3SDLA

Crystal structure of human isg15 in complex with ns1 n-terminal region from influenza b virus, northeast structural genomics consortium target ids hx6481, hr2873, and or2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
95
structure length
95
Chain Sequence
TTQIEVGPGATNATINFEAGILECYERFSWQRALDYPGQDRLHRLKRKLESRIKTHNKSEPENKRMSLEERKAIGVKMMKVLLFMDPSAGIEGFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/antiviral protein
molecule keywords Non-structural protein 1
publication title Structural basis for the sequence-specific recognition of human ISG15 by the NS1 protein of influenza B virus.
pubmed doi rcsb
source organism Influenza b virus
total genus 35
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3sdlA00
4LF7O 2Z0AA 2N74A 4LFCO 4B3TO 4DV7O 4JV5O 2AGAA 2UXDO 1AB3A 2UUCO 2UU9O 1I94O 3T1HO 2UXBO 3O65A 4A5UB 1IBMO 5LL6Y 4JI7O 4OPHA 1IBKO 4JI2O 3M8AA 1KUQA 2E5LO 3OTOO 4DR5O 1NS1A 2UUBO 4OPAA 1IBLO 4JI8O 1N32O 5FLXN 1A32A 1G1XB 4LF6O 4B3SO 4X64O 2VQEO 4DR2O 1FKAO 2HHHO 5IT9N 3RT3C 3T1YO 4LFAO 4DR4O 5LMUO 4DV5O 1F7YA 5BXZA 1YZBA 2JRIA 4JI3O 4X65O 1D2DA 5H5NA 4LF8O 2UUAO 1N34O 4OX9O 4JI1O 4JI6O 4GKKO 1R6TA 4LFBO 1HNXO 4DV4O 4GKJO 1X59A 1FJGO 4DV2O 3R66A 1FYJA 4DV1O 4DV3O 4B3MO 4B3RO 4JYAO 2FKXA 2VQFO 4DV6O 1HNZO 3F5TA 4DR7O 5IWAO 3J81N 4JI5O 4JI4O 3SDLA 5A2QN 1XEQA 1HR0O 1DK1A 4DR3O 4KHPO 1N36O 1N33O 5BY1A 4AQYO 1XMOO 2F4VO 1R1BA 1J5EO 4DV0O 3JAMN 4K0KO 4YHHO 2DJVA 4YY3O 4DR6O 3J7AU 5BR8O 2DOSA 2LW7A 4LF4O 3J80N 5LMNO 4LF9O 4NXMO 4JI0O 4DUYO 4LF5O 2UXCO 1XMQO 2ZM6O 4NXNO 1HNWO 2ZKOA 4DR1O 1XNQO 4X66O 1AILA 1XNRO 4X62O 4DUZO
chains in the Genus database with same CATH superfamily
1M57C 2R72A 3OE7G 4IT5A 2JS5A 5B5EZ 4JASA 1I5XA 3ZMZA 3ZMSA 1VARA 5KHGA 1XUQA 3HR0A 5GTIZ 3RFRA 3T1HO 2LJ2A 1XOUA 1P7BA 2BE3A 2PGGA 4H0LB 1NQTA 4MTXA 5LHGA 4CS4A 3UO2A 4UUJC 4H13B 2IBZH 4I50B 4RQFA 1KB9F 2XAHA 3DC5A 2V1DA 1M57B 4GYCB 1ZAUA 3WU2Z 4DR7B 1H2KA 4JI5B 3H1JH 1V54C 5DN6G 3IJ4A 1N36B 1S72V 4JI6O 3ZN0A 1RPOA 2DYSB 2ODMA 1GN3A 1MSDA 2ZXWC 4B7KA 5B1AC 3B77A 3K03A 3G4SV 3ETQA 3ZRSA 3UO3A 2LO1A 1K4DC 2NLJC 1K33A 4UVCA 4EEQA 3JD0A 1Y74B 1DK1A 2ZM6B 3JCUZ 1XNQB 2QKSA 3HKBB 1K7DA 4QE9A 3ZMUA 3WG7B 5IDJA 2ZNIA 2AZ2A 3BY6A 2PI4A 3TGUH 2W0XA 2JGDB 1OV9A 4DUYO 1K5SA 3MHSC 2P90A 3K57A 1EN4A 4I50A 2ZXWB 3CCUV 2JK5C 3SYQA 3L72H 4X66B 3FYIB 4B3TO 4DUZB 2HEPA 1N4CA 2QKCA 4TUYB 3NXSA 1N0JA 1AJPA 3FYEB 3UQ8A 1SQPH 4A5UB 1BQZA 4FFBB 2HKOA 1YIJV 5AG2A 3CMEV 2XUMA 1RSOB 3H1HH 2CTRA 3DC6A 3QO5A 2A9HA 1Z5WA 5LMUB 1S3JA 3UCSC 3QNEA 1IDSA 5KLVH 1KD1W 4LWSB 1Y74A 1IBLO 5CA1B 4GKKB 1MMMA 4K3AA 1OCOC 2ZQMA 3T1YO 1RM1B 3AG4C 2JGDA 3CCSV 1BHAA 1T5EA 1KQSU 1VQ5V 3KKYA 4OX9O 1YITV 3QVNA 5JCOC 5KX5B 4X65B 1F23A 4J9YB 4BIZA 1B6QA 4FZ1A 1BGYH 5EIBD 1VF5B 2EILC 4JGSA 2F95B 1K8AW 5DEDA 4QPKA 4Z1VA 2GDSA 3M99B 4TUYA 3FB6C 4B3MB 4I5SA 3S3XA 3EVKA 2A06H 4CH5A 3LSQA 4FFBA 3CB2A 2E3CA 1B06A 1K34A 4YHHO 1RSOA 4MTFA 4BWAA 5EBLC 1KP2A 1S5LZ 2ILMA 2WLJA 2Q69A 1P4RA 2WA3A 1NBMG 2K1EA 4GX0A 4LWSA 3T1HB 5LMNB 5CA1A 1E1RG 3ICXA 5EBWC 1AP6A 4MVUA 3DTUB 1XBLA 3ETDA 3F5WC 2HJFC 5CB4B 3ZS8C 2HLDG 4UCRA 1SA0B 3OMNB 3OUSA 1IX9A 2UXDO 4RWUA 3VQXA 3UKMA 4FVMA 3OMAB 2R9AA 3RYCB 3E89A 4L87A 3M7MX 5KX5A 3F7VC 4EKWA 1IBKO 4C7UA 1VF6A 1AR1B 3N2GB 3RBZA 4YXWG 4TV9B 1FD9A 2VS0A 4U3FH 5EIBC 1P49A 1VQKV 4DW0A 3LUTB 3U10A 1OCZC 4LF6O 1Y6XA 3I55V 3EHBB 2Q0AA 3RT3C 1R3JC 2QWPB 2DMXA 4B3SB 2F93B 2LGQA 4FFKA 1NR7A 1NVPB 1WP8A 4O4HB 5K1XA 1US6A 1M1KW 1FJGO 3S3WA 5CB4A 2VWJA 5LA6B 1SA0A 1HNXB 3JATB 2XOKG 4DUYB 5GONB 2BCCH 4IIJB 3RYCA 3CC2V 3T4DA 2BTOA 1F4MA 1FPOA 1N33B 3N2GA 4TV9A 3W7WA 4B7EA 1MZFA 4B3TB 3JAKB 1PP9H 4D7SA 4DR6B 5BR8B 4BAYA 4RAIA 3OEEG 5EK0A 5LGTA 3C3SA 2LW1A 2H94A 3SJBC 1XMQB 1XL4A 4DR1B 3K5NA 3SPIA 2E75B 4FZ0A 1BT8A 5LP6B 4BW5A 2YC0A 1ORQC 2HR3A 4HZ3A 3CC7V 2NN4A 4NB5A 1YTFD 2Y69B 1N0NA 2OWOA 4O4HA 2H3OA 3CD6V 2GTAA 5LA6A 2R70A 4CH4A 3ZHUA 5KHHA 3CE2A 1BHBA 3JATA 4P9OA 4YJ3B 3SYPA 5GONA 1I7FA 4IIJA 2CGOA 1Q82W 1R73A 2JEUA 1N32O 4DR5B 5EBMC 1G1XB 3STZC 3BFRA 3BCCH 2AHYA 2HHHO 4WFAV 4LBEC 4MVQA 3SPGA 1WAZA 4DR4O 3KCXA 3JAKA 3SYAA 1EN5A 3B40A 4JTAB 2M6YA 1B04A 5KAIZ 1NZ6A 1FXHA 4JI1O 1W0KG 3JSLA 5IE9A 1FXKB 1VQLV 3ZHSA 1KMIZ 4YHHB 1SC5B 3OFNG 4DV3O 3K04A 2OIGA 3FKSG 2C2AA 2FKXA 1HNZO 