2W0FC

Potassium channel kcsa-fab complex with tetraoctylammonium
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
102
structure length
102
Chain Sequence
ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT LIGHT CHAIN
publication title Structures of Kcsa in Complex with Symmetrical Quaternary Ammonium Compounds Reveal a Hydrophobic Binding Site.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/metal transport
total genus 41
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2008-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2w0fC00
1QLEC 4H33A 4I9WA 2EINC 4P30A 4GX5A 2DYSC 1ORQC 2BOCC 2HG5C 3K03A 3WG7C 1K4CC 2WLNA 3OGCC 4WFGA 5CBGA 3F5WC 3T2MA 2BOBC 3SPCA 2Y69C 4X89A 5KUMA 4PA4A 3KG2A 5EC2C 3E8FA 4QNHB 3T4ZA 4MTGA 4QE7A 4R6ZA 4CBCA 1J95A 2ITCC 2Q67A 4JTAB 4P9PA 2A9HA 4MVQA 4MW3A 3LNMB 4RAIA 1R3KC 3F7VC 2WLIA 3FB5C 3K08A 4WFEA 5B1BC 2JK5C 4RO2A 4F4LA 5EBMC 2EIJC 2ZD9A 2WLLA 2IH1C 4RUFA 4X88A 4PDMA 5EBLC 2DYRC 2WLKA 3BEHA 3E8GA 3LDDA 4MTOA 2DWDC 4OXSA 3STZC 3R65A 3AG2C 3RVYA 3ABKC 2EIKC 4LBEC 4MSWC 2ZXWC 3E8HA 2A79B 4WFFA 2ATKC 4MW8A 4MVUA 5CBFA 2HJFC 4MVRA 3OUSA 3AG3C 3RBZA 2X6AA 3X2QC 2WLMA 3SPHA 3TCUA 3RW0A 3T4DA 2X6BA 1OCZC 4R7CA 4TWKA 1P7BA 1M57C 1OCRC 1K4DC 3SYCA 3ASOC 2HVJC 4G28B 2WLHA 4MVZA 4PA6A 5E1AC 4LCUC 4XDLA 4PDVA 1KKDA 1R3JC 3K0GA 1JVMA 1S5HC 2P7TC 3FB8C 4LP8A 3ABMC 5CBHA 3SYAA 4H37A 4XDKA 3TETA 4DXWA 2A0LA 2EILC 3ASNC 4JTDB 3E89A 2K1EA 4HYOA 4RUEA 1R3LC 4PDRA 4MTFA 1R3IC 3K04A 3PJSK 3SYPA 5EC1C 2YEVA 1XL6A 4WFHA 3T1CA 4MVSA 4MVOA 2R9RB 5KUKA 2X6CA 2AHYA 4R8CA 1OCOC 4R50A 2AHZA 1M56C 3ABLC 1G4YB 2HFEC 4XDJA 3LDEA 3EFFK 1LNQA 3OR6C 4PA7A 2HVKC 3LDCA 4X8AA 1OCCC 3LUTB 4GX2A 5EK0A 3SPIA 2NLJC 3STLC 1V55C 5J9PC 4J9YB 1XL4A 3AG1C 5B1AC 3UM7A 4P9OA 2Q68A 4PA9A 5BZBA 2WLIB 5EBWC 3SYQA 3SYOA 3E8BA 2EIMC 3SPJA 5IY5C 3AG4C 2WLJA 2WLLB 3OR7C 3E86A 3UKMA 4GX1A 2H8PC 2ITDC 4PA3A 3E83A 3SJQC 2QKSA 4J9ZB 4P2ZA 3ZJZA 3IGAC 4JTCB 3HPLC 1ZWIC 2W0FC 4BW5A 2KB1A 3ZRSA 3F7YC 4GX0A 3IFXA 5B3SC 3VOUA 3RVZA 2OCCC 3K0DA 3K06A 3SPGA 2Q69A 2QTOA 4MS2A 3OUFA 1BL8A 4EKWA 3FB6C 4UUJC 4PDLA 4ZBMA 4HZ3A 2Q6AA 2IH3C 4MVMA 3GB7C 1V54C 3JYCA 4KFMA 4QE9A 4G27B 2DWEC 3FB7C
chains in the Genus database with same CATH superfamily
1QLEC 3QNEA 1EZJA 2B5UA 2CGNA 1ZUQA 3ZBHA 2QEXV 3OTOO 1AI4A 1ZLZA 4O4HB 5H5NA 4B7KA 4I7ZB 3S3XA 2OIEA 3E8FA 2KG7A 2ZNIA 1PPJH 4LNUA 3DTUB 4IL6Z 1SQXH 2QR4A 4LF4O 4IT5A 2A3QA 1VQ7V 4HNAB 1M90W 2WSSG 2DW4A 3K3WA 1BGYH 4RUFA 2EIJB 4O4JB 3LDDA 4AILC 2YIDA 4WFAV 3JAMN 1NJIW 2R70A 1BZKA 3RW0A 3DGEA 1AR1B 2Q4PA 3QO7A 1QVFU 1YDXA 4GT1A 5LMNO 1XNQB 2YICA 1H2MA 1Q86W 4IHJB 2Q5ZA 3ABMB 1PNLA 1WPBA 3CMEV 2P6JA 3KCYA 2GV9A 4WFHA 4ZHQA 2V4DA 2R9RB 4AQYB 4R8CA 4AHCA 3CPWU 2Q7HA 1I08A 4NVPA 1YF2A 1XL4A 1YCIA 4G2KA 3CRCA 3SYQA 1R73A 3CXCU 2PYJA 1L0NH 2UUBB 1KP3A 3L75H 1RPRA 1W0JG 1WB7A 3J81N 4LF7O 1NVPB 4TQFA 1N32O 2BTOA 4I55B 4OX9O 1SQPH 4X20A 2KKWA 2RCVA 3QVNA 2ZE7A 1YSCA 3CCVV 1DK1A 1AJNA 1NTZH 2BCCH 3BRCA 2OCHA 2EJ7A 1CP9A 1EN6A 2OT5A 4HBNA 3JSNA 2CGOA 4CS2A 4FLUA 3JD4A 2QA4V 2NNUA 4UB8Z 4WBNB 2IW5A 1K97A 4K8XA 1QCEA 1WAZA 2NR5A 3TK1A 1AI5A 4O2AA 1J95A 4L87A 3E22B 3ZRWA 1K5QA 5B1BC 2JK5C 1VMGA 2ZD9A 1YJ9V 1GM8A 2CTPA 3JCUZ 3CCJV 1R1BA 3RVYA 5LMUB 2EIKC 3N2KA 4LBEC 3ZN1A 1XILA 5H6QA 4WFBV 4MVRA 5LHHA 1MSWD 3T4DA 3ZN0A 1SQFA 4X65B 1BCCH 1IVSA 2ZQMA 1VP7A 4YHHO 4JI6O 4TV9A 3WB1A 2Q0AA 1XREA 3IC9A 3L9DA 3P32A 1N4CA 3D3QA 5IWAO 2ZDIA 1VF6C 3K5OA 1WNSA 2AHYA 4JI0O 3OEEG 3UT5B 1SA0B 4J9YB 1I94B 2L35A 3JAWB 1QU7A 5B5EZ 1B06A 5LOVA 1WJZA 4GKKO 3VQVA 3E86A 1M93A 2QDOA 3DSQA 5L3DA 5JJNB 5LA6A 3G6EV 3OAAG 2UXCB 2KB1A 3CMAV 1FS0G 3IFXA 2YI8A 3B40A 4FLXA 2YXYA 4BR6A 5LYJB 3KKYA 2LW7A 4DV2B 3OGIB 1KBHA 3B77A 2DYSC 4JI1B 1P4RA 2CTQA 3WG7B 3EHBB 5EYPA 5LXTB 4DR2B 2LW1A 4J7JA 1Q90D 1VQKV 1L0LH 3A8TA 1OZ0A 3SR2C 2Y48A 3K08A 3FB5C 4C7UA 4DV6O 2Z0AA 2BTQB 5LP6A 2WLLA 4O2BB 4FM0A 2L6LA 4DV5B 3ICXA 3BEHA 1PP9H 1DF5A 2ZIMA 3E8HA 4TT3G 2F95B 4UV8A 4LFCO 3Q4HA 3AG3B 5CN0A 3HKBB 1AI7A 1OCZC 1Y66A 1Z5WA 1OCRC 1P49A 1Y74A 1K8AW 4KHPO 3I56V 4LCUC 4PDVA 1HNZO 1WB8A 3FB8C 4JV5B 1VQ4V 3MDSA 4DXWA 4DV3O 5BMVB 3DC5A 1BMFG 4UCVA 4O4LA 1R3LC 1JJ2U 1YXBA 3P3PA 4J7ZA 2VWJA 4UVAA 4JI8O 1PKXA 3QF7A 1AROP 4YXWG 4X66B 1OHHG 3LDEA 3EFFK 4OGQB 1IBKB 5BXZA 3O65A 4NTWA 5DM6V 1V55C 1FXHA 5EBWC 3U10A 3LSUA 4KUMA 5JVDB 2MK3A 3SJQC 2A06H 3ZJZA 3L71H 3RGBA 1EN5A 2B1GA 1ENVA 3WFVA 2VQEB 2LJ2A 1D5NA 4I50A 4I9QA 3A2FA 1LUVA 2AW9A 1H2LA 2OWOA 5IY5B 4UCUA 4GX5A 3OM3B 1W2BU 5CA1B 2BOCC 3WB2A 2F93B 4GUNA 3APQA 2XUMA 4LF9B 3T4ZA 5LL6Y 4LF8B 4TSFG 4NXNB 2QM7A 4RAIA 2YIAA 2WLIA 3THOA 1DLBA 4U3FH 4JI5B 3JD2A 3JATA 2DYRC 4FZ0A 1S76D 2E74B 3FYEB 1WA8A 1FJGB 1ROPA 4JYCA 2H3OA 4DR4O 5KHGA 4DR5O 1NH2B 1P7BA 2E75B 3W7XA 4G28B 2WLHA 2EZOA 3HKCB 2Z3YA 5GONA 3G71V 2N05A 4X1IB 3N2GB 4H37A 1AJPA 3LNNA 4FLVA 1XMOB 5IYZB 1RPOA 3HKDB 2C2AA 3CX5F 3I5DA 2P4VA 1JFFB 3OR6C 3C3SA 1YEWA 3CJHA 3H9VA 1NI8A 5KA6A 3UM7A 2Q68A 2XAFA 5HFMA 2XAHA 3AG1B 2Q9LA 4DUZB 3SPJA 4FLYA 1L1FA 5JWPA 4FLWA 4DK0A 1K33A 1HR0B 1HW7A 3CP1A 4DUYO 5B3SB 1EM1A 2Q69A 4I0XB 2JEXA 2DE0X 5IE9A 2DOSA 1ZL8A 1V54C 1NBMG 4YIOA 1VF5B 1H8EG 1TVKA 2QM4A 4K8ZA 2EIMB 3H01A 1MABG 2VWKA 3H1HH 4FFKA 3K59A 1G1XB 4CH3A 5CBGA 1VF6A 2BOBC 3P30A 3SPCA 4IYIA 5EC2C 3CCRV 2Y69B 1GK9A 3ZHVA 1RM1C 1I7FA 4MTGA 2ZCEA 2UXNA 4FPPA 3JAKB 3CSXA 4F4LA 2IJHA 3K58A 5EBMC 2QTSA 1PD3A 4DR6B 4DR3B 2E76B 5KX5B 4ZIBA 3GWKC 4MSWC 1M9NA 4QJFB 4J10A 3L73H 3CCSV 3NR7A 3TXSA 3J80N 4B3SO 1FYJA 5KA5A 2UXBB 2JDIG 2ADPA 2P7TC 2HLDG 2KQXA 1K34A 4GYCB 2EILC 4JI0B 4NXMB 5ITZA 4JYYA 3T1YO 3ASNB 4J41A 1K5SA 4PI2A 5JQGA 4LFBO 2ZR2A 2RDCA 4FFBB 2HFEC 3BA8A 3LDCA 1VQ8V 1Y76A 4DRXB 