3P30A

Crystal structure of the cluster ii fab 1281 in complex with hiv-1 gp41 ectodomain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
91
structure length
84
Chain Sequence
TVQVRKLLSGIVQQQSNLLRAIEAQQHLLKLTVWGIKQLQARVWLQWDKEISNYTHIIYELIEESQKQQEKNEQELLELDKWAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 gp41
publication title Distinct conformational states of HIV-1 gp41 are recognized by neutralizing and non-neutralizing antibodies.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
total genus 35
structure length 84
sequence length 91
ec nomenclature
pdb deposition date 2010-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3p30A00
1DF4A 3B8NA 3P30A 5KA6A 2EBOA 2EZPA 3CP1A 3B77A 1QR9A 4FK5C 2LP7A 1Y66A 4JGSA 1ENVA 1DLBA 5H9CA 4G2KA 1K34A 1MG1A 5HFMA 4N21A 1QCEA 5HFLA 1I5XA 1QBZA 4E2LA 2M7WA 1K33A 1JPXA 2EZOA 1F23A 4JF3A 5KA5A 3H01A 1DF5A 2MK3A 1SZTA 1JQ0A 3CYOA 3M99B 4FJCC 4FIPC 5CMUA 5CN0A 3WFVA 3MHSC 1MOFA 3GWOA 4N23A 3K9AA 2OT5A 2X7RB 3B8MA 3MHHC 4JPRA 1Y4MA 1QR8A 1I5YA 1EBOA 2P6JA
chains in the Genus database with same CATH superfamily
2GV9A 2YXYA 4X1KB 4QPKA 1FS0G 1PNLA 4JI6O 2YC0A 3WG7B 3B40A 3LDCA 2YIBD 4NB5A 4MS2A 4X62O 4LFCB 2BOBC 4DR1B 1OCOC 4IHJA 2UXNA 3BA9A 4R6ZA 4YHHO 1Q90D 2KQXA 1G4YB 1M57B 2GBOA 2KKWA 3AG7A 4DV3B 4DV2O 5BR8B 1D2DA 2EIMB 4NR1A 3T4DA 4LBEC 1FAFA 1BGYH 4R8CA 2DW4A 2VQFB 5IYCO 2ZXWB 3TJTA 1S76D 1Q8IA 4JI1B 1GM7A 4DR4O 1BS3A 1NVPD 3IFXA 1KP2A 2HHHB 5JJNB 2KG7B 4OX9O 1UFIA 2DE0X 2EZPA 3ZMSA 2UUCB 1JJ2U 1SQFA 2JIZG 1ZL8B 3K58A 4MVMA 4B7EA 2LJ2A 1NQTA 4MT8A 3JD0A 2IH3C 4I5SA 4NYKA 2QWNB 1AJPA 4AQYO 3AG4C 2EILC 2YUAA 1D5NA 5GTHZ 5J2TA 3ETEA 4KUMA 2HFEC 1I94B 3OMNB 4IGGA 4O2BB 4FMTA 4XBFA 1MABG 4O2AB 3HKCB 4DR2B 4DR3B 3X2QC 3ABMB 2ZE6A 2K1EA 1N33O 3CJHB 2GTAA 5IDJA 2JGDB 3T1HB 1Z5WA 2JS3A 1JX9A 4WF9V 3BVOA 2RQ6A 3Q4HA 3OMIB 2NR5A 4FFKA 3G80A 3JAKA 2GDSA 3DTUB 1NTZH 1Y67A 1NTKH 1WAZA 3O9OA 4UCRA 2WLMA 1BMFG 3RT3C 2UXCB 4GX2A 2F4VO 2V7QG 1V54C 4DXWA 2WA4A 1F4MA 1YEWA 2RJZA 5EBWC 3D36C 1IVSA 4BIUA 3H1JH 4BW9A 4H37A 5J9PC 5C8YA 1QLEB 5B1AC 1KU9A 2CTQA 3RVYA 4DUYB 2ZINA 4E4EA 4DR6O 4TQFA 4DK1A 3ZMVA 5CBHA 2Q5ZA 1B6QA 5EBMC 1KD1W 2R70A 4TV9B 3SGIA 1E79G 2ZR3A 1PM9A 2OIEA 3K5LA 1S5LZ 3F7YC 1Q6HA 1OCZB 3AG1C 4I50B 4YJ2A 1M9NA 3ASNB 4DW0A 2LO1A 3FFQA 2Y69B 1YI2V 1BHBA 4NXMO 3CXCU 2GUZA 1S77D 1H2KA 2OCCB 4JF3A 1WA8A 3ZCCA 1DF5A 3BAAA 1CEZA 2CE4A 4FJCC 4EFEA 3H1KH 5ITZA 1W59A 3AEIA 1YVWA 5LP6C 1I94O 1R73A 1Q6UA 3RYCA 2VRZA 3BHPA 2IJKA 3KZIZ 4DV7O 3JAWB 3B77A 2P22C 3N27A 5D5PA 3STLC 3RYHB 1JFFB 1H2NA 4KP4A 4PI0A 4TUYA 3JD1A 4DR3O 4DR2O 4LP8A 3BPZA 2FB5A 1B06A 5LMNB 4JV5B 1A32A 4G27B 1K33A 2WSSG 1YF2A 2UU9O 3F5WC 3I56V 2K9PA 2A9HA 1K3EA 3FB5C 5EC1C 3KG2A 5H2FZ 1FYJA 4UB6Z 4CS4A 3GB7C 3TXSA 5IJ0A 2ITDC 1HNWO 1DTOA 1OCOB 5CA0B 2WA3A 1EZJA 1Y6XA 2QKCA 2R9RB 2ZDIA 4J7KA 2HG5C 3CX5F 1XNQB 2DWDC 1BT8A 5K1PA 4H13B 4FLZA 3CCUV 3SPCA 1US6A 4HNAA 5EC2C 2HEPA 3HKBA 3EXAA 4LF4O 1GN6A 2YEVA 4JAUA 3BRCA 1P7GA 1M56C 1J5EO 1KYOF 5EZYB 1I08A 4P30A 1VF6C 2D3OW 1FJGO 1WPBA 2LFRA 4B3MO 2Y48A 3VQYA 3C3TA 4PA3A 2XAJA 5DECA 2X0LA 3SYCA 5IY5C 1S72V 5EK0A 2NN4A 2JK5C 2PYLA 3ZIAG 3AG4B 2EILB 3DGEA 5D5QA 4O4LA 3K0GA 1XREA 4O4IB 5E79Z 1VQPV 3QF7A 4W4LA 3ZMTA 1Q86W 5KHIA 3UT5A 2A3QA 3E35A 3JATB 2Y0PA 3TXQA 1UPGA 1P4RA 4J7JA 5GONA 1O9HA 4X66B 4TWKA 5JCOA 1Q5OA 1G8MA 1NU1H 2P67A 3ZRWB 3I5DA 5GTIZ 3C3SA 4JV5O 3LDDA 1XI1A 1FXKC 4FFBB 1OV9A 4WFFA 4OPHA 1AP6A 2UXBO 2YXLA 5FLXN 2OT5A 4GKJO 1QR8A 1AP5A 1EN5A 2E74B 1M4UA 4HBNA 1V54B 4ZKIA 3K08A 1K5QA 5H9CA 4GX1A 1YZBA 2VQEB 1XNQO 2XT9A 5B1AB 2WLKA 1KECA 4DW1A 3CC7V 1XNRO 4K0KO 2ZM6B 2WAMA 4WFEA 3RBZA 3LNNA 2O57A 4JI5B 5LHGA 1AI5A 4U3JB 1S0VA 1QU7A 4YY3B 4X1YA 4LF9O 1K34A 4DV4O 4FPPA 4DV6O 3AG1B 1COWG 1AVMA 1MMMA 5KX5A 5EBLC 4IIJA 4I0XB 3N2GB 2XUMA 3HKEA 1M1KW 3LSUA 1JVMA 1W2BU 5LP6B 3CCRV 3IC9A 3M99B 1RSOA 1XDCA 3ETDA 2DYRC 3DC6A 3MHSC 1NZ6A 2QGNA 1IZ3A 4JI4B 2KSDA 2BOCC 4KFMA 4MW8A 2BSKA 1NVPB 5LYJB 1W0KG 3F5TA 2V4DA 5KA6A 4CS3A 4GYCB 1KQSU 2A0LA 3P3NA 3ABLC 1Y66A 3LDEA 4MTXA 1BQ0A 3SJCC 4F6RA 5BMVB 3B09A 3CCSV 2XOKG 4X9QA 3ICXA 1HR0B 3G67A 5FNVB 2Q6AA 4PDRA 1SQQH 3ABKC 2BE3A 1PL0A 3NR7A 4JI7O 3K04A 1QHTA 4GX5A 2RCVA 4WFAV 4OPAA 5CMUA 3JARB 3SR2C 4JPRA 4LFBB 5TISZ 1EN4A 1VIBA 1YSCA 2CH7A 3U0ZA 1M56B 3ZRXA 4BW5A 1IBMB 2X6AA 1FXVA 2FL4A 3CWBH 1MZFA 3R65A 2Y4UA 3L70H 1IBLO 4JI6B 1SQVH 2RNBA 2QM4A 1Q43A 2W0XA 4NTYA 3W7SA 3OTOB 5IY5B 3O65A 4WBNB 1ZTEA 3FYEB 1MZEA 4ICGA 5LA6B 3RFRA 4WFHA 2WLLB 4TT3G 4DV2B 5LGTA 3ZHQA 4UV8A 4JYCA 3SPJA 4MTOA 1I5XA 3SYAA 1R1BA 5J2UA 1Y74A 3A8TA 1YITV 2EJRA 2EIJC 1IX9A 4O4HA 5EIBC 4DR4B 1WP7A 3J7AU 1N32O 3ZHRA 3KCYA 3P30A 1AB3A 4OX9B 5BZBA 2N74A 1SA0B 3SPIA 1FXKB 5IYZB 1K7DA 4N21A 3ZHSA 4DRXB 2DWEC 2DOSA 1IBKO 1GKFA 3L74H 4LNUA 2HP8A 2YSUB 2W0FC 3JAMN 3NXSA 1H2SB 3GVMA 1P7BA 3CCQV 1RM1B 1K92A 2JJ1G 4JASA 1TVKA 4CS2A 1HP8A 4I7ZB 5IWAO 2BTQB 3OMAB 5KA5A 1N33B 3TCUA 3P32A 3SJBC 3MHHC 3OD4A 3CCVV 3IJ4A 1XL6A 3CC2V 4K8ZA 1PNKA 1RFYA 3N2KB 3ETGA 2IW5A 1DLBA 5L3FA 1GMGA 2E3CA 2F4VB 2E75B 1WP8A 1XMOO 1OCRC 1L8DA 2JGUA 2NNUA 4AI8A 3OTOO 4TV8A 3MAQA 3SPGA 5L3EA 1CXZB 1IXBA 1VQKV 3K79A 3J80N 3EHBB 1J95A 1PL4A 1SZXA 2EX3A 2PI4A 2F43G 4U3FH 4DR6B 1VQ7V 4JAVA 3B2EE 3VBBA 1NR1A 1QQCA 2DYRB 4IHJB 1VF7A 2GHYA 2ZDIC 4CC6A 5CN0A 