3OTFA

Structural basis for the camp-dependent gating in human hcn4 channel
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
197
structure length
197
Chain Sequence
b'DSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Structural basis for the cAMP-dependent gating in the human HCN4 channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 61
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2010-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3otfA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3otfA02
2QDRA 5JSRA 4KWJA 4IEWA 4A2UA 4MH0E 1NZCA 3FX3A 3UKTA 3LA2A 3WW3A 1YUDA 1ZZBA 2H6BA 5EZWA 2PFWA 4KU7A 2ETEA 3H1WA 2CV6A 4MGYE 1CAXB 2BNNA 4XFCA 2QJVA 2IXHA 3HQXA 1ZNPA 2GU9A 1NYWA 4YSFA 2B8MA 2MPFA 4J1XA 1ZVFA 4ZU4A 5JAXA 2H0VA 2XL9A 3RDIA 3NKTA 4LLOA 3S7IA 5I0TA 5LEJA 3LAGA 5I8SA 4QGMA 1ZZCA 1CAXA 4BH9A 3VHRA 2GC1A 3H3UA 1CAUA 4XFFA 3LOIA 5BY5A 5FLIA 5I0RA 1V70A 4IEYA 2XKOA 3EQEA 1ZRRA 2OYZA 4R52A 4HVQA 1VP6A 4QXKA 1UD1A 4I02A 2PA7A 2PQQA 1J1LA 3E97A 3GYDA 3H9AA 4J1WA 4XFAA 3ETQA 5T3NA 1EYBA 3H3ZA 1LB2A 4IEZA 4FAHA 3KSCA 1O5LA 2P17A 3CF6E 1X7NA 1ZZ7A 2D5FA 1QWRA 1EP0A 1LR5A 3I7DA 4XFIA 4ONUA 4UBHA 5LRSA 3DL3A 3MDPA 1ZRFA 5I8YA 3PNAA 4XF1A 3MYXA 5AVPA 1UCXA 1J3RA 3FE5A 3FZ3A 1RUNA 4F8AA 2C0ZA 4L11A 1X82A 4QX5A 4HVOA 3CEWA 1CAWB 4D7TA 3G7DA 2OZJA 1CGPA 1YWKA 2GC0A 2UY8A 5J48A 5FLHA 4QMAA 3HT1A 5CU1A 2WFPA 1O4TA 3EBRA 2EVXA 1O5UA 2HKXA 4K8FA 4MV2A 4XF4A 5LEKA 5KHGA 1NXMA 4AQ2A 4AVBA 3NVCA 2GC2A 2IXJA 4IERA 1ZZ8A 2PYTA 4PJYA 3L2HA 1OD5A 3OF1A 3RYKA 3RNSA 3RZZA 5D1IA 2GAUA 3M3IA 4E2SA 1CAWA 2PHDA 4Q0UA 4E2GA 2PAEA 3TNQA 1ZZ6A 5I91A 3DV8A 3MZHA 3CO2A 3FWEA 5J3UA 2EAAA 1XE7A 1FT9A 2F4PA 1LKNA 1SQ4A 2CGPA 2PAKA 1X8EA 4AXOA 3DN7A 3D82A 3H8UA 4X6RB 2XGXA 3NL1A 3ELNA 4HSLA 4MGIE 1G6NA 1QXJA 5KHKA 5HI0A 5KBFA 5K8SA 4I3PA 3HT2A 1CX4A 1VJ2A 1UIJA 3LWCA 4AQ6A 4KWKA 3H50A 4B29A 5I0SA 3ACLA 3SMHA 4I0BA 4LEJA 1DGWA 4IEPA 3PLQA 3SCFA 3UKVA 4F7ZA 1WA4A 4DINB 2EA7A 2XLGA 4HMZA 5I8TA 3ES1A 1DZRA 4MUVA 3BU7A 3FJSA 1NE6A 3KCCA 1YFXA 4YYOA 4LULA 3HIFA 5I93A 3EO6A 1FXZA 3ES4A 1PM7A 1RC6A 4CYDA 4META 3SCGA 4JTNA 3ROUA 3MPBA 2CAVA 3E6CC 3PVBB 3RPQA 1ZZ9A 2IXLA 4FT8A 2FMYA 3H1MA 2BNOA 4KL1A 4P9GA 3OCPA 4Q0SA 1RUOA 3BPZA 1SEFA 4Q0VA 4XETA 1RGSA 1J58A 3E5XA 1IPJA 1J3QA 1Y3TA 4O9EA 5F1RA 4HLTA 3SHRA 3EJKA 3I54A 5C6CA 5LRRA 4D7SA 1QXRA 4LUKA 4L2NA 3QOPA 4XFGA 3RYPA 1CAVB 1J3PA 3H7JA 4WZCA 4Z82A 1WGPA 4N9HA 1DGRA 4MZUA 4PIZA 3QACA 1ZREA 2UY9A 2QNKA 4BHPA 4LA3A 4HVRA 5BV6A 2IXCA 2GH2A 4LA2A 2IC1A 1O3RA 3LA3A 2WC2A 1UW8A 2D93A 4UXAA 4E2QA 1RL3A 2ZCWA 1ZRDA 3ZDSA 5FLJA 4XEZA 4H7LA 2K0GA 3O14A 3NJZA 5KHHA 4HSJA 3NSTA 1O3QA 5EFUA 1HW5A 4TLFA 4HBNA 4ZU7A 4I01A 1YHFA 3S0MA 4QGLA 2V09A 3M70A 3DKWA 2Q1ZB 1Q5OA 1XRUA 3IWZA 4XFHA 2Z69A 4EWAA 5C8WA 1O3TA 4BYYA 4QM9A 4HN0A 4I09A 5BXXA 3BCWA 4IEUA 2OZ6A 5BPXA 2H6CA 4RD7A 3IDCB 4WVZA 2B9UA 3E5UA 3JZVA 2QCSB 5KHIA 2XLAA 5BUVA 4IEVA 3CJXA 3B02A 4MX3A 1YFWA 2GZWA 4X6QB 3KGLA 2VPVA 3EHKA 4KWLA 4IESA 3R6SA 2BEOA 2XHKA 1RTVA 1ZX5A 2ET1A 4FAGA 1I6XA 2CAUA 5I0UA 5FPZA 4ORFA 2ET7A 4HZFA 2Q4SA 3BB6A 3KMHA 2BYVE 1WLTA 4AVAA 2MNGA 4R8HA 4GULA 2XLFA 3ST7A 4BIFA 3S7EA 2XKPA 1H1MA 3E5QA 4I0AA 2FQPA 3OTFA 1XE8A 3CL1A 4I2OA 2ZKLA 1YFYA 4OFGA 5J7MA 3U10A 2O1QA 4EV0A 2Z2SB 3USSA 2OA2A 1TQ5A 2O8QA 4QGNA 2IXKA 1CAUB 4EROA 3UKNA 2I45A 1OI6A 3IBMA 2BGCA 3WW1A 5CADA 4Q0PA 3FFQA 2HJIA 3I59B 3WW2A 1Q3EA 1UIKA 2QVSB 1FI2A 5JR7B 2GC3A 5E16A 4PIYA 2PTMA 1NE4A 2IXIA 4MGZE 3E6BA 5JCTA 4IETA 3SCHA 3LZZA 2XL7A 3TNPB 2K9ZA 2ATFA 3U0ZA 4OLLA 3IIAA 4EWEA 3D0JA 3I59A 4QM8A 4YNIA 1O3SA 4FBFA 2MHFA 2E9QA 4WBBA 3H1YA 1L3JA 3CLPA 5FCCA 5FQ0B 4YARA 4IEOA 3IDBB 5FPXA 1VR3A 1Y9QA 3BALA 1YLLA 2Y0OA 4XF3A 1UPIA 2OPKA 1IPKA 1X8MA 1OMIA 2Q30A 5CVRA 3WW4A 3LA7A 3KGZA 1CAVA 4Q0QA 2PHLA 4ZU5A 2UYAA 4LTAA 3C3VA 3D0SA 1J59A 3E6DA 4N9IA 1QY4A 2B5HA 4KU8A 5FQ0A 4Q29A 3RYRA 2PAMA 2VECA 4LUMA 3OGJA 1GQGA 2DCTA 1DZTA 1YFUA 2BNMA 3GBFA 2Q0AA 2UYBA 1EPZA 1LRHA 4HN1A 1O7FA 5FDBA 4JTOA 1H1IA 4EWDA 4YRDA 1OFNA 3SXWA 3FHIB 1I5ZA 4IEQA 4XF9A 4O9GA 4XFBA 2D5HA 4PIXA 5JSOA 4IEXA 4AVCA 4XF0A 1U12A 4JVAA 1GQHA 1SFNA 5JSPA 3NW4A 3N4MA 1JUHA 2VQAA 4Z07A 4NVPA 5KHJA 5E1RA 3U11A 2D40A 1Q43A 2KXLA 4JV4A 4UBGA 1EY2A 1PMIA 2N7GA 1ZRCA 3OD0A 4MGKE 3H7YA
chains in the Genus database with same CATH superfamily