1TVKB 2QWQB 4UCSA 4F4LA 5LP6A 1M56C 1NI8A 5GTHZ 3T1CA 2RNBA 4RUFA 1BE3H 1R3IC 4H33A 3VBBA 2F43G 5JJNB 2AZ0A 2UXDB 2QM4A 5CA3A 1YDXA 1HDJA 4PDLA 1IBKB 2Z0AA 3T2MA 4P2ZA 2DQ0A 2QSAA 4TT3G 3RVZA 2IH1C 1I94O 1YSCA 2Q8VA 3ABLB 1AR5A 4X8AA 5CBGA 2Y48A 1FXKA 1WPBA 1IVSA 4LF6B 4JZGA 3A0RA 4UCOA 2IM9A 5HFMA 5H6RA 2V7QG 2E5LO 1TVKA 2WLMA 1K73W 2XT9A 2GTSA 3HPLC 1R6NA 2RCVA 3F7YC 1CP9A 3E35A 4ZHQB 3LSSA 2DQ3A 1FJGB 4H44B 3STLC 5CBFA 2Q4PA 1YZBA 2B1GA 1JFFB 5ITZB 1XHXA 2QM8A 1NR1A 3CEIA 5L3BA 4PHZA 4FLTA 2Q67A 2EINC 3G80A 4NTYA 1VQ7V 3BA8A 2JGUA 4GKJO 1URFA 4DXWA 1NH2B 2YEVB 2VQFO 2QWOB 3E86A 3ML0A 3E22B 1H2GA 3SYOA 3SYCA 1Y4MA 2AXTZ 2EJ7A 3LDCA 3CCJV 1Q3EA 1I08A 2GV9A 3QG5A 2IJIA 2Q68A 1GM9A 2LW7A 2W6IG 1B3QA 3OGIB 2WLHA 4QE7A 4CS3A 3ABTA 4LF9O 3IAYA 1FXVA 5CA0B 1AJNA 5JWPA 2Y0PA 2CGNA 2OT5A 2YS8A 5EYPB 3W7UA 5L3GA 4UVAA 1U96A 4ZHQA 1QR8A 4G28B 1JOYA 1OHHG 4J7KA 1JFFA 5ITZA 4AILC 1H2NA 2P06A 1CXZB 4JV5B 1IURA 4DRXB 2UU9B 3GB7C 1UFIA 4B08A 2PTMA 2RDCA 2YEVA 4FM2A 2PYLA 1H38A 1YVWA 3K0GA 4DR4B 4ZBMA 2YXYA 1NS1A 4UV9A 1SERA 4CC5A 3E22A 3ASOB 2KQXA 3AG7A 3ZN1A 2ITCC 4JI1B 4KP4A 3U11A 2BOCC 3ZX6A 1H2MA 1PNLA 1FKAO 2QR4A 2DYSC 4DV3B 1H8HG 2EIJB 1OCCB 1PNMA 5KMGB 1L1FA 5DM6V 4WFEA 2FTKA 5CA0A 2ZR2A 4WFFA 3G71V 3SPHA 4QPJA 1QR9A 5H5NA 4TWKA 2Q5ZA 5EYPA 1XHZA 1UPGA 1R6TA 3JD4A 5LXTB 4JZ2A 3JAWB 4LP8A 3R66A 4RO2A 5L3EA 2H8PC 3WG7C 4PDVA 1BQ0A 5IYBO 3EFFK 5FL7G 2OIEA 4JYAB 4DV6B 1D5NA 1GKFA 2EIKB 4DRXA 4JI4B 3D3IA 1RFYA 4Z2WA 4YY3O 3SJAC 2NNUA 4EFEA 2X6BA 2ADPA 1SF9A 1GM8A 1H8EG 3E8FA 4QJFB 2CE4A 1I94B 4O4IB 2P6JA 1DLBA 1NTZH 3AG3B 1GK9A 2ETNA 3FB8C 1LUWA 3ZJZA 1SZXA 4TQFA 5KMGA 2E5LB 3N27A 1K9MW 1VQ9V 4CH3A 4X1IB 2ZNJA 4KL1A 1XDCA 3U0ZA 2UUCB 5LXTA 3JAWA 2WLIB 4MVSA 5B3SC 2WPDG 1N8RW 1Q6HA 4FLWA 4MVZA 4CZZA 1I5YA 1RM1C 3GVMA 3D8CA 2Q7GA 1W0JG 2RQ6A 4AHCA 1JVMA 2JJ2G 1AI7A 4DR2O 4GKJB 2WAMA 5IJ9B 1KC8W 1VQNV 4LFAO 2QKAA 2XAFA 3E8GA 1Y76B 1VF6C 1F7YA 2EX3A 4KXRA 4O4IA 1BL8A 1VEWA 3OTFA 3GWOA 4FM0A 4TQDA 5B3SB 1JA8A 2B9ZA 3OT7A 1Q90D 3CCMV 2WLKA 3E8HA 4LFBB 3F5TA 4LF9B 3MDSA 3P30A 3OAAG 4X1IA 2KKWA 4HYOA 1HR0O 1WNSA 4KHPO 1NVPD 1SETA 1J5EO 2Z3YA 2WLIA 1ROPA 4WBNB 4O4LB 3VQVA 4U7NA 3BABA 2GSMB 4KUMA 2PY5A 4YIPA 1HNWO 2ZKOA 1TUBB 1IZ3A 3THOA 3PN1A 4X1YA 1NKDA 3ABMB 3C3TA 5EZYB 3K08A 4UB6Z 3RN4A 5IJ9A 4LF7O 4BIUA 1VQ8V 3B8MA 2N74A 3A2FA 1Y76A 4MVRA 1QQCA 3JD1A 4E4EA 1GTOA 1L8DA 2ZIOA 4RUEA 5CN0A 1SQBH 2E74B 1FFTB 2D3OW 1V55C 2HP8A 3ZHRA 3MHHC 1OCRB 4JI2O 1NT2B 2F23A 1FFXB 5K1PA 3OTOO 1VQ6V 4FMTA 4OPAA 4UB8Z 4PA9A 4R7CA 2DYRB 3FAVB 2OYQA 1VMGA 4WBNA 4O4LA 2NR5A 5IYCO 3L73H 2B5UA 2IW5A 2OTLV 2WA4A 1Q86W 2GHYA 1TUBA 3JD2A 4JTCB 3FFQA 5LOVB 1V55B 5EZYA 3KG2A 4DV4O 4YY3B 4JI6B 2QDOA 2L6LA 1FYJA 2CK3G 4PD4F 2JEXA 3RWRD 4B3RO 1JX9A 4JF3A 3VQWA 2VWKA 3G67A 3MAQA 4D7TA 3SDLA 5F2VO 4QIWF 2FMLA 2YXHA 3OEHG 3J7AU 1FFXA 4R8CA 2D2CB 1JMKC 2ZIMA 1XILA 2XAGA 1SQFA 3K06A 2ZR3A 1UJWB 3K9AA 2UXCO 4LC1A 2ITDC 2BTQB 3OW2U 1QVFU 3H1KH 5LP6C 3CRQA 3FAVA 3PJSK 2AHZA 3SGIA 2JIZG 4X62O 2YI8A 2Y69C 5BMVB 4NVPA 4UXNA 2OCHA 5JJEB 2DW4A 3ETGA 4MS2A 4N21A 4UCVA 2XHBA 4Q6GA 1M9NA 1AI5A 3CCVV 2WLNA 5LOVA 5LL6Y 1DGSA 1ZSPA 2QEXV 4NTWA 4DR2B 3M8AA 4TV8B 5H9CA 4LFAB 1SQVH 4FLZA 5FNVA 1AVMA 2YSUB 3OMIB 3HKCB 2HVJC 1W59A 3ZRWB 1HWYA 4WFHA 2Q0OC 3CPWU 4Z1MG 3RYIB 4NR1A 1IBLB 1DF4A 3CX5F 1BMFG 4GX2A 1GH6A 1FXKC 2WLLB 3QF7A 2ZE7A 1Q43A 3SJQC 4DV5O 4IYIA 3T1YB 3WFVA 1ZUQA 2BTQA 1HW7A 3H1IH 1NTMH 2QGNA 2HVKC 4PA3A 3WB1A 4CS2A 3QO7A 1J95A 4OX9B 1TAEA 3LSUA 4J9ZB 5BMVA 5EC1C 5EC2C 2YDEA 2K9PA 2HFEC 4JYYA 3OGCC 2Y0IA 1Q81W 2YIDA 4GT1A 1HNWB 4MVMA 2FL4A 4K0KO 5KA5A 4DK1A 1EM1A 2BOBC 1P84F 1NH2D 3B2EE 4TV8A 4LF7B 2PYJA 4LF4O 4L8JA 1D5AA 2A7WA 3HKCA 1RP3B 4X89A 4NXMO 4JI0O 2XNDG 1JCHA 3ZRWA 2HG5C 4ASUG 1ZL8B 1AILA 3RYIA 1CEZA 3ABLC 5LYJB 1M4UA 1XQ8A 3OM3B 2WLLA 1GN4A 2EJRA 3HKDB 3Q4HB 1Y66A 3L70H 1AB3A 4FLVA 1TGOA 2UXBO 1I0HA 1KU9A 2Q9LA 5C93A 1LR1A 2ARHA 5J2TB 4U7OA 5D5PA 1Y67A 3IC7A 4JTDB 2L35A 5J2UA 1G6UA 4MW8A 1O9GA 4I0XB 4UFZA 1V9PA 3RGBA 3BPZA 1R3LC 5FLXN 5KAFZ 5JH7A 1EZVH 4JYBA 4DV4B 2QM7A 5DECA 4XDJA 3T4ZA 1MSWD 4B3RB 1Q6IA 5LHIA 2RJZA 4OGQB 2Q7HA 3CCEV 4MVOA 1YXBA 3SPCA 1GAXA 1ZL8A 3A0BZ 5LYJA 2YIBA 3B8NA 1QBZA 1K5QA 1RPRA 3HKDA 2YUAA 3Q4HA 2EIMC 5IWAO 3HKEB 4UVBA 1BZKA 1GN2A 4WFBV 1K4CC 