2W0FC

Potassium channel kcsa-fab complex with tetraoctylammonium
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
102
structure length
102
Chain Sequence
b'ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT LIGHT CHAIN
publication title Structures of Kcsa in Complex with Symmetrical Quaternary Ammonium Compounds Reveal a Hydrophobic Binding Site.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/metal transport
total genus 41
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2008-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2w0fC00
3ASOC 1R3JC 2X6AA 3ABKC 4R7CA 1OCOC 4QE7A 5EBWC 3LDEA 2WLHA 3RW0A 3JYCA 4QE9A 3E83A 3RVYA 2Q6AA 2AHZA 3SYAA 2KB1A 1OCZC 4G27B 4PDLA 3ABMC 1V55C 5KUMA 3SPGA 4MSWC 3F7VC 5EK0A 4F4LA 3E89A 2ATKC 5B1BC 2ZD9A 4ZBMA 2IH1C 4H33A 5IY5C 4RO2A 2ITCC 4MTGA 5EC1C 3K0GA 5E1AC 1M56C 2BOBC 2A79B 2NLJC 2WLLA 3AG3C 3E8HA 3SYQA 4CBCA 3ASNC 4R8CA 3T4ZA 3OUFA 2EIMC 2Q68A 2WLIA 3SPHA 3VOUA 5B3SC 3ABLC 3IFXA 2IH3C 3LNMB 4EKWA 3STZC 4H37A 4MS2A 1KKDA 4LCUC 1S5HC 1P7BA 4R6ZA 2EIJC 3SJQC 4MW3A 4JTCB 4P9PA 3STLC 2X6CA 2WLLB 3LDCA 3SPCA 5BZBA 2HFEC 2HVJC 3TETA 4P30A 2WLIB 2YEVA 4UUJC 1R3LC 4PA6A 3RBZA 4PDVA 3TCUA 4PA7A 3F7YC 4RAIA 1J95A 2JK5C 4MVSA 2A9HA 2P7TC 4TWKA 5J9PC 3AG4C 3K06A 5B1AC 4MW8A 4HZ3A 3T1CA 3ZRSA 2W0FC 3OUSA 4PDMA 3FB7C 4WFGA 4BW5A 2WLMA 3FB6C 2K1EA 3F5WC 3LUTB 3K03A 4WFEA 4WFHA 4XDKA 2OCCC 4LP8A 4PDRA 4R50A 4GX2A 1R3KC 3SYCA 5EBMC 5CBGA 3E8GA 1G4YB 3T4DA 4XDJA 2DWDC 4P2ZA 4RUEA 3RVZA 3SYPA 4QNHB 1JVMA 4MTOA 3R65A 3BEHA 4RUFA 4MVOA 1ORQC 3OR7C 1BL8A 5EC2C 3FB8C 2ITDC 3OR6C 4J9YB 4MTFA 2QTOA 3K08A 2EINC 1M57C 3AG1C 1K4CC 2DYRC 3LDDA 2Q67A 2H8PC 2HJFC 2Y69C 4LBEC 2HG5C 1LNQA 2HVKC 2WLJA 4P9OA 3WG7C 4PA3A 4GX1A 4JTDB 3UM7A 3AG2C 4MVZA 1OCRC 3GB7C 1V54C 4MVMA 1K4DC 2WLKA 3E86A 3K04A 3ZJZA 5KUKA 4X8AA 2DYSC 2ZXWC 2AHYA 2DWEC 4JTAB 5CBFA 4WFFA 2R9RB 4XDLA 4PA4A 4PA9A 4DXWA 3T2MA 1OCCC 3UKMA 4I9WA 3X2QC 2EIKC 2BOCC 3IGAC 4X89A 5CBHA 4MVRA 2Q69A 3SYOA 1XL6A 4GX0A 4OXSA 3FB5C 1R3IC 3KG2A 2X6BA 5EBLC 4KFMA 3PJSK 4GX5A 1XL4A 3EFFK 1ZWIC 3E8FA 4J9ZB 4MVUA 3SPJA 1QLEC 2WLNA 3K0DA 3OGCC 3HPLC 4HYOA 4X88A 4G28B 4MVQA 3SPIA 2QKSA 2EILC 3E8BA 2A0LA
chains in the Genus database with same CATH superfamily
2QM8A 4J80A 2KKWA 1IBMB 1IXMA 1RSOA 1KP3A 3K5MA 3FYIB 1WP7A 3C3SA 4TOIA 1DF4A 3QO5A 3CCJV 1LR1A 3VBBA 4LF8B 4FFKA 1FD9A 4CBCA 5LHGA 2QTSA 2ZE5A 5TISZ 1TVKA 4UVBA 5B1NA 4WBNA 4JASA 4B7KA 2RJZA 3ZN0A 1H2NA 1RPRA 2IJIA 4LFBO 2Z5UA 2JK5C 3CJHA 4TQFA 4NVPA 3AG4C 3T1CA 3VQVA 1OCRB 4JYAO 1JCHA 4QIWF 4RQFA 1N32B 2K1EA 3B4SA 2QJ1A 2QDOA 4DUZO 4R50A 4LNUB 3A8TA 3R66A 1G6UA 2Y0PA 5B1OA 3L75H 3WFVA 3RVZA 4CC6A 1BL8A 3G4SV 2DQ0A 5C93A 5ITZA 2DYRC 5KLVH 1D2DA 2EILB 4N21A 3ASOB 3UT5B 4B3TO 4Q20A 5FLXN 4MVMA 2UUAO 2YEVB 2QA4V 4B3RB 4O2BA 4I50B 5GONA 1NZ6A 4NTXA 2RDCA 3FYEB 1AB3A 3SYOA 4LWSA 3T1YO 2Z0AA 1VQMV 5EBLC 1SQGA 4FM0A 1YF2A 1VIBA 3K0DA 3ZN1A 3B77A 2M7WA 2ZIMA 3JASB 4BAYA 1NH2D 1I5YA 2AHZA 2ZM6O 2UU9B 4MSWC 3K9SA 2ATKC 1AILA 2P67A 4HNAA 4BIZA 1N36B 4IIJB 2LFSA 4UVAA 4QPKA 4B08A 3MHSC 1SQPH 1BHAA 3STZC 1R1BA 1KC8W 1SQVH 1XMOB 1WN7A 3ZRWA 1H8EG 3ZHUA 4MW3A 3KCXA 3W7XA 1N33O 1E1RG 2KG7B 1ZL8A 4X1KB 2HHHO 4K0KB 4J11A 1YITV 3ZMUA 2ODMA 3JD0A 4BW5A 1DK1A 1M90W 3CXHF 1WJZA 4P2ZA 1KKCA 4IHJA 2ADPA 4JF3A 1Y74B 1YTFD 4J9YB 4JI3O 4JI0O 5EYPA 4I0XA 3W7WA 4E2LA 2HVKC 2QGNA 2EJRA 3I5DA 2YS8A 3HKCA 2MW2B 2Z3YA 4AHCA 1VARA 1A32A 2OT5A 2AGAA 1XNQB 1W0JG 2IU0A 3JAWB 1J5EO 2UUBB 1IURA 1RM1B 4FLYA 1ZSPA 1SF9A 3CP1A 1SS3A 1NR1A 5AG2A 5BR8B 2ZCEA 4D7SA 4DV2B 2E74B 4OGQB 4TV8A 5F2VO 4RQEA 1QVGU 1KUQA 3ETQA 3OEHG 2QWNB 4I55A 1M1KW 1M93A 3AK2A 2ADQB 3JYCA 4DV4B 1K5SA 3D3IA 2HKOA 2VQFB 1YDXA 5B1BC 1BT8A 5DECA 5LA6B 4ZBMA 5LGUA 3MD0A 4LF5O 5E1AC 3E8HA 1Q6HA 1SETA 1SC5B 3SYQA 1SQXH 4IGGA 4LH7A 4F6EA 1HNZB 3RYIB 1TGOA 2CUGA 2WSSG 3GWOA 3H01A 1GKFA 1Z2GA 2ZE8A 5CA0A 5L3BA 4R6ZA 5IYBO 4X20B 2VWKA 1H2GA 4P9PA 4GKJO 1EN4A 3CRAA 1J95A 2G38A 3CHXA 4UCUA 3J7AU 2A7WA 5LGNA 1BCCH 3S3XA 2PZSA 2PYLA 1X59A 2VWJA 3HKEB 2OCCC 4LF4O 1PNKA 2NNUA 4PJ0Z 3OT7A 5CA1A 2EZOA 4X62B 1R73A 1I94O 1I5XA 2AW9A 5HFLA 5A9GA 3ZMSA 3CCRV 3OR7C 2ITDC 4MT8A 3K08A 2H8PC 5IYDO 4JYYA 1LNQA 4LH6A 1H2KA 2P6JA 4P9OA 4J10A 2E75B 1EZVH 4LF6O 3K5LA 2H3OA 4FLTA 4UCTA 3IGAC 1V9PA 2JEXA 1VEWA 4GKKB 3CPWU 4EFEA 1Q6IA 4D6TH 4MVUA 5LXTA 1HWYA 3ZX6A 3SPIA 4LR3A 5LBQA 2A0LA 2LW7A 4J7JA 4IYHA 4ZI7B 3BA9A 1OCZC 2HR3A 5C8YA 5KUMA 1RFYA 1FAFA 4DR6B 2BSKA 3K0GA 2A06H 1WPBA 2Q68A 1F23A 3QNEA 3ABLC 3CC4V 3OFNG 3LNMB 2XNDG 3CYOA 1HNXB 5FNVA 2ZE7A 2DMXA 1M57B 1S72V 2BTQB 2HFEC 4TWKA 4DV3O 1PNMA 2KQXA 4I7ZB 2QWRB 4O4LB 3FB7C 4UB8Z 3BAAA 1QCEA 5EIBC 2Y4TA 4DV6B 5KX5B 2ZXWB 4CH4A 2YIDA 2PI4A 1US6A 4DUYB 2FTKA 4U3FH 2EBOA 2QEXV 5J2UB 4B3SB 4QNHB 4GZRB 3CMEV 4LFAB 1I7FA 4DR2B 4AI8A 4OX9O 3A2FA 3H9VA 3CCLV 2R70A 3LDDA 4I5SA 4UCRA 1IX9A 4D7TA 3FAVB 4J7ZA 1JPXA 3ZRVA 3W7TA 1XNRO 3GB7C 3WB1A 2JGDA 3TXQA 4FLXA 1Q43A 1XOUA 4XDLA 4JI5B 4K8ZA 1RP3B 1TUEB 3RYHB 4X1IB 2YICA 4MVRA 2R9IA 4GX0A 2UXCB 1FYJA 2LFRA 2GTSA 4KHPO 1JQ0A 5IJ0B 5JJNB 2NR5A 5CN0A 4OPAA 2QKSA 2Q73A 1K9MW 5CB4A 1XQ8A 1BE3H 2GUZB 2LQTA 2CDYA 3RVYA 4X1YB 3CWBH 3SPGA 1N4CA 2PTMA 4DR7B 1ZAUA 3J80N 4FK5C 4PELA 3H1HH 2QWPB 1VQ8V 2WLIA 3SPHA 1EFRG 3JSLA 2IH3C 4X66B 1H2LA 3DGEA 4EKWA 3OMIB 2ARHA 1VF5B 1WA8B 1S5HC 3RYCA 3SJQC 2HP8A 1HDJA 1ROPA 4IL6Z 4DRXA 2P06A 4P30A 4PA6A 4PDVA 1GH6A 3JATB 4FLWA 1NQTA 5IYZB 1WB7A 3ABKB 1SERA 3JARA 1AJPA 4WFHA 1K33A 2BE3A 4JI8O 1OZ0A 3SYCA 5EBMC 4DO2A 2M6YA 4X65O 1GO3F 4RWUA 3UO2A 2F1MA 3QVNA 5BMVB 2ZDIA 4FPPA 1BGYH 1QHTA 4LF9B 2RN9A 4ZHQB 1BZKA 2FL4A 2F93B 3K5NA 2UXDO 1AR1B 3AG2C 4CS3A 4NXNB 1QU7A 4KP4A 1GM7A 1N0NA 5KUKA 