3OTFA

Structural basis for the camp-dependent gating in human hcn4 channel
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
197
structure length
197
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Structural basis for the cAMP-dependent gating in the human HCN4 channel.
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2010-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3otfA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3otfA02
1TQ5A 3U11A 2B8MA 4IEYA 1ZREA 1PMIA 1SFNA 1NYWA 1I5ZA 3H3UA 4HMZA 3HIFA 4ZU5A 2CAUA 3I7DA 4AVAA 3L2HA 1QXJA 2Q4SA 4I2OA 1WA4A 3OD0A 2ET1A 1LB2A 4JTOA 1YUDA 2ATFA 3SHRA 1HW5A 1RC6A 3BB6A 4KWKA 1CAXA 2D5FA 4LULA 2XL9A 1EP0A 3NL1A 2HKXA 4XF1A 3S7IA 3GBFA 1DZRA 3ES4A 4J1XA 3MDPA 1DZTA 1XRUA 4BHPA 1O7FA 4UBGA 1J1LA 1EYBA 5HI0A 5JSPA 4F7ZA 4OLLA 4B29A 4QX5A 4Q29A 5FQ0B 5J48A 1X8EA 2DCTA 2N7GA 4MUVA 2GC1A 2H6CA 1ZRDA 1NE4A 5FPZA 1ZZ7A 2XKPA 4XFAA 3KMHA 4E2SA 5I8SA 2XL7A 2C0ZA 4K8FA 3OF1A 4IEXA 4J1WA 3S7EA 1UIKA 4DINB 1QY4A 5E1RA 4MGYE 1OFNA 5CVRA 3FHIB 2QNKA 2CAVA 1FI2A 2CV6A 3JZVA 2UYBA 3SXWA 3CJXA 3KGLA 3DN7A 1O3QA 3S0MA 5I91A 1J3RA 1OMIA 3IDBB 2BGCA 2F4PA 5EFUA 4BH9A 3C3VA 1WGPA 3IIAA 2IXKA 2XLFA 2FMYA 3M3IA 3OGJA 1RGSA 2PAKA 1X82A 3FZ3A 2H6BA 2GH2A 1VR3A 4PJYA 5BXXA 2GZWA 2PFWA 5J7MA 3PLQA 1ZZ6A 4XFFA 3SCGA 3ETQA 4TLFA 3H50A 4FT8A 1L3JA 1O5UA 5KHJA 5FCCA 3EHKA 3BALA 2Q30A 3ST7A 2MNGA 4QGNA 3DKWA 1YWKA 2BYVE 4HN1A 4XFGA 1UPIA 4JTNA 2GU9A 4R52A 2BNOA 3U0ZA 1WLTA 4P9GA 4LA3A 3I54A 3HT2A 3EQEA 4O9GA 4L2NA 4QMAA 3USSA 3OCPA 5CU1A 3UKTA 2K0GA 5I0UA 3WW1A 5FQ0A 4NVPA 5I8YA 3PNAA 4UBHA 5I8TA 1UW8A 3NVCA 1DGRA 3EO6A 1XE7A 4HVRA 1PM7A 4IEUA 1ZNPA 2OA2A 5T3NA 1CX4A 4Z07A 2IXLA 2GC0A 3M70A 2IXHA 3OTFA 1Q43A 2VPVA 1XE8A 1Q3EA 4I0AA 1RUOA 1RTVA 1X7NA 4LLOA 4META 5D1IA 1GQGA 4YNIA 4MGKE 3H7JA 1Y3TA 5KHIA 2PTMA 3U10A 1YFWA 4FAGA 4I0BA 4ZU7A 5BUVA 4QXKA 3CLPA 1U12A 4I3PA 4PIYA 3DV8A 5KHGA 3RYPA 5I0SA 3UKNA 4QM9A 4X6RB 1I6XA 4AXOA 2OYZA 1ZZCA 1J59A 2UY8A 1IPKA 4HN0A 3ZDSA 1RUNA 5KHHA 1NE6A 2I45A 4Z82A 3G7DA 1H1IA 1O3SA 2Q1ZB 3RYKA 4ORFA 4I02A 4D7SA 4XF3A 4XFIA 2VQAA 4JV4A 3MYXA 3E97A 3NW4A 4HBNA 4N9HA 1FXZA 2BNNA 2IC1A 3FWEA 3LOIA 2PAMA 2GAUA 1ZRFA 2D5HA 3HT1A 3E6CC 1QXRA 3BCWA 1YFXA 4KL1A 4CYDA 4EV0A 4YRDA 2XKOA 4YYOA 3R6SA 4KWJA 1G6NA 4GULA 1O3RA 2PYTA 3ELNA 4MX3A 5C8WA 1ZRRA 2K9ZA 4EWDA 1V70A 2B9UA 4EWEA 3I59B 4QM8A 5AVPA 2Q0AA 1ZZ8A 3EJKA 5FLIA 3EBRA 4IEZA 5I0TA 3H7YA 4XEZA 4LUKA 1X8MA 4XFBA 4E2GA 2XGXA 1JUHA 5FLHA 4I01A 2QCSB 3RPQA 5JAXA 3CO2A 1UCXA 3D0SA 2ET7A 5BPXA 3LA2A 3N4MA 1UD1A 5E16A 5C6CA 2QJVA 3KCCA 1SEFA 1CGPA 4F8AA 4ZU4A 4Q0PA 3KGZA 4H7LA 1NZCA 3LWCA 3H1WA 5K8SA 4QGLA 2EAAA 2BNMA 1O5LA 2MHFA 1Q5OA 3E5QA 5F1RA 2OPKA 1VJ2A 3CEWA 3WW2A 3RYRA 3MPBA 2CGPA 5CADA 5JSRA 1CAWA 1DGWA 4HSJA 3H9AA 5FLJA 2ZCWA 4MGIE 2IXJA 1SQ4A 3H3ZA 2Z69A 4PIXA 4Q0SA 3FFQA 3DL3A 4RD7A 4HVQA 2MPFA 1CAVB 1YLLA 3ACLA 2V09A 3E6BA 2H0VA 3NSTA 1CAUA 2Z2SB 3LZZA 2XHKA 4E2QA 5I93A 1ZRCA 1J3PA 4FAHA 1EPZA 4MGZE 3E6DA 1H1MA 4ONUA 1NXMA 1Y9QA 2WFPA 4LTAA 4WZCA 4AQ2A 4FBFA 4I09A 3I59A 4JVAA 4XF0A 3NJZA 3BU7A 4IEPA 4XETA 3WW4A 5LEJA 3SMHA 4AVCA 3KSCA 3SCFA 4X6QB 2OZJA 3ES1A 3PVBB 4MZUA 3SCHA 1RL3A 4LA2A 4IESA 4R8HA 2EA7A 4HZFA 1CAWB 1ZX5A 4YARA 2QDRA 3FE5A 3UKVA 4Q0QA 4EWAA 2PQQA 4MV2A 2WC2A 2Y0OA 1GQHA 5FPXA 3IBMA 3RZZA 2O8QA 3HQXA 3QOPA 5I0RA 4Q0VA 4Q0UA 1CAUB 2B5HA 1O3TA 2BEOA 1UIJA 2E9QA 3TNPB 2HJIA 2ETEA 5KHKA 4AQ6A 1J58A 3IDCB 4O9EA 3BPZA 4IEVA 4AVBA 3E5UA 1VP6A 2EVXA 4MH0E 5JCTA 2O1QA 2XLAA 5LRRA 2OZ6A 3E5XA 3CF6E 2KXLA 1YFUA 4HVOA 3D0JA 4BYYA 3CL1A 4QGMA 4PIZA 4XF9A 1LRHA 3FX3A 1YFYA 4WVZA 1CAVA 2VECA 5BV6A 1IPJA 1CAXB 2GC3A 3H1MA 1ZVFA 2PAEA 1OI6A 3ROUA 4HLTA 4L11A 5FDBA 1OD5A 3RDIA 5JR7B 2IXCA 2UYAA 4HSLA 4N9IA 1YHFA 2FQPA 1ZZ9A 3GYDA 4IERA 3MZHA 5LEKA 3D82A 4KU8A 4UXAA 2PA7A 3QACA 4BIFA 3RNSA 2UY9A 4IETA 4WBBA 2D93A 4IEWA 1FT9A 4KU7A 2PHLA 3O14A 5KBFA 3IWZA 5EZWA 2QVSB 4YSFA 1J3QA 1O4TA 4XFCA 3LAGA 5J3UA 2PHDA 3LA3A 2ZKLA 3VHRA 3FJSA 4IEOA 2D40A 4EROA 5BY5A 3B02A 4D7TA 3TNQA 2P17A 1EY2A 3H8UA 2GC2A 1ZZBA 3LA7A 3WW3A 4KWLA 4LUMA 4XF4A 3H1YA 2IXIA 1LKNA 4IEQA 4A2UA 5LRSA 5JSOA 4XFHA 1LR5A 4OFGA 1QWRA 3NKTA 4LEJA 2XLGA
chains in the Genus database with same CATH superfamily
1V9U2 4ZZ5A 1TVKB 1EUTA 4RQPB 4LBJA 2AZ2A 2AHZA 1VAKA 5CB7A 2R49A 2QM7A 4GB31 4JTOA 4WV8A 2PXJA 1N3OA 3WDVA 4BDVB 2DYCA 1D0HA 3PVNA 2DURA 3B69A 3DYOA 3KB5A 2ZKNA 2VVFA 3HKDA 3J7HA 5A7PA 5ANQA 1ENQA 5F6KA 1VQ8V 4R9AA 4FLTA 1QLEB 2WO2A 4Q4W1 5KA6A 3IIIA 3LDBA 4DINB 2YXHA 5E1RA 5JCOA 4GQ7A 1B6QA 4AW7A 1CD3G 3J8F3 1K34A 2J1AA 4ATFA 2F4PA 3GZEA 1UOGA 5FIXA 3MW3A 5FYBA 4Q8LA 4E8DA 1RPRA 3WP4A 3IMNA 5B3SB 2DCZA 4D94A 4K1ZA 1ZWIC 1XNQO 3OGVA 1HJFA 4FT8A 4XUTA 3VZLA 4CU9A 4AEJA 2VJXA 2Z4FA 3OMIB 2DBNA 3GZUC 3AM2A 2BYVE 3AKQA 2VR4A 3AKPA 1HNXO 4K40A 5CU1A 2K0GA 3GHNA 2Q5ZA 1UW8A 2JEUA 4Q1PA 1LOCA 4JI2O 1B04A 3PUHA 4FFGA 1D4M3 1G9FA 4MW8A 2VUCA 1V55C 4AHZA 1FATA 3BVOA 3THDA 1W6NA 2QTWB 4YJ2B 2EXIA 3ABUA 1EN4A 1PO13 1LHNA 3AG1C 4X64B 4GMP1 3FKSG 4CEYA 1UPGA 