3P30A

Crystal structure of the cluster ii fab 1281 in complex with hiv-1 gp41 ectodomain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
91
structure length
84
Chain Sequence
TVQVRKLLSGIVQQQSNLLRAIEAQQHLLKLTVWGIKQLQARVWLQWDKEISNYTHIIYELIEESQKQQEKNEQELLELDKWAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 gp41
publication title Distinct conformational states of HIV-1 gp41 are recognized by neutralizing and non-neutralizing antibodies.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
total genus 35
structure length 84
sequence length 91
ec nomenclature
pdb deposition date 2010-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3p30A00
1I5XA 1SZTA 3B8MA 1K33A 1DF5A 2EZPA 1ENVA 2OT5A 4JGSA 3H01A 3GWOA 1K34A 1QR8A 4G2KA 4N23A 4FJCC 1I5YA 2MK3A 1JQ0A 3B8NA 5HFLA 1MOFA 4FK5C 4FIPC 2LP7A 1QCEA 3B77A 1F23A 5KA6A 3CP1A 4JF3A 4E2LA 2X7RB 3CYOA 1EBOA 1QR9A 1Y66A 3WFVA 2EBOA 1QBZA 4N21A 5KA5A 1DF4A 3MHHC 5HFMA 3K9AA 1DLBA 4JPRA 5H9CA 3MHSC 1MG1A 3M99B 5CN0A 1JPXA 2M7WA 2P6JA 1Y4MA 5CMUA 3P30A 2EZOA
chains in the Genus database with same CATH superfamily
2CTQA 4EB6B 1PPJH 4MVSA 1KP3A 3P3PA 1RP3B 1OV9A 2DQ0A 4WFGA 1P49A 3ZHUA 3I5DA 3OD4A 4DK1A 4JF3A 2KG7A 3JARB 3TCUA 3QO8A 5IE9A 3SGIA 2UUAB 4GKJB 5LYJA 4ZKIA 1KD1W 2EZPA 3I56V 1IVSA 1Y74A 2GV9A 3HKBB 5KUMA 2JGUA 3OUFA 3RYFB 1XUQA 2P90A 4DR1B 2UU9O 1HNXO 4TV9B 1XNRB 3B77A 4K3AA 4LP8A 1SETA 2MW2B 1AB3A 1ZUQA 4B3MO 1DF4A 3FB8C 5EYPB 5EZYB 4CH4A 1I5XA 3H1LH 2UUCO 4LH6A 4MTXA 3JD3A 3ZN0A 3X2QB 4B3TO 1B04A 1XL6A 2CGNA 3D36C 5L3DA 1N34O 1NVPD 2EINB 2BSKA 1M4UA 4J41A 1DLBA 5B5EZ 1JFFB 1MG1A 1BE3H 4B3SO 2YEVA 2XHBA 4TUYB 1J5EB 3HKDA 1RFYA 2Z3YA 1TGOA 5LHHA 5HFLA 5LHIA 2R9IA 3BA9A 3E2EA 3DXRA 1O9HA 1F7YA 4FZ1A 4NTXA 4YIOA 4RO2A 4AQYO 4FLTA 3RYHA 3IC7A 2X0LA 1G8MA 1FJGB 2PTMA 3T1CA 1WP7A 4O2AA 2HJFC 3ZMSA 4FK5C 2YXHA 4WFHA 1ZLZA 3CCEV 3HKEA 1DGSA 3C90A 3AK3A 1M93A 1JA8A 3K58A 4YY3B 4YHHB 2DJVA 4L8JA 2KG7B 4ZIBA 3JASB 2ILMA 5IT9N 3OR6C 1TUEB 1WJZA 5A9GA 3ABKC 4FLYA 3I55V 5LYJB 5BR8O 4FJCC 3KKYA 2ZCEA 1XEQA 1Q7YW 2PYLA 2A7WA 4QPKA 1NZ6A 3BVOA 4RUEA 1Y74B 2Q73A 4X64B 2IJJA 5DECA 2YSUB 2XAQA 4MVRA 4BIUA 1K4CC 3AK2A 3JCZA 1NJIW 4P9OA 2DYRC 4DV4B 5GTHZ 2PF4E 1XDCA 1Q3EA 1ZL8A 1GN2A 4K0KO 3CEIA 4JI6B 5KA6A 3G71V 5KAFZ 1L8DA 3QNEA 4IGGA 4FFKA 1Q6IA 2FB5A 2YXYA 4TV8A 3BPZA 5EK0A 2BSKB 4MVMA 3A0RA 4K35A 4H13B 3ABLC 1HWYA 1YJNV 4I9WA 3OTOB 1XHXA 1QVGU 1UPGA 4IHJA 4HNAA 1M1KW 1KQSU 2YEVB 3CCVV 3F7YC 4WCEV 3HKDB 3W7TA 4LF6B 2HR3A 1PL0A 1YZBA 2IU3A 1QR9A 4LWSA 2RQ6A 4N21A 4TT3G 3ZMZA 1B3QA 1NU1H 3RYCA 1MMMA 2CE4A 4X65B 3SYPA 3DXRB 2K1EA 3RVZA 5LHGA 2LFSA 2Q5ZA 1VQOV 1VP7A 2NNUA 4XDKA 4IYIA 1N8RW 1RSOA 3RYHB 4JI5O 2HLDG 1IDSA 4J7KA 1NTKH 2EJ7A 1WLEA 1CPYA 2YXLA 4JI1O 3D36A 2WPDG 2YICA 3DGEA 2QSAA 1IURA 2CTWA 4O2AB 4J10A 3LDCA 3H1KH 4I4TA 1ZAUA 2W0FC 2A3QA 5GW7A 1N32B 1D5NA 5CA3A 2EIJC 3AG2C 3HKEB 3FB7C 5IWAO 2IBZH 2V7QG 3F5WC 1K5SA 1KKDA 1OZ0A 4JI4B 2QA4V 4A5UB 1SQGA 3DC5A 2LJ2A 2GTSA 2QWOB 2P67A 4UCOA 1NTZH 4QIWF 1XMOB 1AI7A 2Y69C 2ZXWB 1V54B 4KUMA 4PV1B 2WLHA 5AG2A 2DOSA 3ZEDA 3N2KA 5K1PA 3LUTB 4ZBMA 1HNZO 4GX2A 1WN7A 4EFBA 4QNHB 3O9OA 2YDEA 4JASA 2UUBB 4GX5A 3AEIA 4FLXA 1DTOA 5LP6A 5JJJB 2F23A 1ZL8B 1AR1B 4LFAO 3A0BZ 5EBMC 3ZBHA 3JYCA 2EILC 4PA7A 1AJPA 3CCUV 3JSLA 1Q6HA 3G67A 2BTQB 1H8EG 4TV8B 3H01A 1ZSPA 2JEXA 1IBLO 3J7AU 1YJ9V 4J42A 4DUYO 1LR1A 1W0KG 1XBLA 4UVBA 1QCEA 3ZN1A 4Z2WA 1MSDA 4IHJB 1K8AW 2UXDO 2EBOA 2UU9B 2UUAO 2R9RB 4HNAB 4GKJO 3SPGA 3OUSA 2UXCO 4B3MB 3WB1A 1Q81W 2W6IG 4GUNA 3ZRXA 1O9GA 4ZOLA 4LWSB 4KHPB 3RYCB 4XBFA 2UUCB 1JOYA 4DW1A 1THZA 4BW5A 2JDIG 4B3TB 3W7WA 4JYAB 1FPOA 3ZHQA 1N34B 1RSOB 3A2FA 3X2QC 4ICGA 4DR3O 2DQ3A 1WNSA 4PDVA 1L1FA 4W4KA 2EINC 1J95A 4I55A 1KECA 1WAZA 1VQLV 4NVPA 4LCUC 1UFIA 1XOUA 4I4TB 3EHBB 1I08A 1S3JA 3OW2U 4B3SB 4WBNB 2MK3A 4RWUA 1HR0B 4ASUG 4DV3O 4JI2O 4MVQA 5CBFA 2H3OA 2F95B 1SQQH 1K4DC 3S3WA 3ZHSA 4YJ3A 2QKCA 5IJ9A 4AQYB 3CJHA 3FX7A 2CTRA 2RN9A 2WA3A 5B66Z 4CH5A 3N2KB 4FM0A 4OX9O 4B3RO 4NTWA 1Q8IA 2R9AA 1NVPB 4FPPA 2ZINA 5KHJA 3VQYA 2HVKC 2HKOA 3HR0A 1G4YB 3BAAA 3CCMV 3LDDA 3FB5C 2RJZA 4JI3B 1P84F 1H2NA 3WB0A 5JJNB 2A0LA 1SQBH 5BR8B 1I0HA 3FD9A 4QGPA 4L87A 4YY3O 4UB6Z 4CS4A 4YHHO 2GBOA 1GAXA 4JPRA 3ABKB 3Q4HA 3K5LA 2WLJA 3WU2Z 5EBLC 3QVNA 1L0LH 4TWKA 4TQDA 1S0VA 3ZMTA 2FKXA 2CH7A 2RDCA 4ZOLB 4E2LA 4ZHQA 2BTOA 2CK3G 4K0KB 5IY5B 4Z1MG 1IBMO 3E89A 5BXZA 2ITCC 2ARHA 3KCYA 2Z0AA 1R73A 1Y4MA 3VQVA 3E8BA 3H9VA 4LF8O 2Q0AA 4NXMB 4JI6O 2DYSC 1Q5OA 4I55B 1OCOB 1MA1A 5EC2C 3E86A 3UM7A 5JJEB 4BW9A 1MNGA 3ABLB 1N33O 1AI5A 1GN3A 4LR3A 3CYOA 1KU9A 4PDRA 1EZJA 1QNMA 2YIAA 4YIPA 2XTAA 3FAVA 3T1HO 3OTOO 3OMAB 3K57A 2IU0A 2JJ2G 2DN9A 4YJ3B 5IJ9B 3CRQA 4ABMA 3CJHB 1EM1A 4PA6A 4JI7O 2A06H 2QGNA 4PI0A 1H8HG 1JX9A 1Q86W 1WB8A 3OEHG 4JI1B 4X65O 1H38A 1BSMA 1VQ4V 2W6JG 3C3TA 4F6EA 5IWAB 3SYCA 2ZE5A 4U7NA 4UXNA 1KMIZ 5D5PA 1PNLA 5L3CA 2LP7A 2EIJB 2OTLV 1GN6A 3AG2B 1VIBA 3ZHVA 5FNVA 5B1BC 5BZBA 1N32O 5IDJA 4UCUA 5KLVH 2CDYA 2JRIA 3SYAA 3KCXA 4B7KA 1GM7A 1K33A 1TAEA 2Y69B 1MZFA 2QJ1A 1YHQV 4UV9A 1HNZB 1SS3A 3DTUB 4RQEA 1Y76A 2CH7B 3RBZA 3SR2C 4UFZA 4HBNA 4OGQB 2R70A 1SRYA 2JIZG 4LFAB 5JCOA 4I9QA 2XASA 1ENVA 1WPBA 4FM1A 2LFRA 2UXBO 2UUBO 2Y0PA 3O65A 1QLNA 1KP2A 2EILB 3DSQA 1IBLB 1M90W 1K7DA 2XAFA 1FYJA 4DUYB 2B9ZA 2C2AA 2Z5UA 2YI8A 