3OTFA

Structural basis for the camp-dependent gating in human hcn4 channel
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
197
structure length
197
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the cAMP-dependent gating in the human HCN4 channel.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 61
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2010-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3otfA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3otfA02
3MZHA 1CAVB 1ZZ9A 1YUDA 3CF6E 4RD7A 2MHFA 3I59A 3LWCA 2D40A 1X8MA 4F8AA 3FJSA 2XKPA 1QXRA 3IWZA 4UBHA 3QOPA 4MX3A 1ZZ7A 2PTMA 3FX3A 1O4TA 5KHIA 1SEFA 2XLGA 4QGMA 5D1IA 3LAGA 4PIZA 3BB6A 1OMIA 2O1QA 2E9QA 3M70A 3E5UA 4Z07A 5J3UA 2B8MA 1RC6A 3WW2A 4Q29A 2PA7A 1ZX5A 4XFAA 1Q43A 4BHPA 4NVPA 1LRHA 4XFCA 2Z2SB 4EROA 1QXJA 4HVOA 4KWKA 4XFGA 1NE4A 3VHRA 5JSOA 3M3IA 5JAXA 1UIKA 4X6QB 2EA7A 4IEVA 3E6DA 3WW1A 2ET7A 4OLLA 1RUOA 4QX5A 4WBBA 3EBRA 4LLOA 4WVZA 4N9IA 3HT2A 2GC1A 1DGRA 1ZRDA 4I0AA 2XHKA 4FAGA 3U11A 2PHDA 1NXMA 4XF4A 3NL1A 5FPZA 3U0ZA 3NKTA 3BU7A 5KHGA 5BY5A 2HKXA 3KSCA 1VR3A 1UPIA 1WLTA 4LTAA 5JR7B 3QACA 4WZCA 3R6SA 2Z69A 4D7SA 4MV2A 3IDBB 4LA3A 3JZVA 3EJKA 4CYDA 4EV0A 2IXIA 2UY9A 1J58A 3S7EA 1H1IA 4B29A 1CGPA 4AQ6A 4AVBA 5JSPA 1XRUA 4D7TA 3DN7A 3OTFA 2IXKA 2GH2A 3MPBA 2PAEA 4HVQA 1X8EA 2GC3A 3RYPA 4IEPA 3HT1A 3E97A 4F7ZA 1O7FA 3FZ3A 3SXWA 1SFNA 4HSJA 1J3QA 4EWEA 3G7DA 3DL3A 1RTVA 3RYRA 1UD1A 3IDCB 3KCCA 3S0MA 1UIJA 2CV6A 1O5UA 1CAXB 5LRRA 1PM7A 1JUHA 2N7GA 4IEOA 4E2SA 4BH9A 2OPKA 1LKNA 3LA2A 4XF1A 3LA3A 4Q0QA 1FI2A 4N9HA 1CAXA 2XGXA 4QM9A 5JCTA 3IBMA 3FE5A 4XEZA 2QCSB 2MNGA 2OA2A 3BCWA 5BUVA 4XETA 4HN1A 2FMYA 4XFFA 5BV6A 4AVCA 1CAWA 1TQ5A 2BEOA 2PQQA 4MUVA 1NE6A 3SCFA 4P9GA 3SHRA 4YNIA 1YFYA 1YFWA 1I6XA 3CO2A 5FLIA 1DGWA 2Q30A 4ZU7A 2BNOA 3EO6A 4R8HA 4BIFA 3OF1A 3USSA 2P17A 2VECA 5C8WA 3CJXA 1OD5A 5F1RA 1ZRCA 1WGPA 4KU7A 5I0TA 2MPFA 4LA2A 2H0VA 1QY4A 4I09A 5I8SA 2Q4SA 3RDIA 4META 2UYAA 5FCCA 3KGZA 4I0BA 2QVSB 1J1LA 3L2HA 4XFIA 2GU9A 4LULA 2F4PA 3KMHA 3S7IA 4LUKA 3BALA 5E16A 3H50A 5FDBA 3DV8A 2PHLA 2VQAA 2OYZA 3TNPB 2UYBA 2QJVA 5KHJA 5E1RA 4JTOA 1QWRA 1YFXA 4YRDA 2IXHA 2CAVA 3BPZA 2QDRA 1V70A 1FXZA 2OZ6A 2K0GA 1ZREA 4O9EA 3NJZA 4MGYE 3PVBB 3RZZA 5I8TA 1Q5OA 3NSTA 1ZNPA 5EZWA 1Y9QA 4UXAA 1Q3EA 5BXXA 2Q0AA 3HIFA 4MGIE 4E2GA 4IESA 1XE7A 3EQEA 2QNKA 2HJIA 4Q0VA 1O5LA 1PMIA 4EWDA 1DZRA 5KBFA 3I59B 2UY8A 5JSRA 4BYYA 2XLAA 4HLTA 5K8SA 2BNMA 4ONUA 1RGSA 1IPKA 4GULA 2DCTA 4JTNA 4R52A 2O8QA 2C0ZA 4IEXA 1CAUA 1ZZ8A 3GBFA 3ETQA 2B9UA 5CVRA 3LA7A 4JV4A 1UCXA 1WA4A 2D5FA 4QMAA 4IEYA 2FQPA 4EWAA 3E6CC 1FT9A 4ZU4A 4FBFA 2XKOA 4IEZA 3H1WA 3D0SA 1L3JA 1O3QA 1SQ4A 1DZTA 1CAWB 4HVRA 3NW4A 4MH0E 3OCPA 2IXJA 1I5ZA 5I0UA 2EVXA 4HSLA 4XF9A 3HQXA 3H7YA 5I93A 1J3RA 2IC1A 3H1YA 4JVAA 1EY2A 4IEUA 4L2NA 4Q0SA 3FHIB 4QGLA 4IEWA 3TNQA 3U10A 3FWEA 4XF0A 1HW5A 1H1MA 1VJ2A 3CL1A 4I01A 4I3PA 5FLJA 3SMHA 5HI0A 5I91A 5LEKA 2PAMA 1RL3A 1J3PA 3H7JA 3B02A 4Q0PA 5FQ0B 4AXOA 4I02A 5C6CA 1YHFA 4MZUA 4H7LA 2VPVA 4I2OA 4QM8A 2PAKA 4DINB 1EPZA 4IETA 2GZWA 4KU8A 3RPQA 1VP6A 2OZJA 3LOIA 4YARA 5J48A 2ATFA 2EAAA 1G6NA 3OGJA 3NVCA 3FFQA 5J7MA 4FT8A 2H6BA 1CAVA 4XFBA 1YLLA 2D93A 2Y0OA 2ZKLA 2KXLA 3O14A 3ST7A 5CU1A 1J59A 1LR5A 4QGNA 4KL1A 1XE8A 2ETEA 5LEJA 2XLFA 1ZZBA 5FQ0A 1X82A 4PJYA 1U12A 3H3ZA 4FAHA 4XFHA 4KWJA 2CGPA 2Q1ZB 4L11A 1GQHA 3GYDA 2IXCA 3N4MA 3ES4A 1OI6A 4HMZA 3ACLA 1GQGA 3D82A 4A2UA 5CADA 4ORFA 3ELNA 4HZFA 3IIAA 1ZRRA 5EFUA 4MGKE 2D5HA 1IPJA 4OFGA 3RYKA 1YFUA 3MYXA 2GC2A 4QXKA 4HN0A 3CEWA 4KWLA 3LZZA 5I0RA 2XL7A 4HBNA 1O3TA 3ROUA 3I7DA 2WC2A 3H8UA 2GAUA 5LRSA 1LB2A 2K9ZA 1NZCA 4PIYA 4YSFA 4TLFA 1YWKA 5FLHA 3ZDSA 4J1WA 1ZRFA 3SCGA 1CAUB 4Q0UA 3UKTA 3I54A 2PFWA 4K8FA 3ES1A 2ET1A 2PYTA 2CAUA 1O3SA 2BGCA 3WW3A 1O3RA 5T3NA 3SCHA 5BPXA 2I45A 2GC0A 1Y3TA 3UKVA 2BNNA 3RNSA 4E2QA 1ZZ6A 4IERA 3H1MA 5FPXA 2ZCWA 3MDPA 2WFPA 4O9GA 3PLQA 2XL9A 5I0SA 1EYBA 2BYVE 3KGLA 1CX4A 1X7NA 3DKWA 1EP0A 4PIXA 4Z82A 1ZZCA 4LEJA 4UBGA 3D0JA 3C3VA 2H6CA 1RUNA 4IEQA 4YYOA 3UKNA 1NYWA 2V09A 3E5QA 5AVPA 5KHHA 4AVAA 1OFNA 5KHKA 4AQ2A 3H9AA 2B5HA 4X6RB 3H3UA 3E6BA 4XF3A 4ZU5A 1ZVFA 4LUMA 1UW8A 4MGZE 3WW4A 3PNAA 4J1XA 5I8YA 3E5XA 3OD0A 3EHKA 2IXLA 3CLPA
chains in the Genus database with same CATH superfamily
4JYBA 3LIGA 3WXPA 2UU9B 2D6KA 5DAQA 1ZZ7A 5F9TA 1N3PA 3VQVA 3P6BA 2JDIG 4CCOA 1AVMA 5DAWA 5JR2A 2X29A 3VHNA 4JI7O 1OLMA 3LF7A 4NVPA 4MVQA 3OUJA 2LGWA 5CFCA 1UF2C 4BIUA 1BBT3 3E6DA 2RDRA 1CXZB 2RJKA 3WW1A 3D4KA 1NKGA 1AL22 4I0AA 3RI9A 3L72H 4LLFA 2F43G 1DQ6A 1BHAA 2VMCA 1W0JG 2YROA 4CDQC 5FJKA 3SITA 4KG8A 4COZA 2R9AA 2VMGA 1T5EA 4FPOB 3RW0A 1J58A 4O4IA 2ZCEA 1GICA 4AQ6A 1K5QA 1RUC2 2WABA 1REDA 2P3JA 3ZYIB 2B46X 1GAXA 1BK0A 1WW7A 3OY8B 1SKVA 2XHNA 3UL2A 5D2AA 1BHGA 1C3HA 2DU0A 1DIWA 2BQPA 3FFZA 1YIFA 5CFDC 3CYOA 2V4AA 1BQPA 3A7QA 3S5AA 1OT5A 3ZMSA 3R0RA 1JUHA 5A32B 2YYOA 2CDOA 3IBMA 3FE5A 4K6BA 1PL4A 2CWMA 1F4AA 4CH6A 3U78A 1N1TA 3CCQV 1RMU1 2GMEA 4OI4A 3JUUA 1XBLA 1QJZA 1S55A 1RITA 4KGGA 2CHHA 3WLUA 1SPPB 1U5XA 3BA8A 