1VQ6V

The structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vq6V00
3CMAV 5DM6V 3CPWU 1VQ7V 1QVGU 1N8RW 1VQKV 1VQNV 3G4SV 3CCUV 1NJIW 4WCEV 1Q81W 1YJ9V 3CCEV 3CCQV 3CCSV 1K73W 1R73A 1JJ2U 3CC7V 2OTJV 3CCVV 3G71V 2QEXV 3I56V 2QA4V 1VQLV 1KC8W 2D3OW 4WFAV 1YITV 3CCMV 1VQOV 1YI2V 3OW2U 1K8AW 1VQPV 3CC2V 1QVFU 1KD1W 1S72V 1Q82W 1YHQV 3I55V 1M90W 1VQMV 1M1KW 3G6EV 1YIJV 3CCLV 1W2BU 1KQSU 4WF9V 1Q7YW 1YJWV 3CCRV 1VQ5V 3CCJV 1Q86W 1VQ9V 1VQ6V 3CMEV 3CXCU 1YJNV 1VQ4V 1VQ8V 1K9MW 3CD6V 4WFBV 2OTLV 3CC4V
chains in the Genus database with same CATH superfamily
3OGCC 1VQ7V 2N04A 4CC5A 4O2AA 5JJNB 4K8XA 3JAWB 3U0ZA 4KXRA 3FB7C 4MTFA 3OTOO 4YJ2B 2B1IA 5LP6A 5LOVB 4CBCA 3JD2A 3THOA 3CJHA 2WLLB 2YXYA 4EFEA 3SJBC 1FAFA 4PDVA 3B8NA 1RM1B 1L8DA 4DR5O 3HKEA 1QQCA 5ITZA 2V7QG 1GKFA 4F6RA 1W2BU 4O4JA 2AHZA 2WLKA 4JAVA 2WLHA 3JALA 3TETA 2ADPA 1DK1A 4FK5C 5KMGA 2P7TC 3PJSK 5KHHA 2UXCO 2AZ2A 3MHHC 4C7UA 1R73A 4BIUA 3W7SA 5BMVA 1HR0B 4LF7O 4JI5B 2ZT9B 1SQGA 5IYZA 1AJNA 4DV3B 2BCCH 2EIKC 4YIPA 4HNAA 3L72H 2DWDC 1Y4MA 4O2AB 2BTOA 2Q67A 1US6A 3ZRVA 4OPHA 5LP6B 4RUFA 4DV7O 1FD9A 4XBFA 3CYOA 3CJHB 1Y76B 4PDRA 2WLIB 4TQDA 4LFAB 1L0LH 3ETGA 1AJPA 3RYIA 2UU9B 3J7AU 5IJ9B 2ZE8A 1URFA 4YHHO 3HKEB 5ITZB 2XASA 3BHPA 4FLVA 4AHCA 4F6RB 3D3QA 1VEWA 4LF8B 1FKAO 1FYJA 1BCCH 3JALB 1N32O 1WNSA 4QE9A 2W6IG 1SQFA 4JF3A 5KMGB 4DV5O 2E5LB 2XAQA 1H2NA 3N2GB 2LO1A 3L70H 2DQ0A 3APQA 2KB1A 2XT9A 4MW3A 4YXWG 3ZHVA 2QWNB 5BMVB 3ZRXA 2QGNA 1BHAA 2EZPA 5IYZB 4MVRA 4DR1B 1HNXB 4RQFA 3PN1A 4HNAB 2ZE7A 5LMNO 2B5UA 1OCOB 2F4VO 3FYIB 1JVMA 3BCCH 2QWPB 1P7BA 1VQ4V 5CBGA 5LHGA 2PZSA 2YS8A 4IYHA 3RYFA 1EN5A 4PA4A 3CCVV 3T1YB 2OIGA 4I7ZB 3K08A 1NT2B 3C3SA 1S72V 4JV5B 1YHQV 2IJIA 4HBNA 2PF4E 5KA5A 3RYIB 1GM9A 2JVDA 3E8GA 4BAYA 2Q73A 2YICA 1K9MW 4WFGA 4NTXA 3S3WA 5LP6C 4UV8A 1I5YA 5CBHA 1WB8A 4ICGA 1JA8A 3ASOB 2HFEC 4U7OA 1BSMA 1XUQA 2XAFA 4FZ0A 3CWBH 3JATA 5LHHA 3K5LA 3K59A 3B09A 4A5UB 3DTUB 2JIZG 1TVKB 4IT5A 2YUAA 3WG7B 3LDDA 3N2KA 3F5TA 2VRZA 1G8MA 1QLEB 1SZTA 2QWOB 3CC4V 5CB4A 2EX3A 4Q6GA 3X2QB 4FFKA 1SA0B 3U11A 3ZRWB 1IBKB 2PUSA 1JJ2U 4DUYO 1IXMA 4B3SB 2Q6AA 3ZMTA 1G4YB 1R3LC 5L3FA 1MZFA 1BZKA 1E1QG 3OR6C 2YEVA 2WAMA 2CE4A 3MHSC 3KZIZ 4XDJA 3WU2Z 3OD4A 4UCUA 1F51A 1PKXA 2X6CA 5BR8B 3AG3B 4DV0O 4WFHA 1AR1B 4X1YA 1SKVA 1U97A 2AHYA 1DGSA 3MD0A 2Y4UA 1YI2V 3SYAA 1OCOC 1AR5A 4I0XA 2P90A 3ZMSA 4TSFG 2CTPA 1XNQO 4IYIA 1K97A 2W6JG 2CGOA 2DJVA 2JJ2G 2RN9A 1DTOA 3DC6A 3IAYA 1N0NA 1OCRB 4LNUA 4X1KB 4G28B 2OTJV 5EYPB 1CP9A 1IVSA 4F6EA 3N2KB 4X62O 1AI7A 4L87A 2ZNJA 5DECA 4DR7O 2XAJA 4LFBB 3H1IH 1DF5A 2OTLV 1BGYH 3ASOC 3AG7A 4JI8O 1Q81W 4PV1B 2UUAO 2W0FC 3ETEA 4FJCC 2ZIMA 1ZL8B 3LSSA 5B66Z 1AB3A 4PA6A 2AXTZ 5BR8O 3HKCA 3B8MA 1GN2A 1WA8B 2WLNA 1SETA 1QLEC 4PA3A 5GTIZ 5IYDO 4X1YB 3JSNA 1I94B 5EBMC 4JI1B 4X64B 1QR9A 1ROPA 3BEHA 2YDEA 4I0XB 2HHHO 4K3AA 4YY3B 3UT5A 1IBMO 4J80A 1QU7A 1AROP 3G6EV 4OX9B 1K4DC 2Q0OC 1EFRG 3OMAB 3CXCU 4UCRA 4LNUB 4HZ3A 2EZOA 3AG3C 1JMKC 5EBWC 2MW2B 2CTWA 2GHYA 1VMGA 1XILA 1H2KA 1ZLZA 3JCUZ 2B9ZA 5LMUB 1KD1W 4RUEA 3FB6C 1WB7A 3IFXA 4I5SA 4I55A 5LHIA 4IGGA 1K92A 4Z1MG 5LA6A 3E89A 3TXQA 4JTAB 3H01A 3RW0A 2R9AA 2Q8VA 2ZKOA 1XBLA 2NNUA 3L71H 4EB6B 4B3MB 4JI0O 3ZEDA 3HKCB 1N4CA 1IBLB 2AZ0A 2QSAA 5CN0A 5A9GA 1WP8A 5DN6G 4X64O 3I55V 3S3XA 3SJCC 2IU0A 4DK0A 2NLJC 1YTFB 4YY3O 3EHBB 3OMNB 3ZRSA 4N23A 1TA8A 3GWOA 2EJ7A 4BR6A 1QLNA 3ML0A 3BA9A 3ZN1A 3ABKB 5JCOA 4MVZA 5C8YA 5JJEB 3A0RA 2A79B 4Z2WA 4LFCO 2ZCEA 3LSQA 4W4KA 3ZN0A 4DUZB 4X1IA 5J2UB 2OCHA 1XQ8A 5LMUO 1Q5OA 4MT8A 2LGQA 2VQFO 2E76B 1THZA 3ASNB 3D3IA 4LC1A 4CZZA 4B3TO 4NVPA 1N34B 1MSDA 4LBEC 4I55B 4WFFA 5BZBA 4FLUA 2XAGA 2EINB 3APOA 2ZIOA 1KUQA 1IBLO 1YF2A 4G27B 4MVUA 5FNVA 1SQQH 4JYYA 4LF4O 3ABMB 1XL4A 4TQFA 1YTFD 4X20A 2VS0A 3IJ4A 2F95B 3RVYA 3BA8A 4J41A 3FAVA 1YIJV 1U96A 3T4DA 1S77D 4B3RO 1PNLA 4U3JA 2ODMA 3OM3B 2HVKC 2IJHA 2PGGA 3F7VC 3WB2A 4DUZO 5CA3A 1FXKB 2CUGA 4DXWA 3FKSG 3G71V 4RQEA 3ZJZA 2UUCO 3CC2V 3JAWA 5FPOA 1VQMV 4DK1A 1R3IC 2UXBO 2VQEO 5LOVA 4UUJC 1E1RG 2KQXA 4X9QA 3OTOB 2WLLA 1ZX3A 1QR8A 2HJFC 4FZ1A 4WCEV 3CSXA 2EBOA 2DN9A 4PI2A 4K35A 4LR3A 2ZINA 1VQOV 1K8AW 4P30A 3SYPA 4KFMA 1AJQA 1PL4A 3T1HO 4R6ZA 3ASNC 4X20B 4F4LA 4AQYO 3CMAV 4DR5B 2DYRB 3SYQA 1HW7A 1Y66A 2IW5A 2OYQA 2F43G 4MVQA 3FAVB 4NTWA 4FFBB 3CCMV 1V54B 2GUZA 3CRMA 2VWKA 2B1GA 3VBBA 1F23A 4K0KO 2Q7GA 4PDLA 3FD9A 3AG4B 2QKAA 1DF4A 3SYCA 2UXCB 3WB0A 1WN7A 3ABMC 5IWAO 2UUBO 2JS5A 4LF7B 5L3DA 1L1FA 3ABTA 4EKWA 3RYHA 2M7WA 3NR7A 1Y76A 3H9VA 2NR5A 4BIOA 5H2FZ 1LUWA 2EIJB 3QVNA 5JCOC 4DV7B 2WLIA 1YZBA 1FXKC 3CPWU 2HJDA 5L3GA 4LF6B 3VQYA 1IXBA 1Q90D 2ZQMA 4O2BB 1XNRO 3ICXA 2YXLA 5LL6Y 5IJ9A 3K03A 1JFFA 2YC0A 1I08A 1BE3H 4DR6B 2UXXA 4JZGA 4DV4O 5B1AB 1NR7A 1GMGA 4YHHB 3BAAA 1Q8IA 2QM4A 5B1OA 5EIBD 1KP2A 4ZHQB 2Z3YA 5LYJB 3CRCA 5TISZ 1N8RW 1NZ6A 3JASB 3QO7A 1FFXB 2GUZB 4KHPB 3N2GA 3JCZA 1N32B 1AI5A 1KU9A 4CH5A 1G6UA 4LH6A 4TV8B 1NTZH 3JD0A 4DV5B 3OAAG 3OW2U 3ZHRA 2X6AA 1V55B 3UO3A 5J2TB 3DC5A 5AG2A 3HB3B 5JVDA 2BTQA 5EBLC 3QO8A 5IE9A 2VWJA 1XREA 1ZSPA 2EILB 4EEQA 5LMNB 5CA1B 1GK9A 3RYHB 4PJ0Z 1V54C 3UCSC 2F4VB 3STLC 1N36O 5EIBC 4LF6O 2JGUA 3AG4C 3C3TA 3ABLB 1M93A 1M57B 4I4TA 1D5AA 5IT9N 1PD3A 5EC2C 3OT7A 4DR6O 4WFBV 2NN4A 4FVMA 1SERA 4UVBA 1K33A 1COWG 1JFFB 