1RM1C 2UXDB 2RMKB 5LGUA 3FYEB 1TA8A 2Q68A 1D2DA 3JD2A 2UXCB 2HG5C 2AZ2A 2OIGA 3FAVB 4PDLA 2QR4A 4PELA 3CRRA 3CMEV 4BR6A 3OTFA 1YCIA 1IBKB 1OJHA 2H8PC 5KHHA 2QWQB 4DR3B 3ABMB 3ETQA 4KHPO 3K04A 1MSWD 1AR5A 4JGSA 2GSMB 4FLVA 5GTIZ 1RPOA 4CBCA 4JYAO 3PN1A 4O4HB 3M7MX 1VMGA 2YIBA 1BS3A 2EIMB 2LGQA 5KHGA 3OT7A 2P4KA 3VOUA 3UKMA 4DV3B 4JI2B 1NI8A 5L3EA 3CMAV 3EVKA 5FNVB 4OXSA 3KZIZ 5IYZB 3CB2A 1JMKC 4BIZA 1HR0O 1AP6A 4LF9O 1S5LZ 4O4LA 3SPCA 3G80A 2CUGA 3ZIAG 1U97A 1MABG 3E8FA 3K5NA 4J11A 3G4SV 3ASOC 1PKXA 4OX9B 4B3RB 3ML0A 2ZE7A 3CWBH 3ABUA 2NN4A 1YEWA 2JGDA 1Y76B 5B1NA 4EFEA 1R3JC 4JAUA 2A9HA 4JZGA 2NLJC 4IYHA 3H1JH 4C7UA 3DC6A 2UXNA 4X1YA 4R7CA 1GRJA 5LP6C 1PM9A 4DR2O 1QHTA 1SERA 4F6RA 4PA3A 5LOVA 4U3JA 4JI3O 2BOCC 3SJBC 1SKVA 2VRZA 1I5YA 3AG7A 2XAJA 2A79B 2QEXV 2QWNB 4UCVA 1H2MA 1R6TA 1EN5A 1FAFA 3NXSA 1Y67A 1IBMB 1KYOF 1NTMH 1PV0A 2EIKC 1ZTEA 2JJ1G 5IY5C 2DW4A 3U11A 3HPLC 1YVWA 4H33A 2VWJA 4UVCA 3GVMA 4LF8B 1XQ8A 2DWEC 4MTGA 1A32A 5CB4A 3MDSA 3JD1A 3W7UA 3G6EV 5J2UA 4LBEC 2DYSB 1N33B 3ZRVA 1OCOC 3T4DA 1R3LC 3E22A 5LL6Y 1R1BA 2JK5C 1NH2B 4NXMO 5LGTA 4AILC 1SQPH 3T1HB 1QVFU 2XNDG 2RCVA 1I7FA 1VQ8V 2RNBA 3OGIB 4MVOA 3L74H 1VQPV 2WWWA 4YXWG 1VF5B 1OCZB 4FVMA 4CZZA 4OPAA 4TSFG 4JI7B 4O4LB 3STLC 4CH6A 2P22C 2Y4TA 2ATKC 4X89A 4PJ0Z 1N36O 5BMVA 1K97A 3GWOA 3D3QA 1FFXA 4WFAV 1GN4A 1HW7A 1YTFD 1FXVA 2JGDB 4Z1VA 3SPIA 3E8HA 5EIBD 4MT8A 4X1YB 3HKCA 5FPOA 2QKAA 3P30A 3OAAG 4I5SA 4D7SA 5B1BB 2DE0X 3IFXA 4GX0A 4F6RB 4MVZA 4XDLA 2EJRA 3N2GA 5LOVB 4U3JB 5C93A 3R66A 1K92A 2LQTA 2LO1A 2IJHA 1EZVH 3L71H 2VS0A 5JQGA 1SQVH 3K0GA 1HNWO 1R6NA 2JVDA 1H2SB 2UXBB 4DRXA 2CTPA 5EIBC 2WLIA 1M5IA 3ZJZA 5HFMA 1ROPA 1VF6C 3SYOA 1L0NH 2ZDIA 5CB4B 3H1IH 3TK1A 4FFBA 4DV0O 5DM6V 1IXMA 1EFRG 4MSWC 4MTFA 5J2UB 2L35A 2E76B 3E22B 1JQ0A 1RM1B 1S72V 1M57B 2E74B 2ZM6O 2EX3A 3W7SA 1NBMG 4W4LA 3T4ZA 1SESA 1B6QA 4GKKO 1YDXA 5B3SC 1DK1A 1VQ7V 3K79A 1AI6A 4UCRA 2QE7G 1XHZA 4ZI7A 5C8YA 4X88A 2XOKG 1K73W 5H2FZ 1QU7A 5L3FA 3BA8A 3CSXA 3ABMC 1YI2V 1IBKO 2OIEA 5BMVB 3NR7A 1YIJV 4DV1B 3CC4V 1FFXB 3CRMA 1KKCA 2HP8A 1QLEB 1W2BU 2BOBC 3ETEA 2EIMC 1FFTB 2GHYA 2FMLA 5F2VO 3HKCB 4WFBV 5LMUO 2P4VA 3LNNA 3SPJA 4IT5A 4LF9B 2GUZA 2HEPA 2WLLA 5B1OA 3N2GB 2AW9A 4JYBA 4BAYA 4LFCO 4JI8B 2K9PA 2R72A 2N74A 3AG3B 4GCZA 5JQGB 1GM9A 4J9YB 4JTCB 4UCTA 3L75H 5KX5A 1YF2A 3ASOB 1PL4A 3UO2A 2ZKOA 1VEWA 2XT9A 1WP8A 3AK1A 4FZ0A 5H9CA 3JAWA 3MD0A 1F4NA 5JCOC 4DRXB 4DR2B 5IYDO 3BY6A 5LP6B 3RGBA 1E1RG 1AI4A 1XNQO 2B5UA 3KG2A 2YIBD 3L72H 4FFBB 3CS5A 4FLWA 1P7BA 2VQEO 4DO2A 1NH2D 1EN6A 5L3GA 3LDEA 1EBOA 2WLKA 1BT8A 1V55B 2Q6AA 3CX5F 5FLXN 3JAKA 3ZRWA 3CC2V 3H1HH 3OFNG 5BY1A 1SF9A 4K8ZA 3R65A 3OE7G 4G2KA 5IYCO 1S76D 3B4SA 4JTAB 1LUWA 1S77D 3CE2A 3CD6V 2IJKA 2EIKB 4ZI7B 5KA5A 5C8YB 3OEEG 1G1XB 4DR5B 1VQKV 4X9QA 3M99B 3P3NA 5LA6A 4DR4B 2AHYA 1VF6A 3BCCH 1FS0G 1BGYH 4I50A 1KC8W 1WB7A 1B06A 4PA9A 1E79G 2AGAA 1LNQA 3RFRA 1WPXA 2X6CA 5GONA 1IZ3A 4MW3A 3CXCU 2N04A 2PZSA 2ODMA 4CC5A 2KSDA 1KBHA 2GUZB 2WLLB 5CA1A 1I94O 1OCZC 3J80N 3BRCA 1K34A 2NR5A 1N36B 4GZRB 2V4DA 1HDJA 1Q90D 2QKSA 1BZKA 3JATA 2JS3A 1YXBA 4UV8A 2CAZC 5KX5B 4IL6Z 2Q67A 3AG1B 2JS5A 4WFEA 1XILA 1FXKC 2ZIOA 4DV5O 4NXNO 1S5JA 5KHIA 2YC0A 4AI8A 2W0XA 4RQFA 3JAWB 1QR8A 1VQ6V 2F1MA 1MOFA 3ABTA 3ICXA 4DV7O 4EEQA 1NR1A 3TGUH 2H94A 2QWPB 2QDOA 4UCSA 3UT5A 4R50A 5CBHA 2KQXA 2LW7A 1XI1A 3K3WA 4U3FH 3D8CA 3RYIA 3LSQA 2Y0IA 2IH1C 1NR7A 2ZE6A 3VBBA 4DXWA 1N0JA 3Q4HB 5IYBO 5CA0A 3ZRWB 4LF4O 1HNWB 1COWG 4TOIA 3WG7B 4LFBB 3WB2A 2N05A 2YIDA 1TVKA 3CCRV 5H5NA 5B1AC 1K3EA 1YTFB 4ZHQB 2HFEC 1FD9A 4NR1A 3L9DA 4J9ZB 4QJFB 5LA6B 4DV0B 2LW1A 3E83A 2OTJV 4I50B 3CCLV 1N0NA 1EN4A 5H6RA 1R3IC 3ZRSA 2Y4UA 4I0XA 2WA4A 4PDMA 2ZM6B 4P30A 5E1AC 1W59A 4D7TA 3W7XA 3JALA 1M57C 4WFFA 4DYLA 4GKKB 1SZTA 5GONB 2DWDC 2FTKA 3OM3B 2Q8VA 3QG5A 3IC9A 3ZS8C 4DV6B 5B3SB 5CA1B 5FL7G 1F51A 3JASA 1BHAA 1FKAO 4JYYA 2ZNJA 1BCCH 3A8TA 3JATB 1BL8A 4CS2A 2PYJA 3OMNB 4LNUA 4LF7B 4U7OA 1QLEC 3K06A 1VARA 5EBWC 4RUFA 4MS2A 4DV1O 5LMUB 5KHKA 1AVMA 1BHBA 5JVDA 2XUMA 2HJDA 5LBQA 5CN0A 2QTOA 2P6JA 4X1IA 3PJSK 2Y48A 4H0LB 4JAVA 2OYQA 3B8MA 4LFCB 3UT5B 3U10A 1BMFG 4GLXA 4FLUA 3B8NA 2HVJC 3ETGA 3T1YB 4B7EA 3RYIB 5KUKA 1ZWIC 5JWPA 2O57A 3AG3C 4JI8O 1CXZB 1TUBA 5CA0B 3K0DA 4H37A 4QE9A 3QO5A 4JV5B 1FXKA 4D6TH 1TVKB 2ETNA 4QE7A 1AP5A 2Q4PA 2ZQMA 1JJ2U 4O4JA 2XAGA 1P4RA 3BABA 5LXTA 2X7RB 4KFMA 4CS3A 1XNQB 4I7ZB 2ITDC 2QWRB 2FL4A 2VQEB 1SZXA 1JCHA 2ZDIC 5E79Z 2ZT9B 4I0XB 3B40A 5D5QA 3VQWA 2YS8A 5J9PC 1V55C 3ZX6A 4X20A 3JALB 2JEUA 4R6ZA 1VQ9V 3UCSC 1AILA 5ITZA 1M56B 3ASNB 1F4MA 2P5OA 5KAIZ 4JI0O 2VQFB 2ADQB 4J80A 5LMNO 4MTOA 4X66O 1AROP 2OCCC 4O2BA 4MVUA 5A2QN 2CGOA 2WSSG 4DV2O 4BIOA 3K5OA 4TQFA 1F23A 1WA8A 4LNUB 4DR5O 1OCCC 4LF5O 2X6BA 4DR4O 1G6UA 3EFFK 3RVYA 2PI5A 1BQZA 2QM4A 3E8GA 2LGWA 5JVDB 3APQA 4J7ZA 3BFRA 4JZ2A 1OCRB 4N23A 4X1IB 1I94B 2F66C 3C3SA 2AZ0A 3JAMN 4KL1A 4JTDB 2BTQA 3JD0A 4GT1A 2ZR2A 4HZ3A 1K5QA 1TUBB 2QM7A 3CXHF 5IJ0A 4R8CA 3AG1C 3N27A 2E3CA 4DV5B 2HHHO 1PNKA 4NXNB 4XDJA 3EXAA 2ZIMA 1IX9A 3AG4C 1US6A 4O4IA 1FXKB 4Q20A 2L6LA 4HYOA 1XMQB 1RPRA 2AXTZ 4KXRA 5L3BA 4QPJA 3BEHA 1CEZA 3UO3A 4DV7B 2YUAA 4O4JB 1OHHG 5LXTB 3CCQV 4DR6B 1PD3A 1GM8A 2UXXA 2E75B 2ZNIA 3L70H 3OR7C 1Q43A 1VQ5V 3FKSG 3K08A 1VQNV 4FIPC 4GX1A 2PI4A 1U96A 1JJOA 4X20B 3IGAC 1QBZA 3FB6C 4LF4B 