3SDLA

Crystal structure of human isg15 in complex with ns1 n-terminal region from influenza b virus, northeast structural genomics consortium target ids hx6481, hr2873, and or2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
95
structure length
95
Chain Sequence
b'TTQIEVGPGATNATINFEAGILECYERFSWQRALDYPGQDRLHRLKRKLESRIKTHNKSEPENKRMSLEERKAIGVKMMKVLLFMDPSAGIEGFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 1
publication title Structural basis for the sequence-specific recognition of human ISG15 by the NS1 protein of influenza B virus.
pubmed doi rcsb
source organism Influenza b virus
molecule tags Viral protein/antiviral protein
total genus 35
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3sdlA00
3J7AU 1N32O 4DV4O 1HNXO 1J5EO 4DR1O 1DK1A 3OTOO 4LF6O 4JI4O 4DV7O 5H5NA 1I94O 3SDLA 2ZM6O 4DR2O 3RT3C 3JAMN 1XMOO 1R1BA 4DV0O 4KHPO 4B3RO 1NS1A 2UXBO 4LF7O 2UUBO 4JI8O 4JI7O 4LF9O 5LL6Y 3F5TA 4JI0O 4GKKO 1FJGO 4K0KO 1HR0O 4B3SO 2N74A 4X66O 2F4VO 5A2QN 1FKAO 4DV2O 4LFBO 4LF5O 4X64O 2VQEO 4DV3O 4DR4O 1KUQA 1IBLO 2UXDO 5BR8O 4JI5O 5LMNO 2HHHO 4GKJO 4YHHO 5IT9N 1XEQA 4JI3O 4DUZO 1AB3A 4JYAO 4LFAO 4JV5O 3T1YO 4LF8O 2VQFO 4YY3O 1N36O 2FKXA 1HNWO 1A32A 4B3MO 4LF4O 2UXCO 4OPHA 3J80N 5BXZA 1N34O 3T1HO 5BY1A 4DV6O 1XNRO 2DOSA 3J81N 1R6TA 4X65O 4OX9O 4DR7O 1XNQO 4A5UB 4JI2O 5IWAO 4DUYO 4NXMO 4DR6O 1XMQO 3M8AA 2ZKOA 4LFCO 1HNZO 2UUCO 1FYJA 3O65A 1F7YA 2Z0AA 4DV5O 1D2DA 3R66A 2UUAO 2UU9O 1N33O 2LW7A 1YZBA 4DR3O 4JI1O 1AILA 5LMUO 4NXNO 4B3TO 4X62O 4OPAA 4DR5O 1IBMO 2E5LO 1X59A 5FLXN 1IBKO 2DJVA 2AGAA 4AQYO 4JI6O 2JRIA 4DV1O 1G1XB
chains in the Genus database with same CATH superfamily
2DYRB 1Q7YW 4I5SA 4IIJA 1QVGU 3FFQA 2YC0A 3HKBA 2XTAA 4F6EA 2Q69A 1XNRB 1PV0A 2QDOA 1NI8A 2ITCC 1W2BU 1EZJA 5LA6A 2ETNA 2XAGA 4DUYB 2IBZH 4KHPO 5L3GA 1RM1C 1SRYA 2BSKB 4I0XB 3TXQA 1VP7A 3DGEA 1F23A 1F4MA 2A06H 3F5TA 1Y6XA 4YJ3B 3A0RA 3KZIZ 5C93A 3OEHG 5L3DA 1HWYA 1N33B 1AJPA 3FAVA 4L87A 1QLEB 4J7ZA 2Q7EA 2BOBC 4J7JA 4MVSA 4TUYB 4UCUA 3ZMUA 1XREA 3GWKC 3RYHA 3OFNG 4LFAO 3JD3A 3K08A 2K9PA 2IJJA 1N8RW 2E76B 3AG3B 2EZOA 4LNUA 1RP3B 4RUFA 2RJZA 4FM1A 3JD0A 4ZIBA 2PTMA 3J81N 4MVZA 2CTQA 5FPRA 1VQOV 4LH6A 2DYRC 3RWRD 5IWAO 5AG2A 2DMXA 1YI2V 3U10A 2ZNJA 2FL4A 1DF4A 4I55B 3G4SV 3H9VA 1EN5A 1KYOF 4UVBA 3O65A 5IY5B 4I4TA 3OTFA 2Q4PA 4DK1A 2KQXA 3AG2B 3CWBH 3JAKA 4X1YA 2Y4UA 5D5QA 1QLEC 2Z3YA 5H9CA 1NH2B 4FJCC 3HPLC 4RQEA 4YXWG 5KUMA 2R9AA 3AK2A 4LF6O 2H94A 3JAWA 3SYPA 1Q86W 3JSLA 4R50A 5EK0A 4MVQA 4MTOA 5KHIA 1XMOO 1YDXA 3AG3C 1NT2B 1VQ6V 1R1BA 2FB5A 4B3RO 1GMGA 4IL6Z 1VMGA 1Z5VA 4JI0O 4GKKO 5LOVB 2CTPA 5LGNA 2ZXWC 4OXSA 1Q43A 2GTSA 2DQ0A 1WN7A 2OYQA 1TA8A 1BCCH 1K97A 5IY5C 1JJ2U 1BGYH 1XEQA 4U3JA 5KUKA 3SPHA 2MW2B 3E8HA 4H0LB 1YF2A 3HKCB 1SQQH 2F1MA 4QE7A 2IH3C 4EB6B 4DV4B 2EIJB 1VQPV 2GSMB 3ZMVA 1Q90D 2DOSA 2WA3A 4X20B 1KKDA 1MNGA 3JATA 1WLEA 5A9GA 1IX9A 2YIBD 1PNLA 1FYJA 1D2DA 3RYCA 2UU9O 4GUNA 4KXRA 2QGNA 2BE3A 1K5QA 2WLIA 1PKXA 5GW7A 1VQ4V 4UB6Z 4NTYA 2P06A 3SPCA 2HFEC 3CCLV 4JYAB 1NR7A 2ZQMA 3PJSK 3AG4C 2QWQB 3H1JH 2BCCH 1ENVA 1J5EO 1JFFA 4MS2A 1S77D 2Y4TA 3RYFA 4EFEA 3T4DA 1SQGA 3AK1A 4EEQA 4HNAB 3WB1A 2EULA 4FFKA 3RT3C 3JAMN 4WFBV 2DE0X 5IJ0A 2EIJC 4UCRA 2JEUA 1XMQB 4O4IA 1NJIW 1WP8A 1GM9A 4LF7O 4MSWC 4RAIA 3KCXA 3WB2A 4B3SO 3OGCC 2RDCA 4X66O 4TV8A 1FXKB 4X64O 1IBLO 2UXDO 4GX1A 2WWWA 5BR8O 4FLXA 4FPPA 4WBNB 4I50B 1M4UA 4UV8A 4PA3A 1L0NH 4YJ2B 3LDCA 5ITZA 5CN0A 1ZL8B 3CEIA 1YTFB 4Q20A 4QPKA 1S0VA 5BY1A 3OTOB 3E22B 4DR7O 4D7TA 2XASA 2YEVB 4DR2B 1K9MW 3N2KB 1JOYA 3CMAV 2LO1A 2BSKA 3BAAA 4I0XA 4CBCA 4IT5A 4PDVA 4YJ3A 1SESA 2W6IG 3Q4HB 2RMKB 4DV5O 3R65A 3ABMB 2OT5A 1H38A 4TUYA 1S72V 5FNVB 2P22C 3RN4A 4JAUA 3W7WA 1N4CA 1ZSPA 1FXKC 2AGAA 3CXCU 4MW3A 3MHSC 4AQYO 2YS8A 2IU3A 4FLZA 2HKOA 1HNWB 2L6LA 4I9QA 2QWOB 2ZIOA 3G80A 3LUTB 1Q6HA 2QJ1A 3CRRA 3CPWU 4DV7O 3T1HB 2LW1A 4OGQB 3KCYA 4X88A 1VF7A 2PGGA 1VQ7V 4F6RB 1VF5B 3E2EA 2D3OW 4I55A 4JTCB 4KL1A 3UT5B 2UUBO 2VQFB 2UUCB 1AI7A 4FLUA 3ZBHA 2GBOA 2ZNIA 2IJKA 4DV3O 4PA7A 3B40A 5EBWC 1H8HG 1I0HA 3T4ZA 4NB5A 2JS3A 2HHHO 3ABMC 2OCCC 2GV9A 1IBKB 4ASUG 1H8EG 1JMKC 2A9HA 2EIKC 2Y0PA 1G4YB 4FM0A 4TWKA 4OPHA 5EZYB 2KSDA 3ZMZA 2HEPA 3WG7B 3G6EV 3AEIA 4KP4A 4JI4B 2N05A 4DR3B 4GT1A 3FKSG 2QM8A 3JD4A 4DR6O 4UCVA 5LOVA 1WA8B 