3OTFA

Structural basis for the camp-dependent gating in human hcn4 channel
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
197
structure length
197
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the cAMP-dependent gating in the human HCN4 channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 61
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2010-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3otfA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3otfA02
1DZRA 4OLLA 2MHFA 2MPFA 5I91A 4A2UA 2PAMA 2IXLA 3I54A 2B5HA 1YLLA 2ATFA 3OCPA 3PVBB 1SEFA 2XKOA 2BEOA 5LRSA 3NL1A 4K8FA 3TNPB 1WGPA 4N9IA 4ZU5A 4MH0E 1O3TA 3FWEA 2B8MA 1IPKA 3SXWA 1VR3A 5JSOA 1GQGA 4D7SA 3H1MA 1ZVFA 3H8UA 3RYKA 4AVCA 1Y9QA 3LWCA 4I3PA 3KGLA 3G7DA 4O9GA 2GH2A 4KWLA 3LA3A 4META 4WVZA 4XFIA 3ROUA 3D0JA 2OZ6A 3BALA 1ZNPA 2PHLA 5E1RA 1U12A 1ZRRA 4FAGA 2HKXA 5EZWA 1O5LA 2PTMA 2Q0AA 4MGZE 4JTNA 2OYZA 5LEJA 4YARA 4LUKA 4PIYA 4Z07A 4J1XA 1H1IA 1NE6A 3E5UA 3E6BA 3ES4A 3C3VA 3FE5A 1UW8A 1ZZBA 3H3UA 2IXKA 1VP6A 5I8YA 2PFWA 4AXOA 5HI0A 1RL3A 5BV6A 5KHKA 4I0BA 3M70A 4XETA 4MZUA 3KMHA 1ZZ9A 3U10A 3ES1A 1O3SA 1CX4A 1ZZCA 4HSLA 1DGRA 2PYTA 1YFWA 4YRDA 1NE4A 3BCWA 4WBBA 1NXMA 2ET7A 1EP0A 2IXJA 1SQ4A 3HQXA 2B9UA 3OF1A 3H1YA 4AVAA 5KHHA 4BIFA 4ZU7A 2O1QA 1RUOA 2D5HA 2EAAA 4P9GA 3DKWA 2IXIA 4R8HA 2QDRA 3B02A 4IEWA 2UYBA 3SHRA 4LULA 1CAVA 3IWZA 1YFUA 4Z82A 4KL1A 2BGCA 2BNMA 1FXZA 4ORFA 3D0SA 2O8QA 1CAVB 2UYAA 4IEOA 4IETA 4PJYA 4X6QB 3SCHA 1PM7A 2XGXA 3H9AA 4I02A 4XF3A 1QXRA 5J48A 1DGWA 4UBGA 2K9ZA 3LOIA 4LLOA 4O9EA 3DL3A 3TNQA 5I0RA 4ONUA 5LRRA 3H1WA 5FQ0B 4QX5A 5BY5A 3NJZA 1L3JA 2K0GA 3MDPA 2PQQA 3U0ZA 1X8EA 1J3RA 5FLHA 2ETEA 4I2OA 3DN7A 2EVXA 4UBHA 5JSPA 2QJVA 5I0UA 4MGYE 2QNKA 3D82A 1HW5A 1OMIA 1ZRDA 3H3ZA 4QMAA 3I59B 2PAKA 3UKTA 4E2SA 1WA4A 1I5ZA 3HIFA 3IIAA 2FMYA 2IC1A 3FFQA 1WLTA 2CAUA 3CJXA 3E5XA 1ZRFA 5I0SA 2Z2SB 1GQHA 1YFYA 4JVAA 4UXAA 1G6NA 3E6DA 3L2HA 4Q29A 5KHJA 1QXJA 3FZ3A 4JTOA 4L2NA 1O3RA 4KWKA 1IPJA 4L11A 1ZZ6A 1LKNA 4LA3A 3BU7A 2H0VA 3WW4A 1NZCA 3H50A 4F7ZA 3RDIA 4I09A 3ZDSA 2KXLA 3IBMA 3R6SA 4EWEA 3KGZA 1Q43A 3LA7A 4MGKE 4IERA 1H1MA 3H7YA 1RTVA 3RYRA 2D93A 1EPZA 2BNOA 5AVPA 1I6XA 1EYBA 1CAUA 4E2GA 3QACA 3E6CC 1X7NA 1CAXB 5JR7B 4HN1A 2D5FA 3LA2A 2UY8A 3NW4A 4IEYA 5CU1A 1XE7A 1J58A 3KCCA 2VPVA 1ZREA 3IDCB 4XFHA 1ZZ8A 3MPBA 4AVBA 5JAXA 4TLFA 4EV0A 1O4TA 4EROA 4XEZA 3EO6A 4QM8A 4FT8A 3MZHA 5EFUA 3ELNA 2GC3A 3EQEA 1JUHA 3IDBB 4E2QA 3CEWA 3DV8A 4HBNA 4MGIE 1UIKA 4XFAA 4B29A 3S7IA 3GYDA 4KU8A 4QGMA 4XF1A 4FAHA 5C6CA 5K8SA 2H6CA 3NVCA 3VHRA 4IEQA 5T3NA 3NSTA 4QXKA 4MV2A 4IEVA 4N9HA 4PIXA 4HSJA 5KBFA 1ZZ7A 4WZCA 3E5QA 1J59A 3RPQA 4LA2A 4IESA 5JSRA 2PAEA 3U11A 4IEZA 1CGPA 4XFFA 4H7LA 1YWKA 2Q30A 4HZFA 3KSCA 5LEKA 3FHIB 5I0TA 4JV4A 5F1RA 4KWJA 2F4PA 4R52A 1SFNA 3OGJA 4EWAA 2OZJA 1V70A 5E16A 3H7JA 4FBFA 1J3PA 3RNSA 1CAWB 3CL1A 3ACLA 1OFNA 4MX3A 4PIZA 2XKPA 3RYPA 4YSFA 1CAUB 2IXHA 5BPXA 3CO2A 4NVPA 2XLGA 2WC2A 1UPIA 5J7MA 1YFXA 2V09A 3QOPA 5FDBA 3BB6A 3OTFA 4IEUA 2OA2A 3LAGA 4HVOA 3ETQA 5CADA 5FLIA 3WW2A 1Q5OA 2Y0OA 3S0MA 2XL9A 1CAXA 2IXCA 2PHDA 5CVRA 4F8AA 5D1IA 2UY9A 3FX3A 1O7FA 3WW3A 2CAVA 2MNGA 4BHPA 1LRHA 1RGSA 4Q0VA 4QM9A 4EWDA 2N7GA 4YNIA 5I8SA 1X8MA 1DZTA 1LB2A 3I7DA 4XFBA 2XHKA 3HT2A 4HN0A 2GC1A 3GBFA 3NKTA 4MUVA 3O14A 4BH9A 4LEJA 4XF9A 3M3IA 4OFGA 2GZWA 3JZVA 4LTAA 2DCTA 4KU7A 5KHGA 1CAWA 2H6BA 5FLJA 1TQ5A 2XLFA 1ZRCA 4HVRA 5BUVA 1FT9A 2CV6A 4I0AA 3S7EA 2BNNA 3SCFA 4HMZA 1FI2A 1RUNA 2ET1A 2Q4SA 5JCTA 5FPZA 1YHFA 2QVSB 3PNAA 3BPZA 1QWRA 2D40A 2WFPA 3MYXA 4QGLA 2C0ZA 3FJSA 3RZZA 2E9QA 1UD1A 3N4MA 2ZCWA 1LR5A 3I59A 4HLTA 3USSA 5FPXA 4Q0UA 3OD0A 3UKVA 4YYOA 5J3UA 1X82A 4XFGA 2GC0A 1RC6A 1UCXA 4Q0SA 1EY2A 2GU9A 4GULA 4Q0PA 3SCGA 1VJ2A 4XFCA 3HT1A 3PLQA 5KHIA 1OI6A 4AQ2A 4DINB 1O3QA 4HVQA 3EJKA 1PMIA 1UIJA 5FQ0A 3SMHA 1O5UA 4AQ6A 1YUDA 3ST7A 1Y3TA 4QGNA 2QCSB 4X6RB 3LZZA 2VECA 1XE8A 2CGPA 1NYWA 4RD7A 2XL7A 3UKNA 3CLPA 1J3QA 3CF6E 4D7TA 2GAUA 3EBRA 2XLAA 2I45A 2PA7A 4IEPA 4IEXA 2VQAA 1ZX5A 2GC2A 5I93A 4XF0A 2Q1ZB 1XRUA 4Q0QA 5C8WA 4XF4A 4ZU4A 2OPKA 2ZKLA 5FCCA 1Q3EA 1J1LA 5BXXA 2Z69A 4CYDA 4J1WA 3WW1A 3E97A 1OD5A 2HJIA 5I8TA 2P17A 4I01A 2BYVE 1QY4A 2FQPA 4LUMA 4BYYA 3EHKA 2EA7A
chains in the Genus database with same CATH superfamily
4Y1VA 4R6ZA 1BVP1 2PLV3 2BWAA 4HL0A 1IQDC 3FUOA 2B5HA 2ATFA 2Y60A 3T0BA 2C6SA 4O4LB 1AR63 2BOBC 2F1MA 1IGOA 1HDJA 1F15A 4NKGB 1XMQO 5HXMA 2QWQB 5JMOA 5JR2A 3VZLA 1W2OA 4CEWB 2I2SA 2RR11 5FYUA 5CFCC 3WG7B 3IJ4A 4X1YB 3VB9A 1WBLA 2VWKA 1ZRRA 4LF9O 2A6ZA 3OBRA 3Q4HB 1O9HA 5CN0A 3ZFFA 3K5LA 2ILMA 4Y33A 5A3OA 5JQGA 1RPRA 1PO12 2WN2A 3LEIA 4U3FH 1Q6UA 3MFAA 5KXBA 1NTMH 1QHDA 3BGAA 2DUOA 1N8RW 4QAWA 4FFBA 2WNOA 2EBOA 1NXMA 1W90A 1PGSA 3QD6A 5IYBO 4CXYA 1IG0A 3TEZA 1BLZA 1HXS1 4O4JA 2G9GA 3DKWA 3MLKA 1VRH1 1FNYA 5TISZ 1GMMA 1V9U1 1TE1B 2OPWA 1TZOA 1VALA 2XGXA 1ENRA 5C8CB 4AHYA 1DGWA 1HNWB 4LNVA 2ZABA 2IBZH 2ZQMA 2FDHA 2ADPA 2WNVB 2XONA 3W20A 3E22B 3PJQA 4CDQB 4B3SB 2DQ0A 4WM8B 3WR0A 4KFMA 3B3QE 4LOTA 2VVDA 4ABMA 2J1TA 2BOIA 