OR7B 4Q6YA 3ZK0A 4LFBB 1MJ8L 5B8CA 2GUOB 1H9DA 1WZAA 1JZDC 4BFNA 5ISZA 1NZRA 4POUB 4ALAL 3EH3B 1LWHA 3HAEB 4JPKL 5CCKH 3IAYA 3TEYA 4Z7IA 1P1ZB 1FYTE 4Y89A 3U36B 1BMWA 1U3YA 4HIHB 1RM1B 1ZGLA 3Q4HB 2FT8A 2CR0A 4XODA 1ICTA 2ATKA 3UZVB 2WOBA 3KVDD 4QTHB 1A4BA 2OMTA 4YSQA 1NTZH 1OAUL 4PUBH 2DJVA 1CE6A 4PJEB 1E6JH 4NYKA 3RTLA 5J1TC 4JI4O 4PS4H 3PDOB 3U0TA 4QKXB 2DPKA 2IPTL 3GBDA 1WISA 3HUJE 3ETSA 3X1GA 1HNXO 1F4WL 3HMXH 1XH0A 2EDMA 2J8HA 4JAAA 3WY1A 8CGTA 5EIQA 3CRMA 3D6GA 5DLLA 4K94C 5D96B 4E4EA 3WS3B 4TSAL 3H4FA 1YN7A 4KXAA 3GXUB 3K03A 2WY3B 5JOPE 4TF4A 4NXNO 3AB0B 2WVTA 1EAOA 4M6AA 2EC8A 2J8UA 5LGUA 3LKOB 1D7DA 2YIAA 4CH4A 3SKJL 5C0AB 3HTLX 2DQGL 5HJ3B 3UCQA 1I94B 3QFJE 5A7BA 4ADIA 2PPEA 4CH6A 2NCMA 3FRPB 5E7FA 1OM9A 5GS1C 4ZFOB 4G43B 4Y9FA 5BZZA 4PPTA 4ZODA 1FZMB 1JOIA 2VUOA 3EFFA 2CGRH 2F2HA 3L2LA 3MRHB 5C08E 3NFPB 5SWZA 2SEBA 2YPVA 4RAVA 5C8YA 3B1TA 2QKCA 4LKXA 1P4BH 4AGLA 2J12B 4BE6A 2DD8L 2ODHA 2M8XA 4FG0A 4QIWF 2PTTB 1JUFA 5EBLA 1F2QA 4YXLL 5JH7A 3HNVL 4KO6A 2JIZG 1EANA 3HBPA 5KBDA 5IB4A 4FM0A 5F6HJ 1FGVH 2QTOA 4K9EC 1UD5A 2B4CH 2Q5BA 4P5TB 5AL8A 2Q8VA 5J5EA 1HSAA 3JAWA 2A83A 1JCHA 3QRLA 4HJIA 1JTOA 4X7TA 3VYOA 2PXYB 2G2PA 4IRSB 2YXFA 4PI2A 2J8OA 1CR9H 4AV4A 3N5AA 1WIUA 1ZV2A 2BVPA 5I8KL 3RIKA 3DVFA 4YXHH 3QI9A 4FQJH 3VRIA 1S5IH 2ZPKL 3LZFH 1QFHA 4RMWA 2JVDA 5PAZA 4DVRL 4ETYA 5IROA 5ES4B 3P4NB 1JMZA 3MHSC 2XXMB 2YUXA 3MLXL 5AW0B 4Z78A 1IE4A 2ZWZA 3DRTA 3C5SB 4O2AA 2AEIT 2QGBA 1AC0A 4FEMA 4YDVB 4XNYH 3P3PA 4EI5D 1M57B 2DWDB 4JDZB 3HG2A 2EDXA 4K3GA 5AW7B 2R0ZH 4OFDA 1FVDB 4FTVA 2J55A 1N36B 1BSIA 1TVBB 2K0RA 3CJJA 2Q73A 2IPUK 2JKJA 3DARA 3OJDB 5L2KD 3MRJB 1VGEL 4YPGA 4E9WA 5FS5A 2K6WA 2EJRA 2ZOKB 3O8XA 4OX9O 3IPEA 3OHMB 1Q90D 3MJ9L 4C83B 5C92A 5I76A 5I9QC 1BMZA 1F4XH 4P4KD 1F2XK 4GXUN 1OE1A 2PCFB 5C0JB 1R0AH 3N2GB 1JVOA 3QDJA 2BWIA 2DI8A 2IAMC 2ENPA 2VISA 2YPLD 3CPUA 3MZGB 1GJWA 2F1MA 5EZYB 2VDPL 4I4WA 3GSRB 4FLUA 3KWWA 4PGCB 1L9QA 5T5FA 2PWHA 2CKBL 3TIDA 3BKCL 4AJ0A 4LPXA 4U1JB 1FH2A 1EERB 3FUEA 3QULB 3R7RA 2EVGA 2XY2A 1EZUA 4LOEA 2RJZA 2J1YA 1OTSC 5F97E 1QABA 4GFXA 3QDJE 5KVFE 4POYA 2F9BT 3Q44A 3BDXA 4QHMA 5CEXA 2FEDD 4QRPA 4DGWC 4PY8J 5T5NF 4LLAA 2YDEA 4PHXA 5INCB 4JDTH 1JK9B 2YC1A 3A6BL 5EH1A 2ZINA 4YSDA 3CZNA 3EJUA 3OB0H 4X6CB 5BZWB 3BSZA 3PWUA 1F4YH 1V8HA 1KC8W 5JLZA 5FNVA 2DZEA 1GOFA 2H3KA 3OR7A 1J5HA 5FLUA 2KS0A 4CS4A 4EB6A 4Z3EA 4GRMB 3JSLA 43CAB 2YEVB 1T1YB 5F9OL 4XNMB 4OX9B 3MRNA 2YD7A 2EIMB 4URKA 1G84A 2QM8A 4JASA 1A7OL 3IFNL 1AR2A 4LF5O 1DVXA 1IBBA 1U8LA 3QQDA 3BDBA 3MLVH 3GMRA 2KQXA 1PCSA 1H8NA 4PGEB 4APXB 4BD4A 1F0LA 3WL9A 3RA7L 4B53A 1X5IA 1DANT 1ZLSH 2FX9H 2LV4A 4ZW6A 1J0IA 1JF5A 2R83A 4EI5A 1J0JA 4IHOB 4L4JA 1GPOH 1LHZA 2VXTH 1S7RB 2VN6A 2Y0IA 2PO6D 4OT1H 4TNGA 2YIBA 1E0OB 4TN9A 3CFBB 3KEHA 1RSFA 2BINA 4PLKC 3EGSA 2VJ0A 2QJ1A 1F97A 5C3TA 1L0QA 2UZXB 4W9LC 3D4CA 2E7LA 4WJKB 1QNZL 4ZOCA 1HIML 2WMPA 4QRFA 1ZVYA 1VF6C 3C09C 5KYXB 4K7PY 3E3QC 2NLJB 4KZDL 4XVOA 5DLML 2YGPA 5EF1A 2YAPA 1JHKL 4NRYA 3PAVA 1I9JL 5L88L 1VSCA 1IL1B 1U97A 3HRZB 4LPVA 4NZTL 1DQML 4FNTA 1MFMA 1UJ3B 1YY8B 4G9FD 3C5SA 1H38A 3QZLA 4ETQB 3QEHA 1EEYB 2HLAB 1U8IA 3EKCA 3MTRA 5GJSH 3X12A 5JMRA 1SYVB 2Q87A 3MLYL 4HK0B 4NNYB 5IMMB 3FSVA 5GGVY 4HMEA 4ZPVB 5CD3A 1BHGA 1U41A 3RDTD 4IQHA 1CT8A 1KGWA 3WEAA 3LEVL 3LCYA 2EULA 5BXZA 2B5IC 3VU1A 2BDNL 4QO1A 3TXAA 1KCKA 5ABDE 4M5TA 1TAEA 1YEGL 2MK3A 1SXZA 4MJ6A 1NC2B 1FRGH 1N33O 4H8HA 1J9CT 4GY4A 5H35A 2MTPA 2ZE6A 5KYWA 5DJZA 3VQ2C 1O6VA 1UXLA 3QNXA 4GSQA 3CFEB 3DROB 4RAUA 3OR6C 1NCGA 4POZD 1DLBA 2G4EA 2ZXWC 3CWBH 1BGXH 2QTVA 5GRJH 3ZTCC 1XNQO 4PJ0Z 1SY6A 4KZCA 2YPKA 4GW4B 1ZK5A 1HDMA 4NN7B 3MGTA 4UTAH 3MXVL 2W0FA 3CG8A 4PW4A 1CTMA 4M6NL 2WBWB 5I8OH 2Y69C 3PV7A 3AS0A 1BVNT 