1I3HA 3IZOA 2VRZA 3CHXA 2ZHLA 1AR91 2O8OA 4P5YA 1N47A 3ZFEA 4UFKA 5F1RA 1ZRCA 5H9QA 4LF8O 5A2QN 5I0TA 1UU5A 2HBUA 3STZC 1M56B 2X5IA 2W0XA 3OEAA 3CMEV 1OLME 4CP9B 3MO4A 4I4TB 4KP4A 1YQ6A 1BSMA 1Q8QA 2QVSB 4NRPA 4GX0A 4ZONA 1F31A 4CU9A 4RQFA 3I2GA 5IK8A 5B5EZ 4CS2A 2IJJA 1BS3A 5IK4A 4L97A 4CEYA 4MSWC 1ZM1A 2XH6A 2H0BA 3LOBA 4AI0A 4LCUC 2VZQA 5IK5A 2OQ7A 2PYJA 1XYNA 2OCCC 1ULPA 5LA9A 3OMNB 1ZSPA 5DUUA 2WA3A 2WAAA 3T2TA 1RYYA 4X64O 4HLTA 1DDLA 4JV5B 1Y9MA 4LF9O 2BNMA 2C0ZA 4WM8C 3GZUC 3ETQA 4FFBA 2W08A 5FMOS 2V5YA 1WA4A 3D36C 4B08A 3M8AA 3A4UA 1ZBA1 2OX0A 5IY5B 2KD7A 1AROP 3VL8A 1WLWA 3ZFGA 3K79A 4O4HB 1IX9A 1R083 1DLCA 2GSYA 5EBWC 4A41A 3HQXA 3OMIB 4J7KA 3POSA 1V6MA 5EP9A 1XILA 4E2LA 2Z5WA 3PDQA 4O2BB 4BK4A 1XEQA 4Q20A 1HQWA 5FY5A 1HXS2 4ZI7A 3OYWA 1AP6A 2Y0IA 2QQKA 2MEV2 1LOCA 2VNVA 3JAWB 1N1VA 4FTSA 1KEXA 3NJYA 4QM8A 1EPZA 1ZA7A 5F6KA 5J48A 3C90A 4PBPA 4FXKB 4NIIA 2WO7A 1JMKC 1Z5WA 2Y6GA 1YLLA 4LBQA 5CU1A 1ND2B 4DR6O 4H7MA 1V6KA 2C26A 1JHJA 3LSSA 1PO13 3H3ZA 3H1JH 1VPHA 2QWOB 3Q8FA 5FY7A 2WKKA 4WM8A 4UXNA 1RUJ3 3ACLA 3LDBA 3ETGA 2JGDA 2BPA2 3R05A 3ACFA 2NLRA 4P08A 4IL7A 5LYJB 4ISQA 1KB9F 3T30A 5J2TB 3WUCA 2ITCC 4PBOA 4JV5O 3STLC 1GZTA 4CRQA 1XI1A 2AREA 2AENA 3NXSA 1ACCA 3H8UA 2CTPA 1GP6A 3RRDA 4JAAA 4UOJA 2BSKB 5C8CB 3IFXA 3UKTA 5EBMC 3I49A 1SZBA 3THOA 4JZGA 2JX9A 2P67A 3O65A 1AR72 1QQP3 2DYSB 2ZGPA 4BE3A 3B94A 4GKYA 1NUKA 1NQTA 4DUXA 5DG2A 3AM2A 1SZXA 4LHNA 4XAAA 2OYQA 1ZZ6A 1CEZA 3CC4V 4XZUG 1UXZA 2ZCWA 2WFPA 4AGVA 5JI9A 5CN0A 2VM9A 3T4DA 3V65A 1AXKA 4B3TB 1W8OA 4GQ7A 3W7TA 4CUBA 1ZZCA 3D0JA 3J7AU 2ZAAA 3UKNA 2V09A 3RJRA 1NY71 4YW5A 1I7FA 1Q8SA 4NWWA 1NR7A 4JI6B 4X6RB 4Y1UA 1QJY3 2LO1A 4XW3A 4GH4B 3SJAC 3OJBA 4RD7A 3G80A 1X8MA 3AG2B 2JICA 3IWZA 1Q82W 3FL7A 2QWRB 2PTMA 3SPJA 4K7JA 1QLEC 3ACIA 3I5DA 3LAGA 2WR9A 4OHYA 2O1QA 5A6ZA 2MK3A 4LF4O 3E1F1 2X53S 2WLIA 1W39A 5FYBA 4CDXC 1XBFA 4CC5A 2WNOA 4XFCA 2XJQA 2Q67A 3N9NA 4XE9A 3RYIB 5FZEA 5JAXA 5LMUB 4RQPA 4BQ3A 1QJU3 2OUHA 1V0AA 3MW3A 2GMPA 4DY3A 4XF4A 4PCRA 4CP9A 3NJVA 3U0ZA 2BVBA 2JKBA 3ABMB 1SMVA 3IT8A 3BU7A 1OUSA 5A7PA 2WLLB 5IJ0A 3U07A 2K46A 1NTKH 3R6SA 1W9YA 3C7OA 2QQUA 4LA3A 4NHMA 1ALYA 2P3YA 4D6QA 2ZT9B 4B29A 4UVAA 3POBA 1OUXA 4D7TA 2B39A 4ZS3A 1PGW1 3ML0A 5BXZA 3CS5A 3RYPA 1VF6A 2A75A 1CZSA 1JYXA 1DHKB 1O7FA 2HWD3 3FZ3A 4AGRA 4OHWA 3ABZA 3DL3A 2YC0A 2Q8EA 2IFWA 2WLKA 1QNYA 1OVSA 4S2FA 3DPRA 5IYBO 4LNVA 5FLXN 1QDOA 2EXJA 5KMGB 1OURA 3ZFFA 1J5EB 1CIYA 1RUH2 1MSDA 4Q4V1 1HIXA 3MAQA 1FOD3 3RZHA 1RHI1 3O12A 1TQ5A 5C8CA 4YFZA 4LF4B 3SEPA 3W58A 4BLIA 3TEZA 3BOWA 5CFCB 1C8M2 4AI8A 2W1SA 2QR4A 4RHV3 1KQRA 3OGGA 5EC2C 4OMCA 1QIQA 5C33A 2DOSA 2WT2A 3KV6A 2Y38A 4SBVA 5FZGA 3WQ7A 4CCJA 3VHPA 3LSQA 2NMNA 2GTAA 4LH7A 3P32A 5GZDA 1OD3A 3UM7A 2JG9C 2JG9B 5FTTC 4DV3O 4LULA 4LBQB 5CBHA 1NS1A 5EIBD 2LS6A 1UOFA 5GM0A 2Z5UA 5C9AC 1GQPA 2ZNJA 2K0GA 1FXVA 3NJZA 3SYAA 1R1A3 1TUBB 1WJZA 1W8HA 2NP0A 3HIFA 2AZ5A 4EE2A 3N7LA 5F8PA 3JD3A 3GZTB 1XE7A 1VBD2 3EQEA 2OW4A 1NTMH 1HQLA 4BWAA 2PF4E 3IM0A 5JSRA 3BA9A 4AQYB 4XUTA 3SGIA 1YI2V 5LOVA 2X6AA 4JDOA 2G9GA 4JTNA 4Q27A 4LKDA 2XAGA 5L9VA 1FAFA 1AR83 4P14A 4FLXA 1M06G 4JASA 4NIAA 4FBFA 4IEZA 3TAYA 3D0SA 4LHSA 1QVGU 5HCBA 3SDLA 5LHHA 3NW4A 1RUH1 4Q4V2 2C9KA 2WZ8A 4FFBB 4BM8A 3H7YA 1AI5A 4JGYA 1N33B 5E88A 2ZGUA 4L99A 3RSJA 4YGEA 2BTVC 4LITA 2EAKA 3AKQA 4Y24A 5CMUA 3OTOB 3VBSB 1RL3A 4HONA 1SERA 3H7JA 3JBG3 5EIBC 2VOKA 4Q4W1 4H14A 4H7LA 3AK1A 1CQ9A 2GZWA 1B09A 4JI0B 1GO3F 1RUF2 3AP9A 2DVFA 2ZMLA 4XFBA 1UO9A 1IPSA 3E83A 1MQTC 3T0DA 3ZIAG 2BOIA 1R64A 4QGNA 2VMIA 2GHYA 1UYZA 4FOVA 4HG6B 4FAHA 1A34A 3O1RA 2WSSG 4KWJA 2QSAA 2DN9A 2DUPA 2EIBA 1K3EA 2DVGA 5CIRA 3T1MA 1NCRC 1CJPA 1VQLV 4DNYA 4OFGA 1F4MA 3RYKA 1X9PA 2HWC1 1FPN3 3LB9A 1SACA 5I0RA 1RUI3 2VVEA 3ROUA 1BBT1 1R091 4MVRA 5FPRA 5BNPC 5JUVA 5CA0A 1JYWA 1IXBA 3I54A 4BA6A 2X10A 4J41A 5KMGA 2W3JA 3ZFFB 4ES8A 1O3RA 5H9SA 2JK5C 1N33O 1ZUQA 2F4VB 1OF4A 1W9SA 2Y6JA 4E2QA 1VAMA 4UV8A 2ZGSA 5B4XA 1Q56A 2VUAA 2BFUL 5FP7A 1K34A 4E4SA 3AYCA 4Y20B 1W6QA 4QPWA 4AVAA 3BTAA 1W90A 3H9AA 4LBOA 1VB2A 2OT7A 4NIHA 3TEXA 3TEWA 2QEXV 3E5XA 3OD0A 3AKPA 2ID4A 2JDPA 1EZVH 4CPBA 2F4LA 3QO7A 1WLDA 4MX3A 3BY6A 1COV1 4V1PA 3VBUB 5C93A 1QCEA 4MGSA 3LNMB 4IXLA 3WDYA 1BHBA 2VQFB 1C8NA 2DVDA 1F2NA 2XVKA 2VBBA 4AI2A 1N3OA 4R9DA 3UV9A 3I2OA 4EB6A 1LRHA 3ZXKA 1W3XA 3WP3A 1LOBA 3P30A 4I7ZB 4K1YA 4R8CA 3ZN1A 3RYFB 1RMU2 1FFXB 4RAIA 4E8CA 4LBNA 5C71A 2A6ZA 2WLPA 3CCUV 4GMP0 2OUJA 4FOWA 1N0JA 2IJHA 4OHXA 4NWVA 3CJHB 5FV3A 4LXLA 5FO9B 1WCDJ 2PLV3 4HK8A 4F6RB 5BNNA 3E97A 1SCRA 3JALA 3AMMA 3ABLB 4ARXA 1UKRA 3MDSA 1VBB3 4RFRB 1KXGA 1DGWX 1YZBA 1UIJA 4I0XB 4UVCA 1O5UA 3T3YA 4AAXA 4MVUA 4PV1B 4P9XA 1HB2A 5ACA3 1W0PA 3RZGA 2HWF1 4P9IA 5JCTA 2WAMA 2QCSB 5CB7A 4B3RO 2VZVA 3A0RA 4LF7O 4EKWA 4IIJB 2WLJA 2VQFO 4DV2B 2PELA 4KI5M 2XWJB 4P9GA 2PMWB 4FLWA 4PDRA 4HPKB 4FZ0A 2VZ3A 4BIFA 4QHZA 4OPHA 2P17A 3POIA 1XNQB 4AVSA 1M5IA 1JFFB 2PY5A 3O1TA 4HAMA 2W9XA 2DYSC 5DDJ1 2GH8A 3OBZA 4BQ2A 3EFFK 1HJFA 3G4SV 4B4QA 1MG1A 5A7SA 3TXSA 1X59A 5B4NA 5IWAO 2VMEA 2ODMA 4GB31 3WD5A 