5LXTA 1VF6A 3E8HA 2QEXV 2IU3A 1NU1H 3JSLA 1YITV 4JYAO 2FTKA 2QJ1A 1GN6A 2A7WA 2LGWA 2RMKB 1QCEA 2EIJC 3K57A 4KHPO 3KG2A 3CCLV 1MABG 2XTAA 2RNBA 1SQXH 2DQ3A 1JOYA 4J42A 3ZMUA 3G80A 4GKJO 1XL6A 1TVKA 1VQNV 1RM1C 3K5MA 4N21A 1JR9A 5B1AC 3ZRWA 4ZI7B 1SA0A 2CGNA 3BRCA 4JTCB 1JPXA 5K1PA 2IJJA 3EXAA 5JVDB 1FFTB 2BTQB 2ZE6A 4JZ2A 2CAZC 2ZR3A 3CCJV 3UO2A 4DUYB 3CE2A 4D6TH 4E4EA 4B7KA 4DRXA 4TOIA 1ZTEA 3CCEV 3SYOA 1M9NA 5D5QA 5D5PA 1TGOA 3TK1A 4I4TB 3AG2B 3B77A 3HPLC 4FM0A 1V55C 4B08A 2KSDA 3GVMA 3BABA 3A2FA 2YIDA 4IL6Z 4DV0B 1BHBA 3JAMN 5LXTB 2EILC 3P32A 5DM6V 4B7EA 2F66C 3CXHF 2WLMA 3SR2C 5H9CA 3FFQA 1OCCB 3W7TA 2R70A 4X1KA 3ABLC 4UFZA 1XNQB 1M57C 2WLJA 4J7ZA 5EYPA 5LBQA 4GKKO 3DSQA 3CX5F 3NXSA 3BVOA 1HNZO 2A3QA 2YSUB 1BT8A 3SJAC 3OE7G 4TV9A 1P84F 3DXRA 1KKCA 2K1EA 4X62B 1GN3A 3F5WC 2M6YA 4GX1A 1OCZB 1Y6XA 4DR7B 2RDCA 2CTRA 4PELA 1ZL8A 4MSWC 3QF7A 4QJFB 4JI8B 4DR3O 4DRXB 3VOUA 2ZR2A 2CTQA 2UUAB 1WA8A 3LDEA 1AR4A 5GTHZ 2OIEA 1FJGO 1GM7A 1NH2B 2HEPA 2PYJA 3M7MX 2LW1A 3SPCA 2OCCB 2Y0PA 4KL1A 5LGUA 2E3CA 4CH3A 1H8HG 2PYLA 1NS1A 1W59A 3CP1A 2Y0IA 5L3EA 2EJRA 2HHHB 1FPOA 2F1MA 4O4HB 1KKDA 1IBMB 4OXSA 4FM1A 1H2GA 3AG2C 4P2ZA 3FYEB 2LJ2A 1FXVA 1KC8W 1PPJH 4OGQB 2QDOA 3RYCA 4Z1VA 3SPHA 1MZEA 4TV9B 3RT3C 3DXRB 1VF6C 1NKDA 2XUMA 2IH1C 4NR1A 3QTCA 2H94A 2DW4A 2P4VA 2RQ6A 1JQ0A 1SZXA 1NH2D 2Y69B 4EB6A 4AI8A 1HDJA 1RFYA 2Q4PA 3RN4A 1PL0A 3WG7C 1Q86W 1YCIA 4X65B 4O4LA 4JI0B 1I0HA 1M4UA 2ZE5A 3SPJA 3X2QC 3K58A 4UXNA 3Q4HA 4DV1O 1OCZC 5B5EZ 3KKYA 3VQXA 5K1XA 2JDIG 4QIWF 1S76D 4IIJB 4DR4O 2Z5UA 3QO5A 1Q82W 5KHIA 4X66B 5E1AC 3WB1A 1VQ6V 2E74B 4ASUG 2E75B 2OCCC 1NJIW 5J2UA 4J9YB 1P49A 4HAMA 1YSCA 3RYCB 5KX5A 4LFCB 2CH7B 2CK3G 3CC7V 1HP8A 2CDYA 2FL4A 1ORQC 1ZWIC 4DV6O 1I7FA 2VQFB 1PNMA 1ENVA 2ZD9A 4R50A 4JI4O 2ITCC 1SESA 5J9PC 4B3TB 2PI5A 1OCRC 3L74H 5IY5B 4X65O 1N0JA 5L3BA 1D2DA 4FM2A 1NVPB 1M56B 1RP3B 4WFAV 2KKWA 4NYKA 2QM7A 4O4LB 2ADQB 1P7GA 4LF4B 2XNDG 1YJWV 5CA0A 4YJ3A 1AILA 5LGNA 4NXMB 3IC9A 3Q4HB 1PV0A 2N05A 3OR7C 1GN4A 4X66O 3CCQV 4L8JA 2LW7A 2H3OA 1EM1A 2EIMB 2WA4A 2AGAA 4B3RB 1YEWA 4LWSB 1FXKA 1EBOA 1H2SB 3TCUA 5GONA 1AP5A 1R6KA 1TUEB 1M90W 1XEQA 4I9QA 3JD3A 3MAQA 5KX5B 1WJZA 2UXNA 2UUCB 4LF9B 2PTMA 5FLXN 1NQTA 4J11A 3ABUA 2VQEB 4QGPA 2UXBB 4DW1A 1XHXA 4NXNB 1S5JA 4DV2B 2JJ1G 3VQVA 1WP7A 4FLZA 4UCVA 4D7SA 1TUBB 2V4DA 2GTAA 3CCSV 4NXMO 4OPAA 3T1HB 2JGDB 3A0HZ 5CA0B 4XDKA 4YJ3B 1M5IA 4H33A 2Z0AA 4R8CA 4AQYB 1KBHA 4NTYA 1HNWO 4FLWA 4FFBA 1VQ9V 3A0BZ 1FXHA 4RAIA 1JX9A 2A06H 5IY5C 4BIZA 3E35A 2Q0AA 4GLXA 4W4LA 1M56C 5GONB 4K0KB 4GX2A 3ZX6A 4WBNA 4MVSA 2X7RB 2IM9A 3L9DA 2DOSA 4I9WA 3K06A 4LF9O 2YIAA 3HKDA 1VIBA 5CMUA 5IWAB 1YXBA 1WAZA 2D2CB 4GZRB 3T1CA 2UUBB 2WSSG 4JYCA 4K8ZA 4UCTA 5IJ0A 4NXNO 5H5NA 2ILMA 3M8AA 4NKGB 3LNMB 2P5OA 4DV2O 2EIMC 3ABKC 4GUNA 1MMMA 1K73W 1Y74B 2HKOA 4DR2O 4JI6B 4PHZA 3W7XA 1VQPV 1N33O 1XMOO 4O2BA 3MDSA 4P9OA 3K79A 1J5EO 2KG7B 5B3SB 3JAKA 4LP8A 3UKMA 1VQKV 1XNRB 4I50B 1H2MA 4TWKA 4DYLA 1FS0G 1SRYA 4H44B 4ZHQA 3STZC 4DV4B 4R7CA 4MTXA 2BOCC 3QG5A 5LYJA 5FPRA 2AW9A 4LCUC 3H1JH 3JASA 2EINC 2QM8A 1FFXA 5F2VO 1KYOF 2DYSB 4UV9A 3K9AA 1AP6A 5EZYA 4TV8A 2IJKA 1K4CC 1KECA 1GO3F 1H8EG 5KLVH 5EC1C 1CEZA 1K7DA 5B1BB 5J2TA 4WBNB 1OHHG 3EFFK 3JD1A 3RBZA 3ZHTA 2DMXA 2F23A 3HKDB 2D3OW 2LP7A 4UVAA 1GAXA 1IDSA 1B6QA 5CA1A 2F93B 4UCSA 4JI6O 2Q68A 2QR4A 1H2LA 5IJ0B 1Q6IA 4JI3B 1Z5VA 2FYUH 3AK1A 2ETNA 2L6LA 3D36A 1N36B 2LFRA 4GYCB 2N74A 3M99B 2YIBD 1WLEA 2QTOA 3OEEG 1K5QA 2ARHA 4E2LA 2O57A 3JAKB 1G1XB 3OUSA 1SC5B 5A2QN 3SGIA 4FPPA 3T4ZA 3E22A 1S5LZ 5C93A 2ZM6O 1D5NA 4CH4A 4JYAB 2UXDO 2HLDG 2P22C 5CBFA 3I56V 3RWRD 1QBZA 4BW9A 5EZYB 4YIOA 1OV9A 1QHTA 3K9SA 3KCYA 4JI2B 5KA6A 1IX9A 1B04A 4GKJB 1BQ0A 4GT1A 5B3SC 1MSWD 3ZMVA 2P4KA 4ZI7A 1XOUA 3W7WA 4DW0A 2DYRC 2JEUA 1EZJA 1QVGU 4CS4A 3G67A 4JI3O 4ZBMA 3OGIB 2QKCA 2DYSC 1PNKA 1S3JA 2JS3A 3TXSA 4JASA 2ZDIA 5BY1A 4KUMA 5B1NA 2C2AA 3E8BA 4JAUA 3LSUA 2XOKG 1O9HA 3LDCA 3TGUH 5B1BC 4FMTA 3JD4A 1I5XA 3K04A 3CRRA 4GCZA 2BE3A 4UB6Z 2GV9A 3TJTA 3CRAA 3ZCCA 4Q20A 4CS3A 3E22B 1NR1A 1AI6A 4JGSA 2DE0X 2EULA 4MTOA 1BS3A 4JTDB 4X8AA 3P3NA 4JI2O 1PP9H 4GKKB 4JPRA 2HG5C 4O4JB 4GX5A 2JEXA 1HNZB 4H37A 1BMFG 1BL8A 1P4RA 1KMIZ 1B06A 1EZVH 4LF5B 3IC7A 1HR0O 4JI5O 4J7KA 3CHXA 2FKXA 1VP7A 1T5EA 4DV3O 3DGEA 5H6RA 1Q43A 3J81N 2QE7G 5DEDA 5L3CA 2L35A 4DR3B 2R9IA 5GW7A 1KQSU 4PD4F 1Y67A 1SQBH 1FJGB 2A9HA 3SPGA 4UVCA 1UJWB 4MVMA 1YJNV 1IURA 1XDCA 1R3JC 5JJJB 1Z2GA 4MVOA 4LFAO 4JYBA 1YJ9V 2JRIA 2UU9O 2GSMB 4O4HA 1R6TA 2R9RB 3QNEA 4J10A 3D36C 4J7JA 2YXHA 3L73H 1WPBA 4HYOA 3LNNA 1IZ3A 5FL7G 4LF8O 3SPIA 1XMQB 4MTGA 1HWYA 1XI1A 2ZXWB 4LF5O 2XAHA 2E5LO 3SDLA 5KUMA 2JK5C 1VARA 1RPOA 2GTSA 5IYBO 3ZHSA 2ZNIA 5LGTA 3JYCA 4QPKA 1BQZA 4DR1O 2HP8A 1VQ5V 3CCRV 1HNXO 4PI0A 3CRQA 4AILC 1LUVA 4X89A 1SS3A 2HR3A 1UFIA 1LNQA 4FLYA 2X0LA 4RO2A 3KCXA 4U7NA 4P9PA 5JWPA 1R1BA 3K3WA 3SJQC 1CXZB 3ETDA 3AEIA 1DLBA 2WWWA 4TUYA 1SF9A 4CC6A 3J80N 2QKSA 3I5DA 4G2KA 3T1YO 1V9PA 4CH6A 4IIJA 4DV1B 3RYFB 4JV5O 3ZIAG 2ITDC 4QPJA 4DR4B 2ZDIC 1AVMA 2QWQB 3VQWA 2WPDG 2H8PC 3JARA 1XMQO 1VF5B 4PDMA 4O4IA 2Q5ZA 2CH7A 3E83A 1MNGA 4FLXA 3H1KH 4JAAA 3WFVA 2P6JA 2ATKC 3RFRA 3OEHG 1L0NH 1MOFA 2RJZA 3G6BA 1Q6HA 3JATB 3CCUV 4NB5A 1B3QA 4WFEA 1OCCC 4DV6B 4DO2A 2DWEC 1OZ0A 5KAFZ 