3EHBB

A d-pathway mutation decouples the paracoccus denitrificans cytochrome c oxidase by altering the side chain orientation of a distant, conserved glutamate
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
252
structure length
252
Chain Sequence
QDVLGDLPVIGKPVNGGMNFQPASSPLAHDQQWLDHFVLYIITAVTIFVCLLLLICIVRFNRRANPVPARFTHNTPIEVIWTLVPVLILVAIGAFSLPILFRSQEMPNDPDLVIKAIGHQWYWSYEYPNDGVAFDALMLEKEALADAGYSEDEYLLATDNPVVVPVGKKVLVQVTATDVIHAWTIPAFAVKQDAVPGRIAQLWFSVDQEGVYFGQCSELCGINHAYMPIVVKAVSQEKYEAWLAGAKEEFAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/immune system
molecule keywords Cytochrome c oxidase subunit 1-beta
publication title A d-pathway mutation decouples the paracoccusdenitrificans cytochrome C oxidase by altering the side-chain orientation of a distant conserved glutamate
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 74
structure length 252
sequence length 252
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2008-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ehbB02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3ehbB01
1ASOA 2J55A 5B7EA 1TEGA 1JXFA 3FU7A 3ABLB 1MDAA 4BWTA 2VW4A 1AS6A 3X1EA 3ZBMA 3HEIB 2FTAA 2HX8A 1AR1B 2WSDA 3NSDA 1WA1X 4A2DA 3FU7B 4GYBA 4KO5A 5I28A 3H56A 2BW5A 1NIEA 4HCFA 1A4BA 4RH4A 5I6PA 1L9TA 3TBCA 3NSCA 3TA4D 3PXLA 1SDDA 3QJVB 3NJLA 2FNWA 1AZCA 2FQEA 2HX7A 9PCYA 4WTQA 5TK4A 1AZRA 1ET8A 1SHWA 5I6LA 4E9VA 1DZ0A 4YSEA 1XB3A 2XX0A 3SBQA 3L45A 5I6OA 1JZFA 4HAKA 1TU2A 4Q8BA 2AZAA 1NTDA 3NJGA 1CYWA 3X1GA 2IH8A 2XXGA 3MX0B 1A4AA 2PPDA 4PAZA 1NIFA 1NIAA 1J9QA 4FAAB 2H5UA 1PF3A 1KDJA 3DTUB 5B1AB 3DKHA 3WNJA 1FFTB 2YXVA 2QPDB 2CJ3A 2H47C 3ZIYA 3FSVA 4P5SA 1MZZA 3QJTB 2GHZA 2JKWA 4E9XA 3FYIB 5A7EA 2ZONA 2HX9A 1FWXA 3EF4A 1DYZA 1AANA 1L9PA 5I6NA 1AS8A 4DPCX 1ADWA 5I5JA 4A2HA 1IC0A 1CYXA 4UAHA 2HZHA 3BVDB 4A68A 1BXUA 2IWEA 5I5MA 1JZGA 2WO2B 1L9QA 2A3TA 4PCYA 4E9YA 3QQXA 5I6KA 1KV7A 2BWDA 6PAZA 2YAHA 4HIPA 3IBOA 1KBWA 2RACA 2XLLA 1NIBA 1GW0A 2GC7C 2UXFA 1ASPA 2BO0A 1WAEA 1SF3A 3T6XA 3D12B 3PAVA 4E9SA 5AFAA 2XV2A 3NJKA 1JXGA 3OMIB 1BXAA 2I7OA 5FC9A 1WS8A 1VLXA 2H3XC 1WS7A 2Y1AA 1A3ZA 5D4JA 1PAZA 3FSZA 1OE2A 3H4HA 1J5CA 4A2GA 4HZ1A 3SBPA 1AZNA 3AG2B 1AQ8A 5I26A 5D4IA 1J5DA 4K9JA 3QJQB 5B1BB 1OCCB 2UXTA 1PNCA 3ABKB 2XU9A 3GXUB 3UAAA 3C75A 3HB3B 2GSMB 1W6WA 2YARA 1IBZA 1NWOA 2DY2A 2PP8A 2CCWA 3TASA 3AY2A 2YQBA 1GS7A 3AW5A 2EIMB 2HLEB 4F7KA 1M9WA 1OE1A 1XB6A 3FQYA 2NRDA 2XVBA 4L0PB 1M56B 3TBBA 1KBVA 1BYPA 2R7EA 3X1NA 1SF5A 1A4CA 5B7MA 2VM4A 3PAZA 3NSFA 2I85A 2IDUA 4HHGA 1IKOP 3PLYA 4GY4A 2IWKA 4G72B 1XMEB 2QT6A 2QPEB 3FYEB 4YSAA 2Q9OA 4GP5B 5PAZA 3UGEA 1AS7A 4DP9X 4E9QA 4BWWA 2J5WA 4N8UA 3U25A 1E67A 1URIA 4YSQA 1EZLA 3WI9A 2BWIA 1PZCA 1JERA 2PPFA 4CSZA 3X2QB 1HAUA 2IDSA 1E30A 4A66A 4E9TA 4QLWA 2OJ1A 5ANHA 1J9TA 1PCSA 3NYKA 3IN2A 2HRHA 1ZPUA 1T5KA 1QLEB 1BQRA 4ZK8A 1M57B 1GSKA 2IDFA 3RYMA 1OCZB 4MFHA 1JZHA 4YSOA 3NJNA 3T6WA 3AG3B 2DV6A 4A2FA 1BYOA 1AZBA 2MRYA 2ZWNA 2EINB 3NSYA 5TK2A 3GDCA 1E5YA 2XV3A 3WG7B 4G7QB 5F7AA 2FQGA 4BWUA 1QNIA 4HCGA 1NICA 1E5ZA 2I7SA 4YSSA 4FA7B 4GXFA 3WIAA 3AG1B 1I53A 1TEFA 2W8CA 2GC4C 3DIVA 1OOWA 2HXAA 2JXMA 4KNSA 1AG0A 1ZIBA 4E9WA 1NZRA 3QJUB 4KO9A 3S8GB 1AACA 4E9RA 2ZXWB 1NWPA 4DP2X 1MG2C 1SNRA 2XWZA 1JVOA 2GIMA 2YXWA 3WKPA 2UXGA 2XYBA 1ZIAA 2CUAA 3V9CA 2PCFA 3CZUB 3ZDWA 4DP5X 4W9ZA 2IDTA 2Q5BA 2YAFA 1OCRB 3NP3A 3JTBA 4BDVA 5LDUA 1MG3C 1QHQA 4NERA 7PAZA 1ET5A 3UAEA 4YVNA 3ABMB 4AI7A 2PPEA 3TU6A 4BDVB 4KOBA 7PCYA 1AOZA 2BHFA 4CSPA 2CAKA 1PLBA 3NJHA 3NJFA 2PPAA 1SJMA 1BAWA 5F7BA 5B3SB 3SQRA 2PPCA 2YAEA 1R1CA 2PP7A 4BXVA 1RCYA 3EHBB 3FS9A 4HALA 4YSRA 1XB8A 3T6VA 5B1KA 2E86A 4KO7A 4AKOA 1GR7A 2YEVB 3ZX1A 1F56A 4W1TA 3FSWA 1NIDA 1ID2A 4JHUA 5PCYA 2W88A 2WO3B 1KCBA 3QJRB 2UXVA 1V55B 3UADA 3CDZB 3ASNB 3FPXA 1GS6X 1KGYE 3WKQA 2P80D 1RZQA 1SHXA 4QKTA 1TKWA 2GI0A 3FU9A 1JZJA 4GP4B 1AG6A 3WNIA 4YSUA 2IDQA 2FT8A 4DPAX 4F2FA 1B3IA 3OMNB 4YVUA 4YSDA 3NJJA 5B1JA 3S3DB 4N4YB 3CG8A 4HCIA 3OMAB 3UACA 3GYRA 3S3CB 2OV0A 1W6LA 4X4KA 2HRGA 2BZ7A 2DWTA 2Y69B 1AIZA 2FJSA 3FQ1A 3FT0A 4UF7C 4BK5C 3IE9A 1OE3A 3G5WA 4BXSV 2IH9A 3N55A 3EH3B 2DYSB 1CURA 2BW4A 2FWLB 3CVBA 3IEAA 4TXVB 2VSMB 2UX7A 1GY1A 3X1BA 1SFHA 1AAJA 1KDIA 5E9NA 4KNUA 1J9SA 2XX1A 4YL4A 3IN0A 2BP0A 2N0MA 4G70B 6PCYA 3AZUA 3CVCA 3N2JA 4HHWA 8PAZA 1ZDQA 2BP8A 2YAOA 1KCWA 2QDVA 2P80A 5AKRA 2BP0B 1KYAA 3UABA 4G71B 1CUOA 1HAWA 4M3HA 3SBRA 4DP4X 2BP8B 1PNDA 1ASQA 1GY2A 1X9RA 1IUZA 2EIKB 4P5RA 2EIJB 3ABGA 4AKQA 1AZUA 2IAAC 1BQ5A 2X87A 3EH4B 1YLBB 2FT6A 2VM3A 2B3IA 1BXVA 2XV0A 3NJIA 2LLNA 4NB7A 4AZUA 1NPNA 1SDDB 1ILSA 1V54B 1GS8A 4KNTA 4WKXA 3MBWB 3OM3B 1PMYA 2XXFA 1JOIA 3FSAA 4KOCA 3OD3A 2CALA 1PZAA 1HFUA 1WA2X 1N70A 4DP7X 2DWSA 4G7RB 1GYCA 2J56A 5B7FA 1N68A 2PLTA 1WA0X 4UANA 3ASOB 1W8EA 1RZPA 4A2EA 3S3BB 3PPSA 3ERXA 2AFNA 1UATA 1MZYA 1JVLA 1X9UA 2YAMA 2IWFA 3NT0A 4YSTA 2X88A 2FQDA 4JKNA 1ZDSA 4YSCA 1ILUA 4Q89A 4ENZA 4DP1X 2OCCB 2ZOOA 4DP8X 1ZV2A 3EH5B 5EHFA 2PCYA 1OF0A 1BQKA 1L9SA 2XUWA 3FPYA 1FA4A 1BEXA 3V9EA 5B1JC 5D4HA 1EHKB 2VSKB 3FQ2A 2QDWA 1NDTA 2CBPA 4M4RB 3CDZA 1E65A 2TSAA 1PLCA 2JFCA 2BZCA 1JXDA 4JHVA 4DPBX 1NINA 2GBAA 5AZUA 4YSPA 4DP6X 1J9RA 3BQVA 2EILB 3AG4B 3T9WA 2J57A 1L9RA 1OCOB 2YAPA 3NP4A 3OQRA 4G7SB 4KO6A 2B08A 4DP0X 3PCYA 3T6ZA 4GP8B 2AZUA 1ETJA 1JZEA 2PP9A 3KW8A 4AKPA 2TSBA 1CC3A 2VW7A 4AX3A 5I5IA 2FT7A 3T71A 3QJSB 3PAUA 3JT2A 4EF3A 1IBYA 3S8FB 1L9OA 2AANA 1A65A 2AVFA 3FU8A 1PLAA 5I6MA 4NAJA 5IY5B 1A8ZA 3QPKA 1PY0A 4F2EA 2FQFA 3CVDA 2MTAA 1RKRA 2UX6A 3KW7A 3NJMA 1PZBA 2VW6A 2DYRB 2VMJA 1ET7A 1OV8A 1SFDA 3X1FA 2VN3A 1NPJA 2GB2A 1JZIA 3H4FA 2R7EB 1V10A 2YAQA 4A67A