4JZGA 1WAZA 4JI7B 1I0HA 3MAQA 1NT2B 5IE9A 4X89A 4JI1O 5L3CA 2WWWA 1FFTB 3ETGA 4U3JA 4UB6Z 2N74A 1ZUQA 1MNGA 2QM7A 2PUSA 1GN6A 1YSCA 1QLEC 1LUVA 2XAFA 3ETEA 4MVQA 1MG1A 4DV7O 3WU2Z 1R3JC 1SRYA 2PGGA 3ABKC 3E83A 3AG7A 1QVFU 3AG4B 2Q4PA 2MK3A 3ZIAG 4YHHB 1IBKO 2AZ2A 3CSXA 2BOBC 3AG3C 5JCOA 3CB2A 1WLEA 1N8RW 1VF6A 3RYFA 1IBMO 4KXRA 3BCCH 1S77D 4W4KA 3ICXA 4QJFB 4ZKIA 5EZYB 4LF8O 3JSNA 4I4TB 3LSSA 1SQFA 5BZBA 3SPCA 2DYRB 3L73H 4UUJC 2YEVA 1YJ9V 2Q7HA 4I50A 4YJ3A 2CH7A 2A9HA 5B1AC 1UFIA 1EZJA 3OUSA 5LOVB 5IJ9B 2WLMA 1EN6A 1W0KG 3D36A 4NTYA 3HB3B 3ZRXA 1NBMG 1F51A 1KU9A 4CC5A 5CBGA 3E35A 2WPDG 1N34B 2LP7A 1NR7A 4ZOLB 2ZQMA 2Q9LA 1VMGA 2XAGA 5BY1A 4MVOA 1N32O 1GM9A 2YUAA 3GVMA 2FMLA 4J7KA 3T1HB 4BIOA 1MABG 3HKBB 2Y69C 3OE7G 1YIJV 2Q5ZA 1RPOA 3ZMZA 2F66C 1O9HA 4BWAA 1L0NH 1ENVA 2ZKOA 4WFAV 3P30A 1YVWA 3ZCCA 4OXSA 1LUWA 4CH6A 1QR9A 3S3WA 4B3RO 4JI6B 3AK1A 1IBLB 3OGCC 4NR1A 4Z1VA 1K3EA 4EB6A 1Q82W 1L8DA 1SQQH 3LSUA 2ZDIC 5L3DA 4KL1A 1HR0B 3E2EA 1VP7A 1AVMA 3L70H 5H5NA 5KHHA 5D5QA 1FPOA 2A79B 4UFZA 2WLLA 3D8CA 1Y74A 3ZBHA 1VQKV 2LJ2A 3K5OA 4O4IB 2ZNJA 2BTOA 5KAIZ 4WFBV 2UU9O 3ZMTA 2XHBA 2P90A 4TUYB 3BABA 2ETNA 1BHBA 3AK3A 5LMUB 2YDEA 1GAXA 2X6CA 2PY5A 1WNSA 1NH2B 1MOFA 4PA7A 1TVKB 4PI0A 4WBNB 4O4HB 1KD1W 1JA8A 3K06A 5IWAB 1XMOO 2IBZH 3ZRSA 1FJGB 2GDSA 4WFGA 1HNWB 1P84F 3KZIZ 2ZR3A 1R3KC 4Z1MG 4XDJA 2GHYA 4K0KO 3JAKA 3D3QA 1H38A 3DTUB 4DV1B 3N2KA 2DQ3A 3OTOB 4QPJA 1HW7A 1Y4MA 1IXBA 2ZNIA 1Q86W 2ZT9B 4ZIBA 4DK1A 1CP9A 3JAMN 3U0ZA 1KECA 1K4DC 3RYIA 5B1BB 2OTJV 1D5NA 3QF7A 1FXHA 5ITZB 3GWKC 2R9RB 2GV9A 5B66Z 3CC2V 3DSQA 3X2QC 2BOCC 1K5QA 1XMQB 1GRJA 3C90A 1YTFB 1BMFG 1MSDA 1KP2A 1XNQO 4O2BB 1ZWIC 1D5AA 3H1LH 3JALB 2UUBO 3OGIB 2R72A 3DXRA 1W59A 5IT9N 4R7CA 4TSFG 4LWSB 5BR8O 5DN6G 4DV2O 2QKAA 1DF5A 3Q4HA 4B3MB 1OV9A 2ZD9A 5L3FA 3U10A 4MTGA 3JD1A 2OCCB 3CD6V 3T4ZA 1EBOA 2EIMC 4DV4O 4JI3B 4PD4F 4LCUC 1ZTEA 5H2FZ 4NXMB 1JOYA 4HNAB 1K97A 4UCOA 2IM9A 2YIBA 1ZLZA 2WA3A 4YJ2A 1G8MA 4TQDA 1U97A 4PDMA 3ZRWB 1SA0A 1AR5A 3F5WC 4NB5A 4WFEA 4XBFA 4U7OA 1ZL8B 1NU1H 2UXXA 4JYCA 2X7RB 3ZHRA 4QGPA 4RUEA 4MTOA 4LFCB 1NVPD 3FB8C 2UXBB 4ZI7A 2XASA 2QTOA 1NVPB 4FLVA 4O2AA 3JD4A 2AXTZ 4UXNA 4X62O 4UV8A 3P32A 4X64B 4PA3A 3L72H 2OIGA 1W2BU 4MVZA 3IC7A 3JD2A 2XAHA 1OCZB 1V54C 2W0XA 1YJNV 4X9QA 4AQYB 3TGUH 1DGSA 5EYPB 2KSDA 1JFFB 3K57A 2Q69A 4O4JA 1PM9A 4FM2A 3ABLB 5JH7B 1VQ7V 2VQEB 1Q81W 2BTQA 3SPJA 4X88A 4BW9A 3MHHC 3UQ8A 3I55V 3CCEV 5KX5A 4GKKO 4QE9A 2KB1A 1K7DA 1CPYA 1M4UA 1V55C 2B9ZA 3OMAB 5EIBD 4H44B 5L3EA 1Z5VA 4C7UA 4UCVA 3B8NA 3BHPA 4I55B 5B3SC 3IFXA 4FLZA 4DW0A 4DR6O 3K9AA 4JTCB 1YHQV 3VQXA 2F4VB 2IJJA 2QM4A 3RFRA 3B40A 4Q6GA 3ZHTA 1HNXO 5CA0B 1OHHG 2XT9A 2V1DA 4DR1B 1GTOA 4XDKA 2IJKA 3HKDA 2R9AA 2UXNA 5GW7A 1R6TA 2YI9A 4FZ1A 2D3OW 4DV6O 1NKDA 2L35A 2GUZA 3G6EV 1MSWD 1PNLA 4X1YA 4LC1A 4I9QA 5KHKA 2RNBA 5JJEB 4DUYO 4N23A 4CH3A 1YEWA 2HJFC 5CA1B 5LMNB 1Y76A 4B3SO 2Q8VA 2E5LB 5H6QA 4LFAO 4TV9A 4DR2O 5JQGB 3ZJZA 3K04A 4X8AA 2OYQA 2OIEA 5JVDB 5FPRA 4DXWA 1WA8A 3T2MA 1OCCC 1TA8A 3E22B 1VQ5V 2QWQB 4UVCA 1K92A 4JI5O 5J2TA 2OWOA 2DJVA 4G28B 2Y4UA 1TUBA 5EBWC 2UXCO 1PKXA 3K79A 1YI2V 4JV5B 4G27B 4PDLA 3ABMC 1K34A 1FXKA 1FXVA 5LXTB 3FFQA 1M56C 4K35A 3OUFA 2JEUA 2Q7EA 2WAMA 4GCZA 4ZHQA 5C8YB 1JJOA 1Y66A 1EN5A 3DC5A 1MZEA 4PI2A 1ZX3A 3P3NA 3DC6A 4X66O 3FX7A 1AROP 2Q0OC 3AG2B 4CZZA 5H6RA 5KMGA 3N2GA 2K9PA 3K03A 1B04A 5LYJB 4JI4B 3AEIA 3QO7A 3U11A 3ZHSA 4DR5B 3IC9A 1G4YB 1COWG 4FZ0A 4F6RB 3G67A 1N0JA 4CS4A 3BEHA 2YXYA 3OW2U 1ORQC 2Y48A 1UPGA 4CS2A 1Q3EA 4DW1A 2HEPA 2EZPA 2CTRA 1QLEB 2EINC 3AG1C 1UJWB 4GYCB 1GK9A 3SJAC 1VF7A 2YC0A 1FKAO 3APOA 4DV0B 1OJHA 4LF9O 1WB8A 1BQZA 5LP6A 5FPOA 2V4DA 2AHYA 2QR4A 3WB0A 3KCYA 4FLUA 4MTXA 3AG3B 1EM1A 3UKMA 5IDJA 3G71V 2Y0IA 4JGSA 4NXNO 2LGWA 2CTWA 3B8MA 5BXZA 2WA4A 4FFBB 2JGDB 4YY3B 2E76B 2CAZC 3EFFK 1FFXB 2GSMB 4JI7O 4HYOA 3ABUA 5IJ9A 4NKGB 2X6AA 3J81N 4K8XA 4EFBA 2P5OA 4EEQA 2H94A 3CS5A 5B1AB 1YJWV 5IY5C 5HFMA 1AI5A 1NJIW 2QWOB 5CB4B 3ASNC 5LHHA 2HLDG 1IZ3A 2EULA 3A0BZ 5JJJB 3O65A 4YHHO 4LF7B 4DV5B 2XUMA 4L8JA 4LNUA 2OCHA 2WLIB 3IAYA 2Y69B 3TCUA 1MZFA 1KBHA 3ABTA 5E79Z 4HBNA 4J42A 3FB6C 4JI2B 4ABMA 2PI5A 2A3QA 1YCIA 4GUNA 3VQYA 4DRXB 3L74H 3BPZA 1VQ6V 4E4EA 1IDSA 3UT5A 3R65A 1FS0G 5KAFZ 4RUFA 1Q90D 1FXKC 3LSQA 4DR3B 4MTFA 3CRCA 3L71H 4JAUA 1N34O 2P22C 2HG5C 1GN4A 1SKVA 3WG7C 4DR4B 3UM7A 1I08A 1AJQA 4O4IA 2N05A 3T1HO 2DYSC 1O9GA 3G6BA 4TUYA 1T5EA 2EIKC 2UUCB 3JASA 5DM6V 5JWPA 1JR9A 1KB9F 1R3IC 1R6NA 1L1FA 1DLBA 1U96A 1NTKH 3P3PA 2JGUA 3G80A 1CXZB 2VS0A 3HPLC 4O4HA 2B1IA 4IIJA 4IT5A 1OCOC 2CTPA 1JX9A 4U3JB 4JI6O 4F4LA 1IBLO 1R6KA 4ASUG 5CMUA 1H8HG 2YXLA 5EC1C 2D2CB 2IU3A 2W6JG 2B1GA 5KHIA 2F43G 3OEEG 4YIOA 2KG7A 4LFBB 4X1KA 1HR0O 2ZINA 5LP6C 1B06A 4BR6A 2EIJC 4JYAB 3B2EE 2O57A 3RYFB 2FYUH 3BVOA 4DUZB 1VQLV 3TETA 3PN1A 3RBZA 1NTMH 5A2QN 4FVMA 4NTWA 5J9PC 4MW8A 2LO1A 3ZHVA 5LMUO 3ZS8C 2JS3A 2HJDA 1RSOB 4CH5A 1S3JA 1AP6A 2XOKG 2DWDC 3TJTA 3CE2A 3X2QB 4YJ3B 2CH7B 5IWAO 1N36O 2FKXA 3JALA 1FJGO 3SYPA 1JMKC 1BSMA 1JVMA 4B3TB 1HNWO 2Q0AA 4OPHA 3OTFA 2UUAB 4Z2WA 5L3GA 3BRCA 1AR4A 3A0RA 3JD3A 1SZXA 3JAWA 2W6IG 3O9OA 2ZIOA 3CC7V 3NXSA 1NS1A 4DV1O 1OCRC 1S76D 3T1YB 1F4NA 1SQBH 3OTOO 1URFA 3CJHB 1S0VA 1XBLA 1M5IA 4WFFA 3VQWA 5CA3A 5IYCO 2EIMB 5JCOC 1VF6C 4KFMA 2BCCH 2ZM6B 1Y67A 5LA6A 1XUQA 2WLNA 2E3CA 2L6LA 3CEIA 1H2MA 1Y6XA 2EILC 3E8BA 2CTQA 3CCQV 3ASOC 1XMQO 4QE7A 1GM8A 4GT1A 2WLHA 2Q6AA 3SYAA 1VQOV 1THZA 3CMAV 3CRRA 3F7VC 3E89A 2YI8A 5K1PA 4X20A 5KHGA 4YIPA 4EB6B 4R8CA 2JJ2G 3K3WA 3D36C 1N33B 1AP5A 3UO3A 5GONB 3CRQA 1AJNA 4KUMA 4B3MO 4MS2A 1SESA 2HHHB 4J41A 1P7BA 5H9CA 3BY6A 3ML0A 3HKEA 4B7EA 2DOSA 2WLLB 3LDCA 3SGIA 3CX5F 3SJBC 4L87A 3BA8A 5D5PA 