3RYCA 4GLXA 2XOKG 1I5YA 3AG7A 3O9OA 4NKGB 4U7NA 4H44B 2R9IA 5IDJA 4U7OA 1THZA 3UKMA 2YUAA 4PA3A 3CCMV 4J9ZB 1QBZA 1RFYA 2R9AA 3HPLC 5H2FZ 4KL1A 1JPXA 3JD1A 3IAYA 3RVZA 4FIPC 1F7YA 1N36O 2PF4E 4JI7O 2ZM6O 1FXKB 1S0VA 3FYIB 1S77D 3HKEB 1GRJA 3K9AA 5JH7A 1R6KA 2DWEC 4W4KA 1BS3A 4H33A 5L3CA 5KAFZ 3OGCC 3ZS8C 1KMIZ 1Y4MA 1IBMO 4B3RB 2OTLV 1PNKA 4Z1MG 3H1IH 1Y6XA 4QE7A 2Y0IA 3WB0A 4CS4A 2ETNA 3ZMVA 4MW3A 4FMTA 1YTFD 1SERA 1Y67A 3H1JH 2F43G 5K1XA 2WWWA 5TISZ 1QLNA 3AG2C 1P7GA 4O4HA 1N34B 2ATKC 3OUSA 3ETQA 5BR8O 4DV0O 3RT3C 3SJAC 3CRMA 4BIUA 4LF6O 1XMQB 2UU9O 4PA6A 2AXTZ 1M57B 4HNAA 1S5HC 4LP8A 1IBLO 4K0KB 2A7WA 4JYAO 1EBOA 1QHTA 4O4IB 2AGAA 4HYOA 2PTMA 1NR1A 2LFRA 3K04A 1SQGA 2Q0OC 1N33O 1AR5A 4LNUB 3KZIZ 2KSDA 3JASA 2PGGA 1HNWB 3SPIA 3L70H 1VQLV 1LUWA 4PA9A 4QGPA 1SZTA 3CC2V 5IY5C 4XBFA 4L8JA 4P2ZA 1TGOA 2UXDB 3EXAA 5D5PA 4GKJO 2LO1A 1RSOB 1MOFA 1NZ6A 4DV7O 2JGDA 5FNVB 3JYCA 3ETGA 2HHHB 1XHZA 3LSSA 1H8HG 4UCOA 4MT8A 4YJ3B 4YJ2B 5CA0B 1XI1A 4FLZA 4ZOLA 3CWBH 5L3EA 3G67A 4UVCA 4TUYB 3B8NA 2OIGA 4P9PA 2WAMA 5KMGA 1GN4A 2W6IG 1ZSPA 2EJRA 3OTFA 3ABKC 4JZ2A 1FD9A 5F2VO 1F51A 1SKVA 4MW8A 4JI3O 4RQFA 2X6AA 4X20B 3SJBC 1N0NA 3X2QB 3E22A 4U3JA 3RYIA 1X59A 1P84F 5FPRA 1KKDA 1H2SB 4JGSA 5FL7G 3SYAA 2RN9A 1KP2A 4JI4B 4KP4A 5IJ9A 3ZX6A 3E89A 3FX7A 2K1EA 2CDYA 2F4VB 3PJSK 1MMMA 3J7AU 2Q8VA 3ABUA 2AZ0A 1OCOC 2E5LB 5J2TB 5H6RA 2YS8A 1JQ0A 1M5IA 2IU0A 3W7UA 4O2AB 3K5NA 4IYHA 5B1AC 3ZRWB 4IIJB 3SYOA 4DUYB 2EIMC 1VQNV 4NR1A 2JIZG 3N2KB 2QWRB 4BW5A 1NVPD 1VQ5V 5H9CA 2ZE8A 1I5XA 3K06A 1KQSU 3ZHQA 3JD0A 4MS2A 5CA3A 2Q7GA 3JAWA 5KHIA 3RYFA 4TV9B 1NR7A 3HR0A 3G6BA 3PN1A 4CH5A 1FFXA 2EINC 4YY3O 1K4CC 3CCUV 4X89A 3MHHC 1AJQA 2Y4TA 2RMKB 2P90A 4GZRB 4H13B 3UCSC 2VS0A 3ZMTA 2A9HA 1FPOA 3LNMB 2Z5UA 2CE4A 3DXRB 1XNRO 3ZHUA 3S3WA 5LOVB 1HNXB 2QKAA 5LHGA 1B6QA 4LC1A 3STZC 5LA6B 1SQVH 1U96A 1KU9A 4FJCC 2UUCB 3ZHSA 1GM7A 2UUAB 3BVOA 1MA1A 2QWQB 1E1QG 1MNGA 4B3MB 3ASOC 4HAMA 1Q8IA 5KHHA 1R3JC 2IJKA 1AP6A 2XASA 4X9QA 2BTQA 3IJ4A 4F6EA 2QJ1A 3BHPA 2CAZC 1MZFA 1R3IC 4MVOA 2R72A 2UXXA 2PYLA 1IXMA 1M56C 4TQDA 3ABLB 2W6JG 2HVKC 4DR7O 3LUTB 2YIBA 1OCCB 4DV1O 2ZKOA 3BA9A 2WPDG 1F4NA 5BZBA 2HR3A 2K9PA 1J5EO 5LP6B 2M7WA 2WLLB 1XQ8A 3AG4B 1K9MW 4JI2B 2H8PC 4X62B 4UV9A 2P67A 1G6UA 4DR1O 4DV4O 5JCOA 3Q4HB 2P5OA 4K35A 2OCCB 4MTXA 1R6NA 3QG5A 1K3EA 3FB6C 1YZBA 3UO2A 3CRQA 4G27B 3T1HB 1B04A 2D2CB 5JVDA 4LH7A 1Q3EA 4I9WA 4P30A 1FFTB 4QPJA 4Q6GA 2RQ6A 1QLEB 5LGNA 2EZPA 3U0ZA 3T2MA 2GUZA 1U97A 5K1PA 3MAQA 4JTAB 4Q20A 4CC6A 4F6RA 4MVQA 3F7VC 3OTOB 2OYQA 3JSLA 2EIJC 5KLVH 1FXVA 4PDMA 1H2GA 1BSMA 1JR9A 4X64O 2DWDC 4OXSA 1XNQO 2NN4A 4LWSB 4X1YA 4Z2WA 3RYHA 4LF4B 1GM9A 1YVWA 1VEWA 4UFZA 4TWKA 2B1IA 5E1AC 2ILMA 1YITV 4AQYO 2YIBD 3ABMC 4JYBA 3TGUH 2PI4A 4JTDB 3LSQA 1YJNV 4MTFA 2JS3A 5LMNB 1EFRG 4MVSA 4A5UB 2X6CA 3ZCCA 4JAUA 3A0RA 1TAEA 2UUBO 3M8AA 4UXNA 2OTJV 3HKCA 3STLC 4PV1B 4X1IA 3N2GA 4J11A 2WLIB 5AG2A 5KHJA 2WLJA 4TV8A 3VQXA 4IGGA 3HKDA 3CRRA 3E83A 1FAFA 1DTOA 2WA4A 2H94A 1EN4A 2LGWA 3VBBA 5J2UA 2YXLA 1BQZA 4PDLA 3ETDA 4HZ3A 2Q6AA 5GONB 4LF7B 1N32B 3CE2A 1BE3H 4KFMA 5A9GA 1S72V 1JJOA 4OX9B 1HP8A 4GCZA 2HEPA 1WLEA 2P22C 2X7RB 3F5WC 2JJ1G 3E2EA 3KG2A 4QNHB 1IDSA 4I0XA 5LHIA 1KECA 4X1KB 1XHXA 1US6A 3OMNB 5LMUO 2ITCC 2Q67A 1PV0A 3CJHB 2RJZA 1PNMA 2QWNB 5B1BB 4BIOA 4X65O 4KXRA 2IH1C 1B3QA 5IJ0A 2BSKB 1CEZA 1HDJA 3R65A 1TUEB 2EIKB 2QWOB 4MVUA 5EZYB 3TCUA 1AI6A 3BCCH 1V9PA 3JAKA 1H38A 2LFSA 2JGUA 4NTYA 3U11A 4EFBA 2JRIA 2A0LA 2Y4UA 1TVKB 1RP3B 4CH6A 4I4TB 5KX5A 4RUEA 2FL4A 1YHQV 1I94O 2YEVA 3W7SA 3T1CA 3FAVA 1AILA 4YHHB 4JI6B 4TOIA 2XNDG 2G38A 2O57A 4XDJA 3FFQA 3OE7G 2ZNJA 1IZ3A 1SRYA 1TA8A 5IWAB 2UXCO 3ABTA 3TXQA 1TUBA 2Q73A 3GVMA 3E35A 1PL4A 5IYDO 5JJJB 3IGAC 4DV2O 3QO8A 4GX0A 1Z2GA 1VQOV 3RWRD 4GKKB 4JI1O 4DRXA 3AK1A 4CC5A 1BL8A 2ZE5A 2VQFO 4UUJC 4ZBMA 5C8YB 4DR2O 2DMXA 3GB7C 2CH7B 2FKXA 2HP8A 4RQEA 4EB6B 1ZTEA 3RN4A 3M99B 4PJ0Z 1ORQC 3WG7C 3K03A 2MW2B 2DYSB 2QKCA 4ZI7B 1QQCA 2P4KA 2EX3A 5JQGB 1YJWV 1KUQA 4DV5O 5IYBO 5CB4A 2YDEA 3GWOA 2Q7EA 1VF7A 5L3BA 4DW1A 1NT2B 4PI0A 3RYCB 2ADQB 1R3KC 3EVKA 4AI8A 1M1KW 1HWYA 2VRZA 1R6TA 4JV5O 2FTKA 4WFFA 5BY1A 3AG3C 2ZINA 3DC6A 4DV6B 4WCEV 1SESA 1UFIA 4UVBA 4CS3A 1VQ9V 3B4SA 1OCZB 4MVZA 2XTAA 4K3AA 1KYOF 1OCRB 1JCHA 4LFCB 5B1NA 3G4SV 3JALB 3JARB 1AB3A 4KHPB 3C3TA 3SYPA 1HNZB 2IJIA 4FLTA 5JCOC 3BAAA 4JASA 1G4YB 3ZRVA 4DV3B 1J5EB 4LF5O 2XT9A 4GX2A 2NLJC 4DR1B 4JI8B 1WP7A 3M7MX 4ASUG 5GTIZ 2VQEO 4O4JA 2ARHA 1NKDA 2GTAA 3JCZA 1W59A 1Q7YW 5E79Z 1E79G 2N74A 3SPGA 2KG7B 3H1KH 2FYUH 2CUGA 1O9GA 4CZZA 1OV9A 4IHJA 2JS5A 3C90A 2V1DA 4QE9A 4LF9O 1GAXA 3K79A 4LF8O 3BY6A 4NXNO 3QO5A 3WU2Z 2WLNA 4JI5O 3SGIA 5KUMA 1RSOA 3TJTA 4X64B 2FB5A 3JASB 1FJGO 5FNVA 3D36A 3CC4V 2LGQA 2PUSA 4DW0A 1MG1A 1QR9A 1JX9A 2XAGA 4YJ3A 1BHAA 4YJ2A 2DYRB 5B66Z 1NTMH 5CA0A 4I55A 4ZHQB 3RBZA 4YIPA 4B3TO 2WLMA 1XMOO 2RNBA 3SYCA 4TUYA 1K4DC 3NXSA 2HVJC 1SQQH 2YXHA 1JVMA 3A0BZ 1CPYA 2JGDB 5CBHA 4DR4B 4QIWF 4DR5B 3F5TA 5EC1C 2ODMA 5LGUA 4D6TH 4DUZO 4WBNA 4ZOLB 1DGSA 3CYOA 5EK0A 1HR0O 5J9PC 1COWG 3AG1C 3CC7V 3D8CA 5KMGB 4LFAO 1JOYA 2GDSA 1KKCA 3ZRSA 3F7YC 5J2TA 2M6YA 5B3SC 4FZ1A 2QE7G 5DEDA 1Q6IA 4JF3A 4U3JB 3RYIB 1YI2V 4EKWA 5JJEB 3L72H 3OMAB 4IIJA 5A2QN 1V54B 3FB7C 2QM8A 5IJ9B 3ETEA 3B09A 3W7TA 1AVMA 2Y69C 1T5EA 4Z1VA 3SDLA 3OFNG 4DR3O 4DR6O 3K9SA 3UT5A 4FM2A 1SA0A 1WP8A 3ML0A 1RM1B 3BPZA 1LR1A 1K7DA 4I5SA 3ZMZA 3CD6V 4N23A 4PELA 4WFEA 4RO2A 4X88A 1VQPV 1H2KA 2UXBO 2BE3A 5IYCO 2A79B 1N0JA 1GN2A 2CTWA 2YI9A 2HJFC 4ZKIA 3P3NA 1UJWB 4NXMO 2DQ3A 5LYJA 1Q6HA 2GBOA 2XHBA 4JZGA 3K0GA 3RYFB 3DXRA 2ZE6A 4JAAA 3ASNC 3CCLV 2EILB 1FFXB 4PDRA 3OT7A 1E1RG 1KB9F 4B3SB 5EIBC 1XL6A 2F23A 2LP7A 5LXTA 4J7KA 1WN7A 