chains in the Genus database with same CATH superfamily
1ASOA 4LRIA 3K57A 3AUVA 4NO0D 5E2WL 3L3HB 1MNUH 4WLCA 1U4FA 3OAUH 4TN9A 3UBFA 3MV9D 5C0IB 2HYMA 3LZPA 1G7HB 3MR9B 3EYUL 4IU2A 4Z0BL 5C0BB 2FLBT 3KPLB 4JFDA 4LF9B 7TAAA 3E8UH 3QORB 3EYOA 3NCCB 3GMOB 5LGTA 2G2NA 4CC5A 2D73A 3LIZL 2DLFH 1E6OL 2Q76B 4J10A 4NHUB 3LXAA 3C5ZB 4NCC2 1DJYA 1JZ3A 4HHAA 2HPTA 1KFGA 3TA4D 3IDNB 3V4VB 4EKXA 5I66A 5B66Z 5F1SA 5J3HD 2SEBB 4GX2A 2BXYA 3BUPA 5H2FZ 1H2NA 3ME0A 4LLVA 2UY6A 2JB6B 3D3VE 3DURB 3GSNL 3L1OL 5EZJB 1AZRA 3HNSL 1TFPA 2R0WL 3L4CA 1ET8A 3MRGA 3DDGA 3R7QA 3RPIA 4O4JA 1YVWA 2RCSL 2YGOA 3KLQA 1PKQA 4Q4IA 5JVDB 2WWKT 1K5NA 1NUNB 1G1XB 1F4XL 3FO1B 4X50A 4Z7OB 5DQJA 3EGSA 1LK2A 4FXKA 4QCIA 3GPEA 1P4UA 5EIBD 4R8WL 4AHCA 1Y7VA 1SZXA 2V5RA 2YK1H 4X0NA 4RWYH 5CJQL 2H0JA 4O2EA 2EILC 1LO0H 1N34B 2I07A 2VDNB 1P4BH 4NO2A 3LNFA 1F1AA 4MVSA 1UA6L 2HT4D 3KCPB 4E2OA 1NGWB 3FB5A 5FNVA 2IBZX 2DWXA 2R29H 3BIKB 4FG2A 4LHUA 1F02I 3ZIYA 5I0ZA 3NZHL 4LSDA 1CL7L 4UCVA 3FSVA 4WEEA 3RY5A 4MXWH 3VDBA 4FHKA 5A7EA 4GLRH 1GGCH 5IEKB 4IBQA 3BSZH 4I18C 2PUSA 1YDPA 5CGBA 1DYZA 1GA2A 5I6NA 3TURA 1AS8A 4IBLT 3QZWA 3BA8A 4AEIH 4FNQA 4JFPA 3OWRA 5EBLA 1MAMH 1MFUA 5D7IE 1NBZB 2Q67A 2BSDA 3VFSB 5IQ7L 5A9GA 3VE0B 4J27A 4FYRA 2P7TB 1C8QA 3WUWG 4FQ2L 1GXEA 2WO2B 3PWPA 5L6YH 2CRIA 3TJHC 3VMOA 2W81C 3R0NA 4DR6B 2E3CA 2F5AH 4FFYH 4HIPA 5IFHH 3LVEA 5IFAL 5HGHB 3KPRE 2Q9LA 4NO3B 5BMVB 2UXFA 2Y7MA 4AYGA 4RO2A 4N0UE 3STLB 2VQ1B 1WAEA 2F53E 5AVUB 4ZO7A 3FTGB 3CU7A 5HY9A 3LS5H 2NNAA 3CTTA 3IGUA 2CUHA 1N32B 1JK8B 1FCCA 5T5FA 4PS3A 3G5XB 1ETZB 2GJ6B 3ABLC 2VDML 1ES0A 5CINL 1P2CA 1F97A 3A4DA 4GG6B 4OM1H 1XNQO 2VL4A 3TCTA 2XVLA 1YJWV 4BHUI 1F5WA 1D2OA 3TJTA 3QUYD 2K1MA 4HZ1A 3SBPA 3U9PL 4Y0GA 1FZKB 1U8PB 5J6HB 1OAUL 3EJCA 3NZSA 4B97A 1MHCB 4FYTA 5C97A 3T3MF 1F41A 5K9JL 4RGMB 3HB3B 3FTYA 2DLHA 2PKDA 1DVUA 4R7CA 3TA3A 2J43A 4IQHA 4Z7QF 2R39A 4XN1A 3AY2A 1DBML 5I0VA 3CGTA 4QRTB 1CGUA 3CRCA 2EIMB 2F43G 4ANWA 2FH6A 1M9WA 5TDNA 1I1CA 5GSRB 4L0PB 2X6CA 4IYHA 1W59A 1MKFA 3FB6C 4QOKE 4LFCO 3DTXA 3LX9A 4HAGA 1QFPA 5EUOE 1KEGH 2XN1A 5IVOA 5GS0C 3SDXF 5TDPA 4WWNA 2NY2D 3I6GA 1EJOL 4NXKA 2IPUK 4G72B 3QUMB 3BUIA 4TF4A 5E2WH 3SDCB 3FYEB 1NH6A 3WU1A 1S3KH 1YPZA 3EYUH 4Z0BH 3HNTL 4YBLC 5PAZA 3U6XA 2WSPA 5IBLC 4DP9X 1ACXA 1IC7L 1XGTB 3T1YO 3KYMB 4GS7C 2N01B 5ENWA 3RBSA 4DKDC 3UT5B 1K9MW 3A2FA 1E6OH 1MSDA 3O4LA 4L23A 1TQCC 5AB0A 1DFBH 4CSZA 1IGIL 2A7BA 3PXJA 1MCOL 2RMKB 1F11B 2WXNA 5DCCA 4U0RC 4YJ2A 1NMCB 4HWUA 1S7QB 2FB4H 4FC3E 1E5UI 2FJGB 3L2NA 2LW3A 1K4DB 1M7UA 2A9MH 3CFQA 3OX8A 1U8MA 3WJJA 1NANH 3B9DA 3L1OH 3GHPA 3W82A 1HHIA 3EDEA 4TV8A 1FC2D 4IHOB 1CPYA 3G08B 3HNSH 3K03A 2R0WH 3HLKA 1LP9A 3TZVA 3AXLA 2CLRB 4DK6A 1VF5C 1H5BA 2DRUA 4BZ2A 3CRMA 2UWEB 4D9QE 5I1JL 3SGDH 1IT9L 3Q8BA 2R2HA 5K59F 1XGRB 2JKJA 4HUUB 3VQ1C 1F4XH 2PWHA 4WW1B 4LH6A 5C2BH 4I3RL 5BVJA 2HVJC 1FXKA 2FZ3A 3MBEA 3MMEB 3UYPB 1GIGL 1T5EA 1U21A 2B5IB 2FEEL 2GJJA 4WKZA 5HD8C 3H8NA 1BD2D 4R8WH 2W38A 3V4UL 3HE7B 1FAFA 1G5GA 3QUZD 5CJQH 2VLJD 5EU5A 3VA2C 1T2QH 4U1IB 4F7TB 1HINH 5LBSA 1NCHA 1T1YB 3SPVB 4ZXBD 1X5YA 1H8SA 1TPXC 1UA6H 4XE5B 3INUL 3GMLA 5A2LH 43CAA 3EO0B 5HYJD 4FA6A 3IXAB 3AT9A 2YS4A 3MRBB 3NZHH 1CL7H 4PG2A 4IRJB 2WTRB 4KKLD 1ZTXL 1UJWB 3K8LA 4YC2C 4AV5A 1BQHA 2HH0L 5ITFA 2FWOB 1H2SB 4HLZG 4D7PA 2VZSA 2EKJA 1B04A 3US1A 1DJWA 4ZO6A 2GUYA 4HKBA 1CMOA 2X4UA 2WXRA 3HRPA 3RVVD 1OAQH 1JVOA 5IQ7H 5D5ME 3ARQA 4YXLH 4U1SB 2UXGA 5LP6C 2H8PC 3GMNA 1ND0A 4TPRH 4M7KL 4OF0A 1WBZB 2B77A 4EB6A 2HT3C 2XFGB 4NN6B 2YAFA 2KERA 3ZU8A 4X65O 2K9FB 1SS3A 5IFAH 4GUOA 3FTUA 1JQ0A 5C9JB 1HILA 2XWEA 5K9KB 4HLJA 2P5EE 4RAUA 3TNNB 4QY8A 4PCSA 3ZE1E 1GC1H 3TBSB 5HHPA 1HHGA 2R0LL 2DYPD 4NFDA 5HYFA 1MWAL 2ATPA 2J1KA 2H4EA 4RQQA 4CSPA 1PLBA 3NJFA 1SYVA 2PPAA 3NSXA 5CINH 1YC7A 1A0QL 2VDMH 3BD3A 4KZ0A 4WI5A 1R73A 3DJZA 4ZOAA 2NSXA 3VXRA 4AM0Q 3ZXAC 4YZFE 5DI8A 4UU9A 2G3NA 1NLBL 4R9HA 4YDLC 3RA7L 5EO9A 3T6VA 5B1KA 4P59L 1N6QL 1I1FA 5DS8A 3L3JA 5JHMA 3M99B 2GJZB 4X5XB 1R3LA 3KS0J 5J6SA 2R23A 3GSOA 5K9JH 4DVRL 2WY3B 1P84K 2A74B 3FFCA 3M45A 3PHQB 1EUUA 4QIRA 1NT2B 2NXYD 1KCUH 1DBMH 4UQ3A 2BIHA 4DV0O 3OAYH 4TYUA 3EJZD 4Q4EA 3GSNB 1GAFL 4Y4KD 3BO8B 4O2CA 5C0JB 4MMYA 3FOLA 5DXWA 1R3IC 4W68A 3SJVB 3T0EB 3FN3A 4P4KD 3QQ3A 1YY8B 4MS8C 2R72A 5C3TA 2JJVA 3GMPA 4GBXD 3HRZA 1DVSA 4GKLA 2E8ZA 3CG8A 3HNTH 5GRJL 4AQ1C 3DK2A 4F20A 2KLRA 3PDGA 3EUUA 1IC7H 2OZNA 4XP9L 1WB8A 3GIVB 2J6EA 3WAJA 3PGFH 1GRJA 5AQ0A 4OTXL 4X62O 3GB7A 3VWKD 2YRZA 3BPOB 1IGIH 2IH9A 4QO1A 3WJMB 3E8BA 1JNLL 3B8YA 3QISA 2BIQA 2Y7SA 4KXZI 4S1DC 1QQDA 3RVTC 1WIUA 4KX9A 2WUBL 5I30H 3AC0A 