1XREA 3RT3C 2IW5A 1Q7YW 3C3TA 4DK0A 4NXMO 1JFFA 1PPJH 2XAQA 1VQPV 1V54B 5GTIZ 1JJ2U 3TXSA 1QNMA 2RCVA 5JH7A 1BQ0A 2VQFO 4JI0B 1P49A 3L9DA 3JCUZ 4FM1A 1F4MA 1HNZO 2C2AA 1HP8A 2P4KA 3W7SA 1DTOA 4JYBA 3K59A 1J5EB 3JAKB 2XTAA 4JTDB 4LFCO 5DEDA 4FMTA 3SR2C 2UXBO 1XDCA 1V55B 2WLKA 3E86A 3CCVV 3N2KB 2CK3G 2DWEC 2QKCA 4X64O 2JVDA 2RQ6A 5B3SB 3FB5C 3KG2A 2ZR2A 4AQYO 3OM3B 2JJ1G 2X6BA 3THOA 3M8AA 5GTHZ 1KYOF 4IHJB 4LF5B 2VQEO 1P7GA 2YXHA 4I0XB 2ILMA 2N04A 3SJCC 5EK0A 5K1XA 2CGNA 2ITCC 4PHZA 3IJ4A 2JIZG 3DXRB 3HKCB 1RM1C 4GKJB 2OTLV 2X0LA 3Q4HB 1PP9H 4O4LA 4FJCC 2XAJA 1SZTA 4K3AA 5JQGA 1XILA 4LF4B 1R3LC 4TV8B 4RAIA 3OAAG 5JVDA 1XHZA 4JPRA 5J2UA 2DE0X 1I94B 2YIBD 5KHJA 2F4VO 3K58A 3I56V 3QO8A 4PDRA 3E22A 2FB5A 1OCCB 2DN9A 4YJ2B 3FAVA 5LL6Y 3CXCU 5FL7G 3UCSC 2YIAA 1VQ4V 4DR1O 1SA0B 3B09A 3RN4A 1K4CC 2Q67A 2QE7G 1NI8A 4LF6B 3RYHA 2YSUB 4LBEC 4X1IA 1QBZA 2JDIG 1QQCA 3EXAA 2GTAA 3TK1A 4GX1A 3ABMB 1M9NA 3A0HZ 5IJ0A 3SDLA 4WF9V 4O2AB 4PA9A 5LMNO 1M56B 2E5LO 4I9WA 1GMGA 1XL6A 1K8AW 1Q6UA 2Q7GA 1WPXA 3PJSK 3APQA 4G2KA 4HZ3A 4O4JB 4FIPC 3LDEA 4DYLA 5LYJA 3H1JH 5B5EZ 4F6RA 3H1IH 1B6QA 4H33A 4A5UB 4RO2A 1G1XB 2NLJC 3VOUA 4JV5O 3ETDA 3FKSG 3JATA 4H37A 5IYZA 4DV3B 4U7NA 2EJ7A 5LGTA 1VQ9V 3OD4A 2EINB 3AG1B 3LNNA 2PYJA 3F7YC 4IYIA 1NTZH 4MVSA 1GN3A 1X4TA 2ZE6A 4JAVA 2W0FC 5BMVA 3H1KH 4OX9B 4LP8A 4GX2A 4FFBA 1FFXA 1VQNV 4DR7O 2BSKB 4JAAA 4UV9A 1XNRB 4JI4O 2EX3A 4DR5O 3OR6C 3CCUV 3KKYA 2F23A 1M57C 4GLXA 2VRZA 1K73W 3HKDB 3ZHQA 2WLJA 4HAMA 5FNVB 2F95B 4KHPB 4W4LA 2ZXWC 1L0LH 4JTAB 5CBFA 5IY5B 4PA4A 2NN4A 3RGBA 2GBOA 1S5JA 1Q5OA 1Y76B 1QR8A 3ASNB 4DV0O 2B5UA 5CBHA 1YXBA 4H13B 1H2SB 4TV9B 5LHIA 3CCSV 2DW4A 4GX5A 1XL4A 3ZEDA 4J9ZB 1XHXA 3HR0A 3EHBB 4JZ2A 3JCZA 1BS3A 2RMKB 2V7QG 3RW0A 1E1QG 1CEZA 1Q8IA 2IJHA 4YY3O 1XEQA 1PD3A 3EVKA 5EZYA 2JRIA 5J2TB 2IH1C 4I4TA 1TUBB 3M7MX 1QLNA 5KA6A 4TT3G 1KKDA 1GN2A 5LOVA 1FXKB 1B3QA 3W7UA 3QG5A 3STLC 1P4RA 3ZMVA 2HVJC 4JI8B 3WB2A 1IVSA 4X65B 4UCSA 4ZOLA 3OMNB 2LW1A 3WG7B 2P7TC 3MDSA 4NYKA 4LF7O 1TAEA 2JS5A 4DV5O 3LUTB 2DYSB 1AI7A 1PL4A 3E8GA 3HKBA 3T4DA 3FD9A 2P4VA 2EIKB 2UXDB 1KMIZ 1E79G 4YXWG 4AILC 1XI1A 2CE4A 4WCEV 2LGQA 3RWRD 4JI2O 1AI4A 5KMGB 3M99B 1MA1A 5EC2C 3N2GB 2CGOA 4BIUA 4ICGA 2PF4E 3RYCB 1OCOB 4JI1B 3CRMA 3N27A 4DR3O 1AI6A 3NR7A 1MMMA 1F7YA 4H0LB 2AZ0A 1KQSU 4DR4O 1Z5WA 3QTCA 5KA5A 4DV7B 3JARB 3F5TA 1S5LZ 4PV1B 1YZBA 2QSAA 3BFRA 5LP6B 2EIJB 3E8FA 3CCMV 2UUCO 1IBKB 1PV0A 1PL0A 1WP8A
chains in the Genus database with same CATH topology
3ASOC 2QM8A 3CCEV 3I55V 4QE7A 1GM8A 4GT1A 2WLHA 4QE9A 1IXMA 3RVYA 2Q6AA 3SYAA 1VQOV 2KB1A 1THZA 3CMAV 1K7DA 1CPYA 1KP3A 3FYIB 1V55C 3OMAB 3SPGA 1DF4A 3F7VC 3QO5A 3E89A 3CCJV 3VBBA 5L3EA 3B8NA 4CBCA 4R8CA 4FK5C 4PELA 2JJ2G 5LHGA 3K3WA 1VQ8V 2WLIA 3SPHA 5B3SC 1EFRG 3IFXA 2IH3C 4UVBA 5B1NA 3DGEA 4EKWA 1AJNA 3OMIB 4KUMA 4MS2A 1SESA 1S5HC 4JASA 1P7BA 5H9CA 3BY6A 3ML0A 3SJQC 3K9AA 4JTCB 3ZN0A 1YHQV 1ROPA 2WLLB 1RPRA 3LDCA 2IJIA 2IJJA 4L87A 4P30A 4PA6A 4PDVA 2Z5UA 2IW5A 1Q7YW 2JK5C 1NQTA 3AG4C 3T1CA 2XAQA 1OCRB 1OHHG 1VQPV 1V54B 1JCHA 3ABKB 1JJ2U 4QIWF 2V1DA 4RQFA 1SERA 2K1EA 1AJPA 1GTOA 1K33A 4WFHA 2IJKA 4XDKA 4R50A 1OZ0A 3SYCA 5EBMC 4DO2A 5B1OA 1GO3F 2UXNA 3WFVA 5GW7A 3RVZA 1F4MA 2D3OW 2ZDIA 4FPPA 2C2AA 1BL8A 1NKDA 3G6EV 3G4SV 1MSWD 1PNLA 2DQ0A 4LC1A 3W7SA 5C93A 1DTOA 2DYRC 4JYBA 4N23A 2HJFC 2EILB 4N21A 3ASOB 5H6QA 1AR1B 3MHHC 4Q20A 4JTDB 3AG2C 4FMTA 4KP4A 4MVMA 1GM7A 1V55B 2WLKA 3E86A 3K04A 2YEVB 3ZJZA 5KUKA 3CCVV 4X8AA 2QA4V 2CK3G 2DWEC 4DXWA 3T2MA 1OCCC 3FYEB 4X89A 3SYOA 2WWWA 5L3CA 5B3SB 1FFTB 3ETGA 3FB5C 3KG2A 2ZR2A 1VQMV 3OM3B 2JJ1G 2X6BA 1VQ5V 5EBLC 2QM7A 4UVCA 1K92A 1YSCA 1QLEC 2XAFA 3ETEA 3K0DA 3ZN1A 4G28B 3B77A 4MVQA 2M7WA 1MG1A 1R3JC 1SRYA 3ABKC 5EBWC 1PKXA 3K79A 1YI2V 4BAYA 1NH2D 3E83A 1I5YA 2AHZA 4G27B 1QVFU 3AG4B 4PDLA 3ABMC 4MSWC 5EK0A 2ATKC 1K34A 1FXKA 2MK3A 1FXVA 3ZIAG 2P67A 2ITCC 4BIZA 2JIZG 1M56C 2BOBC 3AG3C 1WLEA 1N8RW 2LFSA 3OUFA 4UVAA 2JEUA 1RM1C 4QPKA 2WAMA 3MHSC 4GCZA 2OTLV 1S77D 1BHAA 2X0LA 3STZC 4QJFB 1KC8W 1Y66A 4ZKIA 4FJCC 2XAJA 3ZRWA 1H8EG 3LSSA 1SZTA 4MW3A 3W7XA 5BZBA 3SPCA 2DYRB 1E1RG 4UUJC 2YEVA 1R3LC 1YJ9V 4RAIA 1AROP 3OAAG 2A9HA 4JPRA 5B1AC 1YITV 3AG2B 3ZMUA 1EZJA 4CZZA 5H6RA 3OUSA 3JD0A 4BW5A 2WLMA 1W0KG 3D36A 3ZRXA 3HB3B 3K03A 1NBMG 3I56V 3AEIA 3QO7A 3QO8A 4PDRA 1M90W 1F51A 5CBGA 1G4YB 1OCCB 1COWG 3E35A 2WPDG 4P2ZA 2LP7A 1NR7A 2ZQMA 5FL7G 3CXCU 4JF3A 3BEHA 1VQ4V 2XAGA 3OW2U 4MVOA 1GM9A 1ORQC 2Y48A 1YTFD 4J9YB 2EZPA 2EINC 1QLEB 3AG1C 1K4CC 2Q67A 1UJWB 1GK9A 1MABG 2QE7G 3W7WA 2Y69C 2YSUB 4LBEC 3OE7G 1YIJV 1QBZA 4E2LA 2HVKC 1RPOA 2JDIG 3ZMZA 3TK1A 4GX1A 2EJRA 2Z3YA 3ABMB 1M9NA 1ENVA 2OT5A 2AHYA 1W0JG 4WF9V 2IU0A 4WFAV 4PA9A 3P30A 4MTXA 1M56B 3AG3B 3UKMA 5IDJA 3G71V 4I9WA 4JGSA 1GMGA 1RM1B 3ZCCA 1XL6A 4OXSA 1K8AW 3B8MA 3CP1A 1WPXA 1NR1A 1QR9A 3PJSK 3EFFK 2GSMB 3OGCC 4HYOA 4RQEA 4G2KA 3ABUA 1K3EA 4HZ3A 1QVGU 1Q82W 3OEHG 2X6AA 1M1KW 4FIPC 3LDEA 3JYCA 1K5SA 3D3IA 2ZDIC 2HKOA 5L3DA 2H94A 5B1AB 1B6QA 5B1BC 3E2EA 1YJWV 4ZBMA 4H33A 5IY5C 4RO2A 3MD0A 5HFMA 5LGUA 1AI5A 1NJIW 5E1AC 3E8HA 2A79B 2NLJC 2WLLA 1SETA 1VQKV 3SYQA 3ASNC 5LHHA 2HLDG 3VOUA 3ETDA 2WSSG 4WFBV 3ZMTA 3FKSG 3GWOA 3H01A 1GKFA 2P90A 4H37A 4U7NA 5L3BA 4R6ZA 5IYBO 5LGTA 1VQ9V 1BHBA 4P9PA 1H2GA 2X6CA 2EINB 3AG1B 1NH2B 1MOFA 2WLIB 2Y69B 3TCUA 4PA7A 3F7YC 1J95A 4MVSA 1KD1W 3K06A 3ABTA 4JAVA 3ZRSA 5LGNA 2W0FC 4WFGA 3FB6C 2PI5A 2ZR3A 2OCCC 4LP8A 1PNKA 2NNUA 4GX2A 1R3KC 1VQ6V 4Z1MG 4XDJA 2GHYA 1VQNV 2EZOA 1H38A 1R73A 1I5XA 5HFLA 3R65A 1FS0G 4UV9A 4RUFA 3ZMSA 1FXKC 3DTUB 3CCRV 3OR7C 3LSQA 2ITDC 3OR6C 4MT8A 4MTFA 2DQ3A 3CCUV 3K08A 1M57C 4JAUA 4QPJA 2H8PC 1Y4MA 1K73W 5IYDO 1Q86W 2HG5C 1LNQA 1CP9A 2P6JA 2WLJA 