3SDLA

Crystal structure of human isg15 in complex with ns1 n-terminal region from influenza b virus, northeast structural genomics consortium target ids hx6481, hr2873, and or2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
95
structure length
95
Chain Sequence
TTQIEVGPGATNATINFEAGILECYERFSWQRALDYPGQDRLHRLKRKLESRIKTHNKSEPENKRMSLEERKAIGVKMMKVLLFMDPSAGIEGFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the sequence-specific recognition of human ISG15 by the NS1 protein of influenza B virus.
pubmed doi rcsb
source organism Influenza b virus
molecule tags Viral protein/antiviral protein
molecule keywords Non-structural protein 1
total genus 35
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3sdlA00
3O65A 1HNWO 2F4VO 3J7AU 4JI1O 1FJGO 1HNZO 1N36O 5LL6Y 5IT9N 4GKJO 4JI0O 1IBKO 4LF8O 4YY3O 1DK1A 4DR2O 2HHHO 4DV7O 4LF7O 4DR5O 4X62O 1N32O 4B3RO 1FKAO 2E5LO 1J5EO 4JV5O 2UUCO 1KUQA 2N74A 2VQFO 4K0KO 3RT3C 1N34O 1YZBA 3M8AA 5FLXN 5BR8O 2UUAO 4YHHO 2UXDO 2UUBO 1A32A 4DV1O 1HNXO 1X59A 3SDLA 1XNQO 4DV4O 4DUZO 4OPAA 4DV2O 1R6TA 1NS1A 4DV5O 2DJVA 3F5TA 4DR6O 5LMUO 4JI7O 4OPHA 5H5NA 4X66O 4LF6O 2JRIA 4LF4O 4LF9O 2DOSA 4DV6O 4JI6O 2ZKOA 3T1HO 1N33O 4LFBO 4JI3O 1IBLO 1XEQA 4B3TO 1F7YA 2UXBO 4JI8O 5A2QN 3J81N 4A5UB 4DUYO 3T1YO 4LFCO 4AQYO 4JI5O 4JYAO 5IWAO 2FKXA 4DR1O 1G1XB 5LMNO 4DR4O 4B3MO 4LF5O 2VQEO 3R66A 1D2DA 4DR3O 3J80N 4B3SO 1HR0O 1AILA 1R1BA 2UXCO 4DV0O 1FYJA 2ZM6O 4X64O 3JAMN 5BY1A 4OX9O 4NXMO 4LFAO 4JI4O 2LW7A 2Z0AA 4DR7O 3OTOO 1XMQO 4KHPO 4X65O 1I94O 1IBMO 4DV3O 2UU9O 1XNRO 1AB3A 4JI2O 4NXNO 2AGAA 4GKKO 1XMOO 5BXZA
chains in the Genus database with same CATH superfamily
4F6RB 1AP6A 1VQ7V 2DMXA 1HNWO 3HKBA 3DSQA 1SERA 2O57A 5CB4A 3GWOA 4JI1O 1AJQA 3D36C 1GM9A 1Q81W 4JAUA 2Q6AA 3N2KB 2E5LB 1PL0A 4PV1B 4O2BB 1PV0A 3QF7A 2F93B 2IH1C 4E4EA 4X88A 4DR2B 1YITV 5J2UB 1SA0B 4Z2WA 4DR5B 3RT3C 1K34A 3L71H 1WN7A 2BCCH 1IBKB 1GN3A 1H38A 4UFZA 4CC5A 2H94A 1ZTEA 5KX5B 2QWRB 4I55B 3IFXA 4MT8A 4PA7A 1HW7A 3JAKB 1PKXA 3RYCA 5LP6C 1SKVA 1X59A 1FAFA 4U3JA 1W59A 3B40A 2IU3A 1HNXB 5D5PA 5LMUO 3IAYA 1S76D 2IJIA 4X1KA 5IYCO 3DXRA 2QR4A 3HKCB 1NTMH 4AQYB 1FXHA 2GHYA 1WPBA 2IH3C 2WLHA 3E35A 4TWKA 3CMEV 5LMNO 4R8CA 3SYQA 4DV6B 3X2QC 3FX7A 4H44B 3EHBB 2CH7A 2NLJC 4DR4B 4L87A 2UU9B 4CS3A 1PNLA 3CCLV 3RYIB 1NT2B 4X64O 4LP8A 2G38A 2ZNJA 3CE2A 4O4IB 2PI5A 3SJBC 2Z0AA 5L3DA 3U0ZA 4JZ2A 4KHPO 2YS8A 4X65O 2WLKA 4IHJB 4UV9A 3CCRV 3ABMC 1XNRO 2EINB 1RPRA 4DV0B 4FLWA 2P5OA 2MW2B 2F4VO 4LNUB 3LDEA 3B8MA 2LW1A 1RP3B 3DTUB 2ZE5A 5KHIA 2WLIB 3ZRXA 4X1IB 4LF8O 1KP3A 1UFIA 1YF2A 3OGIB 3K5OA 4UV8A 1JOYA 4X62O 2JJ1G 3GB7C 3MHSC 5IY5B 2ILMA 1OCCC 1KUQA 4X8AA 2D2CB 2UUAB 3CRAA 2CAZC 2GBOA 2QSAA 3D8CA 3RYFA 2VQFB 3D3IA 4WBNA 3OMNB 2KKWA 4RO2A 3G4SV 1M90W 2F66C 1PNKA 2MK3A 1CP9A 1NR7A 2QKSA 5J2UA 2W6IG 1MOFA 4JI5B 1GTOA 1D5AA 2GV9A 1MG1A 2Q7GA 2JEUA 1KB9F 3GVMA 2YXHA 3JD2A 4LF6B 4QPJA 2JGUA 5KUKA 4TUYA 3BPZA 2YIBA 3CEIA 5L3GA 1GMGA 4TV8B 1XQ8A 5BZBA 1SS3A 1XL4A 2W0FC 5EYPA 4B3SB 5JH7A 4WFHA 1IBMB 4PI2A 1I5YA 3ZRVA 1FYJA 1BGYH 3JAMN 4GKKB 1WB7A 1Q6IA 4NXMO 4JI4O 2QDOA 2QWOB 3CCVV 5GTIZ 5F2VO 4FM2A 3ETQA 1B06A 3SGIA 4WFFA 4JTAB 1GM8A 2CE4A 3A0BZ 5GTHZ 1SQXH 5KMGB 3JALA 4JTCB 1LR1A 1Y74B 4PD4F 4HAMA 1ZLZA 3KZIZ 4WBNB 1FXKB 2GTAA 2CDYA 3W7UA 4JI0O 3M7MX 4JYCA 4X20B 1I7FA 1P7GA 3FB7C 1IBKO 4J9YB 4PDVA 2KQXA 1US6A 1B3QA 3SR2C 1E1RG 5C93A 4GZRB 2YXYA 3FB5C 1KP2A 4X1IA 2HKOA 2LJ2A 5E1AC 2KB1A 4O4LA 1FFXB 3ETDA 3K58A 2ZINA 1JCHA 5KHKA 5DEDA 3T1YB 4MTFA 3RFRA 4JI7O 4B08A 4DV4B 4FVMA 2DOSA 3BA9A 1JJ2U 3AG3C 1YIJV 4ZHQA 4DV6O 1KD1W 3P30A 4UCVA 1RM1B 4UB8Z 1FXVA 2QM8A 4LFCO 3ZRWB 3C90A 2CUGA 5IWAO 3WB1A 1VQOV 2DQ0A 4FIPC 2WLNA 3CCEV 3OEHG 2R9RB 1RM1C 2VQEO 3FB8C 4KHPB 1JVMA 4OX9B 1FXKA 1JQ0A 4GYCB 4DV0O 4DR7B 3BABA 2H8PC 4J80A 2IJHA 1YVWA 1AI7A 1Q6UA 5EZYA 3K9SA 2OCHA 2XNDG 5LGNA 1KBHA 2ADQB 5B1BC 2JJ2G 3ASOB 5KHJA 4EFEA 4LF8B 4MVSA 4YY3B 2DYSB 5JCOC 4U3JB 1LUVA 1ZAUA 5KAFZ 4RWUA 2PY5A 5LL6Y 1GO3F 2RCVA 1FS0G 5AG2A 1VQ9V 4QIWF 4FZ1A 3E22A 1DK1A 2OIEA 4FLUA 3ABMB 2JGDB 2Q4PA 3KCYA 2HP8A 1NKDA 2DYRB 3FAVB 2WA4A 5L3EA 1SETA 1SA0A 3ABLB 1Y74A 3SYOA 3ZRWA 1N32B 5B1OA 4ASUG 4YJ3B 2RDCA 3BEHA 5KX5A 3LSQA 3WB2A 3SPIA 1EM1A 1R73A 3RYCB 3E89A 3OR7C 1L8DA 4DR6O 3K79A 5EC2C 4LF9O 1R6NA 