1PQZA 3QBTB 4PV9B 2WV3A 1IQWH 2VDQB 2ZKMX 4PA7A 1J9SA 5D93C 2IOMA 5T1LB 5EEZA 4PJ9B 3RWEA 2D03L 5SWSB 4P2RE 3QIBD 3ZE2B 1N59B 2KZBA 2NY7L 2YKKA 3TBTB 2GTQA 4JGJA 1HNFA 5I1JH 5E5RB 3GBML 4OFYD 4BFNA 4YDVB 3GRWH 3FOMA 4GZRB 1SPDA 5DA0B 1D6VH 2FECL 3GWKC 3DX7B 2QDVA 3PQYE 2P80A 5FUZL 5JLZB 1GIGH 5TE6L 5LA6B 1NDGB 1CFQB 5CA1B 3PJSB 4N1CA 5FHBH 1CUOA 5CZXC 4LFAB 3UPRA 3GLAA 5IMMA 2GT9B 2HKFH 4X7SL 4POZD 3QFJE 4JI7B 1FVDB 1U8HB 1DN0B 3MFGB 5I6XB 4KDWA 1H3PL 4RGNC 4U3CA 3AMKA 4EBQL 4UXNA 4HUXB 5F6HJ 3LDCA 4OFKA 3K2KA 2E7LC 3BD5A 5MEOA 2VO8A 2YIBD 1LL1A 1VF7A 1VACB 2AJUL 3EO1A 4U3SB 4YJZL 3DVNB 3KDMB 4KXRA 1K4CA 4MNQD 1WIOA 5CKAA 2XKNA 4JFEE 3CCSV 3O6FD 2CALA 4M7KH 1I1YB 1CDGA 4HUMB 1AYRA 3CQQA 3DX8A 3OTTA 4UT9H 4FVMA 2YUVA 5F89B 4C58B 1H3XA 2AKRA 1M71A 4HKZA 4LCYA 5IFJA 4HH9B 4DWHA 4GQQA 4I50A 1LO5A 3Q7JA 4U1JA 5CCHE 3UC0L 1TSRA 3TM6A 4IBUA 4JRYE 1RZKL 4X80L 1TR7A 2YBGA 5J56B 4RGNE 2R0LH 2B0SH 4Y2DC 2HTKC 4NKGB 1U9KA 3PPSA 4PJIF 4X6CA 1MWAH 3X3FL 1DBJL 3VXSA 5IR1B 2MJWA 3WY4A 3GJFB 3BPNC 5E6YA 4KU1A 3ARBD 1A0QH 5KTEH 1NC4D 1XXDC 1QSED 1ZDSA 2OQJB 2PF6A 4MLIA 5BUGA 4DP1X 1LEKB 3D69B 3S2CA 1VCAA 2EO9A 4HOMA 4YHOL 2WINB 2XIBA 1QLEL 1M90W 2DH3A 2HAZA 3FZUC 1R24B 3IDXL 3RA7H 3NA9L 1A6WH 1TQBB 2A77L 4JE4B 4AXWA 2F0CA 1VADA 3LRHA 4P9HL 1N6QH 3FPYA 3PFQA 3OXSB 3RE0A 3O8XC 3STZB 2OSYA 3O2DL 2EZPA 1FZOA 3QFGA 4U6YB 4TUUA 2AEQL 4DVRH 3ULVL 2CBPA 2PYLA 3CD6V 4DV2O 3RWHB 2CSPA 3U6RB 2DQ0A 1GZPB 1PLCA 2UZYB 2ATKA 1JXDA 4OB5L 8FABA 3DC0A 3N0AA 1COBA 4J4PA 4I0PC 4NN7C 3QXUA 4RZCA 1U8IB 1UQSA 4QNPE 2EIEA 4AZ8A 4DP6X 5ACZB 4ZUUB 3FU0A 3RDTD 3V4LA 3RYIB 1K92A 3ARGB 2YEZB 3VQVA 1JF1B 2KH2B 2C1PB 3O6LL 1A5FL 1UC6A 3TPKA 2HFTA 4H13B 1UM6L 4X4YA 3B83A 4XP9H 5DO2C 5JQHC 1FL3B 3RL2A 3WY3A 1EEYB 5SWZE 3F64A 1SM3L 3SZ6A 1JNLH 4RISL 3SGKA 1A8ZA 2HJLB 3SD5A 4OCMC 4NRYB 1MCQA 2WUBH 1RUQH 4BRJA 2ZE0A 2CPUA 1T89A 3W9EA 5AOZA 4BRVA 2YICA 5SX5H 2D7QA 3RL1B 2D03H 1KXQE 2M26A 2ROYA 2C3GA 3WEAA 2UY7B 4U1LA 1WJZA 1UM5L 1B4JH 5DC0A 3FQXB 4PB0H 4M6AA 1TVKB 4GI6A 5C09D 2AK4A 3BKYL 2NY3B 5D1ZB 4AL8C 5JHDB 4YHHO 4QRBA 5FUZH 3FJTA 4ADJA 4AQEA 2JCCE 1OW0C 3SR2C 5IVZA 1QTYT 3QDME 1BAGA 3CSGA 4G7VL 1UB5B 5CLXA 1NL0L 4ZMZA 3MJ9L 1IBLO 1XCQB 2WZ6A 3MJ7A 1NOAA 2LLLA 3AY4A 4ZPVA 3MOBH 2FBOJ 2JK5B 2V5YA 5DRZB 3IKKA 1GOHA 3CC5A 4CU7A 1KJ3H 5DK2A 3VYOA 3H56A 2WZ5A 4OCLC 4L9LC 5KHKA 4DV6B 5MEQB 1H3PH 1XL4A 1NFIB 1UT1A 2ED7A 2DQ6A 2NY0B 3TT1H 4EBQH 3FT2B 4K94H 4AWJC 1SDDA 1AE6H 4DEPB 4MJ6B 2FNWA 3WDJA 5FKAA 2LTQB 2EDEA 5D7KE 4U6VL 4XMKL 3WKNA 4EN2A 3MLXL 2AJUH 4F7PA 3VXTA 2JH2A 1AROP 5KHJA 4JI4O 1C7TA 2CRZA 3LN5B 5IJVB 1G9NC 2WBJB 4PRID 5K1PA 2Z0AA 1KTDA 1JSYA 1ZKAA 3SBQA 4DIXA 1TU2A 4NUPA 1BFOA 1C16A 3BP7A 3D9AH 3UC0H 2BE3A 5BVPL 1OSPH 3O3AA 2VLRB 2C3VB 2BVYA 4IIJB 1PF3A 3NABH 1QTSA 3X3FH 1DBJH 3WOVA 5CIPB 1FPOA 3DKHA 3F6LA 1B6UA 3FW6A 1HS6A 3OGOE 5D7JB 4GSDL 2CWRA 1VQMV 4GO6B 5MENE 4GH7B 2NW2B 3IS1X 3N44F 1JAEA 1H38A 1T04B 5FECB 3ARFC 2ADIA 3FCSB 2E7DA 4F5CE 1WK0A 4X4XA 2A77H 5B1CA 3RGVC 4DR4B 4P9HH 5I5JA 3O3DB 3S97C 4UAHA 3CE1A 3O2DH 4C54A 4O2FB 2J20A 4XPAH 5I5MA 5D1QA 3CPWU 2AEQH 5ABAA 3SO3C 2KHAA 5IROC 1FNGB 2NY4D 2I9LB 5HI4C 1BHGA 4UM9D 4KRMB 3U0PB 2C9AA 2H6PB 4WUUA 4X0KB 2AABL 1EAPB 2XLLA 5KYUA 2QR4A 1GW0A 2VC2L 3HG1E 3MLTA 4WY7L 3ZHSA 1JCKA 1TJGL 1WZLA 4AY0A 5LXVA 3K5MA 3T0VA 3W2DL 2Y0IA 3K74B 4E9SA 3RZCD 5AAMC 3SOBL 2XV2A 1JXGA 1DF4A 1BVLB 1WA8B 5FYKH 1SOKA 4OFDA 4IOFC 1IAMA 1R3JA 1SUJA 3V0IA 3LZFL 3WMSA 3O6LH 1CFNB 2GUZA 1S9XB 1A5FH 1YN7A 3VQ2C 1OXYA 4PGCB 4OF8A 4DV1B 3K9AA 4IKNA 3BP4B 3ESOA 1KACB 2OMVA 1J5CA 4QXTA 4ODTL 2XAFA 1CI3M 4JI6O 4LRIC 4K4KA 1AZNA 4M1DL 3S9DB 4QJ5B 5JNYB 2IW5A 4KX7A 4HH8A 2A2QT 1T6WA 1SM3H 1AXSA 1N0NA 5C0CD 4RISH 4I2XB 1V9PA 3AU1A 5BO1L 2OI9C 3BEVB 3KVDD 1R6KA 2DQTH 4P2QB 3KYNB 2WYHA 4G8GD 2QEXV 3ZRWB 3RJOA 4CSSA 5E94A 3AW5A 3K1DA 3UTSE 4X2UA 2CO2A 5D2NB 2W59A 5E51A 3I75B 3D05A 4X20A 4QWWD 1H3GA 3KDPB 5BXFA 4OLXH 1KELH 2GV9A 3VGHA 4PJ7E 2AK1H 1ZTMA 4K73A 3BKYH 2E3VA 1HNXB 4PJXE 4P2ZA 3ZJZA 3Q4HB 5ESQB 1FO0H 2DB8A 3QWNA 5GRUL 4G7VH 3MJ9H 5ERWA 4Z78B 5IYZB 1KCVL 4JFDE 1WAZA 4NM8H 5C0DB 4J3OC 1HHKA 3E8HA 4FXKC 5FM5M 4M5ZL 4YSQA 1EZLA 3EDFA 2EYTA 2OKMA 1FYHB 4IU3B 3W9DA 5IW6A 2V9UA 2QWPB 4U3JB 2B15A 3HMXA 1I94O 1DP0A 3VI3B 4E9TA 3UTTA 4MVUA 1CK0H 3NYKA 4G6FB 1FG9C 2XFXB 4C56E 4PGEA 1DLFL 3CHQA 3KPNA 1QLEB 4XMKH 1I7ZB 3FB5C 4FK5C 4LWSB 3MLXH 1GKFA 1JV5B 3GI8L 2XN9D 4XP1L 5EH1A 1G6UA 2JCCF 3I6LE 2DKMA 3UZQB 4A2FA 1WNSA 1A7OL 2XG4B 2XBZA 4W70A 2PN5A 1DBAL 1NQTA 2EINB 3ETQA 5EBLC 3MTRA 4LVOB 5IBUG 2OR9L 5TK2A 3TBWA 3ZMUA 3O3EA 2YOAA 1PYWA 2Z4TA 1J8HE 3DRTA 4L8SA 4EKWA 1JUFB 1QNIA 2Z4QA 1I3GH 3CZEA 4G9DB 1OPGL 2V3EA 4NQVB 4UTAA 4ZMWA 5EU6B 2BOBB 3AGVA 4XO9A 1TEFA 4LVNC 4UT6L 2W8CA 3ULUF 4HEME 4HJSA 1QU7A 4ENEC 4PJAB 1CBJA 3QEHB 4I3GA 1NEUA 1NZRA 2VLME 3VQWA 3GXNA 4XXDA 5IUSA 1DVZA 4WF7A 5EYPA 2PNDA 1SXSA 3MRIB 3AVEA 1N2RA 5CUSL 3IDMB 2OL3A 3BWUC 1MG2C 3T6QC 4JE0A 1RU9L 4HK3N 5DRWA 3DROB 1NBVH 4XGZA 1ORQB 2YPLD 3JCZA 4KI5C 1MY5A 1AP2B 1FORH 1DDHA 4OZHF 2PCFA 4FKHA 1LR1A 1M93A 2YD9A 4ZTPL 3ZKXC 2CDFB 5H2BA 5HYSG 5JO5A 2NXZC 