1Y66A

Dioxane contributes to the altered conformation and oligomerization state of a designed engrailed homeodomain variant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
50
structure length
50
Chain Sequence
QWSEEVERKLKEFVRRHQEITQETLHEYAQKLGLNQQAIEQFFREFEQRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dioxane contributes to the altered conformation and oligomerization state of a designed engrailed homeodomain variant.
pubmed doi rcsb
source organism Escherichia coli
molecule tags De novo protein
molecule keywords engrailed homeodomain
total genus 24
structure length 50
sequence length 50
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1y66A00
4JPRA 5H9CA 5KA6A 1MG1A 4JGSA 1ENVA 1MOFA 1DF5A 1Y4MA 2LP7A 3MHHC 4FJCC 4FK5C 1I5XA 1QR9A 1K34A 3H01A 3GWOA 1DF4A 3B77A 4N21A 2MK3A 2X7RB 4JF3A 4G2KA 4FIPC 4N23A 2EBOA 1QBZA 3M99B 2M7WA 1F23A 1JQ0A 3WFVA 1QCEA 1I5YA 1Y66A 4E2LA 2OT5A 3B8NA 5HFMA 1K33A 5CN0A 5HFLA 1DLBA 3K9AA 3MHSC 5CMUA 2EZOA 1EBOA 3P30A 3CYOA 2P6JA 1SZTA 3CP1A 1JPXA 1QR8A 5KA5A 2EZPA 3B8MA
chains in the Genus database with same CATH superfamily
4B3TO 3IGAC 3N27A 1VF7A 3KG2A 3UO3A 4LFCO 4HZ3A 1GO3F 2GTSA 2Q69A 1AJNA 5E79Z 3FKSG 4FLZA 5LOVA 3ZMTA 3BPZA 3HKDA 4H37A 4H33A 2LW1A 4CS4A 3CMAV 2GHYA 2JS3A 2CGOA 3RYCB 5IJ9B 5KA6A 1D5NA 4FK5C 1B3QA 2CAZC 2YXHA 4IL6Z 2CK3G 2WLLB 4P9OA 1V55B 3W7UA 1GAXA 2IJJA 1FJGB 3MAQA 3FFQA 1V54B 4ZIBA 1BL8A 2PF4E 2AHZA 3SPHA 3QF7A 3SJBC 4LF5O 1U97A 4DR5O 1SZTA 4GX2A 3ZMVA 1Z2GA 3SPCA 3AEIA 1IBKO 3L71H 1NTKH 2QTOA 4WCEV 1MOFA 1OCRB 1HNZB 2P67A 4I9QA 2BCCH 3T4DA 4DV7B 4UV8A 3NXSA 5C93A 4FM1A 3QO8A 1YHQV 1E1RG 3JCZA 4RAIA 4JI5O 1J5EO 4H13B 4LH7A 4JYAB 4HYOA 2QSAA 1S77D 2JDIG 4JI7B 2LP7A 3HKBA 2QA4V 4XDLA 4B7EA 1IBKB 4QIWF 5CA0B 4JTAB 5TISZ 4O2AB 1KUQA 2QWQB 4J7ZA 4IT5A 1I94B 3IAYA 3ZHSA 4PI0A 1AJPA 5A9GA 3D36C 3E8BA 2EZPA 3OAAG 1Q43A 4JI3O 1TGOA 2KSDA 5LGTA 4DR1O 1PNKA 3B77A 2W0XA 3L9DA 5J9PC 3W7WA 2A9HA 4AHCA 1BS3A 2QWNB 3E89A 2JRIA 4TOIA 2KKWA 3SYOA 1KD1W 5FNVB 3DSQA 1N0NA 4JYBA 3SJAC 1SF9A 2WPDG 2NN4A 2ZDIC 4U3JB 4FLYA 4LF6B 4XDJA 2Z0AA 1S0VA 4LFBO 2Y0PA 5IWAO 4YJ2A 4KP4A 1QU7A 4UUJC 1VQ8V 5KHIA 1HP8A 4PA3A 2R9IA 2K1EA 1EBOA 3CCMV 2P6JA 4MSWC 4FLWA 2F93B 3HKCB 4WBNA 1B04A 5L3DA 1FD9A 2LO1A 5JVDB 4JI0O 2EINC 2JVDA 1JVMA 1N34B 2EIMC 1H2NA 4JI3B 3ABMB 2P7TC 4J7JA 3CWBH 1E79G 1Y76A 5A2QN 2L6LA 1K5SA 3WFVA 2Q9LA 4DR6O 4OX9O 3ZJZA 1NT2B 3AG4B 5GONB 4JI4B 2XAJA 5BY1A 1AI4A 2OCHA 1GN3A 2EJRA 4YY3O 2NNUA 1YF2A 4DR1B 4QPJA 3OUSA 2BSKB 4TV9B 3OTFA 4F6RA 1I5XA 1ZL8A 2PY5A 1VMGA 3QNEA 1VF5B 5EBMC 4KXRA 2Q73A 5LMNB 1CEZA 5EYPB 1IX9A 2P4VA 4JI5B 1M9NA 3IFXA 4FFBB 4IGGA 4HBNA 2XNDG 2R9RB 3B8MA 2YS8A 4GX0A 2JJ2G 4K0KO 2YIDA 2WA3A 1AJQA 3G80A 2WLKA 4P30A 1NR1A 1GN6A 1KECA 4EEQA 3GWKC 2DJVA 3LNMB 4DUYO 5DN6G 2DQ0A 4DR2O 4ZOLB 3CS5A 2F66C 2DYSB 4WFFA 5GTIZ 1ROPA 1BQZA 2VQFO 3FB5C 5K1XA 2A06H 2Q68A 2IW5A 2A3QA 4ZOLA 2DYSC 3CB2A 4K3AA 1SERA 3OEHG 1WA8A 3R66A 4FIPC 2EBOA 5B1AC 4ICGA 4J42A 4NYKA 1KBHA 4DV5O 4O4LB 4LF5B 2JGDB 1G8MA 2OWOA 3FB7C 2CE4A 4R6ZA 4OX9B 1RM1C 5B1BB 3ICXA 4LCUC 4FFKA 4K8XA 4K8ZA 1F4MA 4RUFA 3ZX6A 4N21A 2QM4A 1VF6C 2M6YA 4KHPO 4DK0A 3J7AU 5JJNB 3OEEG 2K9PA 2WA4A 1GN2A 3QO5A 4NTWA 3CP1A 3K0DA 2VQEB 3T1YB 5CBHA 2QKAA 1SQPH 2QM7A 1YIJV 1NH2D 2ZM6B 1I7FA 3LSSA 4FFBA 3UCSC 2QR4A 4JZGA 3UKMA 2XAFA 1B06A 1YI2V 1ZL8B 4K35A 5IYBO 3ABUA 3O9OA 2Q7GA 1XQ8A 4HNAA 3K59A 4DV1B 4LF9B 4FZ0A 2EIJB 1VP7A 1SRYA 3B4SA 3ZHQA 2OTLV 3ZN0A 4DRXA 4LFAB 2XUMA 2HKOA 1W2BU 1WLEA 1R6TA 3P3NA 4I50A 4ZBMA 2IH3C 1XUQA 5CA0A 1WA8B 3WB0A 2ZIOA 1KU9A 3HKBB 3ZMZA 1QR9A 1PKXA 3H01A 4X65O 1Y74B 4YIPA 2Q4PA 4N23A 4ASUG 2HEPA 1OCZB 3SGIA 2HHHO 4MVSA 1G4YB 2FL4A 4IIJA 4O4HB 5CA1A 1SC5B 1WJZA 3RYCA 2F4VO 3I55V 2BE3A 3T1YO 2N74A 4U3JA 1VQ6V 3F7VC 4DV7O 3ASOC 1H8HG 1PP9H 1VF6A 1PPJH 2ADQB 3ZHUA 2YDEA 2UXBO 1I08A 4LNUA 2W0FC 1JFFB 4MVZA 1AR5A 4B3SO 1K3EA 2YI8A 4DW1A 2ZQMA 4PELA 4JAUA 3ABLC 2PYJA 3CRAA 4X1IB 2E74B 5BR8O 3AK2A 4BW9A 4I7ZB 4AQYB 3ABLB 4FZ1A 1YEWA 4KL1A 1WB8A 4JAAA 1GMGA 4LR3A 5LA6B 1R3IC 1XL4A 2ZT9B 4O2BA 4CC6A 1QLEB 2IH1C 5BR8B 2P22C 3OMNB 3X2QB 1VARA 1AILA 1OCOB 3RW0A 4I55A 4OPHA 3BCCH 3M99B 4GUNA 3SJQC 4I0XB 4NXNB 1FS0G 3E86A 4UB6Z 3KCYA 4UVCA 3I5DA 1N33B 4UV9A 4WF9V 4GKKB 2FMLA 3OUFA 3AG4C 1H8EG 3HKDB 1VQOV 1K34A 5GW7A 1RSOB 5BMVB 2CH7A 4DV3O 5KX5A 1XI1A 3VQVA 1QNMA 5BMVA 3D3QA 2R70A 4IHJA 1YJNV 4X65B 4O4HA 1YITV 4Z2WA 1CP9A 1YZBA 4NVPA 5KA5A 3HPLC 1NS1A 2GTAA 4JYYA 4JI4O 4FVMA 3ABTA 3JSNA 4J7KA 5LMUB 4CS2A 1S72V 1SESA 1N32O 5EZYB 5B66Z 1N36B 2ZR3A 4DXWA 1Y66A 3CXHF 4B3MO 1K9MW 1UPGA 5L3BA 4OPAA 1BHBA 4YJ3A 5KMGB 3SDLA 1OCZC 4O2BB 3SPGA 2XOKG 3T2MA 5LXTA 4J80A 1R6NA 1XREA 3U0ZA 4RUEA 1FFXB 3QVNA 4AILC 1VQLV 3JD1A 2GV9A 1GRJA 4RQFA 1HDJA 3J81N 5IWAB 3VQYA 1BHAA 3EFFK 2UUCO 3UO2A 4X66B 5IJ0B 5J2UB 4R8CA 5LGNA 5IY5B 3H1JH 4DR7O 2EX3A 2FB5A 1TVKB 3A0HZ 3AG1B 3JAKB 3K03A 2B5UA 2DYRB 4I4TB 2AZ0A 2XAHA 1S5LZ 5LL6Y 3T1HO 1MZEA 1QBZA 2MW2B 2WSSG 3E8HA 4GZRB 4BR6A 2XTAA 3C90A 4PDVA 2BTOA 3FX7A 2LFRA 1M56C 1AP5A 4D7TA 2JK5C 4JGSA 4O4IA 2QJ1A 4DV0O 2DE0X 5J2TA 1VQKV 2JGUA 1M56B 1G6UA 4A5UB 1HNXO 4PDLA 4QNHB 4DV4O 1NBMG 4AI8A 2HP8A 1Q7YW 4J9YB 1TA8A 5L3EA 4JI7O 1F7YA 4JAVA 1HR0O 1FFTB 4JTDB 2E5LO 3L73H 5EK0A 1J5EB 3E22B 1QVGU 1WP8A 1AR1B 4LF8O 3QG5A 4DUZB 5FPRA 1XL6A 