3EHBB

A d-pathway mutation decouples the paracoccus denitrificans cytochrome c oxidase by altering the side chain orientation of a distant, conserved glutamate
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
252
structure length
252
Chain Sequence
QDVLGDLPVIGKPVNGGMNFQPASSPLAHDQQWLDHFVLYIITAVTIFVCLLLLICIVRFNRRANPVPARFTHNTPIEVIWTLVPVLILVAIGAFSLPILFRSQEMPNDPDLVIKAIGHQWYWSYEYPNDGVAFDALMLEKEALADAGYSEDEYLLATDNPVVVPVGKKVLVQVTATDVIHAWTIPAFAVKQDAVPGRIAQLWFSVDQEGVYFGQCSELCGINHAYMPIVVKAVSQEKYEAWLAGAKEEFAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1-beta
publication title A d-pathway mutation decouples the paracoccusdenitrificans cytochrome C oxidase by altering the side-chain orientation of a distant conserved glutamate
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/immune system
total genus 74
structure length 252
sequence length 252
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2008-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ehbB02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ehbB01
1MG3C 5IY5B 4FAAB 4FA7B 4DP2X 2OV0A 1EHKB 1JZGA 1ZIAA 3NP3A 4KO5A 1KCWA 3SBRA 4QKTA 3HEIB 3OMNB 4DP5X 1V54B 1OCOB 3IN2A 3X1FA 3S3CB 2LLNA 2H47C 2IDTA 1GS6X 1A4CA 1A4AA 2BW5A 1M56B 2DYRB 2CCWA 5B7EA 5PAZA 1WA0X 3OD3A 5I28A 1TEGA 3T6ZA 1WA1X 3MBWB 1CYWA 3T71A 4YSPA 2XYBA 2ZXWB 1NPNA 1AG0A 4AZUA 1KDJA 1WS7A 2VM4A 1MZZA 2IH8A 5ANHA 4E9YA 3IBOA 1PLAA 1RZQA 1TEFA 3D12B 2BP0A 4ZK8A 4BWUA 4GYBA 1J9QA 2VMJA 3MX0B 2AZAA 3NYKA 4MFHA 4E9SA 3S8FB 3UABA 3FU8A 2BHFA 1NWPA 2EIKB 1FA4A 2AFNA 4UANA 3RYMA 3HB3B 1X9UA 1A8ZA 3G5WA 5I26A 2HZHA 2XWZA 2VM3A 1AZCA 3AG2B 2JXMA 1J5CA 1AAJA 1PZAA 2YQBA 3AW5A 5AZUA 1OV8A 4YVNA 1JXGA 3AY2A 1ASPA 5F7AA 4E9QA 3NP4A 2UXVA 2IDQA 3EH5B 4YL4A 2DWSA 2WSDA 5I6NA 3H56A 5PCYA 1SF5A 3PCYA 1I53A 2FT6A 2XV0A 4YSAA 1NIDA 3ABMB 3H4HA 3ERXA 3OM3B 3WNJA 4DP9X 2YAMA 2ZONA 4KNTA 3EH4B 3QJVB 3OMIB 4YVUA 4E9TA 3KW7A 3NSFA 1TKWA 1GS7A 2CJ3A 2VW4A 3UAAA 3S3BB 2QDVA 2FQFA 2X87A 5I6PA 2GB2A 1IUZA 1J9SA 1A4BA 2R7EB 1L9SA 3NSYA 4DPAX 4KO6A 2OJ1A 2P80A 4GXFA 2BP8B 3FPYA 5B1AB 4G7QB 4N4YB 1AZBA 4W1TA 3WIAA 1MZYA 2XUWA 1BAWA 3FQYA 3IN0A 3QJRB 5D4HA 5I5JA 4A2EA 1AOZA 1BXVA 1L9RA 3FSWA 1PZCA 4UAHA 1BQRA 3QJSB 3QJTB 4E9RA 1IKOP 2ZOOA 4YSEA 1UATA 1DYZA 8PAZA 3WKPA 4M4RB 3JT2A 2XLLA 3PXLA 2XU9A 1HFUA 1ET7A 4DP8X 1FFTB 2IDFA 1PAZA 2YARA 4F7KA 3FSZA 3CG8A 3N2JA 1OE3A 1GR7A 1J9TA 4HZ1A 1HAUA 2XVBA 2XXGA 4YSOA 2HRGA 4BDVB 2PP9A 2XX0A 3NSDA 5FC9A 1ADWA 3JTBA 1ASQA 2FTAA 4YSRA 1VLXA 4YSUA 1PMYA 1AZUA 1NIFA 1XB3A 2VW6A 1ZDQA 4AKOA 1WAEA 2AZUA 2UXFA 1E5YA 1ZPUA 1SJMA 1YLBB 3U25A 3BVDB 1SFDA 2QDWA 3CDZA 3KW8A 1KYAA 4K9JA 3CZUB 3FU7A 1PY0A 4G72B 3UACA 4KNUA 4DP1X 1SHWA 4TXVB 1PZBA 1SNRA 3NJJA 1JOIA 1NDTA 4G71B 1A3ZA 2VSMB 1FWXA 2AANA 2W8CA 2CUAA 2YXWA 1IBZA 5TK2A 1GW0A 4P5RA 4AKPA 1E30A 1KBWA 1KV7A 2GHZA 1AANA 1WS8A 4BWTA 1N68A 1CURA 2QPEB 3V9EA 2HRHA 3ABKB 2XV3A 3TBBA 2PPAA 5B7FA 2FWLB 2UXGA 2YAPA 2B3IA 1T5KA 4DP7X 2DWTA 3IEAA 2HX7A 4P5SA 3PAUA 2TSAA 5TK4A 4CSPA 1W6WA 1BXUA 3NJMA 5I5MA 3X2QB 2RACA 1OOWA 4L0PB 3QJQB 3PAZA 1ET8A 4DPCX 2YAOA 4YSSA 1DZ0A 3WI9A 1NICA 1NPJA 2GBAA 3FQ1A 1L9QA 1RKRA 2BWDA 2BO0A 1PLCA 2BZ7A 2OCCB 1AR1B 3EH3B 4GP5B 1ASOA 2Y1AA 1JZIA 1WA2X 3SBQA 2GC7C 1NZRA 1J9RA 5B1KA 3NJFA 2YXVA 2A3TA 2YAHA 5B1BB 2GIMA 2UX7A 5I6KA 2YAFA 4DPBX 1SDDB 2FT7A 3CVDA 1ZV2A 2FNWA 2QPDB 4NB7A 1N70A 1V55B 4W9ZA 4A2FA 1ILSA 3GYRA 4KOBA 3T6VA 1URIA 3UADA 2EIJB 2PPDA 1GY2A 5F7BA 1BQKA 2IWEA 9PCYA 1AZNA 4A67A 1SF3A 2PLTA 1V10A 2I7SA 1JXDA 4KOCA 4BWWA 1JERA 1BYPA 4KO7A 3AG3B 1BEXA 3PLYA 5D4JA 1PF3A 1KGYE 2EILB 3NJHA 2HLEB 1BYOA 3GDCA 3ZBMA 5B1JC 1XB6A 4WKXA 3X1BA 4A2DA 3DKHA 2GC4C 1ET5A 2MRYA 4GP4B 1RZPA 4NAJA 6PCYA 1AZRA 1W8EA 2R7EA 5LDUA 1IBYA 1KDIA 1OE2A 1GYCA 3X1EA 1ID2A 2BP8A 3UAEA 1JVOA 1SHXA 4UF7C 3AG1B 2PPFA 3FT0A 4Q89A 3S8GB 4JHVA 2DYSB 1JZJA 4A2HA 1JZFA 3FPXA 4BK5C 3CDZB 4YSQA 1NINA 2B08A 2PP8A 4YSDA 3FYIB 2GI0A 4HAKA 1NTDA 4HCGA 5AKRA 2HX8A 2VSKB 2BW4A 2FQGA 2J5WA 2QT6A 3T6XA 2TSBA 3ABLB 3FSAA 2Q9OA 3WNIA 3TASA 4NERA 4Q8BA 4X4KA 2EINB 2HX9A 4DP4X 3H4FA 3V9CA 1KBVA 1KCBA 2BWIA 2I85A 3T6WA 1ILUA 5I6OA 5B7MA 2CALA 4BDVA 2J56A 1CYXA 2X88A 3ABGA 3FSVA 4AI7A 3S3DB 1M9WA 3TU6A 1M57B 3ASOB 4HHWA 4KNSA 4CSZA 3NT0A 1OCZB 2XXFA 2BP0B 2FQDA 4GY4A 4PCYA 2VN3A 3TA4D 3FU9A 1PNCA 3QQXA 4EF3A 1XMEB 5A7EA 1QLEB 1AACA 2YAQA 2IAAC 2Y69B 3IE9A 5D4IA 3ZX1A 2FJSA 2NRDA 3ZIYA 2IWFA 1L9TA 2J55A 3L45A 4G70B 4HCFA 4E9XA 3CVCA 2UXTA 1OE1A 3AG4B 1JXFA 2ZWNA 3NJLA 3UGEA 2AVFA 3QJUB 1PLBA 1L9OA 1JVLA 1PCSA 2CBPA 3X1NA 1QHQA 1XB8A 1A65A 2PPCA 4E9WA 5E9NA 1GSKA 4GP8B 2P80D 1AS6A 4HCIA 3X1GA 1NIEA 1MDAA 5EHFA 5I5IA 1AIZA 2FQEA 1CC3A 1OCCB 2JKWA 3GXUB 1BQ5A 1W6LA 2HXAA 2H5UA 4F2FA 3NSCA 2DV6A 2J57A 1RCYA 2PCYA 3AZUA 1IC0A 3FQ2A 4HIPA 3OQRA 2Q5BA 1PNDA 2W88A 2GSMB 1GS8A 1CUOA 1OCRB 1MG2C 1SFHA 3SQRA 4HALA 5I6MA 2CAKA 3PPSA 1X9RA 3ZDWA 4E9VA 3NJKA 1AS8A 1J5DA 2IWKA 1SDDA 3DTUB 1EZLA 4F2EA 1OF0A 5B3SB 2PPEA 1AS7A 1B3IA 4PAZA 3QPKA 4A2GA 1BXAA 4WTQA 4JHUA 3BQVA 2YAEA 3TBCA 1JZHA 3C75A 3WKQA 1E65A 1F56A 4M3HA 4ENZA 3OMAB 2MTAA 2XV2A 4YSTA 3NJNA 2PP7A 1AG6A 3NJIA 3EHBB 4G7SB 2WO2B 4QLWA 1HAWA 3FYEB 4A68A 4DP6X 5AFAA 1ZIBA 4G7RB 2UX6A 2H3XC 1JZEA 2WO3B 4YSCA 3NJGA 2IDSA 2IH9A 2JFCA 4A66A 7PCYA 2PCFA 2E86A 5I6LA 3SBPA 1AQ8A 4N8UA 1E5ZA 1QNIA 4BXVA 2FT8A 6PAZA 3T9WA 2BZCA 1R1CA 3DIVA 3FU7B 3PAVA 3FS9A 4AKQA 2EIMB 4RH4A 1NWOA 1TU2A 3CVBA 3ASNB 1GY1A 7PAZA 4HHGA 1NIAA 2XX1A 2YEVB 3WG7B 3N55A 2VW7A 4JKNA 2IDUA 1ETJA 4AX3A 2I7OA 4KO9A 2DY2A 4BXSV 5B1JA 1NIBA 1E67A 1ZDSA 3EF4A 1L9PA 4DP0X 2N0MA