2VD7A 1O9HA 3K04A 4ZXKA 2X5IA 4P30A 2RS31 3PUHA 3LA2A 3VD5A 3CZUA 1IQDC 2RQ6A 4QPGC 2ZGPA 2LJ2A 5JI9A 3VQYA 3M3EA 2DURA 4W65A 2FCTA 3JARA 3MV11 3PVNA 4P9YA 3ETGA 1B35C 4MHUA 1XI1A 4XUOA 3RYCB 4LLOA 3R4UA 4K6BA 4JI7O 1S55A 4QGMA 2Z0AA 2ARXA 2VZQA 3C3TA 4GKKO 2QDNA 1BSMA 1D0GA 5KXBA 2X09A 3LOIA 5EC1C 3AZZA 3ZXJA 2OYZA 1J5EO 5GTHZ 3A7QA 4J1WA 5KWRA 2CTRA 4XFAA 5JJJB 3KM5A 4DR6O 2FL4A 2EAKA 5BR8B 2PGGA 3RWNA 3WCSA 1N3QA 4ONUA 2Z5WA 4XJ9A 3HMYA 1O4ZA 1L8DA 5CFDA 3OJBA 3CJIC 3FLRA 1KJLA 1T2XA 3PTYA 3E8GA 4CU8A 1GO3F 4QE7A 4YZ3A 4BLJA 4Y3OA 2VTXA 4ZI7A 2XH6A 5FY1A 4OYUA 1P7BA 1YC61 2A79B 2MEV2 4PBOA 5GLZA 2W95A 3PJYA 4CXXA 5BNNC 4LO8A 4E2SA 1BBT2 2F43G 4OUSA 2WZR1 3VZNA 2ZEZA 4O4JA 2RVAA 1K9MW 1XE7A 3OGSA 4JKMA 4RUEA 2IW5A 2QDOA 3D82A 3KV4A 2JKXA 1IBLO 3ZFGA 4MGIE 4FLYA 2D98A 3R0RA 1G6NA 4EN0A 4U2AA 4AEKA 1VJ2A 3H50A 4JI8B 5FXXA 4AHCA 3CC2V 4LBQD 1CZSA 2ZEXA 4JGYB 4UCVA 2RS13 1W8UA 4JTCB 4COUA 1C3HA 3AL6A 5LA0A 1VBA1 3VL8A 1NE6A 5FZ3A 1FYUA 3E1F1 3ZFEB 2CDPA 5TSWA 2YXYA 2DWEC 3THTA 4R50A 3W7SA 3RYCA 1RUOA 5IAXA 4ZIBA 3K2OA 1J58A 4O9EA 4XDQA 4GWIA 5C6CA 4O2AB 2V5DA 3UETA 1J3PA 3H7JA 4Z82A 3QLQA 3JD3A 4LLFA 1UYPA 4JZ2A 3IJ4A 3AX4A 2VBPA 4DR4B 3WP4A 5FZFA 1JZ5A 2ZGKA 2XONA 3SEPA 4U36A 2RDSA 2YEVB 2BJSA 3MO4A 3ACIA 4H7LA 4W6XA 4MHRA 4OMDA 3E2EA 4HXCA 2BGPA 5HCHA 4HBNA 2FDJA 1PVC3 4ZU7A 4I55B 3HBKA 1OCCB 3ZMUA 3IWZA 3H1KH 4ZKIA 4TQDA 4C90A 4E4HA 4CEYB 1ONAA 1I3HA 2EILB 3AP5A 2B9UA 1R6TA 4J9YB 1H8VA 3TYJA 2EF6A 3AFGA 5C93A 2HBTA 4JI0B 4X6QB 2EZOA 2R073 3OGCC 1V6LA 1CP9A 2WKKA 1TME2 2LROA 1K7DA 5KLVH 4CU6A 1KRIA 3SYCA 3O1VA 2MK3A 1PZ9A 3PUAA 4R8HA 5LMNB 1BE3H 1JZ7A 2I74A 4E8DA 3I97A 1Q90D 5JXJA 3T4HB 3WX5A 1YIJV 3KHBA 2DOSA 4SBVA 3JAKB 2A75A 2IXKA 3FAVA 3T0BA 2VRZA 5FY5A 1HXS3 3FFQA 3K0DA 4JGYA 1X50A 3O1PA 5LBBA 3TNPB 1QDOA 1IHMA 4I5SA 3N7KA 5A1FA 2XBO3 4ASMB 4GH4B 3ZYRA 3H1YA 1SG3A 1W9WA 1BK0A 1MPXA 1KKDA 4QPGA 3OMAB 1MS3A 4O2AA 4QKFA 4NXMB 1JYVA 4LE3A 1W6MB 2Y69B 2GNMA 3LA7A 2CYFA 2P37A 4FLXA 4CXYA 4RGAA 5EBMC 1WPXA 1W2OA 4TV8B 4KXRA 2PAMA 3OGJA 2QTOA 4AOCA 4I0XB 2BNMA 1JYCA 3BGAA 1LRHA 2B9ZA 4LF6O 3FKSG 1C8M3 4IL6Z 1QJU2 4I55A 2Z42A 1XNTA 4PIXA 3WQBA 3HNBM 2BE3A 4GJYA 4XDKA 2ZOEB 3D5OA 3T4DA 1LHOA 2XJTA 5CKMA 3P6BA 4Z07A 1S0EA 3WDWA 4J6GA 4MGKE 3B2EE 2WLPA 4QGPA 5FZBA 4YG0A 1XJAA 1CQ9A 2X6CA 2AZ5A 2IBZH 4DV6O 5E79Z 2VM9A 4E4DX 3ETDA 4KU7A 2D6KA 5EYXA 1POV3 5LW9A 2BNNA 3DYMA 3HQXA 2GU9A 1NYWA 4NO4A 4FFHA 3VDDB 2XL9A 1UMHA 1SZTA 5CA1B 4TUYA 5DPNA 3QD6A 3NJXA 1WMEA 3JAKA 3N9PA 1A6CA 4YW3A 3PHMA 1EFRG 4RQEA 2FDHA 1B06A 2CH7B 1UF2C 3ZMOA 4JHTA 3ETQA 3K0GA 2E33A 1EV13 1LB2A 4IEZA 3POFA 5CB7A 5E88A 4LC1A 1QWRA 3BIWE 5IJ0A 4PF5A 1QEXA 2HWF3 4BXSV 5LRSA 1Y9MA 3WD5A 4UUJC 3MIHA 1IURA 3NAPC 1QQP3 2WLNA 4NIGA 4PLMA 1BQPA 1XMQB 1LUWA 4MTOA 4TQFA 1X82A 2VNOA 1BCXA 4FPFA 1SC5B 5ITZB 2G19A 4QXHA 1OH4A 3LSEA 4R9BA 4HFSA 2Q7EA 4PJYA 3RZZA 5D1IA 4FOVA 1DYKA 4I0XA 4X8AA 1AX2A 4ZHNA 2TBVA 3CO2A 1XNAA 4IT5A 5A3OA 1PVC2 2XVGA 3BTYA 3WXPA 4LNVA 3K4AA 4OULA 5LA2A 1PMHX 1M56C 2RS11 3VBUB 1NOVA 2IH3C 3POYA 4DR7O 2W3JA 3GNEA 2ZHLA 3HT2A 2XWJB 4QQPA 2VW1A 1V55C 3VD7A 4FPOB 4BM8A 5A3TA 2O8OA 2R7EB 4XDOA 4CCLA 4QX2A 2DUOA 5C5UA 4BIUA 1JCHA 4CCMA 4B4QA 3ECQA 4OI1A 4FFFA 3F5TA 1IGOA 3H1HH 5CA1A 4TOIA 1SEFA 2N04A 2K46A 4YFZA 4H33A 1SLAA 5FZ7A 2VUJA 3VBFC 4PELA 1AR92 4GA9A 2EXIA 2QTSA 2IJHA 1PVC1 2OYQA 2VMCA 1CAVB 2CH7A 1N1VA 3AG4C 3K5OA 3L2YA 3NXSA 2WABA 1Q8IA 1UW8A 2JECA 2P4VA 4Y26A 3CXHF 4PJ0Z 3TXSA 2Y6JA 3LCPA 2XBO2 5J98B 3T09A 4BQ5A 4CCCA 2HLEA 2WAAA 3SYOA 5EFUA 2VUDA 3KHCA 2DTWA 4DUYO 1XL4A 2E7AA 2R071 2JE7A 1ULOA 1VF5B 4CP9B 1NA1C 4NTXA 3VBSC 3K3OA 1O3TA 3MIBA 2IVIB 2A0LA 1LHWA 1QU7A 2IZWA 4I09A 4JI3B 4RD7A 4DV0B 4AVTA 4V2VA 2XLAA 3GZTB 3CJXA 2X6BA 2DU1A 1YFWA 1A78A 3ZXAC 1W6OB 3KCYA 4DV5O 4CC6A 4BLIA 1C8M2 3PN1A 4ORFA 4NIDA 3BB6A 1HXS1 2WA4A 3RYFB 2RMU3 3WT3A 4GULA 1UY3A 2GP5A 3AK2A 3BPSA 3VBUA 3N27A 4OI4A 1UZWA 2UXBB 1CJPA 5EIBC 4CU7A 3RBZA 5FPAA 2LP7A 3T1HO 4CCEA 1W8OA 2P2KA 2XBO1 2XVLA 2PXJA 2ZGSA 3KVBA 3IB3A 1PO13 4CUCA 4L87A 3E83A 5JQGA 2W1WA 4E4EA 2J1EA 1ZTEA 5D8AC 1K34A 1NE4A 2QGNA 1H6XA 2RCVA 1GV9A 2ZEWA 1TMF3 2VQFO 2VXJA 4MGZE 5A9GA 1HJGA 4MVMA 2XL7A 2PY5A 2WINB 1HJFA 3NKGA 5TISZ 4DFSA 3RS6A 4D69A 1NR7A 3NR7A 4FQ4A 3CEIA 5IK8A 5FPXA 5DG1A 3ZS8C 3DYPA 1C8M1 3AKRA 1IPKA 5A70A 4FQZA 3ZHUA 3RZJA 4OXSA 1CAVA 3KZ4C 3LD8A 5JJNB 1W2TA 1EV12 1MR5A 1W06A 4N9IA 3ZRXA 2EULA 3N2KA 1UMZA 4K0KO 1VQPV 4NE9A 3GBFA 2AR6A 2UYBA 4S2GA 4GKYA 4AEJA 3ABMC 4P9LA 4KHPB 3Q4HB 2DCYA 2JG8C 1RUH2 1FPN2 4BQ3A 1TNRA 4CP9A 1POV1 5DAXA 4DV7B 5BNPC 5JSPA 1UU6A 2XHBA 1JHNA 5FPOA 5E89A 1JR9A 2QZ2A 4OMCA 4BXFA 4KWJA 2VNRA 3Q8EA 1E5SA 3NAPA 5JIUA 1W6OA 4BMBA 1F4MA 3AP4A 3WW3A 4YJ3B 3AK1A 3GBWA 1NA1B 3M2MA 4Q4X3 3VBSB 4NRMA 1OQDA 1TEIA 2LRPA 3RYFA 3CCSV 1RUI3 4FFKA 2LTNA 4J1XA 3CS5A 1EV11 4LF9B 2WWSA 1GBGA 5DN6G 5I8SA 2ZEYA 3HKDA 5GM0A 4BH9A 1W0PA 2PQSA 4Q4Y3 4TV9B 4OQ8A 2QKCA 1HNXO 4B3RB 2RDNA 1QQP1 1UD1A 4DR1O 3HQRA 4I50B 5HCAA 1WBFA 2YBPA 4YW6A 1A3KA 3S3XA 2JD9A 3NV3A 4OX9B 1UPGA 2AW9A 1XMOO 3AP7A 3IPVA 2A73B 3P30A 3OE7G 4JGZB 3PNAA 4XF1A 4LR4A 2KM2A 1VQ4V 4EE2A 3TEXA 4AZZA 2DQ0A 4LPLA 4LHNA 1J3RA 4W50A 2CUGA 3VOUA 3V64A 4O65A 1WAZA 4RGKA 3E8FA 4HVOA 4OHVA 2G4IA 1UOFA 1F5FA 4QDQA 1ZX3A 2JDAA 3FB7C 1Q8QA 2HHHB 3C90A 1FNYA 1URFA 4J80A 3K79A 3ABKC 4JX0A 1WD4A 3H1LH 3VBFA 4BISA 1W2BU 3HR9A 1NY71 3BU0A 1Y43B 3LEGA 4DIQA 4IE0A 4UCUA 3Q4HA 3WQ0A 5F3CA 2E76B 1PV0A 1KFUL 4YM2A 4DV1O 3WDXA 1KITA 2R0HA 4O2BB 3THDA 5KBFA 4DV4B 1U97A 3ACLA 1QOSA 1LENA 5CMUA 4DQAA 2JG8B 3LEIA 1Z2GA 4YJ3A 4QX7A 4W8JA 1NA1A 3T2PA 3VBSA 5L7OB 3J7NA 2PI5A 3EO6A 3F7YC 3IAPA 5GLWA 3RFRA 1G8MA 3RZHA 2WLLB 1QXPA 4LH7A 1JFFA 1IS5A 3RYIB 4B3MB 5C70A 1AUYA 1XQNA 3CBNA 1RMU2 4YGDA 3S57A 3B9CA 1LGNA 2VQEB 4FPCA 1PO12 4TV9A 