3SDLA

Crystal structure of human isg15 in complex with ns1 n-terminal region from influenza b virus, northeast structural genomics consortium target ids hx6481, hr2873, and or2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
95
structure length
95
Chain Sequence
TTQIEVGPGATNATINFEAGILECYERFSWQRALDYPGQDRLHRLKRKLESRIKTHNKSEPENKRMSLEERKAIGVKMMKVLLFMDPSAGIEGFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 1
publication title Structural basis for the sequence-specific recognition of human ISG15 by the NS1 protein of influenza B virus.
pubmed doi rcsb
source organism Influenza b virus
molecule tags Viral protein/antiviral protein
total genus 35
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3sdlA00
3T1YO 4LFBO 4JV5O 5LMNO 4LF9O 1YZBA 5LL6Y 4DV4O 5IWAO 4B3SO 4JI4O 4JI5O 2UUBO 1D2DA 2VQFO 4NXNO 4DV3O 1XMOO 5IT9N 4DV5O 5BXZA 3O65A 2LW7A 2Z0AA 4LF6O 4X62O 4JI2O 1R1BA 2DJVA 4A5UB 4YY3O 4JI1O 3JAMN 2UXCO 4DV7O 4DR5O 4X64O 1R6TA 1HNWO 2F4VO 1N32O 4LF8O 4DR1O 1AB3A 1XNQO 4OPAA 4DUZO 4DV0O 1I94O 1G1XB 1KUQA 1F7YA 1IBKO 1IBMO 3R66A 5H5NA 2UU9O 1HNXO 3J81N 2HHHO 3M8AA 3F5TA 1N34O 4DV2O 1A32A 4LF7O 4KHPO 3J80N 2N74A 4LFAO 4LFCO 4GKJO 1AILA 2ZKOA 5FLXN 1N36O 1DK1A 3RT3C 4B3TO 4AQYO 1J5EO 1HNZO 4DR2O 3SDLA 4X66O 4GKKO 4DR4O 2DOSA 4K0KO 4JI7O 4OPHA 5BY1A 1FYJA 4DUYO 5A2QN 4DR3O 2ZM6O 4JI0O 1HR0O 4DR7O 2JRIA 4JI3O 4LF5O 4LF4O 1FJGO 2UUCO 1FKAO 1XNRO 4JI8O 3OTOO 1XEQA 3J7AU 4JYAO 3T1HO 4DV1O 1N33O 4YHHO 4OX9O 4DR6O 2UXBO 1XMQO 2FKXA 1X59A 2E5LO 2UUAO 4B3MO 4NXMO 2UXDO 1IBLO 2AGAA 4JI6O 2VQEO 4DV6O 4X65O 5LMUO 1NS1A 5BR8O 4B3RO
chains in the Genus database with same CATH superfamily
1PD3A 4MTOA 3GWOA 5EZYA 5B66Z 5CMUA 2A3QA 5EIBD 5KX5A 5IWAO 2WLLB 4JI5O 2PF4E 4NTWA 1XMOO 2AHZA 5KAFZ 3UO2A 4IIJA 3H1KH 1AJNA 3BPZA 2Q9LA 2RDCA 2BSKA 2JGDA 4BWAA 2QKCA 3CYOA 3ZRWA 2IJKA 2YXLA 1AJPA 4G28B 2YIAA 1FXKA 1XMQB 1AB3A 4UB6Z 4OPAA 3ZHRA 1J95A 1KP2A 4PDMA 2UXDB 4K8ZA 1GH6A 3HKBA 5B1OA 2ZR2A 4MVOA 3CC7V 4LF7O 2JDIG 1Z2GA 2OCHA 2XAQA 2ZDIC 4NTXA 5FLXN 3MHSC 5IWAB 1YTFB 5EYPB 1XMOB 4ZHQB 1XHZA 1QR8A 4DK0A 1P84F 4IL6Z 4DR3O 2WLIB 1MG1A 2X0LA 4WFAV 1NH2D 2K9PA 2KG7B 5H2FZ 1QR9A 1K4CC 1SS3A 4J7KA 1R3KC 1OCOC 3BABA 3ZMSA 3RGBA 4X9QA 3CRAA 1BS3A 2VQEO 3CSXA 4LF7B 3SJCC 4K8XA 2IM9A 3TXQA 1G4YB 2ZINA 1QVFU 1M56C 4JV5O 1JQ0A 4W4KA 1K4DC 4QJFB 5K1XA 2E74B 2IBZH 2P5OA 4I7ZB 2JS5A 4DR3B 1WA8B 4X62O 5ITZB 1H8EG 4D7SA 2XASA 4LNUA 4Z1VA 5IYZB 2H8PC 2IH1C 4WFGA 3AG1C 4RO2A 3UT5B 3EHBB 5KHIA 4MVQA 2R9AA 1R6TA 1Q43A 2YICA 5LYJB 3E89A 3VQXA 4ZOLA 2GHYA 3A2FA 3M99B 1URFA 1S76D 3QTCA 2VQEB 3HKDB 1XILA 4DV7B 4JV5B 2GUZA 2EIKB 3OUSA 4LBEC 5LHGA 2H94A 3SJAC 1WP7A 5L3CA 2FMLA 4WCEV 1JFFA 4X62B 4WFEA 3VQYA 2XNDG 1AI5A 4X1IB 4FMTA 1YTFD 3H1LH 4N21A 1FXHA 2QTOA 1F23A 1JCHA 1H2LA 3S3WA 2YDEA 5EYPA 1KD1W 4NXMO 4FM0A 2GTSA 1XI1A 3KKYA 5IYCO 2HFEC 4TQDA 1AI4A 1I08A 4PV1B 1OCZB 4LP8A 3FB6C 1JMKC 3BY6A 4PA3A 4O4HB 4LWSB 5FNVB 4UVCA 3ZMVA 4LF9O 3Q4HB 5J2UA 2OCCB 1AROP 2LGQA 2EZPA 2EJ7A 1XUQA 2YIBD 4W4LA 5KMGA 2PI4A 1SESA 2DYSC 2EZOA 2JJ2G 3E8BA 2KB1A 1PKXA 3CCLV 2UXCO 5EC2C 2KQXA 4QPKA 1VEWA 3N2KB 3ZIAG 3E2EA 4X64O 5JH7B 4DR1O 4NXMB 4WF9V 4I50A 1H2NA 1YCIA 4J41A 3LDDA 4XBFA 4TV8A 3EFFK 4CS3A 3CMAV 2ITDC 3OGIB 1GM9A 4LF9B 3UT5A 1MABG 4KXRA 4YIPA 2YS8A 1Z5VA 4GKKO 2ZD9A 5LOVA 4DK1A 4ZIBA 4IGGA 1UJWB 4FZ1A 2Q7EA 5IDJA 2UXCB 1TAEA 4X64B 3RFRA 5LGUA 3HKEA 3UM7A 4DR1B 2VWJA 1BCCH 4HYOA 3RYIB 2LO1A 3K03A 3QO5A 2GDSA 3F5WC 5IY5C 5IJ0B 4GUNA 3L73H 5JVDB 3L74H 3GWKC 1VQNV 3CJHA 3ZRXA 3T1CA 3AEIA 4UCOA 1QLNA 2A0LA 1W2BU 4X1IA 5LGNA 4JZGA 1IVSA 1WP8A 3T1YO 5EBMC 3GVMA 3LSUA 4L8JA 3HKCA 4MVSA 5GW7A 4JZ2A 1W0KG 1Y66A 4GKKB 3LSSA 1M93A 1YJNV 2B1GA 3JCUZ 1DTOA 4RUEA 3DXRB 2BTOA 2CUGA 1VQ4V 3IJ4A 3HB3B 4MVMA 1OJHA 3P30A 4X1KA 3W7UA 5J2TB 3VOUA 4LWSA 1Y76A 2XOKG 5J9PC 3FB5C 4PDRA 4O4JB 1CP9A 5L3EA 2F43G 3ABMC 3BAAA 2HEPA 2ZXWC 3IC9A 2DYRC 1A32A 1TVKB 4J80A 4P9PA 4KHPO 2QTSA 3T1YB 4OXSA 2AXTZ 2PZSA 4NKGB 2HVJC 1ZX3A 4J9YB 3SPIA 1SQGA 1VQOV 1SZXA 4O4LB 1FS0G 3UKMA 3NR7A 2HG5C 3CB2A 1YITV 3OD4A 1SRYA 1VARA 3C3SA 3LSQA 1VIBA 1L0LH 2JRIA 1JJ2U 2V7QG 2YI9A 4IHJA 3JASB 3QNEA 2NLJC 3R65A 1RP3B 5D5PA 2IJIA 3T1HO 1Q86W 1DF4A 4OX9O 1Q81W 1Q8IA 2E5LO 5GTHZ 4GX5A 4Q20A 2ADQB 1HP8A 4JI6O 3WB0A 4KHPB 3K08A 