3JD0A 4FP2A 4DXWA 1M06G 5JWPA 4I0XB 4JYBA 2HKOA 4Y22A 4LF6O 1R6TA 4XDOA 5BYNA 2RMKB 1IZ3A 1S5HC 3O1OA 5FJHA 4UXAA 3OGSA 1VQ4V 1RVF2 2W91A 2Z4FA 2JEXA 3NV1A 4UT5A 1CJDA 1UMIA 1MS8A 1SQGA 3BU7A 4X62B 2XJTA 1F51A 3ZDVA 1OVSA 4FOYA 1D7PM 4WVWA 5FO7B 1VBA2 5DAXA 2WYFA 4LFCO 2BVBA 4P5HA 4YW2A 3B5LB 3WUDA 2YPJA 2DU1A 1HNXO 2BNOA 5AVPA 3H1IH 4UI9L 5H9SA 2FCVA 3LFMA 5A7NA 1CAXB 1Q8VA 2VQTA 4AGGA 3JARA 1FKAO 2ZEWA 5CU1A 1J58A 4Y3OA 1F35A 2Y8KA 1I7FA 4R4ZA 4QM8A 4FPFA 3F7YC 1S2KA 2UXXA 2VG9A 2VNOA 4P9XA 3WQBA 5FYYA 5FBJA 4U3JB 5C6CA 1K42A 3VHRA 2F95B 2OIGA 2RS12 3FLTA 1NT0A 2JDMA 1J59A 4XUNA 2A71A 5DZFA 1FJGO 2RS13 2PMWB 2XOKG 1FMD1 2ZGPA 4CDUA 5LHIA 1YWKA 3VHPA 4UVCA 1COV1 5JOWA 5FZMA 3CJIA 3I2FA 4YZ2A 5LWBA 3TEYA 2Q8OA 4QU1A 4MX3A 2BFUL 1BGYH 2BCCH 1FFTB 4EEQA 2WNUA 4FPOB 2MK3A 1ZBE2 2JDAA 1VPHA 3ZMNA 4RL7A 5ISLA 3CCRV 3OTFA 1VQ6V 3I3QA 1GP5A 2DWRA 5ITZA 1UOGA 5F5IA 5A1AA 2YI8A 2EIMB 2DCJA 2HR3A 1QQP3 3J8F1 2HJFC 4QM9A 1KC8W 4CH6A 2YZ4A 1DF0A 1LB2A 4LWSA 5AFBA 3UV9A 1VBB1 4NN0A 2GC1A 3BABA 4BH9A 1NVPB 1LAJA 3D3IA 3JCUZ 2GZWA 3JAKB 2VY0A 5C8YB 3B69A 2ZE5A 4X20A 1C4RA 1ZL8B 3SCFA 4C0HA 1IBKB 1ZBA2 2Q4SA 5BR8O 2DTWA 1Z5WA 1EPWA 5EZYA 2HWB3 3O5SA 2HBUA 4YYOA 2E5LO 3ABUA 4IE5A 2ID4A 2BU9A 4MXWA 3VDBA 3SYPA 4B3TB 4LO8A 4XDKA 2J22A 1RUI1 3HNMA 3LIHA 5FP4A 1AR62 4LF9B 4HVQA 4GMP1 1K3IA 4XXPA 4LF8B 2W2IA 5JDBA 4PD4F 2HEYF 5IHRA 1OOPC 1SMVA 1X9PA 2W87A 1N0JA 1PK6C 2ZGSA 5IVBA 2E75B 3VKOA 2XLAA 2ZEYA 1MS5A 2Q1MA 1QJX1 4JGYB 3ZRSA 3WZ1A 3JARB 2JKBA 4H7MA 4XF0A 4LBNA 4BM8A 2YEVA 1AB3A 3K3WA 1GH6A 5FCCA 2QKDA 3ZX6A 1RUG2 5GLUA 1N3PA 3EHBB 5KX5A 3O7OA 1RHI2 3ML0A 3SYAA 4YGEA 2BOCC 1W6MB 1WW4A 3ETGA 2PAMA 3VD5A 3S3XA 3ZFGC 3AKSA 2JDYA 4JDNA 3OPWA 2AENA 2ZCEA 3U1XA 1WW7A 1NLSA 5DUWA 1ZTEA 4MH0E 4K7JA 4CC6A 2CH7B 4HKWA 1YJKA 2JDNA 2ZM6B 3H1MA 1RUF3 2JDPA 3RYKA 4IGPA 1YITV 1XNRB 1R6NA 1NA1C 2A3QA 1AL23 2CDOA 4UVBA 3D0JA 1THZA 5CMUA 1X36A 5LK7B 4BE3A 3IIIA 2ZXQA 4IDZA 4YARA 2GHYA 1XSRA 4JHZA 1SCRA 3C7GA 5A6XA 3N9QA 3D36A 1Z2GA 3D4KA 1N47A 4LP8A 3SYOA 4GKJO 3K4ZA 1GLHA 1D5AA 5FY1A 2PYTA 3NWKA 5FPRA 4CEYB 2DBIA 2WLLA 2WT0A 5FK7A 1HQNA 2XBO3 3PU3A 4JZRA 5IVVA 2IXJA 1SQ4A 4J10A 5HCHA 3OYWA 3WNMA 4XAEA 1OZ0A 5LP6A 1PIV3 4P9GA 1JH5A 2DTYA 1BVVA 1RVF3 3GM8A 3NR7A 5LMNB 4OPHA 4FVMA 4B4PA 3KB5A 3AMPA 4YHHB 1FXZA 3TXSA 3WDWA 1GZTA 3GNEA 5D21A 2IU0A 2OVUA 5FWJA 2X10A 2CTQA 5FFOC 4PDMA 2RMU2 3MDPA 1GZWA 5JJNB 3T4DA 2H3OA 4RR3A 3CXHF 1EN5A 2DMXA 3K59A 3AP5A 1RSOA 2HJDA 3JXSA 2E31A 3EYPA 1N33B 5IK8A 3UKTA 2CH7A 4CU8A 3Q9OA 4H3WA 1M5IA 3FFQA 3POBA 1ZYBA 1AJNA 5I0SA 1O8PA 1AYN1 4EFEA 1YFYA 3UK9A 4GMP0 1HP8A 2ZGQA 1CD3G 4BQ1A 4DR7O 2QKCA 5GONB 1NZCA 1HKDA 4YG0A 1RUH1 3OPZA 4UW6A 1F8VA 2E51A 3KVBA 1HJGA 1H1AA 4YY3O 2VH9A 3INAA 4XHXA 3IBMA 2ES3A 3URFA 4GALA 2YEVB 3F2ZA 5CB4A 3F7VC 2OUHA 2ZGKA 3BUCA 2J7MA 1CPNA 1I6XA 1J83A 2P3KA 3NJVA 3E6CC 3WOGA 2D3OW 3CKHA 3WDTA 4CDUC 1PZ8A 4NIDA 2JGDA 4H0LB 4MVRA 3EXAA 1PK6A 4JI4O 1K9MW 4FPYA 3AK1A 3CMAV 1AJQA 5L3GA 1P7BA 4YM3A 2WO1A 3TCUA 1KD7A 1G9DA 4DXSA 5IYCO 3AZYA 5IYZB 1D4M2 2VW0A 5IW0A 1Q82W 4FMTA 4PI2A 1MS1A 2OCCB 2EILB 4X20B 3HQRA 1XPWA 4R7CA 4I50B 4Y20B 1GO3F 1Q6HA 1Y76A 1VMJA 3KCXA 1K5MC 2Q30A 3SH5A 1FXVA 2ARAA 3ZFGA 4KWJA 4BCUA 2HWF2 3RZMA 2RQ6A 1RM1C 4FBFA 1SQFA 3GZTB 3PVEA 4JI0B 1AILA 2HWF3 3FMGA 1BBT3 3KF5A 4WCEV 2JECA 1VAMA 3UM7A 4CP0A 3KKYA 1XJAA 1HXS3 1DU3D 5D1IA 2CU5A 2GTAA 3AK2A 4M3CF 4BHPA 2W1UA 1D0HA 5FUPA 2X5IB 2AXTZ 4OQ8A 4OCTA 1G9BA 2VJXA 4MUVA 5HFMA 4XAAA 4QDSA 3LIGA 4DR1B 2PI5A 2XJUA 4HZ3A 2FYUH 3DEMA 3WT3A 2A1XA 1GRJA 5CYYA 1WA8B 3IPVB 1M56B 4WVMB 3UKVA 5IFPA 1DF5A 4B1LA 1IBMB 2UUAB 4J9YB 4D6QA 3OEEG 1DYKA 2XHNA 3KHBA 4QIWF 1FV2A 2JG9C 1V55C 1QH6A 4AQ6A 1PKXA 4FVVA 1NYWA 2AW9A 1J3QA 4CP1A 1T2XA 1VBC1 3LSSA 2GAUA 2WBKA 2QZ2A 3PVNA 5CEHA 1BXHA 4CXWA 2PA7A 1AR91 5A33B 5L3EA 2WA3A 1Y6XA 5A7OA 2P90A 5FMOS 1NCQC 5BNOC 1W6MA 1F4MA 5LMNO 1K8AW 1QY4A 2FQPA 5ABJB 5IVCA 2P67A 1Y4WA 2CGOA 2BUKA 4YZ5A 1I94O 5GW7A 5LRSA 1WMEA 5FYVA 1QU0A 3WV6A 1WCUA 3NV2A 3SXWA 1OCCB 4JI6B 5T52A 5JSOA 4P9YA 1VAVA 3X29B 1ZVFA 5IVFA 2DWDC 4U3JA 2E7TA 4X65O 4MSWC 3RRDA 3AKRA 3ZN5A 3BU0A 4UW5A 3V0BB 4QPGA 4META 2K9PA 4COUA 4BLJA 3RT3C 2HWC3 5L3CA 2BGOA 1LU2A 1SQBH 2UXBB 2EX3A 4AHXA 4DUXA 3I49A 3VOUA 2OCHA 1NE6A 4RQPB 1VP6A 3T3YA 1ZBE3 4XETA 3THTA 3KMHA 1VBE2 2DN9A 5FZHA 3PMEA 3ENRA 4K20A 5L3BA 3PUHA 3JBG1 1VBE3 1GZCA 2ZMKA 1RB8G 3P5BA 5L3DA 5B1AC 3GHNA 4AVAA 5J96B 1X33A 1YQ6A 3JAWB 1S2EA 4DR6B 3PHMA 3LOBA 1SF9A 3POSA 1AYM1 1AI5A 3CX5F 4LKEA 4QHOA 3HPNA 3N36A 2FDJA 3AKTA 1K5MA 2UYAA 3ZYIB 3CDZB 5ITZB 2FZ2A 4P5YA 2R9RB 4IXLA 5FYIA 1QIQA 1S0FA 2DVDA 1PZ9A 3N9PA 1GAXA 4Y5SA 3BY6A 2NR5A 4XJ9A 2B7YA 1CZSA 4G4FA 4BXSV 4X1KB 2ITCC 4KG0A 1ND2C 1R093 2QNKA 4BIUA 3IPVA 5FKBA 4QQ2A 2ZAHA 4LF4O 4GX0A 1I5ZA 1VF7A 2JG8C 1QOOA 2GMPA 4CDUB 1U5ZA 4N53C 1UXZA 2Z2SB 3OBZA 4PF1A 2WFF2 4LKDA 2D6KA 2IJHA 1SC5B 3I4IA 4C91A 3IAQA 4OQ9A 3ZSLA 4L2NA 1O3RA 2PHRA 3R05A 5CA0B 5JJJB 2LGQA 2R061 2KXLA 3PVOA 1GYKA 3R6SA 1EFRG 1VQ9V 1H0BA 3ZXEA 3SGIA 5CBFA 2WAAA 3K75B 3L9DA 3B09A 4HK8A 