2W0FC

Potassium channel kcsa-fab complex with tetraoctylammonium
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
102
structure length
102
Chain Sequence
b'ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT LIGHT CHAIN
molecule tags Immune system/metal transport
source organism Mus musculus
publication title Structures of Kcsa in Complex with Symmetrical Quaternary Ammonium Compounds Reveal a Hydrophobic Binding Site.
pubmed doi rcsb
total genus 41
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2008-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2w0fC00
3E8GA 1J95A 3ABMC 4WFFA 4CBCA 4PDLA 3LDCA 3SPCA 3FB7C 4RO2A 5EK0A 2A0LA 4JTCB 2ATKC 4QNHB 1M56C 2K1EA 2Y69C 4RUFA 2HJFC 3OGCC 3SJQC 3STLC 3LUTB 3T1CA 3SPGA 2NLJC 4BW5A 2EINC 2Q68A 2EIMC 1G4YB 4H37A 3EFFK 4G28B 3SYCA 1ORQC 2YEVA 4HYOA 2X6BA 4X89A 2R9RB 4XDJA 2WLNA 4P30A 3STZC 1R3IC 4GX0A 4JTDB 4X8AA 1OCCC 3SPIA 3AG3C 3TETA 3HPLC 3ZRSA 4R6ZA 2HG5C 3SPHA 5B3SC 4MVSA 4DXWA 1KKDA 2P7TC 3ASNC 2DYRC 2H8PC 4XDKA 3FB8C 2WLLB 3F7VC 2IH1C 2WLLA 2ITCC 2OCCC 4LBEC 3RVYA 4PA3A 2AHYA 4J9ZB 4MW3A 5EBWC 2HVKC 1R3JC 3AG2C 4WFGA 3UKMA 4KFMA 2ITDC 3KG2A 3E8HA 3TCUA 3OUFA 4MVMA 4P9PA 4MTOA 3OR6C 3K03A 4PA9A 5EC1C 4GX2A 4MW8A 2ZXWC 3FB5C 1JVMA 1R3KC 4QE7A 4MVQA 4RAIA 4X88A 2DWDC 3LDDA 3SPJA 1LNQA 5KUKA 4WFHA 2WLHA 2QKSA 4MVUA 3ABLC 3SYQA 4PA7A 4MVOA 4XDLA 4TWKA 3FB6C 3BEHA 1V55C 3F5WC 4P2ZA 5KUMA 3JYCA 4R50A 4QE9A 2IH3C 2EILC 3OUSA 5EBLC 3E8FA 5IY5C 4G27B 2Q67A 3K0DA 3K08A 2EIKC 4I9WA 4PDVA 5E1AC 3WG7C 1OCRC 2X6AA 2WLMA 4R8CA 3F7YC 2W0FC 2ZD9A 4PDMA 3AG1C 4H33A 3RVZA 5EBMC 4EKWA 2HVJC 3R65A 3ASOC 3IFXA 3ABKC 1BL8A 2HFEC 1P7BA 3SYOA 4RUEA 2WLIA 3OR7C 2JK5C 4GX5A 4MTGA 4MS2A 5EC2C 5B1BC 1ZWIC 1M57C 1OCOC 4PA6A 2EIJC 3X2QC 3UM7A 4HZ3A 5CBFA 3T4ZA 5BZBA 2DYSC 3SYAA 3T2MA 3AG4C 5CBHA 1XL4A 4UUJC 4WFEA 2BOBC 4J9YB 2DWEC 2A79B 3E8BA 4LP8A 4ZBMA 3K04A 2Q6AA 2Q69A 4OXSA 5CBGA 2QTOA 2WLJA 3E86A 5B1AC 4LCUC 3IGAC 2KB1A 3GB7C 3LDEA 2A9HA 3RBZA 3PJSK 4MSWC 4PDRA 1R3LC 2WLIB 4R7CA 4F4LA 5J9PC 3LNMB 3ZJZA 1V54C 4MTFA 3E89A 4P9OA 1K4CC 4MVRA 3RW0A 4JTAB 4MVZA 4GX1A 2X6CA 3VOUA 1OCZC 3T4DA 1S5HC 2WLKA 3E83A 1XL6A 4PA4A 3SYPA 2AHZA 3K0GA 2BOCC 3K06A 1K4DC 1QLEC
chains in the Genus database with same CATH superfamily
1EM1A 1K3EA 4X1IB 2AZ0A 4GT1A 1FXKA 3B40A 5EK0A 4JTCB 4AILC 4IHJA 3BCCH 3SJQC 4DV4O 3CSXA 4DR7O 1RSOB 5BMVA 3CJHB 1IXMA 1FJGB 2X6BA 1SQPH 1HR0O 5BY1A 5J2TA 1P4RA 5B1AB 4K8ZA 1L1FA 4KFMA 4DRXA 1B04A 5JWPA 1Y6XA 2XAHA 1JQ0A 2DWDC 1RSOA 4WFHA 1QU7A 5DECA 3ABLC 1P49A 4CH5A 1X4TA 1QCEA 4B7EA 2Q67A 4DYLA 4U3JA 3SYOA 3K79A 3T1YO 1IBKO 1HR0B 3EXAA 2XAFA 1PPJH 1XI1A 3RYHA 1ZX3A 4HZ3A 3D36A 5IE9A 4YJ2A 1HNZB 5DM6V 5IYZA 2QSAA 3ZX6A 1YZBA 4Z1MG 2IU3A 4GKJO 2R9AA 5J2UA 2AGAA 1NJIW 1OV9A 4TQDA 4DR4O 2FMLA 3RBZA 1RPOA 4X62B 4I4TA 3HKEA 4P9OA 5FPOA 4X9QA 4NYKA 3SR2C 2NNUA 2WLKA 3E83A 1LUVA 1Y74A 2DMXA 4DV0B 4GKJB 5CA1A 4FLWA 2UU9B 4GCZA 1H2LA 1KBHA 5LBQA 4TV9A 3WFVA 5LHGA 1F51A 1SQVH 1OCCC 1XHXA 3ZHTA 1TUEB 2LGQA 2Q7HA 2P6JA 4MVSA 1KKDA 2GUZA 2F4VB 2OCCC 4OPAA 4EB6A 5IJ9A 2BSKA 3OMAB 5GONB 3WB1A 4L8JA 2RDCA 5EZYB 4RAIA 3OEHG 4MVQA 5JCOA 1YDXA 4JI4B 2MK3A 3K9AA 3BEHA 3TK1A 2W6JG 3JARA 4HNAA 3OUSA 3E8FA 5E1AC 5LA6B 1YSCA 2E5LO 3R65A 1BSMA 3JATA 1GRJA 4MS2A 5EC2C 4GZRB 1M57C 1U96A 3JAWB 1Q6IA 3E2EA 4EEQA 5LYJB 1QVGU 4TQFA 2YXLA 5D5QA 5H6RA 3IJ4A 4WFEA 1Q6UA 2BOBC 2Y4UA 1AVMA 2YI9A 2ARHA 3WB0A 5CBGA 2XAGA 3OMIB 2Q0OC 2RMKB 2JRIA 1MSWD 1D2DA 3ZRWB 4NTWA 1QQCA 2UUBO 3PN1A 5LL6Y 5AG2A 1AROP 4TV8B 2H94A 3LSSA 4FIPC 3ZMSA 4FFBB 4JI2B 3K0GA 3K06A 4TUYB 1HNXB 1QVFU 5K1PA 1J95A 4O4HB 2LFSA 4JI0O 4QNHB 5LMNO 5KHKA 5EYPB 4WBNA 3H9VA 5KX5A 5LGUA 1WAZA 2CUGA 2EINC 4FPPA 3FX7A 3VQVA 3CMEV 1SZXA 3SYCA 1S76D 4X64B 4ZOLA 4J7JA 3JALB 2LO1A 2CGNA 3CE2A 4CH4A 1HNXO 3ZRWA 1BQ0A 3RVYA 2JS5A 4LF4O 4O4IA 1IBMB 3ZMTA 4DUZO 1E79G 1XBLA 5GW7A 4NTYA 4X88A 1CP9A 1WJZA 4OX9O 5LP6C 4B3RB 3K57A 1OCOB 2EJRA 4UXNA 5LYJA 4J11A 3FAVB 4MVOA 2OTJV 3UO2A 3N27A 1AI7A 3ABUA 3CPWU 3OM3B 3DTUB 1SF9A 4Q6GA 4I50B 3JCUZ 4WFAV 4GYCB 4LNUA 4DV3B 4JI8O 4ZI7B 2RCVA 1ZSPA 1S3JA 2Q8VA 2QGNA 3OR7C 2CAZC 5JQGA 2RJZA 5E79Z 4LF9B 3B8NA 5KLVH 1AILA 4FLVA 3ZHQA 3JALA 1J5EO 3T1YB 1JJ2U 5EZYA 2WLJA 2QM8A 4O4HA 1KMIZ 3LDEA 1YITV 4DW0A 4TUYA 1E1RG 2NR5A 2XT9A 4FLZA 3RW0A 1TUBA 2BE3A 2XOKG 3SYPA 5IJ0A 4TV9B 1G1XB 2BTOA 1W0JG 4GKKO 3RYFA 3ABMC 3SPCA 2DE0X 4RO2A 3DC6A 3SGIA 3IC9A 5LMNB 4N21A 4UCRA 3EFFK 2F23A 4XDJA 4HYOA 4JI4O 3HB3B 1JFFB 2WLNA 3OTOO 3EHBB 3HPLC 4TSFG 3I5DA 4JI2O 4HBNA 5FNVA 3CXHF 1VQ9V 3CCSV 4W4LA 4AQYO 3E22A 3AG7A 1KB9F 4O2AA 4FLUA 3ABKB 5JJJB 3AG2C 2AW9A 3W7UA 1OHHG 2QWPB 3H1HH 4I0XA 2JJ2G 4JYAO 5IY5B 1YJWV 1FKAO 5IYZB 4WCEV 1NH2D 2DJVA 2VQFO 1XNQO 2R9IA 1P7GA 2X7RB 3RYHB 4DV4B 4R50A 1SQXH 2ZIOA 1ZUQA 4B3SB 3K08A 4KL1A 2JIZG 4LF5B 1JPXA 3QTCA 5LGNA 4PDMA 3ZRXA 3AG1C 5EBMC 2UXXA 4FVMA 2KQXA 3HKCA 4FM0A 2YIBD 5BR8B 3VBBA 1FS0G 1BS3A 3CCRV 1JR9A 3OTFA 1K8AW 4YJ3A 5BZBA 4CS4A 3AG4C 4K0KO 1OZ0A 1W2BU 1BQZA 2IM9A 5HFLA 1M90W 2RNBA 3JSNA 4DR5O 3H1LH 1PNKA 3E86A 3NR7A 3CMAV 2ZINA 2P4KA 4PDRA 2CTPA 1WA8B 1M5IA 4R7CA 5A9GA 2PI4A 4JI1O 5IDJA 4MTFA 4JTAB 3F5TA 5KMGB 1CEZA 4FFKA 3B09A 1AR1B 2OTLV 4RQFA 1K4DC 4J7ZA 3B77A 2CTRA 2WAMA 4LFAB 1MNGA 2WSSG 4I55B 5LHHA 1N36B 3BAAA 1LUWA 3SJBC 3WB2A 3AG3C 3AG4B 1B3QA 4R6ZA 1AI6A 1K92A 2GHYA 3LNNA 3J81N 1SESA 4IYIA 2PZSA 3DC5A 1G6UA 1GMGA 2PUSA 3ZCCA 3CCVV 4WF9V 1WB8A 1E1QG 3OUFA 1XREA 4NVPA 4B7KA 2EIKB 4QE7A 2YIDA 2ZQMA 4I55A 4KXRA 3SJAC 4U7NA 2VWJA 1SKVA 1AI4A 2UUAO 3C90A 2VQEO 2D3OW 3NXSA 1NBMG 1SQFA 3QO8A 1H2SB 1WA8A 4MTXA 1P84F 5JVDA 3H1KH 2VWKA 4NXMB 4X66B 3AK3A 1RM1C 5H2FZ 3SYAA 2E76B 2E75B 4KP4A 5KA5A 1YVWA 2YS8A 