2I07B 1EM1A 1TZOA 4LBEA 2YA2A 5AVRB 1UHVA 3KPOA 4AVJA 2B0SH 2WLLB 3IDIA 5AFAA 1JVKA 4IYKA 3MJ6A 4AEFA 1AO7A 2WVVB 1UOVA 4W6YB 4WV1C 5D1XB 5J4MA 3ARFA 3DUUB 2CO2A 4YLBA 1FL3B 1ENVA 5GRWA 3IDXL 3O9WD 1UC6A 1TR7A 4B3SO 1V27A 1ZT4A 5HTSA 4MNQD 3WFCH 5A6LA 4AW4A 4W9JC 1OAKL 3NSFA 4U33A 1IZ3A 3ZKXC 1XZ0B 4ODTH 1A6VL 2B1HL 4HLZG 5SV4A 1I1YB 5CA1A 2YD4A 3IDYC 1CYWA 3VRIB 1AD9A 3BVNB 1MLCB 2EE2A 4APQD 1AS6A 3GYRA 3U0ZA 4EVNA 4O4HA 3NIFB 4WFGD 2LT9A 4AMKL 5C8JB 5KN5A 3D51A 3TN0A 4UNIA 2IJ0C 4LQ1A 2V5MA 2JELH 3OM3B 2OP4L 2PETA 2VE6A 3BGAA 1P0SE 3L3KB 4NC2B 1E27A 2VL5A 4QEGA 5D1ZB 1JZIA 5E51A 2E74B 2P24B 4KTYA 4L9LB 2G0LA 4LVNC 2XYCA 2W5PA 2OMNA 3T0ED 4J80A 4QRPB 2A9NH 4N8VB 1DVZA 2PTTA 2F43G 4ZTPL 2D03L 2NUPA 1C08B 2VXVH 2ZG1A 1OCZC 4N24A 1P7QD 3L73H 2ZICA 4JANA 3JQOB 4DV5B 3FB7A 4OJYA 1UA6H 1Q72H 3MAWA 4FF9A 3FC8A 4YBHA 2EYRA 4OKDA 2BP8A 4YZFE 1G87A 2FLMA 1G7IB 3NDZE 4PJFE 5D4QA 2IG2L 3TIDB 4LLMA 3CIQA 2HFFB 4S1SH 4XO8A 5KX5B 2ZXWB 2BFGA 5TH2B 3VQLA 3S4SB 4JI1O 1NGYA 1VACB 3GVMA 4GX1A 2LU3A 3KLAA 2A7BA 3QJOA 2JGUA 3VG0L 2RNBA 3T6ZA 5IEHB 3QCUL 4CADB 5GIRA 2JJSC 4DV3O 4JQVC 4N0CC 3QORB 1GN6A 2Y69B 4XNUL 3C3TA 3NIFF 1EFRG 3FTUA 3KXFB 2ED9A 3DPBA 3AAZA 3MBEB 2VOTA 2LW1A 1OT2A 4GO8A 4FULA 4H0GA 4Z1PA 3BYYA 3H0TA 1INDH 3N06B 3QNZA 4KPHL 4C4KT 4D3CL 2CGNA 4U4BA 3F7KA 3JV4A 2YPVL 4PJHF 2G0KA 1N4XH 5CB4B 1VEWA 2C3VA 5H37H 2IH8A 3WEXB 4BRVA 2IPKA 1HHKB 2QWRB 4YBQC 4PH8A 1ULVA 5E56A 3DHPA 4J1UA 1B4TA 4PR5A 4X62B 5DRNB 2WKLA 3FCUB 2HJKA 3B9AA 2ILMA 1DK1A 1HNXB 3MV9D 4ILDA 4LCWD 5B38G 3GLEA 1Z6JT 1UACL 5LGHH 4K3EL 3VDCA 3A8TA 1M1SA 2NZ9D 1NGWB 2Y5QA 3KGRA 4X80L 1JTPA 5D9SA 4OT1L 5ETUA 5GJTL 1EVUA 4O00A 3BJLA 5AW9B 2KSDA 1Y7VA 3D69A 5F96L 1TA8A 2DY2A 5AKVA 3LXCA 3P4OA 3VSVA 5DUPL 2ESVB 1OHHG 3ZTJG 1FAIH 3ZL4H 4PA6A 5TPWL 3GSQB 2YJLA 4XCYB 4JZJC 3MCYA 1OF0A 3NBNA 2I9LA 5TFSL 4OZFB 3WE6B 3QHTC 2Z31C 4F7EB 3RFZB 1AKJD 3RWHA 4YFDB 2DM2A 3ABGA 4XCFH 1S9WA 4ODBD 4GG6E 1ECZA 2A0LC 2ZIDA 3KPPA 4M8VA 2JKXA 2IANB 1HOCA 4YGVB 2WUCL 4IM8A 3CX5F 5A2JH 3AACA 2WUBL 5C86A 1X44A 3IDIB 4JE0A 1ZA6A 4X6DF 3APMA 4N2BA 1HNYA 2MQCA 4J9YB 4WTWA 3HZVB 5H94B 5B22A 3MV11 1BA9A 1YUKB 2RQ6A 1G94A 2DMCA 2NY6D 2XA8L 1M05A 4M61B 5I66B 4PVBA 4MMYA 2I24N 4XPTL 5FV2A 5LGKA 4XXWC 5DDHB 1KGUA 1OSYA 3B2VL 4NZDA 4WFFA 4FMTA 3VXMB 2UXCB 2YMTA 1G8MA 4ZMYA 1REIA 2W9EH 4P4RA 1JMKC 1BEYH 5EOCL 4JFFD 2JKLA 4KI5E 2HPOA 1TTFA 3T08A 4DK3A 2LFSA 2Y3NA 2P22C 5ISZD 1D6EB 3EJPA 1A0QH 1D5IL 5I18L 1P84K 5AOMA 1CLCA 2VDKH 3PWLA 1KJVA 5DHDA 2ZXDA 2BNRE 1F3DH 4QO1B 5D8JL 1ZIAA 3MI6A 3OSKA 2HRLA 3QDAA 4U7SA 1VF6A 2H47C 4WZ9A 3WHE1 4N0FB 4ZPVA 2V17H 5CD3B 4LZKA 2NSMA 4MS8C 2FO8A 1CI5A 1RUAL 2DYPD 4NKMB 2O61A 3H9SB 1M93A 1YEEH 3PHQB 4GMSH 1FGNH 3KYNB 3AG4B 4EFBA 3CCVV 5EB9A 1XQ8A 1DQTA 3IU4H 3MRDA 3TT3H 4AQEB 4F1ZA 3I3DA 5DMKB 2OCFD 2Z35B 5ANHA 1UJ3A 2WQSA 3MA9H 4TPRH 4KHXL 3V0JA 5F89B 4ZUUB 1UZ8A 2BSBA 4GB9A 2RMNA 2IH1A 1N64L 1D9KB 1YN6B 1WWWX 3JALB 1AACA 5CA1B 4N2OA 4R3SA 5I0XA 2N0KA 3L6FA 5D70H 5AOJA 3QXAB 3UJJH 3BSGA 5A9GA 2A4CA 4XZUB 3FQUA 4QPKA 3D0LA 5AAWC 3ZN6A 4EXPX 1EAJA 2DYSB 4X4ME 4FQCH 2GG1A 4XOEA 1ZJAA 4XVTH 1OV8A 4LFCO 2N05A 1IQDA 1UFUA 1WFOA 5H2BA 1ID5I 4L0PB 2MJWA 3KPLB 2W95A 5ERWA 3NESA 4JFVA 2D31A 1U8MA 2XTSA 1R3KC 3KCYA 3QT2A 4X5WA 3DECA 4BYHA 5C0GB 2ROXA 4K23L 1QLEH 5EC2B 1W72B 5FHBH 1MJ8H 2RTTA 1FO0B 1JGIA 1PV0A 3LVTA 5E8OA 3W7SA 4P0DA 2BW4A 2V2XB 1VQ7V 1HINH 1RZ7L 4JGMA 1THCA 4F9PA 3W39A 5DTFA 4MJ6B 5ABZA 4APXA 4PJBB 1QWNA 4KO5A 3LHPL 1PPJH 4F8NA 3OLGA 3WN6A 2F19L 3MCKA 4A7VA 5JORB 4XX1E 1WSST 3INOA 5KBMA 3UAFA 3WHXA 4DVBB 4R6UA 4YDZA 4RMBA 4CMMA 3LUTB 3LAFA 1MCNA 1QQCA 2WNKA 4BFIB 5HYJE 3VWKC 3B8NA 4N0UB 3EDKA 1UA3A 5AL0A 3BQUC 4PV8B 1I8IB 2D2CC 3QI9D 