4FLTA 4QE7A 3B8MA 2EINC 5JJJB 3ABLB 3J81N 2BCCH 5KHKA 3OAAG 4UVCA 5LMUO 3RYFA 2XTAA 4NXMB 1JR9A 4X88A 1XBLA 4BAYA 3ZX6A 5IT9N 4DR5O 1YTFB 4JAAA 3RGBA 2DYSC 5KHJA 1EBOA 4DV7B 1P49A 3THOA 2N04A 3UCSC 4DO2A 1GAXA 2Z0AA 3A0BZ 1NI8A 1SQPH 1F23A 4FM2A 3H01A 2UU9B 5KMGA 2Q7HA 5J2TB 4P9PA 1RP3B 1Y76A 3H1HH 3BABA 2ZT9B 1VP7A 1N36O 4BIZA 3E8FA 4XDJA 3ASOC 1ZX3A 3DXRA 5B3SC 4JGSA 1HNWB 1L1FA 3CMAV 1HW7A 2PGGA 3BA8A 2QKAA 5JCOC 4YIPA 1JPXA 4IT5A 2ZIOA 4JYBA 2AGAA 3ZRVA 3QO7A 2AZ2A 1KB9F 1ORQC 3ABTA 4NKGB 4FZ0A 4ZOLA 3Q4HB 2ODMA 3UO2A 3JAKB 4LF4B 3ML0A 1YIJV 5BY1A 4I4TA 4UCOA 4LF8O 1TUBA 1J5EB 2EIJB 4RQFA 1M90W 2W6JG 4MVZA 5C8YB 1FJGB 4O4JA 2Q7EA 4DV0B 2CTRA 3ETQA 4B3MB 3GWOA 3K5NA 2QKSA 1AI6A 4FM1A 2RDCA 1HNZO 1KKDA 3BEHA 3VOUA 4RUEA 4K3AA 1BSMA 2XASA 2ZE5A 3SJAC 4X8AA 4Z1MG 3HB3B 4YJ2B 1GM8A 5LXTA 2CK3G 3TK1A 1K8AW 4LWSA 1S5JA 3H9VA 4TSFG 3H1IH 3EFFK 1DK1A 2GUZB 1OHHG 1LUVA 2JJ2G 2QM8A 2IJIA 3HR0A 2QR4A 1XMQO 1WA8B 1JMKC 3GWKC 3L73H 2EZOA 5H5NA 3LUTB 1JQ0A 4I55A 5ITZB 1SS3A 2A06H 2Q69A 2OTLV 2UXBB 3RYCB 3L71H 2E5LO 4GKJB 2X6BA 1OCRB 1YCIA 4TUYB 3CD6V 3G6EV 4Z2WA 4GKKO 2Z5UA 1GH6A 2WLHA 2UXDO 1QNMA 2RMKB 4WFGA 1URFA 3WU2Z 1AJNA 3ZHUA 2QE7G 1VQOV 5B1OA 3QO8A 4LF6O 3FB7C 3K57A 3A2FA 4L87A 5B5EZ 4NXNB 1XNRB 4K0KB 4DR7B 3ZRSA 5IJ0B 4MW3A 4B3TO 1BHAA 5LHHA 4MVUA 4G28B 2P4KA 1SRYA 3D3IA 1PNMA 1F7YA 3M7MX 1N4CA 2CTPA 2LGQA 2H94A 4LF9B 3CXHF 4DV4B 1QBZA 1GM9A 4DV6B 4FM0A 2EINB 4UCSA 4DV1O 2F93B 3QO5A 5K1XA 1SERA 5B1NA 5LOVA 4KHPO 4HNAB 2Q73A 3OT7A 3SPHA 4UCUA 4DV0O 5DM6V 4LH6A 5L3CA 5L3BA 2HLDG 2YEVB 4PJ0Z 5KHHA 5IE9A 1W0JG 2OIGA 1XQ8A 4PI2A 3D8CA 3ZS8C 3E86A 4RAIA 2CAZC 1X59A 2DYSB 1BCCH 4UFZA 1K5SA 3JYCA 1FFXA 1MSDA 1YTFD 4AILC 5H6RA 1IDSA 4U7OA 1NT2B 2LFSA 3X2QB 1N34O 4OGQB 4DK0A 3FAVA 1EFRG 2PUSA 2HR3A 2P4VA 2PTMA 5JH7A 2OTJV 4O4LB 2M7WA 3OW2U 2YI9A 1MSWD 3UKMA 4ABMA 2PY5A 4MVSA 1XUQA 2A79B 1GN3A 3UT5B 4BWAA 3ASOB 1H38A 5B3SB 3CRRA 1VQ5V 2Y4TA 4JI7B 4JTCB 1NJIW 3QG5A 3ZHTA 1KBHA 4GX0A 2JRIA 1UJWB 1VQLV 1R6TA 4QIWF 4NXNO 4DR7O 1Q81W 4R7CA 4LF7O 3E2EA 3FB8C 5KHGA 4ZI7A 1IBLB 2YIBA 4QJFB 4GCZA 4YJ3A 1PV0A 5EIBD 1XHZA 2IU0A 1QVGU 1T5EA 5CA1A 5LBQA 2Q68A 5CA3A 4CH4A 3K59A 3QVNA 1NR7A 2LW1A 3HKDA 1FFTB 4C7UA 3W7WA 4HYOA 2PYJA 2LGWA 2D2CB 3G71V 1XHXA 4X1YB 3ZMUA 2P5OA 3K03A 2DJVA 1JA8A 1WB7A 4OXSA 1SQGA 2ZIMA 5KX5B 3HPLC 1M93A 2B5UA 2N05A 4IIJB 4RUFA 5LYJA 1N32B 4UXNA 3HKEB 1RPOA 4DV5O 2QWRB 2F66C 2YS8A 2PI5A 1ENVA 5HFMA 2BTOA 1KKCA 4PA7A 3OGIB 3B4SA 2ZD9A 1RSOB 1VQ8V 4LFAB 1IBKB 4J41A 3CYOA 1GK9A 4LH7A 2VWJA 2BSKB 3SYOA 2W6IG 4X20A 1H2MA 4ZHQA 2WPDG 1L0LH 2WLNA 4JYAO 5JVDA 5L3GA 2IJJA 1QCEA 4F6RB 2R9IA 3WB2A 5IWAB 4J80A 5CBGA 5JQGA 3ZEDA 1KC8W 1D5AA 5EYPA 1YJNV 3WFVA 4DUZO 4X1IA 4UCTA 1AI4A 2P7TC 3OR7C 1R3LC 4D7SA 2ZE7A 1ZAUA 3T4ZA 1TUEB 4ASUG 2DQ3A 3OUSA 3FB6C 3ZBHA 3E22A 1I0HA 4X64O 1XMOB 1E1RG 3SDLA 2A7WA 1XOUA 2H3OA 4R50A 4J9YB 4RO2A 5LA6A 3JALA 2CH7B 4J10A 4CC5A 2V1DA 1QR9A 4WFBV 1HNXB 4KL1A 3APOA 2QTOA 3T1YO 4JI3O 1S3JA 1AR4A 4GLXA 1WB8A 5IJ9A 1M5IA 4MVQA 3JSLA 3RYIA 5CB4A 2QTSA 4JYYA 5LMUB 4U7NA 1QVFU 5IYZA 1YJWV 2AW9A 4DRXA 1ZWIC 1R3JC 1VARA 1CPYA 3JASA 5J2UB 1Y74B 4LFAO 3OUFA 4FIPC 4O4HB 5B1BC 1KUQA 2F95B 2ITCC 4DR5B 2WLIA 4FLVA 4MSWC 2OCHA 3CPWU 3BFRA 1G6UA 3S3XA 4W4KA 4EB6A 3OEHG 3ASNC 4CH6A 1L0NH 1YHQV 3DSQA 3U10A 4LNUB 4EEQA 3CCJV 2B1IA 2FYUH 4JI2O 1H2LA 3FD9A 2FTKA 1SQXH 3LNMB 1KMIZ 1I5YA 3L75H 5FPRA 1H8HG 2Q0OC 3W7XA 3CMEV 1TVKB 3L9DA 1N36B 4X1KA 2YIAA 1WN7A 1NH2B 3OTFA 4MTGA 2YDEA 3E89A 1VEWA 5JJEB 2R72A 5A9GA 4FZ1A 5F2VO 2UUAO 2CTWA 4NTXA 2DMXA 2EBOA 3E8GA 2XAQA 3EVKA 3SYQA 3DC5A 2PZSA 1V55C 2QWQB 3AK2A 4PA4A 4LF8B 1HNXO 1FPOA 2IH1C 2EIKC 1NKDA 3R66A 4TV8B 2QA4V 1ZLZA 3KKYA 3FKSG 1Y4MA 3K06A 1BQZA 2Q8VA 1SQBH 2KG7A 1B04A 1GTOA 4J9ZB 2Q4PA 1ZL8A 1HNZB 1R3KC 1OCCC 2WWWA 4Q20A 4JI8O 1ZSPA 4PA9A 2IM9A 4UCVA 2OYQA 4LF5O 2YIDA 1B3QA 3ABKB 1K73W 4ZIBA 4RWUA 1VQNV 4X65O 2VWKA 3FYIB 5FPOA 3APQA 5KUKA 4LR3A 4O2BA 3RYFB 1K97A 2P90A 3RVZA 2HVKC 4O2AA 3HKCA 1VQ4V 1FXHA 3OM3B 2X6CA 2HKOA 3OEEG 5B66Z 5FL7G 1XMQB 1VF5B 3CJHA 3LSSA 3AG3C 2JGDA 2IJHA 4JTAB 4D6TH 1NTMH 4IYHA 2E5LB 1JOYA 2CGNA 4MVRA 3P3PA 3JSNA 4JI0B 3JCUZ 1PD3A 1EZVH 1FD9A 4HZ3A 2NLJC 5LL6Y 2ETNA 4GKKB 3QNEA 3CRCA 1JJOA 2UXDB 3KCXA 1S5HC 5KMGB 3AK3A 4H33A 3K9AA 4LF6B 1Y76B 4FK5C 4K35A 3AG2C 1H2GA 1SESA 3B8NA 2H8PC 3I55V 4B3TB 3DXRB 4CZZA 4LFCO 3A0HZ 4DR1O 4FLUA 4MTFA 5L3DA 4TV9A 2ILMA 4LC1A 4PA6A 1N0NA 4DV1B 1SETA 4KHPB 4HAMA 4QNHB 4ZOLB 4DV3O 4I50A 2WLJA 5BR8O 5GW7A 2XNDG 2ATKC 4I4TB 2ZQMA 3SYPA 3ZN1A 1TAEA 2IU3A 1GRJA 1TUBB 1Q3EA 2L6LA 2ZE8A 5B1BB 5HFLA 3VQXA 2VQFO 1N0JA 3BY6A 4JI1O 1MA1A 5KUMA 3W7UA 1SZTA 4O4JB 1JCHA 2M6YA 5BXZA 2HHHO 3CRMA 3F7VC 3WB0A 2UUCO 3QTCA 3E8BA 3JAWA 2JVDA 3RYHA 1N34B 1JFFA 1AJQA 3T2MA 2ZNIA 3MD0A 1I7FA 1U97A 3RWRD 1CP9A 2XHBA 5LGUA 3H1LH 1GN4A 4CH3A 2ADQB 5LXTB 1VMGA 4LWSB 3MDSA 1AR5A 2Q9LA 4JI0O 2HVJC 3L72H 4XDKA 3T1CA 5IYDO 3CCMV 3AK1A 4NVPA 1NH2D 4X89A 5CA0A 4FLWA 1IXMA 2YICA 2AHYA 1BE3H 3T1HO 4I55B 4PHZA 1SC5B 3CEIA 4BR6A 1Q82W 1TA8A 2G38A 2EULA 4P9OA 4RQEA 3CHXA 1V55B 5KAIZ 2AZ0A 2EIKB 2JDIG 4LF7B 2R9AA 2UXXA 2UXCO 4B3RB 4PDLA 5EZYA 1BL8A 4MVOA 1WLEA 4LCUC 3HKBB 2XAFA 3U11A 5KAFZ 4DUYO 2DN9A 2QWPB 2GTSA 1OCCB 2ARHA 2AXTZ 1E1QG 1DGSA 4G2KA 3W7TA 1GO3F 4IYIA 4E2LA 5LOVB 3G6BA 4O4IA 2QM7A 3VQWA 