3OTFA

Structural basis for the camp-dependent gating in human hcn4 channel
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
197
structure length
197
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the cAMP-dependent gating in the human HCN4 channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 61
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2010-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3otfA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3otfA02
3NSTA 2WC2A 2QNKA 5JAXA 5JSOA 5FPZA 2IXHA 5JCTA 3RDIA 3H50A 2PYTA 3KCCA 2K9ZA 2MHFA 2K0GA 2BNNA 1PM7A 3E5UA 3KMHA 3LA7A 4EWAA 1CAXB 1Q43A 3BB6A 1CAVA 4BIFA 4MUVA 2IC1A 4N9IA 4AVBA 2GC3A 3HQXA 4XFIA 4MGKE 3EQEA 4YNIA 2PA7A 1O5LA 5J7MA 5KBFA 3EO6A 5KHJA 4LLOA 5BXXA 2H6CA 1NXMA 2Q1ZB 3NKTA 4B29A 1Q5OA 4OLLA 3U0ZA 5J48A 4MGYE 3SHRA 1O3RA 2VECA 4I02A 2H0VA 2QCSB 3E97A 5KHHA 1LKNA 5BPXA 4UXAA 3GBFA 3ES4A 5FPXA 2GAUA 3NVCA 1RL3A 3H8UA 1GQHA 4FAHA 3M3IA 5K8SA 4L2NA 3PLQA 5FLHA 4ONUA 4QMAA 3MZHA 4AVAA 1TQ5A 1YFYA 1EPZA 1X8MA 2XL7A 3FFQA 3WW2A 3WW4A 3FHIB 2D93A 2ZKLA 1RUOA 1ZRDA 3UKVA 4FT8A 4ORFA 4IEOA 5T3NA 3E5XA 5EZWA 4O9GA 4MV2A 4XFBA 2BGCA 4LTAA 2XL9A 3JZVA 2PAKA 5LRSA 2P17A 3PNAA 1NE4A 3MDPA 1YWKA 2OZ6A 4LUMA 4LUKA 4JVAA 4QXKA 1LR5A 4IEZA 5JSPA 1FT9A 2C0ZA 3IWZA 1X8EA 4F8AA 1YHFA 4KWJA 3H1MA 3GYDA 4HVRA 1OMIA 1SQ4A 3SXWA 4FAGA 5FCCA 1IPKA 2E9QA 2UYBA 1GQGA 1RC6A 3USSA 4R8HA 4UBGA 3KGLA 3WW3A 3ZDSA 1SFNA 4HZFA 3BALA 5BV6A 4XF0A 2GU9A 5F1RA 3CL1A 5I0UA 3WW1A 4QM9A 2XLAA 3FJSA 4XFFA 4JV4A 2BNMA 2PQQA 4F7ZA 2VPVA 1XRUA 4YRDA 4KWKA 5AVPA 2PAMA 4BHPA 3H1YA 1CAVB 1FI2A 4K8FA 3SMHA 1O5UA 2PHLA 4J1WA 3LWCA 3IIAA 2EAAA 2XLFA 4IEPA 4DINB 3BU7A 3EBRA 4XF1A 2V09A 4EV0A 3IDCB 3D82A 1JUHA 3OTFA 2F4PA 3DV8A 3I7DA 1UIJA 3OGJA 3RZZA 3SCFA 3QOPA 3TNPB 4HMZA 3EHKA 3HIFA 5FLJA 5J3UA 1ZX5A 2XKOA 4N9HA 4LEJA 3G7DA 1ZVFA 5I0TA 2MPFA 3LA2A 2B9UA 2FMYA 1NYWA 2CV6A 3IBMA 2IXCA 5KHKA 2O1QA 2KXLA 2PFWA 3M70A 4WVZA 5FQ0A 3E6CC 4HN1A 1WGPA 5JR7B 1CGPA 5I91A 3FWEA 2B8MA 1OD5A 5BY5A 4HVQA 1PMIA 2B5HA 2Z69A 1RTVA 4QM8A 3LAGA 3U10A 1CX4A 2UY9A 1ZZBA 4L11A 1ZREA 1X7NA 3CLPA 4EROA 1NZCA 1U12A 5LRRA 2Q4SA 3RPQA 4IERA 4AQ2A 4I0AA 4ZU4A 3E6BA 2QDRA 3CJXA 3MYXA 1UD1A 2D5HA 4A2UA 1DZTA 1WLTA 2OZJA 1YUDA 1J1LA 1DGWA 4CYDA 3VHRA 3MPBA 3OD0A 5I8YA 1IPJA 4QGMA 5FLIA 2GH2A 2BEOA 3H1WA 3B02A 3I54A 1ZZ7A 2QJVA 3QACA 1EP0A 3LZZA 4E2QA 5JSRA 1YLLA 4Z82A 2IXJA 4BH9A 1ZZCA 2IXLA 4ZU7A 5FDBA 4YSFA 4XF4A 2WFPA 4I3PA 2XGXA 2IXIA 3DL3A 1J3PA 4Q0PA 4XF9A 1CAWB 1YFWA 1FXZA 1G6NA 2I45A 3E6DA 4QX5A 2UYAA 2EA7A 1QXRA 2O8QA 4I09A 3NW4A 1J3QA 4I0BA 4MGZE 2BYVE 4AVCA 4IETA 2ETEA 1ZRFA 3UKTA 4PIZA 2Z2SB 1LB2A 4PIYA 2ET1A 2XHKA 4MZUA 4Q29A 3H7YA 4IEYA 4KU7A 5EFUA 4IEWA 4GULA 3FE5A 3ACLA 4HVOA 3UKNA 4LA3A 3KSCA 4EWEA 3S0MA 5I8TA 2H6BA 4E2GA 4AQ6A 4PIXA 4IEVA 1CAUA 1EYBA 1X82A 5BUVA 3U11A 3FX3A 1J58A 4Q0VA 3ETQA 2EVXA 2PTMA 4UBHA 4XFHA 3R6SA 1L3JA 4JTNA 4XF3A 4NVPA 2GZWA 4HLTA 5D1IA 3D0SA 1SEFA 4H7LA 2OYZA 4HBNA 4X6RB 3OCPA 1DGRA 5C8WA 1UPIA 2OA2A 3NJZA 2Y0OA 3H7JA 1Q3EA 1J3RA 1H1MA 3E5QA 4XFAA 1QXJA 3I59B 4HN0A 1V70A 1UW8A 1ZRRA 4YYOA 3C3VA 4Q0UA 1RGSA 3I59A 1O3QA 2PAEA 1I5ZA 3IDBB 3PVBB 1Y3TA 2CAVA 5CADA 4D7TA 3DN7A 5I0SA 2BNOA 2XLGA 4ZU5A 3EJKA 1RUNA 3KGZA 4LULA 4RD7A 4XFCA 1ZNPA 1ZZ8A 2MNGA 2QVSB 4JTOA 5E16A 1OFNA 2GC2A 1DZRA 1LRHA 1ZRCA 2Q0AA 5KHGA 4HSJA 3ST7A 4OFGA 1YFUA 2XKPA 4META 1UCXA 3LA3A 4MH0E 3BCWA 3H3ZA 2CGPA 2UY8A 4I2OA 4WBBA 4FBFA 4KL1A 5KHIA 1O7FA 4XFGA 2IXKA 4EWDA 3NL1A 2GC1A 2HKXA 2ET7A 1CAWA 4LA2A 4KWLA 2CAUA 1OI6A 4R52A 3CF6E 3BPZA 2FQPA 4IEUA 5LEJA 1VJ2A 1WA4A 3RNSA 2HJIA 4QGLA 1O3SA 1XE7A 1CAXA 5C6CA 1EY2A 2VQAA 4TLFA 4Z07A 2D40A 3RYPA 3N4MA 1QY4A 1VR3A 1NE6A 4MGIE 3ELNA 2D5FA 5LEKA 1HW5A 4MX3A 3OF1A 4D7SA 5CU1A 3D0JA 3LOIA 1O3TA 5I8SA 4Q0QA 4E2SA 4BYYA 3FZ3A 3TNQA 2ATFA 4I01A 4J1XA 4QGNA 2PHDA 5I0RA 4O9EA 3O14A 3L2HA 4IESA 5HI0A 3S7IA 4XEZA 4XETA 1XE8A 3SCHA 3H9AA 2DCTA 1QWRA 3S7EA 3RYRA 1J59A 1CAUB 3H3UA 4KU8A 3RYKA 2N7GA 5CVRA 4AXOA 2ZCWA 3CEWA 1H1IA 1YFXA 3ES1A 3DKWA 4X6QB 1Y9QA 3SCGA 4P9GA 2OPKA 5I93A 1ZZ6A 1VP6A 2GC0A 4Q0SA 3HT1A 5E1RA 2Q30A 4YARA 3CO2A 4PJYA 1I6XA 1UIKA 4WZCA 1ZZ9A 5FQ0B 3ROUA 4IEXA 1O4TA 3HT2A 4IEQA 4HSLA
chains in the Genus database with same CATH superfamily
2WC2A 5JAXA 1OCZB 3CCRV 3WF0A 4CS2A 3OBRA 5C70A 1V9PA 3PVOA 3NNGA 1Q86W 4DEQA 1RUE1 3SJQC 2ID4A 4R9AA 3G80A 4MGKE 1DHKB 2FCTA 4J11A 2VXRA 4LO5B 5EYYA 4BIZA 1OFSA 2YGMA 5LMNO 1M4WA 1YJWV 5J48A 1HNZO 2HWD2 4ARXA 2D44A 2PI5A 4K40A 1GN6A 4UCVA 4AGVA 1V55B 1C57A 5GTHZ 2C5DA 3U4XA 1LENA 5B1BB 1LHVA 3PLQA 1OA2A 3CE2A 1YFYA 4GB33 1GFF2 3T1MA 4FLUA 3A2FA 4OHXA 2YU1A 5F2SA 2NLRA 1EAH2 2XTAA 5FYZA 3JZVA 1YJNV 1PVC2 2WLHA 2PHFA 1YNAA 2Q7GA 5IYBO 4XYXA 2FMDA 4XQDA 2A3XA 2R30A 4C0HA 5FYTA 4X20B 2Q73A 4Q4Y2 4DK0A 4HVRA 2Z3YA 2EIJC 1SQ4A 5FCCA 1GNYA 1DQ4A 2MW2B 1SFNA 2GU9A 5AC92 3OEEG 1Q6HA 2W39A 1IKQA 3HN3A 4P9IA 4DR6B 3WG7C 2A75A 1PK6C 2VZSA 2YXLA 1MSDA 1O5UA 4JI6O 4TYSA 5KAFZ 2JKBA 2B7YA 4D6RA 1DQ0A 1HNZB 1URFA 3D82A 1JUHA 3G67A 