4N23A 2UXDB 4LFBO 4GUNA 1S5JA 2Q7EA 1WJZA 5A2QN 1NJIW 3HB3B 2ZQMA 2UXXA 4NXMB 1VQMV 4KXRA 3I5DA 4NKGB 5LP6A 4Q20A 4D6TH 4PI0A 2Q0OC 2PUSA 3U10A 1EN4A 3JD4A 4G28B 2XUMA 4ZHQB 5BY1A 1KU9A 4WFBV 3NXSA 2OYQA 3JATB 4LCUC 2R9IA 4JYYA 2PTMA 3CC7V 2YXLA 1CEZA 2XOKG 4I7ZB 3S3WA 1PD3A 2CTWA 5GONB 2HVKC 3ZHRA 2PF4E 4IYIA 4I9WA 3OTOB 4B3RB 4UCOA 1SQQH 2QGNA 4X89A 5CBHA 2HLDG 4CS4A 3QO7A 1K8AW 3G80A 4O4HA 3SPGA 1AR1B 1TUBA 3RYHA 3LDCA 1H2NA 4TV8A 2WSSG 4I0XB 3AEIA 1DF4A 3JASA 3ASOC 3AG1C 2FYUH 4DK1A 2UUAO 3CYOA 5B1NA 4EFBA 3FAVA 2HR3A 4TQDA 2ARHA 3QO5A 3UO3A 2HVJC 3D3QA 1OCOB 5IWAB 2ZE6A 2P67A 3CRQA 2BTQA 4LH6A 1EN6A 4LBEC 1OCZB 5LBQA 2ZKOA 3STZC 3UQ8A 4YJ3A 1HDJA 1TVKA 1B04A 4DK0A 4I5SA 2Y48A 1IBLB 3OAAG 3OE7G 3ZN0A 3THOA 4CZZA 1PPJH 2C2AA 3SJAC 4O4JB 1OV9A 2ZNIA 5LHIA 4B7EA 1NBMG 1OJHA 1S72V 2WLLA 4JAVA 4B3SO 2XAGA 1NTKH 3DGEA 3JARA 1XMQB 1MNGA 3CC4V 2JS5A 4NR1A 4EB6A 1YTFB 3H1HH 1XHZA 4AHCA 3OGCC 4YJ2B 1NU1H 2EJ7A 2ZDIA 3PN1A 1H2SB 3ZMSA 2P6JA 1HNWB 2AGAA 3G67A 3ZHTA 3OD4A 4PA6A 3HKEB 1S77D 1QR9A 3H1IH 1XILA 1K97A 2LQTA 1CXZB 1R6KA 3OEEG 1GK9A 2XAHA 2UXNA 4GKJO 1NI8A 5EBMC 3ABKC 2HHHO 1Y67A 4DR5O 1MABG 1IDSA 2QEXV 2NN4A 1YJWV 3RWRD 4DW0A 4J11A 2W0XA 1F4MA 3JD3A 4NVPA 1N34O 3RBZA 2FTKA 4X20A 5LXTB 1AI6A 3M8AA 2EILC 1PNMA 2Q0AA 1K4DC 1SZTA 4I55A 4PELA 3ICXA 3ASNC 4DRXA 1HNXO 4CH4A 1M57C 2YICA 2A06H 2YUAA 3EXAA 2OTLV 4YHHB 4WFAV 1Y6XA 3FYIB 2DYRC 4FMTA 4K8XA 1AJPA 2HEPA 3WU2Z 4XDJA 5L3BA 1XEQA 4IL6Z 1SQVH 5J2TB 1IZ3A 1ZSPA 4BAYA 4JI8O 3JATA 2GDSA 3HKBB 3CCJV 4GX2A 2ZR2A 2EIJB 1VQLV 4GX5A 4DR4O 1BS3A 5EBWC 4J7KA 1KQSU 1W0JG 4DR3O 3OUFA 3W7WA 4TUYB 3ZMUA 4K8ZA 2E75B 3QNEA 2WPDG 3AG7A 1GRJA 4OX9O 2HJDA 3HKDB 2PZSA 5DM6V 5EK0A 5C8YB 5KHGA 3BFRA 4TT3G 1XMOB 2AW9A 1U97A 1XOUA 3JAKA 2FMLA 2BSKA 3H1KH 1GN4A 5IJ9A 2ETNA 2EIMC 5EBLC 2ZE8A 3K0DA 4F4LA 2W6JG 5IT9N 1AR5A 2EILB 1FFXA 3E83A 3W7XA 1WA8A 1V9PA 1XDCA 1OCOC 1DGSA 1DF5A 2EZOA 1NZ6A 1K3EA 3RW0A 4FLVA 2EIKC 2VQFO 4K0KO 3AG4C 1X4TA 4DV5B 3E22B 1BQ0A 4K35A 2Y4UA 1AP5A 4ZBMA 5H2FZ 3CCMV 5CN0A 1HWYA 1P4RA 2UUBO 2LGWA 3NR7A 1G8MA 2B9ZA 4IYHA 1URFA 2EIMB 3K5MA 1QBZA 4LF6O 3Q4HB 1M57B 3JAWA 3ML0A 4U3FH 1S5HC 4DR6B 2QKAA 4YIPA 4B3TO 2HJFC 3CC2V 4TOIA 4OGQB 3J81N 4DUYO 1VF7A 5LMUB 1XBLA 3CP1A 1Y4MA 2JEXA 4JGSA 4ZOLB 1RPOA 4FPPA 4FM0A 2ZXWC 3BA8A 4I9QA 4DW1A 4NTWA 3E8BA 3UT5B 1JR9A 2ZD9A 4D7SA 3ZRSA 3RYIA 3KKYA 3HR0A 5D5QA 1NR1A 5IYZA 4DV3O 1QU7A 1YCIA 4JI2O 2EBOA 2K1EA 3SPJA 3SYPA 1F51A 3CCQV 2XT9A 1V54C 3MHHC 1MSDA 2BOCC 3O65A 3TXSA 3N2GB 2EIJC 1GKFA 3S3XA 5EZYB 1HNZO 2R70A 3UM7A 4ZI7A 1WLEA 1RSOA 1V54B 2M7WA 3B2EE 1QLEB 4LF7O 4XDKA 2LFSA 2A0LA 1H2LA 2N74A 3ZX6A 2LO1A 4ICGA 1S0VA 3UKMA 5E79Z 4PJ0Z 3ZEDA 2Q7HA 2EZPA 1WP8A 3WG7B 3ABTA 4U7NA 5CBFA 1ZL8B 2IJJA 1ORQC 4X62B 1K4CC 1L0LH 1A32A 1WA8B 2Q67A 3RN4A 4DV1O 3FYEB 2OCCB 3MDSA 4DV4O 4MVRA 3ASNB 1NS1A 2Z5UA 3F5TA 3ZHQA 4OPHA 1BCCH 1YTFD 5JQGB 4BW9A 4J9ZB 4YIOA 1K5QA 1KYOF 4J10A 3L9DA 2YI9A 4UXNA 1W2BU 4FM1A 2YIBD 1QLNA 1SQFA 3SYCA 1VQ8V 4JYAO 5L3FA 3ZIAG 3JSLA 4B3MO 5GONA 2L35A 2P22C 4BIUA 4MTXA 3T4ZA 4FFKA 5IJ9B 5B1BB 1EFRG 4LR3A 3G6EV 3CMAV 4G27B 2UXCB 2FL4A 2LW7A 2N05A 5IJ0A 3TJTA 2YDEA 4IIJA 2QTSA 1I94O 4HNAA 1IBMO 3A0RA 4JYBA 2RN9A 1TGOA 1THZA 2YIAA 4DXWA 4CBCA 1AJNA 4LFAB 3J7AU 2PI4A 5LGUA 3APOA 4HZ3A 4B7KA 1TA8A 4PA3A 3A0HZ 1Z2GA 4QE9A 3ZMTA 1VQ4V 2UUCB 4J41A 1XI1A 1EZVH 3ABLC 3OW2U 5K1PA 1NVPB 1OCRC 2ZIMA 4JV5O 4HBNA 2JGDA 2HHHB 3CX5F 3CXCU 3EFFK 1YHQV 4JI0B 3C3TA 1BMFG 1U96A 3CRMA 5L3CA 3CJHA 3W7TA 3M99B 4AILC 1VARA 2A3QA 1YJ9V 1MMMA 3SDLA 4B3TB 1N8RW 4Q6GA 4LF9B 1I0HA 4FZ0A 2L6LA 3DXRB 5IYBO 5FNVB 1M4UA 4F6RA 2UXBB 3G6BA 4X1KB 1AI4A 2VS0A 3SJCC 2A9HA 1M93A 4FK5C 3LNNA 3X2QB 3ZMZA 1NQTA 1QR8A 3T1YO 2Y69C 4J7ZA 2ZM6B 2LP7A 4JI8B 2IW5A 2ZE7A 4H33A 3HKEA 2AXTZ 1RFYA 1NH2D 2CGNA 4FJCC 1K7DA 1H2GA 4K3AA 1SC5B 4QJFB 3CXHF 2EJRA 1MZEA 4EEQA 1RSOB 2K9PA 3CRRA 2VWJA 3BY6A 1HNZB 1N36B 4PA4A 4QE7A 1AROP 4CH5A 1XMOO 5BXZA 3LUTB 4LF7B 2ZIOA 1MSWD 1JA8A 1COWG 4LNUA 2IM9A 2P90A 3QG5A 1ZWIC 4NXNB 1R3KC 2DWEC 4YY3O 3D36A 3T2MA 1UJWB 4X1YB 5CA0B 1WB8A 5JWPA 2RJZA 3CRCA 4QNHB 4DV1B 1NH2B 1PM9A 4PHZA 3ZMVA 3GWKC 2PGGA 4UUJC 3EVKA 2VRZA 3B09A 1I5XA 3T1HB 1PL4A 1N0JA 5BR8B 2P06A 4JAAA 1H2KA 4OPAA 3ZHVA 2XHBA 3LSUA 2DJVA 4JI6B 1WP7A 4X66O 3CWBH 3SJQC 1JX9A 