1Y66A

Dioxane contributes to the altered conformation and oligomerization state of a designed engrailed homeodomain variant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
50
structure length
50
Chain Sequence
QWSEEVERKLKEFVRRHQEITQETLHEYAQKLGLNQQAIEQFFREFEQRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords engrailed homeodomain
publication title Dioxane contributes to the altered conformation and oligomerization state of a designed engrailed homeodomain variant.
pubmed doi rcsb
source organism Escherichia coli
total genus 24
structure length 50
sequence length 50
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1y66A00
3H01A 1Y66A 1JQ0A 1K33A 5H9CA 1DF4A 4G2KA 1I5YA 1QR9A 2EZPA 5KA5A 4FJCC 4FIPC 1Y4MA 3P30A 1K34A 3K9AA 1QCEA 3CYOA 2LP7A 1DLBA 5CN0A 5CMUA 2EBOA 3MHHC 4FK5C 5HFLA 5KA6A 1EBOA 2EZOA 2MK3A 2X7RB 1JPXA 2P6JA 3B8NA 4N23A 4E2LA 1MOFA 2OT5A 3WFVA 1DF5A 4N21A 3CP1A 3B8MA 1I5XA 4JGSA 1F23A 3B77A 1QBZA 4JPRA 3MHSC 2M7WA 4JF3A 1QR8A 3GWOA 3M99B 5HFMA 1ENVA 1SZTA 1MG1A
chains in the Genus database with same CATH superfamily
1HWYA 4JYAO 1BQ0A 1VQ8V 4LCUC 3RYIA 4G27B 4FIPC 5EC1C 2YIBD 4GX5A 1AI7A 1S72V 2OIEA 4NXNO 2HHHB 3K3WA 2ZKOA 2XHBA 4UB8Z 1YJWV 1VQMV 1GN2A 4LNUB 1K33A 5GTHZ 4G2KA 4PJ0Z 3OT7A 3LSQA 4O4JB 3APOA 1H8EG 3RW0A 1RM1B 2BSKB 4LF6B 5HFLA 3WG7C 5LYJA 3ZRXA 1G4YB 2QTOA 2ZR3A 1IXBA 1BMFG 1ZL8B 3EXAA 5B5EZ 1NT2B 1DGSA 4LFBO 3ETQA 4NXMB 1H38A 3HKBB 2R9AA 2DYSB 4DUYB 2DYSC 1FPOA 1AJNA 1P7BA 3KKYA 1K34A 4K0KB 2WLJA 3SPIA 4DV7O 2XAFA 2QR4A 4MVRA 2F23A 1AB3A 4O4HA 2P67A 4O4IA 1YXBA 5CA3A 5KMGA 3ZMZA 2YI8A 4MVSA 3MHSC 5JCOA 3M8AA 3NXSA 1SA0A 4CS3A 2RN9A 1J5EB 2IJIA 1KP3A 5EZYB 4DUZO 1GTOA 1G8MA 3ASOB 3IGAC 3I55V 1G6UA 3P3NA 2UUAB 4IIJB 3ZMTA 2V1DA 4ZI7B 3JD2A 3CCEV 1Z5VA 4MT8A 3U0ZA 2Q0OC 2WLIA 5LGNA 4LH6A 3TETA 5HFMA 3ZRSA 1Q43A 1M93A 4XDLA 5DM6V 5CBGA 3FB7C 1FJGO 1IBKB 4JI3B 5KX5A 4O4LA 2MK3A 1Y74A 4J41A 3CHXA 3GVMA 2W0XA 3FFQA 3ABMC 4LFAO 1N32B 2LGWA 4MTGA 3LDCA 5B1BC 4DR4B 2UXBB 5C93A 4DR1O 1XHXA 3CPWU 3TXSA 3ZHRA 2Q5ZA 1JMKC 5J2UB 5BXZA 2QM8A 2GBOA 3O9OA 4X8AA 3OUSA 4K8ZA 1XDCA 3ZX6A 1K3EA 2VQFO 2YIAA 2JVDA 2JEUA 2EINB 3CRCA 1GN6A 1Q6UA 3E86A 2W6JG 4LC1A 4Z2WA 4CZZA 1BQZA 2KG7B 4LR3A 1RSOB 1EZVH 3VOUA 3SJBC 2ZE6A 4TOIA 2QWQB 5JQGA 4J42A 1R3LC 4W4KA 4DK1A 2YXLA 1YZBA 4FFKA 4U7OA 3HB3B 1Q86W 4ZIBA 1L0NH 2OTLV 5IJ9A 1HW7A 1R1BA 3FD9A 2WAMA 1M57B 1I94O 3WB0A 1U97A 1TUBB 5B1AB 4TUYB 3JATB 5EIBC 2E75B 2PGGA 5EBWC 1M5IA 5BZBA 3UCSC 1EFRG 5LOVA 1QR9A 2P4VA 2YIBA 2JIZG 3J80N 2RJZA 4K3AA 1JJOA 2OCCC 4LP8A 3E83A 2PI5A 1ZWIC 2QKSA 5B3SB 3K5LA 1S3JA 1G1XB 1FFXA 3B2EE 1HR0B 3RWRD 4O2AB 2GUZA 3STLC 3IFXA 4GKJO 1BZKA 1OCRC 4TWKA 2QWOB 1SZXA 1NZ6A 4WBNA 3QF7A 3RFRA 4DV4B 2X6BA 4JYYA 3HKEA 3E35A 3P30A 2XAJA 4I4TB 