5C70A 2LGQA 1YI9A 4DR6O 3WINE 1SLAA 3LFMA 2YPJA 3TRSB 1POQA 1BGYH 5FMBA 1W0JG 3WHUA 1L0LH 1RUE1 3WQ1A 4DO0A 3HT1A 2OTLV 4X66O 1V6JA 3B5LB 1WPBA 1N1VA 3L73H 4XAAA 3ZBHA 4IHJA 1F4MA 2HP8A 4HPKA 4FVVA 1FXKA 3ELNA 3K9AA 3T1HB 2B9UA 1J95A 1RM1C 3VB9A 4PA7A 1XMOB 4OMCA 1CONA 4B1MA 3R4UA 4DR3B 4LOTA 3CO2A 3VD7A 4QKNA 3W7WA 4FPEA 5E16A 4YM0A 5FUNA 2NR5A 2FZ1A 1Y9MA 1GU3A 4H7LA 1NCQA 4K3AA 4E4DX 2W52A 1N32B 3PMSA 4FPLA 4IUGA 1KC8W 1XI1A 4A7YA 2QTOA 2HEVF 4TXWA 4K9SA 1CAWA 2BERA 3GXUA 2ZCWA 3VKMA 5T50A 1LHOA 2IXJA 3H3ZA 4XYXA 1ACCA 4N7UA 4LE4A 1KP2A 2AW9A 2L6LA 1MPXA 2LALA 1W04A 2MW2B 1VBB3 4NXMO 2VU9A 3S57A 2QQKA 4IXLA 4RFT0 2IVIB 3CCMV 1MQTA 2I74A 3HQUA 4WBNB 2E32A 4XHBA 2EJ7A 4XJUA 2ADPA 5D5PA 4I55A 3WB0A 1K3IA 4O4JA 5FYIA 3ML0A 4KG8A 4J10A 2EA7A 2WS93 1CAWB 2QDRA 1SFYA 4MSVA 3ICXA 3NQHA 1PX4A 5JH7A 4V2WA 2H94A 1JOBA 1K5SA 1TA8A 1RMU1 3HQXA 2VUJA 3MW4A 5LA2A 1OBNA 4UCUA 5JXIA 3Q4HA 2B5HA 1BMV1 1BKZA 4AQ6A 3N9QA 4CU8A 3BPZA 1HP8A 5LA9A 5FKBA 1U5XA 5FUIA 2G38A 4WFEA 4XDLA 1MQTB 3HKCA 2LW8A 2V7QG 1D4M1 2MEV1 5LZ6A 1R3IC 4DZGA 4O4JB 2A73B 1HX6A 1YFYA 4WVZA 2VECA 1UNBA 1DBNA 1POV0 4AFAA 3JARB 5CKQA 4AGGA 1OD5A 1JZ3A 2CY6A 4W6YA 2E26A 3K3NA 1ZZ9A 5LEKA 2PA7A 4AI1A 5IE9A 3ZFGA 5C9AB 3CD6V 5FBJA 3OGRA 3N7LA 1XNQB 1Y67A 2WQZC 1VIWB 4AR2A 3M7MX 2BJSA 3WF3A 1VQPV 5DN2A 4LE3A 3VHRA 2ZD9A 4LP8A 3A0KA 1RP3B 3H8UA 1PX3A 5EWSA 3FHAA 2Y6KA 5FNVB 3PUIA 4LH6A 1W8WA 4RA0A 2RJKA 3OYWB 1XOYA 2BTOA 5GONB 2WZR2 1Y4WA 4B4QA 4YW4A 1B35A 1K92A 4O4HB 3IZOA 3L2HA 2DCKA 4QIWF 3P6BA 5GLUA 2WLIA 4NUBA 1UU5A 3EFFK 3OEEG 3ZFFC 2A6VA 1RUJ3 1H8EG 1LHWA 5EJ1B 4GIQA 2J1VA 1DZTA 4QNHB 3GZAA 4IE4A 4MS2A 1CWPA 1O7FA 1XNRO 1IX9A 1TUEB 4YJ3B 1VARA 1CIYA 1XC6A 1AP6A 1W0PA 2HWF2 2JJ6A 1B35B 2XKPA 2QQOA 3A23A 5LXTA 5C71A 4CCMA 3WF4A 1RHI3 3W5MA 2AXTZ 1HDJA 3ORJA 3OEBA 3T1YB 3AKTA 1DGLA 1WCSA 5LY2A 1J3RA 4D0QA 1L7RA 5EFUA 1XMQO 5B2GB 1RGSA 2JE8A 1X82A 2X5IC 1VMGA 1JYVA 2PN5A 4W50A 3SEPA 3N7KA 3J26N 4UCSA 4AVVA 3VBFA 4YY3B 3VBHC 1MS0A 2YICA 2WS91 3E2EA 1BHGA 1V54C 3BALA 3VHPA 1NJIW 4YG6A 5GZCA 1VBE1 4OVEA 1H2NA 4R7CA 1CIWA 3R4DB 4L2NA 4XXPA 4BQ3A 5C5TA 1T2XA 5DECA 1W6MA 1BYHA 1H9PA 4QB2A 4LNVA 1FOD3 1ZAUA 1AHSA 4Z07A 1U96A 2P3JA 1X9TA 2ZXWC 2RE9A 3W20A 3VBFB 5L7OC 3OG2A 2UU9O 4HNAB 1VQMV 2UXDB 2RS31 1F31A 3ZRVA 1OVPA 3USUA 4OUSA 3JB8A 5KMGA 1US2A 5I0SA 4CH6A 3O5SA 3TEZA 2W39A 4W4KA 1EM1A 1OCCB 4UFHA 4AOCA 4S2FA 4A5UB 1OLQA 2I45A 1S2EA 2XUMA 1HN0A 3AC0A 1GK9A 2QTSA 5CFDA 5CAZA 1W28A 1VBA1 2BNNA 2A6XA 3RZLA 3CB2A 1GQPA 5LA6B 1BS3A 3T4DA 1QOTA 4C0HA 1JMUB 3UT0A 5FL7G 3I2FA 2GBOA 1AXYA 4CDXA 5DZFA 4LF4O 4Y1XA 4OPHA 2VMCA 4JI8B 3I59B 2LW7A 5FLIA 5FY8A 1DF4A 3TN93 1JVMA 5K0UC 4JI6O 1AI6A 3IAQA 1AROP 3ZKYA 3RGBA 3KV9A 1VMJA 4DUWA 4BK4A 3B4SA 1WAZA 1MEC2 1RUJ1 5FP8A 1JFFB 1CGPA 3FBMA 3JU9A 3E22B 3W7UA 2DUOA 4C8DA 1W0KG 4TYSA 4TUYB 3NNJA 4M3CF 1U0AA 1MS8A 4IIJB 3JYCA 4J11A 1TUBB 2CGPA 1JU3A 5FOJB 5DAQA 1JZ2A 2OW4A 3H9AA 3W7SA 1XJAA 1NA1C 3WG7C 4PIXA 2CHHA 2XJQA 1QHTA 1FPN1 1V9PA 2F1MA 2HWD1 2IH3C 4FPGA 4HVQA 5DAPA 2IM9A 1CAUA 4QDQA 3P30A 3LZZA 1IKQA 4DUYB 3MHHC 1O4YA 2ADDA 2GNBA 2RDSA 3AMPA 4LTAA 1PGW1 1LU2A 3IAPA 3ECQA 4FBFA 2QQLA 4AK3A 4A7ZA 4TWKA 1Y6XA 3HQRA 4AI2A 2OZJA 5LASA 1RL3A 3AX4A 2OIIA 1BZKA 4ASMB 1GICA 2PLV1 3QH7A 1GANA 1RVF1 1HXS2 1W8UA 2WC2A 2VNRA 2HG5C 1G86A 2Y0OA 3SKJE 2W1UA 3RZZA 2LUWA 4IL6Z 1CAUB 4FM0A 3PJYA 3CIHA 3E1F1 1FOD1 3AG2B 1X36A 3N9PA 3UNPA 2PHUA 2P7TC 1W99A 2C24A 5FRAA 1QNYA 3TETA 3GBWA 2KXLA 4YIOA 1WA8B 3WG2A 3WSOA 1K5MB 3KVBA 3WG4A 1IDSA 4ZKIA 4W4LA 4DR2B 1KKDA 3APQA 4RR3A 2RS12 3VKLA 3VZKA 5FDBA 1BEV3 5FTTC 2UYAA 3AP5A 1YHFA 5A9GA 2DQ0A 3Q8FA 1H8TA 3DGEA 3RNSA 1B09A 2JENA 2ZX0A 4GH4B 2BOIA 1A3KA 2A7AA 4UUJC 5LBBA 1RUC3 5A7SA 5EZWA 3V0AA 1LOAA 1O4TA 3LAGA 5IWFA 1N34B 2XJVA 2PUSA 5FYVA 5F39A 2VUDA 4P9YA 1QNMA 1NCQC 3OPTA 2HJDA 2Q0OC 1DGSA 4NIHA 5EV7A 4AI3A 4Q2FA 4H37A 2DN9A 1GZWB 1R6KA 4ZONA 1EN5A 4LEJA 2X10A 2B8MA 4TV8A 1D0GA 2CU5A 1H8TB 3HWJA 1GKBA 4I2OA 1W90A 2W91A 4LKDA 2QQIA 4YXWG 4DV7B 3C8XA 1KP3A 2ZNJA 5CKMA 3T2PA 3KF5A 5FYCA 2YIBD 1GN2A 3QO8A 2JDAA 1MS9A 4XZPA 3JD3A 3RYHA 4NAMA 4W6WA 3OBAA 2QE7G 3NWKA 1ZRDA 4UF0B 1ZZ7A 2C0ZA 4OUMA 1EAH2 4CXWA 3VZJA 3IPVA 4JYBA 1A8DA 3AZVA 4LF5O 4CU6A 2WLNA 1K8AW 2HEPA 3X2QC 2CAVA 3SJQC 5E89A 4HXCA 3S0MA 1UQXA 3VD9A 3QTCA 4I4TA 4FM2A 1KQRA 1HR0B 1ZSPA 5FZDA 3RW0A 4LO7A 2EIEA 4PDWA 5FZ4A 5DZEA 5BR8B 1GAXA 3JD72 1ODNA 1BQPA 2DTWA 1DP0A 4LWSA 3LE0A 1R092 4QGNA 3IPVB 4HN1A 1UYYA 2W0FC 3ZFGC 3HT2A 3VBSB 4XVHA 4AFBA 4DK1A 1EN6A 1DGRA 3G80A 3HKEA 4GB32 4L8JA 1VQKV 2XQRA 3MV11 2NQYA 2W95A 3T2TA 1F35A 2UXBB 1C4RA 1X7NA 1SCRA 3OT7A 4HKWA 1BEV1 1H8HG 2LM3A 4OUEA 3DV8A 1WLEA 1QQP3 1YYNA 3UKNA 4BB3A 3Q8BA 2YXYA 1URXA 1ZZCA 4HN0A 4J7KA 2Q7HA 4LPLA 4Z82A 1RUC1 2BV4A 3GWKC 4Q4W2 1O3SA 4UVAA 3C3SA 1K5QA 2W0XA 2G9GA 3ZHQA 1LNQA 1PZ8A 1QJU3 4ZKTB 2W9XA 2E5LB 4Q4X3 5J2TB 3MD0A 1PVC3 2ZKOA 4KWJA 1G6NA 2HH9A 2IU3A 3J7NA 1NTZH 1P84F 1HV1A 1WD3A 2BBVA 3EBRA 1K3EA 4JCKA 3H1HH 2JG8A 1GM8A 4UFKA 1RSOB 3WNKA 1Q6IA 4CA9A 4JC1A 1QXPA 2YDEA 4D6RA 1OJHA 