2Y0IA 3SYCA 4P30A 2JGUA 4JZ2A 2LW7A 1AR5A 3LDEA 4UVAA 1Y74B 3DXRA 4LF5B 3X2QB 5KA5A 5LMUO 3FX7A 3B8MA 4B3TO 4JF3A 4CS3A 3A8TA 3NR7A 3T2MA 4GKJB 1QCEA 4YHHB 1CEZA 1XL4A 4HZ3A 2P7TC 3HKCA 4DV0B 3ZRVA 4K3AA 1Y66A 1YHQV 3SJAC 5JJEB 4EB6A 1B04A 1KU9A 1H2GA 1NKDA 2DYSB 2Y48A 1MABG 3K5LA 4DYLA 3SPIA 1WNSA 3WG7C 4FIPC 1URFA 4JI8O 5LP6B 4MVMA 5B5EZ 1R73A 1F4NA 2NNUA 3G67A 2UUAB 3UQ8A 4LFBO 3CCMV 3O9OA 4FM2A 1G8MA 1LNQA 2YI8A 3K5NA 4DUZO 1AB3A 2N04A 1OCZB 4G2KA 4LF8O 3JASA 1VIBA 2XOKG 2E74B 5K1XA 3X2QC 2C2AA 1TVKB 2V4DA 4B3MO 4DW0A 3JYCA 3IFXA 3ETGA 2ADPA 4HNAA 4DV6O 2R9IA 1GN6A 1KKCA 4X65O 1I08A 3SPGA 3CCRV 3L9DA 4FFBB 4JTAB 2OCHA 2F23A 1WPXA 2DYSC 1TUBB 1MSWD 3T1CA 1HNZO 4TT3G 1HDJA 1QNMA 2V1DA 1FXKA 5EYPB 3K58A 5HFLA 3RBZA 4PA6A 3K04A 1BZKA 2OTLV 5EIBD 4WBNA 4I50A 1YCIA 5LP6C 4YJ2A 3W7XA 2ZE6A 1X59A 2Q7HA 1GK9A 3CC7V 4UUJC 2OTJV 1HW7A 1THZA 3LSQA 1ZTEA 3MHHC 3ABKB 1OCZC 3E22A 1GN4A 1ROPA 2YEVA 3APQA 3E86A 3ZRWB 4GYCB 3CC2V 3N2KA 4JI2B 2GHYA 2M6YA 2DW4A 1QBZA 5HFMA 5J2UA 2QKSA 1S5LZ 1P7BA 2F4VO 5JCOC 3D36A 1WJZA 5FNVA 3DSQA 3CB2A 3EXAA 1TAEA 2BTQB 4FLVA 4JI3O 5CA0B 3B4SA 4ZI7B 5KHGA 3UO3A 2KB1A 5JQGB 1KECA 5B1AC 3CRAA 4JASA 5JH7B 2AHYA 2W0XA 5FL7G 1MA1A 3L73H 3OMAB 4PA9A 4I7ZB 2KG7B 2HG5C 3ZCCA 4F6RA 5KX5B 4UVCA 1D5AA 2ZT9B 4K35A 1XDCA 4BIUA 3ABKC 2H8PC 4KHPB 4LFCO 2ZR2A 4XDJA 3FB8C 2EINB 4PD4F 1LR1A 3ZRXA 2QA4V 3LNMB 1P4RA 1Q81W 3ABTA 2ZDIA 4IGGA 4AILC 2FYUH 1SQXH 2JJ1G 4IYHA 4O4HB 1BL8A 2VWJA 2LGWA 1SS3A 3EHBB 1R3KC 5KAIZ 5FLXN 2Z5UA 4HYOA 4LFAB 1L1FA 3N2GB 5L3CA 1NTMH 5EZYA 3VBBA 5JJJB 1HNXO 5GONB 2DWDC 1TUEB 2YICA 4X8AA 2OIEA 3QO7A 3CC4V 1V55B 4P9PA 1H2NA 1KB9F 4QGPA 4H37A 5IWAB 4GX5A 5IYDO 1R3JC 1CP9A 2DWEC 3W7UA 1WA8A 1KD1W 2R9RB 3RYIA 1IXBA 1YITV 3VOUA 4LF4B 1W0KG 3CCEV 3FYIB 5IJ9B 1Y74A 2VQEO 1FAFA 3CCVV 1DGSA 1JPXA 5DEDA 3CJHB 5EBLC 5DM6V 5CA1B 1K34A 2ADQB 2XNDG 1N36O 2FMLA 2HP8A 4CH5A 2E3CA 3P32A 4GZRB 2CGNA 4LF6B 4GCZA 2Q8VA 4OX9O 1XNQO 3OD4A 1M93A 2JS5A 4E2LA 1XMOB 2PI4A 4UXNA 4B3RB 4FLYA 2QM7A 1GN3A 1V55C 4UB8Z 5LP6A 5KHJA 4JI0B 4GKKB 3AG2C 4QE9A 1NQTA 2YSUB 3H1LH 3K9AA 3LDDA 1IXMA 5CBGA 2YXLA 3S3WA 3BCCH 4DR5O 4OPAA 1Q6UA 4TQFA 2Q67A 1XOUA 1M9NA 4W4LA 2ILMA 4FZ0A 3ZHQA 2BOCC 1NTKH 4ZOLB 1TVKA 3BABA 1J95A 1JJOA 2CH7B 4LWSB 2ZE8A 4H33A 3KKYA 5H5NA 1KQSU 1I94O 2HR3A 3DTUB 5JCOA 5TISZ 1TUBA 5IDJA 3SYAA 3H1IH 4IHJB 4PI0A 2BTOA 4F4LA 5EYPA 3FD9A 1WB8A 4JTDB 1QR8A 2UU9B 2WLKA 2WLLB 5E79Z 4DR4O 1OZ0A 3WFVA 3P30A 1K73W 3W7SA 4JI5O 2QWPB 4TV9B 2W0FC 1CXZB 4AHCA 4JV5O 4EKWA 2IW5A 5JVDB 1P7GA 1B3QA 2EX3A 3QG5A 4X9QA 5B1NA 2UXCO 1QHTA 5BXZA 1J5EB 4LBEC 5H6QA 1VARA 1JVMA 1RFYA 1KP3A 3ZRWA 2L35A 2OIGA 3OR6C 4U7NA 1OHHG 3CMEV 4IYIA 4CC5A 2XAQA 2ZKOA 1K4DC 4LF7B 3BPZA 4JAAA 4B3SB 4X66B 2Q0AA 2WLHA 2PYJA 4X64B 2BTQA 1AILA 4PHZA 2HLDG 1IBLB 2UXDB 1AI6A 1PPJH 3D3IA 5BR8B 4X62O 5CA0A 1CPYA 4H13B 4NR1A 1IBMO 2E5LO 2HVJC 3G71V 4ZI7A 3H01A 3RVYA 3CYOA 1XHZA 3M7MX 3GVMA 4YIPA 3CD6V 5JQGA 4J9ZB 2XAHA 5JH7A 5LXTB 3SR2C 5L3EA 2CUGA 2P90A 1SQVH 3MD0A 3DC6A 5KX5A 1YJWV 4DR7B 4WFAV 1SQBH 3ZHTA 4HBNA 2NLJC 2LFRA 3AG1B 2AHZA 3F5WC 3OMNB 2DQ3A 1MMMA 4LF9O 2EJRA 3BA8A 3JD2A 1FJGO 1EZVH 3H1HH 3JARB 2EIMB 3K0GA 1SETA 2ARHA 3K0DA 4DV2O 1AJQA 2RNBA 3E8FA 4QNHB 5IYZB 5LA6B 1ZX3A 2Q0OC 2PYLA 3N2GA 2VQFO 4P2ZA 1YJNV 4AQYB 3E89A 4FLWA 5DECA 5GONA 1IURA 3OW2U 2IU0A 5L3BA 1N34O 4O2AB 4MW8A 1R6TA 4CH4A 4DV7B 2ZD9A 1K92A 4WCEV 2G38A 4E4EA 4RWUA 4NXMO 2P4KA 5DN6G 1QU7A 3M8AA 5FPOA 1FPOA 1AVMA 5H6RA 2WA4A 3OEEG 2LP7A 5LHHA 5BMVB 4X1KB 3D36C 2UUBB 1F7YA 4LH7A 2Q6AA 4ZHQB 1O9GA 3TCUA 1SZTA 3E8GA 5IJ9A 2VWKA 3AG1C 4LNUB 4RO2A 4DR3O 1YSCA 2GTAA 2X7RB 3U11A 2YXHA 3VQVA 4DV3B 4JI1O 1PP9H 3ZJZA 2AXTZ 1S3JA 3CJHA 4NXNO 3N27A 5CA1A 1V9PA 2YIDA 2EIMC 5CB4B 2VS0A 3K5MA 2WPDG 1OV9A 2GUZB 4N21A 2OWOA 3D8CA 4JI6O 1OCOB 3P3NA 1NVPB 1VQLV 4DR1O 1DK1A 1XUQA 3IC7A 3CCUV 4ICGA 2AZ2A 4GLXA 5CBFA 2YUAA 3TETA 3CP1A 3ZS8C 2A0LA 3CHXA 4K8XA 4QPJA 5B3SB 4DV0O 4DR6B 1YTFD 4BIOA 5LYJB 3A2FA 3GB7C 2KKWA 4J11A 4JI7O 2ZDIC 2JVDA 1JR9A 3SYQA 4Z1MG 4K0KO 5C8YB 4WF9V 2R72A 1US6A 1HR0O 3VQYA 2P67A 1GN2A 3QO5A 2ODMA 4X20A 5LMUB 5LMNO 5B1OA 1WB7A 1Z2GA 4B3TB 1V54B 1G6UA 3I56V 2QKCA 4ZOLA 4YY3O 1NTZH 2CH7A 4LWSA 3J80N 1AR4A 4DK0A 2X6BA 1DF5A 3C90A 1BE3H 3K03A 1OCOC 1Y67A 5KAFZ 3ZHRA 1EN6A 2W6JG 