3MHHC 3GWKC 4WBNA 3K9AA 4DK0A 4X62O 1Q82W 2ZE8A 4DUZO 5ITZB 3WG7C 3U0ZA 4HAMA 4J7JA 2P06A 4FLZA 1HP8A 2KB1A 1VQMV 5B1AB 1NKDA 1M9NA 4O2BB 3ETDA 4DR7O 2WAMA 2WLMA 1NQTA 2X6AA 3QF7A 3T2MA 2M7WA 1GO3F 2BCCH 1WA8B 5KMGA 2P7TC 1UJWB 1PP9H 1MZEA 1SA0A 1NT2B 3APOA 2OWOA 1AJNA 4DW0A 2F4VO 3LSSA 4PA4A 3WFVA 2E5LO 4LFBO 4GYCB 1JVMA 4OPHA 3MAQA 3CC7V 3CCSV 4IIJA 2XAHA 3STZC 1AR4A 1GKFA 3FYIB 4DV6O 5LGNA 2F93B 3RN4A 2Q7GA 3CRAA 3JD4A 1XREA 5IJ0B 1HNXB 2B1GA 3F5TA 3K9SA 1YSCA 3S3XA 3ZCCA 4AHCA 3MHSC 4O4IB 4UVAA 1ZX3A 3BHPA 3F7VC 4LF7O 4NKGB 3IJ4A 1DF5A 3TJTA 3CHXA 4DR1O 1XNRO 4KP4A 5TISZ 3ZHRA 3ZMVA 1AJQA 3HB3B 3M8AA 1N4CA 1V9PA 4G27B 3P32A 4EKWA 5FPRA 4RAIA 1X4TA 3T1YO 3D3IA 3OGCC 4X1KA 3B09A 2G38A 3TXQA 3CP1A 3LSUA 2FYUH 3SJAC 4E4EA 3ZMUA 1NS1A 1J5EO 4JV5O 2WLNA 4NTYA 2IM9A 2WLIB 5J2TA 4F4LA 3ZHTA 1CP9A 3B2EE 5KMGB 5EC1C 3G6BA 3RT3C 2IJIA 1SA0B 1T5EA 4Q6GA 1SQXH 4P2ZA 1R3KC 2Q69A 1FJGO 4UUJC 1LUVA 3SPHA 4CC6A 1S5HC 5JH7A 4JI0B 4FMTA 1M56C 3ASNC 4UB8Z 4IIJB 5LMNB 5K1XA 4X66B 1YJWV 1FXHA 4B08A 4MW8A 1Q6UA 4DV2B 2VQFO 2D3OW 4PD4F 2OCCB 3SDLA 1JPXA 1GH6A 1D5AA 4YJ2A 4LF5B 3VQXA 4LH7A 1XL4A 1OCCB 2GDSA 2DMXA 2Q0OC 4NB5A 4JAAA 1GTOA 1VF7A 2YI9A 3LNMB 4X64O 2PGGA 1Y66A 4EB6A 4JYCA 2DYRB 2IH3C 4H44B 1OCRC 3SJCC 3OMIB 1GK9A 2VWKA 1X59A 4PI2A 4DV4O 2Q7EA 2ADPA 1Z5WA 3TETA 5DN6G 2OT5A 3JARA 2M6YA 2QTSA 3IAYA 4CH3A 4FM2A 1R6KA 1IXBA 1P7GA 1URFA 3K59A 2QM8A 5DEDA 2Q9LA 1H2LA 1GMGA 1QQCA 3CRCA 2HHHB 3CCJV 3QO7A 4WF9V 1SC5B 2BE3A 4LC1A 4X1KB 3HKBA 3K5MA 3RYFA 5H6QA 3AG4B 4TV9A 3J81N 3RWRD 5CBGA 1Y6XA 4LF6O 3FFQA 2F43G 1XMQO 4JI5B 3QTCA 2OCHA 5J2TB 5EYPA 5EZYA 1KUQA 1SQFA 2Q7HA 4NYKA 2D2CB 2ZR3A 4DR6O 4O4HA 5CMUA 2EZOA 2AHZA 4PHZA 4X62B 3GB7C 4X8AA 4DUZB 3JCUZ 2V1DA 2PY5A 1YITV 2GTAA 2ZD9A 3TXSA 3E35A 5JH7B 1JFFA 3JAKB 1H2KA 3SJQC 5IYZA 3CPWU 3UQ8A 4TUYA 2B1IA 3THOA 1JR9A 1ORQC 1K9MW 4DR7B 3K03A 3JSNA 1BQ0A 4JI4O 1E1QG 2ZXWC 1V54C 3A0HZ 2EULA 2KKWA 2IW5A 4YJ2B 1XMOO 4BWAA 4P9PA 3L73H 4K8XA 1PNMA 1KB9F 2F4VB 1Z5VA 1Z2GA 1W0JG 2PUSA 4G28B 2E5LB 1H2GA 3SYQA 3RW0A
chains in the Genus database with same CATH topology
3TK1A 2WLJA 5DM6V 1IXMA 1EFRG 4MSWC 4MTOA 5EBLC 1AROP 2OCCC 4MVSA 1KP3A 4MVUA 4MTFA 2WSSG 4TWKA 1S0VA 3ZMTA 1JQ0A 2DQ0A 4WFGA 1RM1B 1S72V 1M57B 1F23A 4JF3A 4E2LA 3W7SA 1NBMG 3T4ZA 2CK3G 1SESA 1OCCC 5IY5B 4Z1MG 2X6BA 3E89A 1B6QA 3TCUA 2ITCC 3QO8A 3EFFK 3RVYA 2PI5A 5B3SC 1R73A 1Y4MA 3E8BA 4ZKIA 3E8GA 1KD1W 1VQ7V 2EZPA 3K79A 1AI6A 3I56V 2QE7G 2DYSC 1OCRB 4N23A 5KUMA 4X88A 2XOKG 1K73W 3OUFA 1OCOB 5L3FA 2P90A 3ABMC 5EC2C 3E86A 3UM7A 3B77A 4LP8A 1YI2V 1SETA 3ABLB 1AI5A 3CYOA 4JTDB 1YIJV 3CC4V 1DF4A 3JD0A 4PDRA 3FB8C 1EZJA 1QLEB 1W2BU 2BOBC 4GT1A 3ETEA 2EIMC 1I5XA 3OMAB 1FFTB 2IU0A 2ZR2A 2GHYA 4HZ3A 4MTXA 3JD3A 3ZN0A 1K5QA 2QM7A 3X2QB 2JJ2G 4R8CA 4WFBV 3AG1C 1XL6A 5L3DA 1NVPD 1PNKA 2EINB 4XDJA 3AG4C 4PA6A 4Q20A 1FXKB 3SPJA 4HYOA 1H8HG 1RPRA 2WLLA 1JX9A 5B1OA 5L3BA 1Q86W 4QPJA 3OEHG 3BEHA 1CEZA 1H38A 4JYBA 1DLBA 1OHHG 1MG1A 4BAYA 3CCQV 2YEVA 1VQ4V 1PD3A 2W6JG 2UXXA 1GM8A 3AG3B 3OR7C 4GCZA 3SYCA 4U7NA 2Z3YA 4UXNA 1GM9A 4J9YB 4JTCB 1VQ5V 5LHHA 3FKSG 3K08A 5HFLA 5LHIA 1VQNV 1PNLA 2R9IA 3ASOB 2LP7A 4FIPC 5L3CA 2EIJB 2OTLV 4GX1A 3AG2B 2PI4A 3E2EA 5B1BC 5BZBA 3IGAC 1QBZA 5IDJA 3FB6C 4RO2A 3MHHC 3K9AA 3IC7A 5H9CA 1Q82W 3MD0A 3SYAA 1F4NA 5IYDO 2X0LA 3WG7C 1G8MA 1GM7A 1K33A 3BY6A 3T1CA 4HAMA 2Y69B 1E1RG 2HJFC 1AI4A 3ZMSA 2B5UA 3KG2A 2KB1A 1VQMV 4FK5C 5B1AB 1NKDA 1YHQV 4WFHA 4UV9A 1P7BA 3CCEV 1M9NA 4DO2A 1NH2D 5L3GA 3DTUB 3ETDA 3LDEA 1EBOA 4RQEA 2WLKA 1V55B 2WAMA 2WLMA 1NQTA 2X6AA 3RBZA 2Q6AA 3T2MA 2M7WA 1SRYA 2JIZG 1GO3F 3OR6C 2XASA 3ZRWA 2P7TC 3CC2V 3OFNG 1TUEB 1ENVA 1UJWB 3R65A 3ABKC 3OE7G 4G2KA 2LFRA 3I55V 5IYCO 1AJNA 4FJCC 1S76D 1QLNA 4JTAB 1S77D 1KP2A 2EILB 3CD6V 1Q7YW 1M90W 1K7DA 3LSSA 2XAFA 4QPKA 4RUEA 2C2AA 4PA4A 2Z5UA 2IJKA 2EIKB 3WFVA 5KA5A 1JVMA 3OEEG 3CC7V 3CCSV 1VQKV 2IJJA 1RM1C 3M99B 2YSUB 2XAHA 5LGUA 2XAQA 2AHYA 4MVRA 3FYEB 1FS0G 2Q68A 3STZC 4BIUA 1GKFA 3JD2A 1K4CC 1KC8W 3FYIB 3JCZA 5LGNA 1NJIW 4P9OA 2DYRC 2HG5C 4PA9A 1E79G 4PDLA 1LNQA 1WPXA 4PELA 3JD4A 5KA6A 3CMEV 3G71V 3QNEA 2X6CA 2B1GA 4MW3A 1YSCA 3CXCU 5EK0A 3ZCCA 3MHSC 2H8PC 4MVMA 3ABMB 4UVAA 3A0RA 2WLLB 3ABLC 3K04A 1MSWD 3F7VC 1HWYA 1YJNV 4I9WA 1OCZC 1DF5A 4JGSA 2GSMB 1RPOA 1QVGU 4KP4A 1K34A 4CBCA 1M1KW 1KQSU 3ZMVA 1AJQA 2YEVB 3CCVV 3F7YC 2EIMB 3HB3B 3W7TA 4WCEV 2QKSA 2HR3A 1PL0A 3VOUA 3UKMA 2IU3A 1QR9A 4N21A 4UV8A 4TT3G 2Q67A 3AG1B 3ZMZA 5L3EA 3CMAV 4WFEA 4G27B 3SYPA 1FXKC 2K1EA 3RVZA 4OXSA 5LHGA 3P32A 2LFSA 4EKWA 1VQOV 2NNUA 4XDKA 1N8RW 4BIZA 4RQFA 4RAIA 1QR8A 2HLDG 3D3IA 3OGCC 1VQ6V 1MOFA 1WLEA 3ABTA 1CPYA 3SPCA 3D36A 2WPDG 3ZIAG 3CP1A 1NR1A 3DGEA 2H94A 1MABG 3LDCA 3E8FA 2W0FC 3ZMUA 4R50A 5GW7A 3G4SV 3ASOC 5CBHA 1PKXA 2EIJC 2WLNA 5CA3A 3AG2C 3FB7C 2V7QG 3ML0A 3F5WC 3K3WA 2WLIB 3ABUA 4F4LA 1K5SA 5B1NA 3LSQA 1KKDA 1OZ0A 1CP9A 2IH1C 2QA4V 1R3JC 1NR7A 4JAUA 3VBBA 2A9HA 4DXWA 2NLJC 2UXNA 5IYBO 3ZRWB 4R7CA 2P67A 5EC1C 1COWG 3WG7B 4QIWF 1AI7A 2IJIA 2Y69C 1V54B 2ZXWB 4KUMA 4P2ZA 1R3KC 1SERA 2Q69A 2WLHA 3CCRV 4PA3A 5B1AC 1K3EA 1YTFB 4UUJC 3SPHA 1S5HC 2HFEC 3LUTB 2BOCC 4FMTA 1M56C 4ZBMA 3ASNC 4J9ZB 4QJFB 4GX2A 1I5YA 4QNHB 1YJWV 2XAJA 1FXHA 2A79B 3E83A 2OTJV 2QEXV 3CCLV 4JASA 4MW8A 4GX5A 3AEIA 5H6RA 1R3IC 3ZRSA 1DTOA 2D3OW 4PDMA 2OCCB 1AR1B 3NXSA 