2WA4A 4U7OA 4M4RA 2QFEA 1XREA 1KS4A 3NNGA 2Q8EA 5F3GA 5AFBA 2JG9B 4RO2A 2ARCA 4AFMA 1US6A 2VQTA 1PHMA 4QX3A 5C8CA 3WNLA 4FQ4A 2ZGSA 5IVJA 1OD3A 3UGHA 4Q0SA 1SFPA 3LDRA 1CAVB 1HW7A 2V09A 3E6BA 5D8AA 4LBNA 4BLIA 2E3CA 2WZ8A 4EN0A 1I5PA 5KUKA 2J7MA 1VRH3 5L73A 4AQ2A 5A70A 1YQ6A 2A71A 1AR71 4IGGA 1WLWA 4JDMA 3SMHA 3BRCA 5FKCA 1R1ZA 1NBMG 2ZX1A 4GCZA 4LF7B 4J9ZB 4BW5A 1O4ZA 2OIEA 3FE5A 1RUE2 5L3BA 5LBCA 1MACA 4GKKB 1QU0A 2OUJA 2JKBA 3QOPA 1KYOF 4D7YA 4AAPA 1OUXA 1L8DA 3BUCA 3I2OA 5EJ3A 2ZX2A 4JAVA 4E4SA 5JCTA 1SDDB 1RUF3 1QQCA 2DWDC 3IM0A 4IT5A 2P5OA 4W6XA 5H9QA 3AG4C 4BYYA 4CH3A 3INAA 3CL1A 5EBMC 3KM5A 4IL7A 5HCAA 2VZSA 1AJPA 3ROUA 1ENRA 1AILA 3WVJA 4IERA 1CZSA 1QQP1 2J42A 2X8KA 1Z5VA 1JHJA 2ODMA 4N90A 2ZNIA 3ZX6A 4LHLA 5FMDA 2IBZH 3IB3A 4F6RB 4PV1B 2RJ2A 3NV2A 1WMXA 2JDUA 4P9JA 2XVKA 5FY7A 3RZKA 1W9WA 2E7TA 4ET7A 2M6YA 3B7MA 1VF6A 4KWLA 3N9NA 1YIJV 4EJRA 1G1XB 1XILA 3PJQA 4XFHA 3AP7A 1A6CA 3GWOA 1K97A 2RS53 2W6JG 1PMIA 4ZU5A 4AVAA 2E75B 3D3IA 4ES9A 2FMDA 2IFRA 1W2BU 4DR7B 5KLVH 2CH7B 1SDWA 5GLWA 5L3GA 5LL6Y 4KWKA 2OQ7A 4H33A 5BNPB 3K4DA 2Q4PA 2XL9A 4OX9B 2HKXA 2ZR3A 3S7IA 1BMV2 3OTOB 4P08A 4Y5Z0 1OF3A 3IDAA 1AX1A 2XQXA 1TME3 4Y20A 3ZYJB 1KXGA 1NU1H 1D4M2 2XMLA 2MEV2 5IDJA 4FZ1A 4JI1B 4F83A 2BU9A 3O7OA 2ORXA 2ZIOA 1HB4A 5DAVA 2WO7A 4JI3O 3NV4A 5H5NA 3IC7A 4Q4Y3 1AVMA 3PU3A 3AP9A 1ENVA 4DV6O 5LMUB 3IDBB 5FMCA 3PVOA 5GLVA 1VBC1 3B93A 3HKBB 3I2KA 2YG0A 4RS5A 3IC9A 3N2KB 4GLXA 4E2LA 1B06A 1K7DA 1OA4A 1O5UA 1E5IA 5KHJA 1SLIA 4M3CE 4RR3C 4TWTA 2Y0PA 2Q30A 4LF6O 1TE1B 2P6JA 1S5LZ 4DY3A 1LGCA 5GLTA 4N43A 1LODA 2A3QA 2NN4A 4CH5A 2AC1A 2BFUS 4QMAA 4P14A 4A3ZA 3K4ZA 4UVBA 2WLQA 1NT2B 5EPAA 5DUWA 1QCEA 3FLTA 4RS5B 2QBXA 1RUD3 1KDMA 1BVVA 3LB9A 1SZXA 4META 1S76D 1V6OA 5JZGA 3H7JA 1RXFA 5JOZA 1AR63 4K20A 4S2GA 1MZFA 4QXKA 1U12A 3WQ0A 4MVOA 3LEKA 3RI8A 2JECA 2XJSA 3ABLB 5FY9A 2BGPA 3WQ7A 4LQRA 2BOBC 1BL8A 2JEMA 3K08A 4DUZB 4MGSA 2VQAA 1RUI3 2IZWA 2BTVC 4CDQB 2EINC 3NW4A 4N9HA 5F5IA 4JX0A 1FXZA 2SBAA 1NQJA 4CEWB 2AEZA 1VBB2 2VW2A 3HPLC 3JAWA 2YC0A 5EC2C 1D4VB 5TSWA 5J2UA 3P3PA 2WYFA 2F4VB 2B7YA 3U4XA 1S0FA 4ISRA 5JZGB 4X1YA 2RS51 3AYAA 1C28A 1PVXA 4R8CA 2XBO3 1IXMA 1G6UA 4J9YB 4P9WA 5KUMA 3ZXDA 5CMUA 3LEIA 3AYCA 4E27A 4HKOA 3POBA 2YBSA 2CK3G 4E2GA 2WS92 5F5QA 2QKAA 1I7FA 1UOJA 2A1XA 2P37A 4LORA 2Z5WA 3CMAV 1ZX3A 1VBE2 5LWBA 4BOWA 3SH4A 5GM0A 4QGLA 4PI0A 4NHXA 4AWDA 5LK7B 2VAUA 4ARYA 3GHMA 2TBVA 5A2QN 4PDWC 4X1YB 3CNAA 3RYRA 5JSRA 2WLLA 5HBAA 4X1KA 4P5YA 3J80N 1PNKA 3PUSA 4PJ0Z 1LJ7A 3UJOA 1J5EO 2RS32 5J98B 2YGLA 2DBIA 2Z2SB 1JU4A 3E86A 3GCXA 2P4EA 1JOJA 4JZ2A 2WFPA 2R6QA 5A7WA 4R9BA 3NR7A 1VRBA 4I0WB 4JVAA 4O4IA 4NHYA 2Q8VA 4WM8A 3SCHA 1GZTA 1VBA2 1M4UA 3Q8CA 3K4AA 4BXSV 1AR83 4MTOA 3M7AA 2F43G 1M06G 1CP9A 3RBZA 3UT5A 2UUBB 1VP7A 3DXUA 1UN1A 4OHZA 5D21A 4YIPA 3JATA 1QR8A 2E9QA 4KFMA 1DQ2A 4XJAA 5BNNB 5A1AA 4ZI7B 3I5DA 1SBDA 4A3XA 1JOYA 2DJVA 1R64A 1LENA 1NCRC 2OZ6A 4GKXA 5EYPA 3RZGA 1HRV3 4QE7A 1OCOC 4O4IB 1W6OA 2Y69C 1YQCA 4XDQA 1RUJ2 4I50A 2DDUA 3ZXKA 2LROA 1RB8G 3S30A 1GP4A 4YZ1A 1AR61 4KWUA 4COYA 1ZRIA 5CG9A 2VWJA 5JR7B 4D6QA 4HSLA 3D82A 3JQWA 3F95A 1BVP1 1V9U3 1WA6X 4XQDA 3TEYA 4IETA 1UU4A 4RQPC 1O9GA 4IEWA 2JG8C 1VQ7V 3APBA 1FJGB 4B3RO 1Q8OA 2ZKLA 3SJBC 2HWD2 4PLNA 5CA1A 2P3YA 4LIUA 4YLZA 3A0RA 3ZSJA 4J7JA 5GTIZ 4V1PA 1ULCA 3WW3A 5CNAA 1W6OB 2Q69A 3ZSLA 5LBEA 2VH9A 1LKNA 3RQ0A 4I0XB 1JOPA 5J9PC 5JSOA 1E57A 1PGW2 3WLUA 1DQ6A 2ZGMA 3BAAA 1J1TA 2XNDG 3VDDA 3CMEV 4FCAA 5C8CC 5IVYA 3WNXA 1QLEC 5JR2A 2RG4A 4QX8A 2DUPA 4KH9A 3UL2A 3WR0A 4FLVA 2PLV2 3FUQA 5A1LA 5D8AC 1RVF2 4Z92B 3NNMA 1BHAA 5ISLA 2TEPA 2RMKB 4BM8A 1UMHA 1KDKA 4UCRA 4X88A 4W65A 4BPZA 4JI0O 1DZRA 1PGL1 4L0PA 1XRUA 2FDFA 1WCUA 1SA0A 1JH5A 4YGBA 1FOD2 2ZAAA 1SBEA 4LITA 4OLLA 4XMIA 2KB1A 5LOVB 1X8EA 2ZGKA 3VDDB 3ABMB 4TZDA 1FFXA 2BWAA 3GDBA 3OAAG 5IYBO 1UIKA 2EILC 3K0GA 3PDQA 4DPNA 1JR9A 1DDLA 3RRDA 4RUEA 4UCOA 1UPSA 2VWKA 1TMF3 3ZEDA 1OMIA 1UXXX 5BNOB 5B1NA 3K59A 2IXKA 3M3IA 2FMYA 4MADA 3OGJA 1GFF2 4MHRA 1VR3A 2VBBA 3SYPA 5BXXA 2GZWA 3J9SA 1S0EA 1OKQA 3JALB 4ZOLA 5FV3A 2R30A 3KHCA 1QOOA 5A6YA 1AR81 2WNVC 2G1MA 3B77A 1Z0HA 5FXVA 1NVPD 1W2UA 1TNRA 1WLTA 4A44A 3I54A 3VUOA 4BAYA 3WP5A 1K4DC 3VOUA 2YIAA 2WLMA 1KBHA 3KQRA 5FQ0A 2IJJA 3B9CA 5K1PA 5CB4A 5HCBA 1YI7A 2E74B 3NVCA 2KKWA 3TN92 4O4LA 2Q73A 3CEIA 3NMBA 2EJRA 1TEIA 1KJRA 1ZNPA 3LF7A 1HB3A 2GP3A 3KLSA 2V72A 4ZOLB 2DU0A 4X8PA 2PQSA 1G9DA 5CISA 3ZLIA 5AC93 5A33A 4R6ZA 1PK6B 3IMMA 4PD4F 1Y3TA 5FYSA 3GALA 4MVSA 1LTEA 4UYBA 5E88A 3VBRA 5AFEA 1W8TA 4H44B 3G67A 4IE0A 4QX0A 3FMGA 4H13B 2Y6HA 1N1TA 2A06H 3SYQA 3G7DA 5KAFZ 2O0OA 4C90A 3BY6A 5CB4B 1LESA 2C5DA 1WCQA 5GZDA 2ARBA 3ASOC 2IC1A 2YROA 1Z7S3 4BQ5A 2A6YA 1MVEA 2A6ZA 1ZRFA 4Z1VA 4XPVA 5J37A 3LDCA 4NIIA 4XBFA 2D7FA 4XBNA 1MS5A 1QEXA 4DUVA 1ZRRA 3K57A 2ZIMA 1UJWB 2ZGRA 1SPPB 4DV1B 5BZBA 3LGRA 1X8MA 5LCWL 1GOHA 2JIJA 3RPQA 3TGUH 4JGZA 3I2HA 1I0HA 2WNUB 3K58A 4FPOB 1R083 4CCDA 5EC1C 4PDRA 5K8SA 4IE6A 4H3WA 2DMXA 2BWCA 2JKXA 2Y34A 1GN6A 5F1RA 4UFIA 2D3SA 1BBT1 1REFA 2EIKC 4QPYA 3ASNC 1REEA 1F9KA 