5LP6A 2EULA 1NTMH 3OM3B 3UM7A 4DR2B 2IM9A 3BCCH 2L35A 2UXDO 1AR1B 3CRQA 1JOYA 1N34B 4I9QA 1SZTA 4X1IB 3OMIB 4B3SO 3AG3C 3KCYA 2P7TC 2CDYA 4FJCC 1CP9A 1PL4A 1SQXH 1JX9A 1NJIW 4MTOA 2CTWA 1IX9A 3RBZA 2EBOA 1HNZB 4BIOA 4PDVA 4ZBMA 2DYRB 3CP1A 4LH7A 2DOSA 2QEXV 1LUVA 3BVOA 1WAZA 4QNHB 3T1HB 1OCOC 4DV5O 3RYIB 1QQCA 1XILA 3E8FA 2H94A 4DV3B 1QHTA 1N33B 3CD6V 1VF6A 4UFZA 2HR3A 1K73W 3A8TA 1URFA 4YY3O 3H9VA 5FLXN 2QE7G 2WLNA 4X65O 1OHHG 4WF9V 4C7UA 4J7KA 4I9WA 2ITDC 3RT3C 1KBHA 1WA8A 1D5NA 3HKBA 3L71H 1HNXO 1US6A 4CH6A 2IJHA 1UJWB 1BHBA 3JALA 3FB8C 3ABUA 3DC6A 4JI4B 1OCCC 2Z5UA 4X62O 3AG4B 4LFCO 5L3FA 2AZ0A 1AJPA 1MABG 3CCVV 3CCLV 4JI0B 3JAMN 1V54C 3OGIB 2D2CB 4F6EA 2UXCO 4LF9O 5K1PA 2JGDA 3OE7G 4R7CA 3UT5A 1OJHA 5IYZA 3W7WA 4X66B 2F66C 2JK5C 1H2LA 3CS5A 3FYIB 1L8DA 4P9PA 4O4HB 3D3QA 3HR0A 4IIJA 2CK3G 4O4IB 1GN4A 4JAVA 4JGSA 1SA0B 4U3JA 4JV5B 3ABLB 1PV0A 3GWKC 3W7SA 1QVFU 3ZHSA 4BWAA 5LBQA 1YTFD 4DW1A 4RUEA 5A2QN 2UUBO 1U96A 3S3XA 1OZ0A 5H6RA 4CH3A 2WLIB 2VS0A 5K1XA 1P7GA 1AR5A 3JD4A 4X64O 3W7UA 4DR6B 2EILC 3M7MX 2X6AA 3CB2A 4DR7O 4UXNA 1JQ0A 1HNWO 3JSLA 3T2MA 3TK1A 4WFAV 2R72A 5KX5B 2ZDIC 5LL6Y 1M56B 2K9PA 3CJHA 1M56C 5J2UA 3A2FA 4NTXA 1K97A 2XUMA 2ZIMA 4WFGA 2BOBC 3JSNA 4HYOA 4YJ2A 3AG7A 2Q4PA 4ICGA 1Y4MA 4I55B 3CYOA 4GUNA 4A5UB 2Y69C 4UVBA 3RYFB 2KG7A 4X20A 4OX9B 2LW1A 3L75H 1IDSA 5BR8O 2ZT9B 4GX0A 1RPOA 2IBZH 2XAGA 4KP4A 1RP3B 1Q6HA 1BGYH 2JGUA 2NR5A 4ZHQA 3OR7C 4UCOA 1JA8A 2ODMA 3ML0A 2XT9A 1TGOA 2NNUA 4JZ2A 2GTAA 3CSXA 1FXKC 1KB9F 5JQGB 2JS5A 1V55C 1B04A 1E1QG 1TUBA 3JATA 2Y4UA 1K8AW 1YEWA 4HZ3A 2W6IG 5L3CA 1SQPH 5IJ9B 4GYCB 4U7NA 3E22A 1XEQA 3BAAA 3K58A 3K9SA 3FB6C 2P06A 3LSSA 3ZBHA 1NI8A 1CXZB 4DR3B 3UO3A 5LA6A 3GWOA 4PI0A 2PI4A 1Y6XA 3P32A 1HR0O 4KL1A 5LOVB 1TUEB 2R9RB 2Y48A 5IE9A 4JI7B 2ZNJA 1QLEB 5JVDB 4GKKB 1AR4A 1OV9A 1PD3A 2CTRA 1ZUQA 1EBOA 1FFXB 5IY5B 4IL6Z 2X7RB 5GW7A 3JARA 4LWSA 2LW7A 2GUZB 2Q7HA 4UVAA 3KG2A 5LGUA 3SYPA 4DR2O 4JYCA 4EB6A 3SYOA 1HDJA 2F4VO 2ETNA 4FVMA 4X1IA 1XNRO 2PF4E 4DV0O 5CB4B 4B3MO 3HKEB 3C3TA 2DE0X 1ZX3A 4BIZA 4P2ZA 5LP6B 4HNAA 3E2EA 2ARHA 3L74H 4JI6O 5JJNB 4Q6GA 2WSSG 2QDOA 3CCUV 3H1IH 1F7YA 4B3TO 3FAVB 4PDMA 3D36C 2B5UA 3G67A 4B3RO 3ZIAG 3E8HA 1I5YA 5ITZB 1XNQO 4MSWC 4R50A 1BE3H 5AG2A 4JI5O 3T1YB 4JTCB 3B40A 2UUCB 2H8PC 4Z1VA 5CA1A 2HVKC 1OCZB 3SYQA 4J7ZA 4CC6A 4I50A 1QR8A 3BY6A 3QVNA 4FMTA 1GK9A 1I7FA 3E8GA 2RMKB 2CAZC 5KUMA 4UCSA 2P22C 3BRCA 2JJ2G 1VF6C 4FLWA 1RM1C 2O57A 4KHPB 4MS2A 3SYCA 4KUMA 1D5AA 2A3QA 4FPPA 4QE7A 4TQFA 3ZMUA 3SJCC 1IBMO 3AEIA 1WA8B 3K5OA 3O65A 1Q6IA 2EIMB 2EIMC 3G80A 4JI0O 4LF7O 1XQ8A 1VQKV 3JALB 2NLJC 1KQSU 3L72H 2AHZA 1H2MA 5KHGA 3CCQV 3ETGA 4N21A 4GX2A 2A06H 4QPJA 2DMXA 2Z0AA 2AW9A 1R6KA 3D8CA 3ABKB 2JGDB 4UCUA 2DWEC 1SS3A 3CWBH 3JD0A 4LF8O 1F51A 1KKDA 3UT5B 5IYZB 