2WLMA 1HNZO 1FXKB 2OYQA 1OV9A 4X9QA 1NZ6A 1R6KA 3OR7C 3ZMSA 4EFEA 5CBFA 4B08A 3OMAB 4LNUB 3WB1A 1N4CA 1XMQO 1BMFG 5LMNO 2P4KA 2QWPB 1FJGO 3S3WA 4PV1B 2PUSA 1SQBH 2W6IG 4E2LA 2N04A 2UXCO 3STLC 4XDKA 1H2SB 4MT8A 3SYAA 3F5WC 4MVMA 2JEUA 1RFYA 1D2DA 2NR5A 1ZSPA 1M57C 1K5QA 1DF4A 4WFGA 5IYDO 2LJ2A 3ABKC 4CS3A 2RMKB 4LP8A 3OMIB 1NKDA 3IC7A 1K7DA 4B3TB 2QE7G 3APQA 4DV2O 1PL4A 3OGIB 3CPWU 3RN4A 3OE7G 5D5PA 2IU3A 1VQ7V 3PN1A 1R73A 1QHTA 4W4KA 2A7WA 1O9HA 1XBLA 4LF6O 3BRCA 3LSUA 2GDSA 1AVMA 2Y48A 4JTCB 1YJ9V 1PNMA 1XILA 1T5EA 1YDXA 4BIOA 3CCEV 1LUWA 1IDSA 3W7XA 2Y4UA 4QPKA 2Q0AA 3JAWB 4X1KB 1NU1H 2FYUH 3HB3B 3EHBB 4FLVA 3W7SA 1TVKA 4X89A 5B5EZ 2EJ7A 2ZIMA 1M90W 4WFEA 5JQGB 4ZI7A 2ZKOA 4LF4O 3ETDA 3RYIB 1I94O 2ZNIA 3L72H 2UUBO 2GSMB 2YIBD 2JS5A 2UU9B 1F51A 4GCZA 1RPRA 1WP7A 2A79B 4P9PA 4ABMA 2HVKC 3F5TA 3P3PA 1H2KA 5LOVB 3BAAA 3G67A 1GM7A 1NR7A 4EKWA 4JYAO 3T1CA 5H6RA 3JSLA 4MTFA 1US6A 1CXZB 4Q6GA 1FXKC 2IJKA 3JD2A 3RYFB 1VEWA 2CGNA 5EYPA 3RBZA 1RM1B 2IJHA 2IBZH 3CCVV 4DR3O 4QE9A 5JVDA 3K08A 5LXTB 4BIUA 1IXBA 1WB7A 5LHHA 1PV0A 1EZVH 1URFA 4UVAA 2PYLA 1TUEB 2Z3YA 1XEQA 5GONA 4J9ZB 3A0BZ 4EB6B 4CH3A 2QKSA 1H38A 2ZE6A 2ITDC 1S76D 4I4TA 2DMXA 2PI5A 4JI2O 1TAEA 5FNVA 4I5SA 4O4JA 1AI5A 3B40A 1OHHG 2VWJA 2OTJV 1M1KW 1Q3EA 5EC2C 3AG3B 1NVPD 4O4IB 1WPBA 4QE7A 3CSXA 2YEVB 3DXRB 3FAVA 3JD3A 1L1FA 2OIGA 4MW3A 4NXMO 1MNGA 3CEIA 4ZI7B 4NXMB 5IY5C 1EN4A 4MTGA 2QWRB 2YI9A 3HKEA 1HNWO 3ZHRA 2EIMB 2Q67A 2BTQA 5JH7B 2RDCA 2QTSA 1NJIW 3A2FA 4E4EA 2DW4A 1IBLO 4H44B 3CMEV 4UCRA 2UUAO 3KCXA 4LBEC 1ZLZA 4I0XA 4FLTA 2EZOA 2Y0IA 3DGEA 1SA0B 1YVWA 1FKAO 4JI8O 2X6AA 1ZWIC 4LWSA 3E22A 1SQQH 4DR3B 2HLDG 1P84F 1UFIA 1YXBA 4DUZO 4Q20A 2W6JG 3LSQA 5KX5B 5H6QA 1JFFA 1EZJA 1XOUA 3OT7A 4GX5A 1XNQB 4UCVA 2EULA 1S3JA 1HR0B 3A8TA 3RFRA 1S5JA 4PA6A 4R50A 4FLUA 4CC5A 2UU9O 1VQPV 4X1IA 2LQTA 3RVYA 4JV5O 2KG7A 3IC9A 3RVZA 4GKJO 4DO2A 1DLBA 4PDRA 2DQ3A 1O9GA 2CTQA 3CD6V 3BA8A 3RWRD 4JI6O 2ZR2A 3AG7A 1NTZH 5H9CA 1VQ9V 5KHHA 2BOCC 4JI1B 3L74H 3JALA 3S3XA 5JCOC 1EFRG 4X1YA 4U7NA 1MSWD 5EIBC 3ZHVA 2F23A 5IJ0A 4UCTA 4B7KA 2EILC 2D2CB 1PL0A 4I9WA 3ETQA 2AGAA 2Q6AA 1RP3B 1N8RW 4DRXB 3JARB 1J95A 4BW5A 5LGUA 5F2VO 1N0JA 5KMGA 1H2MA 4CH4A 1K8AW 2O57A 5HFMA 1AI6A 3SYCA 2VS0A 5B1NA 3TXQA 2Z5UA 1L0LH 2G38A 3A0RA 3TJTA 2EIJC 5EBWC 1LNQA 4LC1A 1YSCA 5DEDA 3G4SV 2DN9A 2VRZA 2LGWA 2ZDIA 3FYIB 1YCIA 1N32B 4NTXA 5LMUO 3DXRA 3ZCCA 3K5OA 4W4LA 1DGSA 2OT5A 5DECA 3JALB 4DV6O 2DYRC 2HR3A 2WLIA 4GLXA 1Q82W 5EBLC 3JD0A 1YJWV 4FJCC 4OXSA 3STZC 3LNNA 3FYEB 2B1GA 1XMQB 2ILMA 3VOUA 1ZUQA 1B6QA 3MDSA 1JJOA 3G6EV 1VQ4V 1XMOB 2P90A 1RPOA 4HAMA 3VQXA 5JCOA 1Y4MA 1Q6HA 2ZINA 5LP6C 2A0LA 3H1IH 2QGNA 2YIAA 1X4TA 1KP2A 1KC8W 4ZHQA 4EB6A 3NR7A 5LP6B 3RYHB 4LF7O 4X20B 4TWKA 5H2FZ 4O4LA 1SKVA 3H9VA 5LA6A 1JR9A 5B1AB 1L8DA 3BY6A 3CRMA 4X88A 4HNAB 1WN7A 1R3LC 3L70H 1MZFA 3AG2C 3HR0A 3OM3B 1NVPB 2M7WA 3RYIA 4JI2B 4O4JB 2X6CA 1Q86W 3BHPA 3WG7C 1OCCB 1QR8A 3JAWA 4B3RB 1Y6XA 1JA8A 2V1DA 4MW8A 1FXHA 2UXXA 2ZXWB 3ZRVA 3JASA 1K73W 3HKEB 3J80N 5KAIZ 2UXDB 1OCCC 4L87A 4TV8B 4B3RO 1CPYA 3AG3C 2FTKA 1IXMA 1ORQC 4P2ZA 4JASA 2F43G 2YEVA 4DR7B 5KLVH 1KKDA 3OFNG 3H1LH 2YSUB 1SQFA 2Y69C 2UUCB 4TV9A 1FPOA 5L3FA 1BE3H 1NTMH 3ZBHA 2HHHB 2HJFC 5ITZB 4JI6B 4X64B 2H3OA 1XNRO 1YTFD 3E8FA 1QCEA 2C2AA 3CC4V 2QKCA 3O65A 1XNQO 3CYOA 1BQ0A 1V55C 3CJHB 4R7CA 1JX9A 3ZEDA 1D5AA 1DF5A 3EVKA 2PTMA 1XMOO 2JJ1G 3LDCA 4YHHB 1PM9A 2ITCC 1W0KG 3K5LA 1MSDA 2RQ6A 2R72A 2ARHA 3N2GB 3Q4HB 4PDMA 3CX5F 1BSMA 4FLXA 2XT9A 1SQXH 1EM1A 2D3OW 5IE9A 2YUAA 2ODMA 3K3WA 3ASNC 3SR2C 4X62B 1SETA 1F23A 2WLIB 3MD0A 5HFLA 3OTOB 2AXTZ 3G6BA 4CH6A 1PNLA 3ASNB 1Y74A 1IBLB 1KQSU 4NXNO 1GTOA 3W7TA 4DYLA 2ETNA 3KKYA 3UM7A 1DTOA 2Q0OC 1KP3A 1K4CC 3RGBA 1GN4A 1DK1A 1YTFB 2HJDA 2FKXA 3LDDA 5LP6A 1R3JC 3WU2Z 4WFBV 4WFHA 2F1MA 4CZZA 1IZ3A 2B9ZA 4IYHA 1KB9F 3AG2B 4GX1A 5EIBD 3HKCA 5IYZB 5FPOA 2RN9A 3OTOO 2PGGA 4KFMA 1WNSA 3JD4A 2WLHA 3WG7B 2HG5C 2XHBA 4X62O 4TUYA 3SYPA 5FLXN 3H1KH 3X2QC 1OJHA 2UXCB 4AQYO 1OCOC 3DC5A 3OGCC 1KYOF 1COWG 1SZXA 4FPPA 3M8AA 4CH5A 1RSOA 1ZX3A 1K97A 2VQFB 4JPRA 2H8PC 4LH6A 3D8CA 4X8AA 2IU0A 1A32A 1Q8IA 4O2AA 4YHHO 2KG7B 1U96A 2QM8A 4G2KA 4UCSA 1W59A 1SQVH 1R3KC 4Z1MG 4TSFG 3JAKA 4U7OA 1AB3A 1G1XB 3K0GA 4LF8B 3VQWA 2F4VB 1S5HC 1GKFA 3ZMUA 2X0LA 2UUBB 2N05A 1JMKC 4PA7A 1QQCA 3D36A 3FD9A 1H2GA 1XNRB 2KQXA 4X64O 4I50B 1BT8A 5K1PA 3QTCA 3JARA 3ZRWB 1LUVA 2GUZB 5L3GA 4UCUA 3UT5B 5IDJA 4U3FH 2LFSA 5AG2A 1HWYA 2WLNA 1VQ5V 3K06A 3UQ8A 3B09A 4UFZA 5B1OA 2LW7A 4DW0A 1ZTEA 3ZRSA 1XDCA 1E1QG 4MS2A 2UXDO 2EIKC 3CCRV 3U10A 1TUBA 3TXSA 4F6EA 5LBQA 3T1HB 5IT9N 1F4NA 2Q7HA 3CCJV 5BXZA 5JH7A 4RWUA 1V54C 3BFRA 3M7MX 5L3CA 3N2GA 2IJIA 3T4ZA 4J11A 3LDEA 4X66O 5B1BC 1KKCA 4LWSB 4MVRA 5KHKA 2ATKC 4UXNA 3B2EE 5LYJA 1GM9A 2UXNA 2P5OA 4IYIA 3FAVB 1EN5A 1MABG 1Y67A 2YC0A 2Q8VA 1PD3A 4LF7B 5KHJA 5IYZA 2Y4TA 1GH6A 4I55B 3AK1A 1FFXA 3EXAA 2KB1A 2VWKA 2NLJC 4RQEA 5CN0A 3UT5A 2IM9A 4EFBA 5E1AC 1N36O 1Q90D 1XHXA 1Y76B 4H0LB 1UJWB 3QO7A 3CE2A 3CRCA 3E8GA 3ZRWA 5BZBA 1TUBB 5EZYA 1SA0A 4JYCA 4MTOA 5KHGA 2XAGA 3FB6C 2Y69B 1MMMA 4MTXA 2YICA 3CHXA 1GM8A 3RYFA 3JYCA 3ABMC 4UVBA 5JQGA 5KUKA 2L35A 1JPXA 3TCUA 2ZCEA 3R65A 1BGYH 3AK3A 3L75H 3MHHC 4DV6B 4DR2B 3H1HH 1AI7A 1P7BA 1FYJA 2HVJC 3ZS8C 3GB7C 4PA9A 2F95B 2AW9A 3TK1A 4K0KB 3B8NA 5JJEB 4TQFA 2AHYA 4IIJB 