3OTFA

Structural basis for the camp-dependent gating in human hcn4 channel
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
197
structure length
197
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the cAMP-dependent gating in the human HCN4 channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 61
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2010-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3otfA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3otfA02
4QM9A 4EWEA 3I54A 1UIKA 3CO2A 3PLQA 3FFQA 3IWZA 3O14A 3UKNA 1QY4A 3WW1A 1FI2A 2BNOA 4KL1A 5T3NA 3RYKA 5I8SA 2UYAA 2IXLA 2VQAA 1OI6A 4XF9A 3D82A 4FAHA 3U0ZA 5FDBA 3LZZA 4AXOA 2IXCA 4WBBA 2GC1A 1UD1A 4X6QB 1ZZ7A 2ATFA 2PAMA 5E1RA 5J48A 2C0ZA 2QJVA 3FJSA 4YNIA 2MPFA 4HBNA 5EFUA 1EPZA 3KMHA 4A2UA 1CX4A 4LA2A 1VR3A 4HVQA 1OD5A 1CAUA 4XEZA 2Q0AA 1ZX5A 3BU7A 4EWDA 2K9ZA 5KHHA 4D7TA 2B9UA 2EVXA 4XFFA 3RNSA 3ES1A 4I0AA 3H1YA 2EAAA 3IDCB 5I0UA 3H3UA 3ROUA 1J3RA 1LRHA 1XE7A 4E2SA 5I91A 3BALA 1X8MA 4AVCA 5I93A 2D93A 2VPVA 4AQ2A 4META 3I59A 5KHKA 4XFCA 2MHFA 1Y9QA 3I7DA 1J1LA 3E97A 1ZZCA 2XKPA 3I59B 2IXJA 5FCCA 1UIJA 4IEUA 5J7MA 1DGWA 4ONUA 2WC2A 5BUVA 3R6SA 1O5LA 2GZWA 5I0TA 4Q0SA 4XF1A 2QNKA 2PAKA 5FLHA 4E2QA 4ORFA 2QCSB 1IPJA 2PAEA 3VHRA 3QOPA 2VECA 4QGLA 4MV2A 1LB2A 1G6NA 4XF4A 3S0MA 3E5XA 3MYXA 3H9AA 3HIFA 1QWRA 4ZU4A 3B02A 2HJIA 4IEQA 1O5UA 1ZZ6A 2ZKLA 1YLLA 3CLPA 4MZUA 4O9EA 5LEJA 3BCWA 3U10A 3N4MA 3NSTA 4PIXA 2OPKA 3HT2A 4AVBA 2GAUA 4X6RB 1O7FA 4L11A 3USSA 5JSRA 1U12A 4Z07A 2EA7A 3ST7A 3H7YA 2Q1ZB 1OMIA 4JTNA 2BEOA 2XLFA 1FT9A 3CF6E 2XHKA 4PIYA 4OLLA 3EJKA 4OFGA 1ZRCA 4XFHA 4JTOA 2OZ6A 3NKTA 4ZU7A 4HSJA 4O9GA 1QXRA 4YSFA 4HN0A 1CAWA 2UY9A 3MDPA 2V09A 4YRDA 5KHIA 4XF3A 3QACA 1ZRDA 3SCFA 1IPKA 1I5ZA 3DN7A 1WA4A 1GQHA 2GC3A 1YFUA 3MZHA 1VJ2A 2PA7A 3RDIA 1CAVB 2IC1A 4LUKA 3ZDSA 1YFXA 2QDRA 1ZRRA 5CVRA 1SEFA 3LAGA 1CAVA 2XGXA 5LRRA 5CADA 4FT8A 1Y3TA 4EROA 2B8MA 4BHPA 2PQQA 1RC6A 3DKWA 4HSLA 4IEXA 2IXKA 3WW4A 1XRUA 1DZRA 2BNMA 1O3RA 1VP6A 3TNQA 4FAGA 3L2HA 5FLIA 5EZWA 2E9QA 4HN1A 4MGYE 5CU1A 3FE5A 3H1WA 1LKNA 1WGPA 2H6BA 4HLTA 4WZCA 1RUOA 1L3JA 4HMZA 1NXMA 2XLAA 4MGIE 3JZVA 5J3UA 3MPBA 1SFNA 1EP0A 4I0BA 1QXJA 3E6DA 2BYVE 3OGJA 3D0JA 3KCCA 2FMYA 4IEOA 2Q30A 4IEZA 4XFAA 3EHKA 4N9HA 1NE4A 2Q4SA 4XFIA 2I45A 4IEVA 3CJXA 2XLGA 4PJYA 4XETA 2ET7A 3EO6A 4I09A 3GBFA 1LR5A 3KSCA 1NYWA 4MGZE 1J59A 3LA7A 3NW4A 3CL1A 2N7GA 2PHDA 4HZFA 3U11A 1YFWA 1FXZA 3E6CC 1TQ5A 3H8UA 3OTFA 2PTMA 4IEPA 3RPQA 4XFGA 4HVOA 3DL3A 1UW8A 2F4PA 1H1MA 2KXLA 1V70A 3H50A 1X82A 1RGSA 1I6XA 4IEYA 3OF1A 3IIAA 4KWKA 3CEWA 2P17A 4J1XA 4B29A 4QGMA 3WW3A 4LLOA 4BH9A 5LRSA 2FQPA 2DCTA 4CYDA 1OFNA 2GC2A 3RYPA 2GH2A 3PNAA 1J3PA 2UYBA 1ZVFA 2O1QA 3KGLA 4KU8A 5LEKA 1O3QA 2XL7A 1WLTA 2XL9A 2XKOA 2OZJA 1CAUB 4R8HA 3DV8A 4MGKE 5E16A 3LOIA 1CAWB 5FQ0A 3EBRA 1J58A 1YWKA 5I8TA 5JR7B 4LULA 3OCPA 4FBFA 4Q0UA 3S7EA 1DGRA 5BPXA 3NL1A 4MUVA 4QGNA 4QM8A 3RZZA 4UXAA 4LUMA 1GQGA 4ZU5A 4BYYA 1RL3A 5KBFA 4GULA 3H7JA 5K8SA 1EY2A 1ZRFA 3ES4A 1O3SA 2OA2A 3NVCA 3S7IA 4I01A 3FZ3A 4L2NA 3UKTA 3SXWA 1O4TA 4QMAA 2K0GA 3H1MA 1YFYA 5AVPA 5I0RA 1CAXA 4R52A 4I02A 4QX5A 1Q43A 5C6CA 1X8EA 2D5FA 3WW2A 2CGPA 3SHRA 4D7SA 4TLFA 4AQ6A 4AVAA 4E2GA 2Z2SB 4F8AA 2BNNA 2H0VA 2Z69A 4H7LA 5FLJA 5JSPA 4WVZA 4KU7A 4IEWA 1Q3EA 4BIFA 4YARA 3LA3A 2CAVA 3BB6A 3E5UA 4Q0VA 5FPXA 5KHJA 1X7NA 4XFBA 3UKVA 3LA2A 1UCXA 2CAUA 5F1RA 3RYRA 4XF0A 4Z82A 1O3TA 4EV0A 4YYOA 4LTAA 5BXXA 5KHGA 2ET1A 3GYDA 4IETA 1YHFA 3HQXA 1HW5A 3ACLA 1J3QA 2B5HA 4EWAA 2CV6A 2D40A 4IESA 1NE6A 3ELNA 1ZNPA 4IERA 3G7DA 2UY8A 1XE8A 3OD0A 4LEJA 4MH0E 1YUDA 2PYTA 4NVPA 4N9IA 3C3VA 1RUNA 3FWEA 5BV6A 3D0SA 4KWLA 3BPZA 4Q0QA 1CAXB 4UBGA 3M3IA 4P9GA 3H3ZA 1ZZ9A 4LA3A 1Q5OA 1EYBA 1RTVA 1PM7A 1CGPA 3LWCA 1DZTA 2IXIA 3SCGA 1JUHA 2PHLA 4RD7A 3IDBB 3IBMA 3PVBB 4QXKA 2GU9A 4F7ZA 2H6CA 3ETQA 3E5QA 4I2OA 2D5HA 2ZCWA 5I0SA 4Q0PA 4HVRA 1ZZ8A 5JAXA 5C8WA 5D1IA 4I3PA 2Y0OA 2HKXA 2ETEA 4K8FA 2OYZA 5I8YA 4PIZA 3EQEA 1H1IA 4UBHA 2IXHA 3HT1A 2GC0A 1SQ4A 4J1WA 2O8QA 3SCHA 3NJZA 2WFPA 5JSOA 4Q29A 4JVAA 3E6BA 2QVSB 3KGZA 2MNGA 5FPZA 1ZREA 5FQ0B 3FX3A 4MX3A 1PMIA 2BGCA 3FHIB 4KWJA 3TNPB 3SMHA 5JCTA 1ZZBA 4DINB 2PFWA 5BY5A 4JV4A 1NZCA 5HI0A 1UPIA 3M70A
chains in the Genus database with same CATH superfamily
1I94O 1OH3A 1BEV1 4UCOA 1WA6X 5T3NA 1FJGB 4B3NA 3MBWA 1PL0A 4BQ3A 5CA1A 2W1SA 5IK5A 4XILA 3ZKYA 4WM7B 1AJPA 1GR3A 4X64O 3JBG1 4Q4V1 1VRH2 4XJAA 5H6QA 1NH2D 2OYQA 1NR7A 1K8AW 3SEPA 5GZDA 2YB7A 1W6MB 4GLXA 1VQKV 3Q8EA 4UYBA 1W99A 3W21A 2R72A 4XEZA 2Q0AA 3BU7A 1QBZA 3FAVB 1S0IA 1LHUA 3N35A 1TZOA 4HANA 1K5MC 3IDCB 3ZSMA 3ORJA 1BGYH 2WA4A 3I59A 4R7CA 4DMIA 5KMGB 5D2AA 5L3DA 1JMUB 2EILC 1QU7A 1AROP 4RHV3 4YZ5A 3B7MA 4N90A 4FLWA 2GZWA 5I0TA 1HNZB 1RPRA 3ZFFB 4WFGA 4CS3A 1WN7A 3QOPA 2HG5C 4XF4A 1H6XA 5T5JA 3UNPA 2IJIA 1CPMA 2XB6C 3CLPA 5F2WA 5K1PA 1STMA 4YVSA 5AC91 4BR6A 3A8TA 2WR9A 4PD4F 1YI2V 3NNFA 4UXNA 2XHKA 3OBRA 2YBSA 4XFHA 3V0AB 2V09A 5EZYA 4IV3B 3IKWA 4YVWC 1VBD3 3SLIA 1WA4A 5E8AA 2WSVA 2WNUA 1CX1A 4TYSA 1YITV 3GHMA 