2MK3A 2EJ7A 4R8CA 3ZX6A 1K5SA 2JEXA 4IHJA 3OGIB 4JI8B 1XBLA 3MAQA 4C7UA 5GTIZ 3SPJA 1Q82W 5B3SC 4CS4A 2WLLA 1WAZA 4JGSA 1VEWA 4LFBB 3OMIB 4TV9A 1SERA 4JPRA 4QIWF 3C3SA 4BWAA 1KMIZ 5B66Z 4DUZB 5JVDA 4LF8B 4DV1O 1FFXB 3SJBC 4UCSA 1N32O 4KUMA 2WLNA 4B3MB 4BW5A 1V54C 3F7YC 1N0JA 3MDSA 4MTXA 4DV6B 2ZM6O 3HKEB 3TK1A 1T5EA 1QR9A 3SGIA 3L74H 3CCSV 3ETDA 4DW1A 2UXBO 1ZL8A 3ZHSA 1HNZB 3JD1A 3UO2A 4J41A 3STLC 3AG7A 3WU2Z 1BS3A 1FKAO 1QLNA 3CXHF 4MVOA 4O4JB 3JALB 1KC8W 1R6KA 5IT9N 2B5UA 3T1YO 3BA9A 1I5XA 3Q4HA 5LXTA 5CBHA 4DXWA 3L72H 2LQTA 1K33A 4ABMA 1XNRO 4TOIA 2LFSA 2B1GA 1BMFG 1FD9A 4NVPA 2F66C 4BIZA 1YJ9V 3I5DA 1EM1A 4DUYO 4PA4A 4X89A 5BZBA 2R70A 1NZ6A 1ORQC 4TQDA 5ITZB 3K5OA 2XAFA 3ETQA 3JARA 1JQ0A 1N33O 4BR6A 2PF4E 2F4VB 2JGDB 1YZBA 2UXXA 4NTWA 1AI5A 3IJ4A 3B8NA 5IYZA 3BHPA 1Q6IA 4XBFA 1AR1B 2ZE5A 2AZ0A 2CE4A 4PDRA 4JI3B 3UT5A 3CCQV 4DRXB 1X4TA 1MZEA 5KHHA 1IVSA 4X1IB 3HKDB 4O2AA 1AJNA 4PV1B 2IH1C 1E79G 2B9ZA 3DC5A 3HB3B 3SDLA 3K06A 1LUVA 2YXYA 4ZKIA 1WP7A 3E35A 4UCOA 5BMVA 4X1KA 4LFCB 2NN4A 4CS2A 1SZXA 4ZHQA 3A0BZ 3BRCA 4PDLA 3ETEA 2XUMA 3L70H 3ZHUA 1HP8A 2Q9LA 1QQCA 1PM9A 3RGBA 5D5PA 3QF7A 2JIZG 3EFFK 2ITDC 1ZUQA 2WSSG 1L0LH 3FB6C 1SQPH 5CB4A 2GUZA 4TSFG 2ZXWB 4FZ1A 2QTSA 4LF4O 4CH3A 3A0HZ 4GX0A 1HNXB 1XQ8A 4J7KA 1IZ3A 3ABLB 4A5UB 1ZWIC 4NKGB 2EINC 2B1IA 2GDSA 5CA3A 3K3WA 5LYJA 4J42A 1FS0G 1W59A 5LGTA 4K8ZA 1U97A 1YEWA 1OJHA 5C8YA 4PDMA 2CK3G 1K3EA 4UV9A 3WB0A 5JWPA 1SA0B 3CS5A 3ICXA 1M5IA 2CDYA 2RQ6A 4HAMA 1RSOB 3QNEA 4BW9A 1Y4MA 4WFGA 4O4LB 2VQEB 1K8AW 3RFRA 1OCCB 3QO8A 5E1AC 1AP6A 3K9SA 1R6NA 3W7TA 3H1KH 4CH6A 2JRIA 1OCRB 1G1XB 1Q8IA 2XHBA 1N36B 3J7AU 4DV4O 1UJWB 2HJDA 3G6BA 5KHKA 1SQFA 2ZCEA 3APOA 1L8DA 1GTOA 1KP2A 3AG4B 1JCHA 3AK3A 3K59A 3DXRB 2RN9A 3M99B 4OX9B 1XNQB 1PNMA 2HJFC 1UFIA 3CRQA 2K1EA 3CSXA 4UFZA 5J2TB 4N23A 3ABLC 1GRJA 1P49A 4ZBMA 4FMTA 4MT8A 1D5NA 4R6ZA 1M56B 3VQXA 3F7VC 2P4VA 2YI9A 2H3OA 3S3XA 4J10A 1VQ5V 3CRMA 4FFBA 3K79A 1WPBA 2JK5C 4Q6GA 4DR5B 1AROP 1PL0A 4JYAO 3ZIAG 1IDSA 1FFXA 1LUWA 3TJTA 2FKXA 1OCCC 2IM9A 1ZLZA 4P9OA 4LC1A 4NTXA 1B06A 1QVFU 3ABUA 3HKEA 2X0LA 1I94B 1OCRC 4PJ0Z 4I9WA 3OE7G 1MSDA 1PNKA 4MTFA 1XMQO 1FFTB 2X6AA 1NR1A 5KA6A 3JASB 2WAMA 5F2VO 1Y76B 4GX2A 3CRCA 2Z0AA 3PN1A 1M90W 2ATKC 4MTGA 2QWRB 3B77A 1PD3A 4CC6A 3ZMTA 4G28B 3LSSA 4O4JA 4DR4B 5GTHZ 3JALA 4LP8A 4JI5B 1M56C 2QE7G 1BHAA 1NH2D 4JV5B 1H2MA 3QTCA 5LHIA 3TXSA 2UXCB 3B09A 1I5YA 3JSNA 4J80A 3OTOO 3HR0A 1MOFA 1FXVA 1XL6A 3B2EE 4DO2A 1GAXA 4DR2O 4W4KA 4FK5C 3ASNB 3VQWA 1NS1A 3QVNA 4B7KA 1JX9A 5LL6Y 1F51A 3ZHVA 1DTOA 1RPOA 1M57B 5KLVH 2JGDA 5IE9A 3FB5C 1Z5WA 1S76D 2QR4A 2KG7A 3ZN1A 4FVMA 4NYKA 3LNNA 3K57A 3E8BA 4X62B 3CX5F 4JZGA 1IBMB 3FYEB 2E5LB 1YIJV 4O2BB 2EZPA 4DRXA 1TGOA 2D2CB 5KMGB 2YIBA 4X1IA 1GM8A 1HNWO 3RW0A 2ZR3A 3HKDA 5J2UB 2OCCB 4IIJB 4DV5B 2RCVA 3EVKA 3HKBB 5CMUA 4JYBA 4YIOA 3T1HO 1Q5OA 1ZAUA 3CE2A 3UM7A 2Q7GA 4O4HA 3I55V 5H2FZ 2EIKB 2ZIMA 3E83A 1VF6C 1GKFA 4L8JA 2UUCO 4PELA 5LBQA 4LF9B 5B1BB 1FJGB 1GM7A 3ASNC 2QWNB 3FB7C 3LSUA 3FAVB 4DV2B 2V7QG 1VQ9V 5LGUA 2QSAA 2XT9A 1NBMG 1O9HA 1M57C 1PL4A 2F43G 4UCTA 1IBKO 3RYHB 3SYOA 1M1KW 1YVWA 2FTKA 3STZC 1EN4A 1VQ8V 3NXSA 3OT7A 1N34B 4JI4O 3KG2A 3IAYA 3CCJV 2Q5ZA 2UXNA 3BY6A 2JDIG 3THOA 3BEHA 4JAVA 2A79B 1NU1H 4PI2A 4NXMB 4LCUC 2HHHB 3UCSC 2HVKC 2E75B 2IJHA 1SA0A 1AI4A 2Q68A 3P3PA 4KFMA 1RSOA 5A2QN 1KBHA 1SKVA 4I4TB 3L75H 4O4LA 4LF5O 1KUQA 2WLJA 4FLTA 4XDLA 3GWOA 1S5JA 4JI1B 3ZRSA 5B1BC 4GKJO 4NXNB 3ZN0A 4YHHO 3JAKB 2A3QA 4X1YB 3JCUZ 1P84F 3OUFA 1AP5A 1Q3EA 3ML0A 4D6TH 4R7CA 1XI1A 4WFHA 4JI6B 2PI5A 2PY5A 4WFEA 3RYIB 1VQKV 1SF9A 4RUEA 4MVRA 3RVZA 5IYBO 4DR1B 2QKAA 3JAWB 1BSMA 4RQFA 1EFRG 3IC9A 1H2SB 1BT8A 2ZE7A 4QJFB 1COWG 5J2TA 1B6QA 2CAZC 2EILB 1H2LA 5LHGA 2F95B 5IYCO 3SJCC 1VQMV 4JI7B 2CGOA 3C3TA 4U7OA 3JCZA 1BQZA 1MZFA 1SC5B 4K0KB 1HR0B 2UUAO 3SJQC 3BFRA 5EIBC 5EC2C 4EFBA 4CZZA 2NR5A 2JJ2G 1EBOA 3IGAC 5LMNB 2DJVA 5JJNB 4U3JB 1N0NA 3ASOB 1S5HC 2QM4A 4YY3B 5L3FA 5J9PC 4D7SA 2YDEA 4G27B 4J9YB 1R3IC 4BAYA 2X6CA 3OAAG 2M7WA 2Y69B 1I7FA 4U3FH 1XHXA 1E1RG 4Z2WA 2CTRA 4JYYA 3JATB 4JYCA 2DN9A 1BHBA 2LGQA 1VQNV 1MG1A 1Y76A 2O57A 1W0JG 4B7EA 1BQ0A 1H2KA 2N74A 1JA8A 2QEXV 2IJIA 3RYCB 1FXHA 2EILC 2P5OA 3UKMA 2EBOA 2YIAA 2ZINA 2WLIB 2P6JA 4XDKA 4X65B 3BVOA 1E1QG 2A7WA 2CTWA 2VRZA 1U96A 2WLMA 4DV1B 2PUSA 3TGUH 1A32A 4H44B 1N32B 1JFFB 1VF6A 1K4CC 1XILA 3OUSA 5EC1C 3ZEDA 1RM1B 3RYFB 3ASOC 4LR3A 2PZSA 4B08A 5B1AB 2ZM6B 4JI2O 5EBMC 1K7DA 4AI8A 3OR7C 5IJ0B 3ZMSA 3U0ZA 4O4IB 1NVPD 2Y69C 2UXBB 3L71H 2F93B 2Q73A 1GH6A 1R3LC 3R66A 4WFFA 5K1PA 1RPRA 2XAJA 4TV8B 1GO3F 2QTOA 3D3QA 4MVUA 3OM3B 4O2BA 4Z1VA 1YXBA 5KMGA 2LJ2A 2AW9A 3T1YB 1UPGA 1DLBA