3CWBH 2AW9A 2CDYA 3WB0A 5A2QN 1ZWIC 1VQOV 2IJJA 2WWWA 1IXMA 4R6ZA 4N23A 3WB2A 4AQYO 4BIOA 2RN9A 2MK3A 5J2TA 2P22C 4PELA 4X62B 1OZ0A 3BVOA 4BW9A 2X0LA 3ZIAG 3JALB 4I0XA 2ZE8A 2QTSA 2XAQA 4LF5O 1JPXA 2CTWA 4NXNO 4GZRB 4FM1A 3CXHF 4X66O 1AI4A 1XNRO 2A79B 2GBOA 5J9PC 3O9OA 4DUZO 2A0LA 1SZTA 4WFGA 1F4NA 4X20B 1M90W 1ZX3A 2EIMB 5E1AC 5KHKA 3ZHTA 2RMKB 5LHHA 4NTXA 2FB5A 4TSFG 5IYZA 1PV0A 3ASOC 1YCIA 5FPRA 4IHJB 1DF5A 3RYFA 4F6RB 1Q5OA 3HKEA 3X2QB 5JQGB 4UCTA 4DV5B 2EIJC 1OCCC 1G4YB 4I55B 3BEHA 3HB3B 1N32B 4XDLA 5IT9N 3JYCA 2QTOA 2ZT9B 5HFLA 1GRJA 3H1LH 3JALA 3KZIZ 1WB7A 2HHHB 3FB7C 4RQEA 3IC9A 2LQTA 2QE7G 5LBQA 1NU1H 4J10A 5CMUA 3CRMA 4JI3O 4X65O 1D2DA 1N34O 3I5DA 1QVGU 4K0KB 2Q6AA 2EIKC 3LDDA 3BHPA 3K0DA 4B3MO 4LF4B 4X20A 1GO3F 4NXMB 4JI0B 1HNZB 3TETA 3K58A 4ABMA 1IXBA 2KG7B 2W6JG 1H2SB 3AG2B 4IHJA 2M7WA 4F6RA 3W7XA 3AG3C 5CBHA 2B1IA 1H2LA 3AG1C 5LMNO 3FX7A 1PD3A 5JQGA 3E2EA 2UXBB 1QCEA 4I55A 4J7ZA 1MNGA 4F6EA 3D36A 3DGEA 3CCLV 2VRZA 2ZE6A 3ZHVA 1K3EA 2WSSG 3IGAC 2DWEC 1CPYA 4DW1A 4EB6B 4QNHB 3OUFA 2JJ1G 5E79Z 4PA4A 3VOUA 4DV7O 1QLEB 3OD4A 4PV1B 4CBCA 2KB1A 5B1OA 3ZMTA 4FK5C 1IBMO 1PL0A 2CTPA 4JI7O 4WF9V 4AI8A 2P4VA 1EFRG 1KUQA 3AG1B 1R3KC 2UUBO 4K35A 3UM7A 3W7SA 2IJKA 3I56V 2JVDA 2KG7A 1BCCH 4B3SO 2G38A 4PJ0Z 1LNQA 3JD3A 4X64O 1SQQH 1L0LH 5L3DA 2IH3C 5IWAB 1VP7A 2YIAA 1QHTA 3ETEA 2UUAO 3BAAA 1AROP 2W0FC 4AQYB 2LGWA 3RYHB 4KFMA 3ZHQA 1HNXO 2CH7B 5JJJB 4EB6A 4DV1O 4X1YB 5LGUA 1V54B 1JR9A 1K97A 1AJQA 4LF5B 1XEQA 2VQFB 1Z5VA 4NXNB 1N33O 5B1AB 5BY1A 1YI2V 2N04A 4ZOLB 1R1BA 2F4VO 1XNRB 3G6EV 4DR6O 3QO8A 5BR8O 3CRRA 3R65A 1LUVA 3ABMC 1FAFA 3L71H 1S5HC 2V4DA 4J7JA 2XTAA 1XMQO 4DO2A 1ENVA 2X6CA 3ZRXA 1VQ4V 4DR1O 4LCUC 4J42A 1ZTEA 2QWRB 4O2AB 2ZE5A 4HBNA 2ZCEA 3K3WA 4LFCO 5KHJA 1OCRC 4GX5A 4Q20A 2JS3A 3HKBA 3MD0A 2QA4V 1XI1A 3A0HZ 3CCQV 1NJIW 3KCYA 3B09A 4FJCC 3RYHA 1YJNV 4OPHA 1BSMA 3VQYA 2CH7A 1PKXA 2DYRC 4EFBA 4FIPC 1SRYA 4DR5O 1PPJH 5H2FZ 3K59A 4JI3B 2EZOA 2LP7A 3QTCA 1N34B 2QJ1A 4ZOLA 1P7GA 1MG1A 1AR4A 3CJHB 4YJ2B 4PA6A 5D5QA 4ZI7B 3CHXA 4FLYA 4XDKA 1OCOB 3DSQA 3APQA 1SKVA 2PF4E 2XASA 4J80A 5L3FA 2N05A 3K9SA 4O2AA 3AG4B 1KYOF 3BRCA 3JARB 5C8YB 3K5OA 1X59A 4DV2O 4PI2A 1EZJA 3GWKC 5IYDO 1YEWA 1MOFA 5IY5C 1VF7A 5H6QA 1PM9A 2Q73A 4I9WA 2EILB 4G2KA 2DJVA 2XAJA 3P32A 4LNUB 2IJHA 2E76B 4DV7B 2ZD9A 2CUGA 3N2KB 5FNVB 3LDEA 2P67A 4JYCA 1IBMB 4XBFA 1O9HA 2EBOA 3CJHA 1JJ2U 4JI7B 3AK2A 5IJ0B 2X6AA 4YJ2A 3D3QA 2IU0A 4ZI7A 4GX1A 3CXCU 2P7TC 4TOIA 3AEIA 4NKGB 4NYKA 1JQ0A 3C90A 1S77D 2AGAA 5KUKA 1QU7A 2UUBB 5IY5B 3JCZA 4P30A 1OJHA 1K92A 1MZEA 4FPPA 3O65A 1QLNA 5FPOA 2EULA 5C8YA 3JARA 4UV8A 2YIBD 4X64B 4WCEV 2X7RB 3AK3A 1KKDA 4K8ZA 3CMAV 3UT5B 4MT8A 4X88A 4I4TB 1PNKA 5JCOA 4OXSA 1WA8B 2O57A 3CSXA 3APOA 4JI8O 2UUAB 5LGNA 1WLEA 3NR7A 4BR6A 2VQEO 3SJCC 1COWG 4DV1B 4LNUA 3LNNA 2PZSA 3K5LA 1JJOA 2MW2B 3E83A 2ZDIC 1OCZB 3N2KA 1VIBA 4R50A 4LF8O 1KKCA 4JPRA 5JVDB 2F4VB 4IL6Z 4HNAB 1HP8A 2OCCC 3OR6C 5IJ0A 3RVYA 4DR3O 4ZIBA 4IYHA 1XMOO 2CTQA 4DV0O 4GUNA 1HR0B 4MTOA 4KHPB 5KA6A 1X4TA 3TXSA 2IU3A 3ZMVA 1J5EB 3J80N 4LFCB 3UT5A 4I4TA 1WA8A 2PI5A 1KP3A 5J2UB 4MW3A 1AP5A 5B1NA 4PDMA 3K5MA 2OCCB 4J11A 4ICGA 2QWNB 5JH7B 3ABUA 5B66Z 1Q6UA 3B4SA 4JV5O 2GUZB 5KHIA 4P9PA 4I9QA 2UU9O 5JVDA 3BA9A 4JAAA 2P4KA 2YICA 4HNAA 1EN6A 1SQXH 4QGPA 4LR3A 3A8TA 4FLUA 1L0NH 1ZLZA 2KSDA 3EXAA 1XL6A 4JAUA 4PI0A 1YHQV 1YJ9V 1FS0G 3ZRVA 4JI2B 2EZPA 4HAMA 1SS3A 3G6BA 3OTOB 1A32A 2LFSA 4G27B 1Q7YW 1S0VA 3ABKC 1BS3A 1PL4A 4DV2B 2Q7EA 3H01A 1DTOA 3AK1A 2HJDA 1TA8A 1GMGA 3SR2C 2ZDIA 5BXZA 2DN9A 1KECA 3ZEDA 1W2BU 1THZA 3E8BA 1Q8IA 1KBHA 4YJ3A 4X9QA 3TCUA 4JYAO 3LNMB 4DYLA 4DV6O 4X1KB 4YIOA 3P3NA 2JDIG 4IGGA 4DK0A 4DR7O 4JI5O 2GUZA 4JI4O 4U3JB 1N36O 3L75H 4LH6A 2Z5UA 1VQMV 3JAMN 3IFXA 2CAZC 4FLXA 3ABKB 5IYZB 2F1MA 1M93A 1M56B 3DXRB 2ZINA 5B1BC 1F51A 3RYFB 3CYOA 3ZBHA 1WB8A 2ZM6O 2LFRA 1WJZA 1XNQO 1YTFB 2UXCB 5BZBA 3K79A 2ADQB 5GW7A 4O2BB 1EBOA 4CH6A 3CRAA 1E79G 4W4KA 2DE0X 4W4LA 2R9IA 1WN7A 2UXXA 1AI6A 3CRCA 4GLXA 2UUCO 4JI8B 3X2QC 3W7TA 1NTKH 3JSNA 3L74H 4PA7A 4I7ZB 2VQEB 1YJWV 3TK1A 3OR7C 1MA1A 3D36C 4X1KA 1M5IA 5B1BB 1SESA 4D6TH 2F66C 2UXNA 4CC6A 1WPXA 2ATKC 4U3JA 4LF8B 1MABG 2OTJV 5TISZ 2BSKB 3ASNC 2PUSA 4O4JB 2YXLA 1E1QG 3JASB 1YF2A 4J41A 1TUEB 1S76D 1Z2GA 3L9DA 3DXRA 5LMUO 2R9RB 4K8XA 3CP1A 2JRIA 3CC4V 4MSWC 3TXQA 4PDRA 4DR3B 1U97A 2Y4UA 2P5OA 4JAVA 2FYUH 4GKKO 1XMOB 4ZKIA 4DV0B 3CS5A 4GCZA 4O2BA 4LFBO 1SQGA 5KUMA 3FD9A 4LH7A 3AG2C 1R6KA 3J81N 3ZCCA 2EINB 3RW0A 4E2LA 2YI9A 3P3PA 4UCUA 3ASNB 3TJTA 1GM7A 1QNMA 5A9GA 1GN6A 2DWDC 2DOSA 3FB5C 1G8MA 5L3CA 2Y4TA 3CCRV 2A3QA 1WP7A 1QLEC 3SPJA 2BSKA 3H9VA 4H37A 4O4JA 1XREA 4MTGA 1VQPV 1S5JA 3JASA
