1VQ6V

The structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vq6V00
3CD6V 3CCEV 1VQOV 3CMAV 3CCQV 1QVFU 3CCVV 1YIJV 1N8RW 4WFBV 3CCLV 1VQ9V 1NJIW 2QEXV 3CCMV 1VQLV 1YITV 1M1KW 1QVGU 3OW2U 1K8AW 1VQ6V 1VQ7V 1JJ2U 5DM6V 1VQ8V 2OTJV 1KD1W 3CCUV 2OTLV 3G4SV 3CXCU 1YJWV 4WCEV 1VQPV 2D3OW 4WFAV 1K9MW 1Q7YW 3CC7V 3CMEV 1VQMV 1Q86W 1Q82W 3I55V 1YHQV 4WF9V 1YJNV 3CC2V 3CCRV 1VQNV 1KQSU 1VQKV 1K73W 3CCSV 3G71V 1VQ4V 1YJ9V 3CPWU 1R73A 1W2BU 1S72V 2QA4V 1YI2V 3I56V 1Q81W 1KC8W 1VQ5V 3G6EV 3CC4V 1M90W 3CCJV
chains in the Genus database with same CATH superfamily
2VWKA 3W7WA 3CJHB 1SERA 5J2TA 4DR7O 3CCLV 2PTMA 4JI4O 1XI1A 1R3JC 1KYOF 5IJ9B 4JASA 3OEEG 1AJNA 2QWOB 1VF6A 1WB7A 1IBKO 3K79A 1E1QG 3RYCA 1ORQC 1R6NA 3ZRWB 1G4YB 3KG2A 4NXMB 3KCYA 1P49A 2B1GA 2EILC 1ZWIC 1R6KA 5GW7A 2Q7HA 3I5DA 4X8AA 4DV3O 3AG4B 5L3EA 2AXTZ 2UUCO 2Z5UA 3TETA 3CCSV 2V1DA 3UM7A 2W0FC 5CA3A 5IE9A 1ENVA 2HJDA 1MABG 3D36C 5CA0A 1M1KW 1H2NA 2OCHA 4F6RA 2DJVA 1YCIA 2ZXWC 3SYPA 4C7UA 1VQMV 1SA0B 1WLEA 1Q5OA 1PNLA 2FKXA 4ZHQB 1NI8A 2B1IA 4IT5A 4Q6GA 1S3JA 3N2GA 1N34B 5C8YB 4LNUB 4BW9A 1OCRB 1B04A 5IY5C 2OCCB 4LFAO 3AG4C 3QO5A 4FM0A 2JS3A 3JD1A 4YY3B 4QJFB 3VQVA 1ZSPA 2GTAA 4LH6A 2PZSA 3ETQA 1L1FA 4HYOA 5CA1A 2EX3A 2EZPA 3DTUB 2Q5ZA 2UUBB 2RN9A 3WB0A 4G27B 4CH5A 5FPOA 3C3SA 2UXCO 4GKJB 4LWSB 4UUJC 2BSKA 5H6QA 3QO8A 1RPOA 3MD0A 4FIPC 4JZGA 2HHHO 4KL1A 1YJ9V 2AW9A 5IJ9A 3ABLB 1OCCB 4KXRA 2A06H 3VQYA 3ZCCA 4X62O 4XDKA 1Q43A 1N33O 3UO3A 3SJBC 4MTOA 5BR8B 2ODMA 2UUAB 3A0RA 5B1BC 3SJQC 3CC7V 1AR5A 3BPZA 2Q68A 4K8XA 1AP6A 3ICXA 3W7SA 3ZHTA 2Q73A 1PNKA 4YJ2B 4R6ZA 1Y74B 3SPIA 2ZE5A 3OE7G 2ZKOA 2BOBC 3BFRA 3WG7B 4I7ZB 4KUMA 1B6QA 1QR9A 2WLLA 2W0XA 3K3WA 2PYLA 5L3BA 1JVMA 2EJRA 1IVSA 3STZC 1U97A 2WPDG 3LDDA 4HNAB 1GM9A 1NU1H 2P06A 2WAMA 2E75B 5EC1C 4IL6Z 4J7ZA 1XNQO 3U0ZA 4J7JA 1WA8B 1K5SA 1NTKH 4H0LB 3CCMV 4DV2B 1JJ2U 1QLEC 4CH6A 1R3IC 2YI8A 4GX0A 4LFBO 2X6CA 3VBBA 2FTKA 2ZDIA 3JALA 4PDVA 4DV6B 1H8HG 5KX5B 4RAIA 1KP2A 2EIJC 4N21A 1FXHA 4GX5A 2BCCH 1RP3B 2CH7A 1YHQV 2Q8VA 2Q67A 1RPRA 2Q0OC 4Q20A 2QM8A 1BMFG 3ZN0A 1A32A 2P22C 1AILA 1HP8A 4MT8A 1Q3EA 3EXAA 1F23A 2WLJA 1H2KA 2Q7EA 2CK3G 5LBQA 3QTCA 2H94A 2EINC 2UXBB 2KQXA 4MVUA 4UV8A 3H1HH 1BS3A 3T1HO 3RVYA 3CCVV 4DRXA 3APQA 2CTRA 3DGEA 1ZTEA 1TGOA 4LFCO 3T1YO 1CPYA 2CTPA 4O4LB 2FMLA 4J9ZB 5GTIZ 4ZOLA 5FNVA 4TV9B 4QPJA 4LF8O 5A2QN 1VQ4V 1W2BU 5GTHZ 1HNXO 4JI8B 1K3EA 3E22B 2Y4UA 3CWBH 2RJZA 1AP5A 1NBMG 4PA7A 4WFHA 3P32A 4IHJB 4FLTA 1N32O 2EINB 3ETGA 4DXWA 1KBHA 2HG5C 4F6EA 3ZMVA 3SJAC 3W7XA 3W7UA 1GMGA 3SPJA 1K92A 3ZRVA 3BA8A 1GK9A 2BTQB 3T4ZA 2LQTA 1XQ8A 1YI2V 3BVOA 4HNAA 3ZHVA 3K5MA 2DOSA 3RYIB 5K1PA 2F93B 1CP9A 1URFA 2YXLA 4JAVA 2RMKB 4B3RO 1H8EG 4JGSA 5JCOA 2W6IG 5D5QA 1YVWA 2YS8A 3L70H 3M7MX 1H2LA 5LMUO 1WA8A 2QDOA 1XMQB 3CXHF 3VQXA 3SPGA 3JAKA 2EIMB 1U96A 3LSSA 3QG5A 4DR2O 5CN0A 4MVSA 2GTSA 1BZKA 3FD9A 1AI6A 3FYIB 4JI0O 2H8PC 3ZIAG 2P4KA 4DUYB 5L3CA 4JI3O 3G6BA 4DV4B 2JGDA 4JAAA 3EFFK 1L0NH 4XDLA 1FXKA 3MDSA 2JS5A 4L87A 5KHKA 5IT9N 2CGNA 1EFRG 2LP7A 2R9AA 1Q8IA 5JJNB 4IIJA 4DV0O 1GN4A 2XAJA 4Z1MG 1V55C 2JJ2G 2WLNA 4I50A 4FPPA 4NTWA 2GUZB 3RBZA 4X66B 1VF5B 2F95B 4HBNA 1IBLB 4LCUC 1GH6A 1ZAUA 3UCSC 3O65A 4W4LA 2D3OW 1K9MW 3BAAA 3C3TA 1YTFB 2G38A 3ZMZA 3RVZA 2EBOA 3ZMUA 3GWOA 4LBEC 4WFGA 2ZNJA 2DN9A 2AGAA 1JMKC 1W0KG 2F1MA 5KUKA 2AHZA 2YSUB 2XAHA 3QO7A 4JV5O 1QQCA 4JI1O 4TV9A 4ZBMA 1Q7YW 1HNZO 2DMXA 2EIKB 3ZMSA 4B3TO 3JASB 3CC2V 4NXNB 2EIMC 1PL0A 1P7BA 4X64B 1MZEA 4K8ZA 5IYCO 3SPCA 3FAVB 4FM2A 3D3QA 2BTQA 2RDCA 3K9SA 4IHJA 4BIZA 1AR4A 1S76D 4DR6O 4LR3A 4YHHO 2Z3YA 4PV1B 1Z2GA 5FLXN 1SQQH 1Y76A 1R3LC 2ZM6O 4LF4O 1AI4A 2CTQA 3OTOO 2HEPA 4J7KA 2OCCC 4DR5O 1SETA 2Q6AA 2YDEA 4EB6A 3ML0A 4MVQA 4O4JB 4X1YA 1AR1B 4JI8O 2P6JA 2WA4A 3K06A 1VQOV 1PNMA 4DV5O 5KX5A 1WJZA 1GN3A 3E86A 4K3AA 5J2UA 4PJ0Z 1F4MA 1EBOA 2MK3A 2CE4A 4WFAV 2HVJC 4I55A 4LFCB 1JFFA 1EZVH 1SQVH 5IYZA 1RM1B 3MHHC 3S3WA 5KA5A 4YXWG 1M56B 3AG1B 3T1HB 3CMAV 5KMGB 1D5AA 4K0KO 4U7NA 5HFLA 5EK0A 1K8AW 2XAFA 2E3CA 1NKDA 2QKAA 3RYHA 2KG7B 2IM9A 1FKAO 4O4IA 2F4VO 4GYCB 3JYCA 4LF6O 5IDJA 2GUZA 5IWAO 3IJ4A 1XMOO 4OPAA 1MNGA 2YEVB 1K4CC 2EULA 2VQFB 1E79G 2VQFO 2PUSA 2CUGA 1Y74A 3B77A 4FK5C 4DV5B 4ZOLB 2YIDA 3AK1A 5H9CA 5IYDO 2M6YA 2QKCA 4DR5B 1M56C 2HJFC 3AG7A 3CEIA 1Q6UA 5LMNB 2Y0PA 4I9WA 5B1AC 2B5UA 4JTAB 1P7GA 1Q90D 3BABA 2HP8A 2VS0A 5EZYB 3RT3C 4K0KB 1K73W 4AQYB 1KC8W 3F7YC 4J42A 4TUYB 1MA1A 2YIBD 1V54B 4PA9A 1G1XB 1QHTA 1TVKA 3TJTA 3KZIZ 1G6UA 1SESA 2XTAA 4B3RB 5IJ0A 3OMNB 3CX5F 2PY5A 2IJIA 3X2QC 1W0JG 1M9NA 4ABMA 1Q6IA 5F2VO 4LF5O 4P2ZA 2AZ0A 2ITCC 4XDJA 4J80A 4ZKIA 1M93A 2P5OA 3JAKB 2H3OA 1YEWA 4GX2A 4X1YB 3FYEB 2EIKC 1NR1A 2OIEA 4MVZA 3FX7A 4DK0A 1V9PA 3Q4HA 2ZM6B 2JK5C 1THZA 5J2UB 1N33B 2GHYA 3E89A 3BY6A 4YHHB 3TK1A 4DR6B 5E79Z 3L71H 4DV7B 4I55B 4Z1VA 4FMTA 4JAUA 1EZJA 5B3SC 4B7KA 3FB5C 4DV0B 3P3PA 5LGTA 2FYUH 5B1BB 5JQGB 1FXKB 2ILMA 1PV0A 5KLVH 4LWSA 1NVPB 1BSMA 1IXBA 4JI1B 1LNQA 5BXZA 1XMOB 1F4NA 4QE9A 3ZN1A 1OCCC 4OPHA 3BEHA 3ABLC 5EIBC 3ZJZA 4TT3G 2KG7A 4UVCA 1I7FA 1VEWA 4CS2A 3E8GA 5GONA 4GZRB 4DV4O 2B9ZA 3D8CA 3P30A 1B3QA 3QVNA 4IYHA 4PA6A 2Q69A 1S5JA 1PP9H 2UXBO 1XEQA 4NYKA 4O4LA 1AJQA 3HKEA 1YJNV 4GLXA 3VQWA 4X1IB 1VQKV 3JD4A 3E83A 2PI4A 2HKOA 4X66O 2QA4V 1BGYH 