3WG3A 4BQ2A 4TT3G 4I50A 2QNKA 4HVRA 5FO7B 3P3PA 3T2QA 1SBEA 1FJGB 1H6YA 1F31A 3BI3A 4UXAA 1H2LA 3I3QA 5LY2A 1D2DA 1H8HG 4L92A 3MW2A 5JDBA 1RIRA 4JGZA 4QPIB 5FYIA 2A7AA 4AQSA 3BTXA 2WT0A 2JB8A 4FFGA 5CBFA 5FOBB 3GCWA 1NCQC 5F2WA 5KUMA 2RMU1 1LTEA 2UUAB 4AFBA 3CB2A 4JI1B 1MEC3 4OI2A 2DCJA 2LW1A 2C26A 3AMNA 2WYSA 1EZVH 3BAAA 3GZEA 1WLCA 1LHVA 2QWPB 1PO11 2I07B 3UJOA 4HYOA 1MVQA 3WEZA 2NLJC 5CA0B 3OBRA 3WCRA 2EIEA 1RM1C 4X1KB 4KWUA 5LB6A 2ID4A 4PD4F 5LA6B 1TMF1 2C24A 3MLLA 3U75A 4O2BA 3ASNB 1TQ5A 4QGNA 3VBOC 1G9AA 2LO1A 1CAUB 2Y6FA 4ZKTB 4A6OA 1W0OA 3WW1A 4W4ZA 2BOBC 4ISRA 2JG8A 3O1SA 4JI5O 2FCVA 4JI2B 3WW2A 5IT9N 4Q4X2 2RS53 3TN93 3ZXEA 1W6NB 2Q6AA 4PIYA 5L7OA 4DO0A 1BQ0A 4GX2A 1BQZA 4N43B 4YW7A 1AR1B 4COYA 5JCTA 4QQ2A 1VMHA 4LHKA 4PLNA 5FYTA 1GM7A 2ZIMA 1K12A 2VG9A 4OLLA 3G67A 1CVNA 5FYSA 1W59A 4CEWB 3E8BA 5HCBA 4CDQB 3RYIA 4EN8B 3WG4A 1NVPD 1Q6UA 2BERA 2YIDA 2P5OA 1MABG 2JIZG 1WPBA 5EJ1B 2FDKA 4ZU5A 1LJ7A 1MS0A 4L8JA 1Q6HA 3E6DA 2H8PC 2LW8A 5FQ0A 4WM8B 4CE8A 1W0JG 5C3QA 3UV9A 5FKBA 4WF9V 4HNAB 2FKXA 2ZHMA 3OTOO 4LF7B 4IIJA 1I5ZA 2ZZQA 2OCHA 4CU9A 4XFBA 2YFUA 4QD2A 1DQ1A 4Q4X1 1QOOA 1W05A 3MW4A 5J2TB 4AVCA 3OEAA 4CCNA 3L75H 1JZ4A 1TZOA 3W7UA 3WNKA 3TAYA 5JLVA 1PMIA 3OUIA 3INAA 2DU0A 3UGHA 2QQJA 2Q7GA 1ND3C 4B8EA 4MH0E 1STMA 5DM6V 3JCZA 5CKNA 1FFTB 4NPLA 2DYSC 4Q4Y1 2UUBB 1TVGA 1RUE3 2VQ0A 2PF4E 2DCZA 3L71H 5CA0A 5KXEA 1ZNPA 5FYHA 1CN1A 2MPFA 1AL22 1SF9A 3NRUA 3T2MA 5LEJA 1Z5VA 4XE9A 2PELA 3AVRA 1PGW2 3NNMA 4DW1A 2ZNIA 3DF0A 5FZOB 1CAUA 2QWOB 4PDLA 3ASOB 4XIKA 1PGSA 1RXGA 2EIMC 2XKOA 4EJRA 4XIOA 4HAMA 3WNLA 3J7AU 1CZTA 1I94O 5EIYB 3ZHVA 3BVOA 1W6NA 4FTSA 1X7NA 3AL5A 4N43A 1OCZC 3TEZA 4J7KA 1SETA 4QPWA 1JW6A 3DC5A 4CEWA 4X66B 5LGUA 1WW6A 5A3UA 4WFEA 5FO9B 1YI9A 2H0BA 2P6CA 2ADDA 4QAWA 3ETPA 1KBHA 3DC6A 4JYAB 5FLHA 5GW7A 2DBNA 5BY1A 2RR13 3DUIA 4EZHA 4O4LA 2IWGB 2BOCC 2RJZA 4WM8A 4XUQA 3B69A 4BAYA 2LS6A 1D2QA 1KECA 3UNPA 4X89A 4Q0UA 5FREA 4E2GA 1EM1A 5JMOA 5F32A 4ASLA 5K0UC 1VQKV 2PZSA 1U96A 4RA0A 4XBNA 1AYM3 3T08A 3CCRV 4KMQA 2Z4FA 2OCCB 4YLZA 1X8EA 3CCJV 2HWE2 1H8EG 4ZONA 4TSFG 4DR2O 1V6NA 4HK9A 4JYBA 2GN7A 4LBNA 2FDFA 3JD0A 5K8SA 3TXQA 2CNAA 1COWG 5EIBD 4Q1PA 5IT6A 4YZ1A 3L74H 3WP5A 1IBMO 5F2SA 3SCFA 4F7ZA 3D6EA 5L9BA 3DXUA 1BS3A 3APOA 2VMIA 1L0LH 3SPCA 2P3KA 3BU7A 3RJ2X 4TXWA 4A44A 2JE9A 3PVEA 4LULA 2JIGA 1WMFA 3RPQA 2CE4A 1ZZ9A 4LFBB 4S2DA 4BWOA 4GQ7A 1WMXA 4YZ4A 3HJRA 2WQZC 1DQ5A 1S2EA 1YIPA 3DKQA 3EJKA 2XJSA 2WT1A 1QXRA 5B3SB 4YY3B 4N9HA 3TN92 3ALQA 1FMD3 1H8TB 2JX9A 1YQ5A 2GH2A 2CTQA 1YNAA 3LA3A 2W1UA 4PDWB 2OXBA 1HDKA 1RL3A 1MEC1 5FLJA 3USUA 1MSWD 4Y33A 3SYAA 1WN7A 4P2ZA 3NSTA 1M1KW 2P06A 5EJ3A 2BTOA 3LDDA 2Q1ZB 4EWAA 2FB5A 2KKWA 2CL2A 1FFXA 3ZSMA 4QX1A 5BXXA 1HNZB 3VZJA 3THOA 2B9VA 1CJDA 4CA9A 4KGQA 1B6QA 1PX3A 3ZIAG 1P8JA 2RMKB 1QKQA 3B8MA 3R6SA 3BN6A 4B3NA 1AILA 1Q81W 2VZRA 4MTXA 1R1A3 1OPOA 5BMVB 3OGVA 3RZMA 1XMQO 2OQ6A 2MNGA 3ZR5A 2RS51 3TN91 3ST7A 1AR72 1OZ0A 3FYIB 3JBG2 2VH9A 3IMMA 2R72A 3CXCU 3CL1A 5H9PA 5J2UB 3USSA 1JYTA 4RS5B 5K0UB 2NR5A 4AI9A 1JXNA 2JG9B 5KXDA 1IQAA 1T6GC 2BGCA 4H14A 2FZ2A 4N53B 2DWDC 1ND2B 5FRAA 1WUVA 5J09A 4CP2A 1GOHA 3D4KA 1F4AA 5FXWA 2BWCA 1PX4A 3I2HA 5JXHA 4RAIA 4OHYA 5H9QA 2LFRA 2WLMA 3OD4A 4P00B 2XNDG 1YHQV 1IXBA 4IGOA 2JICA 1DGRN 2HR3A 4B1MA 1K4DC 4AILC 2WO2A 1L3JA 1GLHA 3K06A 2RHPA 1G8WA 3HD8B 4D6SA 3I3DA 2QQVA 1VBD3 2VU9A 5C33A 3J7LA 4YW5A 1JMKC 1ZWIC 2X7RB 3RWRD 1HNWO 1H8TA 4YIOA 3JBG1 4IGQA 4XJ8A 1YFUA 2OT7A 2Q0AA 4LP8A 5JPMB 3STLC 5E1AC 1H1IA 4UXNA 2AZ2A 3FHIB 3UO3A 3JD73 5LA9A 1AP6A 3GJAA 1URXA 5H9RA 5LOVB 5K9YA 1RUE1 1VF6C 1ZA7A 3ZN5A 1AJQA 4AFCA 2XOKG 2VQAA 3WNMA 1H30A 5J37A 4FK5C 3AC0A 4JV4A 2A3WA 2Y0PA 1NH2D 1W90A 1OCRC 1WNSA 1A32A 2ZGOA 1H2KA 3PURA 4J41A 5IY5B 2A6YA 4WM7B 2OIEA 2OKXA 4J10A 5T52A 4JGSA 4QXCA 1H9PA 2B8MA 5JZGB 3E89A 3ZX6A 2H0VA 3SKVA 3LAGA 3CCVV 4D94A 5T5LA 5J2UA 3RW0A 4RS5A 1W9FA 4UB8Z 5K0UA 1YQ6A 1V70A 2JG9A 3EQEA 3NQHA 4N53A 3ACFA 1ND2A 2PQQA 3T2TA 4JASA 1NBMG 4Y5TA 2NM1A 5DAVA 3KSCA 1W0KG 1ZZ7A 2V4AA 5M0TA 2OX0A 3I7DA 2Y6HA 1UOGA 1VBE2 3H3LA 2GSYA 2RR11 3MDPA 1ZRFA 2WLIA 2CDOA 5BNOB 1ZA4A 2BOJA 3ZSJA 2WDBA 2VMDA 2DE0X 1CAWB 1GICA 1AYM1 3SKJE 2PHUA 3AG2B 1YVWA 4DV3O 2UXDO 1YJ9V 2UY8A 4TSVA 1BVP1 1XOUA 1FMD2 4MV2A 3RNSA 1OA2A 3ZOIA 3LPGA 4GMP0 1OVPA 1N0NA 4JI7B 1XHXA 3IAYA 1LKNA 3GXUA 3L73H 2WBKA 4XHBA 1VQMV 5EC2C 3SQOA 4OCTA 4R7CA 2BW8A 1AI4A 1J5EB 1SCSA 1IZ3A 1W3VA 2EIBA 3UGFA 4YGCA 1W8TA 4X20B 3AYEA 4DR6B 2V1DA 3KB5A 5IFTA 4U3JA 5BNQA 1FOD2 4FZ0A 2XAHA 3SMHA 4HK8A 3K57A 4XURA 3BYWA 4WCEV 4J7JA 3ZMTA 4WM7A 2XLGA 4QU2A 2R9RB 2JDYA 5I8TA 1R1A2 3VZOA 2W0XA 3P32A 1XNRO 1L7LA 4IHJA 4FPHA 5FZEA 5JZGA 1FMD1 2ZE8A 4DV7O 3ZIWA 1IS4A 5JOWA 5CFCC 1H2SB 5LYJB 4Q0SA 4DV2O 1RGSA 1X9TA 4YXWG 5JR2A 2WO3A 1CR7A 1KP2A 3I54A 2RM23 3AXEA 3MF9A 4XHXA 3QNEA 4YVWC 1YDXA 4U3FH 1O8SA 1JHJA 1C5IA 5IYDO 4GX0A 1DTOA 4BHPA 3FUOA 1W6QB 3MLKA 2GN3A 1S0CA 3TK1A 5H5NA 2KSDA 1D4M3 4QX0A 2DN9A 1OA3A 2BQPA 3I49A 4NAMA 2VO5A 1Y6XA 3AZYA 3NJZA 1QU0A 4IV3B 1P7GA 4CH5A 2ZKOA 1GQPA 2QFEA 1GYKA 3M70A 4E27A 