chains in the Genus database with same CATH topology
4LF7O 2Z0AA 2N74A 4LFCO 4B3TO 4DV7O 4JV5O 2AGAA 2UXDO 1AB3A 2UUCO 2UU9O 1I94O 3T1HO 2UXBO 3O65A 4A5UB 1IBMO 5LL6Y 4JI7O 4OPHA 1IBKO 4JI2O 3M8AA 1KUQA 2E5LO 3OTOO 4DR5O 1NS1A 2UUBO 4OPAA 1IBLO 4JI8O 1N32O 5FLXN 1A32A 1G1XB 4LF6O 4B3SO 4X64O 2VQEO 4DR2O 1FKAO 2HHHO 5IT9N 3RT3C 3T1YO 4LFAO 4DR4O 5LMUO 4DV5O 1F7YA 5BXZA 1YZBA 2JRIA 4JI3O 4X65O 1D2DA 5H5NA 4LF8O 2UUAO 1N34O 4OX9O 4JI1O 4JI6O 4GKKO 1R6TA 4LFBO 1HNXO 4DV4O 4GKJO 1X59A 1FJGO 4DV2O 3R66A 1FYJA 4DV1O 4DV3O 4B3MO 4B3RO 4JYAO 2FKXA 2VQFO 4DV6O 1HNZO 3F5TA 4DR7O 5IWAO 3J81N 4JI5O 4JI4O 3SDLA 5A2QN 1XEQA 1HR0O 1DK1A 4DR3O 4KHPO 1N36O 1N33O 5BY1A 4AQYO 1XMOO 2F4VO 1R1BA 1J5EO 4DV0O 3JAMN 4K0KO 4YHHO 2DJVA 4YY3O 4DR6O 3J7AU 5BR8O 2DOSA 2LW7A 4LF4O 3J80N 5LMNO 4LF9O 4NXMO 4JI0O 4DUYO 4LF5O 2UXCO 1XMQO 2ZM6O 4NXNO 1HNWO 2ZKOA 4DR1O 1XNQO 4X66O 1AILA 1XNRO 4X62O 4DUZO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF7 O;  2Z0A A;  2N74 A;  4LFC O;  4B3T O;  4DV7 O;  4JV5 O;  2AGA A;  2UXD O;  1AB3 A;  2UUC O;  2UU9 O;  1I94 O;  3T1H O;  2UXB O;  3O65 A;  4A5U B;  1IBM O;  5LL6 Y;  4JI7 O;  4OPH A;  1IBK O;  4JI2 O;  3M8A A;  1KUQ A;  2E5L O;  3OTO O;  4DR5 O;  1NS1 A;  2UUB O;  4OPA A;  1IBL O;  4JI8 O;  1N32 O;  5FLX N;  1A32 A;  1G1X B;  4LF6 O;  4B3S O;  4X64 O;  2VQE O;  4DR2 O;  1FKA O;  2HHH O;  5IT9 N;  3RT3 C;  3T1Y O;  4LFA O;  4DR4 O;  5LMU O;  4DV5 O;  1F7Y A;  5BXZ A;  1YZB A;  2JRI A;  4JI3 O;  4X65 O;  1D2D A;  5H5N A;  4LF8 O;  2UUA O;  1N34 O;  4OX9 O;  4JI1 O;  4JI6 O;  4GKK O;  1R6T A;  4LFB O;  1HNX O;  4DV4 O;  4GKJ O;  1X59 A;  1FJG O;  4DV2 O;  3R66 A;  1FYJ A;  4DV1 O;  4DV3 O;  4B3M O;  4B3R O;  4JYA O;  2FKX A;  2VQF O;  4DV6 O;  1HNZ O;  3F5T A;  4DR7 O;  5IWA O;  3J81 N;  4JI5 O;  4JI4 O;  3SDL A;  5A2Q N;  1XEQ A;  1HR0 O;  1DK1 A;  4DR3 O;  4KHP O;  1N36 O;  1N33 O;  5BY1 A;  4AQY O;  1XMO O;  2F4V O;  1R1B A;  1J5E O;  4DV0 O;  3JAM N;  4K0K O;  4YHH O;  2DJV A;  4YY3 O;  4DR6 O;  3J7A U;  5BR8 O;  2DOS A;  2LW7 A;  4LF4 O;  3J80 N;  5LMN O;  4LF9 O;  4NXM O;  4JI0 O;  4DUY O;  4LF5 O;  2UXC O;  1XMQ O;  2ZM6 O;  4NXN O;  1HNW O;  2ZKO A;  4DR1 O;  1XNQ O;  4X66 O;  1AIL A;  1XNR O;  4X62 O;  4DUZ O; 
#chains in the Genus database with same CATH topology
 1M57 C;  2R72 A;  3OE7 G;  4IT5 A;  2JS5 A;  5B5E Z;  4JAS A;  1I5X A;  3ZMZ A;  3ZMS A;  1VAR A;  5KHG A;  1XUQ A;  3HR0 A;  5GTI Z;  3RFR A;  3T1H O;  2LJ2 A;  1XOU A;  1P7B A;  2BE3 A;  2PGG A;  4H0L B;  1NQT A;  4MTX A;  5LHG A;  4CS4 A;  3UO2 A;  4UUJ C;  4H13 B;  2IBZ H;  4I50 B;  4RQF A;  1KB9 F;  2XAH A;  3DC5 A;  2V1D A;  1M57 B;  4GYC B;  1ZAU A;  3WU2 Z;  4DR7 B;  1H2K A;  4JI5 B;  3H1J H;  1V54 C;  5DN6 G;  3IJ4 A;  1N36 B;  1S72 V;  4JI6 O;  3ZN0 A;  1RPO A;  2DYS B;  2ODM A;  1GN3 A;  1MSD A;  2ZXW C;  4B7K A;  5B1A C;  3B77 A;  3K03 A;  3G4S V;  3ETQ A;  3ZRS A;  3UO3 A;  2LO1 A;  1K4D C;  2NLJ C;  1K33 A;  4UVC A;  4EEQ A;  3JD0 A;  1Y74 B;  1DK1 A;  2ZM6 B;  3JCU Z;  1XNQ B;  2QKS A;  3HKB B;  1K7D A;  4QE9 A;  3ZMU A;  3WG7 B;  5IDJ A;  2ZNI A;  2AZ2 A;  3BY6 A;  2PI4 A;  3TGU H;  2W0X A;  2JGD B;  1OV9 A;  4DUY O;  1K5S A;  3MHS C;  2P90 A;  3K57 A;  1EN4 A;  4I50 A;  2ZXW B;  3CCU V;  2JK5 C;  3SYQ A;  3L72 H;  4X66 B;  3FYI B;  4B3T O;  4DUZ B;  2HEP A;  1N4C A;  2QKC A;  4TUY B;  3NXS A;  1N0J A;  1AJP A;  3FYE B;  3UQ8 A;  1SQP H;  4A5U B;  1BQZ A;  4FFB B;  2HKO A;  1YIJ V;  5AG2 A;  3CME V;  2XUM A;  1RSO B;  3H1H H;  2CTR A;  3DC6 A;  3QO5 A;  2A9H A;  1Z5W A;  5LMU B;  1S3J A;  3UCS C;  3QNE A;  1IDS A;  5KLV H;  1KD1 W;  4LWS B;  1Y74 A;  1IBL O;  5CA1 B;  4GKK B;  1MMM A;  4K3A A;  1OCO C;  2ZQM A;  3T1Y O;  1RM1 B;  3AG4 C;  2JGD A;  3CCS V;  1BHA A;  1T5E A;  1KQS U;  1VQ5 V;  3KKY A;  4OX9 O;  1YIT V;  3QVN A;  5JCO C;  5KX5 B;  4X65 B;  1F23 A;  4J9Y