3K5MA 3CCUV 3SPIA 4J41A 1QVFU 3TGUH 3E2EA 2CTRA 5CA1B 4DV0B 1ENVA 5FL7G 1K4DC 2BOBC 3N2KA 2E5LB 5LYJB 4FM2A 5KUMA 2RCVA 4DK1A 4JZ2A 1I5YA 3ETEA 2DOSA 2CH7B 4GYCB 1X59A 2GUZA 3MHSC 1M57B 3CCSV 2CUGA 5CA3A 4WFAV 3DTUB 1THZA 4TT3G 4FM0A 1BCCH 3K9SA 4DR6B 3E83A 3K5NA 3G71V 4GT1A 4F4LA 2DWEC 1N34O 5JJJB 3RT3C 1KMIZ 4JI1O 1M5IA 2YXLA 4Z1VA 3THOA 2RNBA 4B3SB 4X1YB 3SYQA 5CB4B 2GBOA 3TETA 1VIBA 2ZE5A 1V9PA 2WWWA 2CDYA 3OR6C 4G28B 1AROP 2RJZA 1K92A 4L8JA 5H5NA 4DR4O 3CCLV 1WPXA 1OCRC 3APOA 2WLJA 2QEXV 1GK9A 1M93A 1M4UA 4D6TH 4J10A 2WLLA 4F6RB 5CBGA 1Q81W 3C3TA 1QLNA 1H2LA 3ETGA 3CCQV 3SPJA 2E75B 2ZD9A 4XBFA 4B3MB 1SQGA 3OW2U 2HFEC 1SS3A 3PJSK 4QJFB 1JJ2U 1IVSA 2E3CA 1FXVA 4X1KA 4JI8B 2WAMA 3CXCU 1AP6A 5ITZA 3BA9A 1FAFA 5B3SB 1P7GA 3GWOA 4YIOA 1IURA 3P32A 2JEXA 4D7SA 4TUYB 2ZE8A 2P06A 5D5QA 1MA1A 2UUAB 1K33A 4G27B 4C7UA 4PA4A 4TV8A 5LHGA 2ZM6O 4GKKO 2EILB 2PZSA 1HNWB 3U11A 2X6BA 2VQEO 1L0NH 2AZ2A 2X7RB 2CTWA 5IYCO 1HW7A 2OCCB 3KZIZ 1LR1A 3GVMA 4CBCA 5KAFZ 2YIBA 2V4DA 4OGQB 4DV4B 1HNXB 3Q4HA 1JCHA 1Z5WA 4KHPB 5C8YA 2B1IA 5J2UA 2OCCC 1R1BA 2Q7EA 2ZE7A 4RO2A 3I56V 4DR5B 1FXKA 5GTHZ 2EIKB 3ABKB 1MG1A 3K79A 1AR4A 3N2KB 4PJ0Z 5IJ9A 4MVUA 4UCOA 3CC7V 1W0JG 1IBMO 4QGPA 3DC6A 2MK3A 4PHZA 5C8YB 1P4RA 5EC1C 3ZIAG 1IBMB 3CRQA 4MVOA 2EINB 4DV5B 1Q6UA 1NH2B 4ZHQB 3CJHA 4X20A 2QDOA 2JGDA 2QWOB 3JCUZ 2CTPA 4MVQA 2PI4A 1P49A 2OIEA 4UB8Z 5CB4A 4BWAA 2H94A 3D3IA 4LFCB 3AG1C 3BEHA 3ZRXA 3K9AA 5CMUA 3JAMN 4DUYB 4NKGB 4ZKIA 1Z5VA 1BZKA 3JATA 4NR1A 4TQDA 2XAQA 1NQTA 3IJ4A 4YJ3B 2UXBB 5JWPA 4BIZA 3ML0A 3JASB 4YXWG 3RYHA 3K58A 2R9AA 4GKJB 2YXYA 4JF3A 4JV5B 3WB2A 2JIZG 2BTQB 1I0HA 1JQ0A 3ASOB 3VBBA 3BVOA 2Q5ZA 4LF4B 3P30A 3CRRA 3LUTB 2XASA 3SJCC 5J2TB 1XHZA 1ZAUA 4DV1O 4LF9O 2ZNJA 3C3SA 2V7QG 1JOYA 2BSKA 3ZN1A 4NB5A 3E35A 2DWDC 3CC2V 4YY3B 2LGQA 1WAZA 4PD4F 4YJ2B 4LFAO 5B3SC 4PI2A 4IHJB 2E76B 3BABA 1VQMV 1NI8A 4DV3B 1VQNV 4JI0B 4DR4B 1OZ0A 5LHIA 3ZHTA 1EN6A 3OD4A 5DM6V 1QLEC 3F7YC 4WBNB 3JATB 4NTYA 1N33O 3FB8C 3K04A 1Q6IA 3K57A 2ZXWC 4FMTA 2ADPA 4BAYA 4KUMA 4DV2B 4LFBB 1Q5OA
chains in the Genus database with same CATH topology
3OMNB 3X2QB 2X6AA 1ZWIC 3IGAC 5B1OA 3KG2A 4HZ3A 2HLDG 1OCOB 1GO3F 2Q69A 3RW0A 3ZRSA 1AJNA 4Q20A 2W6JG 3FKSG 3LSQA 5H6QA 3M99B 1E1QG 3SJQC 1EZJA 4MS2A 3ZMTA 2EIKC 4GX5A 3CCRV 1FS0G 3E86A 4UVCA 4H37A 4H33A 5LBQA 1S3JA 3CMAV 2GHYA 1F4NA 3CCJV 4PA6A 4UV9A 4WF9V 5KA6A 1V54C 3OUFA 3AG4C 4FK5C 1H8EG 1VQOV 1K34A 5GW7A 4R50A 2CK3G 5L3CA 2WLLB 2IJIA 4P9OA 3T4ZA 1V55B 3W7UA 2IJJA 1VQPV 3LDEA 5B1BC 3RVYA 1YJNV 4MVRA 1V54B 2ATKC 4UXNA 3RVZA 1GM9A 2UXNA 1BL8A 3SPHA 2AHZA 4DO2A 1DLBA 1YITV 1CP9A 4PDRA 2DQ3A 1SZTA 4GX2A 1MABG 3ZMVA 3CD6V 5KA5A 3HPLC 3SPCA 2ZR2A 3AEIA 5H9CA 4WCEV 2QTOA 1VQ9V 1MOFA 1PD3A 2BOCC 1OCRB 2P67A 3ABTA 3T4DA 1S72V 1SESA 4UV8A 1EFRG 2KB1A 4U7NA 1MSWD 2ZR3A 3NXSA 4DXWA 5C93A 3QO8A 2NLJC 1YHQV 1Y66A 1E1RG 4RQEA 3JCZA 4RAIA 5CN0A 2EILC 5E1AC 1K9MW 5L3BA 1BHBA 1PL0A 4I9WA 1UJWB 4HYOA 1OCZC 3QO7A 2Q6AA 1S77D 2JDIG 2XOKG 3SPGA 3E8GA 3T2MA 3ZRWA 2LP7A 2QA4V 5BZBA 1R6NA 4XDLA 1N8RW 4QIWF 1J95A 4JTAB 4RUEA 4BW5A 1VQLV 4JYCA 4MTOA 5LGUA 2XAGA 3JD1A 4RQFA 3FB6C 1K8AW 2Y69B 5HFMA 4MTXA 1AI6A 1BHAA 3SYCA 3EFFK 1GM8A 5B1NA 2Z5UA 3A0RA 3JYCA 2EIJC 3ABMC 4UVBA 1AJPA 5KUKA 4R8CA 1JPXA 5EBWC 3TCUA 3R65A 3E8BA 5LGNA 2EZPA 5IY5B 1LNQA 3OAAG 4LC1A 1YSCA 3G4SV 3AG1B 3MHHC 5LGTA 3K03A 2B5UA 2DYRB 1AI7A 2ZDIA 1P7BA 1PNKA 3B77A 2HVJC 2XAHA 3FYIB 5J9PC 3W7WA 2A9HA 1QBZA 3GB7C 4PA9A 2WSSG 3ZCCA 3E8HA 3TK1A 3E89A 2OT5A 3B8NA 3SYOA 2AHYA 1KD1W 2DYRC 2HR3A 2WLIA 4PDVA 4JYBA 3CCUV 1Q82W 5EBLC 3JD0A 2WPDG 3SPIA 2LFRA 1QVFU 1YJWV 1M56C 2ZDIC 3E2EA 4FJCC 2JK5C 4JGSA 4OXSA 1ENVA 5FL7G 1K4DC 2BOBC 3STZC 4XDJA 1S0VA 3FYEB 4KP4A 1VQKV 2B1GA 5KUMA 1M56B 1I5YA 3ETEA 4UUJC 3VOUA 1VQ8V 4PA3A 4PDLA 4QNHB 1NBMG 2R9IA 3MHSC 2K1EA 1B6QA 1M57B 3CCSV 1Q7YW 1EBOA 4J9YB 5L3EA 3CCMV 4JAVA 5CA3A 2P6JA 4MSWC 1FFTB 4WFAV 3G6EV 4JTDB 1VQ4V 2P90A 3DTUB 1RPOA 1THZA 4HAMA 5L3DA 1Y4MA 2EINC 2A0LA 4TT3G 5EK0A 1JVMA 2EIMC 1QVGU 3E83A 3G71V 3ABMB 2P7TC 1AR1B 4GT1A 1E79G 4F4LA 1K5SA 1KP2A 2DWEC 1KC8W 3WFVA 3ZJZA 3AG4B 1XL6A 2WLMA 1FXKB 2XAJA 4TWKA 1AI4A 2EJRA 2NNUA 5B1AB 1R6KA 3SYQA 3OR7C 3ZMSA 3BY6A 4X88A 5CBFA 3TETA 4QPJA 3OMAB 3OUSA 1I5XA 1R3LC 1BMFG 3QNEA 2WWWA 3AG2C 5EBMC 3OM3B 1NVPB 3OR6C 4G28B 2M7WA 1AROP 1CEZA 1K92A 2W6IG 4E2LA 3CCLV 3STLC 1WPXA 1OCRC 4XDKA 4MT8A 2WLJA 3SYAA 1M9NA 3IFXA 2X6CA 2QEXV 1Q86W 3WG7C 1OCCB 3F5WC 1GK9A 1QR8A 2XNDG 2V1DA 2R9RB 3B8MA 1FXHA 2WLLA 2UXXA 4GX0A 4MW8A 4MVMA 2ZXWB 2JEUA 2JJ2G 3ZRVA 5CBGA 1Q81W 1QLNA 1AJQA 1M57C 1K5QA 1K73W 1DF4A 3ETGA 3CCQV 3SPJA 2WLKA 4P30A 1NR1A 1OCCC 4WFGA 5IYDO 1KECA 4L87A 2ZD9A 4XBFA 1CPYA 3AG3C 3LNMB 5DN6G 2DQ0A 2FTKA 3OW2U 1IXMA 1ORQC 2HFEC 3ABKC 4JASA 2F43G 4P2ZA 2DYSB 3PJSK 2YEVA 1ROPA 4LP8A 4WFFA 4QJFB 1JJ2U 3OMIB 1NKDA 3IC7A 1KKDA 1K7DA 1FXVA 2QE7G 3FB5C 2YSUB 3OFNG 2WAMA 3CXCU 2Q68A 2IW5A 2Y69C 5B3SB 3CPWU 5L3FA 2DYSC 3OE7G 2HJFC 3GWOA 1SERA 3OEHG 2IU3A 4FIPC 2EBOA 3P32A 5B1AC 2JEXA 1YTFD 3E8FA 1VQ7V 1R73A 1QCEA 2C2AA 1G8MA 1K33A 3CC4V 3FB7C 4R6ZA 3CYOA 4G27B 1V55C 4PA4A 4R7CA 1JX9A 1RM1C 5LHGA 2Y48A 5B1BB 4JTCB 1YJ9V 4LCUC 1DF5A 1PNMA 2EILB 1F4MA 2X6BA 3CCEV 4RUFA 4N21A 3W7XA 2X7RB 4QPKA 5IYCO 2JJ1G 2OCCB 3LDCA 3HB3B 3OEEG 3EHBB 4CBCA 3W7SA 2ITCC 1W0KG 4X89A 1M90W 1JCHA 