2UXDB 1YTFB 4P9OA 4OMCA 1ORQC 5CKMA 1K45A 2QGNA 1AXKA 3ZRVA 4LEJA 2MPFA 2B9UA 1JOJA 1D0HA 1DF5A 2KXLA 1AUYA 5C9AA 2Q8VA 1IXMA 5FK8A 2JE9A 4N90A 4AEKA 2Z69A 4CVUA 1VMGA 4HFSA 1SBEA 3JU9A 2VH9A 1WAZA 3LSDA 4FFBB 3AC0A 3CD6V 1WD4A 5LRRA 4YW6A 2JENA 5L3FA 3E35A 4EQVA 1RVF3 4E8DA 1YUDA 1R3JC 2PLV3 5EPAA 1MEC2 3C7FA 4PLOA 5E1AC 5H6RA 3JASA 3U4SA 1XBLA 3WNPA 1DG6A 3SNMA 4XUTA 2BBVA 4O65A 3K03A 1I94O 2W1UA 2WPDG 5B4XA 3OTOB 1EV11 1MA1A 3CZJA 1V6JA 4EEQA 2WQZC 4YJ3B 4CS3A 3F7VC 1H2GA 1X9TA 4MVRA 2XAJA 4AEDB 1VF5B 2VZUA 2ZMNA 4AOCA 4I09A 4MGZE 2LROA 5DG1A 3NNLA 4IQPA 2DVDA 4DPNA 2Q7EA 2QKCA 3OGGA 1TUBB 4CEWB 3PUSA 1JS9A 1BK0A 4UF0B 4B08A 3POGA 5G05L 2LFRA 3SYCA 4AHYA 3UT5B 3VZOA 3AKQA 1RUD2 1QBZA 1WLWA 5LHHA 3L73H 4R50A 3K08A 4MGQA 2Y0IA 1W9TA 3OBAA 3WNKA 4JI5O 4IHJB 5FWJA 5C8CB 3VUOA 4X6RB 1N1SA 3KCXA 2VOWA 1OKOA 3ZFFC 4ZKTB 3VQYA 5CA1A 3SPGA 4XQWA 4LKEA 1WKYA 4DV7B 1R1BA 1KP3A 2AEZA 1T5EA 3AKPA 2ITDC 1W2UA 3I2JA 4JAAA 1IS4A 5B5EZ 2B9ZA 3WNLA 1AI4A 4NROA 3ZFEC 5A1FA 1OA3A 3DECA 3K0GA 4DV5B 4YZ3A 4K7JA 5FYYA 4GWNA 3VBBA 3NNMA 1LU1A 1CWPA 1KU9A 2ET7A 3I97A 2IH3C 3AYCA 5FO8B 2AGSA 1MOFA 2FQPA 4M3CB 1ZWIC 1VJ2A 2DCKA 2VOKA 4LF8B 2R041 3LSSA 4LF5B 2A79B 1MABG 2X7RB 3B69A 1PZ8A 3PTYA 4MX3A 2HEPA 2XPJA 3K04A 2RM21 3AX4A 4P9PA 1ULCA 3STLC 2VXJA 4CP9B 2EX3A 1NKDA 4IESA 1PPJH 2AUYA 2N05A 4Q4W2 2XR4A 3JAWA 4DV4B 3ZFEB 5LBCA 2RJZA 3SYAA 3CZUA 4WVMB 4YGDA 1LUWA 1AR92 3I55V 3G71V 1YCIA 3T4ZA 1HNXB 2E74B 2GC0A 1ZZ9A 1LECA 1DCSA 3ETGA 2QNKA 1OH3A 5GLZA 2XJPA 4EWAA 1DF0A 3VGIA 3BB6A 4DV4O 5KUKA 2VQEB 4QU1A 3I2GA 2GC3A 3OGSA 3GJAA 3CMGA 4YM0A 1JBCA 2IZWA 4FFKA 2BCCH 3MLJA 2YXYA 3WQ0A 1RINA 5FV3A 3OGRA 2EULA 1BJQA 3BABA 2VW1A 4UXAA 1N3OA 2EJ7A 1SC5B 5FKBA 2W6IG 1RL3A 2ILMA 2DTWA 5JLVA 2E51A 2W1QA 4CUGA 3VV1A 1ULEA 2JXAA 3V0BB 5T54A 1TQ5A 5ANQA 3WF2A 1C5IA 1RM1C 4NXMO 3AVRA 3B9CA 1ULGA 4K0KB 4XJ9A 2AH2A 1AR63 1ENSA 4CDQA 2JE7A 2QEXV 3WNXA 5F3EA 2IFWA 3WDYA 5IJ0A 5JSPA 3MIFA 1WCDJ 4KWJA 3GYDA 1UXZA 5IK8A 3WNOA 2Y38A 5C8YA 2E9QA 4DFSA 4AHWA 4R8HA 4YFZA 3C3TA 3GM8A 2R16A 4GALA 1GU3A 1B06A 2RCVA 2GALA 2DVFA 1NT2B 4K9SA 4J41A 4XFFA 4FLTA 5H6QA 3QTCA 1W8FA 4KWKA 2D98A 4CXXA 4KGGA 1M56B 3ZYGA 2W92A 4COWA 1JYIA 4IEPA 2DW4A 3G6BA 1DK1A 4PI2A 4DV1O 4M4PA 1AI5A 5KLVH 5DAVA 1L0NH 1TGOA 1LGNA 1UIJA 3JBG1 4ZIBA 2VR4A 5A6ZA 5DAQA 5CG9A 4N9HA 3PVNA 3ZX7A 3G7DA 2YV8A 1NOVA 1GKFA 4C1WA 2KA3A 1UNBA 3IAPA 1QHDA 5FMOS 4BJ0A 1M93A 4EZHA 3WFVA 1TME2 1RUI2 1XBFA 3LDDA 1P7BA 1UPSA 5B3SB 4EROA 1R3LC 5FP3A 2DUPA 2VQTA 4N21A 1OCCC 4AQ2A 2P2KA 5ANNA 2ADDA 2D5HA 1G9BA 3ABKC 1GM7A 3BVCA 1AJKA 5LOVB 2ZHMA 1W8TA 2VMDA 2YICA 4PDWB 1N47A 1YLLA 1DQ6A 1EV13 1NY71 4XC9A 4IV1A 2Y6FA 4BH9A 1ZSPA 3TWIA 3M8AA 1PVXA 3X2QC 4N43A 2P4VA 1XNQO 4QX5A 1OCCB 1G6NA 3F95A 3I49A 1HP8A 1XHZA 3HJRA 2VCBA 3NW4A 1LJ7A 2GMMA 3IJ4A 4GMP3 2ZE5A 2W47A 1GMMA 2YUEA 3S3WA 3VBSB 3JSLA 1JA8A 2EXHA 1A6CA 2W1WA 2ADEA 5F5IA 4KU7A 3OYWB 3AK0A 4BWOA 3UKNA 2XONA 3K3WA 2FD8A 3ZFFB 4LO6B 5ABJA 3KHBA 3ZMOA 5FXVA 4B1LA 1RMU3 1A8DA 1RITA 1NU1H 3CMEV 4Q4X2 1PO23 5EIBC 2VOXA 4Y22B 1R73A 4Y1UA 2PTMA 2Y0PA 2P1BA 1N36B 1RVF2 4YG6A 2BPA2 4DB5A 4FOWA 4HLTA 4K8ZA 1K42A 2OYZA 2Q7HA 4X8PA 1V9U2 2QA4V 3HWJA 2MEV1 1AF9A 3WG2A 5F2VO 3KD4A 3GVMA 5F5CA 4XTMA 1OH4A 3DXRB 2E53A 3C3VA 2X10A 4FI9A 1GZTA 2LW1A 1I1EA 1VF7A 2DTYA 2EIDA 4NHYA 5CYYA 2IH1C 1MS1A 1OPOA 1OLME 1ZZ8A 2GBOA 4PCRA 4JI4B 3WG4A 3JD2A 4M01A 3CMAV 3TN91 3IPVA 5GONB 2QZ2A 3MIBA 4META 1XNAA 4PA4A 4WM7B 4I50B 4MH0E 3KM5A 4GZ9A 1H8VA 4FFBA 1W6MA 3EVKA 3SC7X 2GC1A 3VKNA 2HKXA 4Z2WA 2FHRA 5IYYA 3I2OA 3PUAA 1L7QA 2JIZG 4X66B 1K92A 3D4KA 1VR3A 3ZKUA 3RVYA 3DC6A 1VQNV 4JC1A 4Q0QA 3URFA 4O9EA 2ZXQA 3IDAA 2OKXA 4Q20A 1J59A 1M4UA 3H3UA 3JARA 5FYMA 1W2TA 4MVQA 2V5YA 4GX5A 1IG0A 2Y33A 2E75B 4I50A 1KKDA 1ZZ6A 2JB8A 2SBAA 4XXAA 4PJYA 4FPCA 3FB5C 3DXTA 5K4LA 2HHHB 3BUCA 5C3RA 4IEQA 4DR5B 3ZN0A 3M3CA 2ZM6O 4CDUA 2MHFA 5AFEA 3E5UA 1JR9A 4DMIA 1W90A 4UFJA 2IC1A 4LHSA 3POSA 1RHI3 5JIUA 4CEWC 4HZ3A 5DEDA 2QQNA 2Q6AA 4YG0A 1IXBA 1ASJ3 2IJHA 3ZSJA 1XNBA 5EYPA 4XQ4A 1GANA 2LTNA 3AXDA 3U0ZA 2E31A 2VECA 5KHHA 4YHHO 4NTXA 2YZ4A 4F83A 2HWC2 3WT3A 4OMDA 3WQBA 2FCVA 4ZHQA 1NR1A 2QE7G 3LKJA 3H8UA 5DECA 4DS0A 4FAHA 1URXA 5FUIA 3E22A 5I0DA 3IFXA 5C9AC 2WINB 4XILA 3FHIB 3FFZA 1ZBA2 4TV9A 4V2VA 2VY0A 5LRSA 2ZJCA 3PNAA 1Z78A 3MDPA 1AYN3 2ZS6B 1WW6A 4YJ2B 3VLBB 3JALB 4QQPA 4NAOA 4UW3A 4XJ8A 2F6BA 2YHJA 1K34A 5CN0A 3N9QA 1W0PA 4CSWA 4MS2A 2Q69A 1OMIA 2XBO3 1GQGA 3USSA 1HW7A 1RC6A 2GSYA 4XDKA 2VNGA 3HB3B 4IXLA 2ODMA 5JJJB 4O2AB 3H1IH 1JU3A 3WW1A 4KNCA 4DR7O 2HWD1 1HV0A 2P6HA 3BYWA 1LULA 2I07B 3ZMNA 1JTZX 3ALQA 2ZGLA 3ASOC 4QHOA 3B40A 2J1RA 5C8CC 4LJHA 4I9WA 1V0AA 3IIAA 4XZPA 1SQVH 2EAAA 4RQFA 5A3WA 2YY1A 2GDFA 1HB2A 1OA4A 2ARBA 2X0LA 3RZZA 2AACA 2NMOA 2BE3A 1E1RG 4CTEA 1MQTB 1JYVA 2X5IA 4RGKA 5KAIZ 1EAH1 1QU0A 1CPMA 3LQCA 3O0WA 3K06A 1W0KG 3BVOA 1CGPA 2YSUB 5FQ0A 1PGW2 3T1CA 4YZ1A 4JAUA 5A6QA 1QDOA 1POQA 1YI9A 1OD5A 4PHZA 2ZBJA 1PL4A 3AKRA 2UY9A 1SF9A 4DXSA 3MHHC 4LP8A 3RI9A 1JYNA 2QM7A 2RJLA 4K21A 4A3ZA 3ZXFA 4BQYA 2WAMA 1VBD3 