chains in the Genus database with same CATH topology
3J7AU 1N32O 4DV4O 1HNXO 1J5EO 4DR1O 1DK1A 3OTOO 4LF6O 4JI4O 4DV7O 5H5NA 1I94O 3SDLA 2ZM6O 4DR2O 3RT3C 3JAMN 1XMOO 1R1BA 4DV0O 4KHPO 4B3RO 1NS1A 2UXBO 4LF7O 2UUBO 4JI8O 4JI7O 4LF9O 5LL6Y 3F5TA 4JI0O 4GKKO 1FJGO 4K0KO 1HR0O 4B3SO 2N74A 4X66O 2F4VO 5A2QN 1FKAO 4DV2O 4LFBO 4LF5O 4X64O 2VQEO 4DV3O 4DR4O 1KUQA 1IBLO 2UXDO 5BR8O 4JI5O 5LMNO 2HHHO 4GKJO 4YHHO 5IT9N 1XEQA 4JI3O 4DUZO 1AB3A 4JYAO 4LFAO 4JV5O 3T1YO 4LF8O 2VQFO 4YY3O 1N36O 2FKXA 1HNWO 1A32A 4B3MO 4LF4O 2UXCO 4OPHA 3J80N 5BXZA 1N34O 3T1HO 5BY1A 4DV6O 1XNRO 2DOSA 3J81N 1R6TA 4X65O 4OX9O 4DR7O 1XNQO 4A5UB 4JI2O 5IWAO 4DUYO 4NXMO 4DR6O 1XMQO 3M8AA 2ZKOA 4LFCO 1HNZO 2UUCO 1FYJA 3O65A 1F7YA 2Z0AA 4DV5O 1D2DA 3R66A 2UUAO 2UU9O 1N33O 2LW7A 1YZBA 4DR3O 4JI1O 1AILA 5LMUO 4NXNO 4B3TO 4X62O 4OPAA 4DR5O 1IBMO 2E5LO 1X59A 5FLXN 1IBKO 2DJVA 2AGAA 4AQYO 4JI6O 2JRIA 4DV1O 1G1XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7A U;  1N32 O;  4DV4 O;  1HNX O;  1J5E O;  4DR1 O;  1DK1 A;  3OTO O;  4LF6 O;  4JI4 O;  4DV7 O;  5H5N A;  1I94 O;  3SDL A;  2ZM6 O;  4DR2 O;  3RT3 C;  3JAM N;  1XMO O;  1R1B A;  4DV0 O;  4KHP O;  4B3R O;  1NS1 A;  2UXB O;  4LF7 O;  2UUB O;  4JI8 O;  4JI7 O;  4LF9 O;  5LL6 Y;  3F5T A;  4JI0 O;  4GKK O;  1FJG O;  4K0K O;  1HR0 O;  4B3S O;  2N74 A;  4X66 O;  2F4V O;  5A2Q N;  1FKA O;  4DV2 O;  4LFB O;  4LF5 O;  4X64 O;  2VQE O;  4DV3 O;  4DR4 O;  1KUQ A;  1IBL O;  2UXD O;  5BR8 O;  4JI5 O;  5LMN O;  2HHH O;  4GKJ O;  4YHH O;  5IT9 N;  1XEQ A;  4JI3 O;  4DUZ O;  1AB3 A;  4JYA O;  4LFA O;  4JV5 O;  3T1Y O;  4LF8 O;  2VQF O;  4YY3 O;  1N36 O;  2FKX A;  1HNW O;  1A32 A;  4B3M O;  4LF4 O;  2UXC O;  4OPH A;  3J80 N;  5BXZ A;  1N34 O;  3T1H O;  5BY1 A;  4DV6 O;  1XNR O;  2DOS A;  3J81 N;  1R6T A;  4X65 O;  4OX9 O;  4DR7 O;  1XNQ O;  4A5U B;  4JI2 O;  5IWA O;  4DUY O;  4NXM O;  4DR6 O;  1XMQ O;  3M8A A;  2ZKO A;  4LFC O;  1HNZ O;  2UUC O;  1FYJ A;  3O65 A;  1F7Y A;  2Z0A A;  4DV5 O;  1D2D A;  3R66 A;  2UUA O;  2UU9 O;  1N33 O;  2LW7 A;  1YZB A;  4DR3 O;  4JI1 O;  1AIL A;  5LMU O;  4NXN O;  4B3T O;  4X62 O;  4OPA A;  4DR5 O;  1IBM O;  2E5L O;  1X59 A;  5FLX N;  1IBK O;  2DJV A;  2AGA A;  4AQY O;  4JI6 O;  2JRI A;  4DV1 O;  1G1X B; 
#chains in the Genus database with same CATH topology
 2DYR B;  1Q7Y W;  4I5S A;  4IIJ A;  1QVG U;  3FFQ A;  2YC0 A;  3HKB A;  2XTA A;  4F6E A;  2Q69 A;  1XNR B;  1PV0 A;  2QDO A;  1NI8 A;  2ITC C;  1W2B U;  1EZJ A;  5LA6 A;  2ETN A;  2XAG A;  4DUY B;  2IBZ H;  4KHP O;  5L3G A;  1RM1 C;  1SRY A;  2BSK B;  4I0X B;  3TXQ A;  1VP7 A;  3DGE A;  1F23 A;  1F4M A;  2A06 H;  3F5T A;  1Y6X A;  4YJ3 B;  3A0R A;  3KZI Z;  5C93 A;  3OEH G;  5L3D A;  1HWY A;  1N33 B;  1AJP A;  3FAV A;  4L87 A;  1QLE B;  4J7Z A;  2Q7E A;  2BOB C;  4J7J A;  4MVS A;  4TUY B;  4UCU A;  3ZMU A;  1XRE A;  3GWK C;  3RYH A;  3OFN G;  4LFA O;  3JD3 A;  3K08 A;  2K9P A;  2IJJ A;  1N8R W;  2E76 B;  3AG3 B;  2EZO A;  4LNU A;  1RP3 B;  4RUF A;  2RJZ A;  4FM1 A;  3JD0 A;  4ZIB A;  2PTM A;  3J81 N;  4MVZ A;  2CTQ A;  5FPR A;  1VQO V;  4LH6 A;  2DYR C;  3RWR D;  5IWA O;  5AG2 A;  2DMX A;  1YI2 V;  3U10 A;  2ZNJ A;  2FL4 A;  1DF4 A;  4I55 B;  3G4S V;  3H9V A;  1EN5 A;  1KYO F;  4UVB A;  3O65 A;  5IY5 B;  4I4T A;  3OTF A;  2Q4P A;  4DK1 A;  2KQX A;  3AG2 B;  3CWB H;  3JAK A;  4X1Y A;  2Y4U A;  5D5Q A;  1QLE C;  2Z3Y A;  5H9C A;  1NH2 B;  4FJC C;  3HPL C;  4RQE A;  4YXW G;  5KUM A;  2R9A A;  3AK2 A;  4LF6 O;  2H94 A;  3JAW A;  3SYP A;  1Q86 W;  3JSL A;  4R50 A;  5EK0 A;  4MVQ A;  4MTO A;  5KHI A;  1XMO O;  1YDX A;  3AG3 C;  1NT2 B;  1VQ6 V;  1R1B A;  2FB5 A;  4B3R O;  1GMG A;  4IL6 Z;  1VMG A;  1Z5V A;  4JI0 O;  4GKK O;  5LOV B;  2CTP A;  5LGN A;  2ZXW C;  4OXS A;  1Q43 A;  2GTS A;  2DQ0 A;  1WN7 A;  2OYQ A;  1TA8 A;  1BCC H;  1K97 A;  5IY5 C;  1JJ2 U;  1BGY H;  1XEQ A;  4U3J A;  5KUK A;  