3QO5A 3CP1A 4WFEA 3K0DA 2B1IA 2OCCC 4PDMA 4RO2A 3I56V 1FXKA 2EIKB 5CBHA 3ABKB 1MG1A 3K79A 2QM7A 1YIJV 3ETDA 2D3OW 1NH2D 3CC7V 4MVUA 1W0JG 2GSMB 2MK3A 3K3WA 3LSSA 1F51A 3ASNC 1SETA 4GCZA 1P4RA 1F23A 1RPRA 2A79B 2WLIB 5EC1C 3ZIAG 3UKMA 2XAFA 4P9PA 4MVOA 2HVKC 2EINB 1YI2V 3MD0A 5HFLA 5IYBO 1NH2B 1GM7A 1NR7A 3ABUA 1PNLA 4EKWA 3ASNB 3T1CA 5H6RA 4MTFA 1KQSU 1GTOA 4MVQA 1FXKC 2IJKA 3JD2A 2PI4A 3W7TA 2EIJB 3UM7A 1DTOA 1SRYA 3RBZA 1KP3A 1K4CC 1RM1B 2IJHA 2H94A 3D3IA 2OTLV 1YTFB 3CCVV 3ZN0A 3LDDA 3AG1C 4QE9A 1R3JC 3BEHA 4WFBV 4WFHA 3ZRXA 3K08A 3K9AA 2HKOA 5CMUA 1WLEA 1W2BU 4CZZA 4ZKIA 4ZBMA 3AG2B 4BIUA 5LHHA 2IH3C 2XAQA 1NQTA 4GX1A 4UVAA 3ZMZA 4BIZA 4KFMA 1TUEB 3ML0A 1QR9A 2Z3YA 1PKXA 3H01A 4YXWG 3JD4A 4J9ZB 2WLHA 4JF3A 3WG7B 4N23A 2HG5C 2JIZG 2QKSA 1H38A 2ITDC 4ASUG 1S76D 1OCZB 1JQ0A 3SYPA 4MVSA 3ASOB 2PI5A 3VBBA 3X2QC 1G4YB 4I5SA 1AI5A 1OCOC 1OHHG 3OGCC 3P30A 1COWG 3I55V 3LUTB 2XASA 4FPPA 1VQ6V 2OTJV 1M1KW 3F7VC 5EC2C 3AG3B 1K97A 3ASOC 1H8HG 4JPRA 2H8PC 1NVPD 4QE7A 4X8AA 2IU0A 2V7QG 2YEVB 1JOYA 3JD3A 1L1FA 2W0FC 4MW3A 4MVZA 3ZN1A 3E35A 2DWDC 2QM8A 3CC2V 4G2KA 1K3EA 2ZQMA 5IY5C 4MTGA 1R3KC 4PELA 4JAUA 4Z1MG 4TSFG 3ABLC 4U7OA 5B3SC 2EIMB 2Q67A 3K0GA 1S5HC 1VQMV 1GKFA 1NJIW 3ZMUA 1VQNV 2X0LA 3ABLB 2DW4A 1OZ0A 5LHIA 4PA7A 5DM6V 1QLEC 3CMEV 3D36A 3F7YC 1H2GA 1GMGA 3FB8C 3K04A 1R3IC 1XL4A 4LBEC 2ZXWC 3ZRWB 4FMTA 5L3GA 5IDJA 2LFSA 2EZOA 1QLEB 3DGEA 4BAYA 4KUMA 1HWYA 2WLNA 2IH1C 1VQ5V 3K06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JPR A;  5H9C A;  5KA6 A;  1MG1 A;  4JGS A;  1ENV A;  1MOF A;  1DF5 A;  1Y4M A;  2LP7 A;  3MHH C;  4FJC C;  4FK5 C;  1I5X A;  1QR9 A;  1K34 A;  3H01 A;  3GWO A;  1DF4 A;  3B77 A;  4N21 A;  2MK3 A;  2X7R B;  4JF3 A;  4G2K A;  4FIP C;  4N23 A;  2EBO A;  1QBZ A;  3M99 B;  2M7W A;  1F23 A;  1JQ0 A;  3WFV A;  1QCE A;  1I5Y A;  1Y66 A;  4E2L A;  2OT5 A;  3B8N A;  5HFM A;  1K33 A;  5CN0 A;  5HFL A;  1DLB A;  3K9A A;  3MHS C;  5CMU A;  2EZO A;  1EBO A;  3P30 A;  3CYO A;  2P6J A;  1SZT A;  3CP1 A;  1JPX A;  1QR8 A;  5KA5 A;  2EZP A;  3B8M A; 
#chains in the Genus database with same CATH topology
 4B3T O;  3IGA C;  3N27 A;  1VF7 A;  3KG2 A;  3UO3 A;  4LFC O;  4HZ3 A;  1GO3 F;  2GTS A;  2Q69 A;  1AJN A;  5E79 Z;  3FKS G;  4FLZ A;  5LOV A;  3ZMT A;  3BPZ A;  3HKD A;  4H37 A;  4H33 A;  2LW1 A;  4CS4 A;  3CMA V;  2GHY A;  2JS3 A;  2CGO A;  3RYC B;  5IJ9 B;  5KA6 A;  1D5N A;  4FK5 C;  1B3Q A;  2CAZ C;  2YXH A;  4IL6 Z;  2CK3 G;  2WLL B;  4P9O A;  1V55 B;  3W7U A;  1GAX A;  2IJJ A;  1FJG B;  3MAQ A;  3FFQ A;  1V54 B;  4ZIB A;  1BL8 A;  2PF4 E;  2AHZ A;  3SPH A;  3QF7 A;  3SJB C;  4LF5 O;  1U97 A;  4DR5 O;  1SZT A;  4GX2 A;  3ZMV A;  1Z2G A;  3SPC A;  3AEI A;  1IBK O;  3L71 H;  1NTK H;  2QTO A;  4WCE V;  1MOF A;  1OCR B;  1HNZ B;  2P67 A;  4I9Q A;  2BCC H;  3T4D A;  4DV7 B;  4UV8 A;  3NXS A;  5C93 A;  4FM1 A;  3QO8 A;  1YHQ V;  1E1R G;  3JCZ A;  4RAI A;  4JI5 O;  1J5E O;  4H13 B;  4LH7 A;  4JYA B;  4HYO A;  2QSA A;  1S77 D;  2JDI G;  4JI7 B;  2LP7 A;  3HKB A;  2QA4 V;  4XDL A;  4B7E A;  1IBK B;  4QIW F;  5CA0 B;  4JTA B;  5TIS Z;  4O2A B;  1KUQ A;  2QWQ B;  4J7Z A;  4IT5 A;  1I94 B;  3IAY A;  3ZHS A;  4PI0 A;  1AJP A;  5A9G A;  3D36 C;  3E8B A;  2EZP A;  3OAA G;  1Q43 A;  4JI3 O;  1TGO A;  2KSD A;  5LGT A;  4DR1 O;  1PNK A;  3B77 A;  2W0X A;  3L9D A;  5J9P C;  3W7W A;  2A9H A;  4AHC A;  1BS3 A;  2QWN B;  3E89 A;  2JRI A;  4TOI A;  2KKW A;  3SYO A;  1KD1 W;  5FNV B;  3DSQ A;  1N0N A;  4JYB A;  3SJA C;  1SF9 A;  2WPD G;  2NN4 A;  2ZDI C;  4U3J B;  4FLY A;  4LF6 B;  4XDJ A;  2Z0A A;  1S0V A;  4LFB O;  2Y0P A;  5IWA O;  4YJ2 A;  4KP4 A;  1QU7 A;  4UUJ C;  1VQ8 V;  5KHI A;  1HP8 A;  4PA3 A;  2R9I A;  2K1E A;  1EBO A;  3CCM V;  2P6J A;  4MSW C;  4FLW A;  2F93 B;  3HKC B;  4WBN A;  1B04 A;  5L3D A;  1FD9 A;  2LO1 A;  5JVD B;  4JI0 O;  2EIN C;  2JVD A;  1JVM A;  1N34 B;  2EIM C;  1H2N A;  4JI3 B;  3ABM B;  2P7T C;  4J7J A;  3CWB H;  1E79 G;  1Y76 A;  5A2Q N;  2L6L A;  1K5S A;  3WFV A;  2Q9L A;  4DR6 O;  4OX9 O;  3ZJZ A;  1NT2 B;  3AG4 B;  5GON B;  4JI4 B;  2XAJ A;  5BY1 A;  1AI4 A;  2OCH A;  1GN3 A;  2EJR A;  4YY3 O;  2NNU A;  1YF2 A;  4DR1 B;  4QPJ A;  3OUS A;  2BSK B;  4TV9 B;  3OTF A;  4F6R A;  1I5X A;  1ZL8 A;  2PY5 A;  1VMG A;  3QNE A;  1VF5 B;  5EBM C;  4KXR A;  2Q73 A;  5LMN B;  1CEZ A;  5EYP B;  1IX9 A;  2P4V A;  4JI5 B;  1M9N A;  3IFX A;  4FFB B;  4IGG A;  4HBN A;  2XND G;  2R9R B;  3B8M A;  2YS8 A;  4GX0 A;  2JJ2 G;  4K0K O;  2YID A;  2WA3 A;  1AJQ A;  3G80 A;  2WLK A;  4P30 A;  1NR1 A;  1GN6 A;  1KEC A;  4EEQ A;  3GWK C;  2DJV A;  3LNM B;  4DUY O;  5DN6 G;  2DQ0 A;  4DR2 O;  4ZOL B;  3CS5 A;  2F66 C;  2DYS B;  4WFF A;  5GTI Z;  1ROP A;  1BQZ A;  2VQF O;  3FB5 C;  5K1X A;  2A06 H;  2Q68 A;  2IW5 A;  2A3Q A;  4ZOL A;  2DYS C;  3CB2 A;  4K3A A;  1SER A;  3OEH G;  1WA8 A;  3R66 A;  4FIP C;  2EBO A;  5B1A C;  4ICG A;  4J42 A;  4NYK A;  1KBH A;  4DV5 O;  4O4L B;  4LF5 B;  2JGD B;  1G8M A;  2OWO A;  3FB7 C;  2CE4 A;  4R6Z A;  4OX9 B;  1RM1 C;  5B1B B;  3ICX A;  4LCU C;  4FFK A;  4K8X A;  4K8Z A;  1F4M A;  4RUF A;  3ZX6 A;  4N21 A;  2QM4 A;  1VF6 C;  2M6Y A;  4KHP O;  4DK0 A;  3J7A U;  5JJN B;  3OEE G;  2K9P A;  2WA4 A;  1GN2 A;  3QO5 A;  4NTW A;  3CP1 A;  3K0D A;  2VQE B;  3T1Y