2IJKA 2QWNB 1IBLO 5HFMA 5ITZA 5JVDA 3CJHB 1BSMA 1JJOA 3IC9A 1N33B 1R3LC 2DWDC 5LA6A 3BHPA 2WLJA 1YI2V 2YI8A 1VF5B 4MS2A 4G2KA 4LF5O 1XUQA 4BW5A 4CH6A 1K73W 4TV9B 1I94B 1K5SA 3CPWU 5JH7B 1HR0O 4XBFA 4I0XA 5J2TA 5KLVH 2D3OW 2YEVA 2CGOA 5JJJB 3N27A 1EBOA 4MVZA 4QGPA 5K1XA 2ZCEA 4LFAO 1Q90D 2EULA 3OMAB 5J9PC 4MVQA 1W0KG 1AB3A 3LNMB 3ZN1A 4YJ2A 4JASA 1KKDA 1VF6C 4RUFA 3C3SA 5B3SB 5H6QA 4PDMA 5LHGA 4JI2B 1L1FA 3BVOA 1IXMA 2E76B 3MD0A 2OCCC 4GKJB 1J95A 1KKCA 3A8TA 3AK1A 5C8YA 1FJGB 2KG7B 1S3JA 3E8GA 3OMIB 2HG5C 4B3RO 1QCEA 1FKAO 1N34B 4NTXA 3TGUH 3VOUA 3VQVA 1S5LZ 3CB2A 4KL1A 4UB6Z 4PDRA 1N0NA 3VQXA 2R72A 5LA6B 4DUZB 4DV2B 3B77A 4YHHO 1ZL8A 5CA1A 4CC6A 1Q6HA 4KFMA 3CD6V 2EIKB 1XNQO 3CHXA 3B8NA 1HP8A 4DRXB 1SRYA 4LF4B 4PDLA 3P32A 3ZCCA 4WCEV 1QVGU 2QWQB 2ZXWB 1SESA 4ZIBA 1GH6A 3DC6A 3ZBHA 4JI3B 1BQZA 3T1CA 2FKXA 1G1XB 4DR3B 1E79G 4O2BA 2EX3A 3FB6C 1XREA 3HPLC 1P7BA 4LH7A 1YEWA 3R66A 4DR1B 1D2DA 2WAMA 4GCZA 3MAQA 5ITZB 1AILA 5KA5A 1XNRB 1O9GA 4N21A 2WLMA 1PP9H 3P3NA 2CTQA 3P3PA 1MZFA 4R50A 2DE0X 5B66Z 1E1QG 3PJSK 1OCCB 4IT5A 2XTAA 4WFGA 3K0GA 1OZ0A 2LGQA 2BOBC 1Q86W 3ETEA 4U7OA 5TISZ 2X6AA 3OM3B 4NXNO 2H3OA 2AHYA 2Y0PA 4RQFA 1Q82W 1K33A 1BHAA 2YEVB 2XAQA 4KUMA 3E8FA 4UCSA 5IYZB 4I4TB 4JI1B 3F7VC 2CH7B 2YIDA 2JVDA 3FD9A 4K0KB 5CA3A 1GN6A 1Y66A 5IYDO 3B4SA 2E5LO 2DW4A 3L75H 2UUCO 3ZS8C 3CS5A 4AI8A 4JV5B 2CK3G 5FL7G 5BMVB 2NNUA 1K9MW 4RAIA 3ABUA 1GM7A 4KP4A 2WWWA 2KG7A 3BRCA 1T5EA 2GUZB 3TK1A 1R6TA 1DLBA 2Y69B 3AK3A 1UPGA 5H5NA 2Z3YA 1MA1A 1ENVA 3K5NA 2B1GA 2DN9A 4JZGA 3TXQA 1LUWA 1F7YA 2UXBO 3TETA 3DC5A 2XASA 1YSCA 4AQYO 1IXBA 2JS3A 4FLYA 4JI4B 3ZHSA 4Z1VA 4X9QA 2GTSA 1R1BA 3AK2A 3F7YC 4C7UA 3IC7A 1AI5A 4IGGA 1VQKV 2ITDC 5LHHA 3WFVA 2DYSC 1FXKC 1M9NA 4X64B 4UCUA 4J42A 2N04A 4FLTA 5KMGA 1YDXA 3E86A 1V55C 2Q5ZA 1Q7YW 4NB5A 3OFNG 3APQA 2BTQB 5FPOA 5BMVA 3HKDA 4GX1A 2E3CA 1H2MA 2F1MA 2CTPA 3WB0A 4DV7B 3K3WA 3QTCA 1V55B 5CA1B 2LFRA 4MTGA 1J5EB 1AVMA 3W7SA 1YXBA 1WPXA 4O4HB 3K5LA 3T4DA 4CH3A 3JD1A 1FFTB 1QNMA 3JASB 4GT1A 1XNQB 1B6QA 4W4KA 4ABMA 1KECA 2F23A 1KMIZ 3JYCA 4I4TA 2V1DA 4JI7B 2PYJA 4I50B 4UCTA 3SYAA 2RNBA 2QTOA 1ZX3A 2X0LA 3K59A 4DV5O 2YSUB 5EC1C 4L8JA 3L73H 4JI6O 2UUBB 1I08A 4NYKA 2PYLA 4X66B 3K08A 2GUZA 4P9OA 4QPKA 5EYPB 1JFFA 1ZUQA 2ADPA 1TUBB 1DTOA 4UVAA 1XL6A 3BCCH 5IY5C 5FNVA 4WFEA 1VP7A 5FPRA 3E2EA 5JVDB 3CCUV 4BIZA 4DUYB 4LF5B 2UXCO 1BL8A 4DYLA 3CSXA 4O4LB 4BWAA 1OHHG 1F23A 2A7WA 1AR4A 4NTYA 4EKWA 2X7RB 4JPRA 3TCUA 1VQ6V 4JTDB 1F4NA 3IJ4A 4UCRA 3VQWA 1CPYA 3CCSV 3VQYA 2QM7A 4MSWC 2IU0A 4RUEA 4DV3B 3N2KA 3RGBA 3K9AA 1GAXA 5H9CA 1IVSA 2XAFA 1Q43A 4DR2O 2DQ3A 3K04A 1N32O 4MW3A 4OXSA 4CS2A 4MVOA 2JK5C 4TQFA 5JJEB 4FLZA 2QKCA 4GX0A 2OT5A 1BZKA 3RVZA 4X1YA 5CA0A 5LOVB 3JCZA 1JFFB 1P49A 1QLEC 2V4DA 2UXDO 3FKSG 1M1KW 3KCXA 4H13B 4DUZO 4DV2O 1BT8A 2E74B 4H37A 1FD9A 2X6CA 1VQ5V 4LF4O 4JF3A 3I55V 3G71V 1H8EG 5JQGA 2ZR3A 4WF9V 3OT7A 4A5UB 4UVCA 2QE7G 1O9HA 4UVBA 3H01A 4P30A 2CTRA 2BTOA 1SQGA 4P9PA 4O4IA 4RQEA 3K57A 4TSFG 4LFCB 5KA6A 3LDDA 4J7JA 4F6EA 3J80N 1L0NH 3OUSA 2RMKB 4JYAB 1M56B 4H0LB 1QVFU 1NVPD 4B3MB 4DR7O 2ITCC 2P4KA 2Q69A 3RVYA 3OTOO 1SQBH 1OCRB 2F95B 4MVUA 1TUEB 2QA4V 1SQPH 3K06A 2WA3A 4TV9A 1IURA 1SZXA 1G6UA 2BSKB 3WG7C 1GN2A 3LSSA 2F4VB 1Q8IA 3HKCA 3VBBA 1LNQA 1WNSA 2P7TC 3AG2B 3IGAC 4HNAB 4O2AA 2QM4A 2AZ2A 2ATKC 5LP6B 5B1AC 5LYJB 4FFBA 3RYFB 4XDLA 2BE3A 1Z5WA 4R6ZA 3SPCA 1VMGA 2X6BA 4ZOLA 1VEWA 1EN5A 1P84F 3H9VA 2QJ1A 2Y4TA 1YZBA 2HFEC 5KAIZ 3L72H 1OCZC 5DN6G 4IHJA 2RQ6A 3H1JH 5BR8O 1IX9A 3L70H 1K92A 3AG4B 3K03A 3BAAA 2OTJV 3KG2A 5CMUA 3N2GA 2M6YA 5B1AB 3Q4HA 5LOVA 1N33O 3E8HA 2AZ0A 5HFLA 3UCSC 4ZKIA 1TAEA 4DO2A 4LFBB 4P2ZA 5KHHA 2ZT9B 2B1IA 3JARB 2V7QG 4EB6B 5B3SC 2WLLB 1JPXA 2F43G 3L74H 2B5UA 2FB5A 3AG3B 4HYOA 3ABKB 5A9GA 1QHTA 4O2AB 5CB4B 3ZHUA 2ZM6O 1Y76B 5LMNB 1YJNV 2JDIG 1JMKC 1R3JC 1ROPA 3H1LH 1EZJA 2Q9LA 1SF9A 2OIGA 1M56C 5CBGA 2UU9O 5B5EZ 3QO8A 1VIBA 5LGTA 1H8HG 5EIBC 4YXWG 1N4CA 5EIBD 4MTOA 1FPOA 3JAWB 1BHBA 5IDJA 4Z1MG 4X65B 4ZI7B 1FJGO 1TVKB 3JD0A 1N36O 3UO2A 2QWPB 4D7TA 2P4VA 4O4JA 1VQPV 3RYHB 3JSNA 4LWSA 4E2LA 4DV7O 1BE3H 1J5EO 5LXTA 2YC0A 1R3IC 3ETGA 5IE9A 1KC8W 1Q5OA 5FLXN 3OR6C 5LYJA 3FFQA 3UT5A 5IJ0B 2NR5A 3STLC 1NTZH 1VF6A 1Z5VA 2WLIA 3AG2C 3JALB 1WAZA 5KUMA 3R65A 2OWOA 2Q8VA 2ZDIC 2JRIA 4I50A 1Y76A 5JJNB 3T1HO 4JI3O 3SPHA 2EINC 3AG1B 2VWKA 3OTFA 3A2FA 3ZJZA 3I56V 3F5WC 4JI5O 2ODMA 2VQEB 3JCUZ 4DR1O 1Q3EA 5GW7A 2KSDA 4GLXA 2Q68A 1XHXA 3QVNA 5JCOA 5DECA 1D5NA 2Q73A 2GSMB 1QQCA 3O9OA 1M5IA 4LC1A 4FLXA 2A79B 1VQNV 5H6RA 4MW8A 4BIOA 4IIJB 2R9AA 2JIZG 4LWSB 1G4YB 4W4LA 2AHZA 4FFBB 2Y0IA 1XMQO 2XAJA 4R7CA 4MVMA 4PA9A 1HR0B 2IBZH 4BR6A 4GKKO 3U11A