3OEHG 2GTAA 5BZBA 4OGQB 3K06A 4RWUA 3UO3A 5LP6B 3BFRA 5LA6B 5C93A 3APQA 3ETEA 1JJOA 3N2GB 3ZHTA 1PNLA 3X2QC 3JARA 3L72H 5TISZ 2EIJC 1XDCA 1L8DA 3QO7A 5LMNB 3JATA 2XT9A 4YJ3B 3T1HB 5JQGA 1OZ0A 4OX9B 2FB5A 2E5LB 4PHZA 2WLJA 4AI8A 5H9CA 4JI6B 2EX3A 5FPRA 1QCEA 1K8AW 2DYSB 1NVPB 3QO8A 4O4IB 3RVZA 3TJTA 4I4TA 1DLBA 5J2TA 5JJJB 3H1JH 1QQCA 2ZIMA 2E76B 3MHHC 1N4CA 4QE7A 4DR2O 3FD9A 1YJ9V 2QWOB 1M4UA 3ZCCA 2IJJA 5A9GA 2EINC 2DWDC 4DUYO 3ASNC 4Z2WA 2ZM6O 1VF6C 1B06A 3SPHA 2QWNB 1IXMA 3ZN1A 1P4RA 1NR7A 3JAKA 4P2ZA 4EEQA 2A06H 5KHJA 2QM4A 1GRJA 5JCOC 4I5SA 3N27A 4HZ3A 4B3MO 4CS2A 1TUEB 3L70H 5B1NA 4JYBA 3C3TA 1OCZC 3E35A 5CB4A 2E3CA 1AP5A 4RUFA 1AR4A 3STLC 4LFBO 4JYAB 3SPCA 3W7TA 4DR2B 4I55A 2Z3YA 4DV4O 4ZBMA 1D2DA 4DUYB 2ZM6B 2Y0PA 4DRXB 1BE3H 3QG5A 3AK2A 1K34A 1K5SA 4ABMA 3LDCA 3W7XA 2ZNJA 2NR5A 5CA0B 4LF8O 1O9GA 2YEVB 4B3MB 4F4LA 3BCCH 4DV0O 1BHBA 2UU9O 1JOYA 1GKFA 4J11A 3AG2C 3CC2V 1AJQA 1NZ6A 4LFBB 3CMEV 4X8AA 1E1RG 5EK0A 4FFKA 3JCZA 3QF7A 3LDEA 4JASA 4DV4B 2PY5A 1NVPD 2L6LA 1EZVH 1R6NA 1LUWA 4UUJC 1PP9H 4YJ2A 2PUSA 1FYJA 3RYHA 2A7WA 3ABMB 3CWBH 4FPPA 5A2QN 1NBMG 3CCSV 4UVBA 2ZXWB 2DYRB 2Y48A 3PJSK 5KHHA 1GO3F 4ICGA 4LF8B 4WFBV 3ZMTA 5LHHA 3FB7C 4DV0B 1PNKA 4TOIA 5H6QA 2UU9B 3FAVA 3D3QA 1S72V 1IBLO 1FPOA 4U3JB 3CC4V 3TGUH 3K59A 4GLXA 5LXTB 4R50A 4WBNB 2F93B 5IYBO 3K5LA 1I7FA 5GTIZ 2ZNIA 1VQPV 2VQFO 3CCRV 3CP1A 2LW7A 3CCMV 2Q7GA 3CD6V 1SQXH 1VQ6V 2LW1A 1GM7A 1JVMA 1SF9A 3RYCB 3FX7A 3E8FA 2X6AA 4YY3O 4DV7O 2IU0A 4TT3G 2P90A 4FIPC 1HNWO 2LGWA 1SZTA 3MDSA 1IBLB 4BR6A 1I94O 1G1XB 1KUQA 2WLNA 5B1BC 2CTRA 2OIEA 2NNUA 3X2QB 4LCUC 2RMKB 4EFBA 1SKVA 4PDLA 3CXHF 3ZJZA 3ZX6A 2BTQA 4GKJO 2ZIOA 2EIJB 4BAYA 2D3OW 3HPLC 1Q6UA 4AQYO 1UFIA 2LFSA 1ZL8B 2QR4A 1BSMA 5KUKA 2VQFB 4DR4O 3B09A 3MAQA 2WLLA 4X20B 3ZRSA 4JI3O 4YY3B 3ABUA 1FKAO 3A8TA 4FLYA 3OTOO 3OAAG 3TK1A 4O2AB 5CBHA 1V54B 1HNWB 5JJNB 3K5NA 2D2CB 4TV9B 4EB6B 1I94B 3K57A 4TUYB 1PL0A 1Q3EA 4J9ZB 1VQ9V 2N04A 4E2LA 2BOBC 5FPOA 1YEWA 2ARHA 2EINB 2DMXA 2Z5UA 3ASNB 2Q0OC 2YC0A 3VQVA 4X65O 4GKJB 4AQYB 5LP6C 2P4KA 1S3JA 4DR4B 2AHYA 1BQ0A 3HR0A 3U0ZA 3B8MA 1AR1B 2ZE8A 3CCJV 2OTLV 4ZHQA 4AILC 2AZ2A 1WB7A 4BIZA 2DN9A 1Q6HA 2DQ3A 2Q67A 2Z0AA 3AG3B 4JI3B 3THOA 3CX5F 2WLIA 3PN1A 1IX9A 2QWRB 5IJ9B 3OTOB 1XHXA 2KG7A 4UCUA 2Q7HA 3H01A 2LJ2A 4O2BB 4YIOA 2QGNA 3RN4A 2HKOA 4DXWA 4GT1A 3WU2Z 1F7YA 2PI5A 1BHAA 1Q5OA 4BW5A 2QWPB 1IBMO 5CA3A 1K92A 3AG4C 4X65B 2HJDA 3M8AA 5DN6G 4UVAA 4GCZA 1H2MA 3OFNG 2YIBA 2QEXV 3LNMB 4IYHA 3SPJA 1DK1A 3RT3C 3E86A 1FXKC 2H3OA 1H2SB 1YF2A 4BW9A 1HNZO 3KCYA 4KUMA 1AI6A 3SYOA 3K3WA 1OCCC 4FZ0A 1WA8A 1YXBA 3E8GA 5ITZA 3AG2B 3K9AA 1YI2V 2YXYA 5IYZA 4PA4A 1TUBB 1SA0B 3CCUV 3RWRD 3OEEG 3SYAA 4FVMA 2KSDA 4DV1O 5LYJA 1TA8A 2Q0AA 4MW8A 1IBMB 2UXXA 4CS4A 2ADPA 2X6BA 4XDJA 2O57A 3ZN0A 2AGAA 1VQLV 1RSOB 2UUCB 3JALB 1R73A 3HKDA 2PYJA 1I5XA 1B3QA 5L3GA 5E79Z 1HNZB 2NN4A 1RM1C 2Y69B 3ZHQA 5KHKA 2CK3G 1R6KA 4JTCB 2WLHA 1XL6A 4HNAB 5KHGA 1SQVH 5BXZA 1GMGA 2W0FC 4FLUA 3B77A 3RYFB 3CCQV 2ODMA 1VF6A 4ZI7B 3TCUA 4DR5O 4DV1B 3DTUB 4Q6GA 4JTAB 4FM2A 1I0HA 1YHQV 5LGTA 4FK5C 3OM3B 1PM9A 2LQTA 2ZE5A 3J81N 4WFHA 3K58A 4GZRB 2R72A 4B7EA 3SYCA 3K0GA 4GX0A 4MSWC 5BMVB 4O4HA 5FNVA 2Q73A 4HAMA 2CTWA 1OCRC 1J5EO 3L9DA 3ETDA 3Q4HA 3E22B 4U7OA 1GM8A 1H8HG 5EBLC 1IURA 1D5AA 4JGSA 2QM7A 5B1BB 5CA1B 4KFMA 3IAYA 3A0BZ 2E75B 3O9OA 5B3SC 1Q90D 4LF5O 1Y74B 1AP6A 1IZ3A 2Q4PA 3FB8C 4I0XB 1K9MW 4DR5B 1X4TA 2X6CA 3JD0A 3GB7C 5IE9A 4P9OA 3N2KA 2RCVA 5JH7A 1QLEB 2M6YA 2UUAO 1EN6A 1WPXA 3KCXA 4JI0B 5IYDO 4X89A 1P7GA 4L87A 1RPOA 3DSQA 5LMUO 1NS1A 3G4SV 2OT5A 2IJHA 1SC5B 2EILC 3WB1A 4NTYA 1J5EB 2YSUB 2Y4TA 4X1YB 5LMNO 4MT8A 3JSNA 1QVGU 2M7WA 1H2GA 4B3SO 3WG7C 4FFBB 2F23A 2QDOA 3SYPA 2JIZG 4LF5B 4JI2O 4G2KA 5C8YB 3CE2A 1GN3A 4PDVA 2N05A 5L3DA 3JAWB 4F6RB 2IU3A 2ZDIA 3VBBA 2IW5A 3OUFA 3RYIA 2UUAB 1WB8A 1XNQO 3D3IA 2Y0IA 4JAUA 1KB9F 1ZSPA 1COWG 3IFXA 5CBFA 5IJ0A 5JVDA 5JWPA 5H5NA 2W0XA 3JD4A 1P49A 5LMUB 2ATKC 1NR1A 4LH6A 2Q68A 5KA6A 4B7KA 4MS2A 1SETA 2CGNA 5EZYB 2A79B 1NTZH 4RQFA 1G6UA 3ABLB 3C90A 4TWKA 2Q5ZA 4B3SB 5KX5B 1KMIZ 2WSSG 1NQTA 3CXCU 4MTXA 4ASUG 3DXRA 3OR7C 4H44B 4JI2B 1V55B 4IIJB 3BRCA 3OGCC 2EIMC 3AG4B 1R3JC 3H1IH 3CS5A 4FLWA 1FJGO 2BSKB 2JGDB 1PV0A 2FL4A 4CH5A 1V54C 1XNQB 1GN4A 1FXKB 4JYAO 1N33O 2ETNA 4UB8Z 4G27B 