4P30A 5E1AC 5EBMC 3JYCA 1JPXA 2EILC 4PA7A 3W7XA 1AJPA 1M57C 4WFFA 3CCUV 1SZTA 2EIKC 2DWDC 2FTKA 2JJ1G 1H8EG 1XL4A 5IY5C 2DW4A 3H01A 3HPLC 1OCCB 2JEXA 3OM3B 4H33A 1YJ9V 4UVCA 5B3SB 1GTOA 1W0KG 2DWEC 4UVBA 5FL7G 1QCEA 1F51A 4MTGA 3LNMB 3ZN1A 1BHAA 3JD1A 3W7UA 1Y66A 1K8AW 4JYCA 2EBOA 1H2GA 2DYRB 2IH3C 2R9RB 3G6EV 3SPGA 1OCRC 3OUSA 4LBEC 2DYSB 3ZRVA 3OMIB 1OCOC 1GK9A 3T4DA 1R3LC 1BL8A 1Q81W 2W6IG 2JK5C 3ZRXA 1NH2B 5LGTA 3TETA 3OMNB 5DN6G 2OT5A 1QVFU 2XNDG 4U7OA 4XBFA 1JOYA 1QLEC 3K06A 1VQ8V 1R6KA 1THZA 2JDIG 4MVOA 4BW5A 3W7WA 5EBWC 4RUFA 1VQPV 2QM8A 4MS2A 2WWWA 1GMGA 4YXWG 1BHBA 1OCZB 3X2QC 3CCJV 3QO7A 4WF9V 2DQ3A 4CZZA 4TSFG 5LBQA 3STLC 4PDVA 4LC1A 1L1FA 5CN0A 2EINC 1J95A 2QTOA 2P6JA 3PJSK 1KECA 2Y48A 3AG4B 4JAVA 5H6QA 1VQLV 3B8MA 2ATKC 4LCUC 4X89A 3EHBB 1S3JA 5CBGA 3OW2U 1BMFG 1K97A 3GWOA 2F43G 2MK3A 4WFAV 3B8NA 2HVJC 1YTFD 4ASUG 3ETGA 1FXVA 4MVQA 5CBFA 5KUKA 1ZWIC 3SPIA 3AG3C 3E8HA 1K4DC 2ZR3A 4MT8A 5CMUA 3K0DA 3P30A 2EZOA 4H37A 3OAAG 2AHZA 4I5SA 4QE9A 3QO5A 1FXKA 3GB7C 5B1BB 4X8AA 3IFXA 4GX0A 2V1DA 4MVZA 2EJRA 4XDLA 4QE7A 2ZQMA 5C93A 1YITV 2ZD9A 3E35A 1JJ2U 2XAGA 1P4RA 2X7RB 4KFMA 3SJQC 1K92A 3CPWU 2B1IA 2IJHA 2ITDC 1ORQC 1K9MW 1JCHA 2ZDIC 1NVPB 4FPPA 3K03A 2HVKC 2HKOA 1E1QG 2ZXWC 1V54C 1G4YB 3CCMV 3K0GA 3LDDA 5J9PC 3FB5C 1V55C 2IW5A 1R6NA 2JEUA 4P9PA 4R6ZA 1VQ9V 2A0LA 4L87A 1M56B 1PNMA 3ASNB 1F4MA 2WLIA 3ZJZA 5HFMA 4JPRA 1ROPA 1W0JG 3ABKB 3SYOA 4G28B 2ZDIA 3SYQA 3RW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I5X A;  1SZT A;  3B8M A;  1K33 A;  1DF5 A;  2EZP A;  1ENV A;  2OT5 A;  4JGS A;  3H01 A;  3GWO A;  1K34 A;  1QR8 A;  4G2K A;  4N23 A;  4FJC C;  1I5Y A;  2MK3 A;  1JQ0 A;  3B8N A;  5HFL A;  1MOF A;  4FK5 C;  4FIP C;  2LP7 A;  1QCE A;  3B77 A;  1F23 A;  5KA6 A;  3CP1 A;  4JF3 A;  4E2L A;  2X7R B;  3CYO A;  1EBO A;  1QR9 A;  1Y66 A;  3WFV A;  2EBO A;  1QBZ A;  4N21 A;  5KA5 A;  1DF4 A;  3MHH C;  5HFM A;  3K9A A;  1DLB A;  4JPR A;  5H9C A;  3MHS C;  1MG1 A;  3M99 B;  5CN0 A;  1JPX A;  2M7W A;  2P6J A;  1Y4M A;  5CMU A;  3P30 A;  2EZO A; 
#chains in the Genus database with same CATH topology
 2CTQ A;  4EB6 B;  1PPJ H;  4MVS A;  1KP3 A;  3P3P A;  1RP3 B;  1OV9 A;  2DQ0 A;  4WFG A;  1P49 A;  3ZHU A;  3I5D A;  3OD4 A;  4DK1 A;  4JF3 A;  2KG7 A;  3JAR B;  3TCU A;  3QO8 A;  5IE9 A;  3SGI A;  2UUA B;  4GKJ B;  5LYJ A;  4ZKI A;  1KD1 W;  2EZP A;  3I56 V;  1IVS A;  1Y74 A;  2GV9 A;  3HKB B;  5KUM A;  2JGU A;  3OUF A;  3RYF B;  1XUQ A;  2P90 A;  4DR1 B;  2UU9 O;  1HNX O;  4TV9 B;  1XNR B;  3B77 A;  4K3A A;  4LP8 A;  1SET A;  2MW2 B;  1AB3 A;  1ZUQ A;  4B3M O;  1DF4 A;  3FB8 C;  5EYP B;  5EZY B;  4CH4 A;  1I5X A;  3H1L H;  2UUC O;  4LH6 A;  4MTX A;  3JD3 A;  3ZN0 A;  3X2Q B;  4B3T O;  1B04 A;  1XL6 A;  2CGN A;  3D36 C;  5L3D A;  1N34 O;  1NVP D;  2EIN B;  2BSK A;  1M4U A;  4J41 A;  1DLB A;  5B5E Z;  1JFF B;  1MG1 A;  1BE3 H;  4B3S O;  2YEV A;  2XHB A;  4TUY B;  1J5E B;  3HKD A;  1RFY A;  2Z3Y A;  1TGO A;  5LHH A;  5HFL A;  5LHI A;  2R9I A;  3BA9 A;  3E2E A;  3DXR A;  1O9H A;  1F7Y A;  4FZ1 A;  4NTX A;  4YIO A;  4RO2 A;  4AQY O;  4FLT A;  3RYH A;  3IC7 A;  2X0L A;  1G8M A;  1FJG B;  2PTM A;  3T1C A;  1WP7 A;  4O2A A;  2HJF C;  3ZMS A;  4FK5 C;  2YXH A;  4WFH A;  1ZLZ A;  3CCE V;  3HKE A;  1DGS A;  3C90 A;  3AK3 A;  1M93 A;  1JA8 A;  3K58 A;  4YY3 B;  4YHH B;  2DJV A;  4L8J A;  2KG7 B;  4ZIB A;  3JAS B;  2ILM A;  5IT9 N;  3OR6 C;  1TUE B;  1WJZ A;  5A9G A;  3ABK C;  4FLY A;  3I55 V;  5LYJ B;  5BR8 O;  4FJC C;  3KKY A;  2ZCE A;  1XEQ A;  1Q7Y W;  2PYL A;  2A7W A;  4QPK A;  1NZ6 A;  3BVO A;  4RUE A;  1Y74 B;  2Q73 A;  4X64 B;  2IJJ A;  5DEC A;  2YSU B;  2XAQ A;  4MVR A;  4BIU A;  1K4C C;  3AK2 A;  3JCZ A;  1NJI W;  4P9O A;  2DYR C;  4DV4 B;  5GTH Z;  2PF4 E;  1XDC A;  1Q3E A;  1ZL8 A;  1GN2 A;  4K0K O;  3CEI A;  4JI6 B;  5KA6 A;  3G71 V;  5KAF Z;  1L8D A;  3QNE A;  4IGG A;  4FFK A;  1Q6I A;  2FB5 A;  2YXY A;  4TV8 A;  3BPZ A;  5EK0 A;  2BSK B;  4MVM A;  3A0R A;  4K35 A;  4H13 B;  3ABL C;  1HWY A;  1YJN V;  4I9W A;  3OTO B;  1XHX A;  1QVG U;  1UPG A;  4IHJ A;  4HNA A;  1M1K W;  1KQS U;  2YEV B;  3CCV V;  3F7Y C;  4WCE V;  3HKD B;  3W7T A;  4LF6 B;  2HR3 A;  1PL0 A;  1YZB A;  2IU3 A;  1QR9 A;  4LWS A;  2RQ6 A;  4N21 A;  4TT3 G;  3ZMZ A;  1B3Q A;  1NU1 H;  3RYC A;  1MMM A;  2CE4 A;  4X65 B;  3SYP A;  3DXR B;  2K1E A;  3RVZ A;  5LHG A;  2LFS A;  2Q5Z A;  1VQO V;  1VP7 A;  2NNU A;  4XDK A;  4IYI A;  1N8R W;  1RSO A;  3RYH B;  4JI5 O;  2HLD G;  1IDS A;  4J7K A;  1NTK H;  2EJ7 A;  1WLE A;  1CPY A;  2YXL A;  4JI1 O;  3D36 A;  2WPD G;  2YIC A;  3DGE A;  2QSA A;  1IUR A;  2CTW A;  4O2A B;  4J10 A;  3LDC A;  3H1K H;  4I4T A;  1ZAU A;  2W0F C;  2A3Q A;  5GW7 A;  1N32 B;  1D5N A;  5CA3 A;  2EIJ C;  3AG2 C;  3HKE B;  3FB7 C;  5IWA O;  2IBZ H;  2V7Q G;  3F5W C;  1K5S A;  1KKD A;  1OZ0 A;  4JI4 B;  2QA4 V;  4A5U B;  1SQG A;  3DC5 A;  2LJ2 A;  2GTS A;  2QWO B;  2P67 A;  4UCO A;  1NTZ H;  4QIW F;  1XMO B;  1AI7 A;  2Y69 C;  2ZXW B;  1V54 B;  4KUM A;  4PV1 B;  2WLH A;  5AG2 A;  2DOS A;  3ZED A;  3N2K A;  5K1P A;  3LUT B;  4ZBM A;  1HNZ O;  4GX2 A;  1WN7 A;  4EFB A;  4QNH B;  3O9O A;  2YDE A;  4JAS A;  2UUB B;  4GX5 A;  3AEI A;  4FLX A;  1DTO A;  5LP6 A;  5JJJ B;  2F23 A;  1ZL8 B;  1AR1 B;  4LFA O;  