B;  5CBH A;  2QKA A;  1SQP H;  2QM7 A;  1YIJ V;  1NH2 D;  2ZM6 B;  1I7F A;  3LSS A;  4FFB A;  3UCS C;  2QR4 A;  4JZG A;  3UKM A;  2XAF A;  1B06 A;  1YI2 V;  1ZL8 B;  4K35 A;  5IYB O;  3ABU A;  3O9O A;  2Q7G A;  1XQ8 A;  4HNA A;  3K59 A;  4DV1 B;  4LF9 B;  4FZ0 A;  2EIJ B;  1VP7 A;  1SRY A;  3B4S A;  3ZHQ A;  2OTL V;  3ZN0 A;  4DRX A;  4LFA B;  2XUM A;  2HKO A;  1W2B U;  1WLE A;  1R6T A;  3P3N A;  4I50 A;  4ZBM A;  2IH3 C;  1XUQ A;  5CA0 A;  1WA8 B;  3WB0 A;  2ZIO A;  1KU9 A;  3HKB B;  3ZMZ A;  1QR9 A;  1PKX A;  3H01 A;  4X65 O;  1Y74 B;  4YIP A;  2Q4P A;  4N23 A;  4ASU G;  2HEP A;  1OCZ B;  3SGI A;  2HHH O;  4MVS A;  1G4Y B;  2FL4 A;  4IIJ A;  4O4H B;  5CA1 A;  1SC5 B;  1WJZ A;  3RYC A;  2F4V O;  3I55 V;  2BE3 A;  3T1Y O;  2N74 A;  4U3J A;  1VQ6 V;  3F7V C;  4DV7 O;  3ASO C;  1H8H G;  1PP9 H;  1VF6 A;  1PPJ H;  2ADQ B;  3ZHU A;  2YDE A;  2UXB O;  1I08 A;  4LNU A;  2W0F C;  1JFF B;  4MVZ A;  1AR5 A;  4B3S O;  1K3E A;  2YI8 A;  4DW1 A;  2ZQM A;  4PEL A;  4JAU A;  3ABL C;  2PYJ A;  3CRA A;  4X1I B;  2E74 B;  5BR8 O;  3AK2 A;  4BW9 A;  4I7Z B;  4AQY B;  3ABL B;  4FZ1 A;  1YEW A;  4KL1 A;  1WB8 A;  4JAA A;  1GMG A;  4LR3 A;  5LA6 B;  1R3I C;  1XL4 A;  2ZT9 B;  4O2B A;  4CC6 A;  1QLE B;  2IH1 C;  5BR8 B;  2P22 C;  3OMN B;  3X2Q B;  1VAR A;  1AIL A;  1OCO B;  3RW0 A;  4I55 A;  4OPH A;  3BCC H;  3M99 B;  4GUN A;  3SJQ C;  4I0X B;  4NXN B;  1FS0 G;  3E86 A;  4UB6 Z;  3KCY A;  4UVC A;  3I5D A;  1N33 B;  4UV9 A;  4WF9 V;  4GKK B;  2FML A;  3OUF A;  3AG4 C;  1H8E G;  3HKD B;  1VQO V;  1K34 A;  5GW7 A;  1RSO B;  5BMV B;  2CH7 A;  4DV3 O;  5KX5 A;  1XI1 A;  3VQV A;  1QNM A;  5BMV A;  3D3Q A;  2R70 A;  4IHJ A;  1YJN V;  4X65 B;  4O4H A;  1YIT V;  4Z2W A;  1CP9 A;  1YZB A;  4NVP A;  5KA5 A;  3HPL C;  1NS1 A;  2GTA A;  4JYY A;  4JI4 O;  4FVM A;  3ABT A;  3JSN A;  4J7K A;  5LMU B;  4CS2 A;  1S72 V;  1SES A;  1N32 O;  5EZY B;  5B66 Z;  1N36 B;  2ZR3 A;  4DXW A;  1Y66 A;  3CXH F;  4B3M O;  1K9M W;  1UPG A;  5L3B A;  4OPA A;  1BHB A;  4YJ3 A;  5KMG B;  3SDL A;  1OCZ C;  4O2B B;  3SPG A;  2XOK G;  3T2M A;  5LXT A;  4J80 A;  1R6N A;  1XRE A;  3U0Z A;  4RUE A;  1FFX B;  3QVN A;  4AIL C;  1VQL V;  3JD1 A;  2GV9 A;  1GRJ A;  4RQF A;  1HDJ A;  3J81 N;  5IWA B;  3VQY A;  1BHA A;  3EFF K;  2UUC O;  3UO2 A;  4X66 B;  5IJ0 B;  5J2U B;  4R8C A;  5LGN A;  5IY5 B;  3H1J H;  4DR7 O;  2EX3 A;  2FB5 A;  1TVK B;  3A0H Z;  3AG1 B;  3JAK B;  3K03 A;  2B5U A;  2DYR B;  4I4T B;  2AZ0 A;  2XAH A;  1S5L Z;  5LL6 Y;  3T1H O;  1MZE A;  1QBZ A;  2MW2 B;  2WSS G;  3E8H A;  4GZR B;  4BR6 A;  2XTA A;  3C90 A;  4PDV A;  2BTO A;  3FX7 A;  2LFR A;  1M56 C;  1AP5 A;  4D7T A;  2JK5 C;  4JGS A;  4O4I A;  2QJ1 A;  4DV0 O;  2DE0 X;  5J2T A;  1VQK V;  2JGU A;  1M56 B;  1G6U A;  4A5U B;  1HNX O;  4PDL A;  4QNH B;  4DV4 O;  1NBM G;  4AI8 A;  2HP8 A;  1Q7Y W;  4J9Y B;  1TA8 A;  5L3E A;  4JI7 O;  1F7Y A;  4JAV A;  1HR0 O;  1FFT B;  4JTD B;  2E5L O;  3L73 H;  5EK0 A;  1J5E B;  3E22 B;  1QVG U;  1WP8 A;  1AR1 B;  4LF8 O;  3QG5 A;  4DUZ B;  5FPR A;  1XL6 A;  2WLM A;  1HNZ O;  1FXK B;  2OYQ A;  1OV9 A;  4X9Q A;  1NZ6 A;  1R6K A;  3OR7 C;  3ZMS A;  4EFE A;  5CBF A;  4B08 A;  3OMA B;  4LNU B;  3WB1 A;  1N4C A;  1XMQ O;  1BMF G;  5LMN O;  2P4K A;  2QWP B;  1FJG O;  3S3W A;  4PV1 B;  2PUS A;  1SQB H;  2W6I G;  4E2L A;  2N04 A;  2UXC O;  3STL C;  4XDK A;  1H2S B;  4MT8 A;  3SYA A;  3F5W C;  4MVM A;  2JEU A;  1RFY A;  1D2D A;  2NR5 A;  1ZSP A;  1M57 C;  1K5Q A;  1DF4 A;  4WFG A;  5IYD O;  2LJ2 A;  3ABK C;  4CS3 A;  2RMK B;  4LP8 A;  3OMI B;  1NKD A;  3IC7 A;  1K7D A;  4B3T B;  2QE7 G;  3APQ A;  4DV2 O;  1PL4 A;  3OGI B;  3CPW U;  3RN4 A;  3OE7 G;  5D5P A;  2IU3 A;  1VQ7 V;  3PN1 A;  1R73 A;  1QHT A;  4W4K A;  2A7W A;  1O9H A;  1XBL A;  4LF6 O;  3BRC A;  3LSU A;  2GDS A;  1AVM A;  2Y48 A;  4JTC B;  1YJ9 V;  1PNM A;  1XIL A;  1T5E A;  1YDX A;  4BIO A;  3CCE V;  1LUW A;  1IDS A;  3W7X A;  2Y4U A;  4QPK A;  2Q0A A;  3JAW B;  4X1K B;  1NU1 H;  2FYU H;  3HB3 B;  3EHB B;  4FLV A;  3W7S A;  1TVK A;  4X89 A;  5B5E Z;  2EJ7 A;  2ZIM A;  1M90 W;  4WFE A;  5JQG B;  4ZI7 A;  2ZKO A;  4LF4 O;  3ETD A;  3RYI B;  1I94 O;  2ZNI A;  3L72 H;  2UUB O;  2GSM B;  2YIB D;  2JS5 A;  2UU9 B;  1F51 A;  4GCZ A;  1RPR A;  1WP7 A;  2A79 B;  4P9P A;  4ABM A;  2HVK C;  3F5T A;  3P3P A;  1H2K A;  5LOV B;  3BAA A;  3G67 A;  1GM7 A;  1NR7 A;  4EKW A;  4JYA O;  3T1C A;  5H6R A;  3JSL A;  4MTF A;  1US6 A;  1CXZ B;  4Q6G A;  1FXK C;  2IJK A;  3JD2 A;  3RYF B;  1VEW A;  2CGN A;  5EYP A;  3RBZ A;  1RM1 B;  2IJH A;  2IBZ H;  3CCV V;  4DR3 O;  4QE9 A;  5JVD A;  3K08 A;  5LXT B;  4BIU A;  1IXB A;  1WB7 A;  5LHH A;  1PV0 A;  1EZV H;  1URF A;  4UVA A;  2PYL A;  1TUE B;  2Z3Y A;  1XEQ A;  5GON A;  4J9Z B;  3A0B Z;  4EB6 B;  4CH3 A;  2QKS A;  1H38 A;  2ZE6 A;  2ITD C;  1S76 D;  4I4T A;  2DMX A;  2PI5 A;  4JI2 O;  1TAE A;  5FNV A;  4I5S A;  4O4J A;  1AI5 A;  3B40 A;  1OHH G;  2VWJ A;  2OTJ V;  1M1K W;  1Q3E A;  5EC2 C;  3AG3 B;  1NVP D;  4O4I B;  1WPB A;  4QE7 A;  3CSX A;  2YEV B;  3DXR B;  3FAV A;  3JD3 A;  1L1F A;  2OIG A;  4MW3 A;  4NXM O;  1MNG A;  3CEI A;  4ZI7 B;  4NXM B;  5IY5 C;  1EN4 A;  4MTG A;  2QWR B;  2YI9 A;  3HKE A;  1HNW O;  3ZHR A;  2EIM B;  2Q67 A;  2BTQ A;  5JH7 B;  2RDC