1Q6IA 4TQDA 2RN9A 2YI8A 3K5OA 4NTWA 3JATA 4DV5B 3G4SV 1Q7YW 4GZRB 2HJDA 2PF4E 3AG3B 3ZRWA 3RW0A 4B08A 1Z5VA 4FLXA 3OGCC 4FFBA 4UUJC 1FFXB 4D7TA 3CCLV 3PN1A 1PKXA 2P6JA 3CSXA 3FAVB 5GONB 4JYAB 1X4TA 3VQVA 2JS5A 4FVMA 4TOIA 1RPRA 3CB2A 4QE9A 5JH7B 1OZ0A 5LMNO 3D36A 1BZKA 4IL6Z 4Z1VA 4B7KA 5DEDA 3IAYA 2UUBB 1XEQA 3AG2B 1WNSA 4DUZB 2Q0AA 1K4CC 2LW7A 2B9ZA 3D3QA 3M8AA 1ZUQA 1AR1B 3E83A 2XAGA 2LP7A 4U3JA 2Z3YA 2JEXA 4XDLA 3UQ8A 1RM1C 3LSQA 1YXBA 3JCZA 4B3RO 4F4LA 5IYBO 1VQMV 3ZHVA 4X64B 4CH5A 3SJQC 4UVBA 1IURA 1K4DC 3CRQA 4K8XA 1SKVA 1MNGA 2YXHA 4I0XA 4I9WA 3N2GA 1LUWA 5KLVH 4ZI7B 3WB1A 3CS5A 1NBMG 4UB8Z 4YJ3B 3JD2A 1K9MW 2ZNJA 3WG7C 3K5MA 2HJFC 4EKWA 5LP6A 5CA1B 4PELA 3UO3A 4F6EA 1ROPA 3TGUH 3T1YB 4N23A 4JI3B 3OFNG 3HKDB 3STZC 4KXRA 1DF4A 3JD4A 1M57C 4L8JA 1VQ6V 2OWOA 4UV9A 1R3IC 1HWYA 4JZ2A 3CCEV 4JZGA 2EIMC 2EJ7A 2IBZH 2Q67A 2QSAA 5BMVA 4QPJA 4A5UB 3K3WA 2F23A 4QGPA 2ZXWC 5FNVA 2GSMB 4J11A 4PV1B 4CBCA 3C90A 4FLYA 1Z2GA 3JD3A 5C93A 4Q6GA 3UM7A 4X66O 3CE2A 1MG1A 4P2ZA 1AI7A 3IC7A 2ZR2A 2UUBO 2VS0A 2FKXA 3JARA 4X20B 4I9QA 4JI2B 4B3SB 5JWPA 3S3WA 4ZHQB 2JEUA 2Y0IA 3ZN0A 3CP1A 5JVDB 5E1AC 4WCEV 1TGOA 1LR1A 1N8RW 4H44B 1VF6A 1V9PA 1LNQA 2VQEO 5JQGB 4JTDB 1PPJH 5EYPB 2CUGA 4AHCA 3FX7A 4X1IB 3ABMC 1P84F 2UUAB 2ZM6O 2Q7GA 4WBNA 4JI5O 1YDXA 5H6QA 2WLLA 4BIOA 1XL4A 2AHZA 2QWOB 4YY3O 5CBFA 2CDYA 3K9SA 4X62B 3E22B 2ZKOA 1YJ9V 4PDVA 4PD4F 2C2AA 2MK3A 1R6NA 4YHHB 4GT1A 3JALB 1AILA 3CRAA 2X7RB 2L35A 2FMLA 4GUNA 1OJHA 1QLEC 4YIOA 1PP9H 2MW2B 1THZA 2KB1A 1WJZA 1SA0A 2CGOA 3ABUA 1FXKA 5DN6G 3OR6C 4H0LB 4EFBA 4J42A 2F1MA 4JI8B 2E76B 4JI4O 1VQ9V 1MOFA 5IJ9B 3TETA 4LF5B 4UVAA 1SF9A 3RYIB 1HDJA 3ZMZA 4X65B 1G1XB 5CB4B 1AROP 1OCZC 3IGAC 1F4NA 3BCCH 3RN4A 2ADPA 1QLNA 4YXWG 1EN6A 1KP3A 2QJ1A 2Y69C 1FKAO 3K0DA 4PDMA 1WPXA 4ZBMA 3JASB 5AG2A 2ZCEA 4AQYB 2BTQA 1O9GA 1HR0O 2OCCC 1NS1A 2WLIB 3CC4V 4B3SO 1R6KA 3OE7G 1H8EG 3ZJZA 2DQ0A 5LHIA 4EB6B 3PJSK 4J7ZA 3N2KA 2QDOA 5A2QN 1XILA 2XAHA 1EM1A 2B1GA 1U96A 2LQTA 5LGNA 3E8HA 3A0RA 4DYLA 2QEXV 1GN2A 4LFBO 2P06A 1F51A 1IBMO
chains in the Genus database with same CATH topology
2WLJA 5GW7A 3ABKC 4U7OA 2XNDG 1PL0A 2LFSA 3X2QB 2ATKC 4QPKA 3K04A 1FS0G 1PNLA 2ZQMA 1EFRG 3SYPA 3WG7B 3ZN1A 3LDCA 4GX5A 2IU3A 2HR3A 4MS2A 5B1BB 5HFLA 2OTJV 2BOBC 2M7WA 3BY6A 1OCOC 4WFAV 2UXNA 5KUMA 4R6ZA 3W7UA 1SZTA 5CMUA 3OW2U 1MSWD 3UKMA 4MVSA 1G4YB 1JCHA 2A79B 1M57B 4JPRA 3ASOB 1H38A 3F7VC 1YSCA 5B3SB 1M56B 3ZRXA 3E8BA 4BW5A 2X6AA 1VQ5V 1FXVA 2EIMB 4JTCB 3R65A 1AJQA 3T2MA 1NJIW 3T4DA 3MD0A 4LBEC 4GX0A 4R8CA 2DW4A 1UJWB 5IYCO 2ZXWB 1CP9A 1S76D 1VQLV 1GM7A 3W7SA 5LGUA 5IY5B 4QIWF 3FYEB 1NVPD 3IFXA 1KP2A 1Q81W 4WFHA 2EZPA 3ZMSA 2WLLB 4TT3G 1JJ2U 5LGTA 2JIZG 4R7CA 2HVJC 4UV8A 4JYCA 3E2EA 3FB8C 4MVMA 4XDKA 3T1CA 5IYDO 1NQTA 3CCMV 3SPJA 1NH2D 4X89A 4MT8A 3JD0A 4QJFB 4MTOA 2IH3C 1IXMA 4GCZA 1I5XA 4I5SA 3SYAA 2AHYA 1AJPA 2IU0A 1YITV 1QVGU 2EJRA 3AG4C 2EILC 5LBQA 2EIJC 2Q68A 5CA3A 1Q82W 3ETEA 4KUMA 2HFEC 3OMNB 1NR7A 3P30A 1FFTB 4P9OA 4RQEA 3W7WA 4FMTA 1V55B 5BZBA 4HYOA 3G71V 4XBFA 2EIKB 1MABG 2JDIG 3ZMUA 2UXXA 3SPIA 1FXKB 1K7DA 4N21A 3X2QC 3ABMB 3K03A 2DWEC 4PDLA 2K1EA 4OXSA 1BL8A 4MVOA 5IDJA 1GKFA 1JX9A 2YSUB 2W0FC 3HPLC 1WLEA 4WF9V 2B5UA 4LCUC 4RUFA 3NXSA 2XAFA 4UXNA 1P7BA 3CCQV 1RM1B 1K92A 1RPOA 3OMIB 2JJ1G 4JASA 1OCCB 3DTUB 1E1QG 2PI5A 1ENVA 4G2KA 5HFMA 2WLMA 1BMFG 4GX2A 4PA7A 3W7TA 1GO3F 2V7QG 4E2LA 1V54C 4DXWA 3OMAB 2ZD9A 1F4MA 5KA5A 1VQ8V 3TCUA 5EBWC 3CYOA 4BIUA 1GK9A 3SYOA 2QM7A 4H37A 5J9PC 2W6IG 3P32A 1QLEB 3MHHC 3CCVV 5B1AC 1XL6A 3RVYA 2WPDG 1PNKA 3CC2V 2WLNA 3ETGA 5L3GA 3G4SV 1Q7YW 3ZMVA 5CBHA 2IW5A 1DLBA 5L3FA 1B6QA 1GMGA 5EBMC 2IJJA 1QCEA 2R9IA 3AG3B 3ZRWA 1KD1W 3RW0A 5CBGA 1OCRC 1KC8W 1E79G 2ZR3A 3OGCC 4UUJC 1YJNV 3WFVA 2NNUA 3SPGA 5L3EA 3CCLV 3F7YC 1PKXA 1AI4A 1OCZB 3AG1C 2P7TC 3OR7C 1M9NA 2P6JA 3ASNB 1VQKV 1R3LC 3K79A 3T4ZA 3EHBB 2Y69B 1J95A 1YI2V 1BHBA 1TUEB 3CXCU 4ASUG 2PI4A 2F43G 2DQ3A 3OUSA 1VQ7V 3FB6C 1RPRA 4JAVA 3VBBA 1S77D 4QE9A 1OZ0A 1NR1A 3D36A 2DYRB 2OCCB 4JF3A 2GHYA 1E1RG 3ZCCA 1DF5A 2ZDIC 1CEZA 4FJCC 3AG2B 5CN0A 4R50A 4J9YB 4RO2A 3AEIA 1K4CC 4QE7A 3B8MA 2EINC 1R73A 3ABLB 2IJKA 1AR1B 3E83A 2XAGA 3STLC 2V1DA 3B77A 3OAAG 1QR9A 4UVCA 2LP7A 2Z3YA 2JEXA 4KP4A 4XDLA 1RM1C 4WFBV 3LSQA 3JD1A 4LP8A 3JCZA 4X88A 4F4LA 4G27B 5IYBO 1K33A 4BAYA 1VQMV 2WSSG 2QTOA 3F5WC 3I56V 1S3JA 2A9HA 3SJQC 1YTFB 1K3EA 3FB5C 4UVBA 5EC1C 1K4DC 2DYSC 3KG2A 4MVQA 1EBOA 3GB7C 4I9WA 2ITDC 4U7NA 1DTOA 1OCOB 1QVFU 1NBMG 4DO2A 1YJWV 3JD2A 1EZJA 1ZWIC 2ZDIA 2R9RB 1K9MW 1R3JC 3WG7C 1CPYA 2HG5C 2HJFC 4EKWA 1F23A 2DWDC 3H01A 3OUFA 4PELA 4FIPC 5B1BC 1ROPA 3CCUV 3SPCA 4P9PA 4N23A 2ITCC 5EC2C 2WLIA 4MSWC 3CPWU 3OFNG 3STZC 1DF4A 4BIZA 3E8FA 3JD4A 4XDJA 1M57C 3ASOC 2YEVA 4JAUA 3OEHG 3ASNC 1VQ6V 5B3SC 4JGSA 4UV9A 1M56C 1R3IC 1L1FA 1HWYA 3CMAV 3CCEV 2EIMC 2Q67A 1YHQV 4QPJA 1JPXA 4P30A 3K3WA 4JYBA 3ZRVA 3CCJV 2B1IA 3QO7A 2D3OW 1ORQC 2FTKA 3ABTA 2ZXWC 2LFRA 3LNMB 2GSMB 2Y48A 4CBCA 1I5YA 4PA3A 2XAJA 3SYCA 2X0LA 5IY5C 1S72V 3JD3A 5C93A 3UM7A 1H8HG 5EK0A 3CMEV 3W7XA 3ML0A 1YIJV 2JK5C 3ZIAG 1NH2B 1MG1A 4P2ZA 3AG4B 2EILB 3DGEA 4MTGA 2EIJB 1AI7A 3IC7A 3E89A 2ZR2A 3K0GA 4RQFA 1M90W 1VQPV 2W6JG 4MVZA 3ZMTA 2JEUA 1Q86W 3E35A 3GWOA 2EBOA 2QKSA 3ZN0A 3CP1A 3E8GA 2XAQA 1P4RA 3SYQA 1AI6A 5E1AC 1KKDA 4WCEV 4TWKA 3BEHA 3VOUA 4RUEA 1N8RW 