4L87A 2YC0A 3K04A 4IHJB 4QIWF 3DSQA 4X1YA 1BZKA 3GWOA 1FPOA 1QNMA 3ZMZA 2VRZA 3CRQA 4X20A 3PJSK 4YHHB 2QE7G 3I56V 5LMUO 3ZJZA 4BIUA 5CMUA 2QKAA 3QG5A 1Q82W 3S3WA 5LGTA 3BRCA 2AHZA 4ZKIA 3CCEV 1ZTEA 4WFFA 2QR4A 2QEXV 1Y76A 5B3SB 2K1EA 2P90A 3OGCC 2QM7A 4FJCC 4J7KA 5L3FA 4H37A 2YSUB 1XUQA 1ZAUA 1WPBA 3MDSA 4JTDB 1H2MA 2EINB 4QPJA 2HEPA 3W7TA 3B2EE 2P67A 1M56B 2HG5C 4O2AB 2IU0A 1FD9A 2YXHA 3ASNC 2H8PC 3O9OA 3FD9A 1FFTB 2BTQB 2FKXA 5C8YA 2DOSA 4JZGA 4AI8A 5L3BA 4YIPA 1YTFB 1XDCA 3CP1A 1R3KC 2DYSB 3N2GB 4NXNO 3OEEG 4K0KB 1BCCH 5LP6B 1Q90D 3L70H 1NKDA 1IXBA 3RYCA 4YJ3B 5C93A 2FYUH 1N4CA 4I7ZB 1T5EA 4DV5O 2P22C 1DF4A 1FFXA 4JF3A 1N36O 4D7SA 3HKCB 1ZWIC 2QWQB 1SA0A 4LF5O 2WWWA 1H8EG 1AB3A 4D6TH 3A0HZ 5CA0B 2FL4A 2O57A 3WG7B 2F1MA 1RPRA 3TXSA 5H5NA 1F23A 4BW9A 4B3RO 1Y4MA 3CCUV 4OX9B 1DLBA 4LFCB 5JH7A 3I55V 4U7OA 1M9NA 1ZL8A 5IT9N 1TVKB 1FXVA 2CGOA 3QF7A 4LFAO 2EILB 1PNLA 4D7TA 2A7WA 2V4DA 1QLEC 2Y48A 1M1KW 2ZE7A 2ZKOA 5L3GA 4A5UB 2EULA 4EFEA 1J5EB 2EIMC 3MD0A 1KQSU 1OCZB 3AK2A 1Q86W 1N34B 2CH7B 1MG1A 1GN6A 3TETA 2OIGA 5KHJA 2ZE5A 3RYIA 3H01A 1S5JA 2A3QA 3LSQA 4JI3B 3THOA 3CD6V 2KG7A 2YXYA 2Q9LA 1Y66A 1OJHA 1IURA 3TCUA 3ETEA 4MTOA 5EC1C 1WPXA 4E4EA 5JCOC 1IBKB 3LDDA 3SPJA 1XOUA 4JPRA 4NTXA 1VQMV 1VARA 4PA7A 5GTIZ 3A0RA 4EFBA 1VQ5V 5A2QN 4LFBO 4N23A 1VF6C 3D8CA 4W4KA 4O4LA 2EIKC 1JJOA 2N05A 2GBOA 2PTMA 3B4SA 1D5AA 3W7XA 4EKWA 2QTSA 1NR7A 4K35A 4DV5B 2V1DA 4DO2A 3L73H 3CRMA 2OCCB 4BWAA 3GVMA 4LNUB 4OGQB 2CH7A 5TISZ 4IT5A 4JI5O 4QPKA 3K58A 1NZ6A 2A79B 4OXSA 4YY3B 4U3FH 2IJKA 1D5NA 2KB1A 4LWSA 3ZS8C 2P5OA 1GO3F 4MSWC 2JGDB 2RN9A 3APQA 1VP7A 1K4CC 2QA4V 2F95B 5LA6A 5CB4A 3SDLA 1VQ6V 1GH6A 1XL6A 2F4VO 1TVKA 4O4JA 4HNAB 4UV8A 3CC4V 4NR1A 4FZ0A 1YJ9V 3BA8A 4RUFA 1KECA 3STLC 1K5SA 2Q68A 5IWAO 3MAQA 5KHGA 2ZDIA 3TGUH 3AG2B 1KP3A 2YUAA 3K5OA 4JI8B 4DR5B 3CC7V 4UV9A 3IAYA 4J42A 2B1IA 2WLLA 4LF8B 3M7MX 4J9ZB 4X1YB 1H8HG 2CDYA 3ZBHA 3OR6C 1VQPV 2F66C 5LP6A 1V54B 4MVUA 2ZR2A 3A0BZ 4X1KA 3CRCA 4JAVA 3N2GA 4PI2A 3UCSC 4DR3B 2UXBO 4PD4F 2YIBA 1S5LZ 2EILC 3OW2U 1BMFG 5IY5C 1N0JA 1I0HA 1YCIA 1Q7YW 1YEWA 3ZEDA 1UFIA 4R8CA 3OMNB 1BE3H 2QM4A 1KC8W 3ABKC 4I4TB 4JAAA 4JI7O 1UPGA 2WA3A 1N0NA 4UVAA 4JZ2A 2OYQA 1GAXA 3JCZA 5CBHA 1NVPD 4FLTA 2PGGA 2ILMA 3CRAA 1GTOA 1Y76B 2H3OA 1XNRO 1R6KA 4LH6A 2UXCB 2BCCH 4BR6A 1N33B 2HR3A 4DR2B 3QNEA 4E2LA 4CC5A 3TJTA 1MSDA 2X6CA 1OCZC 1X59A 4EB6B 3ZMUA 2EIMB 1SRYA 5B66Z 1XILA 5KHHA 4CBCA 2KSDA 4DV6O 4PDLA 2Q4PA 3K59A 4DV3O 2HJFC 2JJ1G 3SPGA 2ZNJA 3DXRA 2L6LA 3STZC 2R9RB 2LFRA 3CCLV 1VEWA 1NTMH 1F7YA 2P7TC 1GN3A 3F7VC 2OT5A 1BHAA 1JOYA 5LMUB 2Y4TA 1R3JC 3ASOB 2PF4E 4CC6A 2ZE6A 3QO7A 3KG2A 4PA9A 3DXRB 2OCHA 1YHQV 1NI8A 2DQ3A 3ZMVA 5JJEB 1FXKB 5CA3A 4TWKA 1UJWB 2R70A 3MHHC 4QE9A 3S3XA 1TGOA 1Z2GA 1XMOB 2Q0AA 3CB2A 1N8RW 3FYEB 3UT5B 4DV2O 3K5NA 4UCSA 4B08A 3OD4A 1R6NA 4ZIBA 4H0LB 4CS3A 1I94O 3X2QB 4DR6O 2ZIMA 4MTGA 4O2BB 2QJ1A 4U3JB 2GTSA 3L75H 4B3SO 1XMQB 1XHZA 2RQ6A 3OFNG 1GK9A 1I7FA 3UT5A 1ENVA 1SZTA 1AI5A 2DWEC 3E8BA 4ZBMA 2Q69A 4UB6Z 4Q20A 3GB7C 3UQ8A 2A9HA 4JV5O 4MVRA 5EIBC 4DRXB 1XQ8A 1I5XA 4FZ1A 4H13B 5DEDA 2ZR3A 4NB5A 3A8TA 2IJIA 2BOCC 4PV1B 3KCXA 3RN4A 1RP3B 4IL6Z 2NLJC 1G8MA 2IJHA 2AZ2A 1EBOA 4JI6B 4G28B 3HKBB 4JV5B 3CJHA 5BMVB 5IJ0B 4J80A 4CH6A 3G67A 3SPHA 4X1IA 3GWKC 2WLLB 2ITCC 4DUYB 1K33A 4J41A 3OT7A 5D5PA 3G6EV 4NXMO 2HKOA 4LF6B 1LR1A 2UUAB 1KUQA 1H2KA 1AR4A 3MHSC 5GTHZ 2GTAA 2AXTZ 3M99B 4UFZA 4FM1A 2FTKA 2QKCA 3FFQA 3P32A 2LW1A 4O4JB 4MT8A 4G27B 4I0XB 3OGIB 4H44B 3JD4A 1GM7A 3E22B 4I50A 3J80N 2JEXA 1AJQA 2WLIA 2JGDA 4PI0A 4LWSB 4B3TO 5IYBO 1DTOA 1JFFA 5B1NA 1SC5B 4JYYA 4ZHQB 2QWRB 4JYBA 2UUCO 5FL7G 2QTOA 4O4IB 2UXDB 4DUZB 3ZIAG 1NTZH 3RYFB 1S72V 1KU9A 5L3CA 2W0XA 4UCTA 3AG1B 5FLXN 3BY6A 4LF9O 1VQ4V 3D36C 1ZLZA 3G4SV 1TUBB 1L0NH 1B06A 3G71V 3ICXA 4O4LB 4KHPO 4WBNB 2ZCEA 5EYPA 5KX5B 4PHZA 4X66O 4IIJA 4DK0A 3T1CA 1WP8A 4JI5B 1VQ8V 3H1JH 4UCUA 4JI1B 4DR6B 3D3IA 2ZT9B 4LF7O 2ZDIC 2CTQA 4KHPB 4BIOA 4DXWA 4XDKA 1XMOO 3JAKB 1SERA 2NN4A 2AHYA 2CK3G 4PJ0Z 3VQYA 1WLEA 2YICA 3ETGA 1XEQA 4WFGA 4YIOA 1AR5A 3UKMA 4ZHQA 3E8HA 2G38A 1Q3EA 1PL4A 3K03A 1H2NA 3M8AA 3SYQA 3ABMB 4UB8Z 3K5MA 1O9GA 1WB7A 3FB6C 2Y0PA 1V55C 2VS0A 4GUNA 1GN2A 3JATB 1Q43A 1EN6A 4J10A 3VQWA 1FAFA 1GN4A 2YDEA 3G6BA 3CCMV 1MZEA 2ODMA 1HWYA 1P7BA 4UCVA 4RUEA 3FYIB 3R66A 2JK5C 4GX5A 2W6IG 4C7UA 2UUBB 4BIZA 4PA6A 1IVSA 1XL4A 4DV7B 1EN4A 2D2CB 4HAMA 4IIJB 2BSKB 5B1OA 2N04A 4LF6O 4XBFA 2HJDA 4DR2O 5EIBD 2A06H 1MOFA 4B3TB 2B1GA 4F6EA 4MVZA 2VQFB 4GX1A 4PELA 3IC7A 1H2GA 3HKBA 4JI7B 4DV7O 3E8GA 2DQ0A 1PV0A 1M4UA 3FB7C 5HFMA 4CZZA 4DK1A 3LUTB 2E3CA 3JASA 2Z0AA 4BW5A 2Y0IA 2E74B 2ETNA 5BR8O 1SS3A 2YEVA 4OPHA 4NXNB 3CX5F 3ZN0A 3SPIA 1HW7A 2LW7A 1XNRB 3JAWA 2DYRB 1BHBA 3FB8C 1HNWB 4PA3A 4X65O 2F43G 5LHIA 4MVMA 2ZNIA 3L9DA 1JVMA 1EZJA 2V7QG 2LGWA 4UVCA 1Q81W 3ZHUA 4QGPA 4Z2WA 5KUMA 4ABMA 3ETDA 1HNWO 1IZ3A 2OIEA 5CA0A 1YXBA 3QO5A 2WLMA 3RVZA 5FPRA 4JYCA 1F4NA 1QR8A 3U11A 5B1BC 1FFXB 2GUZB 5B1BB 1OCOC 4LF7B 3X2QC 5JJNB 3P3PA 4FLXA 1N33O 2DYSC 3RYCB 1L8DA 4DR4B 3U10A 3JSLA 1K97A 1EZVH 3BPZA 2GSMB 1VF7A 2XUMA 4BAYA 5B5EZ 5H9CA 3BA9A 1FXKC 2YIAA 5CA1B 1NVPB 5JVDB 1AP6A 4B3MB 2ZE8A 2OWOA 5J9PC 1JX9A 5C8YB 4QJFB 2UUCB 4YY3O 1MABG 3HKEB 4RQEA 1K7DA 1RFYA 4TOIA 3Q4HB 3CXCU 3BABA 2JGUA 3LDCA 2A0LA 3L71H 2QWOB 2Y69C 4DR1B 2P4VA 4WFBV 1MA1A 1G4YB 1L0LH 1EN5A 3D3QA 4ASUG 3JD1A 1R3IC 4X8AA 4YJ2B 4FK5C 3U0ZA 4LR3A 3ZRVA 4G2KA 3ZRSA 1VIBA 3ZN1A 1WP7A 2JDIG 1SQGA 1I08A 3EVKA 1NTKH 2QDOA 3KCYA 1OCCB 3W7SA 3CWBH 2ITDC 3FKSG 2GV9A 4X20B 4DV1O 5DN6G 1THZA 1M57B 1SQBH 1K9MW 4P2ZA 3CYOA 3Q4HA 5IWAB 1JMKC 3KKYA 2ZXWB 1AJPA 1XMQO 1MMMA 3F7YC 2M7WA 5KMGA 2ZD9A 3RFRA 2HFEC 3K9SA 2FB5A 1H38A 2XAQA 5J2TB 