3OMIB 3ZEDA 4O4JA 3HKBB 1OCCB 3OMNB 5D5QA 2YXHA 4DV6O 1TVKA 4PI0A 4FLTA 2V1DA 4YXWG 2ZCEA 2OYQA 3B2EE 2OIGA 1G8MA 1DF5A 1BGYH 4WFFA 2PYLA 5AG2A 4O4LA 2P67A 2KKWA 5FL7G 2JK5C 3ETQA 1I5YA 4F6EA 2QKAA 5IT9N 4DV5O 3AG3C 1R1BA 1L1FA 1FJGB 4LR3A 4JPRA 3BHPA 2QSAA 2Q69A 2BE3A 5CN0A 2CTPA 4QE9A 3JASA 2JGUA 1N33B 5F2VO 1RM1B 2F4VO 2XUMA 2LFRA 3EVKA 4MVZA 1EZJA 1IBKO 4DV6B 1M57C 1F51A 4GX2A 3K9SA 2P4VA 5EBWC 3E8HA 4J7ZA 1CPYA 3NXSA 2ZKOA 2IH3C 1R3IC 1CEZA 1GAXA 3BA9A 4B08A 5LP6A 3CCVV 3SDLA 4X66O 4J7JA 5DEDA 1MMMA 5LA6A 3IGAC 4UCVA 4DV5B 2ZE6A 3N2GA 4LNUB 4LF4O 4PA9A 2YIDA 3BA8A 1NU1H 3G6EV 3LUTB 1YDXA 2F4VB 3D8CA 3WFVA 4YJ3A 2LP7A 4N23A 1OCRB 3B8NA 4R8CA 1IBKB 4ZOLB 4DR6O 4CC5A 3ZHSA 1KU9A 1H38A 2JVDA 1QNMA 3U10A 5HFLA 4FLVA 4O4IA 5B3SB 1WLEA 4U3FH 2GUZB 1NTMH 3P3NA 2ZT9B 3JD3A 4D6TH 2RQ6A 2CDYA 4NB5A 2Y69C 2P6JA 4X66B 5L3FA 4JTDB 2BOCC 3D36C 1VQMV 3SPGA 1JFFB 1SQQH 3I55V 2A9HA 4LF4B 2GV9A 1W59A 4UXNA 3WB2A 3B40A 5DM6V 1ZUQA 2PTMA 2EILB 4K35A 2XAGA 3ETGA 2ITCC 4JI5B 4DR6B 1AR5A 4K3AA 4KL1A 2WLKA 1KQSU 2P06A 3WG7B 2CAZC 1SQPH 3ZRVA 2EBOA 3BVOA 2VRZA 1R3LC 4BIUA 3TXSA 2RN9A 4AHCA 4MTGA 1SERA 1Q82W 1S5HC 5J2UB 4EKWA 1US6A 2GBOA 1RPRA 3STZC 3JYCA 4JI7O 1BZKA 5KMGB 1BQZA 2CH7B 1V9PA 2Y4UA 1KYOF 4DRXA 2Q8VA 1WJZA 3ZBHA 4PA6A 2ZQMA 1S0VA 4UCTA 3OTFA 3B4SA 1MNGA 1O9HA 5HFMA 1Y67A 3J7AU 3ABKC 4CBCA 3OMAB 1QLEC 4IT5A 1U97A 5CA0A 4I50B 1Q6IA 2YEVA 2JEXA 1X59A 2F1MA 1THZA 2VWKA 3F7YC 4MVRA 4TV8B 2EIMB 1JPXA 1K5QA 2QM8A 4PI2A 5BR8O 4B3RO 2XAJA 3ASOB 1DGSA 1KKCA 2DE0X 2OTJV 5LL6Y 5GONB 4JI7B 1KP3A 5KA5A 4CZZA 1EM1A 3OW2U 5LOVB 3W7WA 4NXNO 3T4ZA 4CH3A 4H37A 5LBQA 1HWYA 3H9VA 3O65A 1W0JG 3A0HZ 4LF6O 2XTAA 4JYYA 4FLZA 2JS3A 4ZKIA 1LR1A 4JAAA 2PGGA 3HKEB 3P32A 1YSCA 3T2MA 2VS0A 1QBZA 1N32O 1JA8A 4NYKA 2G38A 3CJHB 1MSDA 3H1HH 3G67A 1GN6A 4E4EA 1VQ5V 3EXAA 4U3JA 1FXVA 3F5TA 5BR8B 4B3RB 4GX1A 1YVWA 3SGIA 4EFEA 4LFCO 3HKCB 2YUAA 3LNNA 5LXTA 4WBNA 4DYLA 5EC1C 2WA3A 4FJCC 1HDJA 3ABLC 2JEUA 3L75H 3I56V 4H13B 1PNMA 1SQFA 2DOSA 4NXNB 1Z5WA 1MSWD 5BY1A 1EN4A 1T5EA 2B9ZA 4LF6B 1V55C 5EIBC 1K97A 4H33A 1M57B 1FFXB 1GN2A 3K79A 4X1KB 3W7SA 1F4NA 3K0DA 2UUCO 1M90W 3RYCA 1Y76B 3AK1A 5KUMA 1L0NH 1N32B 2R9IA 3AK3A 3S3XA 2HJFC 2WWWA 2AZ0A 2R70A 4YHHO 1VQ7V 5B1AC 2AW9A 4RAIA 1YIJV 1ZTEA 2CH7A 1P7BA 3ZMUA 5E1AC 4LFCB 3I5DA 1ORQC 1FD9A 2OWOA 3A0RA 5JJEB 3BEHA 1ROPA 3U11A 4JYCA 1S77D 2ZR3A 2XAFA 1ZL8A 4DW1A 3ZHVA 4JI4O 2RJZA 2R9RB 2UUBO 1KECA 4DO2A 4DV3O 4X20A 1OV9A 3G6BA 3VQWA 4D7TA 3AG7A 1XREA 3FKSG 4A5UB 1ENVA 4IHJB 2W6JG 2ZE7A 5DECA 4O2AA 4YHHB 5GONA 3ZHUA 1H2KA 2QJ1A 3CRCA 4TV9A 4EB6A 1N0JA 4TUYA 2RNBA 1NI8A 5K1PA 3R66A 3ML0A 4MVUA 4UFZA 1KKDA 1BT8A 3CRMA 1HNXO 1U96A 2C2AA 4X88A 3P3PA 3J80N 2N74A 4UCSA 1N36O 4JF3A 4I9QA 3APOA 3SJBC 4B3TO 3UQ8A 5LHIA 4JI4B 3UCSC 1TGOA 3ZS8C 1RFYA 2UUBB 3K5OA 4PJ0Z 4DV3B 2L35A 3G80A 1QHTA 5JCOA 1LUVA 3JARB 4PELA 4JI0O 1HR0O 4DR7O 3ABTA 4J10A 2B1IA 4UV8A 1ZAUA 5IJ9A 1NKDA 1XNRO 3OT7A 3JATB 4JI8O 4BIOA 4PD4F 5JQGB 3T4DA 1M9NA 1XEQA 2P7TC 2WPDG 5B5EZ 1MZFA 4O2BA 1OCOB 3CRRA 2UXBO 1XBLA 1AVMA 1HNXB 2W6IG 1Y6XA 1FFXA 3DC6A 2Q6AA 4I4TB 4H0LB 2UXNA 4QNHB 3K04A 1N36B 1M56B 3MD0A 1GTOA 2EJRA 4B3TB 4DW0A 4NR1A 5L3BA 1NTKH 1YZBA 3ABKB 3FFQA 2B5UA 4U7NA 1YJWV 2FYUH 1PL4A 1OHHG 1HR0B 4DR7B 3IC7A 1M1KW 3TETA 3ICXA 2YI8A 1XNRB 1K73W 4QGPA 4LH7A 4JI8B 1JR9A 4JI1O 3JAMN 1TUBA 1SA0A 4NVPA 2MK3A 3AG1B 3JAKB 2X7RB 1FAFA 4TQFA 2UXBB 1SQBH 4LC1A 1ZLZA 4DUZO 1WAZA 5H6RA 1HW7A 1EFRG 3KZIZ 3RBZA 3OE7G 1BL8A 1VP7A 2WLMA 4KP4A 5CB4B 4DV2O 1RSOA 2XHBA 3JALA 1VQ8V 4MW3A 1VF7A 3JD1A 3FYEB 3F7VC 3RVYA 4LFAO 4HBNA 1AILA 4GYCB 1M5IA 2GSMB 1UPGA 4I55B 3CRQA 3FYIB 1CXZB 3CHXA 1WNSA 3D36A 4K0KO 4XDKA 4OPHA 4HNAA 2CGOA 2HVKC 1Q7YW 4JAVA 2F66C 3L71H 3RYFA 1S5LZ 1K7DA 3SYQA 2MW2B 4JI1B 4ZI7A 3JSLA 1E1QG 1B04A 1D5NA 4IYIA 4DUZB 4CC6A 1GK9A 2FKXA 5CBGA 2P22C 4PA7A 1XOUA 4DV2B 3KG2A 2XAHA 4UCRA 3G71V 2HLDG 4LFAB 3ZMZA 2JJ1G 3E83A 3ASOC 4FLXA 5BMVA 1EBOA 3ZRWB 3OR6C 4XDLA 4K0KB 1XL4A 1ZWIC 1WN7A 2HP8A 3DC5A 3E22A 4C7UA 1B6QA 4YJ2B 5B1AB 3RYHB 2K1EA 2BCCH 2QWQB 4MTFA 5CA1A 2QA4V 4FM1A 1JX9A 3CCEV 2DJVA 2CE4A 1S5JA 4R7CA 3JD2A 1NJIW 1Y74A 4I0XA 3CPWU 2EIKC 1PPJH 2ILMA 1QU7A 3K5MA 2DQ0A 3QVNA 3FAVB 1EN5A 3RW0A 1VQKV 1XQ8A 1KBHA 2HHHO 1K33A 1N34O 1VMGA 4I9WA 2WAMA 2FTKA 2WA4A 1BMFG 3DGEA 4TSFG 2DWEC 1IDSA 4CH6A 2HR3A 2QKSA 2CTQA 4X1YA 4CH4A 1E79G 1NT2B 1NH2B 2QE7G 1K3EA 1MOFA 4J42A 4FFBA 1AI7A 5KAIZ 1MA1A 1KC8W 1F4MA 4UV9A 5C8YA 1IXBA 1N8RW 1WPBA 2EULA 1Y4MA 3JAWA 4F6RA 1N0NA 3M7MX 2OCCC 5IY5B 1FFTB 1LNQA 4P30A 1VF5B 5KLVH 1XMQO 2V4DA 2UXDO 2HHHB 4Z1MG 1N34B 3CEIA 4R6ZA 2DW4A 3SR2C 4QPJA 4QIWF 3SJQC 2F95B 4RQEA 2BTQB 1MZEA