1V6OA 3B00A 4AVSA 2KG7A 4DO2A 1R1A1 1B3QA 1JI6A 3BCWA 2GUZB 3RWKX 4EB6A 3R66A 1OA4A 5BPXA 2H6CA 4EFEA 3E5UA 5KXCA 2B1IA 4NRPA 5B2GB 4GUNA 1NX9A 2K1EA 3LSUA 5LP6C 4CS4A 3IM0A 1Y67A 4IESA 3H01A 1Z7S2 5FY4A 1H0BA 3JYCA 2JDUA 3KV9A 5I0UA 1YZBA 2ET7A 2AHYA 4PA9A 1BYHA 1US6A 2BYVE 4IYHA 3G6JB 3PJQA 4UFIA 2QQIA 1XEQA 2VZ1A 1YFYA 3M3QA 1LEDA 2E31A 2O8QA 1XNBA 3MHZA 4UT5A 3RZKA 4BW9A 3UT5B 3SYPA 1WLDA 1UQXA 1VBD1 1W04A 1TGOA 1VF6A 5FY8A 1WLEA 4A42A 2YC4A 1YJKA 5EHDA 3I2JA 2VS0A 4UW6A 5JPNB 5GALA 5LYJA 2DQ3A 3CLPA 3WDUA 4O4HB 5A7OA 3NNJA 4PI2A 4AEDC 1JU3A 4B4PA 4LBKA 4LE4A 1X8MA 3JD71 3JAWB 5FZDA 1I0HA 2F6BA 1V6KA 4XW3A 1PM4A 4O7XA 1J59A 4PF1A 2YROA 1BLZA 5FXVA 2WS93 4QHZA 1W6QA 3AKSA 3X2QB 2VVFA 4GJZA 5LBQA 3VQXA 4XJWA 3WNNA 3ZN0A 4JTOA 1PNMA 1OFNA 1CPNA 3I2FA 4Q8KA 2Z79A 3RVHA 1TUBA 2J1UA 4Q6GA 4E8CA 4P9JA 5C4WB 5FR3A 4JVAA 3Q9OA 2GUZA 3U11A 2VVEA 3ITQA 1D7PM 4CPBA 3I3EA 4BQWA 1QCEA 1HW7A 4RQPB 1AR63 4K40A 2H94A 4QX3A 2DCKA 2VAUA 3DGTA 1NZCA 3UKTA 4DEVA 4LBOA 4X62O 4OPAA 4M01A 3MLJA 2CV6A 1JS9A 1CAXB 5FZKA 2E7QA 4GALA 3UQ8A 4UVCA 5A7WA 4CRQA 1WKYA 4LFCO 1ZVFA 5LXTA 5LP6B 5J1XA 1KQRA 2HEVF 4F6RB 4C8DA 3Q8BA 1ZBE3 2JS5A 2A6XA 3SPHA 2RDCA 1MQTC 2CGNA 4BK5A 3AMMA 1VP6A 3VB9A 3UT5A 5IVFA 1JA8A 4XTPA 3ZX7A 2X53S 1REFA 2JE8A 4LF6B 4PDVA 4I9WA 3WF2A 4LT5A 1LR5A 3K4ZA 1GN2A 1ODNA 3KS7A 4HANA 4UFJA 4BB3A 4BU2A 5C3SA 4UAPA 5AVPA 3T1CA 4RHV3 3SPIA 2IJKA 2GP3A 3WFVA 1PNGA 2JEXA 4O4HA 2JJ2G 3WLUA 3M7AA 3CEWA 1GUIA 5GZGA 4DV6B 4YM1A 1UPSA 4MYEA 2E5LO 5CFCA 3MIDA 2XHNA 2X05A 3ASIA 3RYKA 2N74A 1SQFA 4QNHB 2GAUA 2PHDA 4H37A 1H9WA 4D3WA 2PAEA 1X9PA 2L35A 3MZHA 2BSKB 3P3NA 1GN3A 1FATA 4J42A 5KC6A 2PAKA 2J1SA 3IC9A 3DN7A 1A34A 1GOFA 4ZY9A 4FPKA 1UY2A 3W58A 3MUZ1 4E4ZA 4ZXEA 3PMEA 2WLHA 3BRCA 1F35A 1ACCA 2KD7A 1KEXA 1PGL1 4YHHO 4LWSB 1CX4A 4B29A 1B04A 1AX0A 2DUPA 1BZWA 4RQPA 5IYBO 2VZVA 1GSLA 1YXWA 2YU1A 5SV8A 3JU9A 4FOWA 2RM21 2VQUA 5IVEA 5DN2A 1APNA 3N7LA 4GB32 3V0BA 2CAVA 1ULDA 2Q5ZA 2W52A 2WUHA 1DHKB 5LP6A 3NWKA 2WSUA 1SQPH 2VOKA 4LO5B 2OT5A 2VTFA 2OW4A 4F6RA 4XJZA 4NRQA 2WT2A 4P08A 4INDA 1D4M1 3DEMA 5LWBA 1Y3TA 2VOXA 5J96B 1N1SA 4EN7B 5JH7A 1SESA 1DGRA 3U1XA 1C8NA 1FKAO 3WP3A 2C9KA 4Y1XA 4BR6A 3MBWA 1I5PA 5DDJ2 2XUMA 4AWDA 1IX9A 4DR7B 1MQTB 1V00A 3O0VA 1LOAA 2A06H 1GWMA 4BQYA 3ZDVA 4QGLA 1KFXL 3N7JA 2Z69A 5FP9A 2PHFA 1RUD3 4PDMA 1LGBA 1KS5A 3HKEA 1XBFA 4IEUA 5IE9A 4JC1A 2CTVA 5CIRA 2QQUA 1G86A 4S2HA 4TN7A 1GU3A 3AKPA 1AJOA 4C1XA 2ADEA 4FXKB 4XAAA 3EHKA 1QMJA 3WNXA 1YI7A 2XHKA 4MT8A 4AEDA 5T54A 2Q1MA 5C7GA 4XBLA 1KS4A 1E1RG 4OUMA 4DZGA 2B7YA 5DG2A 3CCUV 4CBCA 1H2MA 2EZPA 1VQNV 1UZ0A 4D8MA 2JK5C 3KF5A 1F23A 2OVUA 4JYYA 4EV0A 5HV4A 1NLSA 4JDOA 4LWSA 1K5JA 1UAIA 1F9KA 2Y33A 2YB7A 1AR62 1OI6A 3LDBA 2HJIA 4L9BA 2P6HA 1S0DA 1QJZA 3OOXA 5E16A 3E22B 2VMEA 2J42A 4DUYB 3M3CA 5DUVA 2P7TC 2JENA 5G04L 2DV9A 4EWEA 2WS91 2YC0A 3C7GA 3BY6A 5B4XA 4AGGA 1GZCA 3OEEG 2FDIA 1OJHA 4YARA 4IEOA 2ZAAA 4N21A 1YYNA 1D4VB 1EBOA 1OLQA 4FOYA 3TWIA 4DV5B 3WSOA 5FYMA 5IW0A 3ZJZA 1MACA 2W1QA 1HR0O 5IVYA 3K51A 5EBWC 5D21A 1Y4MA 4JF3A 1CWPA 2HVKC 2NN4A 2PI4A 3WDYA 1MQTA 3ZFFC 1KGYA 1AR61 3T1HB 4DYLA 4D6TH 2OIGA 2G9ZA 3DECA 2BRTA 3EB7A 3ATGA 1SFNA 1UZZA 4CDWB 4JRLA 2VGDA 5GZDA 2LUWA 3L9DA 1X59A 3H1JH 3TBDA 1QH7A 3IN9A 1DGSA 2VQFB 5A6ZA 1JYNA 4A2UA 1JOPA 1ZBE1 3I4IA 1HLCA 5LCWL 3JCUZ 1DBNA 4P9OA 5DQ0A 2GTAA 5B4NA 3F5WC 2FYUH 1GNZA 2EX3A 4ZS2A 5JAXA 4RO2A 1UKRA 1WCQA 4R4XA 5CFDC 3AZXA 3VHRA 2GC1A 3OY8A 4G2KA 4X9QA 1YRZA 1TA8A 1IG3A 2Q73A 4RHV1 4K0KB 4C1WA 1PNKA 2W2IA 2E6VA 5EZYB 2UURA 5IDJA 2P3YA 5A1LA 4CZZA 5KMGB 4FPEA 1EN4A 3E22A 1G6UA 5DEDA 2P17A 4G3YC 1R3IC 2UU8A 4XFIA 3MIGA 1TVKA 5A33B 2VBDA 2Y26A 1JOYA 4K8XA 2GH8A 2MEV3 1UOJA 3N2GA 4MGQA 3ZFGC 4B08A 4TWTA 1OLMA 1CESA 3CRRA 3N36A 1BBT3 3OR6C 1IXMA 5J48A 2F4VO 1V9U3 4Y4YA 2OUJA 1JUIA 4I7ZB 5IJRA 1YO8A 1NXMA 3LF7A 3ZHRA 1KC8W 4X8NA 2HH9A 3HVDA 1ZZ6A 4MOAA 2BFUL 4DUWA 3WB1A 3GWOA 4RFT0 4PT6A 1O59A 4OZOA 1Q8OA 1HDJA 5A7PA 1RUD2 1HNXB 3WF1A 4DR1B 1KU9A 1MSDA 4DR3O 3AVSA 5ERLA 5HI0A 3S5AA 5KC5A 4YG3A 4RUFA 4Q8LA 1XMOB 3A8TA 4YGEA 1Q7YW 4HMZA 4ABMA 2D6NA 3PMSA 1K45A 4XQ4A 3FJSA 1PHMA 4AGRA 2ZX2A 1CIWA 4LJHA 5IUQA 3MPBA 1ASJ2 4FT8A 3CDZB 5B1NA 3AP9A 1UX7A 2E51A 1BKZA 4JKKA 1JJ2U 5H6RA 4HLTA 4LCUC 3MW3A 5A7SA 4HETA 1FV2A 2E75B 2VXRA 1NS1A 4D6QA 4Z1VA 5JMCA 5EZYA 1LNSA 2HG5C 4PIZA 1RUD1 5IK5A 3IFXA 1EN5A 1PL0A 4CXWA 3NV1A 4IE5A 1PP9H 1DF4A 1EAH2 2XJPA 2HYXA 4UFZA 4DV1B 2WAOA 1M57B 1SACA 4J11A 1BT8A 1GNYA 2ZT9B 1SS3A 3DXRB 1XDCA 2GALA 1YHFA 3S0MA 3DKWA 2PMWB 3KKYA 4AHZA 5IYCO 3KG2A 5FNVB 1TME3 3N9NA 4M00A 3D3AA 2YUAA 1GMGA 4MW8A 2R6QA 3ZR6A 1SLBA 4JGYC 2Y4TA 3KGLA 5T5JA 3WNPA 3IMNA 4WV8A 2GDSA 1RTVA 3UM7A 4PV1B 2B46X 4LKEA 3ZFEC 2W91A 3WB0A 4TYSA 3JB8A 3IDEA 1ZM1A 3G4SV 1VALA 3ZFFA 3FHQA 4W6YA 1N32O 1QH6A 3AXDA 3W5NA 5CYYA 1RUF2 5AC92 1XSRA 3I59B 1POQA 3J8F2 3HB3B 4X1YB 2PTMA 5BXZA 1HQLA 2EXHA 3Q8FA 2IJIA 2FCUA 4MGSA 4FFBB 2K9ZA 3MDSA 2ATFA 3TEYA 3IT8A 4F83A 3IIAA 2RE9A 4EN6B 1OCCC 1WJZA 4WBBA 2AHZA 1Z78A 5L9VA 5JVDB 3LB9A 1SLCA 4CEYC 3CD6V 5EV7A 3AJYA 