4X1KB 1R1BA 1DF5A 4JI0B 3ML0A 3T2MA 3E35A 2UXCO 1JA8A 1YF2A 4UUJC 2MW2B 4IGGA 2Q7GA 4LP8A 1PNMA 2Q6AA 1V55B 1B6QA 3CC2V 3T1HO 5ITZB 4F4LA 1V54C 3E89A 3AG3B 1OCRB 4F6RB 3VOUA 3T4DA 1S5HC 1GKFA 1R73A 4DW1A 1K5QA 5LXTA 3C3TA 4FMTA 1DK1A 1CXZB 2CE4A 5KAIZ 1NR1A 2EJ7A 4DUYO 2JVDA 5KAFZ 4P30A 4DV6B 2R72A 1QHTA 4FLYA 3J7AU 1A32A 1JCHA 1QBZA 2QWNB 3QVNA 2EZPA 1PP9H 2IH1C 2ZM6O 1URFA 2HLDG 1VF6A 5EBWC 2PY5A 4JI3O 2JS3A 4P9PA 3JAMN 3CCJV 2YEVB 4MW8A 3FB5C 2DW4A 1Z5WA 3OAAG 1N34O 3OTOB 1YJNV 2IBZH 2QKSA 4KUMA 4I9QA 1TA8A 5LOVA 3W7WA 4X62O 4X64O 2IH3C 1VQ7V 3LSUA 1OCRC 4LFCO 4K8XA 4H33A 2XHBA 1Z5VA 4DV0O 2PYJA 1IBLB 1Y67A 3ABLB 1NT2B 4JGSA 5CN0A 3T4ZA 5CBFA 2IW5A 4DR3O 2UXBB 2IJJA 2HHHO 5L3DA 1PM9A 1I94B 4J9YB 1CPYA 2YI8A 3AK1A 5K1XA 5B1AC 4LCUC 1NS1A 1YTFD 2KG7B 1DGSA 5JQGB 1QR9A 4TT3G 1R3LC 4YHHO 4X65B 1KYOF 3HKDA 3KZIZ 3N2KB 3L72H 2EBOA 1SQQH 4AQYB 4K3AA 4ZI7A 5CB4B 2KKWA 2N74A 3VQXA 4CH3A 2B9ZA 3RT3C 1M93A 3C3SA 1YI2V 3LNMB 5FNVB 3B8MA 1HDJA 2Q5ZA 2DN9A 2ATKC 1VQNV 4DV2B 1VQLV 2EX3A 3RWRD 3K5LA 2JEUA 3HR0A 1N32O 3JASB 3APOA 4GX0A 1WN7A 2C2AA 2PI5A 3ZHRA 2M6YA 5F2VO 1Q8IA 1IDSA 1YIJV 1VQOV 1FJGO 3HKDB 1ZL8B 1PKXA 3JAKA 4LBEC 4I5SA 4RWUA 1QLEB 4AHCA 1NU1H 2ZM6B 2HVKC 1COWG 3DGEA 3BHPA 4DV1B 4UVBA 3JD3A 5IYDO 1KP2A 2ZXWC 2Y69B 5KUKA 4ICGA 2WLHA 1AJNA 1TAEA 4NKGB 1BGYH 1SA0B 1W0KG 1VMGA 3JYCA 2UU9O 3P3NA 1MZFA 2GDSA 4JI6O 5BXZA 5EBLC 3WG7C 3K0DA 1QLNA 4PDVA 3CEIA 2X6AA 4FFBA 2XASA 4TV8A 1V9PA 3IFXA 1BL8A 2HP8A 4JAUA 3G80A 2Z5UA 5LOVB 3RYIB 3CCQV 2EIJC 1VF5B 3UM7A 4DR1O 2F93B 3TXQA 5L3EA 1KD1W 1F4MA 1WNSA 3T1HB 2LP7A 1IX9A 2B5UA 5KHIA 2L35A 2EIJB 3FAVA 3IGAC 2P06A 2UXNA 4JASA 4B3MO 2WLIB 1Q5OA 2Q7EA 4YXWG 4LF4B 4FM2A 3O65A 3ABTA 1FYJA 2Q73A 3N2KA 2E5LB 3JD2A 3JARB 1NQTA 1GM9A 5JH7B 3K3WA 3ASNB 5H6QA 1VQKV 1M56C 1ROPA 3CRRA 4ZOLB 1Q6HA 5LXTB 2VQEB 1ORQC 4UCOA 1GM8A 3AEIA 4X89A 2PYLA 5GONA 5IJ9B 1SETA 3ZHVA 5B3SC 2DYRC 2LQTA 3CS5A 5ITZA 4LFBB 1R6TA 4MW3A 1BT8A 3H1IH 1NH2B 1PD3A 3WU2Z 4GX2A 4Z1VA 1FXHA 3OE7G 1LNQA 2LJ2A 2CTWA 5IYCO 2HHHB 1PL0A 4XDLA 1HNZO 3F5WC 4DR7B 4LC1A 3A2FA 1U97A 2XNDG 1Y74B 3JD0A 4I9WA 2X0LA 1IBLO 3L74H 1K34A 2W0FC 3UO3A 3ZHSA 3RGBA 1XNQB 2HVJC 2BTQA 3ASOC 1S0VA 1RM1B 5KA6A 4GKKB 3BVOA 3SJCC 1US6A 1S77D 1EFRG 2Z3YA 1I5YA 2WPDG 1AP5A 3BFRA 2ADPA 5J2UB 1IBMO 2EZOA 3ETQA 4LF8O 1O9HA 2XAJA 4CS2A 1KKCA 3P30A 4GLXA 4LH7A 2WA4A 4O2BA 1W59A 1N32B 1HP8A 2XTAA 2K9PA 2ADQB 3CHXA 4F6RA 4PA4A 2UXDO 4IYHA 4JYAB 1K73W
chains in the Genus database with same CATH topology
1K3EA 3B77A 3CXCU 4GT1A 4CBCA 4PDLA 3LDCA 2WAMA 1FXKA 5EK0A 2A0LA 4JTCB 3SJQC 2Y69C 2HJFC 2JJ1G 2WSSG 3SPGA 4WFBV 1G4YB 5LHHA 1IXMA 4ASUG 3STZC 2X6BA 2R9RB 3JD1A 1R3IC 4X8AA 2LFRA 3CCLV 4FK5C 3AG3C 3ZRVA 3AG4B 4G2KA 3ZRSA 3ZN1A 4R6ZA 1AI6A 1K92A 2GHYA 2JDIG 2P7TC 1SESA 3F7VC 1P4RA 2OT5A 1BHAA 5B1AB 1JOYA 1GMGA 1OCCB 3ZCCA 3W7SA 1R3JC 3CCVV 3ASOB 4WF9V 1L1FA 4KFMA 2ITDC 3QO7A 3KG2A 1E1QG 3OUFA 3FKSG 4PA9A 2EIKB 2XAHA 4QE7A 1JQ0A 1YHQV 2DWDC 2ZQMA 4WFHA 4U7NA 5DN6G 3ABLC 1THZA 2DQ3A 3ZMVA 1M57B 1FXKB 1K9MW 5CA3A 4TWKA 1UJWB 1AI4A 4P2ZA 3CYOA 3MHHC 1QCEA 4QE9A 2D3OW 3NXSA 2Q67A 1N8RW 2ZXWB 3FYEB 1AJPA 1NBMG 3QO8A 3F7YC 2M7WA 2ZD9A 1R6NA 2HFEC 3SYOA 3X2QB 3K79A 1H38A 2XAQA 4MTGA 4MTXA 2XAFA 4HZ3A 1DF5A 3OFNG 3ML0A 1RM1C 3D36A 1GK9A 3SYAA 3T2MA 3E35A 5DM6V 1ENVA 1SZTA 4KP4A 5KA5A 4UUJC 4Z1MG 1AI5A 2IU3A 4L87A 2DWEC 4LP8A 3E8BA 1PNMA 4ZBMA 3K04A 2Q6AA 2Q69A 1V55B 4QIWF 1B6QA 3GWOA 4Q20A 3CC2V 3ZMZA 1NJIW 3GB7C 2A9HA 3RBZA 3PJSK 1RPOA 2QE7G 3I56V 4F4LA 3ZJZA 4BIUA 1V54C 3E89A 4P9OA 3AG3B 4MVRA 5CMUA 1OCRB 1Q82W 1I5XA 2NNUA 2ZR3A 3VOUA 3T4DA 5LGTA 1S5HC 2WLKA 3E83A 1GKFA 1R73A 2AHZA 2IJIA 4ZKIA 2BOCC 3CCEV 1K5QA 4FMTA 4WFFA 2QEXV 5B3SB 2K1EA 2P90A 1NR1A 2QM7A 3OGCC 4FJCC 2NLJC 1G8MA 4GCZA 2IJHA 5L3FA 4H37A 1EBOA 5LBQA 4G28B 3WFVA 2YSUB 4P30A 5LHGA 1F51A 4JTDB 2EINB 1OCCC 4QPJA 1TUEB 3W7TA 2P67A 2P6JA 1M56B 2HG5C 2IU0A 4MVSA 3SPHA 1KKDA 1JCHA 1QBZA 3ASNC 2H8PC 2WLLB 2EZPA 2IH1C 2ITCC 2OCCC 2HLDG 1K33A 1FFTB 5EBWC 3G6EV 2HKOA 3OMAB 4P9PA 5L3BA 1YTFB 3CCJV 2YEVB 3CP1A 4MW8A 3FB5C 1R3KC 3OEHG 4MVQA 2DYSB 2DW4A 4RAIA 3OAAG 3MHSC 1YJNV 2QKSA 2MK3A 3K9AA 3M99B 3OEEG 4KUMA 2FTKA 3BEHA 3TK1A 3W7WA 2W6JG 3P32A 2IH3C 1VQ7V 3OUSA 1NKDA 4MT8A 3E8FA 4G27B 5E1AC 1OCRC 5C93A 3JD4A 1YSCA 4H33A 3R65A 1GM7A 1DF4A 2JEXA 1AJQA 2WLIA 4JF3A 5EC2C 4MS2A 1ZWIC 1M57C 3E2EA 3ABLB 2WWWA 1H8EG 5CBFA 4JGSA 5CN0A 3T4ZA 5IYBO 2IW5A 1QVGU 5H6RA 1DTOA 2IJJA 5L3DA 5B1NA 4WFEA 3WG7B 2BOBC 4J9YB 1RPRA 1F23A 1Y4MA 3CCUV 4JYBA 1DLBA 1CPYA 5FL7G 2QTOA 5CBGA 2XAGA 3OMIB 5B1AC 4LCUC 1YTFD 3ZIAG 3I55V 1MSWD 4U7OA 1S72V 1QR9A 4TT3G 1R3LC 1M9NA 3ZRWB 5L3CA 3AG1B 3BY6A 1VQ4V 1FXVA 3G4SV 2EBOA 1AROP 2H94A 3LSSA 4FIPC 3ZMSA 2EILB 1PNLA 3G71V 3K0GA 3K06A 1QVFU 1YI2V 3LNMB 1QLEC 2Y48A 3B8MA 1J95A 1M1KW 2LFSA 2ATKC 4QNHB 5L3GA 1VQNV 1VQLV 3T1CA 5LGUA 1VQ8V 2EINC 4FPPA 2EIMC 3MD0A 3CMEV 1S76D 3SYCA 1OCZB 2JEUA 3D3IA 1KQSU 1Q86W 4GX0A 2PI5A 1MG1A 2C2AA 2ZDIC 3TETA 1YIJV 4DXWA 1VQOV 4XDKA 3H01A 3ZRWA 1PKXA 4LBEC 1SERA 3LSQA 3RVYA 2AHYA 4I5SA 2CK3G 1QLEB 3CD6V 1WLEA 2HVKC 3ETGA 1COWG 3DGEA 3ZMTA 1Y66A 4WFGA 3UKMA 3E8HA 3ETEA 3TCUA 1E79G 4MTOA 3K03A 1WPXA 4UVBA 5EC1C 3JD3A 5GW7A 5IYDO 1KP2A 2ZXWC 4X88A 1CP9A 2Y69B 3LDDA 3SPJA 4JPRA 5KUKA 2WLHA 1AJNA 1VQMV 1OCOB 2EJRA 3ABMB 4PA7A 4UXNA 3SYQA 4MVOA 2OTJV 3A0RA 3FB6C 1W0KG 1V55C 1VQ5V 3JYCA 1AI7A 4N23A 3ABUA 3CPWU 3OM3B 3DTUB 5EBLC 3WG7C 3K0DA 2EIKC 1QLNA 4PDVA 2X6AA 4WFAV 2XASA 3CCMV 3W7XA 4EKWA 1HWYA 1S3JA 3IFXA 1BL8A 1NR7A 1P7BA 2V1DA 4JAUA 3FYIB 4RUEA 3OR7C 4DO2A 2JK5C 4GX5A 2W6IG 2Z5UA 2OCCB 4BIZA 4PA6A 2EIJC 3B8NA 3CCQV 3UM7A 5L3EA 1KD1W 1XL4A 1F4MA 1JJ2U 4QPKA 4HAMA 4XDJA 2LP7A 