1RTVA 3CB2A 2D93A 5DUVA 1EYBA 1S5JA 2H8PC 5ABJA 3AG1C 5L9VA 4GUNA 1KRIA 3VBBA 2D5FA 1RUH2 1TMF1 2PHWA 4COWA 4RHV1 3T0DA 3THOA 2QFEA 3PIGA 2ARHA 1B3QA 4XEZA 3BIEA 4XDQA 1WLDA 4I50A 2KG7B 4E2QA 2WN3A 3WG3A 4H13B 2ZEXA 1F4NA 3VBHC 1LHNA 4RGKA 4XFAA 1BHAA 3S7IA 3HBZA 3OR6C 2VUDA 3ZXFA 2HEWF 5BNOA 5B1BC 3QG5A 4PIXA 5KBFA 5DZEA 4LA2A 2R1DA 2VQUA 2TEPA 2VMDA 5FZLA 3VKMA 3OUIA 3DF0A 5I0TA 5LHGA 3K04A 5DMYA 2OXBA 2WZR3 1N1SA 3IDEA 2SBAA 1UOFA 4AVTA 2A0LA 2YXLA 1UZYA 4DV6O 3FB8C 2XKPA 3RSJA 2W0FC 3ZRWB 5FDBA 1L1FA 1W06A 4HVOA 4DEQA 3W59A 1MZ5A 4JI1O 2WUHA 1S2BA 5B3SB 2WR9A 4XMAA 4LHNA 4MTGA 2J1AA 5KAFZ 3VZKA 4CE8A 3WINE 4BK5A 2D98A 1YI2V 2PHUA 4ARXA 1OLQA 2C5DA 2XAGA 2VNRA 3AYAA 5L7OA 2VMEA 1S76D 1SZTA 3RYCA 1SCSA 3MYXA 2WFPA 2BP6A 1ONAA 5J2UA 3C90A 5C4WC 1YZBA 2GU9A 1UY4A 1ULDA 2AEYA 1XNTA 5G04L 4HG6B 1LEMA 1IHMA 1QNMA 3WF2A 3IDAA 5FP3A 2CTPA 3CCQV 1NLRA 4FTEA 3ZMZA 3W7SA 2P6CA 1C8NA 1WLWA 2LUWA 5ERLA 2VQAA 3GWOA 3ILRA 1Y74A 1NTZH 2Q5ZA 4IV1B 4QKBA 2IU3A 3K03A 2QR4A 3LDCA 3DPRB 5LHHA 4UW3A 4DB5A 1K33A 1Y9GA 5E1AC 5DDJ3 5FZCA 3QO5A 1BCXA 2Z69A 2JD9A 4BAYA 1R3KC 2UUCO 3IMNA 3BI3A 3VBUA 2ZX3A 1HR0B 2VZSA 2ZGLA 4J7ZA 3SH3A 1H38A 3THDA 3JQXA 3MI8A 4RQPA 3HNBM 2VQ0A 4Q4X3 3SPIA 4ZU5A 2WNUC 4A44A 4Q6GA 4JI8B 1RUF2 5FMOL 4CZZA 3L9JT 2WINB 1AR61 4QPGB 1QBZA 3ZHUA 1HN0A 1L0NH 3L75H 4UV8A 2P6JA 3ZKUA 4UCOA 2YXHA 2WABA 3T1YB 3ZYFA 3ZR5A 1O5LA 1C1LA 3NAPA 1AR73 1QDCA 2Y0PA 1GN4A 1P7GA 1PM4A 1XBLA 2Q1FA 1P4RA 3BTXA 1ZBA1 2M7WA 3RZJA 3WP6A 1ZZBA 1SLCA 4YJ2B 5I8YA 5HI0A 2WLJA 2NN4A 1YFWA 2W9XA 3L74H 4DS0A 2EINB 4DV7O 4A6OA 3HQXA 5CFCB 3ACFA 4BIFA 5KHHA 1BQ0A 3UT5B 1ND2A 5KR7A 1GNHA 2E53A 2JJ1G 1PL4A 3G6BA 3AP6A 2YBPA 1H8TA 3VKLA 4N53A 2X7RB 5LY2A 3KHCA 1FMD3 4H14A 3SCHA 2FDGA 2WLNA 1H2MA 2G4IA 5FY0A 4N8MA 4CSWA 4IV3A 3JD4A 2B9ZA 4K3UA 4W65A 3AL5A 5LRRA 5FQ0B 4J25A 3VDCA 1NCQB 5EBLC 3CPWU 1COV2 2WLLB 3SJAC 4Y26A 4I2OA 1URFA 5FY9A 4UBHA 1W8TA 4MVMA 3HD8B 2BERA 4MGYE 1NZIA 1EN6A 1OQEA 5JPMB 1HQWA 3PUAA 1F4AA 3I8TA 2HYKA 1XC6A 2VBPA 3OGIB 2JWPA 5DG1A 4Y1XA 1N34B 4NXNB 1ZL8A 3CJXA 4UFLA 1LODA 4L8JA 3VZJA 2XQRA 3RZKA 3CC4V 4OX9B 4UF0A 2WAMA 5IWAB 1LUVA 1R6KA 3ZHTA 4QPIC 1W8WA 3UL2A 2UURA 2VZTA 2YXYA 2GNMA 1FPOA 4K1ZA 1ULCA 2EULA 4RO2A 4IGQA 4DV2O 1KDKA 4BIZA 4UCSA 4HT1T 1BSMA 4DPNA 1N1TA 5E79Z 5CFCA 2IM9A 4AFDA 4UFZA 3OUFA 5FTTC 1AXYA 1NBMG 3C7HA 1IBLO 1BEV2 1YTFD 1PGW2 4LORA 4Y20A 1MS4A 4PI0A 1ZREA 5EP9A 3VN4A 4DNYA 5JZGB 4Y5Z0 4IV1C 1FATA 3AYCA 3OUSA 3LDEA 4DUVA 1RVF1 1UPSA 3MZHA 4BW9A 5EFUA 2WFF3 1KP3A 3ZXLA 3VBSB 3K9SA 3IGAC 2ZMLA 2GMMA 3ZSMA 3OB8A 3NSTA 2QQOA 4N9HA 4I3GA 1NUKA 3QO7A 4AG4A 1AL22 1LOBA 4TV8A 4XFFA 4PA4A 3O1UA 2RM21 1DLCA 3OGJA 1SRYA 1RIRA 4R9DA 4XVHA 3APQA 2HWE2 3OTOO 1H2LA 5LA6A 5B1BB 1IOAA 2Y0IA 3WF0A 1HNZB 5FR3A 2UWBA 1K12A 1MABG 1AF9A 4NRPA 3WG1A 5HCAA 4ZKTB 1V9U2 5HXVA 1CAXA 4QD2A 5DN2A 1OOPB 4W4LA 3NRUA 1G6UA 2YFUA 5LZ6A 4MGQA 1UZWA 5JCOA 4GLXA 2JDUA 2CAZC 1X8MA 2QQNA 4P9OA 2WAOA 3GBFA 4FJCC 2OX0A 1U96A 4LTAA 2DCTA 1OCCC 4DO0A 4HVRA 5JJEB 1IX9A 1PO11 1G7YA 4J6GA 1QF3A 3MUZ1 4HMZA 4NOTA 3SISA 5LW9A 2R70A 1AX0A 3FJSA 3SKJE 2E9QA 4FI9A 1GZWB 3AMMA 3TK1A 5A3UA 2WWSA 2GNTA 1TGOA 3CJIB 4L9BA 5J3UA 1B06A 4H55A 5CZKA 3AKPA 4LF7O 1EY2A 3SCGA 5LATA 5EBMC 1W6PA 2XPJA 2YHJA 2FMDA 2J1UA 4CDXA 4RHV2 2E74B 5EPAA 1RUF1 4ZXKA 1W39A 2QCSB 1NVPD 2JE7A 2XL7A 1D4M3 4HOOA 1YF2A 4L99A 2O0OA 3LGRA 1BQZA 3O1SA 4HKLA 1SKVA 2WQ8A 3JBG3 1LGBA 3QLQA 3IAYA 3ZKYA 1XRUA 1AR72 3PUSA 3MIBA 4EB6A 3LQCA 3POJA 3IM0A 4W4ZA 2PXJA 3S3WA 4LJHA 4AE2A 2ZGMA 3ATGA 3UT0A 1O9GA 4OLLA 1US2A 5C5UA 4AEDB 1TVGA 1YTFB 4DUZO 2QQIA 1QJY3 4IHJB 3BTZA 2ZGUA 3ABMC 4QB2A 1T6GC 2E33A 3QNEA 5F5AA 4DQAA 4RSUA 2A79B 5FKCA 4A42A 4U36A 3KGLA 1Q81W 5FOJB 1POV3 1XMOO 3H1LH 3ECQA 2FB5A 2D44A 2A9HA 5E1RA 3IKWA 4FAGA 3V65A 2WYSA 4NJ4A 4AR2A 1VMFA 4MXVA 5LEJA 1UX7A 5CKQA 3G80A 1PNGA 1R091 4IE7A 4DV0B 4LIVA 3VGIA 2YV8A 2IXKA 2CWSA 3AJZA 3C7EA 3E86A 4HPKA 2HVKC 5CKNA 1F31A 3JQWA 1PK6B 1H9PA 4ASMB 1EP0A 5KX5B 3UGHA 4QB1A 5A6YA 5DG2A 3B01A 3TETA 5K1XA 4XHBA 3FC0A 3I2IA 5JOYA 5L9RA 1VBE1 4CDWA 4QGPA 1CAVA 4COVA 3OOXA 3GCXA 5BNQA 3FFZA 2QWPB 3ZRWA 4Q8LA 4FXGB 4WBNB 2BBVA 2B39A 4WV8A 2JK5C 3RGBA 3ACHA 5BY5A 1RUJ2 1L3JA 3VBOB 4PQQA 2B4KA 2WQZC 2ZACA 5BNNA 1GNZA 4L0PA 3AMNA 4I30A 1R73A 1NCQA 5FZKA 2QWOB 3H3ZA 1M57C 2TNFA 3T2OA 4DXTA 2IC1A 4LO4B 4OHWA 4J80A 2EIMC 5F3CA 4AI9A 1SQPH 3CBNA 5H5NA 4Q4X1 3OW2U 1OKOA 4P08A 2XJSA 2OT5A 1HRV3 1VQ5V 3L71H 3E6DA 5DZGA 4Q29A 1K4DC 1HIXA 1NOVA 1FFXA 2VXRA 4LA3A 2OTJV 4BA6A 4F7ZA 1T5EA 4CRQA 1KQSU 4KUMA 1WMDA 4CH3A 4MS2A 3I5DA 1ACCA 4DV1O 3JB4C 5FZOA 5F3GA 4DR4O 4CUBA 3IAPA 1AR92 2A6YA 2RR13 4P14A 1ZBA3 2IZWA 3TB0A 2VOWA 4CCMA 3AG3B 4CDXC 1DQ2A 3LA2A 3QH7A 2OQ7A 1ORQC 4FPLA 4AGVA 3MLJA 5AFEA 1HX6A 3OE7G 4LMFA 3J26N 4FT8A 3N27A 2WFF1 3U14A 5EXOA 1UJWB 4MXWB 2DVAA 5K8SA 1JQ0A 1UYYA 4IEVA 1AP6A 4HFSA 2AREA 1UAIA 1IG3A 3T4VA 2PAEA 4NYKA 4D94A 5IVEA 2ZX1A 1BE3H 1OCOC 2HP8A 4LK7A 5F1RA 2UWCA 2C9AA 5DUUA 4BPZA 5CG8A 1J3PA 3M1HA 1W0OA 4YGDA 4XDLA 1CAUB 2BOJA 1IS3A 4LQRA 2OWOA 1XNCA 