chains in the Genus database with same CATH superfamily
4GXVL 4FA7B 3Q1EA 4QYOA 4WHYG 1P7KB 2OZ4H 3IJYB 3I2CH 4K35A 2EE9A 3ISWA 5T1KA 3WN6A 3VGBA 3QZBA 4R4ND 5HJ3A 3X14B 3HEIB 2OYPA 1X9LA 1VQLV 3LXBA 3EYOB 3KPSD 2JVUA 2NSXA 3AVEA 2YBRB 4XAKE 4U6XB 3RWHA 3VSQA 4IW4C 1T1YB 5LUMA 1MIEH 1TTFA 3PNRB 3OKDB 1Q9OB 1ZHKB 2UVEA 1D2PA 1HQRB 1KXQA 1QWUA 2FEEI 1GN4A 1QHOA 2A4ZA 4AMXA 2J1KA 3MJ9A 3U0TB 2AZ0A 4CDGC 4OTXL 3KGRA 1N32B 4JFZH 5EZLB 5L4JA 5E6IC 1SLVA 5KVEE 3CQFA 2MCPL 1QP1A 2BY2A 1YYML 4TULH 4JNXA 4ZFGL 1U8JB 4HKJB 1KN2H 4NHUB 5KBNC 1NGXB 3NIFF 1C08B 5HGDB 2QSVA 4Y7MA 5E6YA 1DBMH 1UXLA 1TQCC 4KV5F 1B4RA 1KD1W 4U1MB 2YXLA 5TFSH 4KRNA 5T3ZL 2OMWA 4M8VA 1DFXA 3CXHF 3EJYD 1N67A 4OCNC 2VL5A 3D18A 5KS9A 4NC1C 1K5QA 1AC0A 1EJOH 1UFGA 4PJXE 1BGYH 4FNLH 3OGOE 3AG2B 3QEHB 1JWMB 5CA1B 3AW5A 2B4CL 1I8IA 2E74C 1OV8A 3B9KB 3KR3H 3V0HA 5J6HA 1A6ZB 3VWKD 1YJNV 1CGSL 3AT8A 4K23L 4NWTL 4XX1E 1SKVA 1QLEH 2IDQA 4P4KC 1J5HA 3NPZB 4N2BA 3RIFK 2UWEB 4MA7L 4X6DF 1QFWL 2QWNB 5KVFL 4X6CA 4WNJA 1AOHA 5FLVA 1QWHA 2FJHA 4JDTH 2WUBL 4DGYL 3FU6A 1NCHA 5F89A 3UX9B 4ZMVA 1X4TA 3GMLA 4MCYA 3AEIA 3IJ4A 2DM2A 2R1XA 5J1TC 3OMIB 2CK0L 3QIBD 5EIBC 5KYXB 4U1NA 1FL3B 2J88L 1TKWA 1GS7A 2XN1A 3BEVA 5JPNA 3P40A 4G6JH 5GRUL 1HNXB 4KK9C 4EB6B 1P4BH 4GRLA 3ARTA 1TENA 3JWDL 3UPRB 2HFTA 5I1AB 3IJ7A 1R0AH 1ZX3A 3JTTB 2H4EA 4KHPO 1AJ7L 4Y16B 3RL1B 1Q0XL 4A7QA 1A4JA 3L3DB 4LCYA 1Y07A 4GEJA 5JOFA 3PGDB 3WXWH 3PG2A 1M7DA 4N8CH 4CN1A 2OJ1A 4DV4O 2ICWA 3LEVL 4BCYA 4G7QB 1HHKA 1F42A 2GSGA 3E83A 2Z31C 1S46A 4PW4A 3SGEH 4PJFF 3S35X 4O2EB 3PFUA 1JDCA 1AOZA 2NYKA 3ZTNH 4DR7O 3QJTB 5HGHB 1AHMA 3HBQA 4R3SB 3ETEA 1M6OB 5AYTA 5GQBA 2L7QA 1AC6A 4O4JA 2Y3NA 3FT4B 2ERJB 3MRDB 4NQCA 2IDFA 1L9NA 4RMUA 1E7UA 4YMPA 1WISA 5IROC 4LO9A 1E5BA 1DQLH 2F1MA 2K0RA 4CNIB 4F2MA 2ARJQ 2DWDA 1HAUA 2VZSA 2VQFB 3BP5A 2MNWA 4JFEA 3O6MH 5I76B 3OSVA 2HJKB 2P8PB 4NQDB 2XX0A 4GAAA 5DC2A 4X8XA 5E8NA 2JVDA 3T1WA 2DKSA 3CSBA 1MHEB 1X5ZA 3HFMH 1R6KA 2IW5A 2XTJC 3CX5K 1MCFA 3KWVA 4HPOL 4JI7O 4JG1L 1TQBB 2JF1A 3AROA 1EAOA 1ZPUA 2RBLA 4OI8A 1SJMA 1K72A 5JPMB 3EZJB 3HIZA 3VI4B 4L2YA 3FQUA 3N41F 2FWUA 4NBXB 4R26L 4O9HL 2Y0PA 4APQA 2UV3A 2HCZX 4N20A 3UJJH 2DBJA 4F58L 1SNRA 4PJCB 3UIZA 3W56A 4XBMA 3QUKB 2OCHA 1VDGA 1JDDA 4AZ8A 4AXWB 2QM7A 2OIGA 2H8PA 5MHSE 5LGJB 4WK2B 4WFHA 4AKPA 1P9MC 4PN6A 2QPFA 2WZAA 5A9GA 4NTXA 4V1DB 4P3DA 1QFPA 2R29H 2NX5B 3MXWL 1HH6B 3K72B 3DURA 4I0XA 1YC8A 2XXCB 4O2CA 4G27B 1OTSD 1CCZA 3TIEB 3MRBA 3QVNA 3PE9A 1JTTA 2C7FA 3OKLB 3DK2A 5DEZA 1CWVA 5GRVK 4N0YL 4NYLB 4PJEE 2Q0ZX 1LR1A 1MFAL 2R1YB 2PWDA 3ILPB 5KSUB 4PP2B 2M8XA 1WWCA 3RJOA 3NA9H 4KROB 5LBGA 3WD5H 2AW2A 4BSVB 2ED7A 5HSFA 3N85H 4Y19D 3JZYA 2DWEA 1E9QB 2Y7QA 3LS4H 4FI8A 5BRZE 2PY5A 2R2EB 2XG5A 3PAZA 4FERA 4JRYB 4XP5H 5KN5B 3VFRA 4UNTA 3TO2A 1VQ7V 4AGLA 3WXVH 4AYFB 4Y4FB 3F7KA 3VQMA 2NR6C 3T0DA 2X4OB 1RHFA 4FZEH 4DV3B 5L3GA 2BMKA 2CGRH 3FO2B 4JS7A 4LOEA 4X6BA 4ANUA 1JGLH 5AB1A 2O6CA 3BUIA 3ZKMD 4MZRA 3OHMB 1CDYA 3HVDA 4DJMA 5JHLA 1M90W 1SMOA 5IFHH 2B0SH 4JN2A 4U1JB 5GRJH 5JIQA 2DM7A 1ZV2A 4PB0L 3MX0A 2A5UA 2WBKA 4KMTH 1MRDL 2HT3D 1QLNA 3I55V 1ILSA 1WBYB 4NRZA 2H2SC 4ENEC 3QHTC 4YDZA 3KWUA 3BQUC 5FNVA 4J3BA 4XO4A 5CMAB 1IC7L 1FXKC 4AYEC 3SYQA 4XGZA 3BDXA 5IDJA 1ND0B 1OT4A 5J1SC 4KJYB 1U91B 2G9KA 1ID5I 1AXIB 5I1GL 2C1PB 5TQ2L 5DJ2B 5KVEH 1PSKL 3I75B 1WIOA 3Q5OA 1HCYA 4DF9A 4B7KA 1JXDA 3ABUA 2PR4L 5E8PB 2Z7WA 1BYPA 2JCCA 3COOA 1PY9A 1MHHA 5KVDL 2VABA 3L72H 3BPLC 4PA9A 4B3MO 1BEXA 4DFIA 2QMJA 2DYPA 4JKPH 4P05A 3EYQC 3BAIA 4F33A 2NN4A 3EG9A 1KWGA 3V5HA 3E86A 4FQXC 4AY0A 3QISA 3WFBL 4UIMA 3M1BA 4OY9A 3MLVH 4HISA 5L2KD 2MQ0A 3BE1H 3C60C 2CM6A 3FB6A 2Q6WB 3JSNA 2HTLC 3CDGB 1IJNA 3AG1C 3BGFB 3GUFA 4AJ0A 5EA0H 3OAUL 1A25A 1NCCL 3QC5X 5FWRA 2R7EA 3FQTA 4XC3H 1HCFX 3OPZH 2EX3A 5ACMA 4A7TA 3U2JA 4ONGH 4WEBL 3P1VA 3QZOA 3G6DL 5DYOB 1JVOA 2AK1H 1KIUA 1PPIA 3T3PE 2C9AA 1SDAB 3GRBA 4Y2DC 1N5AA 1FFXB 4J3OH 1OAJA 1T21A 2E7LC 5I8CA 2IXQA 2DYSB 3WMSA 4FQCH 2P90A 3L2NA 3HI1A 4GSDH 4YHZH 5GJTH 1EGJH 4JMNA 1YEEH 3FPXA 2DI8A 1WPXA 1OGSA 3WFDH 1LE9A 2Q87A 3IMRA 3WTSA 3HR5A 3PWLA 4X2UA 2QJDA 2CUHA 1M57C 2ZNIA 5DUMH 3ULUF 5F7DB 3QUZD 2CBQA 2OYMA 3RGVB 4Q8BA 4X0KA 3RX7A 4LASH 4JO4H 1KY7A 3IYLW 3MSPA 1O9HA 1YZBA 1TCMA 5FA3A 2OL3H 3DHMA 4MNGB 4B5ZA 1Y1DA 1GZHA 4M6OL 3FMGH 1EAJA 1DN0A 2P49B 2RALA 1TETL 3UPAA 2APXA 3ZHRA 1E9PB 5C0AD 1F45A 4HHWA 4LFAB 4BFEA 5HDRA 1HDJA 2EO7A 4CSZA 2EUZA 5EBLC 1GGIL 4D94A 4FFYL 4GY4A 3JV6B 2P7TA 2G3ZA 2WZ5A 4PCYA 1GTNA 2D0FA 3P4MB 4ZAKD 3LV3A 4G6AC 1G7IB 2YD8A 2Y1VA 5FHBL 4EF3A 1Q82W 1J11A 4PG2A 5H6QA 5HI3D 4JEGB 3AITA 4Z5RA 4OPAA 3VXMA 3WFEL 3PJSB 