chains in the Genus database with same CATH topology
3T1YO 4LFBO 4JV5O 5LMNO 4LF9O 1YZBA 5LL6Y 4DV4O 5IWAO 4B3SO 4JI4O 4JI5O 2UUBO 1D2DA 2VQFO 4NXNO 4DV3O 1XMOO 5IT9N 4DV5O 5BXZA 3O65A 2LW7A 2Z0AA 4LF6O 4X62O 4JI2O 1R1BA 2DJVA 4A5UB 4YY3O 4JI1O 3JAMN 2UXCO 4DV7O 4DR5O 4X64O 1R6TA 1HNWO 2F4VO 1N32O 4LF8O 4DR1O 1AB3A 1XNQO 4OPAA 4DUZO 4DV0O 1I94O 1G1XB 1KUQA 1F7YA 1IBKO 1IBMO 3R66A 5H5NA 2UU9O 1HNXO 3J81N 2HHHO 3M8AA 3F5TA 1N34O 4DV2O 1A32A 4LF7O 4KHPO 3J80N 2N74A 4LFAO 4LFCO 4GKJO 1AILA 2ZKOA 5FLXN 1N36O 1DK1A 3RT3C 4B3TO 4AQYO 1J5EO 1HNZO 4DR2O 3SDLA 4X66O 4GKKO 4DR4O 2DOSA 4K0KO 4JI7O 4OPHA 5BY1A 1FYJA 4DUYO 5A2QN 4DR3O 2ZM6O 4JI0O 1HR0O 4DR7O 2JRIA 4JI3O 4LF5O 4LF4O 1FJGO 2UUCO 1FKAO 1XNRO 4JI8O 3OTOO 1XEQA 3J7AU 4JYAO 3T1HO 4DV1O 1N33O 4YHHO 4OX9O 4DR6O 2UXBO 1XMQO 2FKXA 1X59A 2E5LO 2UUAO 4B3MO 4NXMO 2UXDO 1IBLO 2AGAA 4JI6O 2VQEO 4DV6O 4X65O 5LMUO 1NS1A 5BR8O 4B3RO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1Y O;  4LFB O;  4JV5 O;  5LMN O;  4LF9 O;  1YZB A;  5LL6 Y;  4DV4 O;  5IWA O;  4B3S O;  4JI4 O;  4JI5 O;  2UUB O;  1D2D A;  2VQF O;  4NXN O;  4DV3 O;  1XMO O;  5IT9 N;  4DV5 O;  5BXZ A;  3O65 A;  2LW7 A;  2Z0A A;  4LF6 O;  4X62 O;  4JI2 O;  1R1B A;  2DJV A;  4A5U B;  4YY3 O;  4JI1 O;  3JAM N;  2UXC O;  4DV7 O;  4DR5 O;  4X64 O;  1R6T A;  1HNW O;  2F4V O;  1N32 O;  4LF8 O;  4DR1 O;  1AB3 A;  1XNQ O;  4OPA A;  4DUZ O;  4DV0 O;  1I94 O;  1G1X B;  1KUQ A;  1F7Y A;  1IBK O;  1IBM O;  3R66 A;  5H5N A;  2UU9 O;  1HNX O;  3J81 N;  2HHH O;  3M8A A;  3F5T A;  1N34 O;  4DV2 O;  1A32 A;  4LF7 O;  4KHP O;  3J80 N;  2N74 A;  4LFA O;  4LFC O;  4GKJ O;  1AIL A;  2ZKO A;  5FLX N;  1N36 O;  1DK1 A;  3RT3 C;  4B3T O;  4AQY O;  1J5E O;  1HNZ O;  4DR2 O;  3SDL A;  4X66 O;  4GKK O;  4DR4 O;  2DOS A;  4K0K O;  4JI7 O;  4OPH A;  5BY1 A;  1FYJ A;  4DUY O;  5A2Q N;  4DR3 O;  2ZM6 O;  4JI0 O;  1HR0 O;  4DR7 O;  2JRI A;  4JI3 O;  4LF5 O;  4LF4 O;  1FJG O;  2UUC O;  1FKA O;  1XNR O;  4JI8 O;  3OTO O;  1XEQ A;  3J7A U;  4JYA O;  3T1H O;  4DV1 O;  1N33 O;  4YHH O;  4OX9 O;  4DR6 O;  2UXB O;  1XMQ O;  2FKX A;  1X59 A;  2E5L O;  2UUA O;  4B3M O;  4NXM O;  2UXD O;  1IBL O;  2AGA A;  4JI6 O;  2VQE O;  4DV6 O;  4X65 O;  5LMU O;  1NS1 A;  5BR8 O;  4B3R O; 
#chains in the Genus database with same CATH topology
 1PD3 A;  4MTO A;  3GWO A;  5EZY A;  5B66 Z;  5CMU A;  2A3Q A;  5EIB D;  5KX5 A;  5IWA O;  2WLL B;  4JI5 O;  2PF4 E;  4NTW A;  1XMO O;  2AHZ A;  5KAF Z;  3UO2 A;  4IIJ A;  3H1K H;  1AJN A;  3BPZ A;  2Q9L A;  2RDC A;  2BSK A;  2JGD A;  4BWA A;  2QKC A;  3CYO A;  3ZRW A;  2IJK A;  2YXL A;  1AJP A;  4G28 B;  2YIA A;  1FXK A;  1XMQ B;  1AB3 A;  4UB6 Z;  4OPA A;  3ZHR A;  1J95 A;  1KP2 A;  4PDM A;  2UXD B;  4K8Z A;  1GH6 A;  3HKB A;  5B1O A;  2ZR2 A;  4MVO A;  3CC7 V;  4LF7 O;  2JDI G;  1Z2G A;  2OCH A;  2XAQ A;  2ZDI C;  4NTX A;  5FLX N;  3MHS C;  5IWA B;  1YTF B;  5EYP B;  1XMO B;  4ZHQ B;  1XHZ A;  1QR8 A;  4DK0 A;  1P84 F;  4IL6 Z;  4DR3 O;  2WLI B;  1MG1 A;  2X0L A;  4WFA V;  1NH2 D;  2K9P A;  2KG7 B;  5H2F Z;  1QR9 A;  1K4C C;  1SS3 A;  4J7K A;  1R3K C;  1OCO C;  3BAB A;  3ZMS A;  3RGB A;  4X9Q A;  3CRA A;  1BS3 A;  2VQE O;  3CSX A;  4LF7 B;  3SJC C;  4K8X A;  2IM9 A;  3TXQ A;  1G4Y B;  2ZIN A;  1QVF U;  1M56 C;  4JV5 O;  1JQ0 A;  4W4K A;  1K4D C;  4QJF B;  5K1X A;  2E74 B;  2IBZ H;  2P5O A;  4I7Z B;  2JS5 A;  4DR3 B;  1WA8 B;  4X62 O;  5ITZ B;  1H8E G;  4D7S A;  2XAS A;  4LNU A;  4Z1V A;  5IYZ B;  2H8P C;  2IH1 C;  4WFG A;  3AG1 C;  4RO2 A;  3UT5 B;  3EHB B;  5KHI A;  4MVQ A;  2R9A A;  1R6T A;  1Q43 A;  2YIC A;  5LYJ B;  3E89 A;  3VQX A;  4ZOL A;  2GHY A;  3A2F A;  3M99 B;  1URF A;  1S76 D;  3QTC A;  2VQE B;  3HKD B;  1XIL A;  4DV7 B;  4JV5 B;  2GUZ A;  2EIK B;  3OUS A;  4LBE C;  5LHG A;  2H94 A;  3SJA C;  1WP7 A;  5L3C A;  2FML A;  4WCE V;  1JFF A;  4X62 B;  4WFE A;  3VQY A;  2XND G;  1AI5 