4HAMA 4P9OA 3WG7C 3UM7A 1AJQA 1KECA 1K4DC 5B1BB 2OTJV 2DYSC 2ZXWC 1FXHA 4JTAB 5CBFA 5IY5B 2R9RB 4PA4A 3CC2V 3X2QC 1QR8A 2EIKC 2BOCC 1K5QA 2B5UA 3ASNB 3IGAC 5CBHA 5DM6V 1R3IC 2JEXA 1YTFB 5LHIA 1R6NA 1L1FA 1DLBA 3CCSV 2DW4A 4GX5A 1BMFG 3CPWU 1XL4A 1KP2A 1ZWIC 4J9ZB 4MVUA 1HWYA 3SPIA 3HPLC 3EHBB 2B1IA 3JCZA 5LBQA 2A0LA 2V7QG 4R7CA 1OCOC 1E1QG 4TSFG 3RW0A 1CEZA 1JX9A 1OCZC 2HR3A 2IJHA 5DN6G 5KUMA 1PD3A 4F4LA 1R6KA 1DF5A 4ASUG 5CMUA 2ZD9A 5L3FA 1H8HG 2IH1C 4MTGA 3JD1A 5EC1C 3K0GA 2IU3A 2W6JG 2B1GA 2OCCB 3CD6V 3T4ZA 1EBOA 2F43G 3OEEG 2EIMC 2Q68A 1F23A 3QNEA 3ABLC 3CC4V 3OFNG 3LNMB 2XNDG 5KA6A 1QLNA 4TT3G 1KKDA 3CYOA 4LCUC 1FXKB 2EIJC 1JOYA 1K97A 3W7UA 3STLC 1M57B 1P4RA 3ZMVA 1S72V 2HFEC 1VQLV 2HVJC 3TETA 3RBZA 3OMNB 3WG7B 2P7TC 4TWKA 1PNMA 5J9PC 1G8MA 4MW8A 4PDMA 3FB7C 3ZRWB 1QCEA 3F5WC 3LUTB 2DYSB 2ZXWB 4WFEA 4XBFA 1AI7A 1S3JA 2XOKG 3E8GA 2PI4A 4U7OA 3T4DA 2DWDC 2FTKA 3X2QB 2EIKB 2UXXA 2EBOA 4JYCA 2X7RB 2QEXV 4RUEA 3SYPA 4QNHB 1JVMA 3CMEV 4MTOA 1E79G 4YXWG 1K9MW 4WCEV 1AI4A 1NVPD 3M99B 3FB8C 5EC2C 2XASA 3CCLV 2QTOA 5L3GA 1NVPB 4BIUA 3LDDA 3A0RA 4I5SA 3JD3A 3JD4A 4UXNA 4UV8A 3P32A 1OCOB 1JPXA 2W6IG 4PA3A 3ZRVA 3CC7V 3NXSA 3W7TA 1W2BU 4MVZA 3IC7A 3JD2A 2XAHA 1OCRC 1OCZB 3GB7C 1S76D 1V54C 1F4NA 1YJNV 1AI6A 1S0VA 4WFFA 1KQSU 4XDLA 1TUEB 5CA3A 5KA5A 5IYCO 4MVRA 2Q69A 2EIMB 2R9IA 4GX0A 3ABLB 1VQ7V 1Q81W 2LFRA 4KFMA 1JQ0A 2EIJB 3E8FA 3SPJA 3CCMV 2WLNA 5CN0A 4X88A 2QKSA 2EILC 3E8BA 3CCQV 1PL0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASO C;  1R3J C;  2X6A A;  3ABK C;  4R7C A;  1OCO C;  4QE7 A;  5EBW C;  3LDE A;  2WLH A;  3RW0 A;  3JYC A;  4QE9 A;  3E83 A;  3RVY A;  2Q6A A;  2AHZ A;  3SYA A;  2KB1 A;  1OCZ C;  4G27 B;  4PDL A;  3ABM C;  1V55 C;  5KUM A;  3SPG A;  4MSW C;  3F7V C;  5EK0 A;  4F4L A;  3E89 A;  2ATK C;  5B1B C;  2ZD9 A;  4ZBM A;  2IH1 C;  4H33 A;  5IY5 C;  4RO2 A;  2ITC C;  4MTG A;  5EC1 C;  3K0G A;  5E1A C;  1M56 C;  2BOB C;  2A79 B;  2NLJ C;  2WLL A;  3AG3 C;  3E8H A;  3SYQ A;  4CBC A;  3ASN C;  4R8C A;  3T4Z A;  3OUF A;  2EIM C;  2Q68 A;  2WLI A;  3SPH A;  3VOU A;  5B3S C;  3ABL C;  3IFX A;  2IH3 C;  3LNM B;  4EKW A;  3STZ C;  4H37 A;  4MS2 A;  1KKD A;  4LCU C;  1S5H C;  1P7B A;  4R6Z A;  2EIJ C;  3SJQ C;  4MW3 A;  4JTC B;  4P9P A;  3STL C;  2X6C A;  2WLL B;  3LDC A;  3SPC A;  5BZB A;  2HFE C;  2HVJ C;  3TET A;  4P30 A;  2WLI B;  2YEV A;  4UUJ C;  1R3L C;  4PA6 A;  3RBZ A;  4PDV A;  3TCU A;  4PA7 A;  3F7Y C;  4RAI A;  1J95 A;  2JK5 C;  4MVS A;  2A9H A;  2P7T C;  4TWK A;  5J9P C;  3AG4 C;  3K06 A;  5B1A C;  4MW8 A;  4HZ3 A;  3T1C A;  3ZRS A;  2W0F C;  3OUS A;  4PDM A;  3FB7 C;  4WFG A;  4BW5 A;  2WLM A;  3FB6 C;  2K1E A;  3F5W C;  3LUT B;  3K03 A;  4WFE A;  4WFH A;  4XDK A;  2OCC C;  4LP8 A;  4PDR A;  4R50 A;  4GX2 A;  1R3K C;  3SYC A;  5EBM C;  5CBG A;  3E8G A;  1G4Y B;  3T4D A;  4XDJ A;  2DWD C;  4P2Z A;  4RUE A;  3RVZ A;  3SYP A;  4QNH B;  1JVM A;  4MTO A;  3R65 A;  3BEH A;  4RUF A;  4MVO A;  1ORQ C;  3OR7 C;  1BL8 A;  5EC2 C;  3FB8 C;  2ITD C;  3OR6 C;  4J9Y B;  4MTF A;  2QTO A;  3K08 A;  2EIN C;  1M57 C;  3AG1 C;  1K4C C;  2DYR C;  3LDD A;  2Q67 A;  2H8P C;  2HJF C;  2Y69 C;  4LBE C;  2HG5 C;  1LNQ A;  2HVK C;  2WLJ A;  4P9O A;  3WG7 C;  4PA3 A;  4GX1 A;  4JTD B;  3UM7 A;  3AG2 C;  4MVZ A;  1OCR C;  3GB7 C;  1V54 C;  4MVM A;  1K4D C;  2WLK A;  3E86 A;  3K04 A;  3ZJZ A;  5KUK A;  4X8A A;  2DYS C;  2ZXW C;  2AHY A;  2DWE C;  4JTA B;  5CBF A;  4WFF A;  2R9R B;  4XDL A;  4PA4 A;  4PA9 A;  4DXW A;  3T2M A;  1OCC C;  3UKM A;  4I9W A;  3X2Q C;  2EIK C;  2BOC C;  3IGA C;  4X89 A;  5CBH A;  4MVR A;  2Q69 A;  3SYO A;  1XL6 A;  4GX0 A;  4OXS A;  3FB5 C;  1R3I C;  3KG2 A;  2X6B A;  5EBL C;  4KFM A;  3PJS K;  4GX5 A;  1XL4 A;  3EFF K;  1ZWI C;  3E8F A;  4J9Z B;  4MVU A;  3SPJ A;  1QLE C;  2WLN A;  3K0D A;  3OGC C;  3HPL C;  4HYO A;  4X88 A;  4G28 B;  4MVQ A;  3SPI A;  2QKS A;  2EIL C;  3E8B A;  2A0L A; 
#chains in the Genus database with same CATH topology
 2QM8 A;  4J80 A;  2KKW A;  1IBM B;  1IXM A;  1RSO A;  1KP3 A;  3K5M A;  3FYI B;  1WP7 A;  3C3S A;  4TOI A;  1DF4 A;  3QO5 A;  3CCJ V;  1LR1 A;  3VBB A;  4LF8 B;  4FFK A;  1FD9 A;  4CBC A;  5LHG A;  2QTS A;  2ZE5 A;  5TIS Z;  1TVK A;  4UVB A;  5B1N A;  4WBN A;  4JAS A;  4B7K A;  2RJZ A;  3ZN0 A;  1H2N A;  1RPR A;  2IJI A;  4LFB O;  2Z5U A;  2JK5 C;  3CJH A;  4TQF A;  4NVP A;  3AG4 C;  3T1C A;  3VQV A;  1OCR B;  4JYA O;  1JCH A;  4QIW F;  4RQF A;  1N32 B;  2K1E A;  3B4S A;  2QJ1 A;  2QDO A;  4DUZ O;  4R50 A;  4LNU B;  3A8T A;  3R66 A;  1G6U A;  2Y0P A;  5B1O A;  3L75 H;  3WFV A;  3RVZ A;  4CC6 A;  1BL8 A;  3G4S V;  2DQ0 A;  5C93 A;  5ITZ A;  2DYR C;  5KLV H;  1D2D A;  2EIL B;  4N21 A;  3ASO B;  3UT5 B;  4B3T O;  4Q20 A;  5FLX N;  4MVM A;  2UUA O;  2YEV B;  2QA4 V;  4B3R B;  4O2B A;  4I50 B;  5GON A;  1NZ6 A;  4NTX A;  2RDC A;  3FYE B;  1AB3 A;  3SYO A;  4LWS A;  3T1Y O;  2Z0A A;  1VQM V;  5EBL C;  1SQG A;  4FM0 A;  1YF2 A;  1VIB A;  3K0D A;  3ZN1 A;  3B77 A;  2M7W A;  2ZIM A;  3JAS B;  4BAY A;  1NH2 D;  1I5Y A;  2AHZ A;  2ZM6 O;  2UU9 B;  4MSW C;  3K9S A;  2ATK C;  1AIL A;  2P67 A;  4HNA A;  4BIZ A;  1N36 B;  4IIJ B;  2LFS A;  4UVA A;  4QPK A;  4B08 A;  3MHS C;  1SQP H;  1BHA A;  3STZ C;  1R1B A;  1KC8 W;  1SQV H;  1XMO B;  1WN7 A;  3ZRW A;  1H8E G;  3ZHU A;  4MW3 A;  3KCX A;  3W7X A;  1N33 O;  1E1R G;  2KG7 B;  1ZL8 A;  4X1K B;  2HHH O;  4K0K B;  4J11 A;  1YIT V;  3ZMU A;  2ODM A;  3JD0 A;  4BW5 A;  1DK1 A;  1M90 W;  3CXH F;  1WJZ A;  4P2Z A;  1KKC A;  4IHJ A;  2ADP A;  4JF3 A;  1Y74 B;  1YTF D;  4J9Y B;  4JI3 O;  4JI0 O;  5EYP A;  4I0X A;  3W7W A;  4E2L A;  2HVK C;  2QGN