3SDLA

Crystal structure of human isg15 in complex with ns1 n-terminal region from influenza b virus, northeast structural genomics consortium target ids hx6481, hr2873, and or2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
95
structure length
95
Chain Sequence
b'TTQIEVGPGATNATINFEAGILECYERFSWQRALDYPGQDRLHRLKRKLESRIKTHNKSEPENKRMSLEERKAIGVKMMKVLLFMDPSAGIEGFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 1
publication title Structural basis for the sequence-specific recognition of human ISG15 by the NS1 protein of influenza B virus.
pubmed doi rcsb
source organism Influenza b virus
molecule tags Viral protein/antiviral protein
total genus 35
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3sdlA00
4YHHO 2UUCO 2DJVA 4X62O 3M8AA 4LF7O 4X66O 1D2DA 5BY1A 4DR7O 3OTOO 1HNXO 3J80N 2UUBO 2FKXA 1NS1A 5BR8O 4DR5O 4DV3O 4K0KO 1XEQA 1N34O 4JI2O 4JI4O 4A5UB 1DK1A 1IBLO 2LW7A 5FLXN 2VQFO 4DV0O 1I94O 4DUZO 2VQEO 2N74A 1FKAO 4DV6O 4DR6O 3JAMN 3SDLA 2ZKOA 1XMOO 4KHPO 4JI3O 2AGAA 2ZM6O 1N33O 3O65A 4LF5O 1KUQA 4GKJO 5BXZA 1AILA 4DR3O 5IWAO 3T1YO 4DUYO 1HR0O 4B3SO 4JI0O 4LF9O 4JYAO 1IBKO 1N32O 4LFAO 1XNQO 1FJGO 4DR1O 1HNZO 4GKKO 4NXNO 4X65O 4B3MO 2HHHO 4NXMO 4DR4O 2UXBO 1XNRO 3R66A 4JI6O 2UXDO 5IT9N 4DV2O 4JI5O 4B3RO 3J7AU 1HNWO 1X59A 2UUAO 4JI7O 1FYJA 1A32A 3F5TA 5LMNO 4DV4O 4DR2O 4X64O 4LF6O 4OX9O 4DV7O 4LFCO 4LFBO 1N36O 2UXCO 4DV1O 4OPAA 4JI1O 1XMQO 1G1XB 4LF4O 4DV5O 2E5LO 2JRIA 4JV5O 4OPHA 3RT3C 5LMUO 1R1BA 4LF8O 2DOSA 4YY3O 1AB3A 4B3TO 5LL6Y 2UU9O 1R6TA 1IBMO 1YZBA 4AQYO 1F7YA 3T1HO 2Z0AA 5H5NA 1J5EO 5A2QN 2F4VO 3J81N 4JI8O
chains in the Genus database with same CATH superfamily
1DLBA 2WPDG 3RN4A 3AG2C 2YXYA 1AI6A 3SJCC 2YSUB 3ZHVA 3CRQA 4RQEA 4GT1A 3S3WA 3W7WA 3OAAG 4JYAB 1EN6A 4D6TH 1EN5A 4WF9V 1I5XA 5HFMA 3CCJV 1AVMA 3TXQA 2Y4UA 5IYCO 5L3GA 3X2QC 2UXDB 1FKAO 3JAMN 3E35A 3SDLA 1HNWB 1SERA 3WB1A 3E22A 4DR2B 4F6RB 4J11A 2DYSC 1KYOF 1N33O 4WCEV 4LF5O 3VQVA 2Q7EA 1AP5A 1JFFB 2CTQA 4GYCB 4B3SO 2EZOA 3OR7C 5KUMA 4JYYA 1QVGU 1IXMA 1B04A 5CB4A 4LF8B 1VQ7V 3K79A 3LDCA 4NXMO 3N2KA 3OUFA 3A8TA 4AHCA 1OCCC 3JD1A 2BE3A 1YJWV 3J7AU 1BGYH 5TISZ 2PY5A 2B1IA 4FLTA 4X62B 1JR9A 4JI3B 1JCHA 3AK3A 3KCXA 2N05A 3OT7A 2LFRA 2V4DA 4I0XB 3VQXA 3F5WC 1VQNV 5JWPA 3W7TA 2IH1C 3ICXA 3AG3B 4I9QA 5C8YB 3G80A 3E8GA 3N2GB 1Q43A 3P3PA 2QKCA 1IBMO 1F7YA 4GX0A 4DK0A 1FXKC 3P32A 2P90A 1ZX3A 1VQPV 2F4VO 4WFFA 4ZKIA 4JI8O 1GO3F 4X66O 2YI9A 3ZRWA 4RUEA 4DW1A 4X64B 4ASUG 3K5LA 1K4CC 1HR0B 2AXTZ 2IJJA 2QM4A 3I56V 2YI8A 4K0KO 3OTFA 5EZYA 2B1GA 4X65B 4PV1B 2LW7A 4GCZA 4CC5A 4YJ2B 3ZX6A 5CBHA 4LR3A 5LP6B 2CK3G 4PI0A 1BQZA 1KUQA 4BIUA 4GKJO 3RGBA 3OD4A 1PNMA 4G2KA 2UUCB 2Q9LA 3STLC 1S5LZ 2ZIMA 3LDEA 1PL4A 3ZBHA 1S76D 1V9PA 1VF5B 5E1AC 2K9PA 3BY6A 1VQ9V 5LGTA 2KQXA 4KFMA 3SYCA 3K06A 2JDIG 2X0LA 1KU9A 2WWWA 2QWNB 2VQFB 4IIJA 1R3JC 1R73A 1PKXA 2EZPA 4KHPB 4KP4A 4DR7B 4UUJC 4JF3A 5DM6V 1BT8A 1TVKA 3TCUA 2VS0A 4I9WA 2E5LO 2GV9A 2JEUA 1ZAUA 2LGWA 3RT3C 3PJSK 2JIZG 3HB3B 1J95A 3OMAB 5D5QA 2Q73A 5KHGA 2BTQB 4FJCC 4YJ3A 4EFEA 5LYJB 1VF6A 5A2QN 3TGUH 4X1YA 5DEDA 4TQFA 1XILA 3ABKB 4TOIA 3A0HZ 3LDDA 4BIZA 1S0VA 2ZCEA 2EJ7A 4NKGB 4ZI7A 4JI0B 1XI1A 4IHJB 1V55C 3K08A 2WLNA 4DR5O 1NTMH 1Z5VA 1HP8A 1R6KA 1IX9A 1S3JA 2XAFA 3CSXA 1Y74B 3S3XA 5B3SB 4ZBMA 2NR5A 1B6QA 4LF6B 1WAZA 3F7VC 1AJNA 3ZIAG 4WFAV 4BW5A 4O4JA 4O2AA 4TUYA 4Z1VA 5KHJA 3MD0A 1K92A 2CTRA 3UT5B 1BHBA 3Q4HA 4UCUA 5H6RA 2HJFC 5H2FZ 5B66Z 2MK3A 4C7UA 2ATKC 1PP9H 3A0RA 5LGUA 5FL7G 2OT5A 5B1BC 2UUAO 2ADQB 1A32A 4YJ3B 2ITDC 3AG7A 3G67A 4LFBO 5KHHA 4RQFA 3FD9A 5FNVA 2P4KA 2Q8VA 4TT3G 1QVFU 3SYAA 4LF4O 2UUBB 3CEIA 2CGNA 4PI2A 1VQ6V 3K59A 1YF2A 1Y76A 4DV3B 2YICA 3ASNB 3BPZA 1SF9A 4I55B 4JI2B 3KG2A 3E86A 3ZHUA 3JASB 4J10A 4LFAB 2F95B 3QO8A 4NXNB 3HKDB 4WFGA 2Q5ZA 4E2LA 1MNGA 3BAAA 4CS3A 2EIJC 4NTYA 4FZ0A 4OXSA 3RVYA 1D2DA 4Z1MG 4FFKA 2JJ2G 4DV7B 1B3QA 1FFXA 2UXCB 1HNXO 2HJDA 4P2ZA 3DC5A 4R6ZA 4DK1A 5KAIZ 4QIWF 4TUYB 2NNUA 4G27B 2PYJA 1XMQB 2ITCC 5IYZA 2DYRC 2NN4A 3JATB 2M6YA 3Q4HB 3SPHA 4DV0O 1I94O 2QTOA 3HKCB 2RDCA 4YY3B 1RPOA 4I5SA 1H38A 2Q4PA 2R72A 3W7SA 4MW8A 1P7BA 2ZXWC 3JARB 2JS3A 4YIPA 2PUSA 2QKSA 5CA1B 5IWAO 5JVDB 1GN3A 1UPGA 5FNVB 4DV5B 3T1CA 3ABMC 1TUBB 2P4VA 1JJOA 3TXSA 2L6LA 4DR4O 1Y76B 1ZUQA 4BR6A 4B3RO 5KAFZ 3F5TA 