2YICA 4LR3A 4ZHNA 4LKSA 1WD4A 2Y34A 4AVVA 5CVRA 4NB5A 1ASJ3 4LHSA 2VQFB 3JAWA 1DGLA 3KT1A 1WCQA 4B3MO 1PM9A 3JBG2 1BCCH 1OOPA 2FMLA 1GOGA 4NUBA 4JAVA 1COWG 2F93B 3D3AA 1VB4A 1BBT1 5FZ9A 5IK5A 5DPNA 3R0RA 1FI2A 2OW4A 2V4DA 2D40A 2DYRB 1VBD2 4I0WB 4TSVA 1P84F 1LR5A 3USSA 3BHPA 1GR3A 1VBD3 2OIEA 4PA6A 4LOSA 2KD7A 1VJ2A 1OF4A 4XTMA 3A0KA 2OCCC 1QNWA 2VNVA 1YUDA 2EIDA 4KP4A 2UUCB 1WCDJ 2VECA 2VBDA 2ZHKA 4A45A 4FK5C 4YVSA 3A22A 4WM8C 4E27A 2ITDC 4UCRA 1D2QA 5BNNC 2LW8A 2R16A 4TXWA 5F6LB 1E5RA 1JOPA 5A3TA 2PHTA 5FPVA 2JIZG 2DUPA 1GV9A 4FFGA 1YDXA 3AG3C 4CDXB 1MACA 2WWJA 4XDPA 3T09A 1AX2A 1AYN3 2VL4A 4CCJA 1DZRA 2GUZA 2GMEA 1SERA 2BSKA 4MTOA 1VBC3 4DXRA 4Q4X2 1AYN2 2XKOA 5IJ0A 4DV5B 1VBC2 1BJQA 1ND3B 1GP4A 2WNUB 1MZFA 1CEZA 1CN1A 4AHWA 3RWNA 2LP7A 4L97A 2JE9A 2ADEA 3FWEA 1C28A 4XMIA 4D7SA 1KP2A 4OHXA 2VQEO 3ILFA 4NRMA 4AVCA 3ZYGA 2VO5A 4AQYO 4DV7B 1RUJ1 5EBWC 3OGVA 4CZSA 5F32A 4Q26A 4EE2A 3ICXA 5BNNB 1AJKA 4PIYA 5L7OB 2LRPA 2PHXA 4RQFA 3UKMA 3ES4A 4E4ZA 4YJ3A 2A3XA 2PFWA 1RL3A 2CSGA 4JX0A 3U10A 2Y4TA 2PELA 3K9AA 4CCNA 2JG8B 2VVEA 4I4TB 4JYCA 5F8PA 2O1QA 3APBA 2VCBA 2PY5A 4QXHA 3GF6A 5I0DA 1JYCA 1HV0A 4AAPA 4J42A 1XL6A 4O4JB 4JI3B 4ZONA 1MSDA 3I2DA 2EICA 1OFSA 1RUI3 4XYXA 2WDBA 4PQ9A 1E5IA 4HPKB 3LOIA 4D7YA 1CONA 3VBFC 4NXNO 5D8AC 3AMHA 2HWF1 3NJZA 3H9VA 2F17A 1J3RA 1XNQB 3J7MA 4R9CA 3AP9A 1O8SA 5AVAA 4E8DA 4XOGA 5E6HA 3SEPA 1OPOA 1FYJA 1OMIA 1VEWA 4LBQD 3RBZA 2D43A 4KWUA 4EZ4A 3BAAA 2FMYA 1UZVA 1X9TA 2W39A 5H6RA 1Y76B 4G28B 4LH6A 1TG7A 4FPPA 4PCRA 3MIGA 1QXJA 3KF3A 2MW2B 4CDQC 3WNKA 5B1AB 1JI6A 3LKJA 3U4XA 1ZZ6A 1H8HG 4BISA 2BRTA 1VQ8V 1QJU3 4ASKA 3VDDB 3BTAA 3KWVA 4DR3B 4DR5O 1AR71 5A32A 1GFF2 1LULA 5L19A 5FP8A 1ENVA 3KV6A 2R063 4I4TA 1HW7A 1EPZA 5LA2A 4LO6B 2NN8A 3NAPC 4GYCB 1SA0A 2D6MA 4W6XA 2QM4A 1SLLA 3USUA 2HWD3 1A6CA 3MIDA 1ALYA 4DRVA 4NO4A 2X09A 4G2KA 3MPBA 2ATKC 1K4CC 1O4TA 3G6JB 1QQP2 1N33O 3EQEA 5EZYB 3QO8A 5F37A 1WD3A 1SQXH 1YJWV 4GX2A 4B29A 4QGMA 2JENA 5JMCA 5GLTA 3K06A 4QXKA 1W2AX 1QMJA 3TN93 5H9RA 4OI0A 1CGPA 5A3MA 3CCJV 1S0CA 4GKKB 3N7KA 4JV4A 2DW4A 4UFIA 1QH7A 2F4PA 4IV3C 2FHRA 1Q86W 1OQDA 2FCTA 3SPHA 1NR1A 3CMGA 5ANQA 3VBHB 4FLTA 2JJ2G 1IS4A 3MLLA 4PDWA 3WW2A 1SLIA 1ZBE1 5C70A 1IVSA 2UY9A 4A7YA 2VZRA 2HWE1 3WW3A 1S77D 3N9MA 4GKJB 1HDKA 4OHYA 1WW6A 1XOYA 4Q0VA 5K0UA 2JG9A 1S4CA 5EJ3A 4U2AA 3N9LA 2RM22 2P4KA 3HT2A 3MIHA 3VQWA 5IJ9B 2I07B 3NKTA 1YC61 3O14A 3VV1A 4NPRA 4OFGA 1FMD2 4DR2O 3WF1A 1AL21 3TOJA 2LW7A 2Q8CA 2H6BA 4JKKA 1JBCA 2K2SA 5IT6A 1PV0A 4YJ3B 2BNNA 5JCTA 3PNAA 3B77A 5H9CA 1TNRA 3HPLC 1VF5B 2P4EA 1FV3A 4JC1A 1VQKV 4GMP3 4MVOA 4XACA 4RWUA 2ODMA 2X6AA 2R9AA 3N2KB 5FO8B 5A1FA 2R043 3KM5A 4O4IA 1GUIA 3RVYA 3K08A 3WEZA 3WSOA 5FZGA 4D8MA 1A8DA 2VRZA 1PGW1 4XBFA 3ETDA 1BEV1 1SQVH 1XE8A 2WT2A 4RD7A 2XHBA 4GIQA 3CHXA 1DYPA 1W9FA 4D7TA 5LASA 1L7LA 3QH6A 1KXGA 4NHMA 5IAXA 4PJ0Z 4PF5A 1VBA1 3VBHA 2ZKLA 4JGZA 2AGAA 3B00A 4Z1VA 2LGWA 1RUG1 1OHHG 5CFDB 5I8TA 4LUMA 1CX1A 1FJGB 1L7RA 4GKXA 4P9PA 4N21A 1QLEC 4A2UA 4W50A 5C8CC 3WDYA 1QJX2 4CP2A 4QT6A 5CG9A 3LUTB 5GM0A 2CDPA 3QVNA 4WM7B 4CDQA 2JDHA 4COZA 1OT5A 5KUKA 5IYZA 1HB4A 3QBQA 1IPKA 1PNMA 4ES8A 4W8JA 1RUI2 3AK0A 3H8UA 4UB6Z 4FLUA 3LWCA 2ERFA 1S3JA 4WVZA 2PI4A 3JALA 3WNLA 1ZNPA 2OYQA 5JI9A 1RPOA 2Q7EA 1Q8IA 1GN6A 2UU9B 3T08A 5J37A 1WNSA 3ZFEB 4NHXA 3I3BA 4TYSA 3ZHQA 3A0RA 4GWIA 4O7XA 1OA4A 3SYQA 1F2NA 3CS5A 1VBB2 4GKYA 5DUXA 4N23A 1E1QG 1KBHA 3CWBH 3NKGA 4CA9A 4JV5O 1LUWA 3GZEA 2FDFA 1W6NB 4FFFA 1T6BX 5EJ1B 5A80A 5BMVA 2KM2A 4CVUA 2DYSB 1K5QA 4HKOA 4X6QB 4IEOA 4X66B 1PM7A 3N2GA 4JAAA 4R50A 4LBLA 4MVZA 1XU1A 2J1VA 4G3YC 3M3CA 4AI1A 1W8HA 3K2OA 2CK3G 2XAQA 3ZIXA 2K0GA 2A6WA 4JZ2A 2YMZA 1DCSA 1KDMA 4RGAA 1AI4A 2Q7HA 1JOYA 3WB2A 2N05A 4CPBA 4FM1A 3D82A 3E1F1 3CJHA 2M6YA 3JU9A 1G8MA 2RS11 5LMUB 3MPPG 2JICA 3J7HA 2UXNA 2DF7A 4QKNA 4JPRA 3C7OA 1ZRFA 1R1ZA 4INDA 1JMKC 4GKKO 1G6NA 1TUBB 2FCUA 3U75A 1IDSA 3AM2A 5KHJA 1RUD1 3T0AA 2P6HA 1IPJA 1XNAA 1VBA3 1XNDA 3G6EV 5FLXN 1W2NA 5FUIA 1AHSA 2DYRC 4O4HA 3WP4A 1IXBA 1IKQA 2W94A 3U37A 1M57B 2ZR2A 5IY5B 2PN5A 4IERA 2A06H 5IYDO 1V6MA 1BMV2 3LPFA 1V54C 2RJ2A 3VLBB 4TQFA 3RYHB 5LBCA 4MW8A 1BYHA 4XJZA 1JCHA 1M4WA 1JX9A 4GX5A 1KITA 3POFA 3IDCB 4XFHA 4IIJB 5FBZA 1JU4A 1SZBA 5JAXA 3CE2A 4Q5OA 3HN3A 5LA9A 3ABKB 4YJ2A 3K3OA 3WB1A 3PDQA 4PDWC 3OMIB 4EKWA 4CEWA 3H0OA 2W3JA 1FXKB 4XURA 5IJ0B 1QLEB 4AF9A 1EN4A 5HV4A 4YHHO 2XMLA 3LEKA 1WUVA 2HVJC 2K1EA 1DIWA 1LGNA 1OPMA 3M3EA 4Q20A 1HQLA 3ZRXA 5E16A 3B94A 1SZXA 3FB6C 2LM3A 1QJEA 2IXHA 3MO4A 3JB8A 2WC2A 1AR5A 5LOVB 4X89A 2OA2A 1J5EO 1VRH3 5FLIA 2XL9A 2PLV1 1BK0A 2Q0OC 5BXZA 4JI7B 1VRH2 4CEYA 5BNPC 3ASNB 4EWDA 1HNZO 4Z2AA 3JALB 1CZVA 3KT4A 3V0BA 3JZVA 3MEPA 1V9PA 2UXCO 4QPIA 3D3QA 5K7PA 2E32A 3WVJA 3N35A 2XUMA 2ZM6O 3VDAA 3O1TA 2YY1A 5JQGB 4CUAA 1GKFA 4LLFA 2ET1A 4PDVA 3CZUA 2UU8A 1QR9A 1JTZX 3SPGA 2QE3A 5LCWL 4Q0UA 1H2KA 4Q0SA 4JI5B 1HWYA 1HLCA 4AQ2A 4I7ZB 1DLLA 4JKLA 1ULFA 5FUNA 2YIBA 1TMF2 1V6IA 1JJOA 4BWAA 1SLBA 2RJZA 3T1LA 5T55A 3UKNA 3CZJA 4QDRA 4K8RB 4KI5M 4NMIA 4CCKA 5A70A 4JI1B 3VHOA 4UVAA 3CIHA 3WHUA 