3BALA 4JAVA 4WFAV 1AR4A 3TNPB 1OJHA 1RUD1 3D3IA 3RVZA 2A9HA 1DGRN 1WLCA 4XTMA 1BJQA 2Y6FA 2FKXA 3RZZA 2EIKC 5I8TA 1QJY2 4WFGA 3APOA 2ZGOA 1ND2A 2P06A 3UT0A 4IESA 1EAH1 4DUWA 3VD9A 3LE0A 4ZZ8A 3ABLC 1O4ZA 4GMP1 4XBQA 4LNUB 3K5LA 2UUAO 3D6EA 2A7AA 4G28B 2C6SA 3MICA 2LFRA 4B3SO 2HWB1 5LY2A 1JN2P 3J7HA 1RM1C 1GZCA 4AWDA 2JG8A 1RSOA 4DV1O 3UK9A 3DXTA 4FZ1A 2G38A 5DPNA 4JI0O 3ASIA 1Z7S2 5KX5B 1O3QA 1R092 2WS91 4PLNA 1YDXA 2TNFA 3KB5A 1A32A 5I0UA 5JPMB 2VY0A 4S2HA 3I2DA 5IVBA 1GMMA 2GV9A 2P4VA 1R1ZA 4XBLA 2ZAHA 4R9BA 1BGYH 3Q8CA 1UX6A 3U10A 1HW5A 4XUQA 4CA9A 1AR62 1ODNA 1SQFA 4XJZA 4JRAA 1ENSA 4YVWB 4GWIA 2O14A 2D6LX 5KAFZ 2UXDO 2Y48A 3RVYA 3SLIA 4YARA 2VNGA 3BHPA 1RUC1 3NVCA 5J7MA 4CDQB 2WS93 3KVAA 1W6PA 4YJ2B 1W6NA 4QB1A 3H9VA 2DFCA 3GGLA 4UUJC 1EN5A 1MVQA 1YRZA 1Y74B 1K8AW 1D0GA 5L3EA 4X62B 1RUE2 5EBLC 1ZZBA 2PHWA 4JGZA 3GYDA 2IXCA 4FPJA 1BQZA 2WIIB 3ELNA 2J42A 4HZFA 4JTCB 1E5RA 4KNCA 4DO0A 1K33A 2XL7A 3RZLA 5EYXA 3I7DA 4O7XA 1S72V 2GAUA 1FFXA 2IU3A 3M3QA 3BPSA 4YSFA 1CPNA 4ABMA 3AVRA 5JJNB 4MTXA 3FLTA 3MIGA 3M7MX 1QJEA 4ZZ5A 1CD3G 2I74A 2BGCA 3NMBA 4IW3A 2OVUA 2OXBA 4YM0A 3WF1A 2JWPA 3F5TA 1Y76B 2VWJA 4EZHA 3WB1A 4JGYB 4JKMA 3PLQA 3OPZA 3AMHA 3TK1A 2ARXA 3H1KH 3JD0A 1OC1A 4KQ7A 2HWE2 3SKJE 4UBGA 3I55V 4ASMB 2XUMA 3ZSEA 4UT5A 3CBNA 5CKMA 4IEQA 3E5QA 4YJ3B 1VARA 3G6EV 1D2DA 2IW5A 1R1BA 4AQ2A 2JE7A 3O1UA 3H3UA 3E6BA 1ZVFA 5GZGA 1UW8A 3H1LH 4J1XA 4BR6A 1EUTA 3LSEA 5H9PA 3L73H 3WG7C 4JC1A 3K3OA 4F8AA 3N27A 2QDNA 4Q2FA 1TA8A 5J3UA 4UI9L 2ARCA 4OULA 3GF6A 3BI3A 2Z2SB 3ILNA 1QXJA 5JSOA 1WP7A 2YFZA 2AW9A 3SYQA 3B7MA 4A7ZA 1BMFG 5FYYA 5J37A 3SYPA 4QHBA 3K9AA 5J36A 5BY5A 3B01A 5SV5A 2F6BA 5JR7B 5FZHA 2A5ZA 2JEXA 1HRI3 4Z2AA 5E8AA 2F17A 3UQ8A 1LAJA 4PQ9A 1K7DA 5F5QA 3BEHA 1RUF1 3S57A 3OTFA 1IG3A 2HWB3 2Q9LA 2GALA 4WM8B 4QX0A 4BIOA 4F7ZA 4QKFA 4QD2A 1SFNA 4UFIA 1R1A1 3EXAA 4HPKA 2QZ2A 1AR63 4ISRA 4LE4A 3OUSA 3ITQA 2OPKA 2NNUA 2JJ6A 3LA2A 1HRI1 3N36A 2GNTA 1OSGA 1OCRC 4TSFG 2HJFC 1WN7A 3POFA 2W1WA 4K9SA 3MEPA 5ABJB 4CZZA 2P2KA 2QQLA 1K3IA 3VD7A 4P9JA 3ZX7A 1YFYA 3L9DA 2JJ1G 1RUH3 2AH2A 5ERLA 5AC92 1NX9A 2XPJA 1YNAA 1G8WA 2MW2B 5IWFA 4YIPA 4JYAO 4R4XA 2RM21 1ULDA 2HWD2 1C1LA 4OZOA 2RS11 1FNZA 5JOWA 5DABA 3IDAA 1UY4A 4UCVA 4KH9A 5E16A 2Q8VA 4D69A 3L75H 5I0DA 4JQTA 4XDJA 2WFF1 2QTSA 4DR5O 4D3WA 1ZREA 3VBFB 4LC1A 4GH4C 3BTYA 2WYSA 2EZOA 3AXDA 4JI2B 5LA6A 2QQOA 5FNVB 3T1YB 1DZRA 4RR3A 5J1XA 4LIUA 3JQXA 1T6BX 5LGUA 4YXWG 3WP6A 4ONUA 1RGSA 4QX1A 3JD72 4COUA 2HG5C 4TSVA 5JZGA 4LFBO 4B3NA 1Z0HA 2BCCH 2UXBO 3KF5A 1PNLA 4ZBMA 1XMOO 1A8MA 4DV6B 4LBJA 5HFMA 1Y66A 3HNMA 3BFRA 3CJIB 3HNYM 4XCAA 1TVKA 2PHTA 4XF9A 1ULFA 3ABMC 1WKYA 1B04A 3GHNA 2QE7G 4FPCA 3WB2A 1OA4A 4JYCA 1ZL8A 2ARBA 2BGOA 4XF0A 5JDBA 2IWGB 4RYDA 2Y69B 2UXNA 1H8TA 1VQKV 1Q6IA 2E74B 2XWBB 3WCSA 2FB5A 2AZ0A 1CP9A 2LALA 2ATFA 3MF6A 2RVAA 4NXMO 2QE3A 5F32A 5K4LA 3FFQA 2FBEA 4FM2A 4CXXA 1W6MA 1UU4A 3C7GA 3ETDA 4CSWA 3KV9A 4Y5SA 4J25A 1K5JA 2C1FA 1J59A 5CA1B 5IK7A 3M8LA 4UFJA 3AG4B 3CXHF 4XFHA 5B66Z 1NKDA 1L0NH 2G4IA 5LA2A 1TZOA 4JI2O 2P3IA 1GQGA 5L3GA 2ZDIA 1ST8A 2Y6LA 4X65O 3APQA 1ZRRA 2YY1A 4MGKE 2ARAA 1MSWD 3MYXA 2G19A 3AJZA 3FB5C 5APAA 1RB8G 1YXWA 3VBUC 1YEWA 1KFUL 2WDBA 4ES9A 1RUF3 2EIMC 2DBNA 2RR13 1VBA3 1JJOA 1OHFA 1ZRFA 3N2GA 1HDKA 4DV4O 1OH3A 4ZI7B 3OYWB 4PLMA 4QX3A 1EM1A 3JARB 1GN2A 2VTXJ 4AHWA 1F35A 2YUAA 1I5YA 3UKVA 3AMNA 3RNSA 4TOIA 1ASJ3 3D3AA 4XUNA 1H9PA 2XHBA 2X0LA 2CNAA 4XJ8A 4A3ZA 4N43B 3BTXA 1DU3D 4AK3A 2XNDG 2YIBA 2HWE1 2ZKNA 1SRYA 3UT5B 1WUVA 5IJ9B 2PHXA 2LQTA 3AVSA 4DK0A 1KP2A 2YZ4A 3K5NA 4DW0A 2IJKA 3OUFA 1AR71 2RHPA 3WHTA 1A8DA 3VD4A 3THTA 5H5NA 3E8BA 4URAA 3BB6A 3K75B 4AL9A 5J98B 3PMSA 2R30A 3AG1C 4BHPA 1GKBA 4GWMA 1SF9A 4K1ZA 1DK1A 1LNSA 3M3IA 3LFMA 1U96A 3ZR5A 4H44B 4OLLA 4LO4B 2X5IC 2EJ7A 2VR4A 2NLJC 4I50A 3OW2U 3VD3A 1W8WA 4DRVA 5F3EA 2HKXA 2XUEA 4EEQA 5FY1A 1IXMA 2CDPA 4FOQA 3WDVA 1DCSA 4LK7A 2JD9A 3AKTA 4V2WA 2QUOA 3CCVV 5JSPA 1JH5A 4KFMA 3W5NA 2CYFA 3FHQA 4AQSA 5FPAA 1TEIA 5LA6B 2AEYA 4BW5A 1H0BA 3FC0A 3ZSMA 3J8F2 4AHYA 1GWKA 4MG2A 1HP8A 3HEIA 4Q4Y2 1L8DA 3LKJA 4B4RA 2BJSA 4A4AA 4FIPC 2WNUA 1LJ7A 1GUIA 5FZ4A 3JBG2 4NTWA 4I0WB 1YI9A 1HR0O 1OCZC 4O61A 5IHRA 3VOUA 5FPVA 1RIRA 2Z79A 2QQIA 4HETA 1CAXA 3RZJA 3FB6C 3RBZA 2OCHA 4I0XA 2BBAA 1S0DA 2ZM6B 3ABKC 2O57A 3WQ0A 2VTFA 3T0AA 1V9PA 4HOOA 4K20A 1JHNA 2WZPP 1DGWA 1XSRA 2Q30A 4R8HA 4DUYB 4RGGA 4IV3A 2F1MA 3USSA 5CFCC 3AFKA 3CJHA 1FXKA 4I09A 5EK0A 3I2FA 4GYCB 4YWAA 4CUGA 2ADDA 3B2EE 3ZM8A 2GU9A 1YIPA 4H13B 1S5LZ 2F4PA 4LUKA 4HYOA 3MIEA 1RUC3 5IATA 4YW4A 1FJGO 2Q5TA 4Q4X2 1FXZA 4OQ9A 1UN1A 1JYNA 5FZCA 1CONA 4P02B 3PIJA 4KMQA 2ZX0A 1ZNPA 1O8PA 2P37A 1RXGA 4H2AA 3ZR6A 1S4CA 4IV1B 1KD7A 1VIBA 2HVKC 1I94O 4R9AA 2RMU2 3OAAG 1AR81 3WNMA 2RV9A 2FCVA 2A73B 4GULA 5FY0A 5L3DA 1URFA 2D43A 4JV4A 5LASA 3RWNA 1J84A 4DRXA 1KRIA 4ZU4A 2XKOA 2HEVF 1UQXA 3NR7A 4U7NA 3FAVB 3HJRA 3S30A 1J95A 3H01A 1JZ6A 4AEDA 2X05A 3O1VA 3AYAA 3H1YA 3ASNB 3TYJA 3TNQA 4QQOA 3ZRVA 3ZCCA 4TUYA 2CTQA 5LEKA 2ZZQA 4AF9A 4AXOA 4UB8Z 1JI6A 4FLZA 4LFAO 1M57B 4LO6B 5F2WA 2YU1A 