1IBKO 4JI4B 3ZMZA 5CB4B 4B3SO 4QE7A 3RGBA 3AG1B 5BXZA 2MK3A 2ZXWC 4J9ZB 1ZAUA 1KP3A 4TUYB 2V1DA 4RWUA 2LFSA 2QA4V 2YEVB 1QVFU 2GDSA 2BSKA 4H0LB 1MA1A 4WF9V 2GBOA 4LWSA 4MS2A 4FIPC 5E79Z 5JQGA 2Q69A 1VQ8V 3HR0A 2X6BA 2P06A 5JH7A 3W7UA 1VQLV 2YI9A 4IHJA 3H1HH 2R72A 2IBZH 5KUKA 3JARB 1WPXA 2K9PA 1KB9F 4BW5A 3OTFA 1ZUQA 4O4IB 1GRJA 4XDLA 4TT3G 1GM8A 3AK2A 2W0XA 1MG1A 2Q7EA 1R6NA 2P67A 5HFMA 4GX0A 4EFBA 3B2EE 3G4SV 1K3EA 3C90A 4LFBO 1A32A 3BPZA 2OWOA 3A8TA 1TUBA 2WA3A 3K5OA 3ZHQA 3B40A 1M1KW 3FB8C 2JGDA 3ETQA 3UQ8A 3CB2A 1EN4A 4KP4A 2PY5A 3P3PA 1RSOA 4UCOA 3E86A 3GWKC 5IYCO 1W0KG 2Y48A 2BSKB 2Y69C 4U3FH 1HNWB 1I94O 2FMLA 5HFLA 1Q6UA 3OUFA 3R65A 5JQGB 4JI1O 3BY6A 3AG1C 3ZHUA 2QTSA 5JH7B 3P30A 3OMIB 4IHJB 4D7TA 1CPYA 2Y4TA 4JI7B 1O9GA 1F7YA 4OX9O 3R66A 5KHKA 3E8FA 1NTMH 1YDXA 3UT5B 1E79G 2OT5A 5KHGA 3CEIA 3OFNG 1Q3EA 3EVKA 1Y74A 4ZOLA 1NVPD 3ZBHA 3BFRA 4DR2B 3H1LH 1XHZA 2KG7A 1SQVH 4MW8A 1N33B 1XMOB 4UB8Z 3U10A 4I50A 3FB5C 2FB5A 4QNHB 1J5EB 1NTKH 2YIBA 1Z5WA 5H6QA 4B3MO 1J95A 2HVJC 5LA6B 3B4SA 3T2MA 3K0DA 1X59A 3FX7A 1LR1A 1RSOB 5KHJA 1F4MA 4PA7A 1S5HC 1PM9A 1UPGA 2Q9LA 4LH7A 4ZIBA 4CS2A 1GTOA 4JI7O 5KAIZ 2XHBA 3K0GA 2Q7HA 1JJOA 1YVWA 5IDJA 3O65A 5C8YB 3IGAC 3L75H 1JCHA 3HKBA 4ZOLB 1OJHA 4X1IB 3D8CA 1K34A 1QNMA 4YJ2A 4X88A 1W0JG 1F4NA 1RPRA 3CMEV 2LQTA 1N34O 2PI4A 3CD6V 1R3KC 2A0LA 2G38A 1SQPH 3ZS8C 5FNVB 1X4TA 2ZM6B 2RCVA 1S0VA 2UXDB 2BOBC 3N27A 3F7YC 2EIKB 4ZKIA 2YI8A 3CS5A 4PA9A 1AI4A 1GH6A 1NBMG 1TAEA 1H38A 2QWRB 4H13B 3E2EA 3RVZA 1NI8A 1VF7A 3GB7C 3AK3A 1EN6A 3K5NA 4U3JB 4BWAA 4ABMA 4FLTA 1Q7YW 3LUTB 5EK0A 1K5SA 3UM7A 2IH3C 3HKBB 3O9OA
chains in the Genus database with same CATH topology
3OGCC 2H94A 2DW4A 5H6RA 1THZA 1VQ7V 3ASNB 2QE7G 5L3CA 1JQ0A 3D3IA 3FB7C 4LC1A 4CZZA 4MTFA 1NH2D 2B1IA 2Y69B 2R9IA 4LBEC 5BZBA 4WFFA 4CBCA 3JD2A 2XAGA 5GW7A 2EINB 1PL0A 1KQSU 3WG7C 2WLLB 2A9HA 3SPGA 1Q86W 4UVCA 4G27B 4MVMA 4MVUA 1UJWB 1YJNV 3SPJA 3X2QC 1R3JC 4UXNA 4MVOA 3ABMB 1XL4A 4JYBA 1YJ9V 1YTFD 1OCZC 4PDVA 3B8NA 1RM1B 2GSMB 2JDIG 4QIWF 1S76D 2Z5UA 2R9RB 3QO5A 3RVYA 3QNEA 1Q82W 2V7QG 1GKFA 1YIJV 1W2BU 3T4DA 2AHZA 5E1AC 1S77D 2WLKA 4HYOA 1VQ6V 4JAVA 1PNLA 5FL7G 2WLHA 3SPIA 4ASUG 3TETA 3OM3B 4MTGA 1HWYA 2OCCC 2HVKC 2IJHA 4FK5C 2ZXWB 3F7VC 1NJIW 2P7TC 5CA3A 1FXKB 2XAHA 3PJSK 4HAMA 4J9YB 1YSCA 3MHHC 4DXWA 3FKSG 1R73A 2CK3G 4BIUA 3CC7V 5KUMA 3G71V 2JK5C 4RQEA 3ZJZA 1RPOA 3W7SA 5IYBO 3CC2V 1ORQC 1ZWIC 1AJNA 5LGTA 1VQMV 3JYCA 4QPKA 1PNMA 1ENVA 1R3IC 2EIKC 1VQ5V 3CCRV 2ZD9A 4R50A 4UUJC 2DWDC 2ITCC 1E1RG 4X89A 1Y4MA 1SESA 2HR3A 5J9PC 1LNQA 2PI5A 2WLLA 1OCRC 2Q67A 2X0LA 4RO2A 1QR8A 3ZRVA 4U7NA 2HJFC 4WCEV 4P9PA 5IY5B 2EBOA 4RUFA 3K3WA 4XBFA 5L3BA 3CYOA 3SJQC 3ETDA 1NVPB 3AEIA 1M56B 1DLBA 2WWWA 4WFAV 1VQOV 1K8AW 4P30A 4PDRA 2QKSA 2QM7A 2WLIB 3SYPA 4KFMA 4G2KA 1AJQA 2XNDG 1YJWV 5LGNA 4R6ZA 3ETGA 3ASNC 1AJPA 4F4LA 3OR7C 3CMAV 2DYRB 3ZIAG 2ITDC 4QPJA 2ZDIC 3SYQA 1Y66A 2IW5A 3CCQV 2XASA 2EIMB 2F43G 2WPDG 2H8PC 4MVQA 3CCMV 1V54B 1FXKA 4PDMA 1EBOA 2B1GA 3TCUA 3VBBA 1F23A 1R6KA 3E83A 1TUEB 1M90W 4PDLA 4QE9A 2W6IG 3AG4B 3JD3A 4JF3A 1DF4A 3SYCA 2XAQA 3ABMC 3WFVA 2P6JA 2ATKC 3OEHG 2DQ0A 2KB1A 1MOFA 4MW3A 2UXNA 3CCUV 4YXWG 4WFEA 5L3DA 1OCCC 1NQTA 3ZRXA 4DO2A 1BHAA 2EZPA 4MVRA 2DWEC 3ABTA 1L1FA 4RQFA 3ABUA 1OZ0A 4EKWA 2M7WA 3ZMZA 4QE7A 2B5UA 2JJ1G 1OCOB 2EIJB 3FYIB 1JVMA 3AG1B 1P7BA 1VQ4V 2WLIA 2MK3A 2ZXWC 4J9ZB 1FXKC 3CPWU 5CBGA 5L3GA 5LHGA 1KP3A 2V1DA 2ZQMA 3CCSV 4PA4A 2LFSA 3CCVV 2QA4V 2YEVB 3K08A 3K03A 1QVFU 4XDKA 4H33A 2UXXA 1S72V 5B1AB 4R8CA 1YHQV 2IJIA 5KA5A 1NR7A 4WF9V 1GMGA 1GM9A 1VQ9V 3E8GA 4FIPC 4MS2A 4BAYA 2Q69A 1FXHA 4RAIA 5B1OA 1KP2A 1VQ8V 1K9MW 3W7UA 2X6BA 1JX9A 2Z3YA 4WFGA 1VQLV 5IY5C 4UV8A 1I5YA 1N8RW 4BIZA 5KUKA 5CBHA 3QO7A 1WPXA 3ASOB 2HFEC 3E35A 4U7OA 4BW5A 1M56C 3JCZA 4GX2A 4XDLA 1AI5A 2XAFA 4MVSA 4TT3G 2X7RB 1GM8A 3JD0A 5LHHA 3OAAG 3OW2U 4I9WA 3K06A 2X6AA 1MG1A 5CMUA 1R6NA 1V55B 3T1CA 2WSSG 3DTUB 4JYCA 2JIZG 3HB3B 3WG7B 3LDDA 1G8MA 2P67A 5HFMA 1QLEB 1SZTA 5EBLC 3QO8A 4GX0A 3CC4V 3LNMB 3X2QB 3ZRWB 3G4SV 2EILB 1K3EA 2EIMC 3ABKC 1GK9A 1K73W 2HKOA 1JJ2U 1IXMA 1V54C 2Q6AA 3ZMTA 1G4YB 3STLC 3W7XA 1R3LC 5L3FA 1VQPV 1E1QG 3AG4C 3OR6C 1M1KW 3FB8C 4P9OA 3ABLB 2YEVA 1M57B 3K79A 5B3SB 2WAMA 4LP8A 1PD3A 5EC2C 3MHSC 4KP4A 3UKMA 4WFBV 1VQKV 4XDJA 1SERA 4UVBA 4TWKA 1F51A 1PKXA 2X6CA 1K33A 1FS0G 1SRYA 3E86A 1COWG 3AG3B 4WFHA 3STZC 1AR1B 1W0KG 5IYCO 2Y48A 4MTXA 4R7CA 2BOCC 2Y69C 3E8HA 2QEXV 2AHYA 2IU3A 3MD0A 4LCUC 5HFLA 1YITV 3OUFA 2FTKA 3R65A 1YI2V 2EINC 2QM8A 3SYAA 1OCOC 2DYSB 1QCEA 2EIJC 3BY6A 3AG1C 4UV9A 3K9AA 2P90A 3KG2A 3P30A 1MABG 3OMIB 3ZMSA 3CCLV 4TSFG 2IJKA 1K4CC 1KECA 2DQ3A 1CPYA 3ZMUA 1JOYA 1GO3F 1H8EG 1K97A 2W6JG 5EC1C 1XL6A 1CEZA 2JJ2G 1K7DA 5B1BB 1DTOA 1OHHG 3EFFK 3JD1A 3RBZA 1VQNV 3E8FA 1OCRB 1RM1C 1E79G 4G28B 4N21A 2OT5A 2OTJV 1CP9A 3OFNG 5B1AC 2LP7A 4UVAA 3ZRWA 2D3OW 4JTCB 1JPXA 1B6QA 2IJJA 1FFTB 1AI7A 4L87A 2Q68A 1NVPD 2ZR3A 3CCJV 2XAJA 1DF5A 2OTLV 3ASOC 3D36A 4MW8A 2LFRA 1Q81W 3CCEV 3SYOA 1M9NA 2W0FC 3ETEA 3M99B 4FJCC 3FB5C 3TK1A 3LSSA 1WLEA 2QTOA 4QNHB 3OEEG 1K5QA 5H6QA 3AG2B 3B77A 1J95A 2HVJC 1V55C 3HPLC 4PA6A 4E2LA 3T2MA 3B8MA 3K0DA 3OUSA 4FPPA 2WLNA 3T4ZA 1SETA 1QLEC 1F4MA 5C93A 4PA7A 1BHBA 4PA3A 5IYDO 1S5HC 2EILC 3P32A 5DM6V 2HLDG 5CBFA 