3B09A 1A2YB 1PX8A 2YDEA 2VC2H 1ONQA 4RAVB 4WY7H 5HGDB 5E6RB 1TJGH 4NO5B 3PY9A 3QUXD 5AVRB 2GY7B 3TA3C 4FFWC 4I9WD 1AOZA 4B9PA 3FDWA 3UZVA 5JA8B 4KROD 5IJ0B 3DK0A 2VJXA 2Y3AA 4GW5A 4JQIL 4OCSL 4YNYA 4XTRD 3LZFH 4GAGL 3UXFA 2P44B 2YEVA 2WPDG 4YAQB 1O5PA 3IGLA 3CYOA 1ZRUA 4YSRA 3DXAD 1C5CH 3PWNB 1OAXL 3HG5A 1IBKO 2DEYX 4N2LA 4QRRD 2Q6AA 1O6VA 3WB2A 5BO1H 3QXAB 4OLWL 4AYDC 3KG2A 5KSVA 4F37F 5ESAB 1CGTA 1CO1A 2BNUA 3QJRB 4K5LA 4NNXA 4EFBA 1FJ1A 3UADA 4IEFA 2HUHA 4G42A 3HI1B 4WWKD 5D9SB 1AQDB 3IJEA 3SKOA 4JGMA 3K04A 1QVFU 3GMRA 5BMFL 4AYID 4P46A 2QSVA 1BBJA 3L72H 3WJJC 3G7TA 4AGNA 3ZN1A 3WNIA 2I69A 3KPSA 2KKWA 2P8MA 5GRUH 2PTMA 3TZVC 5FYKD 2YRPA 1RQ5A 1H5BC 1ZS8A 1RZJL 2L0DA 1ERNA 1YPZE 1H15B 4QJFB 1KCVH 1MCFA 4DJMA 1UD2A 1OSYA 3JAWA 4Z76B 2OXGA 2XWXA 1FFNA 4X4KA 1FXKC 1YG9A 3MBEC 5CEZH 5LNDA 3QEUB 1DSFH 4XRCA 4D0CB 5D7LA 2D4DA 3O4LE 3IE9A 4JI1O 1H6EA 4GMSH 15C8H 2ZSVA 4NUJA 4BXSV 4LFBB 2W9DL 4MW3A 5A2CA 1LE5A 4KKPA 1BZOA 3MJWA 1OAZH 4JRXA 3FC8A 3HG0A 4AQYO 2VR3A 2GI7A 4N87A 1I1AB 3L4YA 5H37H 2CMRL 4OZ4B 4WI6A 3REWB 2QGDA 3IN0A 4PG2C 5F3HB 3WAKA 1WUNT 1A14L 5KN5A 5T1MB 1A7OH 3F01A 4LGRB 3AZUA 4WSJA 3ZKNC 3CVCA 1DBAH 1OTUD 4CDHA 1KXVA 8PAZA 1NM9A 2ITEA 1RSOA 2DDQH 1FIEA 2OR9H 4ZODA 1A6AA 4UVBA 4ZSOA 3MNWB 4Y19D 2B9ZA 4NNPL 1HI6B 2WXHA 1OLLA 3R66A 4P2AA 3S2AA 3UO1H 5DEGB 2E59A 2JKNA 1PNDA 1X9RA 1IUZA 2PCPA 2R59A 4LFHG 4MWFB 3JQOB 4Q0XL 5JIMA 1AZUA 1J18A 2X87A 4EPSA 5DN6G 5F93C 5F7HA 2Z93A 3BAAA 3N40P 5B3SC 4U2ZA 1EEQA 4Q74A 2QQNL 5KYXB 5IWAO 1MCWM 2KPNA 2IH1B 3PWLA 1UKSA 1JV2B 2CKBA 3DUUB 2WMPA 3I3DA 3LNIA 4NYLA 3EHBC 3WNMA 4UIKH 5BRZD 4P3WA 5CUSH 3ROOB 3MBWB 2QWRB 4E41A 3H9SA 1TVHA 2XXFA 1OTSD 3KAAA 4MXQD 4P23B 1XF2B 3G9VA 1AGEA 1Q94A 4KOCA 4U6XA 4LF4B 3F7YB 4OZFG 2PY5A 4ODSH 5J57B 2AAAA 1LK3H 5EEXA 4MS2A 2C26A 2EUWA 4ZMAT 4N8CH 3BH8A 1UACL 1R3LC 3ASOB 4JW3A 3FN0L 4OF6A 1JP5A 3IJYA 3MQIA 2XWJA 4JANA 3VD4A 2BVOB 5IESH 1XD1A 4JPVL 2DS4A 4BW9A 3ERXA 4FFTA 4N6RB 3L75H 1CU4L 1T0MA 2W1NA 4JQIH 4D9RE 2AQRA 4NM4H 4GAGH 2LHAA 3C9NA 3VXRE 2CGNA 3FRPB 4FS0A 4MJ5B 4EI6A 4OVVA 4XAKE 1J95A 1A6ZB 2YMXL 3QUGA 2COQA 2F2HA 4QF1B 4DP8X 4F33B 1LNQA 4OCXL 2PCYA 2WANA 4ODBD 4CDGC 1VEPA 1QO3A 1L9SA 1ZMYA 5EZOL 3HRZC 1OALA 4PLOB 5J11B 5D72H 1JPFA 5K9QI 1EHKB 1JZ5A 4L37B 3FFCE 4IKKA 2O6EA 4QRUB 2HG5B 5ID0B 1THZA 3GB7C 1A21A 3SDYL 2YSTA 1FFXB 4IS6B 2ZINA 5LGHH 1JF5A 5FPIA 5TE4H 2LP7A 3BYTA 2EDBA 3OB8A 2IAMB 1Q86W 3F00A 4BCXA 2DJMA 3JUZA 5BMFH 4NNYA 1O75A 4XDLA 2Y4TA 3A5VA 4WNJA 1I8IB 2PXYB 1SQVH 4JTAB 1RK7A 4R3SB 3P9WB 5CSZA 2E5LO 3FFQA 4QYOB 3CP1A 3QG5A 3WB0A 4DVBA 1JZEA 3FONB 1U8OB 3QNYB 4Q14A 4JGNA 2NR6A 4N9GA 3KGTA 5C7ZA 1JNNL 5IT2L 2WQSA 1F4WL 1UB6A 3DIFB 1DE4A 2F74B 3ESUF 2O4EA 3GSUB 1A65A 1MFVA 2FSEA 3FO0H 3TEXA 5ABZA 1LM8V 1YHPA 1KWKA 1OSEA 4WVRA 4FQXD 2VZVA 4PEEA 3LCYA 5JQGA 2G9HA 3AUWB 5KJ7E 2HR3A 4WI4A 2D2OA 4AI8A 5DD6A 3FD9A 3CMEV 5IB3B 1RKRA 2CMRH 2OZ4L 1HNYA 2G75A 4O4YL 4ZKIA 1BQZA 1A14H 4AGLA 1X59A 4OIIH 2HFFA 4LKXB 2ZF9A 1JPSL 1ET7A 5D1XD 4GW4B 4YHPA 1KQSU 4CJ0A 5FX3A 5C8YB 1U2YA 3NIFB 3S36X 1V10A 4GKNB 5BJTB 2ESVB 4L5FE 1USZA 1K4CC 4FNTA 4PS7A 4XNZB 3QZMA 1XGPB 4RNRB 1DF5A 1YMMB 1HEZA 3FH8A 4N25A 1Q4NX 2WKOF 3WO4C 3PNWA 4GQRA 3QUKB 1AR1B 3EBGA 3WS3B 5CEZD 1CDYA 4MTGA 1P53A 2CU9A 5DD1H 1NIEA 2WD0A 1ODUA 1TSHA 1XQ4A 5IIEA 3OUSA 4LOUC 3U30B 4UCUA 4RH4A 1ZSDB 2QQNH 1KLFA 1G7IB 4LBEA 4LCWB 3PXLA 2PUQT 2QSCH 4Z7IA 1BJ1J 4XPTH 3ZT6A 2HX7A 2GBTA 5CBAA 4OFVA 2DQEH 2V7NB 4FOMA 5I1DB 2EEAA 4L8JA 4U1MA 2RFXA 4YBHA 1XH1A 3JD2A 5HJ3B 5ISZB 2B1AL 1KLGA 4A2MA 4R97B 1QFOA 4X7TA 2J1WA 5CBEB 1D7CA 5IQNA 4LLMB 3TCXA 1JFFA 1S46A 2Z91B 3FN0H 4BUGA 2P42B 1Y74A 5G55A 4I4TB 4WWOA 1WBYA 1IVTA 3APQA 4JPVH 1QR4A 4WNQB 4X6CE 2PZSA 4NO0A 2ATKC 2CM6A 1CU4H 2UXBO 4JO1L 3VXSE 4BFIA 1XIWC 3MV9A 4ODXB 1RZ8A 3NMEA 4OJYA 4MNGB 4TRPH 2Q7YA 4J4PC 4O5LL 1GSMA 4LHUG 5KBPA 2CJ3A 5CP7A 5L2JB 2QA4V 4FTDA 4HWZA 4F7EB 2C3HA 2NY6C 4JFOB 2A9NL 4OCXH 3C8HA 1UZ8B 3DC5A 1AANA 1FVCB 1L9PA 3EH1A 2DIEA 3CXHF 3BVWA 1N0LA 5EZOH 4B3SB 4PTTA 4OM0L 3H0TA 3TBYB 1MCEA 1BXUA 3F58H 5TFSL 3NFNA 2DKUA 5DZ9A 4O4IA 4PGBB 4B3MO 1S0VA 1RZGA 2FBJL 3T1CA 4X1IA 5IDJA 2ZXCA 3I3EA 4B0MM 5I6KA 4RMWA 1AHWB 2WLIA 3EYQD 1EUTA 4TQFA 3IBOA 3DX3A 5EN3A 4H8WH 3SGKC 4KV5F 2ZOKB 3N85H 4DQOL 4PJEF 1E7UA 1R46A 1T89C 4DUWA 1FUNA 2VITB 2ICWA 2Y6SC 2X6BA 4B3TO 3RWIA 5ALBH 2I7OA 2ZXDA 3E86A 4J8QA 3SQOL 5EEYA 4JR9L 1QHOA 2FYYB 1CDBA 2R2BB 5CZRA 3OLEA 2OYQA 1F4WH 4M1GL 5KZCD 4GRLA 1F4NA 2KYIA 3L3KA 1QBLL 2BCKB 3RU8L 2JKIS 5IEHA 5L3FA 1LWJA 1F6FB 5LYJB 2EIKC 1EPFA 1N0XL 2D31A 2NYKA 2V2XB 4OZGB 3VXME 1OCCB 1IGCH 1A1NB 2XTJD 3AY4C 4ZFOB 3ABKB 3SKNB 3TBVA 5FDWB 4FN0A 1OP3H 1N4XL 5E6IB 4H40A 1OM3L 3AS1A 4U7SA 5L0QB 3DO7B 2DTML 3BEHA 2OZ4H 2P8PA 3IGKA 1OE1A 4AJWA 4O4YH 2GKIA 4R96A 4X9BA 4PLKD 1M56B 4FMFA 3RIFF 1JPSH 1KBVA 3QWOB 4HBCL 1ZCRA 1KBGL 1ANUA 5E1HB 3WL9A 3GUTA 3VGBA 1ML0A 3HHSB 5F9OL 5E8PA 4JX0A 1LTXA 3WHXB 1CFMA 5IKCA 2J73A 1H3UA 1PX4A 2QGEA 2V1DA 2W92A 2NUTB 2ZAGA 3KPLA 1XNQB 4L1HA 3S0PA 4Z1PA 1F42A 3QORA 3TS8A 3CC7V 3VNZA 1EHNA 3GMOA 4JKWA 3A6CH 5DHVB 4E9QA 2WVVB 3NCJH 4N2EA 1GYAA 1SERA 2QPSA 