3T2PA 1CESA 2VMFA 5CG9A 4M4RA 4WFHA 3N9OA 3VDAA 5BNPB 2WSUA 4N8MA 4J10A 1NCRA 1WCKA 2KA3A 1HRV3 4WFFA 2ZGTA 4CCLA 4PA6A 4FFIA 1BKZA 4Y5TA 2RS53 4TQDA 2ETEA 1WNSA 3DKQA 2X5IB 4CEYC 2A6YA 1FMD3 1OOPA 2DTWA 2XOMA 5JMOA 3GCXA 4ORFA 4Z2WA 4COYA 2OTJV 5EJ1B 1AVBA 3TN92 5ACA2 3LDKA 1W6QB 1D5NA 4XIOA 5FZ1A 3TCUA 2YG0A 4K40A 1O3TA 5DZEA 1RVF3 1PKXA 5T54A 4PIYA 1NZCA 2IM9A 1G9DA 2Q8CA 3RMYA 4RWUA 4UW6A 1GNYA 4CCEA 1V54C 3AP5A 1BVVA 1SETA 2W6IG 3F2ZA 2RS33 3C7EA 3AZWA 4C90A 4UVBA 2ZR3A 5F37A 3OGRA 4LOTA 1PIV1 2BYVE 3KGLA 2ES3A 4LOSA 3WSOA 2R32A 1FOD2 3VBUA 2VVDA 2E7TA 4COWA 5JWPA 4EYUA 5KHHA 4GX2A 2UXXA 1AB3A 1QJX2 5A3WA 5EIYB 2B5HA 5E79Z 2XQRA 5F3GA 2VW1A 3KWVA 2WFF2 4TWKA 1Q8IA 1V6IA 1JYIA 4GWJA 4L9BA 4HNAA 3Q8AA 4N21A 2MHFA 1YF2A 3N35A 4BZ4A 1JS9A 1IBKB 4FPGA 1TME2 2EZPA 3QOPA 1RUG2 1H6XA 3JAWA 2R0FA 2M7WA 1AJNA 1COV3 4Q29A 4HANA 3A0NA 1TMF1 2VCAA 4Q4X3 4WBNB 3JSNA 2J1EA 1EV11 4FVVA 2QWNB 2ADQB 4WM7B 5CG8A 5GZEA 3RJ2X 4RHV1 2JE8A 1BEV3 2YS8A 4FFFA 3AL6A 2R0HA 3NRUA 3ZIWA 2ZEYA 1DGRA 3K0GA 3U11A 4A6SA 4I50B 4RGAA 2P6CA 3ZYBA 4NOTA 4FPKA 3O9OA 1OCCB 2AUYA 1RUJ2 4NMIA 2FTKA 4FVMA 1UPIA 2WN2A 2J1RA 3SC7X 4GALA 1VBB2 4XABA 3S7EA 3U4SA 3HOBA 5H6RA 1ODMA 2W47A 5GW7A 1W0OA 4ITCA 3NV1A 1W2OA 5DUVA 1EBOA 3GBWA 1N0NA 4LIVA 2JS3A 1PGW2 2RNBA 2R1BA 2ETNA 1NU1H 2J1TA 1UD1A 3M99B 2Q68A 5FO8B 1G9FA 1MABG 2DURA 2YV8A 4I30A 4YW2A 4AQYO 4S2DA 1QVFU 4B3TO 2DYRC 3U75A 1SQBH 4JX0A 4Q0QA 2JD4A 1UZZA 1F5JA 1U5IA 4CUCA 3ZIXA 2CH7A 2ZD9A 5BUVA 3OFNG 3B9CA 2UUBO 2PZSA 4LR4A 4MUVA 1ULEA 3DGEA 4FLYA 3FKSG 4P2ZA 4MOAA 4GKKO 1OOPB 2DU1A 3SCFA 4YM2A 4DB5A 4XQWA 3H1HH 1I6XA 4JI1O 4YG3A 4CS3A 1K5MB 3O0WA 2VECA 3KQ4B 5HV4A 5JOYA 2BWCA 4MXVA 1OF3A 3ZN4A 5DG1A 3KV5A 2VZSA 1Q6UA 4RQPC 4LA2A 4A7KA 2H0VA 2EULA 1QY4A 2Q4SA 2QZ3A 5FCCA 4WCEV 5IW0A 5A3TA 5FZLA 5DDJ3 5F3CA 1DFQA 2EF6A 1LUWA 5A3UA 1R6TA 3ZFEB 1RUD3 3UJQA 1FX5A 3K46A 2Q1MA 2YXYA 1V6NA 2EIJB 3S7IA 2VAUA 3H42B 1WCUA 1XXNA 5KHJA 2BDRA 1Y4WA 5IVEA 3AB0A 1AJQA 1ENRA 1ND3B 1WMXA 2CDYA 4O9EA 5FWJA 2UUCB 4XJWA 1B06A 3CPWU 3RYFA 5EZWA 4ZHQA 3PVEA 3V64A 4LFCB 5C8CC 2XAFA 1Y4MA 3AZZA 1O5LA 4CEWA 4IGPA 4EFEA 2VOTA 1KS5A 4A7YA 4LBEC 3K4AA 1JZ5A 1POV0 3PN1A 4DEVA 1AYN1 3LA7A 3S3WA 3UT5A 1QOOA 2NN8A 1MR5A 1L3JA 3AZVA 3K03A 4DRXB 1SQ4A 4Z92B 1DZTA 2IUWA 1QKQA 2XASA 3WOGA 5A3PA 5K0UC 2XOKG 3A21A 1LHVA 3HPLC 1KC8W 2A70A 2ZHKA 1UMZA 3KG2A 4FI9A 2WN3A 1LEDA 2A0LA 1VRH1 4NAOA 1UYXA 1UMHA 3CZUA 1Q6HA 1J3PA 3VBSC 2G1MA 4L92A 1NA1C 2VNOA 3O0VA 5IDJA 5F5AA 3DYPA 2W6JG 2QGNA 3OEEG 5K0UB 1OCZB 1VP6A 5LA0A 3LOIA 1QH7A 2VQUA 3LFIA 3CNAA 3ZSJA 1BCCH 3O1OA 4W4LA 2GDFA 1MQTB 1KP3A 4AI1A 3R66A 1Q8PA 3TN93 5AFBA 1P49A 2VC9A 1RUJ1 1SS3A 4MADA 2W1UA 4OGQB 3AK3A 1WBFA 1CWPA 3KHCA 5L9RA 1PO11 3D3QA 5FY8A 4UCRA 3K3WA 3R4UA 5FMDA 4JRLA 5CBFA 1K5MA 4X1YB 1GRJA 5T5JA 1E57A 3ZN6A 2KB1A 1HQNA 4AHXA 1XQ8A 4QXKA 4NPRA 3RVHA 1M56C 3PUIA 1W2TA 2CTRA 1WZXA 2YC2A 2K9ZA 2AZ2A 2Y60A 2WNUB 1Z7S1 4R7CA 2E7AA 5CISA 2XJRA 1QJFA 1W99A 3TOJA 4MW8A 1PZ7A 2FYUH 3OGSA 3CZJA 4TYSA 4DMIA 2ET1A 5A3MA 1L7LA 4O4LB 1DQ0A 1F5FA 3RWKX 3BVCA 3SCHA 4F6EA 4XURA 4BB3A 1Y3TA 3ZHQA 5FNVA 5B1OA 1JA8A 2RDSA 2GBOA 3KM5A 4C0BA 3MBWA 3A0BZ 3LDEA 5JOXA 3QH7A 4AI3A 3DKWA 5FYTA 1YHQV 2PI5A 3DPRC 4YYOA 2FZ1A 2BBVA 3JASA 1VQ5V 2DCKA 3U4XA 1OFNA 5FYUA 1W3VA 1DQ5A 3DXUA 1DQ1A 4OXSA 3PTRB 1QF3A 3ZJZA 1RUD2 2QQPA 4X1IB 2BOJA 5FZKA 1SA0B 1RXFA 3WV6A 4U7OA 4QPKA 3VKMA 4A5UB 4PD4F 4NXNO 5FUIA 3WP4A 1IDSA 3LUTB 5KHIA 4B3MO 4XILA 3VKNA 4YY3O 2EXHA 1GOGA 1NA1B 3B69A 2YFUA 3NAPC 5C3PA 5IT6A 5IE9A 2PA7A 1NG0A 4XFAA 1NVPB 2Y34A 5FZ7A 1G1XB 3ZX6A 5A1FA 4OCTA 3WT3A 1LGCA 4K35A 2W46A 5ABJC 3GVMA 2K9PA 3IMMA 1L7QA 1R093 4WBBA 5L3FA 5E6HA 1QU7A 3DXRB 2OIEA 3E8GA 2RCVA 1TME3 5FPZA 5BY1A 1GN6A 3V0AB 5T5LA 3KSCA 1AR1B 1XREA 2GN3A 2OT5A 4FPPA 2JDMA 3VZKA 3ZOIA 5KC6A 3WNXA 3JZVA 2C9AA 4EV0A 4M00A 2D6MA 2GMMA 4IDZA 4K0KO 3RYCA 2UU8A 1K5MC 3CSXA 5FMBA 4RUFA 1K97A 2ZGQA 3SXWA 1HLCA 4DUVA 4DR6B 1EPWA 1RTVA 3RYRA 1ZBE3 3PJSK 2ZABA 4AHCA 4IEOA 2E26A 3O5SA 1S3JA 2YPJA 1ULOA 2XGXA 1PV0A 4CH3A 3H8RA 4GKJO 5BV6A 4MGTA 4UCTA 2AEZA 3WF0A 5JQGB 4FLTA 1AXYA 1WPBA 3GZAA 1NE6A 1F8VA 4JI5O 1MS0A 3JAKA 2KM2A 4M3CA 1R3IC 2NN4A 3L70H 3GALA 3SEEA 3RMXA 4N90A 4NPLA 2W91A 3FX7A 4N53B 4YLZA 3OF1A 4BAYA 3K08A 1RUG3 1Z78A 1QBZA 1HN1A 3S3XA 2RS52 2X7RB 1PGL1 2OCCB 4META 4G9SB 4XHXA 1AYM3 1M9NA 4UCUA 1HRV2 3NNFA 3UJOA 2JDYA 1HW7A 2JIGA 1VE0A 4QT6A 2OYZA 3ILFA 1NJIW 4GB32 5FXZA 3LDCA 1HRV1 4DV5O 2HYKA 1SBDA 4X8NA 4LF6O 5EC1C 4LWSB 5JOZA 3K77A 4UXAA 4DV0O 3I2IA 5IVYA 3PVOA 2QNKA 4Q0VA 1XMQO 3ZYHA 1PVXA 4LP8A 2E53A 1MZ5A 2YHJA 2V1DA 2DVAA 2ITDC 2RQ6A 2DUOA 1K92A 4RQEA 2DJVA 1ZX3A 3KD4A 1Q8OA 1R3JC 1RMU3 4JI7B 2D6PA 3POYA 4XPVA 4QHOA 3H1WA 5B3SB 1MOFA 4YZ2A 1X50A 4QPIA 3O1PA 4JI5B 3PVNA 2R041 4OHVA 3J9SA 1JUIA 4WVVA 4BWOA 3TWIA 1OCRB 3WG4A 3WB0A 2QKDA 4MGQA 3JBG1 1BZWA 3LIHA 4K21A 1UX7A 2HYXA 2WWWA 3PL0A 4DV2O 4XVHA 1GOFA 3O1SA 4QJFB 5IT9N 4MZUA 4UAPA 4QE9A 5B1AC 2PAKA 1YTFD 1XOYA 3THPA 5EPAA 1H2GA 2Q7EA 3DECA 3NV3A 4GWNA 5IYDO 2QA4V 3J81N 3DYMA 1MS3A 1U5YA 