2B5UA 2A79B 2EIJB 5B1OA 4OXSA 2IJKA 2WLJA 2QM8A 3IGAC 2KB1A 3LDEA 4XBFA 2UXNA 1YITV 1GO3F 4JASA 4MSWC 2WLIB 1E1RG 1MOFA 1K4CC 2B1GA 3RW0A 4YXWG 2QA4V 4MVZA 3ABTA 4GX1A 2XOKG 1VQ6V 3SYPA 1XL6A 4PELA 3IC7A 1H2GA 3JD2A 4UV8A 1W0JG 1NQTA 3E8GA 2DQ0A 3ABMC 1GM9A 3SPCA 3FB7C 3K3WA 3ASNB 5HFMA 4RO2A 3CC4V 5H6QA 4CZZA 1VQKV 1YJ9V 1M56C 4RUFA 1KECA 3STLC 3LUTB 1ROPA 4BW5A 1K5SA 2Q68A 4N21A 3EFFK 1ORQC 1GM8A 2YEVA 3AEIA 3HB3B 2ZDIA 4HYOA 2WLNA 3AG2B 4X89A 1KP3A 3EHBB 3ZN0A 1SETA 3SPIA 3HPLC 4TSFG 5B3SC 3CC7V 4UV9A 2DYRC 2DYRB 1BHBA 1VQ9V 3FB8C 2B1IA 3CCSV 2WLLA 4PA3A 4J9ZB 4MW3A 2F43G 1H8HG 3ABKB 3AG2C 1NH2B 1PD3A 3W7UA 1OHHG 5LHIA 4MVMA 3OR6C 1VQPV 2JJ2G 4GX2A 1JVMA 1V54B 1EZJA 5IY5B 1YJWV 1FXHA 3OE7G 1LNQA 2V7QG 4UVCA 1Q81W 4WCEV 1NH2D 4MVUA 2R9IA 2ZR2A 5IYCO 1PL0A 4XDLA 2X7RB 3F5WC 4JAVA 5KUMA 4LC1A 4R50A 2EILC 2XNDG 3ETDA 3OW2U 1BMFG 3JD0A 5IY5C 1Q7YW 3K08A 4I9WA 2X0LA 2JIZG 1JPXA 3QO5A 2WLMA 4R8CA 1K34A 3OMNB 2W0FC 5LGNA 4PDMA 3AG1C 3ZRXA 3RVZA 5EBMC 1KC8W 2HVJC 1S0VA 2UXXA 3ASOC 4JYCA 1RM1B 3ABKC 5KA6A 1F4NA 1QR8A 5B1BC 1S77D 3VBBA 1EFRG 2Z3YA 1I5YA 1FS0G 2WPDG 5B1BB 1OCOC 3X2QC 3CCRV 4UVAA 1K8AW 5BZBA 2DYSC 2EZOA 3AG4C 3JCZA 5CBHA 1NVPD 1K97A 1OZ0A 1W2BU 2XAJA 5HFLA 1M90W 2GSMB 4BAYA 1GTOA 3P30A 5H9CA 1PNKA 3E86A 1R6KA 1FXKC 1NVPB 3CMAV 2HR3A 4PDRA 3QNEA 4E2LA 4R7CA 5J9PC 2PI4A 5IDJA 4MTFA 4JTAB 1JX9A 4QJFB 1CEZA 1MABG 2X6CA 1OCZC 4PA4A 3ZMUA 4RQEA 2EIMB 1AR1B 2OTLV 1SRYA 1K7DA 4RQFA 1K4DC 1K73W
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E8G A;  1J95 A;  3ABM C;  4WFF A;  4CBC A;  4PDL A;  3LDC A;  3SPC A;  3FB7 C;  4RO2 A;  5EK0 A;  2A0L A;  4JTC B;  2ATK C;  4QNH B;  1M56 C;  2K1E A;  2Y69 C;  4RUF A;  2HJF C;  3OGC C;  3SJQ C;  3STL C;  3LUT B;  3T1C A;  3SPG A;  2NLJ C;  4BW5 A;  2EIN C;  2Q68 A;  2EIM C;  1G4Y B;  4H37 A;  3EFF K;  4G28 B;  3SYC A;  1ORQ C;  2YEV A;  4HYO A;  2X6B A;  4X89 A;  2R9R B;  4XDJ A;  2WLN A;  4P30 A;  3STZ C;  1R3I C;  4GX0 A;  4JTD B;  4X8A A;  1OCC C;  3SPI A;  3AG3 C;  3TET A;  3HPL C;  3ZRS A;  4R6Z A;  2HG5 C;  3SPH A;  5B3S C;  4MVS A;  4DXW A;  1KKD A;  2P7T C;  3ASN C;  2DYR C;  2H8P C;  4XDK A;  3FB8 C;  2WLL B;  3F7V C;  2IH1 C;  2WLL A;  2ITC C;  2OCC C;  4LBE C;  3RVY A;  4PA3 A;  2AHY A;  4J9Z B;  4MW3 A;  5EBW C;  2HVK C;  1R3J C;  3AG2 C;  4WFG A;  3UKM A;  4KFM A;  2ITD C;  3KG2 A;  3E8H A;  3TCU A;  3OUF A;  4MVM A;  4P9P A;  4MTO A;  3OR6 C;  3K03 A;  4PA9 A;  5EC1 C;  4GX2 A;  4MW8 A;  2ZXW C;  3FB5 C;  1JVM A;  1R3K C;  4QE7 A;  4MVQ A;  4RAI A;  4X88 A;  2DWD C;  3LDD A;  3SPJ A;  1LNQ A;  5KUK A;  4WFH A;  2WLH A;  2QKS A;  4MVU A;  3ABL C;  3SYQ A;  4PA7 A;  4MVO A;  4XDL A;  4TWK A;  3FB6 C;  3BEH A;  1V55 C;  3F5W C;  4P2Z A;  5KUM A;  3JYC A;  4R50 A;  4QE9 A;  2IH3 C;  2EIL C;  3OUS A;  5EBL C;  3E8F A;  5IY5 C;  4G27 B;  2Q67 A;  3K0D A;  3K08 A;  2EIK C;  4I9W A;  4PDV A;  5E1A C;  3WG7 C;  1OCR C;  2X6A A;  2WLM A;  4R8C A;  3F7Y C;  2W0F C;  2ZD9 A;  4PDM A;  3AG1 C;  4H33 A;  3RVZ A;  5EBM C;  4EKW A;  2HVJ C;  3R65 A;  3ASO C;  3IFX A;  3ABK C;  1BL8 A;  2HFE C;  1P7B A;  3SYO A;  4RUE A;  2WLI A;  3OR7 C;  2JK5 C;  4GX5 A;  4MTG A;  4MS2 A;  5EC2 C;  5B1B C;  1ZWI C;  1M57 C;  1OCO C;  4PA6 A;  2EIJ C;  3X2Q C;  3UM7 A;  4HZ3 A;  5CBF A;  3T4Z A;  5BZB A;  2DYS C;  3SYA A;  3T2M A;  3AG4 C;  5CBH A;  1XL4 A;  4UUJ C;  4WFE A;  2BOB C;  4J9Y B;  2DWE C;  2A79 B;  3E8B A;  4LP8 A;  4ZBM A;  3K04 A;  2Q6A A;  2Q69 A;  4OXS A;  5CBG A;  2QTO A;  2WLJ A;  3E86 A;  5B1A C;  4LCU C;  3IGA C;  2KB1 A;  3GB7 C;  3LDE A;  2A9H A;  3RBZ A;  3PJS K;  4MSW C;  4PDR A;  1R3L C;  2WLI B;  4R7C A;  4F4L A;  5J9P C;  3LNM B;  3ZJZ A;  1V54 C;  4MTF A;  3E89 A;  4P9O A;  1K4C C;  4MVR A;  3RW0 A;  4JTA B;  4MVZ A;  4GX1 A;  2X6C A;  3VOU A;  1OCZ C;  3T4D A;  1S5H C;  2WLK A;  3E83 A;  1XL6 A;  4PA4 A;  3SYP A;  2AHZ A;  3K0G A;  2BOC C;  3K06 A;  1K4D C;  1QLE C; 
#chains in the Genus database with same CATH topology
 1EM1 A;  1K3E A;  4X1I B;  2AZ0 A;  4GT1 A;  1FXK A;  3B40 A;  5EK0 A;  4JTC B;  4AIL C;  4IHJ A;  3BCC H;  3SJQ C;  4DV4 O;  3CSX A;  4DR7 O;  1RSO B;  5BMV A;  3CJH B;  1IXM A;  1FJG B;  2X6B A;  1SQP H;  1HR0 O;  5BY1 A;  5J2T A;  1P4R A;  5B1A B;  4K8Z A;  1L1F A;  4KFM A;  4DRX A;  1B04 A;  5JWP A;  1Y6X A;  2XAH A;  1JQ0 A;  2DWD C;  1RSO A;  4WFH A;  1QU7 A;  5DEC A;  3ABL C;  1P49 A;  4CH5 A;  1X4T A;  1QCE A;  4B7E A;  2Q67 A;  4DYL A;  4U3J A;  3SYO A;  3K79 A;  3T1Y O;  1IBK O;  1HR0 B;  3EXA A;  2XAF A;  1PPJ H;  1XI1 A;  3RYH A;  1ZX3 A;  4HZ3 A;  3D36 A;  5IE9 A;  4YJ2 A;  1HNZ B;  5DM6 V;  5IYZ A;  2QSA A;  3ZX6 A;  1YZB A;  4Z1M G;  2IU3 A;  4GKJ O;  2R9A A;  5J2U A;  2AGA A;  1NJI W;  1OV9 A;  4TQD A;  4DR4 O;  2FML A;  3RBZ A;  1RPO A;  4X62 B;  4I4T A;  3HKE A;  4P9O A;  5FPO A;  4X9Q A;  4NYK A;  3SR2 C;  2NNU A;  2WLK A;  3E83 A;  1LUV A;  1Y74 A;  2DMX A;  4DV0 B;  4GKJ B;  5CA1 A;  4FLW A;  2UU9 B;  4GCZ A;  1H2L A;  1KBH A;  5LBQ A;  4TV9 A;  3WFV A;  5LHG A;  1F51 A;  1SQV H;  1OCC C;  1XHX A;  3ZHT A;  1TUE B;  2LGQ A;  2Q7H A;  2P6J A;  4MVS A;  1KKD A;  2GUZ A;  2F4V B;  2OCC C;  4OPA A;  4EB6 A;  5IJ9 A;  2BSK A;  3OMA B;  5GON B;  3WB1 A;  4L8J A;  2RDC A;  5EZY B;  4RAI A;  3OEH G;  4MVQ A;  5JCO A;  1YDX A;  4JI4 B;  2MK3 A;  3K9A A;  3BEH A;  3TK1 A;  2W6J G;  3JAR A;  4HNA A;  3OUS A;  3E8F A;  5E1A C;  5LA6 B;  1YSC A;  2E5L O;  3R65 A;  1BSM A;  3JAT A;  1GRJ A;  4MS2 A;  5EC2 C;  4GZR B;  1M57 C;  1U96 A;  3JAW B;  1Q6I A;  3E2E A;  4EEQ A;  5LYJ B;  1QVG U;  4TQF A;  2YXL A;  5D5Q A;  5H6R A;  3IJ4 A;  4WFE A;  1Q6U A;  2BOB