1IZ3A 3J81N 1M57B 4I0XB 2Y48A 4UFZA 1JOYA 2R9IA 4DUZB 1TUBB 1N8RW 3CS5A 3MAQA 3H1JH 4CZZA 1K7DA 4FZ1A 1L8DA 5IY5B 4RUEA 1H2GA 1LR1A 2QGNA 1VF7A 1XL4A 1XREA 3F5TA 2L6LA 3ABMC 1KQSU 1S77D 3JSNA 3M99B 5LXTA 2YI9A 1MOFA 1SQBH 2X6BA 1S72V 3JALB 2A79B 1GRJA 4DV7O 1VMGA 2LO1A 3FB7C 3L9DA 1GTOA 4WFEA 4LF6B 4I9QA 1VQ9V 2F4VB 4JTDB 3FB6C 2Q7GA 3RW0A 1BL8A 1N32B 2NN4A 2WSSG 5ITZA 4DUYO 3ASNC 1YF2A 5KHIA 1HDJA 4DV2O 1DF5A 3HKCB 2JEXA 2RQ6A 2QM7A 1B06A 3R65A 4FLWA 1D5NA 5LP6A 1FFTB 1K33A 4LP8A 1I0HA 4RQEA 2XHBA 1XMQO 4YIOA 5CB4A 5LMUB 1GKFA 4J11A 1N0JA 5D5PA 3T4DA 3CRAA 2OTJV 3ASOB 1LUVA 4YIPA 3HKDA 4BR6A 2JGDB 5IYZB 4JI4B 1CXZB 1GN6A 2F43G 4PDLA 2BE3A 5JH7A 1WAZA 1QLNA 5JQGA 3BRCA 1BE3H 1VQLV 2X7RB 4L8JA 1EM1A 2VRZA 3OTFA 5LMNO 1IBLO 1VARA 4ZI7A 3JATA 5EC2C 4AI8A 1QU7A 2YC0A 1Y6XA 2N05A 3CHXA 3CSXA 3CD6V 3CCEV 4PDRA 1YIJV 2DQ0A 5LA6B 2XUMA 4X1IA 3SYCA 3ZMTA 1GM8A 3WB2A 4GKJO 3PN1A 4DUZO 1FXVA 5IWAB 2WWWA 2GSMB 2NR5A 1BHBA 4UCOA 1FD9A 5JVDB 2OIGA 4JI3B 3ETDA 1L0LH 3AG3C 4LFBB 4GX1A 3H1IH 3K04A 3KKYA 4JI0B 1M4UA 2ARHA 1OJHA 3SYQA 3AEIA 1MSDA 2IW5A 1FAFA 4PI2A 5EZYA 4DR2B 4PD4F 2YXYA 4KHPB 4BIOA 1YXBA 2QSAA 4H37A 4ZHQA 2PGGA 3ABKB 4X9QA 1QCEA 1TVKB 3K08A 3E35A 5DECA 3ZRXA 3LNNA 5LXTB 5FL7G 2E74B 3UQ8A 4O4HA 2EJ7A 1I08A 4CC5A 1PKXA 4LNUA 4JI6O 2W6JG 4I4TA 3DXRB 1N36O 3I56V 4ICGA 3T2MA 1R3KC 3JD0A 1NTMH 2IU3A 3OTOB 4TQFA 1YITV 4JYBA 2UUAO 4FLUA 2PF4E 1KECA 1K97A 1COWG 3CRQA 1IDSA 3VOUA 1TA8A 3AG3B 2DYRC 2JJ1G 3JARB 4IIJB 4F4LA 2JDIG 1V54C 5CB4B 2K9PA 4LF5B 4NXMO 3HKBA 2WLIB 1VQ5V 3CC4V 4D7TA 2QWNB 1JA8A 1HNZB 1KMIZ 3ZX6A 2UXCB 2JEUA 2UU9O 1AB3A 2P7TC 3HB3B 2IJKA 1OCZB 4DRXB 3SPHA 3OAAG 2JGUA 5KUMA 4AQYO 1PL4A 3HPLC 3A0BZ 4R8CA 2JVDA 4NKGB 4A5UB 4FLZA 5FNVB 3ZHUA 3KCXA 3M8AA 2XASA 5IYBO 4YJ3B 4OX9O 3E8HA 3LSUA 3U11A 2R70A 5EBMC 4BIUA 1OCOC 3S3XA 1PPJH 3ZHSA 1Q81W 1EN6A 5B66Z 3UO2A 5CA0B 2WLLB 1SS3A 4TSFG 2YICA 1K4DC 1NQTA 1H2MA 5DM6V 2WLHA 1JCHA 4JF3A 4JTCB 4U3JB 4PI0A 3E8BA 3G67A 3H1LH 1Q6HA 3B40A 5A9GA 1EN5A 2YXHA 1WNSA 4R50A 1NVPD 3RGBA 5L3FA 3CCQV 2X6AA 4DV3B 4FLVA 1Z5WA 2OWOA 4I4TB 1NR7A 2Q9LA 3L74H 5L3DA 3OT7A 1FS0G 4JYYA 4PA3A 4WBNB 3CRCA 3DXRA 4BWAA 4DYLA 3ZS8C 5TISZ 1KD1W 4X20A 1Q86W 2DE0X 1M57C 4O4IB 4X65B 1SQFA 3G71V 1I94O 1WP8A 2EILB 2BOCC 4MVOA 4DV6O 3G80A 2WLMA 4G2KA 3RWRD 4AHCA 4LF4B 4B08A 5KHHA 3BHPA 3LUTB 1YJWV 4U7OA 1VQPV 3LDCA 3CP1A 1RSOA 3ZRSA 5LOVA 1R73A 4X64O 4ASUG 2HHHB 2EZOA 4LF8B 1XNQB 3N2KA 4FJCC 1M90W 1NJIW 4NXNO 2IH3C 4B3TB 4YJ3A 5LA6A 4P30A 4LF9O 1IBKB 2AHYA 4XBFA 3T1YB 1XUQA 2NLJC 4JV5B 4J9YB 2ATKC 4E2LA 4TWKA 3PJSK 2L35A 1JX9A 2VWJA 1N4CA 4GT1A 2IU0A 1ZL8B 1AROP 4UVAA 2JRIA 3LSQA 5BMVB 2Y69B 2E5LO 1IXMA 1FFXA 1BQ0A 1V55B 3QF7A 4YY3O 4MW3A 2R72A 1H38A 3CE2A 2OTLV 3RYFB 5LYJB 3FAVA 1SKVA 1VIBA 3JAWA 3WU2Z 5DEDA 3L73H 4UCUA 4JI7B 1PD3A 4DW0A 4O4HB 3O9OA 3U10A 2CDYA 4IGGA 4IYIA 3OUFA 3E8FA 1WN7A 1VQ7V 3DC5A 3MHSC 1OCRC 3CRMA 4O2BA 2N04A 4PDMA 3N2GB 2PI5A 1BHAA 2UUBO 3JD2A 1VP7A 1UPGA 2HR3A 1EN4A 2ZDIC 3ZHQA 3IC7A 2LFRA 3DC6A 1DF4A 3LNMB 2ADQB 3Q4HB 2CTWA 5KA6A 5B1AB 1QR8A 2IJJA 3K5OA 5B1OA 1SQPH 4G28B 2KKWA 4K35A 2QWQB 5JH7B 2YUAA 4UB6Z 2WLIA 3H1KH 1SZTA 2DQ3A 3K59A 3CB2A 1GN2A 2ZR3A 1MG1A 3A2FA 4UCSA 4CC6A 1Y4MA 5LHIA 2D2CB 3J80N 5GONB 2FB5A 1I5YA 2LJ2A 2ZNIA 4DK1A 4J10A 1ROPA 4MSWC 5B5EZ 1Y66A 2ZD9A 1RSOB 3LDEA 3CPWU 4I50B 2A7WA 3HKEB 2LW1A 4FVMA 4RUFA 2DYSB 3JSLA 1AVMA 2GV9A 2GDSA 5CBFA 4LC1A 1K34A 2O57A 4JYAO 5BR8O 3I55V 3IFXA 1W59A 1KP3A 4X62B 2UXDB 4B3SO 2X0LA 2E76B 1N0NA 1YTFD 1HNXB 5BMVA 2Q4PA 1G8MA 4PHZA 1NH2D 3OM3B 1RM1C 1OCZC 3ETEA 2F66C 4UCRA 3STLC 3K03A 3X2QB 5AG2A 5K1XA 3JAWB 3K5NA 4HAMA 2P90A 1E1RG 2XNDG 3JASA 4O2AB 1FFXB 5IJ0B 5ITZB 4UCVA 3OEHG 4CS4A 3RYIA 2ZE6A 4D6TH 5CBHA 1K5QA 3CRRA 5LP6C 2QJ1A 4WFBV 4JI2O 1YDXA 3A8TA 4RWUA 3WB1A 4B3MO 4X88A 1S0VA 4NVPA 3CXCU 4EB6B 5JJJB 5KAFZ 3CMEV 1Q82W 1J95A 1N34O 1GO3F 3SJCC 2V4DA 4H44B 4W4KA 1NT2B 3ABTA 1OHHG 4BW5A 4X1KA 1NH2B 1XL6A 1T5EA 5KHJA 4UB8Z 4DW1A 2IH1C 3FKSG 3THOA 4GKKB 5J9PC 5DN6G 4DV1O 4TQDA 3IGAC 5HFMA 1H2SB 2ZR2A 3D36A 3OR6C 4R7CA 3OMAB 3P3NA 2ETNA 3OGIB 4TV8A 4X89A 3B2EE 5LOVB 2QE7G 1RFYA 2UUCB 1MMMA 1XDCA 2K1EA 3JARA 2QTSA 4RQFA 3JATB 4MVMA 4BAYA 4FFBA 1GM7A 3AG2C 1XILA 2LGQA 4GCZA 1KB9F 4B7EA 3QNEA 4CS3A 4HZ3A 4P9PA 3WG7C 3N2KB 3JCZA 3ZBHA 1AJPA 2YEVA 1UJWB 1VF6C 2JIZG 3AG1C 3JD3A 1WP7A 3OW2U 1I5XA 1J5EO 1TUBA 2XAGA 3E2EA 3SGIA 2F23A 5JVDA 1NZ6A 2WA3A 3K0DA 3K0GA 3SYAA 4N23A 4H13B 2GBOA 3OD4A 4KFMA 1GAXA 4PELA 5JJEB 4FFKA 2DYRB 4U3JA 2CGOA 5LYJA 3RYFA 3G4SV 3SYOA 2C2AA 1SF9A 1MZFA 4LF7O 4WFFA 3HR0A 1SA0A 3K58A 5B1NA 2QR4A 4MTFA 4NTXA 2MW2B 2ZT9B 1WB8A 3K9AA 1XNRO 3ASOC 2P67A 4DR1B 1VQ8V 2YIAA 1KUQA 1F7YA 2DW4A 1YSCA 1F51A 1AI5A 1HNWO 2ZINA 4PA4A 3UT5A 4QNHB 4NR1A 1JR9A 1JJOA 3G6EV 1FJGB 1KU9A 1IBMO 2Z0AA 3ASNB 2UXDO 1XHZA 3AK3A 4WBNA 4LFAB 4DR4O 3RYHB 3WFVA 4JYAB 3UKMA 2Q0AA 4J41A 3IAYA 2HFEC 5EBLC 4TV8B 2R9RB 3OMIB 5JWPA 3ABMB 5C93A 1D2DA 2LW7A 1DTOA 2NNUA 4DV1B 1I94B 3L72H 1R1BA 5J2TB 1KKCA 3R66A 4MW8A 1QVGU 1VQ6V 5BZBA 4Z2WA 4DO2A 1HR0O 1HR0B 3CYOA 3H01A 1Y67A 4WF9V 1NS1A 3ZHRA 2ADPA 2M7WA 1CEZA 2A9HA 4UCTA 4EFBA 1ZX3A 3RYCB 1US6A 3FB8C 3OFNG 4YJ2A 3FFQA 2KSDA 2IBZH 5CBGA 2XAQA 1HWYA 4EFEA 2PYJA 4MTGA 3SDLA 1X4TA 4DR4B 4CH4A 1HW7A 2KB1A 4QIWF 