3A0B Z;  5EBM C;  3ZBH A;  3JYC A;  2EIL C;  4PA7 A;  1AJP A;  3CCU V;  3JSL A;  1Q6H A;  3G67 A;  2BTQ B;  1H8E G;  4TV8 B;  3H01 A;  1ZSP A;  2JEX A;  1IBL O;  3J7A U;  1YJ9 V;  4J42 A;  4DUY O;  1LR1 A;  1W0K G;  1XBL A;  4UVB A;  1QCE A;  3ZN1 A;  4Z2W A;  1MSD A;  4IHJ B;  1K8A W;  2UXD O;  2EBO A;  2UU9 B;  2UUA O;  2R9R B;  4HNA B;  4GKJ O;  3SPG A;  3OUS A;  2UXC O;  4B3M B;  3WB1 A;  1Q81 W;  2W6I G;  4GUN A;  3ZRX A;  1O9G A;  4ZOL A;  4LWS B;  4KHP B;  3RYC B;  4XBF A;  2UUC B;  1JOY A;  4DW1 A;  1THZ A;  4BW5 A;  2JDI G;  4B3T B;  3W7W A;  4JYA B;  1FPO A;  3ZHQ A;  1N34 B;  1RSO B;  3A2F A;  3X2Q C;  4ICG A;  4DR3 O;  2DQ3 A;  1WNS A;  4PDV A;  1L1F A;  4W4K A;  2EIN C;  1J95 A;  4I55 A;  1KEC A;  1WAZ A;  1VQL V;  4NVP A;  4LCU C;  1UFI A;  1XOU A;  4I4T B;  3EHB B;  1I08 A;  1S3J A;  3OW2 U;  4B3S B;  4WBN B;  2MK3 A;  4RWU A;  1HR0 B;  4ASU G;  4DV3 O;  4JI2 O;  4MVQ A;  5CBF A;  2H3O A;  2F95 B;  1SQQ H;  1K4D C;  3S3W A;  3ZHS A;  4YJ3 A;  2QKC A;  5IJ9 A;  4AQY B;  3CJH A;  3FX7 A;  2CTR A;  2RN9 A;  2WA3 A;  5B66 Z;  4CH5 A;  3N2K B;  4FM0 A;  4OX9 O;  4B3R O;  4NTW A;  1Q8I A;  2R9A A;  1NVP B;  4FPP A;  2ZIN A;  5KHJ A;  3VQY A;  2HVK C;  2HKO A;  3HR0 A;  1G4Y B;  3BAA A;  3CCM V;  3LDD A;  3FB5 C;  2RJZ A;  4JI3 B;  1P84 F;  1H2N A;  3WB0 A;  5JJN B;  2A0L A;  1SQB H;  5BR8 B;  1I0H A;  3FD9 A;  4QGP A;  4L87 A;  4YY3 O;  4UB6 Z;  4CS4 A;  4YHH O;  2GBO A;  1GAX A;  4JPR A;  3ABK B;  3Q4H A;  3K5L A;  2WLJ A;  3WU2 Z;  5EBL C;  3QVN A;  1L0L H;  4TWK A;  4TQD A;  1S0V A;  3ZMT A;  2FKX A;  2CH7 A;  2RDC A;  4ZOL B;  4E2L A;  4ZHQ A;  2BTO A;  2CK3 G;  4K0K B;  5IY5 B;  4Z1M G;  1IBM O;  3E89 A;  5BXZ A;  2ITC C;  2ARH A;  3KCY A;  2Z0A A;  1R73 A;  1Y4M A;  3VQV A;  3E8B A;  3H9V A;  4LF8 O;  2Q0A A;  4NXM B;  4JI6 O;  2DYS C;  1Q5O A;  4I55 B;  1OCO B;  1MA1 A;  5EC2 C;  3E86 A;  3UM7 A;  5JJE B;  4BW9 A;  1MNG A;  3ABL B;  1N33 O;  1AI5 A;  1GN3 A;  4LR3 A;  3CYO A;  1KU9 A;  4PDR A;  1EZJ A;  1QNM A;  2YIA A;  4YIP A;  2XTA A;  3FAV A;  3T1H O;  3OTO O;  3OMA B;  3K57 A;  2IU0 A;  2JJ2 G;  2DN9 A;  4YJ3 B;  5IJ9 B;  3CRQ A;  4ABM A;  3CJH B;  1EM1 A;  4PA6 A;  4JI7 O;  2A06 H;  2QGN A;  4PI0 A;  1H8H G;  1JX9 A;  1Q86 W;  1WB8 A;  3OEH G;  4JI1 B;  4X65 O;  1H38 A;  1BSM A;  1VQ4 V;  2W6J G;  3C3T A;  4F6E A;  5IWA B;  3SYC A;  2ZE5 A;  4U7N A;  4UXN A;  1KMI Z;  5D5P A;  1PNL A;  5L3C A;  2LP7 A;  2EIJ B;  2OTL V;  1GN6 A;  3AG2 B;  1VIB A;  3ZHV A;  5FNV A;  5B1B C;  5BZB A;  1N32 O;  5IDJ A;  4UCU A;  5KLV H;  2CDY A;  2JRI A;  3SYA A;  3KCX A;  4B7K A;  1GM7 A;  1K33 A;  1TAE A;  2Y69 B;  1MZF A;  2QJ1 A;  1YHQ V;  4UV9 A;  1HNZ B;  1SS3 A;  3DTU B;  4RQE A;  1Y76 A;  2CH7 B;  3RBZ A;  3SR2 C;  4UFZ A;  4HBN A;  4OGQ B;  2R70 A;  1SRY A;  2JIZ G;  4LFA B;  5JCO A;  4I9Q A;  2XAS A;  1ENV A;  1WPB A;  4FM1 A;  2LFR A;  2UXB O;  2UUB O;  2Y0P A;  3O65 A;  1QLN A;  1KP2 A;  2EIL B;  3DSQ A;  1IBL B;  1M90 W;  1K7D A;  2XAF A;  1FYJ A;  4DUY B;  2B9Z A;  2C2A A;  2Z5U A;  2YI8 A;  1RM1 C;  2UXD B;  2RMK B;  5LGU A;  3FYE B;  1TA8 A;  2Q68 A;  1D2D A;  3JD2 A;  2UXC B;  2HG5 C;  2AZ2 A;  2OIG A;  3FAV B;  4PDL A;  2QR4 A;  4PEL A;  3CRR A;  3CME V;  4BR6 A;  3OTF A;  1YCI A;  1IBK B;  1OJH A;  2H8P C;  5KHH A;  2QWQ B;  4DR3 B;  3ABM B;  3ETQ A;  4KHP O;  3K04 A;  1MSW D;  1AR5 A;  4JGS A;  2GSM B;  4FLV A;  5GTI Z;  1RPO A;  4CBC A;  4JYA O;  3PN1 A;  4O4H B;  3M7M X;  1VMG A;  2YIB A;  1BS3 A;  2EIM B;  2LGQ A;  5KHG A;  3OT7 A;  2P4K A;  3VOU A;  3UKM A;  4DV3 B;  4JI2 B;  1NI8 A;  5L3E A;  3CMA V;  3EVK A;  5FNV B;  4OXS A;  3KZI Z;  5IYZ B;  3CB2 A;  1JMK C;  4BIZ A;  1HR0 O;  1AP6 A;  4LF9 O;  1S5L Z;  4O4L A;  3SPC A;  3G80 A;  2CUG A;  3ZIA G;  1U97 A;  1MAB G;  3E8F A;  3K5N A;  4J11 A;  3G4S V;  3ASO C;  1PKX A;  4OX9 B;  4B3R B;  3ML0 A;  2ZE7 A;  3CWB H;  3ABU A;  2NN4 A;  1YEW A;  2JGD A;  1Y76 B;  5B1N A;  4EFE A;  1R3J C;  4JAU A;  2A9H A;  4JZG A;  2NLJ C;  4IYH A;  3H1J H;  4C7U A;  3DC6 A;  2UXN A;  4X1Y A;  4R7C A;  1GRJ A;  5LP6 C;  1PM9 A;  4DR2 O;  1QHT A;  1SER A;  4F6R A;  4PA3 A;  5LOV A;  4U3J A;  4JI3 O;  2BOC C;  3SJB C;  1SKV A;  2VRZ A;  1I5Y A;  3AG7 A;  2XAJ A;  2A79 B;  2QEX V;  2QWN B;  4UCV A;  1H2M A;  1R6T A;  1EN5 A;  1FAF A;  3NXS A;  1Y67 A;  1IBM B;  1KYO F;  1NTM H;  1PV0 A;  2EIK C;  1ZTE A;  2JJ1 G;  5IY5 C;  2DW4 A;  3U11 A;  3HPL C;  1YVW A;  4H33 A;  2VWJ A;  4UVC A;  3GVM A;  4LF8 B;  1XQ8 A;  2DWE C;  4MTG A;  1A32 A;  5CB4 A;  3MDS A;  3JD1 A;  3W7U A;  3G6E V;  5J2U A;  4LBE C;  2DYS B;  1N33 B;  3ZRV A;  1OCO C;  3T4D A;  1R3L C;  3E22 A;  5LL6 Y;  1R1B A;  2JK5 C;  1NH2 B;  4NXM O;  5LGT A;  4AIL C;  1SQP H;  3T1H B;  1QVF U;  2XND G;  2RCV A;  1I7F A;  1VQ8 V;  2RNB A;  3OGI B;  4MVO A;  3L74 H;  1VQP V;  2WWW A;  4YXW G;  1VF5 B;  1OCZ B;  4FVM A;  4CZZ A;  4OPA A;  4TSF G;  4JI7 B;  4O4L B;  3STL C;  4CH6 A;  2P22 C;  2Y4T A;  2ATK C;  4X89 A;  4PJ0 Z;  1N36 O;  5BMV A;  1K97 A;  3GWO A;  3D3Q A;  1FFX A;  4WFA V;  1GN4 A;  1HW7 A;  1YTF D;  1FXV A;  2JGD B;  4Z1V A;  3SPI A;  3E8H A;  5EIB D;  4MT8 A;  4X1Y B;  3HKC A;  5FPO A;  2QKA A;  3P30 A;  3OAA G;  4I5S A;  4D7S A;  5B1B B;  2DE0 X;  