1G8MA 2P67A 3ZRWB 1V55C 4PA4A 1LNQA 3LDDA 2IH1C 4JTDB 2EIKC 1NKDA 2XASA 1FXKC 4WFFA 2QA4V 3ABMC 4X8AA 4Z1MG 3HB3B 2OT5A 3FKSG 1Y4MA 3K06A 1QR8A 5H6QA 1GM8A 2CK3G 3TK1A 1K8AW 2WLLA 1GTOA 4TSFG 4J9ZB 1XL4A 2AHZA 1V54B 4ZKIA 3EFFK 3K08A 5CBFA 1OHHG 1K5QA 5H9CA 1R3KC 4GX1A 2JJ2G 2QM8A 1OCCC 2IJIA 2WWWA 4Q20A 1YJ9V 4PDVA 2EZOA 4PA9A 2C2AA 2MK3A 5B1AB 3LUTB 1JQ0A 1R6NA 2WLKA 2Q69A 1KECA 4GT1A 2OTLV 3CC7V 3ABKB 1K73W 2WAMA 4WFEA 3RBZA 1VQNV 2X7RB 3FYIB 5KUKA 5LHGA 1AI5A 1S0VA 1QLEC 1K97A 2X6BA 1OCRB 1THZA 2P90A 2KB1A 3RVZA 3CD6V 3G6EV 2HVKC 1K34A 1VQ4V 3ABUA 1FXKA 1FXHA 4FPPA 5DN6G 3OR6C 2Z5UA 3OM3B 2X6CA 2WLHA 2HKOA 3OEEG 4WFGA 5FL7G 1AJNA 3AG1B 1COWG 3LSSA 3AG3C 2QE7G 1VQ9V 1VQOV 1MOFA 3QO8A 2IJHA 4JTAB 5B1OA 3FB7C 3TETA 4UVAA 4L87A 5EBLC 3ZRSA 4MW3A 3ZMZA 1BHAA 5LHHA 1JOYA 4MVUA 1AROP 4MVRA 4G28B 1SRYA 3D3IA 1OCZC 1M1KW 3IGAC 1F4NA 1PNMA 1PD3A 1QLNA 1JVMA 4YXWG 1KP3A 2H94A 2Y69C 4HZ3A 2NLJC 3K0DA 1W2BU 4PDMA 1WPXA 3QNEA 1QBZA 4ZBMA 1GM9A 3CCRV 2EINB 1S5HC 3M99B 3QO5A 1SERA 3ETDA 2DYRC 5B1NA 2OCCC 3MHSC 4H33A 3SPHA 2WLIB 4MW8A 2BOCC 4KFMA 3K9AA 3CC4V 1NVPB 1R6KA 5DM6V 3OE7G 1H8EG 4FK5C 3ZJZA 3AG2C 1W0KG 5L3CA 1H2GA 1SESA 3B8NA 5L3BA 5KA6A 2HLDG 2DQ0A 2H8PC 3I55V 5LHIA 1KQSU 2YEVB 3PJSK 2A0LA 3ABLC 1Y66A 3LDEA 4MTXA 1W0JG 4CZZA 2XAHA 4MTFA 5L3DA 3E86A 4RAIA 4LC1A 2B1GA 4PA6A 3CCSV 2XOKG 2DYSB 5LGNA 3E8HA 1K5SA 1SETA 3A0RA 3JYCA 2QEXV 4HAMA 1YTFD 2Q6AA 4QNHB 4PDRA 1F51A 5H6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DF4 A;  3B8N A;  3P30 A;  5KA6 A;  2EBO A;  2EZP A;  3CP1 A;  3B77 A;  1QR9 A;  4FK5 C;  2LP7 A;  1Y66 A;  4JGS A;  1ENV A;  1DLB A;  5H9C A;  4G2K A;  1K34 A;  1MG1 A;  5HFM A;  4N21 A;  1QCE A;  5HFL A;  1I5X A;  1QBZ A;  4E2L A;  2M7W A;  1K33 A;  1JPX A;  2EZO A;  1F23 A;  4JF3 A;  5KA5 A;  3H01 A;  1DF5 A;  2MK3 A;  1SZT A;  1JQ0 A;  3CYO A;  3M99 B;  4FJC C;  4FIP C;  5CMU A;  5CN0 A;  3WFV A;  3MHS C;  1MOF A;  3GWO A;  4N23 A;  3K9A A;  2OT5 A;  2X7R B;  3B8M A;  3MHH C;  4JPR A;  1Y4M A;  1QR8 A;  1I5Y A;  1EBO A;  2P6J A; 
#chains in the Genus database with same CATH topology
 2GV9 A;  2YXY A;  4X1K B;  4QPK A;  1FS0 G;  1PNL A;  4JI6 O;  2YC0 A;  3WG7 B;  3B40 A;  3LDC A;  2YIB D;  4NB5 A;  4MS2 A;  4X62 O;  4LFC B;  2BOB C;  4DR1 B;  1OCO C;  4IHJ A;  2UXN A;  3BA9 A;  4R6Z A;  4YHH O;  1Q90 D;  2KQX A;  1G4Y B;  1M57 B;  2GBO A;  2KKW A;  3AG7 A;  4DV3 B;  4DV2 O;  5BR8 B;  1D2D A;  2EIM B;  4NR1 A;  3T4D A;  4LBE C;  1FAF A;  1BGY H;  4R8C A;  2DW4 A;  2VQF B;  5IYC O;  2ZXW B;  3TJT A;  1S76 D;  1Q8I A;  4JI1 B;  1GM7 A;  4DR4 O;  1BS3 A;  1NVP D;  3IFX A;  1KP2 A;  2HHH B;  5JJN B;  2KG7 B;  4OX9 O;  1UFI A;  2DE0 X;  2EZP A;  3ZMS A;  2UUC B;  1JJ2 U;  1SQF A;  2JIZ G;  1ZL8 B;  3K58 A;  4MVM A;  4B7E A;  2LJ2 A;  1NQT A;  4MT8 A;  3JD0 A;  2IH3 C;  4I5S A;  4NYK A;  2QWN B;  1AJP A;  4AQY O;  3AG4 C;  2EIL C;  2YUA A;  1D5N A;  5GTH Z;  5J2T A;  3ETE A;  4KUM A;  2HFE C;  1I94 B;  3OMN B;  4IGG A;  4O2B B;  4FMT A;  4XBF A;  1MAB G;  4O2A B;  3HKC B;  4DR2 B;  4DR3 B;  3X2Q C;  3ABM B;  2ZE6 A;  2K1E A;  1N33 O;  3CJH B;  2GTA A;  5IDJ A;  2JGD B;  3T1H B;  1Z5W A;  2JS3 A;  1JX9 A;  4WF9 V;  3BVO A;  2RQ6 A;  3Q4H A;  3OMI B;  2NR5 A;  4FFK A;  3G80 A;  3JAK A;  2GDS A;  3DTU B;  1NTZ H;  1Y67 A;  1NTK H;  1WAZ A;  3O9O A;  4UCR A;  2WLM A;  1BMF G;  3RT3 C;  2UXC B;  4GX2 A;  2F4V O;  2V7Q G;  1V54 C;  4DXW A;  2WA4 A;  1F4M A;  1YEW A;  2RJZ A;  5EBW C;  3D36 C;  1IVS A;  4BIU A;  3H1J H;  4BW9 A;  4H37 A;  5J9P C;  5C8Y A;  1QLE B;  5B1A C;  1KU9 A;  2CTQ A;  3RVY A;  4DUY B;  2ZIN A;  4E4E A;  4DR6 O;  4TQF A;  4DK1 A;  3ZMV A;  5CBH A;  2Q5Z A;  1B6Q A;  5EBM C;  1KD1 W;  2R70 A;  4TV9 B;  3SGI A;  1E79 G;  2ZR3 A;  1PM9 A;  2OIE A;  3K5L A;  1S5L Z;  3F7Y C;  1Q6H A;  1OCZ B;  3AG1 C;  4I50 B;  4YJ2 A;  1M9N A;  3ASN B;  4DW0 A;  2LO1 A;  3FFQ A;  2Y69 B;  1YI2 V;  1BHB A;  4NXM O;  3CXC U;  2GUZ A;  1S77 D;  1H2K A;  2OCC B;  4JF3 A;  1WA8 A;  3ZCC A;  1DF5 A;  3BAA A;  1CEZ A;  2CE4 A;  4FJC C;  4EFE A;  3H1K H;  5ITZ A;  1W59 A;  3AEI A;  1YVW A;  5LP6 C;  1I94 O;  1R73 A;  1Q6U A;  3RYC A;  2VRZ A;  3BHP A;  2IJK A;  3KZI Z;  4DV7 O;  3JAW B;  3B77 A;  2P22 C;  3N27 A;  5D5P A;  3STL C;  3RYH B;  1JFF B;  1H2N A;  4KP4 A;  4PI0 A;  4TUY A;  3JD1 A;  4DR3 O;  4DR2 O;  4LP8 A;  3BPZ A;  2FB5 A;  1B06 A;  5LMN B;  4JV5 B;  1A32 A;  4G27 B;  1K33 A;  2WSS G;  1YF2 A;  2UU9 O;  3F5W C;  3I56 V;  2K9P A;  2A9H A;  1K3E A;  3FB5 C;  5EC1 C;  3KG2 A;  5H2F Z;  1FYJ A;  4UB6 Z;  4CS4 A;  3GB7 C;  3TXS A;  5IJ0 A;  2ITD C;  1HNW O;  1DTO A;  1OCO B;  5CA0 B;  2WA3 A;  1EZJ A;  1Y6X A;  2QKC A;  2R9R B;  2ZDI A;  4J7K A;  2HG5 C;  3CX5 F;  1XNQ B;  2DWD C;  1BT8 A;  5K1P A;  4H13 B;  4FLZ A;  3CCU V;  3SPC A;  1US6 A;  4HNA A;  5EC2 C;  2HEP A;  3HKB A;  3EXA A;  4LF4 O;  1GN6 A;  2YEV A;  4JAU A;  3BRC A;  1P7G A;  1M56 C;  1J5E O;  1KYO F;  5EZY B;  1I08 A;  4P30 A;  1VF6 C;  2D3O W;  1FJG O;  1WPB A;  2LFR A;  4B3M O;  2Y48 A;  3VQY A;  3C3T A;  4PA3 A;  2XAJ A;  5DEC A;  2X0L A;  3SYC A;  5IY5 C;  1S72 V;  5EK0 A;  2NN4 A;  2JK5 C;  2PYL A;  3ZIA G;  3AG4 B;  2EIL B;  3DGE A;  5D5Q A;  4O4L A;  3K0G A;  1XRE A;  4O4I B;  5E79 Z;  1VQP V;  