1HNWO 4PBPA 4K8ZA 3OR7C 3ZX7A 3O0WA 4N23A 4N43C 1AYN1 1BEV2 4FOQA 4GZ9A 5LBQA 1XQ8A 1TMF1 3IJ4A 1ND2B 5I93A 3ZYRA 1EPZA 5A32B 4DB5A 4K0KO 1RUH3 4ABMA 1QJY1 4LFCB 1RUC2 3UO3A 1OOPA 5JPMB 1ND3B 2DCYA 3A22A 5FBZA 5B1BB 2B46X 3SCFA 4X6QB 4QQ2A 3ES1A 1OA3A 4R8HA 1DG6A 4BLJA 4DYLA 1GNYA 4O2BA 5L9BA 3OBRA 2Z5UA 3WF0A 1QVGU 1NQTA 3IDEA 3WUDA 1UYPA 5IWAO 4LIVA 2O8QA 1O8PA 2BE3A 1Q6HA 2VY0A 2OCCC 3IDCB 5JI7A 2XJPA 1VP6A 1DYPA 2VTXA 1AP5A 4WCEV 5G05L 1OOPB 1ST8A 3BIWE 4MVZA 4CP9B 4KNCA 5KXEA 2D43A 2E6VA 2VQFO 3RYFA 2ZS6B 4K7JA 3SPJA 1VBD1 4L9BA 4XF9A 4IV1A 1F7YA 2DF7A 4UFMA 1YRZA 4BCUA 1I9RA 3NJVA 3LDKA 4QPIA 2JD4A 1R73A 1XYNA 4LBQB 1LOFA 2WZR3 1XHXA 1AI5A 3K75B 4JYAB 3ZRWA 2Y26A 4LT5A 3NAPB 2AYHA 4XFCA 1RUG3 2HEWF 4XQ4A 3LA3A 1L7QA 4KGQA 3H1IH 4CDUA 5FP4A 3B02A 3BPSA 4D7TA 5FP7A 3RYFB 4XF4A 2ZEYA 3NXSA 4IV1B 3KD4A 5F3EA 1DGWX 3ZYBA 1YJNV 3JAKA 3WX5A 4UB6Z 4NAOA 1OPOA 3NKTA 1AR72 3M2MA 3PU8A 3KV4A 3J7MA 1IBLO 4TTGA 2HWF3 3MUZ1 1QXJA 2B1IA 1HQNA 4JAUA 2JGDA 4J42A 2V4DA 3D3QA 3ZFEC 2ATFA 2PHXA 2D5FA 2WWSA 1W8OA 4CDUB 1EP0A 1FNZA 3NL1A 2BSKB 2NLJC 5IFTA 1K9MW 1R081 3ES4A 3CU7A 2ZEXA 3WF2A 1EYBA 5JSPA 4XXAA 4QX5A 1AL23 4WM8C 4XDJA 1ULFA 2VG9A 2H6CA 4JKLA 4YW1A 3VHOA 3O12A 5I8SA 2K1EA 1QOSA 1GUIA 5BYNA 1IG3A 3ACGA 5CKNA 2OQ6A 4YVSA 2JGDB 1MMMA 2EIDA 2KM2A 5FZ6A 3N27A 3FHIB 1UMIA 1VF7A 1IVSA 2D3PA 3N7JA 3WF1A 4XCBA 4DOUA 1QQP2 3VBOA 2ZDIC 1QH7A 2G9ZA 1FKAO 2LP7A 4X65B 5DDJ3 5LYJA 2YUEA 4LOSA 1FFTB 3VLBB 3SEEA 1LGNA 4G2KA 1YJWV 4CXXA 3HVDA 2XVLA 1N36B 3DXTA 2AR6A 3VBUA 4CP1A 2MNGA 3WNMA 1YI2V 5JPNB 2JDIG 1IBKO 5JJEB 2VTXJ 3RZHA 1SETA 2ID4A 4W8JA 3MUY1 3OCPA 1ENXA 1I5YA 5DXDA 5TISZ 4QX7A 1KB9F 4Z1MG 3U78A 4QHOA 4JHTA 3SGIA 2IXHA 2XJTA 4JF3A 3GNEA 4NWWA 3BFRA 3L70H 1UZZA 2WQ8A 1RTVA 4WM7B 5DG1A 2PMWB 5LK5A 2PTMA 1JODA 5K9YA 5T5JA 2D3OW 4AEDB 5KWRA 5KA5A 4FVMA 3BHPA 3I97A 2EAKA 3JQXA 5GZGA 2TNFA 3AXDA 2D6MA 5C4WA 1HWYA 4C1XA 1VQ6V 4U36A 2XAQA 2GTAA 5B4NA 1E5SA 1MEC3 1I94O 1N0JA 2GDSA 2QJ1A 1GP6A 4P5HA 4U3JA 2W94A 4EV0A 2P4KA 1VBC2 4FO9A 4JYYA 3QVNA 1CZVA 1NLRA 1DZQA 1K42A 2WAMA 2Q0AA 4P9XA 3VZOA 2BUKA 5I0TA 2ZINA 3C3TA 5HCFA 1UWWA 1C1FA 4ZS3A 4AEMA 2JB4A 5FLHA 3RYCB 1AX0A 3D36A 4I01A 2WSUA 2CWSA 2D6LX 2VMEA 5EK0A 3B9IA 1IZ3A 4MGTA 3MEPA 2VZ1A 1BLZA 3LOBA 1UMZA 2VMIA 2JE7A 4Q27A 1UOFA 1RUF2 1AL21 2VCAA 2ZGQA 4HKLA 4JI4O 3ILNA 2ZCEA 1GM7A 4HSJA 3ZHRA 1V6MA 2G4IA 5L9RA 3JAMN 5DPNA 4LO6B 1IBMB 1BMFG 3TCUA 3CRQA 2GH8A 3I3MA 3AL6A 3ZVXA 1AI4A 1FS0G 3FB6C 4P30A 4MXWB 2R1BA 1SACA 4XIOA 1VQ5V 4TV9B 1FX5A 5DDJ1 2IVJA 1CJPA 3AG2C 4X1IB 2GP5A 3UGFA 5F8PA 4B08A 2YEVA 1QMJA 4FLWA 3BIEA 1T6BX 4PT6A 1VPHA 1K5MC 1ZX5A 2ZACA 3HOBA 5K4LA 2Y6FA 1WB8A 4DV5B 4G3YC 2O8OA 2R9AA 2WWJA 5L36A 1V55B 2VS0A 5BMVB 1C1LA 1MVQA 2RS52 1W03A 4Q0VA 5H6RA 2ZJCA 3QLQA 5IY5C 3ZR5A 2QWNB 2WUHA 3O0VA 1DHKB 3HN1A 4LO8A 3H8RA 3RZMA 3G6EV 1VB2A 1YFUA 4HVOA 3AG3B 3D0JA 5GKAC 3VDAA 1NTKH 3P1IA 5CA0B 1NH2B 1CAXB 1ZUQA 3FB5C 2FDIA 1W05A 3ETGA 4RAIA 1XYPA 1TME2 1UX6A 1IG0A 2PHFA 4DQAA 1H8VA 3NJXA 2ZM6O 2V73A 2JS5A 2R72A 3O14A 2GTSA 3AZWA 3ZXFA 5ABJC 1S0DA 3FJSA 2E53A 1GO3F 5AG2A 3LFIA 4IV3B 1EY2A 4GWJA 2XHBA 4UW4A 3PIJA 2GV9A 4OI1A 4IEQA 4QQHA 4OQ8A 2ZGOA 4GWNA 2XLGA 4BQXA 1U5IA 2VVEA 5FZFA 3UYJA 1I08A 4IQPA 2EIJB 4B7KA 4JKMA 5JVDA 4CC5A 3PMEA 4LNUB 1CXZB 5HXVA 3SDLA 1H0BA 1OCZB 2G19A 2PHWA 2ZA9A 1IURA 4GYCB 1UFIA 2NP0A 3K46A 4BHPA 3NRUA 4XQWA 4GAZA 1X9PA 2X29A 5EZYB 3GCWA 4UB8Z 4NJ4A 2EICA 2DCTA 1SQPH 4DV2O 4DW0A 5LMNB 2XJUA 4LF9O 4NRMA 3RFRA 3VQYA 1AR62 5LY1A 4Y22A 5E1AC 2ZABA 5EBLC 3RYIA 3JASA 3OMAB 2XAJA 1GWMA 4FOWA 4MTFA 3ZXJA 2GH2A 4EN7B 2VQEO 3DXRB 4JI7O 5BNQA 4XFFA 5FZ8A 4GB33 1O8SA 3H50A 1S55A 2N74A 4GXLA 4Q8KA 1S5HC 2ZZQA 1UZ0A 2D44A 2JDPA 4DUXA 4Y5TA 2ES3A 1DLLA 2J1RA 4QPIC 3DKWA 5FO7B 5C3OA 4YW3A 1Q8PA 5IW0A 3ZIXA 5B4XA 1URFA 3MICA 3T0BA 2ZR2A 2Q1FA 1LEDA 2KG7A 1WBFA 1STMA 5IVFA 1VF5B 3WW1A 2VBDA 1XNBA 4B3SO 4GX2A 4Q4W3 3THCA 4HVRA 3B3QE 4WVWA 2P4VA 2A79B 1HB1A 1YQ8A 4OI4A 3AG7A 2XDVA 3B09A 4NN0A 1AYM3 4I0AA 3O0XA 4DR1B 1YSCA 5DUVA 4FTSA 2CNAA 3WV6A 3LEMA 3G71V 1Q8SA 3CJIB 1BQZA 2ZX3A 2FCTA 1PMHX 1W3XA 3BN6A 3VQVA 1PMJX 2ZMNA 2XG3A 2OPWA 3POYA 4RUFA 1JCHA 1GOFA 3E97A 5IJ0A 4XE9A 2NMNA 3OB8A 5DQ0A 5F6LB 1M9NA 2DVAA 2Z42A 2JRIA 4MW3A 2JE9A 2WRAA 1Q7YW 4IE5A 2UUAB 2XKOA 4LFAO 3ZFFB 3QO7A 5FY4A 1XDCA 2X5IA 3AK1A 1KEXA 3HR9A 4JI5O 1SMVA 4M3CA 3ZMUA 1OUSA 1W6PB 4EWEA 2E63A 4NPRA 5AVPA 3Q9OA 3UKMA 2BZDA 4KP4A 2VOTA 1VEWA 3H7YA 1DTOA 4NRPA 3LCPA 3VBHA 4YVSC 3ZOIA 1AR82 1JQ0A 3ETPA 5FZOB 1W06A 2ET7A 3VBOC 1Y74B 3CZUA 2QJVA 1APNA 4WF9V 4F8AA 4PCRA 4AVSA 3SLIA 1NZCA 2OS2A 3LWCA 4PDLA 1AXKA 1US3A 1Z78A 1OA2A 2H3OA 5JXJA 3CP1A 2GNDA 1PPJH 4K3UA 3AMQA 1H4HA 1VJ2A 4PF5A 2X5IB 4ZBMA 1YTFB 4CDWA 2BQPA 2I2SA 2WT0A 4MGIE 4HYOA 4DR4O 4JGYB 4C91A 1JYWA 1BT8A 3VBHB 5C3RA 4UXNA 2HWB3 1W6QB 3MV01 3H8XA 3N2GB 5JIAA 1SZBA 2H8PC 2L9LA 4PI2A 5J09A 3U75A 3ZN4A 2RDQA 4H0LB 2C6SA 1H2GA 5FK7A 4FPHA 1ZL8A 5JMCA 1Q56A 4LA2A 1KD1W 4LF8O 5LP6B 4YARA 2BTQA 3UKVA 4LLFA 3OE7G 2ZXWB 4MV2A 4ZXEA 2P34A 5L7OB 3ABKB 3RJ2X 