1AJQA 5L3EA 4ZOLA 3ASOC 2QWRB 4HBNA 2PY5A 4JV5O 3CC2V 4PDRA 3HKDA 2Z3YA 3LNMB 4FM0A 3LNNA 1QBZA 4Z1MG 4KXRA 4DV1B 1AI6A 3E8BA 2HKOA 1T5EA 4U3JB 3X2QB 5LHHA 3SPHA 3X2QC 2B1GA 1BL8A 2ZNIA 4YHHO 3SJAC 1IURA 1XMOB 1IBLB 4IGGA 5B1NA 4XBFA 3K59A 5DN6G 2IJKA 1K9MW 2Q67A 2EIKB 4H0LB 3TCUA 1PL0A 4J9ZB 5IWAB 1R73A 4CH4A 3N2GA 1COWG 3CRAA 3K03A 1WPBA 2N05A 4JYBA 3SPCA 2CGOA 3C90A 2EZPA 4IHJA 3L73H 4BAYA 3CJHB 4CS2A 3JYCA 4I55A 3H1HH 1KYOF 1Q8IA 1MZEA 3B4SA 3RYFA 1SQGA 2IU0A 3CE2A 1GN3A 1ORQC 3B8MA 1VMGA 1YITV 3J81N 2QTSA 2YC0A 3CRRA 4YJ2B 5C8YA 4D7TA 4JI8B 4IYIA 2OWOA 2EINC 1ZAUA 2KQXA 4XDJA 5LMUO 1ZSPA 4J11A 1EN4A 3MHHC 4X20B 1FS0G 2UXXA 2LGQA 2XAHA 5EC2C 5LMNB 2YSUB 1PNMA 4H44B 3W7TA 1NU1H 3THOA 3G6EV 1BCCH 1TAEA 3FB5C 4NVPA 2ATKC 3KCXA 4MVUA 5LXTA 2P5OA 4R6ZA 3SYAA 1JR9A 2UU9O 3K5MA 3PN1A 4PA9A 4ZHQB 1BHAA 1W2BU 3K08A 3D3IA 1LR1A 3OTFA 1M57C 4LF5B 2PZSA 2Q8VA 2PYJA 5EBLC 3JAKB 4QJFB 5A9GA 4RAIA 5B1AC 3SPGA 4R8CA 2HFEC 3L9DA 2Q73A 4YXWG 4JTDB 1R6TA 3OEHG 1Q3EA 4MVOA 4F6RA 3CCMV 3SR2C 3E22B 4WFEA 4X88A 5JVDA 3F5WC 1BT8A 3MDSA 1Y67A 5B3SC 4JI7O 2E3CA 4TV8B 5LA6B 2VRZA 1WP7A 3HKCA 3OTOB 3H01A 1NR1A 5JH7A 1NH2D 5KA5A 2LQTA 2LFSA 5CB4A 4DV6B 2QM4A 4FFBA 4JI1O 2AGAA 3AG2B 4B7EA 3JARB 4LWSB 1JPXA 1WP8A 1BSMA 1YHQV 2LO1A 5BY1A 4JI2B 1MZFA 5IYCO 2F1MA 3JCUZ 4B7KA 2M7WA 3FAVA 1IXMA 4EB6B 2KSDA 1X4TA 5IT9N 2E5LB 4O2BA 4D7SA 4DK0A 3F7YC 5KHIA 1QNMA 4DR5O 4HNAB 5ITZA 4I0XA 1N0NA 1QLNA 4RWUA 1Q81W 5LHGA 1FXHA 3E89A 2L6LA 4UUJC 1XMQB 2DYRC 4JPRA 2QJ1A 1V9PA 4QIWF 4F4LA 4UV8A 3DGEA 2BOCC 1EZJA 2HHHO 1PPJH 2JDIG 1DK1A 1Q90D 3ETDA 2C2AA 5B1OA 3APQA 1N4CA 5CA1B 4J7JA 2PUSA 5FNVB 2KB1A 3LUTB 4WFBV 3ZRWA 4I50B 4AILC 3DC5A 3LDDA 4WFFA 4PV1B 4LF6O 1SESA 2Q7GA 4KHPO 4MW8A 1YTFB 5CBHA 2QA4V 1EM1A 1WLEA 1WPXA 1S77D 3RYHB 3VQVA 4K8XA 4DXWA 4NXMO 1UFIA 3AG4C 4DUYO 2AHYA 3CCSV 4K0KO 2FKXA 1XL6A 1FD9A 2FL4A 1YCIA 1Z5WA 4EFEA 3JD3A 1WN7A 4FLUA 4EEQA 3RYCA 4LFBB 1QVGU 4TQDA 1FYJA 3T4ZA 1VIBA 2XTAA 3G71V 1J5EO 2ZE8A 4X1KA 2EJ7A 3I5DA 1S0VA 1YDXA 4J10A 1SETA 2HG5C 4W4LA 5JCOC 2UXNA 4DV7B 5LHIA 2ZM6B 2UUAO 2IH1C 3VQYA 3ABLC 4PD4F 5IJ0A 3ZCCA 3ZS8C 4ZOLB 4EFBA 3J7AU 4MVZA 3Q4HB 3STZC 3UQ8A 1S5LZ 3U11A 2RDCA 3HKDB 4P9OA 4ZKIA 4DUZB 2LFRA 4UCVA 3JCZA 5IDJA 4Q20A 4JI3O 1IBKO 4L8JA 2ADQB 2WLHA 1SQFA 4DYLA 3A0HZ 2Q9LA 1VQ4V 3ASNB 2WA3A 2Q68A 1N32O 4DR4O 4JAUA 2UXBO 1TA8A 2YXHA 4OPAA 1FJGB 5EYPA 3N2GB 4KFMA 1P49A 4MTXA 2V4DA 3EVKA 3N2KB 4DRXA 4IHJB 2MW2B 2QKAA 1DLBA 4LFAB 4IT5A 4G28B 4DR1B 4TV9A 2X0LA 2QWPB 3RN4A 1VQOV 4JTAB 2NN4A 1GMGA 5C8YB 2QKCA 5L3BA 3K06A 1YIJV 2B1IA 2V7QG 5J9PC 5H6QA 1XL4A 2VQFB 4K35A 1KD1W 3TJTA 2Q7EA 2QGNA 2EZOA 4E2LA 3JAKA 3UKMA 4UCRA 3VQWA 5LXTB 2VQEB 5D5PA 4UCTA 2Y0PA 3OMAB 1NS1A 2JRIA 2N04A 1JCHA 3VQXA 2GHYA 4PI2A 2ZXWB 1VQ6V 3R66A 2WLLB 3SPJA 