5EBWC 4H33A 1BQZA 1TAEA 2A0LA 4TUYA 4O2AA 2BTOA 1LUWA 4MVRA 1HNWB 1P84F 4D7SA 2Y4TA 4I5SA 5L3GA 3TCUA 3APOA 3W7TA 1BCCH 4DR7B 4KP4A 2QWRB 1ZLZA 5EYPA 3GB7C 5B3SB 2VQEO 4UV9A 1WPBA 1FPOA 2FL4A 3IC9A 4E4EA 2Y0IA 1R6TA 1X59A 1SQGA 5LL6Y 1Y76B 1OZ0A 1JPXA 2CH7B 2AZ2A 4LF7B 1DGSA 4JI5O 3AK2A 5EIBD 5CMUA 4DR3B 2N74A 2IJHA 2QKSA 1JQ0A 4OXSA 3B8MA 4U3FH 4EEQA 4WCEV 4DR3O 4JI5B 4B3MB 3HKCA 1IBMB 3A0HZ 4NB5A 3K5LA 3C90A 3GWKC 1FJGO 1OCOB 3JAMN 3F5WC 3CCJV 3UT5B 4QPKA 1J5EB 2ZQMA 1BT8A 4TOIA 3OR7C 4EKWA 2HVKC 2UU9B 1S5LZ 5H5NA 3DSQA 1DK1A 3SR2C 4X20B 5CA1B 2DYSC 2ZIMA 4MTXA 5LHHA 1SQXH 3K57A 1AI7A 1KKDA 3B8NA 1XHXA 2QTOA 2QEXV 4ZI7B 4B3SB 1NTZH 4FFBB 3J7AU 3E22A 2YIBA 1OV9A 3B4SA 1XBLA 5FPRA 2UXNA 3CJHA 2V7QG 2A3QA 1SZXA 2OT5A 2XT9A 4NTYA 1O9HA 3N27A 4JPRA 4QE7A 2WLKA 3T1CA 1IURA 2RNBA 3TXQA 3ZRWA 2UXXA 1N36B 1PM9A 4FZ0A 3D3IA 4JI6B 3NR7A 1QVFU 3H9VA 5H2FZ 1FYJA 4GKKO 3AG2B 4X65O 1IX9A 4I0XA 4UXNA 1Z5VA 2EIJB 3ABUA 1ZL8A 5KHGA 4GUNA 1YZBA 1FXKC 2ZE7A 2LFSA 5LGNA 4F6RB 3JCUZ 4KHPO 4JI7O 4FLXA 3L75H 4CH3A 1UFIA 3ZEDA 3NXSA 3BA9A 3RFRA 3CCUV 2ZIOA 2RCVA 1QLEB 4AILC 1SC5B 3ABKC 4ZIBA 5EYPB 2E5LB 3EHBB 3EVKA 1VQNV 4JZ2A 4JYCA 5H6RA 2QM4A 1TUEB 4FLYA 1DLBA 3OUSA 3F7VC 5LGUA 2HLDG 5LHGA 2DWEC 4MS2A 4CBCA 2ZXWB 4O2BB 4DR1O 5JCOC 1QBZA 4O4JA 4RO2A 1XNRB 2ZCEA 4LF9B 4LH7A 5LP6B 5C8YA 2OYQA 1SRYA 2DWDC 2P4VA 3RN4A 4QGPA 1QNMA 3TGUH 1WPXA 1O9GA 2Y69C 2ZE8A 5BY1A 4P9OA 4X1KB 1XOUA 1JFFB 1M5IA 3HKDB 2CAZC 3OGCC 5E1AC 4OX9B 2BSKB 1MSWD 2XOKG 1S5HC 1P4RA 5KMGA 3HKBB 5KAIZ 3CCRV 3GVMA 2LGWA 3TXSA 4JI2B 4UVBA 2ITDC 3BCCH 2QWPB 4OGQB 4FM1A 1ZUQA 3B09A 2VQEB
chains in the Genus database with same CATH topology
3W7WA 3ABKB 1SERA 3CCLV 1QCEA 1W0KG 3ABTA 1OHHG 3K08A 4BW5A 1R3JC 3E35A 1NH2B 1XL6A 5KUKA 2AHZA 2YSUB 4JASA 2XAHA 3OEEG 3QO7A 3ZRXA 2IH1C 4ZBMA 3FKSG 5FL7G 1AJNA 1Q7YW 5J9PC 5DN6G 2EIKB 3ZMSA 3IGAC 3CC2V 2EIMC 1PL0A 1P7BA 5HFMA 3D36A 2ZR2A 1PKXA 1E1QG 3K79A 3OR6C 4R7CA 1ORQC 1R6NA 2W6JG 3OMAB 3SPCA 1G4YB 3ZRWB 3KG2A 5IYCO 3I56V 4X89A 3T2MA 2B1GA 1R3KC 2QE7G 3JD0A 4BIZA 2EILC 2K1EA 1S76D 1ZWIC 2IU3A 1R6KA 2Z3YA 4RQFA 1YITV 5GW7A 4JYBA 4MVMA 4BAYA 1KECA 1R3LC 1K97A 1COWG 1GM7A 1AI4A 3AG2C 4X8AA 3VOUA 3AG3B 3AG4B 5L3EA 4GCZA 2DYRC 2OCCC 2JJ1G 1SETA 2Q6AA 2Z5UA 3QNEA 4F4LA 3TETA 3CCSV 2V1DA 4HZ3A 2JDIG 1V54C 4P9PA 3WG7C 3UM7A 3ML0A 4MVQA 2W0FC 3JCZA 5CA3A 2WLIB 1AR1B 1VQ5V 3CC4V 1AJPA 2P6JA 3K06A 1ENVA 2YEVA 1UJWB 1VQOV 2JIZG 1PNMA 3AG1C 3JD3A 1MABG 1M1KW 3OW2U 3E86A 2JEUA 1F4MA 1EBOA 1I5XA 2ZXWC 2MK3A 3SYPA 4WFAV 2HVJC 2P7TC 1VQMV 3HB3B 2IJKA 1OCZB 1WLEA 3SPHA 2XAGA 3E2EA 1PNLA 1RM1B 3MHHC 3OAAG 3K0GA 5KA5A 3K0DA 4YXWG 1M56B 3AG1B 3SYAA 5KUMA 2B1IA 3HPLC 1S3JA 4N23A 4R8CA 3CMAV 4KFMA 1OCRB 4U7NA 5HFLA 4PELA 5EK0A 5IY5C 1K8AW 2XAFA 2DYRB 2OCCB 3AG4C 1NKDA 3QO5A 3G4SV 2XASA 3SYOA 3JD1A 5IYBO 2C2AA 3E8HA 4QJFB 5EBMC 4BIUA 4WFFA 3JYCA 1OCOC 5B1NA 5IDJA 1Q81W 1L1FA 4HYOA 2EZPA 3DTUB 4MTFA 2WLLB 4G27B 3K9AA 3ASOC 4TSFG 1K4DC 1NQTA 2P67A 2YEVB 5DM6V 1VQ8V 1K4CC 2WLHA 1JCHA 4JF3A 1E79G 4UUJC 2DW4A 1YSCA 3B77A 1F51A 4FK5C 4JTCB 1AI5A 3E8BA 3QO8A 4PA4A 5H6QA 5H9CA 1RPOA 5IYDO 3MD0A 4FIPC 4QNHB 1YJ9V 3ABLB 1OCCB 4R50A 3G6EV 1NVPD 3ZCCA 5L3FA 3CCQV 1M56C 2HJFC 2X6AA 3ASNB 4XDKA 4I9WA 5B1AC 2B5UA 4JTAB 4MTOA 1NR7A 3A0RA 5B1BC 3SJQC 3WFVA 3CC7V 2Q68A 3UKMA 5L3DA 1FS0G 3W7SA 1K73W 2HFEC 1PNKA 4PA3A 4R6ZA 3SPIA 3OE7G 5EBLC 1KC8W 3F7YC 2R9RB 3OMIB 3ABMB 5C93A 2BOBC 1DTOA 1V54B 2NNUA 4KUMA 3WG7B 1B6QA 1QR9A 4PA9A 2WLLA 3K3WA 4MW8A 1QVGU 1VQ6V 5BZBA 5L3BA 4DO2A 1JVMA 1SESA 1KD1W 3CYOA 2EJRA 3OMNB 3STZC 3H01A 1Q86W 2IJIA 3X2QC 4WF9V 1M57C 2M7WA 1W0JG 2WPDG 3LDDA 1M9NA 2A9HA 3G71V 1CEZA 2EILB 1GM9A 4P2ZA 2BOCC 2ITCC 2WAMA 4MVOA 4XDJA 5EC1C 4ZKIA 3FB8C 3OFNG 2WLMA 4G2KA 5CBGA 2XAQA 1HWYA 1K5SA 4GX2A 4MTGA 3CCMV 3FYEB 1JJ2U 2EIKC 1NR1A 1QLEC 3LUTB 4MVZA 4U7OA 1VQPV 1YJWV 3LDCA 1R3IC 3CP1A 3ZRSA 2JK5C 4GX0A 1THZA 2X6CA 3VBBA 2KB1A 2GHYA 2FTKA 3E89A 2ZDIA 3BY6A 3TK1A 4QIWF 5EBWC 4H33A 1R73A 4FMTA 4JAUA 4PDVA 4ASUG 2EZOA 2A0LA 1EZJA 5B3SC 4FJCC 1M90W 4MVRA 3FB5C 1NJIW 2IH3C 1H8HG 5LGTA 4I5SA 4P30A 1FXKB 5B1BB 4RAIA 5L3GA 2AHYA 4XBFA 1NVPB 2NLJC 3TCUA 4J9YB 1KP2A 2EIJC 4N21A 2ATKC 4E2LA 1FXHA 1LNQA 3W7TA 4GX5A 4TWKA 3PJSK 1F4NA 4KP4A 1YHQV 4QE9A 1JX9A 2Q67A 1RPRA 3GB7C 3ZN1A 2IU0A 4GT1A 4UV9A 5B3SB 1OCCC 4Q20A 3BEHA 1AROP 3ABLC 4UVAA 3ZJZA 4TT3G 2QM8A 4UVCA 3LSQA 1BMFG 3E8GA 3ZN0A 1OZ0A 3P30A 2Y69B 1JPXA 4PA6A 1IXMA 1V55B 2Q69A 4MT8A 5CMUA 2IJHA 4MW3A 2QKSA 1H38A 1JQ0A 1AJQA 1F23A 3B8MA 2WLJA 4OXSA 2OTLV 4WCEV 2CK3G 5LBQA 2H94A 2EINC 1YJNV 4MVUA 4UV8A 1VQKV 3JD4A 3E83A 2PI4A 1PD3A 2HKOA 1OCOB 2QA4V 1M57B 3F5WC 3CCJV 2Y48A 1JOYA 2R9IA 3OUFA 4QPKA 3RVYA 3E8FA 3CCVV 1N8RW 3DGEA 2ZQMA 4CZZA 1K7DA 3OR7C 4EKWA 1VQ7V 3MHSC 5IY5B 1OCRC 2HVKC 1CPYA 4RUEA 1H2GA 4PDMA 2PI5A 4J9ZB 1BHAA 1XL4A 3ABMC 1KQSU 1S77D 3M99B 4QPJA 3JD2A 1MOFA 1VQ4V 2X6BA 1W2BU 2DYSC 1S72V 2A79B 4MTXA 5LHHA 2HR3A 1K3EA 2ZDIC 2LFRA 3IC7A 3FB7C 1GTOA 1AI7A 1DF4A 4WFEA 3LNMB 1KKDA 1VQ9V 4JTDB 3FB6C 3B8NA 2QTOA 2QEXV 1NBMG 4PA7A 3RW0A 4WFHA 1BL8A 3P32A 2EINB 5B1AB 5KA6A 2WSSG 3ETGA 3ASNC 4DXWA 1QR8A 2HG5C 3ZMVA 2IJJA 3W7XA 2UXNA 5B1OA 1GMGA 3W7UA 1DF5A 2V7QG 2JEXA 2OT5A 2QM7A 4G28B 3SPJA 3R65A 1K92A 3ZRVA 1GK9A 3T4ZA 