C;  2Y4U A;  1AVM A;  2YI9 A;  2ARH A;  3WB0 A;  5CBG A;  2XAG A;  3OMI B;  2Q0O C;  2RMK B;  2JRI A;  1MSW D;  1D2D A;  3ZRW B;  4NTW A;  1QQC A;  2UUB O;  3PN1 A;  5LL6 Y;  5AG2 A;  1ARO P;  4TV8 B;  2H94 A;  3LSS A;  4FIP C;  3ZMS A;  4FFB B;  4JI2 B;  3K0G A;  3K06 A;  4TUY B;  1HNX B;  1QVF U;  5K1P A;  1J95 A;  4O4H B;  2LFS A;  4JI0 O;  4QNH B;  5LMN O;  5KHK A;  5EYP B;  4WBN A;  3H9V A;  5KX5 A;  5LGU A;  1WAZ A;  2CUG A;  2EIN C;  4FPP A;  3FX7 A;  3VQV A;  3CME V;  1SZX A;  3SYC A;  1S76 D;  4X64 B;  4ZOL A;  4J7J A;  3JAL B;  2LO1 A;  2CGN A;  3CE2 A;  4CH4 A;  1HNX O;  3ZRW A;  1BQ0 A;  3RVY A;  2JS5 A;  4LF4 O;  4O4I A;  1IBM B;  3ZMT A;  4DUZ O;  1E79 G;  1XBL A;  5GW7 A;  4NTY A;  4X88 A;  1CP9 A;  1WJZ A;  4OX9 O;  5LP6 C;  4B3R B;  3K57 A;  1OCO B;  2EJR A;  4UXN A;  5LYJ A;  4J11 A;  3FAV B;  4MVO A;  2OTJ V;  3UO2 A;  3N27 A;  1AI7 A;  3ABU A;  3CPW U;  3OM3 B;  3DTU B;  1SF9 A;  4Q6G A;  4I50 B;  3JCU Z;  4WFA V;  4GYC B;  4LNU A;  4DV3 B;  4JI8 O;  4ZI7 B;  2RCV A;  1ZSP A;  1S3J A;  2Q8V A;  2QGN A;  3OR7 C;  2CAZ C;  5JQG A;  2RJZ A;  5E79 Z;  4LF9 B;  3B8N A;  5KLV H;  1AIL A;  4FLV A;  3ZHQ A;  3JAL A;  1J5E O;  3T1Y B;  1JJ2 U;  5EZY A;  2WLJ A;  2QM8 A;  4O4H A;  1KMI Z;  3LDE A;  1YIT V;  4DW0 A;  4TUY A;  1E1R G;  2NR5 A;  2XT9 A;  4FLZ A;  3RW0 A;  1TUB A;  2BE3 A;  2XOK G;  3SYP A;  5IJ0 A;  4TV9 B;  1G1X B;  2BTO A;  1W0J G;  4GKK O;  3RYF A;  3ABM C;  3SPC A;  2DE0 X;  4RO2 A;  3DC6 A;  3SGI A;  3IC9 A;  5LMN B;  4N21 A;  4UCR A;  3EFF K;  2F23 A;  4XDJ A;  4HYO A;  4JI4 O;  3HB3 B;  1JFF B;  2WLN A;  3OTO O;  3EHB B;  3HPL C;  4TSF G;  3I5D A;  4JI2 O;  4HBN A;  5FNV A;  3CXH F;  1VQ9 V;  3CCS V;  4W4L A;  4AQY O;  3E22 A;  3AG7 A;  1KB9 F;  4O2A A;  4FLU A;  3ABK B;  5JJJ B;  3AG2 C;  2AW9 A;  3W7U A;  1OHH G;  2QWP B;  3H1H H;  4I0X A;  2JJ2 G;  4JYA O;  5IY5 B;  1YJW V;  1FKA O;  5IYZ B;  4WCE V;  1NH2 D;  2DJV A;  2VQF O;  1XNQ O;  2R9I A;  1P7G A;  2X7R B;  3RYH B;  4DV4 B;  4R50 A;  1SQX H;  2ZIO A;  1ZUQ A;  4B3S B;  3K08 A;  4KL1 A;  2JIZ G;  4LF5 B;  1JPX A;  3QTC A;  5LGN A;  4PDM A;  3ZRX A;  3AG1 C;  5EBM C;  2UXX A;  4FVM A;  2KQX A;  3HKC A;  4FM0 A;  2YIB D;  5BR8 B;  3VBB A;  1FS0 G;  1BS3 A;  3CCR V;  1JR9 A;  3OTF A;  1K8A W;  4YJ3 A;  5BZB A;  4CS4 A;  3AG4 C;  4K0K O;  1OZ0 A;  1W2B U;  1BQZ A;  2IM9 A;  5HFL A;  1M90 W;  2RNB A;  3JSN A;  4DR5 O;  3H1L H;  1PNK A;  3E86 A;  3NR7 A;  3CMA V;  2ZIN A;  2P4K A;  4PDR A;  2CTP A;  1WA8 B;  1M5I A;  4R7C A;  5A9G A;  2PI4 A;  4JI1 O;  5IDJ A;  4MTF A;  4JTA B;  3F5T A;  5KMG B;  1CEZ A;  4FFK A;  3B09 A;  1AR1 B;  2OTL V;  4RQF A;  1K4D C;  4J7Z A;  3B77 A;  2CTR A;  2WAM A;  4LFA B;  1MNG A;  2WSS G;  4I55 B;  5LHH A;  1N36 B;  3BAA A;  1LUW A;  3SJB C;  3WB2 A;  3AG3 C;  3AG4 B;  1B3Q A;  4R6Z A;  1AI6 A;  1K92 A;  2GHY A;  3LNN A;  3J81 N;  1SES A;  4IYI A;  2PZS A;  3DC5 A;  1G6U A;  1GMG A;  2PUS A;  3ZCC A;  3CCV V;  4WF9 V;  1WB8 A;  1E1Q G;  3OUF A;  1XRE A;  4NVP A;  4B7K A;  2EIK B;  4QE7 A;  2YID A;  2ZQM A;  4I55 A;  4KXR A;  3SJA C;  4U7N A;  2VWJ A;  1SKV A;  1AI4 A;  2UUA O;  3C90 A;  2VQE O;  2D3O W;  3NXS A;  1NBM G;  1SQF A;  3QO8 A;  1H2S B;  1WA8 A;  4MTX A;  1P84 F;  5JVD A;  3H1K H;  2VWK A;  4NXM B;  4X66 B;  3AK3 A;  1RM1 C;  5H2F Z;  3SYA A;  2E76 B;  2E75 B;  4KP4 A;  5KA5 A;  1YVW A;  2YS8 A;  4L87 A;  2YC0 A;  3K04 A;  4IHJ B;  4QIW F;  3DSQ A;  4X1Y A;  1BZK A;  3GWO A;  1FPO A;  1QNM A;  3ZMZ A;  2VRZ A;  3CRQ A;  4X20 A;  3PJS K;  4YHH B;  2QE7 G;  3I56 V;  5LMU O;  3ZJZ A;  4BIU A;  5CMU A;  2QKA A;  3QG5 A;  1Q82 W;  3S3W A;  5LGT A;  3BRC A;  2AHZ A;  4ZKI A;  3CCE V;  1ZTE A;  4WFF A;  2QR4 A;  2QEX V;  1Y76 A;  5B3S B;  2K1E A;  2P90 A;  3OGC C;  2QM7 A;  4FJC C;  4J7K A;  5L3F A;  4H37 A;  2YSU B;  1XUQ A;  1ZAU A;  1WPB A;  3MDS A;  4JTD B;  1H2M A;  2EIN B;  4QPJ A;  2HEP A;  3W7T A;  3B2E E;  2P67 A;  1M56 B;  2HG5 C;  4O2A B;  2IU0 A;  1FD9 A;  2YXH A;  3ASN C;  2H8P C;  3O9O A;  3FD9 A;  1FFT B;  2BTQ B;  2FKX A;  5C8Y A;  2DOS A;  4JZG A;  4AI8 A;  5L3B A;  4YIP A;  1YTF B;  1XDC A;  3CP1 A;  1R3K C;  2DYS B;  3N2G B;  4NXN O;  3OEE G;  4K0K B;  1BCC H;  5LP6 B;  1Q90 D;  3L70 H;  1NKD A;  1IXB A;  3RYC A;  4YJ3 B;  5C93 A;  2FYU H;  1N4C A;  4I7Z B;  1T5E A;  4DV5 O;  2P22 C;  1DF4 A;  1FFX A;  4JF3 A;  1N36 O;  4D7S A;  3HKC B;  1ZWI C;  2QWQ B;  1SA0 A;  4LF5 O;  2WWW A;  1H8E G;  1AB3 A;  4D6T H;  3A0H Z;  5CA0 B;  2FL4 A;  2O57 A;  3WG7 B;  2F1M A;  1RPR A;  3TXS A;  5H5N A;  1F23 A;  4BW9 A;  4B3R O;  1Y4M A;  3CCU V;  4OX9 B;  1DLB A;  4LFC B;  5JH7 A;  3I55 V;  4U7O A;  1M9N A;  1ZL8 A;  5IT9 N;  1TVK B;  1FXV A;  2CGO A;  3QF7 A;  4LFA O;  2EIL B;  1PNL A;  4D7T A;  2A7W A;  2V4D A;  1QLE C;  2Y48 A;  1M1K W;  2ZE7 A;  2ZKO A;  5L3G A;  4A5U B;  2EUL A;  4EFE A;  1J5E B;  2EIM C;  3MD0 A;  1KQS U;  1OCZ B;  3AK2 A;  1Q86 W;  1N34 B;  2CH7 B;  1MG1 A;  1GN6 A;  3TET A;  2OIG A;  5KHJ A;  2ZE5 A;  3RYI A;  3H01 A;  1S5J A;  2A3Q A;  3LSQ A;  4JI3 B;  3THO A;  3CD6 V;  2KG7 A;  2YXY A;  2Q9L A;  1Y66 A;  1OJH A;  1IUR A;  3TCU A;  3ETE A;  4MTO A;  5EC1 C;  1WPX A;  4E4E A;  5JCO C;  1IBK B;  3LDD A;  3SPJ A;  1XOU A;  4JPR A;  4NTX A;  1VQM V;  1VAR A;  4PA7 A;  5GTI Z;  3A0R A;  4EFB A;  1VQ5 V;  5A2Q N;  4LFB O;  4N23 A;  1VF6 C;  3D8C A;  4W4K A;  4O4L A;  2EIK C;  1JJO A;  2N05 A;  2GBO A;  2PTM A;  3B4S A;  1D5A A;  3W7X A;  4EKW A;  2QTS A;  1NR7 A;  4K35 A;  4DV5 B;  2V1D A;  4DO2 A;  3L73 H;  3CRM A;  2OCC B;  4BWA A;  3GVM A;  4LNU B;  4OGQ B;  2CH7 A;  5TIS Z;  4IT5 