2W0FC

Potassium channel kcsa-fab complex with tetraoctylammonium
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
102
structure length
102
Chain Sequence
ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Kcsa in Complex with Symmetrical Quaternary Ammonium Compounds Reveal a Hydrophobic Binding Site.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/metal transport
molecule keywords ANTIBODY FAB FRAGMENT LIGHT CHAIN
total genus 41
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2008-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2w0fC00
1JVMA 3E8GA 1M57C 3SJQC 3R65A 4WFGA 1S5HC 2EIKC 3OGCC 4X8AA 3E8BA 3F7VC 4MVSA 4MW8A 3RVZA 3RW0A 2EIJC 2DYSC 4OXSA 4EKWA 2Q6AA 3ZRSA 2WLJA 4RUFA 3STLC 4MVQA 4P9PA 4WFEA 1J95A 4PA7A 3IFXA 3OR6C 3SPIA 4JTAB 3UM7A 4WFFA 1ZWIC 1ORQC 4KFMA 5EBWC 2WLLB 3ZJZA 3PJSK 3F5WC 3LDCA 4LCUC 2K1EA 3SPCA 1K4DC 3E8HA 2Q68A 2HJFC 2WLMA 3T2MA 3TETA 3LDEA 2EINC 3SPJA 3K06A 3SYCA 2A79B 4MTFA 3SYOA 4MVUA 4RO2A 2ZD9A 2W0FC 4WFHA 2WLHA 2EIMC 3FB5C 2QKSA 5CBGA 2AHYA 2A0LA 1R3KC 4PDMA 2ZXWC 2Q69A 2WLKA 4DXWA 3K0DA 4JTCB 3SPHA 5B1AC 3OR7C 5IY5C 4JTDB 3X2QC 1QLEC 2R9RB 2ITDC 2YEVA 4PA9A 3LDDA 4I9WA 4PA4A 4XDLA 3RVYA 3SYQA 3E83A 3SPGA 3OUSA 3EFFK 3GB7C 5EBLC 4X89A 1K4CC 4G27B 2Y69C 4RAIA 5J9PC 2BOCC 2WLIB 2KB1A 3LUTB 3ABKC 3TCUA 5KUMA 2AHZA 5EBMC 2EILC 2WLNA 3JYCA 1OCRC 2H8PC 1P7BA 4PDVA 4MS2A 2X6AA 5EC2C 4GX0A 2HG5C 3BEHA 5EK0A 4HZ3A 1V55C 4MVRA 3AG1C 5B1BC 2DYRC 2NLJC 4PDLA 4QE9A 3VOUA 4TWKA 3WG7C 2BOBC 4GX5A 3OUFA 4X88A 5E1AC 1KKDA 2P7TC 3K04A 2IH1C 2X6CA 3K03A 4P9OA 4MVOA 3FB6C 1V54C 1XL6A 1OCCC 3ASOC 4MVMA 4P2ZA 4MW3A 2ATKC 4MTOA 5EC1C 4ZBMA 3FB7C 5B3SC 4GX1A 4HYOA 4G28B 2X6BA 4RUEA 2HVKC 4F4LA 5BZBA 2WLLA 1G4YB 4R8CA 2QTOA 3ABMC 4MTGA 4QNHB 3SYPA 4QE7A 3HPLC 4R50A 5CBHA 4PDRA 3T4DA 1R3JC 2A9HA 1M56C 4PA3A 2IH3C 4CBCA 5KUKA 3ASNC 1OCZC 4BW5A 1R3IC 3UKMA 5CBFA 3AG3C 2OCCC 3STZC 2ITCC 4J9ZB 3RBZA 4UUJC 3IGAC 2HFEC 3ABLC 3K0GA 3LNMB 1OCOC 3AG4C 3F7YC 4R7CA 4GX2A 4MSWC 1BL8A 1R3LC 4H33A 3T4ZA 3KG2A 4XDKA 2JK5C 4J9YB 2HVJC 4P30A 3AG2C 4H37A 1LNQA 3T1CA 2DWDC 2DWEC 2WLIA 3E86A 3FB8C 4MVZA 1XL4A 3E89A 4R6ZA 3E8FA 3K08A 4PA6A 4XDJA 3SYAA 2Q67A 4LBEC 4LP8A
chains in the Genus database with same CATH superfamily
2QR4A 3THOA 2EJRA 4TV8B 1SESA 3CJHA 5EIBD 2YXHA 5LA6B 4KFMA 2BTQB 1BZKA 4U3FH 1SQQH 5CB4A 2Q0OC 3RYFA 3K9AA 1S72V 2Y4TA 4LFCB 3Q4HA 2W6IG 3CX5F 2W0FC 4O2AB 5BMVA 3QO8A 2F95B 3JASA 1Q8IA 4BW9A 1GAXA 4W4LA 3W7TA 4DV0B 1TVKB 5KHJA 4RQEA 1IBMO 4I55A 1RSOB 5C8YA 1SZXA 4DO2A 2MK3A 2ZIOA 3E22B 5KUMA 3TCUA 1QLNA 1XMQO 3OTFA 5J2UB 3AG3B 5LGNA 3ASOC 4P2ZA 3OEEG 5B3SC 5GTHZ 2HVKC 3ML0A 2VWKA 1EFRG 2E74B 2H3OA 4B3RO 2D3OW 5KX5A 3G80A 1AB3A 2IU0A 2QWNB 2IH3C 4TV8A 3RWRD 3P3PA 1D2DA 2YEVB 3LNMB 2EILB 3K59A 5J2UA 1Q6UA 3T4ZA 4K0KO 1GTOA 1XDCA 2HVJC 5IYDO 2XOKG 2XAFA 3K08A 2WA3A 1NI8A 3SJQC 2AZ0A 1YZBA 4X8AA 4DR7B 2CE4A 4MW8A 2DYSC 4PD4F 1MNGA 2OIEA 4I50B 3STLC 1DF4A 3FAVA 4X20B 4E2LA 2ZINA 5EBWC 3ZJZA 3K9SA 3CRAA 2EBOA 4FM2A 1GMGA 5KA6A 2Q68A 3T2MA 2Z3YA 5CMUA 2VS0A 2ZD9A 4O4JB 4FZ1A 4DXWA 3T1YB 4UVAA 3JD0A 1N33O 4JV5B 1FJGO 4LNUB 3RVYA 4D6TH 2ZT9B 3D3IA 1IVSA 5EBLC 1BHAA 2KB1A 2RDCA 1Y76A 4KP4A 1QVGU 3BY6A 2LW1A 1PPJH 1IBLB 1Y67A 2LP7A 4TQDA 5KAIZ 5B1BC 1VQ5V 1VF6A 2C2AA 4X9QA 5J2TB 3WG7B 3CC4V 3JD2A 3FB6C 1S5JA 1V54C 1OCRB 1WLEA 5KHHA 3C3SA 2DMXA 1JMKC 3JALB 1VQMV 1G4YB 4DV6O 2CDYA 4KHPB 3OTOO 4QE7A 3T4DA 2E5LO 5KHGA 4PA3A 1FJGB 1H8HG 4YXWG 1DGSA 3TGUH 5CBFA 3OD4A 2ITCC 4N23A 1NT2B 5ITZB 3ABKB 5IWAB 3JAWA 1AP5A 2A06H 5L3FA 1M4UA 2WLIA 2Q67A 2VWJA 2OIGA 2EIJB 4WFGA 2LGWA 1Q82W 2OTLV 3MAQA 4DUYO 5J2TA 3JATB 4CH5A 1PV0A 2N04A 4UCVA 2QE7G 4DR4B 1Q81W 3F5WC 1WP7A 2QTSA 5B1NA 4FVMA 1JR9A 3L9DA 2UXDO 3NR7A 2ZR2A 4I5SA 1BCCH 1E79G 1IBKB 3CHXA 2AHYA 4PELA 1VQ4V 2WLKA 3LSUA 4WBNA 4KL1A 2PTMA 3DXRB 3D3QA 3JD1A 5EYPB 4I9WA 4BIOA 4GKKO 5ITZA 4YY3B 2DOSA 5JJEB 2KQXA 1NU1H 1GO3F 2WLNA 1PD3A 4Q6GA 1NZ6A 1MSWD 1PNLA 2BOBC 4JI8O 1ZAUA 2Y4UA 1KBHA 4TSFG 4B3SO 5D5PA 2ODMA 5JH7A 2YI9A 2ZDIC 1NR7A 1LUVA 4JI4O 1MZEA 2KG7A 4O4IB 1GM7A 1L8DA 4IGGA 1QNMA 3T1YO 1VF7A 3LNNA 3CXHF 3A2FA 4JAVA 1RPOA 3WFVA 5EYPA 4XBFA 4GX2A 1JX9A 5AG2A 1Q3EA 1RP3B 2VQFO 3T1HO 3CCSV 2QGNA 3FD9A 5JVDB 2QM7A 1IBLO 5DM6V 3H1LH 4R6ZA 4PA6A 2DE0X 4LP8A 3UQ8A 3AK3A 1HNZB 2IBZH 3QG5A 5LOVA 1YIJV 2DQ0A 2QKAA 1ZUQA 4J80A 1IDSA 1PKXA 4NYKA 4WFEA 4KUMA 1QR8A 2CTWA 4LF4B 1K4DC 4BAYA 2KKWA 1YTFD 2A79B 3CD6V 5JJNB 2M7WA 4DW0A 3A0BZ 5LMNO 2GTAA 4KXRA 5B1AC 1K3EA 2ITDC 4PA4A 1ZSPA 2GHYA 2NN4A 2XTAA 4NTXA 4LH6A 1L0NH 4EB6A 3IC7A 4PDVA 4X64B 1SETA 2X6AA 1MA1A 2YXYA 3B40A 2OCCB 5KA5A 3K5LA 4BWAA 2F93B 4X1YA 5E1AC 4J41A 4ZIBA 4X88A 1XNQO 4YY3O 5CA0B 2ILMA 3CSXA 1XL6A 3AEIA 2ZE6A 2B9ZA 2ATKC 4MTOA 5IJ9A 2UUAB 4ZHQB 1BE3H 5CA1A 5JCOC 3OTOB 4FLWA 4JGSA 1QU7A 3ZHUA 2P67A 5LOVB 2Q73A 5KHIA 4L87A 4LF5O 2GTSA 2QSAA 3ZRWB 4WCEV 5H5NA 3M7MX 4TUYB 4J9YB 2UUCO 4DR1O 2X7RB 4K8XA 4JASA 2IJJA 4XDJA 5K1XA 4ABMA 2QJ1A 3EHBB 2FB5A 3CWBH 1G8MA 2IJKA 3CE2A 1N32O 4DRXA 1PL0A 1OZ0A 1BQ0A 1YJNV 5LXTA 1GN6A 4LCUC 1G1XB 2HJFC 4LF6O 4OX9O 3K06A 4MTFA 4YJ2A 1RFYA 3SYOA 3M99B 3ZMTA 4KHPO 1VQOV 3J81N 3CCEV 3JASB 3EVKA 4JTCB 4UXNA 1OCZB 4B3TO 4JYAO 3EFFK 4LWSA 3AG2B 1K34A 4JI6B 4YIPA 2L6LA 5LP6A 4LF9B 2ZQMA 1YEWA 4CZZA 3W7UA 3AG4B 1ZL8A 1XHXA 5LA6A 3JATA 2XT9A 4X1KB 4JI7B 3G4SV 2EZOA 4FLXA 3ETDA 4GCZA 4TWKA 4DV7B 1KKDA 1AR1B 1SQGA 1V55B 5BR8O 3ZHVA 3I5DA 2QWRB 3ZN1A 4A5UB 2V1DA 5LP6C 1R6TA 1AROP 4JI7O 2B5UA 5B1OA 5IJ0A 2GV9A 1SQFA 4D7TA 4LF9O 4CC5A 1AJQA 2QWOB 2ZXWB 2VQFB 5KAFZ 4GZRB 1S77D 3H9VA 3OT7A 2W6JG 1OCOC 3F7YC 2A3QA 3RN4A 3W7XA 4U7OA 3HKBB 1JJOA 1LNQA 2VQEB 4MVZA 2FL4A 4UCTA 3IJ4A 1FS0G 3G6BA 2Y0PA 