4JPRA 4QE7A 2WLKA 3T1CA 3ZRWA 1YI2V 2UXXA 1FFTB 2WLIA 1K33A 4LP8A 4RQEA 3D3IA 1QVFU 1SZTA 2DQ3A 3AG2B 1GKFA 2ZR3A 1MG1A 3T4DA 1Y4MA 4UXNA 5LHIA 2OTJV 1CP9A 3ASOB 4JAVA 1I5YA 1H8EG 2EIJB 3ABUA 4JGSA 2W6IG 1ROPA 4MSWC 1Y66A 2ZD9A 1FXKC 2F43G 4PDLA 2LFSA 3LDEA 3CPWU 3SPGA 5LGNA 2EIMB 3LSSA 4RUFA 2DYSB 5CN0A 1QLNA 4MVSA 1VQLV 5CBFA 3NXSA 2X7RB 4LC1A 1AI6A 3FYIB 1K34A 2H8PC 3ZIAG 3CCUV 1QLEB 5L3CA 3ABKC 3IFXA 5EC2C 1KP3A 3I55V 3EHBB 1VQNV 2X0LA 4JYCA 1YTFD 5H6RA 1TUEB 1G8MA 3EFFK 1NH2D 3OM3B 1RM1C 1DLBA 3OUSA 3F7VC 3CD6V 1OCZC 3CCEV 3ETEA 4PDRA 4XDLA 1YIJV 2DQ0A 2HLDG 5LGUA 5LHGA 2DWEC 1FXKA 4MS2A 4CBCA 3STLC 2ZXWB 3SYCA 4L87A 3K03A 3X2QB 3ZMTA 1EFRG 2LP7A 1GM8A 1QBZA 4RO2A 4HAMA 2P90A 1SRYA 1E1RG 2DWDC 2XNDG 1FXVA 2WWWA 2XAJA 2GSMB 4Z1MG 1WPXA 1V55C 2JJ2G 2WLNA 4FPPA 1BHBA 2Y69C 3RBZA 3OEHG 4P9OA 3ETDA 5CBHA 1K5QA 3AG3C 4WFBV 4GX1A 3K04A 4LCUC 3OGCC 5E1AC 4X88A 1MSWD 2XOKG 1S0VA 3CXCU 2D3OW 3SYQA 1K9MW 3AEIA 1S5HC 1YTFB 3CMEV 2IW5A 1P4RA 1Q82W 1J95A 3ZMZA 1GO3F 3RVZA 2EBOA 3CCRV 4UVBA 2ITDC 3ZMUA 3GWOA 4LBEC 4WFGA 4H37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CD6 V;  3CCE V;  1VQO V;  3CMA V;  3CCQ V;  1QVF U;  3CCV V;  1YIJ V;  1N8R W;  4WFB V;  3CCL V;  1VQ9 V;  1NJI W;  2QEX V;  3CCM V;  1VQL V;  1YIT V;  1M1K W;  1QVG U;  3OW2 U;  1K8A W;  1VQ6 V;  1VQ7 V;  1JJ2 U;  5DM6 V;  1VQ8 V;  2OTJ V;  1KD1 W;  3CCU V;  2OTL V;  3G4S V;  3CXC U;  1YJW V;  4WCE V;  1VQP V;  2D3O W;  4WFA V;  1K9M W;  1Q7Y W;  3CC7 V;  3CME V;  1VQM V;  1Q86 W;  1Q82 W;  3I55 V;  1YHQ V;  4WF9 V;  1YJN V;  3CC2 V;  3CCR V;  1VQN V;  1KQS U;  1VQK V;  1K73 W;  3CCS V;  3G71 V;  1VQ4 V;  1YJ9 V;  3CPW U;  1R73 A;  1W2B U;  1S72 V;  2QA4 V;  1YI2 V;  3I56 V;  1Q81 W;  1KC8 W;  1VQ5 V;  3G6E V;  3CC4 V;  1M90 W;  3CCJ V; 
#chains in the Genus database with same CATH topology
 2VWK A;  3W7W A;  3CJH B;  1SER A;  5J2T A;  4DR7 O;  3CCL V;  2PTM A;  4JI4 O;  1XI1 A;  1R3J C;  1KYO F;  5IJ9 B;  4JAS A;  3OEE G;  1AJN A;  2QWO B;  1VF6 A;  1WB7 A;  1IBK O;  3K79 A;  1E1Q G;  3RYC A;  1ORQ C;  1R6N A;  3ZRW B;  1G4Y B;  3KG2 A;  4NXM B;  3KCY A;  1P49 A;  2B1G A;  2EIL C;  1ZWI C;  1R6K A;  5GW7 A;  2Q7H A;  3I5D A;  4X8A A;  4DV3 O;  3AG4 B;  5L3E A;  2AXT Z;  2UUC O;  2Z5U A;  3TET A;  3CCS V;  2V1D A;  3UM7 A;  2W0F C;  5CA3 A;  5IE9 A;  1ENV A;  2HJD A;  1MAB G;  3D36 C;  5CA0 A;  1M1K W;  1H2N A;  2OCH A;  4F6R A;  2DJV A;  1YCI A;  2ZXW C;  3SYP A;  4C7U A;  1VQM V;  1SA0 B;  1WLE A;  1Q5O A;  1PNL A;  2FKX A;  4ZHQ B;  1NI8 A;  2B1I A;  4IT5 A;  4Q6G A;  1S3J A;  3N2G A;  1N34 B;  5C8Y B;  4LNU B;  4BW9 A;  1OCR B;  1B04 A;  5IY5 C;  2OCC B;  4LFA O;  3AG4 C;  3QO5 A;  4FM0 A;  2JS3 A;  3JD1 A;  4YY3 B;  4QJF B;  3VQV A;  1ZSP A;  2GTA A;  4LH6 A;  2PZS A;  3ETQ A;  1L1F A;  4HYO A;  5CA1 A;  2EX3 A;  2EZP A;  3DTU B;  2Q5Z A;  2UUB B;  2RN9 A;  3WB0 A;  4G27 B;  4CH5 A;  5FPO A;  3C3S A;  2UXC O;  4GKJ B;  4LWS B;  4UUJ C;  2BSK A;  5H6Q A;  3QO8 A;  1RPO A;  3MD0 A;  4FIP C;  4JZG A;  2HHH O;  4KL1 A;  1YJ9 V;  2AW9 A;  5IJ9 A;  3ABL B;  1OCC B;  4KXR A;  2A06 H;  3VQY A;  3ZCC A;  4X62 O;  4XDK A;  1Q43 A;  1N33 O;  3UO3 A;  3SJB C;  4MTO A;  5BR8 B;  2ODM A;  2UUA B;  3A0R A;  5B1B C;  3SJQ C;  3CC7 V;  1AR5 A;  3BPZ A;  2Q68 A;  4K8X A;  1AP6 A;  3ICX A;  3W7S A;  3ZHT A;  2Q73 A;  1PNK A;  4YJ2 B;  4R6Z A;  1Y74 B;  3SPI A;  2ZE5 A;  3OE7 G;  2ZKO A;  2BOB C;  3BFR A;  3WG7 B;  4I7Z B;  4KUM A;  1B6Q A;  1QR9 A;  2WLL A;  2W0X A;  3K3W A;  2PYL A;  5L3B A;  1JVM A;  2EJR A;  1IVS A;  3STZ C;  1U97 A;  2WPD G;  3LDD A;  4HNA B;  1GM9 A;  1NU1 H;  2P06 A;  2WAM A;  2E75 B;  5EC1 C;  4IL6 Z;  4J7Z A;  1XNQ O;  3U0Z A;  4J7J A;  1WA8 B;  1K5S A;  1NTK H;  4H0L B;  3CCM V;  4DV2 B;  1JJ2 U;  1QLE C;  4CH6 A;  1R3I C;  2YI8 A;  4GX0 A;  4LFB O;  2X6C A;  3VBB A;  2FTK A;  2ZDI A;  3JAL A;  4PDV A;  4DV6 B;  1H8H G;  5KX5 B;  4RAI A;  1KP2 A;  2EIJ C;  4N21 A;  1FXH A;  4GX5 A;  2BCC H;  1RP3 B;  2CH7 A;  1YHQ V;  2Q8V A;  2Q67 A;  1RPR A;  2Q0O C;  4Q20 A;  2QM8 A;  1BMF G;  3ZN0 A;  1A32 A;  2P22 C;  1AIL A;  1HP8 A;  4MT8 A;  1Q3E A;  3EXA A;  1F23 A;  2WLJ A;  1H2K A;  2Q7E A;  2CK3 G;  5LBQ A;  3QTC A;  2H94 A;  2EIN C;  2UXB B;  2KQX A;  4MVU A;  4UV8 A;  3H1H H;  1BS3 A;  3T1H O;  3RVY A;  3CCV V;  4DRX A;  3APQ A;  2CTR A;  3DGE A;  1ZTE A;  1TGO A;  4LFC O;  3T1Y O;  1CPY A;  2CTP A;  4O4L B;  2FML A;  4J9Z B;  5GTI Z;  4ZOL A;  5FNV A;  4TV9 B;  4QPJ A;  4LF8 O;  5A2Q N;  1VQ4 V;  1W2B U;  5GTH Z;  1HNX O;  4JI8 B;  1K3E A;  3E22 B;  2Y4U A;  3CWB H;  2RJZ A;  1AP5 A;  1NBM G;  4PA7 A;  4WFH A;  3P32 A;  4IHJ B;  4FLT A;  1N32 O;  2EIN B;  3ETG A;  4DXW A;  1KBH A;  2HG5 C;  4F6E A;  3ZMV A;  3SJA C;  3W7X A;  3W7U A;  1GMG A;  3SPJ A;  1K92 A;  3ZRV A;  3BA8 A;  1GK9 A;  2BTQ B;  3T4Z A;  2LQT A;  1XQ8 A;  1YI2 V;  3BVO A;  4HNA A;  3ZHV A;  3K5M A;  2DOS A;  3RYI B;  5K1P A;  2F93 B;  1CP9 A;  1URF A;  2YXL A;  4JAV A;  2RMK B;  4B3R O;  1H8E G;  4JGS A;  5JCO A;  2W6I G;  5D5Q A;  1YVW A;  2YS8 A;  3L70 H;  3M7M X;  1H2L A;  5LMU O;  1WA8 A;  2QDO A;  1XMQ B;  3CXH F;  3VQX A;  3SPG A;  3JAK A;  2EIM B;  1U96 A;  3LSS A;  3QG5 A;  4DR2 