chains in the Genus database with same CATH topology
3O65A 1HNWO 2F4VO 3J7AU 4JI1O 1FJGO 1HNZO 1N36O 5LL6Y 5IT9N 4GKJO 4JI0O 1IBKO 4LF8O 4YY3O 1DK1A 4DR2O 2HHHO 4DV7O 4LF7O 4DR5O 4X62O 1N32O 4B3RO 1FKAO 2E5LO 1J5EO 4JV5O 2UUCO 1KUQA 2N74A 2VQFO 4K0KO 3RT3C 1N34O 1YZBA 3M8AA 5FLXN 5BR8O 2UUAO 4YHHO 2UXDO 2UUBO 1A32A 4DV1O 1HNXO 1X59A 3SDLA 1XNQO 4DV4O 4DUZO 4OPAA 4DV2O 1R6TA 1NS1A 4DV5O 2DJVA 3F5TA 4DR6O 5LMUO 4JI7O 4OPHA 5H5NA 4X66O 4LF6O 2JRIA 4LF4O 4LF9O 2DOSA 4DV6O 4JI6O 2ZKOA 3T1HO 1N33O 4LFBO 4JI3O 1IBLO 1XEQA 4B3TO 1F7YA 2UXBO 4JI8O 5A2QN 3J81N 4A5UB 4DUYO 3T1YO 4LFCO 4AQYO 4JI5O 4JYAO 5IWAO 2FKXA 4DR1O 1G1XB 5LMNO 4DR4O 4B3MO 4LF5O 2VQEO 3R66A 1D2DA 4DR3O 3J80N 4B3SO 1HR0O 1AILA 1R1BA 2UXCO 4DV0O 1FYJA 2ZM6O 4X64O 3JAMN 5BY1A 4OX9O 4NXMO 4LFAO 4JI4O 2LW7A 2Z0AA 4DR7O 3OTOO 1XMQO 4KHPO 4X65O 1I94O 1IBMO 4DV3O 2UU9O 1XNRO 1AB3A 4JI2O 4NXNO 2AGAA 4GKKO 1XMOO 5BXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O65 A;  1HNW O;  2F4V O;  3J7A U;  4JI1 O;  1FJG O;  1HNZ O;  1N36 O;  5LL6 Y;  5IT9 N;  4GKJ O;  4JI0 O;  1IBK O;  4LF8 O;  4YY3 O;  1DK1 A;  4DR2 O;  2HHH O;  4DV7 O;  4LF7 O;  4DR5 O;  4X62 O;  1N32 O;  4B3R O;  1FKA O;  2E5L O;  1J5E O;  4JV5 O;  2UUC O;  1KUQ A;  2N74 A;  2VQF O;  4K0K O;  3RT3 C;  1N34 O;  1YZB A;  3M8A A;  5FLX N;  5BR8 O;  2UUA O;  4YHH O;  2UXD O;  2UUB O;  1A32 A;  4DV1 O;  1HNX O;  1X59 A;  3SDL A;  1XNQ O;  4DV4 O;  4DUZ O;  4OPA A;  4DV2 O;  1R6T A;  1NS1 A;  4DV5 O;  2DJV A;  3F5T A;  4DR6 O;  5LMU O;  4JI7 O;  4OPH A;  5H5N A;  4X66 O;  4LF6 O;  2JRI A;  4LF4 O;  4LF9 O;  2DOS A;  4DV6 O;  4JI6 O;  2ZKO A;  3T1H O;  1N33 O;  4LFB O;  4JI3 O;  1IBL O;  1XEQ A;  4B3T O;  1F7Y A;  2UXB O;  4JI8 O;  5A2Q N;  3J81 N;  4A5U B;  4DUY O;  3T1Y O;  4LFC O;  4AQY O;  4JI5 O;  4JYA O;  5IWA O;  2FKX A;  4DR1 O;  1G1X B;  5LMN O;  4DR4 O;  4B3M O;  4LF5 O;  2VQE O;  3R66 A;  1D2D A;  4DR3 O;  3J80 N;  4B3S O;  1HR0 O;  1AIL A;  1R1B A;  2UXC O;  4DV0 O;  1FYJ A;  2ZM6 O;  4X64 O;  3JAM N;  5BY1 A;  4OX9 O;  4NXM O;  4LFA O;  4JI4 O;  2LW7 A;  2Z0A A;  4DR7 O;  3OTO O;  1XMQ O;  4KHP O;  4X65 O;  1I94 O;  1IBM O;  4DV3 O;  2UU9 O;  1XNR O;  1AB3 A;  4JI2 O;  4NXN O;  2AGA A;  4GKK O;  1XMO O;  5BXZ A; 
#chains in the Genus database with same CATH topology
 4F6R B;  1AP6 A;  1VQ7 V;  2DMX A;  1HNW O;  3HKB A;  3DSQ A;  1SER A;  2O57 A;  5CB4 A;  3GWO A;  4JI1 O;  1AJQ A;  3D36 C;  1GM9 A;  1Q81 W;  4JAU A;  2Q6A A;  3N2K B;  2E5L B;  1PL0 A;  4PV1 B;  4O2B B;  1PV0 A;  3QF7 A;  2F93 B;  2IH1 C;  4E4E A;  4X88 A;  4DR2 B;  1YIT V;  5J2U B;  1SA0 B;  4Z2W A;  4DR5 B;  3RT3 C;  1K34 A;  3L71 H;  1WN7 A;  2BCC H;  1IBK B;  1GN3 A;  1H38 A;  4UFZ A;  4CC5 A;  2H94 A;  1ZTE A;  5KX5 B;  2QWR B;  4I55 B;  3IFX A;  4MT8 A;  4PA7 A;  1HW7 A;  3JAK B;  1PKX A;  3RYC A;  5LP6 C;  1SKV A;  1X59 A;  1FAF A;  4U3J A;  1W59 A;  3B40 A;  2IU3 A;  1HNX B;  5D5P A;  5LMU O;  3IAY A;  1S76 D;  2IJI A;  4X1K A;  5IYC O;  3DXR A;  2QR4 A;  3HKC B;  1NTM H;  4AQY B;  1FXH A;  2GHY A;  1WPB A;  2IH3 C;  2WLH A;  3E35 A;  4TWK A;  3CME V;  5LMN O;  4R8C A;  3SYQ A;  4DV6 B;  3X2Q C;  3FX7 A;  4H44 B;  3EHB B;  2CH7 A;  2NLJ C;  4DR4 B;  4L87 A;  2UU9 B;  4CS3 A;  1PNL A;  3CCL V;  3RYI B;  1NT2 B;  4X64 O;  4LP8 A;  2G38 A;  2ZNJ A;  3CE2 A;  4O4I B;  2PI5 A;  3SJB C;  2Z0A A;  5L3D A;  3U0Z A;  4JZ2 A;  4KHP O;  2YS8 A;  4X65 O;  2WLK A;  4IHJ B;  4UV9 A;  3CCR V;  3ABM C;  1XNR O;  2EIN B;  1RPR A;  4DV0 B;  4FLW A;  2P5O A;  2MW2 B;  2F4V O;  4LNU B;  3LDE A;  3B8M A;  2LW1 A;  1RP3 B;  3DTU B;  2ZE5 A;  5KHI A;  2WLI B;  3ZRX A;  4X1I B;  4LF8 O;  1KP3 A;  1UFI A;  1YF2 A;  3OGI B;  3K5O A;  4UV8 A;  1JOY A;  4X62 O;  2JJ1 G;  3GB7 C;  3MHS C;  5IY5 B;  2ILM A;  1OCC C;  1KUQ A;  4X8A A;  2D2C B;  2UUA B;  3CRA A;  2CAZ C;  2GBO A;  2QSA A;  3D8C A;  3RYF A;  