4JI4B 4CPBD 2YICA 4FT8A 1NVPD 2Y0OA 5CFDB 1R081 3OEBA 4NROA 1LR5A 3ZHVA 1AR5A 3HKBB 3MHZA 4JTAB 4M3CF 4Q4W2 5KWRA 1SDWA 4TWTA 4JI8B 2K2SA 4QQ2A 5LMNO 4U3JB 2BERA 3AK0A 3D82A 4GMP3 5FP3A 1YTFB 1VRH2 1RUE3 3IAPA 2QQJA 1OXCA 2WNVB 5LP6B 2X8KA 3MF9A 4HN0A 1URXA 2RR11 1D5AA 4LPLA 2R061 5J2UA 1OQDA 4K3UA 1US2A 2DE0X 3ZYJB 3NNGA 1BEV1 4JGYC 1XNDA 3W5MA 4BOWA 1P4RA 4IE7A 4Q0UA 1LU1A 3POGA 5JXGA 4O2BA 3PIGA 1OKQA 3PHMA 3G71V 1XU1A 4UW3A 1ND3C 3RT3C 5KA6A 2YBSA 4WF9V 3BU0A 2QJ1A 3MDPA 5I0SA 4O4HA 4DV3B 4JDMA 5GLTA 3JCUZ 2VQEB 2VCMA 1NH2B 1C5IA 3C3VA 1KGYA 1DLLA 4PA9A 1NYWA 4CEYB 4FPYA 2BRTA 5FBZA 1U97A 3SH4A 3ZPYA 1UZYA 2ZDIC 3F5WC 3EMRA 3KT4A 1VQMV 4UFHA 2X6CA 4CP1A 5HFLA 1C28A 4PA3A 1XL4A 1F7YA 1XPWA 5FYVA 1ZZ9A 3CCSV 3JU9A 2D40A 4QPIC 5JLVA 1IBLO 1M93A 3ZRWB 4Y1ZA 2RS12 4W8JA 1FS0G 2DYCA 3FX3A 5D1IA 1CZTA 1N1SA 1XYPA 3QBQA 1YQ5A 3WW2A 5E1AC 1QR9A 2RG4A 1VQ7V 1ND3A 4PI2A 1TVGA 4BPZA 5EYPB 3LGRA 2WO2A 4UWDA 3ZXDA 4X62O 4IEVA 3CB2A 2PXJA 1N4CA 2GDSA 3WR0A 2JIJA 4N7IA 4LLOA 2BTOA 2QQMA 3ZMZA 1TAEA 1Z5VA 4CDUB 2ZGLA 3NL1A 1LESA 1AJKA 1XNRO 2RM23 1WB8A 1YVWA 4OYUA 5FMOL 3C7FA 3I3BA 4MV2A 1YYNA 2RS13 1G9AA 3KT1A 1M4WA 2RJZA 2VU9A 4AEDB 1KDMA 2HLEA 3IN9A 1CN1A 5DQ0A 4DZGA 1V9U1 3DN7A 1YQ8A 3JASB 2R9RB 3N9MA 2WO3A 2VQEO 1QR8A 4A45A 3CQOA 2ZEZA 1YJKA 4XXAA 5LOVB 3LEMA 1WMFA 1V9U2 3S0MA 2LP7A 3PTYA 4QIWF 1PGSA 3FD9A 4CDXB 4CCKA 3DGTA 1Y76A 4Y22B 3X2QB 2D3OW 3E35A 1N32B 1KITA 1QXPA 3LA3A 5IJRA 2ZIMA 5FZOB 1VBE1 2MNGA 4E8DA 5KXDA 4XFFA 3IC7A 2ZMNA 3B3QE 2UXBB 3Q8BA 1H38A 4QPIB 2WZR2 2PHFA 4HK9A 4FQ4A 1FV2A 4FPLA 1M57C 3VBHB 3F95A 1PM9A 2YI8A 2AXTZ 4NRQA 2Y69C 5IJ9A 1EV12 5A1LA 3JB4C 1TMF2 4BIZA 3J7LA 1BE3H 1OD5A 3OUIA 1VBD1 2RDNA 1GLHA 4Q1PA 4DV0B 5EYYA 3MIBA 2HBTA 2XAJA 2F4VO 2YIDA 1W28A 1LR1A 1B35C 4UF0B 1JMUB 5FZ8A 2V5DA 3L2HA 3OR7C 5FDBA 1JJ2U 5F5CA 4QX2A 5E1RA 2WZR3 3PJQA 2R70A 2QDRA 2E6VA 3QF7A 1F23A 1GH6A 4JI6O 4JPRA 4P5HA 1H2KA 4OMDA 4FFGA 3ASOC 4P9OA 2CL2A 4YVWA 1KDKA 2WT1A 4BQ4A 1Q3EA 3A0KA 2YBPA 3ZYFA 1JZ8A 2HEWF 3OBRA 5JIAA 3ABTA 3MLKA 1V6LA 5FXVA 2E7QA 4QX7A 2RMKB 5LW9A 1RJ7A 1JZ3A 1Z2GA 3M3EA 1QHDA 4BDVB 2VZPA 1N32O 1S77D 3K48A 3VBFC 1US6A 1BLZA 4UF0A 5FXXA 3IJ4A 3KHBA 4PDLA 4O4JB 1S1AA 1ND2C 3AKSA 3GJBA 3E6CC 1J83A 4GIQA 4I5SA 1RHI2 1BEV2 5FOJB 5GLUA 3UGHA 3EHBB 3ZS8C 5FYSA 5CA1A 1BMV1 1AJOA 5H6QA 1KQSU 4C1WA 1TVKB 4OPAA 2YB7A 2WLLA 5IJ0B 2YIAA 3GJAA 2V73A 1PO22 4IEUA 5KLVH 3U37A 1VJ2A 4I3PA 2ZEXA 2XB6C 4Q0PA 2WWJA 4XDOA 2YXLA 1QLEB 3HKEA 4BMEA 1WD4A 3LEKA 4FLUA 3ZYPA 2YXSA 2EAAA 2Y6KA 4GUNA 3RS6A 3J4UH 1V6JA 2QFEA 1AR93 2VGDA 4IHJA 3GB7C 2VUCA 1WP8A 1R6NA 2GNDA 4LORA 1QDCA 1A78A 4MVMA 4IE5A 5IYZA 2CGPA 2ZE6A 3UO3A 4G4FA 5FIXA 5KAIZ 4GA9A 1AX0A 3N4MA 2QM7A 4LJHA 3M2MA 3D5OA 4A2UA 5IVFA 1OCCC 3IIAA 4JCKA 1L0LH 1F4HA 3T4VA 3QG5A 2XBO1 4ZPIA 4AI9A 2P5OA 5FY4A 3USUB 4HBNA 2WLMA 5BR8O 3PJYA 2R042 1XJAA 2QQVA 1UYYA 5J09A 2Y64A 1GNZA 3AG2C 3T2QA 1N3QA 4D7YA 3M4FA 3AK2A 1ZBA2 1D4M2 4W50A 3T1YO 4DR3O 4LKSA 3OBAA 5EYPA 3ZEDA 2R6QA 4KG0A 2GNBA 4DR4O 5BPXA 2BOCC 2GC0A 2BNNA 4D94A 2Q1FA 4O9GA 2P6JA 2D97A 3HN3A 5FZFA 3GM8A 4A42A 5A7WB 4JTDB 2NPIA 1M4UA 5HXMA 1FOD1 5AVPA 4OX9O 3I2HA 4G2KA 5C5UA 3QO5A 2A3QA 5CB4B 1CX1A 3NNLA 5I8YA 4JGZC 3EHKA 3E22A 1CAVB 1SPPA 4YW6A 4QXBA 4RL7A 4BXSV 2Q0OC 1IOAA 4A44A 4UBHA 1W8FA 4XBNA 2IVJA 3ZYGA 2XLGA 1NTZH 2CK3G 5CAZA 5ANQA 1RINA 1LOAA 2IVIB 4AOCA 4YW7A 5JZGC 4UFMA 1Q43A 3HD8B 3SNMA 2JKXA 4DV1B 1AXZA 1FPN1 3ZFFC 3ABUA 4HVOA 4EROA 1NE4A 3ORJA 1U5ZA 5FK8A 2EA7A 4XXPA 2R072 5K0UA 4WVZA 1O8SA 3CCLV 2PHDA 3HKCA 1NXMA 2QKCA 2ENRA 3N2GB 3QNEA 4RN5A 4MTFA 4QPGA 4DO2A 1RUE1 4GX1A 3K0DA 5GLZA 4N43A 2ZXWB 5DAXA 3TB0A 2V4DA 2WNVA 3EJKA 5F2SA 1S0IA 3CD6V 1ASJ1 2C4XA 4BCUA 3U14A 2JIZG 3M7AA 3C8XA 3ZFEC 5DN2A 4HVQA 3WDWA 1XNCA 1E79G 3DEMA 5DN6G 4QPGB 2BUKA 4J9ZB 4LBLA 2RDCA 4DXWA 1AR61 2ZPXA 4XJ9A 4BQ5A 4JKKA 3OBTA 2CV6A 2DBIA 2HHHO 1SQGA 2ZX2A 2N7GA 4BH9A 1TG7A 1A3KA 1PHMA 3ZYRA 4FJCC 2I2SA 4JGSA 3VV1A 2DCZA 5A3NA 2D2CB 1GWMA 5KXCA 4LHLA 4YHHO 1ULCA 1HB3A 1AL21 4EN0A 3H1IH 1AZDA 1ZL8B 5BNQA 4JDNA 2BE3A 4RS5C 3CO2A 2D44A 3WNPA 4ZU7A 4P9YA 5FPLA 3VBOA 2JDAA 2MPFA 3CRMA 5I8SA 4UFLA 4LFAB 5DEDA 3JCIA 4XJUA 4NTYA 5IVVA 2W0FC 3AP4A 3WG1A 3DXRA 4CCDA 1CIWA 1GZWA 5JIUA 3VBSA 3ZMOA 4NE9A 2ZZJA 2FDJA 2DUQA 3VZMA 2JGDB 3POEA 1VAKA 1ZBA3 1UOGA 2W39A 3LEIA 2ZXWC 1C57A 4ASLA 2XBO3 1XMOB 1IQDC 1AX2A 2C2AA 2WQ8A 4XBFA 2W2IA 3VN4A 4JQRA 5ABJA 1MA1A 3PVBB 1LGBA 5F6LB 2CUGA 1N1YA 2RS51 1VMFA 1UY1A 4EN8B 3N7KA 5C4WA 2WYFA 1JCHA 1XB9A 1GK9A 2Q0AA 5LGNA 3KV4A 2FDKA 5JPNB 1ENXA 5FFOC 4EWDA 3OOXA 4QB6A 1I0HA 3AXEA 4HKLA 3T1HO 5K8SA 5F7UA 4ZKIA 3ZN6B 2JG9A 2JXAA 1F4NA 5GONA 1ZZ8A 4YGCA 2J1SA 3LCPA 1EZJA 1FXKB 4R6ZA 1AYN3 2KQXA 1BCXA 5EV7A 1UFIA 3CKHA 3NO8A 4LF5O 1P8JA 4JF3A 4JI3O 1COWG 2EVXA 1HB1A 1O6UA 1W2NA 2KKWA 2ZM6O 1LECA 5DZFA 5C8YA 3DCQA 2PAMA 4P9WA 4BQ1A 5EQUA 2VZRA 3J8F1 1AL0G 2VPVA 1G9CA 4IETA 4D8MA 4IE6A 2RJ2A 1SFYA 4HZ3A 3VBBA 3DPRB 1S2BA 1W04A 2FCTA 1JBCA 1QMJA 1XE8A 2E63A 2ZINA 5LMUO 1K42A 5JJEB 4DV4B 1RM1B 1U12A 2QM4A 1S5JA 3CJIC 1GQHA 