3L70H 2YICA 3JD1A 1H8HG 4X1YA 1L1FA 1Q82W 4UV9A 3WB1A 5F2VO 1AVMA 3VBBA 5KHHA 4TV8A 4CH5A 1I94B 3WU2Z 3HPLC 2E76B 3DXRB 4F6RB 3H1KH 3BA8A 5JJEB 3OUFA 1QLEC 4CC5A 5KA6A 1RPRA 5IY5C 4GT1A 4DV4O 2GDSA 4RUFA 2BTQA 4B08A 1F23A 3B77A 1R3IC 3CXCU 4GX1A 5CA0A 3HKCB 2ILMA 2JS3A 5JH7B 3IJ4A 3QNEA 3RVYA 3GB7C 4X89A 1WB7A 4GKJB 4FFBB 1PM9A 3AK1A 2EIJB 2LP7A 5LP6C 2RQ6A 3AK3A 1N34O 2FB5A 1SF9A 5DEDA 2N74A 4FLVA 3AG1B 1ROPA 4LF4B 1XUQA 1JFFA 1NR7A 3FYEB 2R70A 3ZN0A 4O2BB 1HNZO 4ABMA 4P30A 3R65A 1VQ7V 1E79G 2FMLA 2UXDB 5KUKA 4I0XB 3BHPA 4DV2B 3QO5A 2Q69A 2EJRA 3FKSG 1KP2A 4B3SB 3T1HO 2X6CA 1OCZC 5FNVA 2OCHA 4NB5A 1AI5A 2IJJA 3I56V 4DV3O 1N33O 1K4CC 3G6BA 3ZN1A 4NKGB 4GCZA 3ZMSA 3ICXA 1IZ3A 1W0KG 2ZE7A 3OMNB 2H3OA 2DQ3A 5JJJB 4DV5B 3RYHA 1J95A 1ZLZA 2OT5A 3ZRWB 4FZ0A 4AHCA 3OD4A 1B3QA 1P4RA 2Y4TA 1LUWA 4H37A 4JI4O 3K5NA 4YY3B 1R6NA 2OTJV 2Q6AA 1KUQA 4HAMA 4FM2A 3WG7B 4X65B 3N27A 2Y0IA 3CC4V 5J2TB 1Z2GA 1HNXB 3G4SV 1A32A 4QGPA 1TVKB 2F93B 1SQVH 4X66O 2GSMB 4X62B 4LFCB 2ZE5A 3ABKC 2RNBA 2QWNB 3OW2U 1F4MA 3RYCB 4L87A 1O9HA 2UXCB 2ZM6O 3K57A 4LF9B 2YEVB 2QM7A 4X1KB 3ZHUA 3Q4HA 4XDKA 3C3SA 4N23A 2CUGA 1F4NA 4YJ3A 3JASA 4OXSA 1VP7A 3SGIA 2AXTZ 3QG5A 3ZMVA 2BE3A 4H33A 2WA4A 1VF5B 5IJ0B 3BA9A 2BTOA 4NTYA 1SQQH 4DR6O 2KKWA 4UB6Z 4EKWA 2DQ0A 3ETEA 2A79B 2EIKC 2F43G 2F95B 2HP8A 1H2GA 3LDEA 3IC9A 5IYDO 2UUBB 3RGBA 3CRMA 1Y66A 4WFHA 3ABTA 3N2KA 1VF7A 4PDLA 1QCEA 2ZDIA 1N0JA 1KECA 4X64B 1PP9H 2YIDA 2LJ2A 2A7WA 1AI4A 3OFNG 1Q5OA 4DR7B 3IAYA 5FPRA 5FL7G 1HNWB 2P4KA 5EYPB 3ABMB 3P3PA 4BW9A 3CCJV 2IH3C 4DW0A 1VQNV 4FLZA 5B1BB 4DRXB 4OX9O 4J9YB 2XNDG 2D3OW 3JAWA 3ZHTA 1XREA 2CH7A 1SERA 1ZTEA 4TV9B 1Y76A 3T1CA 4JASA 4MW3A 1K4DC 3CXHF 1H2NA 1NH2B 1MG1A 1B06A 4MTFA 5BR8B 3DTUB 3BFRA 4I5SA 2VQEO 2WLLA 1KKCA 5CMUA 1FXKA 1S76D 1MSWD 1WNSA 4E4EA 1GH6A 1VQPV 1MSDA 1NQTA 1I5XA 5EBMC 1PKXA 1KU9A 4AQYB 4J80A 1XI1A 3K0GA 1YJNV 2VWKA 3DXRA 5H9CA 4PELA 3MAQA 3BPZA 5E79Z 3RVZA 4GLXA 2AZ2A 4BIUA 4X1YB 4DR3O 5CN0A 3B09A 3OEEG 1GM8A 2XASA 2JEXA 2YUAA 3DSQA 2A0LA 3LSUA 4GKKO 3MD0A 1NKDA 1K5QA 2OCCB 4D6TH 1NTZH 3CEIA 2ITCC 1N36B 1XHZA 2GTSA 2ZD9A 5KHKA 3AG2C 5GTIZ 2BTQB 3FX7A 1YJ9V 1FAFA 5CA0B 3ZJZA 1OCRB 1K5SA 5BMVA 5DECA 4LF4O 2ZCEA 2PTMA 2DN9A 4PA3A 1AILA 3KZIZ 3H1JH 2GV9A 1O9GA 5FPOA 5H2FZ 1XNRB 2F4VB 2XAQA 4DV0B 2HJDA 4B3MB 1M4UA 1JFFB 3QO8A 1KMIZ 1IVSA 4DV2O 5EIBD 2IW5A 5B66Z 4JI6B 3T1YO 3D36A 2UUCO 1M90W 3WB2A 3AG3B 1S5HC 1GRJA 4B3TB 2HEPA 1W0JG 3CMEV 3ZHQA 3K9AA 4PHZA 4BR6A 2VWJA 1VEWA 3F7VC 2WWWA 4B3RB 1GAXA 4JZGA 4JYAB 1FFTB 3EFFK 1XNQB 3IC7A 4JI5B 2B9ZA 4CBCA 3K04A 5GONB 1YI2V 1OCOB 4NXNB 5EK0A 1VQ9V 1MNGA 4LNUA 4O4JA 4PA7A 4FLXA 4OGQB 1D2DA 1GO3F 2BSKA 2ZQMA 2FTKA 1BS3A 4RQEA 1ZL8A 4PA4A 4RQFA 1THZA 5J2TA 2A9HA 3W7XA 3CCRV 2OYQA 1K92A 4JF3A 1VQ5V 3S3WA 1TVKA 2WPDG 