4XMKH 5EUOF 5C0JB 3SE4C 2UY7B 2YAQA 2IAAC 4KKPA 4UUJA 5L7XL 5H2FZ 5JW4R 3HKBB 2H45A 5KSAC 3WTVA 2Y7LA 3HNVL 3OKEA 4MTXA 3AACA 4G6KH 4NSKB 1TAEA 3Q06A 2NTFA 3X3GL 3MCLL 4O2FA 1SY6L 1LVEA 1OE1A 3G5VA 3N0PB 4QJ5B 1CGUA 4MAZA 4ICWA 1H2GA 2HRLA 4IK6A 1U2HA 4N2MA 1JAEA 1MOFA 3OBAA 4XPGL 1OWRM 5SWZB 5LQBL 2N74A 1RZJH 4Y5VC 2UUAB 2XWDA 3BHPA 2Q7YA 3MAWA 3KPTA 5SWQA 1T7XA 1IGTB 4G6FD 1XILA 4H8WC 4NO3A 1BQUA 1XZ0A 4UTAH 2W9EL 3QI9C 4KK5D 4Y1AE 3KMDA 2WXOA 3KXFE 3SOTA 3G04A 4DKAA 1K92A 2OT5A 4R4FH 5I18L 3HE7A 4IK7A 3CH1B 5CKAA 4JLRB 4CVXB 2J57A 1EK3A 2XRAL 4RETB 3MGTB 2WLLB 4L3EA 5KUKA 1CXEA 2R0WL 5I0DA 2QHRL 4HCRL 4XBGB 5ILTL 3REWA 2EKSB 4XVJL 1XFPA 3MNVB 1OTUD 3O11A 5HHOD 1IBLO 3BEWB 4L4VB 5IBLD 3K2UL 2P8MB 4HJTA 1JGEB 3D0VA 4FYTA 3UZEC 5TDNA 4GKOA 3H9SD 3KNBA 1JUFB 3QQ4A 4XMPH 2XY2A 1AO7A 1XL6A 4KU1A 4DN3H 1UYWH 4DHLA 1BHGA 5GGSA 3L95B 4MX7A 2JB6B 3OWEA 4JZNA 5ICXA 2YMXH 4AJYV 4AQYB 2C9XA 1AZVA 1R75A 3MODH 3RNQA 5C07A 2WTPA 2XICA 5JYLA 3VH8G 1XEDA 5EO1B 2VRQA 4YSTA 4AEIL 1AG6A 4XCYB 1HINL 4LVOB 3OUFA 3RILA 1RH8A 4M8QA 3U9UA 1XR8B 1XREA 2LQRA 2X9ZA 1U42A 3GWOA 1OK0A 4YDKL 5I0WA 1HNGA 4PS3A 4K8XA 3WB0A 1IVSA 4YSCA 1HP8A 1WFTA 2EIMC 3K2KA 3NJGA 3TM6A 4PJ7E 4JAAA 2NW3A 4LU5L 3T8XA 4IRJD 2QQLH 2YFNA 3T2PA 5KA5A 2EDEA 4FXKB 4I1PA 2FB4H 3L5JA 4UCOA 4KAQL 4TV3A 4XOEA 5DK0B 4LF8O 5I6LA 1T7VA 4LKXB 4DK0A 4OLEA 4OLZL 1OWWA 2E9JA 1F6AA 2R23B 3HS0B 4JO3L 3H6AA 4Y8DC 4DEWA 3SDCA 4ES9A 3IRPX 4XP4L 1KUQA 5ITBL 3M17A 4EDWL 4PI2A 4TWKA 2ADQB 1AE6H 1GY1A 1HKFA 4FULA 2F4VB 3B8MA 1QR4A 4CW1B 3LRMA 4HHGA 4IJ3C 4NWUH 4UDUB 4P57B 1UFUA 4FLQA 2YEVB 4KKAC 4JZ2A 4JYBA 4FYSA 2P43B 5IFJA 2IDUA 1IGIH 4LDCA 3UTSB 1FVCB 1UGKA 2OA9A 2XNAB 3A0OA 2B15A 1KSRA 1TCRA 4Q6IC 4I50B 1J0ZA 2YA0A 3NABH 2VQEB 1OEZW 4RGND 1ZLVH 3VH8B 4AH2B 1CFSB 4J2XA 2Q3XA 3MRFB 4ODHH 1XMOO 5DJ8B 1UZ6E 3KYOB 1CR9L 2LW1A 1CT8A 1KT2B 2EDTA 43C9B 3V4UL 4CILA 4R6ZA 1NCWH 3FH5A 3HZVA 4LOUD 2CGNA 4LNUB 3HAEH 4JFFA 5IT9N 4UV7L 5CJQL 1KCSL 2WIIA 3ZKQD 5BUGA 3OHXA 3IN2A 4JPSA 4PJGA 1BS3A 1QSFA 5FDYA 1A02N 3ECQA 3TJPA 2ORBH 1AP6A 2VNCA 4TOYL 1JNJA 3KLDA 1XTMA 3UDWC 3SDAB 3GC3A 3N1QC 3IWVA 3P30A 1CLYL 4FTVA 2VO8A 4PA4A 4PRPA 1IE4A 4TV9B 5D5MF 3MBWB 5TH2B 4O2AB 4H0LC 2JCWA 1PX8A 1TVDA 3A8TA 1K85A 2ZKMX 1D5MB 3AREC 3CZSA 4YDIH 2D7QA 4HEPG 2IH8A 1EAPB 1HR0B 3ISYA 4GSRA 3FD9A 3H1ZA 3IBOA 5CEXB 2BOBC 3BT2L 5ETUA 3D12B 4D9LL 5F7EL 4B3SB 4LARH 3EVKA 2DF3A 1I1AA 1T2JA 3CWGA 5CU9A 4M8RA 3RKDC 4IBSA 2E46A 4WBNA 4UNUA 3AY4C 1BX2A 3QO0A 3BP4B 3O3BB 5DGRA 2X1PA 1GVIA 2GHYA 4OFPA 3MUGB 1A7RL 3NZHL 4ZI7B 1X9UA 2N56A 1E5UI 2E76B 2Y5TA 3KL3A 1AR4A 3H42H 3G5WA 2ESVD 2P24B 4JQXC 3C8HA 4TF4A 2MPAH 2WNWA 5DZAA 3FO9B 1JSYA 2ZKHH 4QUOA 2BNQE 1U8NA 2JTYA 1R5IB 2NLJA 3KLKA 2ZX9A 5GJSH 3QNYB 1U41A 2Z8WC 4NZUH 3BHBA 4ANVA 4R6UA 2HHHB 1Z5LA 4JFXB 1IC1A 3UBXI 3BCFA 3ZYOA 3MRHA 3BYYA 3GBNL 1TYJA 1ZA6B 3GSQA 5D2NA 5E8DL 4YX2H 2KS0A 4HIQA 2DD8L 4OF3A 4PA3A 1MJ7H 4B9KC 5BS0A 3NSFA 5AOKA 5L4MA 5I1IH 5C0BD 2OMYA 4FMKA 5B1AC 5J6SA 5IYZB 3TV3H 4B41A 3LPOA 1MREL 1KKCA 1SOXA 1G6UA 4HWBH 5TF1L 4I9WA 5TD4A 2AXFA 4PRAB 1R3KA 3DETD 4ZFOB 4BFGA 2QQNH 2MCAA 5BW7A 1IQWL 5IGXL 4X89A 4WHDA 2G2RB 1O7DC 1R3IL 4OF0A 4FQ1L 1JGVH 1JWUA 3KPPB 5FW6A 5I6XB 1KIPA 1YY8B 1G1OA 3ZRCC 2B1GA 2WXQA 3DO3A 1SZNA 3WIAA 1K5NB 3QJRB 4U7NA 4JFDB 1BXVA 4UAHA 2JK5A 3PWJB 4PJAB 5F7FA 4LHJB 2GCYA 3Q8BA 4G42B 4M1CC 4Z76A 5DVPA 1WCQA 2VLJE 4H8QA 3P9WB 3BVNB 1IQDA 1MFCL 2VWKA 5DRZB 1F0LA 1H3WM 1FPTL 3DI3B 3HS9A 4PW9A 3F7PC 3FUEA 2FYUH 4NZFA 5EBMA 3V0GA 2X4NA 5IP4A 1FO0L 4A37A 1Q8MA 2FX9H 5E5MA 3RTQA 2B3RA 2QM4A 3IAYA 1M1KW 1VIWA 2H7WA 4PB9L 3W9DA 2FTAA 2KLSA 1VGEL 1E0OB 2XV6B 4KX9A 1SQVH 1EVUA 1FNSH 1PMYA 2JWYA 2PWGA 1AZUA 2Z4QA 3MNZA 5GSVA 4YZWA 1CXKA 2XPGB 4WVRA 3HPLA 4X5XA 4PJBF 2YXFA 4OCMC 4X64O 2Z1PA 3K6SA 3OUSA 3BAJA 4I18C 3DXRB 1VQMV 4P2RE 4O58H 4Y9GA 5FGCE 3RVWC 5IHZA 1CICB 3O41B 5EOCL 4TXVB 3BZEB 1EXUB 2ZP8A 4ATWA 3BH4A 4Z0BL 3TXSA 1VFAA 1YPZE 2CZNA 3ULUL 2R56H 2XN9A 3EO9H 1NL0L 3B8SA 4L5FL 2BNUB 2YMTA 4I0CC 5EN2B 1KV7A 4L1HA 1XF4A 2OMVB 2ZSVB 3ZMUA 1A3RH 3QUHA 5ALCL 4Q9QH 2QKIB 1IAIM 2BIHA 3MLXL 2HRHA 5C92A 4QGPA 4F20A 4TUOA 4JFYB 5BPPA 3TBBA 3P4OA 3RL2B 5KHJA 4IRSB 3DGGA 4Z7UF 4YHKH 5FUZH 3TBSA 3TWYA 2F54B 1IGYA 5KMGB 2X89D 1WA8A 2EH7L 5CD5D 2HEPA 2CLVB 1LEIA 3QDGA 5SV3A 2NY0C 2JJ2G 4FZ0A 1CI5A 4NUJB 5SV4A 1BJMA 3BUDA 3VWJA 4GCZA 1INDL 4CBZA 4D8PA 1GOHA 3QO5A 1W6WA 1YEIH 1GC1H 4EN3B 3M45A 4IKJA 2J4WH 3UZVA 4WI2A 3RP1A 3VVVA 4NUPA 5G4NA 5I5MA 1MRCL 3FB7B 4YY3B 3QJQB 1FLRH 5GS0L 3R4RA 3O9WD 3OT7A 4BFKA 4WWKB 1NICA 4XWOD 1NPJA 4L8SB 5DZJA 2GBAA 3ARFA 1L9QA 1MRFH 4GT7A 3ILDA 2BWDA 4HUUA 4JM4L 4TSCH 3ZYZA 5JZ7D 4WUUD 3GM0A 2EUWA 4G80B 2OCCB 5GGTA 1JZIA 2OMTB 5KBMA 5K9OB 4R7NB 4DKDC 2BJML 2AEWA 3ARRA 5AW5B 2YXVA 3K9SA 3L7FA 4JRXA 5JIMA 2BIOA 5CJOH 4CADB 2BS71 2JEUA 2Y1ZA 4Y4KB 3W2DH 3ZLQC 3ELQA 2AJZA 4GO9A 4YIQB 4RFEB 3P4NB 1W8OA 3RFZC 3CCHB 1L5GB 1NANI 4TM9A 1E6OL 3ARGC 1KP3A 2DQ3A 3QFDA 5HDBB 1DVFA 1IFRA 4S1QL 4YXHH 1LEGB 1I7RA 3JTSB 5HYJE 3P69A 4Q9RH 3CN3A 1TUBA 3FQRA 5AUMA 3SPVB 4GAGL 1G7JB 3QEQE 4PDRA 4Z78A 3OC5A 5KYWA 3UL4A 