O;  5CN0 A;  4MVS A;  2GTS A;  1BZK A;  3FD9 A;  1AI6 A;  3FYI B;  4JI0 O;  2H8P C;  3ZIA G;  2P4K A;  4DUY B;  5L3C A;  4JI3 O;  3G6B A;  4DV4 B;  2JGD A;  4JAA A;  3EFF K;  1L0N H;  4XDL A;  1FXK A;  3MDS A;  2JS5 A;  4L87 A;  5KHK A;  5IT9 N;  2CGN A;  1EFR G;  2LP7 A;  2R9A A;  1Q8I A;  5JJN B;  4IIJ A;  4DV0 O;  1GN4 A;  2XAJ A;  4Z1M G;  1V55 C;  2JJ2 G;  2WLN A;  4I50 A;  4FPP A;  4NTW A;  2GUZ B;  3RBZ A;  4X66 B;  1VF5 B;  2F95 B;  4HBN A;  1IBL B;  4LCU C;  1GH6 A;  1ZAU A;  3UCS C;  3O65 A;  4W4L A;  2D3O W;  1K9M W;  3BAA A;  3C3T A;  1YTF B;  2G38 A;  3ZMZ A;  3RVZ A;  2EBO A;  3ZMU A;  3GWO A;  4LBE C;  4WFG A;  2ZNJ A;  2DN9 A;  2AGA A;  1JMK C;  1W0K G;  2F1M A;  5KUK A;  2AHZ A;  2YSU B;  2XAH A;  3QO7 A;  4JV5 O;  1QQC A;  4JI1 O;  4TV9 A;  4ZBM A;  1Q7Y W;  1HNZ O;  2DMX A;  2EIK B;  3ZMS A;  4B3T O;  3JAS B;  3CC2 V;  4NXN B;  2EIM C;  1PL0 A;  1P7B A;  4X64 B;  1MZE A;  4K8Z A;  5IYC O;  3SPC A;  3FAV B;  4FM2 A;  3D3Q A;  2BTQ A;  2RDC A;  3K9S A;  4IHJ A;  4BIZ A;  1AR4 A;  1S76 D;  4DR6 O;  4LR3 A;  4YHH O;  2Z3Y A;  4PV1 B;  1Z2G A;  5FLX N;  1SQQ H;  1Y76 A;  1R3L C;  2ZM6 O;  4LF4 O;  1AI4 A;  2CTQ A;  3OTO O;  2HEP A;  4J7K A;  2OCC C;  4DR5 O;  1SET A;  2Q6A A;  2YDE A;  4EB6 A;  3ML0 A;  4MVQ A;  4O4J B;  4X1Y A;  1AR1 B;  4JI8 O;  2P6J A;  2WA4 A;  3K06 A;  1VQO V;  1PNM A;  4DV5 O;  5KX5 A;  1WJZ A;  1GN3 A;  3E86 A;  4K3A A;  5J2U A;  4PJ0 Z;  1F4M A;  1EBO A;  2MK3 A;  2CE4 A;  4WFA V;  2HVJ C;  4I55 A;  4LFC B;  1JFF A;  1EZV H;  1SQV H;  5IYZ A;  1RM1 B;  3MHH C;  3S3W A;  5KA5 A;  4YXW G;  1M56 B;  3AG1 B;  3T1H B;  3CMA V;  5KMG B;  1D5A A;  4K0K O;  4U7N A;  5HFL A;  5EK0 A;  1K8A W;  2XAF A;  2E3C A;  1NKD A;  2QKA A;  3RYH A;  2KG7 B;  2IM9 A;  1FKA O;  4O4I A;  2F4V O;  4GYC B;  3JYC A;  4LF6 O;  5IDJ A;  2GUZ A;  5IWA O;  3IJ4 A;  1XMO O;  4OPA A;  1MNG A;  2YEV B;  1K4C C;  2EUL A;  2VQF B;  1E79 G;  2VQF O;  2PUS A;  2CUG A;  1Y74 A;  3B77 A;  4FK5 C;  4DV5 B;  4ZOL B;  2YID A;  3AK1 A;  5H9C A;  5IYD O;  2M6Y A;  2QKC A;  4DR5 B;  1M56 C;  2HJF C;  3AG7 A;  3CEI A;  1Q6U A;  5LMN B;  2Y0P A;  4I9W A;  5B1A C;  2B5U A;  4JTA B;  1P7G A;  1Q90 D;  3BAB A;  2HP8 A;  2VS0 A;  5EZY B;  3RT3 C;  4K0K B;  1K73 W;  4AQY B;  1KC8 W;  3F7Y C;  4J42 A;  4TUY B;  1MA1 A;  2YIB D;  1V54 B;  4PA9 A;  1G1X B;  1QHT A;  1TVK A;  3TJT A;  3KZI Z;  1G6U A;  1SES A;  2XTA A;  4B3R B;  5IJ0 A;  3OMN B;  3CX5 F;  2PY5 A;  2IJI A;  3X2Q C;  1W0J G;  1M9N A;  4ABM A;  1Q6I A;  5F2V O;  4LF5 O;  4P2Z A;  2AZ0 A;  2ITC C;  4XDJ A;  4J80 A;  4ZKI A;  1M93 A;  2P5O A;  3JAK B;  2H3O A;  1YEW A;  4GX2 A;  4X1Y B;  3FYE B;  2EIK C;  1NR1 A;  2OIE A;  4MVZ A;  3FX7 A;  4DK0 A;  1V9P A;  3Q4H A;  2ZM6 B;  2JK5 C;  1THZ A;  5J2U B;  1N33 B;  2GHY A;  3E89 A;  3BY6 A;  4YHH B;  3TK1 A;  4DR6 B;  5E79 Z;  3L71 H;  4DV7 B;  4I55 B;  4Z1V A;  4FMT A;  4JAU A;  1EZJ A;  5B3S C;  4B7K A;  3FB5 C;  4DV0 B;  3P3P A;  5LGT A;  2FYU H;  5B1B B;  5JQG B;  1FXK B;  2ILM A;  1PV0 A;  5KLV H;  4LWS A;  1NVP B;  1BSM A;  1IXB A;  4JI1 B;  1LNQ A;  5BXZ A;  1XMO B;  1F4N A;  4QE9 A;  3ZN1 A;  1OCC C;  4OPH A;  3BEH A;  3ABL C;  5EIB C;  3ZJZ A;  4TT3 G;  2KG7 A;  4UVC A;  1I7F A;  1VEW A;  4CS2 A;  3E8G A;  5GON A;  4GZR B;  4DV4 O;  2B9Z A;  3D8C A;  3P30 A;  1B3Q A;  3QVN A;  4IYH A;  4PA6 A;  2Q69 A;  1S5J A;  1PP9 H;  2UXB O;  1XEQ A;  4NYK A;  4O4L A;  1AJQ A;  3HKE A;  1YJN V;  4GLX A;  3VQW A;  4X1I B;  1VQK V;  3JD4 A;  3E83 A;  2PI4 A;  2HKO A;  4X66 O;  2QA4 V;  1BGY H;  1IZ3 A;  3J81 N;  1M57 B;  4I0X B;  2Y48 A;  4UFZ A;  1JOY A;  2R9I A;  4DUZ B;  1TUB B;  1N8R W;  3CS5 A;  3MAQ A;  3H1J H;  4CZZ A;  1K7D A;  4FZ1 A;  1L8D A;  5IY5 B;  4RUE A;  1H2G A;  1LR1 A;  2QGN A;  1VF7 A;  1XL4 A;  1XRE A;  3F5T A;  2L6L A;  3ABM C;  1KQS U;  1S77 D;  3JSN A;  3M99 B;  5LXT A;  2YI9 A;  1MOF A;  1SQB H;  2X6B A;  1S72 V;  3JAL B;  2A79 B;  1GRJ A;  4DV7 O;  1VMG A;  2LO1 A;  3FB7 C;  3L9D A;  1GTO A;  4WFE A;  4LF6 B;  4I9Q A;  1VQ9 V;  2F4V B;  4JTD B;  3FB6 C;  2Q7G A;  3RW0 A;  1BL8 A;  1N32 B;  2NN4 A;  2WSS G;  5ITZ A;  4DUY O;  3ASN C;  1YF2 A;  5KHI A;  1HDJ A;  4DV2 O;  1DF5 A;  3HKC B;  2JEX A;  2RQ6 A;  2QM7 A;  1B06 A;  3R65 A;  4FLW A;  1D5N A;  5LP6 A;  1FFT B;  1K33 A;  4LP8 A;  1I0H A;  4RQE A;  2XHB A;  1XMQ O;  4YIO A;  5CB4 A;  5LMU B;  1GKF A;  4J11 A;  1N0J A;  5D5P A;  3T4D A;  3CRA A;  2OTJ V;  3ASO B;  1LUV A;  4YIP A;  3HKD A;  4BR6 A;  2JGD B;  5IYZ B;  4JI4 B;  1CXZ B;  1GN6 A;  2F43 G;  4PDL A;  2BE3 A;  5JH7 A;  1WAZ A;  1QLN A;  5JQG A;  3BRC A;  1BE3 H;  1VQL V;  2X7R B;  4L8J A;  1EM1 A;  2VRZ A;  3OTF A;  5LMN O;  1IBL O;  1VAR A;  4ZI7 A;  3JAT A;  5EC2 C;  4AI8 A;  1QU7 A;  2YC0 A;  1Y6X A;  2N05 A;  3CHX A;  3CSX A;  3CD6 V;  3CCE V;  4PDR A;  1YIJ V;  2DQ0 A;  5LA6 B;  2XUM A;  4X1I A;  3SYC A;  3ZMT A;  1GM8 A;  3WB2 A;  4GKJ O;  3PN1 A;  4DUZ O;  1FXV A;  5IWA B;  2WWW A;  2GSM B;  2NR5 A;  1BHB A;  4UCO A;  1FD9 A;  5JVD B;  2OIG A;  4JI3 B;  3ETD A;  1L0L H;  3AG3 C;  4LFB B;  4GX1 A;  3H1I H;  3K04 A;  3KKY A;  4JI0 B;  1M4U A;  2ARH A;  1OJH A;  3SYQ A;  3AEI A;  1MSD A;  2IW5 A;  