1G4YB 1H8HG 3UKMA 3UO3A 2AHYA 4I50B 2XT9A 2PYLA 1W0JG 1HWYA 4UVCA 2FL4A 2E75B 2HVKC 5EK0A 4XDKA 3IC7A 2WLLA 4B7KA 4O4HA 1P4RA 3JSNA 3VBBA 4DV6B 3JAWA 4GUNA 5KMGA 1HNZB 2EJRA 1GN4A 4IYIA 3ZCCA 3JALB 4YHHO 2QM8A 5L3FA 3H9VA 2NLJC 3ZMTA 2GTSA 4R7CA 5CN0A 3RYIB 5BY1A 3MHSC 2IH3C 3ZMUA 3ZMZA 2QSAA 2QA4V 4PA6A 3EFFK 2BSKA 2Y69C 2OCCB 1N34O 4EEQA 4A5UB 2C2AA 1K34A 1KBHA 4EB6A 1H2SB 3DXRB 2UU9B 2V1DA 3HR0A 5B1AB 2WA4A 2ZM6O 1WPBA 1QLEB 4J7KA 2E3CA 1P49A 3O65A 3D8CA 1BMFG 2YIBD 1AILA 4P30A 3W7XA 1MG1A 1QNMA 1CP9A 4PA3A 4CS4A 3LUTB 1KD1W 2XHBA 3BEHA 2EBOA 1BCCH 3K9SA 2HHHO 1DF4A 2LW1A 1VF6C 4JI4B 4TWKA 3ASOB 4U7OA 2VQEB 3JAWB 1JOYA 3ABLC 3FYIB 2CAZC 4D7TA 1X4TA 3ZJZA 3A0BZ 4OPAA 1D5AA 1Q86W 1F4MA 1GH6A 3QTCA 2YEVA 4JAVA 1YCIA 2CTPA 1DGSA 1JQ0A 4DUYB 5FPRA 1GAXA 3E8BA 4F6RA 2QTSA 2FB5A 3WB2A 3M99B 4Z2WA 3K57A 3JD2A 3UQ8A 4B3MB 3AG1B 5H5NA 4YXWG 1JFFA 1BS3A 3B8MA 4FK5C 3T4ZA 2DJVA 1BHAA 3B4SA 2G38A 2KG7B 1XHXA 1YSCA 3CPWU 4J9ZB 2DMXA 1D5NA 4O2BB 1WB8A 1LUWA 4QE7A 3QG5A 4UCVA 3WB0A 4FLUA 1MZFA 3T4DA 2LGQA 3O9OA 2OWOA 2ZNJA 1N32B 3B8NA 2E76B 2IJKA 3AG4B 2F93B 1WN7A 2IBZH 3D36A 2KKWA 3CYOA 2YDEA 4FIPC 2IU0A 5L3CA 1SZXA 3P30A 4H33A 4JI7B 4I0XA 1OCRC 1GM8A 1OCZB 2JGDB 1J5EB 3VOUA 5JJJB 1AI7A 3H1LH 1DTOA 2JGUA 4KL1A 5IY5B 5C8YA 3LNMB 4JI1B 3N2GA 3THOA 1K97A 1JJ2U 4JYAO 3P3NA 4X8AA 1THZA 2Y48A 4JV5B 2YEVB 5LMUB 1FD9A 2Q6AA 1S5HC 2UXDO 4LBEC 5H6QA 3GVMA 4HAMA 1HNWO 4DR2O 1OHHG 2BOBC 4HNAB 5JJEB 3IGAC 1RM1B 4F6EA 1N33B 4PA7A 4LF5B 4BWAA 4LWSB 4YJ2A 1YEWA 2QKAA 3SPCA 4LF8O 4PDVA 5LP6A 4B3SB 4H13B 1FXVA 1WP8A 1EFRG 1IBLB 2EINC 1YITV 2Z3YA 4GZRB 1M4UA 2XOKG 3E89A 4NXMB 3CHXA 5DN6G 3RYFB 4X62O 3M8AA 1VIBA 1GTOA 1H2KA 4B7EA 1HW7A 3FX7A 2R9IA 4JASA 2EIMC 1IBKB 1TAEA 1JMKC 4L87A 4UV9A 2O57A 1W59A 5J2UB 2H94A 4QPJA 4DR6O 1W2BU 1WA8B 2N04A 3H01A 4H0LB 4LFCB 1P7GA 2MW2B 2F4VB 4JI8B 4MTOA 3APOA 3CC4V 4ZIBA 1VEWA 1HR0O 1Q3EA 2BTQA 3SPJA 1UFIA 5LYJA 1IURA 3K0DA 5K1PA 1OCOB 1NQTA 1Z2GA 4X65O 2A0LA 3R66A 4J80A 1K33A 3NXSA 1FYJA 3JD3A 4IHJA 2CTWA 1QR8A 2ZDIA 4UVAA 1VQLV 3B77A 2ILMA 4MVOA 1GK9A 2ZQMA 3LSQA 1KECA 4HYOA 5HFLA 3CX5F 2AZ0A 3U10A 5L3DA 2Q69A 4GKJB 1NBMG 3F7YC 1NTKH 3CRMA 2XAQA 4JYBA 4O4LA 3GWKC 1Y74A 2GBOA 1R6TA 3FKSG 5KX5B 3LSUA 2XAGA 2Z0AA 4B08A 2CE4A 4WFHA 1L1FA 1M56C 3BA8A 3UT5A 1QU7A 4DRXB 1AJQA 2RMKB 3ETQA 4DR7O 4H37A 1EZJA 3QNEA 2EX3A 3J80N 1M57C 2FKXA 1PM9A 2X6AA 5EC1C 1FJGB 1TUEB 2E5LB 1GM7A 5E79Z 1XNRB 5C93A 2A7WA 3LNNA 4MVZA 4KXRA 3WU2Z 2ZE8A 2ADPA 1SA0B 2M7WA 3BRCA 1Q6IA 5IY5C 5LMNB 4DV4B 4J42A 1Q5OA 1FXHA 4QGPA 1I7FA 4I4TB 4I55A 1B06A 5CMUA 3K3WA 3JASA 4IGGA 3CB2A 4JI0O 4CH4A 1PNLA 2OIEA 3HKDA 2GHYA 1QCEA 2FTKA 3FAVB 3SGIA 5LOVA 3G4SV 2KSDA 4FZ1A 5BMVB 3D3IA 4O4LB 4JI6O 4DR5B 4ZHQB 4NR1A 3CCLV 4JI5O 2P22C 3L70H 5LHHA 1AI4A 4LCUC 4LF6O 1SS3A 1L0LH 2LJ2A 3BVOA 2WAMA 3JYCA 2HFEC 3RYHB 3IAYA 4MTXA 1XOUA 1G8MA 1XL6A 2QM7A 4J7ZA 1M1KW 4L8JA 3JATA 4ZOLB 2WSSG 3GB7C 3HKCA 5J2TB 4JAAA 2YIBA 1OJHA 3D36C 3JARA 2QWRB 4FLVA 3IC9A 2B9ZA 3BA9A 3ZHTA 1ENVA 1YZBA 5CA1A 5JVDA 3JCZA 1V54B 2UUAB 3AG3C 1TUBA 1JPXA 1JVMA 4JTAB 3C90A 4I7ZB 2DW4A 1AR4A 4UCTA 1IVSA 5AG2A 2UUBO 3CMAV 3RYCB 5JH7B 4PDMA 1JA8A 5BR8O 4DV3O 4MSWC 1BQ0A 4I50A 1ZLZA 3ML0A 4JI2O 2QEXV 4QNHB 1GM9A 5LOVB 1CXZB 5EIBD 4CH6A 3ZHQA 1S5JA 4U7NA 2YIAA 3JCUZ 4CH3A 3CRAA 4FLXA 1GRJA 1LNQA 1MSDA 2WLIB 3CCUV 3DTUB 1VQ5V 4TV8A 1YHQV 3H1KH 2EIKB 5BXZA 1MSWD 3K04A 2AZ2A 3NR7A 5L3BA 3ZEDA 1OZ0A 3ABUA 4RWUA 3LSSA 4MVSA 4PJ0Z 4JPRA 1JX9A 5LP6C 3CJHB 3JALA 1XNQO 4DR1O 4PDLA 5KLVH 2UXBO 3RW0A 4QJFB 3B40A 1OV9A 2WLMA 1US6A 4K8XA 1E1QG 1SZTA 3RYIA 1VMGA 2X6CA 1Z5WA 2OCHA 3AEIA 4OX9O 4NB5A 3SPIA 1YI2V 4X1IB 4DV1O 1YIJV 3OTOB 1NH2B 3HKEB 1GN2A 2H3OA 4XDJA 4DV5O 5GTHZ 1M93A 3QO7A 5IWAB 2Z5UA 2R9AA 3DXRA 1R3KC 1WNSA 3AG2B 5KHIA 2ARHA 4JGSA 2GTAA 1H2GA 3CE2A 3ZN0A 1K9MW 1FPOA 3FB8C 4W4LA 4MTGA 3J81N 4X89A 1PPJH 3L9DA 4EKWA 2GUZB 3T2MA 2JVDA 4TV8B 4ABMA 3T1YB 3VQYA 3G71V 1XBLA 3UO2A 1AP6A 5EYPB 3TJTA 3CRRA 2DE0X 1F51A 3ABKC 1SC5B 5CBFA 4DUZO 3C3TA 3FB7C 4DV6O 2W0FC 2DQ3A 1URFA 3DSQA 1XMOO 3WG7B 2ZDIC 1BE3H 1YJ9V 4GX2A 1COWG 1HDJA 4JZ2A 4FLYA 2VWJA 4DR3O 4FVMA 3FFQA 5ITZB 2P5OA 1OCCB 2YUAA 3RBZA 1WLEA 1RSOB 4DXWA 4LF9O 4U3JB 1W0KG 5B3SC 1U97A 4UCOA 1BL8A 3L73H 4GKKO 3OEEG 2KG7A 1F4NA 4AQYB 4K3AA 3OGCC 3G6EV 