2HKOA 2ZXWB 3D3IA 3SJCC 1K73W 3OEHG 3A0HZ 3T1YB 4PA7A 4X8AA 1VARA 5GTHZ 4ABMA 3W7WA 1X4TA 1F4MA 1N8RW 1KC8W 1KD1W 1IXBA 4LFBB 4O2BA 1F23A 3VQWA 2YSUB 3VQYA 3OR7C 3CRAA 1NQTA 4GX1A 2QKSA 1NS1A 2VQFB 4PHZA 5FPOA 5EYPB 3VOUA 2LQTA 3K0DA 3HKBA 3N27A 1FXKC 4B7EA 2ZT9B 4MVMA 2X0LA 4B3RO 2IU3A 2EBOA 5BMVA 2E3CA 3APOA 4J42A 2D3OW 1Q81W 5D5QA 4RWUA 5KAIZ 1N36B 2XAJA 4JI7B 2ZM6B 1S5LZ 4EEQA 1AR4A 2PY5A 2Y0PA 1Y74B 1OJHA 1N34O 1GO3F 1GN3A 2F1MA 1VIBA 1IBMB 2P06A 2AZ2A 1XMQO 3E8GA 3CB2A 4O4LB 1GTOA 4K0KO 3AG2B 3ZHTA 5CBFA 3SPHA 4PD4F 1XOUA 2X6BA 4R7CA 1GH6A 1M57C 3TETA 4LF5B 5CMUA 5BR8B 4DV0B 1HNWO 3BFRA 5CA1A 4LF6B 4LWSA 2UU9B 2DQ0A 1EZVH 5KUKA 1IBLB 2GUZB 4JAVA 4JYAB 4R50A 2ZIOA 3AK2A 1LNQA 3OMIB 3CCEV 2PZSA 1SQBH 4F6RB 2QSAA 5DECA 2UXDO 4I50B 1BQ0A 3CXHF 1N33B 2JJ2G 3E8BA 2DN9A 1XUQA 2ITDC 5LGTA 2IBZH 1URFA 4JTCB 3L74H 4X1YB 2XAQA 3RYHB 2HHHO 5C93A 3QTCA 3CCQV 1GKFA 1XBLA 4LH6A 1MZEA 3G80A 3OUFA 4JPRA 3D36C 1Q43A 5L3GA 1S5JA 4UCSA 1S3JA 4E4EA 1Z5VA 3JATB 4UCRA 5IYZA 4GKJB 3KCXA 3OD4A 1H2NA 2HG5C 3ZMUA 1WA8B 4WFGA 4QPKA 3B2EE 1VQ6V 4DV7B 4N21A 3ZHRA 2HJDA 1O9HA 1JFFA 4EFEA 1D2DA 4R6ZA 4CBCA 3ZMSA 4BWAA 2GSMB 1A32A 1W0KG 3MD0A 1QNMA 3ZRXA 4B3TB 5B1OA 4TV8B 2WLKA 4MTOA 1SS3A 1SETA 2EULA 4DYLA 2ZR3A 3ABKB 4JI4O 3X2QC 4X1KA 3K5MA 5J2UB 1JMKC 1SC5B 1NTKH 4BIZA 2F4VO 4OPHA 2V7QG 1SF9A 3IC7A 1DF4A 3AEIA 2E5LO 4XDKA 1QR8A 4JI3B 1BHBA 2BSKA 4W4LA 2JEUA 1K92A 4NTXA 1MSDA 3FD9A 5IT9N 3R66A 4NYKA 3BABA 1GMGA 1PL0A 2N04A 5EZYA 3OW2U 3UO3A 3K57A 1BT8A 2AHZA 4LFAB 1OCOB 1M4UA 1NH2D 1Q5OA 4E2LA 1ZAUA 4P9OA 5B1AB 1ZL8B 4D7TA 4I4TA 2DJVA 5IJ0B 1IURA 4H0LB 4BW9A 1YIJV 1ZWIC 2W0FC 5LBQA 5FLXN 3ZEDA 1L8DA 4DK1A 2QTOA 1NU1H 1AP5A 4WF9V 3CEIA 4FVMA 4J80A 2ZDIC 4BAYA 3AK3A 2EINB 1UPGA 4FM1A 2YEVB 3FAVB 4UB6Z 1D5AA 4PA4A 4FFBA 3JD3A 1HNXO 2CK3G 1WPXA 3FKSG 4YY3B 2F66C 5C8YA 1Q82W 3CHXA 2UUCO 1YTFB 3H1LH 2PI5A 2CH7A 2UUAO 4FK5C 1TUBB 4EB6A 4B3MO 5EBLC 4B08A 2GHYA 5L3FA 5ITZB 1G8MA 2QGNA 4ZI7A 2GTSA 2ZXWC 1QVGU 3B8MA 1XNRB 5GW7A 3I55V 4D7SA 2YC0A 2IJJA 1FXKA 4XDLA 2QWPB 3ASOB 1Y76B 1XDCA 3HKEA 3RFRA 5DN6G 4ICGA 1SZXA 2JVDA 4CH4A 3UQ8A 4LR3A 4NB5A 3HB3B 3ABLC 2FMLA 5CB4B 4JI2O 1M56B 4X62O 1OCCC 2CTRA 1JA8A 3ZIAG 4X66O 5LP6C 1I0HA 3JALA 3AG4C 1CXZB 5JH7B 4UCTA 3JARA 1ZX3A 1VQMV 1IBKO 1PM9A 1GN6A 4DR7B 5HFLA 4DO2A 2W0XA 4DV1B 2B9ZA 3MHSC 3T1HO 5EIBD 2OCCC 4OPAA 3CS5A 1Q6UA 1XEQA 2WA3A 3K5LA 1FKAO 2IH3C 1IX9A 1V55B 2IM9A 5KHKA 4DV4B 4O4IA
chains in the Genus database with same CATH topology
1QLEC 2EIMB 3H01A 1EZJA 1MABG 3ETEA 1FFTB 3QNEA 4I9WA 4P30A 4QPJA 1QLEB 2B5UA 5LGNA 2EZPA 5CBGA 2QEXV 3T2MA 1AI4A 2BOBC 3P30A 3SPCA 3W7TA 2Y69C 3OFNG 5EC2C 3E8FA 3CCRV 2Y69B 1GK9A 1RM1C 4MTGA 3DTUB 3ML0A 1RM1B 4JTAB 1K7DA 4Q20A 4I5SA 2UXNA 4MVQA 4FPPA 3ZMZA 1VQ7V 4N23A 4PELA 1M90W 3CD6V 4WFEA 3F7VC 4F4LA 2WSSG 2IJHA 4RO2A 2DW4A 5EBMC 2EIJC 3K3WA 1PD3A 1FXVA 4RUFA 4X88A 4PDMA 1H2GA 2EIJB 1VQPV 3LDDA 2DWDC 4OXSA 4MSWC 5IYCO 1M9NA 4WFAV 2A79B 4QJFB 1GM9A 1NJIW 2HJFC 4ZKIA 1UJWB 3CCSV 2DQ3A 3RW0A 3DGEA 1AR1B 4TWKA 2B1IA 5E1AC 3QO7A 1QVFU 4GT1A 5KA5A 3K0GA 1YITV 2JDIG 2P7TC 2HLDG 1K34A 1Q86W 3ABMC 4JYBA 3ABMB 1PNLA 2EILC 3ASNC 3CMEV 3CCLV 4JTDB 3LSQA 2PI4A 2P6JA 2EILB 3ASNB 1YJNV 4PDRA 4MTFA 1E1RG 1XL6A 1K5SA 4WFHA 1EFRG 4MVSA 2LP7A 2R9RB 2X6CA 2ZR2A 3ZCCA 4JAUA 3A0RA 2HKOA 3D3IA 2ZXWB 4R8CA 1K73W 2HFEC 3OEHG 4UXNA 4PA7A 3LDCA 4X8AA 3CPWU 1VQ8V 2OTJV 3W7WA 3STLC 2XOKG 1XL4A 4G2KA 1I5YA 1F4MA 2WLIB 3SYQA 1N8RW 1KC8W 1R73A 1KD1W 3CXCU 4U7NA 2WLJA 1F23A 2R9IA 2YSUB 5IDJA 4U7OA 3OR7C 1KP3A 1THZA 1NQTA 3UKMA 4GX1A 4PA3A 3E83A 1RPRA 1W0JG 2QKSA 3CCMV 4J9ZB 1QBZA 1DTOA 3HPLC 1NVPB 2H94A 1JPXA 3JD1A 3VBBA 3VOUA 3RVZA 3K0DA 4FIPC 1FXKC 1YSCA 3CCVV 1FXKB 1S0VA 1AJNA 3FYIB 4PDLA 3ETDA 4HZ3A 1S77D 2Q6AA 4MVMA 2X0LA 2IU3A 2EBOA 3K9AA 4KFMA 1R6KA 1S72V 1CP9A 2OT5A 2DWEC 2D3OW 1Q81W 4H33A 5L3CA 4GCZA 1WLEA 2XAJA 2X7RB 3JD4A 3OGCC 2QA4V 3F5WC 2JJ1G 2NNUA 3E2EA 1Y4MA 3KG2A 2IW5A 1K97A 2OTLV 1PNKA 4QNHB 1QCEA 4Z1MG 5LHIA 1KECA 3TK1A 4QE7A 1AI5A 3OMNB 1J95A 2ITCC 2Q67A 4L87A 3ZMVA 4MW3A 1GO3F 3ZRWA 4FMTA 1K5QA 1YTFD 5B1BC 2JK5C 1SERA 1PNMA 2ZD9A 5B1BB 1YJ9V 2IH1C 1GM8A 3CCJV 2F43G 3E8GA 1CEZA 2WWWA 1QLNA 3R65A 1GTOA 3AG2C 3RVYA 2EIKC 3ZN1A 4LBEC 3AG2B 1TUEB 2ATKC 5H6QA 2EIKB 4WFBV 4MVUA 5CBFA 4MVRA 3OUSA 3SPHA 3TCUA 5LHHA 1MSWD 3T4DA 1AI6A 3ZN0A 2X6BA 4R7CA 4BIUA 1M57C 4PA6A 1M57B 2ZQMA 1S5HC 1H38A 4LP8A 2LFSA 3TETA 1EBOA 2A0LA 3P32A 5CMUA 4HYOA 4RUEA 1YHQV 1NR1A 2LFRA 2ZDIA 3K04A 2DQ0A 2YEVA 3W7SA 3T1CA 5KUKA 2XNDG 2AHYA 4JAVA 4R50A 3OEEG 4XDJA 1LNQA 3OMIB 3OE7G 3CCEV 3SPIA 1SRYA 4J9YB 1VQLV 3ABTA 4PA9A 1SZTA 3CC2V 2JJ2G 3E8BA 5IY5C 4XBFA 3E35A 3E86A 2ITDC 5L3DA 5LGTA 5IYDO 3G6EV 4P2ZA 3IGAC 3OAAG 4JTCB 3QO8A 2XAQA 2KB1A 3CMAV 1FS0G 4GX0A 5C93A 3IFXA 3CCQV 1GKFA 1VQOV 3OUFA 1BL8A 4JPRA 1MOFA 4UUJC 4ZBMA 5L3GA 3GB7C 1S3JA 3JYCA 3ETGA 3LSSA 4RQEA 1H8HG 3B77A 3M99B 2DYSC 4MT8A 1ORQC 3WG7C 2HG5C 3K03A 3ZMUA 1P4RA 4WFGA 2DYSB 3WG7B 4QPKA 3EHBB 1VQ6V 4N21A 1YJWV 5IYBO 3GWOA 5L3BA 1VQKV 5L3EA 4R6ZA 4UVCA 4CBCA 3ZMSA 3B8NA 4P9PA 1OZ0A 2GSMB 1R3KC 2Y48A 3K08A 3FB5C 1W0KG 3MD0A 3ZRXA 2WAMA 1M1KW 1HWYA 5B1OA 2WLLA 2WLKA 3BEHA 4MTOA 2W6IG 1SETA 2EJRA 2ZR3A 3ABKC 1DF5A 2FTKA 3E8HA 1F51A 4WFFA 4MW8A 3ABKB 4TT3G 4UV8A 4RQFA 3AG3C 3X2QC 2X6AA 4WCEV 3AG3B 5CN0A 3X2QB 1SESA 1AI7A 1OCZC 1VQ9V 1Y66A 4UVBA 1OCRC 1K8AW 4BIZA 1OCZB 4MVZA 2V7QG 3I56V 1OCRB 4LCUC 4PDVA 1KKDA 3IC7A 4JGSA 1DF4A 3FB8C 5FL7G 3AEIA 3SYAA 1VQ4V 1JCHA 1QR8A 4XDKA 1BHBA 1KP2A 4DXWA 4KP4A 2JEUA 5B1NA 1K92A 3G4SV 3E89A 1BMFG 2K1EA 1R3LC 1JJ2U 3PJSK 3SYPA 3OW2U 1GMGA 1PL0A 4UVAA 3ABUA 1PKXA 4YXWG 1AROP 1OHHG 2IJIA 1OCOC 4JASA 2AHZA 5H6RA 1G4YB 3ZRVA 3LDEA 