A;  4JI5 O;  4QPK A;  3K58 A;  1NZ6 A;  2A79 B;  4OXS A;  4YY3 B;  4U3F H;  2IJK A;  1D5N A;  2KB1 A;  4LWS A;  3ZS8 C;  2P5O A;  1GO3 F;  4MSW C;  2JGD B;  2RN9 A;  3APQ A;  1VP7 A;  1K4C C;  2QA4 V;  2F95 B;  5LA6 A;  5CB4 A;  3SDL A;  1VQ6 V;  1GH6 A;  1XL6 A;  2F4V O;  1TVK A;  4O4J A;  4HNA B;  4UV8 A;  3CC4 V;  4NR1 A;  4FZ0 A;  1YJ9 V;  3BA8 A;  4RUF A;  1KEC A;  3STL C;  1K5S A;  2Q68 A;  5IWA O;  3MAQ A;  5KHG A;  2ZDI A;  3TGU H;  3AG2 B;  1KP3 A;  2YUA A;  3K5O A;  4JI8 B;  4DR5 B;  3CC7 V;  4UV9 A;  3IAY A;  4J42 A;  2B1I A;  2WLL A;  4LF8 B;  3M7M X;  4J9Z B;  4X1Y B;  1H8H G;  2CDY A;  3ZBH A;  3OR6 C;  1VQP V;  2F66 C;  5LP6 A;  1V54 B;  4MVU A;  2ZR2 A;  3A0B Z;  4X1K A;  3CRC A;  4JAV A;  3N2G A;  4PI2 A;  3UCS C;  4DR3 B;  2UXB O;  4PD4 F;  2YIB A;  1S5L Z;  2EIL C;  3OW2 U;  1BMF G;  5IY5 C;  1N0J A;  1I0H A;  1YCI A;  1Q7Y W;  1YEW A;  3ZED A;  1UFI A;  4R8C A;  3OMN B;  1BE3 H;  2QM4 A;  1KC8 W;  3ABK C;  4I4T B;  4JAA A;  4JI7 O;  1UPG A;  2WA3 A;  1N0N A;  4UVA A;  4JZ2 A;  2OYQ A;  1GAX A;  3JCZ A;  5CBH A;  1NVP D;  4FLT A;  2PGG A;  2ILM A;  3CRA A;  1GTO A;  1Y76 B;  2H3O A;  1XNR O;  1R6K A;  4LH6 A;  2UXC B;  2BCC H;  4BR6 A;  1N33 B;  2HR3 A;  4DR2 B;  3QNE A;  4E2L A;  4CC5 A;  3TJT A;  1MSD A;  2X6C A;  1OCZ C;  1X59 A;  4EB6 B;  3ZMU A;  2EIM B;  1SRY A;  5B66 Z;  1XIL A;  5KHH A;  4CBC A;  2KSD A;  4DV6 O;  4PDL A;  2Q4P A;  3K59 A;  4DV3 O;  2HJF C;  2JJ1 G;  3SPG A;  2ZNJ A;  3DXR A;  2L6L A;  3STZ C;  2R9R B;  2LFR A;  3CCL V;  1VEW A;  1NTM H;  1F7Y A;  2P7T C;  1GN3 A;  3F7V C;  2OT5 A;  1BHA A;  1JOY A;  5LMU B;  2Y4T A;  1R3J C;  3ASO B;  2PF4 E;  4CC6 A;  2ZE6 A;  3QO7 A;  3KG2 A;  4PA9 A;  3DXR B;  2OCH A;  1YHQ V;  1NI8 A;  2DQ3 A;  3ZMV A;  5JJE B;  1FXK B;  5CA3 A;  4TWK A;  1UJW B;  2R70 A;  3MHH C;  4QE9 A;  3S3X A;  1TGO A;  1Z2G A;  1XMO B;  2Q0A A;  3CB2 A;  1N8R W;  3FYE B;  3UT5 B;  4DV2 O;  3K5N A;  4UCS A;  4B08 A;  3OD4 A;  1R6N A;  4ZIB A;  4H0L B;  4CS3 A;  1I94 O;  3X2Q B;  4DR6 O;  2ZIM A;  4MTG A;  4O2B B;  2QJ1 A;  4U3J B;  2GTS A;  3L75 H;  4B3S O;  1XMQ B;  1XHZ A;  2RQ6 A;  3OFN G;  1GK9 A;  1I7F A;  3UT5 A;  1ENV A;  1SZT A;  1AI5 A;  2DWE C;  3E8B A;  4ZBM A;  2Q69 A;  4UB6 Z;  4Q20 A;  3GB7 C;  3UQ8 A;  2A9H A;  4JV5 O;  4MVR A;  5EIB C;  4DRX B;  1XQ8 A;  1I5X A;  4FZ1 A;  4H13 B;  5DED A;  2ZR3 A;  4NB5 A;  3A8T A;  2IJI A;  2BOC C;  4PV1 B;  3KCX A;  3RN4 A;  1RP3 B;  4IL6 Z;  2NLJ C;  1G8M A;  2IJH A;  2AZ2 A;  1EBO A;  4JI6 B;  4G28 B;  3HKB B;  4JV5 B;  3CJH A;  5BMV B;  5IJ0 B;  4J80 A;  4CH6 A;  3G67 A;  3SPH A;  4X1I A;  3GWK C;  2WLL B;  2ITC C;  4DUY B;  1K33 A;  4J41 A;  3OT7 A;  5D5P A;  3G6E V;  4NXM O;  2HKO A;  4LF6 B;  1LR1 A;  2UUA B;  1KUQ A;  1H2K A;  1AR4 A;  3MHS C;  5GTH Z;  2GTA A;  2AXT Z;  3M99 B;  4UFZ A;  4FM1 A;  2FTK A;  2QKC A;  3FFQ A;  3P32 A;  2LW1 A;  4O4J B;  4MT8 A;  4G27 B;  4I0X B;  3OGI B;  4H44 B;  3JD4 A;  1GM7 A;  3E22 B;  4I50 A;  3J80 N;  2JEX A;  1AJQ A;  2WLI A;  2JGD A;  4PI0 A;  4LWS B;  4B3T O;  5IYB O;  1DTO A;  1JFF A;  5B1N A;  1SC5 B;  4JYY A;  4ZHQ B;  2QWR B;  4JYB A;  2UUC O;  5FL7 G;  2QTO A;  4O4I B;  2UXD B;  4DUZ B;  3ZIA G;  1NTZ H;  3RYF B;  1S72 V;  1KU9 A;  5L3C A;  2W0X A;  4UCT A;  3AG1 B;  5FLX N;  3BY6 A;  4LF9 O;  1VQ4 V;  3D36 C;  1ZLZ A;  3G4S V;  1TUB B;  1L0N H;  1B06 A;  3G71 V;  3ICX A;  4O4L B;  4KHP O;  4WBN B;  2ZCE A;  5EYP A;  5KX5 B;  4PHZ A;  4X66 O;  4IIJ A;  4DK0 A;  3T1C A;  1WP8 A;  4JI5 B;  1VQ8 V;  3H1J H;  4UCU A;  4JI1 B;  4DR6 B;  3D3I A;  2ZT9 B;  4LF7 O;  2ZDI C;  2CTQ A;  4KHP B;  4BIO A;  4DXW A;  4XDK A;  1XMO O;  3JAK B;  1SER A;  2NN4 A;  2AHY A;  2CK3 G;  4PJ0 Z;  3VQY A;  1WLE A;  2YIC A;  3ETG A;  1XEQ A;  4WFG A;  4YIO A;  1AR5 A;  3UKM A;  4ZHQ A;  3E8H A;  2G38 A;  1Q3E A;  1PL4 A;  3K03 A;  1H2N A;  3M8A A;  3SYQ A;  3ABM B;  4UB8 Z;  3K5M A;  1O9G A;  1WB7 A;  3FB6 C;  2Y0P A;  1V55 C;  2VS0 A;  4GUN A;  1GN2 A;  3JAT B;  1Q43 A;  1EN6 A;  4J10 A;  3VQW A;  1FAF A;  1GN4 A;  2YDE A;  3G6B A;  3CCM V;  1MZE A;  2ODM A;  1HWY A;  1P7B A;  4UCV A;  4RUE A;  3FYI B;  3R66 A;  2JK5 C;  4GX5 A;  2W6I G;  4C7U A;  2UUB B;  4BIZ A;  4PA6 A;  1IVS A;  1XL4 A;  4DV7 B;  1EN4 A;  2D2C B;  4HAM A;  4IIJ B;  2BSK B;  5B1O A;  2N04 A;  4LF6 O;  4XBF A;  2HJD A;  4DR2 O;  5EIB D;  2A06 H;  1MOF A;  4B3T B;  2B1G A;  4F6E A;  4MVZ A;  2VQF B;  4GX1 A;  4PEL A;  3IC7 A;  1H2G A;  3HKB A;  4JI7 B;  4DV7 O;  3E8G A;  2DQ0 A;  1PV0 A;  1M4U A;  3FB7 C;  5HFM A;  4CZZ A;  4DK1 A;  3LUT B;  2E3C A;  3JAS A;  2Z0A A;  4BW5 A;  2Y0I A;  2E74 B;  2ETN A;  5BR8 O;  1SS3 A;  2YEV A;  4OPH A;  4NXN B;  3CX5 F;  3ZN0 A;  3SPI A;  1HW7 A;  2LW7 A;  1XNR B;  3JAW A;  2DYR B;  1BHB A;  3FB8 C;  1HNW B;  4PA3 A;  4X65 O;  2F43 G;  5LHI A;  4MVM A;  2ZNI A;  3L9D A;  1JVM A;  1EZJ A;  2V7Q G;  2LGW A;  4UVC A;  1Q81 W;  3ZHU A;  4QGP A;  4Z2W A;  5KUM A;  4ABM A;  3ETD A;  1HNW O;  1IZ3 A;  2OIE A;  5CA0 A;  1YXB A;  3QO5 A;  2WLM A;  3RVZ A;  5FPR A;  4JYC A;  1F4N A;  1QR8 A;  3U11 A;  5B1B C;  1FFX B;  2GUZ B;  5B1B B;  1OCO C;  4LF7 B;  3X2Q C;  5JJN B;  3P3P A;  4FLX A;  1N33 O;  2DYS C;  3RYC B;  1L8D A;  4DR4 B;  3U10 A;  3JSL A;  1K97 A;  1EZV H;  3BPZ A;  2GSM B;  1VF7 A;  2XUM A;  4BAY A;  5B5E Z;  5H9C A;  3BA9 A;  1FXK C;  2YIA A;  5CA1 B;  1NVP B;  5JVD B;  1AP6 A;  4B3M B;  2ZE8 A;  2OWO A;  5J9P C;  1JX9 A;  5C8Y B;  4QJF B;  2UUC B;  4YY3 O;  1MAB G;  3HKE B;  4RQE A;  1K7D A;  1RFY A;  4TOI A;  3Q4H B;  3CXC U;  3BAB A;  2JGU A;  3LDC A;  2A0L A;  3L71 H;  2QWO B;  2Y69 C;  