2EILC 2OPKA 5L3BA 4K20A 2RJLA 4IQPA 1W8NA 3WW4A 4KBBA 1VB4A 2EJ7A 1Y7BA 3KV5A 3ABUA 1N47A 1QJU3 1SHWB 4YW4A 3A0KA 2VTXJ 3GB7C 1GN4A 2DCTA 3KWVA 3DPRB 5C3OA 1GH6A 3BHPA 1NUKA 1O7FA 2WLKA 3JQXA 5BZBA 4XJAA 4JI4O 4LKFA 1OUXA 3DXRA 1L7RA 2X8KA 1V54B 2VCMA 2ZGTA 1T5EA 4A45A 2W92A 1ULPA 5FYYA 1U12A 2A9HA 2QQOA 3HN3A 1YCIA 4JI5B 1BXHA 1COV3 3CIHA 2WR9A 4MXWB 1V9U2 2VULA 3VHPA 1MMMA 1ZRCA 3H7YA 1UFIA 2YHJA 4BA6A 2JRIA 1XB9A 4P9IA 4LNUA 5EZWA 4MW3A 2GNTA 1Q86W 1IBKO 4FLUA 2IXHA 4YM0A 3L9JT 2A3QA 3N9QA 1I9RA 4GH4C 1SLTA 1VARA 1UN1A 1FV3A 2Q8CA 1LUVA 4PI0A 2QKSA 1H38A 2ODMA 1PVXA 3K08A 4FLZA 4FP3A 1W8HA 5BY5A 2Y69C 5FLIA 3ZCCA 3DSQA 4MS2A 4CCJA 2YGLA 3AG7A 2PLV2 1IKQA 3E97A 2MEV1 3OTOB 1HIXA 3OUSA 1PIV3 4RYDA 4MXVA 4X1YA 2UU9O 1BBT1 1YQ8A 3ACHA 3GF6A 4PCRA 1LOEA 3AJZA 2DTYA 5J36A 2ZAHA 4FFBA 1V9U1 3OUJA 1ULEA 2Y4UA 2WNVC 5GJ6A 3ABLB 3MYXA 4GWNA 4LF5O 2CY6A 4CDXB 4BIOA 3JASB 1UXXX 2VC9A 1RYYA 5JVDA 4NHLA 1NLQA 3VBHB 1VRH2 2VR4A 5CBGA 4X1IB 4K1ZA 1LR1A 4QMAA 5IVBA 4L97A 1EN6A 3EBRA 1DLBA 5JJEB 3UJQA 3RMYA 4P9PA 5ACA3 3L2HA 3DPRA 1SLIA 4FVVA 2CTPA 1NG0A 4OUEA 5DAQA 1AL0G 5FZ8A 2RJ2A 2JDHA 1ALYA 2D3PA 3HNYM 3VDDC 1IDSA 3ILNA 5IK7A 5FFOC 4LK7A 2DVFA 4CCOA 2VCCA 2DFBA 1YQCA 1I94B 4LKSA 2ZABA 2GMPA 2WO1A 5FK8A 4C0BA 2G9FA 2UXXA 1R3JC 4XUNA 3ZYPA 3UKVA 4XACA 1WA4A 1U5IA 3ES1A 1CX1A 2QWQB 4NIIA 3K03A 1AR93 4E4SA 4BMEA 2ZA9A 4K7JA 2QQWA 1HWYA 5JUVA 4KL1A 4P9GA 1SZXA 3A0BZ 3BUCA 1PK6B 2GHYA 2HWB2 2YBSA 5IWFA 5EBLC 4UV8A 1CONA 1OVSA 4KNCA 3ZFEA 4LUKA 1VQ5V 1VQ9V 3RYPA 1N1TA 1XHZA 4MZUA 2VW0A 3AMPA 2V4DA 4WVVA 3VZLA 4QQLA 5DAPA 2IC1A 2A6VA 1TME1 3JD2A 4GT1A 1DF0A 3J7MA 2ZX4A 3OUHA 4DR2B 3AG3B 2WRAA 2YS8A 4CDXA 4NMIA 3VL9A 3JASA 1JJOA 4I01A 3RJRA 2XTAA 3ZRVA 3VBUC 3CCEV 1YJNV 3VBHA 1XRUA 1TNFA 3N9LA 2E26A 1IBMB 2HEPA 1XYPA 3C3SA 4X1IA 4ZZ5A 2QSAA 2YEVA 5HXVA 2OZ6A 4MVTA 4FXGB 3IDCB 2ZE5A 2WNVB 2OTJV 2JS3A 4UYBA 1P84F 2ORZA 4KUMA 2KR2A 5SV5A 4NAOA 4CEYA 2QTWB 1OKOA 2ZXWB 3FB6C 5DABA 2DVAA 2DDUA 2G38A 2VOVA 4LOTA 1NJIW 5GZCA 4GAZA 3I2GA 1UMIA 5C3PA 1H1MA 4JQRA 2HWC3 3AFKA 1S2BA 2ZMKA 3STZC 5G05L 1COV2 5J7MA 3OW2U 4F4LA 2JWPA 1Y74B 2YDEA 3I5DA 1FPOA 2VZUA 2BU9A 2VZPA 3ZMSA 4LHLA 5LBCA 3OM3B 1QR9A 1UIKA 4V2WA 4XCAA 2ETNA 4LK6A 5ABJB 2TNFA 1RPOA 1JZ3A 5LY1A 5FZ4A 1GKBA 3ZXGA 3E6BA 4FVMA 1SA0B 4KBZA 2HEYF 1QJU1 3D0JA 1UZYA 2F23A 2QM7A 2ZE7A 1S72V 3BODA 3OEHG 1YF2A 4XDLA 1VAKA 3M8LA 3MIFA 4X65O 2L9LA 2VNVA 4MVZA 2WFF3 3PL0A 1XE0A 4RR3B 1PIV2 4GH4A 4YVSC 1VBC2 4DXZA 1QY4A 4AHYA 4GKJO 1RUH3 1COV1 1FPN3 4CS3A 1JYWA 4LBMA 1OPMA 3SH5A 3ZSKA 3JQWA 3SH4A 4HN1A 1W6MA 5FDBA 2W9XA 2R30A 1LU1A 3SXWA 2J1TA 4ARYA 1C5HA 2R16A 4TV8A 2B45X 4FTEA 4A5UB 1QNYA 2JIJA 1AVBA 4H7MA 2ZJCA 4R6ZA 4QE9A 1NCRB 2KXLA 1WCSA 2WNVA 1WW7A 2DF7A 5ACA2 1K8AW 1GZWB 2W94A 3J26N 1OUSA 5LMUO 2ZM6O 3B09A 3ZRSA 4DXRA 3NJVA 2BFUS 1AI5A 3BFRA 1QJFA 1NTZH 2P5BA 2O57A 1SERA 4AI0A 1PIV1 1ORQC 1NLRA 1W8FA 1RUC2 2D6MA 2QEXV 4LFAO 1HNWB 4UFLA 4F6EA 1XYOA 2YUEA 5DECA 4LBJA 5F2VO 3ZXKA 2ZX1A 4R52A 4AGVA 4CP0A 5C9AC 3VDDA 3U78A 1W0NA 4NTWA 5FZIA 4MGTA 4DEQA 2IFRA 5T3NA 1V6JA 5ISLA 4DY5A 3H3ZA 3GGLA 2E3CA 5ABJA 1QHTA 2W46A 1ZBA3 3HEIA 1UX6A 3ILRA 2D3RA 3K3NA 5KA6A 2VOTA 2JKBA 4BQ1A 4DB5A 4R9CA 4BCUA 5ACA1 5JCOA 4HZ3A 1DZQA 4IE6A 2WZPP 5I0DA 3G7DA 2DVDA 5CU1A 1R73A 2WFPA 1O5UA 3NVCA 4IERA 2PYTA 1NQTA 4UVBA 1AJKA 5ITZA 4RGGA 2F66C 1RFYA 2F4PA 3PUIA 4CDUB 2DFCA 2DYRB 2BBAA 5FMBA 4YVSB 5LZ6A 3VV1A 3OYWB 3CC4V 1CD3G 3LSSA 3GZUC 1S0BA 3WG7B 3B8NA 4QIWF 1AR91 3HPNA 5DZEA 4HG6B 2SLIA 5EQUA 1NCRA 2JGUA 2OWOA 2HYKA 3I2OA 1KB9F 2YIBA 3PLQA 2GMMA 1JOJA 3JSLA 5FTTC 4QU1A 2JD4A 3WZ1A 1Y9GA 2YXHA 3A0NA 1K5MB 1RMU3 3ES4A 4JGZC 1RC6A 2HWC2 4DV3B 2UXDB 2JDZA 2BNOA 1OOPB 4JAVA 3VHOA 3QVNA 3VLBB 4LF4B 1J3QA 4AEMA 1UZVA 4NIHA 1XU1A 2X29A 3QH7A 2AUYA 3JUUA 1G9DA 3DYOA 4WFFA 4L2NA 4WZCA 3QACA 3JB4C 5ANQA 3W7XA 4AK3A 1AYN2 3OBAA 4WZFA 4JI6O 2AYHA 1J83A 2GDFA 1BGYH 4R9DA 2PHTA 3LDCA 1CPYA 3B94A 1RXFA 3K48A 1FXKB 1OKQA 3LNNA 4HSJA 5C9AB 4HKLA 1RUJ2 4PQ9A 1FYJA 1I08A 5HFMA 5C8WA 4BYYA 1MZEA 4QM9A 4ZHQB 2WFF2 3LNMB 1NT0A 3RYHB 4E2LA 1UU4A 3JZVA 4H55A 3AMHA 4IEVA 2HWC1 4Z8BA 1HB3A 3B02A 1S0JA 1XNRB 1MS9A 3NNGA 2GZWA 4FCAA 3URFA 3THCA 3LFMA 2UXNA 5L7OC 5JI7A 2XVKA 3N7MA 2HJDA 4FAGA 5FYUA 2Y6GA 3HN1A 4DV2B 1HRI2 3VQWA 3OBZA 3TOJA 4A7ZA 4XUPA 3RVZA 4YVSA 1FS0G 4BIFA 1IPSA 3OTFA 5B1AB 1LOFC 5C8YB 3VDCA 2EBOA 2D2CB 2F1MA 3OFNG 1CXZB 3PIGA 3DGEA 1M93A 5CN0A 2B1GA 1MA1A 1QLEC 3BCCH 1H1AA 2J1VA 4WVMB 4UCTA 1XU2A 4QT6A 2B42B 1WW5A 2WFF1 3POGA 1QJX2 4QPIC 4AFDA 2ITCC 1OOPA 1RUH1 5A3WA 2MHFA 1FPN1 4P5HA 4ARXA 3EVKA 5F37A 1QNMA 4GZ9A 3T1YO 3BALA 4K8ZA 3N9MA 4KH9A 1K97A 4A7YA 2WA3A 3G6EV 1GMMA 3AYDA 3D0SA 1C28A 3WR0A 5JOYA 1ZBA2 3MHSC 4B7EA 1JBCA 1JH5A 5FBJA 3U14A 5CBHA 1LOGA 3SYQA 1DQ0A 1BZKA 4JKLA 2P90A 3P1IA 5C9AA 4X88A 4J25A 1M4WA 1S0FA 2X5IB 4IEXA 1ZAUA 4FM1A 3RMXA 5B1OA 1GQHA 3S3WA 3ASNC 3NW4A 3WDTA 4ZHQA 5FYBA 5KHJA 1AR83 3RYHA 1K5SA 4NIAA 4FMTA 3FUQA 3W59A 1R083 3JD1A 3RI9A 4Y24A 1AL23 3VD3A 2QQLA 2V73A 2CK3G 2VL4A 3FX3A 1RVF2 2H6BA 3K5NA 4Z2WA 4MGYE 4N43C 