3O7OA 1JVMA 4Y20A 1R1A1 2BBVA 2CUGA 2PELA 3FB8C 3KT4A 3T4DA 3AK3A 2ZAHA 2ORZA 3ZFEA 3H8RA 5A70A 3TNQA 5FY0A 4LT5A 1PK6A 2VH9A 5FLIA 4EB6B 2LJ2A 3LSQA 4HN1A 5HV0A 3ETGA 5T5OA 1UU4A 2QA4V 1E1RG 1K3EA 3R4DB 1L3JA 2MEV3 3O1PA 4R9CA 1BVP1 3VHNA 5FZ8A 2Q30A 4IEZA 4IYIA 4XJUA 1OQDA 3N36A 5ISLA 3ZXEA 3AMQA 3ZMVA 1UY1A 5IYCO 1AR62 4J42A 4MSWC 4P9OA 3GWOA 4PCRA 3BKZA 3BA8A 3GF6A 1Y9GA 1S1AA 2X29A 2BSKA 4XFGA 2KXLA 2VQFB 4XDKA 1WCKA 4PQQA 2JICA 2Q6AA 5LK7B 1AYN3 5FYSA 4Q4Y3 2HWF2 4UI9L 5CKMA 1VQ7V 2DCTA 3CC2V 3CRQA 3CKHA 3O0VA 4QKNA 2F4VB 3APOA 5E16A 4NMIA 4IV1A 3Q8CA 2PY5A 4RHV2 4YY3O 5G05L 1K45A 3JBG2 5GJ6A 3BHPA 5FMDA 4GULA 1HLCA 1ZRFA 2P3YA 1FOD3 3ZRWA 5B1BB 1Z7S1 3CCQV 5T54A 4KGGA 5BNOB 4R52A 2CDOA 1H0BA 1FXKA 2W1UA 4PLMA 3I2KA 4BWOA 2Q8OA 2DDUA 3K46A 1IG3A 4ZHQB 3Q4HA 1SFYA 2WA3A 5JSPA 4CCMA 2QKAA 3ABLB 1W04A 1G9AA 1OA2A 1U5IA 1CVNA 1MPXA 2GDSA 1VBB3 2ZEZA 2RHPA 1V0AA 5F8PA 2XBO1 3SPJA 5F1RA 2EIMB 2WT0A 4HPKB 2WFF3 1PO21 3FD9A 4TXWA 4Q1PA 3SISA 3I3DA 5IVCA 2ODMA 3ZSJA 2E31A 5APAA 3R4SA 2PF4E 4YVWA 4ZS3A 2RDQA 3C3VA 5LA6A 3TCUA 2XUMA 3FB6C 5K0UB 1FPN1 5CBHA 4Q0QA 1OLQA 2R043 1PV0A 2L9LA 2E75B 4XUPA 2AEZA 1LUVA 4DR5O 4RA0A 4BXFA 4SBVA 4UW3A 1JUHA 4DNYA 4NPRA 2Q67A 3KHBA 1M1KW 4CXYA 4OZXA 1E1QG 1HXS3 5C8YA 3SJAC 1LNSA 5C8WA 2Y0OA 1XOUA 4JKLA 4COUA 1MSDA 4AEDA 3T1LA 2C9KA 1R64A 5HFLA 1UAIA 1W8UA 1H8EG 1PGL2 3MIHA 4JVAA 5CFDA 4JQTA 4LO4B 3THDA 4TV9B 1H2LA 1C3HA 1O59A 2VMCA 1RUF2 2VXRA 3DECA 5KX5A 3SYOA 2W6JG 2ZHNA 4K35A 2YEVB 1V9U2 2BSKB 3FFQA 3B4SA 1GICA 2V4AA 2I2SA 3WW1A 5FP4A 4XBLA 2UYAA 3K77A 3ZRSA 3JUUA 4TV8B 5FDBA 3HPLC 5IWFA 1HKDA 5FP3A 3ZMUA 2PAMA 2GP3A 5J48A 2QTSA 1FOD2 1GZWA 1SZBA 3QH7A 1VAKA 2VMEA 4GH4A 2IVJA 3U07A 1OD5A 4LFCB 3R0RA 2OKXA 4O4JB 1PGW2 1UXXX 2EIEA 1WA8A 4JGZA 1NG0A 2EIKC 4E2SA 4O4HA 3MIGA 5FNVA 1JQ0A 4AI0A 4CCOA 4Y4YA 2MHFA 5KXEA 5FCCA 4IHJA 1DHKB 3ZYPA 3C7FA 4ONUA 3B2EE 1LHVA 5JJNB 2BRTA 4Q0SA 4XF1A 2A75A 2EF6A 3G6BA 2VECA 1CP9A 3OPZA 1DGLA 4HONA 2ZKLA 3CQOA 4UUJC 1ENQA 4TUYB 2OPKA 3JD0A 4QPWA 3AVRA 2ADDA 1QVFU 2Q1ZB 4TOIA 4LC1A 3CCLV 3HNBM 3T2TA 2ZS6B 3GCXA 4FLYA 4ZU7A 1DQ5A 4O9GA 4JGYB 4LF9O 3ZLIA 2NP0A 1XDCA 1YFUA 3P32A 2D6LX 1VMGA 3ZDSA 2QWOB 1XNRB 1A8MA 2GHYA 4FT8A 4ET7A 1BXHA 4ASLA 3LDCA 1CR7A 1C5IA 3U4XA 5A7OA 4LBLA 1AXKA 2YC2A 5FYTA 4B3SO 4U3FH 1XNRO 4LKEA 2DUPA 3CMEV 1LKNA 4DUWA 2H6BA 4P02B 4HMZA 4DY5A 3SKJE 2XJSA 4RGKA 3ASNC 3UO2A 3JALA 1UYXA 4MXWB 2HWF1 1W0OA 3Q8BA 4EN0A 2LRPA 1KJLA 1Q86W 5DQ0A 3VKLA 5ABJA 3T30A 1W28A 3CCSV 1EAH2 4CTEA 3K06A 1FYUA 3HWJA 3MAQA 2JDZA 4BA6A 2EULA 5CIRA 3AG2C 1I6XA 4YZ3A 5L7OA 4OCTA 3H01A 2DURA 1GRJA 4AW7A 3N2GB 4LLOA 3I49A 2UXCO 4FJCC 1WZXA 1J3PA 1RUD3 3KGLA 3O0XA 4UW4A 2HHHO 2WNEA 2X6BA 5FO8B 3A7QA 1OCCC 3OCPA 5JVDB 4QX7A 1IHMA 5FWEA 5HCHA 5KBFA 5K8SA 2XAHA 3ES4A 2XXZA 2OA2A 3NVCA 1SBDA 4BOWA 1Y4MA 1OQEA 2XAQA 5BNPB 3H1MA 4BE3A 2LW7A 2R7EB 3RJRA 3TGUH 3O12A 2JECA 5EJZB 4NXMB 2Q69A 4UAPA 4NIIA 2D5FA 4XIKA 1SLTA 3VBOB 5F3GA 1BEV3 5FR3A 2DTWA 4RQFA 4H7LA 4WVZA 2IFWA 1SQVH 1Y76A 1IBMB 3M3OA 4M4RA 4JDOA 4WVMA 4LF4B 2P6JA 1LNQA 3VL8A 2R16A 1ZL8B 3K58A 5A1AA 2YZ4A 4DXTA 4EV0A 4XW3A 1HB3A 3HBZA 2BZDA 4LBQA 1LGCA 5JI7A 4IERA 1GTOA 3BVOA 3CP1A 1RHI3 3LEIA 4X64B 2HKOA 3D0SA 1OVPA 1RUJ2 4UBGA 1NOVA 4Q8KA 2X0LA 2PXJA 3PTRB 1W0NA 3BUCA 3VZNA 3MV11 3APQA 4JI8O 4P5YA 2BW8A 3DYMA 1SMVA 1MVEA 4DXWA 2ZGQA 2ZCWA 3SPGA 5JZGC 2EX3A 1N47A 3NQHA 2XR4A 4I3PA 1CD3G 1QF3A 3A0KA 4PQ9A 1M57C 4X88A 3JB4C 1XE0A 3THTA 3AMMA 4AWDA 1SQ4A 2O8QA 3ZRXA 2AREA 3OBAA 1R093 4QB6A 4FFBB 1Q90D 4DV0O 3G4SV 1EV11 4FSJA 5E89A 1K5JA 4DINB 4UCRA 4QX1A 4PDWB 1H38A 3OR7C 2E32A 1OCOC 4X8AA 3INAA 2EIBA 5JH7A 1ZWIC 1B06A 2B4KA 3LNNA 5L36A 4WBNB 3OTOB 4X62B 4P2ZA 1K12A 4XUTA 2DW4A 2P67A 4QPJA 1JYVA 1YJWV 3U0ZA 3ZHTA 1RHI1 2HFEC 2ATFA 3J8F2 1NA1B 4PDMA 4JI6O 1CESA 1M4UA 1VF7A 5J9PC 1UN1A 2LM3A 3KKYA 4GH4B 3G80A 4DR3O 4CDWC 5LHIA 1QJFA 4M3CB 3OMNB 2UWBA 5DPNA 4JI6B 2QGNA 2NMNA 5FOJB 3SPIA 1U97A 5EC1C 2CTVA 5J7MA 1US6A 1IX9A 4RR3B 5FLHA 4HNAB 1ULDA 4AHZA 3ZFGB 1Q6UA 1VQ6V 2CGNA 4CDQB 4MV2A 2UUAO 2XG3A 4D3WA 2RS32 1GQPA 4IEQA 4GKJO 4QAWA 4DW0A 3AP6A 3F5TA 5EXOA 1DF5A 1NKDA 3URFA 4RQEA 1Q81W 1GNYA 3UK9A 4AYUA 1UYZA 1RUD1 4C90A 1K4DC 4PDVA 4PHZA 2YMZA 4YRDA 4JI7B 4XQWA 1A6CA 3JYCA 2AXTZ 2HEVF 1E5RA 1WJZA 5FZDA 3FYEB 3VD4A 2PGGA 3HVDA 4XQDA 4JPRA 2WQ4A 2XGXA 4BWAA 1PIV2 2AC1A 2OCCB 2XTAA 3P3NA 1OQ1A 4FZ0A 2P5BA 2WPDG 1C1LA 4W50A 5J98B 1VBA2 4FPYA 4RS5B 3DSQA 3ZEDA 1TMF2 1BQPA 2HWF3 3B69A 4I4TA 3WP3A 3LFMA 3VBRC 3L2YA 4XCAA 4QPGC 1HNWB 4N53A 1TVKA 4C1WA 3VDAA 1XNDA 2NLRA 3RYCB 4XXPA 4Q4W1 3ILRA 4DR5B 1ODNA 4Q4Y2 3VBOC 2PHDA 5KR7A 4NPMA 2RM22 1R6NA 2N04A 4O65A 3VBUA 4BQWA 2RG4A 3SJBC 2PLV1 4LWSB 2SBAA 3AJYA 2CDPA 4W8JA 4CDXB 3CPWU 1UMIA 5B1BC 4BH9A 3ZRVA 1VIWB 3ZYJB 4NIGA 4GIQA 3APBA 2ZD9A 2ADPA 5D8AC 4RR3C 5C4WA 2VQUA 5CBFA 1E5HA 3X2QC 1X9TA 3WF0A 1Y74A 4BQ5A 2ZE6A 1F9KA 1QHDA 4QB2A 3K9AA 3THCA 1O4ZA 4YJ2A 4LHSA 3E2EA 3WCRA 1PMJX 4LQRA 1RUF3 4FQ4A 2ZGTA 3T4VA 1CAXA 4Y4RA 5FZHA 4K21A 3P30A 4JTAB 1UO9A 4TLFA 1OCZB 1V54B 1UKRA 3KD4A 3BYWA 