1FAF A;  4PI2 A;  5EZY A;  4DR2 B;  4PD4 F;  2YXY A;  4KHP B;  4BIO A;  1YXB A;  2QSA A;  4H37 A;  4ZHQ A;  2PGG A;  3ABK B;  4X9Q A;  1QCE A;  1TVK B;  3K08 A;  3E35 A;  5DEC A;  3ZRX A;  3LNN A;  5LXT B;  5FL7 G;  2E74 B;  3UQ8 A;  4O4H A;  2EJ7 A;  1I08 A;  4CC5 A;  1PKX A;  4LNU A;  4JI6 O;  2W6J G;  4I4T A;  3DXR B;  1N36 O;  3I56 V;  4ICG A;  3T2M A;  1R3K C;  3JD0 A;  1NTM H;  2IU3 A;  3OTO B;  4TQF A;  1YIT V;  4JYB A;  2UUA O;  4FLU A;  2PF4 E;  1KEC A;  1K97 A;  1COW G;  3CRQ A;  1IDS A;  3VOU A;  1TA8 A;  3AG3 B;  2DYR C;  2JJ1 G;  3JAR B;  4IIJ B;  4F4L A;  2JDI G;  1V54 C;  5CB4 B;  2K9P A;  4LF5 B;  4NXM O;  3HKB A;  2WLI B;  1VQ5 V;  3CC4 V;  4D7T A;  2QWN B;  1JA8 A;  1HNZ B;  1KMI Z;  3ZX6 A;  2UXC B;  2JEU A;  2UU9 O;  1AB3 A;  2P7T C;  3HB3 B;  2IJK A;  1OCZ B;  4DRX B;  3SPH A;  3OAA G;  2JGU A;  5KUM A;  4AQY O;  1PL4 A;  3HPL C;  3A0B Z;  4R8C A;  2JVD A;  4NKG B;  4A5U B;  4FLZ A;  5FNV B;  3ZHU A;  3KCX A;  3M8A A;  2XAS A;  5IYB O;  4YJ3 B;  4OX9 O;  3E8H A;  3LSU A;  3U11 A;  2R70 A;  5EBM C;  4BIU A;  1OCO C;  3S3X A;  1PPJ H;  3ZHS A;  1Q81 W;  1EN6 A;  5B66 Z;  3UO2 A;  5CA0 B;  2WLL B;  1SS3 A;  4TSF G;  2YIC A;  1K4D C;  1NQT A;  1H2M A;  5DM6 V;  2WLH A;  1JCH A;  4JF3 A;  4JTC B;  4U3J B;  4PI0 A;  3E8B A;  3G67 A;  3H1L H;  1Q6H A;  3B40 A;  5A9G A;  1EN5 A;  2YXH A;  1WNS A;  4R50 A;  1NVP D;  3RGB A;  5L3F A;  3CCQ V;  2X6A A;  4DV3 B;  4FLV A;  1Z5W A;  2OWO A;  4I4T B;  1NR7 A;  2Q9L A;  3L74 H;  5L3D A;  3OT7 A;  1FS0 G;  4JYY A;  4PA3 A;  4WBN B;  3CRC A;  3DXR A;  4BWA A;  4DYL A;  3ZS8 C;  5TIS Z;  1KD1 W;  4X20 A;  1Q86 W;  2DE0 X;  1M57 C;  4O4I B;  4X65 B;  1SQF A;  3G71 V;  1I94 O;  1WP8 A;  2EIL B;  2BOC C;  4MVO A;  4DV6 O;  3G80 A;  2WLM A;  4G2K A;  3RWR D;  4AHC A;  4LF4 B;  4B08 A;  5KHH A;  3BHP A;  3LUT B;  1YJW V;  4U7O A;  1VQP V;  3LDC A;  3CP1 A;  1RSO A;  3ZRS A;  5LOV A;  1R73 A;  4X64 O;  4ASU G;  2HHH B;  2EZO A;  4LF8 B;  1XNQ B;  3N2K A;  4FJC C;  1M90 W;  1NJI W;  4NXN O;  2IH3 C;  4B3T B;  4YJ3 A;  5LA6 A;  4P30 A;  4LF9 O;  1IBK B;  2AHY A;  4XBF A;  3T1Y B;  1XUQ A;  2NLJ C;  4JV5 B;  4J9Y B;  2ATK C;  4E2L A;  4TWK A;  3PJS K;  2L35 A;  1JX9 A;  2VWJ A;  1N4C A;  4GT1 A;  2IU0 A;  1ZL8 B;  1ARO P;  4UVA A;  2JRI A;  3LSQ A;  5BMV B;  2Y69 B;  2E5L O;  1IXM A;  1FFX A;  1BQ0 A;  1V55 B;  3QF7 A;  4YY3 O;  4MW3 A;  2R72 A;  1H38 A;  3CE2 A;  2OTL V;  3RYF B;  5LYJ B;  3FAV A;  1SKV A;  1VIB A;  3JAW A;  3WU2 Z;  5DED A;  3L73 H;  4UCU A;  4JI7 B;  1PD3 A;  4DW0 A;  4O4H B;  3O9O A;  3U10 A;  2CDY A;  4IGG A;  4IYI A;  3OUF A;  3E8F A;  1WN7 A;  1VQ7 V;  3DC5 A;  3MHS C;  1OCR C;  3CRM A;  4O2B A;  2N04 A;  4PDM A;  3N2G B;  2PI5 A;  1BHA A;  2UUB O;  3JD2 A;  1VP7 A;  1UPG A;  2HR3 A;  1EN4 A;  2ZDI C;  3ZHQ A;  3IC7 A;  2LFR A;  3DC6 A;  1DF4 A;  3LNM B;  2ADQ B;  3Q4H B;  2CTW A;  5KA6 A;  5B1A B;  1QR8 A;  2IJJ A;  3K5O A;  5B1O A;  1SQP H;  4G28 B;  2KKW A;  4K35 A;  2QWQ B;  5JH7 B;  2YUA A;  4UB6 Z;  2WLI A;  3H1K H;  1SZT A;  2DQ3 A;  3K59 A;  3CB2 A;  1GN2 A;  2ZR3 A;  1MG1 A;  3A2F A;  4UCS A;  4CC6 A;  1Y4M A;  5LHI A;  2D2C B;  3J80 N;  5GON B;  2FB5 A;  1I5Y A;  2LJ2 A;  2ZNI A;  4DK1 A;  4J10 A;  1ROP A;  4MSW C;  5B5E Z;  1Y66 A;  2ZD9 A;  1RSO B;  3LDE A;  3CPW U;  4I50 B;  2A7W A;  3HKE B;  2LW1 A;  4FVM A;  4RUF A;  2DYS B;  3JSL A;  1AVM A;  2GV9 A;  2GDS A;  5CBF A;  4LC1 A;  1K34 A;  2O57 A;  4JYA O;  5BR8 O;  3I55 V;  3IFX A;  1W59 A;  1KP3 A;  4X62 B;  2UXD B;  4B3S O;  2X0L A;  2E76 B;  1N0N A;  1YTF D;  1HNX B;  5BMV A;  2Q4P A;  1G8M A;  4PHZ A;  1NH2 D;  3OM3 B;  1RM1 C;  1OCZ C;  3ETE A;  2F66 C;  4UCR A;  3STL C;  3K03 A;  3X2Q B;  5AG2 A;  5K1X A;  3JAW B;  3K5N A;  4HAM A;  2P90 A;  1E1R G;  2XND G;  3JAS A;  4O2A B;  1FFX B;  5IJ0 B;  5ITZ B;  4UCV A;  3OEH G;  4CS4 A;  3RYI A;  2ZE6 A;  4D6T H;  5CBH A;  1K5Q A;  3CRR A;  5LP6 C;  2QJ1 A;  4WFB V;  4JI2 O;  1YDX A;  3A8T A;  4RWU A;  3WB1 A;  4B3M O;  4X88 A;  1S0V A;  4NVP A;  3CXC U;  4EB6 B;  5JJJ B;  5KAF Z;  3CME V;  1Q82 W;  1J95 A;  1N34 O;  1GO3 F;  3SJC C;  2V4D A;  4H44 B;  4W4K A;  1NT2 B;  3ABT A;  1OHH G;  4BW5 A;  4X1K A;  1NH2 B;  1XL6 A;  1T5E A;  5KHJ A;  4UB8 Z;  4DW1 A;  2IH1 C;  3FKS G;  3THO A;  4GKK B;  5J9P C;  5DN6 G;  4DV1 O;  4TQD A;  3IGA C;  5HFM A;  1H2S B;  2ZR2 A;  3D36 A;  3OR6 C;  4R7C A;  3OMA B;  3P3N A;  2ETN A;  3OGI B;  4TV8 A;  4X89 A;  3B2E E;  5LOV B;  2QE7 G;  1RFY A;  2UUC B;  1MMM A;  1XDC A;  2K1E A;  3JAR A;  2QTS A;  4RQF A;  3JAT B;  4MVM A;  4BAY A;  4FFB A;  1GM7 A;  3AG2 C;  1XIL A;  2LGQ A;  4GCZ A;  1KB9 F;  4B7E A;  3QNE A;  4CS3 A;  4HZ3 A;  4P9P A;  3WG7 C;  3N2K B;  3JCZ A;  3ZBH A;  1AJP A;  2YEV A;  1UJW B;  1VF6 C;  2JIZ G;  3AG1 C;  3JD3 A;  1WP7 A;  3OW2 U;  1I5X A;  1J5E O;  1TUB A;  2XAG A;  3E2E A;  3SGI A;  2F23 A;  5JVD A;  1NZ6 A;  2WA3 A;  3K0D A;  3K0G A;  3SYA A;  4N23 A;  4H13 B;  2GBO A;  3OD4 A;  4KFM A;  1GAX A;  4PEL A;  5JJE B;  4FFK A;  2DYR B;  4U3J A;  2CGO A;  5LYJ A;  3RYF A;  3G4S V;  3SYO A;  2C2A A;  1SF9 A;  1MZF A;  4LF7 O;  4WFF A;  3HR0 A;  1SA0 A;  3K58 A;  5B1N A;  2QR4 A;  4MTF A;  4NTX