2VQF B;  3D3I A;  4WBN A;  3OMN B;  2KKW A;  4RO2 A;  3G4S V;  1M90 W;  2F66 C;  1PNK A;  2MK3 A;  1CP9 A;  1NR7 A;  2QKS A;  5J2U A;  2W6I G;  1MOF A;  4JI5 B;  1GTO A;  1D5A A;  2GV9 A;  1MG1 A;  2Q7G A;  2JEU A;  1KB9 F;  3GVM A;  2YXH A;  3JD2 A;  4LF6 B;  4QPJ A;  2JGU A;  5KUK A;  4TUY A;  3BPZ A;  2YIB A;  3CEI A;  5L3G A;  1GMG A;  4TV8 B;  1XQ8 A;  5BZB A;  1SS3 A;  1XL4 A;  2W0F C;  5EYP A;  4B3S B;  5JH7 A;  4WFH A;  1IBM B;  4PI2 A;  1I5Y A;  3ZRV A;  1FYJ A;  1BGY H;  3JAM N;  4GKK B;  1WB7 A;  1Q6I A;  4NXM O;  4JI4 O;  2QDO A;  2QWO B;  3CCV V;  5GTI Z;  5F2V O;  4FM2 A;  3ETQ A;  1B06 A;  3SGI A;  4WFF A;  4JTA B;  1GM8 A;  2CE4 A;  3A0B Z;  5GTH Z;  1SQX H;  5KMG B;  3JAL A;  4JTC B;  1LR1 A;  1Y74 B;  4PD4 F;  4HAM A;  1ZLZ A;  3KZI Z;  4WBN B;  1FXK B;  2GTA A;  2CDY A;  3W7U A;  4JI0 O;  3M7M X;  4JYC A;  4X20 B;  1I7F A;  1P7G A;  3FB7 C;  1IBK O;  4J9Y B;  4PDV A;  2KQX A;  1US6 A;  1B3Q A;  3SR2 C;  1E1R G;  5C93 A;  4GZR B;  2YXY A;  3FB5 C;  1KP2 A;  4X1I A;  2HKO A;  2LJ2 A;  5E1A C;  2KB1 A;  4O4L A;  1FFX B;  3ETD A;  3K58 A;  2ZIN A;  1JCH A;  5KHK A;  5DED A;  3T1Y B;  4MTF A;  3RFR A;  4JI7 O;  4B08 A;  4DV4 B;  4FVM A;  2DOS A;  3BA9 A;  1JJ2 U;  3AG3 C;  1YIJ V;  4ZHQ A;  4DV6 O;  1KD1 W;  3P30 A;  4UCV A;  1RM1 B;  4UB8 Z;  1FXV A;  2QM8 A;  4LFC O;  3ZRW B;  3C90 A;  2CUG A;  5IWA O;  3WB1 A;  1VQO V;  2DQ0 A;  4FIP C;  2WLN A;  3CCE V;  3OEH G;  2R9R B;  1RM1 C;  2VQE O;  3FB8 C;  4KHP B;  1JVM A;  4OX9 B;  1FXK A;  1JQ0 A;  4GYC B;  4DV0 O;  4DR7 B;  3BAB A;  2H8P C;  4J80 A;  2IJH A;  1YVW A;  1AI7 A;  1Q6U A;  5EZY A;  3K9S A;  2OCH A;  2XND G;  5LGN A;  1KBH A;  2ADQ B;  5B1B C;  2JJ2 G;  3ASO B;  5KHJ A;  4EFE A;  4LF8 B;  4MVS A;  4YY3 B;  2DYS B;  5JCO C;  4U3J B;  1LUV A;  1ZAU A;  5KAF Z;  4RWU A;  2PY5 A;  5LL6 Y;  1GO3 F;  2RCV A;  1FS0 G;  5AG2 A;  1VQ9 V;  4QIW F;  4FZ1 A;  3E22 A;  1DK1 A;  2OIE A;  4FLU A;  3ABM B;  2JGD B;  2Q4P A;  3KCY A;  2HP8 A;  1NKD A;  2DYR B;  3FAV B;  2WA4 A;  5L3E A;  1SET A;  1SA0 A;  3ABL B;  1Y74 A;  3SYO A;  3ZRW A;  1N32 B;  5B1O A;  4ASU G;  4YJ3 B;  2RDC A;  3BEH A;  5KX5 A;  3LSQ A;  3WB2 A;  3SPI A;  1EM1 A;  1R73 A;  3RYC B;  3E89 A;  3OR7 C;  1L8D A;  4DR6 O;  3K79 A;  5EC2 C;  4LF9 O;  1R6N A;  4N23 A;  2UXD B;  4LFB O;  4GUN A;  1S5J A;  2Q7E A;  1WJZ A;  5A2Q N;  1NJI W;  3HB3 B;  2ZQM A;  2UXX A;  4NXM B;  1VQM V;  4KXR A;  3I5D A;  4NKG B;  5LP6 A;  4Q20 A;  4D6T H;  4PI0 A;  2Q0O C;  2PUS A;  3U10 A;  1EN4 A;  3JD4 A;  4G28 B;  2XUM A;  4ZHQ B;  5BY1 A;  1KU9 A;  4WFB V;  3NXS A;  2OYQ A;  3JAT B;  4LCU C;  2R9I A;  4JYY A;  2PTM A;  3CC7 V;  2YXL A;  1CEZ A;  2XOK G;  4I7Z B;  3S3W A;  1PD3 A;  2CTW A;  5GON B;  2HVK C;  3ZHR A;  2PF4 E;  4IYI A;  4I9W A;  3OTO B;  4B3R B;  4UCO A;  1SQQ H;  2QGN A;  4X89 A;  5CBH A;  2HLD G;  4CS4 A;  3QO7 A;  1K8A W;  3G80 A;  4O4H A;  3SPG A;  1AR1 B;  1TUB A;  3RYH A;  3LDC A;  1H2N A;  4TV8 A;  2WSS G;  4I0X B;  3AEI A;  1DF4 A;  3JAS A;  3ASO C;  3AG1 C;  2FYU H;  4DK1 A;  2UUA O;  3CYO A;  5B1N A;  4EFB A;  3FAV A;  2HR3 A;  4TQD A;  2ARH A;  3QO5 A;  3UO3 A;  2HVJ C;  3D3Q A;  1OCO B;  5IWA B;  2ZE6 A;  2P67 A;  3CRQ A;  2BTQ A;  4LH6 A;  1EN6 A;  4LBE C;  1OCZ B;  5LBQ A;  2ZKO A;  3STZ C;  3UQ8 A;  4YJ3 A;  1HDJ A;  1TVK A;  1B04 A;  4DK0 A;  4I5S A;  2Y48 A;  1IBL B;  3OAA G;  3OE7 G;  3ZN0 A;  3THO A;  4CZZ A;  1PPJ H;  2C2A A;  3SJA C;  4O4J B;  1OV9 A;  2ZNI A;  5LHI A;  4B7E A;  1NBM G;  1OJH A;  1S72 V;  2WLL A;  4JAV A;  4B3S O;  2XAG A;  1NTK H;  3DGE A;  3JAR A;  1XMQ B;  1MNG A;  3CC4 V;  2JS5 A;  4NR1 A;  4EB6 A;  1YTF B;  3H1H H;  1XHZ A;  4AHC A;  3OGC C;  4YJ2 B;  1NU1 H;  2EJ7 A;  2ZDI A;  3PN1 A;  1H2S B;  3ZMS A;  2P6J A;  1HNW B;  2AGA A;  3G67 A;  3ZHT A;  3OD4 A;  4PA6 A;  3HKE B;  1S77 D;  1QR9 A;  3H1I H;  1XIL A;  1K97 A;  2LQT A;  1CXZ B;  1R6K A;  3OEE G;  1GK9 A;  2XAH A;  2UXN A;  4GKJ O;  1NI8 A;  5EBM C;  3ABK C;  2HHH O;  1Y67 A;  4DR5 O;  1MAB G;  1IDS A;  2QEX V;  2NN4 A;  1YJW V;  3RWR D;  4DW0 A;  4J11 A;  2W0X A;  1F4M A;  3JD3 A;  4NVP A;  1N34 O;  3RBZ A;  2FTK A;  4X20 A;  5LXT B;  1AI6 A;  3M8A A;  2EIL C;  1PNM A;  2Q0A A;  1K4D C;  1SZT A;  