B;  4BIZ A;  1B6Q A;  4FZ1 A;  1BGY H;  5EIB D;  1VF5 B;  2EIL C;  4JGS A;  2F95 B;  1K8A W;  5DED A;  4QPK A;  4Z1V A;  2GDS A;  3M99 B;  4TUY A;  3FB6 C;  4B3M B;  4I5S A;  3S3X A;  3EVK A;  2A06 H;  4CH5 A;  3LSQ A;  4FFB A;  3CB2 A;  2E3C A;  1B06 A;  1K34 A;  4YHH O;  1RSO A;  4MTF A;  4BWA A;  5EBL C;  1KP2 A;  1S5L Z;  2ILM A;  2WLJ A;  2Q69 A;  1P4R A;  2WA3 A;  1NBM G;  2K1E A;  4GX0 A;  4LWS A;  3T1H B;  5LMN B;  5CA1 A;  1E1R G;  3ICX A;  5EBW C;  1AP6 A;  4MVU A;  3DTU B;  1XBL A;  3ETD A;  3F5W C;  2HJF C;  5CB4 B;  3ZS8 C;  2HLD G;  4UCR A;  1SA0 B;  3OMN B;  3OUS A;  1IX9 A;  2UXD O;  4RWU A;  3VQX A;  3UKM A;  4FVM A;  3OMA B;  2R9A A;  3RYC B;  3E89 A;  4L87 A;  3M7M X;  5KX5 A;  3F7V C;  4EKW A;  1IBK O;  4C7U A;  1VF6 A;  1AR1 B;  3N2G B;  3RBZ A;  4YXW G;  4TV9 B;  1FD9 A;  2VS0 A;  4U3F H;  5EIB C;  1P49 A;  1VQK V;  4DW0 A;  3LUT B;  3U10 A;  1OCZ C;  4LF6 O;  1Y6X A;  3I55 V;  3EHB B;  2Q0A A;  3RT3 C;  1R3J C;  2QWP B;  2DMX A;  4B3S B;  2F93 B;  2LGQ A;  4FFK A;  1NR7 A;  1NVP B;  1WP8 A;  4O4H B;  5K1X A;  1US6 A;  1M1K W;  1FJG O;  3S3W A;  5CB4 A;  2VWJ A;  5LA6 B;  1SA0 A;  1HNX B;  3JAT B;  2XOK G;  4DUY B;  5GON B;  2BCC H;  4IIJ B;  3RYC A;  3CC2 V;  3T4D A;  2BTO A;  1F4M A;  1FPO A;  1N33 B;  3N2G A;  4TV9 A;  3W7W A;  4B7E A;  1MZF A;  4B3T B;  3JAK B;  1PP9 H;  4D7S A;  4DR6 B;  5BR8 B;  4BAY A;  4RAI A;  3OEE G;  5EK0 A;  5LGT A;  3C3S A;  2LW1 A;  2H94 A;  3SJB C;  1XMQ B;  1XL4 A;  4DR1 B;  3K5N A;  3SPI A;  2E75 B;  4FZ0 A;  1BT8 A;  5LP6 B;  4BW5 A;  2YC0 A;  1ORQ C;  2HR3 A;  4HZ3 A;  3CC7 V;  2NN4 A;  4NB5 A;  1YTF D;  2Y69 B;  1N0N A;  2OWO A;  4O4H A;  2H3O A;  3CD6 V;  2GTA A;  5LA6 A;  2R70 A;  4CH4 A;  3ZHU A;  5KHH A;  3CE2 A;  1BHB A;  3JAT A;  4P9O A;  4YJ3 B;  3SYP A;  5GON A;  1I7F A;  4IIJ A;  2CGO A;  1Q82 W;  1R73 A;  2JEU A;  1N32 O;  4DR5 B;  5EBM C;  1G1X B;  3STZ C;  3BFR A;  3BCC H;  2AHY A;  2HHH O;  4WFA V;  4LBE C;  4MVQ A;  3SPG A;  1WAZ A;  4DR4 O;  3KCX A;  3JAK A;  3SYA A;  1EN5 A;  3B40 A;  4JTA B;  2M6Y A;  1B04 A;  5KAI Z;  1NZ6 A;  1FXH A;  4JI1 O;  1W0K G;  3JSL A;  5IE9 A;  1FXK B;  1VQL V;  3ZHS A;  1KMI Z;  4YHH B;  1SC5 B;  3OFN G;  4DV3 O;  3K04 A;  2OIG A;  3FKS G;  2C2A A;  2FKX A;  1HNZ O;  1TVK B;  2QWQ B;  4UCS A;  4F4L A;  5LP6 A;  1M56 C;  1NI8 A;  5GTH Z;  3T1C A;  2RNB A;  4RUF A;  1BE3 H;  1R3I C;  4H33 A;  3VBB A;  2F43 G;  5JJN B;  2AZ0 A;  2UXD B;  2QM4 A;  5CA3 A;  1YDX A;  1HDJ A;  4PDL A;  1IBK B;  2Z0A A;  3T2M A;  4P2Z A;  2DQ0 A;  2QSA A;  4TT3 G;  3RVZ A;  2IH1 C;  1I94 O;  1YSC A;  2Q8V A;  3ABL B;  1AR5 A;  4X8A A;  5CBG A;  2Y48 A;  1FXK A;  1WPB A;  1IVS A;  4LF6 B;  4JZG A;  3A0R A;  4UCO A;  2IM9 A;  5HFM A;  5H6R A;  2V7Q G;  2E5L O;  1TVK A;  2WLM A;  1K73 W;  2XT9 A;  2GTS A;  3HPL C;  1R6N A;  2RCV A;  3F7Y C;  1CP9 A;  3E35 A;  4ZHQ B;  3LSS A;  2DQ3 A;  1FJG B;  4H44 B;  3STL C;  5CBF A;  2Q4P A;  1YZB A;  2B1G A;  1JFF B;  5ITZ B;  1XHX A;  2QM8 A;  1NR1 A;  3CEI A;  5L3B A;  4PHZ A;  4FLT A;  2Q67 A;  2EIN C;  3G80 A;  4NTY A;  1VQ7 V;  3BA8 A;  2JGU A;  4GKJ O;  1URF A;  4DXW A;  1NH2 B;  2YEV B;  2VQF O;  2QWO B;  3E86 A;  3ML0 A;  3E22 B;  1H2G A;  3SYO A;  3SYC A;  1Y4M A;  2AXT Z;  2EJ7 A;  3LDC A;  3CCJ V;  1Q3E A;  1I08 A;  2GV9 A;  3QG5 A;  2IJI A;  2Q68 A;  1GM9 A;  2LW7 A;  2W6I G;  1B3Q A;  3OGI B;  2WLH A;  4QE7 A;  4CS3 A;  3ABT A;  4LF9 O;  3IAY A;  1FXV A;  5CA0 B;  1AJN A;  5JWP A;  2Y0P A;  2CGN A;  2OT5 A;  2YS8 A;  5EYP B;  3W7U A;  5L3G A;  4UVA A;  1U96 A;  4ZHQ A;  1QR8 A;  4G28 B;  1JOY A;  1OHH G;  4J7K A;  1JFF A;  5ITZ A;  4AIL C;  1H2N A;  2P06 A;  1CXZ B;  4JV5 B;  1IUR A;  4DRX B;  2UU9 B;  3GB7 C;  1UFI A;  4B08 A;  2PTM A;  2RDC A;  2YEV A;  4FM2 A;  2PYL A;  1H38 A;  1YVW A;  3K0G A;  4DR4 B;  4ZBM A;  2YXY A;  1NS1 A;  4UV9 A;  1SER A;  4CC5 A;  3E22 A;  3ASO B;  2KQX A;  3AG7 A;  3ZN1 A;  2ITC C;  4JI1 B;  4KP4 A;  3U11 A;  2BOC C;  3ZX6 A;  1H2M A;  1PNL A;  1FKA O;  2QR4 A;  2DYS C;  4DV3 B;  1H8H G;  2EIJ B;  1OCC B;  1PNM A;  5KMG B;  1L1F A;  5DM6 V;  4WFE A;  2FTK A;  5CA0 A;  2ZR2 A;  4WFF A;  3G71 V;  3SPH A;  4QPJ A;  1QR9 A;  5H5N A;  4TWK A;  2Q5Z A;  5EYP A;  1XHZ A;  