4MVMA 1W59A 5LGTA 2W0FC 2WLMA 1DF4A 3CX5F 1WB8A 4YIPA 1RFYA 5LYJB 3T4DA 1IBMB 3AK2A 1OCCB 1HP8A 2YDEA 2YEVA 1H2KA 2K1EA 1YSCA 1GM9A 1I08A 2RCVA 4LF7B 1V54B 3F5TA 4TT3G 3OGCC 1NTKH 1SKVA 1K7DA 4AI8A 1P84F 4U3FH 1SQBH 2HJFC 2Q0AA 5EZYA 1VQLV 3QO7A 4DV1O 3OAAG 4LF8B 4ZI7A 1NBMG 5KMGB 2ZINA 1H2SB 1SRYA 4YJ3B 1XMOO 1NVPB 1IBLO 3JASB 1XOUA 5JWPA 4NTWA 1YVWA 3M99B 5L3GA 1SC5B 3CMAV 2YI9A 4I7ZB 1I0HA 4YIOA 2IU3A 2QSAA 2G38A 1MA1A 5IWAO 4FM1A 3ASNC 4FK5C 1DTOA 1AP6A 1E1RG 5H5NA 4YHHB 1AP5A 4FZ1A 4BW5A 2R9IA 1M1KW 2EILB 1ENVA 2OIGA 1YF2A 2JJ1G 2WLKA 4O4LB 4UVCA 1VARA 5KAIZ 1Y74B 4JI8O 4NR1A 2P6JA 4OPHA 1FKAO 3TGUH 1PNLA 2DJVA 1R3KC 2CE4A 1X59A 3SDLA 2ADPA 3EHBB 1NVPD 3NR7A 5LMNO 3JAWB 1AROP 2HVJC 2CTPA 2Y69B 1CEZA 3H1LH 2CH7B 2XOKG 1S5JA 1Q7YW 1RSOA 1Y76B 1WJZA 2ZR2A 4TSFG 2CGNA 5LMUB 1L0LH 5D5QA 3BABA 4GZRB 4LF5O 3OR6C 1GKFA 1EN5A 3PJSK 3A0RA 1XBLA 2YXYA 2ZXWC 3BEHA 1FXKB 3TXQA 4AQYO 2UU9B 1V55B 4NYKA 1FXVA 4TUYA 2YS8A 1UPGA 5CBFA 5E1AC 5KAFZ 3UO2A 2BCCH 2PYLA 5L3DA 1B6QA 2EX3A 2E74B 1R3JC 4LBEC 3K79A 3OTOO 1GM7A 4H13B 2ZIOA 4X9QA 3WFVA 4O2AA 3A0BZ 4PA6A 3QTCA 3ZHVA 4FLYA 4DV6O 4JAAA 5IYBO 1N36O 3ZRVA 2HLDG 4JI2O 2DW4A 4CS4A 1LNQA 4QE9A 4I4TA 2P90A 2EIJC 5KLVH 1KC8W 2CTQA 4ASUG 1M9NA 4WCEV 3B8NA 2E5LO 1MOFA 5TISZ 3AG1C 3CC7V 2FYUH 3U10A 4JI1B 4WBNB 4IYHA 1N8RW 5BMVB 2M6YA 4MVQA 1JJ2U 1EN6A 4QPKA 1JVMA 1XMQO 5KHJA 2DWDC 1MMMA 3ZEDA 3K0DA 1PNKA 1CPYA 4FLTA 4RO2A 1DF5A 4DR5B 1QU7A 4DO2A 3SJQC 5GONA
chains in the Genus database with same CATH topology
1EZJA 1HWYA 4J9YB 2XNDG 1VQ8V 2JDIG 4LCUC 2D3OW 4G27B 3ETDA 2C2AA 1Y4MA 4FIPC 5EC1C 3CYOA 5B1OA 2Y69C 4GX5A 4UVBA 1SERA 1AI7A 1S72V 3K3WA 3T1CA 2KB1A 3LUTB 4GX0A 4JASA 4WFBV 1RPOA 3ZRWA 4MW3A 1K4DC 3LDDA 4WFFA 2XAGA 4KP4A 1YJWV 1SESA 1VQMV 1NH2B 1MG1A 4MTFA 3DTUB 1K33A 4MW8A 4G2KA 1YTFB 3OR7C 5CBHA 2QA4V 3ML0A 3LSQA 4I5SA 1H8EG 3RW0A 1WLEA 1WPXA 2WLLA 1RM1B 5CMUA 5HFLA 1S77D 2NNUA 3WG7C 1FXKA 3ZRXA 1G4YB 1FXKC 2QTOA 2ZR3A 1S76D 1MSWD 4DXWA 1BMFG 1VQPV 1V55C 3AG4C 1E1QG 1NQTA 1I5XA 5EBMC 2AHYA 1K8AW 3CCSV 1PKXA 1XL6A 4HZ3A 2W6IG 1H38A 5L3CA 3K0GA 1YJNV 2DYSB 5H9CA 2DYSC 3JD3A 4PELA 1AJNA 1P7BA 4U7NA 3RVZA 1K34A 4BIUA 2WLJA 5CN0A 3FB6C 3OEEG 3SPIA 1QVGU 2XAFA 1GM8A 3T4ZA 3LSSA 4MVRA 3G71V 2XASA 2JEXA 2P67A 2A0LA 1S0VA 5CA3A 1SETA 2HG5C 3ZMZA 4MVSA 3MHSC 3MD0A 1NKDA 3GWOA 3NXSA 2UXNA 2PI4A 5LHIA 3P32A 2IH1C 1TUEB 2R9RB 2Y48A 2IJIA 1KP3A 3ABLC 1QLEB 3ZCCA 1K5QA 2OCCB 1GTOA 1G8MA 2ITCC 3ASOB 3IGAC 3I55V 4MVZA 1PD3A 2ZD9A 1EBOA 5IY5B 3AG2C 3STZC 2V1DA 3ZMTA 2X7RB 5GW7A 3JD2A 3CCEV 4P9OA 4ZKIA 1YJ9V 2LFRA 4MT8A 2WLIA 4UVAA 5LGNA 3JCZA 3KG2A 3ZJZA 5LGUA 1OCRB 3TETA 5IDJA 4Q20A 5HFMA 3SYPA 3ZRSA 4JYCA 2WLHA 3SYOA 1K5SA 4XDLA 5DM6V 5CBGA 3FB7C 4BIZA 1VQ4V 4P2ZA 3ASNB 3E2EA 4PA3A 2Q68A 2MK3A 2WSSG 2XAQA 