1W2BU 2CWSA 4DR4B 3RN4A 5FUNA 2WQZC 5LXTB 2JJ2G 2JENA 4O2AB 4DR7B 4U3FH 1IPJA 1Q8VA 2YGMA 1Z7S3 3LZZA 2PHUA 3VDDB 4YVSC 2WINB 4QQHA 2DW4A 4TLFA 4D6RA 4ZIBA 4K3AA 2LM3A 5L73A 4JI3B 1IS6A 2PFWA 3RZMA 2W52A 2E75B 4K8FA 2PYTA 3BODA 4OUMA 5FZOA 3WW3A 3ZKUA 1VBC1 2I45A 2R073 4HNAB 1GYKA 4QKNA 3POJA 4AAPA 1SBFA 2R1DA 5FMCA 2HWF3 5IWAB 3FB7C 3CJIA 2AYHA 3ZN0A 4QU1A 1ONAA 5BMVB 3HR9A 1UWWA 4Q5OA 5HXVA 3WNOA 3UKMA 4PI0A 4L0PA 2Z42A 2ZE5A 4BISA 2DWRA 2YC4A 4QPYA 1TUEB 4GH4A 1GFF2 3CF6E 1HNZO 3FJSA 4NYKA 2GNMA 2WBKA 4DYLA 3N7MA 2VOXA 3OY8A 3W21A 4CEWC 1STMA 4GXLA 1SLIA 1BXHA 3TXQA 1X33A 4O4IB 3L2YA 4QXCA 3CIHA 2DTYA 4DR7O 3VHRA 4RQPB 2FMLA 3IIIA 4O4LA 2BOBC 4WM7C 2HFEC 4X6QB 1RVF1 4AILC 5A6XA 4QWNA 2ET7A 2ZTNA 5CBLA 1TGOA 2XHKA 3U1XA 1ZLZA 3INAA 4YW3A 4XDLA 2C5DA 4ZXKA 1G9BA 5T52A 1MZFA 4CU7A 4AW7A 5L36A 4L8JA 5DZGA 4LTAA 4PJ0Z 3MV01 1H8TC 5DUXA 4FQZA 1HRI2 3MIDA 4TZDA 2RDQA 4Y3OA 3L71H 4G3YC 1O9GA 1VP7A 1PP9H 2VO5A 2IXKA 2GH2A 3MPBA 2Y4TA 1GZ9A 4IEPA 5BMVA 4DQAA 2VZUA 1KBHA 3ZDVA 1DG6A 4BLJA 1LULA 2EIGA 3IDCB 3RGBA 1XOUA 4V2VA 3IDEA 4O65A 3VDDA 2ZGNA 3QD6A 1LKNA 4DR2B 3KQRA 3JB8A 4WBNA 2HH9A 1F9KA 3OG2A 5FP8A 2XJPA 4BU2A 3FBMA 4XETA 3A0HZ 4C91A 1GTOA 1JOPA 4B4PA 1QGLA 2RMU3 2OIGA 1H30A 4JGZB 4Q8KA 1YQCA 1W6OA 3KCYA 1FJGB 3FLPA 2LW1A 3E22B 4CBCA 5FLIA 4EN6B 1UOBA 4LT5A 4W6WA 1KKCA 1PX3A 4CDWB 1WBLA 1AYM1 5CA3A 3CXCU 3RYHA 3TEYA 2HEPA 1D0HA 3GZEA 3NNJA 4LO7A 3RYCB 4YPJA 3ZMTA 4FP2A 3T4ZA 1ZAUA 1SLLA 3T1HB 5FYHA 3WNKA 5H9RA 4IV3B 4FPFA 2DMXA 1JU4A 1T6GC 3LPFA 1POQA 2XVLA 5J9PC 4JTOA 1PK6B 3BPZA 5EXOA 1V70A 2JDKA 2W5FA 4AZZA 1WCSA 3ZFGC 1S0BA 2VQTA 3ZN5A 3UESA 4YGBA 4M0HA 3NSTA 2AACA 1QNWA 1NH2D 5DECA 4MGIE 2J22A 2XVGA 4MO3M 1PIV2 4WVMA 4TT3G 3I59B 3AYDA 1SCSA 4R9CA 5HCHA 4X1IA 1NLQA 2WPDG 4DR2O 2O8QA 1PPJH 5CKNA 1UCXA 4QMAA 1JX9A 2CE4A 5JJJB 5IAVA 1ZWIC 3J7NA 3E86A 5JZGB 1XE0A 1VMGA 1VQ6V 4OI1A 2VS0A 2P3KA 3OCPA 4AGGA 2P4EA 1LGNA 4FSJA 2Z4FA 3B09A 2QWQB 3K58A 4Q4Y3 1MZEA 4FPEA 4JVAA 3SPCA 2YSUB 3EVKA 5H9CA 4L2NA 3FHIB 4FFHA 1GMGA 1GU3A 2CTVA 3FWEA 2WUHA 1H1MA 3MHSC 1R1A2 2ZX1A 3HR0A 1S0FA 1W06A 2VJXA 3LSDA 3ZXGA 4TXWA 1YIJV 4IE4A 5K7PA 1HNWO 4AFBA 3OGJA 1RUI1 3HWJA 4CXYA 2WWSA 4D6TH 1QU0A 5LL6Y 3O14A 3WEZA 3ACGA 1O9HA 1WWYA 1MNGA 1HX6A 4KL1A 3F7VC 2DDUA 4YZ4A 1REFA 4RS5A 3AG7A 1IBMO 1YJWV 2XMLA 1KU9A 1GR3A 2P22C 3VBRB 4TV8A 1S0VA 2YDEA 1JYVA 1OZ0A 4FMTA 2XJSA 4A3XA 5FO7B 3Q8EA 2VULA 3O7OA 2UUCO 4OUSA 5DMYA 3X2QC 4CDQA 4AEDC 3UCSC 4Q1RA 3ZMNA 2WNUC 1EAH3 2F23A 2B1IA 3WDTA 2PYLA 2A3XA 2JEMA 2MEV3 1UY2A 1W6MB 5BNNC 2FDHA 1W6OB 1LHWA 3IAQA 4FM0A 2ZGKA 2IZWA 3HMYA 2LJ2A 3CEIA 3LEGA 4X8PA 1HKDA 3LDRA 2EJRA 3V0BA 4X1KB 1AUYA 5KX5A 3ME2A 2ZX4A 2E31A 1S2EA 4YZ3A 3BVOA 3JQWA 3HKCB 4LUMA 3OE7G 1WA8B 1HV0A 1BT8A 4WV8A 3CLPA 1FMD2 1MEC3 1PZ8A 1I94B 2ORXA 1W2AX 2E9QA 1GNHA 2ZNIA 2J1UA 3BCCH 1QJU2 4RGKA 1IQAA 1NCRB 2QTOA 1DYOA 4FFKA 1PX4A 4IGQA 1AF9A 5KR7A 2E5LB 4J6GA 4TV9A 3MIHA 3VQXA 2QDOA 2R72A 1R73A 4QX5A 5BNOB 5LK7B 2B9VA 2JECA 2Z0AA 1MS5A 3SJQC 1QQCA 3WX5A 4PELA 5KHGA 3B77A 5FZ9A 3MHHC 1SQQH 1LOFC 1OVPA 2CGOA 1ZTEA 4D0QA 2VZ1A 4CDXA 4P9LA 4QKDA 3RZKA 3D36A 3JCZA 4IYHA 1H1IA 3MIFA 2FDGA 5JVDB 4KHPB 2VCCA 1XRUA 2UUBB 1H2NA 3ZMUA 4M4PA 3K4ZA 2EINB 2PAEA 3FUQA 4TV8B 1X8EA 5J96B 4GD4A 2W68A 1H1AA 1VQ4V 3VBRA 5A7OA 4BMBA 2DCJA 4AVVA 3WVJA 4HSJA 5LGTA 4JZRA 1I9RA 1B6QA 1VBC3 3KCCA 2AR6A 3CCRV 5F5IA 2XR4A 4FTBA 4EZ4A 1THZA 3ICXA 1OA3A 1ASJ2 1AR73 1QQP2 2J1VA 4KBBA 3DTUB 4CS4A 3HKDB 1G6UA 2VW0A 3R4SA 3SPGA 2E51A 1NI8A 1VLNA 2FMYA 1IS4A 2PLV1 2QKSA 2X6BA 3WHUA 3E89A 2BEOA 5FZIA 1BZKA 1GV9A 4PA4A 2L6LA 1C5HA 5IVCA 1UU6A 3USUA 2FDIA 2WNEA 3LQCA 2CSGA 2BNOA 3EO6A 4F4LA 5IFPA 3OMAB 3VQYA 5C8WA 5B1AB 1XHZA 4NTXA 2UYAA 4EFBA 2A79B 5DM6V 3WZ1A 5LWBA 3WDUA 3ON7A 2BGPA 4E4EA 4MXWB 4X20A 4PDWC 2P6HA 1KD1W 1JXNA 2WAOA 1W6PB 3ABKB 2W1QA 4TV9B 1O59A 4KHPO 3C3TA 1R6KA 3VZJA 1F51A 3NNMA 3A8TA 1PZ9A 4BQYA 4MVTA 1SLAA 2BSKA 1H8HG 2JDZA 3CC2V 1EN4A 2A6WA 3IGAC 1SQXH 4Q6GA 5LBCA 3WF3A 2BWAA 2PUSA 2GTSA 3OGCC 4MS2A 3UNPA 3MW2A 3THCA 3NWKA 5KBFA 1VF7A 2W87A 3ZPOA 1P84F 1MZ6A 4DRRA 3K57A 2XLAA 4YGDA 3MW4A 1JR9A 1Q7YW 1IVSA 5LXTA 3J8F3 4GB33 1LENA 2BTQB 1ZYBA 4DOUA 4SLIA 3B5LB 4GCZA 4N7UA 2Q7HA 4I55B 3X29B 4EWAA 1BL8A 2FQPA 5B3SC 1N34B 2JG8B 1DP0A 5B2GB 4Y20A 2FDFA 3MFAA 3IC9A 1PD3A 4J42A 4GJYA 4HKWA 5CFDA 3WG7B 3DYOA 4DIQA 3ZFGB 3CMAV 2ZBJA 1VF5B 1DLBA 1ULGA 4GJZA 3CL1A 2Y26A 4P9PA 2VE1A 3H8OA 2D6OX 1FXHA 1G4YB 5FKBA 1YITV 2DWDC 3SQOA 1HJGA 4E4DX 3JAMN 5J2UB 4Z1VA 4PA7A 5LBEA 1W05A 4LQRA 2E3CA 4IQPA 4NB5A 3W7WA 1FD9A 2VUDA 2IH3C 3BAAA 2B9ZA 2WLIB 1HDJA 4EN9B 5FL7G 5A33A 4C7UA 3HPNA 4LO8A 3T09A 2N05A 1HNXB 5T50A 4H55A 2R071 3B8MA 1LHOA 5JVDA 3K9SA 3Q4HA 1E1RG 4B8EA 2DWEC 1WMEA 4Y1YA 4F83A 1EUUA 2JDUA 4H37A 1GWLA 3KKYA 4IIJA 2ZJCA 3FMGA 1UZVA 5D8AA 4J1WA 2EICA 4DUZB 5DAPA 5ITZB 3FYIB 3J26N 5T5OA 2HLDG 2D3SA 4B7KA 2UUAB 3KLSA 4Z1MG 5E89A 4NN0A 5T3NA 3TRSB 1EN6A 3AG4C 4ATFA 5A6YA 2XL9A 4QGPA 1QNMA 1OHHG 3I3DA 1CX4A 1BVP1 1US3A 4CU8A 1V9U3 1W9FA 5C3QA 1FPOA 3VBHC 5JH7A 2EIJC 3HNBM 4NAMA 1XUQA 