2WLMA 5EBMC 1QR9A 5H9CA 1GTOA 1ROPA 3BEHA 1OCCB 3I56V 3W7TA 1QBZA 3ABLC 3K0GA 5KA6A 1M57C 4GT1A 5B3SC 2WLJA 5LBQA 1MSWD 1AROP 3ZMVA 3G6EV 1K4DC 3NXSA 1EFRG 3OMAB 3CXCU 5IDJA 2YSUB 3W7WA 4HZ3A 3OE7G 2DYRC 2JEUA 2EZOA 3AG3C 5EBWC 1EZJA 1QVGU 3IGAC 2K1EA 1JCHA 4ZBMA 2GHYA 3F5WC 4GX1A 2DYSC 1OCZB 1PNKA 1S3JA 1KD1W 4JASA 4RUEA 1K34A 2ZDIA 3FB6C 4PELA 4X88A 1W0JG 3IFXA 4KUMA 5B1NA 2C2AA 3E8BA 4JAUA 4I5SA 4MSWC 1F4NA 4QJFB 1RPRA 5LHIA 3CMEV 1K92A 2XOKG 4Z1MG 3VOUA 2ZR2A 3E89A 3LDCA 2PI4A 5B1BC 4JTAB 3CD6V 3H01A 3LDEA 4FMTA 3RW0A 1R3KC 3JD4A 1GM7A 2A0LA 1NH2B 1I5XA 2NNUA 3K04A 3SPCA 2OCCB 4GCZA 5LGUA 3ZCCA 4Q20A 5CN0A 1H8HG 1NR1A 1AI6A 4JGSA 5DN6G 3I55V 1S0VA 2IU0A 2BOBC 4MTOA 4JTDB 3F7YC 4X8AA 2EIKB 4ZKIA 2NLJC 3CP1A 1YTFB 3EHBB 3OMNB 3ZRSA 4PA9A 1AI4A 1NBMG 4N23A 5L3EA 2EJRA 3GWOA 1H38A 3E2EA 1QLNA 3ML0A 1KKDA 3RVZA 3ABKB 4OXSA 3ZN1A 4MVZA 1H2GA 3AG2C 4P2ZA 3FYEB 3GB7C 4JPRA 1FXVA 2HG5C 1KC8W 3A0RA 4GX5A 2JEXA 4H37A 1BMFG 3SPHA 1BL8A 2A79B 1P4RA 1Q7YW 3LUTB 3LSQA 3ZN0A 3IC7A 5EK0A 1K5SA 1NKDA 3UM7A 2IH3C 2IH1C 4MT8A 3DGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA V;  5DM6 V;  3CPW U;  1VQ7 V;  1QVG U;  1N8R W;  1VQK V;  1VQN V;  3G4S V;  3CCU V;  1NJI W;  4WCE V;  1Q81 W;  1YJ9 V;  3CCE V;  3CCQ V;  3CCS V;  1K73 W;  1R73 A;  1JJ2 U;  3CC7 V;  2OTJ V;  3CCV V;  3G71 V;  2QEX V;  3I56 V;  2QA4 V;  1VQL V;  1KC8 W;  2D3O W;  4WFA V;  1YIT V;  3CCM V;  1VQO V;  1YI2 V;  3OW2 U;  1K8A W;  1VQP V;  3CC2 V;  1QVF U;  1KD1 W;  1S72 V;  1Q82 W;  1YHQ V;  3I55 V;  1M90 W;  1VQM V;  1M1K W;  3G6E V;  1YIJ V;  3CCL V;  1W2B U;  1KQS U;  4WF9 V;  1Q7Y W;  1YJW V;  3CCR V;  1VQ5 V;  3CCJ V;  1Q86 W;  1VQ9 V;  1VQ6 V;  3CME V;  3CXC U;  1YJN V;  1VQ4 V;  1VQ8 V;  1K9M W;  3CD6 V;  4WFB V;  2OTL V;  3CC4 V; 
#chains in the Genus database with same CATH topology
 3OGC C;  1VQ7 V;  2N04 A;  4CC5 A;  4O2A A;  5JJN B;  4K8X A;  3JAW B;  3U0Z A;  4KXR A;  3FB7 C;  4MTF A;  3OTO O;  4YJ2 B;  2B1I A;  5LP6 A;  5LOV B;  4CBC A;  3JD2 A;  3THO A;  3CJH A;  2WLL B;  2YXY A;  4EFE A;  3SJB C;  1FAF A;  4PDV A;  3B8N A;  1RM1 B;  1L8D A;  4DR5 O;  3HKE A;  1QQC A;  5ITZ A;  2V7Q G;  1GKF A;  4F6R A;  1W2B U;  4O4J A;  2AHZ A;  2WLK A;  4JAV A;  2WLH A;  3JAL A;  3TET A;  2ADP A;  1DK1 A;  4FK5 C;  5KMG A;  2P7T C;  3PJS K;  5KHH A;  2UXC O;  2AZ2 A;  3MHH C;  4C7U A;  1R73 A;  4BIU A;  3W7S A;  5BMV A;  1HR0 B;  4LF7 O;  4JI5 B;  2ZT9 B;  1SQG A;  5IYZ A;  1AJN A;  4DV3 B;  2BCC H;  2EIK C;  4YIP A;  4HNA A;  3L72 H;  2DWD C;  1Y4M A;  4O2A B;  2BTO A;  2Q67 A;  1US6 A;  3ZRV A;  4OPH A;  5LP6 B;  4RUF A;  4DV7 O;  1FD9 A;  4XBF A;  3CYO A;  3CJH B;  1Y76 B;  4PDR A;  2WLI B;  4TQD A;  4LFA B;  1L0L H;  3ETG A;  1AJP A;  3RYI A;  2UU9 B;  3J7A U;  5IJ9 B;  2ZE8 A;  1URF A;  4YHH O;  3HKE B;  5ITZ B;  2XAS A;  3BHP A;  4FLV A;  4AHC A;  4F6R B;  3D3Q A;  1VEW A;  4LF8 B;  1FKA O;  1FYJ A;  1BCC H;  3JAL B;  1N32 O;  1WNS A;  4QE9 A;  2W6I G;  1SQF A;  4JF3 A;  5KMG B;  4DV5 O;  2E5L B;  2XAQ A;  1H2N A;  3N2G B;  2LO1 A;  3L70 H;  2DQ0 A;  3APQ A;  2KB1 A;  2XT9 A;  4MW3 A;  4YXW G;  3ZHV A;  2QWN B;  5BMV B;  3ZRX A;  2QGN A;  1BHA A;  2EZP A;  5IYZ B;  4MVR A;  4DR1 B;  1HNX B;  4RQF A;  3PN1 A;  4HNA B;  2ZE7 A;  5LMN O;  2B5U A;  1OCO B;  2F4V O;  3FYI B;  1JVM A;  3BCC H;  2QWP B;  1P7B A;  1VQ4 V;  5CBG A;  5LHG A;  2PZS A;  2YS8 A;  4IYH A;  3RYF A;  1EN5 A;  4PA4 A;  3CCV V;  3T1Y B;  2OIG A;  4I7Z B;  3K08 A;  1NT2 B;  3C3S A;  1S72 V;  4JV5 B;  1YHQ V;  2IJI A;  4HBN A;  2PF4 E;  5KA5 A;  3RYI B;  1GM9 A;  2JVD A;  3E8G A;  4BAY A;  2Q73 A;  2YIC A;  1K9M W;  4WFG A;  4NTX A;  3S3W A;  5LP6 C;  4UV8 A;  1I5Y A;  5CBH A;  1WB8 A;  4ICG A;  1JA8 A;  3ASO B;  2HFE C;  4U7O A;  1BSM A;  1XUQ A;  2XAF A;  4FZ0 A;  3CWB H;  3JAT A;  5LHH A;  3K5L A;  3K59 A;  3B09 A;  4A5U B;  3DTU B;  2JIZ G;  1TVK B;  4IT5 A;  2YUA A;  3WG7 B;  3LDD A;  3N2K A;  3F5T A;  2VRZ A;  1G8M A;  1QLE B;  1SZT A;  2QWO B;  3CC4 V;  5CB4 A;  2EX3 A;  4Q6G A;  3X2Q B;  4FFK A;  1SA0 B;  3U11 A;  3ZRW B;  1IBK B;  2PUS A;  1JJ2 U;  4DUY O;  1IXM A;  4B3S B;  2Q6A A;  3ZMT A;  1G4Y B;  1R3L C;  5L3F A;  1MZF A;  1BZK A;  1E1Q G;  3OR6 C;  2YEV A;  2WAM A;  2CE4 A;  3MHS C;  3KZI Z;  4XDJ A;  3WU2 Z;  3OD4 A;  4UCU A;  1F51 A;  1PKX A;  2X6C A;  5BR8 B;  3AG3 B;  4DV0 O;  4WFH A;  1AR1 B;  4X1Y A;  1SKV A;  1U97 A;  2AHY A;  1DGS A;  3MD0 A;  2Y4U A;  1YI2 V;  3SYA A;  1OCO C;  1AR5 A;  4I0X A;  2P90 A;  3ZMS A;  4TSF G;  2CTP A;  1XNQ O;  4IYI A;  1K97 A;  2W6J G;  2CGO A;  2DJV A;  2JJ2 G;  2RN9 A;  1DTO A;  3DC6 A;  3IAY A;  1N0N A;  1OCR B;  4LNU A;  4X1K B;  4G28 B;  2OTJ V;  5EYP B;  1CP9 A;  1IVS A;  4F6E A;  3N2K B;  4X62 O;  1AI7 A;  4L87 A;  2ZNJ A;  5DEC A;  4DR7 O;  2XAJ A;  4LFB B;  3H1I H;  1DF5 A;  2OTL V;  1BGY H;  3ASO C;  3AG7 A;  4JI8 O;  1Q81 W;  4PV1 B;  2UUA O;  2W0F C;  3ETE A;  4FJC C;  2ZIM A;  1ZL8 B;  3LSS A;  5B66 Z;  1AB3 A;  4PA6 A;  2AXT Z;  5BR8 O;  3HKC A;  3B8M A;  1GN2 A;  1WA8 B;  2WLN A;  1SET A;  1QLE C;  4PA3 A;  5GTI Z;  5IYD O;  4X1Y B;  3JSN A;  1I94 B;  5EBM C;  4JI1 B;  4X64 B;  1QR9 A;  1ROP A;  3BEH A;  2YDE A;  4I0X B;  2HHH