2XVGA 1PZCA 4PBXA 4G8IB 5J7CC 1AVAA 3BC9A 1B9KA 2Y7NA 3IDNA 4ZFFB 5LGJB 3UERA 5C70A 3L5JA 1DL7H 1T1WA 2EXTA 3MLYL 1GJIA 2JB6A 2G5BB 3DURA 5BZBA 4HJIA 5EZJA 1O6TA 2QTEA 3V6FA 4V1DD 2LU3A 5JYMA 2Y24A 1HN1A 3RYMA 3I50L 1IXMA 4NPKA 5IHHA 4AG4L 3JV4B 1WAAE 3FO1A 4NZRL 3LTVA 4FLXA 1QABA 3QXDA 2JS5A 2ZWNA 3AM8A 1HH9A 3NCWA 2Z92A 2XXCB 4NBZB 1E5YA 4FFBB 1IGFL 3GKWH 3DSQA 2WQRA 2FQGA 3B2MA 1IFHL 2EVFA 5D1QC 3OBAA 3T8MA 1IKFL 3Q9QA 3GRGA 1Y66A 3T1YB 3OWEA 1S7TA 1A1MA 5CB4B 4MYWB 3LV3B 1KN2L 3KCPA 2IGLA 1NGWA 4RQEA 2VABB 2X4TB 4D9LL 4JO1H 4BZ2H 1OARL 4PI0A 3VJ6B 2GEQA 3QEGH 3IYLW 4O5LH 1L0QA 4ZMOA 2DW5A 1T66D 3QAZC 3MRHB 2FD6H 5CHNA 1MXDA 4B9ZA 1CXLA 4JMNA 2EQDA 4EI5B 4N28A 1PG7L 4G27B 3E1ZA 4K5PA 4MX7A 3FX7A 4WAFA 4Z7NB 1E9QB 3BUDA 5BNXD 4JI3O 2VTFA 1R3JC 4Z2WA 3QEQB 4JM2F 4GKJB 4ZTEA 3SKUD 3MCLL 3LXBA 4OM0H 5HDBF 1FE8H 2JWYA 4EUPB 2XWZA 3D3IA 1XGYH 3CBRA 3FBKA 5D1QE 4F1ZA 1CGSL 3EJYC 2QVTA 1RERA 2WQUA 2F54B 4DOHE 1ZK5A 2Q5BA 2K7QA 1OCRB 1Q6UA 4NLHA 4NO3A 2VR6A 4P05A 3O6KL 5FW6A 1G6RL 1Y18A 2DL2A 4LDCA 4JPSA 4WUUE 4X6EB 5IB2A 3GWOA 1RK0B 3LH2L 1OVZA 4KXCA 1ZT1A 2EO7A 4BIUA 4QHLB 3OKDB 3OAAG 4FQJL 3OG4B 1ETZA 1IIIA 1BD2A 1LNUB 4P9OA 4KVNH 1PG7X 4R90L 1KB5B 1S2EA 4IGBB 4GG6A 2YR3A 4GKOA 2VLJA 3HW7A 4NRXA 3SQOH 2PPCA 4JR9H 1OP4A 4G59C 4XO8A 3QI9B 1J1PH 4ZXBA 5JDSA 5JIHA 1AGBA 4YHLL 4BXVA 3C87A 5LGYA 1BDYA 1H0DB 2FSDA 1MJJA 4H8VA 3RU8H 4GEJA 5HYJA 2WSSG 2YIAA 2WNWA 1JG9A 4GAJL 4PBWD 5I1LA 4HMEA 3IFXA 4EDWL 2GK0A 2A6IB 3HKZA 1RJYB 4ZMVA 4B08A 2QWQB 2FAUA 1ID2A 2RR3A 2VRZA 1Q1JH 1KY6A 2DBJA 3EH2A 3W56A 4QRTA 1WFOA 4X65B 5JMOC 5BZXA 1N4XH 2ZX7A 1OM3H 4K3DL 2DQGL 4FQCH 3Q13A 1A6TA 1KCKA 4M5TA 2DTMH 1M57C 3GZKA 5C0AD 1G7QB 4XNMB 4ICGA 4WTWA 4NBXB 2OMZB 4C83A 4L4TB 4MQ7A 2E56A 3IGFA 1VSCA 2E9IA 1CD0A 3KYOA 3I84A 3GO1L 4BH8B 2GI0A 4LSVH 3QUMA 3W11C 4PLNC 4HS6B 1F8TL 3H1KH 2MQCA 1GH7A 2JQZA 2OYLA 4QXVA 3V10A 4X6DB 3KG5A 3RTQD 4U6HA 4EFEA 2CHXA 3IRZA 3BSGA 3WKYA 4KGLA 1TETL 3LRLA 2DYPA 3KYMA 4NENB 4WEMB 4ABVA 4ALAC 5EOTB 4KUCD 2DQMA 4WEBL 2OV0A 4HLZH 4EDXA 4KQ4L 4O58L 4ZAKB 1RZIA 2OJZH 4NT6A 4QMEA 5ADPL 2X1PA 4L8SC 4E5XG 3U2IA 2R29A 2D2CB 1YEGH 4XP6L 4HIXH 5AKTA 2NX5B 5C07D 3UTTE 3TVMB 2VWKA 3BSZA 1GOFA 2IQ9H 3FKUS 1GH6A 2B9BA 4L3EB 4DV0B 4U4BA 5GPRA 3SE3A 3X1BA 5KSBB 2X10A 3G08A 3STBA 2E0PA 5CLTA 3NCXA 3AAZB 3I50H 5DZOA 2UWEA 4FGMA 5DTFA 4AYSA 3SGIA 4G7YL 2N0MA 4NZRH 5GIRA 4NKIL 7CGTA 2QVKA 3O6ML 4TULH 4GOSA 4FFYA 3OD4A 4HOXA 4Y4KA 1IGFH 3RIAF 1OCWL 1YCSA 1F2XK 1NMAH 2X2UA 3S5LG 4EOWH 1G84A 4KUMA 1E27A 5GJTH 2CHNA 4F7TA 2HWZL 3MUZ1 4M6OL 2DWDC 4XODA 3SPVA 3V95A 4DP4X 1KN2H 2HJFB 2P5WB 4UIMA 3PXHA 5ICXA 4D9LH 4X62B 4XNYL 1OARH 4GBXA 4LOEA 4UNVA 1IL1A 3QR2A 2DIBA 4Z7VF 3DOSA 2BC4A 1PKOA 5F44A 5G2NA 4ORGB 1WAAF 2VO5A 3F62A 1P7KB 3VWKA 1JHTA 4J3VA 4JJ5B 2CUMA 2PMZA 3SN6N 5DVOA 2LAGB 4FQPA 1O6SB 5LKNA 4Y9BA 1ACZA 1SXNA 5KG9B 3ROLB 2P48B 2V8MA 4LEEA 2BVQB 3VTAA 3H3KA 1JRHH 4UOW0 1KUMA 3T1HO 2R1XB 4X6FB 4UINL 3CDGB 2AGJH 3EGXB 1WPCA 4ZUVB 3V0WL 1G6RH 4YJ3B 5JOPD 5IUCA 3EYFA 3TBSA 1U8NB 1W8EA 4OFYA 1F4YH 3T1FA 4JG9A 3RVYA 4ATTA 3TCLB 2CLVB 3GF8A 1G9EA 4P57B 1FSKB 4FQJH 4QTHA 4Y4HD 3WFZA 5JQ6H 3HKEA 4WNSA 4N0CC 4BKLA 1MI5D 4R90H 2X88A 5GRYA 1HWWA 2ODHA 3O9WD 5GJSH 4POYA 1CE6A 2AV1A 3V0VB 4PJ8D 3QIUD 4P46C 5EF3A 2Y07L 1CPUA 1D5XB 1BZQK 4I55B 2WIIB 4L4VB 5IOPB 2HKHL 4X5XA 2CO7A 4LZKA 4GAJH 1IBMO 5TGBA 4OV5A 1FA4A 1UG9A 2D8KA 1G1CA 3P30L 3RX9A 2YIBA 1DJXA 5BQ7A 4IHJB 1NI8A 3CEIA 1EJ6A 4JB9L 1KCSH 4LAQH 5FFGA 2OK0L 4K3DH 2DQGH 4MNQA 2IQAB 1AB3A 1OLZA 3GSNA 3MNZB 5L4IA 3BO8A 2BZCA 3O6FA 4WJG3 5GGRB 4PLJD 3Q9PA 4XDKA 4WBNA 3QUHA 1MFBL 4OCYH 5TH2A 2YI8A 4H88H 1CFSA 2JI2A 5C0NC 2A3QA 3KJ4C 1HOCA 1O0VA 3N43F 2K1EA 2FJUB 1RM1C 3B34A 4KO6A 3QK0A 3WNOA 4KQ0A 4NQEB 4KZDL 1E2WA 5C08E 4B9FA 3NAAH 2AZUA 4S0HA 2PP9A 3CSYA 4AH2A 3OKMB 4KVCH 4Y16D 3L1FA 1S3RA 1KXVC 2FGZA 1UFIA 4P9ML 4FERA 4CC4A 3UPAA 1XMWA 2X3BA 3PAUA 4O58H 3ZO9A 3ARBA 2YXHA 1UH3A 4TSCL 1NC4A 1VFAB 4Y1AD 1L9OA 4JFHD 4XP6H 3CLFL 3QHTC 5HPOA 1GN2A 3FO9A 4JRXE 1Y67A 4UOZA 1Z9SA 3EXLA 1JE6A 1KG0A 4PJ9A 2F7RA 4S2SB 2ORBL 4BWAA 1EEZB 1S7UB 1I9RL 4CBPA 2UUAO 2OTUA 3JWNG 1CDCA 4MZIA 4J9YB 4YDVA 1NR1A 3H1ZA 5HHQB 1OV8A 1FHNA 1YEJL 5A2JH 3SD2A 1DDTA 3O6MH 5JLZA 3BKCL 4Y5YB 4B95C 5JCOA 1F45A 4NPJA 3ETBF 3H4FA 2YBRA 4PY8J 1JGDA 1J5OH 1FZJA 5ADOH 3NN8B 3PGCA 3PJSA 5JPNA 1OCWH 2NY5L 4LLQA 2HWZH 1USQA 2GT9A 3ZBMA 1W0YT 3G6JF 4KXDA 3E2HB 1FDLH 1FVDA 4F37K 1U8HA 1DN0A 2IADA 1EXGA 3MKKA 1ZEAL 2QADB 4H1LB 1XZWA 3IMWA 5JIPA 2EZ0D 1TZOA 2BW5A 3D4CA 3MUGB 4DW1A 2L7UA 1II4E 3GM8A 4HUXA 1S7RB 3BSHA 3RWRD 5SV3A 4DQAA 1NM4A 5SWQB 3NSCA 3IU3B 2ZAIA 3OJ2C 5EU7E 2CTWA 3GS0A 3R0MA 4JPQA 3NGBC 2ZCEA 5GS2H 3DDFA 2VN4A 4GINA 4PDMA 4E41E 2VQTA 3H9SE 3CFJB 1J7VR 2E76C 4HCRL 5TK4A 1P4LA 1MJ8L 4AQZA 3CZFB 3CCHB 2P49B 2Q86B 1D5MB 3DETC 1AZZC 1U3HD 3CSFA 5F89A 5B38A 3L1GA 4E4EA 4LCIL 4CJ1A 4IT5A 3CXCU 2C3WA 2KG7A 4QXWA 4O02L 5FM5O 2IANE 3UJIL 3V0WH 2AZAA 3W3BA 4JZNB 4ZPTB 3U82B 1HNZB 3F04A 2ZWKA 5C09A 4F1SA 2BNRE 5T3ZE 3U0TA 3FXIC 4LSQH 5BZDA 5CN0A 2O30A 2CH8A 1WTLA 2AHIA 2AQ2A 1WFIA 2OQJA 1XSKA 3WNJA 3D69A 