3QF7 A;  4W4L A;  3ZMT A;  1Q86 W;  5KHI A;  3UT5 A;  2A3Q A;  3E35 A;  3JAT B;  2Y0P A;  3TXQ A;  1UPG A;  1P4R A;  4J7J A;  5GON A;  1O9H A;  4X66 B;  4TWK A;  5JCO A;  1Q5O A;  1G8M A;  1NU1 H;  2P67 A;  3ZRW B;  3I5D A;  5GTI Z;  3C3S A;  4JV5 O;  3LDD A;  1XI1 A;  1FXK C;  4FFB B;  1OV9 A;  4WFF A;  4OPH A;  1AP6 A;  2UXB O;  2YXL A;  5FLX N;  2OT5 A;  4GKJ O;  1QR8 A;  1AP5 A;  1EN5 A;  2E74 B;  1M4U A;  4HBN A;  1V54 B;  4ZKI A;  3K08 A;  1K5Q A;  5H9C A;  4GX1 A;  1YZB A;  2VQE B;  1XNQ O;  2XT9 A;  5B1A B;  2WLK A;  1KEC A;  4DW1 A;  3CC7 V;  1XNR O;  4K0K O;  2ZM6 B;  2WAM A;  4WFE A;  3RBZ A;  3LNN A;  2O57 A;  4JI5 B;  5LHG A;  1AI5 A;  4U3J B;  1S0V A;  1QU7 A;  4YY3 B;  4X1Y A;  4LF9 O;  1K34 A;  4DV4 O;  4FPP A;  4DV6 O;  3AG1 B;  1COW G;  1AVM A;  1MMM A;  5KX5 A;  5EBL C;  4IIJ A;  4I0X B;  3N2G B;  2XUM A;  3HKE A;  1M1K W;  3LSU A;  1JVM A;  1W2B U;  5LP6 B;  3CCR V;  3IC9 A;  3M99 B;  1RSO A;  1XDC A;  3ETD A;  2DYR C;  3DC6 A;  3MHS C;  1NZ6 A;  2QGN A;  1IZ3 A;  4JI4 B;  2KSD A;  2BOC C;  4KFM A;  4MW8 A;  2BSK A;  1NVP B;  5LYJ B;  1W0K G;  3F5T A;  2V4D A;  5KA6 A;  4CS3 A;  4GYC B;  1KQS U;  2A0L A;  3P3N A;  3ABL C;  1Y66 A;  3LDE A;  4MTX A;  1BQ0 A;  3SJC C;  4F6R A;  5BMV B;  3B09 A;  3CCS V;  2XOK G;  4X9Q A;  3ICX A;  1HR0 B;  3G67 A;  5FNV B;  2Q6A A;  4PDR A;  1SQQ H;  3ABK C;  2BE3 A;  1PL0 A;  3NR7 A;  4JI7 O;  3K04 A;  1QHT A;  4GX5 A;  2RCV A;  4WFA V;  4OPA A;  5CMU A;  3JAR B;  3SR2 C;  4JPR A;  4LFB B;  5TIS Z;  1EN4 A;  1VIB A;  1YSC A;  2CH7 A;  3U0Z A;  1M56 B;  3ZRX A;  4BW5 A;  1IBM B;  2X6A A;  1FXV A;  2FL4 A;  3CWB H;  1MZF A;  3R65 A;  2Y4U A;  3L70 H;  1IBL O;  4JI6 B;  1SQV H;  2RNB A;  2QM4 A;  1Q43 A;  2W0X A;  4NTY A;  3W7S A;  3OTO B;  5IY5 B;  3O65 A;  4WBN B;  1ZTE A;  3FYE B;  1MZE A;  4ICG A;  5LA6 B;  3RFR A;  4WFH A;  2WLL B;  4TT3 G;  4DV2 B;  5LGT A;  3ZHQ A;  4UV8 A;  4JYC A;  3SPJ A;  4MTO A;  1I5X A;  3SYA A;  1R1B A;  5J2U A;  1Y74 A;  3A8T A;  1YIT V;  2EJR A;  2EIJ C;  1IX9 A;  4O4H A;  5EIB C;  4DR4 B;  1WP7 A;  3J7A U;  1N32 O;  3ZHR A;  3KCY A;  3P30 A;  1AB3 A;  4OX9 B;  5BZB A;  2N74 A;  1SA0 B;  3SPI A;  1FXK B;  5IYZ B;  1K7D A;  4N21 A;  3ZHS A;  4DRX B;  2DWE C;  2DOS A;  1IBK O;  1GKF A;  3L74 H;  4LNU A;  2HP8 A;  2YSU B;  2W0F C;  3JAM N;  3NXS A;  1H2S B;  3GVM A;  1P7B A;  3CCQ V;  1RM1 B;  1K92 A;  2JJ1 G;  4JAS A;  1TVK A;  4CS2 A;  1HP8 A;  4I7Z B;  5IWA O;  2BTQ B;  3OMA B;  5KA5 A;  1N33 B;  3TCU A;  3P32 A;  3SJB C;  3MHH C;  3OD4 A;  3CCV V;  3IJ4 A;  1XL6 A;  3CC2 V;  4K8Z A;  1PNK A;  1RFY A;  3N2K B;  3ETG A;  2IW5 A;  1DLB A;  5L3F A;  1GMG A;  2E3C A;  2F4V B;  2E75 B;  1WP8 A;  1XMO O;  1OCR C;  1L8D A;  2JGU A;  2NNU A;  4AI8 A;  3OTO O;  4TV8 A;  3MAQ A;  3SPG A;  5L3E A;  1CXZ B;  1IXB A;  1VQK V;  3K79 A;  3J80 N;  3EHB B;  1J95 A;  1PL4 A;  1SZX A;  2EX3 A;  2PI4 A;  2F43 G;  4U3F H;  4DR6 B;  1VQ7 V;  4JAV A;  3B2E E;  3VBB A;  1NR1 A;  1QQC A;  2DYR B;  4IHJ B;  1VF7 A;  2GHY A;  2ZDI C;  4CC6 A;  5CN0 A;  4FLT A;  4QE7 A;  3B8M A;  2EIN C;  5JJJ B;  3ABL B;  3J81 N;  2BCC H;  5KHK A;  3OAA G;  4UVC A;  5LMU O;  3RYF A;  2XTA A;  4NXM B;  1JR9 A;  4X88 A;  1XBL A;  4BAY A;  3ZX6 A;  5IT9 N;  4DR5 O;  1YTF B;  4JAA A;  3RGB A;  2DYS C;  5KHJ A;  1EBO A;  4DV7 B;  1P49 A;  3THO A;  2N04 A;  3UCS C;  4DO2 A;  1GAX A;  2Z0A A;  3A0B Z;  1NI8 A;  1SQP H;  1F23 A;  4FM2 A;  3H01 A;  2UU9 B;  5KMG A;  2Q7H A;  5J2T B;  4P9P A;  1RP3 B;  1Y76 A;  3H1H H;  3BAB A;  2ZT9 B;  1VP7 A;  1N36 O;  4BIZ A;  3E8F A;  4XDJ A;  3ASO C;  1ZX3 A;  3DXR A;  5B3S C;  4JGS A;  1HNW B;  1L1F A;  3CMA V;  1HW7 A;  2PGG A;  3BA8 A;  2QKA A;  5JCO C;  4YIP A;  1JPX A;  4IT5 A;  2ZIO A;  4JYB A;  2AGA A;  3ZRV A;  3QO7 A;  2AZ2 A;  1KB9 F;  1ORQ C;  3ABT A;  4NKG B;  4FZ0 A;  4ZOL A;  3Q4H B;  2ODM A;  3UO2 A;  3JAK B;  4LF4 B;  3ML0 A;  1YIJ V;  5BY1 A;  4I4T A;  4UCO A;  4LF8 O;  1TUB A;  1J5E B;  2EIJ B;  4RQF A;  1M90 W;  2W6J G;  4MVZ A;  5C8Y B;  1FJG B;  4O4J A;  2Q7E A;  4DV0 B;  2CTR A;  3ETQ A;  4B3M B;  3GWO A;  3K5N A;  2QKS A;  1AI6 A;  4FM1 A;  2RDC A;  1HNZ O;  1KKD A;  3BEH A;  3VOU A;  4RUE A;  4K3A A;  1BSM A;  2XAS A;  2ZE5 A;  3SJA C;  4X8A A;  4Z1M G;  3HB3 B;  4YJ2 B;  1GM8 A;  5LXT A;  2CK3 G;  3TK1 A;  1K8A W;  4LWS A;  1S5J A;  3H9V A;  4TSF G;  3H1I H;  3EFF K;  1DK1 A;  2GUZ B;  1OHH G;  1LUV A;  2JJ2 G;  2QM8 A;  2IJI A;  3HR0 A;  2QR4 A;  1XMQ O;  1WA8 B;  1JMK C;  3GWK C;  3L73 H;  2EZO A;  5H5N A;  3LUT B;  1JQ0 A;  4I55 A;  5ITZ B;  1SS3 A;  2A06 H;  2Q69 A;  2OTL V;  2UXB B;  3RYC B;  3L71 H;  2E5L O;  4GKJ B;  2X6B A;  1OCR B;  1YCI A;  4TUY B;  3CD6 V;  3G6E V;  4Z2W A;  4GKK O;  2Z5U A;  1GH6 A;  2WLH A;  2UXD O;  1QNM A;  2RMK B;  4WFG A;  1URF A;  3WU2 Z;  1AJN A;  3ZHU A;  2QE7 G;  1VQO V;  5B1O A;  3QO8 A;  4LF6 O;  3FB7 C;  3K57 A;  3A2F A;  4L87 A;  5B5E Z;  4NXN B;  1XNR B;  4K0K B;  4DR7 B;  3ZRS A;  5IJ0 B;  4MW3 A;  4B3T O;  1BHA A;  5LHH A;  4MVU A;  4G28 B;  2P4K A;  1SRY A;  3D3I A;  1PNM A;  1F7Y A;  3M7M X;  1N4C A;  2CTP A;  2LGQ A;  2H94 A;  4LF9 B;  3CXH F;  4DV4 B;  1QBZ A;  1GM9 A;  4DV6 B;  4FM0 A;  2EIN B;  4UCS A;  4DV1 O;  2F93 B;  3QO5 A;  