4PY8I 2OMXB 2BMKA 4KKNA 4Z7VB 3O3EA 4FYRA 2UY7A 4K35A 2X1PA 1LGVA 4JO3H 4X7SL 2GV9A 5JIPA 1L9NA 1CLOL 2W07A 1CIUA 3DV4A 3ZHQA 1R5VB 4OLXH 5TE4H 4Z7NF 2VN5A 1V5JA 1SXNA 4PJGF 4OJAA 3ENEA 4OF7A 3IGLA 1T7YA 2PXYC 3GMQA 4YXHL 4WNQA 5KOVC 1QO3A 1E5ZA 3L9DA 4MSWC 3FT3A 2N59A 4IKIA 5KANG 1T4KB 1PL4A 5BRZE 1RZKH 3KYMA 7CGTA 2EZPA 2JEXA 1CVRA 5IBTH 4ZMPA 2WQRA 4YWGH 5HVHC 5KYUB 5EO1A 2H3OA 3EXAA 2OS7A 5EZJA 3MRCA 5KSBF 4P4RB 4PJ7B 2XTJB 3NUKA 3RJQB 2QKSA 2BZCA 1NIFA 1QEWB 2DQGH 3FB5B 4G9FB 2VQ1B 1CDGA 5LOVB 4JAMA 4W81A 5CFAA 2V17L 1MW0A 3TASA 4R4NC 4JFZH 2HUEA 3TGUH 1OE3A 3AJ7A 2YPLA 3CD4A 5LHHA 4UM8B 3T0EB 3DSQA 2HLFD 4DP7X 4BUQA 3FN0L 1F23A 2DWEB 3FONB 1JGEB 4GZRB 4YHMH 3UO3A 1PX3A 4LFBO 4FTVE 4N90E 1SQVH 4JW3A 5AUMA 5BMVB 1VADA 4JDEA 4K3JH 4WTXA 3ZHLA 3F64A 1KG0B 4JG0L 2PP7A 4TL5A 2OX5B 5A2LH 5GGUB 3CCRV 1N26A 1DLHB 4QI3A 1R3IL 2W94A 1OXYA 5TE6H 3F7VA 4IOIA 2BSEA 5HI5C 1X5ZA 2P90A 2YXVA 4X5LA 3JWNC 4X66O 5BQ7B 4HT1L 4WWKC 5IV2B 5IEKA 3P4OB 2MQGA 5GRYA 5KLVH 3SE3A 4JDVB 4L9LA 3LQAL 1FVCB 3F01A 5I24A 2N1KA 2YFNA 4K71C 1SOQA 1G0YR 1UXWB 4JPKH 2AVFA 2WNXA 3BUIA 5HHQB 1Q6IA 3B2EE 1JDDA 1S9YB 4X4YB 4PS7A 4D9LH 1TQWA 1J5OL 1D9KC 3QDMB 4J7RA 4GP8B 4F2ME 1ND0B 5ITZB 4IW4C 2VQEB 1YMME 3U7YH 5EUOB 4W9KC 3HKDA 5IYCO 3DVNA 4H4NA 4M02A 4FABH 4EUPH 3U7WH 3ALPA 2B59A 3EDDA 4MA3B 2Z1PA 3U9WA 4S0SD 4UCTA 2EX3A 4QOKD 4I55A 1E28A 1N32B 2E7DA 3EO9L 4JMXA 1XMQB 1H6FA 4JKKA 4OLWL 4ZUSB 3D1MC 5FB8B 4NUJA 2UUCB 5I8EB 3C2AL 4UZUA 4CN4A 1RVFL 2CJUL 3W0WD 5J9PB 1XF2A 3DV6A 1P49A 4KL1A 4OGXL 1DVSA 5H37G 1RHFA 3AG2B 5ESQA 1FE8L 2OMBA 4BELD 3L9YA 5LA6A 1I1FA 1JRHI 3G5VB 4N1HB 4XO4A 2DBLH 1U33A 1BOGB 3QIBA 3QJSB 1MF2L 2NX5A 4UM9B 1IDSA 5ERWB 2VLKB 4P2CG 1CB4A 2R4RL 5L3DA 4OIFA 3PPEA 2HT3C 4J3OC 2V2WB 2YD2A 3JALA 3RVXC 3MOBL 5IJKA 4MNGA 3GTNA 4GYBA 5LBSH 2ZF8A 4OGQB 4FQLH 1WE5A 3B2MA 3QUXC 5DMKA 2XHNA 1UT9A 4Z0XA 4QHKJ 2OV0A 4G8GE 1FG2B 2VQFO 1CP9A 5GGTL 2OCCC 1MZFA 3D2UA 2XQ0A 2CRZA 4GEIA 4GS7B 4S2SB 3SO5A 1IVTA 1U3JA 3DKHA 4DV6B 3BLPX 4J3BA 5C09D 1W6LA 2I5YH 2Y9RT 3C09B 3QC6X 4A7GF 1MOEA 3D07A 1XF3B 5ISZB 4W70A 3B5HA 4MVZA 3U4EB 2VSDA 5GXBB 4R5VA 2H4EA 5D1QC 4BIOA 5F44A 3K2IA 3TNNB 4LF5B 5FO8B 5IB4B 1VQNV 4X4XB 5C0CB 2BRRL 4PBWD 1IM3A 1SUJA 2XWZA 1NC4A 1M7XA 3AS3A 4QNPE 1U95A 3FCBA 4JI3O 2P8LA 4Y88A 5DK0A 5JIDA 2DWEA 5C0GA 3WO3B 4PJ6A 4HKJB 4XR8C 3RA7H 4I0KA 4LCWB 3EAKA 12E8H 4QOKA 2JXMB 2EC9T 1ONQB 1XNRB 2V2XA 3SYPA 2BCCH 1GHFH 1E4JA 2OM5A 4GUQA 1EHLH 3FOMA 1NUDA 2H6UA 2QMKA 5F7DB 5CFHA 5TDPA 2LABA 5DHMC 3ARFD 3BH9B 2VDRL 4H5SA 7PAZA 4NZJA 5J13C 3PP3K 1MCRA 4EZMA 4L1SA 2IWEA 1XD0A 5HY9B 1QR4A 5KW9L 4RGMB 3NIGE 5G5DB 3ROOB 1E3XA 2N01B 3OAZK 1JHLL 3SDCD 3TEZA 2EBOA 4DUYO 2ZQMA 4DP8X 1HH6A 4AQEA 4Z78B 5SX5H 3VM7A 1GTNA 2BC4B 2ATKB 1I4FA 5IFAH 3GMMB 4GAGH 3HC4H 2EEDA 4M7KH 3VE0B 5DVPA 2QDVA 2IFFL 4G71B 2G60L 3HZKA 2FQDA 3HUJB 5ECJE 1EDHA 2YICA 1WUZA 2AABH 3OKKA 4X8GA 4QRAA 1K5NA 4FM1A 3SBQA 2AGAA 4YXKH 4L18A 4J3OD 5I17B 3HUJF 4ZMXA 2QKAA 2B2XL 3BP6B 1MELA 4JJOA 5L4FA 3IDMA 5J0BA 1N34B 1FFRA 2UX7A 3IPBA 2X4SA 4ICGA 4NN6B 5T3XD 4ZRGA 2FDBP 1K3IA 2ICES 3QUXD 4AVHA 5C9JA 3C60C 1DSFL 3H1IH 4PJ5A 4MVOA 1DBML 2AJ3B 1PLGH 3A24A 2EXSA 2YMXL 1XH2A 3F7RA 1PX8A 1ZEAH 2KDYA 2ICEB 2R9RB 2YSTA 1DL7H 4IU2B 4M7ZB 1BWMA 4FA6A 3PJSA 3KPMA 4Q6GA 2B39A 3APDA 3WFDL 3Q3GA 4AH2B 3K81A 2IM9A 4KRLB 2NY2D 4OCWL 1B3QA 1BAFH 3VWKD 5IJBC 1EDQA 1ZLEA 4NZ8A 1Q7YW 5D1QD 1ZHBB 3TPUB 4ELKA 4F2EA 3D39E 4UQBA 1YEWA 3PWVA 1CXKA 2E86A 4XE5B 1LEKB 2DQCL 4MA1B 4U1LA 3CMOL 5EBMA 4N68A 4B9KC 2E7LC 1XHHA 1FF5A 4KVNL 4TV8B 1AI5A 4KUCF 4PV1C 4DZ8B 1YEJH 4JM4H 2OTJV 1QVOA 4N0YL 1SKVA 1HXYB 3W37A 1W0VB 5BW7C 3CVHB 3GM0A 3V9FA 2APWA 4NN5C 4Y1AA 3D0LB 5CBEA 4OM0L 5JDSB 5MEOB 