A;  2MW2 B;  2ZT9 B;  1WB8 A;  3K9A A;  1XNR O;  3ASO C;  2P67 A;  4DR1 B;  1VQ8 V;  2YIA A;  1KUQ A;  1F7Y A;  2DW4 A;  1YSC A;  1F51 A;  1AI5 A;  1HNW O;  2ZIN A;  4PA4 A;  3UT5 A;  4QNH B;  4NR1 A;  1JR9 A;  1JJO A;  3G6E V;  1FJG B;  1KU9 A;  1IBM O;  2Z0A A;  3ASN B;  2UXD O;  1XHZ A;  3AK3 A;  4WBN A;  4LFA B;  4DR4 O;  3RYH B;  3WFV A;  4JYA B;  3UKM A;  2Q0A A;  4J41 A;  3IAY A;  2HFE C;  5EBL C;  4TV8 B;  2R9R B;  3OMI B;  5JWP A;  3ABM B;  5C93 A;  1D2D A;  2LW7 A;  1DTO A;  2NNU A;  4DV1 B;  1I94 B;  3L72 H;  1R1B A;  5J2T B;  1KKC A;  3R66 A;  4MW8 A;  1QVG U;  1VQ6 V;  5BZB A;  4Z2W A;  4DO2 A;  1HR0 O;  1HR0 B;  3CYO A;  3H01 A;  1Y67 A;  4WF9 V;  1NS1 A;  3ZHR A;  2ADP A;  2M7W A;  1CEZ A;  2A9H A;  4UCT A;  4EFB A;  1ZX3 A;  3RYC B;  1US6 A;  3FB8 C;  3OFN G;  4YJ2 A;  3FFQ A;  2KSD A;  2IBZ H;  5CBG A;  2XAQ A;  1HWY A;  4EFE A;  2PYJ A;  4MTG A;  3SDL A;  1X4T A;  4DR4 B;  4CH4 A;  1HW7 A;  2KB1 A;  4QIW F;  5EBW C;  4H33 A;  1BQZ A;  1TAE A;  2A0L A;  4TUY A;  4O2A A;  2BTO A;  1LUW A;  4MVR A;  1HNW B;  1P84 F;  4D7S A;  2Y4T A;  4I5S A;  5L3G A;  3TCU A;  3APO A;  3W7T A;  1BCC H;  4DR7 B;  4KP4 A;  2QWR B;  1ZLZ A;  5EYP A;  3GB7 C;  5B3S B;  2VQE O;  4UV9 A;  1WPB A;  1FPO A;  2FL4 A;  3IC9 A;  4E4E A;  2Y0I A;  1R6T A;  1X59 A;  1SQG A;  5LL6 Y;  1Y76 B;  1OZ0 A;  1JPX A;  2CH7 B;  2AZ2 A;  4LF7 B;  1DGS A;  4JI5 O;  3AK2 A;  5EIB D;  5CMU A;  4DR3 B;  2N74 A;  2IJH A;  2QKS A;  1JQ0 A;  4OXS A;  3B8M A;  4U3F H;  4EEQ A;  4WCE V;  4DR3 O;  4JI5 B;  4B3M B;  3HKC A;  1IBM B;  3A0H Z;  4NB5 A;  3K5L A;  3C90 A;  3GWK C;  1FJG O;  1OCO B;  3JAM N;  3F5W C;  3CCJ V;  3UT5 B;  4QPK A;  1J5E B;  2ZQM A;  1BT8 A;  4TOI A;  3OR7 C;  4EKW A;  2HVK C;  2UU9 B;  1S5L Z;  5H5N A;  3DSQ A;  1DK1 A;  3SR2 C;  4X20 B;  5CA1 B;  2DYS C;  2ZIM A;  4MTX A;  5LHH A;  1SQX H;  3K57 A;  1AI7 A;  1KKD A;  3B8N A;  1XHX A;  2QTO A;  2QEX V;  4ZI7 B;  4B3S B;  1NTZ H;  4FFB B;  3J7A U;  3E22 A;  2YIB A;  1OV9 A;  3B4S A;  1XBL A;  5FPR A;  2UXN A;  3CJH A;  2V7Q G;  2A3Q A;  1SZX A;  2OT5 A;  2XT9 A;  4NTY A;  1O9H A;  3N27 A;  4JPR A;  4QE7 A;  2WLK A;  3T1C A;  1IUR A;  2RNB A;  3TXQ A;  3ZRW A;  2UXX A;  1N36 B;  1PM9 A;  4FZ0 A;  3D3I A;  4JI6 B;  3NR7 A;  1QVF U;  3H9V A;  5H2F Z;  1FYJ A;  4GKK O;  3AG2 B;  4X65 O;  1IX9 A;  4I0X A;  4UXN A;  1Z5V A;  2EIJ B;  3ABU A;  1ZL8 A;  5KHG A;  4GUN A;  1YZB A;  1FXK C;  2ZE7 A;  2LFS A;  5LGN A;  4F6R B;  3JCU Z;  4KHP O;  4JI7 O;  4FLX A;  3L75 H;  4CH3 A;  1UFI A;  3ZED A;  3NXS A;  3BA9 A;  3RFR A;  3CCU V;  2ZIO A;  2RCV A;  1QLE B;  4AIL C;  1SC5 B;  3ABK C;  4ZIB A;  5EYP B;  2E5L B;  3EHB B;  3EVK A;  1VQN V;  4JZ2 A;  4JYC A;  5H6R A;  2QM4 A;  1TUE B;  4FLY A;  1DLB A;  3OUS A;  3F7V C;  5LGU A;  2HLD G;  5LHG A;  2DWE C;  4MS2 A;  4CBC A;  2ZXW B;  4O2B B;  4DR1 O;  5JCO C;  1QBZ A;  4O4J A;  4RO2 A;  1XNR B;  2ZCE A;  4LF9 B;  4LH7 A;  5LP6 B;  5C8Y A;  2OYQ A;  1SRY A;  2DWD C;  2P4V A;  3RN4 A;  4QGP A;  1QNM A;  3TGU H;  1WPX A;  1O9G A;  2Y69 C;  2ZE8 A;  5BY1 A;  4P9O A;  4X1K B;  1XOU A;  1JFF B;  1M5I A;  3HKD B;  2CAZ C;  3OGC C;  5E1A C;  4OX9 B;  2BSK B;  1MSW D;  2XOK G;  1S5H C;  1P4R A;  5KMG A;  3HKB B;  5KAI Z;  3CCR V;  3GVM A;  2LGW A;  3TXS A;  4JI2 B;  4UVB A;  2ITD C;  3BCC H;  2QWP B;  4OGQ B;  4FM1 A;  1ZUQ A;  3B09 A;  2VQE B; 
#chains in the Genus database with same CATH homology
 3W7W A;  3ABK B;  1SER A;  3CCL V;  1QCE A;  1W0K G;  3ABT A;  1OHH G;  3K08 A;  4BW5 A;  1R3J C;  3E35 A;  1NH2 B;  1XL6 A;  5KUK A;  2AHZ A;  2YSU B;  4JAS A;  2XAH A;  3OEE G;  3QO7 A;  3ZRX A;  2IH1 C;  4ZBM A;  3FKS G;  5FL7 G;  1AJN A;  1Q7Y W;  5J9P C;  5DN6 G;  2EIK B;  3ZMS A;  3IGA C;  3CC2 V;  2EIM C;  1PL0 A;  1P7B A;  5HFM A;  3D36 A;  2ZR2 A;  1PKX A;  1E1Q G;  3K79 A;  3OR6 C;  4R7C A;  1ORQ C;  1R6N A;  2W6J G;  3OMA B;  3SPC A;  1G4Y B;  3ZRW B;  3KG2 A;  5IYC O;  3I56 V;  4X89 A;  3T2M A;  2B1G A;  1R3K C;  2QE7 G;  3JD0 A;  4BIZ A;  2EIL C;  2K1E A;  1S76 D;  1ZWI C;  2IU3 A;  1R6K A;  2Z3Y A;  4RQF A;  1YIT V;  5GW7 A;  4JYB A;  4MVM A;  4BAY A;  1KEC A;  1R3L C;  1K97 A;  1COW G;  1GM7 A;  1AI4 A;  3AG2 C;  4X8A A;  3VOU A;  3AG3 B;  3AG4 B;  5L3E A;  4GCZ A;  2DYR C;  2OCC C;  2JJ1 G;  1SET A;  2Q6A A;  2Z5U A;  3QNE A;  4F4L A;  3TET A;  3CCS V;  2V1D A;  4HZ3 A;  2JDI G;  1V54 C;  4P9P A;  3WG7 C;  3UM7 A;  3ML0 A;  4MVQ A;  2W0F C;  3JCZ A;  5CA3 A;  2WLI B;  1AR1 B;  1VQ5 V;  3CC4 V;  1AJP A;  2P6J A;  3K06 A;  1ENV A;  2YEV A;  1UJW B;  1VQO V;  2JIZ G;  1PNM A;  3AG1 C;  3JD3 A;  1MAB G;  1M1K W;  3OW2 U;  3E86 A;  2JEU A;  1F4M A;  1EBO A;  1I5X A;  2ZXW C;  2MK3 A;  3SYP A;  4WFA V;  2HVJ C;  2P7T C;  1VQM V;  3HB3 B;  2IJK A;  1OCZ B;  1WLE A;  3SPH A;  2XAG A;  3E2E A;  1PNL A;  1RM1 B;  3MHH C;  3OAA G;  3K0G A;  5KA5 A;  3K0D A;  4YXW G;  1M56 B;  3AG1 B;  3SYA A;  5KUM A;  2B1I A;  3HPL C;  1S3J A;  4N23 A;  4R8C A;  3CMA V;  4KFM A;  1OCR B;  4U7N A;  5HFL A;  4PEL A;  5EK0 A;  5IY5 C;  1K8A W;  2XAF A;  2DYR B;  2OCC B;  3AG4 C;  1NKD A;  3QO5 A;  3G4S V;  2XAS A;  3SYO A;  3JD1 A;  5IYB O;  2C2A A;  3E8H A;  4QJF B;  5EBM C;  