1N34B 1KKCA 3T1HB 1M5IA 4O2BA 1X59A 4P9PA 5CA0B 1H2LA 2P6JA 1RPRA 4CZZA 3TK1A 2R9RB 4N23A 3I55V 1FXKB 1FFTB 1G1XB 4MVRA 1MOFA 5LHIA 5BZBA 4MVQA 4MTFA 1VQOV 5B1NA 1S77D 1ZL8B 5H9CA 2LQTA 1NH2D 1AB3A 5LA6B 5JQGB 4B3TO 5LL6Y 2JGDA 2HLDG 4BAYA 1V54C 5EBLC 4X1KB 3OGIB 2HHHB 1YTFB 2PZSA 2CGOA 3H1IH 4TV9B 2Y0PA 2F43G 3ASNC 4LF7O 4FFBB 4UCRA 2XNDG 4IYHA 3ZRSA 3PN1A 2W6JG 2QDOA 5J9PC 4FM2A 4PDRA 2XTAA 2YC0A 2A9HA 1NS1A 2QE7G 2V7QG 4HNAA 2ZNIA 1H8EG 3H1HH 1AI5A 1SQXH 3SYPA 3DC6A 3G6BA 4DV2B 4H44B 1N0JA 2ZKOA 2EIKC 1ZWIC 2XASA 3JAKA 4LWSA 1PL0A 3GWOA 1N36B 1Y67A 1NR1A 4LH7A 2IM9A 3CCSV 4LNUB 5LXTA 2W0XA 1M9NA 3CC7V 1MZEA 4WFBV 1N32O 1Q6HA 1YXBA 1IZ3A 1I5YA 3OM3B 3RYFA 2WLJA 1IXBA 3B09A 2JEXA 3M7MX 4MVMA 3ZRXA 4FM0A 1SQFA 1K4DC 4J9YB 2D3OW 1Q81W 3QVNA 4JI7O 4UCSA 1KB9F 1YVWA 4PD4F 4X20B 4RO2A 2XAHA 4JI1O 5J2UA 1BSMA 1YJNV 3OMNB 1K73W 4JV5O 1WA8A 5LMUO 1H2NA 1K8AW 3HKBB 5IJ9B 4ICGA 3ETDA 4XDLA 4CC6A 2LFSA 2IJIA 3OUSA 2X7RB 1V55B 4UVBA 4W4KA 4O4IB 2QWQB 1QHTA 1ZSPA 2YS8A 1G6UA 3JAKB 5IJ0A 2FYUH 2BCCH 3ETGA 1N8RW 1YTFD 3JD0A 3U0ZA 5IYBO 3IJ4A 2RNBA 2H8PC 4JTCB 2YIDA 5LXTB 1QLNA 5LHGA 5FPOA 1LUVA 1NTZH 3KCYA 1IBLO 3WG7C 5FLXN 3SJBC 3QF7A 4JI3O 4F4LA 2VWKA 3QO5A 5K1XA 3SYOA 1R3LC 4N21A 2OCCC 3H1JH 1SESA 2GDSA 5KX5A 5B1BB 1IBKO 5B1AC 3FB6C 2RQ6A 5D5PA 1VP7A 1QLEC 1IDSA 4CH5A 4UB6Z 3KKYA 1Y4MA 4DRXA 2GSMB 1KP2A 2DN9A 1IBMB 5IT9N 1O9HA 2AHZA 4DR6B 4X64O 4LFCO 3ZHSA 1K5QA 4X66B 5JCOA 4YIOA 1SQBH 2Q67A 4MVUA 3E22B 4HBNA 5IJ0B 1KKDA 2W6IG 3ASOC 4QPKA 1SA0A 2ZE6A 3K9AA 2EIJB 1U96A 4K0KB 2LP7A 4JAUA 2VRZA 2ETNA 3CMEV 2ZR2A 2PF4E 2YXHA 3E8FA 4IL6Z 1L8DA 4I4TA 2WA3A 5B5EZ 4J7JA 5CB4B 1VQMV 1T5EA 2QR4A 2UUCO 3N2KB 2DYRB 1Y66A 1GN6A 3RVZA 3FAVA 1RP3B 4G28B 2WLHA 5BMVA 2CDYA 4UV8A 4ZHQA 5LGNA 3AG1C 2ZXWB 1H2MA 3K5MA 4GX5A 2Y4TA 1I08A 1EBOA 1MABG 4LH6A 1CEZA 3K5OA 1XEQA 1DK1A 3BHPA 1XHZA 4OGQB 2VQFO 2D2CB 4DO2A 2ZE5A 3RYHA 2IW5A 4FLZA 1GMGA 4LC1A 3K03A 3ABMB 4ZOLA 4KHPO 2QWPB 5EBMC 5J2TA 4TSFG 4AILC 1K7DA 3OR6C 1KQSU 3AG4C 3TETA 4R50A 3MDSA 3K58A 1QR9A 1SQGA 3ZN1A 2EULA 3ZRWB 1OCZC 1FJGO 1VQ4V 2ZINA 1XNRO 1E79G 4MS2A 1R3IC 2OIGA 3UCSC 3WFVA 5EZYB 1AR1B 5LMNO 1Q6UA 4DV4O 1BZKA 2JS5A 3RYCA 5JH7A 1WP7A 4WBNA 3OMIB 4NTWA 4PELA 5CA3A 2HVJC 1XUQA 4HZ3A 3BFRA 3E2EA 2UXXA 2PTMA 2JRIA 2BOCC 4OPHA 1R1BA 2DOSA 2QJ1A 4K35A 1KMIZ 2WLIA 1RM1C 2EILB 2ZR3A 2K1EA 1M90W 1NT2B 2QGNA 2ODMA 5CBGA 4JI6B 3C3SA 2P7TC 1NVPB 2Y69B 1QBZA 3SJQC 3ETEA 3CCRV 5JJNB 3MAQA 4JI5B 3CJHA 1KP3A 1WPXA 3N27A 2A3QA 2DWEC 4IIJB 3SJAC 2UXNA 2HG5C 5KUKA 1TVKB 1FAFA 1Y6XA 4X1IA 4R8CA 4XBFA 3EVKA 3OE7G 3HKEA 3KZIZ 1I0HA 4X9QA 4X88A 3SPGA 4K8ZA 5KA6A 4LFBB 3R65A 1MA1A 2RN9A 2X6BA 4Q6GA 4P9OA 2ZD9A 2FMLA 3ZMVA 4LF4B 4X1YB 4WBNB 3CP1A 3CC2V 3IFXA 4TQDA 4BIOA 3ABLB 4UXNA 1Q7YW 4LFAO 1N4CA 4D7SA 3L71H 4NXNO 2Q68A 2L35A 3STZC 1PD3A 1WJZA 4J41A 5BR8B 4ZI7B 3OW2U 3HPLC 3L74H 3CS5A 2GUZA 4PA4A 1SQPH 2ZIOA 4JZGA 2A79B 2Q7HA 1XQ8A 3MHHC 4DV7O 1Q82W 5EYPA 4AI8A 2E74B 1OCOC 2UXCO 1DF5A 1QQCA 3CCVV 1XMQO 1HNXB 3CCEV 1L0NH 2IU3A 4YY3O 5IE9A 3ZHRA 2XUMA 4WFEA 4O4JB 4O2AB 1UJWB 4DV0B 1KC8W 1I94B 5B1OA 1LR1A 1XNQB 4DR1B 4Q20A 5ITZA 3I5DA 1P84F 2UXBB 2B5UA 4PA9A 1RSOA 4U3JA 4CS2A 5KHKA 4BW9A 2Q0OC 4UFZA 4OX9B 3APQA 3OTOO 3CXCU 2HEPA 1GKFA 3FYEB 1NVPD 2RJZA 3JD4A 5LBQA 3CD6V 4FMTA 4DV1B 1RFYA 1OCRB 1Q90D 2DWDC 1K3EA 3CWBH 5CA0A 1NR7A 3SYQA 1XDCA 3A2FA 2Y0IA 3BABA 4NTXA 4DR4B 2N74A 4U3FH 5IDJA 2F1MA 1SKVA 1E1RG 1FXKA 4B3RB 4DYLA 3CRCA 4EFBA 2PI4A 2P06A 3X2QB 1EM1A 2OTLV 5EIBC 5JCOC 1K5SA 3BCCH 5KA5A 3ZS8C 1SQQH 1ZL8A 5LA6A 5JQGA 3L75H 3T1YO 2DYSB 3EXAA 4NYKA 4X1KA 1EN4A 5DECA 4PHZA 5EC2C 4FPPA 4JYCA 4TV9A 2Q7GA 1HNZO 1FFXB 1WB7A 4RUFA 3E83A 2RCVA 4FFBA 2WLKA 3L72H 1Q8IA 3U11A 2CH7A 1PV0A 4DUZB 4NVPA 2Q0AA 5IYZB 4YHHB 3CCQV 1AR5A 5F2VO 1ROPA 1XMOB 2DQ0A 2EINB 1NJIW 1TGOA 1VQKV 2CUGA 1R6NA 5GONA 2EILC 4DR3B 1PNKA 3JSLA 1SETA 4LF9B 3VQWA 1ORQC 1FS0G 3W7UA 2UU9O 4E4EA 4GLXA 4AQYO 4GKKB 3T1HO 3E8HA 3RFRA 2EIMB 4LNUA 5L3EA 2PI5A 2ZM6B 1XL4A 2YXLA 3AK2A 2BTOA 2KB1A 4GX1A 4KUMA 5GTIZ 5A9GA 2IJHA 1EZVH 3K0GA 4RAIA 2JJ1G 2XAJA 5GW7A 4IT5A 2F23A 1TA8A 3SR2C 4LP8A 2ZT9B 2JK5C 3EHBB 4JI4O 1N0NA 2VQEO 1VF7A 2A06H 3ABTA 1CPYA 4X20A 4B3TB 2PGGA 5IYDO 1O9GA 2WLLB 2AGAA 2HR3A 4O4HB 2OYQA 2R70A 2CH7B 1NU1H 2ZE7A 2AW9A 5KMGB 3HKBA 1MMMA 4LF7B 4DUYO 1ZTEA 5IJ9A 1VQ8V 3DGEA 4MW3A 4DW0A 1F23A 3OEHG 5GONB 4B3MO 4O4IA 1SRYA 2P67A 3UM7A 4DV2O 3ZRVA 2LO1A 4UB8Z 3FB5C 2BSKB 1SQVH 3AK1A 3ZMSA 1S72V 1AROP 1N36O 3RWRD 1XREA 4JTDB 4EB6B 4QE9A 3D3QA 2F66C 1AJPA 3K5NA 3OFNG 2QWOB 3CXHF 3CCMV 3B2EE 1NZ6A 1M56B 1NKDA 2HP8A 2OTJV 4CBCA 1NI8A 1VARA 1YDXA 4MT8A 5EBWC 4FM1A 4FLWA 2HKOA 1J5EO 1M57B