3SPH A;  2MW2 B;  3E8H A;  4H0L B;  1YF2 A;  3HKC B;  1SQQ H;  2F1M A;  4QE7 A;  2IH3 C;  4EB6 B;  4DV4 B;  2EIJ B;  1VQP V;  2GSM B;  3ZMV A;  1Q90 D;  2DOS A;  2WA3 A;  4X20 B;  1KKD A;  1MNG A;  3JAT A;  1WLE A;  5A9G A;  1IX9 A;  2YIB D;  1PNL A;  1FYJ A;  1D2D A;  3RYC A;  2UU9 O;  4GUN A;  4KXR A;  2QGN A;  2BE3 A;  1K5Q A;  2WLI A;  1PKX A;  5GW7 A;  1VQ4 V;  4UB6 Z;  4NTY A;  2P06 A;  3SPC A;  2HFE C;  3CCL V;  4JYA B;  1NR7 A;  2ZQM A;  3PJS K;  3AG4 C;  2QWQ B;  3H1J H;  2BCC H;  1ENV A;  1J5E O;  1JFF A;  4MS2 A;  1S77 D;  2Y4T A;  3RYF A;  4EFE A;  3T4D A;  1SQG A;  3AK1 A;  4EEQ A;  4HNA B;  3WB1 A;  2EUL A;  4FFK A;  3RT3 C;  3JAM N;  4WFB V;  2DE0 X;  5IJ0 A;  2EIJ C;  4UCR A;  2JEU A;  1XMQ B;  4O4I A;  1NJI W;  1WP8 A;  1GM9 A;  4LF7 O;  4MSW C;  4RAI A;  3KCX A;  3WB2 A;  4B3S O;  3OGC C;  2RDC A;  4X66 O;  4TV8 A;  1FXK B;  4X64 O;  1IBL O;  2UXD O;  4GX1 A;  2WWW A;  5BR8 O;  4FLX A;  4FPP A;  4WBN B;  4I50 B;  1M4U A;  4UV8 A;  4PA3 A;  1L0N H;  4YJ2 B;  3LDC A;  5ITZ A;  5CN0 A;  1ZL8 B;  3CEI A;  1YTF B;  4Q20 A;  4QPK A;  1S0V A;  5BY1 A;  3OTO B;  3E22 B;  4DR7 O;  4D7T A;  2XAS A;  2YEV B;  4DR2 B;  1K9M W;  3N2K B;  1JOY A;  3CMA V;  2LO1 A;  2BSK A;  3BAA A;  4I0X A;  4CBC A;  4IT5 A;  4PDV A;  4YJ3 A;  1SES A;  2W6I G;  3Q4H B;  2RMK B;  4DV5 O;  3R65 A;  3ABM B;  2OT5 A;  1H38 A;  4TUY A;  1S72 V;  5FNV B;  2P22 C;  3RN4 A;  4JAU A;  3W7W A;  1N4C A;  1ZSP A;  1FXK C;  2AGA A;  3CXC U;  4MW3 A;  3MHS C;  4AQY O;  2YS8 A;  2IU3 A;  4FLZ A;  2HKO A;  1HNW B;  2L6L A;  4I9Q A;  2QWO B;  2ZIO A;  3G80 A;  3LUT B;  1Q6H A;  2QJ1 A;  3CRR A;  3CPW U;  4DV7 O;  3T1H B;  2LW1 A;  4OGQ B;  3KCY A;  4X88 A;  1VF7 A;  2PGG A;  1VQ7 V;  4F6R B;  1VF5 B;  3E2E A;  2D3O W;  4I55 A;  4JTC B;  4KL1 A;  3UT5 B;  2UUB O;  2VQF B;  2UUC B;  1AI7 A;  4FLU A;  3ZBH A;  2GBO A;  2ZNI A;  2IJK A;  4DV3 O;  4PA7 A;  3B40 A;  5EBW C;  1H8H G;  1I0H A;  3T4Z A;  4NB5 A;  2JS3 A;  2HHH O;  3ABM C;  2OCC C;  2GV9 A;  1IBK B;  4ASU G;  1H8E G;  1JMK C;  2A9H A;  2EIK C;  2Y0P A;  1G4Y B;  4FM0 A;  4TWK A;  4OPH A;  5EZY B;  2KSD A;  3ZMZ A;  2HEP A;  3WG7 B;  3G6E V;  3AEI A;  4KP4 A;  4JI4 B;  2N05 A;  4DR3 B;  4GT1 A;  3FKS G;  2QM8 A;  3JD4 A;  4DR6 O;  4UCV A;  5LOV A;  1WA8 B;  2Y0I A;  3SYC A;  4P30 A;  2JGU A;  4JZ2 A;  2LW7 A;  1AR5 A;  3LDE A;  4UVA A;  1Y74 B;  3DXR A;  4LF5 B;  3X2Q B;  5KA5 A;  5LMU O;  3FX7 A;  3B8M A;  4B3T O;  4JF3 A;  4CS3 A;  3A8T A;  3NR7 A;  3T2M A;  4GKJ B;  1QCE A;  4YHH B;  1CEZ A;  1XL4 A;  4HZ3 A;  2P7T C;  3HKC A;  4DV0 B;  3ZRV A;  4K3A A;  1Y66 A;  1YHQ V;  3SJA C;  5JJE B;  4EB6 A;  1B04 A;  1KU9 A;  1H2G A;  1NKD A;  2DYS B;  2Y48 A;  1MAB G;  3K5L A;  4DYL A;  3SPI A;  1WNS A;  3WG7 C;  4FIP C;  1URF A;  4JI8 O;  5LP6 B;  4MVM A;  5B5E Z;  1R73 A;  1F4N A;  2NNU A;  3G67 A;  2UUA B;  3UQ8 A;  4LFB O;  3CCM V;  3O9O A;  4FM2 A;  1G8M A;  1LNQ A;  2YI8 A;  3K5N A;  4DUZ O;  1AB3 A;  2N04 A;  1OCZ B;  4G2K A;  4LF8 O;  3JAS A;  1VIB A;  2XOK G;  2E74 B;  5K1X A;  3X2Q C;  2C2A A;  1TVK B;  2V4D A;  4B3M O;  4DW0 A;  3JYC A;  3IFX A;  3ETG A;  2ADP A;  4HNA A;  4DV6 O;  2R9I A;  1GN6 A;  1KKC A;  4X65 O;  1I08 A;  3SPG A;  3CCR V;  3L9D A;  4FFB B;  4JTA B;  2OCH A;  2F23 A;  1WPX A;  2DYS C;  1TUB B;  1MSW D;  3T1C A;  1HNZ O;  4TT3 G;  1HDJ A;  1QNM A;  2V1D A;  1FXK A;  5EYP B;  3K58 A;  5HFL A;  3RBZ A;  4PA6 A;  3K04 A;  1BZK A;  2OTL V;  5EIB D;  4WBN A;  4I50 A;  1YCI A;  5LP6 C;  4YJ2 A;  3W7X A;  2ZE6 A;  1X59 A;  2Q7H A;  1GK9 A;  3CC7 V;  4UUJ C;  2OTJ V;  1HW7 A;  1THZ A;  3LSQ A;  1ZTE A;  3MHH C;  3ABK B;  1OCZ C;  3E22 A;  1GN4 A;  1ROP A;  2YEV A;  3APQ A;  3E86 A;  3ZRW B;  4GYC B;  3CC2 V;  3N2K A;  4JI2 B;  2GHY A;  2M6Y A;  2DW4 A;  1QBZ A;  5HFM A;  5J2U A;  2QKS A;  1S5L Z;  1P7B A;  2F4V O;  5JCO C;  3D36 A;  1WJZ A;  5FNV A;  3DSQ A;  3CB2 A;  3EXA A;  1TAE A;  2BTQ B;  4FLV A;  4JI3 O;  5CA0 B;  3B4S A;  4ZI7 B;  5KHG A;  3UO3 A;  2KB1 A;  5JQG B;  1KEC A;  5B1A C;  3CRA A;  4JAS A;  5JH7 B;  2AHY A;  2W0X A;  5FL7 G;  1MA1 A;  3L73 H;  3OMA B;  4PA9 A;  4I7Z B;  2KG7 B;  2HG5 C;  3ZCC A;  4F6R A;  5KX5 B;  4UVC A;  1D5A A;  2ZT9 B;  4K35 A;  1XDC A;  