4OV5B 4U1GB 2HFEB 4AL8C 1KG0B 3N42F 3ZDZE 5CJ8A 5DZNA 5KS9F 3CCRV 1JNLH 4X1KB 4OIAA 2ITCA 2NXZC 2CJSA 2MMXA 4G8FA 3ZIAG 1WHPA 5H37G 3SDYL 5MI0C 3NCXA 4IOFC 3OR7A 4QHPA 1FFPB 1GTFA 2GTAA 2WIMA 4I5BA 4JN1L 5TDPB 3WTTA 2YD5A 3CS5A 1IKNA 5EG6C 4JAUA 2PXYA 4AE0A 3IGKA 4X6CF 3SYAA 4G7VL 2KHAA 3U2IA 3WDJA 1PZ3A 3O6FC 3IFOA 1IMHC 3V6OC 1ET5A 3LKOA 1ZK9A 4PUBH 2VOTA 2DQFA 4LK4A 2JLPA 3P73B 5F0PB 4MMYB 1GGBH 3WFHB 3VO0A 2XJLA 1A6WL 4IIQA 2GBVA 2WWOA 1IBYA 4P9HL 5DSCA 4MNQD 2A83B 4W9GC 4AC2A 4M6MH 1OGTA 1AQKL 4RX4D 5IVXB 4QHKJ 1N7ML 2O61A 4XTRC 1BD2A 3EFFB 4ACPA 1RLBA 3EJJX 3TCTA 1JN6B 2E27H 1SBSH 3WN5A 3FT0A 1RULH 4U3HA 5F1OB 2NCEA 4AUUA 3RY6A 4D9QD 1MVUA 4PGBB 1JZJA 3D3QA 3UT5A 1PQZA 2IU3A 1TJGH 3Q2NA 4WW2A 1DUYA 3N50A 3RN4A 4OBSA 5LNEA 5IBTH 1NC4A 3ALXA 1NOAA 1GGCH 1P4LB 4YDVA 3W39B 3BKYH 2ARHA 4AEHH 2R0ZH 2DMCA 5F9DC 1Q81W 3F05A 3ABKC 1Z3GH 4KHXH 5DS8A 1PDKA 4CKVX 1MIMH 3O45B 1ORQA 5JO5B 3I85A 3I02A 5JHMA 4HZLB 3QDMB 3VYOA 1YZZA 1USQA 3M6DA 1IEBB 3S37L 4K8RH 3LIZH 2EIDA 3ARWA 4L4TD 4QXGH 5EZJA 3ABGA 1IM3A 1QABA 3QJZA 1TTBA 2Q76B 3S88L 3B09A 3SE9L 3D2UD 2Q2EB 3OTOB 4WI0A 5AAWA 1S6NA 4S10A 3L2MA 3QFJB 2PTTA 5JIKA 3H2QA 1U8CB 4HFWB 5DUPH 3QNFA 1HIMH 4XDJA 2CHWA 1UA6L 3VXUD 2YPLD 3H6JA 1RZKC 5LXGL 1F41A 4XMLH 3D52A 4H37A 3HPJA 1C5BL 1E3FA 2D31B 5JNYB 3R0MA 5JIIA 4X4YB 3SO3B 1L7IH 3RUGB 2VYRE 4FQLL 5FPRA 2Y69B 2NY5L 1BZEA 2AABH 5D4IA 5I1KH 4ZFQA 5A2LH 4JE4B 3ML9A 1MAMH 2AERT 2VR8A 4LSTL 1SA0B 3U0ZA 4X7CC 4RFOH 2Y25A 3K6DA 3D5OF 5JPNC 4JI8O 2AXGA 3BD5A 1TJIL 3KPSB 4V33A 4OZIA 2NY3B 3NCJL 4GX2A 3KPRA 5JIPA 2EJ7A 1OB1B 2FO1A 5CHNA 2FDBP 4HF5L 1N59B 4GUQA 1E9OA 2VLRE 3JV5A 4X0NA 4ZO7A 2IPKA 3P0GB 1SPDA 2Z91B 4W9JC 3SKOB 2Q7GA 4GLRI 1TSHA 1AS6A 3DVGB 3TBVB 7FABH 4UT6L 2BCKA 5CA0A 4ODXA 2ZG1A 3EXAA 5I5IA 5C9JB 4MJID 2Q7AA 1BVZA 3NEEA 1BW8A 5HHQB 4F2FA 2FJGA 2DV6A 4HIPA 3QQ3B 1MOEA 2CGZA 4MD0A 4UBDD 3IDMB 2G60L 2Y0IA 4JQIH 3H1KH 1FNLA 4LIQL 2YUZA 2CXGA 2I60L 1YC7A 2F23A 2K6WA 4PJ6A 4ONHB 2CKNA 4XPBL 1HQ4A 1NBZA 3ZQWA 1T2QH 1T0PB 2NXYC 1FHGA 2CTRA 3DTUB 2DWDC 5HDOA 4F2EA 4QRPA 5CLZA 3NIGF 4M5TA 4ZT1A 3AB0B 3QQDB 3LSSA 1FH2A 4XE0A 2XZAL 3UEQA 1ZAUA 1D2DA 1HT6A 1TDQA 4W9EC 1M2VB 4X9BA 4D8OA 4DVRH 2UUDH 4GUCA 2D2CC 3VFTB 4DOHB 1I3UA 3VFMB 2XKNB 3C08H 3M88A 4LSPH 2YEQA 1IAIL 3O0RL 2MTAA 4BIZA 2C4FU 3RDTB 3L9DA 5ITZB 1MJJA 1RV6X 2WKGA 4YO0B 5LGUA 1M1XB 2IM9A 1XTLA 3O2DA 4MHHG 2R69H 4NZJA 4FLYA 4RGMC 3OVUB 3QIBB 3HBZA 2GK0A 4CS3A 3F65A 4D9RE 4HW6A 3VRJB 5A6IA 3B5HA 4AV0A 4APQC 5KZCB 1KACB 4XWGL 1UJ3C 4QPEA 1TFHA 4YGAB 4GAFB 4K94C 2H8PC 4GXUM 2X5PA 4HMCA 1WT5A 2CH7A 1OPGL 4Z0XB 3CXDH 3QDHA 1IGMH 1HWHB 5D1XA 3CHXA 5I5RA 1MJ8L 3DUUA 5EC1B 1S9VB 3E89A 3I50H 1ZLDA 2BZCA 4J1UA 1R1CA 1ZHLA 2ICEB 1KTCA 3FCSB 3CVBA 5AOIA 3VXPB 5C0RL 5EEZA 4MS6A 3CE2A 5IT2L 4LQ1A 3Q3GB 4UU9A 4DV2B 4M5YH 4AVIA 1C9SA 4X4ZA 2VWEE 1YEGL 2WQUA 3KM2A 2J8UB 5D7LA 4AX3A 3I6KA 1ZJBA 5IJ9A 1CGWA 4LBEB 5DEFB 1FNHA 2FEDD 4N90D 4PCKA 1QTSA 4OJEH 1NIBA 1WAAA 1ZDSA 3QJHB 4HFUL 1L9PA 2DWEC 2CRYA 2VE6B 4IL6Z 2MIZA 4TNVF 1YJDC 2D3NA 2CQVA 3BKJL 3ML8A 4FFWC 3I56V 4B9CA 4GMTH 4M4PA 2AK4A 2P4KA 3IMVA 3NP3A 5A1AA 1CK0L 2XTJE 4R96A 3TL5A 3BMVA 3BKMH 4IIJA 1CDUA 1RM1B 1E27A 1WD9A 4JASA 2QDOA 1EEZB 1QMUA 1E1QG 1RUKL 4ILDA 4KJQD 4N24A 4P46D 5K5YA 5C0NC 2JTDA 5LMUO 1S5IH 4LDEB 4QO1B 2DBLH 5E56A 1X5KA 2G30A 4PDVA 3JWNG 4MVMA 4IOSD 3T2NH 4QHLA 5LWYH 4LLAA 5GW7A 3T6ZA 3HKDB 4FCAA 4H33A 2LFEA 3HZMB 1EXHA 1HTYA 4ZHQB 1PG7W 2VM4A 5C70A 2QVTA 1FL6B 3LKQB 3IFLL 4ZUWB 5HTSA 1RZ7H 2Y6TE 5A2JH 1G84A 5IB4A 1YNTF 3GF8A 4JCMA 5CEYB 2MQCA 3RYHB 2XWBB 3GO1H 4ZTOL 4YHYC 2PNDA 3FKUS 2ATKA 1ADQH 5E6RB 5I8EB 4XBEH 5IVNA 4ZD3H 4CJ1A 4FM2A 1IM9D 5LDSA 3TYFB 3CGTA 1HYSD 1KIRB 1PIGA 3FL7A 1MH5A 4H8HA 3FOLB 4FQQB 5E1GA 5D1ZD 3M99B 4NPJA 4OLXH 4KDTA 4HWEH 2OS7A 3QDJA 5TQ0H 3WV0A 5GONA 2XWRA 1NEUA 5I75B 1NFDE 4RMTA 1XCQA 2E5LB 2JXMA 4ZSOE 2YQBA 4LXFA 3DX8A 4ZS6C 2AQQA 5HDWA 4NB5A 1JXGA 1YEKL 1Z9SB 3I9IA 3RBZA 3FB6C 5F7AA 3V52L 4B9JA 3OX8A 4Y19B 2H94A 3TBYB 5C0GA 1B88A 3TEYA 2KQNA 2WMPB 4XCCL 3VMOA 4GG8A 1VGKA 5J13C 1M7XA 5FX3A 4LHQB 3TBWB 5E4IA 5IEHA 3US9A 5IK3B 5HFMA 2YXMA 4NNYB 2Z65C 4HLZH 3ZDYE 1KC5H 2VW4A 2BS8A 3CJJA 3UAAA 2VXVH 3L71H 1RK0B 4Q9BA 2EDOA 3OTFA 1A4BA 4UVCA 1PG7L 4YGVA 5EORL 1BFOB 1MQ8A 3T77B 1AILA 5B4MD 3DA0A 3VXOB 1G6RB 3FCTA 3LS5H 1JE6A 2JGUA 1IC5H 2DWYA 3V5KB 2F8IA 4KK8D 1QG3A 3CK0L 1RUML 2HVJA 2XVKA 4NEHB 2YQ2A 3D36A 3LNNA 2B4CC 3LN5A 4C4BA 2VMCA 2YD4A 1ONQA 1S4IA 3MV7D 4YHOH 4MT8A 1MSDA 2KLRA 2Z64C 2VQ1B 3GJFA 3EBAA 2Q10A 3SBWA 1B4TA 4FG2A 1G9ML 3DRTB 1GZHC 3W7WA 3STLA 2H41A 3JT2A 4URTB 3V4PH 4JPVH 2ZXCA 3N44F 2CHDA 4BSWB 3UJIH 2BERA 5LGTA 1GMEA 1YCSA 2BNRD 1RFYA 4QY8B 5ID1A 2J6EL 1GR7A 1HXYA 3OZLA 4ZO8A 1J9TA 4KKBC 4JANB 4QGYA 2VO5A 3JWDC 2GKIA 4KY1L 4CVUA 5MEPB 2OZNA 2QTVA 5FO7A 4XNQB 5L2KB 5EPMB 2OMNA 3T4AA 1AD0A 3FQWB 3L2LA 4PG2C 3LKSA 3D85A 1ADWA 5I82A 4YSRA 3QUYA 5C08D 1QNMA 1Z9OA 4B27A 35C8L 4BZ1L 2OW7A 4UUJC 3FOMB 1T6VN 4Q56A 1ZDQA 2NY1D 2UXFA 1N0JA 3WJMB 1R3JC 2AXTZ 5FYKL 3WIHH 3ZL4L 2FUTA 5BQ7B 5JHAA 3F00A 4XNMB 3CZUB 4DEPC 3IFXA 5CCKH 3A6CL 4DUYO 3OJ2C 3MCKB 