4X1IA 1S5HC 4DV4O 2EIKB 3OGCC 3E8BA 3WU2Z 4F6EA 4EKWA 3ZRSA 1N32B 4RUFA 1TGOA 1X4TA 3N2GA 2PZSA 2OTJV 3UM7A 2UUCB 3PJSK 2ZE5A 1TUBA 3OEHG 1BT8A 3TETA 3E22A 3CYOA 1GN2A 2KSDA 4I55B 3GWOA 3ZS8C 1S3JA 1R3KC 5H2FZ 1FFTB 2ZIMA 4UVBA 3E83A 2V7QG 3OUSA 4GT1A 4W4KA 5LBQA 1I5YA 4LF8O 3DXRA 3DC6A 5GW7A 1WB7A 2EILC 3L75H 3VQVA 1OJHA 1OCRC 4Q20A 4JAAA 1QBZA 2YI8A 4JYAB 3AG1C 3WG7C 2DYRC 2NLJC 3VOUA 1YVWA 5FPRA 3LSQA 2JGUA 2R72A 3SR2C 1OCCC 1BS3A 2CH7A 1H2NA 4GX1A 1ENVA 2X6BA 1FFXB 5B3SB 2RN9A 1EM1A 1FPOA 2F4VO 1W0JG 1CPYA 3W7SA 4JYCA 2Q9LA 4O4JA 4BW5A 1R3IC 1BQZA 4FFBA 2PF4E 3SGIA 3RYFB 3E35A 1K97A 4ASUG 4FLVA 3AG4C 2Q7GA 1SKVA 3WB0A 1VIBA 1FAFA 1P49A 5LHGA 3KG2A 4I50A 2DWDC 1HWYA 1ZLZA 4BIZA 3E8FA 1YTFB 2R70A 3JARB 4RWUA 1E1RG 3RW0A 3QTCA 2CTQA 1NQTA 5CA1B 3L73H 3DGEA 4H13B 3EXAA 4FMTA 4NTYA 5KLVH 5E79Z 4IT5A 4PV1B 5BXZA 2PY5A 2UUBB 1EN4A 2HHHB 4MVUA 1UPGA 2YUAA 4DV2O 1AR5A 4EEQA 4DV4B 2AW9A 5JWPA 4FM1A 4LH7A 4JTDB 1QLEC 3JCUZ 3UO2A 5IYBO 4PI2A 2O57A 3ZIAG 2UU9B 3RYHA 4LWSB 4MT8A 1NTMH 3A8TA 4G27B 1O9HA 4NXNB 3IC9A 1VMGA 3ABKC 4X66B 4J42A 4MS2A 2DN9A 4GX0A 1GK9A 4HAMA 1AI5A 1GKFA 2Q8VA 2JEXA 3VQYA 5L3BA 3ETEA 2Z5UA 3K5NA 3FB7C 3CP1A 4LF4O 1I5XA 4UB8Z 3K3WA 1QLEB 3ASNC 1Z5WA 3AG1B 3UKMA 3JAMN 4DV7O 5IYZB 2ARHA 4K0KB 4GKKB 1KQSU 1VEWA 4ZOLA 3ETGA 3GVMA 3CCRV 3ZRXA 4O4HA 1K5SA 2QDOA 3CRRA 2JK5C 4JZ2A 3OAAG 4JI3B 1HNWO 4IIJB 3E89A 1XNRO 3LSSA 3SYAA 1JA8A 3K79A 3C3TA 1JVMA 1MMMA 1DLBA 4QIWF 2ADPA 3BCCH 3RYIA 2EIJC 3OMNB 2X0LA 2CK3G 1R6NA 4MVQA 4TV9B 4O4IA 1XMOB 1J95A 3TXQA 4O4LB 4GKJO 3LDEA 3JSLA 1GM9A 1XMQB 3SJAC 3HKBA 2GBOA 3SPHA 5HFMA 3OR7C 1FD9A 3QF7A 3JSNA 3SJBC 3A0HZ 4DW1A 4DR2O 2P22C 1O9GA 4NTWA 2F23A 5EZYB 1H2LA 3BVOA 1BGYH 5A2QN 1Y6XA 1Q5OA 5KX5B 3MD0A 3OMAB 2CAZC 2CTPA 4K3AA 4YJ3B 4J7KA 3CEIA 4X1IB 4NKGB 2AGAA 2IH1C 1Y76B 3K03A 3K57A 3ZHTA 3DC5A 4ZI7A 3JARA 3S3XA 4DK0A 4WF9V 5IJ0B 1SQXH 4HYOA 4OGQB 5JVDA 3BFRA 4GUNA 4D7SA 1DK1A 3L70H 1R3JC 4ZOLB 4IYIA 4CBCA 1MZFA 2F1MA 2ETNA 4DV3B 5A9GA 5TISZ 5EZYA 3ZMVA 2L35A 4LNUA 3ABLC 2DQ3A 3GWKC 1F4NA 1EBOA 1XOUA 3CRMA 2BCCH 3JALA 3N2KA 2RJZA 3FFQA 3FX7A 2NR5A 3UT5B 1KB9F 2QM4A 3SJCC 1L1FA 3B4SA 2LW7A 5CBHA 2UXCO 1XNQB 4JI8B 3BHPA 1J5EO 4FFKA 2N74A 1Z5VA 1BHBA 4X65O 2QKCA 3RYCA 1GN3A 1P4RA 2Y0IA 3BPZA 4LF7B 3IFXA 1HR0B 3O9OA 2HR3A 2JRIA 1ZWIC 4ZI7B 2XASA 5IWAO 1Q7YW 3B77A 1MG1A 3S3WA 3K58A 2R9AA 5LMNB 3APQA 2JJ2G 2ZXWC 2LQTA 5IY5C 1VARA 3X2QC 4B3MO 1JFFB 1KECA 4XDLA 5JQGA 4DV6B 2K9PA 1NH2D 3SPGA 1T5EA 4DV5B 5IJ9B 4DR1B 2Q7EA 5J9PC 4GYCB 2UXXA 1EN6A 1B6QA 4K35A 4NXMB 1GM8A 1PL4A 4O4HB 4B3RB 2HG5C 1SZTA 1QCEA 4UV8A 1KD1W 2EX3A 1CP9A 1Y4MA 3Q4HB 2Q4PA 2PGGA 1KC8W 3RYHB 4B7EA 3ZX6A 1PP9H 1WJZA 2CUGA 2EJ7A 3F5TA 3UT5A 1TVKA 1Q90D 1JCHA 2RCVA 2YSUB 3DSQA 4R50A 1VQ7V 2XUMA 3G71V 4HBNA 4Z1MG 3I55V 2OCHA 4LFAB 2FKXA 4TT3G 2EIMB 4UUJC 1XMOO 2M6YA 1JJ2U 5D5QA 4UCSA 4RQFA 4DV2B 2JIZG 4H37A 3E86A 2YIBD 3H1HH 3ZCCA 3JD4A 4CH6A 2CTRA 1XNRB 4LBEC 1SA0B 2JEUA 3FYIB 4DV3O 4CH4A 3RVZA 1LUWA 2Q6AA 1Z2GA 1SQVH 4DUZB 4F6RA 3ABTA 4X20A 3G67A 3E8HA 3QO5A 4CH3A 1K73W 5GONB 5LL6Y 1XI1A 3G6EV 1M1KW 2ZE8A 2Q69A 1VQKV 3OGIB 4PA9A 3R66A 5LGUA 4QGPA 3MDSA 1XBLA 2E76B 5FNVA 1VQLV 4DR4O 4NXNO 3J7AU 1WPXA 2Z0AA 2B1GA 1OCOB 2ZNJA 1P84F 3JYCA 1VQ6V 1W0KG 3D36C 4IHJA 1R1BA 4HZ3A 4DV0O 4JZGA 1WAZA 4NR1A 3K04A 4H44B 4P9OA 2HKOA 4DR5O 5DECA 5EC1C 2IM9A 4F4LA 1B06A 3BABA 2PYJA 1SQBH 1FXHA 4NB5A 3N27A 4O2BA 4WFAV 2EZPA 3RYIB 1AP6A 3AG3C 3AK2A 1M5IA 3OM3B 3CRCA 3O65A 4FIPC 5LHHA 3K0GA 2KG7B 4LF5B 2G38A 4R7CA 2YC0A 4U7NA 4AQYB 1FYJA 2LJ2A 3TJTA 3ZN0A 4TOIA 3ZHSA 5IYCO 1Y74B 2PI4A 1XL4A 1D5AA 3FKSG 1KP3A 3R65A 2EIKC 3F7VC 2DW4A 4IIJA 3I56V 3JAKB 3KZIZ 2XAHA 1WP8A 1ZL8B 4IYHA 3RYCB 1VQPV 3SPIA 2OYQA 4WFFA 2CH7B 3L71H 2JGDB 5FNVB 3OMIB 2K1EA 3KKYA 1N36O 3SPJA 1HR0O 2VQEO 4X64O 1CEZA 1R73A 4QPJA 4RO2A 4YJ3A 3CCQV 1Q86W 3UCSC 3ZEDA 4DUYB 5CBGA 3OE7G 1J5EB 3MHHC 1WA8A 4NVPA 4UFZA 2ZKOA 2YEVA 4JI5B 4YJ2B 1BMFG 4FFBB 1NH2B 4ZKIA 3J80N 5BMVB 4MTXA 1AI4A 4LF8B 2YDEA 5LP6B 2AXTZ 1MABG 1P7BA 3BA8A 3HKCB 4TQFA 3ZMSA 1KU9A 3K5MA 4MVOA 1V9PA 2YIAA 1K92A 3OW2U 3BA9A 1NJIW 1VP7A 2QTOA 3HB3B 3SYPA 1US6A 3HKEB 3VQXA 2XAGA 2A9HA 2UUBO 2VRZA 4FJCC 2FMLA 2LGQA 2DYRB 2UXNA 3RFRA 1JFFA 2QM8A 4J7ZA 4E4EA 1H2SB 2WAMA 4HNAB 3WB1A 2UXBO 2ZE7A 4B7KA 4X66O 4FPPA 4Z1VA 2ZNIA 3ZHQA 4DR2B 4LR3A 2DWEC 3DTUB 3KCXA 3FB8C 5IE9A 4J11A 2MW2B 4X65B 2XHBA 1H2GA 1Q6HA 1VF6C 3E8GA 1NTZH 3C90A 2JDIG 2JGDA 4IHJB 2QEXV 5H9CA 4Z2WA 3RGBA 1YJWV 3LDCA 4CS2A 1N0JA 3B8MA 1IBMB 2QWQB 5FPOA 3CB2A 3SYCA 3ABLB 3CMAV 1NBMG 2HLDG 2QKSA 1VF5B 5DEDA 4GLXA 1YJ9V 3JD3A 1FXKA 2PI5A 5L3CA 2UXBB 2WA4A 3LDDA 4L8JA 2EULA 3AK1A 2DJVA 2Y69C 4RAIA 3LUTB 3H01A 4CC6A 2AHZA 1IBKO 4DV1B 3CC2V 1EZVH 1OCCB 4F6RB 1NKDA 3NXSA 5GONA 3BAAA 4QE9A 3L74H 3ASNB 3H1JH 2JS3A 2ZM6O 4JI5O 2ADQB 1AI6A 4MVMA 4MW3A 4UCUA 4YHHB 5LMUO 4LF6B 4G28B 1W2BU 2HP8A 1W59A 1FFXA 1F23A 2IJIA 3B2EE 2E75B 4JI4B 1KKCA 1A32A 3HR0A 4J9ZB 3IGAC 1F4MA 1Q6IA 5HFLA 1JQ0A 4JYBA 1BL8A 2WSSG 4QJFB 3W7WA 1RPRA 3AG2C 1I94B 1I0HA 2HJDA 4EFEA 2E5LB 1K7DA 1ROPA 2YIBA 4NXMO 2NNUA 3TK1A 4J10A 3ZHRA 5L3GA 1M57B 4B08A 1QQCA 2LFRA 3HKCA 3M8AA 2Q0AA 4JI3O 2ZCEA 1ORQC 2WLLB 1ZTEA 1HNXB 3A0RA 1AI7A 2UUAO 2LFSA 4DYLA 1YXBA 3HKDB 2BSKB 1H38A 5BR8B 5FLXN 2YS8A 2WLHA 2P6JA 4JI2B 4PDMA 1R6KA 1K9MW 1N4CA 2PYLA 1F51A 1VQ8V 2LO1A 4DR5B 3D8CA 2BE3A 2RMKB 1MOFA 1N34O 5KHKA 4JAUA 4X89A 4LFBB 3ZBHA 3N2KB 4I0XB 4LF7O 2P4VA 5CN0A 1B04A 2Q5ZA 2QWPB 4B3TB 1I08A 4ZHQA 4MVRA 1XQ8A 4PDLA 1Y66A 2JS5A 1F7YA 3OUFA 1S76D 2UXCB 2OT5A 1N8RW 1KYOF 4B3SB 1GH6A 1XEQA 5JH7B 4BIUA 1FKAO 4PI0A 4LFBO 4FK5C 3PN1A 4X62O 5KMGB 1N0NA 5BY1A 3APOA 2CGOA 2WLLA 4MTGA 1KP2A 1IZ3A 3L72H 4BR6A 4PDRA 2IW5A 