5K1X A;  1SER A;  5B1N A;  5LOV A;  4KHP O;  4HNA B;  2Q73 A;  3OT7 A;  3SPH A;  4UCU A;  4DV0 O;  5DM6 V;  4LH6 A;  5L3C A;  5L3B A;  2HLD G;  2YEV B;  4PJ0 Z;  5KHH A;  5IE9 A;  1W0J G;  2OIG A;  1XQ8 A;  4PI2 A;  3D8C A;  3ZS8 C;  3E86 A;  4RAI A;  2CAZ C;  1X59 A;  2DYS B;  1BCC H;  4UFZ A;  1K5S A;  3JYC A;  1FFX A;  1MSD A;  1YTF D;  4AIL C;  5H6R A;  1IDS A;  4U7O A;  1NT2 B;  2LFS A;  3X2Q B;  1N34 O;  4OGQ B;  4DK0 A;  3FAV A;  1EFR G;  2PUS A;  2HR3 A;  2P4V A;  2PTM A;  5JH7 A;  2OTJ V;  4O4L B;  2M7W A;  3OW2 U;  2YI9 A;  1MSW D;  3UKM A;  4ABM A;  2PY5 A;  4MVS A;  1XUQ A;  2A79 B;  1GN3 A;  3UT5 B;  4BWA A;  3ASO B;  1H38 A;  5B3S B;  3CRR A;  1VQ5 V;  2Y4T A;  4JI7 B;  4JTC B;  1NJI W;  3QG5 A;  3ZHT A;  1KBH A;  4GX0 A;  2JRI A;  1UJW B;  1VQL V;  1R6T A;  4QIW F;  4NXN O;  4DR7 O;  1Q81 W;  4R7C A;  4LF7 O;  3E2E A;  3FB8 C;  5KHG A;  4ZI7 A;  1IBL B;  2YIB A;  4QJF B;  4GCZ A;  4YJ3 A;  1PV0 A;  5EIB D;  1XHZ A;  2IU0 A;  1QVG U;  1T5E A;  5CA1 A;  5LBQ A;  2Q68 A;  5CA3 A;  4CH4 A;  3K59 A;  3QVN A;  1NR7 A;  2LW1 A;  3HKD A;  1FFT B;  4C7U A;  3W7W A;  4HYO A;  2PYJ A;  2LGW A;  2D2C B;  3G71 V;  1XHX A;  4X1Y B;  3ZMU A;  2P5O A;  3K03 A;  2DJV A;  1JA8 A;  1WB7 A;  4OXS A;  1SQG A;  2ZIM A;  5KX5 B;  3HPL C;  1M93 A;  2B5U A;  2N05 A;  4IIJ B;  4RUF A;  5LYJ A;  1N32 B;  4UXN A;  3HKE B;  1RPO A;  4DV5 O;  2QWR B;  2F66 C;  2YS8 A;  2PI5 A;  1ENV A;  5HFM A;  2BTO A;  1KKC A;  4PA7 A;  3OGI B;  3B4S A;  2ZD9 A;  1RSO B;  1VQ8 V;  4LFA B;  1IBK B;  4J41 A;  3CYO A;  1GK9 A;  4LH7 A;  2VWJ A;  2BSK B;  3SYO A;  2W6I G;  4X20 A;  1H2M A;  4ZHQ A;  2WPD G;  1L0L H;  2WLN A;  4JYA O;  5JVD A;  5L3G A;  2IJJ A;  1QCE A;  4F6R B;  2R9I A;  3WB2 A;  5IWA B;  4J80 A;  5CBG A;  5JQG A;  3ZED A;  1KC8 W;  1D5A A;  5EYP A;  1YJN V;  3WFV A;  4DUZ O;  4X1I A;  4UCT A;  1AI4 A;  2P7T C;  3OR7 C;  1R3L C;  4D7S A;  2ZE7 A;  1ZAU A;  3T4Z A;  1TUE B;  4ASU G;  2DQ3 A;  3OUS A;  3FB6 C;  3ZBH A;  3E22 A;  1I0H A;  4X64 O;  1XMO B;  1E1R G;  3SDL A;  2A7W A;  1XOU A;  2H3O A;  4R50 A;  4J9Y B;  4RO2 A;  5LA6 A;  3JAL A;  2CH7 B;  4J10 A;  4CC5 A;  2V1D A;  1QR9 A;  4WFB V;  1HNX B;  4KL1 A;  3APO A;  2QTO A;  3T1Y O;  4JI3 O;  1S3J A;  1AR4 A;  4GLX A;  1WB8 A;  5IJ9 A;  1M5I A;  4MVQ A;  3JSL A;  3RYI A;  5CB4 A;  2QTS A;  4JYY A;  5LMU B;  4U7N A;  1QVF U;  5IYZ A;  1YJW V;  2AW9 A;  4DRX A;  1ZWI C;  1R3J C;  1VAR A;  1CPY A;  3JAS A;  5J2U B;  1Y74 B;  4LFA O;  3OUF A;  4FIP C;  4O4H B;  5B1B C;  1KUQ A;  2F95 B;  2ITC C;  4DR5 B;  2WLI A;  4FLV A;  4MSW C;  2OCH A;  3CPW U;  3BFR A;  1G6U A;  3S3X A;  4W4K A;  4EB6 A;  3OEH G;  3ASN C;  4CH6 A;  1L0N H;  1YHQ V;  3DSQ A;  3U10 A;  4LNU B;  4EEQ A;  3CCJ V;  2B1I A;  2FYU H;  4JI2 O;  1H2L A;  3FD9 A;  2FTK A;  1SQX H;  3LNM B;  1KMI Z;  1I5Y A;  3L75 H;  5FPR A;  1H8H G;  2Q0O C;  3W7X A;  3CME V;  1TVK B;  3L9D A;  1N36 B;  4X1K A;  2YIA A;  1WN7 A;  1NH2 B;  3OTF A;  4MTG A;  2YDE A;  3E89 A;  1VEW A;  5JJE B;  2R72 A;  5A9G A;  4FZ1 A;  5F2V O;  2UUA O;  2CTW A;  4NTX A;  2DMX A;  2EBO A;  3E8G A;  2XAQ A;  3EVK A;  3SYQ A;  3DC5 A;  2PZS A;  1V55 C;  2QWQ B;  3AK2 A;  4PA4 A;  4LF8 B;  1HNX O;  1FPO A;  2IH1 C;  2EIK C;  1NKD A;  3R66 A;  4TV8 B;  2QA4 V;  1ZLZ A;  3KKY A;  3FKS G;  1Y4M A;  3K06 A;  1BQZ A;  2Q8V A;  1SQB H;  2KG7 A;  1B04 A;  1GTO A;  4J9Z B;  2Q4P A;  1ZL8 A;  1HNZ B;  1R3K C;  1OCC C;  2WWW A;  4Q20 A;  4JI8 O;  1ZSP A;  4PA9 A;  2IM9 A;  4UCV A;  2OYQ A;  4LF5 O;  2YID A;  1B3Q A;  3ABK B;  1K73 W;  4ZIB A;  4RWU A;  1VQN V;  4X65 O;  2VWK A;  3FYI B;  5FPO A;  3APQ A;  5KUK A;  4LR3 A;  4O2B A;  3RYF B;  1K97 A;  2P90 A;  3RVZ A;  2HVK C;  4O2A A;  3HKC A;  1VQ4 V;  1FXH A;  3OM3 B;  2X6C A;  2HKO A;  3OEE G;  5B66 Z;  5FL7 G;  1XMQ B;  1VF5 B;  3CJH A;  3LSS A;  3AG3 C;  2JGD A;  2IJH A;  4JTA B;  4D6T H;  1NTM H;  4IYH A;  2E5L B;  1JOY A;  2CGN A;  4MVR A;  3P3P A;  3JSN A;  4JI0 B;  3JCU Z;  1PD3 A;  1EZV H;  1FD9 A;  4HZ3 A;  2NLJ C;  5LL6 Y;  2ETN A;  4GKK B;  3QNE A;  3CRC A;  1JJO A;  2UXD B;  3KCX A;  1S5H C;  5KMG B;  3AK3 A;  4H33 A;  3K9A A;  4LF6 B;  1Y76 B;  4FK5 C;  4K35 A;  3AG2 C;  1H2G A;  1SES A;  3B8N A;  2H8P C;  3I55 V;  4B3T B;  3DXR B;  4CZZ A;  4LFC O;  3A0H Z;  4DR1 O;  4FLU A;  4MTF A;  5L3D A;  4TV9 A;  2ILM A;  4LC1 A;  4PA6 A;  1N0N A;  4DV1 B;  1SET A;  4KHP B;  4HAM A;  4QNH B;  4ZOL B;  4DV3 O;  4I50 A;  2WLJ A;  5BR8 O;  5GW7 A;  2XND G;  2ATK C;  4I4T B;  2ZQM A;  3SYP A;  3ZN1 A;  1TAE A;  2IU3 A;  1GRJ A;  1TUB B;  1Q3E A;  2L6L A;  2ZE8 A;  5B1B B;  5HFL A;  3VQX A;  2VQF O;  1N0J A;  3BY6 A;  4JI1 O;  1MA1 A;  5KUM A;  3W7U A;  1SZT A;  4O4J B;  1JCH A;  2M6Y A;  5BXZ A;  2HHH O;  3CRM A;  3F7V C;  3WB0 A;  2UUC O;  3QTC A;  3E8B A;  3JAW A;  2JVD A;  3RYH A;  1N34 B;  1JFF A;  1AJQ A;  3T2M A;  2ZNI A;  3MD0 A;  1I7F A;  1U97 A;  3RWR D;  1CP9 A;  2XHB A;  5LGU A;  3H1L H;  1GN4 A;  4CH3 A;  2ADQ B;  5LXT B;  1VMG A;  4LWS B;  3MDS A;  1AR5 A;  2Q9L A;  4JI0 O;  2HVJ C;  3L72 H;  4XDK A;  3T1C A;  5IYD O;  3CCM V;  3AK1 A;  4NVP A;  1NH2 D;  4X89 A;  5CA0 A;  4FLW A;  1IXM A;  2YIC A;  2AHY A;  1BE3 H;  3T1H O;  4I55 B;  4PHZ A;  1SC5 B;  3CEI A;  4BR6 