1UPG A;  1R6T A;  3JD4 A;  5LXT B;  4JZ2 A;  3JAW B;  4LP8 A;  3R66 A;  4RO2 A;  5L3E A;  2H8P C;  3WG7 C;  4PDV A;  1BQ0 A;  5IYB O;  3EFF K;  5FL7 G;  2OIE A;  4JYA B;  4DV6 B;  1D5N A;  1GKF A;  2EIK B;  4DRX A;  4JI4 B;  3D3I A;  1RFY A;  4Z2W A;  4YY3 O;  3SJA C;  2NNU A;  4EFE A;  2X6B A;  2ADP A;  1SF9 A;  1GM8 A;  1H8E G;  3E8F A;  4QJF B;  2CE4 A;  1I94 B;  4O4I B;  2P6J A;  1DLB A;  1NTZ H;  3AG3 B;  1GK9 A;  2ETN A;  3FB8 C;  1LUW A;  3ZJZ A;  1SZX A;  4TQF A;  5KMG A;  2E5L B;  3N27 A;  1K9M W;  1VQ9 V;  4CH3 A;  4X1I B;  2ZNJ A;  4KL1 A;  1XDC A;  3U0Z A;  2UUC B;  5LXT A;  3JAW A;  2WLI B;  4MVS A;  5B3S C;  2WPD G;  1N8R W;  1Q6H A;  4FLW A;  4MVZ A;  4CZZ A;  1I5Y A;  1RM1 C;  3GVM A;  3D8C A;  2Q7G A;  1W0J G;  2RQ6 A;  4AHC A;  1JVM A;  2JJ2 G;  1AI7 A;  4DR2 O;  4GKJ B;  2WAM A;  5IJ9 B;  1KC8 W;  1VQN V;  4LFA O;  2QKA A;  2XAF A;  3E8G A;  1Y76 B;  1VF6 C;  1F7Y A;  2EX3 A;  4KXR A;  4O4I A;  1BL8 A;  1VEW A;  3OTF A;  3GWO A;  4FM0 A;  4TQD A;  5B3S B;  1JA8 A;  2B9Z A;  3OT7 A;  1Q90 D;  3CCM V;  2WLK A;  3E8H A;  4LFB B;  3F5T A;  4LF9 B;  3MDS A;  3P30 A;  3OAA G;  4X1I A;  2KKW A;  4HYO A;  1HR0 O;  1WNS A;  4KHP O;  1NVP D;  1SET A;  1J5E O;  2Z3Y A;  2WLI A;  1ROP A;  4WBN B;  4O4L B;  3VQV A;  4U7N A;  3BAB A;  2GSM B;  4KUM A;  2PY5 A;  4YIP A;  1HNW O;  2ZKO A;  1TUB B;  1IZ3 A;  3THO A;  3PN1 A;  4X1Y A;  1NKD A;  3ABM B;  3C3T A;  5EZY B;  3K08 A;  4UB6 Z;  3RN4 A;  5IJ9 A;  4LF7 O;  4BIU A;  1VQ8 V;  3B8M A;  2N74 A;  3A2F A;  1Y76 A;  4MVR A;  1QQC A;  3JD1 A;  4E4E A;  1GTO A;  1L8D A;  2ZIO A;  4RUE A;  5CN0 A;  1SQB H;  2E74 B;  1FFT B;  2D3O W;  1V55 C;  2HP8 A;  3ZHR A;  3MHH C;  1OCR B;  4JI2 O;  1NT2 B;  2F23 A;  1FFX B;  5K1P A;  3OTO O;  1VQ6 V;  4FMT A;  4OPA A;  4UB8 Z;  4PA9 A;  4R7C A;  2DYR B;  3FAV B;  2OYQ A;  1VMG A;  4WBN A;  4O4L A;  2NR5 A;  5IYC O;  3L73 H;  2B5U A;  2IW5 A;  2OTL V;  2WA4 A;  1Q86 W;  2GHY A;  1TUB A;  3JD2 A;  4JTC B;  3FFQ A;  5LOV B;  1V55 B;  5EZY A;  3KG2 A;  4DV4 O;  4YY3 B;  4JI6 B;  2QDO A;  2L6L A;  1FYJ A;  2CK3 G;  4PD4 F;  2JEX A;  3RWR D;  4B3R O;  1JX9 A;  4JF3 A;  3VQW A;  2VWK A;  3G67 A;  3MAQ A;  4D7T A;  3SDL A;  5F2V O;  4QIW F;  2FML A;  2YXH A;  3OEH G;  3J7A U;  1FFX A;  4R8C A;  2D2C B;  1JMK C;  2ZIM A;  1XIL A;  2XAG A;  1SQF A;  3K06 A;  2ZR3 A;  1UJW B;  3K9A A;  2UXC O;  4LC1 A;  2ITD C;  2BTQ B;  3OW2 U;  1QVF U;  3H1K H;  5LP6 C;  3CRQ A;  3FAV A;  3PJS K;  2AHZ A;  3SGI A;  2JIZ G;  4X62 O;  2YI8 A;  2Y69 C;  5BMV B;  4NVP A;  4UXN A;  2OCH A;  5JJE B;  2DW4 A;  3ETG A;  4MS2 A;  4N21 A;  4UCV A;  2XHB A;  4Q6G A;  1M9N A;  1AI5 A;  3CCV V;  2WLN A;  5LOV A;  5LL6 Y;  1DGS A;  1ZSP A;  2QEX V;  4NTW A;  4DR2 B;  3M8A A;  4TV8 B;  5H9C A;  4LFA B;  1SQV H;  4FLZ A;  5FNV A;  1AVM A;  2YSU B;  3OMI B;  3HKC B;  2HVJ C;  1W59 A;  3ZRW B;  1HWY A;  4WFH A;  2Q0O C;  3CPW U;  4Z1M G;  3RYI B;  4NR1 A;  1IBL B;  1DF4 A;  3CX5 F;  1BMF G;  4GX2 A;  1GH6 A;  1FXK C;  2WLL B;  3QF7 A;  2ZE7 A;  1Q43 A;  3SJQ C;  4DV5 O;  4IYI A;  3T1Y B;  3WFV A;  1ZUQ A;  2BTQ A;  1HW7 A;  3H1I H;  1NTM H;  2QGN A;  2HVK C;  4PA3 A;  3WB1 A;  4CS2 A;  3QO7 A;  1J95 A;  4OX9 B;  1TAE A;  3LSU A;  4J9Z B;  5BMV A;  5EC1 C;  5EC2 C;  2YDE A;  2K9P A;  2HFE C;  4JYY A;  3OGC C;  2Y0I A;  1Q81 W;  2YID A;  4GT1 A;  1HNW B;  4MVM A;  2FL4 A;  4K0K O;  5KA5 A;  4DK1 A;  1EM1 A;  2BOB C;  1P84 F;  1NH2 D;  3B2E E;  4TV8 A;  4LF7 B;  2PYJ A;  4LF4 O;  4L8J A;  1D5A A;  2A7W A;  3HKC A;  1RP3 B;  4X89 A;  4NXM O;  4JI0 O;  2XND G;  1JCH A;  3ZRW A;  2HG5 C;  4ASU G;  1ZL8 B;  1AIL A;  3RYI A;  1CEZ A;  3ABL C;  5LYJ B;  1M4U A;  1XQ8 A;  3OM3 B;  2WLL A;  1GN4 A;  2EJR A;  3HKD B;  3Q4H B;  1Y66 A;  3L70 H;  1AB3 A;  4FLV A;  1TGO A;  2UXB O;  1I0H A;  1KU9 A;  2Q9L A;  5C93 A;  1LR1 A;  2ARH A;  5J2T B;  4U7O A;  5D5P A;  1Y67 A;  3IC7 A;  4JTD B;  2L35 A;  5J2U A;  1G6U A;  4MW8 A;  1O9G A;  4I0X B;  4UFZ A;  1V9P A;  3RGB A;  3BPZ A;  1R3L C;  5FLX N;  5KAF Z;  5JH7 A;  1EZV H;  4JYB A;  4DV4 B;  2QM7 A;  5DEC A;  4XDJ A;  3T4Z A;  1MSW D;  4B3R B;  1Q6I A;  5LHI A;  2RJZ A;  4OGQ B;  2Q7H A;  3CCE V;  4MVO A;  1YXB A;  3SPC A;  1GAX A;  1ZL8 A;  