3EFFK 1OCOB 1JQ0A 2IU0A 3W7UA 1NH2D 4GX2A 2NLJC 5DM6V 1V55C 1FXHA 5B1AC 3ZRWB 4P9OA 4E2LA 5EBWC 5B1AB 3SYOA 2EIMC 4ASUG 1VQNV 4KUMA 2MK3A 1NKDA 3SJQC 3JCZA 3ZJZA 1YIJV 2JIZG 1ZWIC 2W0FC 4BW5A 1Q7YW 1E79G 1NVPD 5LBQA 2B1GA 5H9CA 1VQ5V 1I5XA 3K06A 3SPGA 1KQSU 1ENVA 3WFVA 2QTOA 3JD0A 4MS2A 5CA3A 4CZZA 4QE9A 2V1DA 1NR7A 4WF9V 3K79A 2ZDIC 2EINC 3BY6A 4GX5A 4BAYA 3OM3B 5IY5B 1W2BU 2BOCC 3QO5A 2EINB 1K4CC 2WLNA 2YEVB 3CCUV 4X89A 5KUMA 4PA4A 3MHHC 1AJQA 3JD3A 2CK3G 1WPXA 3T4ZA 3FKSG 3ZMTA 2P90A 4TSFG 2A9HA 1Q82W 2QM7A 3D36A 3CC4V 1YTFB 3LNMB 2Z5UA 2PI5A 4RAIA 2WLIA 1DLBA 4FK5C 1MG1A 3JD2A 1QR9A 5EBLC 1JX9A 2DYRC 2XAGA 2GHYA 5L3FA 1S76D 1G8MA 5LHGA 1BHAA 1B6QA 4LC1A 3FYEB 2DYRB 3STZC 1ROPA 4JYCA 2ZXWC 1QVGU 4FJCC 3B8MA 3RBZA 2WLMA 1GM7A 1E1QG 5GW7A 3I55V 1NH2B 3SYCA 1P7BA 1K4DC 3NXSA 3ASOC 3W7XA 2HVJC 4G28B 4HAMA 2WLHA 2IJJA 1FXKA 2EZOA 4XDLA 3ASOB 1R3JC 2IJKA 1JVMA 2Z3YA 1CPYA 3G71V 5CBHA 2XASA 4H37A 5DN6G 1AJPA 4QIWF 1RPOA 1R3IC 2C2AA 5EC1C 5LGUA 4MVOA 2UXXA 1IXMA 3HB3B 1M56C 3ABLC 3OR6C 1M56B 2W6JG 3ABLB 2HVKC 3CYOA 1OCCC 3LUTB 5EK0A 5J9PC 1COWG 1OCCB 3ZIAG 3AG1C 3UM7A 5KA6A 2WPDG 1F4NA 2Q68A 2XAFA 5BZBA 5HFMA 2HR3A 2XAHA 3CC7V 3AG1B 3SPJA 3AG4C 2M7WA 2WLLB 1L1FA 3AG4B 1VQMV 1K9MW 1JOYA 2H8PC 4UV9A 1K33A 2P67A 5HFLA 4DO2A 3ZRSA 3F7YC 3CP1A 3MHSC 5B3SC 2OCCC 2QE7G 5B3SB 4JF3A 2Q69A 2OCCB 2JEXA 4MTXA 1YI2V 1R6NA 4EKWA 1K3EA 3FB6C 3OMAB 2IH3C 1V54C 1NBMG 1V55B 4G27B 1V54B 1H8EG 3FB7C 2QM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QLE C;  4H33 A;  4I9W A;  2EIN C;  4P30 A;  4GX5 A;  2DYS C;  1ORQ C;  2BOC C;  2HG5 C;  3K03 A;  3WG7 C;  1K4C C;  2WLN A;  3OGC C;  4WFG A;  5CBG A;  3F5W C;  3T2M A;  2BOB C;  3SPC A;  2Y69 C;  4X89 A;  5KUM A;  4PA4 A;  3KG2 A;  5EC2 C;  3E8F A;  4QNH B;  3T4Z A;  4MTG A;  4QE7 A;  4R6Z A;  4CBC A;  1J95 A;  2ITC C;  2Q67 A;  4JTA B;  4P9P A;  2A9H A;  4MVQ A;  4MW3 A;  3LNM B;  4RAI A;  1R3K C;  3F7V C;  2WLI A;  3FB5 C;  3K08 A;  4WFE A;  5B1B C;  2JK5 C;  4RO2 A;  4F4L A;  5EBM C;  2EIJ C;  2ZD9 A;  2WLL A;  2IH1 C;  4RUF A;  4X88 A;  4PDM A;  5EBL C;  2DYR C;  2WLK A;  3BEH A;  3E8G A;  3LDD A;  4MTO A;  2DWD C;  4OXS A;  3STZ C;  3R65 A;  3AG2 C;  3RVY A;  3ABK C;  2EIK C;  4LBE C;  4MSW C;  2ZXW C;  3E8H A;  2A79 B;  4WFF A;  2ATK C;  4MW8 A;  4MVU A;  5CBF A;  2HJF C;  4MVR A;  3OUS A;  3AG3 C;  3RBZ A;  2X6A A;  3X2Q C;  2WLM A;  3SPH A;  3TCU A;  3RW0 A;  3T4D A;  2X6B A;  1OCZ C;  4R7C A;  4TWK A;  1P7B A;  1M57 C;  1OCR C;  1K4D C;  3SYC A;  3ASO C;  2HVJ C;  4G28 B;  2WLH A;  4MVZ A;  4PA6 A;  5E1A C;  4LCU C;  4XDL A;  4PDV A;  1KKD A;  1R3J C;  3K0G A;  1JVM A;  1S5H C;  2P7T C;  3FB8 C;  4LP8 A;  3ABM C;  5CBH A;  3SYA A;  4H37 A;  4XDK A;  3TET A;  4DXW A;  2A0L A;  2EIL C;  3ASN C;  4JTD B;  3E89 A;  2K1E A;  4HYO A;  4RUE A;  1R3L C;  4PDR A;  4MTF A;  1R3I C;  3K04 A;  3PJS K;  3SYP A;  5EC1 C;  2YEV A;  1XL6 A;  4WFH A;  3T1C A;  4MVS A;  4MVO A;  2R9R B;  5KUK A;  2X6C A;  2AHY A;  4R8C A;  1OCO C;  4R50 A;  2AHZ A;  1M56 C;  3ABL C;  1G4Y B;  2HFE C;  4XDJ A;  3LDE A;  3EFF K;  1LNQ A;  3OR6 C;  4PA7 A;  2HVK C;  3LDC A;  4X8A A;  1OCC C;  3LUT B;  4GX2 A;  5EK0 A;  3SPI A;  2NLJ C;  3STL C;  1V55 C;  5J9P C;  4J9Y B;  1XL4 A;  3AG1 C;  5B1A C;  3UM7 A;  4P9O A;  2Q68 A;  4PA9 A;  5BZB A;  2WLI B;  5EBW C;  3SYQ A;  3SYO A;  3E8B A;  2EIM C;  3SPJ A;  5IY5 C;  3AG4 C;  2WLJ A;  2WLL B;  3OR7 C;  3E86 A;  3UKM A;  4GX1 A;  2H8P C;  2ITD C;  4PA3 A;  3E83 A;  3SJQ C;  2QKS A;  4J9Z B;  4P2Z A;  3ZJZ A;  3IGA C;  4JTC B;  3HPL C;  1ZWI C;  2W0F C;  4BW5 A;  2KB1 A;  3ZRS A;  3F7Y C;  4GX0 A;  3IFX A;  5B3S C;  3VOU A;  3RVZ A;  2OCC C;  3K0D A;  3K06 A;  3SPG A;  2Q69 A;  2QTO A;  4MS2 A;  3OUF A;  1BL8 A;  4EKW A;  3FB6 C;  4UUJ C;  4PDL A;  4ZBM A;  4HZ3 A;  2Q6A A;  2IH3 C;  4MVM A;  3GB7 C;  1V54 C;  3JYC A;  4KFM A;  4QE9 A;  4G27 B;  2DWE C;  3FB7 C; 
#chains in the Genus database with same CATH topology
 1QLE C;  3QNE A;  1EZJ A;  2B5U A;  2CGN A;  1ZUQ A;  3ZBH A;  2QEX V;  3OTO O;  1AI4 A;  1ZLZ A;  4O4H B;  5H5N A;  4B7K A;  4I7Z B;  3S3X A;  2OIE A;  3E8F A;  2KG7 A;  2ZNI A;  1PPJ H;  4LNU A;  3DTU B;  4IL6 Z;  1SQX H;  2QR4 A;  4LF4 O;  4IT5 A;  2A3Q A;  1VQ7 V;  4HNA B;  1M90 W;  2WSS G;  2DW4 A;  3K3W A;  1BGY H;  4RUF A;  2EIJ B;  4O4J B;  3LDD A;  4AIL C;  2YID A;  4WFA V;  3JAM N;  1NJI W;  2R70 A;  1BZK A;  3RW0 A;  3DGE A;  1AR1 B;  2Q4P A;  3QO7 A;  1QVF U;  1YDX A;  4GT1 A;  5LMN O;  1XNQ B;  2YIC A;  1H2M A;  1Q86 W;  4IHJ B;  2Q5Z A;  3ABM B;  1PNL A;  1WPB A;  3CME V;  2P6J A;  3KCY A;  2GV9 A;  4WFH A;  4ZHQ A;  2V4D A;  2R9R B;  4AQY B;  4R8C A;  4AHC A;  3CPW U;  2Q7H A;  1I08 A;  4NVP A;  1YF2 A;  1XL4 A;  1YCI A;  4G2K A;  3CRC A;  3SYQ A;  1R73 A;  3CXC U;  2PYJ A;  1L0N H;  2UUB B;  1KP3 A;  3L75 H;  1RPR A;  1W0J G;  1WB7 A;  3J81 N;  4LF7 O;  1NVP B;  4TQF A;  1N32 O;  2BTO A;  4I55 B;  4OX9 O;  1SQP H;  4X20 A;  2KKW A;  2RCV A;  3QVN A;  2ZE7 A;  1YSC A;  3CCV V;  1DK1 A;  1AJN A;  1NTZ H;  2BCC H;  3BRC A;  2OCH A;  2EJ7 A;  1CP9 A;  1EN6 A;  2OT5 A;  4HBN A;  3JSN A;  2CGO A;  4CS2 A;  4FLU A;  3JD4 A;  2QA4 V;  2NNU A;  4UB8 Z;  4WBN B;  2IW5 A;  1K97 A;  4K8X A;  1QCE A;  1WAZ A;  2NR5 A;  3TK1 A;  1AI5 A;  4O2A A;  1J95 A;  4L87 A;  3E22 B;  3ZRW A;  1K5Q A;  5B1B C;  2JK5 C;  1VMG A;  2ZD9 A;  1YJ9 V;  1GM8 A;  2CTP A;  3JCU Z;  3CCJ V;  1R1B A;  3RVY A;  5LMU B;  2EIK C;  3N2K A;  4LBE C;  3ZN1 A;  1XIL A;  5H6Q A;  4WFB V;  4MVR A;  5LHH A;  1MSW D;  3T4D A;  3ZN0 A;  1SQF A;  4X65 B;  1BCC H;  1IVS A;  2ZQM A;  1VP7 A;  4YHH O;  4JI6 