3J8F2 3RRDA 4TSFG 4YVSB 1TVKA 3ZEDA 1J1LA 2EXIA 4MGTA 4RS5C 3PMEA 1W6QB 1YZBA 2BEOA 1WPXA 3A0KA 4YZ5A 3TETA 1R1A1 2IXLA 2ZE7A 1RUF1 5JJNB 4GKJB 3ZFEA 5LZ6A 2JEXA 3W7WA 1QXRA 2E33A 1ZBA3 4I0BA 2PN5A 3JXSA 1F5JA 5LXTA 4C0BA 1UX7A 4X65B 1XMOO 4PI0A 2X05A 4GXLA 2ET1A 4GULA 2AHYA 1I7FA 4EYUA 2N04A 4OI2A 1VBB3 1HKDA 4ZY9A 5CKQA 3E8HA 2XVLA 4RFT0 2KM2A 2GV9A 2H6BA 1AYM2 1BHBA 2ZX3A 5LBFA 4AQ6A 2AEYA 2BTQB 1V54B 2XJTA 4NB5A 4IE5A 1CAUA 5BUVA 1RUC3 3LOBA 3FD9A 3KV9A 2WWSA 4JTNA 4NHKA 5C3SA 4S2DA 4CUAA 1CX1A 3J26N 1O6UA 4OQ9A 4TWTA 1F35A 2WBKA 1EPWA 2IJJA 3IDEA 2DOSA 3BTAA 3ENRA 2IBZH 1GP4A 3I59A 2E76B 3F5WC 2XVGA 1KFXL 5A1LA 3AG1C 4JI8O 3PVBB 2EF6A 2ZXWC 2Y6GA 1NBMG 5H5NA 2MNGA 4NMIA 2DYCA 1K5MA 1DZRA 1NS1A 5CBLA 4JI1B 2Z4FA 4P9WA 4CXYA 3NKGA 2AYHA 3UL2A 5KHIA 1GICA 1NI8A 2J22A 3N2KA 1PIV3 4JQRA 4JHTA 1VMJA 1ACCA 3CF6E 2LQTA 3QLQA 3QH7A 1KS4A 3Q8BA 4Z1MG 1CAXA 4OUSA 1IGOA 2P90A 3VOUA 3KLSA 3C2UA 2ARHA 1S2EA 5LEKA 1HW5A 3M3OA 3ZXJA 3CC4V 2Z5WA 3FZ3A 4C8DA 5J98B 1BBT2 3RZHA 3CKHA 1FAYA 4AFAA 4JV5B 1XE8A 3SCHA 4WFHA 1ODNA 3H9AA 2XJVA 1QMJA 5GZCA 3HKBB 4WBNB 3W5NA 5EWSA 2I74A 2QFEA 3WG7B 1Q56A 3CEWA 3ZRXA 3K3NA 1S0JA 4RWUA 1W9WA 3DKWA 4WF9V 4B3MO 1FNZA 1VP6A 2WNVA 4AILC 3AZWA 1W39A 3CJIC 4BQWA 5E1RA 4WZFA 2HP8A 3ATGA 1AR62 1FMD2 3A0NA 4I5SA 4L97A 3T08A 4TV8A 2V7QG 5FPZA 2G9ZA 4LQRA 4FPGA 4OYUA 4XUNA 4QKDA 1W9SA 3JARB 2ZR3A 2ADQB 4DW1A 1EN5A 3POJA 1CEZA 1I5PA 2A7AA 4Y5SA 5IVEA 1FXHA 3OMAB 2UWAA 3EO6A 1Q81W 5BY1A 2CK3G 1PNFA 3LNNA 4GIQA 2XDVA 3VKFC 2CL2A 2RDNA 5FO9B 5C4WA 5LK5A 4MGYE 2UWCA 2W87A 1OOPC 4B1MA 1JYCA 1UF2C 2D6MA 2KQXA 1LKNA 5CKNA 2VE1A 3L75H 2X6CA 4GX1A 1GQHA 1L7LA 3ZFGA 4QE7A 1QJY2 2ZX4A 4QMAA 4XBLA 1UOGA 1W0JG 2XAGA 2ZKLA 2E3CA 1IBLB 2ARXA 1R083 1UOJA 5CIRA 4EB6B 3UGFA 1N34O 4CP2A 4AF9A 3KWVA 2P5OA 2RS11 3ABZA 1W03A 4A4AA 2ZGSA 4UYBA 3U1XA 1AYM1 1PO11 4PA3A 5FYUA 2FCUA 2QQLA 3HQRA 5GLWA 1FOD2 1VQMV 1FV2A 1OOPB 4LF9O 1X50A 5BMVA 3N7JA 4E4DX 5IY5C 1RXGA 4J7ZA 2OIEA 1UYXA 1MS9A 4XF0A 3CRAA 2ARAA 5I0UA 3I3DA 2RMU1 1VF6C 1NH2D 4FMTA 3F5TA 3A4UA 1W6NA 3P6BA 4NR1A 2JRIA 2LW8A 1VQ7V 2QWPB 3K2OA 1U5XA 4YGCA 3BU7A 3J4UH 3P5BA 3S30A 2YBKA 1OVSA 3DV8A 5FRAA 1EUUA 1H0BA 2Y26A 2D3SA 1GM9A 1BVP1 2Z42A 4BW5A 3B8MA 3CCSV 2FDHA 2D97A 2DN9A 4EE2A 4X62B 1XQ8A 4L87A 2CV6A 1U97A 1O59A 4NRMA 4LHLA 1H8TA 1W8WA 3TEXA 1IPSA 3LAGA 5IVVA 1NJIW 4GH4B 2OIGA 5FZIA 1AILA 2Z79A 1X7NA 2VZTA 1MG1A 3E22B 4DY3A 4XCBA 4UWDA 2JDHA 4NHLA 1TA8A 2UU9B 5C3PA 4CPBA 5F39A 1DZTA 2H0BA 1RSOB 3GB7C 4TT3G 4MADA 2JWPA 4QGMA 2BTOA 4I55A 1W04A 4Q5OA 3JD4A 5F9TA 1LHNA 1IVSA 4Q4W3 2MK3A 1NH2B 2WFPA 4AEDA 3D3AA 1YYNA 3KKYA 3LIGA 5FZ7A 3HKBA 2O8QA 2OQ7A 1PNKA 1AYN2 1ZA4A 3CRMA 4FCAA 4P5HA 4GAZA 3WY6A 4N23A 3INAA 3SPCA 1ONAA 1OLRA 1UY0A 1NZIA 1UYPA 1O4YA 3KB5A 3O0VA 5AG2A 5IWAO 1KMIZ 2QE3A 3ACLA 1H6XA 5DXDA 3OOXA 1L7RA 3ZHRA 1MPXA 3T4VA 1S77D 4J25A 2HWC3 1X82A 3FB6C 4LFCB 2XAQA 4A41A 2B4KA 3JYCA 1L3JA 5FZ0A 4GB31 1RIRA 3UM7A 1JZ3A 1YI7A 1GLHA 4MVTA 3ZRWB 1N3QA 3R65A 1J3RA 3B9IA 2OXBA 4X1YA 1UW8A 2AXTZ 5L3BA 1LTEA 1QLEC 1IOAA 3RYCB 3ZYJB 2B9VA 3RYFB 1PGSA 5LCWL 4UF0A 2J7MA 5KXDA 1QJZA 5KA5A 4P2ZA 4UV9A 2RS12 3T2TA 5FP4A 2YC4A 4CEWA 1FFXA 4D94A 3LFIA 1NX9A 5JCOC 1NLQA 1O7FA 2Q8EA 4QDSA 3T09A 4FOQA 1US3A 4AHXA 3T2QA 4NKGB 4XCAA 5LP6B 1OI6A 1LESA 1CPNA 1RMU2 5BMVB 1QJEA 2JDAA 2W0XA 3UT0A 1QY4A 2GN7A 1BXHA 3WP6A 1EM1A 4MGIE 3K77A 4BCUA 3AG1B 3LCPA 2R32A 5CU1A 2FKXA 2WLMA 1O3TA 1SLBA 2R49A 4I01A 4J1XA 2RS32 3PL0A 5BNPB 4CU9A 1U5ZA 3ZYIB 3O5SA 4QX7A 2W52A 4GD4A 3CRQA 4HOOA 1QXPA 1FPN2 2ZEYA 4AXOA 4NRPA 2R70A 1G6UA 1TMF1 5J2UA 3NWKA 3PU8A 4OI4A 4Z8BA 5I93A 2JG9A 3AJZA 3ZFFA 3HT1A 2EIMC 2XT9A 1TME3 2K46A 4G27B 2JGDB 4BOWA 4Q1RA 1PIV1 3H50A 3KCCA 3OAAG 4BIFA 2ZR2A 2DV9A 3CJIB 5B1AB 2R0HA 5LGNA 1HV1A 1PM4A 1H8TB 3WG1A 4ISQA 3HQXA 4JGYB 3WNMA 3L9DA 4RFRB 5JIAA 4X9QA 1KYOF 1QQP3 4LF5O 2VZOA 4FPYA 3QO7A 4FPKA 3BHPA 4Q4X1 1P4RA 4UVAA 2PLV2 4AQYB 1GMGA 5FZDA 4XACA 5H9PA 3W9AA 3ZBHA 3APBA 3J8F3 1VQ4V 4EFEA 5FUPA 1HRI3 2ETNA 4LIUA 4QB2A 3AEIA 1PL0A 2RDCA 3ZXDA 1C28A 2QKSA 2VMIA 4WM7A 2VO5A 3RT3C 2ZDIA 5T3NA 5L3CA 2DWDC 1CJDA 5GKAC 3Q8FA 2F66C 3ZSKA 1ND3B 1F4NA 5BXZA 3RYFA 5EHDA 4YJ3A 1VP7A 3QNEA 5CZKA 1M57B 3WD5A 3T1HO 1TNFA 4A7YA 2QQKA 2EALA 3UYJA 2R062 2PYLA 4KHPO 1FXKC 3G6EV 2HBTA 1YQ6A 1G4YB 4W4LA 1FATA 1WMDA 4F7ZA 3O1MA 2VPVA 2QTSA 2VMFA 1YQ5A 2PAMA 1RUJ3 4U2AA 3JCIA 4QDRA 2JJ1G 1CAVB 1Z2GA 5EBLC 1UN1A 3WV6A 4Q4V1 3CCQV 3CCUV 1NCRB 1ZM1A 5ACA2 3OGJA 5A7WA 3UJOA 4S2GA 4DRXA 1S0IA 3FB8C 4UUJC 5F6LB 4XHXA 4K6BA 3STZC 1DTOA 1CONA 4HN1A 1FJGB 1M56C 2EILB 3C3SA 2CE4A 1QJX1 4X64O 3ZIAG 3JD3A 2JS3A 1AL0G 4Q8KA 1ZZBA 3BIEA 5DAXA 2X8KA 1LCLA 2B5UA 1BMFG 1VBA3 3VD3A 3MFCA 1ULPA 4IIJB 3OD0A 3H1WA 2ZT9B 1EP0A 1HR0O 2JVDA 1QQP2 2JD9A 1R3IC 4WBNA 4GH4A 1AR4A 2M7WA 1CIYA 2GDSA 3E6DA 4G3YC 4UT5A 1S0FA 2R6QA 4KXRA 4QQOA 1S76D 2G38A 2AR6A 1DLLA 1YJLA 3DYMA 4JI6B 1H4GA 1QH6A 5EP9A 1FMD3 4PDWC 1AR71 3BN6A 4QPIC 3GGLA 2XHKA 1Z7S1 4X66O 2EIEA 4TLGA 3UGGA 3ZS8C 4E4ZA 2IUWA 1QJFA 2WO7A 1CZVA 4IGOA 1YRZA 4TQFA 2VTXA 4FTEA 