3W5MA 4BLIA 4AFCA 4R9AA 2R062 3JSLA 1LOFC 4XF4A 4ZU4A 1ULPA 3MGUA 4CYDA 4J1WA 2DBNA 5A7SA 1GM9A 1LHVA 5KXCA 4BQ4A 4BYYA 3E8HA 4LHLA 5IUQA 2EA7A 4OI4A 3A7QA 1HNXB 1Y7BA 2HWC1 5I91A 3DSQA 2MHFA 3F95A 1NCRA 3OYWB 4GAZA 4PT6A 1WMXA 4JYAB 5GONA 5IYYA 5FPBA 1VR3A 4H44B 5FYZA 3O1RA 3FL7A 1U0AA 4FOVA 3G7DA 1PVXA 1JN2P 1NKDA 1PX4A 3LA3A 4TWTA 3C3SA 5SV8A 2PHLA 4GB33 3K77A 4IL7A 1XYOA 2EILC 2WIIB 4LH7A 1IS6A 4WM7A 1N36O 2FKXA 2O14A 3E6BA 3FE5A 3C3VA 4PA9A 4B1MA 2EIKC 2CWMA 5FZ4A 2DCZA 3OUJA 4OMCA 4FOWA 5LYJB 1NE4A 5J98B 1AYM2 1RM1B 3WY6A 1VIWB 1QHTA 1BMFG 2ZJCA 3FD9A 2G19A 2ZX0A 3R66A 5JPNB 4QX2A 5HCBA 5DN6G 3H1JH 3M4FA 3JD3A 1SPPB 2BNMA 3BRCA 1AP5A 4N43B 3FUQA 5KXEA 4O9EA 1LNQA 4BDVB 2RMU3 3AXEA 3B9IA 1UYPA 2XASA 3U0ZA 1XUQA 4ZS2A 5KXDA 4HNAA 3NO8A 1YJNV 4IT5A 4UAPA 5J09A 2XXZA 3D8CA 1AR81 1W8NA 2ZIOA 2ZAAA 4DUWA 3IIAA 4FLZA 4YXWG 2Q67A 2J1RA 4IE0A 5FMBA 5GLZA 2QTWB 3VBUB 1HN1A 1GN3A 1S0BA 5FZIA 2YUAA 1W9SA 4DY3A 4XQWA 3JAKA 4TT3G 4ZHQA 2XAJA 3T2MA 2C4XA 4N7UA 1Q43A 1OH4A 2F23A 1H1MA 1RUD3 2WZR2 2WSSG 5T5PA 3L72H 5GZEA 3RYRA 4NHYA 2GSMB 1F5JA 3JUUA 3CNAA 1CAUA 4NTXA 3QACA 2HFEC 1AL0G 4E4HA 5IK4A 2AZ2A 4A7ZA 3KZ4C 1UYZA 2GP3A 4ISRA 3D36C 1PIV2 4TLFA 4EV0A 3T2QA 4OMDA 4JAUA 4TSFG 1PVC2 3A8TA 4CPBD 3ELNA 1JUHA 2VZVA 5KMGA 1XNQO 5HV0A 2E63A 2GSYA 1SFPA 2ZX4A 4KU8A 1WPXA 2H0BA 2A3WA 4XJ8A 5LL6Y 1YQ8A 4HAMA 4CDWC 1KMIZ 5BNPA 4DK0A 3RPQA 2EINC 3DGEA 3MAQA 4QB6A 1QR8A 3AG2B 5JUVA 3KSCA 3FHIB 1WW5A 1YHQV 4R52A 4B8EA 3UJQA 1W0NA 4J11A 3ZFEC 3HJRA 2OQ6A 2JE8A 1DHKB 2LFRA 1UOJA 5BPXA 3CO2A 4F6RA 1RUH3 4I9WA 1YFXA 4LFAB 1O4ZA 3OAAG 2ZA9A 3CRQA 2QM7A 2Y0OA 4JTCB 2Q8EA 2W08A 4LF4B 1LOGA 2IWGB 4KBZA 5JH7B 5I8SA 2XHKA 4ZZ5A 2VUCA 4YIPA 3QCWA 5FNVB 3G67A 4KU7A 1CAWA 1A34A 2ZT9B 1JXNA 3KVAA 1MQTA 3B93A 3MD0A 3AZWA 2NLJC 1FT9A 1VLNA 4I0AA 2BQPA 3C8XA 1RUNA 2LROA 5FZDA 3FAVA 1EBOA 1D4M1 4S2FA 3WF4A 1UD1A 5IATA 2ZCWA 3O9OA 3AJYA 4MTXA 4XUPA 2GC0A 1K5SA 5A6QA 3RMYA 4GULA 4I0XA 4AQSA 1FYUA 3RYHA 1NU1H 4HYOA 1SG3A 3ZR6A 2ZPXA 5F39A 4AI2A 1B35C 4QPIB 2X6CA 3V0AB 5LBFA 4UFKA 3WP3A 4RQPC 1OC1A 4GA9A 4C1WA 2FBEA 4OYUA 1JZ5A 1E79G 3HR0A 3WX5A 3A0BZ 2NLRA 2P3IA 2Q9LA 3KQRA 5DEDA 4RFT0 1RUJ3 5LOVA 4MO3M 2Z42A 5FXVA 5FZ1A 5CA0A 2PYJA 1DGWX 1SFYA 1AZDA 3RZGA 3ZFFC 1W8OA 5KC5A 4CBCA 3RJ2X 1FOD3 2A7AA 2XH6A 3I54A 4ZBMA 1YLLA 3HR9A 3RVHA 1B04A 4K8FA 2W0XA 5T54A 3OGCC 5JIUA 3PIJA 4BQXA 3S6PA 3NNLA 4RUFA 1PGL1 3J7AU 2RM23 3ZXKA 1M93A 3K5OA 3FAVB 2CY6A 1QOSA 2RMU1 3VBRA 4XFIA 2DU0A 2YC2A 3A0NA 5EZWA 4K8XA 1DQ4A 2XQXA 4RR3B 2GUZB 4DV4O 4Y5TA 2CL2A 3ON7A 4Z07A 1JW6A 3ZN0A 2VCCA 3ZHVA 3K58A 2C24A 5JI7A 4DEVA 2P37A 4FLVA 1YQ2A 2BFUS 5KHKA 5GZDA 4AEJA 5K1PA 1O3SA 2BGPA 3BOPA 1DGSA 4ZHQB 1NI8A 2P34A 4JQTA 2B42B 2WLHA 2ET7A 2JX9A 4MVQA 1VQMV 1EM1A 3D6EA 3DXUA 4JI0O 3AZZA 4ZU7A 4IGGA 5A7WB 3WDVA 4ZI7B 3UQ8A 1ULGA 5EYXA 2NMOA 1ZX3A 4X8AA 2YBSA 3PUQA 2DYSC 1I1EA 4XIOA 2BGCA 3VKFC 4DUZB 5EHDA 1ODNA 1ZAUA 3POGA 4YVSB 1E5HA 2DE0X 2UUBB 3CC7V 4XF3A 3L70H 2ZHNA 2BVVA 4NROA 4FPCA 4JYYA 1RUE3 2D3RA 4YVWA 5AC93 2AHZA 1NLQA 2MEV2 3ABKC 1W3XA 4LBKA 1VB2A 4UFMA 1RFYA 3I3MA 5APAA 2MEV3 3PTYA 1D2DA 2XG3A 3WG4A 2YXSA 4X64O 1J1TA 4MW3A 3CQOA 1YNAA 4QQLA 1WA4A 4B3SO 1IXMA 3HIFA 1MNGA 3E5XA 3MV11 4V2WA 2FDIA 2F66C 3ZMOA 2JB4A 3UESA 3THPA 4OUSA 3VZOA 2DVGA 3OG2A 4NIIA 3VDDC 1UX6A 1LENA 4JTOA 1U5YA 2V4AA 1RHI1 1JYNA 2CE4A 4LKFA 1XYPA 2ZDIC 1QJY1 3WW4A 4JI8O 1FS0G 4K0KB 1UY2A 4E9KA 4X62O 1R64A 2HG5C 4YW5A 4YW7A 1N32O 4LITA 2YI9A 1K34A 1WBFA 1Z7S1 1IBKO 3VD4A 2HHHO 1Z5VA 2J1SA 3TYJA 2RJKA 1YXBA 5JR7B 1F23A 1B35A 1VAKA 1W3VA 2YPDA 5DAWA 1XE7A 1Q90D 4XZUG 1H6XA 4K35A 1QJU1 1I94B 1HRV1 1VARA 3IC9A 3P3PA 3EO6A 5EQUA 1S0VA 4NAMA 4K21A 3HNYM 4EYUA 5D8AB 4FIPC 2QQWA 3NJXA 3O1PA 2DCKA 4MGIE 3OT7A 3CCMV 4Q4Y1 3GYDA 2AUYA 4CCLA 3FN9A 2RS52 2OUJA 1WP8A 4W6WA 2QQVA 5IJRA 3J81N 3ZYBA 2GTSA 2PZSA 5FYCA 2IH1C 5JCOC 5AC92 2Y6HA 3MUY1 5FRAA 1RMU3 1QQCA 3LSQA 5FV3A 4Y1UA 3FYEB 4CUCA 4B3RO 1RMU2 2W1SA 4B7KA 4FFHA 1V6OA 1KKCA 1DK1A 3J8F2 3H7JA 4A7KA 2XBO2 3BN6A 4KGGA 4PIZA 3J8F3 5KWRA 3OGGA 3H42B 4RUEA 5D5PA 2RS31 2XLGA 5DAQA 3QOPA 4DFSA 1JYTA 2JEUA 2RE9A 4EN6B 3H8XA 2Y26A 3TBDA 4AFAA 1R1A3 5CADA 1L7QA 1YVWA 2QQJA 4JGZB 1GKBA 3LE0A 4GWNA 3ZXAC 4F8AA 3FX3A 3MDSA 4UV9A 3ZMTA 4P9JA 2XR4A 1OLMA 4Z2WA 5FZ6A 2HLDG 4QKFA 1K3EA 5F3IA 4YW3A 1CIWA 1R082 2AEZA 2VOVA 3NMBA 4XF9A 3CJIC 1EUUA 2HEPA 4YZ3A 3AX4A 1XBFA 4ZIBA 1VQNV 1F5FA 1Q8SA 4B4QA 4FLXA 4PA7A 5H9PA 3C7FA 4PDLA 1QWRA 4X1IB 3K0GA 1FNZA 4H33A 3RYCB 3I59A 1XEQA 3LB9A 3IN9A 5F5QA 5T5LA 3M3QA 4DMIA 3PLQA 4OHZA 4BOWA 2FD8A 3ZCCA 1JHNA 2JEMA 5A3WA 5FQ0A 1W2TA 3U07A 3PMSA 3ST7A 4GH4C 4E2LA 3IB3A 1QDOA 1DG6A 2IFWA 2RJLA 5E88A 1AXZA 3AMQA 3HKBB 1DQ0A 2GC2A 1FPN1 2H94A 1DF4A 4HETA 4L8QA 2R7EB 4G27B 1QKQA 2Z5WA 4Q0QA 4LR4A 2VUAA 2DFCA 4Y1ZA 1Y74B 1AVMA 3K57A 3A21A 3WW1A 5GTIZ 4M4RA 2CNAA 5T50A 4N43C 3LSEA 4ZS3A 3UGFA 2YU1A 1TME1 4Y4RA 5FMCA 3LD8A 5C3PA 2RV9A 2OKXA 3M7AA 3VBSC 2E6VA 1K7DA 1ODMA 2DVBA 5ACA2 3LPGA 4MGSA 5B1OA 3VHNA 5IWAO 4J9ZB 2E3CA 3PJYA 1AR1B 1PPJH 5CBHA 4AILC 1OBNA 1XE0A 