3A0B Z;  5LYJ A;  2YIB A;  3B8N A;  1QBZ A;  1K5Q A;  1RPR A;  3HKD A;  2YUA A;  3Q4H A;  2EIM C;  5IWA O;  3HKE B;  4UVB A;  1BZK A;  1GN2 A;  4WFB V;  1K4C C;  3CWB H;  2AW9 A;  2CDY A;  3WB0 A;  5A2Q N;  1ZWI C;  1VQO V;  2IJJ A;  2WWW A;  1IXM A;  4R6Z A;  4N23 A;  3WB2 A;  4AQY O;  4BIO A;  2RN9 A;  2MK3 A;  5J2T A;  2P22 C;  4PEL A;  4X62 B;  1OZ0 A;  3BVO A;  4BW9 A;  2X0L A;  3ZIA G;  3JAL B;  4I0X A;  2ZE8 A;  2QTS A;  2XAQ A;  4LF5 O;  1JPX A;  2CTW A;  4NXN O;  4GZR B;  4FM1 A;  3CXH F;  4X66 O;  1AI4 A;  1XNR O;  2A79 B;  2GBO A;  5J9P C;  3O9O A;  4DUZ O;  2A0L A;  1SZT A;  4WFG A;  1F4N A;  4X20 B;  1M90 W;  1ZX3 A;  2EIM B;  5E1A C;  5KHK A;  3ZHT A;  2RMK B;  5LHH A;  4NTX A;  2FB5 A;  4TSF G;  5IYZ A;  1PV0 A;  3ASO C;  1YCI A;  5FPR A;  4IHJ B;  1DF5 A;  3RYF A;  4F6R B;  1Q5O A;  3HKE A;  3X2Q B;  5JQG B;  4UCT A;  4DV5 B;  2EIJ C;  1OCC C;  1G4Y B;  4I55 B;  3BEH A;  3HB3 B;  1N32 B;  4XDL A;  5IT9 N;  3JYC A;  2QTO A;  2ZT9 B;  5HFL A;  1GRJ A;  3H1L H;  3JAL A;  3KZI Z;  1WB7 A;  2HHH B;  3FB7 C;  4RQE A;  3IC9 A;  2LQT A;  2QE7 G;  5LBQ A;  1NU1 H;  4J10 A;  5CMU A;  3CRM A;  4JI3 O;  4X65 O;  1D2D A;  1N34 O;  3I5D A;  1QVG U;  4K0K B;  2Q6A A;  2EIK C;  3LDD A;  3BHP A;  3K0D A;  4B3M O;  4LF4 B;  4X20 A;  1GO3 F;  4NXM B;  4JI0 B;  1HNZ B;  3TET A;  3K58 A;  4ABM A;  1IXB A;  2KG7 B;  2W6J G;  1H2S B;  3AG2 B;  4IHJ A;  2M7W A;  4F6R A;  3W7X A;  3AG3 C;  5CBH A;  2B1I A;  1H2L A;  3AG1 C;  5LMN O;  3FX7 A;  1PD3 A;  5JQG A;  3E2E A;  2UXB B;  1QCE A;  4I55 A;  4J7Z A;  1MNG A;  4F6E A;  3D36 A;  3DGE A;  3CCL V;  2VRZ A;  2ZE6 A;  3ZHV A;  1K3E A;  2WSS G;  3IGA C;  2DWE C;  1CPY A;  4DW1 A;  4EB6 B;  4QNH B;  3OUF A;  2JJ1 G;  5E79 Z;  4PA4 A;  3VOU A;  4DV7 O;  1QLE B;  3OD4 A;  4PV1 B;  4CBC A;  2KB1 A;  5B1O A;  3ZMT A;  4FK5 C;  1IBM O;  1PL0 A;  2CTP A;  4JI7 O;  4WF9 V;  4AI8 A;  2P4V A;  1EFR G;  1KUQ A;  3AG1 B;  1R3K C;  2UUB O;  4K35 A;  3UM7 A;  3W7S A;  2IJK A;  3I56 V;  2JVD A;  2KG7 A;  1BCC H;  4B3S O;  2G38 A;  4PJ0 Z;  1LNQ A;  3JD3 A;  4X64 O;  1SQQ H;  1L0L H;  5L3D A;  2IH3 C;  5IWA B;  1VP7 A;  2YIA A;  1QHT A;  3ETE A;  2UUA O;  3BAA A;  1ARO P;  2W0F C;  4AQY B;  2LGW A;  3RYH B;  4KFM A;  3ZHQ A;  1HNX O;  2CH7 B;  5JJJ B;  4EB6 A;  4DV1 O;  4X1Y B;  5LGU A;  1V54 B;  1JR9 A;  1K97 A;  1AJQ A;  4LF5 B;  1XEQ A;  2VQF B;  1Z5V A;  4NXN B;  1N33 O;  5B1A B;  5BY1 A;  1YI2 V;  2N04 A;  4ZOL B;  1R1B A;  2F4V O;  1XNR B;  3G6E V;  4DR6 O;  3QO8 A;  5BR8 O;  3CRR A;  3R65 A;  1LUV A;  3ABM C;  1FAF A;  3L71 H;  1S5H C;  2V4D A;  4J7J A;  2XTA A;  1XMQ O;  4DO2 A;  1ENV A;  2X6C A;  3ZRX A;  1VQ4 V;  4DR1 O;  4LCU C;  4J42 A;  1ZTE A;  2QWR B;  4O2A B;  2ZE5 A;  4HBN A;  2ZCE A;  3K3W A;  4LFC O;  5KHJ A;  1OCR C;  4GX5 A;  4Q20 A;  2JS3 A;  3HKB A;  3MD0 A;  2QA4 V;  1XI1 A;  3A0H Z;  3CCQ V;  1NJI W;  3KCY A;  3B09 A;  4FJC C;  3RYH A;  1YJN V;  4OPH A;  1BSM A;  3VQY A;  2CH7 A;  1PKX A;  2DYR C;  4EFB A;  4FIP C;  1SRY A;  4DR5 O;  1PPJ H;  5H2F Z;  3K59 A;  4JI3 B;  2EZO A;  2LP7 A;  3QTC A;  1N34 B;  2QJ1 A;  4ZOL A;  1P7G A;  1MG1 A;  1AR4 A;  3CJH B;  4YJ2 B;  4PA6 A;  5D5Q A;  4ZI7 B;  3CHX A;  4FLY A;  4XDK A;  1OCO B;  3DSQ A;  3APQ A;  1SKV A;  2PF4 E;  2XAS A;  4J80 A;  5L3F A;  2N05 A;  3K9S A;  4O2A A;  3AG4 B;  1KYO F;  3BRC A;  3JAR B;  5C8Y B;  3K5O A;  1X59 A;  4DV2 O;  4PI2 A;  1EZJ A;  3GWK C;  5IYD O;  1YEW A;  1MOF A;  5IY5 C;  1VF7 A;  5H6Q A;  1PM9 A;  2Q73 A;  4I9W A;  2EIL B;  4G2K A;  2DJV A;  2XAJ A;  3P32 A;  4LNU B;  2IJH A;  2E76 B;  4DV7 B;  2ZD9 A;  2CUG A;  3N2K B;  5FNV B;  3LDE A;  2P67 A;  4JYC A;  1IBM B;  4XBF A;  1O9H A;  2EBO A;  3CJH A;  1JJ2 U;  4JI7 B;  3AK2 A;  5IJ0 B;  2X6A A;  4YJ2 A;  3D3Q A;  2IU0 A;  4ZI7 A;  4GX1 A;  3CXC U;  2P7T C;  4TOI A;  3AEI A;  4NKG B;  4NYK A;  1JQ0 A;  3C90 A;  1S77 D;  2AGA A;  5KUK A;  1QU7 A;  2UUB B;  5IY5 B;  3JCZ A;  4P30 A;  1OJH A;  1K92 A;  1MZE A;  4FPP A;  3O65 A;  1QLN A;  5FPO A;  2EUL A;  5C8Y A;  3JAR A;  4UV8 A;  2YIB D;  4X64 B;  4WCE V;  2X7R B;  3AK3 A;  1KKD A;  4K8Z A;  3CMA V;  3UT5 B;  4MT8 A;  4X88 A;  4I4T B;  1PNK A;  5JCO A;  4OXS A;  1WA8 B;  2O57 A;  3CSX A;  3APO A;  