1N1VA 5GM0A 3FX3A 4YVWC 3ETQA 1GOFA 3TEZA 1IBMB 2WQ8A 2R072 4NXMB 2J42A 2ZIOA 2WWJA 1R3KC 1RUE2 1GAXA 1DGRA 2W08A 3LNMB 5ACA3 3E5QA 4K20A 2VQFB 1QJY1 5FPOA 2FZ1A 5EJ1B 1MZ6A 1XYOA 3OE7G 4LO7A 3DF0A 2NYYA 1WW4A 3ETDA 2UU8A 3HR9A 4HKWA 2CGOA 4JTOA 1UFIA 4Y1XA 2HH9A 1R1A3 5IAXA 1N0JA 1WPBA 1LRHA 1JZ6A 1N34B 2Z0AA 4HSJA 4AFCA 4N43C 4FPPA 1D4M2 1RHI1 1DQ5A 2I2SA 3FUOA 4CCJA 4UFIA 1BL8A 1XMOB 2WNUC 4UCSA 4CDWB 4NWWA 4G2KA 4BU2A 2LP7A 2ZGQA 1D4M1 1RHI2 3BPSA 3NJXA 4OX9B 1RFYA 1OOPA 5CA6A 4KH9A 3DSQA 2RJ2A 2VQAA 3RYPA 3FUQA 2D40A 5FP9A 1RPOA 2Q8CA 2P22C 1YVWA 1GO3F 3JASB 5A9GA 2E5LO 4Y1YA 3N2GA 4WM8A 3DCQA 4X89A 3O14A 1S0EA 5C71A 1XB9A 4DR2O 3GCXA 4XURA 4LBEC 1G9CA 2XAFA 1SQXH 3MI8A 4HPKB 3QH6A 3RZGA 1WN7A 2R1DA 1QLNA 1YFXA 4QT6A 4MVUA 5CFCC 1HN0A 3J7HA 3SCGA 1RB8G 2N74A 1POV3 1V54C 1QKQA 5FZMA 1W8HA 2Q30A 4A6SA 2QBXA 1NZ6A 5FQ0B 3WUDA 5LOVA 3B93A 2QM8A 1ZBE1 4GJZA 1WBFA 2ZMLA 4AVVA 4XJUA 4WV8A 5JSOA 2IXHA 5EJ3A 4I7ZB 4L8QA 2K0GA 1X4TA 5JOWA 5A6YA 3LEIA 1COWG 3SLIA 2XJRA 2DYRC 5FTTC 2ZGOA 2F4VB 2VULA 3ZMVA 3TGUH 3ZCCA 3ILFA 1HQWA 2SLIA 4QKNA 3ABMB 1D2SA 4BQ1A 4CXWA 2FDIA 3K9AA 5IYCO 5LYJA 4E2LA 3E8FA 2NM1A 4B29A 2QM4A 4I02A 2H0VA 5FZAA 3J80N 3MF6A 4DR4O 3CDZB 2JDPA 1SLCA 3RYCA 4RR3C 1QNYA 4GYCB 1XSRA 1BHAA 4YVSC 4PA9A 3AJYA 3K5NA 1AHSA 4CCCA 2DCYA 4FT8A 5JVDB 2LW7A 4MV2A 4XFBA 4XMIA 5EXOA 1K5MB 4WVVA 1K7DA 5CFDC 4DXTA 1LGCA 1BQ0A 3FLTA 2ZTNA 3SITA 4W4KA 4SLIA 4DEVA 1ASJ1 3BTZA 1BHGA 2DCZA 5GJ6A 4JTDB 4D69A 2HG5C 1IS5A 2KG7A 1E1QG 5A80A 3ZDSA 1GBGA 4CDUC 4Z2AA 4JX0A 2V4AA 3VBOC 4W8JA 3BALA 2JJ6A 4MVSA 4XDQA 4DY5A 5T5JA 3KV4A 1HRV1 2BDRA 3FJSA 5GALA 3N27A 1E5IA 1SLLA 5GLTA 4K35A 3GZAA 1OC1A 3ZYFA 4LF6B 1SCSA 4MT8A 3TBDA 4AG4A 2ZNIA 4P00B 5L36A 3ZPOA 3OMNB 1BEV1 4URAA 1F4MA 1B3QA 3VKOA 1B04A 2PY5A 3R66A 1P49A 3EHKA 1W8NA 3I2KA 5FLJA 4CDUB 4JYAB 4O4IA 4CH4A 4FM0A 4R9CA 1GSLA 3K5MA 3C8XA 4KP4A 1JI6A 4RAIA 4DR7B 1DGRN 1F51A 1YDXA 2HBUA 1N36O 4CCLA 3E6CC 4ITCA 4YW7A 2L9LA 4LH7A 2A06H 4H14A 3C7EA 5J1XA 1NG0A 5LMUO 4GCZA 1OD3A 4QHBA 1PGL2 4QM8A 1C4RA 4URTA 4LT5A 1PP9H 3W7XA 3CLPA 3ME2A 5C3QA 3ZPYA 5K1PA 2PI4A 4XIOA 5T5LA 3CEIA 4Q1PA 3IKWA 4KQ7A 4CEYA 2DVGA 3JB8A 1GP6A 3T1LA 2VRZA 2BWAA 4FFFA 2C24A 3V0AB 5IVCA 4FP3A 1NA1B 3ZKYA 4YIPA 1ENQA 4P30A 3HR0A 3AYDA 2OT5A 1J5EO 1KITA 1GOGA 4K0KO 5IFPA 1YFWA 3ZRWA 4X8AA 3DYPA 4HPKA 4LORA 3ILNA 4LF8O 1SZXA 3ASNB 4DUYB 5FK7A 4LC1A 2PGGA 4RUEA 3LFMA 2EIGA 3HD8B 2EBOA 4HNAA 3TB0A 2AC1A 2ZX1A 3FMGA 3RZJA 2E7AA 5DN2A 2JGDA 4UW6A 1IBKB 3POBA 4WM8B 4IEYA 4LBOA 5C8YB 3ZSEA 2YG0A 1SLAA 2GNDA 2X5IC 3J9SA 4FM1A 2PHTA 4M3CA 5J2UB 5L19A 1SETA 3NV1A 3D5OA 4Q6GA 4CCKA 4E4HA 2DYSC 4B3SB 3TOJA 1FOD1 3ZXGA 5F7UA 2HVJC 1YHQV 2DWEC 5CEHA 2EINB 1YC61 3VDCA 4P02B 4X65O 3I56V 5C8WA 1RUJ2 2JG9C 1D2DA 5J37A 1P7GA 4IT5A 2OIIA 3R4DB 5T55A 4QB1A 3ZXLA 5FZ1A 3ICXA 2CSGA 5FY0A 4RS5A 2HFEC 3J7LA 5CBHA 2EZOA 4LBQD 3K57A 1JOYA 1Y3TA 2CAVA 3JAKA 2WZPP 5IVJA 4W50A 3WX5A 1MVQA 2ZCEA 1JPXA 2RVAA 2GNBA 5E16A 4RQPC 3CS5A 3EYPA 3FBMA 2ZHNA 4QJFB 1DYOA 5IT9N 4LR4A 3V64A 2GP5A 4QD2A 3CCMV 3LA3A 3MO4A 1AR1B 1XJAA 1XOYA 2ZHKA 3TN92 4TWKA 1JHNA 4BXFA 1S4CA 3C7GA 3KT7A 4XBQA 4KWLA 1DLBA 2Q1FA 1HB4A 4MSWC 3HNYM 2BW8A 5IK7A 4TLFA 3MIGA 3E8BA 1HRV2 4UCUA 5LWBA 1M06G 5JOYA 1NE6A 4LPLA 3ELNA 1IURA 3HBZA 1K4DC 3RS6A 3K5OA 3ZHQA 1H2LA 2ORXA 5FZOB 4I4TA 4PDMA 3TNQA 5FREA 4JI0B 1J84A 1XPWA 1ZTEA 3P3PA 2KD7A 3AYEA 5F3CA 3S7EA 3KT1A 3WF3A 4WVMA 3SYOA 5APAA 4ES8A 4LBQB 2V5DA 3JBG2 3V0BA 1YXWA 3RN4A 5GONA 1VIBA 2VZQA 2K1EA 2QUOA 4IEXA 4K8XA 1BMV2 1QJX2 4QPGC 1G8MA 1UZYA 3HMYA 3U75A 2A73B 1OCRB 1VBA1 4B3RB 1PNLA 4Q27A 4YVWB 1HX6A 1FYUA 3I2DA 3IC7A 1RUI1 1JZ7A 2XBO1 2QSAA 3IAYA 2CDYA 3WCSA 1Q5OA 1OT5A 4QX3A 4MXWB 2A7WA 2DUQA 3GBFA 3USUA 1WLCA 2GAUA 5K8SA 2IFRA 3CNAA 3PIGA 4IV3C 2B1IA 2D93A 1F4HA 1AR72 4ORFA 1KFUL 4O9GA 3ABMC 2YYOA 4M0NA 4CDXA 1UOFA 1PO22 1GNHA 3B09A 4H33A 1QU7A 4LUMA 2UU9O 1FT9A 4JASA 1V6NA 1R64A 3K0DA 2JDYA 5ITZA 1RUG1 4E4SA 4YM2A 5FY9A 4DR5O 2ITCC 4J9ZB 4MW8A 2YI9A 3CBNA 2UXCO 1AJOA 1MEC3 2YC0A 2MEV2 4JZGA 1VBE3 4GH4C 1KRIA 3APQA 3W20A 4AI2A 4PBOA 2EILC 4BISA 2JDKA 4BHPA 4G9SB 3SMHA 3FYIB 2P06A 3OPWA 1OQDA 4DV1B 4OHYA 4K1YA 3QO8A 2DVAA 1QLEB 1N4CA 3QOPA 3CJHB 4HMZA 3TAYA 3T1YO 3HIFA 1VB2A 1NKGA 1W6PA 3ZMSA 1ZA7A 3GXUA 4CEYB 1N32B 4H3WA 3LA2A 4JDOA 3ZFGC 1PVC1 3SH5A 3O1RA 3APOA 1QQCA 1VMHA 2B8MA 3AYAA 1Q8SA 4O4HA 3OFNG 5FY1A 2PELA 3BU0A 4ET7A 5FP7A 2WFF1 1BZWA 3ZMZA 4XAEA 4E27A 1ZREA 4Q8LA 1MVEA 3D36C 3S57A 1MZFA 1S0GA 2ZZJA 4ZU4A 4XMAA 2QDRA 4ZHQB 5BZBA 1OLQA 1WCUA 1O9HA 2C9AA 4LO4B 2RG4A 2WFF3 2YUAA 3AFKA 1R6KA 4O4IB 3U37A 4CP9A 3POEA 2E5LB 3BTYA 2Y6LA 2OCCB 4DRXB 1UY4A 1LAJA 3CXHF 2HEYF 5KXEA 3RYHB 3H1JH 4QPWA 1G9AA 3VQWA 4JKMA 1UOBA 1US2A 1DFQA 4CCMA 4E4EA 3GF6A 1RUH3 1TMF3 2QQIA 2UYAA 5A3TA 3RVZA 3MW2A 4D8MA 2UXDO 1JFFA 2K2SA 1BLZA 1YIJV 4YY3B 2O57A 4HVOA 4DV7O 4NXNB 2WNVB 4EWEA 3R0RA 4Q4Y3 5AC93 3T4DA 2RDRA 5JXHA 4COVA 3UO2A 2BOJA 5E79Z 4DOUA 1RJ8A 5GW7A 3WB1A 2FDFA 3H3LA 4H13B 4Q0VA 5EV7A 1H8TC 3R6SA 2Q8DA 1HNWO 1DGSA 3OD4A 2QDNA 3VL9A 2BVBA 2XG3A 