O;  4K3A A;  4YY3 B;  3UT5 A;  1IBM O;  4J80 A;  1QU7 A;  1ARO P;  3G6E V;  4OX9 B;  1K4D C;  2Q0O C;  1EFR G;  3OMA B;  3CXC U;  4UCR A;  4LNU B;  4HZ3 A;  2EZO A;  3AG3 C;  1JMK C;  5EBW C;  2MW2 B;  2CTW A;  2GHY A;  1VMG A;  1XIL A;  1H2K A;  1ZLZ A;  3JCU Z;  2B9Z A;  5LMU B;  1KD1 W;  4RUE A;  3FB6 C;  1WB7 A;  3IFX A;  4I5S A;  4I55 A;  5LHI A;  4IGG A;  1K92 A;  4Z1M G;  5LA6 A;  3E89 A;  3TXQ A;  4JTA B;  3H01 A;  3RW0 A;  2R9A A;  2Q8V A;  2ZKO A;  1XBL A;  2NNU A;  3L71 H;  4EB6 B;  4B3M B;  4JI0 O;  3ZED A;  3HKC B;  1N4C A;  1IBL B;  2AZ0 A;  2QSA A;  5CN0 A;  5A9G A;  1WP8 A;  5DN6 G;  4X64 O;  3I55 V;  3S3X A;  3SJC C;  2IU0 A;  4DK0 A;  2NLJ C;  1YTF B;  4YY3 O;  3EHB B;  3OMN B;  3ZRS A;  4N23 A;  1TA8 A;  3GWO A;  2EJ7 A;  4BR6 A;  1QLN A;  3ML0 A;  3BA9 A;  3ZN1 A;  3ABK B;  5JCO A;  4MVZ A;  5C8Y A;  5JJE B;  3A0R A;  2A79 B;  4Z2W A;  4LFC O;  2ZCE A;  3LSQ A;  4W4K A;  3ZN0 A;  4DUZ B;  4X1I A;  5J2U B;  2OCH A;  1XQ8 A;  5LMU O;  1Q5O A;  4MT8 A;  2LGQ A;  2VQF O;  2E76 B;  1THZ A;  3ASN B;  3D3I A;  4LC1 A;  4CZZ A;  4B3T O;  4NVP A;  1N34 B;  1MSD A;  4LBE C;  4I55 B;  4WFF A;  5BZB A;  4FLU A;  2XAG A;  2EIN B;  3APO A;  2ZIO A;  1KUQ A;  1IBL O;  1YF2 A;  4G27 B;  4MVU A;  5FNV A;  1SQQ H;  4JYY A;  4LF4 O;  3ABM B;  1XL4 A;  4TQF A;  1YTF D;  4X20 A;  2VS0 A;  3IJ4 A;  2F95 B;  3RVY A;  3BA8 A;  4J41 A;  3FAV A;  1YIJ V;  1U96 A;  3T4D A;  1S77 D;  4B3R O;  1PNL A;  4U3J A;  2ODM A;  3OM3 B;  2HVK C;  2IJH A;  2PGG A;  3F7V C;  3WB2 A;  4DUZ O;  5CA3 A;  1FXK B;  2CUG A;  4DXW A;  3FKS G;  3G71 V;  4RQE A;  3ZJZ A;  2UUC O;  3CC2 V;  3JAW A;  5FPO A;  1VQM V;  4DK1 A;  1R3I C;  2UXB O;  2VQE O;  5LOV A;  4UUJ C;  1E1R G;  2KQX A;  4X9Q A;  3OTO B;  2WLL A;  1ZX3 A;  1QR8 A;  2HJF C;  4FZ1 A;  4WCE V;  3CSX A;  2EBO A;  2DN9 A;  4PI2 A;  4K35 A;  4LR3 A;  2ZIN A;  1VQO V;  1K8A W;  4P30 A;  3SYP A;  4KFM A;  1AJQ A;  1PL4 A;  3T1H O;  4R6Z A;  3ASN C;  4X20 B;  4F4L A;  4AQY O;  3CMA V;  4DR5 B;  2DYR B;  3SYQ A;  1HW7 A;  1Y66 A;  2IW5 A;  2OYQ A;  2F43 G;  4MVQ A;  3FAV B;  4NTW A;  4FFB B;  3CCM V;  1V54 B;  2GUZ A;  3CRM A;  2VWK A;  2B1G A;  3VBB A;  1F23 A;  4K0K O;  2Q7G A;  4PDL A;  3FD9 A;  3AG4 B;  2QKA A;  1DF4 A;  3SYC A;  2UXC B;  3WB0 A;  1WN7 A;  3ABM C;  5IWA O;  2UUB O;  2JS5 A;  4LF7 B;  5L3D A;  1L1F A;  3ABT A;  4EKW A;  3RYH A;  2M7W A;  3NR7 A;  1Y76 A;  3H9V A;  2NR5 A;  4BIO A;  5H2F Z;  1LUW A;  2EIJ B;  3QVN A;  5JCO C;  4DV7 B;  2WLI A;  1YZB A;  1FXK C;  3CPW U;  2HJD A;  5L3G A;  4LF6 B;  3VQY A;  1IXB A;  1Q90 D;  2ZQM A;  4O2B B;  1XNR O;  3ICX A;  2YXL A;  5LL6 Y;  5IJ9 A;  3K03 A;  1JFF A;  2YC0 A;  1I08 A;  1BE3 H;  4DR6 B;  2UXX A;  4JZG A;  4DV4 O;  5B1A B;  1NR7 A;  1GMG A;  4YHH B;  3BAA A;  1Q8I A;  2QM4 A;  5B1O A;  5EIB D;  1KP2 A;  4ZHQ B;  2Z3Y A;  5LYJ B;  3CRC A;  5TIS Z;  1N8R W;  1NZ6 A;  3JAS B;  3QO7 A;  1FFX B;  2GUZ B;  4KHP B;  3N2G A;  3JCZ A;  1N32 B;  1AI5 A;  1KU9 A;  4CH5 A;  1G6U A;  4LH6 A;  4TV8 B;  1NTZ H;  3JD0 A;  4DV5 B;  3OAA G;  3OW2 U;  3ZHR A;  2X6A A;  1V55 B;  3UO3 A;  5J2T B;  3DC5 A;  5AG2 A;  3HB3 B;  5JVD A;  2BTQ A;  5EBL C;  3QO8 A;  5IE9 A;  2VWJ A;  1XRE A;  1ZSP A;  2EIL B;  4EEQ A;  5LMN B;  5CA1 B;  1GK9 A;  3RYH B;  4PJ0 Z;  1V54 C;  3UCS C;  2F4V B;  3STL C;  1N36 O;  5EIB C;  4LF6 O;  2JGU A;  3AG4 C;  3C3T A;  3ABL B;  1M93 A;  1M57 B;  4I4T A;  1D5A A;  5IT9 N;  1PD3 A;  5EC2 C;  3OT7 A;  4DR6 O;  4WFB V;  2NN4 A;  4FVM A;  1SER A;  4UVB A;  1K33 A;  1COW G;  1JFF B;  5LXT A;  1VF6 A;  3E8H A;  2QEX V;  2IU3 A;  1NU1 H;  3JSL A;  1YIT V;  4JYA O;  2FTK A;  2QJ1 A;  1GN6 A;  2A7W A;  2LGW A;  2RMK B;  1QCE A;  2EIJ C;  3K57 A;  4KHP O;  3KG2 A;  3CCL V;  1MAB G;  2XTA A;  2RNB A;  1SQX H;  2DQ3 A;  1JOY A;  4J42 A;  3ZMU A;  3G80 A;  4GKJ O;  1XL6 A;  1TVK A;  1VQN V;  1RM1 C;  3K5M A;  4N21 A;  1JR9 A;  5B1A C;  3ZRW A;  4ZI7 B;  1SA0 A;  2CGN A;  3BRC A;  4JTC B;  1JPX A;  5K1P A;  2IJJ A;  3EXA A;  5JVD B;  1FFT B;  2BTQ B;  2ZE6 A;  4JZ2 A;  2CAZ C;  2ZR3 A;  3CCJ V;  3UO2 A;  4DUY B;  3CE2 A;  4D6T H;  4E4E A;  4B7K A;  4DRX A;  4TOI A;  1ZTE A;  3CCE V;  3SYO A;  1M9N A;  5D5Q A;  5D5P A;  1TGO A;  3TK1 A;  4I4T B;  3AG2 B;  3B77 A;  3HPL C;  4FM0 A;  1V55 C;  4B08 A;  2KSD A;  3GVM A;  3BAB A;  3A2F A;  2YID A;  4IL6 Z;  4DV0 B;  1BHB A;  3JAM N;  5LXT B;  2EIL C;  3P32 A;  5DM6 V;  4B7E A;  2F66 C;  3CXH F;  2WLM A;  3SR2 C;  5H9C A;  3FFQ A;  1OCC B;  3W7T A;  2R70 A;  4X1K A;  3ABL C;  4UFZ A;  1XNQ B;  1M57 C;  2WLJ A;  4J7Z A;  5EYP A;  5LBQ A;  4GKK O;  3DSQ A;  3CX5 F;  3NXS A;  3BVO A;  1HNZ O;  2A3Q A;  2YSU B;  1BT8 A;  3SJA C;  3OE7 G;  4TV9 A;  1P84 F;  3DXR A;  1KKC A;  2K1E A;  4X62 B;  1GN3 A;  3F5W C;  2M6Y A;  4GX1 A;  1OCZ B;  1Y6X A;  4DR7 B;  2RDC A;  2CTR A;  4PEL A;  1ZL8 A;  4MSW C;  3QF7 A;  4QJF B;  4JI8 B;  4DR3 O;  4DRX B;  3VOU A;  2ZR2 A;  2CTQ A;  2UUA B;  1WA8 A;  3LDE A;  1AR4 A;  5GTH Z;  2OIE A;  1FJG O;  1GM7 A;  1NH2 B;  2HEP A;  2PYJ A;  3M7M X;  2LW1 A;  3SPC A;  2OCC B;  2Y0P A;  4KL1 A;  5LGU A;  2E3C A;  4CH3 A;  1H8H G;  2PYL A;  1NS1 A;  1W59 A;  3CP1 A;  2Y0I A;  