3MRJA 1J5DA 4OFYA 5TDNA 3CIAA 3CZSA 3MBWA 1GS8A 4NAQA 1UVQB 2GIXA 4Y4KA 5HHME 2Q0OC 3MRCB 3IDXH 3TYFB 4MAZA 1D5MB 4OF3A 3RWGA 3V0AC 4F9LA 1CTNA 1WEJH 2N0MA 3NACH 3J27A 1T5WA 3QUYA 4HQQL 5LXTB 1M56B 1HQ4A 3KBEA 3HKZA 4KRPC 3ZQ9A 4FFZA 1PD6A 4WO4C 2BNQA 3CRAA 3H6AA 1HNWB 3H3PH 4B9CA 1Z9OA 3PWUB 2IAAC 4LSVH 1BCIA 1OCOC 1SN0A 4N2MA 1QHTA 3KNBB 4KGLA 4S1QL 3SDCC 4NQCE 2DB8A 4LPYA 5EOQL 5E03A 4PJBF 2DRUA 4PRIA 5A2IH 4PRHB 1WFTA 4F33B 1DN0B 2W6JG 3FFDA 5DEJA 4GAGL 4M7KL 4NN6C 2Y72A 3BAEL 3S98A 4ISVB 1RUMH 1YEFL 3OGCC 3HG1D 1EAPA 5E5LA 4PLKD 5B7MA 3MNWB 4V1DB 4WQOA 1A1NA 3WYRA 1EBPA 1KEML 1CXHA 1KB5B 3CJHB 1BXXA 2VUYA 2YK1H 4L1TA 2HJLB 1BJ1H 1ZA3B 1K5QA 3ZRWA 2DQMA 2J71A 4GUPB 4CDHA 5DRWB 4E5XA 3TV8A 2XZAL 1BM7A 2WPGA 3HMWL 4WBNB 1G9MH 1BIIA 2NDGA 4DKEH 3BIKA 4FA7B 2G30A 3DOHA 2UXVA 4P9MH 2HHHB 4AZ8B 5JHLH 1A3RH 2WSSG 1KTDB 1N0XL 1IBFA 2A74C 2BP5M 2FJSA 3OWEA 1HOEA 2KYIA 4RRPA 1MNNA 4D8OA 2VXSL 3BPLC 5KG9A 1XCWA 4FQHB 2I7SA 5E9DA 4M6NH 1J1XH 1IIIA 3GO1L 3LKSB 4G7SB 3QNXB 1JRHL 3UCRA 1P4RA 3FQNB 2YRLA 4HD5A 4XVJH 4YDVA 2A73B 1JGVH 1DL7L 4CNIA 3S88H 2R1XB 3RDTC 3RRQA 1EXGA 1CLYL 4I55B 3LKNA 1HDMB 1DFBH 2H26B 3W9DB 4M7LT 5C8JA 2ARHA 2DYPA 2IJJA 3CFNA 3DOSA 1HESA 1WBYB 2YD6A 3RTQD 2B1AH 2ICEA 4IU2A 4AENA 5AYUH 1AR4A 2VLMD 4F5CA 3MA7A 2N74A 1NC2A 1QI5A 2WLYA 4KJWC 1VGKB 1VQ8V 5AB0A 1Z0MA 1HHJB 2NT0A 1G7PA 5GGTH 5BNXD 2EIJB 3TXQA 3SPIA 4X9HA 1AXTL 5CJXC 2Y06H 4O4LB 4IIQB 3ABZA 2NLJC 1EJOH 4FQ1H 3P2BA 1JHLH 4UFZA 4XP1L 4YS4A 3TH4T 2OZNA 1OV9A 5KW9H 2VDOB 5B4MC 4ONGH 3UZQA 2R2CA 5CUSL 1J8KA 3TBWB 4L29A 3AVEA 4KXZI 4IU3B 1F4MA 4BM7A 8FABA 3U1SL 2EDRA 3CRQA 4NCDA 4DK1A 4KROD 1DUYB 1S6NA 1P7KA 4KGJA 4RBPH 4YNYA 5DJ6B 2ZF9A 4FQPA 6FABL 5I6LA 3FO1A 3Q5TA 5GZOC 5E95B 3L9BA 1CXZB 1KEGH 4XDJA 3UIZA 4AG4L 4HJJH 3CH8A 3ZKQD 3DO4A 5FA3B 4NCC2 1FGVL 32C2B 4OR1A 1BOGA 5C0IB 2IDCA 2ADQB 5DK0B 3EJCA 4G5ZH 1KPVA 1Q0XH 3QF7A 4MX7A 4PJ7F 3D8MA 3KHOA 4PLJC 1N0LA 1T22A 2D7TH 1E5BA 4XP5L 4MYWB 2WCGA 4N2EA 4Q6KA 2W9DL 1GAFL 1JZFA 2FQEA 4NZUL 2AQ1A 4P5MB 4XNXH 3VAEA 5J89A 1ZVSB 2B9ZA 1BYNA 2Y07L 4A2MA 4NZRH 2X2YA 4XNZB 5IHZB 4HS8L 3DC5A 3RX8A 5KYWB 3V6FA 1DN0A 3FFDB 3JAMN 3DJTA 3FB8B 1OW0A 4ABVA 4TPRL 5B1BC 1KLGB 2IQ9L 4FFWD 4I2XE 3QUKB 1H8HG 4HUNB 4UOW1 1QFUL 3KPRA 2ZPKH 3LZFL 3OKLB 1K85A 3KCXA 4LCIH 3IK2A 4PRHE 1ZSDA 5KEZA 1FAKT 2E75C 1QSFD 3N1MC 4GQQA 5FYJE 5HYSA 1N0XH 3AREB 1MSWD 1SEBA 2VDQL 4H0LC 4M3JA 5J9PC 5HDBB 5K59F 3REWA 5IFHL 3CSYB 4XBGB 4ZX6A 3B37A 4OKVA 3RL2A 3ZBMA 1TZHB 3PNRB 2BNQB 4NQSA 4FLVA 3PHAA 4U6YA 1DVFC 1SDAB 4YEFA 1V3KA 3JZYA 5GS0L 1ZT4B 3HRZA 2CO3A 5EU5A 5DJ2B 5AG2A 1GZQA 1EDYA 4KY1H 5MEQB 3BQUB 4U1HB 3P0YH 1DJIA 4R26L 5LDSA 3RWEA 4PRBB 3O2VH 4Y19B 5C0BE 3FUIA 5CGMA 4HFWA 1THZA 4HEMA 4MTXA 3M86A 2C3XA 3FFCB 5HGGS 1OE2A 4G72B 4NQEA 1R33A 3G9AB 4EZKA 4H88L 2WINB 3NCBB 5HGBB 3RWCB 4BFOA 2UXCO 5J6HB 1BZDA 3CVHA 1B4RA 2MHAB 3A4FA 4XN4A 1JXGA 3H6JA 1W8EA 2XUWA 3S8FB 1BW8A 1N5AA 3WU2Z 1IAIH 2ZXEB 2FE0A 1NDMA 1ZLDA 4O2EA 5BO1L 4EI6A 5HXMA 1EGJA 4I0PA 4DN4L 5L0QB 4HNAB 1AYOA 1IC5L 2NPLX 2CA3A 4GS7C 4NR1A 2D9QB 5DJAA 4LH7A 1UEMA 4YLQT 4GKOA 1CBVL 3NJLA 5BZXA 4HS6A 1P7QB 2BSED 3I6KA 4H44C 2OMWA 3BZDA 3L70H 3MLSL 1QLRA 4Z7VE 5IMOB 3FB7B 5D1QB 3ARDA 4G5ZL 4C8XA 4EDXA 1DF5A 4ISVA 4F15B 3E8GA 1NI8A 4L4VD 1F6AA 2IAMA 1XNQB 3H2QA 3QQ3A 1AI6A 2NY1C 3JUZA 2A0LD 4PWKA 2VWJA 1FH5L 4F33A 4ZTOL 1IC7L 4OB5H 2AJ3A 1PNLA 2NW3B 4N2NA 4R7LA 4RDBA 4RGNB 2Z3YA 4QHLA 4YK4C 1MCIA 3QCTH 2ZZUT 3CXHJ 2JJTA 5DEGA 5IROD 1XCTA 5IVXB 3DYPA 2XBTA 4M6MH 3QJZA 5CILH 3U30C 4L48A 1UWEL 3ARBC 3TWCL 4DTGH 5HSFA 4C57C 4D0CB 2YXMA 4WK2B 2NY5L 4TVPD 2ZOOA 4ZQKA 4UTBH 1ZOXA 3B7YA 1HT6A 1KSRA 4K71B 5C0AD 1CK0H 4J8RA 2DEWX 4BQCA 4AQ8A 1JTTA 1KJ3L 4HSAC 5K9JL 