O;  4TV9 A;  3WB1 A;  2Q0A A;  1XRE A;  3IC9 A;  3L9D A;  3P32 A;  1N4C A;  3D3Q A;  5IWA O;  2ZDI A;  1VF6 C;  3K5O A;  1WNS A;  2AHY A;  4JI0 O;  3OEE G;  3UT5 B;  1SA0 B;  4J9Y B;  1I94 B;  2L35 A;  3JAW B;  1QU7 A;  5B5E Z;  1B06 A;  5LOV A;  1WJZ A;  4GKK O;  3VQV A;  3E86 A;  1M93 A;  2QDO A;  3DSQ A;  5L3D A;  5JJN B;  5LA6 A;  3G6E V;  3OAA G;  2UXC B;  2KB1 A;  3CMA V;  1FS0 G;  3IFX A;  2YI8 A;  3B40 A;  4FLX A;  2YXY A;  4BR6 A;  5LYJ B;  3KKY A;  2LW7 A;  4DV2 B;  3OGI B;  1KBH A;  3B77 A;  2DYS C;  4JI1 B;  1P4R A;  2CTQ A;  3WG7 B;  3EHB B;  5EYP A;  5LXT B;  4DR2 B;  2LW1 A;  4J7J A;  1Q90 D;  1VQK V;  1L0L H;  3A8T A;  1OZ0 A;  3SR2 C;  2Y48 A;  3K08 A;  3FB5 C;  4C7U A;  4DV6 O;  2Z0A A;  2BTQ B;  5LP6 A;  2WLL A;  4O2B B;  4FM0 A;  2L6L A;  4DV5 B;  3ICX A;  3BEH A;  1PP9 H;  1DF5 A;  2ZIM A;  3E8H A;  4TT3 G;  2F95 B;  4UV8 A;  4LFC O;  3Q4H A;  3AG3 B;  5CN0 A;  3HKB B;  1AI7 A;  1OCZ C;  1Y66 A;  1Z5W A;  1OCR C;  1P49 A;  1Y74 A;  1K8A W;  4KHP O;  3I56 V;  4LCU C;  4PDV A;  1HNZ O;  1WB8 A;  3FB8 C;  4JV5 B;  1VQ4 V;  3MDS A;  4DXW A;  4DV3 O;  5BMV B;  3DC5 A;  1BMF G;  4UCV A;  4O4L A;  1R3L C;  1JJ2 U;  1YXB A;  3P3P A;  4J7Z A;  2VWJ A;  4UVA A;  4JI8 O;  1PKX A;  3QF7 A;  1ARO P;  4YXW G;  4X66 B;  1OHH G;  3LDE A;  3EFF K;  4OGQ B;  1IBK B;  5BXZ A;  3O65 A;  4NTW A;  5DM6 V;  1V55 C;  1FXH A;  5EBW C;  3U10 A;  3LSU A;  4KUM A;  5JVD B;  2MK3 A;  3SJQ C;  2A06 H;  3ZJZ A;  3L71 H;  3RGB A;  1EN5 A;  2B1G A;  1ENV A;  3WFV A;  2VQE B;  2LJ2 A;  1D5N A;  4I50 A;  4I9Q A;  3A2F A;  1LUV A;  2AW9 A;  1H2L A;  2OWO A;  5IY5 B;  4UCU A;  4GX5 A;  3OM3 B;  1W2B U;  5CA1 B;  2BOC C;  3WB2 A;  2F93 B;  4GUN A;  3APQ A;  2XUM A;  4LF9 B;  3T4Z A;  5LL6 Y;  4LF8 B;  4TSF G;  4NXN B;  2QM7 A;  4RAI A;  2YIA A;  2WLI A;  3THO A;  1DLB A;  4U3F H;  4JI5 B;  3JD2 A;  3JAT A;  2DYR C;  4FZ0 A;  1S76 D;  2E74 B;  3FYE B;  1WA8 A;  1FJG B;  1ROP A;  4JYC A;  2H3O A;  4DR4 O;  5KHG A;  4DR5 O;  1NH2 B;  1P7B A;  2E75 B;  3W7X A;  4G28 B;  2WLH A;  2EZO A;  3HKC B;  2Z3Y A;  5GON A;  3G71 V;  2N05 A;  4X1I B;  3N2G B;  4H37 A;  1AJP A;  3LNN A;  4FLV A;  1XMO B;  5IYZ B;  1RPO A;  3HKD B;  2C2A A;  3CX5 F;  3I5D A;  2P4V A;  1JFF B;  3OR6 C;  3C3S A;  1YEW A;  3CJH A;  3H9V A;  1NI8 A;  5KA6 A;  3UM7 A;  2Q68 A;  2XAF A;  5HFM A;  2XAH A;  3AG1 B;  2Q9L A;  4DUZ B;  3SPJ A;  4FLY A;  1L1F A;  5JWP A;  4FLW A;  4DK0 A;  1K33 A;  1HR0 B;  1HW7 A;  3CP1 A;  4DUY O;  5B3S B;  1EM1 A;  2Q69 A;  4I0X B;  2JEX A;  2DE0 X;  5IE9 A;  2DOS A;  1ZL8 A;  1V54 C;  1NBM G;  4YIO A;  1VF5 B;  1H8E G;  1TVK A;  2QM4 A;  4K8Z A;  2EIM B;  3H01 A;  1MAB G;  2VWK A;  3H1H H;  4FFK A;  3K59 A;  1G1X B;  4CH3 A;  5CBG A;  1VF6 A;  2BOB C;  3P30 A;  3SPC A;  4IYI A;  5EC2 C;  3CCR V;  2Y69 B;  1GK9 A;  3ZHV A;  1RM1 C;  1I7F A;  4MTG A;  2ZCE A;  2UXN A;  4FPP A;  3JAK B;  3CSX A;  4F4L A;  2IJH A;  3K58 A;  5EBM C;  2QTS A;  1PD3 A;  4DR6 B;  4DR3 B;  2E76 B;  5KX5 B;  4ZIB A;  3GWK C;  4MSW C;  1M9N A;  4QJF B;  4J10 A;  3L73 H;  3CCS V;  3NR7 A;  3TXS A;  3J80 N;  4B3S O;  1FYJ A;  5KA5 A;  2UXB B;  2JDI G;  2ADP A;  2P7T C;  2HLD G;  2KQX A;  1K34 A;  4GYC B;  2EIL C;  4JI0 B;  4NXM B;  5ITZ A;  4JYY A;  3T1Y O;  3ASN B;  4J41 A;  1K5S A;  4PI2 A;  5JQG A;  4LFB O;  2ZR2 A;  2RDC A;  4FFB B;  2HFE C;  3BA8 A;  3LDC A;  1VQ8 V;  1Y76 A;  4DRX B;  3RYC A;  4GLX A;  2XOK G;  1I5Y A;  3AG7 A;  3O9O A;  4NKG B;  4U7N A;  4H44 B;  2R9I A;  5IDJ A;  4U7O A;  1THZ A;  3UKM A;  2YUA A;  4PA3 A;  3CCM V;  4J9Z B;  1QBZ A;  1RFY A;  2R9A A;  3HPL C;  5H2F Z;  4KL1 A;  1JPX A;  3JD1 A;  3IAY A;  3RVZ A;  4FIP C;  1F7Y A;  1N36 O;  2PF4 E;  4JI7 O;  2ZM6 O;  1FXK B;  1S0V A;  3FYI B;  1S77 D;  3HKE B;  1GRJ A;  3K9A A;  5JH7 A;  1R6K A;  2DWE C;  4W4K A;  1BS3 A;  4H33 A;  5L3C A;  5KAF Z;  3OGC C;  3ZS8 C;  1KMI Z;  1Y4M A;  1IBM O;  4B3R B;  2OTL V;  1PNK A;  4Z1M G;  3H1I H;  1Y6X A;  4QE7 A;  2Y0I A;  3WB0 A;  4CS4 A;  2ETN A;  3ZMV A;  4MW3 A;  4FMT A;  1YTF D;  1SER A;  1Y67 A;  3H1J H;  2F43 G;  5K1X A;  2WWW A;  5TIS Z;  1QLN A;  3AG2 C;  1P7G A;  4O4H A;  1N34 B;  2ATK C;  3OUS A;  3ETQ A;  5BR8 O;  4DV0 O;  3RT3 C;  3SJA C;  3CRM A;  4BIU A;  4LF6 O;  1XMQ B;  2UU9 O;  4PA6 A;  2AXT Z;  1M57 B;  4HNA A;  1S5H C;  4LP8 A;  1IBL O;  4K0K B;  2A7W A;  4JYA O;  1EBO A;  1QHT A;  4O4I B;  2AGA A;  4HYO A;  2PTM A;  1NR1 A;  2LFR A;  3K04 A;  1SQG A;  2Q0O C;  1N33 O;  1AR5 A;  4LNU B;  3KZI Z;  2KSD A;  3JAS A;  2PGG A;  1HNW B;  3SPI A;  3L70 H;  1VQL V;  1LUW A;  4PA9 A;  4QGP A;  1SZT A;  3CC2 V;  5IY5 C;  4XBF A;  4L8J A;  4P2Z A;  1TGO A;  2UXD B;  3EXA A;  5D5P A;  4GKJ O;  2LO1 A;  1RSO B;  1MOF A;  1NZ6 A;  4DV7 O;  2JGD A;  5FNV B;  3JYC A;  3ETG A;  2HHH B;  1XHZ A;  3LSS A;  1H8H G;  4UCO A;  4MT8 A;  4YJ3 B;  4YJ2 B;  5CA0 B;  1XI1 A;  4FLZ A;  4ZOL A;  3CWB H;  5L3E A;  3G67 A;  4UVC A;  4TUY B;  3B8N A;  2OIG A;  4P9P A;  2WAM A;  5KMG A;  1GN4 A;  2W6I G;  1ZSP A;  2EJR A;  3OTF A;  3ABK C;  4JZ2 A;  1FD9 A;  5F2V O;  1F51 A;  1SKV A;  4MW8 A;  4JI3 O;  4RQF A;  2X6A A;  4X20 B;  3SJB C;  1N0N A;  3X2Q B;  3E22 A;  4U3J A;  3RYI A;  1X59 A;  1P84 F;  5FPR A;  1KKD A;  1H2S B;  4JGS A;  5FL7 G;  3SYA A;  2RN9 A;  1KP2 A;  4JI4 B;  4KP4 A;  5IJ9 A;  3ZX6 A;  3E89 A;  3FX7 A;  2K1E A;  2CDY A;  2F4V B;  3PJS K;  1MMM A;  3J7A U;  2Q8V A;  3ABU A;  2AZ0 A;  1OCO C;  2E5L B;  5J2T B;  5H6R A;  2YS8 A;  1JQ0 A;  1M5I A;  2IU0 A;  3W7U A;  4O2A B;  3K5N A;  4IYH A;  5B1A C;  3ZRW B;  4IIJ B;  3SYO A;  4DUY B;  2EIM C;  1VQN V;  4NR1 