1N36B 1YCIA 2OCCC 1GRJA 1PNMA 1TAEA 1YF2A 3VQWA 1PM9A 2W0XA 2HHHO 4QPKA 5JQGB 4DUZO 2ZR3A 1OV9A 4UVCA 4U3JA 1SQPH 2H94A 3HKDA 1K8AW 3H1KH 2BTOA 4I4TA 1EZJA 1M57C 3P32A 1AR4A 1CXZB 4DR3O 1WNSA 1ZX3A 1YI2V 2WLJA 3P3NA 2EINB 4PA7A 2A7WA 3OR6C 2Q7HA 3E2EA 3ICXA 3ZRWA 2RNBA 3CJHB 4IL6Z 2N05A 2YIDA 3ZMZA 4X62B 2EINC 1MSDA 1HW7A 2UXDB 1FXVA 2Y48A 1SERA 2AZ2A 3MHSC 3CCMV 2A0LA 3IAYA 4X1YB 2P90A 2R9IA 3ZRVA 4C7UA 1BSMA 1FXKB 1M56B 1K33A 1SRYA 3ABMB 5JJJB 1KMIZ 2WLIB 5LXTB 4FLZA 5CA0A 3CXCU 3HKEA 4WBNB 5CB4B 1N34B 2H8PC 1HNWB 3BEHA 3AG7A 1RM1B 2JJ1G 4YHHO 5LMUB 1IXBA 2IJHA 5B1BB 2YXLA 2IU3A 4DV5O 2F66C 4JI1B 4ZBMA 2P5OA 5GTIZ 1YITV 4U3JB 4R8CA 3ABMC 4G2KA 1XUQA 4ICGA 1FXKC 1M56C 5B1AB 1IXMA 3STZC 1M9NA 3VBBA 1YSCA 1DTOA 1UJWB 4JV5O 1N33B 4CS4A 1HNXO 4H33A 4XDKA 1PNKA 3T1HB 1HNZO 1YDXA 4UV9A 5IYZA 4HNAA 4FZ0A 3X2QB 4DR6B 5IDJA 4OPAA 1M93A 4MVSA 5K1PA 1X59A 4H0LB 2GSMB 4P9PA 3JCZA 3UO3A 4JTAB 2D2CB 2P4KA 2WPDG 4X1KA 3B09A 5C8YB 3SPCA 1H8EG 2HEPA 2XNDG 1M90W 2B1IA 5EIBC 1H2KA 2FTKA 1GN4A 1NR1A 3OFNG 4N21A 3H1IH 2EIMC 3FB5C 4LC1A 5H6RA 5CA3A 3U10A 3K0DA 4J7JA 1XHZA 2R9RB 4DR6O 3CS5A 1COWG 1EN5A 3GB7C 1DF5A 4DK1A 4DR7O 3WB2A 4OPHA 1K4CC 3K5OA 2BOCC 2XAJA 3QNEA 2PUSA 2V4DA 4YIOA 1AJNA 5EBMC 3ASOB 1QVFU 1LR1A 4DR3B 1V55C 3CRQA 5C93A 4JI2O 2P7TC 1SF9A 2X6CA 4I4TB 1NVPB 4JI1O 1AJPA 2E3CA 1VQNV 5DN6G 3CC7V 4UCOA 1WN7A 1Q43A 4RUEA 2XAQA 4UB6Z 1G6UA 5LHIA 3CCUV 1IURA 1K5QA 3HPLC 4EB6B 1TUEB 5KUKA 1OCZC 1URFA 3KCYA 4AILC 1THZA 4FLUA 3BRCA 1RSOA 3RBZA 2HFEC 4AHCA 4OX9B 1WPBA 1VQ9V 2CGNA 4I9QA 1E1QG 1R3LC 2Y69B 5KMGA 4LFAO 3ABUA 4P30A 3ZMUA 1D5NA 1L0LH 2FYUH 1JPXA 2BSKA 3P30A 4LFCO 4WFBV 4JI0B 3SDLA 3ETQA 4CS3A 1TUBB 4JPRA 2BTQA 5IT9N 1JOYA 1S5LZ 1HDJA 4OXSA 3FAVB 2F43G 3U11A 4TV9A 4DV1O 1U96A 3QVNA 3CMEV 3CCLV 4JYYA 1KUQA 2YICA 1SA0A 2P06A 4AQYO 1SC5B 4I0XA 2WLMA 4O4LA 1NVPD 1NS1A 4WFHA 2DYSB 2OWOA 3B8NA 3JAKA 5B66Z 1B3QA 4EFBA 3RT3C 3TXSA 4B3MB 3SYQA 5BZBA 1YHQV 1I94O 5JCOA 5B5EZ 3QO7A 1UFIA 5LYJB 4K8ZA 4JI0O 3N2GB 2QA4V 1I7FA 1OHHG 2JVDA 1V54B 1AVMA 2GUZA 5EC2C 4O2AA 5EK0A 1H2MA 1QR9A 1WA8B 4FLYA 4GX5A 2RQ6A 2GDSA 1RM1C 4PHZA 2UU9O 1AILA 1Y74A 5FL7G 3U0ZA 3CCVV 5H6QA 1S0VA 1QHTA 3JAWB 5LGTA 5L3DA 4JI6O 4I7ZB 1XREA 4JF3A 4QNHB 1TA8A 4DRXB 2F4VB 1XILA 1NTKH 4GKJB 1U97A 4FM0A 2WWWA 4FLTA 5LYJA 4AI8A 5F2VO 5L3EA 3CCJV 3CPWU 2GUZB 4UCRA 4MSWC 1HP8A 2ZDIA 4TUYA 4PJ0Z 3T1CA 1WB8A 1IX9A 2ZM6B 3D36A 3FYEB 1P7GA 1SS3A 5IY5B 4O2BB
chains in the Genus database with same CATH topology
2NNUA 3TK1A 3EHBB 2EJRA 1SESA 5L3GA 1M57B 2LFRA 1BHBA 1G8MA 2IJKA 1P4RA 3IFXA 1PL0A 2HR3A 1OZ0A 1YJNV 1ZWIC 1ORQC 4KFMA 2WLLB 2XASA 4LCUC 1Q7YW 2HJFC 3A0RA 1AI7A 3K9AA 1S72V 3B77A 2LFSA 1MG1A 3K06A 4MTFA 2W6IG 3SYOA 1H38A 3M99B 3ZMTA 2W0FC 2WLHA 3QO8A 1VQOV 2JJ2G 2P6JA 3CCEV 4PDMA 2ZXWC 1R6KA 1K9MW 4JTCB 4UXNA 1OCZB 5IY5C 3W7TA 1F51A 3X2QC 1KECA 4XDLA 1VQ8V 1NH2D 3SPGA 3EFFK 1MOFA 4RQEA 3AG2B 1K34A 4JAUA 4X89A 5J9PC 2UXXA 4DO2A 1B6QA 2MK3A 2ZQMA 4CZZA 3W7UA 3TCUA 5KUMA 1QLNA 3AG4B 1GM8A 5CN0A 2HG5C 3AG3B 1SZTA 2EZOA 4MVRA 3G4SV 3ETDA 4GCZA 4PDLA 1Y66A 4TWKA 1QCEA 1KKDA 3OUFA 4UV8A 1AR1B 1S76D 1KD1W 2OT5A 1CP9A 1V55B 1N8RW 5LGNA 1Y4MA 4BIUA 3ASOC 4P2ZA 3OEEG 1KC8W 4FK5C 5B3SC 3ZN1A 2V1DA 2HVKC 3ML0A 1EFRG 1AROP 2WLLA 2B5UA 4MTGA 1JCHA 1KP2A 2YSUB 2D3OW 4R50A 4PDRA 5B1OA 2IW5A 2IU0A 2IH3C 1VQ7V 3G71V 1AJQA 2ZXWB 4Z1MG 2OCCC 1PNMA 3I55V 4TT3G 2EIMB 4UUJC 1S77D 2YEVB 3LNMB 2W6JG 1OCOC 2EILB 3F7YC 4QPKA 3W7XA 1JJ2U 4U7OA 2ZR3A 3T4ZA 1GTOA 4RQFA 4UVCA 2HVJC 2JIZG 4H37A 1LNQA 5IYDO 2XOKG 3E86A 2XAFA 3ZCCA 2H94A 3JD4A 4MVZA 1K8AW 3K08A 1FS0G 4LBEC 1EZJA 1M57C 2JEUA 3FYIB 3P32A 3SJQC 1S5HC 2EIKB 3OGCC 3E8BA 4MW8A 4X8AA 3RVZA 2DYSC 1YI2V 4EKWA 2Q6AA 3ZRSA 2WLJA 4RUFA 3ABTA 3STLC 1DF4A 2EINB 4PA7A 2OTJV 4E2LA 3OR6C 3UM7A 3E2EA 5EBWC 3ZJZA 3ZRWA 3PJSK 2EBOA 1GMGA 5KA6A 3E8HA 3OEHG 2Q68A 3T2MA 3QO5A 3TETA 3ZMZA 2Z3YA 2EINC 3CYOA 5CMUA 1FXVA 2Y48A 1K73W 2ZD9A 1SERA 3MHSC 3GWOA 3G6EV 3CCMV 1M1KW 1S3JA 2A0LA 1R3KC 4DXWA 2Q69A 2P90A 2R9IA 3JD0A 4UVAA 3ZRVA 1FFTB 1VQKV 1FXKB 1M56B 3RVYA 4PA9A 4UVBA 3E83A 2V7QG 3OUSA 3D3IA 5LGUA 4GT1A 1K33A 1SRYA 5LBQA 3ABMB 5EBLC 1BHAA 1I5YA 1VQLV 2WLIB 2KB1A 1WPXA 5GW7A 4KP4A 2B1GA 1OCOB 2EILC 3CXCU 3JYCA 1QVGU 1OCRC 1VQ6V 2H8PC 3BY6A 4Q20A 1W0KG 1QBZA 3BEHA 2LP7A 4HZ3A 3AG1C 1RM1B 5B1BC 2DYRC 2JJ1G 2NLJC 3VOUA 3WG7C 1VQ5V 2C2AA 2IJHA 5B1BB 3WG7B 3CC4V 3K04A 2IU3A 3JD2A 3LSQA 4P9OA 3FB6C 1V54C 1OCCC 2HKOA 1OCRB 1WLEA 5EC1C 4ZBMA 4GX1A 1ENVA 2X6BA 4F4LA 1VQMV 5B3SB 1YITV 1G4YB 4R8CA 3ABMC 1FXHA 4QE7A 3T4DA 1W0JG 4G2KA 1CPYA 3W7SA 1M56C 1FXKC 4JYCA 4PA3A 4WFAV 1H8HG 2EZPA 5B1AB 4YXWG 4BW5A 1R3IC 1IXMA 5CBFA 3AG3C 3STZC 1M9NA 2ITCC 3VBBA 1YSCA 4N23A 3OM3B 4FIPC 5LHHA 3E35A 1K97A 3K0GA 4ASUG 3AG4C 1DTOA 4R7CA 1UJWB 4U7NA 3ABKB 4H33A 5LHGA 3KG2A 4XDKA 1PNKA 4UV9A 5L3FA 2DWDC 1HWYA 2WLIA 3ZN0A 5IYCO 2PI4A 4BIZA 1XL4A 3FKSG 3E8FA 3X2QB 5IDJA 2Q67A 1KP3A 1YTFB 2EIJB 3R65A 4WFGA 1E1RG 2EIKC 3RW0A 3F7VC 4MVSA 1Q82W 2OTLV 2DW4A 1NQTA 3I56V 2GSMB 4P9PA 2XAHA 3DGEA 3JCZA 4FMTA 1VQPV 3SPIA 4JTAB 2QE7G 2WPDG 4WFFA 1Q81W 3F5WC 3OMIB 2K1EA 3SPCA 1H8EG 2XNDG 5B1NA 3SPJA 1M90W 2B1IA 2FTKA 1NR1A 2ZR2A 4I5SA 1CEZA 4MVUA 1R73A 4QPJA 4RO2A 3CCQV 3OFNG 1Q86W 1E79G 4N21A 2EIMC 3FB5C 5CBGA 4LC1A 5H6RA 2AHYA 3OE7G 4PELA 5CA3A 1VQ4V 2WLKA 3MHHC 3K0DA 4JTDB 1QLEC 2R9RB 2YEVA 3JD1A 5IYBO 4I9WA 1BMFG 1NH2B 1COWG 3ZIAG 4ZKIA 3GB7C 1DF5A 4MT8A 1AI4A 1K4CC 4G27B 4MTXA 2BOCC 2XAJA 3QNEA 1GO3F 3ABKC 1AJNA 5EBMC 2WLNA 3ASOB 1PD3A 1MABG 1P7BA 1QVFU 4MS2A 4GX0A 1V55C 1GK9A 1MSWD 4HAMA 1PNLA 1AI5A 1GKFA 5C93A 2BOBC 2JEXA 3ZMSA 2P7TC 2X6CA 4TSFG 4MVOA 5L3BA 3ETEA 1NVPB 2Z5UA 1AJPA 1K92A 1VQNV 3FB7C 