2LU5A 1FJ1A 1WCBA 2DWXA 3GQFA 3DGCR 4LLUB 5F3BA 1S3RA 1K34A 1P84J 4OQTL 3PYCA 3SGIA 1KBBA 4M9PA 5F3FA 2R4SL 2ZG3A 2IF7A 4ADIA 1QEWA 2FSEA 4P5RA 3F04A 4DR6O 4Z7WA 3TIDA 2CTQA 2ZPKH 3DXAD 1AANA 4ALAH 3SJQC 1R3LB 4QRQA 1PZ2A 3G5ZA 3VMNA 3A0BZ 2ADFL 3U1PA 4YPGA 5C2BH 3MLRH 3S34H 1NKDA 2PI4A 4LF5B 3QUZB 4BUGA 4Z7QF 2EIKC 3RWCB 1FFNA 2UXXA 1H6FA 2CCLA 3FRUA 2MQ3A 5K93A 2OMXA 1KENL 3W0WD 1AR1D 1XH3B 5SWSD 1E4XH 1GAFL 4O2BB 4PY8J 3ZMZA 4UM8B 3GK8H 5C0AB 2IJ0C 5B1OA 4QKXB 1OM3L 1SEBA 3WI9A 4KI5C 4HS3A 1J8HE 2CD0A 5EYPA 3EGDB 5A2IH 3G3LA 4FVMA 2JH2A 4Z7VF 1NANH 2KT6A 4LVEA 3D69B 4TPRL 4YEFA 1DL7L 1PLCA 1LO3H 2VDQB 5IHBA 2YJQA 2Y1AA 1U8MB 4LEXH 4PJGF 2MH4A 4RSVA 1F4AA 1VPOH 4J6IA 4U3SB 5DS2A 3RPIA 3APOA 1G87A 4H2AA 1XDTT 4HIIA 4O5LL 5E9DE 1EQWA 3GLEA 2HUEA 4PWKA 3DGEA 3ULAB 3UAJA 2WLZA 3MD0A 2ZCHH 5DZ9A 2JGDA 1JPFA 2PW1B 1Q9WA 1JD9A 2BPBA 2R72A 3RLSA 2IH1A 3INOA 5KWYC 3L3OB 5ACZA 4KOBA 1CLZL 3FFCA 3VD1A 1H3TA 3MNWA 4RIRB 3SDDA 5J8OA 3T1YB 1SJEB 4IGBA 4OX9O 4G43B 1JWSA 1AJPA 1U3YA 3CHRA 1KEML 3IKCB 4ZOEA 5H35A 1L9MA 3HKCA 3GSNH 3TA3B 3VRIA 2WHVA 3TH4T 2OMBA 2R27A 5LXTB 1SF3A 3NMEA 4G9FD 2DKUA 4YXLH 2HPTA 4AGMA 4D0CA 4AGPA 1KY6A 2MOGA 1ITCA 5E6ZA 4FNRA 1V10A 5C6TH 3VXNB 3SDCC 2ZIDA 3OR6A 1NVPD 4YFLI 5LBQA 4TUKL 4PA6A 1Q38A 4X1IB 1WTGT 4ORGA 1CU4H 1CG9B 1MCDA 2DTMH 2QADC 2VMFA 4KO7A 5FYLL 2EO9A 3CB2A 1VIBA 2ZXBA 4EI5D 3GSWA 1L1FA 5D4JA 4G7YL 2C34A 3RHWF 4JM2A 3P0YH 3S36L 5IVZB 2ED9A 3MMEB 2Q68A 4CH4A 1U3HD 2P5WE 4J6RL 3R8QA 2ZOLA 2OL3B 2ZWLT 5HHOB 1OHZA 3K8MA 5JH7A 5ALBL 2PETA 4V11A 1KXVA 4K7PX 2V2XB 1L7TL 1R17A 2LAGB 4UT7L 3H9SB 2F08A 3TFKC 4B9IA 3G08A 5CA3A 3MV9A 1FDLH 4QYAA 4LCCA 1MWOA 3ZDXF 2ZINA 3NFPB 3TNNB 4WFED 4M43L 4EFEA 3OHXC 3UTQA 5J0BA 3ZE1E 5DD5H 1RZFH 2NUTB 4I55B 3ZKND 1GZQB 1MCPH 3Q9QA 2GW5A 2P28B 3KCPA 3L3GA 5D72H 2NYZA 2XHNA 5FLUA 2ZSWA 3RB7A 5DQ9A 4OLUH 2NY4C 3FYIB 3RVVD 3EJTA 5AKRA 3TONA 4ZX3A 3U4BH 4JHBA 2VSKB 4HU8A 2FIKB 4BZ2A 2ZIMA 1Q90D 2QT6A 4OJFH 4TL4A 1BGXH 5DJ6B 5D9SB 4L05A 1IFHH 4X4KA 1P7BA 5DI8B 4DZ8A 3A2FA 3B7SA 4J9ZB 1I1AC 2A6DA 2I85A 3SJBC 1V7NH 3TZVA 4M29A 1XMQO 1A1NA 2WXNA 1A6UL 3KLAA 4AQ1B 2DQMA 4I48B 1M9WA 3I9AA 5GRYA 4F57L 3SDXE 3ARPA 3QP3A 5JXAH 1ZA3B 2IAND 1XX9C 2BM3A 3TO4D 3HLKA 4I89A 5C71A 2QQKL 2LABA 3T0XA 1JV5B 2DJSA 1RURH 1UB6A 3LQZB 4PH8A 4YBLC 3BH8A 3GHEH 3HRZB 2EXYC 2W9LA 2NLJC 1H0DA 3FU9A 4R7VA 2XQYG 3OXRA 32C2B 4M3KB 4C57C 1XMEB 3S8WA 1I8LA 3VMPA 2VITB 5KG9A 1XF5A 1XXDC 3G5YB 2ATPB 5JCOA 1HL5A 1KJ2A 2Y7OA 2WVTA 4Y2NA 4H1LB 4EEEA 2AEPL 2GPZA 4RDBA 3FO0H 1RERA 1VF5C 1K73W 2IWFA 4GLRH 5EU6A 1JZ8A 1SOKA 5HXMA 5D7JB 3L1GA 3QXVA 3JD0A 2CKBL 2D3JA 5FWQA 4MXVF 4JUTA 3NJLA 1Y0LA 3RVUC 1AXSB 4IU2B 3QRGL 1ZEAL 2DI9A 1GKEA 2LU4A 5ISZB 4XDLA 1OSPH 4L1SA 1TZHB 2CJUL 5CS7A 3QUXD 1SUJA 4ELMA 4M7JH 3V7AE 5A2FA 1R3KC 5KANI 4GP8B 3S9DB 3LY6A 5BW7C 3EJPA 2J6EA 3HG5A 1CFVL 4JI0B 2P80D 2OW6A 1TTAA 1RJLA 4U1IA 5F3HA 2CR6A 2OULB 3C9NB 4J11A 5D7KD 5E1AB 5HI5D 3VI4F 4AIOA 3WNNA 3GXUB 2DIAA 4Y2LA 3EJZC 2WSPA 3PL6A 4R8WH 1PFCA 3HAEG 1NGWA 5AVXB 4ODSL 2JK5C 5HYFA 3AWEA 3GMRB 1TQVA 3IT8D 4MDRA 1F00I 2DN9A 2YPKA 3HUJB 2YUAA 3HMWH 3MLSL 4N1CA 1U33A 2UXNA 1RIUH 1DLHB 4L3CA 1SN0A 3TOPA 4EIUA 3L48A 5DD6A 3ZJZA 1X7QB 2FD6L 3QG6A 4HX1B 2QPUA 5GPRA 2ESVB 4OLVH 3JD4A 2XZQL 4EIBA 1VF7A 5EBMC 1FZKB 2R1WB 3NBNA 2H3NB 3NAAH 5GISL 2VRZA 3V0IA 4XB7A 1YNKL 3RTQC 5IMLB 4LMQE 4UTBL 5LBVA 2F53E 3U9PL 2CO2A 5CN2A 4DVBB 4OAWA 3FAVB 1RIVH 1RIHH 5MEND 1X6NA 2VDOB 4ENZA 5G5DB 12E8H 4HDIB 3AG7A 1I9RH 4LF9O 4PJIE 4U6TA 3WSQH 3FN3A 5DURD 4JX0A 4MBRA 1RZIB 3MDSA 3HTLX 5C0BB 5D1QA 1YMHB 4N25A 3UTZB 3K71A 3BAKA 3X11B 4M62L 2E9IA 3MCYA 3CVHB 4XP9H 3EBIA 3HAEB 1P5VB 4QHNA 2AV1B 2E86A 3BDBA 3W11D 5LG6A 4NUMA 2GBOA 3SBPA 3V4VL 2BSBA 1WEJH 2I9TB 3BWAB 6PAZA 4P9PA 2WLIA 1RI8A 3KBEA 3UPCA 3Q48A 3T3PB 3VDBA 1ZTEA 1H2SB 3S35L 3T1HB 1E5AA 2VC2L 5EO9B 5TF0A 3VXSA 1JI1A 1H8EG 4RH4A 5HHMB 1AGBB 3CSYB 5DTFA 4CMHB 1RMFL 1NC2D 3L7EB 3BUYA 1ZSPA 5DHDA 2B9ZA 4DZBA 1IGFL 2GEQA 2HLDG 4XPFH 5F2FA 2CO3A 4TT3G 2YPVL 4WEMB 5K59E 2G9HB 4GQZA 3OB8A 2EH8L 2P45B 4JO8A 5FFGA 4P2OB 1KB5B 3HN8A 3OAWA 2XC8A 4I85A 2NDFA 1GN2A 2A9ML 2VN5A 3KPLB 4XN5A 3HG1A 5EOCJ 2YEZB 4I2XE 3QXDA 4M7LL 1LILA 1MG3C 2Z0AA 3QO1B 3EFOA 3OV6A 1GPOH 4HJ1A 5JW4N 4FJ6A 3ARFC 4TL5A 3JZ7A 3W82A 4KO5A 2WXPA 4PD4F 4LB8A 4KJWC 4DGVL 1NCBL 4RGNE 5E5RB 4MTFA 3WFCH 1WC7B 4MJ5A 5D7IB 1Q94A 5FOJA 4HKZA 3ETBF 4WW2F 3RG1C 4KDWA 4JYCA 4JO1L 5E4AA 1QSED 4NP9A 2DH2A 1MI5A 4NIYE 4UVBA 1PFOA 1A4CA 5C6WH 4IHOA 5B7EA 3TVMD 2D7TH 1FE8L 2ZYSA 2ZUVA 3JATA 3CFEA 5BZWA 2AQNA 3JV4A 3MLZL 5EU5B 4DUVA 1I3RB 3FHEA 4HGMA 5AD0B 1JZ7A 4X99B 4YSPA 1DVFC 1JXJA 4IMLA 4P2QA 4OCRL 2Q69A 4KRPD 4PPTA 4W9HC 5CKGA 4GW4A 2ENSA 3T4YB 1A4KB 1AGEA 1UT1A 4EJ1C 3S5YA 4BWUA 1D6EA 3U36B 3JAMN 2AZAA 3LYRA 1BM3L 1UWXK 3UAFA 1KBGH 4U1HB 2KB1A 5CN1A 1DQQB 4PDLA 3D30A 1MJUL 1P6FA 3QR0A 5IWAB 4XRCA 5FECA 1V3JA 2KL6A 5FV1L 4JHZA 5JOEA 2Z3YA 1IKNC 5E2WH 5FM5M 3ULUD 5DK2B 4FABH 2PXYC 4NPYB 3KXFB 2W80C 4XVSL 1P7QB 4GBXD 5F7LB 2UXVA 2A9AA 4GG6E 1NAKH 3CRMA 3SJVA 3DX6A 3O9WB 4YSAA 1YMME 1IAMA 2DPKA 3A3YB 3Q6GL 4DUXA 1P4IH 