A;  2JIZ G;  3N2K B;  2QWR B;  4BW5 A;  1NVP D;  1VQ5 V;  5H9C A;  2ZE8 A;  1I5X A;  3K06 A;  1KQS U;  3ZHQ A;  3JD0 A;  4MS2 A;  5CA3 A;  2Q7G A;  3JAW A;  5KHI A;  3RYF A;  4TV9 B;  1NR7 A;  3HR0 A;  3G6B A;  3PN1 A;  4CH5 A;  1FFX A;  2EIN C;  4YY3 O;  1K4C C;  3CCU V;  4X89 A;  3MHH C;  1AJQ A;  2Y4T A;  2RMK B;  2P90 A;  4GZR B;  4H13 B;  3UCS C;  2VS0 A;  3ZMT A;  2A9H A;  1FPO A;  3LNM B;  2Z5U A;  2CE4 A;  3DXR B;  1XNR O;  3ZHU A;  3S3W A;  5LOV B;  1HNX B;  2QKA A;  5LHG A;  1B6Q A;  4LC1 A;  3STZ C;  5LA6 B;  1SQV H;  1U96 A;  1KU9 A;  4FJC C;  2UUC B;  3ZHS A;  1GM7 A;  2UUA B;  3BVO A;  1MA1 A;  2QWQ B;  1E1Q G;  1MNG A;  4B3M B;  3ASO C;  4HAM A;  1Q8I A;  5KHH A;  1R3J C;  2IJK A;  1AP6 A;  2XAS A;  4X9Q A;  2BTQ A;  3IJ4 A;  4F6E A;  2QJ1 A;  3BHP A;  2CAZ C;  1MZF A;  1R3I C;  4MVO A;  2R72 A;  2UXX A;  2PYL A;  1IXM A;  1M56 C;  4TQD A;  3ABL B;  2W6J G;  2HVK C;  4DR7 O;  3LUT B;  2YIB A;  1OCC B;  4DV1 O;  2ZKO A;  3BA9 A;  2WPD G;  1F4N A;  5BZB A;  2HR3 A;  2K9P A;  1J5E O;  5LP6 B;  2M7W A;  2WLL B;  1XQ8 A;  3AG4 B;  1K9M W;  4JI2 B;  2H8P C;  4X62 B;  4UV9 A;  2P67 A;  1G6U A;  4DR1 O;  4DV4 O;  5JCO A;  3Q4H B;  2P5O A;  4K35 A;  2OCC B;  4MTX A;  1R6N A;  3QG5 A;  1K3E A;  3FB6 C;  1YZB A;  3UO2 A;  3CRQ A;  4G27 B;  3T1H B;  1B04 A;  2D2C B;  5JVD A;  4LH7 A;  1Q3E A;  4I9W A;  4P30 A;  1FFT B;  4QPJ A;  4Q6G A;  2RQ6 A;  1QLE B;  5LGN A;  2EZP A;  3U0Z A;  3T2M A;  2GUZ A;  1U97 A;  5K1P A;  3MAQ A;  4JTA B;  4Q20 A;  4CC6 A;  4F6R A;  4MVQ A;  3F7V C;  3OTO B;  2OYQ A;  3JSL A;  2EIJ C;  5KLV H;  1FXV A;  4PDM A;  1H2G A;  1BSM A;  1JR9 A;  4X64 O;  2DWD C;  4OXS A;  1XNQ O;  2NN4 A;  4LWS B;  4X1Y A;  4Z2W A;  3RYH A;  4LF4 B;  1GM9 A;  1YVW A;  1VEW A;  4UFZ A;  4TWK A;  2B1I A;  5E1A C;  2ILM A;  1YIT V;  4AQY O;  2YIB D;  3ABM C;  4JYB A;  3TGU H;  2PI4 A;  4JTD B;  3LSQ A;  1YJN V;  4MTF A;  2JS3 A;  5LMN B;  1EFR G;  4MVS A;  4A5U B;  2X6C A;  3ZCC A;  4JAU A;  3A0R A;  1TAE A;  2UUB O;  3M8A A;  4UXN A;  2OTJ V;  3HKC A;  3STL C;  4PV1 B;  4X1I A;  3N2G A;  4J11 A;  2WLI B;  5AG2 A;  5KHJ A;  2WLJ A;  4TV8 A;  3VQX A;  4IGG A;  3HKD A;  3CRR A;  3E83 A;  1FAF A;  1DTO A;  2WA4 A;  2H94 A;  1EN4 A;  2LGW A;  3VBB A;  5J2U A;  2YXL A;  1BQZ A;  4PDL A;  3ETD A;  4HZ3 A;  2Q6A A;  5GON B;  4LF7 B;  1N32 B;  3CE2 A;  1BE3 H;  4KFM A;  5A9G A;  1S72 V;  1JJO A;  4OX9 B;  1HP8 A;  4GCZ A;  2HEP A;  1WLE A;  2P22 C;  2X7R B;  3F5W C;  2JJ1 G;  3E2E A;  3KG2 A;  4QNH B;  1IDS A;  4I0X A;  5LHI A;  1KEC A;  4X1K B;  1XHX A;  1US6 A;  3OMN B;  5LMU O;  2ITC C;  2Q67 A;  1PV0 A;  3CJH B;  2RJZ A;  1PNM A;  2QWN B;  5B1B B;  4BIO A;  4X65 O;  4KXR A;  2IH1 C;  1B3Q A;  5IJ0 A;  2BSK B;  1CEZ A;  1HDJ A;  3R65 A;  1TUE B;  2EIK B;  2QWO B;  4MVU A;  5EZY B;  3TCU A;  1AI6 A;  3BCC H;  1V9P A;  3JAK A;  1H38 A;  2LFS A;  2JGU A;  4NTY A;  3U11 A;  4EFB A;  2JRI A;  2A0L A;  2Y4U A;  1TVK B;  1RP3 B;  4CH6 A;  4I4T B;  5KX5 A;  4RUE A;  2FL4 A;  1YHQ V;  1I94 O;  2YEV A;  3W7S A;  3T1C A;  3FAV A;  1AIL A;  4YHH B;  4JI6 B;  4TOI A;  2XND G;  2G38 A;  2O57 A;  4XDJ A;  3FFQ A;  3OE7 G;  2ZNJ A;  1IZ3 A;  1SRY A;  1TA8 A;  5IWA B;  2UXC O;  3ABT A;  3TXQ A;  1TUB A;  2Q73 A;  3GVM A;  3E35 A;  1PL4 A;  5IYD O;  5JJJ B;  3IGA C;  4DV2 O;  3QO8 A;  4GX0 A;  1Z2G A;  1VQO V;  3RWR D;  4GKK B;  4JI1 O;  4DRX A;  3AK1 A;  4CC5 A;  1BL8 A;  2ZE5 A;  2VQF O;  4UUJ C;  4ZBM A;  5C8Y B;  4DR2 O;  2DMX A;  3GB7 C;  2CH7 B;  2FKX A;  2HP8 A;  4RQE A;  4EB6 B;  1ZTE A;  3RN4 A;  3M99 B;  4PJ0 Z;  1ORQ C;  3WG7 C;  3K03 A;  2MW2 B;  2DYS B;  2QKC A;  4ZI7 B;  1QQC A;  2P4K A;  2EX3 A;  5JQG B;  1YJW V;  1KUQ A;  4DV5 O;  5IYB O;  5CB4 A;  2YDE A;  3GWO A;  2Q7E A;  1VF7 A;  5L3B A;  4DW1 A;  1NT2 B;  4PI0 A;  3RYC B;  2ADQ B;  1R3K C;  3EVK A;  4AI8 A;  1M1K W;  1HWY A;  2VRZ A;  1R6T A;  4JV5 O;  2FTK A;  4WFF A;  5BY1 A;  3AG3 C;  2ZIN A;  3DC6 A;  4DV6 B;  4WCE V;  1SES A;  1UFI A;  4UVB A;  4CS3 A;  1VQ9 V;  3B4S A;  1OCZ B;  4MVZ A;  2XTA A;  4K3A A;  1KYO F;  1OCR B;  1JCH A;  4LFC B;  5B1N A;  3G4S V;  3JAL B;  3JAR B;  1AB3 A;  4KHP B;  3C3T A;  3SYP A;  1HNZ B;  2IJI A;  4FLT A;  5JCO C;  3BAA A;  4JAS A;  1G4Y B;  3ZRV A;  4DV3 B;  1J5E B;  4LF5 O;  2XT9 A;  4GX2 A;  2NLJ C;  4DR1 B;  4JI8 B;  1WP7 A;  3M7M X;  4ASU G;  5GTI Z;  2VQE O;  4O4J A;  2ARH A;  1NKD A;  2GTA A;  3JCZ A;  1W59 A;  1Q7Y W;  5E79 Z;  1E79 G;  2N74 A;  3SPG A;  2KG7 B;  3H1K H;  2FYU H;  2CUG A;  1O9G A;  4CZZ A;  1OV9 A;  4IHJ A;  2JS5 A;  3C90 A;  2V1D A;  4QE9 A;  4LF9 O;  1GAX A;  3K79 A;  4LF8 O;  3BY6 A;  4NXN O;  3QO5 A;  3WU2 Z;  2WLN A;  4JI5 O;  3SGI A;  5KUM A;  1RSO A;  3TJT A;  4X64 B;  2FB5 A;  3JAS B;  1FJG O;  5FNV A;  3D36 A;  3CC4 V;  2LGQ A;  2PUS A;  4DW0 A;  1MG1 A;  1QR9 A;  1JX9 A;  2XAG A;  4YJ3 A;  1BHA A;  4YJ2 A;  2DYR B;  5B66 Z;  1NTM H;  5CA0 A;  4I55 A;  4ZHQ B;  3RBZ A;  4YIP A;  4B3T O;  2WLM A;  1XMO O;  2RNB A;  3SYC A;  4TUY A;  1K4D C;  3NXS A;  2HVJ C;  1SQQ H;  2YXH A;  1JVM A;  3A0B Z;  1CPY A;  2JGD B;  5CBH A;  4DR4 B;  4QIW F;  4DR5 B;  3F5T A;  5EC1 C;  2ODM A;  5LGU A;  4D6T H;  4DUZ O;  4WBN A;  4ZOL B;  1DGS A;  3CYO A;  5EK0 A;  1HR0 O;  5J9P C;  1COW G;  3AG1 C;  3CC7 V;  3D8C A;  5KMG B;  4LFA O;  1JOY A;  2GDS A;  1KKC A;  3ZRS A;  3F7Y C;  5J2T A;  2M6Y A;  5B3S C;  4FZ1 A;  2QE7 G;  5DED A;  1Q6I A;  4JF3 A;  4U3J B;  3RYI B;  1YI2 V;  4EKW A;  5JJE B;  3L72 H;  3OMA B;  4IIJ A;  5A2Q N;  1V54 B;  3FB7 C;  2QM8 A;  5IJ9 B;  3ETE A;  3B09 A;  3W7T A;  1AVM A;  2Y69 C;  1T5E A;  4Z1V