4F6RB 2FGWH 2AITA 4Z6AT 4Q9RH 3GB7B 3B43A 3OKNB 4TNFA 5SWQB 3VSTA 3ARRA 4QXGL 5FO9A 5T1MB 4WI6A 2WLIA 5IJ9B 1MFEL 3CK0L 4FQ2L 4PBXA 4MMZA 1WK0A 4HUWA 1AVMA 4GFTB 5EZOH 4GKNA 3RIAK 3WNLA 3NP3A 4CNIB 4YHNA 2QPEB 2DJUA 1SYSB 2CZNA 3I9PA 2VSKB 2P06A 3ISRA 3SDDB 2YRPA 3SKOA 3ARUA 1SY6L 1GIGH 3HI6L 3VXMA 2NY0C 5LQBL 1I75A 1A14L 3O3UN 4NQED 3FN0H 2W92A 3P73A 5GRUH 3VOUA 1KKCA 5IMKA 1WC7B 3GMPB 5F7UA 2EO9A 3AS1A 4ELMF 1Y18A 1KYFA 3JT2A 4OQTL 3DK2A 3V7MA 2WTOA 2DI9A 2YK1L 2EXTA 1OARH 1IKFL 1IAKA 3K3QA 3S3CB 3UX9B 2BY0A 4GP5B 4JHVA 1WICA 2QQNH 3UACA 5DZLA 2HN7A 4LH6A 3H9HA 3CD6V 2J25A 4NZTH 5KSBA 4XNDA 4U2YA 1HS6A 3OXSA 2C1OA 4UMGA 2HJLA 3K74B 3LN4B 5H2BB 2K45A 4GBXC 4NDMA 1D6VH 4QRPD 4N21A 4IRJD 2DIEA 2LQTA 1MXDA 2WB1A 3DV4B 5GGQL 1T6VN 3GT6A 1G7QA 1YEHH 3G3LA 1HKLL 5CN2A 3MX0B 4HJTA 3MHZA 3I6SA 4JN1L 3NJGA 2IAMD 4NXKA 1FO0L 2OYKA 1YNTB 4YSSA 3U83A 4YMPA 4FLXA 2J1ZA 1RJLA 1Y0LB 4DR1B 3VD5A 1ZY9A 3QJFA 4U7NA 3MUGB 1VENA 4X7SH 1ML0A 5LNDA 2ZYIA 5B8CB 2WQVA 3FYIB 2OW6A 1AE6H 1LLAA 2DQ0A 3S7GA 3FU5A 4J6RL 4LF4B 4B9FA 5BW7A 1I3RA 1D6EA 2H41A 2PWDA 2ZIMA 1AQ8A 3I50L 1XCQA 4YHYB 5IB3A 1JJUA 1K92A 1DGSA 4OBSA 4U1KA 4PBDA 4DFIA 3K6OA 3IJEB 3KL0A 2DWXA 5D6DC 1UCTA 2FBOJ 1GS6X 2B3RA 2VXQL 1LD9A 3GSNL 3CZJA 1PIFA 2UZIL 1HILA 4JFUA 2Y22A 5DZVA 1T80A 2QELA 1G9NH 3WIIH 5BJTA 5SWZB 1IARB 3FF7A 2E7MA 5LDUA 4OSUH 3FKSG 4PJEF 4L8CB 3DX8B 1KUQA 3MV9B 1SMOA 3NZHH 3QUZD 5BQDA 3Q8AA 1AQMA 1R24B 4MQTB 3CXHK 2BFVH 2NUTA 4X9FA 3OR6A 1WFNA 3P3YA 4KK9C 4LLYB 3BVOA 4AQYB 3LNDA 5DD1H 3D3VB 3TXSA 1KU9A 1BSMA 3IFOA 2BE3A 4H2CA 2IBZH 1HOCB 2EICA 3BVUA 1T7VA 1KJ3H 1YN7B 2PN5A 4MXWL 4P5TD 2Z9TA 3WD5L 5J6HA 1BZ9B 4MCMA 2GTZB 3CZLA 3GNMH 3OD3A 4NFBA 5B1JC 2Q8BH 3CRCA 1I3UA 5DMGC 3WUWA 1BQHG 1MFEH 4FQ2H 1EZLA 4Y2NA 2IO5A 4YDIL 2O6PA 3MRKB 3RHWK 5A6MA 1VFAB 3A2FA 5DJ2A 5CN1A 2V7HA 5EUOA 1K73W 4XTRC 2W07B 3QUHA 4Z7NB 2BLFA 2MOVA 4Z7AA 4PD4K 3LPGA 5FKAB 1JGUH 1S9XB 3BHBB 5ADOL 3IGAA 5LXGH 4FZEL 5J2TA 4E9YA 5IHHA 5E1AB 4UIMB 1YY9D 4XRCB 2J8UF 3E80A 3LPWA 4JGSA 5CU9A 3MRMA 3UAEA 3IMVA 1GKEA 5J8OA 1BECA 3QRFM 3VFSA 3L5HA 2FR4A 2EIDA 3L5XL 3O3DB 1JNLH 4JREC 2OJ1A 5FDWB 4I1PA 3PWNB 3GRBA 1DSFH 1GHFL 4K8RL 1H3WM 5LP6C 3VW3L 2E5LB 2VAAB 1QNZH 4D3CH 2EEBA 1J95A 2HTKD 4L3EA 5DJ0A 1FLRL 1HL9A 1N6VA 1UZGA 3TYGL 2OR7A 2QADC 3CVBA 3J2PA 3PG2A 4P4KB 3V6ZB 4JI3B 3VB9A 1N0LB 1T22B 3H9ZA 1D5IH 4KMQA 5KVGH 5D72L 4ANKA 4CH3A 5EZYA 1VKXB 4EPSA 3K5SA 3E2EA 1BQHA 4I13B 1MCJA 3ARED 3OB8A 4TSCL 4DV1B 4R7DA 4GUOA 1B6DA 4YR6B 3MRGB 2H3NB 3CH1A 3GJFH 2PCFA 4IK6A 2DDQH 3MRIB 4K8RD 5FOBB 2AKRA 3TF7C 4OFYD 4X9GA 3CU1A 2R29A 2BTQB 4HJSA 4KJPC 3U2JA 4OLVH 1U8QB 5E6ID 2ID5A 4I0XA 2NY7H 4YFLI 1GC1C 4Y9EA 1VQ9V 4U1MB 1EHKB 1NCNA 3CRRA 2QZQA 5BV7C 2YS8A 1N0JA 1TJIH 1BXUA 1WP6A 3EBIA 4I0PC 1WFJA 1ASPA 2EXYD 5IQ9A 2OYPA 1GSMA 2HX7A 4XP6L 3GJFB 3MKGA 2Q7HA 4TQIA 3Q6GH 3QPQD 3GRWL 3TK1A 2QVKA 3CXFA 3IRCA 4JTDB 4FZ8H 1YNLL 2AJXH 4G6AC 1UXWA 4J3OG 4DRXA 2IGTA 4KK8D 5DVMA 3GMQB 3FU9A 3AFLA 1KLFB 1QSEA 3WG7C 3WUWG 2BH0A 2RQEA 4BDVA 4LSVL 2F61A 1NCDL 1U3HA 3UPAA 4O4YH 2OSLB 4QRBA 5T3ZE 4U1GB 5I75B 4KY2A 2NN4A 2A74A 1S3RA 5EPMA 3NJKA 4HKBB 2YPVH 3SSGA 5BCAA 5EZIL 1RK7A 5EWIL 5IMOA 4BFEA 1L9SA 4EKXA 5FYKD 1J05A 1DQKA 3ZYJA 1M56C 4CMMB 4DV3B 4AEHL 4NAJA 3TGXA 2JI2A 2Q6WA 4CJ1A 1WFIA 5CEZD 2VR5A 1KN4L 3D3VA 4NT6A 4RGND 5KSBB 3LN9A 2LO1A 3HEIB 4YFEA 4HCRA 3ZYOA 1AI7A 2F08A 2XN9D 3H4HA 5DVOA 2Y1YA 3CLFH 4GG8B 1TKWA 3M17B 4UTBL 1RZFH 4CBCA 2E4FA 1AP5A 1CGSL 5JQGA 4JM4L 1LWRA 3KPQA 4JLRA 3L5WA 4B3SB 4WUKL 5LAXB 5T1KA 3V4VH 2E3VA 4FNUA 3CMOH 4ZD3H 5JO5B 1VGEH 2CIKB 4JM0A 4OD2B 2ZCHL 4PA4A 5IFJB 4OAWB 3GBEA 3TETA 1MY5A 1ROWA 4NM8H 4NWUL 5GQBA 3V8CA 1KOAA 2YA1A 1QRNB 2EACA 1XIWA 1AOZA 4U1HA 1A1MA 