4YWAA 4X66O 4OULA 2RS51 1V6KA 4IIJA 5FLJA 2VOXA 4W65A 4NIDA 3UQ8A 4HXCA 4CU6A 4FM0A 3CJIA 1NVPB 4A6SA 1LEDA 1OCZC 1V54C 4MT8A 2VUJA 2V4DA 4MHUA 2W1QA 3CNAA 2VAUA 1UPSA 3LA2A 2PUSA 2P6CA 1ODMA 5KWRA 1ZBE3 4QJFB 4CDXA 1KBHA 1JZ4A 2VW1A 2RS11 4LTAA 3U1XA 3DCQA 1N1VA 3K0GA 2CHHA 4LKFA 2WJSA 3QBQA 4DUZO 3KT7A 4BK4A 1YUDA 3ACIA 2GMPA 1QVGU 3STLC 3H3ZA 4AQYB 1UZZA 3O9OA 1QNMA 4FOQA 3WP6A 3C3SA 3AK2A 1ALYA 1OOPB 2JX9A 1MG1A 4DK1A 3T3YA 2Z0AA 1K5QA 3AZYA 2N74A 5IFTA 4NROA 3H1KH 3NNLA 3RRDA 3B8NA 1OUSA 2Q7GA 4CU8A 4JRLA 4IGPA 4LIVA 3CJIB 4LHKA 1FFXA 2Y6FA 3SCHA 2A5ZA 5DM6V 5IVJA 2F66C 1TGOA 1HRI3 3GZTB 2KD7A 1ZBA1 5A80A 1OC1A 1W6NA 3D36A 1PMIA 5JXHA 5ACA1 4ZOLB 1ZZBA 3KS7A 2QJVA 1RUH2 3M70A 4KU8A 3F95A 1U96A 1S5HC 1YF2A 5BMVB 4XJ9A 3NV4A 1FI2A 4OPAA 5JJJB 1E5IA 4DR2O 1N36O 2QKCA 3O1MA 1L0NH 2KG7B 3D8CA 2ZMKA 3ZR5A 2YG0A 4FAHA 3OEHG 1DTOA 2PN5A 1D5AA 1LESA 4CXWA 4MVOA 1BQZA 2W39A 3UT0A 4OHYA 4KGQA 4HBNA 4MSVA 5CKQA 5JDBA 1S2BA 1CX4A 5JQGB 4HVQA 1ZX5A 3B94A 2QWRB 4EFEA 1PNFA 5H2FZ 5CB4A 3UCSC 3E8HA 4DUVA 5G04L 1AYM3 4CCCA 4KHPB 1BZKA 2VG9A 1UZ0A 5TISZ 3M3EA 1S2KA 2WIIB 4IE5A 4MXWA 3ZMSA 3UM7A 3JAMN 3IZOA 3OYWA 5AFBA 4HKWA 2NN4A 5BUVA 4ZKIA 3MV01 3SH4A 2XWJB 4C1XA 3O1RA 2PAEA 2VZUA 3LSSA 4B3MB 4TN7A 1ZZ6A 1YLLA 1FOD1 4JI2B 4O9EA 1W9TA 1UPGA 4WFBV 1Q8IA 2VNRA 4HG6B 4OLLA 4ATFA 2WBKA 1ZRCA 1RUE3 4JTOA 1RUH1 4HN0A 3ZN5A 3H1JH 4DV6O 3AG4C 3B00A 2Q7EA 3ZIXA 2OUJA 2W08A 3M8AA 1AYN1 2ZGNA 2VCAA 2DF7A 4WBNA 5A3WA 1DQ6A 3I2HA 2YICA 1GKBA 1F35A 1AYN2 3HKEB 3K5NA 4LF8O 4QQHA 4IEXA 1SCRA 1HRI2 4OQ8A 2ADQB 1GH6A 1R1BA 1AI4A 5D8AA 2ZXQA 3I2FA 3IDAA 4BPZA 3ON7A 4DB5A 1MS4A 3VZKA 3N2KA 1NXMA 4XDPA 5DAVA 3I55V 4IV3C 2ZGRA 2DYSC 3GBWA 2FMYA 1S0FA 4IEOA 3N9QA 4FOVA 5A7WB 2F43G 4K40A 4IEVA 4LFCO 4AOCA 4RR3A 5C4WC 3MDSA 4YJ3A 1NYWA 2VQEB 2AZ0A 1W03A 4NHKA 3MLKA 1R1A3 1H8TC 5KA6A 2LGWA 4DR6B 4NIAA 1RMU3 1MNGA 2FCUA 1V70A 4H33A 4FFKA 5LP6A 4JZGA 3UT5A 3FC0A 4EEQA 3PVNA 4P9YA 1VBB2 3Q4HB 3J9SA 4A7KA 1MS1A 2Y0IA 1VF6C 3PNAA 2UYBA 1YJLA 2A73B 3P1IA 1O3QA 4OPHA 2E5LO 3VN4A 2DCYA 3PU8A 2WO2A 2EJRA 4CP2A 2DYCA 3KB5A 5IT6A 5FYVA 4UXAA 2CSGA 4WM8A 2AZ5A 4YGBA 1W6OA 5IK4A 3H7JA 4NHYA 2ZX0A 3OGVA 4DK0A 3PMSA 1GO3F 3AZWA 3K08A 3RZMA 2CYFA 1GP5A 3NJYA 4YW4A 5F7UA 5FIXA 1HDJA 3M7MX 3G6JB 3BOPA 2VTFA 5C8YB 3IJ4A 2FYUH 1XEQA 1AJOA 1EBOA 4RHV1 5GTIZ 5J1XA 2RE9A 2WLLA 2R9IA 3KVAA 4NAOA 3SNMA 1Z7S2 1F2NA 5IE9A 1TUBA 2R49A 1UQXA 3IDEA 4DYLA 1SLCA 4AHWA 3RYRA 3SJCC 4CE8A 4H37A 5CISA 1AJNA 4W4KA 5BXXA 1QHTA 4R9BA 4B7KA 1N3OA 3A0HZ 1VQ8V 5CFCB 1JZ7A 1KS4A 4RUEA 3OTOO 1YTFD 2XQRA 2WUHA 3ETEA 3KZIZ 3JASB 3VZMA 2VBDA 3JSNA 1D2DA 4QU2A 4NVPA 1O4YA 2DWRA 5KMGA 1N0JA 4K8RB 3CCUV 1RUC2 2JDPA 3HR9A 1OD3A 3WG1A 1JJOA 1Z78A 2GMEA 4C0HA 1ND3A 2JG8C 4ZKTB 3MW3A 2H6CA 3WY6A 2B5UA 1FNYA 5I0SA 1US3A 1UY2A 2ARXA 1WNSA 1PNLA 2HKXA 1J5EO 5EPAA 5CG9A 2IJJA 1ZL8A 3H42B 4BIZA 1PIV1 4PLNA 2JIGA 1VAMA 1ZLZA 5BNNC 1OLRA 4KWUA 2BGCA 4IGQA 4LKDA 1QJU2 2ZPXA 3D3QA 4JV4A 2XJUA 4CDUB 3WU2Z 3ACGA 2ZR2A 1UWWA 3D3AA 3AX4A 1VBE1 1OHFA 4IIJB 1F4MA 2D98A 3NKGA 2R042 3ZXDA 1WW4A 4KBZA 2X5IA 5LP6C 4E4EA 3OUSA 2Q8DA 5HCBA 2AHYA 2VQAA 3X2QB 4L92A 4WBBA 2X7RB 3KV4A 5A32A 1VBC1 2VZTA 4MG2A 4N53B 2WNVA 1VLNA 3VBBA 3VOUA 4W6YA 3VL9A 1URXA 2HYXA 5FBJA 5DN6G 2EVXA 4XFFA 3MFAA 1S2EA 2VTXJ 2FDJA 2XVKA 4B1LA 4DEQA 1VQPV 5IHRA 1IG0A 4P9PA 2XKPA 3D36C 4YPJA 3CU7A 1Z7S3 1AF9A 4LWSA 2YSUB 5LYJB 3FMGA 1PNGA 1E5SA 4QGLA 5JXIA 2NYYA 4MVTA 1ZBE1 1ASJ3 3GJAA 3V64A 2RDCA 5LEJA 4QDSA 3MLJA 3UGFA 2OIGA 5DZEA 4O4JA 3NSTA 3RS6A 5C93A 1ASJ1 4X6RB 5LATA 4TWTA 2BFUL 5KXBA 3J7LA 4YHHO 2E7QA 2QQMA 1U5ZA 2UY9A 2RN9A 1VEWA 2O57A 3SCFA 2UXNA 1GFF2 2GC3A 3EFFK 3QTCA 1RXFA 4W6XA 3M8LA 2QSAA 1ZRRA 1G4YB 2ZNJA 5D5PA 4MVSA 3O65A 3RFRA 1Y3TA 3HKBA 1WCQA 3ZHQA 3QO5A 2ZOEB 2PQQA 5LA0A 5FP7A 5HXVA 3PIGA 2RM23 3EHBB 4IGOA 1XNTA 2VM9A 2B39A 2VZ3A 1S76D 1RUD2 1QU0A 2Y60A 3L2HA 1IS3A 1W2OA 2BGOA 2XH6A 3FE5A 2PHWA 4LO6B 2EIJB 4HPKA 5LGUA 1SFNA 2QWNB 2VNOA 4OI0A 3KCCA 1CONA 4BQXA 2OTJV 3BVCA 4XHXA 2WAAA 3BCCH 3G67A 5J2UB 1LOAA 5JOZA 4AQYO 4AI1A 3CJXA 1C8M1 4ES8A 4XETA 2A6VA 5JOWA 5GM0A 3J4UH 4RQPA 1J59A 3VDBA 3LEGA 3AG4B 4UF0A 2Q9LA 3H8UA 3OEEG 2QQUA 4PV1B 1TVGA 3ENRA 1JYXA 3ACHA 5FY7A 3K59A 2ZHKA 4XUNA 2BE3A 5ANNA 4O4IB 4A4AA 5FTTC 3OD4A 5CAZA 3SGIA 3LD8A 3I56V 5FXXA 2H3OA 4Q2FA 3VD7A 2X5IC 4LBEC 2M7WA 2WO3A 5C3RA 3RMXA 2EICA 2W52A 4Q0UA 3ASOB 4MUVA 1MABG 1RL3A 3E8FA 1RPOA 3POBA 3S7IA 4LBQB 4M3CA 1J84A 5HCFA 3BTZA 4A7YA 3ZDVA 4ZI7A 5BNNA 2HVKC 1RITA 3ZVXA 4D7SA 3WDTA 3WF1A 2HEYF 5F39A 3VBSA 5LBQA 3LFIA 4R8CA 1R3IC 3RT3C 2VY0A 2H0VA 4C8DA 4RGAA 1P7BA 4QNHB 1QOTA 1RUG1 1RUG3 4YARA 3POJA 4FPLA 2WN3A 1M56C 4DV3O 3HKEA 4NRQA 3POEA 2X09A 2HH9A 2FHRA 3AZZA 4LIUA 3PDQA 5BNOC 1GZWB 3ZKUA 5JZGB 4DXRA 3T1YB 4CCJA 2VVFA 5GONA 3IMMA 1N33B 1I1EA 3RYIB 1G9CA 3FAVA 2WZR3 1FATA 1YQ5A 5HPOA 4JC1A 1NE6A 2VZPA 4A44A 2UY8A 5A7QA 3FL7A 3IIIA 5FZCA 3AJZA 1H8HG 3CJIC 4EN7B 1QR8A 2YHJA 1PMHX 5LL6Y 4H3WA 3ETPA 3SCGA 4QE7A 3I3QA 5FWJA 1W9YA 2FDHA 3JQXA 5D1IA 4AL9A 1PL4A 3RSJA 1CZSA 2W0FC 1JH5A 