A;  3SDL A;  3OFN G;  4DR3 O;  4DR6 O;  3K9S A;  3UT5 A;  4FM2 A;  1SA0 A;  1WP8 A;  3ML0 A;  1RM1 B;  3BPZ A;  1LR1 A;  1K7D A;  4I5S A;  3ZMZ A;  3CD6 V;  4N23 A;  4PEL A;  4WFE A;  4RO2 A;  4X88 A;  1VQP V;  1H2K A;  2UXB O;  2BE3 A;  5IYC O;  2A79 B;  1N0J A;  1GN2 A;  2CTW A;  2YI9 A;  2HJF C;  4ZKI A;  3P3N A;  1UJW B;  4NXM O;  2DQ3 A;  5LYJ A;  1Q6H A;  2GBO A;  2XHB A;  4JZG A;  3K0G A;  3RYF B;  3DXR A;  2ZE6 A;  4JAA A;  3ASN C;  3CCL V;  2EIL B;  1FFX B;  4PDR A;  3OT7 A;  1E1R G;  1KB9 F;  4B3S B;  5EIB C;  1XL6 A;  2F23 A;  2LP7 A;  5LXT A;  4J7K A;  1WN7 A;  2HKO A;  2ZXW B;  3D3I A;  3SJC C;  1K73 W;  3OEH G;  3A0H Z;  3T1Y B;  4PA7 A;  4X8A A;  1VAR A;  5GTH Z;  4ABM A;  3W7W A;  1X4T A;  1F4M A;  1N8R W;  1KC8 W;  1KD1 W;  1IXB A;  4LFB B;  4O2B A;  1F23 A;  3VQW A;  2YSU B;  3VQY A;  3OR7 C;  3CRA A;  1NQT A;  4GX1 A;  2QKS A;  1NS1 A;  2VQF B;  4PHZ A;  5FPO A;  5EYP B;  3VOU A;  2LQT A;  3K0D A;  3HKB A;  3N27 A;  1FXK C;  4B7E A;  2ZT9 B;  4MVM A;  2X0L A;  4B3R O;  2IU3 A;  2EBO A;  5BMV A;  2E3C A;  3APO A;  4J42 A;  2D3O W;  1Q81 W;  5D5Q A;  4RWU A;  5KAI Z;  1N36 B;  2XAJ A;  4JI7 B;  2ZM6 B;  1S5L Z;  4EEQ A;  1AR4 A;  2PY5 A;  2Y0P A;  1Y74 B;  1OJH A;  1N34 O;  1GO3 F;  1GN3 A;  2F1M A;  1VIB A;  1IBM B;  2P06 A;  2AZ2 A;  1XMQ O;  3E8G A;  3CB2 A;  4O4L B;  1GTO A;  4K0K O;  3AG2 B;  3ZHT A;  5CBF A;  3SPH A;  4PD4 F;  1XOU A;  2X6B A;  4R7C A;  1GH6 A;  1M57 C;  3TET A;  4LF5 B;  5CMU A;  5BR8 B;  4DV0 B;  1HNW O;  3BFR A;  5CA1 A;  4LF6 B;  4LWS A;  2UU9 B;  2DQ0 A;  1EZV H;  5KUK A;  1IBL B;  2GUZ B;  4JAV A;  4JYA B;  4R50 A;  2ZIO A;  3AK2 A;  1LNQ A;  3OMI B;  3CCE V;  2PZS A;  1SQB H;  4F6R B;  2QSA A;  5DEC A;  2UXD O;  4I50 B;  1BQ0 A;  3CXH F;  1N33 B;  2JJ2 G;  3E8B A;  2DN9 A;  1XUQ A;  2ITD C;  5LGT A;  2IBZ H;  1URF A;  4JTC B;  3L74 H;  4X1Y B;  2XAQ A;  3RYH B;  2HHH O;  5C93 A;  3QTC A;  3CCQ V;  1GKF A;  1XBL A;  4LH6 A;  1MZE A;  3G80 A;  3OUF A;  4JPR A;  3D36 C;  1Q43 A;  5L3G A;  1S5J A;  4UCS A;  1S3J A;  4E4E A;  1Z5V A;  3JAT B;  4UCR A;  5IYZ A;  4GKJ B;  3KCX A;  3OD4 A;  1H2N A;  2HG5 C;  3ZMU A;  1WA8 B;  4WFG A;  4QPK A;  3B2E E;  1VQ6 V;  4DV7 B;  4N21 A;  3ZHR A;  2HJD A;  1O9H A;  1JFF A;  4EFE A;  1D2D A;  4R6Z A;  4CBC A;  3ZMS A;  4BWA A;  2GSM B;  1A32 A;  1W0K G;  3MD0 A;  1QNM A;  3ZRX A;  4B3T B;  5B1O A;  4TV8 B;  2WLK A;  4MTO A;  1SS3 A;  1SET A;  2EUL A;  4DYL A;  2ZR3 A;  3ABK B;  4JI4 O;  3X2Q C;  4X1K A;  3K5M A;  5J2U B;  1JMK C;  1SC5 B;  1NTK H;  4BIZ A;  2F4V O;  4OPH A;  2V7Q G;  1SF9 A;  3IC7 A;  1DF4 A;  3AEI A;  2E5L O;  4XDK A;  1QR8 A;  4JI3 B;  1BHB A;  2BSK A;  4W4L A;  2JEU A;  1K92 A;  4NTX A;  1MSD A;  3FD9 A;  5IT9 N;  3R66 A;  4NYK A;  3BAB A;  1GMG A;  1PL0 A;  2N04 A;  5EZY A;  3OW2 U;  3UO3 A;  3K57 A;  1BT8 A;  2AHZ A;  4LFA B;  1OCO B;  1M4U A;  1NH2 D;  1Q5O A;  4E2L A;  1ZAU A;  4P9O A;  5B1A B;  1ZL8 B;  4D7T A;  4I4T A;  2DJV A;  5IJ0 B;  1IUR A;  4H0L B;  4BW9 A;  1YIJ V;  1ZWI C;  2W0F C;  5LBQ A;  5FLX N;  3ZED A;  1L8D A;  4DK1 A;  2QTO A;  1NU1 H;  1AP5 A;  4WF9 V;  3CEI A;  4FVM A;  4J80 A;  2ZDI C;  4BAY A;  3AK3 A;  2EIN B;  1UPG A;  4FM1 A;  2YEV B;  3FAV B;  4UB6 Z;  1D5A A;  4PA4 A;  4FFB A;  3JD3 A;  1HNX O;  2CK3 G;  1WPX A;  3FKS G;  4YY3 B;  2F66 C;  5C8Y A;  1Q82 W;  3CHX A;  2UUC O;  1YTF B;  3H1L H;  2PI5 A;  2CH7 A;  2UUA O;  4FK5 C;  1TUB B;  4EB6 A;  4B3M O;  5EBL C;  4B08 A;  2GHY A;  5L3F A;  5ITZ B;  1G8M A;  2QGN A;  4ZI7 A;  2GTS A;  2ZXW C;  1QVG U;  3B8M A;  1XNR B;  5GW7 A;  3I55 V;  4D7S A;  2YC0 A;  2IJJ A;  1FXK A;  4XDL A;  2QWP B;  3ASO B;  1Y76 B;  1XDC A;  3HKE A;  3RFR A;  5DN6 G;  4ICG A;  1SZX A;  2JVD A;  4CH4 A;  3UQ8 A;  4LR3 A;  4NB5 A;  3HB3 B;  3ABL C;  2FML A;  5CB4 B;  4JI2 O;  1M56 B;  4X62 O;  1OCC C;  2CTR A;  1JA8 A;  3ZIA G;  4X66 O;  5LP6 C;  1I0H A;  3JAL A;  3AG4 C;  1CXZ B;  5JH7 B;  4UCT A;  3JAR A;  1ZX3 A;  1VQM V;  1IBK O;  1PM9 A;  1GN6 A;  4DR7 B;  5HFL A;  4DO2 A;  2W0X A;  4DV1 B;  2B9Z A;  3MHS C;  3T1H O;  5EIB D;  2OCC C;  4OPA A;  3CS5 A;  1Q6U A;  1XEQ A;  2WA3 A;  3K5L A;  1FKA O;  2IH3 C;  1IX9 A;  1V55 B;  2IM9 A;  5KHK A;  4DV4 B;  4O4I A; 
#chains in the Genus database with same CATH homology
 1QLE C;  2EIM B;  3H01 A;  1EZJ A;  1MAB G;  3ETE A;  1FFT B;  3QNE A;  4I9W A;  4P30 A;  4QPJ A;  1QLE B;  2B5U A;  5LGN A;  2EZP A;  5CBG A;  2QEX V;  3T2M A;  1AI4 A;  2BOB C;  3P30 A;  3SPC A;  3W7T A;  2Y69 C;  3OFN G;  5EC2 C;  3E8F A;  3CCR V;  2Y69 B;  1GK9 A;  1RM1 C;  4MTG A;  3DTU B;  3ML0 A;  1RM1 B;  4JTA B;  1K7D A;  4Q20 A;  4I5S A;  2UXN A;  4MVQ A;  4FPP A;  3ZMZ A;  1VQ7 V;  4N23 A;  4PEL A;  1M90 W;  3CD6 V;  4WFE A;  3F7V C;  4F4L A;  2WSS G;  2IJH A;  4RO2 A;  2DW4 A;  5EBM C;  2EIJ C;  3K3W A;  1PD3 A;  1FXV A;  4RUF A;  4X88 A;  4PDM A;  1H2G A;  2EIJ B;  1VQP V;  3LDD A;  2DWD C;  4OXS A;  4MSW C;  5IYC O;  1M9N A;  4WFA V;  2A79 B;  4QJF B;  1GM9 A;  1NJI W;  2HJF C;  4ZKI A;  1UJW B;  3CCS V;  2DQ3 A;  3RW0 A;  3DGE A;  1AR1 B;  4TWK A;  2B1I A;  5E1A C;  3QO7 A;  1QVF U;  4GT1 A;  5KA5 A;  3K0G A;  1YIT V;  2JDI G;  2P7T C;  2HLD G;  1K34 A;  1Q86 W;  3ABM C;  4JYB A;  3ABM B;  1PNL A;  2EIL C;  3ASN C;  3CME V;  3CCL V;  4JTD B;  3LSQ A;  2PI4 A;  2P6J A;  2EIL B;  3ASN B;  1YJN V;  4PDR A;  4MTF A;  1E1R G;  1XL6 A;  1K5S A;  4WFH A;  1EFR G;  4MVS A;  2LP7 A;  2R9R B;  2X6C A;  2ZR2 A;  3ZCC A;  4JAU A;  3A0R A;  2HKO A;  3D3I A;  2ZXW B;  4R8C A;  1K73 W;  2HFE C;  3OEH G;  4UXN A;  4PA7 A;  3LDC A;  4X8A A;  3CPW U;  1VQ8 V;  2OTJ V;  3W7W A;  3STL C;  2XOK G;  1XL4 A;  4G2K A;  1I5Y A;  1F4M A;  2WLI B;  3SYQ A;  1N8R W;  1KC8 W;  1R73 A;  1KD1 W;  3CXC U;  4U7N A;  2WLJ A;  1F23 A;  2R9I A;  2YSU B;  5IDJ A;  4U7O A;  3OR7 C;  1KP3 A;  1THZ A;  1NQT A;  3UKM A;  4GX1 A;  4PA3 A;  3E83 A;  1RPR A;  1W0J G;  2QKS A;  3CCM V;  4J9Z B;  1QBZ A;  1DTO A;  3HPL C;  1NVP B;  2H94 A;  1JPX A;  3JD1 A;  3VBB A;  3VOU A;  3RVZ A;  3K0D A;  4FIP C;  1FXK C;  1YSC A;  3CCV V;  1FXK B;  1S0V A;  1AJN A;  3FYI B;  4PDL A;  3ETD A;  4HZ3 A;  1S77 D;  2Q6A A;  4MVM A;  2X0L A;  2IU3 A;  2EBO A;  3K9A A;  4KFM A;  1R6K A;  1S72 V;  1CP9 A;  2OT5 A;  2DWE C;  2D3O W;  1Q81 W;  4H33 A;  5L3C A;  4GCZ A;  1WLE A;  2XAJ A;  2X7R B;  3JD4 A;  3OGC C;  2QA4 V;  3F5W C;  2JJ1 G;  2NNU A;  3E2E A;  1Y4M A;  3KG2 A;  2IW5 A;  1K97 A;  2OTL V;  1PNK A;  4QNH B;  1QCE A;  4Z1M G;  5LHI A;  1KEC A;  3TK1 A;  4QE7 A;  1AI5 A;  3OMN B;  1J95 A;  2ITC C;  2Q67 A;  4L87 A;  3ZMV A;  4MW3 A;  1GO3 F;  3ZRW A;  4FMT A;  1K5Q A;  1YTF D;  5B1B C;  2JK5 C;  1SER A;  1PNM A;  2ZD9 A;  5B1B B;  1YJ9 V;  2IH1 C;  1GM8 A;  3CCJ V;  2F43 G;  3E8G A;  1CEZ A;  2WWW A;  1QLN A;  3R65 A;  1GTO A;  3AG2 C;  3RVY A;  2EIK C;  3ZN1 A;  4LBE C;  3AG2 B;  1TUE B;  2ATK C;  5H6Q A;  2EIK B;  4WFB V;  4MVU A;  5CBF A;  4MVR A;  3OUS A;  3SPH A;  3TCU A;  5LHH A;  1MSW D;  3T4D A;  1AI6 A;  3ZN0 A;  2X6B A;  4R7C A;  4BIU A;  1M57 C;  4PA6 A;  1M57 B;  2ZQM A;  1S5H C;  1H38 A;  4LP8 A;  2LFS A;  3TET A;  1EBO A;  2A0L A;  3P32 A;  5CMU A;  4HYO A;  4RUE A;  1YHQ V;  1NR1 A;  2LFR A;  2ZDI A;  3K04 A;  2DQ0 A;  2YEV A;  3W7S A;  3T1C A;  5KUK A;  2XND G;  2AHY A;  4JAV A;  4R50 A;  3OEE G;  4XDJ A;  1LNQ A;  3OMI B;  3OE7 G;  3CCE V;  3SPI A;  1SRY A;  4J9Y B;  1VQL V;  3ABT A;  4PA9 A;  1SZT A;  3CC2 V;  2JJ2 G;  3E8B A;  5IY5 C;  4XBF A;  3E35 A;  3E86 A;  2ITD C;  5L3D A;  5LGT A;  5IYD O;  3G6E V;  4P2Z A;  3IGA C;  3OAA G;  4JTC B;  3QO8 A;  2XAQ A;  2KB1 A;  3CMA V;  1FS0 G;  4GX0 A;  5C93 A;  3IFX A;  3CCQ V;  1GKF A;  1VQO V;  3OUF A;  1BL8 A;  4JPR A;  1MOF A;  4UUJ C;  4ZBM A;  5L3G A;  3GB7 C;  1S3J A;  3JYC A;  3ETG A;  3LSS A;  4RQE A;  1H8H G;  3B77 A;  3M99 B;  2DYS C;  4MT8 A;  1ORQ C;  3WG7 C;  2HG5 C;  3K03 A;  3ZMU A;  1P4R A;  4WFG A;  2DYS B;  3WG7 B;  4QPK A;  3EHB B;  1VQ6 V;  4N21 A;  1YJW V;  5IYB O;  3GWO A;  5L3B A;  1VQK V;  5L3E A;  4R6Z A;  4UVC A;  4CBC A;  3ZMS A;  3B8N A;  4P9P A;  1OZ0 A;  2GSM B;  1R3K C;  2Y48 A;  3K08 A;  3FB5 C;  1W0K G;  3MD0 A;  3ZRX A;  2WAM A;  1M1K W;  1HWY A;  5B1O A;  2WLL A;  2WLK A;  3BEH A;  4MTO A;  2W6I G;  1SET A;  2EJR A;  2ZR3 A;  3ABK C;  1DF5 A;  2FTK A;  3E8H A;  1F51 A;  4WFF A;  4MW8 A;  3ABK B;  4TT3 G;  4UV8 A;  4RQF A;  3AG3 C;  3X2Q C;  2X6A A;  4WCE V;  3AG3 B;  5CN0 A;  3X2Q B;  1SES A;  1AI7 A;  1OCZ C;  1VQ9 V;  1Y66 A;  4UVB A;  1OCR C;  1K8A W;  4BIZ A;  1OCZ B;  4MVZ A;  2V7Q G;  3I56 V;  1OCR B;  4LCU C;  4PDV A;  1KKD A;  3IC7 A;  4JGS A;  1DF4 A;  3FB8 C;  5FL7 G;  3AEI A;  3SYA A;  1VQ4 V;  1JCH A;  1QR8 A;  4XDK A;  1BHB A;  1KP2 A;  4DXW A;  4KP4 A;  2JEU A;  5B1N A;  1K92 A;  3G4S V;  3E89 A;  1BMF G;  2K1E A;  1R3L C;  1JJ2 U;  3PJS K;  3SYP A;  3OW2 U;  1GMG A;  1PL0 A;  4UVA A;  3ABU A;  1PKX A;  4YXW G;  1ARO P;  1OHH G;  2IJI A;  1OCO C;  4JAS A;  2AHZ A;  5H6R A;  1G4Y B;  3ZRV A;  3LDE A;  3EFF K;  1OCO B;  1JQ0 A;  2IU0 A;  3W7U A;  1NH2 D;  4GX2 A;  2NLJ C;  5DM6 V;  1V55 C;  1FXH A;  5B1A C;  3ZRW B;  4P9O A;  4E2L A;  5EBW C;  5B1A B;  3SYO A;  2EIM C;  4ASU G;  1VQN V;  4KUM A;  2MK3 A;  1NKD A;  3SJQ C;  3JCZ A;  3ZJZ A;  1YIJ V;  2JIZ G;  1ZWI C;  2W0F C;  4BW5 A;  1Q7Y W;  1E79 G;  1NVP D;  5LBQ A;  2B1G A;  5H9C A;  1VQ5 V;  1I5X A;  3K06 A;  3SPG A;  1KQS U;  1ENV A;  3WFV A;  2QTO A;  3JD0 A;  4MS2 A;  5CA3 A;  4CZZ A;  4QE9 A;  2V1D A;  1NR7 A;  4WF9 V;  3K79 A;  2ZDI C;  2EIN C;  3BY6 A;  4GX5 A;  4BAY A;  3OM3 B;  5IY5 B;  1W2B U;  2BOC C;  3QO5 A;  2EIN B;  1K4C C;  2WLN A;  2YEV B;  3CCU V;  4X89 A;  5KUM A;  4PA4 A;  3MHH C;  1AJQ A;  3JD3 A;  2CK3 G;  1WPX A;  3T4Z A;  3FKS G;  3ZMT A;  2P90 A;  4TSF G;  2A9H A;  1Q82 W;  2QM7 A;  3D36 A;  3CC4 V;  1YTF B;  3LNM B;  2Z5U A;  2PI5 A;  4RAI A;  2WLI A;  1DLB A;  4FK5 C;  1MG1 A;  3JD2 A;  1QR9 A;  5EBL C;  1JX9 A;  2DYR C;  2XAG A;  2GHY A;  5L3F A;  1S76 D;  1G8M A;  5LHG A;  1BHA A;  1B6Q A;  4LC1 A;  3FYE B;  2DYR B;  3STZ C;  1ROP A;  4JYC A;  2ZXW C;  1QVG U;  4FJC C;  3B8M A;  3RBZ A;  2WLM A;  1GM7 A;  1E1Q G;  5GW7 A;  3I55 V;  1NH2 B;  3SYC A;  1P7B A;  1K4D C;  3NXS A;  3ASO C;  3W7X A;  2HVJ C;  4G28 B;  4HAM A;  2WLH A;  2IJJ A;  1FXK A;  2EZO A;  4XDL A;  3ASO B;  1R3J C;  2IJK A;  1JVM A;  2Z3Y A;  1CPY A;  3G71 V;  5CBH A;  2XAS A;  4H37 A;  5DN6 G;  1AJP A;  4QIW F;  1RPO A;  1R3I C;  2C2A A;  5EC1 C;  5LGU A;  4MVO A;  2UXX A;  1IXM A;  3HB3 B;  1M56 C;  3ABL C;  3OR6 C;  1M56 B;  2W6J G;  3ABL B;  2HVK C;  3CYO A;  1OCC C;  3LUT B;  5EK0 A;  5J9P C;  1COW G;  1OCC B;  3ZIA G;  3AG1 C;  3UM7 A;  5KA6 A;  2WPD G;  1F4N A;  2Q68 A;  2XAF A;  5BZB A;  5HFM A;  2HR3 A;  2XAH A;  3CC7 V;  3AG1 B;  3SPJ A;  3AG4 C;  2M7W A;  2WLL B;  1L1F A;  3AG4 B;  1VQM V;  1K9M W;  1JOY A;  2H8P C;  4UV9 A;  1K33 A;  2P67 A;  5HFL A;  4DO2 A;  3ZRS A;  3F7Y C;  3CP1 A;  3MHS C;  5B3S C;  2OCC C;  2QE7 G;  5B3S B;  4JF3 A;  2Q69 A;  2OCC B;  2JEX A;  4MTX A;  1YI2 V;  1R6N A;  4EKW A;  1K3E A;  3FB6 C;  3OMA B;  2IH3 C;  1V54 C;  1NBM G;  1V55 B;  4G27 B;  1V54 B;  1H8E G;  3FB7 C;  2QM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...