4X64B 1VQPV 4MTFA 4D6SA 4M0NA 4QXBA 1RP3B 4WVVA 4KWLA 3JSNA 4BR6A 3KQ4B 1WAZA 2VS0A 2BTVC 4O4IB 2WKKA 3GJBA 1YYNA 4NPLA 1US6A 4MYEA 2EXHA 4Q4V1 1YQCA 1YXWA 1OCRB 1A3KA 1B6QA 5LP6B 2O8OA 5L7OC 4CXXA 3H3UA 5C3QA 3VBFA 2F4LA 5T5OA 1G9FA 3X2QB 3AVSA 4C1XA 3ZHSA 3OBAA 4CUGA 4JZGA 5IJ9A 1JYXA 2LTNA 1L0LH 2RNBA 1HXS2 4LO5B 4RR3C 3ABTA 1NCRB 3WXPA 5FZAA 3MBWA 4OHVA 4K1YA 2JDKA 2WSVA 4JI6O 2X5IA 3IWZA 1LCLA 3JATA 3QF7A 3E2EA 5A3LA 2C9KA 4TV9B 4IETA 1EAH3 2R72A 1AI6A 4FM0A 4UBGA 3DL3A 2NP0A 4FZ0A 3JCIA 3H1WA 1Z0HA 2RG4A 1X4TA 1J95A 3G71V 4UCTA 2RR12 1YIPA 1X50A 4I9QA 5DABA 1UZ0A 1PO21 5I0UA 3RYFB 1XOUA 1I5XA 3FYIB 4JGZC 3LDDA 2ZBJA 3BIWE 3K4AA 3PN1A 2VXJA 5LK5A 4E2SA 2KB1A 1W9TA 4OUEA 4XILA 2P7TC 4BIOA 4M3CE 4AEKA 3JD1A 3POWA 1H4GA 1UNBA 1W6NA 3E22A 2ETNA 2W46A 1RITA 4RQEA 4YY3B 3GHMA 4QKDA 4TV9A 3H50A 4TWKA 4DR7B 2ZX2A 3CRCA 3K4DA 1HNWO 4FZ1A 1HV1A 1GM8A 1XQ8A 4FPHA 1G9AA 1Z78A 5FAXA 5JLVA 3HWJA 4XQDA 3FBMA 3LNNA 5B2GB 3ASNC 3LDBA 1QVFU 4ZOLB 2UXDB 2HWD2 3JD72 1K45A 2JDIG 4QJFB 5BY1A 4MSVA 1ASJ2 3JD73 3BFRA 3S5AA 4I5SA 1FX5A 2A5ZA 4BMEA 4V2VA 4WZFA 4LFCB 2WS93 2H6CA 3RI8A 4MV2A 1UQXA 4LFAO 1PO23 2ZHMA 3RYFA 1NQJA 4RA0A 2WPDG 3GVMA 1UU6A 2QDOA 3BPSA 5EIYB 4COYA 3Q8AA 4HZFA 2R072 1DBNA 4LF5O 1AR93 3H8OA 4OI2A 3MW2A 1OLRA 4ZPIA 1OV9A 3ACLA 3AL6A 2PYLA 5A9GA 2DDUA 4NVPA 1UPIA 1ENQA 3AG2C 1QJX3 5JXHA 1VMHA 3DGTA 2ZE8A 3ETQA 3P6BA 5FYHA 5IVJA 2IXCA 4AVSA 3WDXA 1O7FA 3EMRA 3OJBA 4YNIA 5IDJA 3T4ZA 2WNVC 1R1A1 2RS53 1SETA 3M3IA 1NY71 4NE9A 4JCKA 2DYCA 4CP9B 3JASB 2PQSA 2IJJA 1MEC2 2XLFA 3N3HA 3SH4A 3BCCH 4BB3A 1WA8A 4Q4W3 4XW3A 1OURA 3BPZA 4DIQA 4A6SA 2YIBD 1JU3A 4YPJA 3CRRA 3R65A 4DV6B 5FPXA 2IH3C 4CCOA 1EV11 2AACA 1IPSA 3BEHA 4N43A 1OI6A 1LU1A 1SESA 1RUC1 4IYHA 1TEIA 2V5DA 1E5SA 3NQHA 1H8TB 4QGNA 2KA3A 4ICGA 2LQTA 1XI1A 3K51A 4IV1A 5IE9A 5B1NA 2WSUA 5KC6A 1XL4A 4OX9O 1QJFA 3UT5A 2KG7A 1UY1A 2B9VA 4FO9A 5I93A 2P1BA 1HRI2 1PNFA 1UPGA 5FJKA 4MT8A 5JXGA 2VZUA 1UY0A 4XUTA 4QPGC 1GZ9A 5A7PA 3Q8EA 4BJ0A 3T1YO 2HJIA 4AHZA 3GJAA 1ENSA 1LNSA 2HH9A 2P4VA 2QKAA 5LXTA 3ZLIA 4DR3O 1EAH1 2LW1A 4JASA 1U5IA 3OCPA 3PVBB 3BYWA 1DQ6A 3NL1A 4IW3A 4B3TO 1BQPA 3ZHRA 1PMJX 2R9IA 4A5UB 1H30A 2DV9A 1R3LC 5KA6A 4TTGA 4YZ4A 4RS5C 1RJ7A 1WMFA 4CEYC 2OZ6A 1FOD1 2X5IC 5F6KA 4UOJA 4PLOA 4QE9A 2JB8A 2PTMA 3KV5A 2Q0AA 4JTNA 5J36A 4IE6A 4LIUA 3CSXA 1LTEA 2L6LA 2DVFA 2G9ZA 2YYOA 3E5UA 1UW8A 4QNHB 3CC2V 2IVJA 4AXOA 2DFBA 1KEXA 1MEC1 4C90A 4DW1A 1CX4A 3SDLA 4KMQA 1DGRA 5B66Z 2B1IA 4LBEC 1R1A2 3WU2Z 5JZGA 2GBOA 4XXAA 3CRAA 4O2AB 3P1IA 4R8HA 4DO2A 1OKQA 1BK1A 3ZSJA 1K5MB 4KBBA 3Q4HA 1MZ6A 4PJYA 3PTRB 1V6NA 4JKMA 4P30A 4Q4W1 1RUE2 2K9ZA 2RVAA 1Z7S3 3KLSA 2BWCA 1OUXA 3IFXA 2NM1A 2PQQA 5FLHA 1OHFA 1PX3A 5EYPB 3H01A 3DN7A 5JSPA 3S30A 3ZBHA 1DTOA 4IIJA 4K40A 1LOFA 4UWDA 3ZM8A 2BDRA 4QMAA 2R0HA 3N2KA 2V73A 4MOAA 4LF8O 4X8PA 2WA4A 1WLTA 5EWSA 5FP9A 4JI4B 2N04A 2RDRA 3AZXA 2A3YA 4XQ4A 2CDYA 1ASJ1 1YSCA 3RS6A 5LA0A 3GBGA 1WLEA 4UW4A 2FZ1A 4JHTA 4DV5O 4UFHA 2HWD1 3ZMUA 3VZNA 4XABA 4D6TH 2GNBA 2E26A 3ACIA 4I55A 3RI9A 1OA3A 4CDWB 3IZOA 3J80N 4EN9B 5A1LA 1UY3A 4PLNA 4B3MB 2Q8DA 3DYMA 3DXRB 4WFHA 4GJZA 3RW0A 4NTYA 3MF9A 1R1BA 3P30A 1KQRA 3E8FA 1M9NA 1OJHA 1CP9A 4KXRA 3ZPOA 3SC7X 2UY8A 3NW4A 4LPLA 3M2MA 3AZVA 1SBFA 3B8NA 1CPMA 1ZZ8A 3OEBA 5FXZA 4AVBA 3O0VA 4AK3A 2VUJA 1MR5A 1ZA4A 4YLZA 2E7QA 3ZFFB 2R041 3AG1B 1TAEA 1SDWA 1LEDA 5A33A 2OS2A 4FOQA 1A32A 3IDBB 3PU8A 3LEMA 5K4LA 4UYBA 3PL0A 3H1KH 3MW3A 3ABLC 4UXNA 1ND3A 5A6ZA 4IEQA 2DCYA 5T3NA 4WFFA 5F7UA 4HXCA 4XZPA 1JYIA 3U11A 4IEZA 2QWNB 1KFUL 4H7LA 3IC7A 4ZOLA 1C3HA 2WLMA 1J84A 4KHPO 5EC2C 4YVWB 1Q6IA 4BXFA 5C7GA 1V70A 3CL1A 4FSJA 1PD3A 1OFNA 4ATEA 3BOWA 2A70A 1OVPA 4NTWA 1GOFA 4IEUA 2VM9A 3DC5A 2VW2A 5CISA 4FTSA 1ST8A 3Q8FA 2CHHA 4RS5A 3UETA 5FXXA 4F6RB 1MVEA 5A7WA 4EJRA 4QQOA 4YG6A 1LRHA 4LBJA 4ZZ8A 1M1KW 2L35A 4X8NA 4QX3A 5KUMA 1NAEA 1URXA 4IQPA 4LBQB 2WS92 2BTQB 3MHSC 2VZ1A 2ZGRA 1S1AA 2KKWA 2WLQA 1Y43B 3TN92 3NV4A 3ZN4A 3RZHA 2IUWA 3CP1A 2VQEB 5GLVA 2VZ3A 1D4VB 1ZRIA 1YJLA 2C0ZA 3JYCA 3GCWA 3RZZA 2Y6LA 4DR5B 4JRLA 5FWEA 4U7NA 2B5UA 3OD0A 4LO7A 4DYLA 3NNJA 4Q0PA 2W1QA 5HBAA 4PV1B 5C71A 3T2TA 5KHIA 2JS5A 5LBQA 1O3QA 2ZNJA 3ZYRA 2VMCA 1O5UA 4MLOA 2B1GA 5EIBD 3ZN6B 4A3ZA 2XNDG 3DPRC 2BSKB 3VQYA 1PNKA 5LBBA 1AX1A 3CCUV 1LHWA 4Z1MG 2G1MA 2VD7A 5LMUO 1OD3A 3ZO0B 2AZ5A 2I45A 4IEXA 3A2FA 2JIGA 1ZX5A 2W47A 1G86A 1GBGA 5FZFA 4DOUA 4Z92B 4JI7O 1TME2 2BJSA 4GWJA 1DYOA 1WWYA 1YQ5A 3FLRA 3FKSG 3O0WA 3T1MA 5C4WA 2W52A 1OXCA 2E7AA 1GN2A 4C0BA 4YW6A 4AI0A 3HKDA 2LS6A 3OEAA 4RS5B 3STZC 1PNLA 1QU7A 1YI9A 3LSUA 2IJIA 4GX1A 1GK9A 5FPLA 1APNA 1SBEA 3ZFEA 1JFFB 2DURA 4N9IA 3HKEB 5J1XA 5F2WA 3E35A 2W6IG 3SJQC 3UYJA 5JOZA 1MS0A 1UMZA 2QQMA 1Y9QA 5BR8B 4O9GA 2GH2A 5FIXA 4FQZA 2P3JA 2Y64A 3NNFA 3ZEDA 1IS5A 5H6QA 2CYFA 3ORJA 4E4DX 3GBWA 5BNOB 1CR7A 3SEEA 5EYPA 2ZGOA 1KB9F 3GB7C 4BQ5A 1C8M2 3OFNG 3MW4A 4I0BA 2OIIA 3AG7A 2WRAA 4O65A 5IVYA 2E5LB 1PMHX 4LBOA 1R081 3TGUH 1REDA 2NQYA 1OSGA 3LDKA 2RDSA 4XIKA 4IEWA 2Y69C 1YIJV 3HOBA 4LC1A 1XILA 3FB5C 1W05A 4LFBB 3NAPB 1PHMA 1W8ZA 1S0DA 