3RPKA 3IAYA 2CGYA 3B3BA 3T4ZA 2WINA 2Z35A 3RYHA 3NZ8B 1MNNA 1GKOA 4PRPB 2CRMA 1UURA 4YDJA 2DLGA 4MDIB 2GHZA 3LOWA 1YY9D 1X6NA 3ARPA 3CRRA 2HX9A 2MEJB 1JWUA 1X3DA 3BGMB 1PSKH 4M1CC 4WZ9A 4K07A 2NR6C 2NYYD 2Y23A 1TTFA 1UOKA 2IWEA 2ZYIA 3P30H 3JTTA 3R19A 3LEVL 1J10A 3U6RA 2YKLL 3L2LA 2WXJA 1IZ3A 4YY3O 3OJDA 4PJGA 3V6BR 2XG5A 1QRNB 4BZ1H 2OK0H 1JWSB 3VFRA 3K3QA 2X4RB 1M7XA 3MN8A 3MUUA 4HIQA 4XI5D 1IAIM 3KLHC 3BHPA 1NGZA 2GK2A 1IAKB 4F9PA 3M7OA 1KBWA 4HXBL 5CEYA 3P2TA 5ACZA 1BHBA 2OP4L 3ZTEA 3H2PA 4PRIA 1TTUA 2JJWA 3B9AA 4TUJB 1EO7A 2HN7B 4JFZL 1RAMA 5FS5A 3VXNA 5HFLA 3PAVA 4FABH 4DHLA 2TRHA 5FA4B 5LXGH 2QKIB 3PGDB 3UJJL 3DGGA 1BXAA 2GSIA 1WSST 1F3RB 5FC9A 5FF6A 4MGXA 2EZOA 2Y1AA 3ZTNH 4AMXA 4NKMB 3ESMA 1FL3A 1KGJA 3DV4A 4YPGB 5F7LB 5B4MD 5J5EA 3PWJB 2CDGA 3L9RB 5EOCL 4Z0XB 1T3FA 1S7XB 5DSCB 3MRDB 1KSRA 3U36B 2FVNA 5C9KA 5CN3A 3VAEA 4B60A 1QOKA 5D70H 4CAGA 4K7FA 1QFWI 4MTOA 1JL8A 2AEWA 3MV8D 4HUWA 1Q6HA 4HIJB 3RRQA 2IH3B 2Y5EA 5HHME 2H3OA 3RL1A 3U2SA 2ORBH 3U11A 1I9RH 2CCWA 1BQ0A 2JTYA 2Q68A 4JREB 4Z1VA 4QDGA 3W0WB 4RAHA 4DR1O 1IGML 2R15A 2BTQB 2P6JA 2VMDA 4TVPE 4LBEC 2XVBA 3A6BL 1BYPA 3EF7A 5D1ZA 4BQ8A 1R5VB 2VR7A 4UM9A 5IVXB 3ZL4H 4MAYB 5H6QA 5ACMA 4ACTA 4XH2A 1UWGH 4MB4A 3CPLB 4UV4L 4GFXA 3BP6B 4BUHA 3BZEB 4KXBA 4XR8C 4L1BA 5KBDA 4JASA 2DWEA 4PRHD 5CGMA 1XI1A 3RZCA 5JA9A 3AADB 1MWAA 3LB6C 1Q0YL 5D8JH 3MFFA 1DCEA 3D3VD 1NFIA 5GGVL 4ACPA 1SN5A 4FF9A 3BN3B 1UYWL 1GOGA 1RJLB 1TJIL 1JA8A 4ASUG 2WWNA 3IN2A 5MERB 1NGXA 3P0VH 3G5ZA 1VB9A 1GSKA 5C0CA 1XSOA 5ECGA 4XPFL 5A16B 3P3YA 3AG3B 1TDQA 2BDNL 1EGJL 5IJVA 1AP6A 4LQ1A 1JPEA 3L6FB 4G8GA 5IMLB 1NFDE 4HMCA 4LCIH 1DUZB 4K35A 4LPUA 4TNWF 1N7ML 2K8MA 3GDCA 3UJIH 2XV3A 5J3HC 1VDGA 2Z3FA 4Y9CA 2ENYA 2EE0A 1ECYA 5FM4A 3VFWB 4JHZA 2XOKG 4WWID 4MD4A 4CC1A 2IALA 2NUPB 4FA7B 2YA2A 2Y4UA 1BQUA 4DGIH 1AI4A 4UFZA 3MV9E 2NW2A 2CIKB 4QRQA 4L1TA 2QMKA 1GN4A 5EBWA 5I1AB 1PJ9A 4P2CG 1P5UA 1ZJAA 2XQYG 4OD2B 1MCSA 3ML8A 1CTOA 5EIBC 4ZI7A 4HYTB 1IO4C 1AACA 4DGYL 3AG2C 1LQSR 4DRXA 4FXGB 4ZUTA 1MG1A 4O2FA 3KPRD 4U0QB 3NACL 2JIXB 5DHXB 5GS2D 3VG9B 4NAQA 2HT4C 2OMWA 3ALPA 2MTPA 4LP4A 2FL5B 4PBDA 4BKSC 1BS3A 4KJWD 3DUSB 2XN9A 2H6PA 3P3PA 1S76D 1O7SA 3K72B 2YOCA 2YPVL 4P2OD 1I08A 2YQ2A 5F7FA 4NERA 1REIA 1OO2A 2OP4H 2Y2YA 3B3IA 1UENA 2YRBA 4XWOD 5DD5L 3K46A 2PPEA 4JFZH 1MCNA 4BDVB 2EDHA 1WRFA 1G1KA 2FJFA 2FWUA 1SQXH 1Q38A 2L8AA 4PHZA 1ZA6B 2IV8A 4BKTC 2HCZX 3OZ9H 4PGCA 4HFUL 4UNUA 3P77A 1MJ7H 2RH0A 3BP4A 3LPFA 1A4JB 1KLUB 4KJPD 1JGUH 4H0LB 1KTRL 2DM4A 1A6PA 2O26U 3IDYB 1XWVA 1GM8A 4PJIB 5AD0B 5JNYA 3HFMH 4X99A 5EOCH 3KL3A 2J8UF 4OT1L 1FL6B 3QORC 4ZI8A 5F1OB 2Q8VA 4JFFE 1TO5A 4NQCD 4BFOA 4QOKD 1NCOA 5DUBB 2MCAA 1MNGA 1IBGH 1E8XA 3GMQA 5TJWK 4DERA 4F7MB 4GUPA 3RNKB 3ZUCA 5KS9F 3QQ4A 4B50A 3ETDA 1QKZL 2EDLA 5EEVA 4JN2B 5E00B 2P24B 3UYOD 4AE0A 4CVWA 1IGMH 2YPLA 4AIOA 4XVOA 3A6BH 4ZZFA 4DR3B 4XBMA 5IK3A 3UPCA 4EZMA 2IFGA 4PJHA 3CXHK 1U8JB 1SLUA 2AQSA 4UV4H 5C0BE 3INOA 4O02B 4U7MA 5IYZA 1DUYB 4NVPA 1IEAA 2CR0A 2AJ3B 5KBKA 3QUXA 1HKFA 1U93A 1I7FA 4I9WA 1WZAA 4J3SA 4OCNC 4OJFL 3N9GL 2VZTA 3AM8C 3NPSC 1KYUA 3S3CB 1Q0YH 1Z2KA 3F5WB 3IFOA 2HG0A 1SN0A 2BZ7A 2MKLC 3A4EA 3ORJA 1IBKB 4JDZB 5KTEL 3ULUL 2CE6A 4CVXA 5GGVH 5LGKA 1QVOA 2DYSB 4LB8A 1UYWH 3CQPA 3PV6B 1R5WA 3DO4A 2BW4A 1T6BX 2NY2C 1TJIH 1UWEL 4JRFA 3DXAA 1RZ7L 4HK3J 1KULA 1JV5A 3P11H 1GY1A 3MSPA 3SDDB 4DZBB 4QRRA 2ZXWC 1Z9NA 2XX1A 4XPFH 3O2DA 3V4PB 1PPJH 4IOIB 3DARA 3DMMB 1EGJH 4XXCA 1DLBA 1RVFH 2QTOA 4LKCA 1EANA 5CBGA 6PCYA 1MZEA 1JFQL 4OPHA 3N41F 1VJSA 3ZOAA 5BUPA 4WCYL 4WWKA 4CH4A 3ILPA 1WWCA 1FJGO 4F24A 3BY6A 3VXPA 3MLUL 1HAWA 2AW2A 2BOBA 3HS8A 1NUGA 4IK6A 4R5XA 5F7UA 3HZKA 5CO1A 2IPKB 5LOVB 1TCRB 4AKQA 2CHZA 3BKML 1BQ5A 3BJ91 2KQNA 4HWBH 2COVD 2H3NB 3DGCR 3RIFK 2UU9O 1WO2A 4NZJA 1DN2A 1ESOA 1SY6H 2ADYA 4LIQL 4NQUA 5HYQA 2X05A 1ZXQA 5M95B 7FABL 5T1KD 4RMSA 4DGYH 4F91B 4J6IA 3QUZC 1M05B 2VLKB 3DROA 4OD3L 4TL5A 3NACH 4RMBA 1PMYA 3I9AA 4ZXBC 1X6LA 2YD7A 3ILDA 3N1GC 2WAQA 5J13C 5TD4A 4V11A 1CT8B 3G9AB 2X4PA 3EGDA 2E7MA 4FLQA 4W4LA 2YPVH 4KKLC 1GYCA 2IO5A 4XP4L 3VMPA 3ZZLA 1S9KC 3VW3L 1S7SA 1KPRB 1E4XL 1O5DT 4DGWC 3T4DA 3BPCB 4HD5A 4GI9A 5GGQL 5DD5H 1M7IB 5D2LF 3LD8B 1VGKB 4NWUL 3RVVC 4AW4A 4Y19A 1IAOB 3OKNB 1FO0A 5DHEA 1XF4B 4GG6E 4PJDA 4YAQA 2XPYA 4DV3B 2YXLA 3MJ9A 4HFUH 4P4RB 1E1RG 1NUFA 1H8OA 4HD9A 3PWNA 1QSFD 4OT1H 3U7YL 5IBTL 2FHCA 1SA0A 3TGUH 4N2AA 3O45B 1YECL 1RZFL 5F7EH 1FZMB 4M6NH 4ZHQA 2R4RL 3KPOA 1E4WL 4UDTB 4HIIA 1Y0LA 1NDTA 2W65B 3BIBX 4W93A 3TV8A 1XBLA 3AXIA 4X8CA 4APXA 1AP5A 3IWVA 1NMCC 4QRPB 4NXMO 4A7VA 3QRGL 1BQLL 5I8OL 4K7PL 4O51B 2CBQA 2CGZA 4GB9A 3SE3C 3U79A 4PWKA 1T0NB 1XF5B 5F72S 5I19L 2KLTA 3KBPA 5T1DH 2C7UB 4QXUL 3ZJAA 3T9WA 1JYXA 5LGUA 4LESA 5D96C 1PZUB 2CR6A 4PW3A 2W0FB 5TTRA 3PCYA 1MLBA 5CMAB 5I1IL 3D08A 3E89A 4OVUA 4L18A 2NXYC 3HTLX 4OJFH 3V7AE 3N9GH 3ZMTA 2B5IC 4KHTL 3A21A 3EJZC 5BOZG 3B7TA 2FT7A 4Y4KC 4AL8H 1CP9A 1MAJA 3FHAA 4BSJA 4RETB 2HUEA 4UCFA 1WD8A 2XZAH 1MFDH 3PPEA 4CS3A 3R4RA 3UJTL 5FA3B 4MS8D 4OF7A 1XGUA 3DI2B 3QF7A 3F7VA 4F27A 3RKPA 1QR1A 1C12A 1UWEH 2VM9A 1I1AA 1D9KD 3X13A 4GBXC 4K7PX 2EDWA 