A;  4X1I B;  4FMT A;  1YTF D;  3H1L H;  4N21 A;  1FXH A;  2QTO A;  1F23 A;  1JCH A;  1H2L A;  3S3W A;  2YDE A;  5EYP A;  1KD1 W;  4NXM O;  4FM0 A;  2GTS A;  1XI1 A;  3KKY A;  5IYC O;  2HFE C;  4TQD A;  1AI4 A;  1I08 A;  4PV1 B;  1OCZ B;  4LP8 A;  3FB6 C;  1JMK C;  3BY6 A;  4PA3 A;  4O4H B;  4LWS B;  5FNV B;  4UVC A;  3ZMV A;  4LF9 O;  3Q4H B;  5J2U A;  2OCC B;  1ARO P;  2LGQ A;  2EZP A;  2EJ7 A;  1XUQ A;  2YIB D;  4W4L A;  5KMG A;  2PI4 A;  1SES A;  2DYS C;  2EZO A;  2JJ2 G;  3E8B A;  2KB1 A;  1PKX A;  3CCL V;  2UXC O;  5EC2 C;  2KQX A;  4QPK A;  1VEW A;  3N2K B;  3ZIA G;  3E2E A;  4X64 O;  5JH7 B;  4DR1 O;  4NXM B;  4WF9 V;  4I50 A;  1H2N A;  1YCI A;  4J41 A;  3LDD A;  4XBF A;  4TV8 A;  3EFF K;  4CS3 A;  3CMA V;  2ITD C;  3OGI B;  1GM9 A;  4LF9 B;  3UT5 A;  1MAB G;  4KXR A;  4YIP A;  2YS8 A;  1Z5V A;  4GKK O;  2ZD9 A;  5LOV A;  4DK1 A;  4ZIB A;  4IGG A;  1UJW B;  4FZ1 A;  2Q7E A;  5IDJ A;  2UXC B;  1TAE A;  4X64 B;  3RFR A;  5LGU A;  3HKE A;  3UM7 A;  4DR1 B;  2VWJ A;  1BCC H;  4HYO A;  3RYI B;  2LO1 A;  3K03 A;  3QO5 A;  2GDS A;  3F5W C;  5IY5 C;  5IJ0 B;  4GUN A;  3L73 H;  5JVD B;  3L74 H;  3GWK C;  1VQN V;  3CJH A;  3ZRX A;  3T1C A;  3AEI A;  4UCO A;  1QLN A;  2A0L A;  1W2B U;  4X1I A;  5LGN A;  4JZG A;  1IVS A;  1WP8 A;  3T1Y O;  5EBM C;  3GVM A;  3LSU A;  4L8J A;  3HKC A;  4MVS A;  5GW7 A;  4JZ2 A;  1W0K G;  1Y66 A;  4GKK B;  3LSS A;  1M93 A;  1YJN V;  2B1G A;  3JCU Z;  1DTO A;  4RUE A;  3DXR B;  2BTO A;  2CUG A;  1VQ4 V;  3IJ4 A;  3HB3 B;  4MVM A;  1OJH A;  3P30 A;  4X1K A;  3W7U A;  5J2T B;  3VOU A;  4LWS A;  1Y76 A;  2XOK G;  5J9P C;  3FB5 C;  4PDR A;  4O4J B;  1CP9 A;  5L3E A;  2F43 G;  3ABM C;  3BAA A;  2HEP A;  2ZXW C;  3IC9 A;  2DYR C;  1A32 A;  1TVK B;  4J80 A;  4P9P A;  4KHP O;  2QTS A;  3T1Y B;  4OXS A;  2AXT Z;  2PZS A;  4NKG B;  2HVJ C;  1ZX3 A;  4J9Y B;  3SPI A;  1SQG A;  1VQO V;  1SZX A;  4O4L B;  1FS0 G;  3UKM A;  3NR7 A;  2HG5 C;  3CB2 A;  1YIT V;  3OD4 A;  1SRY A;  1VAR A;  3C3S A;  3LSQ A;  1VIB A;  1L0L H;  2JRI A;  1JJ2 U;  2V7Q G;  2YI9 A;  4IHJ A;  3JAS B;  3QNE A;  2NLJ C;  3R65 A;  1RP3 B;  5D5P A;  2IJI A;  3T1H O;  1Q86 W;  1DF4 A;  4OX9 O;  1Q81 W;  1Q8I A;  2E5L O;  5GTH Z;  4GX5 A;  4Q20 A;  2ADQ B;  1HP8 A;  4JI6 O;  3WB0 A;  4KHP B;  3K08 A;  3OEH G;  2GTA A;  5BZB A;  4OGQ B;  3K06 A;  4RWU A;  3UO3 A;  5LP6 B;  3BFR A;  5LA6 B;  5C93 A;  3APQ A;  3ETE A;  1JJO A;  3N2G B;  3ZHT A;  1PNL A;  3X2Q C;  3JAR A;  3L72 H;  5TIS Z;  2EIJ C;  1XDC A;  1L8D A;  3QO7 A;  5LMN B;  3JAT A;  2XT9 A;  4YJ3 B;  3T1H B;  5JQG A;  1OZ0 A;  4OX9 B;  2FB5 A;  2E5L B;  4PHZ A;  2WLJ A;  4AI8 A;  5H9C A;  4JI6 B;  2EX3 A;  5FPR A;  1QCE A;  1K8A W;  2DYS B;  1NVP B;  3QO8 A;  4O4I B;  3RVZ A;  3TJT A;  4I4T A;  1DLB A;  5J2T A;  5JJJ B;  3H1J H;  1QQC A;  2ZIM A;  2E76 B;  3MHH C;  1N4C A;  4QE7 A;  4DR2 O;  3FD9 A;  1YJ9 V;  2QWO B;  1M4U A;  3ZCC A;  2IJJ A;  5A9G A;  2EIN C;  2DWD C;  4DUY O;  3ASN C;  4Z2W A;  2ZM6 O;  1VF6 C;  1B06 A;  3SPH A;  2QWN B;  1IXM A;  3ZN1 A;  1P4R A;  1NR7 A;  3JAK A;  4P2Z A;  4EEQ A;  2A06 H;  5KHJ A;  2QM4 A;  1GRJ A;  5JCO C;  4I5S A;  3N27 A;  4HZ3 A;  4B3M O;  4CS2 A;  1TUE B;  3L70 H;  5B1N A;  4JYB A;  3C3T A;  1OCZ C;  3E35 A;  5CB4 A;  2E3C A;  1AP5 A;  4RUF A;  1AR4 A;  3STL C;  4LFB O;  4JYA B;  3SPC A;  3W7T A;  4DR2 B;  4I55 A;  2Z3Y A;  4DV4 O;  4ZBM A;  1D2D A;  4DUY B;  2ZM6 B;  2Y0P A;  4DRX B;  1BE3 H;  3QG5 A;  3AK2 A;  1K34 A;  1K5S A;  4ABM A;  3LDC A;  3W7X A;  2ZNJ A;  2NR5 A;  5CA0 B;  4LF8 O;  1O9G A;  2YEV B;  4B3M B;  4F4L A;  3BCC H;  4DV0 O;  1BHB A;  2UU9 O;  1JOY A;  1GKF A;  4J11 A;  3AG2 C;  3CC2 V;  1AJQ A;  1NZ6 A;  4LFB B;  3CME V;  4X8A A;  1E1R G;  5EK0 A;  4FFK A;  3JCZ A;  3QF7 A;  3LDE A;  4JAS A;  4DV4 B;  2PY5 A;  1NVP D;  2L6L A;  1EZV H;  1R6N A;  1LUW A;  4UUJ C;  1PP9 H;  4YJ2 A;  2PUS A;  1FYJ A;  3RYH A;  2A7W A;  3ABM B;  3CWB H;  4FPP A;  5A2Q N;  1NBM G;  3CCS V;  4UVB A;  2ZXW B;  2DYR B;  2Y48 A;  3PJS K;  5KHH A;  1GO3 F;  4ICG A;  4LF8 B;  4WFB V;  3ZMT A;  5LHH A;  3FB7 C;  4DV0 B;  1PNK A;  4TOI A;  5H6Q A;  2UU9 B;  3FAV A;  3D3Q A;  1S72 V;  1IBL O;  1FPO A;  4U3J B;  3CC4 V;  3TGU H;  3K59 A;  4GLX A;  5LXT