4JI8 O;  2UUA B;  5LGN A;  1WLE A;  3NR7 A;  4BR6 A;  2VQE O;  3SJC C;  1COW G;  4DV1 B;  4LNU A;  3LNN A;  2PZS A;  3K5L A;  1JJO A;  2MW2 B;  3E83 A;  2ZDI C;  1OCZ B;  3N2K A;  1VIB A;  4R50 A;  4LF8 O;  1KKC A;  4JPR A;  5JVD B;  2F4V B;  4IL6 Z;  4HNA B;  1HP8 A;  2OCC C;  3OR6 C;  5IJ0 A;  3RVY A;  4DR3 O;  4ZIB A;  4IYH A;  1XMO O;  2CTQ A;  4DV0 O;  4GUN A;  1HR0 B;  4MTO A;  4KHP B;  5KA6 A;  1X4T A;  3TXS A;  2IU3 A;  3ZMV A;  1J5E B;  3J80 N;  4LFC B;  3UT5 A;  4I4T A;  1WA8 A;  2PI5 A;  1KP3 A;  5J2U B;  4MW3 A;  1AP5 A;  5B1N A;  4PDM A;  3K5M A;  2OCC B;  4J11 A;  4ICG A;  2QWN B;  5JH7 B;  3ABU A;  5B66 Z;  1Q6U A;  3B4S A;  4JV5 O;  2GUZ B;  5KHI A;  4P9P A;  4I9Q A;  2UU9 O;  5JVD A;  3BA9 A;  4JAA A;  2P4K A;  2YIC A;  4HNA A;  1EN6 A;  1SQX H;  4QGP A;  4LR3 A;  3A8T A;  4FLU A;  1L0N H;  1ZLZ A;  2KSD A;  3EXA A;  1XL6 A;  4JAU A;  4PI0 A;  1YHQ V;  1YJ9 V;  1FS0 G;  3ZRV A;  4JI2 B;  2EZP A;  4HAM A;  1SS3 A;  3G6B A;  3OTO B;  1A32 A;  2LFS A;  4G27 B;  1Q7Y W;  1S0V A;  3ABK C;  1BS3 A;  1PL4 A;  4DV2 B;  2Q7E A;  3H01 A;  1DTO A;  3AK1 A;  2HJD A;  1TA8 A;  1GMG A;  3SR2 C;  2ZDI A;  5BXZ A;  2DN9 A;  1KEC A;  3ZED A;  1W2B U;  1THZ A;  3E8B A;  1Q8I A;  1KBH A;  4YJ3 A;  4X9Q A;  3TCU A;  4JYA O;  3LNM B;  4DYL A;  4DV6 O;  4X1K B;  4YIO A;  3P3N A;  2JDI G;  4IGG A;  4DK0 A;  4DR7 O;  4JI5 O;  2GUZ A;  4JI4 O;  4U3J B;  1N36 O;  3L75 H;  4LH6 A;  2Z5U A;  1VQM V;  3JAM N;  3IFX A;  2CAZ C;  4FLX A;  3ABK B;  5IYZ B;  2F1M A;  1M93 A;  1M56 B;  3DXR B;  2ZIN A;  5B1B C;  1F51 A;  3RYF B;  3CYO A;  3ZBH A;  1WB8 A;  2ZM6 O;  2LFR A;  1WJZ A;  1XNQ O;  1YTF B;  2UXC B;  5BZB A;  3K79 A;  2ADQ B;  5GW7 A;  4O2B B;  1EBO A;  4CH6 A;  3CRA A;  1E79 G;  4W4K A;  2DE0 X;  4W4L A;  2R9I A;  1WN7 A;  2UXX A;  1AI6 A;  3CRC A;  4GLX A;  2UUC O;  4JI8 B;  3X2Q C;  3W7T A;  1NTK H;  3JSN A;  3L74 H;  4PA7 A;  4I7Z B;  2VQE B;  1YJW V;  3TK1 A;  3OR7 C;  1MA1 A;  3D36 C;  4X1K A;  1M5I A;  5B1B B;  1SES A;  4D6T H;  2F66 C;  2UXN A;  4CC6 A;  1WPX A;  2ATK C;  4U3J A;  4LF8 B;  1MAB G;  2OTJ V;  5TIS Z;  2BSK B;  3ASN C;  2PUS A;  4O4J B;  2YXL A;  1E1Q G;  3JAS B;  1YF2 A;  4J41 A;  1TUE B;  1S76 D;  1Z2G A;  3L9D A;  3DXR A;  5LMU O;  2R9R B;  4K8X A;  3CP1 A;  2JRI A;  3CC4 V;  4MSW C;  3TXQ A;  4PDR A;  4DR3 B;  1U97 A;  2Y4U A;  2P5O A;  4JAV A;  2FYU H;  4GKK O;  1XMO B;  4ZKI A;  4DV0 B;  3CS5 A;  4GCZ A;  4O2B A;  4LFB O;  1SQG A;  5KUM A;  3FD9 A;  4LH7 A;  3AG2 C;  1R6K A;  3J81 N;  3ZCC A;  2EIN B;  3RW0 A;  4E2L A;  2YI9 A;  3P3P A;  4UCU A;  3ASN B;  3TJT A;  1GM7 A;  1QNM A;  5A9G A;  1GN6 A;  2DWD C;  2DOS A;  3FB5 C;  1G8M A;  5L3C A;  2Y4T A;  3CCR V;  2A3Q A;  1WP7 A;  1QLE C;  3SPJ A;  2BSK A;  3H9V A;  4H37 A;  4O4J A;  1XRE A;  4MTG A;  1VQP V;  1S5J A;  3JAS A; 
#chains in the Genus database with same CATH homology
 4LF7 O;  2Z0A A;  2N74 A;  4LFC O;  4B3T O;  4DV7 O;  4JV5 O;  2AGA A;  2UXD O;  1AB3 A;  2UUC O;  2UU9 O;  1I94 O;  3T1H O;  2UXB O;  3O65 A;  4A5U B;  1IBM O;  5LL6 Y;  4JI7 O;  4OPH A;  1IBK O;  4JI2 O;  3M8A A;  1KUQ A;  2E5L O;  3OTO O;  4DR5 O;  1NS1 A;  2UUB O;  4OPA A;  1IBL O;  4JI8 O;  1N32 O;  5FLX N;  1A32 A;  1G1X B;  4LF6 O;  4B3S O;  4X64 O;  2VQE O;  4DR2 O;  1FKA O;  2HHH O;  5IT9 N;  3RT3 C;  3T1Y O;  4LFA O;  4DR4 O;  5LMU O;  4DV5 O;  1F7Y A;  5BXZ A;  1YZB A;  2JRI A;  4JI3 O;  4X65 O;  1D2D A;  5H5N A;  4LF8 O;  2UUA O;  1N34 O;  4OX9 O;  4JI1 O;  4JI6 O;  4GKK O;  1R6T A;  4LFB O;  1HNX O;  4DV4 O;  4GKJ O;  1X59 A;  1FJG O;  4DV2 O;  3R66 A;  1FYJ A;  4DV1 O;  4DV3 O;  4B3M O;  4B3R O;  4JYA O;  2FKX A;  2VQF O;  4DV6 O;  1HNZ O;  3F5T A;  4DR7 O;  5IWA O;  3J81 N;  4JI5 O;  4JI4 O;  3SDL A;  5A2Q N;  1XEQ A;  1HR0 O;  1DK1 A;  4DR3 O;  4KHP O;  1N36 O;  1N33 O;  5BY1 A;  4AQY O;  1XMO O;  2F4V O;  1R1B A;  1J5E O;  4DV0 O;  3JAM N;  4K0K O;  4YHH O;  2DJV A;  4YY3 O;  4DR6 O;  3J7A U;  5BR8 O;  2DOS A;  2LW7 A;  4LF4 O;  3J80 N;  5LMN O;  4LF9 O;  4NXM O;  4JI0 O;  4DUY O;  4LF5 O;  2UXC O;  1XMQ O;  2ZM6 O;  4NXN O;  1HNW O;  2ZKO A;  4DR1 O;  1XNQ O;  4X66 O;  1AIL A;  1XNR O;  4X62 O;  4DUZ O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...