3IFX A;  4GX0 A;  4F6R B;  4MVZ A;  4XDL A;  2EJR A;  3N2G A;  5LOV B;  4U3J B;  5C93 A;  3R66 A;  1K92 A;  2LQT A;  2LO1 A;  2IJH A;  1EZV H;  3L71 H;  2VS0 A;  5JQG A;  1SQV H;  3K0G A;  1HNW O;  1R6N A;  2JVD A;  1H2S B;  2UXB B;  4DRX A;  2CTP A;  5EIB C;  2WLI A;  1M5I A;  3ZJZ A;  5HFM A;  1ROP A;  1VF6 C;  3SYO A;  1L0N H;  2ZDI A;  5CB4 B;  3H1I H;  3TK1 A;  4FFB A;  4DV0 O;  5DM6 V;  1IXM A;  1EFR G;  4MSW C;  4MTF A;  5J2U B;  2L35 A;  2E76 B;  3E22 B;  1JQ0 A;  1RM1 B;  1S72 V;  1M57 B;  2E74 B;  2ZM6 O;  2EX3 A;  3W7S A;  1NBM G;  4W4L A;  3T4Z A;  1SES A;  1B6Q A;  4GKK O;  1YDX A;  5B3S C;  1DK1 A;  1VQ7 V;  3K79 A;  1AI6 A;  4UCR A;  2QE7 G;  1XHZ A;  4ZI7 A;  5C8Y A;  4X88 A;  2XOK G;  1K73 W;  5H2F Z;  1QU7 A;  5L3F A;  3BA8 A;  3CSX A;  3ABM C;  1YI2 V;  1IBK O;  2OIE A;  5BMV B;  3NR7 A;  1YIJ V;  4DV1 B;  3CC4 V;  1FFX B;  3CRM A;  1KKC A;  2HP8 A;  1QLE B;  1W2B U;  2BOB C;  3ETE A;  2EIM C;  1FFT B;  2GHY A;  2FML A;  5F2V O;  3HKC B;  4WFB V;  5LMU O;  2P4V A;  3LNN A;  3SPJ A;  4IT5 A;  4LF9 B;  2GUZ A;  2HEP A;  2WLL A;  5B1O A;  3N2G B;  2AW9 A;  4JYB A;  4BAY A;  4LFC O;  4JI8 B;  2K9P A;  2R72 A;  2N74 A;  3AG3 B;  4GCZ A;  5JQG B;  1GM9 A;  4J9Y B;  4JTC B;  4UCT A;  3L75 H;  5KX5 A;  1YF2 A;  3ASO B;  1PL4 A;  3UO2 A;  2ZKO A;  1VEW A;  2XT9 A;  1WP8 A;  3AK1 A;  4FZ0 A;  5H9C A;  3JAW A;  3MD0 A;  1F4N A;  5JCO C;  4DRX B;  4DR2 B;  5IYD O;  3BY6 A;  5LP6 B;  3RGB A;  1E1R G;  1AI4 A;  1XNQ O;  2B5U A;  3KG2 A;  2YIB D;  3L72 H;  4FFB B;  3CS5 A;  4FLW A;  1P7B A;  2VQE O;  4DO2 A;  1NH2 D;  1EN6 A;  5L3G A;  3LDE A;  1EBO A;  2WLK A;  1BT8 A;  1V55 B;  2Q6A A;  3CX5 F;  5FLX N;  3JAK A;  3ZRW A;  3CC2 V;  3H1H H;  3OFN G;  5BY1 A;  1SF9 A;  4K8Z A;  3R65 A;  3OE7 G;  4G2K A;  5IYC O;  1S76 D;  3B4S A;  4JTA B;  1LUW A;  1S77 D;  3CE2 A;  3CD6 V;  2IJK A;  2EIK B;  4ZI7 B;  5KA5 A;  5C8Y B;  3OEE G;  1G1X B;  4DR5 B;  1VQK V;  4X9Q A;  3M99 B;  3P3N A;  5LA6 A;  4DR4 B;  2AHY A;  1VF6 A;  3BCC H;  1FS0 G;  1BGY H;  4I50 A;  1KC8 W;  1WB7 A;  1B06 A;  4PA9 A;  1E79 G;  2AGA A;  1LNQ A;  3RFR A;  1WPX A;  2X6C A;  5GON A;  1IZ3 A;  4MW3 A;  3CXC U;  2N04 A;  2PZS A;  2ODM A;  4CC5 A;  2KSD A;  1KBH A;  2GUZ B;  2WLL B;  5CA1 A;  1I94 O;  1OCZ C;  3J80 N;  3BRC A;  1K34 A;  2NR5 A;  1N36 B;  4GZR B;  2V4D A;  1HDJ A;  1Q90 D;  2QKS A;  1BZK A;  3JAT A;  2JS3 A;  1YXB A;  4UV8 A;  2CAZ C;  5KX5 B;  4IL6 Z;  2Q67 A;  3AG1 B;  2JS5 A;  4WFE A;  1XIL A;  1FXK C;  2ZIO A;  4DV5 O;  4NXN O;  1S5J A;  5KHI A;  2YC0 A;  4AI8 A;  2W0X A;  4RQF A;  3JAW B;  1QR8 A;  1VQ6 V;  2F1M A;  1MOF A;  3ABT A;  3ICX A;  4DV7 O;  4EEQ A;  1NR1 A;  3TGU H;  2H94 A;  2QWP B;  2QDO A;  4UCS A;  3UT5 A;  4R50 A;  5CBH A;  2KQX A;  2LW7 A;  1XI1 A;  3K3W A;  4U3F H;  3D8C A;  3RYI A;  3LSQ A;  2Y0I A;  2IH1 C;  1NR7 A;  2ZE6 A;  3VBB A;  4DXW A;  1N0J A;  3Q4H B;  5IYB O;  5CA0 A;  3ZRW B;  4LF4 O;  1HNW B;  1COW G;  4TOI A;  3WG7 B;  4LFB B;  3WB2 A;  2N05 A;  2YID A;  1TVK A;  3CCR V;  5H5N A;  5B1A C;  1K3E A;  1YTF B;  4ZHQ B;  2HFE C;  1FD9 A;  4NR1 A;  3L9D A;  4J9Z B;  4QJF B;  5LA6 B;  4DV0 B;  2LW1 A;  3E83 A;  2OTJ V;  4I50 B;  3CCL V;  1N0N A;  1EN4 A;  5H6R A;  1R3I C;  3ZRS A;  2Y4U A;  4I0X A;  2WA4 A;  4PDM A;  2ZM6 B;  4P30 A;  5E1A C;  1W59 A;  4D7T A;  3W7X A;  3JAL A;  1M57 C;  4WFF A;  4DYL A;  4GKK B;  1SZT A;  5GON B;  2DWD C;  2FTK A;  3OM3 B;  2Q8V A;  3QG5 A;  3IC9 A;  3ZS8 C;  4DV6 B;  5B3S B;  5CA1 B;  5FL7 G;  1F51 A;  3JAS A;  1BHA A;  1FKA O;  4JYY A;  2ZNJ A;  1BCC H;  3A8T A;  3JAT B;  1BL8 A;  4CS2 A;  2PYJ A;  3OMN B;  4LNU A;  4LF7 B;  4U7O A;  1QLE C;  3K06 A;  1VAR A;  5EBW C;  4RUF A;  4MS2 A;  4DV1 O;  5LMU B;  5KHK A;  1AVM A;  1BHB A;  5JVD A;  2XUM A;  2HJD A;  5LBQ A;  5CN0 A;  2QTO A;  2P6J A;  4X1I A;  3PJS K;  2Y48 A;  4H0L B;  4JAV A;  2OYQ A;  3B8M A;  4LFC B;  3UT5 B;  3U10 A;  1BMF G;  4GLX A;  4FLU A;  3B8N A;  2HVJ C;  3ETG A;  3T1Y B;  4B7E A;  3RYI B;  5KUK A;  1ZWI C;  5JWP A;  2O57 A;  3AG3 C;  4JI8 O;  1CXZ B;  1TUB A;  5CA0 B;  3K0D A;  4H37 A;  4QE9 A;  3QO5 A;  4JV5 B;  1FXK A;  4D6T H;  1TVK B;  2ETN A;  4QE7 A;  1AP5 A;  2Q4P A;  2ZQM A;  1JJ2 U;  4O4J A;  2XAG A;  1P4R A;  3BAB A;  5LXT A;  2X7R B;  4KFM A;  4CS3 A;  1XNQ B;  4I7Z B;  2ITD C;  2QWR B;  2FL4 A;  2VQE B;  1SZX A;  1JCH A;  2ZDI C;  5E79 Z;  2ZT9 B;  4I0X B;  3B40 A;  5D5Q A;  3VQW A;  2YS8 A;  5J9P C;  1V55 C;  3ZX6 A;  4X20 A;  3JAL B;  2JEU A;  4R6Z A;  1VQ9 V;  3UCS C;  1AIL A;  5ITZ A;  1M56 B;  3ASN B;  1F4M A;  2P5O A;  5KAI Z;  4JI0 O;  2VQF B;  2ADQ B;  4J80 A;  5LMN O;  4MTO A;  4X66 O;  1ARO P;  2OCC C;  4O2B A;  4MVU A;  5A2Q N;  2CGO A;  2WSS G;  4DV2 O;  4BIO A;  3K5O A;  4TQF A;  1F23 A;  1WA8 A;  4LNU B;  4DR5 O;  1OCC C;  4LF5 O;  2X6B A;  4DR4 O;  1G6U A;  3EFF K;  3RVY A;  2PI5 A;  1BQZ A;  2QM4 A;  3E8G A;  2LGW A;  5JVD B;  3APQ A;  4J7Z A;  3BFR A;  4JZ2 A;  1OCR B;  4N23 A;  4X1I B;  1I94 B;  2F66 C;  3C3S A;  2AZ0 A;  3JAM N;  4KL1 A;  4JTD B;  2BTQ A;  3JD0 A;  4GT1 A;  2ZR2 A;  4HZ3 A;  1K5Q A;  1TUB B;  2QM7 A;  3CXH F;  5IJ0 A;  4R8C A;  3AG1 C;  3N27 A;  2E3C A;  4DV5 B;  2HHH O;  1PNK A;  4NXN B;  4XDJ A;  3EXA A;  2ZIM