chains in the Genus database with same CATH topology
4YHHO 2UUCO 2DJVA 4X62O 3M8AA 4LF7O 4X66O 1D2DA 5BY1A 4DR7O 3OTOO 1HNXO 3J80N 2UUBO 2FKXA 1NS1A 5BR8O 4DR5O 4DV3O 4K0KO 1XEQA 1N34O 4JI2O 4JI4O 4A5UB 1DK1A 1IBLO 2LW7A 5FLXN 2VQFO 4DV0O 1I94O 4DUZO 2VQEO 2N74A 1FKAO 4DV6O 4DR6O 3JAMN 3SDLA 2ZKOA 1XMOO 4KHPO 4JI3O 2AGAA 2ZM6O 1N33O 3O65A 4LF5O 1KUQA 4GKJO 5BXZA 1AILA 4DR3O 5IWAO 3T1YO 4DUYO 1HR0O 4B3SO 4JI0O 4LF9O 4JYAO 1IBKO 1N32O 4LFAO 1XNQO 1FJGO 4DR1O 1HNZO 4GKKO 4NXNO 4X65O 4B3MO 2HHHO 4NXMO 4DR4O 2UXBO 1XNRO 3R66A 4JI6O 2UXDO 5IT9N 4DV2O 4JI5O 4B3RO 3J7AU 1HNWO 1X59A 2UUAO 4JI7O 1FYJA 1A32A 3F5TA 5LMNO 4DV4O 4DR2O 4X64O 4LF6O 4OX9O 4DV7O 4LFCO 4LFBO 1N36O 2UXCO 4DV1O 4OPAA 4JI1O 1XMQO 1G1XB 4LF4O 4DV5O 2E5LO 2JRIA 4JV5O 4OPHA 3RT3C 5LMUO 1R1BA 4LF8O 2DOSA 4YY3O 1AB3A 4B3TO 5LL6Y 2UU9O 1R6TA 1IBMO 1YZBA 4AQYO 1F7YA 3T1HO 2Z0AA 5H5NA 1J5EO 5A2QN 2F4VO 3J81N 4JI8O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH O;  2UUC O;  2DJV A;  4X62 O;  3M8A A;  4LF7 O;  4X66 O;  1D2D A;  5BY1 A;  4DR7 O;  3OTO O;  1HNX O;  3J80 N;  2UUB O;  2FKX A;  1NS1 A;  5BR8 O;  4DR5 O;  4DV3 O;  4K0K O;  1XEQ A;  1N34 O;  4JI2 O;  4JI4 O;  4A5U B;  1DK1 A;  1IBL O;  2LW7 A;  5FLX N;  2VQF O;  4DV0 O;  1I94 O;  4DUZ O;  2VQE O;  2N74 A;  1FKA O;  4DV6 O;  4DR6 O;  3JAM N;  3SDL A;  2ZKO A;  1XMO O;  4KHP O;  4JI3 O;  2AGA A;  2ZM6 O;  1N33 O;  3O65 A;  4LF5 O;  1KUQ A;  4GKJ O;  5BXZ A;  1AIL A;  4DR3 O;  5IWA O;  3T1Y O;  4DUY O;  1HR0 O;  4B3S O;  4JI0 O;  4LF9 O;  4JYA O;  1IBK O;  1N32 O;  4LFA O;  1XNQ O;  1FJG O;  4DR1 O;  1HNZ O;  4GKK O;  4NXN O;  4X65 O;  4B3M O;  2HHH O;  4NXM O;  4DR4 O;  2UXB O;  1XNR O;  3R66 A;  4JI6 O;  2UXD O;  5IT9 N;  4DV2 O;  4JI5 O;  4B3R O;  3J7A U;  1HNW O;  1X59 A;  2UUA O;  4JI7 O;  1FYJ A;  1A32 A;  3F5T A;  5LMN O;  4DV4 O;  4DR2 O;  4X64 O;  4LF6 O;  4OX9 O;  4DV7 O;  4LFC O;  4LFB O;  1N36 O;  2UXC O;  4DV1 O;  4OPA A;  4JI1 O;  1XMQ O;  1G1X B;  4LF4 O;  4DV5 O;  2E5L O;  2JRI A;  4JV5 O;  4OPH A;  3RT3 C;  5LMU O;  1R1B A;  4LF8 O;  2DOS A;  4YY3 O;  1AB3 A;  4B3T O;  5LL6 Y;  2UU9 O;  1R6T A;  1IBM O;  1YZB A;  4AQY O;  1F7Y A;  3T1H O;  2Z0A A;  5H5N A;  1J5E O;  5A2Q N;  2F4V O;  3J81 N;  4JI8 O; 
#chains in the Genus database with same CATH topology
 1DLB A;  2WPD G;  3RN4 A;  3AG2 C;  2YXY A;  1AI6 A;  3SJC C;  2YSU B;  3ZHV A;  3CRQ A;  4RQE A;  4GT1 A;  3S3W A;  3W7W A;  3OAA G;  4JYA B;  1EN6 A;  4D6T H;  1EN5 A;  4WF9 V;  1I5X A;  5HFM A;  3CCJ V;  1AVM A;  3TXQ A;  2Y4U A;  5IYC O;  5L3G A;  3X2Q C;  2UXD B;  1FKA O;  3JAM N;  3E35 A;  3SDL A;  1HNW B;  1SER A;  3WB1 A;  3E22 A;  4DR2 B;  4F6R B;  4J11 A;  2DYS C;  1KYO F;  1N33 O;  4WCE V;  4LF5 O;  3VQV A;  2Q7E A;  1AP5 A;  1JFF B;  2CTQ A;  4GYC B;  4B3S O;  2EZO A;  3OR7 C;  5KUM A;  4JYY A;  1QVG U;  1IXM A;  1B04 A;  5CB4 A;  4LF8 B;  1VQ7 V;  3K79 A;  3LDC A;  4NXM O;  3N2K A;  3OUF A;  3A8T A;  4AHC A;  1OCC C;  3JD1 A;  2BE3 A;  1YJW V;  3J7A U;  1BGY H;  5TIS Z;  2PY5 A;  2B1I A;  4FLT A;  4X62 B;  1JR9 A;  4JI3 B;  1JCH A;  3AK3 A;  3KCX A;  2N05 A;  3OT7 A;  2LFR A;  2V4D A;  4I0X B;  3VQX A;  3F5W C;  1VQN V;  5JWP A;  3W7T A;  2IH1 C;  3ICX A;  3AG3 B;  4I9Q A;  5C8Y B;  3G80 A;  3E8G A;  3N2G B;  1Q43 A;  3P3P A;  2QKC A;  1IBM O;  1F7Y A;  4GX0 A;  4DK0 A;  1FXK C;  3P32 A;  2P90 A;  1ZX3 A;  1VQP V;  2F4V O;  4WFF A;  4ZKI A;  4JI8 O;  1GO3 F;  4X66 O;  2YI9 A;  3ZRW A;  4RUE A;  4DW1 A;  4X64 B;  4ASU G;  3K5L A;  1K4C C;  1HR0 B;  2AXT Z;  2IJJ A;  2QM4 A;  3I56 V;  2YI8 A;  4K0K O;  3OTF A;  5EZY A;  2B1G A;  4X65 B;  4PV1 B;  2LW7 A;  4GCZ A;  4CC5 A;  4YJ2 B;  3ZX6 A;  5CBH A;  4LR3 A;  5LP6 B;  2CK3 G;  4PI0 A;  1BQZ A;  1KUQ A;  4BIU A;  4GKJ O;  3RGB A;  3OD4 A;  1PNM A;  4G2K A;  2UUC B;  2Q9L A;  3STL C;  1S5L Z;  2ZIM A;  3LDE A;  1PL4 A;  3ZBH A;  1S76 