5L3E A;  2EJR A;  2HHH B;  1FPO A;  2F1M A;  4O4H B;  1KKD A;  1IBM B;  4OXS A;  4FM1 A;  1H2G A;  3AG2 C;  4P2Z A;  3FYE B;  2LJ2 A;  1FXV A;  1KC8 W;  1PPJ H;  4OGQ B;  2QDO A;  3RYC A;  4Z1V A;  3SPH A;  1MZE A;  4TV9 B;  3RT3 C;  3DXR B;  1VF6 C;  1NKD A;  2XUM A;  2IH1 C;  4NR1 A;  3QTC A;  2H94 A;  2DW4 A;  2P4V A;  2RQ6 A;  1JQ0 A;  1SZX A;  1NH2 D;  2Y69 B;  4EB6 A;  4AI8 A;  1HDJ A;  1RFY A;  2Q4P A;  3RN4 A;  1PL0 A;  3WG7 C;  1Q86 W;  1YCI A;  4X65 B;  4O4L A;  4JI0 B;  1I0H A;  1M4U A;  2ZE5 A;  3SPJ A;  3X2Q C;  3K58 A;  4UXN A;  3Q4H A;  4DV1 O;  1OCZ C;  5B5E Z;  3KKY A;  3VQX A;  5K1X A;  2JDI G;  4QIW F;  1S76 D;  4IIJ B;  4DR4 O;  2Z5U A;  3QO5 A;  1Q82 W;  5KHI A;  4X66 B;  5E1A C;  3WB1 A;  1VQ6 V;  2E74 B;  4ASU G;  2E75 B;  2OCC C;  1NJI W;  5J2U A;  4J9Y B;  1P49 A;  4HAM A;  1YSC A;  3RYC B;  5KX5 A;  4LFC B;  2CH7 B;  2CK3 G;  3CC7 V;  1HP8 A;  2CDY A;  2FL4 A;  1ORQ C;  1ZWI C;  4DV6 O;  1I7F A;  2VQF B;  1PNM A;  1ENV A;  2ZD9 A;  4R50 A;  4JI4 O;  2ITC C;  1SES A;  5J9P C;  4B3T B;  2PI5 A;  1OCR C;  3L74 H;  5IY5 B;  4X65 O;  1N0J A;  5L3B A;  1D2D A;  4FM2 A;  1NVP B;  1M56 B;  1RP3 B;  4WFA V;  2KKW A;  4NYK A;  2QM7 A;  4O4L B;  2ADQ B;  1P7G A;  4LF4 B;  2XND G;  1YJW V;  5CA0 A;  4YJ3 A;  1AIL A;  5LGN A;  4NXM B;  3IC9 A;  3Q4H B;  1PV0 A;  2N05 A;  3OR7 C;  1GN4 A;  4X66 O;  3CCQ V;  4L8J A;  2LW7 A;  2H3O A;  1EM1 A;  2EIM B;  2WA4 A;  2AGA A;  4B3R B;  1YEW A;  4LWS B;  1FXK A;  1EBO A;  1H2S B;  3TCU A;  5GON A;  1AP5 A;  1R6K A;  1TUE B;  1M90 W;  1XEQ A;  4I9Q A;  3JD3 A;  3MAQ A;  5KX5 B;  1WJZ A;  2UXN A;  2UUC B;  4LF9 B;  2PTM A;  5FLX N;  1NQT A;  4J11 A;  3ABU A;  2VQE B;  4QGP A;  2UXB B;  4DW1 A;  1XHX A;  4NXN B;  1S5J A;  4DV2 B;  2JJ1 G;  3VQV A;  1WP7 A;  4FLZ A;  4UCV A;  4D7S A;  1TUB B;  2V4D A;  2GTA A;  3CCS V;  4NXM O;  4OPA A;  3T1H B;  2JGD B;  3A0H Z;  5CA0 B;  4XDK A;  4YJ3 B;  1M5I A;  4H33 A;  2Z0A A;  4R8C A;  4AQY B;  1KBH A;  4NTY A;  1HNW O;  4FLW A;  4FFB A;  1VQ9 V;  3A0B Z;  1FXH A;  4RAI A;  1JX9 A;  2A06 H;  5IY5 C;  4BIZ A;  3E35 A;  2Q0A A;  4GLX A;  4W4L A;  1M56 C;  5GON B;  4K0K B;  4GX2 A;  3ZX6 A;  4WBN A;  4MVS A;  2X7R B;  2IM9 A;  3L9D A;  2DOS A;  4I9W A;  3K06 A;  4LF9 O;  2YIA A;  3HKD A;  1VIB A;  5CMU A;  5IWA B;  1YXB A;  1WAZ A;  2D2C B;  4GZR B;  3T1C A;  2UUB B;  2WSS G;  4JYC A;  4K8Z A;  4UCT A;  5IJ0 A;  4NXN O;  5H5N A;  2ILM A;  3M8A A;  4NKG B;  3LNM B;  2P5O A;  4DV2 O;  2EIM C;  3ABK C;  4GUN A;  1MMM A;  1K73 W;  1Y74 B;  2HKO A;  4DR2 O;  4JI6 B;  4PHZ A;  3W7X A;  1VQP V;  1N33 O;  1XMO O;  4O2B A;  3MDS A;  4P9O A;  3K79 A;  1J5E O;  2KG7 B;  5B3S B;  3JAK A;  4LP8 A;  3UKM A;  1VQK V;  1XNR B;  4I50 B;  1H2M A;  4TWK A;  4DYL A;  1FS0 G;  1SRY A;  4H44 B;  4ZHQ A;  3STZ C;  4DV4 B;  4R7C A;  4MTX A;  2BOC C;  3QG5 A;  5LYJ A;  5FPR A;  2AW9 A;  4LCU C;  3H1J H;  3JAS A;  2EIN C;  2QM8 A;  1FFX A;  5F2V O;  1KYO F;  2DYS B;  4UV9 A;  3K9A A;  1AP6 A;  5EZY A;  4TV8 A;  2IJK A;  1K4C C;  1KEC A;  1GO3 F;  1H8E G;  5KLV H;  5EC1 C;  1CEZ A;  1K7D A;  5B1B B;  5J2T A;  4WBN B;  1OHH G;  3EFF K;  3JD1 A;  3RBZ A;  3ZHT A;  2DMX A;  2F23 A;  3HKD B;  2D3O W;  2LP7 A;  4UVA A;  1GAX A;  1IDS A;  1B6Q A;  5CA1 A;  2F93 B;  4UCS A;  4JI6 O;  2Q68 A;  2QR4 A;  1H2L A;  5IJ0 B;  1Q6I A;  4JI3 B;  1Z5V A;  2FYU H;  3AK1 A;  2ETN A;  2L6L A;  3D36 A;  1N36 B;  2LFR A;  4GYC B;  2N74 A;  3M99 B;  2YIB D;  1WLE A;  2QTO A;  3OEE G;  1K5Q A;  2ARH A;  4E2L A;  2O57 A;  3JAK B;  1G1X B;  3OUS A;  1SC5 B;  5A2Q N;  3SGI A;  4FPP A;  3T4Z A;  3E22 A;  1S5L Z;  5C93 A;  2ZM6 O;  1D5N A;  4CH4 A;  4JYA B;  2UXD O;  2HLD G;  2P22 C;  5CBF A;  3I56 V;  3RWR D;  1QBZ A;  4BW9 A;  5EZY B;  4YIO A;  1OV9 A;  1QHT A;  3K9S A;  3KCY A;  4JI2 B;  5KA6 A;  1IX9 A;  1B04 A;  4GKJ B;  1BQ0 A;  4GT1 A;  5B3S C;  1MSW D;  3ZMV A;  2P4K A;  4ZI7 A;  1XOU A;  3W7W A;  4DW0 A;  2DYR C;  2JEU A;  1EZJ A;  1QVG U;  4CS4 A;  3G67 A;  4JI3 O;  4ZBM A;  3OGI B;  2QKC A;  2DYS C;  1PNK A;  1S3J A;  2JS3 A;  3TXS A;  4JAS A;  2ZDI A;  5BY1 A;  4KUM A;  5B1N A;  2C2A A;  3E8B A;  4JAU A;  3LSU A;  2XOK G;  1O9H A;  3LDC A;  3TGU H;  5B1B C;  4FMT A;  3JD4 A;  1I5X A;  3K04 A;  3CRR A;  4GCZ A;  2BE3 A;  4UB6 Z;  2GV9 A;  3TJT A;  3CRA A;  3ZCC A;  4Q20 A;  4CS3 A;  3E22 B;  1NR1 A;  1AI6 A;  4JGS A;  2DE0 X;  2EUL A;  4MTO A;  1BS3 A;  4JTD B;  4X8A A;  3P3N A;  4JI2 O;  1PP9 H;  4GKK B;  4JPR A;  2HG5 C;  4O4J B;  4GX5 A;  2JEX A;  1HNZ B;  4H37 A;  1BMF G;  1BL8 A;  1P4R A;  1KMI Z;  1B06 A;  1EZV H;  4LF5 B;  3IC7 A;  1HR0 O;  4JI5 O;  4J7K A;  3CHX A;  2FKX A;  1VP7 A;  1T5E A;  4DV3 O;  3DGE A;  5H6R A;  1Q43 A;  3J81 N;  2QE7 G;  5DED A;  5L3C A;  2L35 A;  4DR3 B;  2R9I A;  5GW7 A;  1KQS U;  4PD4 F;  1Y67 A;  1SQB H;  1FJG B;  2A9H A;  3SPG A;  4UVC A;  1UJW B;  4MVM A;  1YJN V;  1IUR A;  1XDC A;  1R3J C;  5JJJ B;  1Z2G A;  4MVO A;  4LFA O;  4JYB A;  1YJ9 V;  2JRI A;  2UU9 O;  2GSM B;  4O4H A;  1R6T A;  2R9R B;  3QNE A;  4J10 A;  3D36 C;  4J7J A;  2YXH A;  3L73 H;  1WPB A;  4HYO A;  3LNN A;  1IZ3 A;  5FL7 G;  4LF8 O;  3SPI A;  1XMQ B;  4MTG A;  1HWY A;  1XI1 