1V54B 3ECQA 3W7UA 3WCRA 1CR7A 3MZHA 3JD73 1VALA 2XKPA 4CCCA 5A7QA 3T2OA 2OKXA 1O4TA 1GM8A 2RE9A 3PURA 4L8QA 1Q90D 2IU0A 2RM22 1MS4A 4X64B 5C3RA 3JATB 1JOYA 2Y33A 4W65A 3FN9A 2SLIA 4MLOA 4KWKA 2J7MA 4UCSA 1NLRA 1V6OA 4FOYA 3GWOA 2VZOA 3HQRA 3UETA 1QOSA 4LK6A 4JYYA 4JI8O 1P7BA 2GUZA 4DEQA 2EIKB 3AG3C 2D3RA 4XQDA 2HVJC 1XL6A 1GBGA 3QACA 3OTOO 3PUAA 2RN9A 2HWC3 5CEHA 2FL4A 2IXIA 2UY9A 3BN6A 3SH5A 1JVMA 1RUI2 1QOTA 3M3OA 1GANA 2JVDA 4BW9A 3JAKB 1J1TA 4P30A 5FAXA 4QAWA 2GUZB 4DXZA 3FYEB 3G7DA 2F66C 1W8UA 3HQUA 1KMIZ 1PO21 2E32A 1JU3A 2ERFA 4AG4A 3LSUA 2DQ3A 2CY6A 2QWPB 4AFAA 2EBOA 5J2TA 3CCJV 3M1HA 2VOVA 2OA2A 5CA0B 1AL23 4BQXA 4RUEA 5EZYA 4S2GA 4U3JA 1D4VB 5HPOA 3VQWA 5FR3A 2WFF3 2IBZH 4I3GA 3E2EA 2ZHMA 3MI8A 4MT8A 3I3MA 1K4CC 2VTXA 4K8XA 2ZMKA 1O91A 1SG3A 4X20B 2LW8A 3ZVXA 3JALB 3BTZA 5KXEA 4ASKA 2Y4UA 5H2FZ 1RUG1 1UXXX 2R7EB 4CP2A 5AC93 3N2KB 3AG3B 2NQYA 4FO9A 4Q4W3 1J1LA 4UW5A 2VBPA 2V72A 4X8AA 3BGAA 3GBGA 4KXRA 5A7NA 3JXSA 1SDDB 4X65B 4M01A 2QJVA 5LATA 2V7QG 2CAVA 3A23A 1N34O 4R50A 3K5MA 3VKOA 2BU9A 2Q5ZA 5IYZB 1GZWB 1DYPA 4MGYE 4DFSA 3VDDC 3JATA 2CH7B 4FXGB 2P34A 5FPUA 4DXRA 2A3YA 4LWSA 1AYM2 4LF8B 1FFTB 4LBKA 1YQ2A 4W4ZA 4LE3A 2HJIA 1L1FA 1PMIA 1W8TA 3GHMA 4B3MB 5AC91 4YY3B 3K04A 1RP3B 2RS31 1C8M1 4E4HA 1IPKA 1IHMA 2DCTA 3N2KA 1H4GA 4MHRA 2E33A 2OS2A 5FUPA 3C3SA 3OD4A 2B9UA 1YI7A 4I9WA 4JAUA 5FZ3A 1PM4A 4IEYA 4PDWB 4JI4O 2A71A 2W94A 3VGIA 4HVRA 4W6XA 4YM3A 2GN7A 2YEVB 2RR12 1Y74A 4HSLA 4WVWA 5ACA1 3K06A 4YVSB 4BXFA 5IYYA 1C1FA 2LUWA 1W8NA 2L9LA 1EY2A 3I4IA 4IEWA 1W03A 1AI7A 4IYIA 5I91A 4I01A 1HNXO 5EZYB 4LF9B 3B02A 5EWSA 2UU9O 4I02A 5C6CA 1SZTA 5FYIA 4CH4A 4R4ZA 3S5QA 3ZO0B 2OZJA 1NR1A 1G6NA 3WP5A 5A32A 5GTIZ 2D93A 1HV1A 3BRCA 1OPOA 4JYAB 3VHOA 1WD3A 5ANNA 1X4TA 1AHSA 4UYBA 5EJZB 3O0XA 5C70A 5FPBA 2MEV1 1PL0A 4L11A 3ASOB 4MYEA 3B40A 4O4JA 2WT0A 3BABA 5EJ3A 5CADA 4LHKA 4B3RB 1RVF2 4LBQD 5HV0A 4DR5B 4OZXA 1QH6A 3UO2A 2Q6AA 2VG9A 2W92A 2SBAA 5A3LA 4YJ3A 5CB4A 5EHDA 4OI0A 3KS7A 2WC2A 4QPGC 5LRSA 3SYCA 5FLHA 1D2SA 2VWKA 1PNGA 4CVUA 1CAUB 1BK1A 4XC9A 1MPXA 4OQ8A 3WQ1A 1IBLB 4C0HA 2ZA9A 4Q26A 5K1PA 5K9YA 5LB6A 1PVC2 3N9LA 3H1MA 5D8AB 3NQHA 4AYUA 1S5HC 2ZACA 3AP6A 3H3LA 3ZRSA 2H6CA 1RUNA 3AC0A 4X66O 1ORQC 4AQTA 4GX5A 4MVOA 3V56A 4RS5B 1SLBA 2HJDA 1VBA1 4DY5A 4LF6B 1PNMA 5IAXA 2UXCO 1VBC2 3B4SA 3J80N 4RR3B 5C4WC 2YI9A 4LFCO 2QM8A 3WF2A 4XHBA 4QDRA 5FXWA 2HEYF 5FY9A 2OPWA 4B3SB 4DXTA 4Z07A 1RC6A 5CNAA 1BYHA 4FTEA 4M3CE 4FLVA 2FD8A 1H4HA 1WCQA 4QDSA 1IGOA 2L35A 1DZQA 2ZX3A 1DF5A 3SPHA 3MGUA 3WG3A 3ZXEA 3AMPA 3ZXFA 5GJ6A 4FAGA 1DGLA 1CPMA 2P90A 3WUDA 3FHAA 2Z3YA 1WLTA 5DAVA 3VDBA 2Z69A 1VQNV 3W9AA 4WZFA 3IDBB 4CTEA 1G8MA 1SA0A 4CYDA 4O2AA 2ZE8A 1UZ0A 2B4KA 5F39A 4AVBA 1JW6A 2D7FA 1WA6X 1OCOB 1VQOV 4XYXA 2NZ9A 4X66B 1D7PM 1HB4A 1LOEA 5L3BA 4QQPA 4C1XA 5D5PA 3FBYA 1UPGA 1MQTA 5LRRA 4Y1XA 4WM7A 2H3OA 4QKBA 1LNQA 4XF1A 1CZVA 4XJAA 2DFBA 2XJTA 1FI2A 1KFXL 4N9HA 4J7JA 4XEZA 1JZ2A 2WSVA 4NO4A 5HCAA 5KUMA 3IKWA 5JI7A 3HKEB 4OX9B 3AMQA 3WINE 4NIDA 2H8PC 5CKQA 3ZRXA 5D21A 5C7GA 4DK1A 3AP7A 5L7OA 4LF5B 2CAZC 3E8FA 3PUHA 3GXUA 3SHRA 4ZOLB 1XNBA 2VCBA 2DCYA 1V55B 1FPN2 1H8VA 3CJXA 3I3EA 3CRAA 4KU7A 1W8ZA 5IFTA 2GSMB 4GT1A 3PUQA 4PDVA 1JPXA 1G86A 2YGLA 4HFSA 2QQNA 1TMF3 3L9JT 4IGOA 3WNLA 4Q4X1 3T1CA 1EV13 4ZOLA 5BYNA 3KMHA 1JZ4A 3DV8A 2PHLA 3OEHG 1QWRA 1OLQA 1YFXA 4HXCA 1I1EA 2IXHA 1APNA 1VBA2 3URFA 5LZ6A 3S6PA 1OCOC 3W20A 3MUZ1 4YVWC 4OHZA 3ZXAC 2NR5A 3T0BA 3ZLIA 4YG0A 1B3QA 3CWBH 4NXNB 1PVC1 2Q7GA 2UY8A 4DPNA 4XZPA 2FCUA 3AZXA 1E5HA 3WNNA 5FRAA 3VBHA 3WF4A 2WRAA 1AP5A 4F6RA 1C4RA 2PQSA 4CC6A 2HHHB 3KZ4C 2M6YA 3EXUA 1NBMG 1GKFA 3VBRC 3ZXLA 2HWF2 3P1IA 3HVDA 1QQP1 3NV2A 4KBZA 1J3RA 3CE2A 2WQ4A 4CCNA 4Q0SA 5JCOA 4J9YB 4CEWB 2R9IA 3SMHA 3OUHA 1DTOA 1IBKO 1YHFA 3ALQA 3SJCC 4I2OA 1POV3 5BZBA 4DINB 3HKDA 1LHUA 4QB2A 5C3SA 4K0KB 3ZBHA 1CJDA 1DF0A 2H6BA 2ZS6B 3OB8A 1OLRA 2YMZA 1IZ3A 3ST7A 3CRCA 1SFPA 2WLNA 3K5OA 3CDZB 3VZOA 4DR3B 2YEVA 4PJYA 1OKOA 4CUAA 4PF1A 2Q1ZB 3AX4A 3ES4A 1OI6A 5FWEA 1LU2A 2OIIA 3AL5A 2VD7A 5EFUA 3ZMVA 1S2KA 4GKJB 3QLQA 4NHKA 1E5SA 5GTHZ 4LF7B 5C3OA 3RYIA 3CEWA 4KWLA 2AGAA 5HCFA 1XNTA 4J80A 4ZKTB 4PQQA 1QJU1 1S0JA 1LB2A 2ZIOA 1YWKA 2YU2A 3OR6C 2BTQA 3SCGA 1Q86W 4IL6Z 4PF5A 2CAUA 2IFRA 3APBA 3JD71 4AEKA 4NJ4A 1FMD1 3ZRWA 2NYYA 3W7XA 2GP5A 4EB6B 1ZBE1 2ZGMA 2Q73A 1PK6A 2P7TC 1MS8A 4IERA 5FPXA 4Y1VA 1VMHA 2NMOA 2UURA 2JGUA 1JOJA 4RA0A 2A06H 1NCQC 5L7OC 3VL9A 1LHNA 1J5EO 1PMJX 3RQ0A 4LEJA 3K2OA 2GP3A 4MVZA 3WU2Z 3CRRA 2WZEA 5GKAC 3G67A 4X89A 1TNFA 4Z8BA 1YXBA 2ZGRA 4D6SA 1UOJA 5FYCA 4I55A 2P1BA 5KHKA 4INDA 4XOGA 3A2FA 1AILA 2VH9A 2IXLA 1VRH3 1YUDA 3PUSA 2WWUA 5TSWA 1XMQB 2QTWB 4QDQA 1KJLA 1MEC1 2FHRA 4OUEA 1IURA 1JFFA 2R49A 5JMCA 4M0NA 2B8MA 1JTZX 4LFBB 4KUMA 3WDXA 2LROA 1UIKA 3CX5F 4YW1A 4J11A 1AX1A 3EBRA 3IB3A 1PO12 4N9IA 2GC1A 1ZRDA 2KG7A 3I2JA 3FLRA 1FATA 1FAYA 5GZFA 1NAEA 2YBKA 1NCQA 1O4YA 3I97A 3KVBA 1VBE2 1MACA 4WZCA 2B1GA 5TISZ 1R3KC 3ETEA 1OBNA 3BYWA 2LGQA 4MXWA 1VIWB 2PN5A 3LDDA 4LR3A 4YHHB 4I4TA 4AFCA 4MVSA 3NAPB 2P4KA 1SQVH 2BVVA 