D;  1V9P A;  1VF5 B;  5E1A C;  2K9P A;  3BY6 A;  1VQ9 V;  5LGT A;  2KQX A;  4KFM A;  3SYC A;  3K06 A;  2JDI G;  2X0L A;  1KU9 A;  2WWW A;  2QWN B;  2VQF B;  4IIJ A;  1R3J C;  1R73 A;  1PKX A;  2EZP A;  4KHP B;  4KP4 A;  4DR7 B;  4UUJ C;  4JF3 A;  5DM6 V;  1BT8 A;  1TVK A;  3TCU A;  2VS0 A;  4I9W A;  2E5L O;  2GV9 A;  2JEU A;  1ZAU A;  2LGW A;  3RT3 C;  3PJS K;  2JIZ G;  3HB3 B;  1J95 A;  3OMA B;  5D5Q A;  2Q73 A;  5KHG A;  2BTQ B;  4FJC C;  4YJ3 A;  4EFE A;  5LYJ B;  1VF6 A;  5A2Q N;  3TGU H;  4X1Y A;  5DED A;  4TQF A;  1XIL A;  3ABK B;  4TOI A;  3A0H Z;  3LDD A;  4BIZ A;  1S0V A;  2ZCE A;  2EJ7 A;  4NKG B;  4ZI7 A;  4JI0 B;  1XI1 A;  4IHJ B;  1V55 C;  3K08 A;  2WLN A;  4DR5 O;  1NTM H;  1Z5V A;  1HP8 A;  1R6K A;  1IX9 A;  1S3J A;  2XAF A;  3CSX A;  1Y74 B;  3S3X A;  5B3S B;  4ZBM A;  2NR5 A;  1B6Q A;  4LF6 B;  1WAZ A;  3F7V C;  1AJN A;  3ZIA G;  4WFA V;  4BW5 A;  4O4J A;  4O2A A;  4TUY A;  4Z1V A;  5KHJ A;  3MD0 A;  1K92 A;  2CTR A;  3UT5 B;  1BHB A;  3Q4H A;  4UCU A;  5H6R A;  2HJF C;  5H2F Z;  5B66 Z;  2MK3 A;  4C7U A;  2ATK C;  1PP9 H;  3A0R A;  5LGU A;  5FL7 G;  2OT5 A;  5B1B C;  2UUA O;  2ADQ B;  1A32 A;  4YJ3 B;  2ITD C;  3AG7 A;  3G67 A;  4LFB O;  5KHH A;  4RQF A;  3FD9 A;  5FNV A;  2P4K A;  2Q8V A;  4TT3 G;  1QVF U;  3SYA A;  4LF4 O;  2UUB B;  3CEI A;  2CGN A;  4PI2 A;  1VQ6 V;  3K59 A;  1YF2 A;  1Y76 A;  4DV3 B;  2YIC A;  3ASN B;  3BPZ A;  1SF9 A;  4I55 B;  4JI2 B;  3KG2 A;  3E86 A;  3ZHU A;  3JAS B;  4J10 A;  4LFA B;  2F95 B;  3QO8 A;  4NXN B;  3HKD B;  4WFG A;  2Q5Z A;  4E2L A;  1MNG A;  3BAA A;  4CS3 A;  2EIJ C;  4NTY A;  4FZ0 A;  4OXS A;  3RVY A;  1D2D A;  4Z1M G;  4FFK A;  2JJ2 G;  4DV7 B;  1B3Q A;  1FFX A;  2UXC B;  1HNX O;  2HJD A;  4P2Z A;  3DC5 A;  4R6Z A;  4DK1 A;  5KAI Z;  4QIW F;  4TUY B;  2NNU A;  4G27 B;  2PYJ A;  1XMQ B;  2ITC C;  5IYZ A;  2DYR C;  2NN4 A;  3JAT B;  2M6Y A;  3Q4H B;  3SPH A;  4DV0 O;  1I94 O;  2QTO A;  3HKC B;  2RDC A;  4YY3 B;  1RPO A;  4I5S A;  1H38 A;  2Q4P A;  2R72 A;  3W7S A;  4MW8 A;  1P7B A;  2ZXW C;  3JAR B;  2JS3 A;  4YIP A;  2PUS A;  2QKS A;  5CA1 B;  5IWA O;  5JVD B;  1GN3 A;  1UPG A;  5FNV B;  4DV5 B;  3T1C A;  3ABM C;  1TUB B;  2P4V A;  1JJO A;  3TXS A;  2L6L A;  4DR4 O;  1Y76 B;  1ZUQ A;  4BR6 A;  4B3R O;  5KAF Z;  3F5T A;  1G4Y B;  1H8H G;  3UKM A;  3UO3 A;  2AHY A;  4I50 B;  2XT9 A;  2PYL A;  1W0J G;  1HWY A;  4UVC A;  2FL4 A;  2E75 B;  2HVK C;  5EK0 A;  4XDK A;  3IC7 A;  2WLL A;  4B7K A;  4O4H A;  1P4R A;  3JSN A;  3VBB A;  4DV6 B;  3JAW A;  4GUN A;  5KMG A;  1HNZ B;  2EJR A;  1GN4 A;  4IYI A;  3ZCC A;  3JAL B;  4YHH O;  2QM8 A;  5L3F A;  3H9V A;  2NLJ C;  3ZMT A;  2GTS A;  4R7C A;  5CN0 A;  3RYI B;  5BY1 A;  3MHS C;  2IH3 C;  3ZMU A;  3ZMZ A;  2QSA A;  2QA4 V;  4PA6 A;  3EFF K;  2BSK A;  2Y69 C;  2OCC B;  1N34 O;  4EEQ A;  4A5U B;  2C2A A;  1K34 A;  1KBH A;  4EB6 A;  1H2S B;  3DXR B;  2UU9 B;  2V1D A;  3HR0 A;  5B1A B;  2WA4 A;  2ZM6 O;  1WPB A;  1QLE B;  4J7K A;  2E3C A;  1P49 A;  3O65 A;  3D8C A;  1BMF G;  2YIB D;  1AIL A;  4P30 A;  3W7X A;  1MG1 A;  1QNM A;  1CP9 A;  4PA3 A;  4CS4 A;  3LUT B;  1KD1 W;  2XHB A;  3BEH A;  2EBO A;  1BCC H;  3K9S A;  2HHH O;  1DF4 A;  2LW1 A;  1VF6 C;  4JI4 B;  4TWK A;  3ASO B;  4U7O A;  2VQE B;  3JAW B;  1JOY A;  3ABL C;  3FYI B;  2CAZ C;  4D7T A;  1X4T A;  3ZJZ A;  3A0B Z;  4OPA A;  1D5A A;  1Q86 W;  1F4M A;  1GH6 A;  3QTC A;  2YEV A;  4JAV A;  1YCI A;  2CTP A;  1DGS A;  1JQ0 A;  4DUY B;  5FPR A;  1GAX A;  3E8B A;  4F6R A;  2QTS A;  2FB5 A;  3WB2 A;  3M99 B;  4Z2W A;  3K57 A;  3JD2 A;  3UQ8 A;  4B3M B;  3AG1 B;  5H5N A;  4YXW G;  1JFF A;  1BS3 A;  3B8M A;  4FK5 C;  3T4Z A;  2DJV A;  1BHA A;  3B4S A;  2G38 A;  2KG7 B;  1XHX A;  1YSC A;  3CPW U;  4J9Z B;  2DMX A;  1D5N A;  4O2B B;  1WB8 A;  1LUW A;  4QE7 A;  3QG5 A;  4UCV A;  3WB0 A;  4FLU A;  1MZF A;  3T4D A;  2LGQ A;  3O9O A;  2OWO A;  2ZNJ A;  1N32 B;  3B8N A;  2E76 B;  2IJK A;  3AG4 B;  2F93 B;  1WN7 A;  2IBZ H;  3D36 A;  2KKW A;  3CYO A;  2YDE A;  4FIP C;  2IU0 A;  5L3C A;  1SZX A;  3P30 A;  4H33 A;  4JI7 B;  4I0X A;  1OCR C;  1GM8 A;  1OCZ B;  2JGD B;  1J5E B;  3VOU A;  5JJJ B;  1AI7 A;  3H1L H;  1DTO A;  2JGU A;  4KL1 A;  5IY5 B;  5C8Y A;  3LNM B;  4JI1 B;  3N2G A;  