A;  2ZXW B;  4LF5 O;  2XAH A;  2E5L O;  3SDL A;  5KUM A;  2JK5 C;  1VAR A;  1RPO A;  2GTS A;  5IYB O;  3ZHS A;  2ZNI A;  5LGT A;  3JYC A;  4QPK A;  1BQZ A;  4DR1 O;  2HP8 A;  1VQ5 V;  3CCR V;  1HNX O;  4PI0 A;  3CRQ A;  4AIL C;  1LUV A;  4X89 A;  1SS3 A;  2HR3 A;  1UFI A;  1LNQ A;  4FLY A;  2X0L A;  4RO2 A;  3KCX A;  4U7N A;  4P9P A;  5JWP A;  1R1B A;  3K3W A;  3SJQ C;  1CXZ B;  3ETD A;  3AEI A;  1DLB A;  2WWW A;  4TUY A;  1SF9 A;  4CC6 A;  3J80 N;  2QKS A;  3I5D A;  4G2K A;  3T1Y O;  1V9P A;  4CH6 A;  4IIJ A;  4DV1 B;  3RYF B;  4JV5 O;  3ZIA G;  2ITD C;  4QPJ A;  4DR4 B;  2ZDI C;  1AVM A;  2QWQ B;  3VQW A;  2WPD G;  2H8P C;  3JAR A;  1XMQ O;  1VF5 B;  4PDM A;  4O4I A;  2Q5Z A;  2CH7 A;  3E83 A;  1MNG A;  4FLX A;  3H1K H;  4JAA A;  3WFV A;  2P6J A;  2ATK C;  3RFR A;  3OEH G;  1L0N H;  1MOF A;  2RJZ A;  3G6B A;  1Q6H A;  3JAT B;  3CCU V;  4NB5 A;  1B3Q A;  4WFE A;  1OCC C;  4DV6 B;  4DO2 A;  2DWE C;  1OZ0 A;  5KAF Z;  1IBK O;  4JI4 B;  3ZMZ A;  5CB4 B;  4B3S O;  4QE7 A;  3RGB A;  3AG1 B;  5BXZ A;  2MK3 A;  2ZXW C;  4J9Z B;  1ZAU A;  1KP3 A;  4TUY B;  2V1D A;  4RWU A;  2LFS A;  2QA4 V;  2YEV B;  1QVF U;  2GDS A;  2BSK A;  4H0L B;  1MA1 A;  4WF9 V;  2GBO A;  4LWS A;  4MS2 A;  4FIP C;  5E79 Z;  5JQG A;  2Q69 A;  1VQ8 V;  3HR0 A;  2X6B A;  2P06 A;  5JH7 A;  3W7U A;  1VQL V;  2YI9 A;  4IHJ A;  3H1H H;  2R72 A;  2IBZ H;  5KUK A;  3JAR B;  1WPX A;  2K9P A;  1KB9 F;  4BW5 A;  3OTF A;  1ZUQ A;  4O4I B;  1GRJ A;  4XDL A;  4TT3 G;  1GM8 A;  3AK2 A;  2W0X A;  1MG1 A;  2Q7E A;  1R6N A;  2P67 A;  5HFM A;  4GX0 A;  4EFB A;  3B2E E;  3G4S V;  1K3E A;  3C90 A;  4LFB O;  1A32 A;  3BPZ A;  2OWO A;  3A8T A;  1TUB A;  2WA3 A;  3K5O A;  3ZHQ A;  3B40 A;  1M1K W;  3FB8 C;  2JGD A;  3ETQ A;  3UQ8 A;  3CB2 A;  1EN4 A;  4KP4 A;  2PY5 A;  3P3P A;  1RSO A;  4UCO A;  3E86 A;  3GWK C;  5IYC O;  1W0K G;  2Y48 A;  2BSK B;  2Y69 C;  4U3F H;  1HNW B;  1I94 O;  2FML A;  5HFL A;  1Q6U A;  3OUF A;  3R65 A;  5JQG B;  4JI1 O;  3BY6 A;  3AG1 C;  3ZHU A;  2QTS A;  5JH7 B;  3P30 A;  3OMI B;  4IHJ B;  4D7T A;  1CPY A;  2Y4T A;  4JI7 B;  1O9G A;  1F7Y A;  4OX9 O;  3R66 A;  5KHK A;  3E8F A;  1NTM H;  1YDX A;  3UT5 B;  1E79 G;  2OT5 A;  5KHG A;  3CEI A;  3OFN G;  1Q3E A;  3EVK A;  1Y74 A;  4ZOL A;  1NVP D;  3ZBH A;  3BFR A;  4DR2 B;  3H1L H;  1XHZ A;  2KG7 A;  1SQV H;  4MW8 A;  1N33 B;  1XMO B;  4UB8 Z;  3U10 A;  4I50 A;  3FB5 C;  2FB5 A;  4QNH B;  1J5E B;  1NTK H;  2YIB A;  1Z5W A;  5H6Q A;  4B3M O;  1J95 A;  2HVJ C;  5LA6 B;  3B4S A;  3T2M A;  3K0D A;  1X59 A;  3FX7 A;  1LR1 A;  1RSO B;  5KHJ A;  1F4M A;  4PA7 A;  1S5H C;  1PM9 A;  1UPG A;  2Q9L A;  4LH7 A;  4ZIB A;  4CS2 A;  1GTO A;  4JI7 O;  5KAI Z;  2XHB A;  3K0G A;  2Q7H A;  1JJO A;  1YVW A;  5IDJ A;  3O65 A;  5C8Y B;  3IGA C;  3L75 H;  1JCH A;  3HKB A;  4ZOL B;  1OJH A;  4X1I B;  3D8C A;  1K34 A;  1QNM A;  4YJ2 A;  4X88 A;  1W0J G;  1F4N A;  1RPR A;  3CME V;  2LQT A;  1N34 O;  2PI4 A;  3CD6 V;  1R3K C;  2A0L A;  2G38 A;  1SQP H;  3ZS8 C;  5FNV B;  1X4T A;  2ZM6 B;  2RCV A;  1S0V A;  2UXD B;  2BOB C;  3N27 A;  3F7Y C;  2EIK B;  4ZKI A;  2YI8 A;  3CS5 A;  4PA9 A;  1AI4 A;  1GH6 A;  1NBM G;  1TAE A;  1H38 A;  2QWR B;  4H13 B;  3E2E A;  3RVZ A;  1NI8 A;  1VF7 A;  3GB7 C;  3AK3 A;  1EN6 A;  3K5N A;  4U3J B;  4BWA A;  4ABM A;  4FLT A;  1Q7Y W;  3LUT B;  5EK0 A;  1K5S A;  3UM7 A;  2IH3 C;  3HKB B;  3O9O A; 
#chains in the Genus database with same CATH homology
 3OGC C;  2H94 A;  2DW4 A;  5H6R A;  1THZ A;  1VQ7 V;  3ASN B;  2QE7 G;  5L3C A;  1JQ0 A;  3D3I A;  3FB7 C;  4LC1 A;  4CZZ A;  4MTF A;  1NH2 D;  2B1I A;  2Y69 B;  2R9I A;  4LBE C;  5BZB A;  4WFF A;  4CBC A;  3JD2 A;  2XAG A;  5GW7 A;  2EIN B;  1PL0 A;  1KQS U;  3WG7 C;  2WLL B;  2A9H A;  3SPG A;  1Q86 W;  4UVC A;  4G27 B;  4MVM A;  4MVU A;  1UJW B;  1YJN V;  3SPJ A;  3X2Q C;  1R3J C;  4UXN A;  4MVO A;  3ABM B;  1XL4 A;  4JYB A;  1YJ9 V;  1YTF D;  1OCZ C;  4PDV A;  3B8N A;  1RM1 B;  2GSM B;  2JDI G;  4QIW F;  1S76 D;  2Z5U A;  2R9R B;  3QO5 A;  3RVY A;  3QNE A;  1Q82 W;  2V7Q G;  1GKF A;  1YIJ V;  1W2B U;  3T4D A;  2AHZ A;  5E1A C;  1S77 D;  2WLK A;  4HYO A;  1VQ6 V;  4JAV A;  1PNL A;  5FL7 G;  2WLH A;  3SPI A;  4ASU G;  3TET A;  3OM3 B;  4MTG A;  1HWY A;  2OCC C;  2HVK C;  2IJH A;  4FK5 C;  2ZXW B;  3F7V C;  1NJI W;  2P7T C;  5CA3 A;  1FXK B;  2XAH A;  3PJS K;  4HAM A;  4J9Y B;  1YSC A;  3MHH C;  4DXW A;  3FKS G;  1R73 A;  2CK3 G;  4BIU A;  3CC7 V;  5KUM A;  3G71 V;  2JK5 C;  4RQE A;  3ZJZ A;  1RPO A;  3W7S A;  5IYB O;  3CC2 V;  1ORQ C;  1ZWI C;  1AJN A;  5LGT A;  1VQM V;  3JYC A;  4QPK A;  1PNM A;  1ENV A;  1R3I C;  2EIK C;  1VQ5 V;  3CCR V;  2ZD9 A;  4R50 A;  4UUJ C;  2DWD C;  2ITC C;  1E1R G;  4X89 A;  1Y4M A;  1SES A;  2HR3 A;  5J9P C;  1LNQ A;  2PI5 A;  2WLL A;  1OCR C;  2Q67 A;  2X0L A;  4RO2 A;  1QR8 A;  3ZRV A;  4U7N A;  2HJF C;  4WCE V;  4P9P A;  5IY5 B;  2EBO A;  4RUF A;  3K3W A;  4XBF A;  5L3B A;  3CYO A;  3SJQ C;  3ETD A;  1NVP B;  3AEI A;  1M56 B;  1DLB A;  2WWW A;  4WFA V;  1VQO V;  1K8A W;  4P30 A;  4PDR A;  2QKS A;  2QM7 A;  2WLI B;  3SYP A;  4KFM A;  4G2K A;  1AJQ A;  2XND G;  1YJW V;  5LGN A;  4R6Z A;  3ETG A;  3ASN C;  1AJP A;  4F4L A;  3OR7 C;  