1N36O 5DC4B 2ITCC 2GK0B 4JV5O 2LQRA 1Q8IA 3JWOC 4YJ3A 1Z32X 5I0DA 3ZHUA 2PW2A 2UZIH 2VW6A 4HUWB 5E6IA 1F3JA 2BHUA 4LP4A 5E6SB 3MN8A 4EN2A 4XAKE 4DUZB 2ZSVA 1JX9A 4ZNCD 3VJ6A 5GRVK 4DQOH 5HGHB 5J11B 2HLEB 4DW1A 2RFXB 4WFBV 1AR5A 2VE6B 2O93L 3AM8A 4LLUA 2WXRA 5GZOA 2OYLA 1MG2C 1KGYE 1LJMA 5FUOH 2EVIA 1ZTEA 4WO0A 2O4EA 3DUSA 3VXTA 4NJ9L 4PBVC 2P44B 3HNTH 4ODSH 3TA3D 2CDFB 3VQXA 1AIFA 3DX0A 3PXJA 4M1DH 4U6VH 3QNYA 3SDAA 3T2PA 4D9QE 1U3NA 4IRSC 4RAIA 4ZFOL 1NGZB 2FZ3A 1P4LB 4MHHG 4MAYC 4KK8C 5AVZB 2DQTL 2B16A 1NLBH 4FFYA 5E8DH 1I4FB 3ZE1E 4F5CE 4M29A 3W3BA 4EDWL 5KYXA 1FPTH 3UC2A 2JV6A 3STLB 4WUUA 5I1IL 1AG0A 3P11H 3VFGL 4DGYL 1MCWW 4LIQE 4YDNA 1F1AA 1VZGA 4Q58C 3WTSA 3EH4B 5KVEE 4M8RA 1NAML 3BW9A 5JPNA 2DMKA 5GS0D 4FC3E 3EYFB 1EBAA 2R2BA 4Y7OC 2NY1B 4J39A 4IIQC 3W82A 1WPCA 1G6VK 1L9MA 2QMJA 1ZWIB 2H8PC 3L4WA 3QFDB 3TO2B 3Q7JA 4XCNA 3IJSB 1AANA 5GGSB 4WF7A 4Z76A 2R1YB 1SERA 4X6FA 2W9LA 1CU4L 2X3BA 5ACZA 1QG3A 1NCCH 4Y4HA 3EJTA 4BKLA 1MKFA 5BR8O 3QH3B 2QSQA 4K3DH 4XXDB 3WXVL 5E2TH 1YQVL 3EUDA 1U8LB 4OGYH 4E41D 3WD5H 4BQBA 2CDGB 5E6RB 4DR4B 4YX2L 3V79C 3EYVA 2JEUA 1KKDA 1R5IB 1WS7A 3KPRD 5HVFB 2DF3A 1A7NL 4FNLH 4Z7UA 4RA3A 5E00B 1JSYA 4J9ZB 4HH8A 3MUUA 3DTDA 5MENE 3JVGA 1UM6L 4LEXH 3VFNA 2KLRA 4UIMA 4XRCA 1NA8A 1O7DE 4CW1A 3SR2C 1H2LA 4MXVF 3G6EV 1X9QA 2AW2A 5I0VA 2L7EA 2ZE0A 3U4KA 2OJZH 4LLDB 5D4IA 5T1DL 3UPRA 5GONB 3S34L 4KDWA 3UDWA 2IFGA 1LMIA 3OB0K 2FR4B 1MCOH 1CFQB 3KS0J 1YXBA 3P4MB 2NNCA 5C6WH 1YNKL 5F7YC 5IBTL 1CYGA 4Y5YA 1BMGA 4PJIF 1T1XB 1NTDA 3CHQA 4NWTH 4JI1B 4OZ4B 2WCSA 4UQAA 2XVBA 4ABUA 2C9QA 5DLMH 4ZFFA 3BRCA 3ILEA 3B56A 3A67H 3TJEH 1VMGA 3RUGE 3PHOA 1RK1B 2V9QA 3UXFA 3MSPA 5DMGD 4U49A 1RZ7H 2V7QG 2C9PA 3GHBL 4M1GH 3FHEA 2HP4A 3TEXA 5AW6B 2X2HA 2E27L 1G5AA 1TQBC 2VDRB 1CICB 1QA9B 2E56A 3P0YL 1LEKA 4CILA 3S5LG 4WUUD 3BP5B 4P48A 3S4SA 2FL5A 3CFKA 2PW2B 1B9ZA 1R6VA 3FQWA 1YITV 2EEFA 4KRPD 1VPOH 4UTCA 1WA1X 3NSYA 4ANWA 2FH6A 1U91A 2BVEA 2HVKA 2P45B 3QSKB 4KQ4H 4ECNA 3SZ6A 4GRLB 1GGTA 3ZW3A 1L9RA 1OQXA 1QX1A 4DKEL 5ID1B 3NIFE 2Z8SA 4GLRI 4NT6B 3MLVL 3ARBA 1LNQA 3Q1EA 1PKQA 3CJHA 4K4KA 4A66A 5TE6L 2CBQA 2WC7A 1YDXA 3TPUA 4AEIL 3S3SA 5HHMB 2UXGA 3KPSA 2P24A 1G7IA 1GOGA 1U8JB 3HB3D 3TX4A 1H3UA 1ZLSL 1OSPL 3T0DA 3CCSV 4CJ0A 2W60B 3SD5A 1YDPB 5ADPL 3GSUA 2CDFA 4LVOC 3ZDYF 2CGYA 4I77L 5IJVB 1RUQL 1KMIZ 4PJCB 3P9LB 3REVB 5I17A 3CDGA 4PVMA 2V37A 2CUGA 2KPNA 4HZAA 2ESVD 1VFOA 1AILA 3VFSB 5DR5L 1KPUA 3RGVB 1I9IL 1COBA 4TV9B 4C56E 5F89A 4ZUUA 4Z7VF 3B3IB 2CNZA 1OZUA 4Y5XB 3RNQB 3PNWB 4DV4O 3O45A 2N3JA 4A7SA 3WI9A 5LAPA 1GGIH 4GCZA 3MYJA 4UB0L 1MCBA 3U6XA 4LF6O 2AJZA 1RM1C 1A3QA 5DWPA 5LXTA 3K0YA 1IX9A 2QFPA 1C7TA 4G1MA 2EH7H 3QUML 5LCVH 1NEPA 1MAML 3L3IA 1ACYL 3QUYC 1YNLH 2ZD0A 4V1DE 1MNUH 4RFOL 3K2UL 3LEYL 3NH7H 2VT0A 2XETA 4N5UA 4K9EH 4AG4H 1D5BA 4LLVB 4RDQF 1MJ7L 3OTOB 3HG0A 2R23B 3GMNA 1AG6A 2VABA 3SBWA 2HKHL 1CZ8H 3BUYB 1EWHA 3QEUA 5L9DL 1HI6A 4X6DE 3NFNB 3VXMD 4AVKA 4QXTA 1QVOB 3Q6FB 1YEKL 4YBQD 3LIZA 4JM2C 3ISWA 5EU6D 2L6LA 4U31A 2EUXA 3C08L 4UB8Z 3D09A 4FS0A 2XQBH 3QWNA 3AMKA 2R39A 4WRLA 3IVKB 2VDPB 4RMVA 3Q43A 1OP5K 1BF2A 2DWEC 1BEXA 3NZ8A 4GT0A 5LMNB 3WTUA 4X6DA 3D9AL 1J05B 1TKWB 2ZUVA 3DI2B 1ZSHA 3L3DA 2EO7A 3M17A 4L3EB 5DHVB 1CF8L 5CZKA 3EVKA 5E8NA 4YO0B 3QEGH 4P2AA 5JXEC 2VKXA 4ZMTA 1NEUA 5IHUL 3C12A 4EOWL 2D7TL 4OQ1A 3N2KA 1C12A 5IWAO 3AW5A 3H9SD 3Q2VA 5BR8B 5CA3A 1LR1A 4WV1B 2XIDA 2AMUA 3WS3A 1ETZA 3EOTH 1ZVNA 2PKDA 3VXUE 4IRSA 2GDSA 1W2KT 2AZUA 2OMTB 5IY5B 5L8KB 2GFBB 2PTVA 4JQIA 3LQMA 3PWJA 2WXJA 1I0HA 5C08A 5B5EZ 3EYSL 1HN1A 1PDKA 3WLWC 5GS1B 2FNWA 3QQNA 1J11A 3EJJX 3M1BB 1ZGLB 4JVUA 5FDYA 4XN8A 2QTSA 2EVFA 1KCSL 4RWYH 4TULL 2WLZA 1PLCA 1FHGA 4JO2L 3DX7B 1C5BH 5FCSH 4MJ5B 4PIBA 