1P9MA 3PQYD 2BX5A 3SOTA 5CWSA 3H1JH 4Q9CA 1OQXA 1H8LA 1I75A 4G1EA 1NAML 2VW6A 12E8H 3EFOA 2UWEE 2EYSB 1NS1A 2X4QA 1N6UA 3VWKC 1JFQH 4LPXA 5J8OA 1NPJA 2GB2A 5LBQA 2HRPH 2PWEA 4S1DD 5D7EA 3PREA 3BDBA 4ZDHB 5LLIC 3BW9A 3D6GA 1JGIA 2J55A 1CLZL 3FB7B 4DKEL 2AXWA 3JATA 3AJ7A 5H35B 1UD5A 2QJDA 2K9PA 3IU4H 4MWFA 4X98A 2FTAA 3NSDA 3QIBC 2VRAA 2L7JA 3BKMH 3RWDB 4LCUA 3MODH 5FO8B 2WWMD 2QJ1A 4JFED 4M3JA 3VFUA 1Q9OA 1S77D 2X0UA 4LIQH 5I6PA 2HP4A 2AJZB 4Z7OF 3QJVB 7FABH 2VXSH 3ROOA 1NTKH 3I2CL 1IB5A 4F2MA 2LGNA 2ADJB 1XF2A 1SVCP 2Y4SA 1HW7A 3A24A 4OD3H 3FB8A 4R6UA 3ZDXB 1MCKA 3M6DA 3F7YA 2WXQA 5GGRY 1IM3D 4FQXA 4POZC 4JRYD 4JY4A 5GGTL 1DZ0A 3X12B 1PJWA 4P59H 3RUGF 2BVPA 3NR7A 1NGYA 1WC7B 3VQMA 1KY7A 3DHPA 3VW3H 2XT9A 1YUHA 2WQXA 3F6IA 1OAJA 3F65A 5I6OA 2AQ1A 1E4XH 2YS8A 3B2UD 2YPKB 3NJGA 5HI3D 3UO8B 4JG1H 3QRFM 2Y48A 4O2BB 5GGQH 2VRKA 3DTDA 2Z0UA 2ICWJ 4NWUH 5J2TB 1D5BB 2Y1ZA 3IFPA 1VQ9V 3O6FC 4MA8L 4KNQA 4RRPG 4MJ5A 5F7DB 1GW6A 3HE6B 3QDJB 3CD4A 3B37A 4MA1B 3V5DA 4U3HA 3ESVF 3OKOA 3BHBA 3AT8A 3U7YH 3RVUC 3RIAK 5KOMC 1MAKA 4Z5RB 1YECH 2WB7A 3PHSA 1RZFH 1B90A 2X89D 4CC4C 2QPUA 4QRUA 2GBVA 1E4WH 2HG5A 5LL6Y 1G43A 5E23A 5ID0A 3ARBC 4NKOA 3BPOC 4IS6A 2A3TA 1XGQB 2CO1A 3SHSA 4MNQE 1AQHA 1HT6A 1P5VA 3DX1A 3ZY7A 2QHLA 4WQOA 4AVJA 2KL6A 2NNXA 2YD1A 4X7CC 2NTFA 1CQYA 2C9VA 3QRGH 5I8OH 4K7PH 2BIIA 5JW5B 2Z7YA 3OEEG 2W07B 1UASA 3ECBA 4PJFF 4R3SA 4PJ9C 2UXBB 2DMKA 3QNXB 4QXUH 3PYCA 4DGVL 1KJVB 4HF5L 4WHTB 5SWZD 1INEL 5I1IH 3CQFA 1HXYB 3IE4A 4ILDA 4JK0D 5JCOC 4KHTH 4PWHA 4FNRA 4KPHL 3WN6A 1XR8B 3KXFB 4JDEB 4JFSA 4LNVA 3B7RL 5E5MA 4UT6A 5JPNC 4DN3L 4QHUA 4MVOA 5CF3A 5IB4A 3OHMB 2XTLA 1NKGA 4PPTA 4HUKB 2GY5A 1FGNH 2MPAL 4FZ8L 5DJ2A 1IGJB 5DZVA 1THCA 3A8TA 2WWKO 2R27A 4LDLB 3TX4A 1WN7A 5FPOA 5DHMC 4MMZB 5I6XC 3K9SA 1INQB 1MREL 3ZE2E 2I25N 5EIIA 1Q1PA 4LKXA 5AVWB 3QDMD 4UQ9A 3T2MA 5I1HL 4AV0A 2WN2A 5JOFB 2QM7A 4N21A 5KYYA 5KX5A 3GT6A 4RLDA 1MSWD 2PW2B 3UAJA 1R6TA 1HC1A 4G6KH 4B3TB 4LFHD 1XGPA 3NSFA 2I85A 2NLJA 4DKEH 1CLZH 5A6MA 2G60H 2AXGA 1RIHL 3QUKA 3VX0A 4YSAA 3QZOA 4JZGA 2UXCO 4G9FD 4OI9A 4H20L 1RV6X 2YWZA 3OTOB 5CJ8A 4DTGL 1JGVL 3ULSA 1RHHA 5D7KD 3QNZA 1BBDL 4JQIA 3UEQA 4NSKB 2JKTM 1E67A 3DO3A 2XCMC 1OT1A 4WK4B 3ULUD 2Q6WA 1ZSDA 2KQMA 1E8YA 1G7IA 2J5LB 4TUOB 1CDIA 4ETQB 2WLLB 3AB0B 4OJDH 1MFCH 4KUZL 1OF2A 3O2WH 1BLNB 4UZGA 5LWYH 4BIKA 3I2CH 4JKPH 4LPCA 3VDCA 4EE2A 2A99A 1MHEB 1NBQA 4Z7WB 1L6ZA 4Y9EA 1TZAA 2BMKA 4PGJA 2X5PA 3HC2A 3QJHA 1TQBC 1U33A 2YFNA 2H32H 1BYOA 4QHNA 1UWYA 5GGTH 4HSCX 3L95A 3ARZA 4J3OF 4G7QB 1B6DA 2A5UA 4I4TA 3QQ9D 4KTYA 4P5MB 1XNRB 4OLYL 5FKPB 5C09E 3EBAA 5A2AA 5E4EC 3FUHA 4LOFA 1HVXA 4WNQA 2ERJC 3K0YA 5GSVB 4YQXL 4PELA 3DSFL 3LYRA 4QPEA 4MA8H 4F9PC 3JV6B 4JFYB 4RMQA 3NRPA 1QWNA 4Q6IA 3FO2B 5HPMA 1NCAL 3ZKQD 1JHKL 4JFOA 1OGSA 4APQD 4BH7A 5BRQA 2G2RA 1U3JA 3SYAA 3LKSB 3QSKB 1L6XA 2DQ3A 1MH5B 2E8YA 2FLMA 5ALCH 3K71B 4E9RA 4MCZA 3WIHL 3D0LA 4HISA 3QFDB 3TBYA 4NOFA 1WP8A 4WDIA 1AC6A 1EO5A 4NTYA 1XH0A 2NY1D 4AJ0A 1BVNP 3HJEA 1NQBA 2AJYL 2C9XA 2VGLM 3TN0B 2V4DA 1W72B 4V1DA 3G5YB 4Q20A 3ARFD 3ZPDA 4C57C 3VSQA 4RBPH 4OI8A 3BVXA 3ZHFA 4G1MB 2C9PA 4RMVA 1NAMB 4B9KC 4BIOA 1J48A 2Y25A 4ONOA 4IYKA 4POUB 2ZF8A 4PRIE 5EU3A 3CFKB 2H45A 1P7QD 1KJMA 4WJKB 5J12C 4I4WB 5IJBC 1NKDA 3LN4A 3MRCB 4YO0A 3B9KD 5LN8A 4AYFA 4HF5H 1YTFD 4B6ZA 2A9CA 1INEH 3S3SA 3UBXA 2NY4C 3WFHA 1T21B 2NY3C 3FAXA 4FKKA 2CLZB 5D1ZC 1BCIA 3WTUA 5DZLA 4Z9KB 3HIZA 4RDBA 5A2QN 4JI3B 3U1PA 4PJBA 3MZGB 1XTMA 4HALA 5DK0B 4EQ2A 1EJ8A 2V2XA 3V6OA 4ZNCD 3ISRA 2DWEC 1M6OA 3K0WA 3O3BA 1G7PB 2QL1A 3D39D 1EJFA 1ZTXE 1I4FB 3QC6X 4IOFD 4L29A 4FZ8H 3RZCC 1NCNA 2XQYK 1WCBB 3N3EA 4JHUA 1E79G 1UVQA 2X70B 5GS1B 1N36O 1SXBA 3F8UB 4OD1L 1DEEB 2F4VB 1MREH 4YDIL 5I74B 4DEPC 4H44B 2OPCA 3IJSB 3V5KB 1ED3B 3CFIC 3COOA 4P8QA 3FPXA 5CGTA 5IG7B 3WKQA 5I1HH 3W7SA 5DMIL 3BAYA 1MIEH 4JFDD 2O6FA 4TMPA 2QQKL 1CDJA 4O9HL 1WJ3A 3C60D 5DUPL 3VFPA 5DFVD 1PD1A 3J7HA 1RSYA 3QQDB 4KK6D 3UTQB 5KYWA 2QFRA 4GEIA 5LBVA 4I77H 5GZND 3LPWA 2QZQA 3IF1B 2A38A 1CLOL 4LF9O 2WVVA 5B1JA 4KK9D 4C56D 4DTGH 1JGVH 1KIQB 1HCVA 3D4ZA 4QWWC 1A7PH 3MOQA 1CD8A 2H1PL 3H7BB 4M7LL 1NGQH 4YHYB 5LGJA 4H26A 3L5WB 3S4SA 3ZE2F 4AC4A 3FQUB 5F1IB 3HOGA 2J3SA 4FLYA 2FO1A 5K39A 1A7QL 4KTDL 4RMTA 5DGRA 5C6WH 5DRNB 3C5SB 1CGYA 2D0GA 1UXWA 1N3NA 3G80A 3K6DA 4AYBA 3FT3B 5H9CA 1NLDL 1WGVA 4I8DA 3Q5TA 3T65B 5CJ5A 2RJZA 5CN2A 5C0CE 1J8HD 5EBWC 2V3FA 3VI4F 4JNXA 1P5UC 4JL2A 4TQEL 1LP9F 3F84A 1UJTA 2AVGA 2BP0A 1TMQA 2ZOUA 3IGAB 4CRPA 1TFHA 1CLYH 1HR0B 3H2WA 3QS2A 4G8GE 3M1BA 2PO6D 2KI6A 1K8DB 2DEWX 3N2JA 3LKPB 5C0AA 4WFFA 1YI2V 1AXTL 3BUYA 1HSAA 1AI1L 2R2CA 2FBRA 2YD3A 4TLTA 2VLRE 4LHUD 5BS0D 5CB4A 2VH5H 2ZP8A 3JZ7A 5FO7A 2X4TA 2C3XA 2VLMD 5I17B 4YQXH 1AGCB 4ZT1A 2MW2B 2L35A 1XH3B 3IAPA 1YEHH 4XNXH 3DSFH 2XACC 3ABGA 4HG4K 4B3RO 3WLWD 3EOAA 3MLRH 2BFVL 3Q2NA 1ZLVK 1QHTA 4TV3A 1NCAH 4GRWB 1KJ2B 4PJCA 4X5RA 1JDAA 1J5HA 1MA1A 3MV7B 4FLRA 1RLBA 3OL2A 3QEQA 1NEPA 1T1ZB 2GJPA 3LKNB 3GK8L 2OSLA 1V54B 3BGFB 1AH1A 3C08L 3N2GA 4TUYA 4DV7O 1C08A 3ARSA 3KNBB 3ZSTA 4PYHA 3ZR5A 2V0AA 2F54A 2AJYH 2GIXA 1X5JA 4MRCA 5F88A 5MP6H 2L04A 2XN9E 1GVIA 