3VQVA 3HWJA 2QQMA 1SQBH 2WPDG 1AXYA 1GAXA 1ZYBA 2PHXA 4URTA 4IV1C 4CEWC 5GKAC 2YC2A 4CDQC 4GWMA 2EALA 3UGGA 1Q8SA 1ZBA1 5C8YA 1SPPB 1RHI3 4JV5O 4XFFA 2EIJB 2IM9A 2YFZA 3HKCB 1JMUB 1QQCA 4AHXA 4LH6A 4XPVA 4WVMA 2D6PA 4WM8C 1E57A 1JU4A 4K8RB 4LQRA 1N34O 3OR7C 3E8HA 5FZLA 3POWA 4P5YA 5LBFA 2X10A 2WQ8A 4P14A 5I8YA 1QLEB 5BYNA 4FI9A 4K3AA 1LNQA 2DVBA 1HV0A 4B4RA 4L11A 5AFEA 2YIBD 2I2SA 4R9AA 1DK1A 4D7TA 1CGPA 2C4XA 4W4KA 4O4JB 4X62B 1E5HA 2NN8A 5FV3A 3L70H 4CZSA 2Q68A 1LULA 4LFCB 2HWE3 4MVSA 3K5LA 3LOBA 1UOBA 3Q8AA 3DV8A 4Y5SA 1Q56A 4PA6A 5CB4B 1EUUA 3FX7A 1SQ4A 1VQ6V 1WA6X 1HP8A 2CGPA 1DQ6A 1ZL8B 4DNYA 1N36O 5B1BB 3ORJA 1VQOV 1ULGA 2BGOA 3ELNA 5FZ9A 3NV4A 2XQRA 2XPJA 4GX1A 2R043 3NNLA 1RMU1 3M1HA 3A4UA 3ASOC 5KHKA 2ZE6A 2YSUB 1VMJA 4I3PA 1BVVA 1UIJA 4JPRA 1UU5A 3MGUA 1CEZA 3SPJA 4QDSA 5C8CB 1W8ZA 4Q26A 4PA7A 4RN5A 2EA7A 1UWWA 5DUWA 3OGRA 1R093 3C7EA 2WZR2 4MUVA 3WB2A 3D8CA 2IUWA 5I93A 1HB4A 4NXNO 5A6YA 1W9TA 2Q9LA 3C7OA 4YWAA 3OCPA 1IKPA 3BPZA 2E5LB 1N3PA 4DUZO 1SPPA 4I30A 3T0DA 3HKCA 4GX5A 3PDQA 2ZACA 5L3CA 4IV1B 2WLLA 2DW4A 1N8RW 1LOFA 3UK9A 3H42B 3BA8A 5JXGA 1VBA2 4Q4V3 2R49A 2JJ6A 4YM3A 2WNEA 1HV1A 2OCCC 2IU3A 2ATKC 2RDRA 4YHHB 3ZN6B 5FP3A 1BHBA 4URAA 3AP6A 3N9OA 5FXZA 4Y22B 4QKDA 5AG2A 1NAEA 4XILA 4DRRA 4QPIA 3E86A 4WVZA 5C71A 1QNWA 5B66Z 1ENRA 4H13B 1GNHA 1SQGA 4MX3A 3AYAA 1U5XA 1UYXA 2HFEC 2WWWA 1AR73 2VPVA 3AG1B 2Y38A 1QHDA 1PD3A 3JBG3 2NQYA 3WU2Z 1EUTA 1X33A 1VP7A 5CB4A 4NHMA 1VRBA 1WLTA 4U7OA 1S0IA 3FAVB 1ZL8A 5FZHA 2EINB 3LSDA 1ZSPA 2ZGNA 1GRJA 4LIUA 1AR82 4LOSA 2OA2A 3BVCA 5LK7B 1R082 4FM0A 1FAYA 5B3SC 4QHBA 3NO8A 1MZFA 2UUCO 4Q0PA 4QPKA 4X1KA 5C8CA 1H8TC 2P3JA 1S2KA 1CZVA 5LA6A 4CSWA 4PDWC 1W99A 3K58A 1XSQA 2HLDG 4G4FA 2W87A 2XJQA 4J7ZA 4DR5O 4QPGB 2Y0IA 4Y20B 3QH6A 4IETA 3WUDA 1RPRA 1H4GA 4YJ2B 1B35B 3ZO0B 2JDIG 3NV2A 2YY1A 3EHBB 3GHNA 5A3MA 3MIEA 1NQDA 1RHI2 3ACGA 4Q20A 2L6LA 2K2SA 4Q4W3 3I55V 3KQRA 1VB2A 1SQXH 2LQTA 4IV1A 3VBBA 4CDQA 2UXCO 2ZZJA 3JATB 4B3TO 1JVMA 1AR81 2YG0A 3B4SA 2WN3A 1EPZA 1S5JA 2QBXA 1R081 2TEPA 3ZHQA 4NB5A 2WNOA 1IG0A 3KD4A 1S76D 1AL21 4Y1ZA 3ZN6A 3D3QA 4LORA 3WHUA 4Z92B 3CJIB 1S5LZ 4IE4A 4TTGA 1PGW1 4UB6Z 4NTYA 4RS5C 2DUQA 4Y22A 2ZIOA 3N4MA 4HNAA 3QTCA 1W3XA 2XAGA 1VMGA 2JG9C 1P49A 4BIZA 3FLTA 2ZGRA 1MVEA 3K3WA 4N53C 1LCLA 1ND2C 4JQTA 4IEWA 2LW7A 4PHZA 1RHI1 5J2TA 1POV0 1K3EA 1YUDA 5BNNB 1V9PA 4TUYB 3A0HZ 2ETEA 2QE7G 4OI0A 1WP8A 2FTKA 4UVAA 4FPYA 3ZXFA 1SLLA 2Q5TA 2R042 4UCSA 1F7YA 1HR0B 2AH2A 3H3UA 5A80A 1AZDA 5IJ0B 4IEYA 1S0VA 3LEMA 1VBE3 4CS2A 3C7HA 5K7PA 1US3A 2XG3A 4QQOA 1R092 1I5YA 4JAAA 5F5QA 5FZOA 5FOJB 1PPJH 5FZCA 4Y20A 4ASKA 5FMOL 4LITA 5FWEA 5EWSA 4YJ2A 4NUBA 1O9GA 3OUFA 1W39A 2D6LX 1B35A 1FXVA 2JJ1G 2W68A 5JVVA 4U7NA 2A6WA 2ZXQA 2HWE1 3D36C 3ZSEA 4NPMA 2FBEA 3GDBA 4CUAA 4D6RA 4K3UA 4OHXA 1DYOA 4NHXA 3J81N 1FD9A 2GC0A 3V56A 4J9ZB 1ULCA 3MAQA 4K8FA 3WVJA 3ILFA 1OV9A 2VQTA 3JATA 2R041 5FPRA 5IY5C 1M9NA 1NZIA 4WM7C 4Q4V2 4SLIA 4DS0A 2EXJA 2LGQA 2BOIA 3RI8A 2F95B 1G9CA 3FWEA 1OLRA 2R32A 5JZGC 4HT1T 3U37A 3UESA 1FOD3 4AXOA 2C6SA 4OGQB 3OG2A 1R091 4NWWA 3CJIA 3IGAC 4XMAA 1E5RA 3CWBH 3O65A 3CP1A 1R1BA 1ST8A 5FPBA 4DPNA 3VHNA 4KI5M 4LXLA 4I0BA 1W2NA 4LEJA 2RJKA 1YSCA 3MPPG 5BNNA 1BL8A 1HN1A 5DUUA 1LU2A 3FHAA 3UO2A 1YIFA 2Q8EA 2TUNA 1OC1A 1G1XB 1RSOB 1YFXA 3HIFA 1ODMA 1ENQA 1PM7A 3OGGA 4CYDA 5JWPA 5BNOC 2A70A 3ROUA 1BCCH 4PQQA 1VF7A 4Q27A 2FMYA 1JZ2A 4XC9A 2RS12 4MVQA 2F4VB 3POBA 3L72H 3F95A 4Q4V1 2YU2A 3AG2C 2NLRA 3RGBA 4EZ4A 1LODA 2GMEA 1A8MA 2ZGMA 4C0HA 1W2UA 2UY9A 5FZ1A 5LASA 3G71V 3ZBHA 4R8CA 5IAVA 2IH1C 2ZCWA 3SGIA 3ZDSA 1VLNA 5DMYA 2OPWA 3B93A 1AP5A 3OB8A 3DCQA 3F2ZA 4DR3B 3SLIA 3HR0A 1AR71 3J7HA 4RSUA 5L3EA 1LAJA 4Q4W2 1SKVA 4PDWA 1UY1A 4HONA 1F4NA 3BABA 2R9AA 1X4TA 1Z7S3 5T55A 1Q6IA 4XBFA 1AB3A 3M3OA 1N4CA 4BE3A 4YZ5A 4P02B 2CAZC 3GBGA 3IKWA 2XAJA 2CHHA 1XBLA 3C2UA 4MSVA 1ZX5A 5IK4A 1QJEA 3ZN4A 4ZPIA 4AYUA 3EMRA 3TCUA 2R9IA 2JDPA 2XLFA 4Z2AA 3W20A 4UV9A 2R072 2ZQMA 4I0AA 1U5ZA 5JQGB 1Q8PA 2OTLV 1XE8A 2AZ0A 3I2IA 4I3GA 1E79G 1AR5A 2ZD9A 1KJRA 2PYLA 2WLQA 2W08A 2YBKA 1HB1A 1S0GA 1OH3A 5BMVA 4EROA 1KKCA 3O5SA 2WIIB 4LIVA 4AAXA 4FM2A 3IBMA 3I2KA 5CADA 1K73W 2QVSB 3FFZA 4Q4W1 3CYOA 2P22C 3B5LB 2ZS6B 2VZSA 4MG2A 4K35A 1LGCA 1RSOA 2P67A 2IXIA 3O0WA 3SCHA 3LE0A 1HXS2 1TUEB 5IATA 4WFAV 2CWMA 3LFIA 4IV3C 1KDMA 4M3CF 4QM8A 2BVVA 4UCOA 4UOJA 2K9PA 5HBAA 3N2KB 2ERFA 3BOPA 2QE3A 1XILA 1HRV3 4MVRA 1OMIA 1GWKA 2PHLA 3BA9A 1YQ2A 3U4SA 3G80A 4NN0A 3FB8C 2WJSA 3RYRA 4LUMA 1DZTA 5FYVA 3O1OA 4GWJA 3T30A 3VKNA 3WF3A 3FB5C 4EWDA 5L3FA 3IC7A 2ZGUA 1NVPB 3UCSC 3K5MA 2D44A 4LF4O 1N32B 2BVBA 2ZMNA 3NAPB 5HXMA 3A2FA 3LSQA 2JXAA 1GP5A 1JUHA 2XWBB 4NVPA 1DGLA 1JYXA 4UFMA 5FZ0A 3BTAA 2DBIA 4IW3A 4BPZA 2VE1A 3D36A 5LOVA 1GZTA 1XNQO 2PFWA 4EQVA 3H1WA 3HKDB 2F17A 3CMAV 1VBE1 2QJVA 1DLCA 4AQYO 1VMFA 1LESA 2XASA 1M56B 3ZMVA 3RDIA 1HN0A 3A0RA 5IVJA 4KGGA 5IWAO 1I5XA 3JXSA 1PNLA 3MD0A 1IOAA 5FYCA 2RNBA 2ES3A 4QXKA 4I02A 4L8QA 3IPVB 3B7MA 2XDVA 4KQ7A 3JALB 2ENRA 1V55B 2ZGLA 3SDLA 3ZYGA 3X2QC 4JI4B 4K9SA 3ZYJB 2PN5A 3CF6E 2CWSA 