5EYXA 3AZYA 3VKNA 2RDCA 3A4UA 4XDOA 3OY8B 2CTQA 1SESA 1UIJA 3SH3A 5C4WC 1J58A 1QGLA 3ZN6A 4N7IA 2ZXQA 4PBOA 2VMFA 4B4RA 4RHV3 4QQPA 3J7LA 3E5XA 2Q9LA 5K0UA 1S0GA 1ZM1A 2F4LA 1NS1A 4PIZA 1LRHA 1AYM1 1GZ9A 3H1MA 1CPMA 4A41A 3SQOA 2SLIA 3HKDB 4E4EA 3GYDA 1HRI3 3L75H 3L2YA 1XBLA 4FPFA 4BIFA 1NX9A 4WBBA 2NZ9A 4FOYA 1FT9A 1JYNA 4OHXA 5LHGA 4YSFA 3RG0A 3D36C 1NA1A 4AG4A 4XIKA 1DLCA 2FTKA 1AYN2 3AXEA 5K0UB 3TNQA 3L72H 3GZTB 1RMU3 1ZZBA 1FXVA 1TMF2 2C1FA 1SF9A 2ZTNA 2D3RA 3K5LA 1S3JA 4DV0O 1W39A 3KV5A 1R3LC 4QU1A 4Q4V3 5FPRA 2XVGA 1ZREA 3O1TA 3K2OA 1NYWA 1I5ZA 3H3UA 2OT5A 3I7DA 1FV3A 5FZHA 2MEV3 4FFBA 1AI7A 1WA4A 3NJYA 4QPGC 3MIGA 5CBFA 1LB2A 5C7GA 1SQGA 3ABTA 3ZHSA 4FPPA 1AR4A 1RC6A 1OQDA 4EEQA 2EXJA 4LULA 2TUNA 4XILA 3WG7B 2N05A 1S0JA 1YJ9V 4CCEA 4J1XA 1XSQA 3SNMA 4AGVA 1XYOA 2RR11 4MTXA 2ARAA 1WN7A 1KKCA 4F7ZA 2ZGPA 4HL0A 4MHUA 2IJHA 3FC0A 5GTHZ 2N7GA 2XR4A 5A3WA 1OH4A 2PF4E 3FB7C 3KMHA 5IAVA 4K8FA 4YVWA 2XL7A 2VW1A 4NE9A 5AC92 3F7YC 4FFBB 1GP5A 5FPUA 2HWB1 4LFAB 2Q1MA 3VHNA 3KWVA 2KA3A 1W6NB 4QHZA 3TWIA 2LGWA 4YZ3A 4CEYB 2YXSA 1V6LA 1OURA 4MVUA 3SCGA 2PI4A 2Q8DA 3ZMVA 4XZUG 4JZGA 3W59A 5DAXA 3ME2A 1Z7S2 2ZGNA 3EHKA 5J1XA 3ZIAG 3ABZA 4JDNA 4QQOA 3THPA 2PZSA 1YITV 2Q7GA 4BWOA 1JZ7A 3U0ZA 3ZYGA 5A3PA 4LA3A 1OLME 1YO8A 3EQEA 1BK0A 2CAZC 4GWIA 4IHJB 3L9DA 4HPKB 1FXKB 3ABLC 2GSYA 1S1AA 4BQ2A 3W58A 4RHV1 4COUA 3EO6A 4DR4B 3A0NA 3WEZA 4YZ5A 3PUQA 4CEWC 3VDBA 2ZGUA 2X6BA 3VZNA 1RUOA 2V5DA 3VN4A 3ZKUA 1R082 3CCJV 3AEIA 4DXRA 1HRI1 1NCQB 4WFGA 4X6RB 2HWC3 5A7NA 2I07B 4YZ4A 4YFZA 3KZ4C 3NO8A 4RGKA 4QX2A 3MIBA 4XJWA 2F6BA 1T5EA 2GNTA 1M56B 1K5JA 2FL4A 2EF6A 5F3CA 3MIEA 3I55V 2C26A 5H9CA 3AJZA 4L87A 2WINB 3I49A 3AYEA 1VBE3 1LAJA 2UUCO 3I3EA 3BCWA 3HNYM 3SR2C 1RUH2 3AJYA 4YRDA 3SJAC 5JLVA 1HNZO 1D5AA 1S0CA 2OIGA 4Q4V1 5H9RA 3MIHA 4UFJA 1PZ9A 2JK5C 3K3WA 4DV4O 2P1BA 5EBWC 1UY3A 2GMMA 4I55B 2XGXA 1UAIA 2PHRA 4QXHA 1DIWA 3WUCA 1KFXL 2JIGA 3MI8A 2RS33 4NXNO 4MYEA 4GJZA 5JH7B 4E8CA 1SEFA 1XNKA 4NR1A 1MS4A 2XWJB 1NR7A 3Q4HB 1VQLV 2EAAA 3AZZA 2Y8KA 3A0HZ 4N21A 2JWPA 3E5QA 3MGUA 3BCCH 2OPKA 1N1YA 1WW4A 5CADA 2P3KA 3ZXLA 2ZAHA 1S2KA 4AZZA 5FMOS 1VMFA 3HKCB 3ON7A 1VBA3 4ISQA 3H3LA 5JI9A 3A2FA 1SQ4A 1HNXB 1UYZA 3I56V 2EZPA 3I3QA 2MPFA 2WN3A 1WW6A 4H55A 4IYIA 3NSTA 4XW3A 4U2AA 2BVBA 3OBTA 5F37A 2Q6AA 1J3PA 4JI2B 4LMFA 2HVJC 4ONUA 1Y9QA 1ULPA 3ZFGB 5IYYA 5BNNC 1XBFA 2QWPB 1GNHA 1RUG2 1UX7A 4B4PA 4EB6A 4INDA 4QAWA 3IGAC 2EULA 4GKYA 5A80A 3ZMSA 1SQXH 2JVDA 4U7NA 1ZA4A 1X50A 3T1CA 3MHZA 3WG1A 1ROPA 4DR6B 1R1A1 3RZJA 4BA6A 3QD6A 4O2AA 3C7OA 3TNPB 2GUZA 5LHIA 3E8BA 3CJHA 3K06A 5KHKA 2EXKA 5FZ9A 2XLAA 5EHDA 3PTRB 4PQ9A 1I5XA 4X66B 4CBCA 1FPN3 1Y76A 3VDCA 4RSUA 3ENRA 2HWD3 3C90A 2WLIB 3ACHA 2GC3A 1TGOA 4Z2AA 1FAYA 3ZXGA 2QEXV 4HLTA 3TAYA 4L11A 4DK0A 2A3WA 1JXNA 3BU0A 3URFA 2AACA 3MBWA 3HB3B 2HWC1 2VOWA 1AL22 3O9OA 2UXCO 4NKGB 2JDKA 2WABA 3B00A 2VZTA 2XAGA 4YHHO 3BTXA 2PLV3 3N3HA 2D40A 1RVF3 4FZ0A 1DQ5A 4DRVA 5LXTB 4X62O 4B3TO 4GA9A 4FTEA 2X6CA 3OGIB 4LR3A 4QPJA 5DDJ2 5ITZA 4OFGA 1QWRA 5CBGA 3K0DA 1C3HA 2UWBA 4CDWC 2QWRB 3ABMC 1RINA 4DR5O 2ZHNA 3W7TA 2Q4SA 3GF6A 4NXMB 2C9KA 2VOKA 1RYYA 4BIZA 3OR6C 4IGPA 2WNEA 1ZTEA 2K46A 2E7AA 4TOIA 4FM1A 2IU0A 4JQRA 2P06A 5FPVA 1JJOA 3DC5A 1MSDA 2LW1A 1Q8QA 1J1LA 1GLHA 1W6MB 4RWUA 1JUIA 4Q29A 1UY0A 4H7MA 4OZXA 1OQEA 5FZ3A 4BIUA 4NHMA 5FZBA 1W8NA 4OMDA 1S2BA 3KT7A 2QA4V 2ZEWA 3HMYA 3ZCCA 2ADQB 5CVRA 4DV3O 1S0VA 5JQGA 1JZ6A 4LFBO 4JV5O 3JZVA 2G9FA 2NLRA 3USUB 5KMGB 2VM9A 3JCIA 1WGPA 2XLFA 4O65A 3T08A 2R0HA 4PJYA 3ZSKA 2ZBJA 5CA3A 5CBHA 4YGEA 3JUUA 2X53S 3ETQA 4TLFA 1OSGA 4NPLA 5IJ9A 4FLZA 1BE3H 3NNLA 4GKJO 4UV8A 1GKFA 3JCZA 1L3JA 3E8FA 5CFDB 1H38A 1UU6A 5C8YA 1P7GA 3CCUV 3AG4B 2XJRA 4BMEA 3CC2V 1PK6C 2PY5A 2HLEA 2ZE8A 3D6EA 2X09A 2X0LA 1VQ4V 1XQNA 2WKKA 4MOAA 5G04L 4NHLA 4CDXB 2DW4A 4YW5A 2OT7A 5I8TA 3A7QA 3DYPA 2D97A 1S0IA 1CX4A 2QKCA 1JW6A 4X89A 4CPBD 3FAVA 2VPVA 4XBQA 3AVSA 4D3WA 4YNIA 5C8YB 3SPGA 1UZVA 3ZMNA 3U10A 2QKSA 1NQDA 3OUHA 4I3PA 2VZUA 1UKGA 5KHGA 5L3CA 2XPJA 5DG2A 1J59A 2R061 3T4HB 1NT0A 3SPCA 5FWEA 1REDA 1DYOA 5DABA 1W0OA 1R6TA 3JB4C 2KQXA 4D7SA 4FLXA 4XFIA 1PO21 4HBNA 3WNPA 5IJRA 3P3NA 1H1AA 2DWEC 2ZE7A 2R071 3T2OA 1XNRB 1QHDA 3FAVB 5IK7A 4LR4A 4KL1A 4BQYA 4G9SB 3QF7A 2JX9A 5C3PA 2OTJV 4HAMA 2VMGA 1ZZ8A 2AZ0A 4N53C 1ONAA 4YVWC 1FYJA 4HT1T 4DRXA 1YIPA 4XEZA 3OEHG 4YFWA 2XB6C 3T30A 1XMQB 5JAXA 1K73W 2W92A 1UD1A 1EV11 3IT8A 3FB8C 1MSWD 3I3DA 3H01A 4Q0PA 1WWYA 5DM6V 1ND3C 1XL4A 3WW2A 3ZDVA 4IGOA 3LDEA 2W3JA 2IUWA 3NV3A 3H0OA 1AJQA 1WMFA 4IW3A 2GMPA 4JRLA 1NY71 4DO2A 1EBOA 2RVAA 1N3QA 3DL3A 2C4XA 4GWMA 2YSUB 5JXHA 1YLLA 3KHBA 4FPCA 4RR3B 4BXFA 4B8EA 3POFA 4J7ZA 1F23A 1SBFA 5IK5A 4ZY9A 4I09A 4S2HA 5IT6A 2UU9B 4URAA 2LTNA 3V0AB 3LPFA 3G6JB 4JPRA 2HR3A 2LO1A 1W8HA 1LUWA 3ZPYA 5IFPA 4AVTA 2J1SA 5APAA 5JUVA 3JD0A 5FZ0A 3JCUZ 2LQTA 1OCRB 2W6IG 4L97A 1PM4A 2QDNA 1X33A 4B1LA 1IXBA 4TV8B 4AQSA 1A78A 4W4ZA 3V0BA 4QGMA 3OM3B 2WN2A 4PQQA 1IPSA 2W1QA 5BV6A 1GM9A 3KG2A 1QBZA 4LF4B 2EINB 2W46A 5DEDA 2V5YA 1XNTA 5EYYA 1ENSA 3DYMA 3RDIA 4UXAA 