4JTAB 2DVBA 4BQXA 2VBDA 1SRYA 2ZA9A 4GB32 2Y0OA 1JH5A 5J2TB 1FNYA 1FXKB 1ZRRA 1QF3A 2OUHA 2BP6A 2LGWA 4FOYA 1G7YA 3DGEA 1TE1B 1X33A 3FKSG 5DZFA 3BCCH 1OZ0A 4N53A 3TK1A 1K97A 2ATKC 2IJKA 1QVGU 2BRTA 2VNVA 1K73W 1W8ZA 1Q8IA 3JAMN 1UMZA 4XFGA 2UUCO 1F4AA 3BKZA 3J8F1 4DUVA 4BPZA 1S0CA 2WO1A 4HKLA 4C7UA 4AQYO 1WA4A 2BUKA 2HJIA 2CAZC 3A7QA 3AG4B 2WO3A 1ZX3A 3SJBC 3H8OA 5A7NA 4D3WA 4YVSA 4J7JA 5A3PA 5IJ9A 3D8CA 2XQRA 2ZINA 5HI0A 4RGAA 3JB4C 4CC6A 1YQ8A 2WSVA 3AZYA 5EYPB 3SH4A 2YROA 2G4IA 3W7TA 3TRSB 1CAUB 1V00A 3OBTA 1XL4A 3WDTA 2WR9A 1Q8PA 1BS3A 2ZCWA 4NWVA 1H38A 4Y5TA 2GMPA 5DG2A 4PQQA 5A33B 2DURA 4OZXA 2J1VA 3MEPA 5C5TA 1UIKA 5HCBA 5IDJA 5BR8B 4YFWA 3OY8A 2OYQA 5HCFA 2XB6C 3GALA 3THOA 4OHZA 3UKMA 1OKQA 5DQ0A 3ZX6A 1CAXB 1Q43A 5K0UC 3BEHA 1XC6A 2UUAB 4OULA 1B35C 1PGW1 1Y9GA 4Y26A 2GP3A 5KHJA 3LGRA 3NKTA 3MFAA 4OUMA 1IZ3A 3K5LA 1R1ZA 1O3RA 4B4RA 3JCUZ 4F6RA 1H2SB 2XUEA 4P08A 5L9VA 2VWKA 1YIFA 5GZFA 1YITV 2A3YA 4YGBA 1VEWA 2A0LA 1SERA 3IN9A 2P4KA 2Q0OC 2HWB3 2WS93 2XOMA 4B8EA 3VBUB 1NT0A 3SISA 3ETPA 2A70A 3UJQA 4C91A 4DUYO 4BM8A 5FXWA 1D5AA 2JEUA 2XAHA 1NLRA 4JGYC 4QU2A 2QQWA 2P17A 2LJ2A 4AQSA 1QJX3 4TZDA 4PA7A 5HCHA 2D7FA 4O4JA 3M2MA 4QXKA 4IGGA 5F32A 4IEZA 1DGWX 2C0ZA 2WAOA 1SPPA 4FP2A 1REDA 1P8JA 1V6MA 5JUVA 1RUG3 5LP6A 2LUWA 3KGLA 2HWE1 2Q68A 4LK6A 3CL1A 4QE9A 4QM9A 4ZI7B 2E6VA 5B4NA 4TOIA 4JI0O 2WLNA 1XRUA 2QQUA 2CWSA 4IE0A 4LF7B 1D5NA 1CZTA 2OCHA 4J7KA 4XF1A 1UZ0A 4V1PA 2VNRA 2O14A 3FLRA 5LGTA 4FK5C 5CA1B 4GX0A 1RUH1 1XYPA 5L7OA 4I55B 2G9GA 2FL4A 2D43A 1YO8A 1UAIA 2W46A 4OPHA 1LGBA 2G9FA 1A34A 4LHNA 3H1HH 4NN0A 1R093 5I91A 5C4WB 2ZKNA 2VQEO 2X09A 4GKJO 3OM3B 2B5HA 2W5FA 1SQFA 2ZDIC 1CX4A 2Y6JA 1RUD3 3Q8CA 3NV3A 2Q5ZA 2VL4A 3UT5A 4CDQC 2ES3A 4IERA 3UCSC 5A7SA 3VQVA 4IV1B 4X1KA 1GTOA 3RJ2X 4LK7A 3MPBA 2JGUA 2ZX2A 3B02A 2P3JA 4JZRA 1VBC3 3I54A 5CNAA 1AJNA 5JSRA 1IDSA 4QDQA 4BB3A 4EN8B 4X64B 4I9QA 3EB7A 4ZU7A 3ABLC 4YSFA 3SPIA 5FPAA 1VBC1 1WJZA 2RNBA 3WG3A 2XGXA 5J96B 1J3PA 2V73A 3T4HB 4TUYA 2Y6KA 3L71H 1VAKA 1CZSA 1W6NB 2W3JA 4M00A 2VVEA 3WDWA 3UKTA 1GP5A 2RR12 5IJ9B 1OCZC 1GM8A 3K75B 4UFLA 5B1NA 1O8SA 4Y4YA 4NHMA 1KD1W 4UCOA 5ITZB 1AR61 2BFUL 3IZOA 5JR2A 2LO1A 3I2FA 1RUI3 1VBE1 3JALA 1G9DA 1MR5A 2QR4A 2F23A 2EVXA 4QX8A 5D8AC 1O91A 4TV9B 2E63A 1G1XB 3VBUA 1SEFA 4LOSA 3ZVXA 3AK2A 3TXQA 3OCPA 2DJVA 2Y8KA 1PO13 1AR81 1NUKA 1POV0 3FAVB 1JMKC 1B09A 4OCTA 3ZXAC 2VOTA 1RUF2 4NRQA 5FJHA 1RGSA 1LNQA 1PVC3 2R9AA 2WWUA 2DMXA 1W2AX 3VN4A 2XUMA 5CADA 3B94A 3VD5A 1H8HG 3KGZA 4IV1C 3DYOA 4XFCA 1SLTA 4RD7A 4QGPA 1HN1A 3AMNA 1KGYA 4L92A 4UI9L 2UXNA 5ISLA 1YFUA 1UZZA 5IK5A 3WB2A 1O4ZA 4LA2A 5A3LA 5JZGB 5C4WC 4AI9A 1GN2A 1PGL1 1PKXA 2ZXWB 2F95B 4U3JB 2D5FA 2UXCB 5ABJC 1UPGA 1HR0B 2W9XA 2YPDA 1LHUA 2R72A 1RUJ1 5JWPA 4INDA 4EB6A 4DW0A 2ZKOA 2J1AA 4NO4A 5LYJB 3HKDB 1BQZA 3E83A 5E8AA 2X53S 4CRQA 1Q82W 4NTYA 5FMDA 5FZEA 4RQPB 4AYUA 4X88A 4HK9A 4COUA 4FZ1A 5JI7A 4BLIA 4JI3B 4DK1A 1ND2B 3PJSK 1JXNA 1TUEB 1AR91 4BR6A 3VBFC 3AXEA 5LB6A 1O4TA 1V6LA 2UUBO 4UVBA 1TVGA 2C26A 4GWMA 4PBPA 1R091 5FOJB 2IVJA 1ND2A 2JB4A 5IJRA 2DBNA 4N9IA 3THTA 5LA1A 1HXS3 3N3HA 4BZ4A 5DUXA 2F93B 3LE0A 5HXMA 5IAVA 3EQEA 4JYBA 3M8LA 1W6MB 3RQ0A 4N53B 3KS7A 1XMQB 4CE8A 1O5LA 2FDJA 3KVBA 2WZ8A 4LWSB 3A0BZ 4D6TH 4YW2A 3ABLB 3W7SA 3RYIB 1EZJA 3E97A 3PMSA 1H1AA 4YG3A 4JCKA 2D3OW 4FLXA 3S5QA 2JDZA 2YFUA 1Q6IA 3NMBA 4XJAA 5BNNB 2FZ2A 1MEC1 2RE9A 2RHPA 3M3IA 2BOIA 2Y48A 1S0VA 4ONUA 1XQNA 1UU4A 3FFQA 2WLIA 2OPWA 4NOTA 1RUOA 2HWE3 2CHHA 3ZR5A 2D3PA 2ZEXA 1BZKA 4DUXA 4MTXA 3TXSA 3D36A 2CTVA 5CFCA 4O7XA 1CPYA 2ZGUA 3ZXEA 3GWKC 2WKKA 2VAUA 4AR2A 3MPPG 4KFMA 1DBNA 4F8AA 3LSUA 5FXZA 4XJWA 4PLMA 4FAGA 3ZOIA 1AJQA 1CQ9A 3UNPA 1UO9A 4Y5Z0 4I0XA 2D6OX 1DGLA 4J42A 1RUE3 4RO2A 3RZMA 4KWUA 5B1OA 4JI7O 4GKKO 3JAWB 2CNAA 5JXIA 2XLFA 1LHWA 1BK1A 1JCHA 3RWNA 1SLIA 1ULOA 1T6GC 1MACA 2F4PA 4P9JA 3GDBA 2D6NA 1IBKO 4ASUG 3OR7C 4YXWG 4R4ZA 1SMVA 4WFAV 2P37A 3A23A 4EJRA 1NYWA 3IBMA 2BTVC 1W2BU 1IS6A 5JOZA 5FLXN 4L99A 2IU0A 4LFAO 3FX7A 4MTFA 1CJPA 4DV0O 2J1TA 3HNMA 2TNFA 3MUZ1 5CBGA 3U10A 3V56A 4DXWA 5HBAA 5FXXA 5C3OA 2V72A 2XJQA 3R05A 2HEWF 4U36A 3N2GB 3BI3A 1S5HC 3CJHA 4DUZB 2VTXJ 2ZZQA 2D6PA 3RMXA 1ZLZA 1V9U1 4JF3A 4XDOA 4Z82A 4JI2O 4OHWA 1SACA 1BE3H 1AR73 2RM22 1OQEA 4X8NA 3VBHA 1OPMA 5H2FZ 4DV6O 1ALYA 1GZWA 1EFRG 2WS92 3DL3A 5A3MA 1XI1A 3WQ7A 4Q26A 5FY5A 5FZ3A 5C9AB 1QQP1 2BERA 5JCOA 1PV0A 5C8CA 4IUGA 1POV1 1OHFA 1UMHA 5LBQA 4IETA 1VB4A 1JMUB 2QWRB 3AP7A 3B3QE 4XPVA 2L6LA 4FLVA 3JD0A 1REEA 1F7YA 1FFTB 4DO0A 4LOTA 3S0MA 5FYBA 2QTWB 2RV9A 2VZVA 4RHV1 1PHMA 3EFFK 3U11A 1LOBA 2VMEA 4UBHA 4XFHA 4YM1A 1GWLA 4QAWA 4RHV2 5HXVA 5JXGA 3JD1A 4CA9A 1GRJA 3D0SA 1NTZH 1OXCA 4CBCA 4YW1A 4BMEA 3HVDA 1VQPV 3WP4A 4G28B 1AR83 3QCWA 2XOKG 4PD4F 5EZYA 1AP6A 4QIWF 3I4IA 3T0BA 1YIPA 2JIGA 5LK7B 4ICGA 4GQ7A 4Q0UA 3CSXA 2VTFA 1O3QA 4JAVA 3IDBB 2UXBO 4JGZB 4FJCC 4KI5M 4D7TA 2BNOA 2VBPA 2CH7B 1CESA 2YXHA 2R7EB 3EJKA 2Q9LA 4XIKA 5EBMC 2GC2A 4IGQA 4Z1VA 3X29B 1US6A 5KHGA 4YW5A 1B35A 1AL22 3RFRA 3IC9A 1Y7BA 2CGPA 2VC9A 2X6AA 1G86A 3RG0A 2ZE6A 