4BIU A;  3ABK C;  2H8P C;  4KHP B;  4LFC O;  2ZR2 A;  4XDJ A;  3FB8 C;  2EIN B;  4PD4 F;  1LR1 A;  3ZRX A;  2QA4 V;  3LNM B;  1P4R A;  1Q81 W;  3ABT A;  2ZDI A;  4IGG A;  4AIL C;  2FYU H;  1SQX H;  2JJ1 G;  4IYH A;  4O4H B;  1BL8 A;  2VWJ A;  2LGW A;  1SS3 A;  3EHB B;  1R3K C;  5KAI Z;  5FLX N;  2Z5U A;  4HYO A;  4LFA B;  1L1F A;  3N2G B;  5L3C A;  1NTM H;  5EZY A;  3VBB A;  5JJJ B;  1HNX O;  5GON B;  2DWD C;  1TUE B;  2YIC A;  4X8A A;  2OIE A;  3QO7 A;  3CC4 V;  1V55 B;  4P9P A;  1H2N A;  1KB9 F;  4QGP A;  4H37 A;  5IWA B;  4GX5 A;  5IYD O;  1R3J C;  1CP9 A;  2DWE C;  3W7U A;  1WA8 A;  1KD1 W;  2R9R B;  3RYI A;  1IXB A;  1YIT V;  3VOU A;  4LF4 B;  1W0K G;  3CCE V;  3FYI B;  5IJ9 B;  1Y74 A;  2VQE O;  1FAF A;  3CCV V;  1DGS A;  1JPX A;  5DED A;  3CJH B;  5EBL C;  5DM6 V;  5CA1 B;  1K34 A;  2ADQ B;  2XND G;  1N36 O;  2FML A;  2HP8 A;  4CH5 A;  2E3C A;  3P32 A;  4GZR B;  2CGN A;  4LF6 B;  4GCZ A;  2Q8V A;  4OX9 O;  1XNQ O;  3OD4 A;  1M93 A;  2JS5 A;  4E2L A;  1XMO B;  2PI4 A;  4UXN A;  4B3R B;  4FLY A;  2QM7 A;  1GN3 A;  1V55 C;  4UB8 Z;  5LP6 A;  5KHJ A;  4JI0 B;  4GKK B;  3AG2 C;  4QE9 A;  1NQT A;  2YSU B;  3H1L H;  3K9A A;  3LDD A;  1IXM A;  5CBG A;  2YXL A;  3S3W A;  3BCC H;  4DR5 O;  4OPA A;  1Q6U A;  4TQF A;  2Q67 A;  1XOU A;  1M9N A;  4W4L A;  2ILM A;  4FZ0 A;  3ZHQ A;  2BOC C;  1NTK H;  4ZOL B;  1TVK A;  3BAB A;  1J95 A;  1JJO A;  2CH7 B;  4LWS B;  2ZE8 A;  4H33 A;  3KKY A;  5H5N A;  1KQS U;  1I94 O;  2HR3 A;  3DTU B;  5JCO A;  5TIS Z;  1TUB A;  5IDJ A;  3SYA A;  3H1I H;  4IHJ B;  4PI0 A;  2BTO A;  4F4L A;  5EYP A;  3FD9 A;  1WB8 A;  4JTD B;  1QR8 A;  2UU9 B;  2WLK A;  2WLL B;  5E79 Z;  4DR4 O;  1OZ0 A;  3WFV A;  3P30 A;  1K73 W;  3W7S A;  4JI5 O;  2QWP B;  4TV9 B;  2W0F C;  1CXZ B;  4AHC A;  4JV5 O;  4EKW A;  2IW5 A;  5JVD B;  1P7G A;  1B3Q A;  2EX3 A;  3QG5 A;  4X9Q A;  5B1N A;  2UXC O;  1QHT A;  5BXZ A;  1J5E B;  4LBE C;  5H6Q A;  1VAR A;  1JVM A;  1RFY A;  1KP3 A;  3ZRW A;  2L35 A;  2OIG A;  3OR6 C;  4U7N A;  1OHH G;  3CME V;  4IYI A;  4CC5 A;  2XAQ A;  2ZKO A;  1K4D C;  4LF7 B;  3BPZ A;  4JAA A;  4B3S B;  4X66 B;  2Q0A A;  2WLH A;  2PYJ A;  4X64 B;  2BTQ A;  1AIL A;  4PHZ A;  2HLD G;  1IBL B;  2UXD B;  1AI6 A;  1PPJ H;  3D3I A;  5BR8 B;  4X62 O;  5CA0 A;  1CPY A;  4H13 B;  4NR1 A;  1IBM O;  2E5L O;  2HVJ C;  3G71 V;  4ZI7 A;  3H01 A;  3RVY A;  3CYO A;  1XHZ A;  3M7M X;  3GVM A;  4YIP A;  3CD6 V;  5JQG A;  4J9Z B;  2XAH A;  5JH7 A;  5LXT B;  3SR2 C;  5L3E A;  2CUG A;  2P90 A;  1SQV H;  3MD0 A;  3DC6 A;  5KX5 A;  1YJW V;  4DR7 B;  4WFA V;  1SQB H;  3ZHT A;  4HBN A;  2NLJ C;  2LFR A;  3AG1 B;  2AHZ A;  3F5W C;  3OMN B;  2DQ3 A;  1MMM A;  4LF9 O;  2EJR A;  3BA8 A;  3JD2 A;  1FJG O;  1EZV H;  3H1H H;  3JAR B;  2EIM B;  3K0G A;  1SET A;  2ARH A;  3K0D A;  4DV2 O;  1AJQ A;  2RNB A;  3E8F A;  4QNH B;  5IYZ B;  5LA6 B;  1ZX3 A;  2Q0O C;  2PYL A;  3N2G A;  2VQF O;  4P2Z A;  1YJN V;  4AQY B;  3E89 A;  4FLW A;  5DEC A;  5GON A;  1IUR A;  3OW2 U;  2IU0 A;  5L3B A;  1N34 O;  4O2A B;  4MW8 A;  1R6T A;  4CH4 A;  4DV7 B;  2ZD9 A;  1K92 A;  4WCE V;  2G38 A;  4E4E A;  4RWU A;  4NXM O;  2P4K A;  5DN6 G;  1QU7 A;  3M8A A;  5FPO A;  1FPO A;  1AVM A;  5H6R A;  2WA4 A;  3OEE G;  2LP7 A;  5LHH A;  5BMV B;  4X1K B;  3D36 C;  2UUB B;  1F7Y A;  4LH7 A;  2Q6A A;  4ZHQ B;  1O9G A;  3TCU A;  1SZT A;  3E8G A;  5IJ9 A;  2VWK A;  3AG1 C;  4LNU B;  4RO2 A;  4DR3 O;  1YSC A;  2GTA A;  2X7R B;  3U11 A;  2YXH A;  3VQV A;  4DV3 B;  4JI1 O;  1PP9 H;  3ZJZ A;  2AXT Z;  1S3J A;  3CJH A;  4NXN O;  3N27 A;  5CA1 A;  1V9P A;  2YID A;  2EIM C;  5CB4 B;  2VS0 A;  3K5M A;  2WPD G;  1OV9 A;  2GUZ B;  4N21 A;  2OWO A;  3D8C A;  4JI6 O;  1OCO B;  3P3N A;  1NVP B;  1VQL V;  4DR1 O;  1DK1 A;  1XUQ A;  3IC7 A;  3CCU V;  4ICG A;  2AZ2 A;  4GLX A;  5CBF A;  2YUA A;  3TET A;  3CP1 A;  3ZS8 C;  2A0L A;  3CHX A;  4K8X A;  4QPJ A;  5B3S B;  4DV0 O;  4DR6 B;  1YTF D;  4BIO A;  5LYJ B;  3A2F A;  3GB7 C;  2KKW A;  4J11 A;  4JI7 O;  2ZDI C;  2JVD A;  1JR9 A;  3SYQ A;  4Z1M G;  4K0K O;  5C8Y B;  4WF9 V;  2R72 A;  1US6 A;  1HR0 O;  3VQY A;  2P67 A;  1GN2 A;  3QO5 A;  2ODM A;  4X20 A;  5LMU B;  5LMN O;  5B1O A;  1WB7 A;  1Z2G A;  4B3T B;  1V54 B;  1G6U A;  3I56 V;  2QKC A;  