5DN6G 3CC7V 3OW2U 2ZDIC 1NR7A 4RUEA 3CP1A 2XAQA 1NJIW 2QTOA 3HB3B 1I5XA 3SYPA 5LHIA 3CCUV 1K5QA 3HPLC 3K3WA 1GM7A 2XAGA 2A9HA 1TUEB 1QLEB 4FJCC 5KUKA 3ASNC 1OCZC 2DYRB 3AG1B 3UKMA 1THZA 1KQSU 3RBZA 2UXNA 2HFEC 2QM8A 4JAVA 3ETGA 1RPOA 2WAMA 3WFVA 1VQ9V 3CCRV 4XBFA 4GX2A 1JX9A 3ZRXA 4FPPA 1E1QG 1K5SA 1R3LC 2Y69B 2JK5C 3CCSV 3ABUA 3OAAG 4P30A 3ZMUA 2QM7A 2DWEC 1JPXA 3DTUB 3P30A 5DM6V 3FB8C 3E89A 4R6ZA 4WFBV 3LSSA 4PA6A 3SYAA 4LP8A 1H2GA 3K79A 1JVMA 3E8GA 1DLBA 4JPRA 2JDIG 4QIWF 2DQ0A 1YIJV 1JOYA 2EIJC 3OMNB 4OXSA 2X0LA 1PKXA 2CK3G 2F43G 1R6NA 4MVQA 2QEXV 4WFEA 5H9CA 1J95A 4KUMA 3CMEV 1YJWV 3CCLV 1QR8A 3LDCA 1K4DC 4BAYA 3B8MA 2WLMA 1YTFD 3LDEA 3SYCA 2A79B 1NVPD 1GM9A 3CD6V 3ABLB 3CMAV 1NBMG 2HLDG 4WFHA 2DYSB 2M7WA 3B8NA 2QKSA 1YJ9V 3JD3A 1FXKA 3SPHA 5HFMA 5B1AC 3OR7C 2PI5A 5L3CA 1K3EA 2ITDC 3LDDA 3SYQA 4PA4A 5BZBA 2GHYA 1YHQV 3QO7A 2Y69C 4RAIA 3LUTB 3H01A 2AHZA 3MD0A 2QA4V 3OMAB 3CC2V 1OHHG 1OCCB 3IC7A 4PDVA 1NKDA 1SETA 1V54B 2X6AA 3NXSA 5EC2C 1QR9A 5EK0A 5KA5A 2OCCB 4QE9A 3ASNB 4GX5A 5E1AC 4X88A 1RM1C 2IH1C 3K03A 1XL6A 3AEIA 1AI6A 5FL7G 4MVMA 4WF9V 4MW3A 3CCVV 2ATKC 4MTOA 4HYOA 4G28B 5H6QA 1S0VA 5LGTA 5L3DA 1W2BU 4JF3A 4QNHB 1F23A 2IJIA 1R3JC 4JGSA 4CBCA 2WWWA 2P67A 4J9ZB 3ZMVA 3IGAC 1F4MA 4L87A 5L3EA 5HFLA 3CCJV 1JQ0A 3ABLC 2DQ3A 3CPWU 3ZRWB 4WCEV 1F4NA 4JYBA 1EBOA 4MSWC 1BL8A 2WSSG 4QJFB 3W7WA 2ZDIA 4J9YB 1RPRA 3AG2C 3T1CA 2X7RB 4JASA 2IJJA 3D36A 3FYEB 4XDJA 5IY5B 1K7DA 1L1FA 1ROPA 5CBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JVM A;  3E8G A;  1M57 C;  3SJQ C;  3R65 A;  4WFG A;  1S5H C;  2EIK C;  3OGC C;  4X8A A;  3E8B A;  3F7V C;  4MVS A;  4MW8 A;  3RVZ A;  3RW0 A;  2EIJ C;  2DYS C;  4OXS A;  4EKW A;  2Q6A A;  3ZRS A;  2WLJ A;  4RUF A;  3STL C;  4MVQ A;  4P9P A;  4WFE A;  1J95 A;  4PA7 A;  3IFX A;  3OR6 C;  3SPI A;  4JTA B;  3UM7 A;  4WFF A;  1ZWI C;  1ORQ C;  4KFM A;  5EBW C;  2WLL B;  3ZJZ A;  3PJS K;  3F5W C;  3LDC A;  4LCU C;  2K1E A;  3SPC A;  1K4D C;  3E8H A;  2Q68 A;  2HJF C;  2WLM A;  3T2M A;  3TET A;  3LDE A;  2EIN C;  3SPJ A;  3K06 A;  3SYC A;  2A79 B;  4MTF A;  3SYO A;  4MVU A;  4RO2 A;  2ZD9 A;  2W0F C;  4WFH A;  2WLH A;  2EIM C;  3FB5 C;  2QKS A;  5CBG A;  2AHY A;  2A0L A;  1R3K C;  4PDM A;  2ZXW C;  2Q69 A;  2WLK A;  4DXW A;  3K0D A;  4JTC B;  3SPH A;  5B1A C;  3OR7 C;  5IY5 C;  4JTD B;  3X2Q C;  1QLE C;  2R9R B;  2ITD C;  2YEV A;  4PA9 A;  3LDD A;  4I9W A;  4PA4 A;  4XDL A;  3RVY A;  3SYQ A;  3E83 A;  3SPG A;  3OUS A;  3EFF K;  3GB7 C;  5EBL C;  4X89 A;  1K4C C;  4G27 B;  2Y69 C;  4RAI A;  5J9P C;  2BOC C;  2WLI B;  2KB1 A;  3LUT B;  3ABK C;  3TCU A;  5KUM A;  2AHZ A;  5EBM C;  2EIL C;  2WLN A;  3JYC A;  1OCR C;  2H8P C;  1P7B A;  4PDV A;  4MS2 A;  2X6A A;  5EC2 C;  4GX0 A;  2HG5 C;  3BEH A;  5EK0 A;  4HZ3 A;  1V55 C;  4MVR A;  3AG1 C;  5B1B C;  2DYR C;  2NLJ C;  4PDL A;  4QE9 A;  3VOU A;  4TWK A;  3WG7 C;  2BOB C;  4GX5 A;  3OUF A;  4X88 A;  5E1A C;  1KKD A;  2P7T C;  3K04 A;  2IH1 C;  2X6C A;  3K03 A;  4P9O A;  4MVO A;  3FB6 C;  1V54 C;  1XL6 A;  1OCC C;  3ASO C;  4MVM A;  4P2Z A;  4MW3 A;  2ATK C;  4MTO A;  5EC1 C;  4ZBM A;  3FB7 C;  5B3S C;  4GX1 A;  4HYO A;  4G28 B;  2X6B A;  4RUE A;  2HVK C;  4F4L A;  5BZB A;  2WLL A;  1G4Y B;  4R8C A;  2QTO A;  3ABM C;  4MTG A;  4QNH B;  3SYP A;  4QE7 A;  3HPL C;  4R50 A;  5CBH A;  4PDR A;  3T4D A;  1R3J C;  2A9H A;  1M56 C;  4PA3 A;  2IH3 C;  4CBC A;  5KUK A;  3ASN C;  1OCZ C;  4BW5 A;  1R3I C;  3UKM A;  5CBF A;  3AG3 C;  2OCC C;  3STZ C;  2ITC C;  4J9Z B;  3RBZ A;  4UUJ C;  3IGA C;  2HFE C;  3ABL C;  3K0G A;  3LNM B;  1OCO C;  3AG4 C;  3F7Y C;  4R7C A;  4GX2 A;  4MSW C;  1BL8 A;  1R3L C;  4H33 A;  3T4Z A;  3KG2 A;  4XDK A;  2JK5 C;  4J9Y B;  2HVJ C;  4P30 A;  3AG2 C;  4H37 A;  1LNQ A;  3T1C A;  2DWD C;  2DWE C;  2WLI A;  3E86 A;  3FB8 C;  4MVZ A;  1XL4 A;  3E89 A;  4R6Z A;  3E8F A;  3K08 A;  4PA6 A;  4XDJ A;  3SYA A;  2Q67 A;  4LBE C;  4LP8 A; 
#chains in the Genus database with same CATH topology
 2QR4 A;  3THO A;  2EJR A;  4TV8 B;  1SES A;  3CJH A;  5EIB D;  2YXH A;  5LA6 B;  4KFM A;  2BTQ B;  1BZK A;  4U3F H;  1SQQ H;  5CB4 A;  2Q0O C;  3RYF A;  3K9A A;  1S72 V;  2Y4T A;  4LFC B;  3Q4H A;  2W6I G;  3CX5 F;  2W0F C;  4O2A B;  5BMV A;  3QO8 A;  2F95 B;  3JAS A;  1Q8I A;  4BW9 A;  1GAX A;  4W4L A;  3W7T A;  4DV0 B;  1TVK B;  5KHJ A;  4RQE A;  1IBM O;  4I55 A;  1RSO B;  5C8Y A;  1SZX A;  4DO2 A;  2MK3 A;  2ZIO A;  3E22 B;  5KUM A;  3TCU A;  1QLN A;  1XMQ O;  3OTF A;  5J2U B;  3AG3 B;  5LGN A;  3ASO C;  4P2Z A;  3OEE G;  5B3S C;  5GTH Z;  2HVK C;  3ML0 A;  2VWK A;  1EFR G;  2E74 B;  2H3O A;  4B3R O;  2D3O W;  5KX5 A;  3G80 A;  1AB3 A;  2IU0 A;  2QWN B;  2IH3 C;  4TV8 A;  3RWR D;  3P3P A;  1D2D A;  2YEV B;  3LNM B;  2EIL B;  3K59 A;  5J2U A;  1Q6U A;  3T4Z A;  4K0K O;  1GTO A;  1XDC A;  2HVJ C;  5IYD O;  2XOK G;  2XAF A;  3K08 A;  2WA3 A;  1NI8 A;  3SJQ C;  2AZ0 A;  1YZB A;  4X8A A;  4DR7 B;  2CE4 A;  4MW8 A;  2DYS C;  4PD4 F;  1MNG A;  2OIE A;  4I50 B;  3STL C;  1DF4 A;  3FAV A;  4X20 B;  4E2L A;  2ZIN A;  5EBW C;  3ZJZ A;  3K9S A;  3CRA A;  2EBO A;  4FM2 A;  1GMG A;  5KA6 A;  2Q68 A;  3T2M A;  2Z3Y A;  5CMU A;  2VS0 A;  2ZD9 A;  4O4J B;  4FZ1 A;  4DXW A;  3T1Y B;  4UVA A;  3JD0 A;  1N33 O;  4JV5 B;  1FJG O;  4LNU B;  3RVY A;  4D6T H;  2ZT9 B;  3D3I A;  1IVS A;  5EBL C;  1BHA A;  2KB1 A;  2RDC A;  1Y76 A;  4KP4 A;  1QVG U;  3BY6 A;  2LW1 A;  1PPJ H;  1IBL B;  1Y67 A;  2LP7 A;  4TQD A;  5KAI Z;  5B1B C;  1VQ5 V;  1VF6 A;  2C2A A;  4X9Q A;  5J2T B;  3WG7 B;  3CC4 V;  3JD2 A;  3FB6 C;  1S5J A;  1V54 C;  1OCR B;  1WLE A;  5KHH A;  3C3S A;  2DMX A;  1JMK C;  3JAL B;  