B;  4R50 A;  4WBN B;  2F93 B;  5IYB O;  3K5L A;  1I7F A;  5GTI Z;  2ZNI A;  1VQP V;  2VQF O;  3CCR V;  3CP1 A;  2LW7 A;  3CCM V;  2Q7G A;  3CD6 V;  1SQX H;  1VQ6 V;  2LW1 A;  1GM7 A;  1JVM A;  1SF9 A;  3RYC B;  3FX7 A;  3E8F A;  2X6A A;  4YY3 O;  4DV7 O;  2IU0 A;  4TT3 G;  2P90 A;  4FIP C;  1HNW O;  2LGW A;  1SZT A;  3MDS A;  1IBL B;  4BR6 A;  1I94 O;  1G1X B;  1KUQ A;  2WLN A;  5B1B C;  2CTR A;  2OIE A;  2NNU A;  3X2Q B;  4LCU C;  2RMK B;  4EFB A;  1SKV A;  4PDL A;  3CXH F;  3ZJZ A;  3ZX6 A;  2BTQ A;  4GKJ O;  2ZIO A;  2EIJ B;  4BAY A;  2D3O W;  3HPL C;  1Q6U A;  4AQY O;  1UFI A;  2LFS A;  1ZL8 B;  2QR4 A;  1BSM A;  5KUK A;  2VQF B;  4DR4 O;  3B09 A;  3MAQ A;  2WLL A;  4X20 B;  3ZRS A;  4JI3 O;  4YY3 B;  3ABU A;  1FKA O;  3A8T A;  4FLY A;  3OTO O;  3OAA G;  3TK1 A;  4O2A B;  5CBH A;  1V54 B;  1HNW B;  5JJN B;  3K5N A;  2D2C B;  4TV9 B;  4EB6 B;  1I94 B;  3K57 A;  4TUY B;  1PL0 A;  1Q3E A;  4J9Z B;  1VQ9 V;  2N04 A;  4E2L A;  2BOB C;  5FPO A;  1YEW A;  2ARH A;  2EIN B;  2DMX A;  2Z5U A;  3ASN B;  2Q0O C;  2YC0 A;  3VQV A;  4X65 O;  4GKJ B;  4AQY B;  5LP6 C;  2P4K A;  1S3J A;  4DR4 B;  2AHY A;  1BQ0 A;  3HR0 A;  3U0Z A;  3B8M A;  1AR1 B;  2ZE8 A;  3CCJ V;  2OTL V;  4ZHQ A;  4AIL C;  2AZ2 A;  1WB7 A;  4BIZ A;  2DN9 A;  1Q6H A;  2DQ3 A;  2Q67 A;  2Z0A A;  3AG3 B;  4JI3 B;  3THO A;  3CX5 F;  2WLI A;  3PN1 A;  1IX9 A;  2QWR B;  5IJ9 B;  3OTO B;  1XHX A;  2KG7 A;  4UCU A;  2Q7H A;  3H01 A;  2LJ2 A;  4O2B B;  4YIO A;  2QGN A;  3RN4 A;  2HKO A;  4DXW A;  4GT1 A;  3WU2 Z;  1F7Y A;  2PI5 A;  1BHA A;  1Q5O A;  4BW5 A;  2QWP B;  1IBM O;  5CA3 A;  1K92 A;  3AG4 C;  4X65 B;  2HJD A;  3M8A A;  5DN6 G;  4UVA A;  4GCZ A;  1H2M A;  3OFN G;  2YIB A;  2QEX V;  3LNM B;  4IYH A;  3SPJ A;  1DK1 A;  3RT3 C;  3E86 A;  1FXK C;  2H3O A;  1H2S B;  1YF2 A;  4BW9 A;  1HNZ O;  3KCY A;  4KUM A;  1AI6 A;  3SYO A;  3K3W A;  1OCC C;  4FZ0 A;  1WA8 A;  1YXB A;  3E8G A;  5ITZ A;  3AG2 B;  3K9A A;  1YI2 V;  2YXY A;  5IYZ A;  4PA4 A;  1TUB B;  1SA0 B;  3CCU V;  3RWR D;  3OEE G;  3SYA A;  4FVM A;  2KSD A;  4DV1 O;  5LYJ A;  1TA8 A;  2Q0A A;  4MW8 A;  1IBM B;  2UXX A;  4CS4 A;  2ADP A;  2X6B A;  4XDJ A;  2O57 A;  3ZN0 A;  2AGA A;  1VQL V;  1RSO B;  2UUC B;  3JAL B;  1R73 A;  3HKD A;  2PYJ A;  1I5X A;  1B3Q A;  5L3G A;  5E79 Z;  1HNZ B;  2NN4 A;  1RM1 C;  2Y69 B;  3ZHQ A;  5KHK A;  2CK3 G;  1R6K A;  4JTC B;  2WLH A;  1XL6 A;  4HNA B;  5KHG A;  1SQV H;  5BXZ A;  1GMG A;  2W0F C;  4FLU A;  3B77 A;  3RYF B;  3CCQ V;  2ODM A;  1VF6 A;  4ZI7 B;  3TCU A;  4DR5 O;  4DV1 B;  3DTU B;  4Q6G A;  4JTA B;  4FM2 A;  1I0H A;  1YHQ V;  5LGT A;  4FK5 C;  3OM3 B;  1PM9 A;  2LQT A;  2ZE5 A;  3J81 N;  4WFH A;  3K58 A;  4GZR B;  2R72 A;  4B7E A;  3SYC A;  3K0G A;  4GX0 A;  4MSW C;  5BMV B;  4O4H A;  5FNV A;  2Q73 A;  4HAM A;  2CTW A;  1OCR C;  1J5E O;  3L9D A;  3ETD A;  3Q4H A;  3E22 B;  4U7O A;  1GM8 A;  1H8H G;  5EBL C;  1IUR A;  1D5A A;  4JGS A;  2QM7 A;  5B1B B;  5CA1 B;  4KFM A;  3IAY A;  3A0B Z;  2E75 B;  3O9O A;  5B3S C;  1Q90 D;  4LF5 O;  1Y74 B;  1AP6 A;  1IZ3 A;  2Q4P A;  3FB8 C;  4I0X B;  1K9M W;  4DR5 B;  1X4T A;  2X6C A;  3JD0 A;  3GB7 C;  5IE9 A;  4P9O A;  3N2K A;  2RCV A;  5JH7 A;  1QLE B;  2M6Y A;  2UUA O;  1EN6 A;  1WPX A;  3KCX A;  4JI0 B;  5IYD O;  4X89 A;  1P7G A;  4L87 A;  1RPO A;  3DSQ A;  5LMU O;  1NS1 A;  3G4S V;  2OT5 A;  2IJH A;  1SC5 B;  2EIL C;  3WB1 A;  4NTY A;  1J5E B;  2YSU B;  2Y4T A;  4X1Y B;  5LMN O;  4MT8 A;  3JSN A;  1QVG U;  2M7W A;  1H2G A;  4B3S O;  3WG7 C;  4FFB B;  2F23 A;  2QDO A;  3SYP A;  2JIZ G;  4LF5 B;  4JI2 O;  4G2K A;  5C8Y B;  3CE2 A;  1GN3 A;  4PDV A;  2N05 A;  5L3D A;  3JAW B;  4F6R B;  2IU3 A;  2ZDI A;  3VBB A;  2IW5 A;  3OUF A;  3RYI A;  2UUA B;  1WB8 A;  1XNQ O;  3D3I A;  2Y0I A;  4JAU A;  1KB9 F;  1ZSP A;  1COW G;  3IFX A;  5CBF A;  5IJ0 A;  5JVD A;  5JWP A;  5H5N A;  2W0X A;  3JD4 A;  1P49 A;  5LMU B;  2ATK C;  1NR1 A;  4LH6 A;  2Q68 A;  5KA6 A;  4B7K A;  4MS2 A;  1SET A;  2CGN A;  5EZY B;  2A79 B;  1NTZ H;  4RQF A;  1G6U A;  3ABL B;  3C90 A;  4TWK A;  2Q5Z A;  4B3S B;  5KX5 B;  1KMI Z;  2WSS G;  1NQT A;  3CXC U;  4MTX A;  4ASU G;  3DXR A;  3OR7 C;  4H44 B;  4JI2 B;  1V55 B;  4IIJ B;  3BRC A;  3OGC C;  2EIM C;  3AG4 B;  