A;  2EJR A;  3I5D A;  2YS8 A;  3HKC A;  2MW2 B;  2Z3Y A;  4AHC A;  1VAR A;  1A32 A;  2OT5 A;  2AGA A;  1XNQ B;  1W0J G;  2IU0 A;  3JAW B;  1J5E O;  2UUB B;  1IUR A;  1RM1 B;  4FLY A;  1ZSP A;  1SF9 A;  3CP1 A;  1SS3 A;  1NR1 A;  5AG2 A;  5BR8 B;  2ZCE A;  4D7S A;  4DV2 B;  2E74 B;  4OGQ B;  4TV8 A;  5F2V O;  4RQE A;  1QVG U;  1KUQ A;  3ETQ A;  3OEH G;  2QWN B;  4I55 A;  1M1K W;  1M93 A;  3AK2 A;  2ADQ B;  3JYC A;  4DV4 B;  1K5S A;  3D3I A;  2HKO A;  2VQF B;  1YDX A;  5B1B C;  1BT8 A;  5DEC A;  5LA6 B;  4ZBM A;  5LGU A;  3MD0 A;  4LF5 O;  5E1A C;  3E8H A;  1Q6H A;  1SET A;  1SC5 B;  3SYQ A;  1SQX H;  4IGG A;  4LH7 A;  4F6E A;  1HNZ B;  3RYI B;  1TGO A;  2CUG A;  2WSS G;  3GWO A;  3H01 A;  1GKF A;  1Z2G A;  2ZE8 A;  5CA0 A;  5L3B A;  4R6Z A;  5IYB O;  4X20 B;  2VWK A;  1H2G A;  4P9P A;  4GKJ O;  1EN4 A;  3CRA A;  1J95 A;  2G38 A;  3CHX A;  4UCU A;  3J7A U;  2A7W A;  5LGN A;  1BCC H;  3S3X A;  2PZS A;  2PYL A;  1X59 A;  2VWJ A;  3HKE B;  2OCC C;  4LF4 O;  1PNK A;  2NNU A;  4PJ0 Z;  3OT7 A;  5CA1 A;  2EZO A;  4X62 B;  1R73 A;  1I94 O;  1I5X A;  2AW9 A;  5HFL A;  5A9G A;  3ZMS A;  3CCR V;  3OR7 C;  2ITD C;  4MT8 A;  3K08 A;  2H8P C;  5IYD O;  4JYY A;  1LNQ A;  4LH6 A;  1H2K A;  2P6J A;  4P9O A;  4J10 A;  2E75 B;  1EZV H;  4LF6 O;  3K5L A;  2H3O A;  4FLT A;  4UCT A;  3IGA C;  1V9P A;  2JEX A;  1VEW A;  4GKK B;  3CPW U;  4EFE A;  1Q6I A;  4D6T H;  4MVU A;  5LXT A;  1HWY A;  3ZX6 A;  3SPI A;  4LR3 A;  5LBQ A;  2A0L A;  2LW7 A;  4J7J A;  4IYH A;  4ZI7 B;  3BA9 A;  1OCZ C;  2HR3 A;  5C8Y A;  5KUM A;  1RFY A;  1FAF A;  4DR6 B;  2BSK A;  3K0G A;  2A06 H;  1WPB A;  2Q68 A;  1F23 A;  3QNE A;  3ABL C;  3CC4 V;  3OFN G;  3LNM B;  2XND G;  3CYO A;  1HNX B;  5FNV A;  2ZE7 A;  2DMX A;  1M57 B;  1S72 V;  2BTQ B;  2HFE C;  4TWK A;  4DV3 O;  1PNM A;  2KQX A;  4I7Z B;  2QWR B;  4O4L B;  3FB7 C;  4UB8 Z;  3BAA A;  1QCE A;  5EIB C;  2Y4T A;  4DV6 B;  5KX5 B;  2ZXW B;  4CH4 A;  2YID A;  2PI4 A;  1US6 A;  4DUY B;  2FTK A;  4U3F H;  2EBO A;  2QEX V;  5J2U B;  4B3S B;  4QNH B;  4GZR B;  3CME V;  4LFA B;  1I7F A;  4DR2 B;  4AI8 A;  4OX9 O;  3A2F A;  3H9V A;  3CCL V;  2R70 A;  3LDD A;  4I5S A;  4UCR A;  1IX9 A;  4D7T A;  3FAV B;  4J7Z A;  1JPX A;  3ZRV A;  3W7T A;  1XNR O;  3GB7 C;  3WB1 A;  2JGD A;  3TXQ A;  4FLX A;  1Q43 A;  1XOU A;  4XDL A;  4JI5 B;  4K8Z A;  1RP3 B;  1TUE B;  3RYH B;  4X1I B;  2YIC A;  4MVR A;  2R9I A;  4GX0 A;  2UXC B;  1FYJ A;  2LFR A;  2GTS A;  4KHP O;  1JQ0 A;  5IJ0 B;  5JJN B;  2NR5 A;  5CN0 A;  4OPA A;  2QKS A;  2Q73 A;  1K9M W;  5CB4 A;  1XQ8 A;  1BE3 H;  2GUZ B;  2LQT A;  2CDY A;  3RVY A;  4X1Y B;  3CWB H;  3SPG A;  1N4C A;  2PTM A;  4DR7 B;  1ZAU A;  3J80 N;  4FK5 C;  4PEL A;  3H1H H;  2QWP B;  1VQ8 V;  2WLI A;  3SPH A;  1EFR G;  3JSL A;  2IH3 C;  4X66 B;  1H2L A;  3DGE A;  4EKW A;  3OMI B;  2ARH A;  1VF5 B;  1WA8 B;  1S5H C;  3RYC A;  3SJQ C;  2HP8 A;  1HDJ A;  1ROP A;  4IL6 Z;  4DRX A;  2P06 A;  4P30 A;  4PA6 A;  4PDV A;  1GH6 A;  3JAT B;  4FLW A;  1NQT A;  5IYZ B;  1WB7 A;  3ABK B;  1SER A;  3JAR A;  1AJP A;  4WFH A;  1K33 A;  2BE3 A;  4JI8 O;  1OZ0 A;  3SYC A;  5EBM C;  4DO2 A;  2M6Y A;  4X65 O;  1GO3 F;  4RWU A;  3UO2 A;  2F1M A;  3QVN A;  5BMV B;  2ZDI A;  4FPP A;  1BGY H;  1QHT A;  4LF9 B;  2RN9 A;  4ZHQ B;  1BZK A;  2FL4 A;  2F93 B;  3K5N A;  2UXD O;  1AR1 B;  3AG2 C;  4CS3 A;  4NXN B;  1QU7 A;  4KP4 A;  1GM7 A;  1N0N A;  5KUK A;  4JZG A;  1WAZ A;  4JI7 B;  1I0H A;  3MAQ A;  1NT2 B;  5IE9 A;  4X89 A;  4JI1 O;  5L3C A;  2WWW A;  1FFT B;  3ETG A;  4U3J A;  4UB6 Z;  2N74 A;  1ZUQ A;  1MNG A;  2QM7 A;  2PUS A;  1GN6 A;  1YSC A;  1QLE C;  1LUV A;  2XAF A;  3ETE A;  4MVQ A;  1MG1 A;  4DV7 O;  3WU2 Z;  1R3J C;  1SRY A;  2PGG A;  3ABK C;  3E83 A;  3AG7 A;  1QVF U;  3AG4 B;  2Q4P A;  2MK3 A;  3ZIA G;  4YHH B;  1IBK O;  2AZ2 A;  3CSX A;  2BOB C;  3AG3 C;  5JCO A;  3CB2 A;  1WLE A;  1N8R W;  1VF6 A;  3RYF A;  1IBM O;  4KXR A;  3BCC H;  1S77 D;  4W4K A;  3ICX A;  4QJF B;  4ZKI A;  5EZY B;  4LF8 O;  3JSN A;  4I4T B;  3LSS A;  1SQF A;  5BZB A;  3SPC A;  2DYR B;  3L73 H;  4UUJ C;  2YEV A;  1YJ9 V;  2Q7H A;  4I50 A;  4YJ3 A;  2CH7 A;  2A9H A;  5B1A C;  1UFI A;  1EZJ A;  3OUS A;  5LOV B;  5IJ9 B;  2WLM A;  1EN6 A;  1W0K G;  3D36 A;  4NTY A;  3HB3 B;  3ZRX A;  1NBM G;  1F51 A;  1KU9 A;  4CC5 A;  5CBG A;  3E35 A;  2WPD G;  1N34 B;  2LP7 A;  1NR7 A;  4ZOL B;  2ZQM A;  2Q9L A;  1VMG A;  2XAG A;  5BY1 A;  4MVO A;  1N32 O;  1GM9 A;  2YUA A;  3GVM A;  2FML A;  4J7K A;  3T1H B;  4BIO A;  1MAB G;  3HKB B;  2Y69 C;  3OE7 G;  1YIJ V;  2Q5Z A;  1RPO A;  3ZMZ A;  2F66 C;  1O9H A;  4BWA A;  1L0N H;  1ENV A;  2ZKO A;  4WFA V;  3P30 A;  1YVW A;  3ZCC A;  4OXS A;  1LUW A;  4CH6 A;  1QR9 A;  3S3W A;  4B3R O;  4JI6 B;  3AK1 A;  1IBL B;  3OGC C;  4NR1 A;  4Z1V A;  1K3E A;  4EB6 A;  1Q82 W;  1L8D A;  1SQQ H;  3LSU A;  2ZDI C;  5L3D A;  4KL1 A;  1HR0 B;  3E2E A;  1VP7 A;  1AVM A;  3L70 H;  5H5N A;  5KHH A;  5D5Q A;  1FPO A;  2A79 B;  4UFZ A;  2WLL A;  3D8C A;  1Y74 A;  3ZBH A;  1VQK V;  2LJ2 A;  3K5O A;  4O4I B;  2ZNJ A;  2BTO A;  5KAI Z;  4WFB V;  2UU9 O;  3ZMT A;  2XHB A;  2P90 A;  4TUY B;  3BAB A;  2ETN A;  1BHB A;  3AK3 A;  5LMU B;  2YDE A;  1GAX A;  2X6C A;  2PY5 A;  1WNS A;  1NH2 B;  1MOF A;  4PA7 A;  1TVK B;  4PI0 A;  4WBN B;  4O4H B;  1KD1 W;  1JA8 A;  3K06 A;  5IWA B;  1XMO O;  2IBZ H;  3ZRS A;  1FJG B;  2GDS A;  4WFG A;  1HNW B;  1P84 F;  3KZI Z;  2ZR3 A;  1R3K C;  4Z1M G;  4XDJ A;  2GHY A;  4K0K O;  3JAK A;  3D3Q A;  1H38 A;  3DTU B;  4DV1 B;  3N2K A;  2DQ3 A;  3OTO B;  4QPJ A;  1HW7 A;  1Y4M A;  1IXB A;  2ZNI A;  1Q86 W;  2ZT9 B;  4ZIB A;  4DK1 