1VQM V;  1G4Y B;  4DV6 O;  2CDY A;  4KHP B;  3OTO O;  4QE7 A;  3T4D A;  2E5L O;  5KHG A;  4PA3 A;  1FJG B;  1H8H G;  4YXW G;  1DGS A;  3TGU H;  5CBF A;  3OD4 A;  2ITC C;  4N23 A;  1NT2 B;  5ITZ B;  3ABK B;  5IWA B;  3JAW A;  1AP5 A;  2A06 H;  5L3F A;  1M4U A;  2WLI A;  2Q67 A;  2VWJ A;  2OIG A;  2EIJ B;  4WFG A;  2LGW A;  1Q82 W;  2OTL V;  3MAQ A;  4DUY O;  5J2T A;  3JAT B;  4CH5 A;  1PV0 A;  2N04 A;  4UCV A;  2QE7 G;  4DR4 B;  1Q81 W;  3F5W C;  1WP7 A;  2QTS A;  5B1N A;  4FVM A;  1JR9 A;  3L9D A;  2UXD O;  3NR7 A;  2ZR2 A;  4I5S A;  1BCC H;  1E79 G;  1IBK B;  3CHX A;  2AHY A;  4PEL A;  1VQ4 V;  2WLK A;  3LSU A;  4WBN A;  4KL1 A;  2PTM A;  3DXR B;  3D3Q A;  3JD1 A;  5EYP B;  4I9W A;  4BIO A;  4GKK O;  5ITZ A;  4YY3 B;  2DOS A;  5JJE B;  2KQX A;  1NU1 H;  1GO3 F;  2WLN A;  1PD3 A;  4Q6G A;  1NZ6 A;  1MSW D;  1PNL A;  2BOB C;  4JI8 O;  1ZAU A;  2Y4U A;  1KBH A;  4TSF G;  4B3S O;  5D5P A;  2ODM A;  5JH7 A;  2YI9 A;  2ZDI C;  1NR7 A;  1LUV A;  4JI4 O;  1MZE A;  2KG7 A;  4O4I B;  1GM7 A;  1L8D A;  4IGG A;  1QNM A;  3T1Y O;  1VF7 A;  3LNN A;  3CXH F;  3A2F A;  4JAV A;  1RPO A;  3WFV A;  5EYP A;  4XBF A;  4GX2 A;  1JX9 A;  5AG2 A;  1Q3E A;  1RP3 B;  2VQF O;  3T1H O;  3CCS V;  2QGN A;  3FD9 A;  5JVD B;  2QM7 A;  1IBL O;  5DM6 V;  3H1L H;  4R6Z A;  4PA6 A;  2DE0 X;  4LP8 A;  3UQ8 A;  3AK3 A;  1HNZ B;  2IBZ H;  3QG5 A;  5LOV A;  1YIJ V;  2DQ0 A;  2QKA A;  1ZUQ A;  4J80 A;  1IDS A;  1PKX A;  4NYK A;  4WFE A;  4KUM A;  1QR8 A;  2CTW A;  4LF4 B;  1K4D C;  4BAY A;  2KKW A;  1YTF D;  2A79 B;  3CD6 V;  5JJN B;  2M7W A;  4DW0 A;  3A0B Z;  5LMN O;  2GTA A;  4KXR A;  5B1A C;  1K3E A;  2ITD C;  4PA4 A;  1ZSP A;  2GHY A;  2NN4 A;  2XTA A;  4NTX A;  4LH6 A;  1L0N H;  4EB6 A;  3IC7 A;  4PDV A;  4X64 B;  1SET A;  2X6A A;  1MA1 A;  2YXY A;  3B40 A;  2OCC B;  5KA5 A;  3K5L A;  4BWA A;  2F93 B;  4X1Y A;  5E1A C;  4J41 A;  4ZIB A;  4X88 A;  1XNQ O;  4YY3 O;  5CA0 B;  2ILM A;  3CSX A;  1XL6 A;  3AEI A;  2ZE6 A;  2B9Z A;  2ATK C;  4MTO A;  5IJ9 A;  2UUA B;  4ZHQ B;  1BE3 H;  5CA1 A;  5JCO C;  3OTO B;  4FLW A;  4JGS A;  1QU7 A;  3ZHU A;  2P67 A;  5LOV B;  2Q73 A;  5KHI A;  4L87 A;  4LF5 O;  2GTS A;  2QSA A;  3ZRW B;  4WCE V;  5H5N A;  3M7M X;  4TUY B;  4J9Y B;  2UUC O;  4DR1 O;  2X7R B;  4K8X A;  4JAS A;  2IJJ A;  4XDJ A;  5K1X A;  4ABM A;  2QJ1 A;  3EHB B;  2FB5 A;  3CWB H;  1G8M A;  2IJK A;  3CE2 A;  1N32 O;  4DRX A;  1PL0 A;  1OZ0 A;  1BQ0 A;  1YJN V;  5LXT A;  1GN6 A;  4LCU C;  1G1X B;  2HJF C;  4LF6 O;  4OX9 O;  3K06 A;  4MTF A;  4YJ2 A;  1RFY A;  3SYO A;  3M99 B;  3ZMT A;  4KHP O;  1VQO V;  3J81 N;  3CCE V;  3JAS B;  3EVK A;  4JTC B;  4UXN A;  1OCZ B;  4B3T O;  4JYA O;  3EFF K;  4LWS A;  3AG2 B;  1K34 A;  4JI6 B;  4YIP A;  2L6L A;  5LP6 A;  4LF9 B;  2ZQM A;  1YEW A;  4CZZ A;  3W7U A;  3AG4 B;  1ZL8 A;  1XHX A;  5LA6 A;  3JAT A;  2XT9 A;  4X1K B;  4JI7 B;  3G4S V;  2EZO A;  4FLX A;  3ETD A;  4GCZ A;  4TWK A;  4DV7 B;  1KKD A;  1AR1 B;  1SQG A;  1V55 B;  5BR8 O;  3ZHV A;  3I5D A;  2QWR B;  3ZN1 A;  4A5U B;  2V1D A;  5LP6 C;  1R6T A;  1ARO P;  4JI7 O;  2B5U A;  5B1O A;  5IJ0 A;  2GV9 A;  1SQF A;  4D7T A;  4LF9 O;  4CC5 A;  1AJQ A;  2QWO B;  2ZXW B;  2VQF B;  5KAF Z;  4GZR B;  1S77 D;  3H9V A;  3OT7 A;  2W6J G;  1OCO C;  3F7Y C;  2A3Q A;  3RN4 A;  3W7X A;  4U7O A;  3HKB B;  1JJO A;  1LNQ A;  2VQE B;  4MVZ A;  2FL4 A;  4UCT A;  3IJ4 A;  1FS0 G;  3G6B A;  2Y0P A;  4X1I A;  1S5H C;  4DV4 O;  2EIK B;  3OGC C;  3E8B A;  3WU2 Z;  4F6E A;  4EKW A;  3ZRS A;  1N32 B;  4RUF A;  1TGO A;  1X4T A;  3N2G A;  2PZS A;  2OTJ V;  3UM7 A;  2UUC B;  3PJS K;  2ZE5 A;  1TUB A;  3OEH G;  1BT8 A;  3TET A;  3E22 A;  3CYO A;  1GN2 A;  2KSD A;  4I55 B;  3GWO A;  3ZS8 C;  1S3J A;  1R3K C;  5H2F Z;  1FFT B;  2ZIM A;  4UVB A;  3E83 A;  2V7Q G;  3OUS A;  4GT1 A;  4W4K A;  5LBQ A;  1I5Y A;  4LF8 O;  3DXR A;  3DC6 A;  5GW7 A;  1WB7 A;  2EIL C;  3L75 H;  3VQV A;  1OJH A;  1OCR C;  4Q20 A;  4JAA A;  1QBZ A;  2YI8 A;  4JYA B;  3AG1 C;  3WG7 C;  2DYR C;  2NLJ C;  3VOU A;  1YVW A;  5FPR A;  3LSQ A;  2JGU A;  2R72 A;  3SR2 C;  1OCC C;  1BS3 A;  2CH7 A;  1H2N A;  4GX1 A;  1ENV A;  2X6B A;  1FFX B;  5B3S B;  2RN9 A;  1EM1 A;  1FPO A;  2F4V O;  1W0J G;  1CPY A;  3W7S A;  4JYC A;  2Q9L A;  4O4J A;  4BW5 A;  1R3I C;  1BQZ A;  4FFB A;  2PF4 E;  3SGI A;  3RYF B;  3E35 A;  1K97 A;  4ASU G;  4FLV A;  3AG4 C;  2Q7G A;  1SKV A;  3WB0 A;  1VIB A;  1FAF A;  1P49 A;  5LHG A;  3KG2 A;  4I50 A;  2DWD C;  1HWY A;  1ZLZ A;  4BIZ A;  3E8F A;  1YTF B;  2R70 A;  3JAR B;  4RWU A;  1E1R G;  3RW0 A;  3QTC A;  2CTQ A;  1NQT A;  5CA1 B;  3L73 H;  3DGE A;  4H13 B;  3EXA A;  4FMT A;  4NTY A;  5KLV H;  5E79 Z;  4IT5 A;  4PV1 B;  5BXZ A;  2PY5 A;  2UUB B;  1EN4 A;  2HHH B;  4MVU A;  1UPG A;  2YUA A;  4DV2 O;  1AR5 A;  4EEQ A;  4DV4 B;  2AW9 A;  5JWP A;  4FM1 A;  4LH7 A;  4JTD B;  1QLE C;  3JCU Z;  3UO2 A;  5IYB O;  4PI2 A;  2O57 A;  3ZIA G;  2UU9 B;  3RYH A;  4LWS B;  4MT8 A;  1NTM H;  3A8T A;  4G27 B;  1O9H A;  4NXN B;  3IC9 A;  1VMG A;  3ABK C;  4X66 B;  4J42 A;  4MS2 A;  2DN9 A;  4GX0 A;  1GK9 A;  4HAM A;  1AI5 A;  1GKF A;  2Q8V A;  2JEX A;  3VQY A;  5L3B A;  3ETE A;  2Z5U A;  3K5N A;  3FB7 C;  3CP1 A;  4LF4 O;  1I5X A;  4UB8 Z;  3K3W A;  1QLE B;  3ASN C;  1Z5W A;  3AG1 B;  3UKM A;  3JAM N;  4DV7 O;  5IYZ B;  2ARH A;  4K0K B;  4GKK B;  1KQS U;  1VEW A;  4ZOL A;  3ETG A;  3GVM A;  3CCR V;  3ZRX A;  4O4H A;  1K5S A;  2QDO A;  3CRR A;  2JK5 C;  4JZ2 A;  3OAA G;  4JI3 B;  1HNW O;  4IIJ B;  3E89 A;  1XNR O;  3LSS A;  3SYA A;  1JA8 A;  3K79 A;  3C3T A;  1JVM A;  1MMM A;  1DLB A;  4QIW F;  2ADP A;  3BCC H;  3RYI A;  2EIJ C;  3OMN B;  2X0L A;  2CK3 G;  1R6N A;  4MVQ A;  4TV9 B;  4O4I A;  1XMO B;  1J95 A;  3TXQ A;  4O4L B;  4GKJ O;  3LDE A;  3JSL A;  1GM9 A;  1XMQ B;  3SJA C;  3HKB A;  2GBO A;  3SPH A;  5HFM A;  3OR7 C;  1FD9 A;  3QF7 A;  3JSN A;  3SJB C;  3A0H Z;  4DW1 A;  4DR2 O;  2P22 C;  1O9G A;  4NTW A;  2F23 A;  5EZY B;  1H2L A;  3BVO A;  1BGY H;  5A2Q N;  1Y6X A;  1Q5O A;  5KX5 B;  3MD0 A;  3OMA B;  2CAZ C;  2CTP A;  4K3A A;  4YJ3 B;  4J7K A;  3CEI A;  4X1I B;  4NKG B;  2AGA A;  2IH1 C;  1Y76 B;  3K03 A;  3K57 A;  3ZHT A;  3DC5 A;  4ZI7 A;  3JAR A;  3S3X A;  4DK0 A;  4WF9 V;  5IJ0 B;  1SQX H;  4HYO A;  4OGQ B;  5JVD A;  3BFR A;  4GUN A;  4D7S A;  1DK1 A;  3L70 H;  1R3J C;  4ZOL B;  4IYI A;  4CBC A;  1MZF A;  2F1M A;  2ETN A;  4DV3 B;  5A9G A;  5TIS Z;  5EZY A;  3ZMV A;  2L35 A;  4LNU A;  3ABL C;  2DQ3 A;  3GWK C;  1F4N A;  1EBO A;  1XOU A;  3CRM A;  2BCC H;  3JAL A;  3N2K A;  2RJZ A;  3FFQ A;  3FX7 A;  2NR5 A;  3UT5 B;  1KB9 F;  2QM4 A;  3SJC C;  1L1F A;  3B4S A;  2LW7 A;  5CBH A;  2UXC O;  1XNQ B;  4JI8 B;  3BHP A;  1J5E O;  4FFK A;  2N74 A;  1Z5V A;  1BHB A;  4X65 O;  2QKC A;  3RYC A;  1GN3 A;  1P4R A;  2Y0I A;  3BPZ A;  4LF7 B;  3IFX A;  1HR0 B;  3O9O A;  2HR3 A;  2JRI A;  1ZWI C;  4ZI7 B;  2XAS A;  5IWA O;  1Q7Y W;  3B77 A;  1MG1 A;  3S3W A;  3K58 A;  2R9A A;  5LMN B;  3APQ A;  2JJ2 G;  2ZXW C;  2LQT A;  5IY5 C;  1VAR A;  3X2Q C;  4B3M O;  1JFF B;  1KEC A;  4XDL A;  5JQG A;  4DV6 B;  2K9P A;  1NH2 D;  3SPG A;  1T5E A;  4DV5 B;  5IJ9 B;  4DR1 B;  2Q7E A;  5J9P C;  4GYC B;  2UXX A;  1EN6 A;  1B6Q A;  4K35 A;  4NXM B;  1GM8 A;  1PL4 A;  4O4H B;  4B3R B;  2HG5 C;  1SZT A;  1QCE A;  4UV8 A;  1KD1 W;  2EX3 A;  1CP9 A;  1Y4M A;  3Q4H B;  2Q4P A;  2PGG A;  1KC8 W;  3RYH B;  4B7E A;  3ZX6 A;  1PP9 H;  1WJZ A;  2CUG A;  2EJ7 A;  3F5T A;  3UT5 A;  1TVK A;  1Q90 D;  1JCH A;  2RCV A;  2YSU B;  3DSQ A;  4R50 A;  1VQ7 V;  2XUM A;  3G71 V;  4HBN A;  4Z1M G;  3I55 V;  2OCH A;  4LFA B;  2FKX A;  4TT3 G;  2EIM B;  4UUJ C;  1XMO O;  2M6Y A;  1JJ2 U;  5D5Q A;  4UCS A;  4RQF A;  4DV2 B;  2JIZ G;  4H37 A;  3E86 A;  2YIB D;  3H1H H;  3ZCC A;  3JD4 A;  4CH6 A;  2CTR A;  1XNR B;  4LBE C;  1SA0 B;  2JEU A;  3FYI B;  4DV3 O;  4CH4 A;  3RVZ A;  1LUW A;  2Q6A A;  1Z2G A;  1SQV H;  4DUZ B;  4F6R A;  3ABT A;  4X20 A;  3G67 A;  3E8H A;  3QO5 A;  4CH3 A;  1K73 W;  5GON B;  5LL6 Y;  1XI1 A;  3G6E V;  1M1K W;  2ZE8 A;  2Q69 A;  1VQK V;  3OGI B;  4PA9 A;  3R66 A;  5LGU A;  4QGP A;  3MDS A;  1XBL A;  2E76 B;  5FNV A;  1VQL V;  4DR4 O;  4NXN O;  3J7A U;  1WPX A;  2Z0A A;  2B1G A;  1OCO B;  2ZNJ A;  1P84 F;  3JYC A;  1VQ6 V;  1W0K G;  3D36 C;  4IHJ A;  1R1B A;  4HZ3 A;  4DV0 O;  4JZG A;  1WAZ A;  4NR1 A;  3K04 A;  4H44 B;  4P9O A;  2HKO A;  4DR5 O;  5DEC A;  5EC1 C;  2IM9 A;  4F4L A;  1B06 A;  3BAB A;  2PYJ A;  1SQB H;  1FXH A;  4NB5 A;  3N27 A;  4O2B A;  4WFA V;  2EZP A;  3RYI B;  1AP6 A;  3AG3 C;  3AK2 A;  1M5I A;  3OM3 B;  3CRC A;  3O65 A;  4FIP C;  5LHH A;  3K0G A;  2KG7 B;  4LF5 B;  2G38 A;  4R7C A;  2YC0 A;  4U7N A;  4AQY B;  1FYJ A;  2LJ2 A;  3TJT A;  3ZN0 A;  4TOI A;  3ZHS A;  5IYC O;  1Y74 B;  2PI4 A;  1XL4 A;  1D5A A;  3FKS G;  1KP3 A;  3R65 A;  2EIK C;  3F7V C;  2DW4 A;  4IIJ A;  3I56 V;  3JAK B;  3KZI Z;  2XAH A;  1WP8 A;  1ZL8 B;  4IYH A;  3RYC B;  1VQP V;  3SPI A;  2OYQ A;  4WFF A;  2CH7 B;  3L71 H;  2JGD B;  5FNV B;  3OMI B;  2K1E A;  3KKY A;  1N36 O;  3SPJ A;  1HR0 O;  2VQE O;  4X64 O;  1CEZ A;  1R73 A;  4QPJ A;  4RO2 A;  4YJ3 A;  3CCQ V;  1Q86 W;  3UCS C;  3ZED A;  4DUY B;  5CBG A;  3OE7 G;  1J5E B;  3MHH C;  1WA8 A;  4NVP A;  4UFZ A;  2ZKO A;  2YEV A;  4JI5 B;  4YJ2 B;  1BMF G;  4FFB B;  1NH2 B;  4ZKI A;  3J80 N;  5BMV B;  4MTX A;  1AI4 A;  4LF8 B;  2YDE A;  5LP6 B;  2AXT Z;  1MAB G;  1P7B A;  3BA8 A;  3HKC B;  4TQF A;  3ZMS A;  1KU9 A;  3K5M A;  4MVO A;  1V9P A;  2YIA A;  1K92 A;  3OW2 U;  3BA9 A;  1NJI W;  1VP7 A;  2QTO A;  3HB3 B;  3SYP A;  1US6 A;  3HKE B;  3VQX A;  2XAG A;  2A9H A;  2UUB O;  2VRZ A;  4FJC C;  2FML A;  2LGQ A;  2DYR B;  2UXN A;  3RFR A;  1JFF A;  2QM8 A;  4J7Z A;  4E4E A;  1H2S B;  2WAM A;  4HNA B;  3WB1 A;  2UXB O;  2ZE7 A;  4B7K A;  4X66 O;  4FPP A;  4Z1V A;  2ZNI A;  3ZHQ A;  4DR2 B;  4LR3 A;  2DWE C;  3DTU B;  3KCX A;  3FB8 C;  5IE9 A;  4J11 A;  2MW2 B;  4X65 B;  2XHB A;  1H2G A;  1Q6H A;  1VF6 C;  3E8G A;  1NTZ H;  3C90 A;  2JDI G;  2JGD A;  4IHJ B;  2QEX V;  5H9C A;  4Z2W A;  3RGB A;  1YJW V;  3LDC A;  4CS2 A;  1N0J A;  3B8M A;  1IBM B;  2QWQ B;  5FPO A;  3CB2 A;  3SYC A;  3ABL B;  3CMA V;  1NBM G;  2HLD G;  2QKS A;  1VF5 B;  5DED A;  4GLX A;  1YJ9 V;  3JD3 A;  1FXK A;  2PI5 A;  5L3C A;  2UXB B;  2WA4 A;  3LDD A;  4L8J A;  2EUL A;  3AK1 A;  2DJV A;  2Y69 C;  4RAI A;  3LUT B;  3H01 A;  4CC6 A;  2AHZ A;  1IBK O;  4DV1 B;  3CC2 V;  1EZV H;  1OCC B;  4F6R B;  1NKD A;  3NXS A;  5GON A;  3BAA A;  4QE9 A;  3L74 H;  3ASN B;  3H1J H;  2JS3 A;  2ZM6 O;  4JI5 O;  2ADQ B;  1AI6 A;  4MVM A;  4MW3 A;  4UCU A;  4YHH B;  5LMU O;  4LF6 B;  4G28 B;  1W2B U;  2HP8 A;  1W59 A;  1FFX A;  1F23 A;  2IJI A;  3B2E E;  2E75 B;  4JI4 B;  1KKC A;  1A32 A;  3HR0 A;  4J9Z B;  3IGA C;  1F4M A;  1Q6I A;  5HFL A;  1JQ0 A;  4JYB A;  1BL8 A;  2WSS G;  4QJF B;  3W7W A;  1RPR A;  3AG2 C;  1I94 B;  1I0H A;  2HJD A;  4EFE A;  2E5L B;  1K7D A;  1ROP A;  2YIB A;  4NXM O;  2NNU A;  3TK1 A;  4J10 A;  3ZHR A;  5L3G A;  1M57 B;  4B08 A;  1QQC A;  2LFR A;  3HKC A;  3M8A A;  2Q0A A;  4JI3 O;  2ZCE A;  1ORQ C;  2WLL B;  1ZTE A;  1HNX B;  3A0R A;  1AI7 A;  2UUA O;  2LFS A;  4DYL A;  1YXB A;  3HKD B;  2BSK B;  1H38 A;  5BR8 B;  5FLX N;  2YS8 A;  2WLH A;  2P6J A;  4JI2 B;  4PDM A;  1R6K