4CH4A 5EYPB 2W6JG 1FAFA 4FTBA 2A3YA 4WVWA 4MVUA 4N90A 4UBHA 5L73A 5DZGA 1G9FA 2R1DA 3UL2A 3FYEB 4RFRB 2BTQB 3FE5A 5B5EZ 2V72A 4F8AA 5C4WC 1VEWA 5APAA 1GZ9A 2HWF2 3POJA 3VBFB 5F6KA 4XQWA 4DXSA 2W5FA 4JTAB 3I2DA 1RUG3 1FOD1 5BNOA 3A22A 5KR7A 3TB0A 1V6IA 5FUNA 4RQPC 1QQP2 5LEKA 1IBKB 4OHWA 1U0AA 2GC2A 3G6BA 2IXJA 4UCRA 2FDGA 3AG4B 4XABA 1GANA 2D3OW 3M3IA 1CAWA 5LATA 1MOFA 2WSSG 3HQUA 3M4FA 5J3UA 4GMP3 2EAAA 4FIPC 4B1LA 4Z1MG 4ZOLB 4PA4A 3CMGA 2XUEA 2R70A 2HVJC 4HSLA 4XAEA 1Z5WA 4RQFA 4A6SA 3KZIZ 5LHHA 5K4LA 2UU9B 4AQ6A 2Q8VA 2C2AA 5FMDA 3J4UH 4GB33 3SNMA 4IEPA 1L7QA 3W7WA 1JFFB 2JGDB 4LF5B 5KX5B 4UW4A 4X20A 2B4KA 2ILMA 5CKQA 2HWF1 2XXZA 3ZHTA 4AL9A 4YYOA 4NROA 1NY72 5FO8B 4EKWA 4N8MA 3E6CC 1D2SA 2SBAA 3PVBB 5A7NA 3UKMA 3H8XA 1KD1W 3W21A 2DWRA 4QB6A 2ZGQA 4KG0A 2ZMLA 4DUXA 3H1IH 5LRRA 1C4RA 4JHZA 4A3XA 5DDJ3 1W03A 3I3MA 1LHUA 4FLWA 3K4DA 4IXLA 3JALA 2BWAA 4PDRA 4CCKA 2Q7HA 1ZLZA 2Q0OC 5FIXA 1AJPA 1QLNA 2WC2A 1Z7S1 3ML0A 5D8AB 5EYPA 2C1FA 4IYIA 2D6OX 4FLVA 3D3IA 4XEZA 2JVDA 4FOQA 4Y5Z0 4B3SB 5KHHA 1RJ8A 4TLFA 2BTQA 5L3DA 3P5BA 2Z3YA 2YGMA 2W6IG 4OZXA 3K75B 5FZAA 3PU3A 1UNBA 1N33O 1HRV2 4MTGA 2Y8KA 3RG0A 4IV3A 2AEZA 4AQTA 2N05A 1OT5A 3AZWA 3LUTB 2YPDA 2ET1A 5KUKA 2LM3A 2QM8A 4HZFA 5ANNA 4BZ4A 3ABMB 4M0HA 2WWUA 4ZOLA 3S7EA 1TAEA 4X64O 3ICXA 3CCLV 4IGGA 2WQ4A 4QPJA 4AI2A 2Z2SB 5BNPB 1XYNA 2GV9A 1W9SA 1J95A 5CA3A 2RMU2 2I45A 3ZYHA 1Q3EA 4G27B 3OT7A 3X29B 2JGDA 1PMJX 5KX5A 2RV9A 2YIAA 1HRV1 3B01A 1GTOA 2E7TA 3O12A 2PHRA 1BMV2 4W4LA 1QOTA 3GALA 2WYFA 1VPHA 1THZA 4K1YA 4YNIA 1O3SA 4PA3A 5FQ0B 1TMF2 2F4LA 1VR3A 4DY3A 1YLLA 4XXAA 4XF3A 3FD9A 1IS6A 2HBUA 3KGZA 2VCAA 3C3VA 4IIJB 3A23A 3FN9A 5AFBA 4KU8A 1GP4A 5CG9A 5D8AA 2JEUA 5FMOS 1K4CC 3JAWA 1CPMA 1RITA 4ET7A 2UWAA 5BR8O 3K59A 4CVUA 4LBEC 1VE0A 4XF0A 2ZHNA 1RUG2 3WY6A 3VKFC 4EFBA 2AGSA 3LDEA 4A4AA 4PBPA 5C3RA 2BZDA 1BMV1 1S77D 2QZ3A 3OD0A 2UWCA 3SH3A 4ZBMA 3ZSLA 4QWNA 5C4WA 1NZ6A 3ABKB 3U4XA 4YIPA 1MZ6A 4IE7A 3S6PA 3FBMA 2XR4A 1DP0A 3O1TA 4X65B 5LK5A 1YITV 3NKTA 4X8PA 5F5IA 4LO4B 3QO8A 1SDDB 1CAXA 5BNPA 5KAIZ 4NKGB 1NH2B 4KFMA 1F51A 4WFHA 4GKJB 1VIBA 5H6QA 1RUI2 5IYZB 3LEKA 1ZRRA 4HVQA 2R0FA 3CRAA 2HKOA 2PA7A 3GYDA 3H9AA 5A7QA 4L0PA 1XPWA 4O61A 4I4TB 3M7MX 5KA5A 1WZXA 3TETA 2YV8A 1MG1A 4JI8O 3VDAA 5LHGA 1RUG1 4Q4Y2 1EP0A 1PNFA 5A6XA 2R1BA 1OF4A 3DL3A 1UL9A 1DFQA 3MI8A 1PL4A 3JAMN 2VY0A 5A2QN 3MV01 3J80N 4O4LB 1WW4A 4QX5A 4CDWC 4ZS3A 4GMP1 1GM8A 2ARHA 1SBFA 1YWKA 5HPOA 3CRMA 5LMUB 2ZM6B 4M4RA 5FP8A 2PHWA 1YJWV 2H3OA 3VDBA 4CP1A 2NP0A 3CHXA 5KHGA 4MADA 4AQ2A 2P34A 2Z5UA 3ZMNA 1OD5A 1G9BA 3K9SA 3ABZA 4NPRA 3TNQA 1S5HC 5LHIA 1RUI1 4JZRA 1J84A 2E63A 3SISA 4GB31 4LFAB 1FT9A 1UY4A 4DR4O 3ABTA 3LIHA 3LDRA 3CKHA 4LKDA 3SJQC 2M6YA 2F93B 2Q1FA 3T1MA 3T1LA 1NCQB 3WF4A 2BSKA 1N1YA 3ZKYA 3PTRB 3LWCA 3RZGA 4I0WB 2BCCH 4GD4A 1JODA 1ASJ3 1NQJA 5DDJ1 1FX5A 4JI0O 1FXZA 3M8AA 3SCGA 1DG6A 1GR3A 4MVOA 4CUBA 1RM1B 3LIGA 1SDWA 1F15A 4FPPA 5F3GA 5F1RA 1IPJA 3KF3A 3T3YA 2Q8DA 5LMNO 1WP7A 4TLGA 1EAH3 3ENRA 3KT1A 1IS3A 3VBOB 3AYCA 5IYZA 1AROP 1OHFA 5A3LA 3USUB 2J22A 4FFIA 2ADQB 4CPBD 5BV6A 2EIKC 2IXCA 2JEMA 4I4TA 2V7QG 4BW5A 5JXIA 1FFXB 5F3IA 5EK0A 1K42A 3B9IA 3ZM8A 3E35A 4QKBA 3FMGA 3CQOA 4MO3M 2A5ZA 1MS5A 2V09A 1W2AX 1HKDA 1NXD1 3WUCA 4HN0A 1GKFA 1HQWA 3RN4A 1Y66A 4COZA 4LHSA 3AM2A 2YI9A 1B09A 4BJ0A 3AK3A 4NXMO 1ULFA 4KWLA 2W1SA 2BDRA 4UFKA 2C5DA 2ZX0A 3GVMA 1MEC2 4NOTA 2CAUA 5FYZA 3VUOA 2VZOA 3KMHA 2Q69A 2XAFA 3ZXLA 3ZEDA 2XKPA 1RUF3 5AC93 3KVAA 2ZKLA 3I56V 3J8F3 4CTEA 5LGTA 5FMCA 1NCQA 1NI8A 1G4YB 4JI6B 1WCDJ 1T6BX 1WLWA 4F3JA 2WSVA 5LA1A 2GTSA 4GLXA 2WN2A 1ND3B 1ENVA 5JR7B 3AK0A 2GC3A 2QKAA 5FPUA 4GXLA 4XYXA 2DYSB 2XJRA 1GFF2 1WCUA 2VMHA 1M57C 3LZZA 2D3SA 2IFWA 1W9YA 4LO7A 3GHMA 2ADPA 2P1BA 2RS52 4CC5A 5FCCA 3IDBB 2ZKNA 3OAAG 3EXUA 1XREA 3VBOA 1G7YA 3K9AA 3GCXA 4Q2FA 2ORXA 2EIMB 4XVHA 3IZOA 5IHRA 1HQNA 2DVGA 2EICA 1GQGA 3APQA 4AG4A 5A3PA 5FLXN 2XJVA 2Q67A 1OCZB 3OMIB 2ZCEA 4D7YA 5GZEA 5EYYA 3FC0A 2EIKB 5GONB 1JZ6A 2WZ8A 1YJLA 3MF6A 2P4KA 4GYCB 1EY2A 3WG1A 2J1RA 5JSRA 4ES9A 4LF8B 2A3XA 5FPLA 3LPFA 4COWA 1LEMA 1YI2V 1ZZBA 4CDWA 2VVDA 2ZR3A 5JOXA 4NJ4A 3T1YB 3KT7A 4XDPA 4ZU4A 3WNOA 2PLV3 5IJ9B 4NHYA 1KD7A 4FSJA 4NYKA 3OMNB 1RUE2 4H2AA 3QG5A 2IVJA 2VWJA 3VKMA 3ZYFA 1NR1A 1J1LA 3FL7A 2WLIB 4PLOA 1ND3A 3DPRC 1RINA 1U5YA 2D5FA 1VRH3 1P4RA 1W8WA 2G9GA 4FPLA 4GZRB 2E53A 1V54C 3ME2A 4CUGA 2Y48A 1RJ7A 2XJUA 5FZGA 5KMGA 3PUSA 3I3BA 2XQXA 5FJKA 5K1XA 5A33A 2YZ4A 2QM4A 2E32A 4KG8A 1O4TA 3IDAA 2EVXA 2ZBJA 1JTZX 1Y76B 5FUPA 4ASUG 3ZRWB 3NNFA 3R05A 1AXKA 5I91A 4TWKA 4M3CB 3O1UA 1OQ1A 4HOOA 2RR12 4JV5B 4FPGA 4U3JB 1ASJ1 3LQCA 1O8PA 2Y6KA 2D7FA 3CPWU 3BOWA 5GONA 4X6RB 2XGXA 5CISA 2BPA2 1QIQA 3OPZA 1XNDA 3VZKA 3CE2A 3QO5A 1PO23 2YXSA 3HPLC 5GLUA 3RZLA 1AYM2 1QXJA 1OFSA 2OIIA 1FXHA 3JCIA 1REEA 3ZKUA 1X36A 4KWKA 3CNAA 4IHJB 1N34B 5I0SA 2VW2A 1VQLV 2PUSA 4FO9A 1AF9A 4JI3O 1EAH1 1AI6A 2W39A 4DV0O 1DU3D 2ZINA 3KCCA 2HWB3 3ZPOA 2YYOA 4R4ZA 5FY9A 1NT2B 3ABLC 1M06G 4META 4JTNA 5A3NA 4CDXC 5F7UA 5IJ9A 4QB1A 3VBHC 1OCOC 2EIDA 2VBBA 1MZ5A 3ZHSA 4XZPA 