4BIU A;  4WFF A;  3JYC A;  1OCO C;  5B1N A;  5IDJ A;  1Q81 W;  1L1F A;  4HYO A;  2EZP A;  3DTU B;  4MTF A;  2WLL B;  4G27 B;  3K9A A;  3ASO C;  4TSF G;  1K4D C;  1NQT A;  2P67 A;  2YEV B;  5DM6 V;  1VQ8 V;  1K4C C;  2WLH A;  1JCH A;  4JF3 A;  1E79 G;  4UUJ C;  2DW4 A;  1YSC A;  3B77 A;  1F51 A;  4FK5 C;  4JTC B;  1AI5 A;  3E8B A;  3QO8 A;  4PA4 A;  5H6Q A;  5H9C A;  1RPO A;  5IYD O;  3MD0 A;  4FIP C;  4QNH B;  1YJ9 V;  3ABL B;  1OCC B;  4R50 A;  3G6E V;  1NVP D;  3ZCC A;  5L3F A;  3CCQ V;  1M56 C;  2HJF C;  2X6A A;  3ASN B;  4XDK A;  4I9W A;  5B1A C;  2B5U A;  4JTA B;  4MTO A;  1NR7 A;  3A0R A;  5B1B C;  3SJQ C;  3WFV A;  3CC7 V;  2Q68 A;  3UKM A;  5L3D A;  1FS0 G;  3W7S A;  1K73 W;  2HFE C;  1PNK A;  4PA3 A;  4R6Z A;  3SPI A;  3OE7 G;  5EBL C;  1KC8 W;  3F7Y C;  2R9R B;  3OMI B;  3ABM B;  5C93 A;  2BOB C;  1DTO A;  1V54 B;  2NNU A;  4KUM A;  3WG7 B;  1B6Q A;  1QR9 A;  4PA9 A;  2WLL A;  3K3W A;  4MW8 A;  1QVG U;  1VQ6 V;  5BZB A;  5L3B A;  4DO2 A;  1JVM A;  1SES A;  1KD1 W;  3CYO A;  2EJR A;  3OMN B;  3STZ C;  3H01 A;  1Q86 W;  2IJI A;  3X2Q C;  4WF9 V;  1M57 C;  2M7W A;  1W0J G;  2WPD G;  3LDD A;  1M9N A;  2A9H A;  3G71 V;  1CEZ A;  2EIL B;  1GM9 A;  4P2Z A;  2BOC C;  2ITC C;  2WAM A;  4MVO A;  4XDJ A;  5EC1 C;  4ZKI A;  3FB8 C;  3OFN G;  2WLM A;  4G2K A;  5CBG A;  2XAQ A;  1HWY A;  1K5S A;  4GX2 A;  4MTG A;  3CCM V;  3FYE B;  1JJ2 U;  2EIK C;  1NR1 A;  1QLE C;  3LUT B;  4MVZ A;  4U7O A;  1VQP V;  1YJW V;  3LDC A;  1R3I C;  3CP1 A;  3ZRS A;  2JK5 C;  4GX0 A;  1THZ A;  2X6C A;  3VBB A;  2KB1 A;  2GHY A;  2FTK A;  3E89 A;  2ZDI A;  3BY6 A;  3TK1 A;  4QIW F;  5EBW C;  4H33 A;  1R73 A;  4FMT A;  4JAU A;  4PDV A;  4ASU G;  2EZO A;  2A0L A;  1EZJ A;  5B3S C;  4FJC C;  1M90 W;  4MVR A;  3FB5 C;  1NJI W;  2IH3 C;  1H8H G;  5LGT A;  4I5S A;  4P30 A;  1FXK B;  5B1B B;  4RAI A;  5L3G A;  2AHY A;  4XBF A;  1NVP B;  2NLJ C;  3TCU A;  4J9Y B;  1KP2 A;  2EIJ C;  4N21 A;  2ATK C;  4E2L A;  1FXH A;  1LNQ A;  3W7T A;  4GX5 A;  4TWK A;  3PJS K;  1F4N A;  4KP4 A;  1YHQ V;  4QE9 A;  1JX9 A;  2Q67 A;  1RPR A;  3GB7 C;  3ZN1 A;  2IU0 A;  4GT1 A;  4UV9 A;  5B3S B;  1OCC C;  4Q20 A;  3BEH A;  1ARO P;  3ABL C;  4UVA A;  3ZJZ A;  4TT3 G;  2QM8 A;  4UVC A;  3LSQ A;  1BMF G;  3E8G A;  3ZN0 A;  1OZ0 A;  3P30 A;  2Y69 B;  1JPX A;  4PA6 A;  1IXM A;  1V55 B;  2Q69 A;  4MT8 A;  5CMU A;  2IJH A;  4MW3 A;  2QKS A;  1H38 A;  1JQ0 A;  1AJQ A;  1F23 A;  3B8M A;  2WLJ A;  4OXS A;  2OTL V;  4WCE V;  2CK3 G;  5LBQ A;  2H94 A;  2EIN C;  1YJN V;  4MVU A;  4UV8 A;  1VQK V;  3JD4 A;  3E83 A;  2PI4 A;  1PD3 A;  2HKO A;  1OCO B;  2QA4 V;  1M57 B;  3F5W C;  3CCJ V;  2Y48 A;  1JOY A;  2R9I A;  3OUF A;  4QPK A;  3RVY A;  3E8F A;  3CCV V;  1N8R W;  3DGE A;  2ZQM A;  4CZZ A;  1K7D A;  3OR7 C;  4EKW A;  1VQ7 V;  3MHS C;  5IY5 B;  1OCR C;  2HVK C;  1CPY A;  4RUE A;  1H2G A;  4PDM A;  2PI5 A;  4J9Z B;  1BHA A;  1XL4 A;  3ABM C;  1KQS U;  1S77 D;  3M99 B;  4QPJ A;  3JD2 A;  1MOF A;  1VQ4 V;  2X6B A;  1W2B U;  2DYS C;  1S72 V;  2A79 B;  4MTX A;  5LHH A;  2HR3 A;  1K3E A;  2ZDI C;  2LFR A;  3IC7 A;  3FB7 C;  1GTO A;  1AI7 A;  1DF4 A;  4WFE A;  3LNM B;  1KKD A;  1VQ9 V;  4JTD B;  3FB6 C;  3B8N A;  2QTO A;  2QEX V;  1NBM G;  4PA7 A;  3RW0 A;  4WFH A;  1BL8 A;  3P32 A;  2EIN B;  5B1A B;  5KA6 A;  2WSS G;  3ETG A;  3ASN C;  4DXW A;  1QR8 A;  2HG5 C;  3ZMV A;  2IJJ A;  3W7X A;  2UXN A;  5B1O A;  1GMG A;  3W7U A;  1DF5 A;  2V7Q G;  2JEX A;  2OT5 A;  2QM7 A;  4G28 B;  3SPJ A;  3R65 A;  1K92 A;  3ZRV A;  1GK9 A;  3T4Z A;  4JPR A;  4QE7 A;  2WLK A;  3T1C A;  3ZRW A;  1YI2 V;  2UXX A;  1FFT B;  2WLI A;  1K33 A;  4LP8 A;  4RQE A;  3D3I A;  1QVF U;  1SZT A;  2DQ3 A;  3AG2 B;  1GKF A;  2ZR3 A;  1MG1 A;  3T4D A;  1Y4M A;  4UXN A;  5LHI A;  2OTJ V;  1CP9 A;  3ASO B;  4JAV A;  1I5Y A;  1H8E G;  2EIJ B;  3ABU A;  4JGS A;  2W6I G;  1ROP A;  4MSW C;  1Y66 A;  2ZD9 A;  1FXK C;  2F43 G;  4PDL A;  2LFS A;  3LDE A;  3CPW U;  3SPG A;  5LGN A;  2EIM B;  3LSS A;  4RUF A;  2DYS B;  5CN0 A;  1QLN A;  4MVS A;  1VQL V;  5CBF A;  3NXS A;  2X7R B;  4LC1 A;  1AI6 A;  3FYI B;  1K34 A;  2H8P C;  3ZIA G;  3CCU V;  1QLE B;  5L3C A;  3ABK C;  3IFX A;  5EC2 C;  1KP3 A;  3I55 V;  3EHB B;  1VQN V;  2X0L A;  4JYC A;  1YTF D;  5H6R A;  1TUE B;  1G8M A;  3EFF K;  1NH2 D;  3OM3 B;  1RM1 C;  1DLB A;  3OUS A;  3F7V C;  3CD6 V;  1OCZ C;  3CCE V;  3ETE A;  4PDR A;  4XDL A;  1YIJ V;  2DQ0 A;  2HLD G;  5LGU A;  5LHG A;  2DWE C;  1FXK A;  4MS2 A;  4CBC A;  3STL C;  2ZXW B;  3SYC A;  4L87 A;  3K03 A;  3X2Q B;  3ZMT A;  1EFR G;  2LP7 A;  1GM8 A;  1QBZ A;  4RO2 A;  4HAM A;  2P90 A;  1SRY A;  1E1R G;  2DWD C;  2XND G;  1FXV A;  2WWW A;  2XAJ A;  2GSM B;  4Z1M G;  1WPX A;  1V55 C;  2JJ2 G;  2WLN A;  4FPP A;  1BHB A;  2Y69 C;  3RBZ A;  3OEH G;  4P9O A;  3ETD A;  5CBH A;  1K5Q A;  3AG3 C;  4WFB V;  4GX1 A;  3K04 A;  4LCU C;  3OGC C;  5E1A C;  4X88 A;  1MSW D;  2XOK G;  1S0V A;  3CXC U;  2D3O W;  3SYQ A;  1K9M W;  3AEI A;  1S5H C;  1YTF B;  3CME V;  2IW5 A;  1P4R A;  1Q82 W;  1J95 A;  3ZMZ A;  1GO3 F;  3RVZ A;  2EBO A;  3CCR V;  4UVB A;  2ITD C;  3ZMU A;  3GWO A;  4LBE C;  4WFG A;  4H37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...