3THO A;  1K97 A;  1JJ2 U;  4JYA O;  3P3N A;  4X8A A;  1THZ A;  2Y48 A;  4JV5 B;  2YEV B;  5LMU B;  1FD9 A;  2Q6A A;  1S5H C;  2UXD O;  4LBE C;  5H6Q A;  3GVM A;  4HAM A;  1HNW O;  4DR2 O;  1OHH G;  2BOB C;  4HNA B;  5JJE B;  3IGA C;  1RM1 B;  4F6E A;  1N33 B;  4PA7 A;  4LF5 B;  4BWA A;  4LWS B;  4YJ2 A;  1YEW A;  2QKA A;  3SPC A;  4LF8 O;  4PDV A;  5LP6 A;  4B3S B;  4H13 B;  1FXV A;  1WP8 A;  1EFR G;  1IBL B;  2EIN C;  1YIT V;  2Z3Y A;  4GZR B;  1M4U A;  2XOK G;  3E89 A;  4NXM B;  3CHX A;  5DN6 G;  3RYF B;  4X62 O;  3M8A A;  1VIB A;  1GTO A;  1H2K A;  4B7E A;  1HW7 A;  3FX7 A;  2R9I A;  4JAS A;  2EIM C;  1IBK B;  1TAE A;  1JMK C;  4L87 A;  4UV9 A;  2O57 A;  1W59 A;  5J2U B;  2H94 A;  4QPJ A;  4DR6 O;  1W2B U;  1WA8 B;  2N04 A;  3H01 A;  4H0L B;  4LFC B;  1P7G A;  2MW2 B;  2F4V B;  4JI8 B;  4MTO A;  3APO A;  3CC4 V;  4ZIB A;  1VEW A;  1HR0 O;  1Q3E A;  2BTQ A;  3SPJ A;  1UFI A;  5LYJ A;  1IUR A;  3K0D A;  5K1P A;  1OCO B;  1NQT A;  1Z2G A;  4X65 O;  2A0L A;  3R66 A;  4J80 A;  1K33 A;  3NXS A;  1FYJ A;  3JD3 A;  4IHJ A;  2CTW A;  1QR8 A;  2ZDI A;  4UVA A;  1VQL V;  3B77 A;  2ILM A;  4MVO A;  1GK9 A;  2ZQM A;  3LSQ A;  1KEC A;  4HYO A;  5HFL A;  3CX5 F;  2AZ0 A;  3U10 A;  5L3D A;  2Q69 A;  4GKJ B;  1NBM G;  3F7Y C;  1NTK H;  3CRM A;  2XAQ A;  4JYB A;  4O4L A;  3GWK C;  1Y74 A;  2GBO A;  1R6T A;  3FKS G;  5KX5 B;  3LSU A;  2XAG A;  2Z0A A;  4B08 A;  2CE4 A;  4WFH A;  1L1F A;  1M56 C;  3BA8 A;  3UT5 A;  1QU7 A;  4DRX B;  1AJQ A;  2RMK B;  3ETQ A;  4DR7 O;  4H37 A;  1EZJ A;  3QNE A;  2EX3 A;  3J80 N;  1M57 C;  2FKX A;  1PM9 A;  2X6A A;  5EC1 C;  1FJG B;  1TUE B;  2E5L B;  1GM7 A;  5E79 Z;  1XNR B;  5C93 A;  2A7W A;  3LNN A;  4MVZ A;  4KXR A;  3WU2 Z;  2ZE8 A;  2ADP A;  1SA0 B;  2M7W A;  3BRC A;  1Q6I A;  5IY5 C;  5LMN B;  4DV4 B;  4J42 A;  1Q5O A;  1FXH A;  4QGP A;  1I7F A;  4I4T B;  4I55 A;  1B06 A;  5CMU A;  3K3W A;  3JAS A;  4IGG A;  3CB2 A;  4JI0 O;  4CH4 A;  1PNL A;  2OIE A;  3HKD A;  2GHY A;  1QCE A;  2FTK A;  3FAV B;  3SGI A;  5LOV A;  3G4S V;  2KSD A;  4FZ1 A;  5BMV B;  3D3I A;  4O4L B;  4JI6 O;  4DR5 B;  4ZHQ B;  4NR1 A;  3CCL V;  4JI5 O;  2P22 C;  3L70 H;  5LHH A;  1AI4 A;  4LCU C;  4LF6 O;  1SS3 A;  1L0L H;  2LJ2 A;  3BVO A;  2WAM A;  3JYC A;  2HFE C;  3RYH B;  3IAY A;  4MTX A;  1XOU A;  1G8M A;  1XL6 A;  2QM7 A;  4J7Z A;  1M1K W;  4L8J A;  3JAT A;  4ZOL B;  2WSS G;  3GB7 C;  3HKC A;  5J2T B;  4JAA A;  2YIB A;  1OJH A;  3D36 C;  3JAR A;  2QWR B;  4FLV A;  3IC9 A;  2B9Z A;  3BA9 A;  3ZHT A;  1ENV A;  1YZB A;  5CA1 A;  5JVD A;  3JCZ A;  1V54 B;  2UUA B;  3AG3 C;  1TUB A;  1JPX A;  1JVM A;  4JTA B;  3C90 A;  4I7Z B;  2DW4 A;  1AR4 A;  4UCT A;  1IVS A;  5AG2 A;  2UUB O;  3CMA V;  3RYC B;  5JH7 B;  4PDM A;  1JA8 A;  5BR8 O;  4DV3 O;  4MSW C;  1BQ0 A;  4I50 A;  1ZLZ A;  3ML0 A;  4JI2 O;  2QEX V;  4QNH B;  1GM9 A;  5LOV B;  1CXZ B;  5EIB D;  4CH6 A;  3ZHQ A;  1S5J A;  4U7N A;  2YIA A;  3JCU Z;  4CH3 A;  3CRA A;  4FLX A;  1GRJ A;  1LNQ A;  1MSD A;  2WLI B;  3CCU V;  3DTU B;  1VQ5 V;  4TV8 A;  1YHQ V;  3H1K H;  2EIK B;  5BXZ A;  1MSW D;  3K04 A;  2AZ2 A;  3NR7 A;  5L3B A;  3ZED A;  1OZ0 A;  3ABU A;  4RWU A;  3LSS A;  4MVS A;  4PJ0 Z;  4JPR A;  1JX9 A;  5LP6 C;  3CJH B;  3JAL A;  1XNQ O;  4DR1 O;  4PDL A;  5KLV H;  2UXB O;  3RW0 A;  4QJF B;  3B40 A;  1OV9 A;  2WLM A;  1US6 A;  4K8X A;  1E1Q G;  1SZT A;  3RYI A;  1VMG A;  2X6C A;  1Z5W A;  2OCH A;  3AEI A;  4OX9 O;  4NB5 A;  3SPI A;  1YI2 V;  4X1I B;  4DV1 O;  1YIJ V;  3OTO B;  1NH2 B;  3HKE B;  1GN2 A;  2H3O A;  4XDJ A;  4DV5 O;  5GTH Z;  1M93 A;  3QO7 A;  5IWA B;  2Z5U A;  2R9A A;  3DXR A;  1R3K C;  1WNS A;  3AG2 B;  5KHI A;  2ARH A;  4JGS A;  2GTA A;  1H2G A;  3CE2 A;  3ZN0 A;  1K9M W;  1FPO A;  3FB8 C;  4W4L A;  4MTG A;  3J81 N;  4X89 A;  1PPJ H;  3L9D A;  4EKW A;  2GUZ B;  3T2M A;  2JVD A;  4TV8 B;  4ABM A;  3T1Y B;  3VQY A;  3G71 V;  1XBL A;  3UO2 A;  1AP6 A;  5EYP B;  3TJT A;  3CRR A;  2DE0 X;  1F51 A;  3ABK C;  1SC5 B;  5CBF A;  4DUZ O;  3C3T A;  3FB7 C;  4DV6 O;  2W0F C;  2DQ3 A;  1URF A;  3DSQ A;  1XMO O;  3WG7 B;  2ZDI C;  1BE3 H;  1YJ9 V;  4GX2 A;  1COW G;  1HDJ A;  4JZ2 A;  4FLY A;  2VWJ A;  4DR3 O;  4FVM A;  3FFQ A;  5ITZ B;  2P5O A;  1OCC B;  2YUA A;  3RBZ A;  