2Z93A 2UY6A 2WOYA 3DOSB 3Q06A 4CVXB 4PWGA 2CO7B 1IGTB 3KW8A 5KHHA 1L1FA 3UM7A 1CGXA 4OIIL 4DV0B 3ZL4L 4MDJA 3O6FC 3BMVA 5HDBF 2PF6A 3QPKA 3D52A 2H1PL 5EBWC 2EQDA 3X2QC 3NEEA 4K55A 4TQDA 4BHUA 3MLZL 4BFJA 5F1IB 2A4ZA 4I0PB 2EJ7A 2APVA 4FXGA 3GMOB 4JG0H 4L8SA 2EDJA 4X80H 1TTCA 5FK9A 3TOPA 1MF2H 3JV0A 3E1F1 4Q9QH 4LQFL 3VXOB 3SDYL 3K91A 1NS1A 4MMXB 3HRPA 4LAQL 2D03H 2VXVL 4UUJB 3SB3A 1TU2A 4FD0A 4G80B 4W9GC 2WXOA 4P46C 2XTJE 2YEQA 4PREA 3T2LA 2VR7A 1I53A 2BOLA 3ASWA 1N59B 1GZPB 3MJWA 4XPAL 5F3FA 1AYRA 2FEEI 3U0WL 2ZKYA 2WQWA 3CGTA 3EG9B 4MD4B 2QDOA 4ZYKB 2IG2H 1TO4A 4PJEA 5LMNO 2YPLE 2WWMC 1VERA 5F1KC 3WN5A 4JZNB 3D5OF 4DSYA 2TAAA 2VQTA 3E8UH 3V9CA 5KUMA 4NVPA 1PJWA 2C7UB 3BI9X 4XBGA 2SODB 3EBAA 2V5RA 1MCKA 1V3JA 3OJ2C 4JPVH 1NH2D 3E22B 2CKBA 3O65A 2CK2A 3CC4V 2ZR3A 5HHOB 1I8KB 5I0WA 1LE5B 4WU5B 1WB7A 3D85B 4EIUA 2YUVA 1NCTA 3FCTB 4N8UA 1MFDL 2PXYA 2X4QA 4TNVK 3M7FB 3FPXA 1EN5A 4L1HA 2B1HH 4B95C 3CVHH 1WIOA 2CU9A 4I1NB 3JASB 1DO6A 4JO4L 3ICXA 3FFCD 2HT3D 3S5YA 1ET7A 3I5DA 3F05A 1NSNH 4GRWE 3WFVA 3RVTD 4G7YL 4PG2A 3UO8B 3C2SA 4X5PA 5JHMA 3ILQD 3LXUX 2R0WH 3F7VB 4XN7A 2IJIA 2FBJH 5J1AB 1FXVA 1KJVB 4JAVA 1MCSA 5C8YB 1ZTMA 3ZL2A 1VCBC 4YE4H 4DV4B 3SQBB 4X6DB 1YTFD 1Y18B 5JQHC 1W59A 1S7TB 5IE9A 4FXLA 4M8QA 5FYKL 4AM0Q 4M4PA 4A2EA 1JGEA 4JHWL 4FL4B 5EC2A 3US9A 1KB9F 5FFGA 2W0XA 4BQ8A 3D08A 4EI0A 2XZCL 3SKMA 1NCBL 1QSFB 4O2EB 1IKFH 4MMXC 2EDEA 4S0HA 2OPCA 5FGBC 1S78D 1DBMH 4JFTA 5I5RA 3NCEB 2G75B 2WXMA 1JXDA 1DVFB 1HWWA 1ASOA 3EO0A 3PQYD 2R23A 1DVQA 1IGYB 2Y23A 4UI2A 3MRPA 4C58B 5EBLC 4UNVA 3NA9L 1I8LA 3GF8A 1J9RA 1IBGL 3IM1A 3GJFK 4CU6A 3D18B 3ZY7A 3QXAA 3BFOA 5E08H 3ZN0A 3IT8D 4FQCL 1WF5A 2BSSA 3ORJA 3FO1B 3FDWA 1AJ7H 3LDBC 2Z34A 4HWEH 1H2KA 4WK0B 3AQXA 2Y3AA 1S3KH 2ROYA 1TCRB 2XNAB 3IN2A 5FNVB 1OWRM 1ZD6A 3FD9A 2AJVH 3E9TA 5D6CB 5BUAA 1OGTA 1B04A 2CK3G 2NRDA 5EOCJ 3NVQA 3QO0A 5FGCE 3B7RL 4MDIB 5INCA 4LPWA 4U6TA 3QQ4A 1W15A 2D0FA 1LO3L 4M7LL 1P6FA 1UB5B 5D55A 1NFIA 1BZ7A 2LE9A 3C6LD 3DX9A 1F6AB 3CDZB 4ZPTA 3WTWA 4JPVL 5F9JA 1V55B 4TTDC 3W7XA 3TM6A 2BVYA 4GW5B 5AVVB 3SDDD 3JT0A 1S5HC 2VM4A 2R70A 2WXLA 3HI5L 1XBRA 4GEJA 3IMBA 3QJXA 3BKJH 5DGRA 1NIAA 3BOVA 3NRPA 5DEZA 5DMIH 3GSRA 2HAZA 3KWWB 2P7TC 2P26A 1R3IC 3GXTA 3GHEH 2XWJA 2F7OA 3IS0X 2IADB 4H8QA 2V3EA 3RL1A 3F58L 2AZ0A 1WCQA 1SQQH 2WP3O 4O2CB 1RL1A 5I30L 5EEUA 4IRJC 3BWUC 4JO2H 4N2LA 2UZXA 3K2MC 4NRZB 4CKVX 1MWAB 2DQDH 1RSOB 5LMUO 3CDYA 4Z2WA 4NHCL 4HBNA 1NZ6A 3SYAA 1L3NA 5B7EA 2P5EA 3GMLB 3HPLB 3SY0B 4ZMOA 4DUYB 5INDA 2DDQL 5T1MA 5FO9B 4GKSA 3K08A 2WQAA 1IM9D 1OSZA 1RP8A 1NQBA 1B3IA 3ULVE 1QLFB 2UUBO 4RZKA 1FL6B 4OPHA 5JIMA 3P69A 3EDEA 4CKQA 2XQYA 1WYJA 4QT5A 3F6IA 4RUFA 3H54A 2ZUWA 4CMHB 3NJHA 3IN0A 3WL9B 2EILB 4KKBC 2BNQD 2NXYD 3GC3A 3JARA 1OAJA 4MBOA 1XO8A 3MUGA 5EU6B 4UYQA 1QP1A 5CD5C 2WW8A 3AWFA 3B4NA 4K07A 5C2UB 4DW0A 4MNQE 2AV7B 4J3OF 4JPWH 6TAAA 1TENA 4RUEA 4GKKO 1NPUA 4Y19D 1WA8B 3SIKA 4XPGL 3LV3B 4AQ1B 1MUJB 1CICC 4NKOB 4IBYA 3QP3A 5H2FZ 1S76D 1LVEA 2BW5A 2FYYB 5JLZB 4FXTA 4FFBA 2Y7NA 5KS9E 2CDEB 5IG7B 4NO5A 1GTFA 1AHWB 2VXUL 3FT9A 4MW3A 1P7QA 4HJ0C 3CZFA 5IJ0A 3UL4A 2HX8A 2E7BA 4TMPA 4HULB 1M53A 3MJ9H 4I3SL 4WO4D 4MVQA 1JWUA 2E9JA 2X70A 2WYIA 4I9XA 5EO0A 5AQ0A 4TVUA 5EN2A 3IDYB 3RE0A 5IJCC 4E0RB 3WFBL 4P2QD 2XAHA 1AJQA 1G6RB 4LVNB 3Q1SH 1RKRA 2Z0BA 2H2PD 4XPFH 5CR1A 4KNSA 2R0ZL 4Y7MA 4DR3B 4G7VL 3SDDC 5CSBA 5CSZB 4JHBA 1EEZB 4DGVL 5DFTA 2WLLA 4X4KA 3IMWA 4ES8A 1MIEH 4FLZA 5D2LE 1ZE3C 4L87A 4AYDC 4QCIA 4F7CB 5CBEB 3C9NB 4W4OA 5IKCA 5EEZA 4GQPH 4XB3A 1C5CL 3RGVC 4L37B 3AAZB 2LU4A 2VR9A 1VQ4V 4JPRA 3NGBC 4I48A 2OMVB 2LW7A 3B8SA 1BGXL 4Y0GA 2P5ED 3G6JF 4X98A 4JV5B 4B97A 1CO1A 2PLTA 1TXKA 3STLC 4DNLA 4Z7QF 1KELL 3O0LA 1J1OL 2K6ZA 3WJMB 5L88H 