1RK0A 1JBJA 2OZ4A 1RK1A 2Y22A 1YQ2A 1Q81W 3D85B 1IGYB 1JNHA 1HZHL 3OKDA 4FXTA 3FQTB 2NQDA 2D3OW 2GSGB 3CH1A 3I6SA 3K80A 3THML 1E0OB 2GTZA 1YNTF 2BP5M 1N32O 3GRBA 4IGBA 1U8CA 1YQVL 5LJYH 2IXQB 3MNMA 2BIOA 3VUAA 2G3ZA 1EA9C 2B1IA 4GRMB 3JASB 3AITA 2FE0A 4G11A 4MNHA 3SZKC 4TNWK 4BCYA 1H8EG 4ELMA 4WO4D 3QUXC 3B4SA 1RZKC 4I2XE 3AS2A 3WUWA 3SJAC 3WEBA 1W0WA 4KROC 3TETA 1FLRH 3HUJA 4P2QE 2X40A 3T1HB 4TSAH 4XTRC 4FJZA 1S7VB 4TNVF 4AGOA 4L5FH 3OGIB 4OD1H 4XNMA 2KZKA 4J1UA 3P4LA 4P3CL 4YDIH 4JLRA 1B4TA 3L74H 2X3AA 4YDKL 2Q7NA 5DMIH 4BH8A 4M48L 2AV7A 2WVUA 1DQLL 1IBFA 4P9HC 4O9HH 4YGVA 4JFQB 3CDCA 3KLSA 5DUPH 2R1WB 1MHPL 2VDRL 3A4FA 5BZWA 3MGOB 1K8IA 3O4LD 4I5SA 1AOHA 1AFVL 4XXCC 3PJNA 2BM3A 3Q1SL 4LVOC 4KKQA 3K06A 3GBLA 4I9WE 1CLOH 4Y4HA 4HKXA 4X8JA 1HWYA 2VW7A 1QNZL 3E6HB 1MI5A 4FG4A 3IVKA 3D09A 1BF8A 4WWKC 1MRCL 1XL6A 4UOJA 2HSIA 2H1PH 1F58L 1AMXA 1T0OA 1ZD6A 3O9WA 3T4AA 3CIAA 3VI3E 4PJ8A 3QIUA 1M4KA 4A7QA 3DBXB 5F7NC 2BOBC 4M29A 4N0RA 3P3RA 1A7QH 3Q01A 3ZTJG 4ZTOL 4L3EA 1PY0A 3DXAE 2WOBA 1CICB 4MMXA 1VENA 2Y7QA 2Q7HA 3CVDA 1A3QA 2W9EL 1TITA 1DQJA 4GCZA 1NLDH 3F3HA 1ZT4B 1F3DH 2ZIOA 1OHHG 1FFPB 3GXDA 3QP3A 3ZS8C 5DJYA 2QPFA 4J3XA 1G7LB 1BHAA 4MDJB 2HTLC 3PIQB 1ZHKB 4MBOA 3ULVE 5BV7B 3MLZH 4GAYB 4DW2L 2H3KA 2ZM6O 2VQ4A 4OIFA 2VMFA 1A3LL 3B6SA 4X66B 1AI1H 5IGXL 3KPPB 3L17A 1EXUB 2EYRB 5EU6E 1EK3A 2KDGA 5EC2A 3MRPB 4EI0A 1DJIA 1CCZA 3KYKL 1EHAA 2P28B 4KO5A 1QASA 4NJAL 4R83A 4ORGA 1IRAY 1OTUC 2VQEB 1BVKA 2CCVA 1HSBB 4Y16A 3WLBA 5F6IC 1L9TA 2VE6B 3A0RA 1FAIL 1DQKA 2BSBA 4P07A 4Y1AA 3UMTA 2X9WA 43C9A 3W5MA 4PV8B 3GK8H 2UUAB 4Z3TA 1SETA 5GGUA 1V05A 4AENB 4EZLA 3OHXB 3C08H 1EX0A 3IETB 5KG9A 1NH2B 1DTUA 3TPUA 4GUCA 1MF2L 4MTFA 4CC6A 3CDGA 3EGXA 3MNVB 3ECQA 4WI0B 5DJ6B 1WDAA 3O4OC 3SDLA 1U8NA 4D9RD 3T2PA 3JSSA 2ZCHL 4TNEA 3I5DA 3VB9A 4XAKD 3OKKA 4UT7L 4OUUB 3T0XA 3THMH 2A6DA 2XWDA 1MHHA 2QM8A 5DJZB 1N5AB 1OTSC 4KAQL 4MXQC 4Y19E 5HDLA 5L4MA 3LKOA 3DTUB 4QTFA 3NVQA 1EAOA 3QJFB 3CWBH 4XX1E 1FFTB 4GUNA 1EXHA 2YXVA 3SCMD 4GKKB 2WLZA 4UQIM 1BT8A 3C6LD 3QJTB 5HJDA 1S7WA 4Y5XB 3JAKB 5EBGA 4UDUB 4FFKA 4YIQB 4TSFG 2BY3A 1CXEA 3JWNH 3Q6FB 1JR9A 5KHIA 5IV2A 5I8CA 5JPMC 2KT6A 4ZUSA 3Q48A 4H2CA 4S1QL 4FDWA 5FDYA 1HDMB 3CN1A 1SYSA 3S98A 3HN3A 2VQFO 3TK1A 3DYPA 1CE1L 3D2UD 3DVIA 3ECWA 5DEFA 4HWEH 2E6JA 4WTXA 1XILA 1KV7A 2VT0A 3F7VC 4V2BA 1QFWM 4O4HA 4PDVA 4YDKH 5I15H 4JG0L 1CLCA 4M48H 1I1AC 1GYVA 4FNLL 5JW4N 3MLWL 3ATBA 4OIBA 1DVFD 3KZIZ 3A47A 2BERA 2VQUA 2Y6TE 3QO0B 2EE3A 5AFAA 2JKXA 2J8OA 3OB0K 2ARHA 1ACCA 5B8CA 1VLXA 2H3XC 3Q1SH 4UMSA 3WFCL 3IMRA 2A0LD 4U1NB 3WN5B 4JPWH 1A64A 4HVBA 1MRCH 1YYLL 3IJ9A 3JWOL 3BVVA 1ACYL 1F58H 2X4OA 1JMKC 1H8NA 2A06H 5I9QB 2G38A 1KYFA 3CXDL 5K9QG 3CCUV 4P5TB 1EZVY 5JH7A 3AU0A 3NIDB 4G6ML 2FYUH 2BH0A 3RAJH 4ZTOH 3T4YB 1FFOA 1PNCA 2VL5B 3ZT7A 1EDHA 4S2SA 2A9AA 4BFEA 5IQOA 2O1AA 4LCUC 3TIDB 3LZRA 1A6UL 3P4OB 4DKFL 1E4HA 2V9TA 4PW9A 3CBJB 5T5NF 2ZUTA 2OX5B 5FGRA 3U0ZA 5A1AA 5DMKA 4FJ6A 4PV1B 1DQVA 2ZKYA 1E1QG 1K73W 3DV6B 4R7NA 1TOXA 3ZCCA 4LVHB 1A4CA 2ZSWB 3T09A 2FO4B 5LAXB 2VM4A 4QTIH 3FB8C 1G6RA 3AQZA 1A3LH 5FW8A 2GFBB 3F7YC 3VI3F 5IGXH 4KRPD 4FQXC 3MRMB 3FAVB 3G5VA 4BD4A 1JZ2A 4HQQL 4XB7A 1JVMA 2Q9OA 3FFDB 4LFAO 5EK0A 3SDXA 4F7CA 1W9XA 2A83B 2WSKA 3DHJA 4JI7O 3DOHA 4FD0A 4MQSB 4KP4A 1AO7B 3WD5H 1UD4A 2CDEA 1PW3A 1EWHA 2H9GB 1RULH 2PPFA 1PLGH 3GXTA 4NPYB 2JQMA 3IXTA 3K6NA 3M07A 4Z7UB 5JIKA 5ID1B 2ZTBA 4HGWA 4NRZA 5IYDO 3GI9H 3MJ6A 4JM2D 2AJXL 4DR1B 4WU7B 1V7NH 2EVHA 2LFRA 3CZFA 4NOBA 4NQDD 3M7MX 4I3SL 1YZZA 2JLPA 1PP9H 1BM3H 3MV8A 3W57A 3SBWA 5TE7L 4FQIH 1JZ8A 3RILA 3CVHL 3APMA 2PYJA 1MF2H 1S78D 4JDVB 4XCEB 3WIFB 4NGHH 4HUVB 2M83A 4JZNA 4LLYA 5E1AA 3VXSD 4HYOA 1WP7A 4LLUB 1QEWB 4JI2B 1CGWA 1GK9A 4PJAF 4BK5A 2HG5C 1DCLA 1T22A 4FG6D 5FW7A 4N8VB 4UT7H 2B5UA 5F9WB 4JZOA 4KAQH 4UQDA 2W80C 4DAGL 2Y1VA 4GSQA 4LARL 3SKJH 3NZ8A 4PRHA 2GC4C 4PRPA 5KUMA 3VU1A 3T2LA 5AZEL 1UOWA 1WICA 1F6AB 4PJ5B 3NH7H 3BGMA 2EVJA 5JMRA 2V5TA 3D3VA 3BKJH 2VDOB 3DX2A 2X9ZA 5DYOB 4Z7VB 1OT2A 4XPBL 3P9LA 4DP2X 3F05A 3RYFB 4XC3L 4S1QH 5JDJA 4BAYA 1NMBH 4OZIB 4J4PD 1XUQA 3IDJB 1QRNA 4ZFZA 3VFVB 1JWSA 1ZSPA 1AGDB 1CE1H 2XUMA 4WV1B 3MBXL 2DZEA 1BOGA 3V6ZA 1QD0A 4PBVC 1K5SA 2WWOA 1U8LB 1MG3C 2OIGA 1V8HA 2ZG1A 3WHE1 1ETA1 5IMKA 1UZ6E 4Q9BA 4JG0H 1ET5A 1EDQA 3HMWH 1Q0XL 3MLWH 1EVTC 2K0RA 4XX5A 1KPVA 1UD6A 4HPYL 3PAYA 1SJEA 2D3VA 2YSSA 5JZ7D 3WFDL 4XN2A 3VXMD 2DQUL 4DFIA 5D6CB 1X5XA 3UAJC 1GL4B 3S37L 1E5CA 2X4SB 4GT0A 3EYQC 4XNZC 4Z0XA 4ABWA 2C8NA 3L9BA 1HH6A 2NLJC 1DSWA 1WZKA 2YAEA 3JWOH 4GW1B 1XB8A 3SPIA 4ZW6A 3GSRB 4EVNA 2PYFA 3CXDH 3NK4A 1US6A 4HIJA 3WXVL 1AR4A 1L0NH 2Z1PA 5ACLA 4TKWA 1JPST 3MA7A 4ALAH 5FXCH 4RWUA 2LU4A 4CH5A 4IGGA 3HLAA 4H0HB 1AKJB 4FQHA 5KHHA 1A6UH 4S1RL 1KENL 3OKEA 2BOCA 5B1NA 2UXVA 1UUSA 4N0UA 5FB8B 2BP3A 1BVOA 1B2WL 1PZ3A 4PRBB 2VCOA 5J1AB 1R5VA 1S8DB 5FOBA 4MAYA 1TZGL 3BQUB 3FT4B 4NQSB 4QKTA 4P2OA 2ESVE 4ELKA 3CPLA 3S37X 2XTJC 3CZKA 3VTMA 2E75C 5T5NG 1YA5A 1XMQB 1H6UA 2IDQA 4UILH 5G4OA 2ITCA 1B3IA 3WY1A 5EBMB 1ZL8A 4X1YB 3KL0A 1UTDA 1J8KA 2XHBA 3W38A 2Q4PA 3GSVB 4UZSA 3CJHA 5HHXL 3N43B 1RSFA 5FYJL 1U96A