4JAUA 3CCUV 3QO8A 3ABMC 4KFMA 2IW5A 4PDMA 4MTXA 3D36A 4MTGA 3LDCA 5B1BC 1M90W 3AG3B 2B5UA 5C93A 1S5HC 3CPWU 3ZIAG 3E8HA 1W0JG 3CMEV 1I5YA 4MSWC 4R50A 3K9AA 2QM8A 1DLBA 4X8AA 4JTCB 3F7VC 2H8PC 2WWWA 2HVKC 3OUSA 4G28B 1OCZB 2X0LA 1FFTB 3EFFK 1VQOV 4JTAB 3IC7A 1K3EA 3SYQA 4CBCA 1GMGA 3K04A 1QR8A 5L3BA 3BY6A 2JEUA 4FMTA 1YI2V 3K06A 1OCOB 2EINB 1YIJV 2B1IA 2V7QG 5EK0A 1GK9A 3E86A 5J9PC 1VQ9V 3E8GA 5H6QA 1XL4A 2W6JG 4LC1A 5KUMA 4CZZA 1KD1W 4PA7A 3VOUA 1GO3F 2JJ2G 2ZQMA 1RM1C 2EZOA 2FTKA 4MS2A 3SYCA 4RQEA 4E2LA 4PA4A 4KUMA 4RQFA 1R3LC 3UKMA 1THZA 4QE7A 4FPPA 3ZMUA 2A9HA 3W7XA 3CCRV 1K92A 4JF3A 4U7OA 3HB3B 1VQ5V 2WPDG 3OMAB 4MVMA 1Q86W 3AEIA 1JCHA 5LGTA 2GHYA 2W0FC 2WLMA 2OTLV 1DF4A 2ZXWB 1VQ6V 2EIMB 2WAMA 2EIMC 2WLLB 3SPJA 1VQKV 2NLJC 3JD1A 3T4DA 1KQSU 1M57B 1H8HG 2AHZA 1OCCB 1L1FA 3CCQV 1Q82W 4UV9A 3ETGA 5B1AB 2YEVA 2K1EA 4GX2A 4N21A 1YSCA 4QPJA 1GM9A 5EBWC 3VBBA 1V54B 4TT3G 5BZBA 1R6KA 3HPLC 3ABKB 3OGCC 1EFRG 1K7DA 2DWEC 3JD0A 1F51A 1QR9A 3OUFA 1KKDA 2JIZG 2HJFC 1QLEC 2OCCC 4LP8A 3QO7A 3E83A 1VQLV 2PI5A 1AJQA 5L3EA 1ZWIC 2QKSA 3ASOC 5KA6A 3OAAG 1RPRA 5B3SB 1S3JA 5IY5C 3CC2V 1NBMG 4PDRA 4GT1A 2Z3YA 3LNMB 4RUFA 1SRYA 3STLC 1F23A 3B77A 1QBZA 1R3IC 4Z1MG 3CXCU 1NVPB 3IFXA 4GX1A 1AI6A 3E8BA 2HKOA 1OCRC 3M99B 4TWKA 4UV8A 5L3GA 3X2QB 3CMAV 5LHHA 3SPHA 3X2QC 2B1GA 1BL8A 3QNEA 3RVYA 2X6BA 2IU3A 3GB7C 3E35A 3P30A 2XAJA 4X89A 5B1NA 2EIJB 2LP7A 4XBFA 3ASNC 3OM3B 4FK5C 3UM7A 5DN6G 2IJKA 1K9MW 1DTOA 1E1RG 2Q67A 2EIKB 3AG1B 4BW5A 1ROPA 3TCUA 1PL0A 2R9IA 4J9ZB 1R73A 1NR7A 1AR1B 1M1KW 1COWG 3FYEB 2EILB 1JOYA 1ENVA 3K03A 1SZTA 3ZN0A 4P30A 3R65A 4JYBA 3OMIB 1VQ7V 3AG3C 3SPCA 1E79G 2P7TC 2EZPA 4FJCC 5KUKA 1CP9A 2JJ1G 1JX9A 4BAYA 2WLKA 1NJIW 4MTOA 4UVCA 3JYCA 3QO5A 2Q69A 2EJRA 3FKSG 3RBZA 1KP2A 2EBOA 2IU0A 4PDVA 2P6JA 2X6CA 1OCZC 4ZBMA 1ORQC 1PNLA 2DYRB 3CP1A 3B8MA 1YITV 1R3KC 1AI5A 2IJJA 2QEXV 3I56V 4QNHB 1K4CC 3EHBB 1NVPD 1OCOC 2EINC 3ZN1A 4GCZA 4XDJA 3ZMSA 1AROP 2HVJC 1W0KG 2Y69B 1CEZA 3OMNB 3E8FA 2H94A 2DQ3A 2XOKG 3MHHC 1Q7YW 1FS0G 2UXXA 3CD6V 2XAHA 2ZR2A 5EC2C 4TSFG 2YSUB 2HR3A 1J95A 1K73W 1PNMA 2OT5A 3ZRWB 3W7TA 3G6EV 3FB5C 2QE7G 2WLNA 2ATKC 4MVUA 1OHHG 4WF9V 1P4RA 4R6ZA 3SYAA 4I9WA 2ITDC 3OR6C 4H37A 1GKFA 3PJSK 3A0RA 4PA9A 1BHAA 1W2BU 1R6NA 3K08A 3D3IA 2OTJV 2ZXWC 2Q6AA 4HAMA 2IJHA 1UJWB 3BEHA 3WG7B 1BHBA 1FXKB 3FB8C 1M57C 3ABUA 1OCCC 1V55B 2Z5UA 3AG4B 5EBLC 5L3FA 1AJPA 1FXVA 4QJFB 3CC4V 4RAIA 1MABG 3CCVV 3CCLV 5B1AC 3SPGA 4R8CA 3G4SV 2HFEC 5CBFA 1V54C 5E1AC 2GSMB 4YXWG 4JTDB 3ABKC 3OEHG 4MVOA 5L3DA 1B6QA 3CCMV 3OE7G 4R7CA 3OW2U 4WFEA 1F4MA 4X88A 4L87A 3F5WC 3W7WA 1R3JC 4LBEC 2JK5C 3K79A 2YEVB 3FYIB 2QM7A 1GM7A 5B3SC 4P9PA 4XDKA 4N23A 2CK3G 3WFVA 1F4NA 4JAVA 4PA6A 4JGSA 5IYBO 4OXSA 3ZRVA 3ZMVA 3H01A 4H33A 3ABLB 1NR1A 2HLDG 1NH2D 5KA5A 3W7SA 