1FYUA 4D6TH 2RS11 4JI6B 1AR73 4MTGA 3UQ8A 3RYHB 1N4CA 4LBKA 2QQUA 3N7MA 2P90A 1UXZA 5IYCO 1FD9A 2WWWA 1H30A 4QU2A 4ZS2A 2E76B 1TNFA 3T1LA 4EKWA 1QDOA 1M4WA 3PVEA 1KS5A 4DEVA 5LRSA 3POSA 2YY1A 3POJA 5AVAA 3WP6A 4I4TB 3D4KA 1SFNA 1XOUA 4UFZA 2ZMKA 4NYKA 1UZYA 2EIMB 4PDWB 4X64O 3U1XA 3ZMZA 2ET1A 4N8MA 2DTYA 3JSLA 3K04A 4LWSB 1ASJ3 4CRQA 4NOTA 5CFCA 1G9CA 1TZOA 2ORZA 3CKHA 3CX5F 3K9SA 3J81N 3R4SA 2Y38A 1BZWA 5JVVA 2QR4A 2GC1A 1NCRA 1GV9A 3UO2A 3HKEB 5FPZA 1AYM2 3T1HO 2WT2A 1WNSA 3VL8A 1D2DA 4WVMA 1IS4A 2DOSA 2P2KA 4OXSA 2P5BA 1H2MA 1XMOO 1VB4A 4FFKA 1YXBA 3LNNA 4DR3O 1FMD1 2E51A 5KAIZ 3FZ3A 1TVKA 4RQPA 3T3YA 3JD1A 4YM2A 3I2IA 5IK8A 4HANA 3LSUA 3PUAA 3MIDA 3W9AA 1N32O 1BCXA 4CUCA 4KHPO 1AXZA 3TBDA 1OCOB 4CUAA 3MFAA 3DUIA 1PD3A 3JD71 4XTPA 5IT9N 5FWJA 5D2AA 4WVMB 2Y48A 2YZ4A 4FPKA 2VZVA 3USSA 1LNSA 1GMMA 2RJZA 2CWMA 1DLBA 3R05A 2XONA 3ZRXA 1C57A 3OGSA 5T3NA 2JG8B 1PL0A 3MLJA 2GC0A 4B3NA 4JAAA 2B4KA 3P5BA 2J22A 2ITCC 1PZ7A 2RMU3 3AFKA 4OPAA 3SYAA 2ETNA 1C5IA 2RR12 4FAGA 3J4UH 1VBC3 3CXHF 4YW7A 2Y64A 4QM9A 3QO5A 4AXOA 4XC9A 2QM8A 2HFEC 4A4AA 3CYOA 2OYZA 1AB3A 4U3FH 1WUVA 5KHHA 1Y4MA 4ASKA 4Q5OA 2QZ2A 2Q1ZB 3APOA 1GWLA 5C8CB 2ZOEB 1SQVH 4P02B 1W2OA 4JV4A 4K1YA 2ENRA 5A3UA 2DYSB 2HWB2 4CE8A 4A42A 4FFIA 2K9PA 1FNYA 2WO1A 3K48A 5D8AB 3U37A 4LBMA 3ACFA 3RI9A 1XB9A 4YYOA 3UV9A 5GZFA 4P9IA 5C8WA 3M4FA 5LBFA 4AL9A 4EWDA 1XPWA 4LF5B 2HLDG 2B45X 4FP3A 2QGNA 2D98A 5FYUA 4XBLA 4IEZA 2Q7EA 2VO5A 2VZQA 4UOJA 4UT5A 2JDYA 2WNVA 1ASJ1 3VKOA 2EILB 4YJ2A 1DQ4A 1XU1A 5F32A 4ZU4A 2FZ2A 1GNZA 1QVFU 3EHBB 4RHV2 1DGRN 2MHFA 3UK9A 4MG2A 2CL2A 2ZMLA 1AR91 3WB2A 3AP6A 2EIGA 4AE2A 1HRI2 3ILFA 2WNVB 4ASUG 3KF3A 3RWNA 4P00B 1SLLA 2A5ZA 3ETEA 3BYWA 3OGCC 3KSCA 2WFF1 3CS5A 4K21A 2DVFA 3AG3C 4AHXA 1RMU2 3CPWU 2UWCA 3IFXA 3CC4V 4DS0A 2VNGA 1U97A 1YVWA 2N04A 3UJQA 4LHSA 3RSJA 3LUTB 5FPXA 4Q4V2 4Q20A 1H9WA 1Y66A 2VBPA 1M5IA 1CZTA 3IAYA 2DUQA 4XDKA 5H6QA 3T1YO 1LOBA 2YFZA 3HAGA 4J6GA 5FZMA 2XH6A 3JSNA 4LK7A 4BE3A 2VQUA 3OD4A 3CE2A 5A3TA 4NIAA 4IV3C 2RMU1 1ZVFA 1OI6A 3ASOB 4YY3O 3DKQA 5FZ1A 3B01A 4FI9A 3MZHA 2L35A 3RN4A 4GX5A 1JTZX 3QACA 3MLLA 2QE3A 5FXWA 4Y20B 2QWQB 4WBNA 1W8ZA 2EIJC 2CTVA 4UFLA 4KHPB 3AMNA 4JTDB 2Y6LA 5GALA 3SC7X 2PHDA 4HK9A 3EVKA 2A75A 4MO3M 4IEOA 5B1AC 4QKBA 2EALA 1Y7BA 3DPRC 5HV4A 1OCZC 4P9LA 2VC9A 3J8F1 4Y4YA 2ZHLA 2UXDO 3KKYA 1NTMH 3V65A 4CCKA 3HIFA 1E1RG 1QU7A 1WB7A 3OD0A 3AB0A 3RJRA 4LXLA 4I9QA 2EIKB 3ASNB 1PNFA 2YS8A 2OCHA 3BTAA 1UZWA 3JARA 1R1A2 1S77D 4I7ZB 5L19A 2JDMA 4N43B 4B7EA 2VOXA 4DIQA 5C9AA 4B29A 4A45A 2PELA 3OUSA 4MUVA 4NRQA 2YC2A 1IGOA 4E2SA 3OF1A 2EZOA 4JI8O 2D6OX 1WP8A 3W5NA 1RXGA 3MFCA 2CV6A 3WDXA 5CN0A 5FNVA 2YI9A 2HWC2 3B8MA 2BGCA 5A6XA 2QQNA 3IIAA 3BGAA 3OYWA 2WL1A 5GONA 1PO11 2H6BA 4O4HA 4YG0A 3PLQA 2OCCB 3X29B 4GD4A 1E5RA 4WFBV 3WCSA 1PNLA 3GJBA 3O65A 3ST7A 1YJLA 1WMDA 1Q8VA 2WR9A 3JAWB 4M0NA 2KSDA 3WQBA 5J2UB 3CJIC 1M57C 4QPWA 5LB6A 4Z8BA 1A8MA 4YM1A 3ZXEA 2M7WA 4IDZA 5I0UA 4YJ3A 3VD3A 4DUYO 1GN4A 1YHQV 1Q6UA 4FXGB 1X4TA 2P6HA 1KU9A 3ZFEA 3W7XA 4NPMA 1BK1A 1NLQA 4XUQA 2OXBA 4JASA 4EFBA 3A0BZ 3POWA 1YFWA 5BUVA 5HV0A 3THTA 3CLPA 1GYKA 3RYPA 1A34A 3AZXA 4RN5A 5FY5A 1YEWA 4CS2A 4NWVA 4DXTA 4J41A 2W1SA 2WLLB 3JBG3 4FXKB 2FDHA 1JHNA 3G6BA 4X1KB 4PA4A 4LJHA 4CUBA 3M3QA 4L99A 2RNBA 5CFCC 2DVBA 4XTMA 3ZFEB 2FMLA 4WFFA 1IQDC 1QXRA 2J1UA 2W87A 2ZDIA 3R6SA 1AF9A 1VBB1 2YBPA 3GGLA 4Q26A 2BCCH 4DR2O 2AH2A 3G4SV 5A7WB 2FBEA 5T5PA 4JI3B 1GRJA 3ZYFA 2V4AA 4LUKA 1EPWA 4WM8B 2GHYA 4JGYC 3OUFA 4DV6B 1OLMA 5T54A 5FZ7A 1W2AX 2YXLA 4HNAA 3C7GA 2RJLA 3KCCA 1N34O 4LH7A 3UT5B 2EBOA 2VMDA 4AI9A 1DK1A 3JATB 3BOPA 3KZIZ 1LU1A 3MLKA 5F2VO 1Z2GA 4LHNA 4LF6B 1NG0A 1FPN2 2DFBA 5EYPB 4CS3A 4OI0A 3GM8A 5LP6C 5FZAA 2Z69A 3AVRA 4X8NA 2FCVA 4BQ1A 2WDBA 1KJLA 1W2NA 3ACLA 4I50B 3ABKC 3CDZB 4OHVA 2ZZJA 4JQTA 3GBGA 3ZN5A 5GJ6A 5LA6A 4H14A 4DV7O 3I2DA 5BXZA 3TB0A 1H1MA 1OH3A 5DZGA 2R062 4CS4A 2AHYA 1OF4A 3E8GA 2CUGA 3I59A 4MGQA 2GN3A 1SKVA 2WSSG 1OVSA 1W3VA 1PO22 2DYRB 1PIV3 4IESA 3F5WC 4HZFA 2DVDA 2R072 3KT4A 2IH1C 1MZ5A 4BIOA 2NMOA 5CA1B 3BABA 1SLCA 2P3IA 2X05A 3T4ZA 1JFFA 5ACA3 2CDYA 3E22A 1JYTA 1UY2A 4PLOA 2QSAA 1D2QA 4TUYA 2RM23 2BEOA 3T1MA 1MZ6A 4KQ7A 5B3SC 4IIJA 3SYCA 3ZPOA 3P32A 1TUBA 1BBT3 4R50A 3E5UA 3AK2A 2A3XA 5F9TA 5FP9A 3JD4A 5JOYA 3WDTA 4SBVA 4I9WA 1HR0O 1HDKA 2WPDG 1AYN3 1G8WA 3ZYPA 1EV12 3WHTA 5JCOC 1IPJA 2DCJA 3MDSA 4BMBA 4TQDA 5BR8O 2R9IA 4ITCA 1S5JA 1QJY3 4A7KA 5CG8A 4V2VA 3POEA 1D5NA 1DFQA 4AYUA 5FXXA 2QZ3A 1BSMA 1SA0B 4Y1UA 2W5FA 3IWZA 2VMHA 3U4SA 3JBG1 2F93B 2IJIA 1NY72 3BTYA 5J3UA 4CC6A 1FFXB 5A7OA 1F2NA 2RDNA 3BTZA 1GN3A 3PN1A 4PLMA 3E89A 3WFVA 1DF0A 2JDZA 4LO5B 1RHI1 2FDJA 4PHZA 4ZIBA 1SQBH 3ZSMA 2UXBO 1F15A 1C8M3 2KD7A 2OWOA 4IEYA 2FKXA 3ZYIB 5SV8A 3A8TA 3C7EA 1J5EB 4UI9L 1QJX3 3H1LH 1VBD3 1WA8A 4EZ4A 1JYCA 2Z3YA 1K5MA 1S72V 1YUDA 4FLUA 3BB6A 3OBZA 2FHRA 4WVVA 1PP9H 2WA3A 4JHZA 3ASIA 3OPZA 2VTFA 4FK5C 4XF1A 4AI0A 2JDHA 3MDPA 1NAEA 2PYLA 4CEYC 5IVCA 2VL4A 2E5LO 4GH4A 5FYZA 5FQ0B 3UETA 4CPBA 4GX1A 4O4LB 4MT8A 1E5HA 4G4FA 2WT1A 2RN9A 3AK3A 3SPHA 