A;  1CP9 A;  3JAM N;  3U0Z A;  1KEC A;  1K4D C;  3RYI A;  5B1B B;  2OTJ V;  1D5N A;  3QF7 A;  1FXH A;  5ITZ B;  3GWK C;  2R9R B;  2GV9 A;  5B66 Z;  3CC2 V;  3DSQ A;  3X2Q C;  2BOC C;  1K5Q A;  1XMQ B;  1GRJ A;  3C90 A;  1YTF B;  1BMF G;  1MSD A;  1KP2 A;  1XNQ O;  4O2B B;  1ZWI C;  1D5A A;  3H1L H;  3JAL B;  2UUB O;  3OGI B;  2R72 A;  3DXR A;  1W59 A;  5IT9 N;  4R7C A;  4TSF G;  4LWS B;  5BR8 O;  5DN6 G;  4DV2 O;  2QKA A;  1DF5 A;  3Q4H A;  4B3M B;  1OV9 A;  2ZD9 A;  5L3F A;  3U10 A;  4MTG A;  3JD1 A;  2OCC B;  3CD6 V;  3T4Z A;  1EBO A;  2EIM C;  4DV4 O;  4JI3 B;  4PD4 F;  4LCU C;  1ZTE A;  5H2F Z;  4NXM B;  1JOY A;  4HNA B;  1K97 A;  4UCO A;  2IM9 A;  2YIB A;  1ZLZ A;  2WA3 A;  4YJ2 A;  1G8M A;  4TQD A;  1U97 A;  4PDM A;  3ZRW B;  1SA0 A;  1AR5 A;  3F5W C;  4NB5 A;  4WFE A;  4XBF A;  4U7O A;  1ZL8 B;  1NU1 H;  2UXX A;  4JYC A;  2X7R B;  3ZHR A;  4QGP A;  4RUE A;  4MTO A;  4LFC B;  1NVP D;  3FB8 C;  2UXB B;  4ZI7 A;  2XAS A;  2QTO A;  1NVP B;  4FLV A;  4O2A A;  3JD4 A;  2AXT Z;  4UXN A;  4X62 O;  4UV8 A;  3P32 A;  4X64 B;  4PA3 A;  3L72 H;  2OIG A;  1W2B U;  4MVZ A;  3IC7 A;  3JD2 A;  2XAH A;  1OCZ B;  1V54 C;  2W0X A;  1YJN V;  4X9Q A;  4AQY B;  3TGU H;  1DGS A;  5EYP B;  2KSD A;  1JFF B;  3K57 A;  2Q69 A;  4O4J A;  1PM9 A;  4FM2 A;  3ABL B;  5JH7 B;  1VQ7 V;  2VQE B;  1Q81 W;  2BTQ A;  3SPJ A;  4X88 A;  4BW9 A;  3MHH C;  3UQ8 A;  3I55 V;  3CCE V;  5KX5 A;  4GKK O;  4QE9 A;  2KB1 A;  1K7D A;  1CPY A;  1M4U A;  1V55 C;  2B9Z A;  3OMA B;  5EIB D;  4H44 B;  5L3E A;  1Z5V A;  4C7U A;  4UCV A;  3B8N A;  3BHP A;  4I55 B;  5B3S C;  3IFX A;  4FLZ A;  4DW0 A;  4DR6 O;  3K9A A;  4JTC B;  1YHQ V;  3VQX A;  2F4V B;  2IJJ A;  2QM4 A;  3RFR A;  3B40 A;  4Q6G A;  3ZHT A;  1HNX O;  5CA0 B;  1OHH G;  2XT9 A;  2V1D A;  4DR1 B;  1GTO A;  4XDK A;  2IJK A;  3HKD A;  2R9A A;  2UXN A;  5GW7 A;  1R6T A;  2YI9 A;  4FZ1 A;  2D3O W;  4DV6 O;  1NKD A;  2L35 A;  2GUZ A;  3G6E V;  1MSW D;  1PNL A;  4X1Y A;  4LC1 A;  4I9Q A;  5KHK A;  2RNB A;  5JJE B;  4DUY O;  4N23 A;  4CH3 A;  1YEW A;  2HJF C;  5CA1 B;  5LMN B;  1Y76 A;  4B3S O;  2Q8V A;  2E5L B;  5H6Q A;  4LFA O;  4TV9 A;  4DR2 O;  5JQG B;  3ZJZ A;  3K04 A;  4X8A A;  2OYQ A;  2OIE A;  5JVD B;  5FPR A;  4DXW A;  1WA8 A;  3T2M A;  1OCC C;  1TA8 A;  3E22 B;  1VQ5 V;  2QWQ B;  4UVC A;  1K92 A;  4JI5 O;  5J2T A;  2OWO A;  2DJV A;  4G28 B;  2Y4U A;  1TUB A;  5EBW C;  2UXC O;  1PKX A;  3K79 A;  1YI2 V;  4JV5 B;  4G27 B;  4PDL A;  3ABM C;  1K34 A;  1FXK A;  1FXV A;  5LXT B;  3FFQ A;  1M56 C;  4K35 A;  3OUF A;  2JEU A;  2Q7E A;  2WAM A;  4GCZ A;  4ZHQ A;  5C8Y B;  1JJO A;  1Y66 A;  1EN5 A;  3DC5 A;  1MZE A;  4PI2 A;  1ZX3 A;  3P3N A;  3DC6 A;  4X66 O;  3FX7 A;  1ARO P;  2Q0O C;  3AG2 B;  4CZZ A;  5H6R A;  5KMG A;  3N2G A;  2K9P A;  3K03 A;  1B04 A;  5LYJ B;  4JI4 B;  3AEI A;  3QO7 A;  3U11 A;  3ZHS A;  4DR5 B;  3IC9 A;  1G4Y B;  1COW G;  4FZ0 A;  4F6R B;  3G67 A;  1N0J A;  4CS4 A;  3BEH A;  2YXY A;  3OW2 U;  1ORQ C;  2Y48 A;  1UPG A;  4CS2 A;  1Q3E A;  4DW1 A;  2HEP A;  2EZP A;  2CTR A;  1QLE B;  2EIN C;  3AG1 C;  1UJW B;  4GYC B;  1GK9 A;  3SJA C;  1VF7 A;  2YC0 A;  1FKA O;  3APO A;  4DV0 B;  1OJH A;  4LF9 O;  1WB8 A;  1BQZ A;  5LP6 A;  5FPO A;  2V4D A;  2AHY A;  2QR4 A;  3WB0 A;  3KCY A;  4FLU A;  4MTX A;  3AG3 B;  1EM1 A;  3UKM A;  5IDJ A;  3G71 V;  2Y0I A;  4JGS A;  4NXN O;  2LGW A;  2CTW A;  3B8M A;  5BXZ A;  2WA4 A;  4FFB B;  2JGD B;  4YY3 B;  2E76 B;  2CAZ C;  3EFF K;  1FFX B;  2GSM B;  4JI7 O;  4HYO A;  3ABU A;  5IJ9 A;  4NKG B;  2X6A A;  3J81 N;  4K8X A;  4EFB A;  2P5O A;  4EEQ A;  2H94 A;  3CS5 A;  5B1A B;  1YJW V;  5IY5 C;  5HFM A;  1AI5 A;  1NJI W;  2QWO B;  5CB4 B;  3ASN C;  5LHH A;  2HLD G;  1IZ3 A;  2EUL A;  3A0B Z;  5JJJ B;  3O65 A;  4YHH O;  4LF7 B;  4DV5 B;  2XUM A;  4L8J A;  4LNU A;  2OCH A;  2WLI B;  3IAY A;  2Y69 B;  3TCU A;  1MZF A;  1KBH A;  3ABT A;  5E79 Z;  4HBN A;  4J42 A;  3FB6 C;  4JI2 B;  4ABM A;  2PI5 A;  2A3Q A;  1YCI A;  4GUN A;  3VQY A;  4DRX B;  3L74 H;  3BPZ A;  1VQ6 V;  4E4E A;  1IDS A;  3UT5 A;  3R65 A;  1FS0 G;  5KAF Z;  4RUF A;  1Q90 D;  1FXK C;  3LSQ A;  4DR3 B;  4MTF A;  3CRC A;  3L71 H;  4JAU A;  1N34 O;  2P22 C;  2HG5 C;  1GN4 A;  1SKV A;  3WG7 C;  4DR4 B;  3UM7 A;  1I08 A;  1AJQ A;  4O4I A;  2N05 A;  3T1H O;  2DYS C;  1O9G A;  3G6B A;  4TUY A;  1T5E A;  2EIK C;  2UUC B;  3JAS A;  5DM6 V;  5JWP A;  1JR9 A;  1KB9 F;  1R3I C;  1R6N A;  1L1F A;  1DLB A;  1U96 A;  1NTK H;  3P3P A;  2JGU A;  3G80 A;  1CXZ B;  2VS0 A;  3HPL C;  4O4H A;  2B1I A;  4IIJ A;  4IT5 A;  1OCO C;  2CTP A;  1JX9 A;  4U3J B;  4JI6 O;  4F4L A;  1IBL O;  1R6K A;  4ASU G;  5CMU A;  1H8H G;  2YXL A;  5EC1 C;  2D2C B;  2IU3 A;  2W6J G;  2B1G A;  5KHI A;  2F43 G;  3OEE G;  4YIO A;  2KG7 A;  4LFB B;  4X1K A;  1HR0 O;  2ZIN A;  5LP6 C;  1B06 A;  4BR6 A;  2EIJ C;  4JYA B;  3B2E E;  2O57 A;  3RYF B;  2FYU H;  3BVO A;  4DUZ B;  1VQL V;  3TET A;  3PN1 A;  3RBZ A;  1NTM H;  5A2Q N;  4FVM A;  4NTW A;  5J9P C;  4MW8 A;  2LO1 A;  3ZHV A;  5LMU O;  3ZS8 C;  2JS3 A;  2HJD A;  1RSO B;  4CH5 A;  1S3J A;  1AP6 A;  2XOK G;  2DWD C;  3TJT A;  3CE2 A;  3X2Q B;  4YJ3 B;  2CH7 B;  5IWA O;  1N36 O;  2FKX A;  3JAL A;  1FJG O;  3SYP A;  1JMK C;  1BSM A;  1JVM A;  4B3T B;  1HNW O;  2Q0A A;  4OPH A;  3OTF A;  2UUA B;  4Z2W A;  5L3G A;  3BRC A;  1AR4 A;  3A0R A;  3JD3 A;  1SZX A;  3JAW A;  2W6I G;  3O9O A;  2ZIO A;  3CC7 V;  3NXS A;  1NS1 A;  4DV1 O;  1OCR C;  1S76 D;  3T1Y B;  1F4N A;  1SQB H;  3OTO O;  1URF A;  3CJH B;  1S0V A;  1XBL A;  1M5I A;  4WFF A;  3VQW A;  5CA3 A;  5IYC O;  2EIM B;  5JCO C;  1VF6 C;  4KFM A;  2BCC H;  2ZM6 