A;  1K9M W;  1N4C A;  2PYL A;  1F51 A;  1VQ8 V;  2LO1 A;  4DR5 B;  3D8C A;  2BE3 A;  2RMK B;  1MOF A;  1N34 O;  5KHK A;  4JAU A;  4X89 A;  4LFB B;  3ZBH A;  3N2K B;  4I0X B;  4LF7 O;  2P4V A;  5CN0 A;  1B04 A;  2Q5Z A;  2QWP B;  4B3T B;  1I08 A;  4ZHQ A;  4MVR A;  1XQ8 A;  4PDL A;  1Y66 A;  2JS5 A;  1F7Y A;  3OUF A;  1S76 D;  2UXC B;  2OT5 A;  1N8R W;  1KYO F;  4B3S B;  1GH6 A;  1XEQ A;  5JH7 B;  4BIU A;  1FKA O;  4PI0 A;  4LFB O;  4FK5 C;  3PN1 A;  4X62 O;  5KMG B;  1N0N A;  5BY1 A;  3APO A;  2CGO A;  2WLL A;  4MTG A;  1KP2 A;  1IZ3 A;  3L72 H;  4BR6 A;  4PDR A;  2IW5 A;  1N36 B;  1YCI A;  2OCC C;  1GRJ A;  1PNM A;  1TAE A;  1YF2 A;  3VQW A;  1PM9 A;  2W0X A;  2HHH O;  4QPK A;  5JQG B;  4DUZ O;  2ZR3 A;  1OV9 A;  4UVC A;  4U3J A;  1SQP H;  2H94 A;  3HKD A;  1K8A W;  3H1K H;  2BTO A;  4I4T A;  1EZJ A;  1M57 C;  3P32 A;  1AR4 A;  1CXZ B;  4DR3 O;  1WNS A;  1ZX3 A;  1YI2 V;  2WLJ A;  3P3N A;  2EIN B;  4PA7 A;  2A7W A;  3OR6 C;  2Q7H A;  3E2E A;  3ICX A;  3ZRW A;  2RNB A;  3CJH B;  4IL6 Z;  2N05 A;  2YID A;  3ZMZ A;  4X62 B;  2EIN C;  1MSD A;  1HW7 A;  2UXD B;  1FXV A;  2Y48 A;  1SER A;  2AZ2 A;  3MHS C;  3CCM V;  2A0L A;  3IAY A;  4X1Y B;  2P90 A;  2R9I A;  3ZRV A;  4C7U A;  1BSM A;  1FXK B;  1M56 B;  1K33 A;  1SRY A;  3ABM B;  5JJJ B;  1KMI Z;  2WLI B;  5LXT B;  4FLZ A;  5CA0 A;  3CXC U;  3HKE A;  4WBN B;  5CB4 B;  1N34 B;  2H8P C;  1HNW B;  3BEH A;  3AG7 A;  1RM1 B;  2JJ1 G;  4YHH O;  5LMU B;  1IXB A;  2IJH A;  5B1B B;  2YXL A;  2IU3 A;  4DV5 O;  2F66 C;  4JI1 B;  4ZBM A;  2P5O A;  5GTI Z;  1YIT V;  4U3J B;  4R8C A;  3ABM C;  4G2K A;  1XUQ A;  4ICG A;  1FXK C;  1M56 C;  5B1A B;  1IXM A;  3STZ C;  1M9N A;  3VBB A;  1YSC A;  1DTO A;  1UJW B;  4JV5 O;  1N33 B;  4CS4 A;  1HNX O;  4H33 A;  4XDK A;  1PNK A;  3T1H B;  1HNZ O;  1YDX A;  4UV9 A;  5IYZ A;  4HNA A;  4FZ0 A;  3X2Q B;  4DR6 B;  5IDJ A;  4OPA A;  1M93 A;  4MVS A;  5K1P A;  1X59 A;  4H0L B;  2GSM B;  4P9P A;  3JCZ A;  3UO3 A;  4JTA B;  2D2C B;  2P4K A;  2WPD G;  4X1K A;  3B09 A;  5C8Y B;  3SPC A;  1H8E G;  2HEP A;  2XND G;  1M90 W;  2B1I A;  5EIB C;  1H2K A;  2FTK A;  1GN4 A;  1NR1 A;  3OFN G;  4N21 A;  3H1I H;  2EIM C;  3FB5 C;  4LC1 A;  5H6R A;  5CA3 A;  3U10 A;  3K0D A;  4J7J A;  1XHZ A;  2R9R B;  4DR6 O;  3CS5 A;  1COW G;  1EN5 A;  3GB7 C;  1DF5 A;  4DK1 A;  4DR7 O;  3WB2 A;  4OPH A;  1K4C C;  3K5O A;  2BOC C;  2XAJ A;  3QNE A;  2PUS A;  2V4D A;  4YIO A;  1AJN A;  5EBM C;  3ASO B;  1QVF U;  1LR1 A;  4DR3 B;  1V55 C;  3CRQ A;  5C93 A;  4JI2 O;  2P7T C;  1SF9 A;  2X6C A;  4I4T B;  1NVP B;  4JI1 O;  1AJP A;  2E3C A;  1VQN V;  5DN6 G;  3CC7 V;  4UCO A;  1WN7 A;  1Q43 A;  4RUE A;  2XAQ A;  4UB6 Z;  1G6U A;  5LHI A;  3CCU V;  1IUR A;  1K5Q A;  3HPL C;  4EB6 B;  1TUE B;  5KUK A;  1OCZ C;  1URF A;  3KCY A;  4AIL C;  1THZ A;  4FLU A;  3BRC A;  1RSO A;  3RBZ A;  2HFE C;  4AHC A;  4OX9 B;  1WPB A;  1VQ9 V;  2CGN A;  4I9Q A;  1E1Q G;  1R3L C;  2Y69 B;  5KMG A;  4LFA O;  3ABU A;  4P30 A;  3ZMU A;  1D5N A;  1L0L H;  2FYU H;  1JPX A;  2BSK A;  3P30 A;  4LFC O;  4WFB V;  4JI0 B;  3SDL A;  3ETQ A;  4CS3 A;  1TUB B;  4JPR A;  2BTQ A;  5IT9 N;  1JOY A;  1S5L Z;  1HDJ A;  4OXS A;  3FAV B;  2F43 G;  3U11 A;  4TV9 A;  4DV1 O;  1U96 A;  3QVN A;  3CME V;  3CCL V;  4JYY A;  1KUQ A;  2YIC A;  1SA0 A;  2P06 A;  4AQY O;  1SC5 B;  4I0X A;  2WLM A;  4O4L A;  1NVP D;  1NS1 A;  4WFH A;  2DYS B;  2OWO A;  3B8N A;  3JAK A;  5B66 Z;  1B3Q A;  4EFB A;  3RT3 C;  3TXS A;  4B3M B;  3SYQ A;  5BZB A;  1YHQ V;  1I94 O;  5JCO A;  5B5E Z;  3QO7 A;  1UFI A;  5LYJ B;  4K8Z A;  4JI0 O;  3N2G B;  2QA4 V;  1I7F A;  1OHH G;  2JVD A;  1V54 B;  1AVM A;  2GUZ A;  5EC2 C;  4O2A A;  5EK0 A;  1H2M A;  1QR9 A;  1WA8 B;  4FLY A;  4GX5 A;  2RQ6 A;  2GDS A;  1RM1 C;  4PHZ A;  2UU9 O;  1AIL A;  1Y74 A;  5FL7 G;  3U0Z A;  3CCV V;  5H6Q A;  1S0V A;  1QHT A;  3JAW B;  5LGT A;  5L3D A;  4JI6 O;  4I7Z B;  1XRE A;  4JF3 A;  4QNH B;  1TA8 A;  4DRX B;  2F4V B;  1XIL A;  1NTK H;  4GKJ B;  1U97 A;  4FM0 A;  2WWW A;  4FLT A;  5LYJ A;  4AI8 A;  5F2V O;  5L3E A;  3CCJ V;  3CPW U;  2GUZ B;  4UCR A;  4MSW C;  1HP8 A;  2ZDI A;  4TUY A;  4PJ0 Z;  3T1C A;  1WB8 A;  1IX9 A;  2ZM6 B;  3D36 A;  3FYE B;  1P7G A;  1SS3 A;  5IY5 B;  4O2B B; 
#chains in the Genus database with same CATH homology
 2NNU A;  3TK1 A;  3EHB B;  2EJR A;  1SES A;  5L3G A;  1M57 B;  2LFR A;  1BHB A;  1G8M A;  2IJK A;  1P4R A;  3IFX A;  1PL0 A;  2HR3 A;  1OZ0 A;  1YJN V;  1ZWI C;  1ORQ C;  4KFM A;  2WLL B;  2XAS A;  4LCU C;  1Q7Y W;  2HJF C;  3A0R A;  1AI7 A;  3K9A A;  1S72 V;  3B77 A;  2LFS A;  1MG1 A;  3K06 A;  4MTF A;  2W6I G;  3SYO A;  1H38 A;  3M99 B;  3ZMT A;  2W0F C;  2WLH A;  3QO8 A;  1VQO V;  2JJ2 G;  2P6J A;  3CCE V;  4PDM A;  2ZXW C;  1R6K A;  1K9M W;  4JTC B;  4UXN A;  1OCZ B;  5IY5 C;  3W7T A;  1F51 A;  3X2Q C;  1KEC A;  4XDL A;  1VQ8 V;  1NH2 D;  3SPG A;  3EFF K;  1MOF A;  4RQE A;  3AG2 B;  1K34 A;  4JAU A;  4X89 A;  5J9P C;  2UXX A;  4DO2 A;  1B6Q A;  2MK3 A;  2ZQM A;  4CZZ A;  3W7U A;  3TCU A;  5KUM A;  1QLN A;  3AG4 B;  1GM8 A;  5CN0 A;  2HG5 C;  3AG3 B;  1SZT A;  2EZO A;  4MVR A;  3G4S V;  3ETD A;  4GCZ A;  4PDL A;  1Y66 A;  4TWK A;  1QCE A;  1KKD A;  3OUF A;  4UV8 A;  1AR1 B;  1S76 D;  1KD1 W;  2OT5 A;  1CP9 A;  1V55 B;  1N8R W;  5LGN A;  1Y4M A;  4BIU A;  3ASO C;  4P2Z A;  3OEE G;  1KC8 W;  4FK5 C;  5B3S C;  3ZN1 A;  2V1D A;  2HVK C;  3ML0 A;  1EFR G;  1ARO P;  2WLL A;  2B5U A;  4MTG A;  1JCH A;  1KP2 A;  2YSU B;  2D3O W;  4R50 A;  4PDR A;  5B1O A;  2IW5 A;  2IU0 A;  2IH3 C;  1VQ7 V;  3G71 V;  1AJQ A;  2ZXW B;  4Z1M G;  2OCC C;  1PNM A;  3I55 V;  4TT3 G;  2EIM