A;  1Q82 W;  1TA8 A;  2G38 A;  2EUL A;  4P9O A;  4RQE A;  3CHX A;  1V55 B;  5KAI Z;  2AZ0 A;  2EIK B;  2JDI G;  4LF7 B;  2R9A A;  2UXX A;  2UXC O;  4B3R B;  4PDL A;  5EZY A;  1BL8 A;  4MVO A;  1WLE A;  4LCU C;  3HKB B;  2XAF A;  3U11 A;  5KAF Z;  4DUY O;  2DN9 A;  2QWP B;  2GTS A;  1OCC B;  2ARH A;  2AXT Z;  1E1Q G;  1DGS A;  4G2K A;  3W7T A;  1GO3 F;  4IYI A;  4E2L A;  5LOV B;  3G6B A;  4O4I A;  2QM7 A;  3VQW A;  1Q6I A;  4TQD A;  2RN9 A;  2YI8 A;  3K5O A;  4NTW A;  3JAT A;  4DV5 B;  3G4S V;  1Q7Y W;  4GZR B;  2HJD A;  2PF4 E;  3AG3 B;  3ZRW A;  3RW0 A;  4B08 A;  1Z5V A;  4FLX A;  3OGC C;  4FFB A;  4UUJ C;  1FFX B;  4D7T A;  3CCL V;  3PN1 A;  1PKX A;  2P6J A;  3CSX A;  3FAV B;  5GON B;  4JYA B;  1X4T A;  3VQV A;  2JS5 A;  4FVM A;  4TOI A;  1RPR A;  3CB2 A;  4QE9 A;  5JH7 B;  1OZ0 A;  5LMN O;  3D36 A;  1BZK A;  4IL6 Z;  4Z1V A;  4B7K A;  5DED A;  3IAY A;  2UUB B;  1XEQ A;  3AG2 B;  1WNS A;  4DUZ B;  2Q0A A;  1K4C C;  2LW7 A;  2B9Z A;  3D3Q A;  3M8A A;  1ZUQ A;  1AR1 B;  3E83 A;  2XAG A;  2LP7 A;  4U3J A;  2Z3Y A;  2JEX A;  4XDL A;  3UQ8 A;  1RM1 C;  3LSQ A;  1YXB A;  3JCZ A;  4B3R O;  4F4L A;  5IYB O;  1VQM V;  3ZHV A;  4X64 B;  4CH5 A;  3SJQ C;  4UVB A;  1IUR A;  1K4D C;  3CRQ A;  4K8X A;  1SKV A;  1MNG A;  2YXH A;  4I0X A;  4I9W A;  3N2G A;  1LUW A;  5KLV H;  4ZI7 B;  3WB1 A;  3CS5 A;  1NBM G;  4UB8 Z;  4YJ3 B;  3JD2 A;  1K9M W;  2ZNJ A;  3WG7 C;  3K5M A;  2HJF C;  4EKW A;  5LP6 A;  5CA1 B;  4PEL A;  3UO3 A;  4F6E A;  1ROP A;  3TGU H;  3T1Y B;  4N23 A;  4JI3 B;  3OFN G;  3HKD B;  3STZ C;  4KXR A;  1DF4 A;  3JD4 A;  1M57 C;  4L8J A;  1VQ6 V;  2OWO A;  4UV9 A;  1R3I C;  1HWY A;  4JZ2 A;  3CCE V;  4JZG A;  2EIM C;  2EJ7 A;  2IBZ H;  2Q67 A;  2QSA A;  5BMV A;  4QPJ A;  4A5U B;  3K3W A;  2F23 A;  4QGP A;  2ZXW C;  5FNV A;  2GSM B;  4J11 A;  4PV1 B;  4CBC A;  3C90 A;  4FLY A;  1Z2G A;  3JD3 A;  5C93 A;  4Q6G A;  3UM7 A;  4X66 O;  3CE2 A;  1MG1 A;  4P2Z A;  1AI7 A;  3IC7 A;  2ZR2 A;  2UUB O;  2VS0 A;  2FKX A;  3JAR A;  4X20 B;  4I9Q A;  4JI2 B;  4B3S B;  5JWP A;  3S3W A;  4ZHQ B;  2JEU A;  2Y0I A;  3ZN0 A;  3CP1 A;  5JVD B;  5E1A C;  4WCE V;  1TGO A;  1LR1 A;  1N8R W;  4H44 B;  1VF6 A;  1V9P A;  1LNQ A;  2VQE O;  5JQG B;  4JTD B;  1PPJ H;  5EYP B;  2CUG A;  4AHC A;  3FX7 A;  4X1I B;  3ABM C;  1P84 F;  2UUA B;  2ZM6 O;  2Q7G A;  4WBN A;  4JI5 O;  1YDX A;  5H6Q A;  2WLL A;  4BIO A;  1XL4 A;  2AHZ A;  2QWO B;  4YY3 O;  5CBF A;  2CDY A;  3K9S A;  4X62 B;  3E22 B;  2ZKO A;  1YJ9 V;  4PDV A;  4PD4 F;  2C2A A;  2MK3 A;  1R6N A;  4YHH B;  4GT1 A;  3JAL B;  1AIL A;  3CRA A;  2X7R B;  2L35 A;  2FML A;  4GUN A;  1OJH A;  1QLE C;  4YIO A;  1PP9 H;  2MW2 B;  1THZ A;  2KB1 A;  1WJZ A;  1SA0 A;  2CGO A;  3ABU A;  1FXK A;  5DN6 G;  3OR6 C;  4H0L B;  4EFB A;  4J42 A;  2F1M A;  4JI8 B;  2E76 B;  4JI4 O;  1VQ9 V;  1MOF A;  5IJ9 B;  3TET A;  4LF5 B;  4UVA A;  1SF9 A;  3RYI B;  1HDJ A;  3ZMZ A;  4X65 B;  1G1X B;  5CB4 B;  1ARO P;  1OCZ C;  3IGA C;  1F4N A;  3BCC H;  3RN4 A;  2ADP A;  1QLN A;  4YXW G;  1EN6 A;  1KP3 A;  2QJ1 A;  2Y69 C;  1FKA O;  3K0D A;  4PDM A;  1WPX A;  4ZBM A;  3JAS B;  5AG2 A;  2ZCE A;  4AQY B;  2BTQ A;  1O9G A;  1HR0 O;  2OCC C;  1NS1 A;  2WLI B;  3CC4 V;  4B3S O;  1R6K A;  3OE7 G;  1H8E G;  3ZJZ A;  2DQ0 A;  5LHI A;  4EB6 B;  3PJS K;  4J7Z A;  3N2K A;  2QDO A;  5A2Q N;  1XIL A;  2XAH A;  1EM1 A;  2B1G A;  1U96 A;  2LQT A;  5LGN A;  3E8H A;  3A0R A;  4DYL A;  2QEX V;  1GN2 A;  4LFB O;  2P06 A;  1F51 A;  1IBM O; 
#chains in the Genus database with same CATH homology
 2WLJ A;  5GW7 A;  3ABK C;  4U7O A;  2XND G;  1PL0 A;  2LFS A;  3X2Q B;  2ATK C;  4QPK A;  3K04 A;  1FS0 G;  1PNL A;  2ZQM A;  1EFR G;  3SYP A;  3WG7 B;  3ZN1 A;  3LDC A;  4GX5 A;  2IU3 A;  2HR3 A;  4MS2 A;  5B1B B;  5HFL A;  2OTJ V;  2BOB C;  2M7W A;  3BY6 A;  1OCO C;  4WFA V;  2UXN A;  5KUM A;  4R6Z A;  3W7U A;  1SZT A;  5CMU A;  3OW2 U;  1MSW D;  3UKM A;  4MVS A;  1G4Y B;  1JCH A;  2A79 B;  1M57 B;  4JPR A;  3ASO B;  1H38 A;  3F7V C;  1YSC A;  5B3S B;  1M56 B;  3ZRX A;  3E8B A;  4BW5 A;  2X6A A;  1VQ5 V;  1FXV A;  2EIM B;  4JTC B;  3R65 A;  1AJQ A;  3T2M A;  1NJI W;  3T4D A;  3MD0 A;  4LBE C;  4GX0 A;  4R8C A;  2DW4 A;  1UJW B;  5IYC O;  2ZXW B;  1CP9 A;  1S76 D;  1VQL V;  1GM7 A;  3W7S A;  5LGU A;  5IY5 B;  4QIW F;  3FYE B;  1NVP D;  3IFX A;  1KP2 A;  1Q81 W;  4WFH A;  2EZP A;  3ZMS A;  2WLL B;  4TT3 G;  1JJ2 U;  5LGT A;  2JIZ G;  4R7C A;  2HVJ C;  4UV8 A;  4JYC A;  3E2E A;  3FB8 C;  4MVM A;  4XDK A;  3T1C A;  5IYD O;  1NQT A;  3CCM V;  3SPJ A;  1NH2 D;  4X89 A;  4MT8 A;  3JD0 A;  4QJF B;  4MTO A;  2IH3 C;  1IXM A;  4GCZ A;  1I5X A;  4I5S A;  3SYA A;  2AHY A;  1AJP A;  2IU0 A;  1YIT V;  1QVG U;  2EJR A;  3AG4 C;  2EIL C;  5LBQ A;  2EIJ C;  2Q68 A;  5CA3 A;  1Q82 W;  3ETE A;  4KUM A;  2HFE C;  3OMN B;  1NR7 A;  3P30 A;  1FFT B;  4P9O A;  4RQE A;  3W7W A;  4FMT A;  1V55 B;  5BZB A;  4HYO A;  3G71 V;  4XBF A;  2EIK B;  1MAB G;  2JDI G;  3ZMU A;  2UXX A;  3SPI A;  1FXK B;  1K7D A;  4N21 A;  3X2Q C;  3ABM B;  3K03 A;  2DWE C;  4PDL A;  2K1E A;  4OXS A;  1BL8 A;  4MVO A;  5IDJ A;  1GKF A;  1JX9 A;  2YSU B;  2W0F C;  3HPL C;  1WLE A;  4WF9 V;  2B5U A;  4LCU C;  4RUF A;  3NXS A;  2XAF A;  4UXN A;  1P7B A;  3CCQ V;  1RM1 