A;  1IX9 A;  3AG4 C;  1US6 A;  4O4I A;  1FXK B;  4Q20 A;  2L6L A;  4HYO A;  1XMQ B;  1RPR A;  2AXT Z;  4KXR A;  5L3B A;  4QPJ A;  3BEH A;  1CEZ A;  3UO3 A;  4DV7 B;  2YUA A;  4O4J B;  1OHH G;  5LXT B;  3CCQ V;  4DR6 B;  1PD3 A;  1GM8 A;  2UXX A;  2E75 B;  2ZNI A;  3L70 H;  3OR7 C;  1Q43 A;  1VQ5 V;  3FKS G;  3K08 A;  1VQN V;  4FIP C;  4GX1 A;  2PI4 A;  1U96 A;  1JJO A;  4X20 B;  3IGA C;  1QBZ A;  3FB6 C;  4LF4 B;  3MHH C;  3GWK C;  4WBN A;  3K9A A;  4DK0 A;  4X62 O;  1Q82 W;  2ZE8 A;  4DUZ O;  5ITZ B;  3WG7 C;  3U0Z A;  4HAM A;  4J7J A;  2P06 A;  4FLZ A;  1HP8 A;  2KB1 A;  1VQM V;  5B1A B;  1NKD A;  1M9N A;  4O2B B;  3ETD A;  4DR7 O;  2WAM A;  2WLM A;  1NQT A;  2X6A A;  3QF7 A;  3T2M A;  2M7W A;  1GO3 F;  2BCC H;  1WA8 B;  5KMG A;  2P7T C;  1UJW B;  1PP9 H;  1MZE A;  1SA0 A;  1NT2 B;  3APO A;  2OWO A;  1AJN A;  4DW0 A;  2F4V O;  3LSS A;  4PA4 A;  3WFV A;  2E5L O;  4LFB O;  4GYC B;  1JVM A;  4OPH A;  3MAQ A;  3CC7 V;  3CCS V;  4IIJ A;  2XAH A;  3STZ C;  1AR4 A;  1GKF A;  3FYI B;  4DV6 O;  5LGN A;  2F93 B;  3RN4 A;  2Q7G A;  3CRA A;  3JD4 A;  1XRE A;  5IJ0 B;  1HNX B;  2B1G A;  3F5T A;  3K9S A;  1YSC A;  3S3X A;  3ZCC A;  4AHC A;  3MHS C;  4O4I B;  4UVA A;  1ZX3 A;  3BHP A;  3F7V C;  4LF7 O;  4NKG B;  3IJ4 A;  1DF5 A;  3TJT A;  3CHX A;  4DR1 O;  1XNR O;  4KP4 A;  5TIS Z;  3ZHR A;  3ZMV A;  1AJQ A;  3HB3 B;  3M8A A;  1N4C A;  1V9P A;  4G27 B;  3P32 A;  4EKW A;  5FPR A;  4RAI A;  1X4T A;  3T1Y O;  3D3I A;  3OGC C;  4X1K A;  3B09 A;  2G38 A;  3TXQ A;  3CP1 A;  3LSU A;  2FYU H;  3SJA C;  4E4E A;  3ZMU A;  1NS1 A;  1J5E O;  4JV5 O;  2WLN A;  4NTY A;  2IM9 A;  2WLI B;  5J2T A;  4F4L A;  3ZHT A;  1CP9 A;  3B2E E;  5KMG B;  5EC1 C;  3G6B A;  3RT3 C;  2IJI A;  1SA0 B;  1T5E A;  4Q6G A;  1SQX H;  4P2Z A;  1R3K C;  2Q69 A;  1FJG O;  4UUJ C;  1LUV A;  3SPH A;  4CC6 A;  1S5H C;  5JH7 A;  4JI0 B;  4FMT A;  1M56 C;  3ASN C;  4UB8 Z;  4IIJ B;  5LMN B;  5K1X A;  4X66 B;  1YJW V;  1FXH A;  4B08 A;  4MW8 A;  1Q6U A;  4DV2 B;  2VQF O;  2D3O W;  4PD4 F;  2OCC B;  3SDL A;  1JPX A;  1GH6 A;  1D5A A;  4YJ2 A;  4LF5 B;  3VQX A;  4LH7 A;  1XL4 A;  1OCC B;  2GDS A;  2DMX A;  2Q0O C;  4NB5 A;  4JAA A;  1GTO A;  1VF7 A;  2YI9 A;  3LNM B;  4X64 O;  2PGG A;  1Y66 A;  4EB6 A;  4JYC A;  2DYR B;  2IH3 C;  4H44 B;  1OCR C;  3SJC C;  3OMI B;  1GK9 A;  2VWK A;  1X59 A;  4PI2 A;  4DV4 O;  2Q7E A;  2ADP A;  1Z5W A;  3TET A;  5DN6 G;  2OT5 A;  3JAR A;  2M6Y A;  2QTS A;  3IAY A;  4CH3 A;  4FM2 A;  1R6K A;  1IXB A;  1P7G A;  1URF A;  3K59 A;  2QM8 A;  5DED A;  2Q9L A;  1H2L A;  1GMG A;  1QQC A;  3CRC A;  2HHH B;  3CCJ V;  3QO7 A;  4WF9 V;  1SC5 B;  2BE3 A;  4LC1 A;  4X1K B;  3HKB A;  3K5M A;  3RYF A;  5H6Q A;  3AG4 B;  4TV9 A;  3J81 N;  3RWR D;  5CBG A;  1Y6X A;  4LF6 O;  3FFQ A;  2F43 G;  1XMQ O;  4JI5 B;  3QTC A;  2OCH A;  5J2T B;  5EYP A;  5EZY A;  1KUQ A;  1SQF A;  2Q7H A;  4NYK A;  2D2C B;  2ZR3 A;  4DR6 O;  4O4H A;  5CMU A;  2EZO A;  2AHZ A;  4PHZ A;  4X62 B;  3GB7 C;  4X8A A;  4DUZ B;  3JCU Z;  2V1D A;  2PY5 A;  1YIT V;  2GTA A;  2ZD9 A;  3TXS A;  3E35 A;  5JH7 B;  1JFF A;  3JAK B;  1H2K A;  3SJQ C;  5IYZ A;  3CPW U;  3UQ8 A;  4TUY A;  2B1I A;  3THO A;  1JR9 A;  1ORQ C;  1K9M W;  4DR7 B;  3K03 A;  3JSN A;  1BQ0 A;  4JI4 O;  1E1Q G;  2ZXW C;  1V54 C;  3A0H Z;  2EUL A;  2KKW A;  2IW5 A;  4YJ2 B;  1XMO O;  4BWA A;  4P9P A;  3L73 H;  4K8X A;  1PNM A;  1KB9 F;  2F4V B;  1Z5V A;  1Z2G A;  1W0J G;  2PUS A;  4G28 B;  2E5L B;  1H2G A;  3SYQ A;  3RW0 A; 
#chains in the Genus database with same CATH homology
 3TK1 A;  2WLJ A;  5DM6 V;  1IXM A;  1EFR G;  4MSW C;  4MTO A;  5EBL C;  1ARO P;  2OCC C;  4MVS A;  1KP3 A;  4MVU A;  4MTF A;  2WSS G;  4TWK A;  1S0V A;  3ZMT A;  1JQ0 A;  2DQ0 A;  4WFG A;  1RM1 B;  1S72 V;  1M57 B;  1F23 A;  4JF3 A;  4E2L A;  3W7S A;  1NBM G;  3T4Z A;  2CK3 G;  1SES A;  1OCC C;  5IY5 B;  4Z1M G;  2X6B A;  3E89 A;  1B6Q A;  3TCU A;  2ITC C;  3QO8 A;  3EFF K;  3RVY A;  2PI5 A;  5B3S C;  1R73 A;  1Y4M A;  3E8B A;  4ZKI A;  3E8G A;  1KD1 W;  1VQ7 V;  2EZP A;  3K79 A;  1AI6 A;  3I56 V;  2QE7 G;  2DYS C;  1OCR B;  4N23 A;  5KUM A;  4X88 A;  2XOK G;  1K73 W;  3OUF A;  1OCO B;  5L3F A;  2P90 A;  3ABM C;  5EC2 C;  3E86 A;  3UM7 A;  3B77 A;  4LP8 A;  1YI2 V;  1SET A;  3ABL B;  1AI5 A;  3CYO A;  4JTD B;  1YIJ V;  3CC4 V;  1DF4 A;  3JD0 A;  4PDR A;  3FB8 C;  1EZJ A;  1QLE B;  1W2B U;  2BOB C;  4GT1 A;  3ETE A;  2EIM C;  1I5X A;  3OMA B;  1FFT B;  2IU0 A;  2ZR2 A;  2GHY A;  4HZ3 A;  4MTX A;  3JD3 A;  3ZN0 A;  1K5Q A;  2QM7 A;  3X2Q B;  2JJ2 G;  4R8C A;  4WFB V;  3AG1 C;  1XL6 A;  5L3D A;  1NVP D;  1PNK A;  2EIN B;  4XDJ A;  3AG4 C;  4PA6 A;  4Q20 A;  1FXK B;  3SPJ A;  4HYO A;  1H8H G;  1RPR A;  2WLL A;  1JX9 A;  5B1O A;  5L3B A;  1Q86 W;  4QPJ A;  3OEH G;  3BEH A;  1CEZ A;  1H38 A;  4JYB A;  1DLB A;  1OHH G;  1MG1 A;  4BAY A;  3CCQ V;  2YEV A;  1VQ4 V;  1PD3 A;  2W6J G;  2UXX A;  1GM8 A;  3AG3 B;  3OR7 C;  4GCZ A;  3SYC A;  4U7N A;  2Z3Y A;  4UXN A;  1GM9 A;  4J9Y B;  4JTC B;  1VQ5 V;  5LHH A;  3FKS G;  3K08 A;  5HFL A;  5LHI A;  1VQN V;  1PNL A;  2R9I A;  3ASO B;  2LP7 A;  4FIP C;  5L3C A;  2EIJ B;  2OTL V;  4GX1 A;  3AG2 B;  2PI4 A;  3E2E A;  5B1B C;  5BZB A;  3IGA C;  1QBZ A;  5IDJ A;  3FB6 C;  4RO2 A;  3MHH