1QVFU 2DW4A 2LFSA 5LBQA 1LNQA 4QE9A 1YTFD 2P90A 4RUEA 2EIJC 3AG2B 1KC8W 4EKWA 4ASUG 1JPXA 1M9NA 1OZ0A 2DQ0A 3B8NA 5H6RA 4WCEV 1MOFA 1YHQV 3ETEA 2A79B 2WLIB 3AG1C 2EIKC 2F43G 5IYCO 3CC7V 1H2GA 3JD4A 2M7WA 3LDEA 5IYDO 1IXMA 3W7UA 1N8RW 2EILC 2X6AA 4MVQA 1Y66A 1JJ2U 4UXNA 1JQ0A 4WFHA 3ABTA 4QPKA 3F7YC 3T2MA 1JVMA 3TK1A 4WFAV 4PDLA 1QCEA 2ZDIA 1KECA 2ZDIC 1M56B 1QLNA 1M56C 1AI4A 2DWDC 1Q81W 5LHGA 3OFNG 1FXHA 3E89A 3K0DA 1PNKA 4UUJC 1K97A 1CPYA 4RO2A 5FL7G 1DF5A 3ABMB 3CCJV 2IH3C 4WFGA 4DO2A 2DYRC 4JPRA 1VQNV 2BOBC 3SJQC 4QIWF 5B1BB 4HYOA 4F4LA 3DGEA 2BOCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H01 A;  1Y66 A;  1JQ0 A;  1K33 A;  5H9C A;  1DF4 A;  4G2K A;  1I5Y A;  1QR9 A;  2EZP A;  5KA5 A;  4FJC C;  4FIP C;  1Y4M A;  3P30 A;  1K34 A;  3K9A A;  1QCE A;  3CYO A;  2LP7 A;  1DLB A;  5CN0 A;  5CMU A;  2EBO A;  3MHH C;  4FK5 C;  5HFL A;  5KA6 A;  1EBO A;  2EZO A;  2MK3 A;  2X7R B;  1JPX A;  2P6J A;  3B8N A;  4N23 A;  4E2L A;  1MOF A;  2OT5 A;  3WFV A;  1DF5 A;  4N21 A;  3CP1 A;  3B8M A;  1I5X A;  4JGS A;  1F23 A;  3B77 A;  1QBZ A;  4JPR A;  3MHS C;  2M7W A;  4JF3 A;  1QR8 A;  3GWO A;  3M99 B;  5HFM A;  1ENV A;  1SZT A;  1MG1 A; 
#chains in the Genus database with same CATH topology
 1HWY A;  4JYA O;  1BQ0 A;  1VQ8 V;  4LCU C;  3RYI A;  4G27 B;  4FIP C;  5EC1 C;  2YIB D;  4GX5 A;  1AI7 A;  1S72 V;  2OIE A;  4NXN O;  2HHH B;  3K3W A;  2ZKO A;  2XHB A;  4UB8 Z;  1YJW V;  1VQM V;  1GN2 A;  4LNU B;  1K33 A;  5GTH Z;  4G2K A;  4PJ0 Z;  3OT7 A;  3LSQ A;  4O4J B;  3APO A;  1H8E G;  3RW0 A;  1RM1 B;  2BSK B;  4LF6 B;  5HFL A;  3WG7 C;  5LYJ A;  3ZRX A;  1G4Y B;  2QTO A;  2ZR3 A;  1IXB A;  1BMF G;  1ZL8 B;  3EXA A;  5B5E Z;  1NT2 B;  1DGS A;  4LFB O;  3ETQ A;  4NXM B;  1H38 A;  3HKB B;  2R9A A;  2DYS B;  4DUY B;  2DYS C;  1FPO A;  1AJN A;  1P7B A;  3KKY A;  1K34 A;  4K0K B;  2WLJ A;  3SPI A;  4DV7 O;  2XAF A;  2QR4 A;  4MVR A;  2F23 A;  1AB3 A;  4O4H A;  2P67 A;  4O4I A;  1YXB A;  5CA3 A;  5KMG A;  3ZMZ A;  2YI8 A;  4MVS A;  3MHS C;  5JCO A;  3M8A A;  3NXS A;  1SA0 A;  4CS3 A;  2RN9 A;  1J5E B;  2IJI A;  1KP3 A;  5EZY B;  4DUZ O;  1GTO A;  1G8M A;  3ASO B;  3IGA C;  3I55 V;  1G6U A;  3P3N A;  2UUA B;  4IIJ B;  3ZMT A;  2V1D A;  4ZI7 B;  3JD2 A;  3CCE V;  1Z5V A;  4MT8 A;  3U0Z A;  2Q0O C;  2WLI A;  5LGN A;  4LH6 A;  3TET A;  5HFM A;  3ZRS A;  1Q43 A;  1M93 A;  4XDL A;  5DM6 V;  5CBG A;  3FB7 C;  1FJG O;  1IBK B;  4JI3 B;  5KX5 A;  4O4L A;  2MK3 A;  1Y74 A;  4J41 A;  3CHX A;  3GVM A;  2W0X A;  3FFQ A;  3ABM C;  4LFA O;  1N32 B;  2LGW A;  4MTG A;  3LDC A;  5B1B C;  4DR4 B;  2UXB B;  5C93 A;  4DR1 O;  1XHX A;  3CPW U;  3TXS A;  3ZHR A;  2Q5Z A;  1JMK C;  5J2U B;  5BXZ A;  2QM8 A;  2GBO A;  3O9O A;  4X8A A;  3OUS A;  4K8Z A;  1XDC A;  