B;  4UUJ C;  1S77 D;  2YEV B;  3LNM B;  2W6J G;  1OCO C;  2EIL B;  3F7Y C;  4QPK A;  3W7X A;  1JJ2 U;  4U7O A;  2ZR3 A;  3T4Z A;  1GTO A;  4RQF A;  4UVC A;  2HVJ C;  2JIZ G;  4H37 A;  1LNQ A;  5IYD O;  2XOK G;  3E86 A;  2XAF A;  3ZCC A;  2H94 A;  3JD4 A;  4MVZ A;  1K8A W;  3K08 A;  1FS0 G;  4LBE C;  1EZJ A;  1M57 C;  2JEU A;  3FYI B;  3P32 A;  3SJQ C;  1S5H C;  2EIK B;  3OGC C;  3E8B A;  4MW8 A;  4X8A A;  3RVZ A;  2DYS C;  1YI2 V;  4EKW A;  2Q6A A;  3ZRS A;  2WLJ A;  4RUF A;  3ABT A;  3STL C;  1DF4 A;  2EIN B;  4PA7 A;  2OTJ V;  4E2L A;  3OR6 C;  3UM7 A;  3E2E A;  5EBW C;  3ZJZ A;  3ZRW A;  3PJS K;  2EBO A;  1GMG A;  5KA6 A;  3E8H A;  3OEH G;  2Q68 A;  3T2M A;  3QO5 A;  3TET A;  3ZMZ A;  2Z3Y A;  2EIN C;  3CYO A;  5CMU A;  1FXV A;  2Y48 A;  1K73 W;  2ZD9 A;  1SER A;  3MHS C;  3GWO A;  3G6E V;  3CCM V;  1M1K W;  1S3J A;  2A0L A;  1R3K C;  4DXW A;  2Q69 A;  2P90 A;  2R9I A;  3JD0 A;  4UVA A;  3ZRV A;  1FFT B;  1VQK V;  1FXK B;  1M56 B;  3RVY A;  4PA9 A;  4UVB A;  3E83 A;  2V7Q G;  3OUS A;  3D3I A;  5LGU A;  4GT1 A;  1K33 A;  1SRY A;  5LBQ A;  3ABM B;  5EBL C;  1BHA A;  1I5Y A;  1VQL V;  2WLI B;  2KB1 A;  1WPX A;  5GW7 A;  4KP4 A;  2B1G A;  1OCO B;  2EIL C;  3CXC U;  3JYC A;  1QVG U;  1OCR C;  1VQ6 V;  2H8P C;  3BY6 A;  4Q20 A;  1W0K G;  1QBZ A;  3BEH A;  2LP7 A;  4HZ3 A;  3AG1 C;  1RM1 B;  5B1B C;  2DYR C;  2JJ1 G;  2NLJ C;  3VOU A;  3WG7 C;  1VQ5 V;  2C2A A;  2IJH A;  5B1B B;  3WG7 B;  3CC4 V;  3K04 A;  2IU3 A;  3JD2 A;  3LSQ A;  4P9O A;  3FB6 C;  1V54 C;  1OCC C;  2HKO A;  1OCR B;  1WLE A;  5EC1 C;  4ZBM A;  4GX1 A;  1ENV A;  2X6B A;  4F4L A;  1VQM V;  5B3S B;  1YIT V;  1G4Y B;  4R8C A;  3ABM C;  1FXH A;  4QE7 A;  3T4D A;  1W0J G;  4G2K A;  1CPY A;  3W7S A;  1M56 C;  1FXK C;  4JYC A;  4PA3 A;  4WFA V;  1H8H G;  2EZP A;  5B1A B;  4YXW G;  4BW5 A;  1R3I C;  1IXM A;  5CBF A;  3AG3 C;  3STZ C;  1M9N A;  2ITC C;  3VBB A;  1YSC A;  4N23 A;  3OM3 B;  4FIP C;  5LHH A;  3E35 A;  1K97 A;  3K0G A;  4ASU G;  3AG4 C;  1DTO A;  4R7C A;  1UJW B;  4U7N A;  3ABK B;  4H33 A;  5LHG A;  3KG2 A;  4XDK A;  1PNK A;  4UV9 A;  5L3F A;  2DWD C;  1HWY A;  2WLI A;  3ZN0 A;  5IYC O;  2PI4 A;  4BIZ A;  1XL4 A;  3FKS G;  3E8F A;  3X2Q B;  5IDJ A;  2Q67 A;  1KP3 A;  1YTF B;  2EIJ B;  3R65 A;  4WFG A;  1E1R G;  2EIK C;  3RW0 A;  3F7V C;  4MVS A;  1Q82 W;  2OTL V;  2DW4 A;  1NQT A;  3I56 V;  2GSM B;  4P9P A;  2XAH A;  3DGE A;  3JCZ A;  4FMT A;  1VQP V;  3SPI A;  4JTA B;  2QE7 G;  2WPD G;  4WFF A;  1Q81 W;  3F5W C;  3OMI B;  2K1E A;  3SPC A;  1H8E G;  2XND G;  5B1N A;  3SPJ A;  1M90 W;  2B1I A;  2FTK A;  1NR1 A;  2ZR2 A;  4I5S A;  1CEZ A;  4MVU A;  1R73 A;  4QPJ A;  4RO2 A;  3CCQ V;  3OFN G;  1Q86 W;  1E79 G;  4N21 A;  2EIM C;  3FB5 C;  5CBG A;  4LC1 A;  5H6R A;  2AHY A;  3OE7 G;  4PEL A;  5CA3 A;  1VQ4 V;  2WLK A;  3MHH C;  3K0D A;  4JTD B;  1QLE C;  2R9R B;  2YEV A;  3JD1 A;  5IYB O;  4I9W A;  1BMF G;  1NH2 B;  1COW G;  3ZIA G;  4ZKI A;  3GB7 C;  1DF5 A;  4MT8 A;  1AI4 A;  1K4C C;  4G27 B;  4MTX A;  2BOC C;  2XAJ A;  3QNE A;  1GO3 F;  3ABK C;  1AJN A;  5EBM C;  2WLN A;  3ASO B;  1PD3 A;  1MAB G;  1P7B A;  1QVF U;  4MS2 A;  4GX0 A;  1V55 C;  1GK9 A;  1MSW D;  4HAM A;  1PNL A;  1AI5 A;  1GKF A;  5C93 A;  2BOB C;  2JEX A;  3ZMS A;  2P7T C;  2X6C A;  4TSF G;  4MVO A;  5L3B A;  3ETE A;  1NVP B;  2Z5U A;  1AJP A;  1K92 A;  1VQN V;  3FB7 C;  5DN6 G;  3CC7 V;  3OW2 U;  2ZDI C;  1NR7 A;  4RUE A;  3CP1 A;  2XAQ A;  1NJI W;  2QTO A;  3HB3 B;  1I5X A;  3SYP A;  5LHI A;  3CCU V;  1K5Q A;  3HPL C;  3K3W A;  1GM7 A;  2XAG A;  2A9H A;  1TUE B;  1QLE B;  4FJC C;  5KUK A;  3ASN C;  1OCZ C;  2DYR B;  3AG1 B;  3UKM A;  1THZ A;  1KQS U;  3RBZ A;  2UXN A;  2HFE C;  2QM8 A;  4JAV A;  3ETG A;  1RPO A;  2WAM A;  3WFV A;  1VQ9 V;  3CCR V;  4XBF A;  4GX2 A;  1JX9 A;  3ZRX A;  4FPP A;  1E1Q G;  1K5S A;  1R3L C;  2Y69 B;  2JK5 C;  3CCS V;  3ABU A;  3OAA G;  4P30 A;  3ZMU A;  2QM7 A;  2DWE C;  1JPX A;  3DTU B;  3P30 A;  5DM6 V;  3FB8 C;  3E89 A;  4R6Z A;  4WFB V;  3LSS A;  4PA6 A;  3SYA A;  4LP8 A;  1H2G A;  3K79 A;  1JVM A;  3E8G A;  1DLB A;  4JPR A;  2JDI G;  4QIW F;  2DQ0 A;  1YIJ V;  1JOY A;  2EIJ C;  3OMN B;  4OXS A;  2X0L A;  1PKX A;  2CK3 G;  2F43 G;  1R6N A;  4MVQ A;  2QEX V;  4WFE A;  5H9C A;  1J95 A;  4KUM A;  3CME V;  1YJW V;  3CCL V;  1QR8 A;  3LDC A;  1K4D C;  4BAY A;  3B8M A;  2WLM A;  1YTF D;  3LDE A;  3SYC A;  2A79 B;  1NVP D;  1GM9 A;  3CD6 V;  3ABL B;  3CMA V;  1NBM G;  2HLD G;  4WFH A;  2DYS B;  2M7W A;  3B8N A;  2QKS A;  1YJ9 V;  3JD3 A;  1FXK A;  3SPH A;  5HFM A;  5B1A C;  3OR7 C;  2PI5 A;  5L3C A;  1K3E A;  2ITD C;  3LDD A;  3SYQ A;  4PA4 A;  5BZB A;  2GHY A;  1YHQ V;  3QO7 A;  2Y69 C;  4RAI A;  3LUT B;  3H01 A;  2AHZ A;  3MD0 A;  2QA4 V;  3OMA B;  3CC2 V;  1OHH G;  1OCC B;  3IC7 A;  4PDV A;  1NKD A;  1SET A;  1V54 B;  2X6A A;  3NXS A;  5EC2 C;  1QR9 A;  5EK0 A;  5KA5 A;  2OCC B;  4QE9 A;  3ASN B;  4GX5 A;  5E1A C;  4X88 A;  1RM1 C;  2IH1 C;  3K03 A;  1XL6 A;  3AEI A;  1AI6 A;  5FL7 G;  4MVM A;  4WF9 V;  4MW3 A;  3CCV V;  2ATK C;  4MTO A;  4HYO A;  4G28 B;  5H6Q A;  1S0V A;  5LGT A;  5L3D A;  1W2B U;  4JF3 A;  4QNH B;  1F23 A;  2IJI A;  1R3J C;  4JGS A;  4CBC A;  2WWW A;  2P67 A;  4J9Z B;  3ZMV A;  3IGA C;  1F4M A;  4L87 A;  5L3E A;  5HFL A;  3CCJ V;  1JQ0 A;  3ABL C;  2DQ3 A;  3CPW U;  3ZRW B;  4WCE V;  1F4N A;  4JYB A;  1EBO A;  4MSW C;  1BL8 A;  2WSS G;  4QJF B;  3W7W A;  2ZDI A;  4J9Y B;  1RPR A;  3AG2 C;  3T1C A;  2X7R B;  4JAS A;  2IJJ A;  3D36 A;  3FYE B;  4XDJ A;  5IY5 B;  1K7D A;  1L1F A;  1ROP A;  5CBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...