3NAPB 2VVDA 2TUNA 3VBOB 5LA6A 2F4LA 3K4AA 3C90A 5CMUA 1N33O 4IV3B 2FB5A 1XE7A 4YIOA 5IVYA 1G8WA 4EKWA 3VHOA 3M3QA 4UCRA 5I8SA 4FTSA 4M3CF 1FAFA 5FYHA 3PTRB 3PIJA 3UO3A 1JJ2U 4WM7C 3AG2C 2DCTA 3K79A 4KBBA 3SEEA 3CIHA 4JYCA 5CVRA 1UZWA 5CB4A 4JGYA 1LOFA 5A7QA 2Z5UA 2OWOA 1Y9QA 5GLUA 3HN1A 1JU4A 4JGZC 5LA0A 3S5AA 1BCXA 3JCZA 5EC1C 1EN6A 1GUIA 1E5HA 4Q4V2 2DU1A 1RUD1 4DYLA 2X5IB 3ZYRA 2OQ6A 5H9RA 3D3IA 1E79G 3RDIA 2PYTA 1QR9A 1DIWA 3I3MA 4TXWA 3T3YA 1R081 2KSDA 3E89A 1WLEA 4LFBB 1DU3D 2QQOA 1NXD1 3WCRA 5A2QN 1W8UA 4OLLA 5FPVA 1YI2V 3MLLA 4NUBA 4LKSA 4AW7A 1F15A 5L7OC 1N0NA 4D0QA 5BPXA 2OX0A 3NVCA 1TAEA 4FOVA 1NCQA 4J9YB 1K12A 5FLHA 4BA6A 1SFPA 2R1BA 1FKAO 1D7PM 3ABKB 1EV12 3N7MA 4XJZA 2Q67A 3B5LB 5EZWA 1NVPD 2OTJV 3C7OA 2BGCA 1YSCA 1M5IA 2R9IA 3JUUA 1WP8A 1YWKA 4UFMA 2W2IA 4FXGB 1KQSU 3B8NA 2JJ2G 1S2KA 2JDUA 4PV1B 1HDJA 3H1MA 1MNGA 3AFGA 2YGLA 2VNOA 4KG0A 2H94A 1M9NA 3SXWA 3WXPA 3U78A 4BW9A 4X1YB 5BV6A 1VALA 4Q4W1 4DV3O 5FZ9A 2IVIB 4NPLA 1UX6A 1TUBA 2PQQA 1IQDC 4LLFA 1I9RA 4ZS2A 4G4FA 1ST8A 3UETA 5LL6Y 3IDCB 2YU2A 2BTQA 4QPIA 3H8RA 3OTFA 5T52A 3I7DA 4PT6A 3TNPB 4MXVA 4HXCA 5DN6G 4NYKA 5I0TA 5DAPA 3NXSA 1AP5A 4FXKB 3PURA 4H0LB 5JR7B 1WGPA 2YFZA 5A70A 3DPRC 2AZ0A 4UCTA 5FZLA 5FMBA 3ZN1A 2W1SA 3RSJA 2RS13 3VZMA 4QXCA 3VBRC 3Q9OA 3ASNC 5BNPA 4PQ9A 1HWYA 3ACIA 1QR8A 2WT1A 4EFBA 3QG5A 4NIDA 2OZJA 2WA3A 1JOBA 3KZIZ 1NA1C 1UKGA 3VHRA 1SCRA 2GH2A 4DO2A 3K48A 2CTRA 3RBZA 5LASA 4LNVA 2GTSA 4YPJA 2LS6A 1U96A 2IXJA 2JG9B 2HYXA 5HV0A 4XF4A 4ZXKA 5FJKA 1VQ6V 2M6YA 2VW0A 4JKLA 4AHZA 1FXZA 4TQDA 3SH3A 1MS0A 3HKEA 3VBRB 3HPLC 3RWKX 3JBG3 4H44B 2ZGMA 3JATA 2DYRB 3AMHA 1VBB1 2KG7B 4MZUA 2J1EA 3LPGA 1NQTA 2EICA 2WA4A 3KSCA 4GKXA 4BIUA 4BXSV 4MG2A 5KR7A 5F5AA 5A3NA 4WM8C 5BNOB 4PIXA 1AX0A 4IEVA 1STMA 1EYBA 4CU6A 3SJCC 5BNQA 5JI9A 2R9RB 2O0OA 3OGCC 2P3KA 4MO3M 2GZWA 2F1MA 1Z0HA 2OA2A 3MAQA 4FVVA 4R4XA 1F8VA 3AVSA 3O1PA 1QXJA 1V70A 3USUB 1W05A 5BR8O 5DM6V 5CG8A 1W9FA 4IW3A 1I5ZA 1GR3A 4ZKIA 1MS8A 4U3FH 1YJKA 4PDRA 5FY8A 5FZFA 4XAAA 4DR4B 1UY2A 1HNWB 3F7YC 3GBWA 4CPBD 4MW3A 5DAWA 5FZ4A 4AEDC 3SJAC 2HLEA 3QBQA 3MDSA 2UWBA 5SV5A 4P9XA 3HPNA 1QJU1 3BCWA 2VMCA 1W59A 4HETA 3ZR6A 4CH6A 2IXKA 1H2KA 2OT7A 5T5PA 1SKVA 1EAH3 4GMP1 1JYTA 2CAUA 4MLOA 5BYNA 3AP4A 4RA0A 2VU9A 2FDKA 4DV2B 3SQOA 1KECA 1R6NA 4JTCB 1OSGA 1VBD2 4FIPC 2WLLA 3A0HZ 2QQPA 2R071 3KT4A 4JYYA 1CIWA 2QWQB 5ERLA 1XNRB 2VJXA 3LOIA 2ENRA 4E2SA 4QGNA 5TISZ 1Y76A 3S7IA 4NHXA 2BWCA 1QGLA 1VPHA 2P67A 5CISA 4JI1O 3WP5A 2DQ3A 4LKFA 3WZ1A 4F4LA 3MLKA 4HL0A 5CFDA 2ZEZA 1VBC2 4I4TB 4FQZA 1PX3A 1DDLA 1ULFA 5HPOA 4ASMB 2CTPA 4Q0SA 3VHPA 1I6XA 1V55C 3ZHVA 3VZJA 3ML0A 3UV9A 5C33A 2FMLA 3A0RA 3ZYHA 3SDLA 4NXNO 1LR1A 2LRPA 4QKFA 1SS3A 2K9PA 2K9ZA 3VBOA 2VGDA 4O61A 2Y60A 1MMMA 1RVF1 4N53C 4B4PA 3AM2A 2RJKA 3CRRA 4ISRA 4LFCO 5FZCA 4O4LB 2FBEA 1XNCA 4DZGA 3M4FA 3C7HA 4JI4O 1XNKA 5KBFA 4ZOLA 3X2QB 5FR3A 1W6OA 4UB8Z 2VOVA 2QDOA 1UXXX 1OURA 4E9KA 4DUWA 4QHZA 1XHXA 1I94B 5D5QA 1EBOA 3CYOA 5FNVA 2ZM6B 4JRAA 1THZA 2UXBB 2RDQA 3VZKA 2DFCA 4XE9A 1GQPA 3OUSA 4FTBA 4LTAA 3ZYPA 5T5OA 5DDJ2 4F3JA 1DQ1A 3THDA 5CAZA 2OUJA 2JG8A 4JRLA 1HNXO 4M0HA 1YHFA 3OYWA 1QOSA 3LEKA 4P5YA 1PO12 2UYBA 3JQXA 5JPNB 4Y3OA 3ON7A 3WOGA 4HAMA 3JD73 1VRH2 4DNYA 1XEQA 1G9FA 2BSKA 1JX9A 2RDSA 4EZ4A 2A6VA 3H1YA 1PK6B 1K33A 3VD7A 2VBBA 4J1WA 3AG2B 1GZCA 2GTAA 4NE9A 4YWAA 2UXXA 2EIJB 3CHXA 1OLMA 1A78A 4WVZA 1K5JA 5L9RA 4FLYA 1I5XA 2RN9A 5LMUB 2GNMA 4FSJA 3ILRA 2RS33 1U12A 3RZLA 2WLQA 2VM9A 5KX5B 2HWC1 5JVVA 2WYSA 1NTMH 3ZN6A 2R073 4P9LA 3QO5A 1WBLA 2X6BA 3N9LA 4X1KB 1XREA 3OUFA 2VUDA 5KX5A 1DZQA 5LP6C 1ZZ7A 4XDLA 2Q8OA 1J1TA 4JI5B 1TVKB 1JZ5A 4X1IA 3IMMA 3SPHA 2ZEWA 4RQPA 1OBNA 3ABUA 4UB6Z 1IBMO 2IXIA 1AVBA 4KUMA 4QPJA 1K3IA 4Q0PA 1CAWB 2WAAA 2NR5A 3LSQA 3V65A 1F9KA 1PO21 3L74H 2EIBA 2HWB1 4HYOA 1YF2A 1ENRA 4ARYA 2JEMA 2BYVE 2ETEA 1ZRFA 1BMV1 4PJ0Z 4PIZA 1UQXA 4UW4A 5FP8A 1SQGA 1FYJA 4JYAO 2YS8A 2DU0A 5DUUA 2Y4TA 2D6KA 2DQ0A 1E5SA 2WQ4A 1FMD1 3WSOA 4RQEA 4PLNA 2VCMA 2F43G 3MV11 3VDDB 4W6XA 3JSNA 4NTWA 3I3QA 5JDBA 4NVPA 1QJY3 3GZEA 5D1IA 2VZRA 1WB7A 4AI8A 4HBNA 5KXCA 5K0UB 1JZ4A 4U7OA 2CH7A 2Y4UA 1XNQB 5FYIA 1NY72 3POYA 4JGZA 3T0AA 3HAGA 4BLJA 4XDJA 1C1FA 1FPN1 3VL8A 4RN5A 4QNHB 3BA8A 2A6ZA 3A8TA 5FO7B 3DN7A 4LE4A 3AKSA 2C9KA 1HB1A 2Y6HA 3RI8A 2AZ5A 2HR3A 2PHRA 1ROPA 3I5DA 4XVHA 5DMYA 1WMFA 4WBBA 1EN4A 4KL1A 4EWDA 2HWF1 4AE2A 1KXGA 5JMOA 1HQNA 4JHZA 1Y4MA 5FZOA 3LEGA 4D7SA 4MVZA 5JZGC 4SBVA 3P30A 4K3UA 3D0JA 4BYYA 4ZXEA 1RUG2 2ATFA 1SQBH 4MOAA 4XBNA 2PHDA 3AG7A 3VD4A 3LDEA 4IV3A 4CH3A 1QJU3 4XETA 3O9OA 1QWRA 2PHWA 4LMFA 1AYN1 4A7KA 3GHMA 3K4DA 4KU8A 2WZR3 4QPKA 1KJLA 2ORZA 3VBUC 3ZRSA 4CDXC 1QH7A 4MTOA 4PF5A 1GOHA 2C1FA 2E32A 5FYSA 4JZ2A 3CO2A 1MQTA 4QX0A 1LEMA 2CU5A 1D4M3 4CP1A 3LB9A 2VUCA 3K3OA 2ZNJA 4KBZA 4RSUA 2E7TA 2WYFA 1YJ9V 2BNNA 3UK9A 1RUC2 4MTGA 3AZZA 2DBIA 2PYJA 2JICA 1PM9A 5JMCA 2W6JG 3O1TA 2WNUA 1DYKA 2PA7A 2CWMA 2R061 2C4XA 3W59A 2KR2A 1X59A 4IYIA 1D0GA 2D2CB 5IY5B 1UWWA 4DRRA 4PDVA 3K4ZA 4UV8A 3LF7A 1GZ9A 2XXZA 5FPXA 2RMU3 3FN9A 4AEJA 1Y6XA 4BK4A 4GT1A 