4ZOL A;  4YY3 O;  1NTZ H;  2CH7 A;  4LWS A;  3J80 N;  1AR4 A;  4DK0 A;  2X6B A;  1DF5 A;  3C90 A;  1BE3 H;  3K03 A;  1OCO C;  1Y67 A;  5KAF Z;  3ZHR A;  1EN6 A;  2W6J G;  2MK3 A;  2EJ7 A;  4R8C A;  3ZX6 A;  1K5S A;  2JEX A;  4IHJ A;  3OGI B;  4JI8 B;  1XBL A;  3MAQ A;  4C7U A;  5GTI Z;  3SPJ A;  1Q82 W;  5B3S C;  4CS4 A;  2WLL A;  1WAZ A;  4JGS A;  1VEW A;  4LFB B;  3OMI B;  4TV9 A;  1SER A;  4JPR A;  4QIW F;  3C3S A;  4BWA A;  1KMI Z;  5B66 Z;  4DUZ B;  5JVD A;  4LF8 B;  4DV1 O;  1FFX B;  3SJB C;  4UCS A;  1N32 O;  4KUM A;  2WLN A;  4B3M B;  4BW5 A;  1V54 C;  3F7Y C;  1N0J A;  3MDS A;  4MTX A;  4DV6 B;  2ZM6 O;  3HKE B;  3TK1 A;  1T5E A;  1QR9 A;  3SGI A;  3L74 H;  3CCS V;  3ETD A;  4DW1 A;  2UXB O;  1ZL8 A;  3ZHS A;  1HNZ B;  3JD1 A;  3UO2 A;  4J41 A;  3STL C;  3AG7 A;  3WU2 Z;  1BS3 A;  1FKA O;  1QLN A;  3CXH F;  4MVO A;  4O4J B;  3JAL B;  1KC8 W;  1R6K A;  5IT9 N;  2B5U A;  3T1Y O;  3BA9 A;  1I5X A;  3Q4H A;  5LXT A;  5CBH A;  4DXW A;  3L72 H;  2LQT A;  1K33 A;  4ABM A;  1XNR O;  4TOI A;  2LFS A;  2B1G A;  1BMF G;  1FD9 A;  4NVP A;  2F66 C;  4BIZ A;  1YJ9 V;  3I5D A;  1EM1 A;  4DUY O;  4PA4 A;  4X89 A;  5BZB A;  2R70 A;  1NZ6 A;  1ORQ C;  4TQD A;  5ITZ B;  3K5O A;  2XAF A;  3ETQ A;  3JAR A;  1JQ0 A;  1N33 O;  4BR6 A;  2PF4 E;  2F4V B;  2JGD B;  1YZB A;  2UXX A;  4NTW A;  1AI5 A;  3IJ4 A;  3B8N A;  5IYZ A;  3BHP A;  1Q6I A;  4XBF A;  1AR1 B;  2ZE5 A;  2AZ0 A;  2CE4 A;  4PDR A;  4JI3 B;  3UT5 A;  3CCQ V;  4DRX B;  1X4T A;  1MZE A;  5KHH A;  1IVS A;  4X1I B;  3HKD B;  4O2A A;  1AJN A;  4PV1 B;  2IH1 C;  1E79 G;  2B9Z A;  3DC5 A;  3HB3 B;  3SDL A;  3K06 A;  1LUV A;  2YXY A;  4ZKI A;  1WP7 A;  3E35 A;  4UCO A;  5BMV A;  4X1K A;  4LFC B;  2NN4 A;  4CS2 A;  1SZX A;  4ZHQ A;  3A0B Z;  3BRC A;  4PDL A;  3ETE A;  2XUM A;  3L70 H;  3ZHU A;  1HP8 A;  2Q9L A;  1QQC A;  1PM9 A;  3RGB A;  5D5P A;  3QF7 A;  2JIZ G;  3EFF K;  2ITD C;  1ZUQ A;  2WSS G;  1L0L H;  3FB6 C;  1SQP H;  5CB4 A;  2GUZ A;  4TSF G;  2ZXW B;  4FZ1 A;  2QTS A;  4LF4 O;  4CH3 A;  3A0H Z;  4GX0 A;  1HNX B;  1XQ8 A;  4J7K A;  1IZ3 A;  3ABL B;  4A5U B;  1ZWI C;  4NKG B;  2EIN C;  2B1I A;  2GDS A;  5CA3 A;  3K3W A;  5LYJ A;  4J42 A;  1FS0 G;  1W59 A;  5LGT A;  4K8Z A;  1U97 A;  1YEW A;  1OJH A;  5C8Y A;  4PDM A;  2CK3 G;  1K3E A;  4UV9 A;  3WB0 A;  5JWP A;  1SA0 B;  3CS5 A;  3ICX A;  1M5I A;  2CDY A;  2RQ6 A;  4HAM A;  1RSO B;  3QNE A;  4BW9 A;  1Y4M A;  4WFG A;  4O4L B;  2VQE B;  1K8A W;  3RFR A;  1OCC B;  3QO8 A;  5E1A C;  1AP6 A;  3K9S A;  1R6N A;  3W7T A;  3H1K H;  4CH6 A;  2JRI A;  1OCR B;  1G1X B;  1Q8I A;  2XHB A;  1N36 B;  3J7A U;  4DV4 O;  1UJW B;  2HJD A;  3G6B A;  5KHK A;  1SQF A;  2ZCE A;  3APO A;  1L8D A;  1GTO A;  1KP2 A;  3AG4 B;  1JCH A;  3AK3 A;  3K59 A;  3DXR B;  2RN9 A;  3M99 B;  4OX9 B;  1XNQ B;  1PNM A;  2HJF C;  1UFI A;  3CRQ A;  2K1E A;  3CSX A;  4UFZ A;  5J2T B;  4N23 A;  3ABL C;  1GRJ A;  1P49 A;  4ZBM A;  4FMT A;  4MT8 A;  1D5N A;  4R6Z A;  1M56 B;  3VQX A;  3F7V C;  2P4V A;  2YI9 A;  2H3O A;  3S3X A;  4J10 A;  1VQ5 V;  3CRM A;  4FFB A;  3K79 A;  1WPB A;  2JK5 C;  4Q6G A;  4DR5 B;  1ARO P;  1PL0 A;  4JYA O;  3ZIA G;  1IDS A;  1FFX A;  1LUW A;  3TJT A;  2FKX A;  1OCC C;  2IM9 A;  1ZLZ A;  4P9O A;  4LC1 A;  4NTX A;  1B06 A;  1QVF U;  3ABU A;  3HKE A;  2X0L A;  1I94 B;  1OCR C;  4PJ0 Z;  4I9W A;  3OE7 G;  1MSD A;  1PNK A;  4MTF A;  1XMQ O;  1FFT B;  2X6A A;  1NR1 A;  5KA6 A;  3JAS B;  2WAM A;  5F2V O;  1Y76 B;  4GX2 A;  3CRC A;  2Z0A A;  3PN1 A;  1M90 W;  2ATK C;  4MTG A;  2QWR B;  3B77 A;  1PD3 A;  4CC6 A;  3ZMT A;  4G28 B;  3LSS A;  4O4J A;  4DR4 B;  5GTH Z;  3JAL A;  4LP8 A;  4JI5 B;  1M56 C;  2QE7 G;  1BHA A;  1NH2 D;  4JV5 B;  1H2M A;  3QTC A;  5LHI A;  3TXS A;  2UXC B;  3B09 A;  1I5Y A;  3JSN A;  4J80 A;  3OTO O;  3HR0 A;  1MOF A;  1FXV A;  1XL6 A;  3B2E E;  4DO2 A;  1GAX A;  4DR2 O;  4W4K A;  4FK5 C;  3ASN B;  3VQW A;  1NS1 A;  3QVN A;  4B7K A;  1JX9 A;  5LL6 Y;  1F51 A;  3ZHV A;  1DTO A;  1RPO A;  1M57 B;  5KLV H;  2JGD A;  5IE9 A;  3FB5 C;  1Z5W A;  1S76 D;  2QR4 A;  2KG7 A;  3ZN1 A;  4FVM A;  4NYK A;  3LNN A;  3K57 A;  3E8B A;  4X62 B;  3CX5 F;  4JZG A;  1IBM B;  3FYE B;  2E5L B;  1YIJ V;  4O2B B;  2EZP A;  4DRX A;  1TGO A;  2D2C B;  