3RVYA 1OOPC 3CXCU 1Y66A 1VPHA 1JOBA 5EIBD 2AACA 1EZJA 4RUFA 1KKCA 1ULGA 3K3NA 4BW9A 5FPZA 1XMQO 4GYCB 2BTVC 2A3XA 4KWJA 3JCUZ 4GH4C 5JCTA 3WQ7A 1PM9A 2P90A 1OPMA 2HLEA 4WCEV 2UXBB 1GP6A 2HJDA 4EWEA 1SPPB 1AR92 4OVEA 3K0DA 2R1DA 2FKXA 3GDBA 4QD2A 5FO9B 3QNEA 1O91A 4X9QA 4PDRA 3SC7X 4Y33A 1JYTA 5LMNO 2AYHA 4M3CF 4LNVA 1B3QA 5JVVA 1ACCA 2FD8A 5FP9A 4FQZA 1UFIA 4LHLA 2OXBA 1K5SA 1UXZA 2VNGA 2VVEA 4LBJA 5A32B 4LA2A 1CAUA 2D97A 5GLWA 5KC5A 2D6MA 5K0UA 4AI2A 2WQ8A 3J7AU 4LF8B 1KFXL 4AVCA 4UW6A 2F4VO 5BR8B 4FOYA 4KMQA 4XFCA 4XBQA 4OXSA 4U3JB 4LBNA 3I59B 4DUZB 2FZ2A 4DV2B 5BZBA 1RUJ1 4E2QA 4WM8C 2DCZA 2VNVA 2RQ6A 1VBA1 5FXWA 3SYCA 5C33A 2XQXA 4S2DA 3D6EA 4URAA 2AENA 4YW2A 5L9BA 5K7PA 1GOHA 4YW1A 5A7SA 4JHTA 4OQ9A 1AP5A 4JKMA 4ISRA 1NQJA 4KFMA 4I0XB 2IU0A 3FYIB 2BEOA 3MGUA 5BNPC 3V0BA 3MEPA 2YIBD 2F1MA 2J42A 1NU1H 2O0OA 4JI4B 2IC1A 3W5NA 4XMAA 3NRUA 2RV9A 2RJ2A 3USUA 1Q82W 1PP9H 1HJGA 5IAVA 4UVBA 1K42A 4I50B 5GZFA 4YZ4A 4ASKA 1AR81 2GTAA 2YS8A 1QH7A 3PMEA 3TN91 5FZ9A 4OGQB 1URFA 1IS6A 1N3QA 2GN7A 3M99B 3NMBA 4LBKA 1MZEA 3O1SA 3H1WA 4HAMA 4NB5A 5IY5B 1VQMV 3ZMTA 4HLTA 3B77A 5J3UA 4KXRA 4DR4O 1RVF2 1PO13 1PX3A 4JV5O 2EZPA 2TUNA 2VOWA 1IVSA 1L7QA 1N1TA 3PUIA 3U11A 3ALQA 3B01A 4LF6B 4IEPA 3AMPA 3I3MA 4IGGA 2W1WA 5C8CA 1AL0G 4MVMA 3H50A 2G19A 4YM3A 1HRI1 2J1UA 2Z5UA 3TN93 1AR83 1DF4A 4LF7B 1WMEA 3H8OA 3BU0A 3K4AA 2P37A 3C7GA 5H9PA 4LF5B 2DFBA 1W3VA 3ZSEA 1NKGA 2OZJA 3GBGA 2GSMB 1UYPA 5FQ0A 3ZYBA 1JS9A 2JWPA 4AEMA 1N32B 3FLTA 5B2GB 3S7EA 1VE0A 5K1XA 3OY8B 2XPJA 1S72V 2YGMA 3ICXA 1EY2A 4DQAA 2HHHB 5FZ6A 2E76B 1HN0A 1XXNA 4CU9A 1PK6C 1YFYA 5JR2A 1Q43A 5FZBA 1XNBA 1LOGA 1ZM1A 4AEKA 3CC4V 3L70H 5FUIA 2WWUA 4Y1VA 1H8VA 4BIFA 3IM0A 2QWQB 1GAXA 2Q0OC 2E26A 1JN2P 3C3TA 1AR1B 1PVC1 2G9GA 2DE0X 5FPRA 4XFBA 4X89A 5D21A 1BS3A 2RS52 4OUMA 3WHUA 4Q27A 4GB33 5M0TA 4EJRA 4BU2A 4YJ2B 1FJGO 4J9YB 3WNOA 4JAAA 1SC5B 1BK1A 4FK5C 4O2BB 4B8EA 3GGLA 5A7PA 1N4CA 3OD0A 3AM2A 3ASNB 1KS5A 2Q8VA 4NXNO 2A3YA 1B6QA 5EZYB 5ITZB 4JYCA 3M3IA 2H0BA 5FXVA 2D3SA 2HWC2 1Q5OA 5BY1A 2X53S 2Y38A 1NAEA 4FPEA 3RBZA 2IXIA 5IYDO 1ND2B 4P9IA 4QXKA 4X1YB 3SPHA 2VZSA 4I2OA 4QX2A 3ZS8C 2CWMA 3U78A 3BN6A 2LO1A 2EIMC 4KQ7A 2LUWA 4LNUB 1H8TB 4GXLA 5I8YA 2P06A 2LALA 2XAFA 4V1PA 1RUC1 3J7NA 4FXGB 1KDKA 3UKMA 4MS2A 5HFMA 1HV0A 3CYOA 3WG7C 2YXLA 4YFWA 1SLIA 4Q4W2 5FZ4A 1AR71 3SR2C 1GN6A 4DV5B 4IYHA 1SHWB 1E79G 1HRV2 3I54A 3WOGA 2JDMA 3IWZA 2F17A 5FPLA 2R071 1B35B 1NS1A 1TME1 1W6PA 4YHHB 1V6JA 3VQVA 5F3CA 3PJQA 3D82A 3MHZA 2IXCA 2P3JA 2BOJA 2ZMNA 4LF6O 4P14A 1K5MB 3KMHA 4B7EA 4TQDA 4Y1XA 2G9ZA 2R9RB 4D7TA 5B1AC 1SQFA 1X59A 2XONA 1LOEA 2V4VA 3ROUA 2QQWA 3ZN6B 4NHMA 1LU2A 3J8F3 3JCZA 1RUE1 1WUVA 4META 4WM7C 3AG1C 2ZGSA 1UX6A 2BPA2 4B3RO 1IXMA 1V6MA 1XMOO 4WV8A 3AL6A 3CRCA 1BZWA 1ZZCA 5CBLA 4H55A 4IEUA 5LY2A 2KQXA 3OW2U 2CU5A 2QNKA 1W39A 2X10A 5E79Z 2PHRA 1G6NA 4NOTA 5BMVA 4Q4V2 4P5HA 1DU3D 2ZXWC 3JARB 2DBIA 3AK0A 4CP9B 1C4RA 1B35A 5JQGA 2HWC1 2DVBA 3ABKC 4LKSA 2CTWA 1XUQA 4UFJA 4AG4A 3JBG3 3BTAA 2VVDA 1HNXO 3I8TA 2OTLV 3ABZA 4JTNA 2BTQB 1MQTB 3NAPA 4BJ0A 2C24A 3RZJA 4LLFA 4JX0A 4CSWA 5A3MA 1DF0A 1VF6A 5ITZA 1ZRDA 4YGEA 1I5ZA 1R1A2 3VBOA 5F2SA 3KWVA 1MZFA 1GQHA 2JD4A 1G7YA 3E86A 2WSSG 3EXUA 3MHSC 2XJVA 1CAVB 4AEDC 4DV7O 4M3CE 4CUCA 3BTYA 3FUQA 4N8MA 1V55B 3MHHC 3VBSB 2ZZQA 3LAGA 1XC6A 2F6BA 3VBUB 3MF6A 2V1DA 3K5LA 3PUAA 4QXCA 2PZSA 3D4KA 4O2AB 3ZFEB 4GWIA 2IXKA 3VBRA 2ZIMA 5B1OA 1B09A 1XRUA 4DV7B 3RQ0A 3OFNG 3W20A 3OUJA 4OYUA 4LOSA 4FLVA 1KD1W 2OX0A 1QCEA 3FFZA 1Y74B 4XDLA 4DR1O 3Q9OA 1QXJA 2DVAA 3LCPA 2B7YA 3WSOA 4BDVB 1FD9A 5AG2A 5GZCA 4PJYA 1I3HA 1S3JA 2V72A 2PHFA 3EO6A 1VF5B 3GBFA 4XDJA 2P3IA 5A3TA 4BK5A 4CCDA 2W2IA 1ZA7A 1KYOF 4DUYB 4HVOA 3DL3A 3VBRB 3NJXA 3B09A 3JAWB 4JI0O 5LA9A 4XJWA 4CP1A 2A6ZA 2P17A 2B46X 3ZHRA 2JE9A 3N7MA 5JIAA 2O1QA 5IVYA 1T6BX 3MIEA 1E57A 2ZEWA 5C71A 4CS4A 4R8HA 4KP4A 4LR3A 1SA0B 4FPKA 2XJQA 1KP2A 1DLCA 3CDZB 5HXMA 3NL1A 4QGNA 4QM8A 4YJ3B 1HJFA 2QQIA 1V9U3 5DUWA 3WDXA 1YIPA 5BNPA 4I01A 1A8DA 3LEKA 4OI4A 1DGWX 3K57A 5C6CA 2GBOA 3N9OA 1UZVA 4C91A 1RVF1 4AQ6A 4HKOA 1GN2A 1JHJA 2VZQA 5CA6A 4B3RB 5CN0A 1I5PA 4IV1C 5AFEA 3TAYA 2VMDA 2DQ0A 1SQPH 5JH7B 1M06G 3MI8A 4O61A 2EBOA 4B4QA 2IH3C 3ZYGA 1UCXA 1VBE2 1F5FA 5F5QA 5FYUA 5C7GA 5GZEA 3SITA 4X1IA 4QWNA 4IETA 4GKJB 1IPSA 4AHCA 3RZGA 2E6VA 1SRYA 3WXPA 4K9SA 4UFZA 5EBLC 1AJQA 5TSWA 2R9AA 5LOVB 2JB4A 1A34A 4PA7A 3IAPA 4WM8B 4UB8Z 3FKSG 3WB0A 3LSEA 2XJTA 1P84F 2ZX1A 3AP4A 1COV3 1CGPA 1XBFA 5T50A 2UU9B 1J95A 3PUQA 3TEWA 3DXUA 1DK1A 5JOXA 4E27A 1H2GA 5JZGA 4LMFA 1OCCB 1NH2B 5AC92 4J7ZA 3F5WC 1AX0A 2JJ6A 3IAQA 1AR4A 3QCWA 1AL22 2JS3A 2MNGA 2VJXA 5FQ0B 3ABMB 1FPOA 4WFEA 1V6LA 4NO4A 4ASMB 3K03A 1VQOV 2V73A 4JYYA 4MVQA 4JTDB 1MACA 2WQZC 1OLME 2BOCC 1DDLA 4FPCA 3LZZA 3IPVB 1TME3 1GWMA 3D3IA 5DAWA 2Y4UA 4OI1A 2QEXV 4I55A 2XDVA 3SH5A 3L72H 4ITCA 1BVVA 2GTSA 4LNUA 3POFA 2Y34A 3RNSA 1W6OB 1IZ3A 3UETA 1W2BU 4GKKB 2EALA 1QQP2 1BBT2 3T1YO 3H1YA 1AP6A 2RVAA 2A6YA 1J3RA 1S0CA 3O1TA 5EJ3A 3GB7C 2P2KA 5FOBB 1ND2A 4S2HA 3U4SA 1H2MA 4B3MO 1YTFB 4CCLA 1M9NA 4Y26A 