4IIQC 3WL9B 5B8CA 3LDEA 3QJVB 4WUUB 3F2LA 5CD3B 4OZIF 1QQDA 3LH2L 5DFTA 1C16A 2MTPA 1J5EB 2VDLL 4BR6A 1EO7A 3O6KL 1JF5A 3MRCB 2Q8AH 4LH7A 1S5HA 4ZPVB 5TE4L 2QDVA 4FG0A 3T0ED 3WN5C 1X6LA 3G6JE 2OBGA 4LLWB 3RY6C 4F8PA 1K97A 1K7DA 5BV7C 3SZKC 2Y07L 4DQOH 1MABG 1E4KA 1KBPA 2AI0L 1A2YB 2X4UA 3GBML 4KO6A 4JTAB 3HOGA 1PKQA 2K6YA 1D5NA 5INCB 1T0OA 3GB7C 4NI3A 3FPYA 4QHKI 1FNGA 1T4WA 2AGJL 2P5EB 2V5TA 2VXSL 1DVZA 3LVTA 3QGVA 3QS2A 4LOVA 1ORQC 4OD3H 1BAWA 5D4HA 2UY6A 4PRHE 1V7MH 4L87A 3FSWA 3EYFA 5DEDA 1JA8A 3MFFA 3QJSB 2ZUTA 4ACTA 2GTWA 4FFBB 4QTFA 1UD6A 4M4RB 2XLLA 1HNWB 3G4SV 2L0DA 4HUWA 4YXKL 3DYPA 1XGUB 3TJEH 2BVTA 4G2AA 4RCAA 3UO1H 3PDOB 4X4XB 1S9XB 3CFBB 5E1HB 2K9PA 2HP8A 5FDWA 3DARA 5FCSH 2A6KB 4FEIA 3WO4C 5JVDA 5EC2C 2EZ0D 2DIEA 1Y1UA 5JXEA 1NGZA 1T22B 4XHJD 1NR7A 1QR1B 2DIJA 3HNSH 3CHSA 1CPYA 3NQIA 5K9JL 2A74C 4DR3B 3I3DA 1HILA 3QZWA 3JTBA 4Z23A 3VXQB 5BO1L 4YPJA 1L6ZA 2JLLA 2IPUK 3L4YA 4ONFH 1JYXA 3KM1A 4OI7A 4MNQB 4P9MH 3L16A 2E0PA 3WKNA 1YXBA 3PWNB 5C8JA 1H15A 5DMKB 1QBZA 4LHUA 2CM5A 2BSRB 2X2JA 1MPAL 1LP9B 3PGFH 1FWXA 2FEJA 1G7MB 1D5IL 3DHJA 3QEUA 1CLVA 2NY7H 4NQQA 2V5SA 1UXSA 2X4RA 4F9LA 1WS8A 4HAGA 4R90H 4XX5A 1CP9A 3SOBH 3RZCD 1CURA 3L5HA 4BQ6A 1QRNA 4KVNH 1R9FA 2VXUL 3CC1A 4MAYD 1FYTD 3FRPG 1U58A 1YAZA 2PPAA 2A9NH 3H9ZA 5IEKA 3O3DB 2JQAA 3EADA 3Q8CA 1NKRA 4GKJB 4MCZA 1Z5HA 4NP4L 3D51A 3K57A 2DEYX 1FL5B 1H3GA 1HDMA 3GMQA 4J3VA 5M95B 4L4TB 2IG2H 2PO6D 1T4KA 4NKIL 1WFJA 3X3FH 1XCTA 2CCVA 3WUWA 1CZ8H 4HBNA 5ANMA 1ECYA 4J80A 3MJ8A 1F1DA 3GRGA 1JV2B 2B1HH 1QFWI 5L3CA 3BDYL 4FLWA 3VBBA 6CGTA 5LGHH 1F4YH 2A2QT 2MOQA 2DQHL 3VXUB 1CQYA 5MEQA 2N04A 3UZQA 4L9LA 1JFFB 1J9RA 1LGVA 3I3EA 2VS0A 1P84K 2OYQA 3L5IA 3WY4A 4YJ2B 3DSFH 5TE6L 3VFWB 2YAFA 1YJ9V 3HJ0A 3H0TA 2BNQB 3RVZA 1OSEA 5E0QA 3VXRD 3FB5A 1A9VA 2FNWA 2OX5A 3B34A 2YIHA 1JHKH 2YQ3A 3AXHA 4R4BA 4A2FA 4AW7A 3VFOB 3RJQB 4B9YA 1JVKA 5IF0A 1IU1A 5L4IA 2PPDA 4JCWA 4YZFF 3FRPB 2YPVA 4HWZB 2BSCA 4Z3IA 4D7PA 1QVGU 3BO8B 3MJ7B 4IDLA 4WI7A 1DQML 1WT5C 3DJRA 3STZA 4UMGA 4NDMA 5GS0C 5D1XC 1YQ2A 5HD8D 3KPQA 4CA4A 1XGRB 1U8PB 4ZODA 3G6AB 3NFNA 1ZLZA 3WB1A 1DVUA 2APVA 3F7VA 2JJWA 3H01A 3FB8C 4DRXA 3F5TA 1JTOA 2ZX6A 3IMTA 1G5GA 3BZ5A 3Q2VA 5T1LD 4C8XA 3DOHA 4FLOA 1NBVL 3CPLA 3DVNA 3PLYA 5DJZB 1ZT7A 3R1GL 3B8NA 4NQCE 3GRWH 3VFGH 4Z6AT 2JQMA 4N28A 4HHAA 4RMWA 1I4FB 4ODBD 4OFYD 5IZ7A 2HLEB 4LSUL 2XG4B 1AHWB 3IDNA 4W9CC 2UXDB 3X12B 3SQBB 3G67A 3Q4HB 4RAUB 4N2KA 4P99A 3MRIA 4WKXA 5EIIG 4A2DA 5KX5A 4JFEE 4LLVB 1QLRA 4JFQB 4G8GB 4WI4A 2JB5H 4M7KH 1C1EH 5LYJA 1KWKA 3MLYL 4NRXA 1GN6A 1W0VB 3BZ4B 1LTXA 5K39A 1CFTB 3TJHD 5CZXC 1EGJA 4PJDE 1M7UA 3V6FA 4YWGH 4HPYL 2PGGA 4OJCA 1ID2A 5LBSH 3BEHA 4C58B 2ZDIA 3FTSA 3LIUA 3MKGA 1YG9A 4K71C 3SJAC 1ZCRA 5GSRA 2WXJA 5B22A 1OP4A 2BOLA 1NLDL 1PGRB 1L0YA 4PI0A 4RQQB 3ECBA 4HS8L 1O7SA 3L73H 4UCVA 4N87A 3OF6A 4QOKB 1G7PB 1JRHL 1HSAB 4XT1C 2ZE8A 2WGNB 1DBAL 1KLGB 3FONB 4FYRA 1T5WA 4QLRA 1ZSDA 5DZLA 3ARZA 4AJWA 4PHZA 1KYOK 2VLLA 1QZ1A 2FQGA 4HQQH 4WFHE 3RX9A 1GKOA 1NLBL 3SD2A 4NBYB 3T2OA 4NQXB 5K69A 5L0QC 3CJHB 5CBHA 4YBQD 5I73B 5IQ7H 2UUBO 4G83A 2E3VA 3RIAK 3RZWA 3H4FA 4AL8H 4I7ZB 2WXFA 3HNTL 3VJ6A 4JBSA 1T89A 2ATKC 4MXWL 5E6SB 5EMYA 5CEZD 1URLA 5EIIB 3N9GL 4OKVB 5HHNB 1BQLL 2FGWL 2IQ9L 4XMTA 4DV0B 3RAJH 4QRRA 4WSKA 4RVBA 4KDTC 3VFNA 4BINA 4HGWB 3A22A 3P11H 1NFIB 5BZXA 4XCNB 5AYUL 4UFZA 3B1TA 4S1DC 3LEYH 5F9WC 2ZNJA 4AQEA 3AG4C 2Y6SD 4ZOLB 1N0XH 2EZOA 3KYKL 1NFKA 3F5WA 2A9BA 1IV8A 4K3EL 1LUWA 3NIGE 2G0KA 4U6XA 1AI7A 5CU5A 3PF2A 5A3ID 2VB5A 1LMIA 2YPLE 4HCFA 4BFRA 4NOFA 3GSUB 1ZHKA 1G7LA 1DSFL 2GDSA 2YKKA 1HQRA 1VCAA 2DL2A 2BVQB 3KPMB 4TSAH 1G7QB 4UCSA 3U0TA 1CTNA 4P46B 4GRMA 4YE4H 3QCTL 5DJCB 1YEJH 2ZM6B 4MVBD 1T04B 1R33A 5SX4H 1QHQA 1U2YA 4F5CE 1GL4B 1WO2A 2W91A 3IPEA 1AP2B 1QFUL 3LNFA 2X4PA 3KYMA 1GJWA 1FIGL 1FGNL 4LP4A 4NHUA 3IXAB 4N86A 2HVJC 1MCBA 1C08A 4OCWH 3WEAA 4QE7A 4WFFA 3D36C 3O6LH 4ZX5A 4PRID 3ROLB 3O8XD 5L9DL 2WXLA 2GTSA 4O4HB 3RIKA 4U3JA 4JZJA 2OMZA 3VNYA 3N27A 1PZSA 2PCYA 2JCCE 1RCYA 2V7HB 1IC0A 2A1WL 2Q8VA 1VEPA 3OQRA 3GSVB 4WV1B 4PA7A 3FQNA 3STLC 1IM9B 1EVTC 4WFAV 2NY5C 3GXNA 1PYWB 3QIUD 2ZOKA 4MJIE 1H5BA 1Z7JA 1D9KB 4Y1TA 3RI5F 2R9IA 3ZR6A 5IMMB 3NJKA 4C56E 2DQCH 3CFUA 3IC7A 5D1ZB 2D3LA 4FLRA 1P7GA 1XWVA 5FPIA 1I1FA 2DQIL 1FZJA 3FQXB 1RZKH 3O3EA 5CP7A 5F9OH 2FHFA 3F7YA 4EMZA 3UBGA 2W0FA 3T4AC 5AW4B 5KYXA 2BOCB 2PI5A 5EU4B 1A1MB 1YVWA 3UPRA 2IAMD 4PS4H 1FSKB 3Q43A 3GI8L 2KZ1B 1ZGLA 4GQRA 4OLWH 1FORL 3VXTB 3RL1A 1EJ6A 3KE0A 1N6UA 4R0LA 1T66D 3H3PL 3LAFA 1MVYA 3RYFB 1V3KA 3IDGB 1T03H 3VQ2C 4RNRB 3ZL2A 4F8TA 5T3ZE 5E79Z 1FNAA 4BA0A 3T1CA 4C83A 1PLGL 1CF8L 1T6WA 4AW4A 2VAJA 1UM5L 2ETNA 4YNYB 4Z7OF 2B8OT 1KOAA 3WG7C 3LXAA 1A14L 4OZHF 4WZ9A 1HNZB 1E5ZA 4RWYH 4O2EA 1ACYL 1AD9A 2LGNA 1I1YA 3B8YA 5CZVL 3U30B 2AW9A 2DAVA 5HI4D 2F0CA 3LSOA 4R3SA 1T0NB 3DMMD 4PLOB 2BE3A 1ZVHA 2LJ2A 1NGQH 5KVFE 2E6JA 4F7EB 2WLMA 1NWOA 2QZ5A 2B39A 3DC0A 3FT4A 3MV7B 3ASNB 4RO2A 5IYDO 1Q0EA 2WLNA 4HLZG 4XOCA 1U2CA 4AYGA 2LU3A 4MDIA 1OANA 1IBMO 1KTLB 2P8LA 5DA4A 4FG6D 2DQUL 2WBJB 2GITB 1DVYA 2O1AA 2VXQL 2ZX5A 1N18A 4JL2A 4LOFA 2FWSA 4WRLA 3WS6A 