1R3J C;  3H1I H;  3CS5 A;  4FLW A;  1FJG O;  2BSK B;  2JGD B;  1PV0 A;  2FL4 A;  4CH5 A;  1V54 C;  1XNQ B;  1GN4 A;  1FXK B;  4JYA O;  1N33 O;  2ETN A;  4UB8 Z;  4G27 B;  3OMI B;  3ZED A;  4O4J A;  3HKB B;  1OCC B;  3OMN B;  5D5Q A;  2YXH A;  4DV6 O;  1TVK A;  4PI0 A;  4FLT A;  2V1D A;  4YXW G;  2ZCE A;  2OYQ A;  3B2E E;  2OIG A;  1G8M A;  1DF5 A;  1BGY H;  4WFF A;  2PYL A;  5AG2 A;  4O4L A;  2P67 A;  2KKW A;  5FL7 G;  2JK5 C;  3ETQ A;  1I5Y A;  4F6E A;  2QKA A;  5IT9 N;  4DV5 O;  3AG3 C;  1R1B A;  1L1F A;  1FJG B;  4LR3 A;  4JPR A;  3BHP A;  2QSA A;  2Q69 A;  2BE3 A;  5CN0 A;  2CTP A;  4QE9 A;  3JAS A;  2JGU A;  1N33 B;  5F2V O;  1RM1 B;  2F4V O;  2XUM A;  2LFR A;  3EVK A;  4MVZ A;  1EZJ A;  1IBK O;  4DV6 B;  1M57 C;  1F51 A;  4GX2 A;  3K9S A;  2P4V A;  5EBW C;  3E8H A;  4J7Z A;  1CPY A;  3NXS A;  2ZKO A;  2IH3 C;  1R3I C;  1CEZ A;  1GAX A;  3BA9 A;  4B08 A;  5LP6 A;  3CCV V;  3SDL A;  4X66 O;  4J7J A;  5DED A;  1MMM A;  5LA6 A;  3IGA C;  4UCV A;  4DV5 B;  2ZE6 A;  3N2G A;  4LNU B;  4LF4 O;  4PA9 A;  2YID A;  3BA8 A;  1NU1 H;  3G6E V;  3LUT B;  1YDX A;  2F4V B;  3D8C A;  3WFV A;  4YJ3 A;  2LP7 A;  4N23 A;  1OCR B;  3B8N A;  4R8C A;  1IBK B;  4ZOL B;  4DR6 O;  4CC5 A;  3ZHS A;  1KU9 A;  1H38 A;  2JVD A;  1QNM A;  3U10 A;  5HFL A;  4FLV A;  4O4I A;  5B3S B;  1WLE A;  4U3F H;  2GUZ B;  1NTM H;  3P3N A;  2ZT9 B;  3JD3 A;  4D6T H;  2RQ6 A;  2CDY A;  4NB5 A;  2Y69 C;  2P6J A;  4X66 B;  5L3F A;  4JTD B;  2BOC C;  3D36 C;  1VQM V;  3SPG A;  1JFF B;  1SQQ H;  3I55 V;  2A9H A;  4LF4 B;  2GV9 A;  1W59 A;  4UXN A;  3WB2 A;  3B40 A;  5DM6 V;  1ZUQ A;  2PTM A;  2EIL B;  4K35 A;  2XAG A;  3ETG A;  2ITC C;  4JI5 B;  4DR6 B;  1AR5 A;  4K3A A;  4KL1 A;  2WLK A;  1KQS U;  2P06 A;  3WG7 B;  2CAZ C;  1SQP H;  3ZRV A;  2EBO A;  3BVO A;  2VRZ A;  1R3L C;  4BIU A;  3TXS A;  2RN9 A;  4AHC A;  4MTG A;  1SER A;  1Q82 W;  1S5H C;  5J2U B;  4EKW A;  1US6 A;  2GBO A;  1RPR A;  3STZ C;  3JYC A;  4JI7 O;  1BZK A;  5KMG B;  1BQZ A;  2CH7 B;  1V9P A;  2Y4U A;  1KYO F;  4DRX A;  2Q8V A;  1WJZ A;  3ZBH A;  4PA6 A;  2ZQM A;  1S0V A;  4UCT A;  3OTF A;  3B4S A;  1MNG A;  1O9H A;  5HFM A;  1Y67 A;  3J7A U;  3ABK C;  4CBC A;  3OMA B;  1QLE C;  4IT5 A;  1U97 A;  5CA0 A;  4I50 B;  1Q6I A;  2YEV A;  2JEX A;  1X59 A;  2F1M A;  1THZ A;  2VWK A;  3F7Y C;  4MVR A;  4TV8 B;  2EIM B;  1JPX A;  1K5Q A;  2QM8 A;  4PI2 A;  5BR8 O;  4B3R O;  2XAJ A;  3ASO B;  1DGS A;  1KKC A;  2DE0 X;  2OTJ V;  5LL6 Y;  5GON B;  4JI7 B;  1KP3 A;  5KA5 A;  4CZZ A;  1EM1 A;  3OW2 U;  5LOV B;  3W7W A;  4NXN O;  3T4Z A;  4CH3 A;  4H37 A;  5LBQ A;  1HWY A;  3H9V A;  3O65 A;  1W0J G;  3A0H Z;  4LF6 O;  2XTA A;  4JYY A;  4FLZ A;  2JS3 A;  4ZKI A;  1LR1 A;  4JAA A;  2PGG A;  3HKE B;  3P32 A;  1YSC A;  3T2M A;  2VS0 A;  1QBZ A;  1N32 O;  1JA8 A;  4NYK A;  2G38 A;  3CJH B;  1MSD A;  3H1H H;  3G67 A;  1GN6 A;  4E4E A;  1VQ5 V;  3EXA A;  4U3J A;  1FXV A;  3F5T A;  5BR8 B;  4B3R B;  4GX1 A;  1YVW A;  3SGI A;  4EFE A;  4LFC O;  3HKC B;  2YUA A;  3LNN A;  5LXT A;  4WBN A;  4DYL A;  5EC1 C;  2WA3 A;  4FJC C;  1HDJ A;  3ABL C;  2JEU A;  3L75 H;  3I56 V;  4H13 B;  1PNM A;  1SQF A;  2DOS A;  4NXN B;  1Z5W A;  1MSW D;  5BY1 A;  1EN4 A;  1T5E A;  2B9Z A;  4LF6 B;  1V55 C;  5EIB C;  1K97 A;  4H33 A;  1M57 B;  1FFX B;  1GN2 A;  3K79 A;  4X1K B;  3W7S A;  1F4N A;  3K0D A;  2UUC O;  1M90 W;  3RYC A;  1Y76 B;  3AK1 A;  5KUM A;  1L0N H;  1N32 B;  2R9I A;  3AK3 A;  3S3X A;  2HJF C;  2WWW A;  2AZ0 A;  2R70 A;  4YHH O;  1VQ7 V;  5B1A C;  2AW9 A;  4RAI A;  1YIJ V;  1ZTE A;  2CH7 A;  1P7B A;  3ZMU A;  5E1A C;  4LFC B;  3I5D A;  1ORQ C;  1FD9 A;  2OWO A;  3A0R A;  5JJE B;  3BEH A;  1ROP A;  3U11 A;  4JYC A;  1S77 D;  2ZR3 A;  2XAF A;  1ZL8 A;  4DW1 A;  3ZHV A;  4JI4 O;  2RJZ A;  2R9R B;  2UUB O;  1KEC A;  4DO2 A;  4DV3 O;  4X20 A;  1OV9 A;  3G6B A;  3VQW A;  4D7T A;  3AG7 A;  1XRE A;  3FKS G;  4A5U B;  1ENV A;  4IHJ B;  2W6J G;  2ZE7 A;  5DEC A;  4O2A A;  4YHH B;  5GON A;  3ZHU A;  1H2K A;  2QJ1 A;  3CRC A;  4TV9 A;  4EB6 A;  1N0J A;  4TUY A;  2RNB A;  1NI8 A;  5K1P A;  3R66 A;  3ML0 A;  4MVU A;  4UFZ A;  1KKD A;  1BT8 A;  3CRM A;  1HNX O;  1U96 A;  2C2A A;  4X88 A;  3P3P A;  3J80 N;  2N74 A;  4UCS A;  1N36 O;  4JF3 A;  