1WLE A;  1RSO B;  4DXW A;  4LF9 O;  4U3J B;  1W0K G;  5B3S C;  1U97 A;  4UCO A;  1BL8 A;  3L73 H;  4GKK O;  3OEE G;  2KG7 A;  1F4N A;  4AQY B;  4K3A A;  3OGC C;  3G6E V;  1N34 B;  1KKC A;  3T1H B;  1M5I A;  4O2B A;  1X59 A;  4P9P A;  5CA0 B;  1H2L A;  2P6J A;  1RPR A;  4CZZ A;  3TK1 A;  2R9R B;  4N23 A;  3I55 V;  1FXK B;  1FFT B;  1G1X B;  4MVR A;  1MOF A;  5LHI A;  5BZB A;  4MVQ A;  4MTF A;  1VQO V;  5B1N A;  1S77 D;  1ZL8 B;  5H9C A;  2LQT A;  1NH2 D;  1AB3 A;  5LA6 B;  5JQG B;  4B3T O;  5LL6 Y;  2JGD A;  2HLD G;  4BAY A;  1V54 C;  5EBL C;  4X1K B;  3OGI B;  2HHH B;  1YTF B;  2PZS A;  2CGO A;  3H1I H;  4TV9 B;  2Y0P A;  2F43 G;  3ASN C;  4LF7 O;  4FFB B;  4UCR A;  2XND G;  4IYH A;  3ZRS A;  3PN1 A;  2W6J G;  2QDO A;  5J9P C;  4FM2 A;  4PDR A;  2XTA A;  2YC0 A;  2A9H A;  1NS1 A;  2QE7 G;  2V7Q G;  4HNA A;  2ZNI A;  1H8E G;  3H1H H;  1AI5 A;  1SQX H;  3SYP A;  3DC6 A;  3G6B A;  4DV2 B;  4H44 B;  1N0J A;  2ZKO A;  2EIK C;  1ZWI C;  2XAS A;  3JAK A;  4LWS A;  1PL0 A;  3GWO A;  1N36 B;  1Y67 A;  1NR1 A;  4LH7 A;  2IM9 A;  3CCS V;  4LNU B;  5LXT A;  2W0X A;  1M9N A;  3CC7 V;  1MZE A;  4WFB V;  1N32 O;  1Q6H A;  1YXB A;  1IZ3 A;  1I5Y A;  3OM3 B;  3RYF A;  2WLJ A;  1IXB A;  3B09 A;  2JEX A;  3M7M X;  4MVM A;  3ZRX A;  4FM0 A;  1SQF A;  1K4D C;  4J9Y B;  2D3O W;  1Q81 W;  3QVN A;  4JI7 O;  4UCS A;  1KB9 F;  1YVW A;  4PD4 F;  4X20 B;  4RO2 A;  2XAH A;  4JI1 O;  5J2U A;  1BSM A;  1YJN V;  3OMN B;  1K73 W;  4JV5 O;  1WA8 A;  5LMU O;  1H2N A;  1K8A W;  3HKB B;  5IJ9 B;  4ICG A;  3ETD A;  4XDL A;  4CC6 A;  2LFS A;  2IJI A;  3OUS A;  2X7R B;  1V55 B;  4UVB A;  4W4K A;  4O4I B;  2QWQ B;  1QHT A;  1ZSP A;  2YS8 A;  1G6U A;  3JAK B;  5IJ0 A;  2FYU H;  2BCC H;  3ETG A;  1N8R W;  1YTF D;  3JD0 A;  3U0Z A;  5IYB O;  3IJ4 A;  2RNB A;  2H8P C;  4JTC B;  2YID A;  5LXT B;  1QLN A;  5LHG A;  5FPO A;  1LUV A;  1NTZ H;  3KCY A;  1IBL O;  3WG7 C;  5FLX N;  3SJB C;  3QF7 A;  4JI3 O;  4F4L A;  2VWK A;  3QO5 A;  5K1X A;  3SYO A;  1R3L C;  4N21 A;  2OCC C;  3H1J H;  1SES A;  2GDS A;  5KX5 A;  5B1B B;  1IBK O;  5B1A C;  3FB6 C;  2RQ6 A;  5D5P A;  1VP7 A;  1QLE C;  1IDS A;  4CH5 A;  4UB6 Z;  3KKY A;  1Y4M A;  4DRX A;  2GSM B;  1KP2 A;  2DN9 A;  1IBM B;  5IT9 N;  1O9H A;  2AHZ A;  4DR6 B;  4X64 O;  4LFC O;  3ZHS A;  1K5Q A;  4X66 B;  5JCO A;  4YIO A;  1SQB H;  2Q67 A;  4MVU A;  3E22 B;  4HBN A;  5IJ0 B;  1KKD A;  2W6I G;  3ASO C;  4QPK A;  1SA0 A;  2ZE6 A;  3K9A A;  2EIJ B;  1U96 A;  4K0K B;  2LP7 A;  4JAU A;  2VRZ A;  2ETN A;  3CME V;  2ZR2 A;  2PF4 E;  2YXH A;  3E8F A;  4IL6 Z;  1L8D A;  4I4T A;  2WA3 A;  5B5E Z;  4J7J A;  5CB4 B;  1VQM V;  1T5E A;  2QR4 A;  2UUC O;  3N2K B;  2DYR B;  1Y66 A;  1GN6 A;  3RVZ A;  3FAV A;  1RP3 B;  4G28 B;  2WLH A;  5BMV A;  2CDY A;  4UV8 A;  4ZHQ A;  5LGN A;  3AG1 C;  2ZXW B;  1H2M A;  3K5M A;  4GX5 A;  2Y4T A;  1I08 A;  1EBO A;  1MAB G;  4LH6 A;  1CEZ A;  3K5O A;  1XEQ A;  1DK1 A;  3BHP A;  1XHZ A;  4OGQ B;  2VQF O;  2D2C B;  4DO2 A;  2ZE5 A;  3RYH A;  2IW5 A;  4FLZ A;  1GMG A;  4LC1 A;  3K03 A;  3ABM B;  4ZOL A;  4KHP O;  2QWP B;  5EBM C;  5J2T A;  4TSF G;  4AIL C;  1K7D A;  3OR6 C;  1KQS U;  3AG4 C;  3TET A;  4R50 A;  3MDS A;  3K58 A;  1QR9 A;  1SQG A;  3ZN1 A;  2EUL A;  3ZRW B;  1OCZ C;  1FJG O;  1VQ4 V;  2ZIN A;  1XNR O;  1E79 G;  4MS2 A;  1R3I C;  2OIG A;  3UCS C;  3WFV A;  5EZY B;  1AR1 B;  5LMN O;  1Q6U A;  4DV4 O;  1BZK A;  2JS5 A;  3RYC A;  5JH7 A;  1WP7 A;  4WBN A;  3OMI B;  4NTW A;  4PEL A;  5CA3 A;  2HVJ C;  1XUQ A;  4HZ3 A;  3BFR A;  3E2E A;  2UXX A;  2PTM A;  2JRI A;  2BOC C;  4OPH A;  1R1B A;  2DOS A;  2QJ1 A;  4K35 A;  1KMI Z;  2WLI A;  1RM1 C;  2EIL B;  2ZR3 A;  2K1E A;  1M90 W;  1NT2 B;  2QGN A;  2ODM A;  5CBG A;  4JI6 B;  3C3S A;  2P7T C;  1NVP B;  2Y69 B;  1QBZ A;  3SJQ C;  3ETE A;  3CCR V;  5JJN B;  3MAQ A;  4JI5 B;  3CJH A;  1KP3 A;  1WPX A;  3N27 A;  2A3Q A;  2DWE C;  4IIJ B;  3SJA C;  2UXN A;  2HG5 C;  5KUK A;  1TVK B;  1FAF A;  1Y6X A;  4X1I A;  4R8C A;  4XBF A;  3EVK A;  3OE7 G;  3HKE A;  3KZI Z;  1I0H A;  4X9Q A;  4X88 A;  3SPG A;  4K8Z A;  5KA6 A;  4LFB B;  3R65 A;  1MA1 A;  2RN9 A;  2X6B A;  4Q6G A;  4P9O A;  2ZD9 A;  2FML A;  3ZMV A;  4LF4 B;  4X1Y B;  4WBN B;  3CP1 A;  3CC2 V;  3IFX A;  