4AEJA 4JI2O 1XNQO 4RQPB 1COV1 4YG3A 5LCWL 1AR5A 1R6KA 1MS0A 2NM1A 1BCCH 1XREA 1KU9A 2FDGA 3RG0A 1RXGA 2DQ3A 1N32O 4IL7A 3I4IA 1YQ6A 3GJBA 4DIQA 4NE9A 1CPNA 1ZRIA 2GAUA 3ABLC 4L11A 3ST7A 2EXJA 4EKWA 3UJOA 1OMIA 5IK7A 1YIJV 4AZZA 1WA8B 2ZM6O 3EJKA 1V6OA 3NKTA 4CUGA 4HSJA 4Y22B 4A42A 3RVZA 4CEYA 3ZM8A 4NIHA 2OIIA 1IPKA 4UV8A 1HXS2 4YGDA 3UV9A 1XMQB 3MZHA 5J2UA 3MW4A 3K3WA 2QDRA 2VBPA 2F4LA 5CVRA 2WAMA 1L7LA 1D2SA 2YI9A 4LR4A 3ACFA 3KG2A 5JI9A 1QXPA 5FYBA 2P22C 2UXBO 3JAKB 5ERLA 2WINB 5GLTA 3OJBA 4CEWA 3GNEA 2C4XA 5FZKA 5BYNA 3HKCB 5LMNB 1UL9A 1W9SA 5LBFA 4CEWC 4LH6A 5JIUA 4DV2O 4FM1A 1VIBA 4CDWB 4ES9A 1RUOA 3JD2A 4X1KA 3A4UA 1F7YA 4GB32 1IBKO 2PLV2 3E6DA 2BYVE 4BW5A 2ZEYA 3POGA 3C8XA 2ARAA 3PVEA 5A6ZA 3AKQA 2MW2B 3PIJA 3ML0A 1IBMO 1F4NA 1JW6A 3RWKX 1W8ZA 2RMU2 1QDCA 1MQTA 4Q8LA 1WPXA 4A41A 1HWYA 1ULFA 1NCQB 4WF9V 1TQ5A 3JAKA 1VBC3 2YIAA 2HWC3 4NWWA 4K20A 3DEMA 4MLOA 3CEWA 1PKXA 3QO8A 1YHQV 1PGSA 2PHTA 3HKDB 1AR72 3UL2A 1CZVA 3A23A 3JD72 5DG1A 4PDWC 2JDAA 1WLTA 4PBOA 1SBEA 5LHHA 4EZHA 1KEXA 3LOIA 3EMRA 3WG7B 4JAUA 5JVDA 4QQLA 4MTOA 2IBZH 2WZEA 4N7IA 2CTRA 4CDUC 3ZHSA 4BYYA 1NTMH 3M7AA 4I0XA 1GOGA 5DDJ1 2BOBC 1PO11 4D6SA 3ABMC 1XOYA 5FPBA 1W3XA 1VB2A 4F6RA 4A3ZA 4D6QA 1PIV3 1HX6A 2ZXWB 2E3CA 1XSQA 1RJ8A 3VUOA 3VZJA 3K48A 4DO0A 2D3OW 1OZ0A 1IBLB 4DY3A 3LA3A 1K34A 1PM4A 1APNA 2AZ2A 2JDYA 1Q8PA 5IAXA 4RSUA 4NHXA 1XPWA 2CAUA 2R062 4XPVA 4MADA 2RS31 4Z82A 4QDQA 4CPBD 1ULOA 3KF5A 2XT9A 1SQQH 5T5PA 1W9FA 5EIYB 2GP5A 4OHVA 3LF7A 4LFBB 2RS33 4IESA 3ELNA 5FK7A 4GMP0 2WS92 4ARXA 4OUSA 3I3EA 4KG0A 3BPZA 1PZ9A 3BY6A 2QFEA 1UU5A 1XILA 3ZIAG 1UNBA 4JI5O 2WLIB 3TXSA 5JCOC 1YJNV 3CXHF 3DF0A 3PVBB 2WZPP 2WLQA 3IGAC 1VBA3 1XYPA 1OUXA 1JODA 1YO8A 4YG0A 4X8PA 4F4LA 3ZFGA 4FI9A 2ZE7A 3RI8A 4EN6B 4TT3G 1DGRN 2UXCB 3NNGA 2QDNA 2QQLA 3DC5A 3HT1A 4J1WA 2LTNA 5LW9A 1R1ZA 2XAGA 3SKVA 1HRV1 2A6XA 2K1EA 5JSOA 3OGRA 1WLCA 1W2NA 2FCTA 5SV8A 3ZYFA 2QWPB 4LJHA 4XIOA 2QM4A 4BMBA 1JTZX 1JZ3A 1ZBA3 3VQYA 4CBCA 1SLBA 1UIKA 4R6ZA 3OB8A 3O14A 1IDSA 3I97A 1HNXB 3HPNA 1LHNA 5FAXA 2MEV2 4UFHA 4I5SA 4Q4X1 2P6HA 1S0JA 5JPNB 3LE0A 1XBLA 4S2FA 3GXUA 1PD3A 1IOAA 1XQ8A 3H0OA 1FS0G 3OOXA 3MF9A 1WMDA 1J83A 1ZA4A 4RWUA 1D4VB 3PU3A 4XJZA 4AQ2A 4QPIB 2ARBA 3LDKA 1J1LA 1UF2C 1D4M3 4P08A 1GZCA 3VKNA 2IJKA 5FREA 1O5LA 4COWA 5EQUA 3DPRB 2PAKA 2AGSA 2VC9A 1W6PB 5CB7A 3SJQC 1POV3 3H1HH 4RL7A 3N3HA 2ADEA 4Y3OA 5L3BA 1EAH3 5T52A 1RUI2 2X5IB 4RFT0 2JKBA 1BL8A 1KQSU 1LOFA 3UGGA 3OGSA 2EAKA 3U10A 2YV8A 1V55C 2ZAAA 1RHI2 3T4HB 3VLBB 5JSRA 1U12A 2EA7A 1SLAA 1RSOB 1COWG 4DZGA 1XI1A 2JEXA 3SEEA 1JX9A 1ASJ2 1AXZA 1RUH3 3POWA 4MVZA 1K9MW 2CTPA 3QACA 2WRAA 4M4PA 1N1YA 5IUQA 3J80N 4LFBO 4ZHQA 2IU3A 5HBAA 4FPHA 5K9YA 4WM7A 1JA8A 2YGLA 4YFZA 1RC6A 3WF4A 4D6TH 4J9ZB 3B40A 3RVHA 2M6YA 4EE2A 1DZRA 2DVFA 3KQ4B 4CRQA 3WNNA 4CVUA 1O3RA 4IE4A 2DN9A 4KBBA 2WO7A 5IJ0A 4QE9A 3FLPA 3AKTA 3CHXA 3RN4A 4AILC 3A21A 4KH9A 3JD3A 3WP5A 3WUDA 3AL5A 5EBMC 4AGGA 4BCUA 2EIKB 1GM8A 1SZTA 2R063 4DV4O 1X9PA 4GMP1 2FBEA 3D0JA 4GALA 2ZGOA 3TEXA 2I45A 4FO9A 3LSUA 4COZA 4JASA 4LXLA 3KSCA 4QHZA 5IDJA 3CL1A 1AZDA 2D3RA 2JG9A 4FP2A 3K4DA 3WDYA 4JGYA 4H7MA 4UF0B 3IT8A 2ORXA 1Y43B 3FUOA 4NYKA 3HAGA 4U36A 1SBFA 4QGMA 2WLNA 3ZFFA 1S5LZ 2FQPA 1RVF3 3RYPA 1R082 2W91A 2R32A 3ZXAC 1LENA 3WINE 4YVSC 2B9ZA 2XJPA 2VMGA 1NR1A 1PVXA 5FY4A 4CEWB 3LDDA 4LULA 4FBFA 1K92A 4JYAO 4LUMA 1GQGA 2GN3A 1SDDB 2HWD3 2Z42A 2YC4A 3NJVA 2FCVA 4DRRA 2Y6LA 5FV3A 1UYYA 4JQRA 4DR2B 5FJHA 1FXKB 5AVPA 2QE3A 1VP7A 1DYKA 3G6EV 1RUI3 4L9BA 2L6LA 3STZC 2A71A 2CH7A 2Y6KA 2B45X 1XNKA 3SYPA 3ZPYA 1BHAA 1PZ8A 1ND2C 2JENA 3E5UA 2Q68A 5KHJA 1LHWA 4K1YA 5EP9A 4AE2A 1KGYA 1HNZO 5L19A 1CQ9A 1FMD1 4GKKO 3PUSA 4XCBA 5KHGA 3RWRD 4DXSA 4JI4O 1N36B 3ZBHA 2ARCA 4P30A 3CWBH 2B5HA 3SDLA 1BHGA 4NRMA 1LAJA 1FX5A 2A70A 2CDYA 2RS13 1YI9A 4CC5A 4MGQA 4RQPC 1CAXB 3ZYIB 3FN9A 1UMHA 3CRMA 5IVEA 2QUOA 3TEZA 1HB1A 3BAAA 1F4AA 2WN2A 3DPRA 2UWAA 2HBTA 3NNMA 2NLJC 1OJHA 4LO8A 3UT5B 4HVRA 3PHMA 1QJEA 4Q26A 4KHPO 5LP6B 5FKCA 2W47A 1SERA 4JF3A 4K8FA 2JK5C 2QQVA 3F7YC 4X20B 1IS5A 1UY0A 4RS5A 4I9QA 4UBHA 4EN8B 2GUZA 4GKYA 3L9DA 1OSGA 3VGIA 4DV1O 4DV6B 2ZINA 3H1IH 1W8NA 3VB9A 4PF5A 1YC61 2Q8CA 3E89A 5CFDB 5FNVB 3TNPB 1DG6A 2KM2A 2YEVA 4HK9A 3J26N 4NTXA 4AK3A 2WABA 3WCSA 1C5HA 3CO2A 4P00B 1QY4A 5C8CB 4LBQD 5L7OB 2LP7A 4CDQC 1I08A 4TLGA 5I8SA 1TA8A 4RYDA 4GJZA 2ZCEA 4LFAO 1H30A 1EM1A 5B66Z 5DDJ2 2IZWA 4GQ7A 3CCJV 1AYM2 3ZMNA 1GYKA 5CYYA 5E1RA 2A3WA 3ZYRA 2OS2A 2ZT9B 3VD5A 3JD4A 3FJSA 4YNIA 2Q7HA 2ZGKA 4YZ1A 1G9DA 1WPBA 5FK8A 5FZLA 4DRXB 3JD71 1G9BA 3FLRA 4I0AA 4YIOA 2VQEO 2NPIA 2VOVA 4J7JA 5A3UA 1KQRA 4XTPA 1RYYA 4ZXEA 5I93A 5EYPB 2NQYA 1YDXA 4P9WA 2ZQMA 2DMXA 1DGWA 4LP8A 2WC2A 5LGNA 2MK3A 4WVVA 4JI3B 4ORFA 3W7SA 2QCSB 1IPJA 3H3LA 5JXGA 3BTXA 1TMF1 4UWDA 1QWRA 4PBPA 1JCHA 3B02A 2WZR2 1S55A 3WG3A 4QPKA 4J25A 1R3LC 1GWLA 1C57A 1WMFA 1QOOA 1BHBA 4JI3O 4I4TB 1FMD2 4HETA 3WV6A 1L7RA 3VHPA 2R061 3USSA 4DR6O 2TEPA 1T6GC 5DZGA 3NXSA 3N9PA 2PI4A 1MEC2 2WLMA 2D44A 1C8M3 4UW5A 4NUBA 3T1MA 4BAYA 3GZUC 3FB5C 3K3OA 4GX1A 2V5YA 