B;  1Y67 A;  5LA6 A;  1XUQ A;  2WLN A;  2E3C A;  2L6L A;  3CEI A;  1H2M A;  1Y6X A;  2EIL C;  3E8B A;  2CTQ A;  3CCQ V;  3ASO C;  1XMQ O;  4QE7 A;  1GM8 A;  4GT1 A;  2WLH A;  2Q6A A;  3SYA A;  1VQO V;  1THZ A;  3CMA V;  3CRR A;  3F7V C;  3E89 A;  2YI8 A;  5K1P A;  4X20 A;  5KHG A;  4YIP A;  4EB6 B;  4R8C A;  2JJ2 G;  3K3W A;  3D36 C;  1N33 B;  1AP5 A;  3UO3 A;  5GON B;  3CRQ A;  1AJN A;  4KUM A;  4B3M O;  4MS2 A;  1SES A;  2HHH B;  4J41 A;  1P7B A;  5H9C A;  3BY6 A;  3ML0 A;  3HKE A;  4B7E A;  2DOS A;  2WLL B;  3LDC A;  3SGI A;  3CX5 F;  3SJB C;  4L87 A;  3BA8 A;  5D5P A;  1XRE A;  3RT3 C;  2IW5 A;  1Q7Y W;  3C3T A;  4DK0 A;  4NXM O;  1JFF A;  1PPJ H;  2XAQ A;  1VQP V;  1V54 B;  5GTI Z;  1JJ2 U;  3TXS A;  1QNM A;  2RCV A;  5JH7 A;  1BQ0 A;  2VQF O;  4JI0 B;  1P49 A;  3L9D A;  3JCU Z;  4FM1 A;  1F4M A;  1HNZ O;  2C2A A;  1HP8 A;  2P4K A;  3W7S A;  1DTO A;  4JYB A;  3K59 A;  1J5E B;  3JAK B;  2XTA A;  4JTD B;  4LFC O;  5DED A;  4FMT A;  3SR2 C;  2UXB O;  1XDC A;  1V55 B;  2WLK A;  3E86 A;  3CCV V;  3N2K B;  2CK3 G;  2DWE C;  2QKC A;  4X64 O;  2JVD A;  2RQ6 A;  5B3S B;  3FB5 C;  3KG2 A;  2ZR2 A;  4AQY O;  3OM3 B;  2JJ1 G;  2X6B A;  3THO A;  3M8A A;  5GTH Z;  1KYO F;  4IHJ B;  4LF5 B;  2VQE O;  1P7G A;  2YXH A;  4I0X B;  2ILM A;  2N04 A;  3SJC C;  5EK0 A;  5K1X A;  2CGN A;  2ITC C;  4PHZ A;  3IJ4 A;  2JIZ G;  3DXR B;  3HKC B;  1RM1 C;  4GKJ B;  2OTL V;  2X0L A;  3Q4H B;  1PP9 H;  4O4L A;  4FJC C;  2XAJ A;  1SZT A;  4K3A A;  5JQG A;  1XIL A;  4LF4 B;  1R3L C;  4TV8 B;  4RAI A;  3OAA G;  5JVD A;  1XHZ A;  4JPR A;  5J2U A;  2DE0 X;  1I94 B;  2YIB D;  5KHJ A;  2F4V O;  3K58 A;  3I56 V;  3QO8 A;  4PDR A;  3E22 A;  2FB5 A;  1OCC B;  2DN9 A;  4YJ2 B;  3FAV A;  5LL6 Y;  3CXC U;  5FL7 G;  3UCS C;  2YIA A;  1VQ4 V;  4DR1 O;  1SA0 B;  3B09 A;  3RN4 A;  1K4C C;  2Q67 A;  2QE7 G;  1NI8 A;  4LF6 B;  3RYH A;  2YSU B;  4LBE C;  4X1I A;  1QBZ A;  2JDI G;  1QQC A;  3EXA A;  2GTA A;  3TK1 A;  4GX1 A;  3ABM B;  1M9N A;  3A0H Z;  5IJ0 A;  3SDL A;  4WF9 V;  4O2A B;  4PA9 A;  5LMN O;  1M56 B;  2E5L O;  4I9W A;  1GMG A;  1XL6 A;  1K8A W;  1Q6U A;  2Q7G A;  1WPX A;  3PJS K;  3APQ A;  4G2K A;  4HZ3 A;  4O4J B;  4FIP C;  3LDE A;  4DYL A;  5LYJ A;  3H1J H;  5B5E Z;  4F6R A;  3H1I H;  1B6Q A;  4H33 A;  4A5U B;  4RO2 A;  1G1X B;  2NLJ C;  3VOU A;  4JV5 O;  3ETD A;  3FKS G;  3JAT A;  4H37 A;  5IYZ A;  4DV3 B;  4U7N A;  2EJ7 A;  5LGT A;  1VQ9 V;  3OD4 A;  2EIN B;  3AG1 B;  3LNN A;  2PYJ A;  3F7Y C;  4IYI A;  1NTZ H;  4MVS A;  1GN3 A;  1X4T A;  2ZE6 A;  4JAV A;  2W0F C;  5BMV A;  3H1K H;  4OX9 B;  4LP8 A;  4GX2 A;  4FFB A;  1FFX A;  1VQN V;  4DR7 O;  2BSK B;  4JAA A;  4UV9 A;  1XNR B;  4JI4 O;  2EX3 A;  4DR5 O;  3OR6 C;  3CCU V;  3KKY A;  2F23 A;  1M57 C;  4GLX A;  2VRZ A;  1K73 W;  3HKD B;  3ZHQ A;  2WLJ A;  4HAM A;  5FNV B;  2F95 B;  4KHP B;  4W4L A;  2ZXW C;  1L0L H;  4JTA B;  5CBF A;  5IY5 B;  4PA4 A;  2NN4 A;  3RGB A;  2GBO A;  1S5J A;  1Q5O A;  1Y76 B;  1QR8 A;  3ASN B;  4DV0 O;  2B5U A;  5CBH A;  1YXB A;  4H13 B;  1H2S B;  4TV9 B;  5LHI A;  3CCS V;  2DW4 A;  4GX5 A;  1XL4 A;  3ZED A;  4J9Z B;  1XHX A;  3HR0 A;  3EHB B;  4JZ2 A;  3JCZ A;  1BS3 A;  2RMK B;  2V7Q G;  3RW0 A;  1E1Q G;  1CEZ A;  1Q8I A;  2IJH A;  4YY3 O;  1XEQ A;  1PD3 A;  3EVK A;  5EZY A;  2JRI A;  5J2T B;  2IH1 C;  4I4T A;  1TUB B;  3M7M X;  1QLN A;  5KA6 A;  4TT3 G;  1KKD A;  1GN2 A;  5LOV A;  1FXK B;  1B3Q A;  3W7U A;  3QG5 A;  3STL C;  1P4R A;  3ZMV A;  2HVJ C;  4JI8 B;  3WB2 A;  1IVS A;  4X65 B;  4UCS A;  4ZOL A;  3OMN B;  2LW1 A;  3WG7 B;  2P7T C;  3MDS A;  4NYK A;  4LF7 O;  1TAE A;  2JS5 A;  4DV5 O;  3LUT B;  2DYS B;  1AI7 A;  1PL4 A;  3E8G A;  3HKB A;  3T4D A;  3FD9 A;  2P4V A;  2EIK B;  2UXD B;  1KMI Z;  1E79 G;  4YXW G;  4AIL C;  1XI1 A;  2CE4 A;  4WCE V;  2LGQ A;  3RWR D;  4JI2 O;  1AI4 A;  5KMG B;  3M99 B;  1MA1 A;  5EC2 C;  3N2G B;  2CGO A;  4BIU A;  4ICG A;  2PF4 E;  3RYC B;  1OCO B;  4JI1 B;  3CRM A;  3N27 A;  4DR3 O;  1AI6 A;  3NR7 A;  1MMM A;  1F7Y A;  4H0L B;  2AZ0 A;  1KQS U;  4DR4 O;  1Z5W A;  3QTC A;  5KA5 A;  4DV7 B;  3JAR B;  3F5T A;  1S5L Z;  4PV1 B;  1YZB A;  2QSA A;  3BFR A;  5LP6 B;  2EIJ B;  3E8F A;  3CCM V;  2UUC O;  1IBK B;  1PV0 A;  1PL0 A;  1WP8 A; 
#chains in the Genus database with same CATH homology
 3ASO C;  2QM8 A;  3CCE V;  3I55 V;  4QE7 A;  1GM8 A;  4GT1 A;  2WLH A;  4QE9 A;  1IXM A;  3RVY A;  2Q6A A;  3SYA A;  1VQO V;  2KB1 A;  1THZ A;  3CMA V;  1K7D A;  1CPY A;  1KP3 A;  3FYI B;  1V55 C;  3OMA B;  3SPG A;  1DF4 A;  3F7V C;  3QO5 A;  3E89 A;  3CCJ V;  3VBB A;  5L3E A;  3B8N A;  4CBC A;  4R8C A;  4FK5 C;  4PEL A;  2JJ2 G;  5LHG A;  3K3W A;  1VQ8 V;  2WLI A;  3SPH A;  5B3S C;  1EFR G;  3IFX A;  2IH3 C;  4UVB A;  5B1N A;  3DGE A;  4EKW A;  1AJN A;  3OMI B;  4KUM A;  4MS2 A;  1SES A;  1S5H C;  4JAS A;  1P7B A;  5H9C A;  3BY6 A;  3ML0 A;  3SJQ C;  3K9A A;  4JTC B;  3ZN0 A;  1YHQ V;  1ROP A;  2WLL B;  1RPR A;  3LDC A;  2IJI A;  2IJJ A;  4L87 A;  4P30 A;  4PA6 A;  4PDV A;  2Z5U A;  2IW5 A;  1Q7Y W;  2JK5 C;  1NQT A;  3AG4 C;  3T1C A;  2XAQ A;  1OCR B;  1OHH G;  1VQP V;  1V54 B;  1JCH A;  3ABK B;  1JJ2 U;  4QIW F;  2V1D A;  4RQF A;  1SER A;  2K1E A;  1AJP A;  1GTO A;  1K33 A;  4WFH A;  2IJK A;  4XDK A;  4R50 A;  1OZ0 A;  3SYC A;  5EBM C;  4DO2 A;  5B1O A;  1GO3 F;  2UXN A;  3WFV A;  5GW7 A;  3RVZ A;  1F4M A;  2D3O W;  2ZDI A;  4FPP A;  2C2A A;  1BL8 A;  1NKD A;  3G6E V;  3G4S V;  1MSW D;  1PNL A;  2DQ0 A;  4LC1 A;  3W7S A;  5C93 A;  1DTO A;  2DYR C;  4JYB A;  4N23 A;  2HJF C;  2EIL B;  4N21 A;  3ASO B;  5H6Q A;  1AR1 B;  3MHH C;  4Q20 A;  4JTD B;  3AG2 C;  4FMT