A;  2QTS A;  1NJI W;  3A2F A;  4E4E A;  2DW4 A;  1IBL O;  4H44 B;  3CME V;  4UCR A;  2UUA O;  3KCX A;  4LBE C;  1ZLZ A;  4I0X A;  4FLT A;  2EZO A;  2Y0I A;  3DGE A;  1SA0 B;  1YVW A;  1FKA O;  4JI8 O;  2X6A A;  1ZWI C;  4LWS A;  3E22 A;  1SQQ H;  4DR3 B;  2HLD G;  1P84 F;  1UFI A;  1YXB A;  4DUZ O;  4Q20 A;  2W6J G;  3LSQ A;  5KX5 B;  5H6Q A;  1JFF A;  1EZJ A;  1XOU A;  3OT7 A;  4GX5 A;  1XNQ B;  4UCV A;  2EUL A;  1S3J A;  1HR0 B;  3A8T A;  3RFR A;  1S5J A;  4PA6 A;  4R50 A;  4FLU A;  4CC5 A;  2UU9 O;  1VQP V;  4X1I A;  2LQT A;  3RVY A;  4JV5 O;  2KG7 A;  3IC9 A;  3RVZ A;  4GKJ O;  4DO2 A;  1DLB A;  4PDR A;  2DQ3 A;  1O9G A;  2CTQ A;  3CD6 V;  3BA8 A;  3RWR D;  4JI6 O;  2ZR2 A;  3AG7 A;  1NTZ H;  5H9C A;  1VQ9 V;  5KHH A;  2BOC C;  4JI1 B;  3L74 H;  3JAL A;  3S3X A;  5JCO C;  1EFR G;  4X1Y A;  4U7N A;  1MSW D;  5EIB C;  3ZHV A;  2F23 A;  5IJ0 A;  4UCT A;  4B7K A;  2EIL C;  2D2C B;  1PL0 A;  4I9W A;  3ETQ A;  2AGA A;  2Q6A A;  1RP3 B;  1N8R W;  4DRX B;  3JAR B;  1J95 A;  4BW5 A;  5LGU A;  5F2V O;  1N0J A;  5KMG A;  1H2M A;  4CH4 A;  1K8A W;  2O57 A;  5HFM A;  1AI6 A;  3SYC A;  2VS0 A;  5B1N A;  3TXQ A;  2Z5U A;  1L0L H;  2G38 A;  3A0R A;  3TJT A;  2EIJ C;  5EBW C;  1LNQ A;  4LC1 A;  1YSC A;  5DED A;  3G4S V;  2DN9 A;  2VRZ A;  2LGW A;  2ZDI A;  3FYI B;  1YCI A;  1N32 B;  4NTX A;  5LMU O;  3DXR A;  3ZCC A;  3K5O A;  4W4L A;  1DGS A;  2OT5 A;  5DEC A;  3JAL B;  4DV6 O;  2DYR C;  2HR3 A;  2WLI A;  4GLX A;  1Q82 W;  5EBL C;  3JD0 A;  1YJW V;  4FJC C;  4OXS A;  3STZ C;  3LNN A;  3FYE B;  2B1G A;  1XMQ B;  2ILM A;  3VOU A;  1ZUQ A;  1B6Q A;  3MDS A;  1JJO A;  3G6E V;  1VQ4 V;  1XMO B;  2P90 A;  1RPO A;  4HAM A;  3VQX A;  5JCO A;  1Y4M A;  1Q6H A;  2ZIN A;  5LP6 C;  2A0L A;  3H1I H;  2QGN A;  2YIA A;  1X4T A;  1KP2 A;  1KC8 W;  4ZHQ A;  4EB6 A;  3NR7 A;  5LP6 B;  3RYH B;  4LF7 O;  4X20 B;  4TWK A;  5H2F Z;  4O4L A;  1SKV A;  3H9V A;  5LA6 A;  1JR9 A;  5B1A B;  1L8D A;  3BY6 A;  3CRM A;  4X88 A;  4HNA B;  1WN7 A;  1R3L C;  3L70 H;  1MZF A;  3AG2 C;  3HR0 A;  3OM3 B;  1NVP B;  2M7W A;  3RYI A;  4JI2 B;  4O4J B;  2X6C A;  1Q86 W;  3BHP A;  3WG7 C;  1OCC B;  1QR8 A;  3JAW A;  4B3R B;  1Y6X A;  1JA8 A;  2V1D A;  4MW8 A;  1FXH A;  2UXX A;  2ZXW B;  3ZRV A;  3JAS A;  1K73 W;  3HKE B;  3J80 N;  5KAI Z;  2UXD B;  1OCC C;  4L87 A;  4TV8 B;  4B3R O;  1CPY A;  3AG3 C;  2FTK A;  1IXM A;  1ORQ C;  4P2Z A;  4JAS A;  2F43 G;  2YEV A;  4DR7 B;  5KLV H;  1KKD A;  3OFN G;  3H1L H;  2YSU B;  1SQF A;  2Y69 C;  2UUC B;  4TV9 A;  1FPO A;  5L3F A;  1BE3 H;  1NTM H;  3ZBH A;  2HHH B;  2HJF C;  5ITZ B;  4JI6 B;  4X64 B;  2H3O A;  1XNR O;  1YTF D;  3E8F A;  1QCE A;  2C2A A;  3CC4 V;  2QKC A;  3O65 A;  1XNQ O;  3CYO A;  1BQ0 A;  1V55 C;  3CJH B;  4R7C A;  1JX9 A;  3ZED A;  1D5A A;  1DF5 A;  3EVK A;  2PTM A;  1XMO O;  2JJ1 G;  3LDC A;  4YHH B;  1PM9 A;  2ITC C;  1W0K G;  3K5L A;  1MSD A;  2RQ6 A;  2R72 A;  2ARH A;  3N2G B;  3Q4H B;  4PDM A;  3CX5 F;  1BSM A;  4FLX A;  2XT9 A;  1SQX H;  1EM1 A;  2D3O W;  5IE9 A;  2YUA A;  2ODM A;  3K3W A;  3ASN C;  3SR2 C;  4X62 B;  1SET A;  1F23 A;  2WLI B;  3MD0 A;  5HFL A;  3OTO B;  2AXT Z;  3G6B A;  4CH6 A;  1PNL A;  3ASN B;  1Y74 A;  1IBL B;  1KQS U;  4NXN O;  1GTO A;  3W7T A;  4DYL A;  2ETN A;  3KKY A;  3UM7 A;  1DTO A;  2Q0O C;  1KP3 A;  1K4C C;  3RGB A;  1GN4 A;  1DK1 A;  1YTF B;  2HJD A;  2FKX A;  3LDD A;  5LP6 A;  1R3J C;  3WU2 Z;  4WFB V;  4WFH A;  2F1M A;  4CZZ A;  1IZ3 A;  2B9Z A;  4IYH A;  1KB9 F;  3AG2 B;  4GX1 A;  5EIB D;  3HKC A;  5IYZ B;  5FPO A;  2RN9 A;  3OTO O;  2PGG A;  4KFM A;  1WNS A;  3JD4 A;  2WLH A;  3WG7 B;  2HG5 C;  2XHB A;  4X62 O;  4TUY A;  3SYP A;  5FLX N;  3H1K H;  3X2Q C;  1OJH A;  2UXC B;  4AQY O;  1OCO C;  3DC5 A;  3OGC C;  1KYO F;  1COW G;  1SZX A;  4FPP A;  3M8A A;  4CH5 A;  1RSO A;  1ZX3 A;  1K97 A;  2VQF B;  4JPR A;  2H8P C;  4LH6 A;  3D8C A;  4X8A A;  2IU0 A;  1A32 A;  1Q8I A;  4O2A A;  4YHH O;  2KG7 B;  1U96 A;  2QM8 A;  4G2K A;  4UCS A;  1W59 A;  1SQV H;  1R3K C;  4Z1M G;  4TSF G;  3JAK A;  4U7O A;  1AB3 A;  1G1X B;  3K0G A;  4LF8 B;  3VQW A;  2F4V B;  1S5H C;  1GKF A;  3ZMU A;  2X0L A;  2UUB B;  2N05 A;  1JMK C;  4PA7 A;  1QQC A;  3D36 A;  3FD9 A;  1H2G A;  1XNR B;  2KQX A;  4X64 O;  4I50 B;  1BT8 A;  5K1P A;  3QTC A;  3JAR A;  3ZRW B;  1LUV A;  2GUZ B;  5L3G A;  4UCU A;  3UT5 B;  5IDJ A;  4U3F H;  2LFS A;  5AG2 A;  1HWY A;  2WLN A;  1VQ5 V;  3K06 A;  3UQ8 A;  3B09 A;  4UFZ A;  5B1O A;  2LW7 A;  4DW0 A;  1ZTE A;  3ZRS A;  1XDC A;  1E1Q G;  4MS2 A;  2UXD O;  2EIK C;  3CCR V;  3U10 A;  1TUB A;  3TXS A;  4F6E A;  5LBQ A;  3T1H B;  5IT9 N;  1F4N A;  2Q7H A;  3CCJ V;  5BXZ A;  5JH7 A;  4RWU A;  1V54 C;  3BFR A;  3M7M X;  5L3C A;  3N2G A;  2IJI A;  3T4Z A;  4J11 A;  3LDE A;  4X66 O;  5B1B C;  1KKC A;  4LWS B;  4MVR A;  5KHK A;  2ATK C;  4UXN A;  3B2E E;  5LYJ A;  1GM9 A;  2UXN A;  2P5O A;  4IYI A;  3FAV B;  1EN5 A;  1MAB G;  1Y67 A;  2YC0 A;  2Q8V A;  1PD3 A;  4LF7 B;  5KHJ A;  5IYZ A;  2Y4T A;  1GH6 A;  4I55 B;  3AK1 A;  1FFX A;  3EXA A;  2KB1 A;  2VWK A;  2NLJ C;  4RQE A;  5CN0 A;  3UT5 A;  2IM9 A;  4EFB A;  5E1A C;  1N36 O;  1Q90 D;  1XHX A;  1Y76 B;  4H0L B;  1UJW B;  3QO7 A;  3CE2 A;  3CRC A;  3E8G A;  3ZRW A;  5BZB A;  1TUB B;  5EZY A;  