1X5XA 3H3BC 5B1JA 5EF3A 2Z8SA 2J25A 3VX0A 1JZ6A 5DRXB 4NQDA 3CVIL 4Q0XH 4X1YB 4WU7B 2JIXA 4NENB 1OAZH 4NJ9L 2H6OA 3CFNA 3MYJB 1I94O 1EHKB 1M56C 2HJLA 3H2PA 3CXCU 5CGTA 5IIEB 1XF3B 2ALAA 4EBQL 2F61A 2G3NA 3DJZA 1GIGL 4LE8A 1E2ZA 4P59H 3SZ6A 1FLTX 2HH0L 3AS2A 4PGDA 5CSZB 1Q0YL 5C08B 4KJPC 3S3CB 1CFBA 2C3GA 5J6GB 5KHIA 4IHBA 4PJHB 1JHTB 3UAJC 3BIAX 5EOTB 4R7CA 5DQDL 5I1CH 4U6VH 1DDTA 1N34B 1CGVA 1R1BA 1HI6B 1W80A 2FZ3A 1IEAB 3B1UA 3MUZ1 5I28A 2DL9A 1WA1X 1CBVL 3PWPD 4FFZH 4P4RA 3BJ91 1AR5A 2HKOA 1YECH 3SDDC 1F90L 3W9EA 2Q6AA 1TXKA 2ADIA 2C3WA 2LOEA 1LYQA 2NX5A 3HB3D 4IGBC 4GRLD 1C5CH 4Z2WA 1ANUA 4XMZA 5C93A 1OCWL 2C9QA 4ZUUB 1AJNA 4PLNC 1MNNA 4DUWA 4AGQA 3DV6A 5KSBE 3PWVA 1GGYA 3OKLA 5FA4A 1IZKA 2KBGA 4MVBC 5HHXL 3NVQA 4NYLA 4L1DA 3DXAB 1NM4A 2R1YA 1TLKA 2A9HA 1HL8A 3OR6C 2PTVA 2VDNB 5FYKD 4C55A 2YRPA 1RHHA 2PW2B 2YGPA 4AV5A 1MMMA 1TLMA 2E6PA 1ODUA 2W60B 4L3EE 4NUGH 4NZRL 4R7LA 4XNUH 4XPTH 2UU9O 3RYMA 2OJZH 3GNML 5E9AA 2P48B 1A8ZA 3ARBD 2EKJA 4JM2C 3TYGH 2VXTH 5FAAA 5SWSB 3A67H 4C47A 2BC4B 1NMAL 3PWUA 2EE0A 4Y4FA 2IMNA 4KI5E 2GFBA 3AY2A 1ASPA 2XAQA 1YJDH 4GQ9L 4MMZA 2X4OA 3NP4A 3EH5B 4MVQA 4QRUB 2WVVB 3FO2A 1TQCB 4HPHA 1FGVL 5I6NA 5HP5A 1KXVC 5E5UB 2RJMA 3PCYA 4LLYA 4NJAL 2HKFH 5EOQL 3W3BA 4LF6B 4HWBA 3JCUZ 1ZTMA 3L9YA 3OM3B 3RWGA 3WNJA 2J8HA 1IT9H 2VDMH 3QEGH 1SLUA 5K33A 2E74B 4PMEA 4LCCC 5DRWA 4NO0D 5C09D 1YRKA 3BPZA 5T5FH 5I1DA 2VDKH 1EBPA 5JHDB 1JNHB 1OQOA 4ZW5A 4X88A 2AJSL 4J8RB 5LGKA 1BJ1J 1BMGA 5I15H 3IFPB 1J9SA 4Y1AA 4QRTB 2W0KA 2IPTL 2WKOA 4FP8H 4LFHG 1LO5A 3GJEB 1OARL 1WBXB 1YY9D 1IDSA 3DROB 4Q2ZB 1G0DA 3E8UH 3VGHA 4KZCA 4CN6A 5HY9B 1XUQA 2HPOA 1QW8A 5JW3L 1H3PL 2W5PA 4M6NL 4N4YB 1AZBA 2XAHA 1WQVT 3B6SA 4JDVA 1E8XA 3E8BA 4XMXA 4RWUA 4FNTA 5EUKB 2Q1EA 1UA7A 1IKFL 4H20H 1M2OA 4ZJ9A 3TZVC 2LP7A 1R24A 4G9FB 3NOIA 4GXVH 3QG7L 4PRDA 4F7TB 1VKXB 3NCWA 1BG1A 2OXHB 1UATA 4AILC 4ODVL 4R97B 4KKLC 1NVPB 1N32O 1HWYA 5DMJB 3WJLC 5IB1B 5IWLC 3QORC 3Q8EA 1AQDA 1KTRL 2Q6WA 3ZO9A 2VERN 2ZAGA 4EI5B 3BUQA 4KKQA 4PV1C 5EF1A 4IJTA 2Z31B 4XR8C 1YN6A 2PYFA 3MZGB 2ZWZA 4UQ3B 4M5ZL 1HCVA 1N3NA 3U2SA 4NAMA 4PRNA 3WEXB 4JCLA 5IQLA 1CDGA 1XEUA 3N91A 1RJYB 4YLCA 3PS6A 4HUXA 1I8LC 1MFNA 4Z7IA 3SCMD 1V54C 5JCOC 1K4CA 3NIFB 1OCOC 4OTXH 4WGVB 5DYOA 3Q05A 3EGXB 2XZZA 3L1OL 4KPHH 4PJ7A 3KLQA 4XMWA 4UQBA 3UM7A 3FT1A 1RK1B 2C3HA 2JS5A 1QSFE 1QBBA 2J5LB 3MBXL 1MCNA 2ZJSH 5CJBA 3UC2A 2QDWA 1OP5K 2CLZB 2QV4A 3QRBA 4TN9A 4QTHB 4PRPE 5CM1A 1QU7A 3L5WB 1G9MC 2YA1A 1A7BA 1W2KT 5L2JB 1A3ZA 2UUCB 3QIWA 1BZKA 2XTJB 3OKNB 4WI5A 5T3ZH 5J56B 1QTPA 2VKWA 4X6DB 1FV1B 1BZOA 3RWEB 3BAYA 3T2LA 3O4LE 4Z77B 4MNGA 3D48R 5J3HC 1OAKL 5JOPD 4G1MB 2B4CH 4UZSA 2YSUB 4MJ6B 5F93C 1CGSH 4K23H 4NWTH 5I74B 5MEOB 3AXLB 1E9PA 4MA7H 4ZFOL 1QFWH 1R6NA 5KVFH 3AADB 1MLCB 3PL6C 3QC6X 3Q1SH 2WUBH 4DGYH 2KZBA 4AI8A 1R34A 5C0CD 4Y88A 2YC0A 2B3IA 3MDJA 4B60A 2HX7A 4P5SA 3PIQB 4PBVC 1Q9LB 1MFDH 4DGWC 2HLAB 1G7IA 1U93B 1MXDA 2J88H 5B1BC 1IGJB 2IANB 1OOWA 2JMRA 5GRUH 4JTCB 1F8TL 3JWDH 3B2VL 3W57A 2YAOA 2GJJA 1A7NL 2W65B 5I17A 4MVUA 1BVNP 3WENA 1AJ7H 5DHVB 3WIIH 2OTWB 1Q0XH 1V55C 3J27A 4QNPE 4NSKA 2E8YA 3GZQA 4PJFB 3SBQA 4MS8C 5BXZA 1UPGA 3TBTB 3MOBL 3NJFA 1ZS8B 2A3TA 2YAHA 4FL4B 2IADA 1EUUA 2ITDA 3LEVH 3S5ZA 2WINB 5SWZA 3VGEA 3MRLB 1YQVL 1EEYA 4P30A 1K8DA 4I9WE 2WZPD 3I6LE 2ZKYA 4N2NA 3GJFK 4C4KT 4LCWD 3S7GA 4HNAB 5D1QC 1MCOL 1URIA 4JUSA 1KTDA 5CGBA 5IUCA 1KFGA 2ZWKA 1N6QL 2ILMA 4HC1L 3QWQB 3QUXB 2F9BT 3RU8L 4MB4A 4LVNC 1XOUA 4BE6A 3POHA 3L9BA 4XH2A 3MRGB 4XBGA 4JY4A 2NUPA 2EKSA 3NGBC 1JERA 3BQUB 4A6YB 5BMFL 4HOMA 5L4FA 3SGDI 3QH3A 1KYFA 3BEWA 1F58L 4L4VA 2CBMA 3N41B 2P8MA 4AJVA 1JGEA 2D7PA 3A21A 2WO4A 4PP1C 4HPOH 1ETZB 5IB3B 3MLUL 3NJHA 4PV8A 4JG1H 2DMKA 3HW7A 3TNMA 2HTKD 2XT1B 3LDBB 4DKFH 3CV5A 2JB6A 1JTPA 4KMLB 2HWZL 5ABAA 2LW7A 4F3FB 4NC0B 5GS1A 3LN4A 4R26H 4O9HH 5D2LA 4MQXC 3BPLB 2WUCL 4YJ3A 2AF2A 3E1F1 4P5KA 4QRBA 4F58H 2YGQA 5DMGD 1R4XA 4HIXL 1HW7A 1MUJB 2XTLA 2IDCA 4I0PD 1UXMA 4IRZL 4WWOA 5CSGA 4ZMQA 3SYCA 1W72B 1XR8A 3T6QC 3C60B 4HJSA 1F3DJ 3QARA 2CIIB 5F7UA 4HKBA 4N2CA 3VG0L 3DX4A 1Z9NA 3AG1B 2FVNA 3VXMD 5MENB 3JV0A 3E9UA 5H8DA 4JW3A 1ZXKA 5T1DH 2RDCA 4DV3O 1M7IB 4N0YH 4PWIA 5DK0A 3TLRA 4YSQA 1MFAH 1VFOA 4YSDA 3D9AL 3LIZA 5BVJA 2R23A 3HS0A 2XN9E 2GTQA 4BJLA 3CC5B 4PIBA 3ICXA 4Y2DB 3I6GB 1MCRA 3Q9PA 5IR1B 2XKSA 3APMA 3BP7B 2WXRA 4FXLA 4QHMB 4DGIH 2VGLM 3NIDE 3V9CA 2E7BA 4CW1A 4MVOA 1KBVA 3L3JA 3U10A 4UDUA 3GMMB 1KTBA 4UVAA 4HIHB 5FUCC 2IQAA 3DJ9A 3V6BR 3G9AB 1JIBA 3ZE0F 1YA5A 4N5ED 4YHPB 1N36O 4EUPH 5D8JL 1M57B 5KJ4A 1NC2B 5GXBB 2NY2B 3HE7D 3ETDA 1CFSA 1GHFL 2NMSA 3MRFA 4HIEB 2Q86B 2LVEA 2Y06L 1F97A 5DJ8A 5JORA 3KEHA 5DDHA 1KJVA 1KT2A 4PB0H 3WCYA 4K4KA 5ESAB 1MRDH 2KG7B 1S7XA 1NMBL 2YIBD 2ILLA 3CFDA 5FF6A 2EDFA 4UQ2A 2G5UA 3CWBH 1AGCB 2EICA 4LGRB 4Y4HD 4LNUA 4P2RA 4N8VG 2ICCA 1IC7H 3LZLA 4LQFL 2OTJV 3MXVL 4KUZH 5EBLB 4BK5A 5B8CC 5I9QC 2QJ1A 5I1GH 5TQ2H 3K6IA 1PSKH 4Y5XB 2EDRA 4HWNA 2UXTA 5F72S 5T1MB 4E5XG 1JXFA 5TH2A 4BE5A 3ARVA 4ZMWA 4UCUA 1J8HB 1S5HC 2PR4H 1GGUA 4NBZB 3RVTD 2JKTM 3ARDD 4Z3FA 1QSEB 3ESMA 4KTDL 3X1NA 4F9PC 4UTCA 4BH7B 1XB8A 1HZHL 