5TQ0H 4D8PA 1GYAA 4S11A 2J72A 3G6AB 1FKAO 3WB1A 4N20A 3CFEA 1INEH 2J1WA 4TXVB 4WU7A 4XBEL 3THMH 1UD3A 1CD9B 3PLYA 2NY4B 3Q9PA 3CCHA 4U1NB 2BP8B 1QHOA 4Q52A 5MP6H 4LCUC 1CXLA 1KPRA 4N2IA 5DHXB 5GZNC 1RFDH 4DR1O 3MOQA 4LVEA 5D5MF 3KKYA 3MBXL 3U7AA 1SN2A 5EPMB 3ABLB 3AT0A 1Y74B 4OTXH 2L04A 3QJFB 4I3GA 1SDDA 2X28A 4R8CA 2WK2A 2RACA 2VM3A 4KH2A 1QR1A 4JM2B 2HA1A 4FIPC 3E7JA 3WIFB 3IE9A 3H56A 3GXFA 5K59E 3FULA 4MCYA 4PWEA 3GHPA 5SWZE 4X1YB 5MEPA 3VRJB 2I32A 2W0PA 4HKZA 3QXUA 1MFBH 3ULUC 3GK8H 1ETB1 3QIWB 2P4KA 3CXCU 1RJZB 4B3EA 1A7OH 3IFNH 3GIZH 2CM6A 3HZKB 4M7LH 4J3TA 2V2WA 1EXUB 1NFAA 3DO3A 5CZXC 5DK2A 4GUCA 4GRWH 4WI4A 4XWGL 1GAFH 2BCKB 2OFQA 2PCPA 1CLYH 3QQXA 1OP3H 3AXHA 2AAVA 2QKIA 1SZTA 3QO5A 3E6HA 3VG0H 3FOMB 3I2CL 2J88L 2AJSH 5F3HA 3O9OA 3WEMA 1MCQA 2J57A 2CJTA 4PJ8D 3RVWD 2B0SL 3GWJA 3POCA 3KZ8A 4LF8B 2VO5A 3BAIA 4HPHA 3KPSD 4LCVA 1YIJV 3LRHA 4X2UA 3JCUZ 5IJKC 4Y9GA 4LEXL 5KSAA 5CZVL 4OQTA 4Z95H 3TBSB 1XCQB 4JFDE 5IB3B 3ZCCA 1XSKA 5E99L 3ML8A 3US1A 5KAIZ 1KTKE 4X4XA 4F37K 3NSXA 2V9RA 1LWJA 5H6QA 3MR9B 2NY3D 2ZAIA 1SQPH 1L6PA 4ONGL 3VCLA 1P5UA 1QZ1A 3OMIB 2O5XL 1RUQH 5AEAA 5IJ0B 4JFQB 3FU3A 4AC4A 3BVNA 1P4LA 3Q0HA 4MB3A 4JYYA 3AWEA 5DFVC 2BVQB 4PS4L 4BH7B 2ZXAA 1BZKA 2X89A 3KNBA 4KROB 4NHCH 1Y4MA 4RGNC 1RVFH 2CJUH 2OTWA 3U9PL 3QHFH 1Y67A 1NBYB 1YECL 3DA0A 3CBKB 2B1IA 2BPBA 3S34H 1RZ8A 5JW3H 2R0KL 2P3YA 5MERA 4JJ5A 1ZJBA 5JHDA 5L2KE 1JF6A 5E6IB 5SWSE 3QUZB 4C59B 4UT6H 4AWJC 4MLSA 3X14B 3OG6B 1ETA1 2C3VB 4PI0A 2EEAA 3L1GA 1AO7B 5D1XA 1RSYA 4DRXB 3GIVB 1ZL8B 4U1SA 4XP9H 1DCEA 3IMTA 3B7SA 4HMCA 2O1AA 1NUNB 1YZZA 4KUMA 2L3BA 3VFUB 1AZNA 4N2HA 1A4JB 5F6IC 4YOKA 4L3AA 4QT5B 5F7HA 3QUYB 4Q6IA 5KJ4A 4QYOB 4AE0A 2J20A 1KPVB 2YLKA 4MX7B 2CUMA 2H9GA 2JI1A 5K93A 1ZCRA 1BFOB 3FUJA 4PTUB 3CE2A 5EK0A 4Y2DD 5EU7C 4ALAH 4ELDA 4KK9D 2GTWA 1Y66A 4JI0B 2G2RA 2GBVA 1Y1UA 2AK4A 3NN8A 5D7IF 4E5XG 1QI3A 1IBZA 2X6MA 4NPKA 3BD5A 1RI8A 1E9PA 1CFVL 4PGBA 1IGCH 5FA4A 1M71B 4ADGA 4YQXL 2CH7A 3ZRVA 5JVDB 4U0RC 4TL4A 4ZAKB 3AK3A 3R18A 4I2XB 4FHJA 4KVCL 2DJSA 4N8CH 4MJIE 3ZIMA 3ELQA 3QGVA 1AJPA 5ECGA 3O3AA 4G7VH 3IF1B 3M46A 4I3RH 5E9NA 3T71A 2WZ6A 3T4ZA 2KB1A 1BFTA 5CGYD 4Z5RA 3RPIA 5C08D 2A6IA 1ANUA 4XGZB 1S9WB 5GISL 3MV01 4UV4L 5HBBA 1R6TA 4X7FC 2DJ4A 1QFWL 4N0RA 4JK0D 3VWJD 2F53E 1MAMH 1U96A 4I18C 3ALXA 4RNRB 4LCCC 3DHJA 5CJBA 3UTSD 3BO8A 1C5CH 3OKOA 3ZDWA 1E5CA 3E2HB 3U36A 3SDLA 4ASUG 3O4OB 4WIQA 3G71V 1KZQA 4RIRB 2R7EB 3OMNB 1J5IA 2HWZL 1NGQL 1T2QH 3SJQC 2EXWD 3D39B 4FNQA 3W9DA 4NQVA 2QM4A 4DR3O 1OAXL 1MUJA 4NKOA 3FFCE 4R96B 1TPXC 5D7KD 5HGDB 3NACL 4UDTA 4P3CL 4IBWA 1TITA 2OMVA 2W91A 2A73A 3ARQA 1QMUA 3PAUA 2LU5A 2XBZA 3QAZC 3Q9QA 4WLCA 3CZUB 4PRAA 3TEUA 4HGWB 3EJZD 5C2BH 4M1CC 1MFVA 2ZWYA 1Z2GA 5D7LD 3B2VH 2HFTA 1VESA 3NCYS 2VIRB 5K9OB 1MVFA 3LZOA 2VNCA 3MODH 1KJ2H 4U1IB 3V5HA 1T3FB 3F7PC 3NMEA 3DRQA 5AVUB 3MJ8B 5IMLB 4MQXC 1RIHH 4F57H 3WKYA 2GT9A 3ZEDA 4XVSL 1G6RA 2GTSA 4DPAX 2VZUA 1PEZA 1F90H 3CUPA 1O0VA 4XPTH 4A6YL 3BWAB 1HKFA 1Z7JA 5IHUH 2W65A 4U3XA 3OZLA 1EEZA 4TSAH 5F1NB 2AK4D 2H32B 1FCGA 4UT9A 1J87A 4HETA 2NW2A 3FF8A 3L9EA 5EF2A 4TRPL 4EOWH 4HIIB 4KC3B 4ZSOA 3WFDH 1QYGL 5DRZA 2CQVA 3QG7H 3FQRA 2NYZA 4YSUA 1T1XA 3V0EA 1HL8A 2DQHL 1XR8B 2CXGA 2M6YA 1HINL 4M03A 2AZ2A 3TV3H 4ODUA 1C1EL 2PXYD 1O6TA 2HFGH 1FUNA 1ILSA 2V5YA 2J5WA 1U42A 3E6FB 3S36X 3KPNB 2ADIB 4JY5H 4BIUA 4HHGA 3VGBA 3LEXA 2ADFL 3UGXA 4Z7VA 3UPCA 1TEFA 5LL6Y 2JF1A 2MOQA 3BXNA 3VXUB 5T33L 2HKFL 2GBOA 1KPRB 1SDYA 3RFRA 2AEQL 4YXLH 1FPOA 4P9PA 4M5ZL 4Z7WB 3FOLB 3L7EB 5FECA 2CGOA 4M43L 2GSGA 2HRPL 1WA0X 1YLBB 2CKBH 1QPPA 3WHXB 1SOXA 3PDGA 2P48B 3CDGB 2IANE 4H1LH 2UX6A 2FD6H 1O7VA 2IBGA 4G11A 1BJMA 3C8DA 4O02B 3FO9B 5IESL 4PGBB 4LHJB 3SGJA 4ZO9A 5E8EB 5L7XL