4AVAA 1BVVA 3OEAA 3ACFA 2NZ9A 3WW2A 4MVMA 1AX1A 3MIDA 2WT2A 2YC2A 3WINE 1ZBE2 3VBRA 3HKEB 1UMIA 3W58A 1AYM3 4A5UB 4BQ4A 4CUBA 1WCSA 2FDGA 2P3YA 2UUBB 3NJVA 5KC5A 4ATEA 4A3XA 4I3GA 5A32B 2OCCC 2GH8A 2B42B 4A45A 1SFYA 2BGOA 2VUAA 5FNVB 1FX5A 3SKVA 4JV5O 4X62O 2WZEA 3FYEB 3CXCU 1L1FA 2RQ6A 1ND2C 1NQJA 2DF7A 5LY1A 1SHWB 4AQTA 5GTIZ 4JV4A 1LHOA 1QOOA 1GWMA 5LA2A 2ZPXA 3AMMA 4JPRA 3CCJV 2A3QA 4HANA 1IKPA 1K8AW 1FI2A 4K8FA 5IWAB 2XWJB 2PHLA 5D8AB 2W94A 1GK9A 4LBLA 4H55A 4A7ZA 3M7MX 3W5MA 4D7YA 1HLCA 3K9SA 3OB8A 4LF9B 4IIJA 4KMQA 3AL5A 4PDLA 1ZX5A 1K5SA 1SA0B 4GMP0 4RR3A 2TEPA 2JECA 3PUIA 2E7QA 5C93A 1HXS1 2IXCA 5KHKA 2O1QA 3M70A 4GLXA 1PZ7A 3POFA 1YEWA 2PUSA 1Z7S2 3LEMA 5FZ6A 1PMIA 2V4VA 2IW5A 3PUQA 3NV2A 5DZEA 2QQMA 3ACHA 2VUJA 2ZD9A 3WR0A 1VBD1 2Q4PA 3KVAA 1BBT3 1XMQO 4LO8A 3AB0A 3E6BA 3NRUA 3PVEA 4CYDA 1RMU1 3OY8B 3CC2V 4XTPA 1KD7A 5BNNC 1UL9A 3MIEA 4WVWA 2EIKB 2BVVA 5F5QA 3N9OA 4NIHA 2WZR2 4ZHNA 5CA3A 4M3CE 1AJPA 3R4UA 3HKDA 4ATFA 1BCCH 1S0DA 1JYXA 2A9HA 2Z2SB 2YIAA 3KZ4C 1PMJX 3T30A 2WO2A 3AP9A 3H7YA 1M1KW 1PNMA 4IEWA 4RS5B 2ZIMA 4JI2B 1AXYA 2Q5TA 1FXVA 3VBFB 2P4EA 3ZSLA 5I8TA 5KC6A 1C8M3 1NCRA 2YEVA 3S3XA 4CCNA 5CA0B 3MHZA 1WW5A 1WUVA 1ENVA 3KCYA 1JFFB 3I3EA 4XF3A 4QQHA 1RYYA 4IHJA 4JI3O 4AK3A 4MGSA 4FLWA 4N7UA 5LHGA 2VCCA 1S3JA 4XFAA 1H1MA 4CEYC 2WLLB 1ZBE3 3TEWA 1HB3A 4L9BA 5EZYB 2XASA 4BIOA 2WN2A 4ZS3A 4AEMA 5I0SA 4CDXB 3BOPA 1RPRA 1RUNA 1X9PA 4LULA 2PXJA 1K9MW 1WZXA 1KQRA 4OGQB 1DQ2A 3EXAA 3VBHC 1LOCA 2NLJC 5H9QA 1SQQH 3H3ZA 4LH6A 4I2OA 4W6WA 4J10A 2MEV3 4YY3O 5F2WA 2HHHO 2D3RA 3TCUA 4CCEA 1GN3A 4FPOB 5GZDA 1J95A 1WA6X 2A5ZA 1HJFA 3B77A 1UZVA 2NQYA 4YLZA 4RHV3 4ZZ5A 4DQAA 1H6YA 2VZ1A 4TUYB 5LY2A 2BU9A 3RYRA 4O2BA 1TG7A 2RMU2 4E8CA 3ZDVA 4AI3A 1COV3 2RR11 2E26A 1Q90D 2DE0X 5JQGB 4X6QB 3AP5A 1JHJA 5A7PA 5HFMA 4CC5A 4LBKA 5FY4A 1JN2P 5FYVA 3F2ZA 5C7GA 4XABA 3OPTA 3PU3A 3AP6A 5L9BA 1QEXA 2W68A 1BEV3 5ACA1 3KF3A 1CD3G 1VBB2 3PJQA 2HWF3 3Q8AA 3LPFA 1NLSA 3VZNA 2ZE8A 4B3SO 1QNMA 2XNDG 3THCA 2VG9A 4ZPIA 4ZONA 2Y64A 1GWKA 4NPRA 4LHKA 5IK4A 3B7MA 1OF3A 5F3GA 4B3TB 4J6GA 2VZ3A 3BY6A 3KG2A 1NXMA 1Y74A 1WMXA 1WNSA 2CTQA 3ZHUA 2YEVB 3LDBA 3CCEV 3AG3C 5IVFA 2P34A 3BAAA 3WDVA 4L2NA 3ZHSA 2OTLV 1ND3A 3MZHA 1EPZA 4LF6O 1U5YA 3GCWA 2WNEA 3SEPA 1H2MA 1LOFC 1S5LZ 2WDBA 3ACGA 2OS2A 5L3GA 3OUHA 1K5QA 4V2WA 1E5RA 5FZ8A 1DLCA 4UFHA 4K3AA 2HVKC 4JVAA 2WWWA 3JD71 3FHQA 3UESA 4B3MB 1X8EA 1QIQA 3J81N 1N32O 3TEYA 3LUTB 1HRV3 4DXRA 3LIHA 5JH7A 1B6QA 1IPKA 4QPGA 4UBGA 3S6PA 5DUVA 5JXJA 4CP0A 3ORJA 1Y66A 3WQ1A 1CXZB 4NJ4A 5J9PC 1VQKV 1W3XA 3N7KA 1JODA 1EZVH 4BQ3A 2XHNA 3L9JT 4LBQA 3LWCA 5FIXA 2EAKA 1JJOA 4R8CA 2V09A 4EV0A 2BV4A 3LDKA 1N33B 3SCFA 3OMIB 3T1HB 5A3OA 5A7OA 5LMNB 4WCEV 3T2OA 5GZGA 4TTGA 3T0DA 2ADPA 3ZJZA 4CUCA 4LNUA 1OQ1A 4A44A 2EXJA 3J7MA 4LKDA 4LE3A 1SZTA 3NV4A 4COYA 3IMNA 5BY5A 1AI7A 5LA6B 1V6KA 3CP1A 1RTVA 5D8AA 3NAPA 3T2PA 3WEZA 5B2GB 4XOGA 1PZ9A 3OG2A 2Q4SA 4UFZA 4UAPA 1UD1A 2VD7A 3W21A 1GKBA 1DGWA 4BWAA 4NAMA 1IPJA 3GZTB 1BGYH 1P84F 1V9U3 3N9PA 4UFKA 2V1DA 2YIDA 2QJ1A 2P6CA 3CPWU 5EJZB 4EN9B 4RGGA 4IE4A 3ZLIA 1REFA 1OVPA 1H9WA 1NR7A 4LBJA 1K5MC 1C8NA 1KP2A 4H37A 3L2YA 1O9GA 1PD3A 1OUXA 4OI1A 2I45A 1AR93 5JOXA 4HK8A 3J7AU 2AREA 1Y9MA 3ZSMA 3ETEA 1A8MA 2PQSA 2GSMB 5IVBA 1GH6A 5FYCA 3WVJA 5LHIA 3MW3A 2DDUA 1VAMA 3AMQA 4ASKA 4QQ2A 1MS5A 4DR1O 4Q29A 5EFUA 4Y4RA 2VZPA 4KHPB 4RUFA 3IAQA 5JZGA 5IE9A 2PZSA 2ZMKA 2ZGKA 3P1IA 3R4SA 2CYFA 5FBJA 5IJ0B 3NJYA 1XNDA 1IHMA 1DF4A 1HJGA 3RWRD 2WRAA 2QZ3A 4DV3B 1JOPA 1WA8B 1AX2A 3DTUB 2QQVA 5IFTA 4LBMA 1Q7YW 3FBYA 5IATA 4ES9A 1ZL8A 2LGQA 4D6SA 3E2EA 3A21A 1WA8A 3NJZA 4B4QA 3A22A 3O7OA 2VVFA 4XDPA 5CB7A 3VBFA 3E1F1 4IL7A 5FY7A 1GV9A 2VQ0A 3AKTA 1GNZA 5A1AA 5J2TA 1PX4A 4O4JB 4OXSA 3MD0A 2ZOEB 2XWBB 3O1UA 5CFCB 1C3HA 4Q4V3 2Q0AA 1SG3A 3N35A 3RJRA 4DV0B 4ZOLB 1IBLO 4DR2B 1F31A 1OCOB 3H42B 2H8PC 1UCXA 2AZ2A 2WLIB 1Q6UA 1AR5A 1LOAA 2WSSG 3NL1A 4MVOA 1J83A 4Y22A 3MV01 4OX9O 3BPZA 2ZACA 2AGAA 4QGLA 4XUQA 1VQ5V 1U0AA 2KB1A 2XVKA 3IT8A 3N4MA 2R043 2NN4A 1QCEA 4MHRA 3ZYBA 4JI8B 3GNEA 1BSMA 2XHBA 4FPHA 3L2HA 4GZRB 2LALA 5FFOC 4XEZA 2WNUB 5M0TA 1RXFA 3LD8A 1N3PA 1Q8QA 3ASOB 4B7KA 4I30A 1I08A 3GHNA 4MSVA 1H1IA 4CS4A 3N7LA 4OQ8A 3I3BA 2G19A 1KEXA 1AROP 2XMLA 1Q8VA 5BNOC 5A7WB 3IIIA 2WN3A 4HT1T 5EQUA 1H9PA 3NSTA 1D2QA 5B66Z 4S2HA 1XL6A 5EC2C 2WLJA 1ENXA 3OPZA 4OZOA 1CAVA 3MGUA 1ZRIA 2EINC 4O2BB 5LGUA 3CRCA 2XH6A 2NP0A 4NPMA 1XDCA 4Q4X3 5T50A 2PLV1 3ITQA 4NIGA 4YNIA 4XW3A 4OI0A 3E8GA 1XNTA 2H6CA 2CTWA 4JDMA 4Z92B 2QCSB 4R9DA 4GUNA 3MW4A 3CQOA 3QVNA 5FAXA 2WT0A 4B7EA 3VBSC 1QHTA 5IWFA 1MZEA 3KF5A 1VQ9V 3P32A 1AL21 2XL7A 4B3RO 1ZRDA 3N2KB 1VIWB 2VCAA 1T6BX 4R9BA 3OUIA 5SV8A 2CGNA 2PAKA 1N1YA 4JI7B 1R092 1APNA 1NE4A 4DR6O 2WJSA 4Q4Y1 4RR3B 1Y4WA 3PDQA 3E86A 3O1SA 4X1IB 3ZHTA 1Q8OA 5J09A 3RYHA 2JG8B 3LDCA 2QWNB 1FV3A 3FHAA 1KUQA 2BQPA 3MICA 2Q1MA 3WW3A 1A32A 5EBWC 3BRCA 5F1RA 5K0UA 3CCLV 1LNSA 1Y74B 4GWIA 3HBKA 4FO9A 3VD9A 4N43B 5JQGA 4DIQA 5LA9A 3OEBA 5AVPA 4FPLA 2XJSA 1K3EA 5FUNA 2UUCB 4YZ2A 4IDZA 3P3NA 1GZWB 3NNJA 3ZN4A 1JW6A 