1I82A 4OJYA 1XZWA 5BZDA 1ES0A 3BH9B 3LZNA 3BAEL 2EULA 1E4KC 3BPOC 4AM0Q 3TGUH 3MLWH 4JQIA 5E9DB 3WFBH 1FN4B 3MTXA 2H2PD 3PUCA 1KLUB 5EHFA 3PJLA 4FLHA 4KTEL 4KRPB 1YSCA 1E40A 5AAMA 1MCKA 3VA2C 3KH3A 1W6LA 4BELD 2KKWA 3IGAB 3CFKB 4Y5VB 3FQ2A 3OAUH 4HJUA 5ERWB 1GRJA 4GIAA 2E4TA 2W88A 3GI9L 4G2KA 1ZWIB 3CFJA 2X40A 5E00B 1S9YB 4A1RA 4KNQA 3FO9A 3OZ9H 1A3LL 5EH1A 3CDCA 4W4KA 1L4IA 3QI9B 4NNPL 1PS3A 2GJZB 3EJCA 1IIKA 3QNYA 4WEBH 4N8VB 3G6DH 3A6BL 5TQ0L 3TEWA 3LOWA 2FECL 4JJ5A 3WKML 4DAGL 3B77A 4OFVA 5J06A 1AKJD 4PLJC 5JXEC 1BBJA 2AJVH 3O81A 1VEOA 5B39A 3BQVA 2Y5QA 1UB5A 3QUMB 2IGLA 3C75A 5IM7A 4WK4B 1WP6A 3MOQA 1THZA 1OGAD 4JI6B 1F56A 3OMAB 4XXDA 1Y76B 5AOLA 1BD2E 3P77A 2EABA 3REVB 4NZTL 2WLKA 3CEIA 3NJIA 2G5BA 2I26N 4JGMA 2ENJA 2IGFL 3ZHFA 2ZR3A 2GJ6B 4X9YA 2GJPA 3TWCL 4FHBD 2EXWD 3JVFC 5DVKA 5KYNA 1S78C 3C90A 3QEQA 1ZIBA 1IZ3A 1NSNL 1SXZA 2VJ8A 4M6OH 5EF2A 1RPQA 2G2RA 3NH7H 4JFFD 2QR0A 3A4AA 1NQBA 3T0EB 1TETH 5K9QI 1YY8A 1NDMB 3L4WA 4NHCH 5GIRA 3JARA 4S1RL 1Q9KA 1BVKB 1JMKC 1BVLB 1X44A 4PJXF 4UQEA 4AG4L 3FFQA 1GM8A 4EQ2A 3K7UA 5EUOB 1GGIH 4X65B 1P1ZB 4FTVD 4JFDA 4OGXL 3HZYB 3BGAA 1PZDA 4FFYH 5F44A 4F9LC 1JI2A 3HE6A 4WNQB 2EIMB 5FHBH 2YK1L 2ZUQC 3FU3A 4P0DA 3CFQA 4NGHL 5ITFB 3WFEH 3ILQC 5GGRB 1HNFA 3C6LC 5D7EA 1YYLH 3QXAA 5L7XH 3QZNA 3AU1B 3MBED 3HNVH 4KO9A 1YUHB 1P2CA 3V7MA 4AQZA 4O4IB 2V2WA 1VAHA 2BY1A 2Q5ZA 3BXNB 4J3OF 3MCLH 1UM4H 1SY6H 1E4JA 3VD7A 3AWFA 3AK2A 1QTYT 4O00A 3V7AG 4NXSA 2W6IG 3N2KA 2EYSB 5IKCB 4XPGH 4IJ3B 3QA3B 5LQBH 2QTOA 5AQ0A 1FHNA 1OK8A 4NQED 3VA6A 4H8VA 1BQSA 5C7XL 4L9LC 4HUVB 4FFKA 1XGPA 4ZMOA 4TV8B 1YEFL 3NFSL 2BINA 5I66B 2W9EH 1CICA 1ZOXA 2MQGA 3O41A 2VN6A 1L0QA 5E23A 5FUOL 2EIZB 1HWGB 4V2BA 3ZRVA 8CGTA 5I18H 4WTZG 1N4XL 2PZSA 4G3YL 4NR1A 1IAKA 3KPRE 4GB9A 2XRAH 2C8NA 1ZLUK 4DO4A 5AZEL 4AQYO 1ADQA 2BNUA 1YEHH 4X8GA 2R0WH 2Z35B 3VCLB 5GGRY 5BS0D 2QHRH 2XYBA 4HCRH 3L81A 2XKUA 1AG0A 4XVJH 4AZUA 2AJUL 2QKIA 3KDMA 2KKQA 1LO0L 2Y72A 1TEFA 4RBPK 1WFNA 1YEDA 3K2UH 2KZKA 3UBXA 4BFNA 3RL2A 4P2AA 3STZC 1A32A 1T1XB 2OZ4L 3B9KD 4HBCL 4KKRA 2B77A 2F54A 4Z1PA 5KMGA 5JW5B 1NI8A 3PP4H 1U95B 2BSTA 3DUSB 4LLDA 3F7VC 1NBYA 3GTTA 1I7TB 1DFBH 4A5UB 4NUJA 3RZCB 5I16B 4GH7B 2HR3A 4PY7B 2P47B 3F3HA 4EN3A 2HFGL 4MAYB 3OEHG 4JPIB 4IRZA 2BTQB 2BOBB 3GSXA 1FBIL 4UYQA 3TN0D 4AQAA 1JG9A 1BIIB 2WTRB 1J0KA 3VYPA 2VQUA 4L8SA 4AEIH 4OT1L 4RWHA 5LVEA 1PTZA 4HK0A 5FGRA 4QRPE 2OTPA 4WWPA 4YDKH 3ENEA 3RWFA 2A73A 1XT5A 2OMTA 2CPUA 5PCYA 1SF5A 4Y16D 2F4VO 1NKGA 3B2MA 3ZQXA 4GIPD 3ABMB 2IFGA 1D5BA 3MRPB 4G5ZL 4LU5H 4OW6A 4L5FE 1KN2L 2HLFC 4KAQH 1IAII 1ZAGA 4YIQA 1R5VB 5INDB 3KW7A 3CCHA 4OLZH 4ZDHA 4ONOA 2VLRA 1XIWD 4JO3H 2VQEO 2PCPB 2ZDIC 2R2BA 3MGOB 1BFVL 5TFSL 3S3BB 1JK9B 3N1MC 4XP4H 4GUOA 5I6PA 2F58L 1H8NA 5ITBH 4EDWH 1F2QA 1FCGA 1U92B 3JTSA 3KLLA 2DW5A 4PJEF 3SPVA 5EZOL 2EJ1A 4TSFG 1G7JA 1M71A 2QKSA 1UC6A 1NCAH 4OV5A 3K06A 2HFEA 4WJ5B 3R19A 1KG0A 3V4PA 2FJFB 2E9WA 4RUEA 4NYKA 4PELA 4JM0A 5B1AB 4LEBA 5A2CA 2HRPL 1TVKA 1HXMB 2WP3T 2NZ9D 3UBFA 4OGQC 4I8DA 4HJ0D 1KNOB 4ZXBC 4LLQB 1BCIA 5TDPA 1UM6H 4E9RA 1C12B 2ZOOA 2E47A 2J1YA 2EDYA 5FKAA 3V4UH 4PTTB 5D7LE 5DLML 5LAXB 2I5YL 1AGFA 1UVQA 4M7LT 3P9MA 3FSZA 5D5MB 1NEPA 4ZS7L 5CJQH 1ZLSL 4PJ9D 1WAAE 1FH5L 1ORSB 3EOYG 5IMKB 4JYAO 3DHPA 4MMYA 4TOYH 4LRIA 2F74A 4K7PL 1Y67A 1GZPB 3WXWL 3QDGD 2HRGA 1P7HL 1CLYH 4LZKA 3VWJD 3FTZA 2F8OA 2AK4E 2PYED 4B9GA 1VQKV 4QRAA 4MQ7B 4QRSA 5HPMA 1VLXA 2XIBA 1I9IL 4WENB 3BT2H 1T20B 3S0PA 2QSAA 4D9LH 4V1DD 5F7EH 1NCTA 4Y9EA 5GS2D 3RA7L 4I2XB 1P4LA 2HHHO 4FEMA 1H9VA 2EUVA 3FU5A 5ADOL 3NJJA 1KBKA 4EKWA 4JRXD 5H37A 3FTGB 4PVMA 5DEGB 1S8DB 3QE5A 1E79G 4DV5O 1A7RH 3NZHH 5F70A 3ZGHA 5JO5A 2DMXA 4KROD 3QDMA 2FWOA 3ZJAA 2VLMD 4I18B 1EBOA 1N68A 2LU7A 1U96A 4DR7B 4MDJB 4IDJL 1NAMB 4E36A 2ZUXA 3G80A 2K4WA 4JZJC 1G6RL 2UXGA 3MV8B 2Q76A 2LT9A 4JREB 4P49A 1P69B 1RUQL 3BUBA 4PD4J 5F7WC 5IW1B 2NZ1A 1KFAL 2OTLV 1XHZA 3D4YA 2KYIA 5D70L 3JD1A 3DIFB 1QBLL 4N2LA 3D87B 3ETBJ 3GBNH 4F7CA 3AG2C 1U8CA 5E8DH 5J1AA 5FEBA 2AMGA 2DD8H 3D6GA 1FYTE 3NJMA 3D33A 1H5BC 4QT5B 5KJ7E 1VZGA 5H4YA 3QFGA 1LQSR 3T3PF 3IK2A 1PZ5B 1Y7VA 1SVCP 2J1ZA 1DZ0A 1YDPB 3SPGA 1MREH 1IBKB 5D6CB 4E4EA 1TJHL 4ZYKB 3RUGA 1VSCA 4GW5A 3UTTE 5LG1A 3QCUL 1XGTA 1CL7H 5D6DC 2CDFB 1F5WA 3F7YC 4JI7B 4KL1A 2NY0B 3EH3B 2W0FC 4PGZA 15C8L 4JI3O 5BZBA 2WSSG 4M61B 4RA0C 1FVDA 1JYNA 1XF2B 1R3IH 3EOAA 4FQ1H 3KPSA 1JYWA 4KVCL 4JVUA 4HSQA 1ZLWH 3A0HZ 1OB1A 4OUUA 5FO8B 1QHTA 4UT9L 4CVZB 4R0LC 2Y4TA 4NB7A 1PKXA 5DWUH 3OKOA 2IMMA 1T0MB 2Z91A 4F7MB 5I30H 3SKOA 4J7RA 2IJHA 1VARA 2EIEA 3GIZH 3INUL 3TBVA 3ZRXA 4YHML 3VXRE 4TNWF 3P3RA 1LWHA 4FNQA 1MAKA 5C9JA 2WGXA 1A1OA 3A47A 4X98A 5C0DA 4N8PA 5C7ZA 1A7PL 2ZE6A 1MFCH 5HHQA 1P4UA 3WE6B 4EKXA 3OJDA 1FPTH 3QQ3A 4YIOA 3PABB 3IDMA 1FO0H 3D3VB 2DLFH 3ARGB 4U1KA 1JPGA 3FTWA 2NSMA 4PJBB 4PRIB 3DX9A 1H2MA 4I4TB 1Q72L 3O8XB 4J4PD 1OAUL 3E7JA 3CRRA 4PB9H 3FFDA 4HEME 2PCFB 5A6LA 5IFHL 3SPCA 1M42A 5GRJL 1GYWA 3B3IB 4Y5YA 1NT2B 5B1JC 3SEPA 1KPRB 3QIUB 3QQDA 3VWKA 3C5ZD 4FMVA 1T1ZB 3HC0B 2MRYA 5MI0B 1RZPA 3VFMA 1B0RA 1G6VK 5J9PB 1AI5A 1W0WA 5HDQL 4Z0BH 5ITZA 1UUNA 2PWHA 2JEXA 1M1XA