5EIYB 1JMKC 2YU2A 5JWPA 3BA9A 2D6KA 3ALQA 4MGYE 1OFNA 1SQFA 5A33B 4J80A 1L1FA 1W8FA 1FI2A 1NOVA 1BJQA 1VQ9V 1HQWA 2FCUA 4JKKA 1GZWA 3VBRB 2R043 4D6SA 3C3VA 2AENA 1FXKC 3WDYA 4QKFA 1GOGA 4FTBA 1IKPA 3V56A 2Z79A 3O1PA 2P67A 4HOOA 5IY5B 3FD9A 5ABJA 2RQ6A 1PIV1 3ZN0A 2JEXA 3B94A 1NZIA 5ACA1 4JTNA 4RQEA 2WYSA 5HFLA 1COWG 1L7LA 3D8CA 3S5AA 2YHJA 2RM21 4B3RB 1YCIA 5IVBA 4LBQD 5F7UA 4UBHA 1XE7A 1M56C 3WCRA 4UF0A 4TSFG 2CGOA 1CR7A 2W68A 1CN1A 2IXLA 2GMEA 5HXMA 4CTEA 3TN91 2W47A 5ABJB 4PDMA 1BXHA 5KXCA 4AEKA 5T5OA 5FY0A 4LLOA 5D1IA 4JGZB 3LSEA 5E8AA 4LF7O 4I0BA 1XSRA 5FREA 4PELA 3VKFC 3CC7V 4OZOA 4GKKO 1MQTC 4AILC 1NUKA 2GN7A 1EZVH 2A70A 3ZXAC 1RUNA 1F4HA 1V6NA 2VZPA 2X7RB 3RYKA 2VZ3A 2R32A 5JOXA 1NR1A 2VUAA 5IHRA 3ILRA 4JI0B 4D8MA 5EP9A 4RFRB 1Q81W 4AHWA 2PAMA 4UV9A 2D5HA 3E6CC 3K5NA 1FMD2 1VMHA 1YFXA 5C9AC 3VBSA 4S2DA 1V0AA 3ZHTA 5JMOA 4NIDA 2A9HA 2PYTA 2YC4A 3F2ZA 3M8AA 2K9ZA 1C8M1 4F4LA 2VRZA 4QM8A 3N9LA 1QJX1 1GH6A 3RT3C 1POV3 4AAXA 4IYHA 1D2SA 1WCKA 3UGGA 2YIBA 5KXBA 4FJCC 1N1SA 1DU3D 5IATA 5FYTA 4O2BB 3N4MA 2BFUL 3THOA 1WBLA 5C6CA 1OQ1A 3RVZA 1FAFA 1SG3A 2FDGA 3CMGA 1H6YA 4DXZA 4KUMA 2AZ5A 3CEWA 2ZEZA 3MPPG 5EIBC 4YW6A 1VIBA 4FIPC 1KQSU 4XUPA 4JGSA 4CCOA 2QQJA 3WNOA 4R4XA 3S3XA 2YI8A 3L74H 1O6UA 4C1WA 5J2TA 1NI8A 4DR7O 4QPIB 1ZRCA 2R041 2JD9A 4GT1A 4Y5SA 1Q90D 2HBTA 4OX9O 4QB1A 3FN9A 1B35C 3DTUB 3NJZA 3ZRWB 4QDSA 3WW4A 3OTOO 5LEJA 2R70A 2JGUA 1RFYA 1RSOA 2HWE3 4PA6A 4QJFB 5C93A 4YPJA 5KX5A 3POIA 2JIZG 1XNAA 1BCCH 5L3DA 4JI1O 4EQVA 5IVVA 5I0RA 3DCQA 5IK4A 3CCRV 3JAKB 2JG9A 4FOVA 1V6KA 3RMXA 3HJRA 2ETEA 5JOWA 1R3KC 4O9EA 2XOKG 4AVBA 1I3HA 1COV3 5LMUO 4XCAA 4MH0E 3AP4A 4KXRA 3CF6E 1XNCA 3MW2A 3O1MA 4EN8B 1ASJ2 3FBYA 3SPIA 3FX3A 4HK8A 1CAVA 2BGOA 3U07A 1CJDA 3OEAA 5KX5B 3CRAA 2LRPA 1N3PA 4NMIA 4LCUC 3PL0A 1G8MA 3H9VA 2QDOA 2HHHO 1MG1A 3UM7A 5FK8A 1KMIZ 1QH6A 4ARXA 3STZC 5KBFA 3VBFC 1J3QA 4BZ4A 1AR92 5JIUA 2OX0A 1LHVA 3CRRA 4YVSB 4NTWA 4B3MO 2GC2A 5FPOA 4RL7A 2J1EA 3H1YA 1OCCC 2QM4A 3H8OA 1W9TA 2WLKA 4FPJA 3VBOB 5FYHA 1YXWA 5JDBA 1YNAA 1HNWB 3E83A 3VQXA 1D7PM 5LYJB 2VULA 2WFF2 3PJSK 2CTPA 1POV1 4MVMA 3ZS8C 1CPNA 1PNMA 3VBUB 5FZIA 5L9VA 4YM3A 4DRRA 2KR2A 1JJ2U 5FY1A 4K0KB 1W9YA 3WNNA 4BK5A 4SLIA 3I2JA 4UW6A 4DUZO 4LKFA 1F8VA 2CGNA 3GBFA 5CA6A 1ZBA3 5DN6G 2F4VO 3POGA 4F6RA 4QKDA 5BY1A 4XDPA 4BISA 2FB5A 2AUYA 5CFDC 5IWAB 2OYQA 1QF3A 3S7EA 3LSSA 4NROA 1M90W 2RMU2 3OUJA 1CQ9A 3KV6A 3FHQA 2QNKA 3PURA 4QT6A 1P8JA 3SXWA 1N47A 2UYBA 1WKYA 2YYOA 3LD8A 5I91A 2E33A 1XU2A 1YQ2A 2XAFA 4CDXC 1R1BA 2VQFB 2YUAA 3SITA 3ACIA 5C4WB 1YF2A 5FXZA 4OQ9A 3HBKA 2HWE1 4ZHQA 1CVNA 2P6CA 3M99B 3E35A 2CH7A 2QQPA 1CESA 3KS7A 5BNPA 2B9VA 1YWKA 3KVAA 5EQUA 1ALYA 1QJU1 2WAAA 1UPIA 2E7QA 4U3JB 3J8F2 1NH2D 4P9GA 4Q4X1 4LO4B 4RGGA 4O9GA 5C33A 3H42B 1PVC1 3UKTA 1LOGA 4H2AA 4NTYA 3DEMA 4Y4RA 4QQLA 4C7UA 3PNAA 5KR7A 3V64A 1COV1 4OHWA 5FZLA 1IHMA 1PM7A 3SJCC 1SRYA 1AZDA 3O1VA 2WO3A 4QPGA 1JZ8A 3HD8B 1DQ1A 4ZHQB 2CTWA 3ZMTA 3M1HA 4ZXKA 1IBLB 1HQLA 4ZU7A 4UW5A 2XASA 3CWBH 2QUOA 1FXHA 2ZE5A 3TYJA 5IUQA 1Q86W 4F3JA 3HKBA 1ZBE3 3ZDSA 2UUBO 3N2KA 1ORQC 4ORFA 2VVDA 2B42B 1WLCA 2ERFA 1O91A 3FYIB 1OXCA 2GALA 3LOIA 4QPGB 4LBEC 3FYEB 2GAUA 1GBGA 4CYDA 4RQFA 2AREA 3EMRA 4GH4C 1PV0A 1PO12 3TK1A 1M93A 4QHBA 1C5HA 1QJZA 3AG1B 2GNMA 1VRH1 1O9HA 4DW1A 2WIIB 4XAEA 4YGDA 2VZRA 5SV5A 2F23A 1KUQA 2YEVB 1VLNA 5IYDO 1S4CA 3WDWA 1DCSA 3BODA 5A3MA 1FJGO 4LBLA 2XTAA 2UXNA 4DEQA 4X20A 2HHHB 3KGZA 3TXSA 1ZBA1 1H8TC 1WCDJ 3KT1A 2BNMA 3I4IA 4ATEA 1RM1B 3CCQV 1HLCA 4WFAV 1RUF1 4HFSA 4CDQA 4B3MB 1IBKB 5JXGA 4CEWA 5KC5A 2OUHA 4RD7A 3SH5A 1VQNV 1RITA 3FFZA 3LIHA 4XURA 2JS3A 2VXRA 2WJSA 2H0VA 2XHKA 4MVRA 3FX7A 3WDUA 1OCRC 1JS9A 5FUPA 2FD8A 4X20B 3EXUA 1QNWA 2F66C 3RMYA 3QG5A 5FPAA 3SISA 3S5QA 4XOGA 2XAHA 1LCLA 3BVCA 4AVCA 2B1GA 1VALA 4K8XA 5GW7A 5KXDA 1ZA7A 1WD4A 4EWAA 1LEMA 4DXWA 1W9FA 4O61A 4Q0UA 1O3TA 4CP0A 2HJIA 4JTCB 2J1TA 2EVXA 2RV9A 1MABG 3QBQA 2O1QA 4PA3A 1I94B 4QGPA 4Y1VA 4M0HA 2A0LA 5HPOA 2V1DA 3VD4A 2YV8A 5JVDB 1I1EA 4LBOA 4RGAA 4QXBA 4RYDA 1LGBA 2PAEA 1KD7A 3VBSC 1V00A 4JTAB 4E4ZA 4YGCA 4KU8A 1ZBE1 1AJNA 4NB5A 1KITA 1G4YB 1TME1 1FPOA 1UYXA 2EIMC 3MO4A 2RDRA 3BI3A 1OLRA 1LULA 2YU1A 1TG7A 2UXXA 3B40A 3LA7A 2JJ2G 4Y22B 3Q8AA 3QH6A 4JI4B 2Q8CA 4A2UA 2YBKA 2YIDA 1PL4A 4Q4Y1 3RYIB 3ZHVA 3JASB 1WPXA 4COVA 3AMHA 4UCTA 3OOXA 3ZN1A 1TQ5A 5EJZB 5BNNA 3T2QA 3I2GA 4ZI7A 2C9AA 4HMZA 1JPXA 4YZ2A 3BEHA 4FFFA 4AFDA 5KC6A 3CBNA 5HFMA 5DMYA 1YTFD 3HR0A 5K1XA 4GUNA 3VBBA 5FJHA 1PGL2 4TSVA 5FP3A 4ASLA 1F5FA 4GJYA 4QX1A 4TLGA 3BA8A 3T0AA 1EZJA 3OW2U 4UBGA 1K33A 5A6ZA 2KG7B 2P22C 4XFAA 5LA1A 3ZJZA 4J1WA 3WD5A 3I8TA 3LKJA 1SCSA 4WZFA 4DV1O 1RUD1 1J83A 1OPMA 2WBKA 4I0XA 3ITQA 5EXOA 3O1RA 1Z5WA 2JG9C 3LNMB 1PNGA 3DN7A 3KGLA 1UKRA 4CXYA 3KCYA 4BU2A 3JBG2 1IS6A 5A1FA 1DQ0A 1JZ4A 3FLRA 5F5CA 1HIXA 1GMGA 5JJNB 4NO4A 5IJ0B 1E79G 3OSDA 1RUI1 5LW9A 3D3AA 1RHI2 4XFGA 2ZM6B 5K7PA 2O14A 2GU9A 4I3GA 3L9JT 2RR13 2UU8A 5A6QA 5F2WA 3FL7A 3CCLV 2Y4UA 1JX9A 1JN2P 5A3LA 3A21A 4XJ8A 3WT3A 4EN9B 4M3CB 5LOVA 4NVPA 5FO9B 4LKEA 2XBO1 2Q67A 5DAWA 