5KMG B;  2YIB A;  4X1I A;  1GM8 A;  1HNW O;  3RW0 A;  2ZR3 A;  3HKD A;  5J2U B;  2OCC B;  4IIJ B;  4DV5 B;  2RCV A;  3EVK A;  3HKB B;  5CMU A;  4JYB A;  4YIO A;  3T1H O;  1Q5O A;  1ZAU A;  3CE2 A;  3UM7 A;  2Q7G A;  4O4H A;  3I55 V;  5H2F Z;  2EIK B;  2ZIM A;  3E83 A;  1VF6 C;  1GKF A;  4L8J A;  2UUC O;  4PEL A;  5LBQ A;  4LF9 B;  5B1B B;  1FJG B;  1GM7 A;  3ASN C;  2QWN B;  3FB7 C;  3LSU A;  3FAV B;  4DV2 B;  2V7Q G;  1VQ9 V;  5LGU A;  2QSA A;  2XT9 A;  1NBM G;  1O9H A;  1M57 C;  1PL4 A;  2F43 G;  4UCT A;  1IBK O;  3RYH B;  3SYO A;  1M1K W;  1YVW A;  2FTK A;  3STZ C;  1EN4 A;  1VQ8 V;  3NXS A;  3OT7 A;  1N34 B;  4JI4 O;  3KG2 A;  3IAY A;  3CCJ V;  2Q5Z A;  2UXN A;  3BY6 A;  2JDI G;  3THO A;  3BEH A;  4JAV A;  2A79 B;  1NU1 H;  4PI2 A;  4NXM B;  4LCU C;  2HHH B;  3UCS C;  2HVK C;  2E75 B;  2IJH A;  1SA0 A;  1AI4 A;  2Q68 A;  3P3P A;  4KFM A;  1RSO A;  5A2Q N;  1KBH A;  1SKV A;  4I4T B;  3L75 H;  4O4L A;  4LF5 O;  1KUQ A;  2WLJ A;  4FLT A;  4XDL A;  3GWO A;  1S5J A;  4JI1 B;  3ZRS A;  5B1B C;  4GKJ O;  4NXN B;  3ZN0 A;  4YHH O;  3JAK B;  2A3Q A;  4X1Y B;  3JCU Z;  1P84 F;  3OUF A;  1AP5 A;  1Q3E A;  3ML0 A;  4D6T H;  4R7C A;  1XI1 A;  4WFH A;  4JI6 B;  2PI5 A;  2PY5 A;  4WFE A;  3RYI B;  1VQK V;  1SF9 A;  4RUE A;  4MVR A;  3RVZ A;  5IYB O;  4DR1 B;  2QKA A;  3JAW B;  1BSM A;  4RQF A;  1EFR G;  3IC9 A;  1H2S B;  1BT8 A;  2ZE7 A;  4QJF B;  1COW G;  5J2T A;  1B6Q A;  2CAZ C;  2EIL B;  1H2L A;  5LHG A;  2F95 B;  5IYC O;  3SJC C;  1VQM V;  4JI7 B;  2CGO A;  3C3T A;  4U7O A;  3JCZ A;  1BQZ A;  1MZF A;  1SC5 B;  4K0K B;  1HR0 B;  2UUA O;  3SJQ C;  3BFR A;  5EIB C;  5EC2 C;  4EFB A;  4CZZ A;  2NR5 A;  2JJ2 G;  1EBO A;  3IGA C;  5LMN B;  2DJV A;  5JJN B;  4U3J B;  1N0N A;  3ASO B;  1S5H C;  2QM4 A;  4YY3 B;  5L3F A;  5J9P C;  4D7S A;  2YDE A;  4G27 B;  4J9Y B;  1R3I C;  4BAY A;  2X6C A;  3OAA G;  2M7W A;  2Y69 B;  1I7F A;  4U3F H;  1XHX A;  1E1R G;  4Z2W A;  2CTR A;  4JYY A;  3JAT B;  4JYC A;  2DN9 A;  1BHB A;  2LGQ A;  1VQN V;  1MG1 A;  1Y76 A;  2O57 A;  1W0J G;  4B7E A;  1BQ0 A;  1H2K A;  2N74 A;  1JA8 A;  2QEX V;  2IJI A;  3RYC B;  1FXH A;  2EIL C;  2P5O A;  3UKM A;  2EBO A;  2YIA A;  2ZIN A;  2WLI B;  2P6J A;  4XDK A;  4X65 B;  3BVO A;  1E1Q G;  2A7W A;  2CTW A;  2VRZ A;  1U96 A;  2WLM A;  4DV1 B;  2PUS A;  3TGU H;  1A32 A;  4H44 B;  1N32 B;  1JFF B;  1VF6 A;  1K4C C;  1XIL A;  3OUS A;  5EC1 C;  3ZED A;  1RM1 B;  3RYF B;  3ASO C;  4LR3 A;  2PZS A;  4B08 A;  5B1A B;  2ZM6 B;  4JI2 O;  5EBM C;  1K7D A;  4AI8 A;  3OR7 C;  5IJ0 B;  3ZMS A;  3U0Z A;  4O4I B;  1NVP D;  2Y69 C;  2UXB B;  3L71 H;  2F93 B;  2Q73 A;  1GH6 A;  1R3L C;  3R66 A;  4WFF A;  5K1P A;  1RPR A;  2XAJ A;  4TV8 B;  1GO3 F;  2QTO A;  3D3Q A;  4MVU A;  3OM3 B;  4O2B A;  4Z1V A;  1YXB A;  5KMG A;  2LJ2 A;  2AW9 A;  3T1Y B;  1UPG A;  1DLB A; 
#chains in the Genus database with same CATH homology
 3J7A U;  1N32 O;  4DV4 O;  1HNX O;  1J5E O;  4DR1 O;  1DK1 A;  3OTO O;  4LF6 O;  4JI4 O;  4DV7 O;  5H5N A;  1I94 O;  3SDL A;  2ZM6 O;  4DR2 O;  3RT3 C;  3JAM N;  1XMO O;  1R1B A;  4DV0 O;  4KHP O;  4B3R O;  1NS1 A;  2UXB O;  4LF7 O;  2UUB O;  4JI8 O;  4JI7 O;  4LF9 O;  5LL6 Y;  3F5T A;  4JI0 O;  4GKK O;  1FJG O;  4K0K O;  1HR0 O;  4B3S O;  2N74 A;  4X66 O;  2F4V O;  5A2Q N;  1FKA O;  4DV2 O;  4LFB O;  4LF5 O;  4X64 O;  2VQE O;  4DV3 O;  4DR4 O;  1KUQ A;  1IBL O;  2UXD O;  5BR8 O;  4JI5 O;  5LMN O;  2HHH O;  4GKJ O;  4YHH O;  5IT9 N;  1XEQ A;  4JI3 O;  4DUZ O;  1AB3 A;  4JYA O;  4LFA O;  4JV5 O;  3T1Y O;  4LF8 O;  2VQF O;  4YY3 O;  1N36 O;  2FKX A;  1HNW O;  1A32 A;  4B3M O;  4LF4 O;  2UXC O;  4OPH A;  3J80 N;  5BXZ A;  1N34 O;  3T1H O;  5BY1 A;  4DV6 O;  1XNR O;  2DOS A;  3J81 N;  1R6T A;  4X65 O;  4OX9 O;  4DR7 O;  1XNQ O;  4A5U B;  4JI2 O;  5IWA O;  4DUY O;  4NXM O;  4DR6 O;  1XMQ O;  3M8A A;  2ZKO A;  4LFC O;  1HNZ O;  2UUC O;  1FYJ A;  3O65 A;  1F7Y A;  2Z0A A;  4DV5 O;  1D2D A;  3R66 A;  2UUA O;  2UU9 O;  1N33 O;  2LW7 A;  1YZB A;  4DR3 O;  4JI1 O;  1AIL A;  5LMU O;  4NXN O;  4B3T O;  4X62 O;  4OPA A;  4DR5 O;  1IBM O;  2E5L O;  1X59 A;  5FLX N;  1IBK O;  2DJV A;  2AGA A;  4AQY O;  4JI6 O;  2JRI A;  4DV1 O;  1G1X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...