4I9Q A;  3APO A;  3SJB C;  4B3T O;  3UQ8 A;  5LHI A;  4JI4 B;  3UCS C;  1TGO A;  3ZS8 C;  1RFY A;  2UUB B;  3K5O A;  4PJ0 Z;  4DV3 B;  2L35 A;  3G80 A;  1QHT A;  5JCO A;  1LUV A;  3JAR B;  4PEL A;  4JI0 O;  1HR0 O;  4DR7 O;  3ABT A;  4J10 A;  2B1I A;  4UV8 A;  1ZAU A;  5IJ9 A;  1NKD A;  1XNR O;  3OT7 A;  3JAT B;  4JI8 O;  4BIO A;  4PD4 F;  5JQG B;  3T4D A;  1M9N A;  1XEQ A;  2P7T C;  2WPD G;  5B5E Z;  1MZF A;  4O2B A;  1OCO B;  3CRR A;  2UXB O;  1XBL A;  1AVM A;  1HNX B;  2W6I G;  1Y6X A;  1FFX A;  3DC6 A;  2Q6A A;  4I4T B;  4H0L B;  2UXN A;  4QNH B;  3K04 A;  1N36 B;  1M56 B;  3MD0 A;  1GTO A;  2EJR A;  4B3T B;  4DW0 A;  4NR1 A;  5L3B A;  1NTK H;  1YZB A;  3ABK B;  3FFQ A;  2B5U A;  4U7N A;  1YJW V;  2FYU H;  1PL4 A;  1OHH G;  1HR0 B;  4DR7 B;  3IC7 A;  1M1K W;  3TET A;  3ICX A;  2YI8 A;  1XNR B;  1K73 W;  4QGP A;  4LH7 A;  4JI8 B;  1JR9 A;  4JI1 O;  3JAM N;  1TUB A;  1SA0 A;  4NVP A;  2MK3 A;  3AG1 B;  3JAK B;  2X7R B;  1FAF A;  4TQF A;  2UXB B;  1SQB H;  4LC1 A;  1ZLZ A;  4DUZ O;  1WAZ A;  5H6R A;  1HW7 A;  1EFR G;  3KZI Z;  3RBZ A;  3OE7 G;  1BL8 A;  1VP7 A;  2WLM A;  4KP4 A;  5CB4 B;  4DV2 O;  1RSO A;  2XHB A;  3JAL A;  1VQ8 V;  4MW3 A;  1VF7 A;  3JD1 A;  3FYE B;  3F7V C;  3RVY A;  4LFA O;  4HBN A;  1AIL A;  4GYC B;  1M5I A;  2GSM B;  1UPG A;  4I55 B;  3CRQ A;  3FYI B;  1CXZ B;  3CHX A;  1WNS A;  3D36 A;  4K0K O;  4XDK A;  4OPH A;  4HNA A;  2CGO A;  2HVK C;  1Q7Y W;  4JAV A;  2F66 C;  3L71 H;  3RYF A;  1S5L Z;  1K7D A;  3SYQ A;  2MW2 B;  4JI1 B;  4ZI7 A;  3JSL A;  1E1Q G;  1B04 A;  1D5N A;  4IYI A;  4DUZ B;  4CC6 A;  1GK9 A;  2FKX A;  5CBG A;  2P22 C;  4PA7 A;  1XOU A;  4DV2 B;  3KG2 A;  2XAH A;  4UCR A;  3G71 V;  2HLD G;  4LFA B;  3ZMZ A;  2JJ1 G;  3E83 A;  3ASO C;  4FLX A;  5BMV A;  1EBO A;  3ZRW B;  3OR6 C;  4XDL A;  4K0K B;  1XL4 A;  1ZWI C;  1WN7 A;  2HP8 A;  3DC5 A;  3E22 A;  4C7U A;  1B6Q A;  4YJ2 B;  5B1A B;  3RYH B;  2K1E A;  2BCC H;  2QWQ B;  4MTF A;  5CA1 A;  2QA4 V;  4FM1 A;  1JX9 A;  3CCE V;  2DJV A;  2CE4 A;  1S5J A;  4R7C A;  3JD2 A;  1NJI W;  1Y74 A;  4I0X A;  3CPW U;  2EIK C;  1PPJ H;  2ILM A;  1QU7 A;  3K5M A;  2DQ0 A;  3QVN A;  3FAV B;  1EN5 A;  3RW0 A;  1VQK V;  1XQ8 A;  1KBH A;  2HHH O;  1K33 A;  1N34 O;  1VMG A;  4I9W A;  2WAM A;  2FTK A;  2WA4 A;  1BMF G;  3DGE A;  4TSF G;  2DWE C;  1IDS A;  4CH6 A;  2HR3 A;  2QKS A;  2CTQ A;  4X1Y A;  4CH4 A;  1E79 G;  1NT2 B;  1NH2 B;  2QE7 G;  1K3E A;  1MOF A;  4J42 A;  4FFB A;  1AI7 A;  5KAI Z;  1MA1 A;  1KC8 W;  1F4M A;  4UV9 A;  5C8Y A;  1IXB A;  1N8R W;  1WPB A;  2EUL A;  1Y4M A;  3JAW A;  4F6R A;  1N0N A;  3M7M X;  2OCC C;  5IY5 B;  1FFT B;  1LNQ A;  4P30 A;  1VF5 B;  5KLV H;  1XMQ O;  2V4D A;  2UXD O;  2HHH B;  4Z1M G;  1N34 B;  3CEI A;  4R6Z A;  2DW4 A;  3SR2 C;  4QPJ A;  4QIW F;  3SJQ C;  2F95 B;  4RQE A;  2BTQ B;  1MZE A; 
#chains in the Genus database with same CATH homology
 3T1Y O;  4LFB O;  4JV5 O;  5LMN O;  4LF9 O;  1YZB A;  5LL6 Y;  4DV4 O;  5IWA O;  4B3S O;  4JI4 O;  4JI5 O;  2UUB O;  1D2D A;  2VQF O;  4NXN O;  4DV3 O;  1XMO O;  5IT9 N;  4DV5 O;  5BXZ A;  3O65 A;  2LW7 A;  2Z0A A;  4LF6 O;  4X62 O;  4JI2 O;  1R1B A;  2DJV A;  4A5U B;  4YY3 O;  4JI1 O;  3JAM N;  2UXC O;  4DV7 O;  4DR5 O;  4X64 O;  1R6T A;  1HNW O;  2F4V O;  1N32 O;  4LF8 O;  4DR1 O;  1AB3 A;  1XNQ O;  4OPA A;  4DUZ O;  4DV0 O;  1I94 O;  1G1X B;  1KUQ A;  1F7Y A;  1IBK O;  1IBM O;  3R66 A;  5H5N A;  2UU9 O;  1HNX O;  3J81 N;  2HHH O;  3M8A A;  3F5T A;  1N34 O;  4DV2 O;  1A32 A;  4LF7 O;  4KHP O;  3J80 N;  2N74 A;  4LFA O;  4LFC O;  4GKJ O;  1AIL A;  2ZKO A;  5FLX N;  1N36 O;  1DK1 A;  3RT3 C;  4B3T O;  4AQY O;  1J5E O;  1HNZ O;  4DR2 O;  3SDL A;  4X66 O;  4GKK O;  4DR4 O;  2DOS A;  4K0K O;  4JI7 O;  4OPH A;  5BY1 A;  1FYJ A;  4DUY O;  5A2Q N;  4DR3 O;  2ZM6 O;  4JI0 O;  1HR0 O;  4DR7 O;  2JRI A;  4JI3 O;  4LF5 O;  4LF4 O;  1FJG O;  2UUC O;  1FKA O;  1XNR O;  4JI8 O;  3OTO O;  1XEQ A;  3J7A U;  4JYA O;  3T1H O;  4DV1 O;  1N33 O;  4YHH O;  4OX9 O;  4DR6 O;  2UXB O;  1XMQ O;  2FKX A;  1X59 A;  2E5L O;  2UUA O;  4B3M O;  4NXM O;  2UXD O;  1IBL O;  2AGA A;  4JI6 O;  2VQE O;  4DV6 O;  4X65 O;  5LMU O;  1NS1 A;  5BR8 O;  4B3R O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...