5GZFA 1W28A 1LOBA 4JRAA 4UFHA 3H8RA 2UXBO 5F39A 4AFMA 3VGIA 4CH6A 5FZ6A 3CX5F 1XNKA 3WQ1A 1KMIZ 3EXAA 4IGPA 3OEBA 1O3RA 4FZ1A 1JYIA 2KG7B 1N36B 1K5QA 4HL0A 2R063 1GK9A 2ARBA 3T2OA 4EB6B 1PZ8A 2DJVA 4DRXB 1R1ZA 5FPVA 1GN6A 1Q5OA 4XFHA 3T0AA 1ENSA 2JB4A 5CA6A 4AAPA 1VQ8V 3PUQA 1NU1H 3SR2C 3NJYA 1GP6A 2QWNB 3MFCA 4XTMA 4HPKB 2AEYA 2QCSB 5KHIA 5JIAA 1RUF1 5AC91 1PZ7A 1H2GA 4GKKB 2WLJA 1M4UA 3J8F1 4NXNB 1Y76A 2BV4A 3ZRWA 1DGWX 3JSNA 2HJFC 5FNVA 2VUAA 4UW5A 4M3CA 1FNZA 1AVMA 1I6XA 2Y6LA 1SBDA 2QQNA 4DUZB 5FPZA 4N7IA 1OF3A 4LR3A 3SC7X 4L99A 3ZN1A 2P3IA 1QVGU 4Y4RA 3TJTA 4B7KA 1PK6C 2B39A 4JZGA 5GLTA 3U10A 4MLOA 2AGAA 3QF7A 4HKOA 4KHPO 1SQQH 5CG8A 1DYPA 3POIA 3RQ0A 3AB0A 3UKNA 2IJJA 4EEQA 1OCRB 1L0NH 1F5JA 1S4CA 5CAZA 5KAFZ 3AZVA 3GWKC 4FP2A 3UT0A 3A21A 1ZUQA 1KDKA 4IDZA 5JOZA 1UJWB 3CC7V 3HBZA 1JX9A 1AI7A 3AG3C 3U0ZA 1WWYA 4G28B 2LFSA 3I59A 2E9QA 3PVOA 1F2NA 1WD3A 4BQXA 1VBC3 1Y9QA 4ATEA 5HV0A 3TGUH 1I1EA 4LF9O 4M0NA 1IBLB 4DK1A 4JTDB 4ES8A 2UWBA 2UYAA 4LTAA 2VZ3A 3RSJA 1VIWB 2B5HA 4JAUA 2WZEA 1TUBB 3K46A 3WG2A 1OCOB 2ZXWC 1VBD2 4LMFA 4B3RO 1SFYA 3KLSA 3Q8CA 5E6HA 1UXZA 1BJQA 1JOBA 4XUTA 5FBZA 4O9GA 4DRXA 4Q1RA 3B40A 1K33A 2Q8OA 5IVVA 1XOYA 4QXBA 5JSOA 4OX9O 2UUCB 1PM9A 1OURA 2VZTA 3DXTA 1Q43A 3SJAC 4AR2A 1AXZA 4HPKA 2A6ZA 2PLV1 3JD72 2YI8A 4DR5B 5A7WB 3SPGA 5LXTB 4GIQA 4DXWA 2QQPA 3QBQA 5ABJC 4UW3A 1RUC3 1TG7A 3TRSB 4B3SO 1CIYA 2KB1A 2HHHO 4MXWA 3WQ7A 4EN9B 2CGOA 3OPTA 5CBLA 4QX8A 1D5NA 5A32B 2CU5A 5JCOC 5FWJA 1DCSA 1R6NA 1SRYA 4AI3A 4XQDA 5I0TA 1C57A 1PO22 1VRH1 2VJXA 3T4ZA 4D0QA 2UXCB 2DMXA 1N0JA 4B3TB 3H0OA 1GWLA 2FZ1A 2ZDIC 5FKCA 4RR3C 4RL7A 2BUKA 5DAWA 4FLTA 1EYBA 2CTWA 1D5AA 4FAHA 2MW2B 4DV4O 4LO6B 5L9RA 1WMDA 4XOGA 1ENXA 3DTUB 4BDVB 4OVEA 3BKZA 3W9AA 1UCXA 2ZR2A 5CFCB 1KUQA 1V6MA 1YTFB 1ZRIA 2DYCA 1QBZA 2QA4V 2OZJA 5F3EA 1NCRC 3K77A 3B3QE 3HT1A 3B77A 2XT9A 3ON7A 4YVWB 4WBNB 4B3MO 2HKXA 4XF4A 2J1AA 4OHZA 3IAQA 3KCXA 3SJCC 2VQEO 3OF1A 4Y1UA 1PO21 2R062 1KYOF 5L19A 2HEWF 5GLVA 3N35A 3ZLIA 4BQ4A 1WA8B 1FJGO 2VMFA 1BEV3 2GNBA 3THPA 2WNUC 3ZIXA 2VOWA 5H9SA 5D5QA 4YW2A 2VWKA 3NL1A 4UI9L 2HWB1 5A6QA 2FD8A 4QHOA 2ITDC 5H9CA 5FY0A 4AI1A 2FMDA 3H8OA 5FK7A 3V0BB 4TZDA 4QB2A 1DGWA 1VBB3 3VBRC 1S1AA 3CRQA 3M99B 1WBLA 2UUAO 1LHNA 5LBEA 2P4EA 4JI1O 5CZKA 1DZRA 3C7FA 4DW0A 3TEWA 2OS2A 1QVFU 5A32A 2IXLA 3H1MA 5JH7B 1REDA 5IFPA 1UYYA 4YGBA 1DDLA 4AE2A 4H0LB 5LL6Y 5L36A 3APBA 4Q0VA 2D97A 4XETA 3SITA 1H2NA 2HP8A 2R061 1GOGA 1AYN3 5HCFA 3ETEA 3E5XA 3LKJA 2WO7A 2YMZA 4C91A 1R64A 4AHWA 1PGL2 1XUQA 2OUHA 3HAGA 3BIEA 4I9QA 5CEHA 2NMNA 2YICA 2V4VA 3QOPA 3R4DB 3AMQA 5DUXA 1ZREA 1PK6A 1RUJ3 3FLPA 3JD4A 4JCKA 4M4PA 3MFAA 2JDMA 2D93A 2RM22 3HNMA 4E2QA 1ZRDA 3HKEB 4UF0B 4JI2O 4CDUC 2HWD3 2DYRC 2YXLA 2K0GA 1KXGA 5C5TA 4XMIA 1IVSA 2VUCA 1QJY3 3CRCA 1RP3B 3GZAA 3KV6A 3WG7C 1QF3A 4AVVA 1VQ7V 2AXTZ 4H44B 1OQEA 1D4M2 2E74B 4AEDB 4GCZA 3CMEV 5F5CA 2XOMA 4YVWA 5FZMA 5L3GA 4WBNA 2XAQA 3MICA 1HRI3 1O4YA 3HOBA 1XNCA 1NTKH 2ZPXA 2BEOA 2Q4PA 1K5MC 1WA8A 2Q4SA 1EPWA 5E8AA 4AVAA 1N3OA 1DIWA 1MS1A 1MS8A 1OOPC 2ZNJA 4CCDA 1L1FA 3O7OA 3E5QA 5EPAA 4I2OA 4YPJA 4LF7O 4OFGA 2OQ7A 1TE1B 5J9PC 4K21A 2A7WA 1JZ8A 1AX1A 3F7VC 4XJUA 2D43A 2XB6C 1ROPA 2AC1A 5F8PA 3ZMZA 3CJHB 1QJX3 1NKGA 3T4VA 2WNUB 1VBC1 5F9TA 4ZZ8A 1SQVH 1Q82W 1Y74A 1UKGA 2XMLA 3AEIA 1NKDA 1FXKC 1AJNA 3HKBB 1O6UA 2UUBO 3VBRB 3VZMA 1AR4A 4ICGA 5FP7A 1D0HA 2Y0OA 2NNUA 4BK4A 1XL6A 1SA0A 4LBLA 1A8DA 2QWRB 4QQHA 3UYJA 4BWAA 4DXTA 3N3HA 4NR1A 1JQ0A 4Q29A 1SMVA 2NYYA 3VN4A 4UWDA 1QGLA 1OLME 4UF0A 1M90W 1WB8A 2BBVA 4YRDA 3S30A 2ZDIA 4RR3A 3FBYA 4IEQA 4XF9A 1RB8G 2WS92 3VKOA 1RUC1 4RWUA 2D5HA 2JDNA 5B1AC 2NMOA 1RVF3 5HFLA 3CU7A 5E1RA 4XDJA 4GKXA 4X66O 2EJRA 2D40A 3RVYA 1VAVA 2N7GA 5CNAA 4XBQA 2VCBA 3CSXA 2QDRA 5F5AA 4QDRA 4MTFA 3PIJA 1O91A 2RG4A 5FL7G 2VNGA 2A1XA 4JYAO 5H2FZ 4IL7A 2P6JA 2X6AA 4OQ9A 4XFCA 1BEV2 4Y1YA 5T5PA 3OY8B 1VAMA 4H3WA 1BHAA 4YSFA 2ARAA 2QR4A 1GZWA 4AF9A 3S7IA 1M5IA 4XZUG 5FAXA 2Y34A 2KQXA 1ZZCA 5EXOA 1BK1A 1W6PB 2RS33 1Z0HA 1BHGA 4XCBA 3POSA 5I0RA 1KP3A 1TVKB 3ZYIB 3CJHA 1VBB2 2WNUA 3VD9A 1SFPA 4O4IB 4DRVA 3QCWA 1GM9A 1ZBE2 4YG6A 1O5LA 3N2GB 3H9VA 2IU0A 4LBQB 2GBOA 3OSDA 3HKBA 1AHSA 2KA3A 2RN9A 1US2A 3KT4A 4YW1A 3CCQV 2CDYA 2QJ1A 4CH3A 5D2AA 3FZ3A 1RUNA 3VBRA 2X5IC 2C0ZA 4E9KA 1SZBA 3BEHA 2WL1A 3W5MA 1XC6A 4DMIA 3VD4A 4LFBO 1XNQB 1BEV1 2PYJA 4RHV2 4S2FA 4KP4A 1OXCA 3POEA 4AVBA 3SEEA 1ZZ8A 4AQYB 4XXPA 3WP6A 2A71A 2QKDA 2HWD2 4YY3O 3OGIB 4HKWA 4ATFA 4AFAA 2AENA 3U07A 4A7KA 5IWAB 1OSGA 1QJY2 1VBB1 2WWJA 3PU8A 2ZX3A 4JYCA 3OBTA 4A41A 3WHTA 2GSMB 3H8UA 3NMBA 1MS4A 2NZ9A 2O14A 3MUY1 2EIJC 2WZR3 2ARCA 4OPHA 4CDUA 2W0FC 1QR8A 4NWVA 4AI8A 3CZJA 3OYWA 3WOGA 2X0LA 3W7TA 1AYN1 2WAMA 1J1TA 4DINB 1HNZO 4YFWA 2Y60A 1YTFD 1C1FA 2ZHKA 3C8XA 3V0AB 2LGWA 1UYZA 2O0OA 3CCMV 5T50A 2Y64A 5T5OA 1RUJ1 1E1QG 2EXKA 3WF0A 3AKTA 1HX6A 2FHRA 1W6PA 4G9SB 4LF8O 3PJSK 2HWD1 1K5MA 2RDQA 3SHRA 3GM8A 2NPIA 3GJBA 4D7SA 1VBA3 1QJY1 4XFGA 1I7FA 3WDVA 1WGPA 4O4IA 4FPJA 1NTMH 3O1RA 3ZVXA 4LA3A 3J9SA 2J7MA 1WB7A 4LA2A 1LECA 2G1MA 2CSGA 4MSWC 4WFBV 4LBQA 1YXBA