3WP3A 3NNFA 2EJRA 4F6RB 2YBPA 1AI6A 3VHNA 2HEVF 3FC0A 3PHMA 5EIYB 2XKOA 1S0BA 2WSUA 5IYZA 4YHHB 1RJ7A 1UU6A 2YIBD 4CH5A 4L0PA 5K1XA 4YW3A 3AK3A 1JUIA 5F37A 2L35A 3TN93 4MYEA 4AAXA 2JDMA 1KDKA 3DEMA 4Y20A 4L11A 1UU5A 4QXBA 3RPQA 1ODMA 2A6XA 4UXNA 4TV8B 4YZ4A 3CJXA 4XUPA 3MYXA 4BE3A 2JKXA 2FTKA 5DZGA 2JG8C 2CDPA 3O1OA 1SDDB 4QXHA 4AFDA 3RYIA 5FLIA 3H0OA 1LEDA 4LNUB 3H9VA 5C5UA 3QACA 1XE0A 5CFDB 1HIXA 2DWRA 5LBEA 1ZZCA 2JD4A 2HWD3 4Y1VA 3OW2U 3ASIA 2EA7A 1KJRA 4O2AA 5B3SC 4AVCA 4AVSA 5EYXA 4UOJA 3K58A 1HXS2 2AHZA 1BQPA 1S1AA 2HWB2 5L7OB 1JVMA 1W9YA 3FE5A 4R7CA 1QNWA 4QPGB 2WNOA 3MHSC 3OJBA 4L8JA 3TJTA 1R082 1VQ8V 5FZKA 2NNUA 3SYQA 2ZAAA 5DDJ3 2PHXA 3FB7C 4XBFA 1WMEA 2B39A 1HQLA 1VBA2 1I5YA 4ZI7A 4DR3O 2CDOA 3EHBB 4O4LA 3WF1A 1MS4A 3WUCA 5EK0A 2EZPA 3I59B 5D5PA 4ZZ8A 1XUQA 3HKCB 4YYOA 4H2AA 4FFIA 4QPIB 1L8DA 4M4RA 3OTOO 1TMF2 1CP9A 2XLGA 4JGSA 2IJIA 4YW4A 3ZMTA 2A6YA 2QVSB 1BT8A 3VB9A 1FOD3 3DC5A 5FPUA 2BSKB 4XZUG 3ZN5A 5KMGB 5H9CA 1QOTA 4FBFA 3KQRA 4UVCA 1UKRA 1OHHG 5JJEB 1CAWA 1OCOC 4R52A 3MIHA 1VBE2 5FZGA 2V4DA 4IEUA 5FPLA 3RNSA 3AZVA 1O3SA 5C6CA 1EY2A 1KDMA 3GZUC 3FAVA 5FL7G 3L72H 2A3WA 3OBZA 3AMPA 1FD9A 3N9NA 3SYPA 3OGIB 1YTFD 1SESA 1ND3C 4CDWC 4MHUA 1HRI1 3NQHA 5FOBB 4GKYA 2J1SA 4OHVA 4Q2FA 2RS52 2BFUS 3VDDA 5IUQA 5FZHA 3PN1A 3CWBH 2VS0A 3IM0A 4XHBA 4O4HB 2RS51 2DYSB 3W7UA 2ZX0A 4MXWA 3WU2Z 3AG3B 5IYZB 3RGBA 3HT2A 4DR1B 4HSLA 2JX9A 3BTXA 4U3JA 4P14A 5JCTA 1PM7A 3LA7A 3KMHA 1XXNA 4DXZA 3NR7A 4WFFA 1FXKA 1A3KA 4MUVA 5L3DA 3OR6C 4QX1A 3VKMA 5F8PA 5IHRA 5KA6A 1SZBA 4LCUC 3VDBA 3BOWA 4QB6A 5G04L 5J7MA 4LLOA 1RM1B 1EUTA 2VW2A 1JZ2A 5AC91 3Q8EA 1S5JA 3CX5F 2JDIG 3O65A 2AENA 3SHRA 3N36A 5FBZA 4DV2O 4FPJA 3O12A 3WB0A 3ES4A 3DXRA 3M7AA 1S55A 5F6KA 3H01A 3FLPA 1X8MA 3DPRA 3BIWE 3HOBA 1FFXB 3WW4A 2YBSA 2YXSA 1W28A 5HV4A 1R1A2 4IEOA 3E5XA 3NAPC 3ZO0B 2WLKA 2RR13 2XL9A 5BNPC 4R6ZA 2ZQMA 3L70H 1ULDA 1SA0A 3DPRB 3JAKB 2JIJA 1LR5A 3M1HA 2QKDA 1NA1A 3IWZA 2QKAA 3K46A 1MZ5A 1U5IA 4QQLA 2DCJA 5D2AA 1XNRO 1AL23 3UQ8A 3U07A 1W99A 3HKCA 2VMGA 3Q4HA 2BOCC 1W0NA 5HCAA 2JE8A 1VARA 2BNMA 3THPA 3WHTA 3B4SA 3G4SV 5AFBA 2EXKA 2G1MA 2R0FA 4DRVA 3FL7A 1H2NA 2WIIB 4BK5A 5DPNA 4OPAA 3SR2C 2PHUA 4DINB 4ABMA 2DUOA 4PDWA 1UYYA 2A71A 3DUIA 4PA6A 1H4HA 3PUHA 3T1YB 1IQAA 2GUZB 2F17A 3H1LH 4AI0A 1ZVFA 1R6TA 3CB2A 3JATB 2FMYA 3B01A 4OVEA 3MUY1 5L3EA 2PFWA 5FMCA 1WWYA 4W6YA 2C2AA 1J5EB 3ZN6B 2OVUA 4JQTA 5KUMA 3WDUA 2P3IA 4NIIA 2HYKA 1F5FA 2WL1A 1ASJ2 4UW5A 2ERFA 2HJFC 1QJU2 4AZZA 3IB3A 3ABTA 2ARCA 3HEIA 3B00A 3O1VA 3GWOA 2JDNA 4A2UA 1M57C 5KXBA 1RSOA 1Y43B 5B1BC 4HG6B 3M3EA 1QDCA 1CN1A 1KS5A 2W95A 1KC8W 4XUOA 5LW9A 1JYWA 2QJVA 1KBHA 3RMYA 4FM2A 3LZZA 2ZGPA 2GUZA 4GA9A 5CB4B 5FMOL 1VF6A 1XSQA 4I3PA 1BEV2 1NQDA 1VLNA 5E6HA 4IL6Z 1WP7A 4XF9A 1RP3B 4Y20B 5DDJ1 1PK6A 2BJSA 1LOGA 1CR7A 3ZIXA 2WZR1 4W4ZA 2O8OA 2WUHA 2XJUA 4DV5O 2QTOA 4FLZA 2C6SA 1LB2A 4KG8A 3G6JB 4FZ0A 3LSEA 3QF7A 2P5BA 4AVTA 1Z7S3 5JH7B 1I0HA 1W2NA 3EMRA 2YPJA 2HLDG 4ZBMA 2VWJA 1S2BA 1SPPB 1VRH1 3JD72 4BQ2A 1H30A 2R042 2F4VO 4Y1ZA 4IE7A 3O0XA 3IPVB 1K4CC 1Z5VA 4H7MA 1SDWA 2NN8A 4DUZO 1UPIA 1LOEA 2VQUA 4CU8A 4C1XA 3HNBM 3SPJA 1V6IA 1WD3A 3BA9A 1KB9F 3WF4A 3Q4HB 2PMWB 2B1GA 2ZAHA 1W0OA 5F3IA 5BNOA 2KKWA 5BNNA 4QKBA 5IT6A 5L73A 1W2OA 4PELA 1YQCA 2NPIA 3ST7A 4HNAB 1PNGA 3KV6A 3ECQA 2XKPA 1OJHA 1JQ0A 2H3OA 1WLDA 2IWGB 5D21A 2EIKC 4B3TO 2AW9A 1M90W 1GYKA 2ZABA 5CA0A 2DFBA 1Y67A 4Z07A 4Y33A 2IU3A 3WHUA 1BBT1 2W91A 3H1KH 4FVMA 3VBSA 1IG3A 1WW7A 1LU2A 1F23A 1SBFA 1VRH3 4ASLA 5GLVA 1NCRC 4GJYA 3PJYA 3BGAA 3SGIA 4CCOA 5A33A 1XILA 3VBHB 4K8RB 3RYKA 2N7GA 3DKQA 1O8PA 4DR3B 3DXUA 4LITA 1F2NA 5IW0A 5TSWA 2OPKA 1VE0A 1AXZA 4LBNA 3IGAC 2P6JA 2J1UA 2LM3A 1GN4A 2FYUH 2ZGNA 2ZHLA 5J36A 1W6PB 2QWOB 1V6OA 1RUH2 1T2XA 3POWA 4Y24A 2LFSA 1H8EG 5EIBD 4FPFA 2EIMB 3OUJA 4OUEA 1Z5WA 4GKKB 4AVBA 2XBO2 1I3HA 4XFIA 1RUC1 4WFGA 2R063 3WLUA 4TSVA 2Y34A 2HJDA 2GMEA 5HFLA 3JQWA 1VAVA 4IYHA 3ZXKA 5BXXA 5KMGA 4S2FA 2WFF2 2JK5C 2Q1ZB 4AAPA 1TNRA 5DABA 1BKZA 1C1LA 2YMZA 2OW4A 4N8MA 3TYJA 1IS3A 4YGEA 2GNTA 3NO8A 5ABJB 4YJ2A 1FS0G 3OGVA 1ZBA1 1DYPA 1YQ2A 1DP0A 3KHCA 3AZXA 2NMNA 4IE6A 1XU1A 1N1TA 3N9MA 4A6OA 4LIVA 3UKVA 2YI8A 1ZAUA 1UY1A 1AZDA 4I0XB 1RUF3 5E89A 3KQ4B 3CCVV 5IYDO 2WABA 3VQXA 3T2MA 2Y69C 2OZ6A 1OV9A 5GZEA 1UY3A 4JDNA 4LUKA 3BODA 4QPYA 1BYHA 1QVFU 5K9YA 3AG4C 1TME1 4U7NA 1C8M2 4CDQB 4BDVB 4BQ5A 4HZFA 4EN6B 4JKKA 3AL6A 1C8M1 5E88A 2XLAA 1COV2 1ZL8B 1VRBA 3M99B 4D6QA 4EN7B 3VDAA 1VMFA 1S72V 3DGTA 4GWJA 4YRDA 2WLPA 2VMHA 4AFBA 2RM23 5FPBA 4AWDA 2B46X 3EBRA 4AGRA 4N7IA 4CCDA 3RVHA 1LODA 2WS91 5CBFA 3J7NA 1AR82 1ZYBA 1SBDA 5FPRA 4CZSA 5J3UA 2IM9A 1HDKA 2UUAO 2B45X 4LWSA 1NCQC 1FPOA 5LXTB 1FPN3 2XQXA 4C90A 2BBAA 2TBVA 5K7PA 5KWRA 4FPEA 1VQOV 3FWEA 4HVQA 2Y69B 3WNNA 4F6EA 4B3NA 1PIV2 2X29A 1L0LH 3EXUA 1NZCA 4FFHA 2YB7A 3V0AA 4KGQA 3I8TA 4I0AA 1MSWD 2ZGTA 5LATA 3B2EE 2HWF2 1WLTA 1YXBA 4NIAA 4AFMA 5H9SA 5DUWA 1HRI2 5I8YA 3RW0A 1W6OB 4COZA 2A6WA 3MBWA 4E2QA 1W8OA 3VZLA 1KKCA 4A42A 3CU7A 2YDEA 5FDBA 3BFRA 3AK1A 4IGPA 4LFAB 4CZZA 2W0FC 4J80A 1AB3A 4AL9A