B;  1K92 A;  1RPO A;  3OMI B;  2JJ1 G;  4JAS A;  1OCC B;  3DTU B;  1E1Q G;  2PI5 A;  1ENV A;  4G2K A;  5HFM A;  2WLM A;  1BMF G;  4GX2 A;  4PA7 A;  3W7T A;  1GO3 F;  2V7Q G;  4E2L A;  1V54 C;  4DXW A;  3OMA B;  2ZD9 A;  1F4M A;  5KA5 A;  1VQ8 V;  3TCU A;  5EBW C;  3CYO A;  4BIU A;  1GK9 A;  3SYO A;  2QM7 A;  4H37 A;  5J9P C;  2W6I G;  3P32 A;  1QLE B;  3MHH C;  3CCV V;  5B1A C;  1XL6 A;  3RVY A;  2WPD G;  1PNK A;  3CC2 V;  2WLN A;  3ETG A;  5L3G A;  3G4S V;  1Q7Y W;  3ZMV A;  5CBH A;  2IW5 A;  1DLB A;  5L3F A;  1B6Q A;  1GMG A;  5EBM C;  2IJJ A;  1QCE A;  2R9I A;  3AG3 B;  3ZRW A;  1KD1 W;  3RW0 A;  5CBG A;  1OCR C;  1KC8 W;  1E79 G;  2ZR3 A;  3OGC C;  4UUJ C;  1YJN V;  3WFV A;  2NNU A;  3SPG A;  5L3E A;  3CCL V;  3F7Y C;  1PKX A;  1AI4 A;  1OCZ B;  3AG1 C;  2P7T C;  3OR7 C;  1M9N A;  2P6J A;  3ASN B;  1VQK V;  1R3L C;  3K79 A;  3T4Z A;  3EHB B;  2Y69 B;  1J95 A;  1YI2 V;  1BHB A;  1TUE B;  3CXC U;  4ASU G;  2PI4 A;  2F43 G;  2DQ3 A;  3OUS A;  1VQ7 V;  3FB6 C;  1RPR A;  4JAV A;  3VBB A;  1S77 D;  4QE9 A;  1OZ0 A;  1NR1 A;  3D36 A;  2DYR B;  2OCC B;  4JF3 A;  2GHY A;  1E1R G;  3ZCC A;  1DF5 A;  2ZDI C;  1CEZ A;  4FJC C;  3AG2 B;  5CN0 A;  4R50 A;  4J9Y B;  4RO2 A;  3AEI A;  1K4C C;  4QE7 A;  3B8M A;  2EIN C;  1R73 A;  3ABL B;  2IJK A;  1AR1 B;  3E83 A;  2XAG A;  3STL C;  2V1D A;  3B77 A;  3OAA G;  1QR9 A;  4UVC A;  2LP7 A;  2Z3Y A;  2JEX A;  4KP4 A;  4XDL A;  1RM1 C;  4WFB V;  3LSQ A;  3JD1 A;  4LP8 A;  3JCZ A;  4X88 A;  4F4L A;  4G27 B;  5IYB O;  1K33 A;  4BAY A;  1VQM V;  2WSS G;  2QTO A;  3F5W C;  3I56 V;  1S3J A;  2A9H A;  3SJQ C;  1YTF B;  1K3E A;  3FB5 C;  4UVB A;  5EC1 C;  1K4D C;  2DYS C;  3KG2 A;  4MVQ A;  1EBO A;  3GB7 C;  4I9W A;  2ITD C;  4U7N A;  1DTO A;  1OCO B;  1QVF U;  1NBM G;  4DO2 A;  1YJW V;  3JD2 A;  1EZJ A;  1ZWI C;  2ZDI A;  2R9R B;  1K9M W;  1R3J C;  3WG7 C;  1CPY A;  2HG5 C;  2HJF C;  4EKW A;  1F23 A;  2DWD C;  3H01 A;  3OUF A;  4PEL A;  4FIP C;  5B1B C;  1ROP A;  3CCU V;  3SPC A;  4P9P A;  4N23 A;  2ITC C;  5EC2 C;  2WLI A;  4MSW C;  3CPW U;  3OFN G;  3STZ C;  1DF4 A;  4BIZ A;  3E8F A;  3JD4 A;  4XDJ A;  1M57 C;  3ASO C;  2YEV A;  4JAU A;  3OEH G;  3ASN C;  1VQ6 V;  5B3S C;  4JGS A;  4UV9 A;  1M56 C;  1R3I C;  1L1F A;  1HWY A;  3CMA V;  3CCE V;  2EIM C;  2Q67 A;  1YHQ V;  4QPJ A;  1JPX A;  4P30 A;  3K3W A;  4JYB A;  3ZRV A;  3CCJ V;  2B1I A;  3QO7 A;  2D3O W;  1ORQ C;  2FTK A;  3ABT A;  2ZXW C;  2LFR A;  3LNM B;  2GSM B;  2Y48 A;  4CBC A;  1I5Y A;  4PA3 A;  2XAJ A;  3SYC A;  2X0L A;  5IY5 C;  1S72 V;  3JD3 A;  5C93 A;  3UM7 A;  1H8H G;  5EK0 A;  3CME V;  3W7X A;  3ML0 A;  1YIJ V;  2JK5 C;  3ZIA G;  1NH2 B;  1MG1 A;  4P2Z A;  3AG4 B;  2EIL B;  3DGE A;  4MTG A;  2EIJ B;  1AI7 A;  3IC7 A;  3E89 A;  2ZR2 A;  3K0G A;  4RQF A;  1M90 W;  1VQP V;  2W6J G;  4MVZ A;  3ZMT A;  2JEU A;  1Q86 W;  3E35 A;  3GWO A;  2EBO A;  2QKS A;  3ZN0 A;  3CP1 A;  3E8G A;  2XAQ A;  1P4R A;  3SYQ A;  1AI6 A;  5E1A C;  1KKD A;  4WCE V;  4TWK A;  3BEH A;  3VOU A;  4RUE A;  1N8R W;  1G8M A;  2P67 A;  3ZRW B;  1V55 C;  4PA4 A;  1LNQ A;  3LDD A;  2IH1 C;  4JTD B;  2EIK C;  1NKD A;  2XAS A;  1FXK C;  4WFF A;  2QA4 V;  3ABM C;  4X8A A;  4Z1M G;  3HB3 B;  2OT5 A;  3FKS G;  1Y4M A;  3K06 A;  1QR8 A;  5H6Q A;  1GM8 A;  2CK3 G;  3TK1 A;  1K8A W;  2WLL A;  1GTO A;  4TSF G;  4J9Z B;  1XL4 A;  2AHZ A;  1V54 B;  4ZKI A;  3EFF K;  3K08 A;  5CBF A;  1OHH G;  1K5Q A;  5H9C A;  1R3K C;  4GX1 A;  2JJ2 G;  2QM8 A;  1OCC C;  2IJI A;  2WWW A;  4Q20 A;  1YJ9 V;  4PDV A;  2EZO A;  4PA9 A;  2C2A A;  2MK3 A;  5B1A B;  3LUT B;  1JQ0 A;  1R6N A;  2WLK A;  2Q69 A;  1KEC A;  4GT1 A;  2OTL V;  3CC7 V;  3ABK B;  1K73 W;  2WAM A;  4WFE A;  3RBZ A;  1VQN V;  2X7R B;  3FYI B;  5KUK A;  5LHG A;  1AI5 A;  1S0V A;  1QLE C;  1K97 A;  2X6B A;  1OCR B;  1THZ A;  2P90 A;  2KB1 A;  3RVZ A;  3CD6 V;  3G6E V;  2HVK C;  1K34 A;  1VQ4 V;  3ABU A;  1FXK A;  1FXH A;  4FPP A;  5DN6 G;  3OR6 C;  2Z5U A;  3OM3 B;  2X6C A;  2WLH A;  2HKO A;  3OEE G;  4WFG A;  5FL7 G;  1AJN A;  3AG1 B;  1COW G;  3LSS A;  3AG3 C;  2QE7 G;  1VQ9 V;  1VQO V;  1MOF A;  3QO8 A;  2IJH A;  4JTA B;  5B1O A;  3FB7 C;  3TET A;  4UVA A;  4L87 A;  5EBL C;  3ZRS A;  4MW3 A;  3ZMZ A;  1BHA A;  5LHH A;  1JOY A;  4MVU A;  1ARO P;  4MVR A;  4G28 B;  1SRY A;  3D3I A;  1OCZ C;  1M1K W;  3IGA C;  1F4N A;  1PNM A;  1PD3 A;  1QLN A;  1JVM A;  4YXW G;  1KP3 A;  2H94 A;  2Y69 C;  4HZ3 A;  2NLJ C;  3K0D A;  1W2B U;  4PDM A;  1WPX A;  3QNE A;  1QBZ A;  4ZBM A;  1GM9 A;  3CCR V;  2EIN B;  1S5H C;  3M99 B;  3QO5 A;  1SER A;  3ETD A;  2DYR C;  5B1N A;  2OCC C;  3MHS C;  4H33 A;  3SPH A;  2WLI B;  4MW8 A;  2BOC C;  4KFM A;  3K9A A;  3CC4 V;  1NVP B;  1R6K A;  5DM6 V;  3OE7 G;  1H8E G;  4FK5 C;  3ZJZ A;  3AG2 C;  1W0K G;  5L3C A;  1H2G A;  1SES A;  3B8N A;  5L3B A;  5KA6 A;  2HLD G;  2DQ0 A;  2H8P C;  3I55 V;  5LHI A;  1KQS U;  2YEV B;  3PJS K;  2A0L A;  3ABL C;  1Y66 A;  3LDE A;  4MTX A;  1W0J G;  4CZZ A;  2XAH A;  4MTF A;  5L3D A;  3E86 A;  4RAI A;  4LC1 A;  2B1G A;  4PA6 A;  3CCS V;  2XOK G;  2DYS B;  5LGN A;  3E8H A;  1K5S A;  1SET A;  3A0R A;  3JYC A;  2QEX V;  4HAM A;  1YTF D;  2Q6A A;  4QNH B;  4PDR A;  1F51 A;  5H6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...