A;  4KP4 A;  4MVM A;  1GM7 A;  1V55 B;  2WLK A;  3E86 A;  3K04 A;  2YEV B;  3ZJZ A;  5KUK A;  3CCV V;  4X8A A;  2QA4 V;  2CK3 G;  2DWE C;  4DXW A;  3T2M A;  1OCC C;  3FYE B;  4X89 A;  3SYO A;  2WWW A;  5L3C A;  5B3S B;  1FFT B;  3ETG A;  3FB5 C;  3KG2 A;  2ZR2 A;  1VQM V;  3OM3 B;  2JJ1 G;  2X6B A;  1VQ5 V;  5EBL C;  2QM7 A;  4UVC A;  1K92 A;  1YSC A;  1QLE C;  2XAF A;  3ETE A;  3K0D A;  3ZN1 A;  4G28 B;  3B77 A;  4MVQ A;  2M7W A;  1MG1 A;  1R3J C;  1SRY A;  3ABK C;  5EBW C;  1PKX A;  3K79 A;  1YI2 V;  4BAY A;  1NH2 D;  3E83 A;  1I5Y A;  2AHZ A;  4G27 B;  1QVF U;  3AG4 B;  4PDL A;  3ABM C;  4MSW C;  5EK0 A;  2ATK C;  1K34 A;  1FXK A;  2MK3 A;  1FXV A;  3ZIA G;  2P67 A;  2ITC C;  4BIZ A;  2JIZ G;  1M56 C;  2BOB C;  3AG3 C;  1WLE A;  1N8R W;  2LFS A;  3OUF A;  4UVA A;  2JEU A;  1RM1 C;  4QPK A;  2WAM A;  3MHS C;  4GCZ A;  2OTL V;  1S77 D;  1BHA A;  2X0L A;  3STZ C;  4QJF B;  1KC8 W;  1Y66 A;  4ZKI A;  4FJC C;  2XAJ A;  3ZRW A;  1H8E G;  3LSS A;  1SZT A;  4MW3 A;  3W7X A;  5BZB A;  3SPC A;  2DYR B;  1E1R G;  4UUJ C;  2YEV A;  1R3L C;  1YJ9 V;  4RAI A;  1ARO P;  3OAA G;  2A9H A;  4JPR A;  5B1A C;  1YIT V;  3AG2 B;  3ZMU A;  1EZJ A;  4CZZ A;  5H6R A;  3OUS A;  3JD0 A;  4BW5 A;  2WLM A;  1W0K G;  3D36 A;  3ZRX A;  3HB3 B;  3K03 A;  1NBM G;  3I56 V;  3AEI A;  3QO7 A;  3QO8 A;  4PDR A;  1M90 W;  1F51 A;  5CBG A;  1G4Y B;  1OCC B;  1COW G;  3E35 A;  2WPD G;  4P2Z A;  2LP7 A;  1NR7 A;  2ZQM A;  5FL7 G;  3CXC U;  4JF3 A;  3BEH A;  1VQ4 V;  2XAG A;  3OW2 U;  4MVO A;  1GM9 A;  1ORQ C;  2Y48 A;  1YTF D;  4J9Y B;  2EZP A;  2EIN C;  1QLE B;  3AG1 C;  1K4C C;  2Q67 A;  1UJW B;  1GK9 A;  1MAB G;  2QE7 G;  3W7W A;  2Y69 C;  2YSU B;  4LBE C;  3OE7 G;  1YIJ V;  1QBZ A;  4E2L A;  2HVK C;  1RPO A;  2JDI G;  3ZMZ A;  3TK1 A;  4GX1 A;  2EJR A;  2Z3Y A;  3ABM B;  1M9N A;  1ENV A;  2OT5 A;  2AHY A;  1W0J G;  4WF9 V;  2IU0 A;  4WFA V;  4PA9 A;  3P30 A;  4MTX A;  1M56 B;  3AG3 B;  3UKM A;  5IDJ A;  3G71 V;  4I9W A;  4JGS A;  1GMG A;  1RM1 B;  3ZCC A;  1XL6 A;  4OXS A;  1K8A W;  3B8M A;  3CP1 A;  1WPX A;  1NR1 A;  1QR9 A;  3PJS K;  3EFF K;  2GSM B;  3OGC C;  4HYO A;  4RQE A;  4G2K A;  3ABU A;  1K3E A;  4HZ3 A;  1QVG U;  1Q82 W;  3OEH G;  2X6A A;  1M1K W;  4FIP C;  3LDE A;  3JYC A;  1K5S A;  3D3I A;  2ZDI C;  2HKO A;  5L3D A;  2H94 A;  5B1A B;  1B6Q A;  5B1B C;  3E2E A;  1YJW V;  4ZBM A;  4H33 A;  5IY5 C;  4RO2 A;  3MD0 A;  5HFM A;  5LGU A;  1AI5 A;  1NJI W;  5E1A C;  3E8H A;  2A79 B;  2NLJ C;  2WLL A;  1SET A;  1VQK V;  3SYQ A;  3ASN C;  5LHH A;  2HLD G;  3VOU A;  3ETD A;  2WSS G;  4WFB V;  3ZMT A;  3FKS G;  3GWO A;  3H01 A;  1GKF A;  2P90 A;  4H37 A;  4U7N A;  5L3B A;  4R6Z A;  5IYB O;  5LGT A;  1VQ9 V;  1BHB A;  4P9P A;  1H2G A;  2X6C A;  2EIN B;  3AG1 B;  1NH2 B;  1MOF A;  2WLI B;  2Y69 B;  3TCU A;  4PA7 A;  3F7Y C;  1J95 A;  4MVS A;  1KD1 W;  3K06 A;  3ABT A;  4JAV A;  3ZRS A;  5LGN A;  2W0F C;  4WFG A;  3FB6 C;  2PI5 A;  2ZR3 A;  2OCC C;  4LP8 A;  1PNK A;  2NNU A;  4GX2 A;  1R3K C;  1VQ6 V;  4Z1M G;  4XDJ A;  2GHY A;  1VQN V;  2EZO A;  1H38 A;  1R73 A;  1I5X A;  5HFL A;  3R65 A;  1FS0 G;  4UV9 A;  4RUF A;  3ZMS A;  1FXK C;  3DTU B;  3CCR V;  3OR7 C;  3LSQ A;  2ITD C;  3OR6 C;  4MT8 A;  4MTF A;  2DQ3 A;  3CCU V;  3K08 A;  1M57 C;  4JAU A;  4QPJ A;  2H8P C;  1Y4M A;  1K73 W;  5IYD O;  1Q86 W;  2HG5 C;  1LNQ A;  1CP9 A;  2P6J A;  2WLJ A;  4HAM A;  4P9O A;  3WG7 C;  3UM7 A;  1AJQ A;  1KEC A;  1K4D C;  5B1B B;  2OTJ V;  2DYS C;  2ZXW C;  1FXH A;  4JTA B;  5CBF A;  5IY5 B;  2R9R B;  4PA4 A;  3CC2 V;  3X2Q C;  1QR8 A;  2EIK C;  2BOC C;  1K5Q A;  2B5U A;  3ASN B;  3IGA C;  5CBH A;  5DM6 V;  1R3I C;  2JEX A;  1YTF B;  5LHI A;  1R6N A;  1L1F A;  1DLB A;  3CCS V;  2DW4 A;  4GX5 A;  1BMF G;  3CPW U;  1XL4 A;  1KP2 A;  1ZWI C;  4J9Z B;  4MVU A;  1HWY A;  3SPI A;  3HPL C;  3EHB B;  2B1I A;  3JCZ A;  5LBQ A;  2A0L A;  2V7Q G;  4R7C A;  1OCO C;  1E1Q G;  4TSF G;  3RW0 A;  1CEZ A;  1JX9 A;  1OCZ C;  2HR3 A;  2IJH A;  5DN6 G;  5KUM A;  1PD3 A;  4F4L A;  1R6K A;  1DF5 A;  4ASU G;  5CMU A;  2ZD9 A;  5L3F A;  1H8H G;  2IH1 C;  4MTG A;  3JD1 A;  5EC1 C;  3K0G A;  2IU3 A;  2W6J G;  2B1G A;  2OCC B;  3CD6 V;  3T4Z A;  1EBO A;  2F43 G;  3OEE G;  2EIM C;  2Q68 A;  1F23 A;  3QNE A;  3ABL C;  3CC4 V;  3OFN G;  3LNM B;  2XND G;  5KA6 A;  1QLN A;  4TT3 G;  1KKD A;  3CYO A;  4LCU C;  1FXK B;  2EIJ C;  1JOY A;  1K97 A;  3W7U A;  3STL C;  1M57 B;  1P4R A;  3ZMV A;  1S72 V;  2HFE C;  1VQL V;  2HVJ C;  3TET A;  3RBZ A;  3OMN B;  3WG7 B;  2P7T C;  4TWK A;  1PNM A;  5J9P C;  1G8M A;  4MW8 A;  4PDM A;  3FB7 C;  3ZRW B;  1QCE A;  3F5W C;  3LUT B;  2DYS B;  2ZXW B;  4WFE A;  4XBF A;  1AI7 A;  1S3J A;  2XOK G;  3E8G A;  2PI4 A;  4U7O A;  3T4D A;  2DWD C;  2FTK A;  3X2Q B;  2EIK B;  2UXX A;  2EBO A;  4JYC A;  2X7R B;  2QEX V;  4RUE A;  3SYP A;  4QNH B;  1JVM A;  3CME V;  4MTO A;  1E79 G;  4YXW G;  1K9M W;  4WCE V;  1AI4 A;  1NVP D;  3M99 B;  3FB8 C;  5EC2 C;  2XAS A;  3CCL V;  2QTO A;  5L3G A;  1NVP B;  4BIU A;  3LDD A;  3A0R A;  4I5S A;  3JD3 A;  3JD4 A;  4UXN A;  4UV8 A;  3P32 A;  1OCO B;  1JPX A;  2W6I G;  4PA3 A;  3ZRV A;  3CC7 V;  3NXS A;  3W7T A;  1W2B U;  4MVZ A;  3IC7 A;  3JD2 A;  2XAH A;  1OCR C;  1OCZ B;  3GB7 C;  1S76 D;  1V54 C;  1F4N A;  1YJN V;  1AI6 A;  1S0V A;  4WFF A;  1KQS U;  4XDL A;  1TUE B;  5CA3 A;  5KA5 A;  5IYC O;  4MVR A;  2Q69 A;  2EIM B;  2R9I A;  4GX0 A;  3ABL B;  1VQ7 V;  1Q81 W;  2LFR A;  4KFM A;  1JQ0 A;  2EIJ B;  3E8F A;  3SPJ A;  3CCM V;  2WLN A;  5CN0 A;  4X88 A;  2QKS A;  2EIL C;  3E8B A;  3CCQ V;  1PL0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...