4RYDA 4MHRA 2JDZA 3HKCB 1NG0A 1XDCA 1ZWIC 3CRMA 3I56V 1S0JA 4GWMA 2WWUA 4UCVA 4ZXEA 2RS32 2ZEZA 3W7XA 5J48A 1TME3 4LLOA 2QA4V 4UF0B 2XBO1 3TNQA 1XXNA 2Y33A 4QX5A 5FZ7A 3ZS8C 4O2BB 4WM8A 4MVSA 4L87A 2WO2A 3M99B 2VNGA 5AC91 5FY7A 3DECA 3L73H 5BNPB 4WVMA 4PBPA 2WO7A 5A7QA 3JASA 4YG3A 3S57A 3ZXJA 2RS51 1A8MA 4GT1A 1H8TC 5CA3A 4Q4Y2 1HB3A 1WZXA 5A3NA 1B09A 5EK0A 5KMGB 2JG9B 2VULA 5C3OA 5K0UB 1B35B 1H9WA 3R4DB 4BWOA 4KHPB 3FZ3A 1NA1B 1QJU2 3CXCU 4G9SB 4ZI7A 3VD7A 5GTHZ 3SNMA 1XNRO 1HRI3 4DUYO 3HKCA 3POYA 1FAFA 1FAYA 1SPPA 3TJTA 4DV3B 2TBVA 3OBTA 3X2QC 3MHZA 3N2GB 2XOMA 3KD4A 2BPA2 2VTXA 1Z7S2 4Q2FA 3LA7A 1LR1A 4K6BA 3VBRC 4FLYA 1OCZC 1W9YA 4OUMA 1Q56A 2E76B 4QQPA 4OPAA 4E2GA 3P3NA 4IEYA 3W21A 2Z5UA 1Y66A 1QJY2 4F6EA 2VPVA 4SBVA 4YW4A 3DXTA 2VW1A 1EUTA 3HN1A 4QX0A 3PJSK 4JGSA 2YC0A 5FK8A 2EIBA 3I3DA 3MFCA 1V54B 3DV8A 4DZGA 3ZOIA 3L2YA 3K48A 3U78A 4XBLA 4XF1A 3W58A 5GZGA 1RJ8A 4HSJA 2QM8A 4MHUA 5CBGA 2EIJC 2ZD9A 1POV1 2WS91 5LEKA 2BTQA 2MEV1 4YWAA 3WF3A 2Q8VA 1CXZB 3SPJA 5F9TA 4CCDA 2HWB2 4Y4YA 4DRRA 3CCLV 5A32B 1G8WA 4YM2A 1V6JA 2JKXA 2FDKA 1PZ7A 4S2DA 4Y1YA 2P06A 5J7MA 4Q4Y3 2V09A 4ATFA 1S5LZ 2EZPA 2PGGA 3SKVA 1NT2B 5JOXA 3BTYA 1GM7A 1F9KA 2PHDA 1LOCA 1H8VA 5JVDB 3SLIA 2ZE7A 2CAVA 5C9AC 4W4KA 1UOBA 3DYPA 3OGRA 5LGTA 1EZVH 4FLWA 2NZ9A 3OMNB 3ETPA 4QE7A 2R49A 2ZKOA 1LGCA 3MIEA 2XWBB 1FXHA 5LY1A 2UU9O 3AKQA 1C8M1 2CV6A 4Y22B 1JS9A 4PA3A 3AB0A 1IBLB 4QPKA 3NNGA 3RN4A 3HQUA 3I97A 3DUIA 1X82A 1SHWB 4XPVA 1C5IA 4DK1A 2R042 1DP0A 2PHFA 2YGLA 5GZCA 1ULEA 2WQ4A 3WD5A 1UIJA 4H2AA 3JATB 1LHOA 1Y3TA 3CMEV 4A4AA 3LZZA 1BHBA 5F3EA 4LF5B 4M4PA 5FZBA 2Y38A 2EIEA 2G9FA 1OA2A 4RFRB 2Z79A 3RG0A 4IEPA 1WPBA 1YJ9V 2XJVA 1EV13 3LCPA 2VMFA 1GNYA 4IL6Z 4X88A 1W0JG 1VQ7V 2EJRA 1ENXA 4CH5A 4C7UA 3FLPA 1Q3EA 2GV9A 1HB2A 3O0XA 2XDVA 3GZUC 3EVKA 1W59A 4QX8A 1UZZA 2R0FA 5C93A 4EQVA 2ZNIA 1I5YA 3T1CA 4AHCA 4WM7C 5FZ0A 2D6LX 1BEV3 2D6NA 2AHYA 2R6QA 3WCSA 1FPN3 2RDQA 3ABMB 1WGPA 1W6PB 4OXSA 3Q8CA 4CU7A 1O3TA 4AQTA 3ZIAG 2OTLV 1JZ2A 2A75A 1FFXB 3VBRB 1GQGA 1IURA 4X9QA 4SLIA 1NTKH 4QX7A 4I3PA 1I5PA 3AYEA 2Y48A 2GDFA 3CU7A 4NHKA 1MZEA 5J2UB 1U12A 2ZS6B 5K0UC 1HJFA 2EXIA 4LUKA 4Q4W2 3DC6A 3TRSB 1Y4MA 4J1XA 5FOBB 1YO8A 2YGMA 5FXWA 4D0QA 3M70A 3J4UH 1N3OA 1Q7YW 4YRDA 3BCWA 4WBBA 1IBMO 2WO3A 1W9WA 2B45X 1PL0A 1O91A 3OF1A 3GXUA 4KGQA 3HKBA 4DV3O 1RUOA 1QGLA 3VQVA 4O4HB 2IXIA 2A6XA 4AGRA 1NA1A 2QDRA 4PDRA 1REEA 2UYBA 2QQUA 1R083 5FMDA 4TUYB 1MG1A 2ZTNA 1CAVB 4OVEA 2LALA 2VMHA 4I02A 4CS2A 4E8CA 3T1HO 2D6PA 2VGDA 1N1VA 1O59A 3KZIZ 1XQNA 2Y6JA 3R4SA 2GALA 1AR4A 2ZDIA 1O6UA 4GB31 4LK6A 2XT9A 1MS3A 1C8M3 2W6JG 2QJVA 4AFBA 1YRZA 1QJZA 2EIGA 5CA1A 1HW5A 2Q73A 3I59B 1A78A 5IFTA 2P2KA 3WQ1A 4M0HA 2CAUA 4ES9A 1NR7A 3ZSEA 4L92A 4P9WA 1MQTB 2VOXA 2WZEA 1GQPA 3HAGA 3WLUA 5EIBC 1MA1A 2ZOEB 2QTSA 2BW8A 5K9YA 1KUQA 4TN7A 1KYOF 4BQWA 3RDIA 4LXLA 1M56C 3HB3B 2D3PA 1JZ4A 2EZOA 3AK3A 1W8UA 4EWEA 1I08A 4R8CA 2EIJB 2XTAA 2A6VA 1LOEA 2C26A 3CD6V 4FM2A 1HR0O 5CIRA 1LHUA 4XJUA 4MVUA 4M00A 3OM3B 2QQPA 2HBTA 1N34O 4FXKB 2QEXV 2V4VA 1SACA 2PUSA 2ZIMA 4NXMO 5LA1A 5C9AB 2YROA 1WN7A 2FL4A 4GCZA 4FCAA 3ASOB 5A2QN 3WB0A 5EJZB 5CBLA 3A0HZ 2AZ0A 5JZGC 1NJIW 4DW0A 3MV01 4HBNA 1D0GA 3VL8A 2ORZA 4K9SA 1OCRC 4TV8B 4J41A 4FQ4A 4PBOA 3ZYPA 2VTFA 1IQAA 2DQ3A 1AR82 3PUIA 5EYYA 4QU2A 1JZ8A 3M8LA 4EN0A 4F4LA 2WLKA 2WZPP 3V64A 4AW7A 2IW5A 2QDNA 4TOIA 5DXDA 1BZWA 5DDJ2 3ZPYA 3VD3A 5H2FZ 3AXDA 4FP3A 1CPYA 4K0KO 1MSWD 4X1KA 5F2SA 1O4YA 4YSFA 1RUE1 1GWKA 3N9NA 4AAXA 3FX7A 3E8GA 1ND2B 3CCEV 1W6QA 1M90W 2F6BA 4DY5A 2G38A 2HHHB 2ZKNA 3OUHA 2HEVF 2MNGA 3ZMSA 4URTA 1RUC3 3MF6A 5BMVB 2UXBO 2JXAA 2ZHLA 2TUNA 4ASUG 5DDJ1 1TUEB 2R071 4GH4A 2BTOA 1QXPA 1VF6C 3SJBC 1TNFA 3ZSKA 3I2KA 4YVSC 3ZVXA 2Y6FA 4JDMA 4FPKA 4JI2B 1CIYA 2X53S 5BZBA 1CESA 5CFDC 1MPXA 2UUBO 4HLTA 5FYMA 1FOD2 5J2TB 4QX1A 5JVVA 2X8KA 5FZ3A 2RN9A 3HT1A 4BZ4A 1QCEA 4FPEA 3VBOA 1PMIA 1V0AA 3NNMA 3SMHA 2NNUA 4HNAB 3BA9A 4CP9A 3TEWA 4E4EA 2C1FA 2WT1A 4DV2B 3VBSA 3EBRA 1CWPA 5FPOA 2AC1A 3NXSA 3W5NA 1BZKA 1ZLZA 1EAH2 1GANA 3E83A 2HWC2 2Q1ZB 4GH4B 2UXDO 1FD9A 1X59A 5C8WA 4CEWC 1YCIA 2QQKA 5C33A 5F5CA 1S0EA 2EALA 1JPXA 1JZ7A 3Q8BA 1GMGA 1RXFA 1D5NA 4FFBB 2ZR3A 1HRI1 2VBBA 1KKDA 2ADQB 1BKZA 4ZKIA 1XB9A 3IT8A 2BEOA 3TNPB 3ZMVA 3ZXGA 4OZOA 4AZZA 2XVGA 2WLIA 4NPMA 3UO3A 2B8MA 2D3SA 4CS4A 2JVDA 3LNMB 5FP7A 4TZDA 5ACA3 1RUC2 1H2NA 4X1YA 1XHXA 1IKPA 3APOA 4GZ9A 2CUGA 4GB32 3GZAA 5C3RA 1EV12 3N7JA 2HKXA 3RWRD 1POV0 4MGZE 2RHPA 5GLWA 2X6BA 2WNVA 5DAVA 4IHJA 3M8AA 1H1IA 1UYXA 3HVDA 5BV6A 5D8AA 3UNPA 5LGUA 4MZUA 1ZZ9A 2GNDA 3ES1A 1ULOA 4ISQA 1DLBA 1NY72 1UL9A 3EB7A 3HKDB 4GZRB 4R4XA 2QKSA 2Q69A 4I55B 4BQ2A 3H1YA 1WCSA 4WF9V 3VUOA 4P00B 3B02A 5B5EZ 1KJLA 3SHRA 4LULA 1UO9A 5E8AA 4XC9A 2W1WA 3SYCA 3V0AA 4Z82A 4YIOA 3P32A 1VMGA 1UWWA 2IJKA 2V1DA 2VWJA 4ORFA 3D0SA 5FPAA 3ABZA 3RVZA 2QGNA 1MEC3 3H9AA 1G4YB 1QXRA 4PELA 3HBKA 2UUAO 2EF6A 5I0RA 4JF3A 3J9SA 3I2OA 3OSDA 3K5MA 4LF6B 4DRXA 1C5HA 1YIFA 1RHI3 3AEIA 2EVXA 3ZYJB 4CS3A 5LP6C 2F43G 4AFMA 1ZRDA 4YGBA 1RYYA 2V7QG 4UUJC 5ACA1 3LEGA 5FNVA 1OCZB 