4I55 A;  4PEL A;  3ICX A;  3ASN C;  4DRX A;  1HNX O;  4CH4 A;  1M57 C;  2YIC A;  2A06 H;  2YUA A;  3EXA A;  2OTL V;  4YHH B;  4WFA V;  1Y6X A;  3FYI B;  2DYR C;  4FMT A;  4K8X A;  1AJP A;  2HEP A;  3WU2 Z;  4XDJ A;  5L3B A;  1XEQ A;  4IL6 Z;  1SQV H;  5J2T B;  1IZ3 A;  1ZSP A;  4BAY A;  4JI8 O;  3JAT A;  2GDS A;  3HKB B;  3CCJ V;  4GX2 A;  2ZR2 A;  2EIJ B;  1VQL V;  4GX5 A;  4DR4 O;  1BS3 A;  5EBW C;  4J7K A;  1KQS U;  1W0J G;  4DR3 O;  3OUF A;  3W7W A;  4TUY B;  3ZMU A;  4K8Z A;  2E75 B;  3QNE A;  2WPD G;  3AG7 A;  1GRJ A;  4OX9 O;  2HJD A;  3HKD B;  2PZS A;  5DM6 V;  5EK0 A;  5C8Y B;  5KHG A;  3BFR A;  4TT3 G;  1XMO B;  2AW9 A;  1U97 A;  1XOU A;  3JAK A;  2FML A;  2BSK A;  3H1K H;  1GN4 A;  5IJ9 A;  2ETN A;  2EIM C;  5EBL C;  2ZE8 A;  3K0D A;  4F4L A;  2W6J G;  5IT9 N;  1AR5 A;  2EIL B;  1FFX A;  3E83 A;  3W7X A;  1WA8 A;  1V9P A;  1XDC A;  1OCO C;  1DGS A;  1DF5 A;  2EZO A;  1NZ6 A;  1K3E A;  3RW0 A;  4FLV A;  2EIK C;  2VQF O;  4K0K O;  3AG4 C;  1X4T A;  4DV5 B;  3E22 B;  1BQ0 A;  4K35 A;  2Y4U A;  1AP5 A;  4ZBM A;  5H2F Z;  3CCM V;  5CN0 A;  1HWY A;  1P4R A;  2UUB O;  2LGW A;  3NR7 A;  1G8M A;  2B9Z A;  4IYH A;  1URF A;  2EIM B;  3K5M A;  1QBZ A;  4LF6 O;  3Q4H B;  1M57 B;  3JAW A;  3ML0 A;  4U3F H;  1S5H C;  4DR6 B;  2QKA A;  4YIP A;  4B3T O;  2HJF C;  3CC2 V;  4TOI A;  4OGQ B;  3J81 N;  4DUY O;  1VF7 A;  5LMU B;  1XBL A;  3CP1 A;  1Y4M A;  2JEX A;  4JGS A;  4ZOL B;  1RPO A;  4FPP A;  4FM0 A;  2ZXW C;  3BA8 A;  4I9Q A;  4DW1 A;  4NTW A;  3E8B A;  3UT5 B;  1JR9 A;  2ZD9 A;  4D7S A;  3ZRS A;  3RYI A;  3KKY A;  3HR0 A;  5D5Q A;  1NR1 A;  5IYZ A;  4DV3 O;  1QU7 A;  1YCI A;  4JI2 O;  2EBO A;  2K1E A;  3SPJ A;  3SYP A;  1F51 A;  3CCQ V;  2XT9 A;  1V54 C;  3MHH C;  1MSD A;  2BOC C;  3O65 A;  3TXS A;  3N2G B;  2EIJ C;  1GKF A;  3S3X A;  5EZY B;  1HNZ O;  2R70 A;  3UM7 A;  4ZI7 A;  1WLE A;  1RSO A;  1V54 B;  2M7W A;  3B2E E;  1QLE B;  4LF7 O;  4XDK A;  2LFS A;  2A0L A;  1H2L A;  2N74 A;  3ZX6 A;  2LO1 A;  4ICG A;  1S0V A;  3UKM A;  5E79 Z;  4PJ0 Z;  3ZED A;  2Q7H A;  2EZP A;  1WP8 A;  3WG7 B;  3ABT A;  4U7N A;  5CBF A;  1ZL8 B;  2IJJ A;  1ORQ C;  4X62 B;  1K4C C;  1L0L H;  1A32 A;  1WA8 B;  2Q67 A;  3RN4 A;  4DV1 O;  3FYE B;  2OCC B;  3MDS A;  4DV4 O;  4MVR A;  3ASN B;  1NS1 A;  2Z5U A;  3F5T A;  3ZHQ A;  4OPH A;  1BCC H;  1YTF D;  5JQG B;  4BW9 A;  4J9Z B;  4YIO A;  1K5Q A;  1KYO F;  4J10 A;  3L9D A;  2YI9 A;  4UXN A;  1W2B U;  4FM1 A;  2YIB D;  1QLN A;  1SQF A;  3SYC A;  1VQ8 V;  4JYA O;  5L3F A;  3ZIA G;  3JSL A;  4B3M O;  5GON A;  2L35 A;  2P22 C;  4BIU A;  4MTX A;  3T4Z A;  4FFK A;  5IJ9 B;  5B1B B;  1EFR G;  4LR3 A;  3G6E V;  3CMA V;  4G27 B;  2UXC B;  2FL4 A;  2LW7 A;  2N05 A;  5IJ0 A;  3TJT A;  2YDE A;  4IIJ A;  2QTS A;  1I94 O;  4HNA A;  1IBM O;  3A0R A;  4JYB A;  2RN9 A;  1TGO A;  1THZ A;  2YIA A;  4DXW A;  4CBC A;  1AJN A;  4LFA B;  3J7A U;  2PI4 A;  5LGU A;  3APO A;  4HZ3 A;  4B7K A;  1TA8 A;  4PA3 A;  3A0H Z;  1Z2G A;  4QE9 A;  3ZMT A;  1VQ4 V;  2UUC B;  4J41 A;  1XI1 A;  1EZV H;  3ABL C;  3OW2 U;  5K1P A;  1NVP B;  1OCR C;  2ZIM A;  4JV5 O;  4HBN A;  2JGD A;  2HHH B;  3CX5 F;  3CXC U;  3EFF K;  1YHQ V;  4JI0 B;  3C3T A;  1BMF G;  1U96 A;  3CRM A;  5L3C A;  3CJH A;  3W7T A;  3M99 B;  4AIL C;  1VAR A;  2A3Q A;  1YJ9 V;  1MMM A;  3SDL A;  4B3T B;  1N8R W;  4Q6G A;  4LF9 B;  1I0H A;  4FZ0 A;  2L6L A;  3DXR B;  5IYB O;  5FNV B;  1M4U A;  4F6R A;  2UXB B;  3G6B A;  4X1K B;  1AI4 A;  2VS0 A;  3SJC C;  2A9H A;  1M93 A;  4FK5 C;  3LNN A;  3X2Q B;  3ZMZ A;  1NQT A;  1QR8 A;  3T1Y O;  2Y69 C;  4J7Z A;  2ZM6 B;  2LP7 A;  4JI8 B;  2IW5 A;  2ZE7 A;  4H33 A;  3HKE A;  2AXT Z;  1RFY A;  1NH2 D;  2CGN A;  4FJC C;  1K7D A;  1H2G A;  4K3A A;  1SC5 B;  4QJF B;  3CXH F;  2EJR A;  1MZE A;  4EEQ A;  1RSO B;  2K9P A;  3CRR A;  2VWJ A;  3BY6 A;  1HNZ B;  1N36 B;  4PA4 A;  4QE7 A;  1ARO P;  4CH5 A;  1XMO O;  5BXZ A;  3LUT B;  4LF7 B;  2ZIO A;  1MSW D;  1JA8 A;  1COW G;  4LNU A;  2IM9 A;  2P90 A;  3QG5 A;  1ZWI C;  4NXN B;  1R3K C;  2DWE C;  4YY3 O;  3D36 A;  3T2M A;  1UJW B;  4X1Y B;  5CA0 B;  1WB8 A;  5JWP A;  2RJZ A;  3CRC A;  4QNH B;  4DV1 B;  1NH2 B;  1PM9 A;  4PHZ A;  3ZMV A;  3GWK C;  2PGG A;  4UUJ C;  3EVK A;  2VRZ A;  3B09 A;  