4TQD A;  4BIO A;  3ABL B;  4UXN A;  1Q7Y W;  4LFA O;  1N4C A;  4D7S A;  3L71 H;  4NXN O;  2Q68 A;  2L35 A;  3STZ C;  1PD3 A;  1WJZ A;  4J41 A;  5BR8 B;  4ZI7 B;  3OW2 U;  3HPL C;  3L74 H;  3CS5 A;  2GUZ A;  4PA4 A;  1SQP H;  2ZIO A;  4JZG A;  2A79 B;  2Q7H A;  1XQ8 A;  3MHH C;  4DV7 O;  1Q82 W;  5EYP A;  4AI8 A;  2E74 B;  1OCO C;  2UXC O;  1DF5 A;  1QQC A;  3CCV V;  1XMQ O;  1HNX B;  3CCE V;  1L0N H;  2IU3 A;  4YY3 O;  5IE9 A;  3ZHR A;  2XUM A;  4WFE A;  4O4J B;  4O2A B;  1UJW B;  4DV0 B;  1KC8 W;  1I94 B;  5B1O A;  1LR1 A;  1XNQ B;  4DR1 B;  4Q20 A;  5ITZ A;  3I5D A;  1P84 F;  2UXB B;  2B5U A;  4PA9 A;  1RSO A;  4U3J A;  4CS2 A;  5KHK A;  4BW9 A;  2Q0O C;  4UFZ A;  4OX9 B;  3APQ A;  3OTO O;  3CXC U;  2HEP A;  1GKF A;  3FYE B;  1NVP D;  2RJZ A;  3JD4 A;  5LBQ A;  3CD6 V;  4FMT A;  4DV1 B;  1RFY A;  1OCR B;  1Q90 D;  2DWD C;  1K3E A;  3CWB H;  5CA0 A;  1NR7 A;  3SYQ A;  1XDC A;  3A2F A;  2Y0I A;  3BAB A;  4NTX A;  4DR4 B;  2N74 A;  4U3F H;  5IDJ A;  2F1M A;  1SKV A;  1E1R G;  1FXK A;  4B3R B;  4DYL A;  3CRC A;  4EFB A;  2PI4 A;  2P06 A;  3X2Q B;  1EM1 A;  2OTL V;  5EIB C;  5JCO C;  1K5S A;  3BCC H;  5KA5 A;  3ZS8 C;  1SQQ H;  1ZL8 A;  5LA6 A;  5JQG A;  3L75 H;  3T1Y O;  2DYS B;  3EXA A;  4NYK A;  4X1K A;  1EN4 A;  5DEC A;  4PHZ A;  5EC2 C;  4FPP A;  4JYC A;  4TV9 A;  2Q7G A;  1HNZ O;  1FFX B;  1WB7 A;  4RUF A;  3E83 A;  2RCV A;  4FFB A;  2WLK A;  3L72 H;  1Q8I A;  3U11 A;  2CH7 A;  1PV0 A;  4DUZ B;  4NVP A;  2Q0A A;  5IYZ B;  4YHH B;  3CCQ V;  1AR5 A;  5F2V O;  1ROP A;  1XMO B;  2DQ0 A;  2EIN B;  1NJI W;  1TGO A;  1VQK V;  2CUG A;  1R6N A;  5GON A;  2EIL C;  4DR3 B;  1PNK A;  3JSL A;  1SET A;  4LF9 B;  3VQW A;  1ORQ C;  1FS0 G;  3W7U A;  2UU9 O;  4E4E A;  4GLX A;  4AQY O;  4GKK B;  3T1H O;  3E8H A;  3RFR A;  2EIM B;  4LNU A;  5L3E A;  2PI5 A;  2ZM6 B;  1XL4 A;  2YXL A;  3AK2 A;  2BTO A;  2KB1 A;  4GX1 A;  4KUM A;  5GTI Z;  5A9G A;  2IJH A;  1EZV H;  3K0G A;  4RAI A;  2JJ1 G;  2XAJ A;  5GW7 A;  4IT5 A;  2F23 A;  1TA8 A;  3SR2 C;  4LP8 A;  2ZT9 B;  2JK5 C;  3EHB B;  4JI4 O;  1N0N A;  2VQE O;  1VF7 A;  2A06 H;  3ABT A;  1CPY A;  4X20 A;  4B3T B;  2PGG A;  5IYD O;  1O9G A;  2WLL B;  2AGA A;  2HR3 A;  4O4H B;  2OYQ A;  2R70 A;  2CH7 B;  1NU1 H;  2ZE7 A;  2AW9 A;  5KMG B;  3HKB A;  1MMM A;  4LF7 B;  4DUY O;  1ZTE A;  5IJ9 A;  1VQ8 V;  3DGE A;  4MW3 A;  4DW0 A;  1F23 A;  3OEH G;  5GON B;  4B3M O;  4O4I A;  1SRY A;  2P67 A;  3UM7 A;  4DV2 O;  3ZRV A;  2LO1 A;  4UB8 Z;  3FB5 C;  2BSK B;  1SQV H;  3AK1 A;  3ZMS A;  1S72 V;  1ARO P;  1N36 O;  3RWR D;  1XRE A;  4JTD B;  4EB6 B;  4QE9 A;  3D3Q A;  2F66 C;  1AJP A;  3K5N A;  3OFN G;  2QWO B;  3CXH F;  3CCM V;  3B2E E;  1NZ6 A;  1M56 B;  1NKD A;  2HP8 A;  2OTJ V;  4CBC A;  1NI8 A;  1VAR A;  1YDX A;  4MT8 A;  5EBW C;  4FM1 A;  4FLW A;  2HKO A;  1J5E O;  1M57 B; 
#chains in the Genus database with same CATH homology
 4YHH O;  2UUC O;  2DJV A;  4X62 O;  3M8A A;  4LF7 O;  4X66 O;  1D2D A;  5BY1 A;  4DR7 O;  3OTO O;  1HNX O;  3J80 N;  2UUB O;  2FKX A;  1NS1 A;  5BR8 O;  4DR5 O;  4DV3 O;  4K0K O;  1XEQ A;  1N34 O;  4JI2 O;  4JI4 O;  4A5U B;  1DK1 A;  1IBL O;  2LW7 A;  5FLX N;  2VQF O;  4DV0 O;  1I94 O;  4DUZ O;  2VQE O;  2N74 A;  1FKA O;  4DV6 O;  4DR6 O;  3JAM N;  3SDL A;  2ZKO A;  1XMO O;  4KHP O;  4JI3 O;  2AGA A;  2ZM6 O;  1N33 O;  3O65 A;  4LF5 O;  1KUQ A;  4GKJ O;  5BXZ A;  1AIL A;  4DR3 O;  5IWA O;  3T1Y O;  4DUY O;  1HR0 O;  4B3S O;  4JI0 O;  4LF9 O;  4JYA O;  1IBK O;  1N32 O;  4LFA O;  1XNQ O;  1FJG O;  4DR1 O;  1HNZ O;  4GKK O;  4NXN O;  4X65 O;  4B3M O;  2HHH O;  4NXM O;  4DR4 O;  2UXB O;  1XNR O;  3R66 A;  4JI6 O;  2UXD O;  5IT9 N;  4DV2 O;  4JI5 O;  4B3R O;  3J7A U;  1HNW O;  1X59 A;  2UUA O;  4JI7 O;  1FYJ A;  1A32 A;  3F5T A;  5LMN O;  4DV4 O;  4DR2 O;  4X64 O;  4LF6 O;  4OX9 O;  4DV7 O;  4LFC O;  4LFB O;  1N36 O;  2UXC O;  4DV1 O;  4OPA A;  4JI1 O;  1XMQ O;  1G1X B;  4LF4 O;  4DV5 O;  2E5L O;  2JRI A;  4JV5 O;  4OPH A;  3RT3 C;  5LMU O;  1R1B A;  4LF8 O;  2DOS A;  4YY3 O;  1AB3 A;  4B3T O;  5LL6 Y;  2UU9 O;  1R6T A;  1IBM O;  1YZB A;  4AQY O;  1F7Y A;  3T1H O;  2Z0A A;  5H5N A;  1J5E O;  5A2Q N;  2F4V O;  3J81 N;  4JI8 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...