3HT1A 5KC5A 4RR3C 5JVVA 2AHYA 1NT2B 3I3QA 4URTA 4AE2A 4CH5A 3HKBA 1SLCA 2ATKC 4Y5Z0 3HB3B 2AC1A 1OPMA 3T2MA 1CAXB 2H94A 3RWRD 1BQ0A 1AI6A 1WW6A 2VBDA 2D3PA 2VUJA 1BMV2 3BCWA 1CAWA 5BNOA 2ADPA 1AYN2 3CP1A 4TUYB 2CTWA 3ZHSA 1LTEA 3N3HA 1M1KW 5FOBB 1I08A 4Y4RA 4YNIA 1DGSA 1VMJA 1HNZB 5B1NA 2F95B 5FZDA 4H33A 1ZRIA 1OQ1A 2HR3A 4N43C 1NXD1 2VMHA 1WGPA 5L9BA 2ADEA 3FAVA 4JKLA 4CDWA 3RDIA 1L7RA 3DC5A 4LO5B 1Y7BA 4A6OA 1HNWB 1C8M3 1GP5A 5IUQA 4IT5A 3H50A 3FUOA 1KS4A 4YRDA 5FYMA 1XC6A 1K4DC 2CGNA 3BIWE 5FZBA 3VLBB 3M3CA 3ENRA 1QJX1 2A7WA 3HBZA 1NY72 1G7YA 1EFRG 3AKRA 2XJVA 2EXIA 4E2GA 1YSCA 3BUCA 1AJPA 2D98A 5BNNB 4RO2A 3POWA 5FKCA 3B93A 2PGGA 4BYYA 4Q4V3 5C9AB 1YJ9V 4E4ZA 2B5UA 1WA8A 4ZHNA 1OH4A 4X88A 4IEXA 1CAUA 5JXIA 4QXHA 4C8DA 4PHZA 2ILMA 2VOWA 3RYHB 5FP4A 1QHTA 2DYRB 1XSQA 4XTPA 1FT9A 2ZE7A 4YG6A 3RI8A 3L74H 1H9WA 1UMIA 2RJLA 1DF4A 2A6VA 2LTNA 4DR1B 4XQ4A 3OGVA 1I5XA 4GLXA 4Q8LA 5I93A 4H0LB 1RJ8A 2VXRA 4DV7B 2ZR2A 2OTLV 4M3CB 1S0CA 5FLJA 5HI0A 3RG0A 1P7GA 1OFSA 3LNNA 1D4M3 5GLVA 1XQNA 1K5SA 5FZ6A 1NQJA 3RPQA 4JI1B 2HWE3 2FZ2A 1E5IA 3K51A 4RFT0 1MMMA 1VRBA 4OI2A 2WL1A 5HBAA 1KECA 1ZA4A 1W9WA 2TUNA 3ACHA 1GM7A 1KKDA 2VVFA 1FYJA 3CCMV 3KT7A 4N53A 5AFEA 3QTCA 2X09A 3B9IA 5KA5A 5LEJA 3VZNA 4MHUA 3LPGA 4N23A 1X9TA 3ZXJA 1V00A 4CE8A 1MVEA 1YCIA 1H6YA 4K8RB 4RHV2 4J7ZA 3ILRA 4W6YA 1KYOF 4CZSA 2UXDB 5LBQA 1LEMA 1YFUA 5JH7B 1W0NA 4LNUA 5IVJA 1QLNA 2EINC 1WB7A 2E5LO 4QX8A 1DYKA 3MLJA 3QO8A 3THDA 1LCLA 1IS5A 5LP6C 2VQ0A 4AFDA 1ENVA 3SJBC 3ZDSA 5CZKA 5D5QA 3VKFC 5GALA 4DR1O 1WPXA 1AR82 1E1QG 1IKQA 5A80A 5G04L 4PT6A 3DC6A 4DV7O 1Y67A 4F3JA 1I5PA 1EAH2 1UAIA 2YXHA 2P5BA 2DF7A 2G9ZA 1VQ8V 3AG1B 3UGGA 1QJY1 2ZOEB 5CYYA 3OSDA 2JB8A 5A7WA 4ZU5A 2R16A 1VQ9V 2XONA 1HWYA 4YZ1A 1N36O 4PDMA 3Q4HB 1RPOA 1XDCA 1IKPA 3I59A 3LWCA 3B8NA 3ZKYA 2B7YA 4YM1A 2DVBA 5FBJA 4B1MA 2EILB 4GZRB 3IPVA 4H3WA 1FNYA 1SEFA 2OWOA 4CDUA 1VF6C 3JSLA 3M70A 1PGL2 3AZYA 1WLEA 4TQFA 3WQBA 3LD8A 5DDJ2 2R062 1ZX5A 3VB9A 3ASNC 5B1BC 4UV9A 1OV9A 3NKGA 2Q8DA 1R3LC 2KR2A 2IJIA 2W95A 3WY6A 1NCQB 1UJWB 1LOGA 2HKOA 1RUOA 3OM3B 1SESA 3HT2A 4EN7B 1Y9GA 1TUBA 3ZSLA 5IY5C 1S76D 1OQEA 2PLV2 4Y4YA 3CRQA 1Q81W 5LP6A 1S0GA 1UY3A 1IS3A 2JDHA 1CGPA 5JXHA 3TGUH 4E9KA 2XAHA 3H0OA 2KSDA 4GZ9A 4NXMB 3JARA 3JD2A 2B45X 4QE7A 1HXS1 1TE1B 3QCWA 1J3QA 1QEXA 5KXBA 3T1LA 3NV4A 5LK5A 4FM1A 1N36B 1D2QA 4CP0A 1RFYA 4E2SA 4E27A 3N9QA 2ZEWA 1PIV3 1NLSA 2JG8C 4QQLA 1PO23 4QM9A 3W7SA 3WG2A 1SHWB 4HN1A 2WS92 1WW4A 1ENQA 1UL9A 2PQQA 1H8TB 1GM9A 4KWUA 2BW8A 3OGIB 3T08A 4NRMA 1GN3A 3PU8A 1RHI3 1WAZA 2YPDA 5BR8B 4ZY9A 2N74A 2QKAA 1YFWA 5LBFA 4TLGA 2RMU1 2EXKA 4YVSA 1MS1A 1FXKC 2E76B 2AGSA 3R65A 3GCWA 4XDKA 4FCAA 1IG0A 5CA6A 3KGZA 1COV2 4I0BA 1GSLA 3K59A 3G6BA 4YZ5A 1U0AA 4JHTA 1B35B 4FK5C 4ICGA 4JHZA 1CVNA 2J1AA 5A9GA 2OZ6A 5C4WB 4TN7A 3D8CA 5L19A 1Q5OA 3G6JB 1Y9QA 1W59A 3I8TA 2VW2A 1AR92 4IUGA 1JODA 1UY0A 2VZTA 1GN4A 5F2VO 1N8RW 1X36A 1YJLA 2JDNA 4CXWA 1WW5A 2FMDA 3BKZA 1TNRA 5C9AA 4R52A 1XYOA 3MD0A 5CVRA 4AHZA 5LHIA 5GZCA 3QH6A 2D5FA 4LMFA 3TETA 3O1MA 3FB8C 3VBOB 1H8EG 3BOPA 3DUIA 4IV3C 2VNRA 1CAWB 4MH0E 2IXJA 2CU5A 3SKVA 2XBO2 1YJNV 5F3IA 3K4DA 5JCOC 3OPTA 1W9TA 2JB4A 1XNQO 5BNPA 4TTGA 1W0KG 4IV1A 4Q4Y1 3PU3A 3AEIA 4XMIA 1SC5B 2XXZA 5A33B 3KZIZ 2YUEA 2EILC 2A1XA 2ZHNA 3CCEV 4KU8A 4FP3A 1H2MA 4DV6O 1B35A 3DSQA 4AEJA 3N7JA 4BK5A 3JD1A 1VQPV 2WLQA 4RSUA 2BV4A 3IMNA 1YC61 4CDUC 2ZQMA 3QVNA 1VAVA 3ETPA 3J7MA 3AYEA 2YIBD 4QU2A 4YFWA 4NKGB 3F7YC 4HMZA 2JRIA 3I2KA 4NHLA 3EB7A 2JE9A 4ATEA 2B42B 1NOVA 4YJ2A 1W6NB 4CU6A 1UZWA 5ISLA 4DV5B 4QPJA 2D6NA 2JEUA 1QJX3 3R4DB 4GKKB 2Q8OA 4EJRA 4COVA 2HP8A 5DXDA 4X1KA 2UWBA 4LBMA 2Q4PA 4XDQA 3JD4A 3SH3A 4NHXA 3GDBA 4PLOA 1OA2A 3VZLA 4DS0A 4Y33A 4DUYO 4MTGA 4MSVA 5C8YB 1DBNA 3ES1A 3OT7A 5LCWL 4HL0A 2RS32 3VBOC 3P3PA 5LBBA 5LY1A 2F93B 1NQDA 3ZHUA 1JZ7A 5FPOA 1X7NA 1YO8A 4Z82A 3ZSKA 1JYTA 2UWAA 1NZ6A 5K1XA 2R063 1PNKA 4FPHA 1NT0A 5M0TA 4IV1C 4XF3A 3VD5A 1GOHA 4MGZE 5T5PA 2QQWA 2Y6HA 5FP9A 1A6CA 1MS9A 2IH1C 2EIMB 1K12A 1QXRA 2PI4A 2BP6A 2XG3A 1JOBA 1D4M1 4L87A 5KUKA 4QGMA 4PIZA 1OMIA 3OPWA 5GONB 3E5UA 1BBT2 4IHJB 1K9MW 1KUQA 5FJHA 1KJRA 5AG2A 4P00B 2JS5A 2ZKOA 4XFGA 2HWC2 4I9QA 2O0OA 2WJSA 4JZ2A 3UYJA 3ZHRA 3C7HA 4XDPA 4QNHB 2EIEA 3CC7V 5LMNB 2TEPA 4IE0A 5FK7A 3NKTA 1M90W 3E8HA 2Y0PA 1VR3A 4WFBV 2LRPA 1AI4A 3MPPG 4D7SA 4NHYA 1VBE3 4U36A 5LA1A 2XJUA 5GLWA 3RFRA 3CU7A 1PMHX 3MLLA 1W2UA 3VKLA 5CBGA 4B7EA 1XNAA 1V55C 4XIKA 2GC3A 3SISA 4DUZO 1JYCA 4NR1A 3Q9OA 5LHGA 5ITZA 3CMGA 2XQXA 3T4HB 2WLHA 4EWEA 4XUOA 1NZIA 3SPIA 3N9PA 1IBMB 2R043 3PMEA 1PM7A 4LH6A 4Y26A 3MFCA 1VBB1 3HBKA 5A3OA 1WMDA 4Y22A 2WO1A 2ARHA 4BJ0A 4WFEA 3K3NA 4HT1T 3TBDA 4AVCA 1UYPA 2G9FA 4NUBA 1FV3A 4KGQA 4LKEA 2I07B 3ATGA 2AHZA 1GP4A 2EIDA 1H2SB 3AJYA 1F15A 3C2UA 3A22A 3B00A 2QBXA 3KF3A 1VEWA 5FYZA 1HR0B 4OVEA 1FYUA 1SQPH 2ORZA 5FREA 4XFIA 1K45A 4ARYA 1XNKA 2VQAA 2UYBA 1T2XA 3H8XA 1REEA 2WNVC 4ZHQB 3JYCA 4UW4A 2HWD1 5JQGA 1XNRB 1FKAO 3NJXA 4XMAA 1UNBA 1PVC3 1VBD3 2BFUS 5BXXA 4IGGA 2Y8KA 1RSOB 1JQ0A 2V4VA 2XAQA 2ZXQA 4AVTA 4K8ZA 1XU2A 5A1AA