3CMA V;  2DYR B;  3ZIA G;  2ITD C;  4QPJ A;  2ZDI C;  3SYQ A;  1Y66 A;  2IW5 A;  3CCQ V;  2XAS A;  2EIM B;  2F43 G;  2WPD G;  2H8P C;  4MVQ A;  3CCM V;  1V54 B;  1FXK A;  4PDM A;  1EBO A;  2B1G A;  3TCU A;  3VBB A;  1F23 A;  1R6K A;  3E83 A;  1TUE B;  1M90 W;  4PDL A;  4QE9 A;  2W6I G;  3AG4 B;  3JD3 A;  4JF3 A;  1DF4 A;  3SYC A;  2XAQ A;  3ABM C;  3WFV A;  2P6J A;  2ATK C;  3OEH G;  2DQ0 A;  2KB1 A;  1MOF A;  4MW3 A;  2UXN A;  3CCU V;  4YXW G;  4WFE A;  5L3D A;  1OCC C;  1NQT A;  3ZRX A;  4DO2 A;  1BHA A;  2EZP A;  4MVR A;  2DWE C;  3ABT A;  1L1F A;  4RQF A;  3ABU A;  1OZ0 A;  4EKW A;  2M7W A;  3ZMZ A;  4QE7 A;  2B5U A;  2JJ1 G;  1OCO B;  2EIJ B;  3FYI B;  1JVM A;  3AG1 B;  1P7B A;  1VQ4 V;  2WLI A;  2MK3 A;  2ZXW C;  4J9Z B;  1FXK C;  3CPW U;  5CBG A;  5L3G A;  5LHG A;  1KP3 A;  2V1D A;  2ZQM A;  3CCS V;  4PA4 A;  2LFS A;  3CCV V;  2QA4 V;  2YEV B;  3K08 A;  3K03 A;  1QVF U;  4XDK A;  4H33 A;  2UXX A;  1S72 V;  5B1A B;  4R8C A;  1YHQ V;  2IJI A;  5KA5 A;  1NR7 A;  4WF9 V;  1GMG A;  1GM9 A;  1VQ9 V;  3E8G A;  4FIP C;  4MS2 A;  4BAY A;  2Q69 A;  1FXH A;  4RAI A;  5B1O A;  1KP2 A;  1VQ8 V;  1K9M W;  3W7U A;  2X6B A;  1JX9 A;  2Z3Y A;  4WFG A;  1VQL V;  5IY5 C;  4UV8 A;  1I5Y A;  1N8R W;  4BIZ A;  5KUK A;  5CBH A;  3QO7 A;  1WPX A;  3ASO B;  2HFE C;  3E35 A;  4U7O A;  4BW5 A;  1M56 C;  3JCZ A;  4GX2 A;  4XDL A;  1AI5 A;  2XAF A;  4MVS A;  4TT3 G;  2X7R B;  1GM8 A;  3JD0 A;  5LHH A;  3OAA G;  3OW2 U;  4I9W A;  3K06 A;  2X6A A;  1MG1 A;  5CMU A;  1R6N A;  1V55 B;  3T1C A;  2WSS G;  3DTU B;  4JYC A;  2JIZ G;  3HB3 B;  3WG7 B;  3LDD A;  1G8M A;  2P67 A;  5HFM A;  1QLE B;  1SZT A;  5EBL C;  3QO8 A;  4GX0 A;  3CC4 V;  3LNM B;  3X2Q B;  3ZRW B;  3G4S V;  2EIL B;  1K3E A;  2EIM C;  3ABK C;  1GK9 A;  1K73 W;  2HKO A;  1JJ2 U;  1IXM A;  1V54 C;  2Q6A A;  3ZMT A;  1G4Y B;  3STL C;  3W7X A;  1R3L C;  5L3F A;  1VQP V;  1E1Q G;  3AG4 C;  3OR6 C;  1M1K W;  3FB8 C;  4P9O A;  3ABL B;  2YEV A;  1M57 B;  3K79 A;  5B3S B;  2WAM A;  4LP8 A;  1PD3 A;  5EC2 C;  3MHS C;  4KP4 A;  3UKM A;  4WFB V;  1VQK V;  4XDJ A;  1SER A;  4UVB A;  4TWK A;  1F51 A;  1PKX A;  2X6C A;  1K33 A;  1FS0 G;  1SRY A;  3E86 A;  1COW G;  3AG3 B;  4WFH A;  3STZ C;  1AR1 B;  1W0K G;  5IYC O;  2Y48 A;  4MTX A;  4R7C A;  2BOC C;  2Y69 C;  3E8H A;  2QEX V;  2AHY A;  2IU3 A;  3MD0 A;  4LCU C;  5HFL A;  1YIT V;  3OUF A;  2FTK A;  3R65 A;  1YI2 V;  2EIN C;  2QM8 A;  3SYA A;  1OCO C;  2DYS B;  1QCE A;  2EIJ C;  3BY6 A;  3AG1 C;  4UV9 A;  3K9A A;  2P90 A;  3KG2 A;  3P30 A;  1MAB G;  3OMI B;  3ZMS A;  3CCL V;  4TSF G;  2IJK A;  1K4C C;  1KEC A;  2DQ3 A;  1CPY A;  3ZMU A;  1JOY A;  1GO3 F;  1H8E G;  1K97 A;  2W6J G;  5EC1 C;  1XL6 A;  1CEZ A;  2JJ2 G;  1K7D A;  5B1B B;  1DTO A;  1OHH G;  3EFF K;  3JD1 A;  3RBZ A;  1VQN V;  3E8F A;  1OCR B;  1RM1 C;  1E79 G;  4G28 B;  4N21 A;  2OT5 A;  2OTJ V;  1CP9 A;  3OFN G;  5B1A C;  2LP7 A;  4UVA A;  3ZRW A;  2D3O W;  4JTC B;  1JPX A;  1B6Q A;  2IJJ A;  1FFT B;  1AI7 A;  4L87 A;  2Q68 A;  1NVP D;  2ZR3 A;  3CCJ V;  2XAJ A;  1DF5 A;  2OTL V;  3ASO C;  3D36 A;  4MW8 A;  2LFR A;  1Q81 W;  3CCE V;  3SYO A;  1M9N A;  2W0F C;  3ETE A;  3M99 B;  4FJC C;  3FB5 C;  3TK1 A;  3LSS A;  1WLE A;  2QTO A;  4QNH B;  3OEE G;  1K5Q A;  5H6Q A;  3AG2 B;  3B77 A;  1J95 A;  2HVJ C;  1V55 C;  3HPL C;  4PA6 A;  4E2L A;  3T2M A;  3B8M A;  3K0D A;  3OUS A;  4FPP A;  2WLN A;  3T4Z A;  1SET A;  1QLE C;  1F4M A;  5C93 A;  4PA7 A;  1BHB A;  4PA3 A;  5IYD O;  1S5H C;  2EIL C;  3P32 A;  5DM6 V;  2HLD G;  5CBF A;  2WLM A;  5EBM C;  1QR9 A;  5H9C A;  1GTO A;  1ROP A;  3BEH A;  1OCC B;  3I56 V;  3W7T A;  1QBZ A;  3ABL C;  3K0G A;  5KA6 A;  1M57 C;  4GT1 A;  5B3S C;  2WLJ A;  5LBQ A;  1MSW D;  1ARO P;  3ZMV A;  3G6E V;  1K4D C;  3NXS A;  1EFR G;  3OMA B;  3CXC U;  5IDJ A;  2YSU B;  3W7W A;  4HZ3 A;  3OE7 G;  2DYR C;  2JEU A;  2EZO A;  3AG3 C;  5EBW C;  1EZJ A;  1QVG U;  3IGA C;  2K1E A;  1JCH A;  4ZBM A;  2GHY A;  3F5W C;  4GX1 A;  2DYS C;  1OCZ B;  1PNK A;  1S3J A;  1KD1 W;  4JAS A;  4RUE A;  1K34 A;  2ZDI A;  3FB6 C;  4PEL A;  4X88 A;  1W0J G;  3IFX A;  4KUM A;  5B1N A;  2C2A A;  3E8B A;  4JAU A;  4I5S A;  4MSW C;  1F4N A;  4QJF B;  1RPR A;  5LHI A;  3CME V;  1K92 A;  2XOK G;  4Z1M G;  3VOU A;  2ZR2 A;  3E89 A;  3LDC A;  2PI4 A;  5B1B C;  4JTA B;  3CD6 V;  3H01 A;  3LDE A;  4FMT A;  3RW0 A;  1R3K C;  3JD4 A;  1GM7 A;  2A0L A;  1NH2 B;  1I5X A;  2NNU A;  3K04 A;  3SPC A;  2OCC B;  4GCZ A;  5LGU A;  3ZCC A;  4Q20 A;  5CN0 A;  1H8H G;  1NR1 A;  1AI6 A;  4JGS A;  5DN6 G;  3I55 V;  1S0V A;  2IU0 A;  2BOB C;  4MTO A;  4JTD B;  3F7Y C;  4X8A A;  2EIK B;  4ZKI A;  2NLJ C;  3CP1 A;  1YTF B;  3EHB B;  3OMN B;  3ZRS A;  4PA9 A;  1AI4 A;  1NBM G;  4N23 A;  5L3E A;  2EJR A;  3GWO A;  1H38 A;  3E2E A;  1QLN A;  3ML0 A;  1KKD A;  3RVZ A;  3ABK B;  4OXS A;  3ZN1 A;  4MVZ A;  1H2G A;  3AG2 C;  4P2Z A;  3FYE B;  3GB7 C;  4JPR A;  1FXV A;  2HG5 C;  1KC8 W;  3A0R A;  4GX5 A;  2JEX A;  4H37 A;  1BMF G;  3SPH A;  1BL8 A;  2A79 B;  1P4R A;  1Q7Y W;  3LUT B;  3LSQ A;  3ZN0 A;  3IC7 A;  5EK0 A;  1K5S A;  1NKD A;  3UM7 A;  2IH3 C;  2IH1 C;  4MT8 A;  3DGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...