4IEUA 4KMQA 2DYSC 5LGUA 1EFRG 4LFCO 3OTFA 2CE4A 5CEHA 1V54B 3CXCU 1XE8A 4AFCA 2ILMA 1LUVA 2F95B 4HZ3A 1IS5A 1OHFA 4MGKE 5KHIA 4X8AA 5BNOA 1SHWB 5C3SA 1WP7A 4LHKA 2UY8A 3M3CA 1GZCA 2QKDA 4LC1A 3JALA 3AK0A 4CDWB 2A3YA 2R7EB 5A3OA 3E8HA 1IS3A 3N36A 3HPNA 3TOJA 2WLHA 4F6EA 2CDPA 2VNVA 2VCMA 3Q8EA 4FMTA 1CX1A 4XMAA 5FZGA 4E4HA 5F2SA 3ZO0B 4DV2B 2HKOA 1O3RA 1R6NA 1KFUL 3BOWA 4LF9B 4MX3A 4AQTA 1N8RW 3ETDA 1V70A 1PM9A 2LS6A 3WG3A 1P4RA 1PIV2 4HONA 4ZZ8A 4XFBA 1ZL8B 1JUHA 1NLSA 2FYUH 5DUUA 2D2CB 4JYAO 2BTQB 2VGDA 5ACA2 3D0SA 5BPXA 1PK6A 2WQ4A 1C8NA 2YGMA 2VQEB 1XXNA 4Q6GA 2RM22 4JI7B 4CCCA 4NTXA 5FOBB 1BBT2 3H1JH 3N9MA 2XOMA 1SQQH 1O5LA 1GWKA 3EB7A 3ZN6B 3MPBA 5M0TA 5T5LA 2DQ3A 4OULA 4FPYA 5IVEA 4XJZA 1DGWA 5FLJA 2BRTA 5BNPC 4CSWA 1HRV1 3ATGA 3FFQA 4GZRB 1VF6C 1QJY2 2A6WA 4B3SB 1WJZA 4MLOA 4FAHA 3T2MA 3O1OA 3S6PA 1AJOA 1MOFA 2WZPP 1SPPA 4XF0A 1V9U1 4IEPA 3AFGA 1AR5A 4XETA 1J84A 1S0BA 5FZKA 1NA1B 4L8QA 3VZMA 2VD7A 3MHSC 3QCWA 2WNUA 2CSGA 2VOVA 4YW2A 1Y43B 3DSQA 2VE1A 3OJBA 1C8M2 3BKZA 2EIBA 4UW3A 4R9CA 2V4VA 4BQWA 4KI5M 1QJX2 3HEIA 1N33O 1G9AA 4N53A 2LFRA 1VBD2 5A3NA 2PYJA 3B2EE 4X65O 3IN9A 2QQMA 3CZJA 1F5JA 2H0BA 1NVPB 1IQAA 2GSMB 1N36O 3AMMA 4JI5B 1JYIA 3PIGA 1ND2A 3RS6A 5A32A 4N9IA 3TXQA 5FYYA 3K77A 1ND3A 2XUEA 5C5UA 4RS5C 2WAOA 1YQ5A 4UCVA 4N53B 4YVWB 4Y26A 1HJGA 3LQCA 1E1QG 4NHKA 1R1A3 2IXIA 2R042 4URTA 3ZMOA 5J96B 1H4GA 1LR5A 3AKSA 3M3EA 1ZLZA 3U11A 4Y1YA 5FZCA 2ZHMA 4CDQC 3CSXA 2VXJA 4CP9A 2IW5A 3SHRA 2VQ0A 3T4VA 2F17A 4P9OA 5JZGC 2VCCA 4LBQA 2ZHKA 5B5EZ 4LF8B 1XNDA 5HI0A 3NAPA 4P9PA 1JI6A 1RJ8A 3SYOA 1XHZA 4Y33A 1LOEA 1NE4A 5GZEA 3I3BA 4PDVA 2WWUA 5EIBD 1WLDA 4AF9A 2RCVA 1QY4A 5CBLA 2JICA 3CCEV 4QE9A 4G28B 5I0DA 2Y0IA 5AC91 3CJXA 1ULGA 1O3QA 3N9OA 1U5YA 3H1KH 4BH9A 4GALA 4Y24A 2PAKA 3AYDA 2DE0X 1K45A 1B3QA 1JBCA 4AQYO 2ITDC 2PFWA 1SLBA 5J7MA 3C7FA 1JA8A 4CVUA 4A6SA 4ICGA 5B66Z 1PKXA 5FCCA 1SLTA 4TQFA 5FPBA 2DFCA 3NKGA 2BSKA 1Z7S1 2Y4TA 2QQVA 3X2QB 1ULOA 1G7YA 2DWRA 3M3OA 4EYUA 1IBMO 3O1SA 4YWAA 3LPGA 1AUYA 4I30A 4CCNA 4CZSA 1PGSA 3SKVA 3QNEA 4CZZA 1VQOV 1NKGA 3M70A 3C7HA 3MAQA 4DV0B 4COZA 1GQGA 5FFOC 5LGTA 1Y9GA 5T52A 4PIYA 4DV5O 4ES8A 2HBUA 3B8NA 1WW5A 2K2SA 2BW8A 1NE6A 3PHMA 1RPOA 5FO8B 4I02A 2BBAA 1KRIA 2JB8A 3DC6A 3KQ4B 3L71H 2HJFC 4JDOA 1P7BA 3J7AU 2NNUA 2JJ1G 3F7VC 1M1KW 2R1DA 4CCJA 3PTYA 1XL6A 5FLXN 1ZYBA 4GULA 4UWDA 1N33B 2WLPA 3KCXA 2Y60A 1CPYA 1RUH1 3OUIA 2EXHA 4HETA 4FSJA 1WMEA 2HWE2 3EJKA 1WZXA 1GR3A 3ZHUA 1NXD1 4EB6B 2A7WA 2YPDA 2B39A 1RIRA 2W08A 2QCSB 3R66A 4AHCA 4GMP0 4D69A 1QJU2 4WM7A 4JRAA 4J25A 3LA2A 4MVTA 1QDCA 3ZR6A 4BJ0A 4XACA 2EX3A 5FZEA 1TAEA 4Q4X2 4BWAA 4AEDA 2VW0A 4MVQA 1PVC2 3H1WA 4L92A 2O57A 4O2AB 4XJ9A 2R9RB 2R063 2IWGB 2X6AA 2BOCC 3VQWA 4Z2WA 2GUZB 1COV2 1OV9A 1OZ0A 3CJHB 1IOAA 1Q5OA 2Q68A 2ZT9B 3WP3A 4ZHNA 1PO23 2DYRC 2DV9A 3U14A 4OCTA 3AKRA 1W9SA 3WY6A 1Y76B 2R073 1OFSA 1DYKA 4EZHA 3GJAA 4MGZE 1MA1A 4DMIA 1HB2A 1NXMA 3VDDC 4WZCA 4A6OA 1U5ZA 2YB7A 4O7XA 2CYFA 3BU7A 2WZR1 2MK3A 1OKOA 3PVBB 4MZUA 3UESA 5E6HA 1EUUA 3WZ1A 1Q8IA 3RYCA 1RUG1 2BVVA 4KGGA 3AL5A 1EV13 4Q0QA 3HNBM 5LA0A 5HCHA 5ANNA 5LMNO 2LFSA 1GQHA 5BNOC 2BP6A 2Y6JA 4JZRA 4AGRA 2ZGTA 1F4AA 5ITZB 1WW7A 4KBZA 1VRH2 3FUOA 2VZOA 3LSDA 1Q82W 2XT9A 2XXZA 4FP2A 2JDNA 5LRRA 1UF2C 2UUCB 3TEWA 2HWF1 4EFEA 5FJKA 1QR9A 5LATA 4AI8A 2QQWA 1HNZB 2ZPXA 3EYPA 5B1OA 1UY4A 4MXVA 4GX0A 1FV2A 4YG3A 5IAXA 2AGSA 4MXWA 2ATKC 1QJEA 2IXCA 2WLJA 1ZBA2 4DV4B 4AQYB 4TV9A 1GTOA 2Z0AA 3HN3A 4X9QA 4ZPIA 1RJ7A 2UY9A 4X1IA 3O1UA 2D93A 4Y3OA 4NXNB 2QVSB 4EE2A 2RHPA 3RWRD 2W1WA 3K51A 1MZEA 5IYZA 3K03A 3IKWA 4OGQB 5BY5A 2LJ2A 5CZKA 3S3WA 2ADEA 2NYYA 3VGIA 2P17A 3OMNB 1W0NA 4M00A 2W2IA 5JQGB 5BMVA 1HXS3 4I5SA 3D5OA 1L0NH 2ZGLA 3ZSEA 4QWNA 3HNMA 4DR1O 4E9KA 2HYXA 2YMZA 4XABA 3CQOA 2CAUA 4FQZA 5F5AA 3LIGA 5IJ9B 3OGGA 4Q1RA 5A7QA 2IFWA 3GB7C 2IJKA 3LSQA 1HW5A 5CA0A 1CAXA 5IYZB 1TVGA 3VV1A 3ZIWA 1T6GC 2RS13 3VBRC 3WU2Z 3CCSV 3K5OA 1UY1A 4KG0A 2ZE6A 4CP2A 4DXSA 3R0RA 3K79A 5J36A 1AJKA 4CCLA 5J48A 2UUAO 1LR1A 1W2TA 5F3IA 2VCBA 2Q8OA 3MF6A 5GLZA 3OPWA 4UVCA 1NKDA 4IEXA 3N35A 1YZBA 3C2UA 2WNUC 4IV3A 1LHUA 3K5MA 3LDDA 1JYXA 2DU1A 5DUXA 1O59A 1AL0G 3VD5A 4PA9A 2D6PA 3WOGA 1UL9A 1ZBE2 2Y33A 1CEZA 1UO9A 1ZZ6A 3NV1A 4LK6A 4COWA 4LNUA 2Y6GA 3M8LA 2FDKA 1ND2C 3WB1A 4DFSA 3DPRA 4JGZC 4OHYA 4Q4Y2 2UXCB 4R52A 1MEC1 2BNOA 2DVGA 4K35A 2ARHA 3CHXA 4NIGA 2ZQMA 4YHHB 3T09A 5B1BC 3TJTA 5EZYA 4M01A 1N0NA 5FR3A 3HBZA 5I8YA 1XEQA 1JZ5A 1KECA 2OA2A 2JXAA 4G27B 3JXSA 4DRXB 1QLNA 4QB6A 1X59A 4X62B 4B3TB 1AX2A 4QDRA 2VNOA 1QIQA 1Q43A 1OC1A 3F5TA 1EAH3 1Q3EA 2E31A 4OYUA 5B1AB 1FMD3 4XHXA 3RWKX 4QPKA 4DR5B 3DPRB 2QWOB 1I6XA 4UAPA 3GVMA 3MIFA 3DXRA 1ULDA 1IPKA 1OOPC 3T0DA 1THZA 2XHNA 3ZRSA 1H1IA 1SERA 3R65A 3DECA 4XF3A 4OI2A 3MYXA 4P2ZA 2WSVA 5H9PA 3ZYHA 3CRMA 1RUD2 2NN8A 3JD73 3FWEA 5H2FZ 1LECA 2ARXA 4C0BA 1R093 1HXS1 1G9BA 2HVKC 2CDOA 4QD2A 5E79Z 3CCVV 4BR6A 3WXPA 3NAPC 3STLC 4BQ4A 2R0FA 1HV0A 1AR1B 4XUNA 1W59A 2BDRA 1HKDA 4DV3B 2R16A 2ZX4A 4LFBB 4JV5B 4M4PA 1RUI2 4IV1C 1YC61 5C3QA 1UCXA 2D6NA 2YFUA 5CIRA 1SS3A