1I5X A;  3T1H B;  1PL4 A;  1N0J A;  5BR8 B;  2P06 A;  4JAA A;  1H2K A;  4OPA A;  3ZHV A;  2XHB A;  3LSU A;  2DJV A;  4JI6 B;  1WP7 A;  4X66 O;  3CWB H;  3SJQ C;  1JX9 A;  2IJK A;  2QWN B;  1IBL O;  5HFM A;  5ITZ A;  5JVD A;  3CJH B;  1BSM A;  1JJO A;  3IC9 A;  1N33 B;  1R3L C;  2DWD C;  5LA6 A;  3BHP A;  2WLJ A;  1YI2 V;  2YI8 A;  1VF5 B;  4MS2 A;  4G2K A;  4LF5 O;  1XUQ A;  4BW5 A;  4CH6 A;  1K73 W;  4TV9 B;  1I94 B;  1K5S A;  3CPW U;  5JH7 B;  1HR0 O;  4XBF A;  4I0X A;  5J2T A;  5KLV H;  2D3O W;  2YEV A;  2CGO A;  5JJJ B;  3N27 A;  1EBO A;  4MVZ A;  4QGP A;  5K1X A;  2ZCE A;  4LFA O;  1Q90 D;  2EUL A;  3OMA B;  5J9P C;  4MVQ A;  1W0K G;  1AB3 A;  3LNM B;  3ZN1 A;  4YJ2 A;  4JAS A;  1KKD A;  1VF6 C;  4RUF A;  3C3S A;  5B3S B;  5H6Q A;  4PDM A;  5LHG A;  4JI2 B;  1L1F A;  3BVO A;  1IXM A;  2E76 B;  3MD0 A;  2OCC C;  4GKJ B;  1J95 A;  1KKC A;  3A8T A;  3AK1 A;  5C8Y A;  1FJG B;  2KG7 B;  1S3J A;  3E8G A;  3OMI B;  2HG5 C;  4B3R O;  1QCE A;  1FKA O;  1N34 B;  4NTX A;  3TGU H;  3VOU A;  3VQV A;  1S5L Z;  3CB2 A;  4KL1 A;  4UB6 Z;  4PDR A;  1N0N A;  3VQX A;  2R72 A;  5LA6 B;  4DUZ B;  4DV2 B;  3B77 A;  4YHH O;  1ZL8 A;  5CA1 A;  4CC6 A;  1Q6H A;  4KFM A;  3CD6 V;  2EIK B;  1XNQ O;  3CHX A;  3B8N A;  1HP8 A;  4DRX B;  1SRY A;  4LF4 B;  4PDL A;  3P32 A;  3ZCC A;  4WCE V;  1QVG U;  2QWQ B;  2ZXW B;  1SES A;  4ZIB A;  1GH6 A;  3DC6 A;  3ZBH A;  4JI3 B;  1BQZ A;  3T1C A;  2FKX A;  1G1X B;  4DR3 B;  1E79 G;  4O2B A;  2EX3 A;  3FB6 C;  1XRE A;  3HPL C;  1P7B A;  4LH7 A;  1YEW A;  3R66 A;  4DR1 B;  1D2D A;  2WAM A;  4GCZ A;  3MAQ A;  5ITZ B;  1AIL A;  5KA5 A;  1XNR B;  1O9G A;  4N21 A;  2WLM A;  1PP9 H;  3P3N A;  2CTQ A;  3P3P A;  1MZF A;  4R50 A;  2DE0 X;  5B66 Z;  1E1Q G;  3PJS K;  1OCC B;  4IT5 A;  2XTA A;  4WFG A;  3K0G A;  1OZ0 A;  2LGQ A;  2BOB C;  1Q86 W;  3ETE A;  4U7O A;  5TIS Z;  2X6A A;  3OM3 B;  4NXN O;  2H3O A;  2AHY A;  2Y0P A;  4RQF A;  1Q82 W;  1K33 A;  1BHA A;  2YEV B;  2XAQ A;  4KUM A;  3E8F A;  4UCS A;  5IYZ B;  4I4T B;  4JI1 B;  3F7V C;  2CH7 B;  2YID A;  2JVD A;  3FD9 A;  4K0K B;  5CA3 A;  1GN6 A;  1Y66 A;  5IYD O;  3B4S A;  2E5L O;  2DW4 A;  3L75 H;  2UUC O;  3ZS8 C;  3CS5 A;  4AI8 A;  4JV5 B;  2CK3 G;  5FL7 G;  5BMV B;  2NNU A;  1K9M W;  4RAI A;  3ABU A;  1GM7 A;  4KP4 A;  2WWW A;  2KG7 A;  3BRC A;  1T5E A;  2GUZ B;  3TK1 A;  1R6T A;  1DLB A;  2Y69 B;  3AK3 A;  1UPG A;  5H5N A;  2Z3Y A;  1MA1 A;  1ENV A;  3K5N A;  2B1G A;  2DN9 A;  4JZG A;  3TXQ A;  1LUW A;  1F7Y A;  2UXB O;  3TET A;  3DC5 A;  2XAS A;  1YSC A;  4AQY O;  1IXB A;  2JS3 A;  4FLY A;  4JI4 B;  3ZHS A;  4Z1V A;  4X9Q A;  2GTS A;  1R1B A;  3AK2 A;  3F7Y C;  4C7U A;  3IC7 A;  1AI5 A;  4IGG A;  1VQK V;  2ITD C;  5LHH A;  3WFV A;  2DYS C;  1FXK C;  1M9N A;  4X64 B;  4UCU A;  4J42 A;  2N04 A;  4FLT A;  5KMG A;  1YDX A;  3E86 A;  1V55 C;  2Q5Z A;  1Q7Y W;  4NB5 A;  3OFN G;  3APQ A;  2BTQ B;  5FPO A;  5BMV A;  3HKD A;  4GX1 A;  2E3C A;  1H2M A;  2F1M A;  2CTP A;  3WB0 A;  4DV7 B;  3K3W A;  3QTC A;  1V55 B;  5CA1 B;  2LFR A;  4MTG A;  1J5E B;  1AVM A;  3W7S A;  1YXB A;  1WPX A;  4O4H B;  3K5L A;  3T4D A;  4CH3 A;  3JD1 A;  1FFT B;  1QNM A;  3JAS B;  4GT1 A;  1XNQ B;  1B6Q A;  4W4K A;  4ABM A;  1KEC A;  2F23 A;  1KMI Z;  3JYC A;  4I4T A;  2V1D A;  4JI7 B;  2PYJ A;  4I50 B;  4UCT A;  3SYA A;  2RNB A;  2QTO A;  1ZX3 A;  2X0L A;  3K59 A;  4DV5 O;  2YSU B;  5EC1 C;  4L8J A;  3L73 H;  4JI6 O;  2UUB B;  1I08 A;  4NYK A;  2PYL A;  4X66 B;  3K08 A;  2GUZ A;  4P9O A;  4QPK A;  5EYP B;  1JFF A;  1ZUQ A;  2ADP A;  1TUB B;  1DTO A;  4UVA A;  1XL6 A;  3BCC H;  5IY5 C;  5FNV A;  4WFE A;  1VP7 A;  5FPR A;  3E2E A;  5JVD B;  3CCU V;  4BIZ A;  4DUY B;  4LF5 B;  2UXC O;  1BL8 A;  4DYL A;  3CSX A;  4O4L B;  4BWA A;  1OHH G;  1F23 A;  2A7W A;  1AR4 A;  4NTY A;  4EKW A;  2X7R B;  4JPR A;  3TCU A;  1VQ6 V;  4JTD B;  1F4N A;  3IJ4 A;  4UCR A;  3VQW A;  1CPY A;  3CCS V;  3VQY A;  2QM7 A;  4MSW C;  2IU0 A;  4RUE A;  4DV3 B;  3N2K A;  3RGB A;  3K9A A;  1GAX A;  5H9C A;  1IVS A;  2XAF A;  1Q43 A;  4DR2 O;  2DQ3 A;  3K04 A;  1N32 O;  4MW3 A;  4OXS A;  4CS2 A;  4MVO A;  2JK5 C;  4TQF A;  5JJE B;  4FLZ A;  2QKC A;  4GX0 A;  2OT5 A;  1BZK A;  3RVZ A;  4X1Y A;  5CA0 A;  5LOV B;  3JCZ A;  