4DR1 B;  2P4V A;  4WFB V;  1MA1 A;  1G4Y B;  1L0L H;  1EN5 A;  3D3Q A;  4ASU G;  3JD1 A;  1R3I C;  4X8A A;  4YJ2 B;  4FK5 C;  3U0Z A;  4LR3 A;  3ZRV A;  4G2K A;  3ZRS A;  1VIB A;  3ZN1 A;  1WP7 A;  2JDI G;  1SQG A;  1I08 A;  3EVK A;  1NTK H;  2QDO A;  3KCY A;  1OCC B;  3W7S A;  3CWB H;  2ITD C;  3FKS G;  2GV9 A;  4X20 B;  4DV1 O;  5DN6 G;  1THZ A;  1M57 B;  1SQB H;  1K9M W;  4P2Z A;  3CYO A;  3Q4H A;  5IWA B;  1JMK C;  3KKY A;  2ZXW B;  1AJP A;  1XMQ O;  1MMM A;  3F7Y C;  2M7W A;  5KMG A;  2ZD9 A;  3RFR A;  2HFE C;  3K9S A;  2FB5 A;  1H38 A;  2XAQ A;  5J2T B;  4X1K B;  1R1B A;  1DF5 A;  4JI0 B;  3ML0 A;  3T2M A;  3E35 A;  2UXC O;  1JA8 A;  1YF2 A;  4UUJ C;  2MW2 B;  4IGG A;  2Q7G A;  4LP8 A;  1PNM A;  2Q6A A;  1V55 B;  1B6Q A;  3CC2 V;  3T1H O;  5ITZ B;  4F4L A;  1V54 C;  3E89 A;  3AG3 B;  1OCR B;  4F6R B;  3VOU A;  3T4D A;  1S5H C;  1GKF A;  1R73 A;  4DW1 A;  1K5Q A;  5LXT A;  3C3T A;  4FMT A;  1DK1 A;  1CXZ B;  2CE4 A;  5KAI Z;  1NR1 A;  2EJ7 A;  4DUY O;  2JVD A;  5KAF Z;  4P30 A;  4DV6 B;  2R72 A;  1QHT A;  4FLY A;  3J7A U;  1A32 A;  1JCH A;  1QBZ A;  2QWN B;  3QVN A;  2EZP A;  1PP9 H;  2IH1 C;  2ZM6 O;  1URF A;  2HLD G;  1VF6 A;  5EBW C;  2PY5 A;  4JI3 O;  2JS3 A;  4P9P A;  3JAM N;  3CCJ V;  2YEV B;  4MW8 A;  3FB5 C;  2DW4 A;  1Z5W A;  3OAA G;  1N34 O;  3OTO B;  1YJN V;  2IBZ H;  2QKS A;  4KUM A;  4I9Q A;  1TA8 A;  5LOV A;  3W7W A;  4X62 O;  4X64 O;  2IH3 C;  1VQ7 V;  3LSU A;  1OCR C;  4LFC O;  4K8X A;  4H33 A;  2XHB A;  1Z5V A;  4DV0 O;  2PYJ A;  1IBL B;  1Y67 A;  3ABL B;  1NT2 B;  4JGS A;  5CN0 A;  3T4Z A;  5CBF A;  2IW5 A;  4DR3 O;  2UXB B;  2IJJ A;  2HHH O;  5L3D A;  1PM9 A;  1I94 B;  4J9Y B;  1CPY A;  2YI8 A;  3AK1 A;  5K1X A;  5B1A C;  4LCU C;  1NS1 A;  1YTF D;  2KG7 B;  1DGS A;  5JQG B;  1QR9 A;  4TT3 G;  1R3L C;  4YHH O;  4X65 B;  1KYO F;  3HKD A;  3KZI Z;  3N2K B;  3L72 H;  2EBO A;  1SQQ H;  4AQY B;  4K3A A;  4ZI7 A;  5CB4 B;  2KKW A;  2N74 A;  3VQX A;  4CH3 A;  2B9Z A;  3RT3 C;  1M93 A;  3C3S A;  1YI2 V;  3LNM B;  5FNV B;  3B8M A;  1HDJ A;  2Q5Z A;  2DN9 A;  2ATK C;  1VQN V;  4DV2 B;  1VQL V;  2EX3 A;  3RWR D;  3K5L A;  2JEU A;  3HR0 A;  1N32 O;  3JAS B;  3APO A;  4GX0 A;  1WN7 A;  2C2A A;  2PI5 A;  3ZHR A;  2M6Y A;  5F2V O;  1Q8I A;  1IDS A;  1YIJ V;  1VQO V;  1FJG O;  3HKD B;  1ZL8 B;  1PKX A;  3JAK A;  4LBE C;  4I5S A;  4RWU A;  1QLE B;  4AHC A;  1NU1 H;  2ZM6 B;  2HVK C;  1COW G;  3DGE A;  3BHP A;  4DV1 B;  4UVB A;  3JD3 A;  5IYD O;  1KP2 A;  2ZXW C;  2Y69 B;  5KUK A;  4ICG A;  2WLH A;  1AJN A;  1TAE A;  4NKG B;  1BGY H;  1SA0 B;  1W0K G;  1VMG A;  3JYC A;  2UU9 O;  3P3N A;  1MZF A;  2GDS A;  4JI6 O;  5BXZ A;  5EBL C;  3WG7 C;  3K0D A;  1QLN A;  4PDV A;  3CEI A;  2X6A A;  4FFB A;  2XAS A;  4TV8 A;  1V9P A;  3IFX A;  1BL8 A;  2HP8 A;  4JAU A;  3G80 A;  2Z5U A;  5LOV B;  3RYI B;  3CCQ V;  2EIJ C;  1VF5 B;  3UM7 A;  4DR1 O;  2F93 B;  3TXQ A;  5L3E A;  1KD1 W;  1F4M A;  1WNS A;  3T1H B;  2LP7 A;  1IX9 A;  2B5U A;  5KHI A;  2L35 A;  2EIJ B;  3FAV A;  3IGA C;  2P06 A;  2UXN A;  4JAS A;  4B3M O;  2WLI B;  1Q5O A;  2Q7E A;  4YXW G;  4LF4 B;  4FM2 A;  3O65 A;  3ABT A;  1FYJ A;  2Q73 A;  3N2K A;  2E5L B;  3JD2 A;  3JAR B;  1NQT A;  1GM9 A;  5JH7 B;  3K3W A;  3ASN B;  5H6Q A;  1VQK V;  1M56 C;  1ROP A;  3CRR A;  4ZOL B;  1Q6H A;  5LXT B;  2VQE B;  1ORQ C;  4UCO A;  1GM8 A;  3AEI A;  4X89 A;  2PYL A;  5GON A;  5IJ9 B;  1SET A;  3ZHV A;  5B3S C;  2DYR C;  2LQT A;  3CS5 A;  5ITZ A;  4LFB B;  1R6T A;  4MW3 A;  1BT8 A;  3H1I H;  1NH2 B;  1PD3 A;  3WU2 Z;  4GX2 A;  4Z1V A;  1FXH A;  3OE7 G;  1LNQ A;  2LJ2 A;  2CTW A;  5IYC O;  2HHH B;  1PL0 A;  4XDL A;  1HNZ O;  3F5W C;  4DR7 B;  4LC1 A;  3A2F A;  1U97 A;  2XND G;  1Y74 B;  3JD0 A;  4I9W A;  2X0L A;  1IBL O;  3L74 H;  1K34 A;  2W0F C;  3UO3 A;  3ZHS A;  3RGB A;  1XNQ B;  2HVJ C;  2BTQ A;  3ASO C;  1S0V A;  1RM1 B;  5KA6 A;  4GKK B;  3BVO A;  3SJC C;  1US6 A;  1S77 D;  1EFR G;  2Z3Y A;  1I5Y A;  2WPD G;  1AP5 A;  3BFR A;  2ADP A;  5J2U B;  1IBM O;  2EZO A;  3ETQ A;  4LF8 O;  1O9H A;  2XAJ A;  4CS2 A;  1KKC A;  3P30 A;  4GLX A;  4LH7 A;  2WA4 A;  4O2B A;  1W59 A;  1N32 B;  1HP8 A;  2XTA A;  2K9P A;  2ADQ B;  3CHX A;  4F6R A;  4PA4 A;  2UXD O;  4IYH A;  4JYA B;  1K73 W; 
#chains in the Genus database with same CATH homology
 1K3E A;  3B77 A;  3CXC U;  4GT1 A;  4CBC A;  4PDL A;  3LDC A;  2WAM A;  1FXK A;  5EK0 A;  2A0L A;  4JTC B;  3SJQ C;  2Y69 C;  2HJF C;  2JJ1 G;  2WSS G;  3SPG A;  4WFB V;  1G4Y B;  5LHH A;  1IXM A;  4ASU G;  3STZ C;  2X6B A;  2R9R B;  3JD1 A;  1R3I C;  4X8A A;  2LFR A;  3CCL V;  4FK5 C;  3AG3 C;  3ZRV A;  3AG4 B;  4G2K A;  3ZRS A;  3ZN1 A;  4R6Z A;  1AI6 A;  1K92 A;  2GHY A;  2JDI G;  2P7T C;  1SES A;  3F7V C;  1P4R A;  2OT5 A;  1BHA A;  5B1A B;  1JOY A;  1GMG A;  1OCC B;  3ZCC A;  3W7S A;  1R3J C;  3CCV V;  3ASO B;  4WF9 V;  1L1F A;  4KFM A;  2ITD C;  3QO7 A;  3KG2 A;  1E1Q G;  3OUF A;  3FKS G;  4PA9 A;  2EIK B;  2XAH A;  4QE7 A;  1JQ0 A;  1YHQ V;  2DWD C;  2ZQM A;  4WFH A;  4U7N A;  5DN6 G;  3ABL C;  1THZ A;  2DQ3 A;  3ZMV A;  1M57 B;  1FXK B;  1K9M W;  5CA3 A;  4TWK A;  1UJW B;  1AI4 A;  4P2Z A;  3CYO A;  3MHH C;  1QCE A;  4QE9 A;  2D3O W;  3NXS A;  2Q67 A;  1N8R W;  2ZXW B;  3FYE B;  1AJP A;  1NBM G;  3QO8 A;  3F7Y C;  2M7W A;  2ZD9 A;  1R6N A;  2HFE C;  3SYO A;  3X2Q B;  3K79 A;  1H38 A;  2XAQ A;  4MTG A;  4MTX A;  2XAF A;  4HZ3 A;  1DF5 A;  3OFN G;  3ML0 A;  1RM1 C;  3D36 A;  1GK9 A;  3SYA A;  3T2M A;  3E35 A;  5DM6 V;  1ENV A;  1SZT A;  4KP4 A;  5KA5 A;  4UUJ C;  4Z1M G;  1AI5 A;  2IU3 A;  4L87 A;  2DWE C;  4LP8 A;  3E8B A;  1PNM A;  4ZBM A;  3K04 A;  2Q6A