4B3SB 4BMEA 2B9VA 1PPJH 5IY5C 1NCRB 4OMCA 3ZYHA 2B8MA 4BHPA 3S5AA 3ZCCA 3DKWA 1GSLA 5K0UC 4AVTA 5KUKA 3AYEA 2JG8A 3OYWB 5FZMA 3X29B 3WUCA 3ABUA 2FMDA 2ZDIC 5CA0B 1VP6A 3W7TA 4IE7A 1W0PA 1POQA 3HJRA 2Q8EA 1AB3A 4N43A 1WBLA 4O4HB 3WHTA 1MOFA 2AH2A 3W58A 5F5AA 1G6UA 2XLAA 2VGDA 3MPBA 5FZ7A 3KQRA 3LB9A 2F23A 4P9LA 4B4PA 3MIFA 2QQJA 4MGZE 2JJ2G 4QPGA 3NW4A 4ISQA 4JI5B 1JHNA 5EBWC 4RFRB 3PL0A 2VZ1A 3RYFB 4F83A 5H6RA 1XHZA 3EB7A 1A78A 2F4PA 3ILFA 1SZXA 1RGSA 2DTYA 5CMUA 2WNUC 3B3QE 4ZY9A 4XACA 4XYXA 1QJX3 1QIQA 2OQ7A 1OFNA 2GH2A 1PK6B 1AX1A 4QQOA 1AR73 3HN1A 2RDNA 2ZEXA 4Q6GA 4D8MA 1NZIA 1PO12 2ZA9A 4HT1T 4OMDA 5EV7A 1CAWB 2WWSA 2V5DA 1ENRA 4G2KA 1DGRA 3WDWA 1FMD3 1V9PA 1U5YA 3T09A 3E8BA 3F2ZA 2R0HA 1ZUQA 2F95B 5LBEA 2ZR3A 1T2XA 2YDEA 4QX5A 1S5JA 2HWB3 2HWE2 3JCIA 5FYMA 3WX5A 3N7LA 1W59A 2GH8A 4XDQA 3T2QA 2Z2SB 1N0NA 3O1OA 1GKFA 2Z69A 2VBBA 2Y6GA 1Q3EA 1BSMA 3LQCA 1GLHA 2IWGB 1I5YA 4MVUA 4WFFA 4NXNB 4ATEA 2A9HA 1VQ9V 3GYDA 3QG5A 1FAYA 4QHBA 3GM8A 2G38A 4HKLA 4IV3A 4FPFA 1KD7A 4E8CA 5F6LB 2C2AA 2IJHA 4J6GA 2PYTA 4XMIA 3ZN0A 3T1HO 2X6AA 4Y1ZA 4E4SA 4DPNA 3S3WA 5C3OA 2Z79A 1JI6A 3RZLA 3LWCA 1NLRA 3IDBB 1XSRA 4F7ZA 5IYYA 2D5HA 1NCRC 4Q0PA 2A6WA 2W94A 3C7EA 5IJ9B 3VKOA 4PDLA 1YJ9V 2CK3G 3T08A 3I3BA 3EQEA 4UT5A 4BIUA 2ITCC 1EPWA 1D7PM 1GBGA 3L73H 1QQP3 1NQDA 3ABTA 1EN5A 1NBMG 2E63A 4I55B 2DYRC 1ZTEA 3RYCA 5JLVA 2WL1A 1O9GA 3KV5A 4YW6A 3WF2A 3WNKA 1QR9A 4AVVA 1QLEC 1VAVA 4B3TB 4XUOA 1C8M2 2B1GA 3N9MA 5HI0A 5FZ1A 3AVSA 4DR4B 2YXHA 4CCEA 2W68A 4DV0B 5IYZB 4GWMA 1HB2A 4YW3A 4JHZA 4B3TO 2ZACA 2BWAA 4LK6A 5FYCA 3LDRA 2KA3A 3KCYA 4X6QB 1ONAA 3J8F1 2C0ZA 4Y1YA 5C3PA 1FV2A 1XMOB 1NJIW 1VR3A 2E53A 5FYZA 1RUE2 1FPN3 2EIDA 1QJY2 2K9ZA 4MTFA 3AMHA 5KHHA 4TWKA 3HKCA 5F32A 4U7OA 4JCKA 3LPFA 5ACA3 5I0UA 1RJ7A 3N7KA 1X8MA 2D93A 1EAH1 2UUAB 4UB6Z 5FZOA 5A7NA 3E97A 1DQ4A 3AYAA 1AXYA 1UIJA 1QOSA 1G86A 1VRH1 4CH6A 1NTZH 3R05A 4AI8A 2HWE3 3RMYA 5EYXA 1NX9A 1IQDC 1HDKA 4MO3M 2QTOA 4E4DX 4M0HA 3E5XA 2YXYA 2ZABA 5FZ0A 4QU1A 3VDDB 4HYOA 1BCXA 1JFFA 5KLVH 2JEUA 3BCWA 1Q8QA 2ZBJA 1I94B 1CXZB 2FDKA 3OMIB 3H9VA 4JGZB 3NWKA 3ZR6A 4YW5A 1LHOA 2A06H 1RUC3 3UJQA 2BFUS 1FT9A 2FMLA 4PIYA 5GONB 3GVMA 1KKDA 5EHDA 1J1TA 1OXCA 1BBT3 1GWKA 4Q4X3 5KHIA 4Y1UA 5LBBA 3WT3A 2JDUA 4B08A 2Y6JA 4FLXA 4I0WB 1VJ2A 2P7TC 3OAAG 2GDFA 1O8PA 4LUKA 3AKPA 4DV3B 2YFUA 1OHHG 2ZX4A 1O6UA 3DGEA 2RR11 1ZSPA 5C70A 1UY3A 2H94A 2BNMA 4UVAA 2R30A 4K1ZA 5GLZA 1HIXA 2ZX2A 3Q8AA 3ZPOA 4DR7B 1EFRG 1N33O 5T55A 3HKDA 1WLEA 1R081 1DBNA 2FZ1A 4WZCA 1ST8A 4OUEA 3RZKA 3AYDA 4A45A 2QQOA 1EP0A 1XQNA 4FLTA 4F6RB 2TNFA 2XVGA 3M1HA 1QNYA 3WB1A 1Z2GA 3WDVA 3EHKA 1YNAA 4EFBA 4D94A 4DR7O 2BDRA 1GNHA 4GX0A 1NA1C 3LNMB 2CWSA 3ZHUA 3POIA 4ZS2A 1VMHA 4QKBA 4FVMA 1WMXA 4K0KB 3TRSB 2MEV1 4O2BA 1PZ7A 1MZ5A 4DR1B 2ZJCA 1FXHA 3FB7C 4Y22A 4BQ4A 2VCBA 3VBFB 3JARA 3RGBA 1MS8A 4IEYA 5D8AB 2YIBA 1W6QA 4MXVA 1DYPA 2LW8A 1LUWA 1QH6A 2PLV3 2GC2A 2GUZB 5LWBA 4AQSA 4FOWA 2J1TA 4B1MA 3ZXFA 1M93A 1M4WA 2Q5TA 5A33B 1XYOA 2JXAA 5LXTA 5I8TA 1Q8SA 4YM2A 5F37A 1MS5A 3RZZA 5FY8A 2VRZA 1VARA 5IVFA 1WB8A 2HWE1 2ZGLA 4FZ1A 1Q8VA 2VQTA 4YM1A 1M5IA 3ZMOA 1ND3C 3WNMA 1TMF3 1PHMA 3V0BB 2OW4A 3HD8B 2E7TA 3DC6A 4ZOLA 5FMOS 4CPBA 5LYJA 1A3KA 1ZX3A 2HLDG 5CA0A 1AI7A 1UOJA 4L99A 5A2QN 4AVAA 1EN6A 1WP7A 1FXKC 3JB8A 4L87A 4X1YA 4HNAA 2ZGUA 3WD5A 1OLMA 4DW1A 3VBUC 3CX5F 1GP4A 1WD3A 4FP3A 2JRIA 2VUCA 1JZ5A 5DDJ3 2Y69C 3CE2A 1DP0A 3HNYM 1OT5A 2VW0A 4RN5A 1JU3A 3O0WA 3TXQA 2ILMA 1UMZA 2EZOA 5JCOA 1KUQA 1D0HA 1G8MA 3MO4A 1Y67A 3AG3C 1VBC2 5LK5A 4B4RA 3TBDA 1YXBA 2WNOA 1ZNPA 5FRAA 1QJY3 1XE8A 3SH3A 1QQCA 1JMKC 1OKOA 3DXRB 3BABA 2PYJA 2YPJA 5CB4B 4L97A 1HW7A 3QF7A 1WBFA 2QZ3A 1JOYA 1RTVA 1PM7A 3ZRWB 3TN92 5B5EZ 3OG2A 2Y6HA 3HMYA 5F5IA 4Y24A 1DCSA 5DN2A 3IBMA 2UWCA 5FUNA 4BIOA 1GOFA 3ETQA 4O4LA 1JZ6A 1QQP1 4K8XA 1YJKA 5GLVA 4DS0A 1ZZ8A 1P49A 1B35C 2VQFO 1IXBA 2QR4A 1XYNA 2UXXA 2BGPA 1SETA 4LCUC 2OYZA 4F6EA 1JYNA 3OEBA 3TWIA 1W2UA 2JG9C 5FY1A 2WFPA 2RMKB 4Q29A 5FXZA 4U3JA 3K04A 3AKRA 3ZXKA 1MEC3 4IHJB 3FHIB 1X33A 4MGSA 4XAEA 1H2KA 1JOPA 3B9IA 1FKAO 1UPIA 1SPPA 3OGCC 2IFRA 5LGTA 3PLQA 2GV9A 2O14A 4GJYA 1FFTB 1LOCA 4KL1A 3DXRA 4LE3A 1KC8W 3RYKA 4FLUA 1UKGA 1SACA 1X50A 4Q4Y1 2IXLA 2Y8KA 1CN1A 5SV5A 3W7XA 1YVWA 3VBHA 1R092 5J2TB 5C9AA 1KRIA 5FY9A 5L3GA 3I2GA 1THZA 3AXDA 2MPFA 2WLKA 1H2NA 4O7XA 4A2UA 4TSVA 4ICGA 4YIPA 3AEIA 1K97A 2CNAA 1M90W 2YC0A 3E35A 4JI1O 3ES1A 2OWOA 1TE1B 4A5UB 4QPGB 1IKPA 5L9RA 5A7WA 3ITQA 1N1SA 1LRHA 1XE7A 3BALA 4P9XA 2J1SA 1RM1C 1NCQC 3VZOA 4UFLA 2VU9A 4H14A 1Y9MA 3FX7A 2Z4FA 1F31A 2QTWB 1NQTA 5IK8A 1GM7A 1B04A 1JJ2U 3MLLA 5FJKA 2YBPA 2J1AA 3NV1A 3CZUA 5F6KA 4AFCA 3OGGA 1GV9A 1WCSA 2HJIA 2DUOA 1FAFA 1QJX2 2Z3YA 2P34A 4J41A 2VW2A 3WNXA 1XNQB 3ZN1A 1GUIA 3L74H 1VQNV 1K5MA 1PX4A 4F3JA 1V6NA 5FP8A 1O7FA 1W05A 3K79A 4I9WA 4E8DA 1GM9A 1WW5A 3H7YA 4ZZ5A 1MS9A 2XLFA 5DXDA 3RWNA 3BRCA 3BI3A 1V00A 4PELA 5LB6A 5KC6A 2OZ6A 4GWNA 4R9DA 1CAWA 3N9NA 2ENRA 3LPGA 3VD3A 2R6QA 3HOBA 2HEWF 2DU1A 3ZXGA 1YSCA 2PA7A 1PNMA 5A3LA 2YFZA 2VOKA 3WG4A 1H9PA 3GZAA 5AC93 3CRRA 3JU9A 1JPXA 