1JFF B;  1P49 A;  1QLE C;  2V4D A;  2UXD O;  3FKS G;  1M1K W;  3KCX A;  4H13 B;  4DUZ O;  4DV2 O;  1BT8 A;  2E74 B;  4H37 A;  1FD9 A;  2X6C A;  1VQ5 V;  4LF4 O;  4JF3 A;  3I55 V;  3G71 V;  1H8E G;  5JQG A;  2ZR3 A;  4WF9 V;  3OT7 A;  4A5U B;  4UVC A;  2QE7 G;  1O9H A;  4UVB A;  3H01 A;  4P30 A;  2CTR A;  2BTO A;  1SQG A;  4P9P A;  4O4I A;  4RQE A;  3K57 A;  4TSF G;  4LFC B;  5KA6 A;  3LDD A;  4J7J A;  4F6E A;  3J80 N;  1L0N H;  3OUS A;  2RMK B;  4JYA B;  1M56 B;  4H0L B;  1QVF U;  1NVP D;  4B3M B;  4DR7 O;  2ITC C;  2P4K A;  2Q69 A;  3RVY A;  3OTO O;  1SQB H;  1OCR B;  2F95 B;  4MVU A;  1TUE B;  2QA4 V;  1SQP H;  3K06 A;  2WA3 A;  4TV9 A;  1IUR A;  1SZX A;  1G6U A;  2BSK B;  3WG7 C;  1GN2 A;  3LSS A;  2F4V B;  1Q8I A;  3HKC A;  3VBB A;  1LNQ A;  1WNS A;  2P7T C;  3AG2 B;  3IGA C;  4HNA B;  4O2A A;  2QM4 A;  2AZ2 A;  2ATK C;  5LP6 B;  5B1A C;  5LYJ B;  4FFB A;  3RYF B;  4XDL A;  2BE3 A;  1Z5W A;  4R6Z A;  3SPC A;  1VMG A;  2X6B A;  4ZOL A;  1VEW A;  1EN5 A;  1P84 F;  3H9V A;  2QJ1 A;  2Y4T A;  1YZB A;  2HFE C;  5KAI Z;  3L72 H;  1OCZ C;  5DN6 G;  4IHJ A;  2RQ6 A;  3H1J H;  5BR8 O;  1IX9 A;  3L70 H;  1K92 A;  3AG4 B;  3K03 A;  3BAA A;  2OTJ V;  3KG2 A;  5CMU A;  3N2G A;  2M6Y A;  5B1A B;  3Q4H A;  5LOV A;  1N33 O;  3E8H A;  2AZ0 A;  5HFL A;  3UCS C;  4ZKI A;  1TAE A;  4DO2 A;  4LFB B;  4P2Z A;  5KHH A;  2ZT9 B;  2B1I A;  3JAR B;  2V7Q G;  4EB6 B;  5B3S C;  2WLL B;  1JPX A;  2F43 G;  3L74 H;  2B5U A;  2FB5 A;  3AG3 B;  4HYO A;  3ABK B;  5A9G A;  1QHT A;  4O2A B;  5CB4 B;  3ZHU A;  2ZM6 O;  1Y76 B;  5LMN B;  1YJN V;  2JDI G;  1JMK C;  1R3J C;  1ROP A;  3H1L H;  1EZJ A;  2Q9L A;  1SF9 A;  2OIG A;  1M56 C;  5CBG A;  2UU9 O;  5B5E Z;  3QO8 A;  1VIB A;  5LGT A;  1H8H G;  5EIB C;  4YXW G;  1N4C A;  5EIB D;  4MTO A;  1FPO A;  3JAW B;  1BHB A;  5IDJ A;  4Z1M G;  4X65 B;  4ZI7 B;  1FJG O;  1TVK B;  3JD0 A;  1N36 O;  3UO2 A;  2QWP B;  4D7T A;  2P4V A;  4O4J A;  1VQP V;  3RYH B;  3JSN A;  4LWS A;  4E2L A;  4DV7 O;  1BE3 H;  1J5E O;  5LXT A;  2YC0 A;  1R3I C;  3ETG A;  5IE9 A;  1KC8 W;  1Q5O A;  5FLX N;  3OR6 C;  5LYJ A;  3FFQ A;  3UT5 A;  5IJ0 B;  2NR5 A;  3STL C;  1NTZ H;  1VF6 A;  1Z5V A;  2WLI A;  3AG2 C;  3JAL B;  1WAZ A;  5KUM A;  3R65 A;  2OWO A;  2Q8V A;  2ZDI C;  2JRI A;  4I50 A;  1Y76 A;  5JJN B;  3T1H O;  4JI3 O;  3SPH A;  2EIN C;  3AG1 B;  2VWK A;  3OTF A;  3A2F A;  3ZJZ A;  3I56 V;  3F5W C;  4JI5 O;  2ODM A;  2VQE B;  3JCU Z;  4DR1 O;  1Q3E A;  5GW7 A;  2KSD A;  4GLX A;  2Q68 A;  1XHX A;  3QVN A;  5JCO A;  5DEC A;  1D5N A;  2Q73 A;  2GSM B;  1QQC A;  3O9O A;  1M5I A;  4LC1 A;  4FLX A;  2A79 B;  1VQN V;  5H6R A;  4MW8 A;  4BIO A;  4IIJ B;  2R9A A;  2JIZ G;  4LWS B;  1G4Y B;  4W4L A;  2AHZ A;  4FFB B;  2Y0I A;  1XMQ O;  2XAJ A;  4R7C A;  4MVM A;  4PA9 A;  1HR0 B;  2IBZ H;  4BR6 A;  4GKK O;  3U11 A; 
#chains in the Genus database with same CATH homology
 3O65 A;  1HNW O;  2F4V O;  3J7A U;  4JI1 O;  1FJG O;  1HNZ O;  1N36 O;  5LL6 Y;  5IT9 N;  4GKJ O;  4JI0 O;  1IBK O;  4LF8 O;  4YY3 O;  1DK1 A;  4DR2 O;  2HHH O;  4DV7 O;  4LF7 O;  4DR5 O;  4X62 O;  1N32 O;  4B3R O;  1FKA O;  2E5L O;  1J5E O;  4JV5 O;  2UUC O;  1KUQ A;  2N74 A;  2VQF O;  4K0K O;  3RT3 C;  1N34 O;  1YZB A;  3M8A A;  5FLX N;  5BR8 O;  2UUA O;  4YHH O;  2UXD O;  2UUB O;  1A32 A;  4DV1 O;  1HNX O;  1X59 A;  3SDL A;  1XNQ O;  4DV4 O;  4DUZ O;  4OPA A;  4DV2 O;  1R6T A;  1NS1 A;  4DV5 O;  2DJV A;  3F5T A;  4DR6 O;  5LMU O;  4JI7 O;  4OPH A;  5H5N A;  4X66 O;  4LF6 O;  2JRI A;  4LF4 O;  4LF9 O;  2DOS A;  4DV6 O;  4JI6 O;  2ZKO A;  3T1H O;  1N33 O;  4LFB O;  4JI3 O;  1IBL O;  1XEQ A;  4B3T O;  1F7Y A;  2UXB O;  4JI8 O;  5A2Q N;  3J81 N;  4A5U B;  4DUY O;  3T1Y O;  4LFC O;  4AQY O;  4JI5 O;  4JYA O;  5IWA O;  2FKX A;  4DR1 O;  1G1X B;  5LMN O;  4DR4 O;  4B3M O;  4LF5 O;  2VQE O;  3R66 A;  1D2D A;  4DR3 O;  3J80 N;  4B3S O;  1HR0 O;  1AIL A;  1R1B A;  2UXC O;  4DV0 O;  1FYJ A;  2ZM6 O;  4X64 O;  3JAM N;  5BY1 A;  4OX9 O;  4NXM O;  4LFA O;  4JI4 O;  2LW7 A;  2Z0A A;  4DR7 O;  3OTO O;  1XMQ O;  4KHP O;  4X65 O;  1I94 O;  1IBM O;  4DV3 O;  2UU9 O;  1XNR O;  1AB3 A;  4JI2 O;  4NXN O;  2AGA A;  4GKK O;  1XMO O;  5BXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...