A;  2Q69 A;  1V55 B;  4QIW F;  1B6Q A;  3GWO A;  4Q20 A;  3CC2 V;  3ZMZ A;  1NJI W;  3GB7 C;  2A9H A;  3RBZ A;  3PJS K;  1RPO A;  2QE7 G;  3I56 V;  4F4L A;  3ZJZ A;  4BIU A;  1V54 C;  3E89 A;  4P9O A;  3AG3 B;  4MVR A;  5CMU A;  1OCR B;  1Q82 W;  1I5X A;  2NNU A;  2ZR3 A;  3VOU A;  3T4D A;  5LGT A;  1S5H C;  2WLK A;  3E83 A;  1GKF A;  1R73 A;  2AHZ A;  2IJI A;  4ZKI A;  2BOC C;  3CCE V;  1K5Q A;  4FMT A;  4WFF A;  2QEX V;  5B3S B;  2K1E A;  2P90 A;  1NR1 A;  2QM7 A;  3OGC C;  4FJC C;  2NLJ C;  1G8M A;  4GCZ A;  2IJH A;  5L3F A;  4H37 A;  1EBO A;  5LBQ A;  4G28 B;  3WFV A;  2YSU B;  4P30 A;  5LHG A;  1F51 A;  4JTD B;  2EIN B;  1OCC C;  4QPJ A;  1TUE B;  3W7T A;  2P67 A;  2P6J A;  1M56 B;  2HG5 C;  2IU0 A;  4MVS A;  3SPH A;  1KKD A;  1JCH A;  1QBZ A;  3ASN C;  2H8P C;  2WLL B;  2EZP A;  2IH1 C;  2ITC C;  2OCC C;  2HLD G;  1K33 A;  1FFT B;  5EBW C;  3G6E V;  2HKO A;  3OMA B;  4P9P A;  5L3B A;  1YTF B;  3CCJ V;  2YEV B;  3CP1 A;  4MW8 A;  3FB5 C;  1R3K C;  3OEH G;  4MVQ A;  2DYS B;  2DW4 A;  4RAI A;  3OAA G;  3MHS C;  1YJN V;  2QKS A;  2MK3 A;  3K9A A;  3M99 B;  3OEE G;  4KUM A;  2FTK A;  3BEH A;  3TK1 A;  3W7W A;  2W6J G;  3P32 A;  2IH3 C;  1VQ7 V;  3OUS A;  1NKD A;  4MT8 A;  3E8F A;  4G27 B;  5E1A C;  1OCR C;  5C93 A;  3JD4 A;  1YSC A;  4H33 A;  3R65 A;  1GM7 A;  1DF4 A;  2JEX A;  1AJQ A;  2WLI A;  4JF3 A;  5EC2 C;  4MS2 A;  1ZWI C;  1M57 C;  3E2E A;  3ABL B;  2WWW A;  1H8E G;  5CBF A;  4JGS A;  5CN0 A;  3T4Z A;  5IYB O;  2IW5 A;  1QVG U;  5H6R A;  1DTO A;  2IJJ A;  5L3D A;  5B1N A;  4WFE A;  3WG7 B;  2BOB C;  4J9Y B;  1RPR A;  1F23 A;  1Y4M A;  3CCU V;  4JYB A;  1DLB A;  1CPY A;  5FL7 G;  2QTO A;  5CBG A;  2XAG A;  3OMI B;  5B1A C;  4LCU C;  1YTF D;  3ZIA G;  3I55 V;  1MSW D;  4U7O A;  1S72 V;  1QR9 A;  4TT3 G;  1R3L C;  1M9N A;  3ZRW B;  5L3C A;  3AG1 B;  3BY6 A;  1VQ4 V;  1FXV A;  3G4S V;  2EBO A;  1ARO P;  2H94 A;  3LSS A;  4FIP C;  3ZMS A;  2EIL B;  1PNL A;  3G71 V;  3K0G A;  3K06 A;  1QVF U;  1YI2 V;  3LNM B;  1QLE C;  2Y48 A;  3B8M A;  1J95 A;  1M1K W;  2LFS A;  2ATK C;  4QNH B;  5L3G A;  1VQN V;  1VQL V;  3T1C A;  5LGU A;  1VQ8 V;  2EIN C;  4FPP A;  2EIM C;  3MD0 A;  3CME V;  1S76 D;  3SYC A;  1OCZ B;  2JEU A;  3D3I A;  1KQS U;  1Q86 W;  4GX0 A;  2PI5 A;  1MG1 A;  2C2A A;  2ZDI C;  3TET A;  1YIJ V;  4DXW A;  1VQO V;  4XDK A;  3H01 A;  3ZRW A;  1PKX A;  4LBE C;  1SER A;  3LSQ A;  3RVY A;  2AHY A;  4I5S A;  2CK3 G;  1QLE B;  3CD6 V;  1WLE A;  2HVK C;  3ETG A;  1COW G;  3DGE A;  3ZMT A;  1Y66 A;  4WFG A;  3UKM A;  3E8H A;  3ETE A;  3TCU A;  1E79 G;  4MTO A;  3K03 A;  1WPX A;  4UVB A;  5EC1 C;  3JD3 A;  5GW7 A;  5IYD O;  1KP2 A;  2ZXW C;  4X88 A;  1CP9 A;  2Y69 B;  3LDD A;  3SPJ A;  4JPR A;  5KUK A;  2WLH A;  1AJN A;  1VQM V;  1OCO B;  2EJR A;  3ABM B;  4PA7 A;  4UXN A;  3SYQ A;  4MVO A;  2OTJ V;  3A0R A;  3FB6 C;  1W0K G;  1V55 C;  1VQ5 V;  3JYC A;  1AI7 A;  4N23 A;  3ABU A;  3CPW U;  3OM3 B;  3DTU B;  5EBL C;  3WG7 C;  3K0D A;  2EIK C;  1QLN A;  4PDV A;  2X6A A;  4WFA V;  2XAS A;  3CCM V;  3W7X A;  4EKW A;  1HWY A;  1S3J A;  3IFX A;  1BL8 A;  1NR7 A;  1P7B A;  2V1D A;  4JAU A;  3FYI B;  4RUE A;  3OR7 C;  4DO2 A;  2JK5 C;  4GX5 A;  2W6I G;  2Z5U A;  2OCC B;  4BIZ A;  4PA6 A;  2EIJ C;  3B8N A;  3CCQ V;  3UM7 A;  5L3E A;  1KD1 W;  1XL4 A;  1F4M A;  1JJ2 U;  4QPK A;  4HAM A;  4XDJ A;  2LP7 A;  2B5U A;  2A79 B;  2EIJ B;  5B1O A;  4OXS A;  2IJK A;  2WLJ A;  2QM8 A;  3IGA C;  2KB1 A;  3LDE A;  4XBF A;  2UXN A;  1YIT V;  1GO3 F;  4JAS A;  4MSW C;  2WLI B;  1E1R G;  1MOF A;  1K4C C;  2B1G A;  3RW0 A;  4YXW G;  2QA4 V;  4MVZ A;  3ABT A;  4GX1 A;  2XOK G;  1VQ6 V;  3SYP A;  1XL6 A;  4PEL A;  3IC7 A;  1H2G A;  3JD2 A;  4UV8 A;  1W0J G;  1NQT A;  3E8G A;  2DQ0 A;  3ABM C;  1GM9 A;  3SPC A;  3FB7 C;  3K3W A;  3ASN B;  5HFM A;  4RO2 A;  3CC4 V;  5H6Q A;  4CZZ A;  1VQK V;  1YJ9 V;  1M56 C;  4RUF A;  1KEC A;  3STL C;  3LUT B;  1ROP A;  4BW5 A;  1K5S A;  2Q68 A;  4N21 A;  3EFF K;  1ORQ C;  1GM8 A;  2YEV A;  3AEI A;  3HB3 B;  2ZDI A;  4HYO A;  2WLN A;  3AG2 B;  4X89 A;  1KP3 A;  3EHB B;  3ZN0 A;  1SET A;  3SPI A;  3HPL C;  4TSF G;  5B3S C;  3CC7 V;  4UV9 A;  2DYR C;  2DYR B;  1BHB A;  1VQ9 V;  3FB8 C;  2B1I A;  3CCS V;  2WLL A;  4PA3 A;  4J9Z B;  4MW3 A;  2F43 G;  1H8H G;  3ABK B;  3AG2 C;  1NH2 B;  1PD3 A;  3W7U A;  1OHH G;  5LHI A;  4MVM A;  3OR6 C;  1VQP V;  2JJ2 G;  4GX2 A;  1JVM A;  1V54 B;  1EZJ A;  5IY5 B;  1YJW V;  1FXH A;  3OE7 G;  1LNQ A;  2V7Q G;  4UVC A;  1Q81 W;  4WCE V;  1NH2 D;  4MVU A;  2R9I A;  2ZR2 A;  5IYC O;  1PL0 A;  4XDL A;  2X7R B;  3F5W C;  4JAV A;  5KUM A;  4LC1 A;  4R50 A;  2EIL C;  2XND G;  3ETD A;  3OW2 U;  1BMF G;  3JD0 A;  5IY5 C;  1Q7Y W;  3K08 A;  4I9W A;  2X0L A;  2JIZ G;  1JPX A;  3QO5 A;  2WLM A;  4R8C A;  1K34 A;  3OMN B;  2W0F C;  5LGN A;  4PDM A;  3AG1 C;  3ZRX A;  3RVZ A;  5EBM C;  1KC8 W;  2HVJ C;  1S0V A;  2UXX A;  3ASO C;  4JYC A;  1RM1 B;  3ABK C;  5KA6 A;  1F4N A;  1QR8 A;  5B1B C;  1S77 D;  3VBB A;  1EFR G;  2Z3Y A;  1I5Y A;  1FS0 G;  2WPD G;  5B1B B;  1OCO C;  3X2Q C;  3CCR V;  4UVA A;  1K8A W;  5BZB A;  2DYS C;  2EZO A;  3AG4 C;  3JCZ A;  5CBH A;  1NVP D;  1K97 A;  1OZ0 A;  1W2B U;  2XAJ A;  5HFL A;  1M90 W;  2GSM B;  4BAY A;  1GTO A;  3P30 A;  5H9C A;  1PNK A;  3E86 A;  1R6K A;  1FXK C;  1NVP B;  3CMA V;  2HR3 A;  4PDR A;  3QNE A;  4E2L A;  4R7C A;  5J9P C;  2PI4 A;  5IDJ A;  4MTF A;  4JTA B;  1JX9 A;  4QJF B;  1CEZ A;  1MAB G;  2X6C A;  1OCZ C;  4PA4 A;  3ZMU A;  4RQE A;  2EIM B;  1AR1 B;  2OTL V;  1SRY A;  1K7D A;  4RQF A;  1K4D C;  1K73 W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...