4M3CB 4CU6A 1S72V 3UGGA 1W0PA 1UU5A 1W2BU 1GQHA 2Z0AA 2QTOA 3N7LA 2CTWA 1WJZA 4OULA 5AG2A 1AI7A 5J9PC 3JD71 5HCFA 1KU9A 4AQYB 4AWDA 4JGYA 1DFQA 3WP5A 1CZTA 2JRIA 1I3HA 1NKGA 1JMUB 1KECA 3KGZA 4MG2A 2CTRA 2F4VO 2JGDB 2YC4A 1GICA 5CB7A 1W03A 1KJRA 1UKRA 3LFIA 4UCUA 3K46A 1JHJA 4XJWA 1JYVA 2VE1A 2XJPA 4JRAA 1C1FA 3W9AA 1QEXA 1XHZA 4EROA 4GQ7A 2VZQA 3POIA 1QLNA 2GN7A 4RHV3 5KAIZ 2GC3A 2VQFO 5IY5C 2V5YA 2AH2A 1EZJA 5E89A 1XMOB 3RFRA 3ZIWA 2I74A 4QPJA 3SQOA 2ZE6A 4IE4A 3PURA 1AJPA 2YBKA 4N7IA 3E5QA 4A41A 1UN1A 3JAMN 5ABJC 1PO22 3FHAA 3POEA 1NS1A 1V55B 1NH2B 2GN3A 1SFNA 2XB6C 5C5TA 4AYUA 3JCZA 5CNAA 1VF6A 5KA5A 1VBB3 3RNSA 1CAWB 4BU2A 4NIHA 1UMHA 1C57A 3ABLB 2EXKA 1R3JC 3H3LA 3LDRA 1RXGA 3ZN1A 3BB6A 2N74A 2XWJB 2W68A 5H9QA 2Q68A 3AFKA 1H2SB 2W5FA 1NX9A 2VCMA 3A4UA 2HWB1 3C3TA 3VBOC 4XDJA 2Q4PA 4XFBA 4EB6B 3THCA 5FYSA 4HN0A 3UO2A 3E89A 2KR2A 2LFSA 3ZJZA 4K3AA 5ANNA 2VZPA 5BUVA 3MIFA 1E57A 5L9BA 2YIDA 2VMIA 4Q4V2 1GTOA 1DDLA 3CEIA 1WCKA 4QGLA 1XMQB 2X29A 4AL9A 3WNOA 1GP6A 3F5WC 5IK7A 4IUGA 1OF3A 1SS3A 1F4HA 5G05L 1RC6A 3WDUA 3HMYA 5GALA 4DINB 4YW1A 3B40A 1PVC3 4N53B 4GXLA 2Y6GA 1MMMA 5SV5A 4LBMA 2Q5TA 4IGOA 4H37A 3QTCA 1H8EG 2C2AA 5EV7A 4OI1A 3KV4A 2WLIB 5FZEA 1TA8A 2ZZJA 3UCSC 5LGNA 3OTOB 5FZOB 3VZMA 4U7OA 4O2AA 3VD9A 2CGNA 4WFEA 2OPKA 2KQXA 5BXXA 3DKQA 1JZ6A 1W6QB 2QUOA 4HANA 1OD5A 3OD4A 1GOHA 3K0DA 2P17A 5JVDA 4CU9A 3OPTA 4OGQB 4XUQA 1VP7A 2W92A 5LYJA 3SITA 2VVFA 3ASOC 2QE7G 2D97A 1FPN2 2IXLA 4PHZA 2WZ8A 4B3RB 3ZXDA 4UFJA 1D2SA 2KSDA 4AEDC 5LA6B 3KG2A 5FY5A 2YUEA 4KG8A 2QZ3A 3H8RA 4B7EA 5FY4A 2VR4A 5IWFA 3I3EA 2P3YA 4WBNA 1BS3A 5IT9N 1GWMA 2Y69B 2ZXWC 1GWLA 3NJYA 5B4XA 3ROUA 1CJPA 4JTDB 3BKZA 2WL1A 4LHKA 4P9IA 3ZX7A 2QWRB 5C8CA 2DJVA 2Q6AA 1N32B 2WWWA 1UKGA 2OT7A 3M3OA 3N9OA 3MHHC 1MQTC 4MVTA 2BZDA 4X1IA 4HSLA 4YM0A 3ME2A 4F83A 4LWSB 4NIGA 3ACGA 4D3WA 3KS7A 4CH4A 4N90A 2B9UA 1JVMA 1OH3A 5LXTB 3TXQA 2D5HA 1OLME 4BQ3A 4CC5A 2ZGTA 3O1MA 1NZ6A 1CQ9A 1KS5A 2VTXJ 2J42A 4KNCA 5CKMA 2JD4A 3EFFK 2R30A 4FTBA 4X66O 3O1VA 2LO1A 1Q8PA 4XCBA 3JD2A 1VQOV 1DGRN 4FFIA 1RMU1 4QWNA 1RSOB 1WB7A 3G4SV 4LCUC 5HFLA 4KH9A 2ETEA 3SPCA 2YG0A 5F2VO 5M0TA 1PGL2 4GD4A 2VAUA 1SLAA 3RZLA 2PAKA 3AYDA 4QQHA 4ET7A 4QXCA 1NXD1 4V1PA 4A3XA 3B7MA 1TMF3 1PP9H 1ZSPA 2AR6A 1J5EB 3WNNA 3HKEA 1QQP1 4B3NA 4URAA 1Y9MA 1QNYA 3V56A 1HRV2 5FZ8A 4JI3O 1W6OA 4KWKA 3W7WA 2H0VA 3H1HH 1WKYA 4TUYA 2Q7GA 1VRBA 3F5TA 4DXZA 2VMGA 3ZDSA 1SBDA 3ITQA 2XJQA 4NIAA 2QQLA 1HB1A 4MGKE 4ZY9A 2IFRA 4Z8BA 3CYOA 1F7YA 4XBNA 2HWE3 1X7NA 1JOJA 3OY8A 1YEWA 3T2PA 4P9LA 3TWIA 5DAPA 3GDBA 2EAKA 1XYNA 5D5QA 4PDWB 3W7TA 2BE3A 2ZXWB 1KGYA 3ZFGB 1SLTA 1JUIA 3T1HB 2NPIA 3K3NA 4QPWA 1N0NA 4JQRA 4XCAA 3KCYA 3FHQA 2EXJA 2AGSA 1XSQA 3AG4C 1H6YA 3W7UA 3N7MA 1W0KG 1AR83 4FAHA 2X05A 4Q8KA 1ZZ7A 3TN91 1ROPA 4IYIA 3D5OA 1STMA 5LBEA 5EC1C 2GP5A 5JXIA 2RDCA 3WCRA 4YGCA 3TAYA 2ENRA 4E4SA 2OZJA 1XNKA 1OCOB 3DXRA 3J7LA 1AYM3 2GDSA 4AEDA 2QBXA 4NWVA 5FREA 1PO13 1DZQA 1NH2D 4YVWC 4QPYA 1SA0B 3RYPA 4JTAB 3OY8B 4FPGA 4WFAV 1H4HA 2A7WA 2Z3YA 4NR1A 4Y24A 4UB8Z 2HYXA 3BODA 1K73W 3LAGA 4WFBV 1QVGU 3K79A 5CB4B 1Q5OA 2ORXA 3EXUA 3S0MA 3RYIB 2XJRA 2YSUB 1R3IC 1TUBA 2SLIA 5A3PA 4YM1A 1Y67A 1W99A 4NRQA 2N7GA 1DZTA 1W6OB 1M4UA 1N1YA 3DPRA 1UFIA 1US3A 1KS4A 2JIJA 4B08A 4YFZA 4NXMB 3WFVA 5KHGA 3VDDA 2PF4E 3E8BA 4BMBA 1V00A 1V6KA 4DV1B 1TQ5A 1JZ3A 1JODA 3S7EA 2R32A 3ALQA 4J7JA 5FYBA 2R073 2NYYA 2JS3A 2WNEA 1V6LA 2J1EA 2YFZA 4XUOA 4O61A 2P22C 2P5OA 1N3QA 3CJHB 5DECA 2D7FA 4M3CA 2A73B 4XFCA 3C2UA 4BK4A 4CCEA 5L73A 1K92A 4JI5O 4YFWA 3ZRVA 1V9U3 1POQA 1NCRC 2YDEA 3WNPA 2CGPA 4DR2B 1W8FA 3CLPA 4WFGA 3CCVV 4OZXA 3O12A 2W95A 3VKNA 4EN8B 5TSWA 2RS33 4YZ1A 1H2GA 3DCQA 4DV4B 4LBQA 1LECA 5L3FA 2XAHA 3I2GA 3E97A 2YU2A 1OQ1A 2JG8A 3M7MX 4NWWA 1TVKB 4LNUA 3GALA 4I01A 1P8JA 3EHKA 4AI8A 3GGLA 2MPFA 1OUSA 3I2JA 4X65B 1GSLA 1BT8A 1SEFA 3I55V 4KQ7A 1AROP 2NMNA 2RDNA 3LF7A 4JV5B 4P2ZA 2V72A 3RQ0A 5FL7G 4DR4B 2AYHA 2UXCB 4O2BA 3SJCC 3BALA 3B4SA 5C9AA 2EIKB 3AP4A 1N36B 5GJ6A 1G1XB 5C8YA 1VBD1 1S0GA 1LJ7A 4HK9A 2OYZA 3FBYA 1AVBA 4QHZA 1FXKC 1KD1W 4DR6O 1MOFA 4TQDA 3WHTA 1XNBA 3AVRA 2XVKA 1BBT2 4BW5A 1GU3A 1I9RA 3OR7C 1ZZCA 3SR2C 2WJSA 5FO9B 2X0LA 5CFDA 1WA6X 1UU4A 1SQQH 2WLPA 1W04A 2EAAA 3WUCA 2ADDA 2QSAA 4D6RA 1UF2C 1Q8OA 1YFUA 5JH7A 4KL1A 2JJ6A 4MADA 4EFBA 2YS8A 2BBAA 4RAIA 1VIBA 3WQ7A 2O8QA 3T4HB 2LJ2A 5FYTA 1MVQA 3HEIA 1VQLV 4GJYA 4ONUA 4D69A 2XVLA 4F3JA 1X8EA 2VOKA 4M01A 1P49A 5DQ0A 1AXKA 2R1BA 4QDQA 3VBFB 3NV3A 3DTUB 5B3SC 3TEXA 2ZMNA 5FPUA 1ZA7A 4K8ZA 1AUYA 1RINA 5LB6A 4Q27A 2YIAA 1ZUQA 5J2TA 4LE4A 1XU2A 2QJ1A 5JIAA 4JYAO 1NQTA 3FB7C 3O65A 3R4UA 4NHLA 4S2GA 5JXJA 2Y4UA 2ARCA 4JVAA 2F4VB 2HLEA 1PVC1 4EN7B 3AFGA 4AI3A 3BVCA 4IV3B 2P5BA 3L2HA 1JOBA 2XUEA 1N4CA 1SDDB 1PIV1 4AOCA 1TVKA 4LNUB 4JDOA 2B46X 4L11A 1LKNA 4Q1RA 1WLCA 2D2CB 2VU9A 3LSDA 3K5NA 4I09A 3WQ0A 1LESA 3VQXA 3WG7C 2Y6KA 4RN5A 4LFBO 4QHBA 2BV4A 5IAVA 2DOSA 1ND3C 3H7YA 3ASIA 3B9CA 1UXXX 2WZR1 2ARXA 1U5XA 3U4SA 1RUG3 2FTKA 1JJ2U 1K97A 3MICA 3A23A 4HN1A 5T5JA 4Q1PA 1VE0A 3KCCA 3ZYHA 1DQ5A 1WP7A 3OEHG 2L9LA