1SA0 A;  4JYC A;  4MTO A;  5KHG A;  2XAG A;  3FB6 C;  2Y69 B;  1MMM A;  4MTX A;  2YIC A;  3CHX A;  1GM8 A;  3RYF A;  3JYC A;  3ABM C;  4UVB A;  5JQG A;  5KUK A;  2L35 A;  1JPX A;  3TCU A;  2ZCE A;  3R65 A;  1BGY H;  3AK3 A;  3L75 H;  3MHH C;  4DV6 B;  4DR2 B;  3H1H H;  1AI7 A;  1P7B A;  1FYJ A;  2HVJ C;  3ZS8 C;  3GB7 C;  4PA9 A;  2F95 B;  2AW9 A;  3TK1 A;  4K0K B;  3B8N A;  5JJE B;  4TQF A;  2AHY A;  4IIJ B;  3K5M A;  3CCU V;  3SPI A;  4J41 A;  1QVF U;  3TGU H;  3E2E A;  2CTR A;  5CA1 B;  4DV0 B;  1ENV A;  5FL7 G;  1K4D C;  2BOB C;  3N2K A;  2E5L B;  5LYJ B;  4FM2 A;  5KUM A;  2RCV A;  4DK1 A;  4JZ2 A;  1I5Y A;  3ETE A;  2DOS A;  2CH7 B;  4GYC B;  1X59 A;  2GUZ A;  3MHS C;  1M57 B;  3CCS V;  2CUG A;  5CA3 A;  4WFA V;  3DTU B;  1THZ A;  4TT3 G;  4FM0 A;  1BCC H;  3K9S A;  4DR6 B;  3E83 A;  3K5N A;  3G71 V;  4GT1 A;  4F4L A;  2DWE C;  1N34 O;  5JJJ B;  3RT3 C;  1KMI Z;  4JI1 O;  1M5I A;  2YXL A;  4Z1V A;  3THO A;  2RNB A;  4B3S B;  4X1Y B;  3SYQ A;  5CB4 B;  2GBO A;  3TET A;  1VIB A;  2ZE5 A;  1V9P A;  2WWW A;  2CDY A;  3OR6 C;  4G28 B;  1ARO P;  2RJZ A;  1K92 A;  4L8J A;  5H5N A;  4DR4 O;  3CCL V;  1WPX A;  1OCR C;  3APO A;  2WLJ A;  2QEX V;  1GK9 A;  1M93 A;  1M4U A;  4D6T H;  4J10 A;  2WLL A;  4F6R B;  5CBG A;  1Q81 W;  3C3T A;  1QLN A;  1H2L A;  3ETG A;  3CCQ V;  3SPJ A;  2E75 B;  2ZD9 A;  4XBF A;  4B3M B;  1SQG A;  3OW2 U;  2HFE C;  1SS3 A;  3PJS K;  4QJF B;  1JJ2 U;  1IVS A;  2E3C A;  1FXV A;  4X1K A;  4JI8 B;  2WAM A;  3CXC U;  1AP6 A;  5ITZ A;  3BA9 A;  1FAF A;  5B3S B;  1P7G A;  3GWO A;  4YIO A;  1IUR A;  3P32 A;  2JEX A;  4D7S A;  4TUY B;  2ZE8 A;  2P06 A;  5D5Q A;  1MA1 A;  2UUA B;  1K33 A;  4G27 B;  4C7U A;  4PA4 A;  4TV8 A;  5LHG A;  2ZM6 O;  4GKK O;  2EIL B;  2PZS A;  1HNW B;  3U11 A;  2X6B A;  2VQE O;  1L0N H;  2AZ2 A;  2X7R B;  2CTW A;  5IYC O;  1HW7 A;  2OCC B;  3KZI Z;  1LR1 A;  3GVM A;  4CBC A;  5KAF Z;  2YIB A;  2V4D A;  4OGQ B;  4DV4 B;  1HNX B;  3Q4H A;  1JCH A;  1Z5W A;  4KHP B;  5C8Y A;  2B1I A;  5J2U A;  2OCC C;  1R1B A;  2Q7E A;  2ZE7 A;  4RO2 A;  3I56 V;  4DR5 B;  1FXK A;  5GTH Z;  2EIK B;  3ABK B;  1MG1 A;  3K79 A;  1AR4 A;  3N2K B;  4PJ0 Z;  5IJ9 A;  4MVU A;  4UCO A;  3CC7 V;  1W0J G;  1IBM O;  4QGP A;  3DC6 A;  2MK3 A;  4PHZ A;  5C8Y B;  1P4R A;  5EC1 C;  3ZIA G;  1IBM B;  3CRQ A;  4MVO A;  2EIN B;  4DV5 B;  1Q6U A;  1NH2 B;  4ZHQ B;  3CJH A;  4X20 A;  2QDO A;  2JGD A;  2QWO B;  3JCU Z;  2CTP A;  4MVQ A;  2PI4 A;  1P49 A;  2OIE A;  4UB8 Z;  5CB4 A;  4BWA A;  2H94 A;  3D3I A;  4LFC B;  3AG1 C;  3BEH A;  3ZRX A;  3K9A A;  5CMU A;  3JAM N;  4DUY B;  4NKG B;  4ZKI A;  1Z5V A;  1BZK A;  3JAT A;  4NR1 A;  4TQD A;  2XAQ A;  1NQT A;  3IJ4 A;  4YJ3 B;  2UXB B;  5JWP A;  4BIZ A;  3ML0 A;  3JAS B;  4YXW G;  3RYH A;  3K58 A;  2R9A A;  4GKJ B;  2YXY A;  4JF3 A;  4JV5 B;  3WB2 A;  2JIZ G;  2BTQ B;  1I0H A;  1JQ0 A;  3ASO B;  3VBB A;  3BVO A;  2Q5Z A;  4LF4 B;  3P30 A;  3CRR A;  3LUT B;  2XAS A;  3SJC C;  5J2T B;  1XHZ A;  1ZAU A;  4DV1 O;  4LF9 O;  2ZNJ A;  3C3S A;  2V7Q G;  1JOY A;  2BSK A;  3ZN1 A;  4NB5 A;  3E35 A;  2DWD C;  3CC2 V;  4YY3 B;  2LGQ A;  1WAZ A;  4PD4 F;  4YJ2 B;  4LFA O;  5B3S C;  4PI2 A;  4IHJ B;  2E76 B;  3BAB A;  1VQM V;  1NI8 A;  4DV3 B;  1VQN V;  4JI0 B;  4DR4 B;  1OZ0 A;  5LHI A;  3ZHT A;  1EN6 A;  3OD4 A;  5DM6 V;  1QLE C;  3F7Y C;  4WBN B;  3JAT B;  4NTY A;  1N33 O;  3FB8 C;  3K04 A;  1Q6I A;  3K57 A;  2ZXW C;  4FMT A;  2ADP A;  4BAY A;  4KUM A;  4DV2 B;  4LFB B;  1Q5O A; 
#chains in the Genus database with same CATH homology
 3OMN B;  3X2Q B;  2X6A A;  1ZWI C;  3IGA C;  5B1O A;  3KG2 A;  4HZ3 A;  2HLD G;  1OCO B;  1GO3 F;  2Q69 A;  3RW0 A;  3ZRS A;  1AJN A;  4Q20 A;  2W6J G;  3FKS G;  3LSQ A;  5H6Q A;  3M99 B;  1E1Q G;  3SJQ C;  1EZJ A;  4MS2 A;  3ZMT A;  2EIK C;  4GX5 A;  3CCR V;  1FS0 G;  3E86 A;  4UVC A;  4H37 A;  4H33 A;  5LBQ A;  1S3J A;  3CMA V;  2GHY A;  1F4N A;  3CCJ V;  4PA6 A;  4UV9 A;  4WF9 V;  5KA6 A;  1V54 C;  3OUF A;  3AG4 C;  4FK5 C;  1H8E G;  1VQO V;  1K34 A;  5GW7 A;  4R50 A;  2CK3 G;  5L3C A;  2WLL B;  2IJI A;  4P9O A;  3T4Z A;  1V55 B;  3W7U A;  2IJJ A;  1VQP V;  3LDE A;  5B1B C;  3RVY A;  1YJN V;  4MVR A;  1V54 B;  2ATK C;  4UXN A;  3RVZ A;  1GM9 A;  2UXN A;  1BL8 A;  3SPH A;  2AHZ A;  4DO2 A;  1DLB A;  1YIT V;  1CP9 A;  4PDR A;  2DQ3 A;  1SZT A;  4GX2 A;  1MAB G;  3ZMV A;  3CD6 V;  5KA5 A;  3HPL C;  3SPC A;  2ZR2 A;  3AEI A;  5H9C A;  4WCE V;  2QTO A;  1VQ9 V;  1MOF A;  1PD3 A;  2BOC C;  1OCR B;  2P67 A;  3ABT A;  3T4D A;  1S72 V;  1SES A;  4UV8 A;  1EFR G;  2KB1 A;  4U7N A;  1MSW D;  2ZR3 A;  3NXS A;  4DXW A;  5C93 A;  3QO8 A;  2NLJ C;  1YHQ V;  1Y66 A;  1E1R G;  4RQE A;  3JCZ A;  4RAI A;  5CN0 A;  2EIL C;  5E1A C;  1K9M W;  5L3B A;  1BHB A;  1PL0 A;  4I9W A;  1UJW B;  4HYO A;  1OCZ C;  3QO7 A;  2Q6A A;  1S77 D;  2JDI G;  2XOK G;  3SPG A;  3E8G A;  3T2M A;  3ZRW A;  2LP7 A;  2QA4 V;  5BZB A;  1R6N A;  4XDL A;  1N8R W;  4QIW F;  1J95 A;  4JTA B;  4RUE A;  4BW5 A;  1VQL V;  4JYC A;  4MTO A;  5LGU A;  2XAG A;  3JD1 A;  4RQF A;  3FB6 C;  1K8A W;  2Y69 B;  5HFM A;  4MTX A;  1AI6 A;  1BHA A;  3SYC A;  3EFF K;  1GM8 A;  5B1N A;  2Z5U A;  3A0R A;  3JYC A;  2EIJ C;  3ABM C;  4UVB A;  1AJP A;  5KUK A;  4R8C A;  1JPX A;  5EBW