3NV2A 4LF4O 3RW0A 3HN3A 4UFKA 1S0VA 2WNVB 2CGOA 1JUIA 4FAGA 4M0NA 3T0BA 4CP9A 2DYSB 5EZWA 2OIEA 2Y48A 5CU1A 4LO7A 5DECA 2OVUA 4GMP3 4NXMO 2BBAA 2RDSA 2EJ7A 1AUYA 1EV12 4FM2A 1DLLA 3LDBA 1W8TA 2IW5A 3JZVA 4JKKA 3N2KB 4PJ0Z 4MW8A 4YVWB 5LOVA 5KUMA 3DUIA 2O8OA 4XFIA 4M00A 2XLGA 4NTWA 5C3QA 4Z92B 3DXTA 1N34O 2RMU1 1FXZA 4DXZA 3E6CC 1TEIA 1GANA 3CIHA 4DRVA 5AVAA 4UVCA 1DGSA 1QJY1 3N7JA 3W7WA 4FVVA 1Q7YW 3ZJZA 2VQ0A 5DG2A 1MSWD 3OBTA 3OF1A 4KWKA 2YUAA 1O9HA 4I30A 1M57B 2VXJA 3CD6V 3JXSA 5IW0A 2DUQA 2JJ1G 5LRSA 3B93A 1DIWA 3H1LH 1AI5A 1GN4A 5LEKA 2C9AA 1Y76B 5JWPA 1NA1A 4MHRA 1CAUB 2Q4PA 5DABA 1J58A 3OY8A 5JR7B 4P9JA 2BERA 2JDKA 3NO8A 3AZXA 3RYIA 4XURA 5A1LA 4OX9B 1GNZA 1AJKA 1ENSA 2CTQA 3AXEA 3NAPC 4LO5B 2E5LB 3HKBB 1POV1 2ZIOA 2W5FA 4QMAA 4XZPA 3BOWA 4IW3A 5KA5A 1R3JC 1D2QA 3WW2A 2D6NA 3ASIA 3ZOIA 2V7QG 3PURA 3V56A 4E2GA 4F8AA 3BIWE 4Y5TA 3WNLA 2I07B 2A7AA 2Y64A 2XMLA 3LUTB 4Y20B 1BQ0A 3VBFA 3B5LB 3OPTA 1F5JA 2X6CA 4CDXC 1IURA 3TB0A 4JAVA 2XHNA 1UJWB 2ATKC 3UKVA 5F2VO 2W9XA 5F9TA 1W6NB 3N2GA 1O3TA 2PYLA 1XL6A 1W2TA 5D5QA 1Q6IA 3DYPA 4BISA 4INDA 3ACLA 1X36A 2VD7A 3QH6A 5FZOB 2D43A 2BV4A 4W4LA 4PA6A 2FL4A 2VMFA 3VQXA 1K7DA 1SESA 1BT8A 4MH0E 1RUNA 1OKQA 5LMUO 4KWLA 3DPRC 2RJZA 4LF5O 4DFSA 3ABKB 4D0QA 4PDWA 3PJSK 1NCRA 3P6BA 4OHXA 5GTHZ 4HFSA 4FCAA 4EYUA 2EIGA 1CJPA 1REEA 3N27A 1DZQA 3E5QA 5LMUB 5ACA2 3TK1A 4O4LB 2C1FA 4IE6A 4R4ZA 3S6PA 2EXIA 4Y5SA 1XJAA 4BXSV 4PIZA 2Y69B 4GCZA 3LEMA 2HP8A 2VL4A 1JXNA 5A6QA 2VWJA 2RR13 3PN1A 2JDIG 4GB31 3E6BA 5H9RA 5DAXA 1MA1A 1RM1B 4AI3A 4MX3A 1YEWA 2XHBA 4MOAA 3O5SA 5BY5A 2GNTA 3AP5A 3K2OA 5F3IA 5F5CA 4U2AA 1NY72 3EVKA 4QM9A 5EIBC 4Z2WA 2JD9A 2PHUA 3UKNA 2XNDG 1YIFA 5FL7G 1MEC1 3J7MA 5FPVA 3S57A 2KB1A 1W06A 5FZIA 1XNCA 2B1IA 1I9RA 4FTBA 1CIYA 4N53C 2ZE8A 4ZXKA 2QQKA 3AP9A 4D6RA 1ORQC 1UY4A 2XWBB 5EWSA 1WW6A 3MIBA 1K33A 2EILB 3AYCA 1TUBB 5FMOL 2R0FA 2WZ8A 5A3OA 1REFA 4W4ZA 3OGIB 5EFUA 3UO3A 1EPZA 2VO5A 4R50A 2BQPA 4FPOB 1R091 4HL0A 3I2DA 4BQ1A 2QE7G 1CZTA 2HYKA 2EAAA 4K0KO 3N9LA 1RUI1 4UCVA 5I0DA 3CZJA 5FKBA 1KDMA 3JATA 3T2OA 1HP8A 3ZX6A 1NCQA 1QKQA 1ULCA 2VWKA 3I2IA 5EC2C 1W8HA 1M56B 2D6KA 2QDOA 5CA3A 1QJZA 1JU4A 2RNBA 3S0MA 3MYXA 1HXS1 3QLQA 4PLOA 4ZU4A 4MZUA 2WLHA 1DFQA 3TOJA 2ZMLA 4CZZA 4UFIA 3N4MA 5CNAA 2LW1A 3LKJA 5FPUA 4LE4A 4PIXA 4PI2A 1H4HA 4QKFA 4EQVA 2GMMA 1OVSA 3UGHA 3WFVA 2OCHA 1SLLA 2JB8A 1RSOA 5LA1A 3TJTA 4OFGA 3T4ZA 4W6WA 4JGSA 2J1VA 1P4RA 5A33A 1BYHA 3AC0A 4YSFA 4JGZC 3MDPA 4PA9A 4Q20A 3R65A 3FHQA 3BODA 1TG7A 5FYHA 4NHLA 5KX5B 4ZONA 1SEFA 1COV2 2R073 4XAAA 5EYPA 4EROA 4I3GA 4JDMA 4DV5O 3VKFC 1OF4A 3RZHA 1NXD1 4XTMA 1XHXA 5FZGA 5IWAO 2ZHMA 2VZRA 4LBMA 3OUIA 3NNJA 3DYOA 4V2VA 1KFUL 4X20A 2VUAA 3BEHA 2VCMA 2LGQA 2A3QA 4TUYA 1CPYA 2J1EA 3VBSC 4A7ZA 1YZBA 1LOFC 2BCCH 3M3CA 4FFFA 4I0BA 2D6OX 3HQRA 4J10A 1NLSA 2GNBA 3NAPB 3T1CA 1I0HA 3K5OA 5FBZA 5A3PA 3KZ4C 3H8XA 1CWPA 1WAZA 4K6BA 2EIJC 4A6OA 4I09A 5ABJB 2UUCO 1D5NA 2CY6A 4K3AA 4ZI7B 4OZOA 5BNNB 5J37A 3VBHC 5C9AC 2AUYA 4DV4B 3OTFA 3SYQA 3RPQA 1HQWA 4XE9A 1RUJ3 5LY1A 1RINA 4BLIA 1JR9A 4JDNA 3V65A 5T5LA 1A32A 2HBUA 1TAEA 1ND3B 5JMOA 4JYAB 4CYDA 4K8ZA 2YBKA 2GALA 2WLLB 4AI9A 2DWDC 5B3SC 1KECA 3FHAA 4GUNA 4QHOA 1PGL1 3JASA 4CCKA 3EBRA 1SKVA 1Q56A 2C6SA 4L8QA 2DWEC 1OA4A 5FMCA 5GZGA 3MUY1 3HQUA 3K51A 4Z2AA 3ZN6A 5BPXA 1Z5WA 3OEAA 1BE3H 3LDEA 5JPMB 3SXWA 2LROA 1OOPA 1D4M1 3OUHA 4A3XA 4QB1A 4I02A 3T2PA 2HJFC 2WNUB 1GZTA 3SHRA 3VD9A 2IVIB 4L0PA 1Y6XA 3AP7A 3KF3A 3VKMA 3KCXA 4CH4A 4ZZ8A 3O1UA 3BB6A 3AKSA 2LFRA 4I50A 1SA0A 1KMIZ 2EXHA 4HK8A 4X65B 4BB3A 4LF9B 1OCRC 2LQTA 2HWD2 1P8JA 1SDWA 3WG2A 1ZAUA 1QJX1 3F7VC 5JOYA 4E4HA 4QQPA 4YG6A 2D40A 4LITA 3G7DA 4URTA 4X65O 1YCIA 3KV9A 2F93B 1U0AA 3LIHA 4RS5C 5BV6A 1F4HA 4CEYB 5E6HA 3OBZA 4LK7A 5IFPA 4OI2A 4ZHNA 1AX2A 1EYBA 5FO7B 1NZ6A 1IGOA 4UV9A 2JE8A 1DZTA 1AILA 1VMFA 2P4KA 4RD7A 3CCEV 3JSLA 2GU9A 1JZ2A 1IS4A 3ZHVA 4DUYO 5DEDA 1JBCA 1HRV3 4DV1B 5JAXA 1US2A 1XL4A 4JV5B 2Y4TA 3KT1A 1Z0HA 3OR6C 1YXWA 3WNPA 1JOJA 2WZR1 3M2MA 2A0LA 4YM0A 2GC0A 2BTOA 1MS3A 2VOTA 2ZKNA 4G3YC 5KXCA 1JFFB 1W8OA 4X8NA 1LR1A 2QVSB 4CH5A 2LS6A 2RJLA 3WB2A 1RUG2 1UX7A 3FX3A 2Z5WA 3AG7A 4CXXA 5H9SA 3SMHA 1L1FA 4K3UA 1NZCA 3L75H 4GX5A 4FIPC 1VRBA 2NNUA 4BM8A 2KSDA 1VQLV 3THOA 5IVVA 4AHYA 5ABJC 1MR5A 5EK0A 4NWVA 2XUEA 5CBGA 2ZM6B 5LBCA 2YIDA 1KXGA 2JG8B 3VBHB 5C9AB 2DOSA 2GNDA 1OI6A 4XF9A 2ZZJA 2VTXA 4X66B 4XDOA 1KP3A 2UXDB 1AYM1 1MMMA 3IMNA 1W0KG 4JTCB 2QJ1A 4AVSA 5B4NA 1QLEB 1JZ8A 4FFBA 3VV1A 2OPWA 4AFMA 1AR61 4DRXA 3H3UA 1UOBA 1K3IA 2J22A 1VBD2 4C7UA 3IN9A 2NN8A 5KHKA 4GKXA 4PA3A 2Q1MA 4UFMA 1OF3A 5BNOA 4DOUA 1H2SB 1K73W 4CS2A 4TV8A 3THPA 1XU1A 3ILNA 3CBNA 4TTGA 4GZRB 1HB4A 4R9AA 3JD73 2R041 4N21A 2BUKA 1TNRA 1W6MA 3HR0A 5IJRA 5J2TA 2UU9O 3W5MA 2BVVA 4NR1A 1GU3A 4XBNA 2NR5A 2VZVA 1SQXH 4YZ2A 5B1NA 4H0LB 2AEYA 4CA9A 2YROA 1DYOA 2BVBA 1PNKA 4QDRA 1OBNA 5L3FA 3CF6E 4BZ4A 2R70A 4G27B 4OHWA 2WNVC 1N8RW 2WS93 2EINC 1QXRA 1ULEA 4U7NA 1VB4A 4GD4A 2JKXA 4XF3A 4FFHA 4AAXA 1H4GA 1LULA 4AFDA 4FMTA 1W8WA 2JG9B 3A0BZ 3MUZ1 4QIWF 1XNAA 1CAVA 4XVHA 5CADA 