C;  3K9A A;  3IC7 A;  5H9C A;  1Q82 W;  3MD0 A;  3SYA A;  1F4N A;  5IYD O;  2X0L A;  3WG7 C;  1G8M A;  1GM7 A;  1K33 A;  3BY6 A;  3T1C A;  4HAM A;  2Y69 B;  1E1R G;  2HJF C;  1AI4 A;  3ZMS A;  2B5U A;  3KG2 A;  2KB1 A;  1VQM V;  4FK5 C;  5B1A B;  1NKD A;  1YHQ V;  4WFH A;  4UV9 A;  1P7B A;  3CCE V;  1M9N A;  4DO2 A;  1NH2 D;  5L3G A;  3DTU B;  3ETD A;  3LDE A;  1EBO A;  4RQE A;  2WLK A;  1V55 B;  2WAM A;  2WLM A;  1NQT A;  2X6A A;  3RBZ A;  2Q6A A;  3T2M A;  2M7W A;  1SRY A;  2JIZ G;  1GO3 F;  3OR6 C;  2XAS A;  3ZRW A;  2P7T C;  3CC2 V;  3OFN G;  1TUE B;  1ENV A;  1UJW B;  3R65 A;  3ABK C;  3OE7 G;  4G2K A;  2LFR A;  3I55 V;  5IYC O;  1AJN A;  4FJC C;  1S76 D;  1QLN A;  4JTA B;  1S77 D;  1KP2 A;  2EIL B;  3CD6 V;  1Q7Y W;  1M90 W;  1K7D A;  3LSS A;  2XAF A;  4QPK A;  4RUE A;  2C2A A;  4PA4 A;  2Z5U A;  2IJK A;  2EIK B;  3WFV A;  5KA5 A;  1JVM A;  3OEE G;  3CC7 V;  3CCS V;  1VQK V;  2IJJ A;  1RM1 C;  3M99 B;  2YSU B;  2XAH A;  5LGU A;  2XAQ A;  2AHY A;  4MVR A;  3FYE B;  1FS0 G;  2Q68 A;  3STZ C;  4BIU A;  1GKF A;  3JD2 A;  1K4C C;  1KC8 W;  3FYI B;  3JCZ A;  5LGN A;  1NJI W;  4P9O A;  2DYR C;  2HG5 C;  4PA9 A;  1E79 G;  4PDL A;  1LNQ A;  1WPX A;  4PEL A;  3JD4 A;  5KA6 A;  3CME V;  3G71 V;  3QNE A;  2X6C A;  2B1G A;  4MW3 A;  1YSC A;  3CXC U;  5EK0 A;  3ZCC A;  3MHS C;  2H8P C;  4MVM A;  3ABM B;  4UVA A;  3A0R A;  2WLL B;  3ABL C;  3K04 A;  1MSW D;  3F7V C;  1HWY A;  1YJN V;  4I9W A;  1OCZ C;  1DF5 A;  4JGS A;  2GSM B;  1RPO A;  1QVG U;  4KP4 A;  1K34 A;  4CBC A;  1M1K W;  1KQS U;  3ZMV A;  1AJQ A;  2YEV B;  3CCV V;  3F7Y C;  2EIM B;  3HB3 B;  3W7T A;  4WCE V;  2QKS A;  2HR3 A;  1PL0 A;  3VOU A;  3UKM A;  2IU3 A;  1QR9 A;  4N21 A;  4UV8 A;  4TT3 G;  2Q67 A;  3AG1 B;  3ZMZ A;  5L3E A;  3CMA V;  4WFE A;  4G27 B;  3SYP A;  1FXK C;  2K1E A;  3RVZ A;  4OXS A;  5LHG A;  3P32 A;  2LFS A;  4EKW A;  1VQO V;  2NNU A;  4XDK A;  1N8R W;  4BIZ A;  4RQF A;  4RAI A;  1QR8 A;  2HLD G;  3D3I A;  3OGC C;  1VQ6 V;  1MOF A;  1WLE A;  3ABT A;  1CPY A;  3SPC A;  3D36 A;  2WPD G;  3ZIA G;  3CP1 A;  1NR1 A;  3DGE A;  2H94 A;  1MAB G;  3LDC A;  3E8F A;  2W0F C;  3ZMU A;  4R50 A;  5GW7 A;  3G4S V;  3ASO C;  5CBH A;  1PKX A;  2EIJ C;  2WLN A;  5CA3 A;  3AG2 C;  3FB7 C;  2V7Q G;  3ML0 A;  3F5W C;  3K3W A;  2WLI B;  3ABU A;  4F4L A;  1K5S A;  5B1N A;  3LSQ A;  1KKD A;  1OZ0 A;  1CP9 A;  2IH1 C;  2QA4 V;  1R3J C;  1NR7 A;  4JAU A;  3VBB A;  2A9H A;  4DXW A;  2NLJ C;  2UXN A;  5IYB O;  3ZRW B;  4R7C A;  2P67 A;  5EC1 C;  1COW G;  3WG7 B;  4QIW F;  1AI7 A;  2IJI A;  2Y69 C;  1V54 B;  2ZXW B;  4KUM A;  4P2Z A;  1R3K C;  1SER A;  2Q69 A;  2WLH A;  3CCR V;  4PA3 A;  5B1A C;  1K3E A;  1YTF B;  4UUJ C;  3SPH A;  1S5H C;  2HFE C;  3LUT B;  2BOC C;  4FMT A;  1M56 C;  4ZBM A;  3ASN C;  4J9Z B;  4QJF B;  4GX2 A;  1I5Y A;  4QNH B;  1YJW V;  2XAJ A;  1FXH A;  2A79 B;  3E83 A;  2OTJ V;  2QEX V;  3CCL V;  4JAS A;  4MW8 A;  4GX5 A;  3AEI A;  5H6R A;  1R3I C;  3ZRS A;  1DTO A;  2D3O W;  4PDM A;  2OCC B;  1AR1 B;  3NXS A;  4P30 A;  5E1A C;  5EBM C;  3JYC A;  1JPX A;  2EIL C;  4PA7 A;  3W7X A;  1AJP A;  1M57 C;  4WFF A;  3CCU V;  1SZT A;  2EIK C;  2DWD C;  2FTK A;  2JJ1 G;  1H8E G;  1XL4 A;  5IY5 C;  2DW4 A;  3H01 A;  3HPL C;  1OCC B;  2JEX A;  3OM3 B;  4H33 A;  1YJ9 V;  4UVC A;  5B3S B;  1GTO A;  1W0K G;  2DWE C;  4UVB A;  5FL7 G;  1QCE A;  1F51 A;  4MTG A;  3LNM B;  3ZN1 A;  1BHA A;  3JD1 A;  3W7U A;  1Y66 A;  1K8A W;  4JYC A;  2EBO A;  1H2G A;  2DYR B;  2IH3 C;  2R9R B;  3G6E V;  3SPG A;  1OCR C;  3OUS A;  4LBE C;  2DYS B;  3ZRV A;  3OMI B;  1OCO C;  1GK9 A;  3T4D A;  1R3L C;  1BL8 A;  1Q81 W;  2W6I G;  2JK5 C;  3ZRX A;  1NH2 B;  5LGT A;  3TET A;  3OMN B;  5DN6 G;  2OT5 A;  1QVF U;  2XND G;  4U7O A;  4XBF A;  1JOY A;  1QLE C;  3K06 A;  1VQ8 V;  1R6K A;  1THZ A;  2JDI G;  4MVO A;  4BW5 A;  3W7W A;  5EBW C;  4RUF A;  1VQP V;  2QM8 A;  4MS2 A;  2WWW A;  1GMG A;  4YXW G;  1BHB A;  1OCZ B;  3X2Q C;  3CCJ V;  3QO7 A;  4WF9 V;  2DQ3 A;  4CZZ A;  4TSF G;  5LBQ A;  3STL C;  4PDV A;  4LC1 A;  1L1F A;  5CN0 A;  2EIN C;  1J95 A;  2QTO A;  2P6J A;  3PJS K;  1KEC A;  2Y48 A;  3AG4 B;  4JAV A;  5H6Q A;  1VQL V;  3B8M A;  2ATK C;  4LCU C;  4X89 A;  3EHB B;  1S3J A;  5CBG A;  3OW2 U;  1BMF G;  1K97 A;  3GWO A;  2F43 G;  2MK3 A;  4WFA V;  3B8N A;  2HVJ C;  1YTF D;  4ASU G;  3ETG A;  1FXV A;  4MVQ A;  5CBF A;  5KUK A;  1ZWI C;  3SPI A;  3AG3 C;  3E8H A;  1K4D C;  2ZR3 A;  4MT8 A;  5CMU A;  3K0D A;  3P30 A;  2EZO A;  4H37 A;  3OAA G;  2AHZ A;  4I5S A;  4QE9 A;  3QO5 A;  1FXK A;  3GB7 C;  5B1B B;  4X8A A;  3IFX A;  4GX0 A;  2V1D A;  4MVZ A;  2EJR A;  4XDL A;  4QE7 A;  2ZQM A;  5C93 A;  1YIT V;  2ZD9 A;  3E35 A;  1JJ2 U;  2XAG A;  1P4R A;  2X7R B;  4KFM A;  3SJQ C;  1K92 A;  3CPW U;  2B1I A;  2IJH A;  2ITD C;  1ORQ C;  1K9M W;  1JCH A;  2ZDI C;  1NVP B;  4FPP A;  3K03 A;  2HVK C;  2HKO A;  1E1Q G;  2ZXW C;  1V54 C;  1G4Y B;  3CCM V;  3K0G A;  3LDD A;  5J9P C;  3FB5 C;  1V55 C;  2IW5 A;  1R6N A;  2JEU A;  4P9P A;  4R6Z A;  1VQ9 V;  2A0L A;  4L87 A;  1M56 B;  1PNM A;  3ASN B;  1F4M A;  2WLI A;  3ZJZ A;  5HFM A;  4JPR A;  1ROP A;  1W0J G;  3ABK B;  3SYO A;  4G28 B;  2ZDI A;  3SYQ A;  3RW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...