C;  3TCU A;  3R65 A;  3E8B A;  5LGN A;  2EZP A;  5IY5 B;  1LNQ A;  3OAA G;  4LC1 A;  1YSC A;  3G4S V;  3AG1 B;  3MHH C;  5LGT A;  3K03 A;  2B5U A;  2DYR B;  1AI7 A;  2ZDI A;  1P7B A;  1PNK A;  3B77 A;  2HVJ C;  2XAH A;  3FYI B;  5J9P C;  3W7W A;  2A9H A;  1QBZ A;  3GB7 C;  4PA9 A;  2WSS G;  3ZCC A;  3E8H A;  3TK1 A;  3E89 A;  2OT5 A;  3B8N A;  3SYO A;  2AHY A;  1KD1 W;  2DYR C;  2HR3 A;  2WLI A;  4PDV A;  4JYB A;  3CCU V;  1Q82 W;  5EBL C;  3JD0 A;  2WPD G;  3SPI A;  2LFR A;  1QVF U;  1YJW V;  1M56 C;  2ZDI C;  3E2E A;  4FJC C;  2JK5 C;  4JGS A;  4OXS A;  1ENV A;  5FL7 G;  1K4D C;  2BOB C;  3STZ C;  4XDJ A;  1S0V A;  3FYE B;  4KP4 A;  1VQK V;  2B1G A;  5KUM A;  1M56 B;  1I5Y A;  3ETE A;  4UUJ C;  3VOU A;  1VQ8 V;  4PA3 A;  4PDL A;  4QNH B;  1NBM G;  2R9I A;  3MHS C;  2K1E A;  1B6Q A;  1M57 B;  3CCS V;  1Q7Y W;  1EBO A;  4J9Y B;  5L3E A;  3CCM V;  4JAV A;  5CA3 A;  2P6J A;  4MSW C;  1FFT B;  4WFA V;  3G6E V;  4JTD B;  1VQ4 V;  2P90 A;  3DTU B;  1RPO A;  1THZ A;  4HAM A;  5L3D A;  1Y4M A;  2EIN C;  2A0L A;  4TT3 G;  5EK0 A;  1JVM A;  2EIM C;  1QVG U;  3E83 A;  3G71 V;  3ABM B;  2P7T C;  1AR1 B;  4GT1 A;  1E79 G;  4F4L A;  1K5S A;  1KP2 A;  2DWE C;  1KC8 W;  3WFV A;  3ZJZ A;  3AG4 B;  1XL6 A;  2WLM A;  1FXK B;  2XAJ A;  4TWK A;  1AI4 A;  2EJR A;  2NNU A;  5B1A B;  1R6K A;  3SYQ A;  3OR7 C;  3ZMS A;  3BY6 A;  4X88 A;  5CBF A;  3TET A;  4QPJ A;  3OMA B;  3OUS A;  1I5X A;  1R3L C;  1BMF G;  3QNE A;  2WWW A;  3AG2 C;  5EBM C;  3OM3 B;  1NVP B;  3OR6 C;  4G28 B;  2M7W A;  1ARO P;  1CEZ A;  1K92 A;  2W6I G;  4E2L A;  3CCL V;  3STL C;  1WPX A;  1OCR C;  4XDK A;  4MT8 A;  2WLJ A;  3SYA A;  1M9N A;  3IFX A;  2X6C A;  2QEX V;  1Q86 W;  3WG7 C;  1OCC B;  3F5W C;  1GK9 A;  1QR8 A;  2XND G;  2V1D A;  2R9R B;  3B8M A;  1FXH A;  2WLL A;  2UXX A;  4GX0 A;  4MW8 A;  4MVM A;  2ZXW B;  2JEU A;  2JJ2 G;  3ZRV A;  5CBG A;  1Q81 W;  1QLN A;  1AJQ A;  1M57 C;  1K5Q A;  1K73 W;  1DF4 A;  3ETG A;  3CCQ V;  3SPJ A;  2WLK A;  4P30 A;  1NR1 A;  1OCC C;  4WFG A;  5IYD O;  1KEC A;  4L87 A;  2ZD9 A;  4XBF A;  1CPY A;  3AG3 C;  3LNM B;  5DN6 G;  2DQ0 A;  2FTK A;  3OW2 U;  1IXM A;  1ORQ C;  2HFE C;  3ABK C;  4JAS A;  2F43 G;  4P2Z A;  2DYS B;  3PJS K;  2YEV A;  1ROP A;  4LP8 A;  4WFF A;  4QJF B;  1JJ2 U;  3OMI B;  1NKD A;  3IC7 A;  1KKD A;  1K7D A;  1FXV A;  2QE7 G;  3FB5 C;  2YSU B;  3OFN G;  2WAM A;  3CXC U;  2Q68 A;  2IW5 A;  2Y69 C;  5B3S B;  3CPW U;  5L3F A;  2DYS C;  3OE7 G;  2HJF C;  3GWO A;  1SER A;  3OEH G;  2IU3 A;  4FIP C;  2EBO A;  3P32 A;  5B1A C;  2JEX A;  1YTF D;  3E8F A;  1VQ7 V;  1R73 A;  1QCE A;  2C2A A;  1G8M A;  1K33 A;  3CC4 V;  3FB7 C;  4R6Z A;  3CYO A;  4G27 B;  1V55 C;  4PA4 A;  4R7C A;  1JX9 A;  1RM1 C;  5LHG A;  2Y48 A;  5B1B B;  4JTC B;  1YJ9 V;  4LCU C;  1DF5 A;  1PNM A;  2EIL B;  1F4M A;  2X6B A;  3CCE V;  4RUF A;  4N21 A;  3W7X A;  2X7R B;  4QPK A;  5IYC O;  2JJ1 G;  2OCC B;  3LDC A;  3HB3 B;  3OEE G;  3EHB B;  4CBC A;  3W7S A;  2ITC C;  1W0K G;  4X89 A;  1M90 W;  1JCH A;  3QO5 A;  3CP1 A;  4WFE A;  3K0D A;  2B1I A;  2OCC C;  4PDM A;  4RO2 A;  3I56 V;  1FXK A;  2EIK B;  5CBH A;  3ABK B;  1MG1 A;  3K79 A;  2QM7 A;  1YIJ V;  3ETD A;  2D3O W;  1NH2 D;  3CC7 V;  4MVU A;  1W0J G;  2GSM B;  2MK3 A;  3K3W A;  3LSS A;  1F51 A;  3ASN C;  1SET A;  4GCZ A;  1P4R A;  1F23 A;  1RPR A;  2A79 B;  2WLI B;  5EC1 C;  3ZIA G;  3UKM A;  2XAF A;  4P9P A;  4MVO A;  2HVK C;  2EIN B;  1YI2 V;  3MD0 A;  5HFL A;  5IYB O;  1NH2 B;  1GM7 A;  1NR7 A;  3ABU A;  1PNL A;  4EKW A;  3ASN B;  3T1C A;  5H6R A;  4MTF A;  1KQS U;  1GTO A;  4MVQ A;  1FXK C;  2IJK A;  3JD2 A;  2PI4 A;  3W7T A;  2EIJ B;  3UM7 A;  1DTO A;  1SRY A;  3RBZ A;  1KP3 A;  1K4C C;  1RM1 B;  2IJH A;  2H94 A;  3D3I A;  2OTL V;  1YTF B;  3CCV V;  3ZN0 A;  3LDD A;  3AG1 C;  4QE9 A;  1R3J C;  3BEH A;  4WFB V;  4WFH A;  3ZRX A;  3K08 A;  3K9A A;  2HKO A;  5CMU A;  1WLE A;  1W2B U;  4CZZ A;  4ZKI A;  4ZBM A;  3AG2 B;  4BIU A;  5LHH A;  2IH3 C;  2XAQ A;  1NQT A;  4GX1 A;  4UVA A;  3ZMZ A;  4BIZ A;  4KFM A;  1TUE B;  3ML0 A;  1QR9 A;  2Z3Y A;  1PKX A;  3H01 A;  4YXW G;  3JD4 A;  4J9Z B;  2WLH A;  4JF3 A;  3WG7 B;  4N23 A;  2HG5 C;  2JIZ G;  2QKS A;  1H38 A;  2ITD C;  4ASU G;  1S76 D;  1OCZ B;  1JQ0 A;  3SYP A;  4MVS A;  3ASO B;  2PI5 A;  3VBB A;  3X2Q C;  1G4Y B;  4I5S A;  1AI5 A;  1OCO C;  1OHH G;  3OGC C;  3P30 A;  1COW G;  3I55 V;  3LUT B;  2XAS A;  4FPP A;  1VQ6 V;  2OTJ V;  1M1K W;  3F7V C;  5EC2 C;  3AG3 B;  1K97 A;  3ASO C;  1H8H G;  4JPR A;  2H8P C;  1NVP D;  4QE7 A;  4X8A A;  2IU0 A;  2V7Q G;  2YEV B;  1JOY A;  3JD3 A;  1L1F A;  2W0F C;  4MW3 A;  4MVZ A;  3ZN1 A;  3E35 A;  2DWD C;  2QM8 A;  3CC2 V;  4G2K A;  1K3E A;  2ZQM A;  5IY5 C;  4MTG A;  1R3K C;  4PEL A;  4JAU A;  4Z1M G;  4TSF G;  3ABL C;  4U7O A;  5B3S C;  2EIM B;  2Q67 A;  3K0G A;  1S5H C;  1VQM V;  1GKF A;  1NJI W;  3ZMU A;  1VQN V;  2X0L A;  3ABL B;  2DW4 A;  1OZ0 A;  5LHI A;  4PA7 A;  5DM6 V;  1QLE C;  3CME V;  3D36 A;  3F7Y C;  1H2G A;  1GMG A;  3FB8 C;  3K04 A;  1R3I C;  1XL4 A;  4LBE C;  2ZXW C;  3ZRW B;  4FMT A;  5L3G A;  5IDJ A;  2LFS A;  2EZO A;  1QLE B;  3DGE A;  4BAY A;  4KUM A;  1HWY A;  2WLN A;  2IH1 C;  1VQ5 V;  3K06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...