1SG3A 2BOIA 4JI1B 3FBYA 3IAYA 4YLZA 3IB3A 1IQAA 1DQ2A 1KJRA 4HSLA 1HV1A 1WP8A 3WW4A 1NUKA 3AFGA 5LXTB 4FFIA 1UU6A 5FFOC 3R66A 2VZOA 4CZSA 4TQFA 3VDDA 3VDCA 1EZVH 2FB5A 4MGIE 4S2GA 3SPCA 1WCUA 2ES3A 4FTSA 2CL2A 4QX8A 2VULA 5L3EA 4IQPA 4X62O 2OT7A 4XOGA 4WFAV 1EUTA 4QGPA 4J11A 3ZFFC 2RS53 2WWWA 4XJ8A 2UU8A 1KITA 5C5UA 2JS5A 2R1BA 4XC9A 3HBKA 3OM3B 3T0AA 3IIAA 4B29A 2ZKOA 5H5NA 3BIEA 4H44B 4AHXA 5IJ9A 4Q4X2 4LORA 1JYIA 4ARYA 4C0BA 3W9AA 4XBFA 2WFF2 3J7HA 5J96B 3S30A 5FPAA 1AHSA 1POV0 2Y33A 5H9QA 2AR6A 1S0DA 2EXKA 3C90A 4QXHA 3G71V 1SQBH 1W2AX 4Y5Z0 2ETNA 3AG3B 1TUEB 1LGNA 1EUUA 1O4TA 1D4M2 2K0GA 5L9VA 2C26A 4KUMA 2NZ9A 4D69A 2A79B 1X8EA 2CAZC 1PO22 2UURA 3GCWA 3MFCA 4Z1MG 3ATGA 3USUB 2XBO2 1F51A 3AB0A 4N43C 2GSYA 5C5TA 4J7KA 2VMHA 4IEWA 2PMWB 2CAVA 1G8WA 5FPXA 2K9PA 1X7NA 1BJQA 4YGCA 2P4VA 3EXAA 5B4XA 4CP0A 4D7YA 2WKKA 3WQ0A 2ET1A 1YHFA 3O1VA 3BPSA 3KM5A 3EYPA 5LA2A 1HW5A 2QM7A 1J3QA 1LOBA 4EWAA 5FYIA 2DU0A 4QX3A 4Q5OA 1GZ9A 2HEPA 1IBKB 4COYA 2HWB2 4MTGA 3FWEA 2ZGPA 2QKDA 5DAPA 3E22B 4NKGB 5GKAC 1QNWA 4AR2A 2VUDA 1YQ2A 4FPJA 1BK0A 3WVJA 1WLWA 4CUAA 4OX9O 3OT7A 4WZFA 3TETA 2Q73A 4O4IA 4NJ4A 4JZRA 4YVSB 5A9GA 5CEHA 1NTKH 1AL21 4GZ9A 4FPGA 4YW7A 5J36A 1L8DA 4X1KB 3CJHA 2OUHA 2JGUA 3E8GA 5FZ3A 2RMU3 3GHNA 4AF9A 1TME2 1VMJA 3KGZA 5A6XA 3WQBA 4MVRA 2OT5A 2VS0A 4WVWA 3IFXA 1HQNA 4MW3A 3S3XA 1SQGA 4Q4V3 1H6YA 4Q1RA 1YQCA 4R4XA 4BQYA 5IWAB 2WT1A 4XHBA 1XU2A 1R3KC 2XJRA 1VALA 4NTYA 4QQ2A 4AFAA 1WKYA 1C8NA 2LFSA 2D3PA 1CEZA 4QX0A 1OPOA 1SF9A 3IC7A 1CIWA 3OUFA 1UZWA 1W8FA 5FPOA 4XXAA 1H1AA 1FFXB 3KHCA 2ITDC 2X8KA 2B9UA 4H2AA 3U14A 3CCRV 4XABA 4CDUA 4OHZA 4G28B 4UOJA 4E4ZA 5I91A 4X1IB 5CG8A 2VPVA 5FZEA 1FV3A 3CSXA 1J5EB 1LTEA 3VBFC 3CEIA 3I7DA 2IXJA 2JGDA 3B9CA 1BBT1 5FUPA 3SQOA 3KV6A 5A3NA 3JAWA 4Z8BA 4PT6A 3W59A 3ETDA 1CJDA 1HQLA 3I2OA 2ID4A 1RMU2 3H9AA 4KI5M 3CS5A 4CUBA 1O5UA 5DUVA 1NLQA 3AMNA 2UUCB 5DUUA 4ZBMA 5CZKA 2VMIA 1MQTC 2QBXA 2P4EA 4AVBA 1P7GA 4GWJA 3C7OA 3OPWA 2JIZG 2WLPA 2BP6A 2R072 2AW9A 3NV3A 5DAQA 2FTKA 4AFBA 3VDDC 5FMBA 1UOGA 1AR91 3CCMV 1WWYA 2ERFA 3WZ1A 1YFXA 3ZIWA 1EN4A 5L7OC 1LGBA 1NVPD 5LRRA 2YYOA 2RJKA 3BGAA 3QD6A 5ANQA 4PI0A 5HV4A 1ROPA 1BMV1 3E1F1 2YY1A 5IYZA 1FYJA 2B42B 2P5OA 5JXJA 1BMFG 1OCRB 4MTXA 3LSDA 2DBNA 4GAZA 2WAOA 4MGYE 2DVGA 1DQ0A 1Y7BA 1WGPA 3ZFEC 2YU2A 3U75A 1OA3A 4UCSA 4FPPA 4XUQA 4K7JA 5BNQA 4IT5A 2IH1C 1BKZA 1LCLA 1RIRA 2RS12 1NE4A 1W9WA 4CU7A 5E88A 1AR63 4JI0B 4I7ZB 2ET7A 4DEVA 1LR5A 1VQ5V 2WFF1 3LA7A 2X05A 1F23A 5H9CA 4HZFA 1YFWA 3RYHB 1HNWO 3P5BA 2XBO3 2ZE5A 2D7FA 5IT9N 2PTMA 1VBB1 2CE4A 3J81N 2C5DA 2Q1FA 1NT2B 2XOKG 4CDQA 3U37A 5K4LA 2Y26A 4J1XA 4E2LA 3WW3A 3WF3A 1R6TA 5FYYA 3CMAV 4Z1VA 3S5QA 5LHGA 2A1XA 1Q8OA 3WLUA 1WW7A 3V0AA 2XKOA 2N05A 2W46A 5IATA 1YWKA 2WLJA 2QZ2A 4JGYC 2BTQA 1H9WA 1V6IA 4ZU5A 4AGVA 3ZSKA 4PA4A 3ZXLA 2WO1A 1O3SA 4EN9B 5IVBA 1PVC2 2JE7A 1G9FA 1N3PA 3UKTA 2VE1A 4V2WA 1PGW1 2PQSA 1R73A 3KLSA 3CRAA 3JALB 5I0RA 4AAPA 2W6IG 2CH7B 2JVDA 4ABMA 5FLXN 2BWCA 2W0XA 2JIJA 2WSUA 2ZX3A 3DKQA 2W95A 3WR0A 4WFHA 4JZ2A 3MD0A 2WLIA 2ZNIA 3IPVA 4Q0VA 4AEDB 5JJEB 1T5EA 4XF0A 5KAFZ 2G4IA 2ARHA 1I7FA 1KB9F 4YYOA 3WQ1A 1ZBE2 1WCDJ 4CC6A 2VR4A 2JDHA 4NRPA 5J09A 2QM8A 4LFAB 3R4UA 1S4CA 3AFKA 2HWB1 4UCTA 4LEJA 1X4TA 5IYBO 1SCSA 2UXDO 2DYRB 4M01A 1MVQA 4FLZA 2WYSA 4P9GA 2XASA 1SFPA 1ZZ9A 2E51A 3CMGA 3ZSLA 1F8VA 1RMU1 3OMAB 1AVBA 3PUHA 4JI7O 4CEYC 3GWKC 3VQWA 3MIDA 3JATB 4DO2A 4EZ4A 2DVDA 2D2CB 4PF1A 3K5MA 2GNMA 3CCVV 1NI8A 5DZFA 1K4CC 2ZTNA 5GW7A 5CFDC 5LZ6A 2VCCA 5B1AB 2EINB 2KR2A 2XVLA 1VBD1 4XZUG 5GALA 3VZLA 3PJYA 3JD1A 1YYNA 1OH4A 4QPIC 1C1FA 4NN0A 3K4ZA 5C8CC 2G9FA 2QQPA 2PFWA 1D0GA 3DTUB 4YY3B 3MPPG 1I5XA 3MICA 3RYHA 2YXSA 1R083 3PVOA 1YI7A 2BNOA 4WVMB 4QPYA 2W3JA 1GN3A 2FDFA 3QO7A 3K75B 2BU9A 3ZN4A 4TSFG 1Q6HA 4IL6Z 4AXOA 2GC1A 3WDUA 2A7WA 1UD1A 1ZZ7A 3RI9A 4KG8A 1RFYA 5CFCA 2WDBA 3T2MA 1PVC3 4CH3A 3GALA 3NR7A 3D5OA 5C3SA 2Y0PA 2YPDA 5EYYA 4EWDA 2DCJA 4YXWG 3AG2B 1OURA 4EB6A 2IM9A 1WD4A 1LODA 5L3CA 2H8PC 1SS3A 1Y9QA 3HEIA 3I2JA 4GA9A 5LA6B 3MW2A 3R6SA 1RP3B 2P3KA 2JGDB 1AL23 4COVA 5L73A 4NPLA 4BLJA 3VHRA 5EJ1B 1JYWA 4IDZA 1QGLA 1LB2A 3HIFA 4ZIBA 2JDNA 1RB8G 2FDIA 4Q4W3 4E9KA 1FXVA 3UYJA 5A6YA 1S0GA 2PHXA 4LOTA 2Q5ZA 3HT2A 1GK9A 1NT0A 2HR3A 1HN1A 1W6QB 4JRAA 5A1FA 2UUBB 1VRH3 4LPLA 3M4FA 4N23A 4Z07A 4LHNA 3A2FA 4SLIA 5FZFA 3QVNA 1ZYBA 4N7UA 1LU1A 4GX2A 4FTEA 3Q8FA 3WEZA 3GZEA 4H13B 1F15A 2ZHLA 3DN7A 1YQ8A 1OCOB 3T0DA 4TV9A 5GLUA 4HOOA 1DQ1A 3RDIA 3LGRA 3IC9A 3ZFGC 4JYBA 5KXDA 1L0LH 1REDA 3POYA 2K46A 2WYFA 1TNFA 2DJVA 4AQTA 3LOBA 3BFRA 5C4WB 1HR0B 2G1MA 4IV1B 2J7MA 5JMCA 2E9QA 1S77D 5IJ0B 1FPN2 1WB7A 5CFCC 2W87A 2XOMA 2ZDIA 3A22A 1BLZA 1PO23 2JEMA 3WP4A 3FBMA 1AR93 5FZAA 4FFGA 1HR0O 1YRZA 4CDWA 3HB3B 3BA9A 3OGJA 3OE7G 3T1HB 4XFAA 1LJ7A 4N9HA 2Q4SA 4IXLA 3JQWA 3E22A 4G4FA 4RO2A 3ASOC 2DFCA 2N7GA 1S0BA 3A0NA 2RM21 4J80A 4JI8B 4BQ2A 2KKWA 2E7AA 5BR8O 4XQ4A 1UW8A 2KG7A 1H1MA 1X82A 3TYJA 3ZO0B 4FXKB 1O8SA 2IUWA 4QT6A 1N34B 3P3PA 5F3EA 1BMV2 1QJU1 2P1BA 4IUGA 1ZVFA 3SYAA 3LIGA 2XL7A 2XL9A 3DV8A 1MZ6A 4MGKE 1ZBA2