3ZX6 A;  1K3E A;  2VQF O;  2YIA A;  2JVD A;  2JEU A;  2EIN B;  3CRC A;  1GN6 A;  1Q6U A;  3E86 A;  2W6J G;  4LC1 A;  4Z2W A;  4CZZ A;  1BQZ A;  2KG7 B;  4LR3 A;  1RSO B;  1EZV H;  3VOU A;  3SJB C;  2ZE6 A;  4TOI A;  2QWQ B;  5JQG A;  4J42 A;  1R3L C;  4W4K A;  4DK1 A;  2YXL A;  1YZB A;  4FFK A;  4U7O A;  3HB3 B;  1Q86 W;  4ZIB A;  1L0N H;  2OTL V;  5IJ9 A;  1HW7 A;  1R1B A;  3FD9 A;  2WAM A;  1M57 B;  1I94 O;  3WB0 A;  1U97 A;  1TUB B;  5B1A B;  4TUY B;  3JAT B;  5EIB C;  2E75 B;  2PGG A;  5EBW C;  1M5I A;  5BZB A;  3UCS C;  1EFR G;  5LOV A;  1QR9 A;  2P4V A;  2YIB A;  2JIZ G;  3J80 N;  2RJZ A;  4K3A A;  1JJO A;  2OCC C;  4LP8 A;  3E83 A;  2PI5 A;  1ZWI C;  2QKS A;  5B3S B;  3K5L A;  1S3J A;  1G1X B;  1FFX A;  3B2E E;  1HR0 B;  3RWR D;  4O2A B;  2GUZ A;  3STL C;  3IFX A;  4GKJ O;  1BZK A;  1OCR C;  4TWK A;  2QWO B;  1SZX A;  1NZ6 A;  4WBN A;  3QF7 A;  3RFR A;  4DV4 B;  2X6B A;  4JYY A;  3HKE A;  3E35 A;  3P30 A;  2XAJ A;  4I4T B;  5LP6 A;  2EUL A;  1NTM H;  3OM3 B;  3UM7 A;  4DR2 B;  2IM9 A;  3BCC H;  2L35 A;  2UXD O;  1AR1 B;  3CRQ A;  1JOY A;  1N34 B;  4I9Q A;  1SZT A;  4X1I B;  3OMI B;  4B3S O;  3AG3 C;  3KCY A;  2P7T C;  2CDY A;  4FJC C;  1CP9 A;  1PL4 A;  1SQX H;  1JX9 A;  1NJI W;  4MTO A;  2CTW A;  1IX9 A;  3RBZ A;  2EBO A;  1HNZ B;  4BIO A;  4PDV A;  4ZBM A;  2DYR B;  3CP1 A;  4LH7 A;  2DOS A;  2QEX V;  1LUV A;  3BVO A;  1WAZ A;  4QNH B;  3T1H B;  1OCO C;  4DV5 O;  3RYI B;  1QQC A;  1XIL A;  3E8F A;  2H94 A;  4DV3 B;  1QHT A;  1N33 B;  3CD6 V;  1VF6 A;  4UFZ A;  2HR3 A;  1K73 W;  3A8T A;  1URF A;  4YY3 O;  3H9V A;  5FLX N;  2QE7 G;  2WLN A;  4X65 O;  1OHH G;  4WF9 V;  4C7U A;  4J7K A;  4I9W A;  2ITD C;  3RT3 C;  1KBH A;  1WA8 A;  1D5N A;  3HKB A;  3L71 H;  1HNX O;  1US6 A;  4CH6 A;  2IJH A;  1UJW B;  1BHB A;  3JAL A;  3FB8 C;  3ABU A;  3DC6 A;  4JI4 B;  1OCC C;  2Z5U A;  4X62 O;  3AG4 B;  4LFC O;  5L3F A;  2AZ0 A;  1AJP A;  1MAB G;  3CCV V;  3CCL V;  4JI0 B;  3JAM N;  1V54 C;  3OGI B;  2D2C B;  4F6E A;  2UXC O;  4LF9 O;  5K1P A;  2JGD A;  3OE7 G;  4R7C A;  3UT5 A;  1OJH A;  5IYZ A;  3W7W A;  4X66 B;  2F66 C;  2JK5 C;  1H2L A;  3CS5 A;  3FYI B;  1L8D A;  4P9P A;  4O4H B;  3D3Q A;  3HR0 A;  4IIJ A;  2CK3 G;  4O4I B;  1GN4 A;  4JAV A;  4JGS A;  1SA0 B;  4U3J A;  4JV5 B;  3ABL B;  1PV0 A;  3GWK C;  3W7S A;  1QVF U;  3ZHS A;  4BWA A;  5LBQ A;  1YTF D;  4DW1 A;  4RUE A;  5A2Q N;  2UUB O;  1U96 A;  3S3X A;  1OZ0 A;  5H6R A;  4CH3 A;  2WLI B;  2VS0 A;  5K1X A;  1P7G A;  1AR5 A;  3JD4 A;  4X64 O;  3W7U A;  4DR6 B;  2EIL C;  3M7M X;  2X6A A;  3CB2 A;  4DR7 O;  4UXN A;  1JQ0 A;  1HNW O;  3JSL A;  3T2M A;  3TK1 A;  4WFA V;  2R72 A;  5KX5 B;  2ZDI C;  5LL6 Y;  1M56 B;  2K9P A;  3CJH A;  1M56 C;  5J2U A;  3A2F A;  4NTX A;  1K97 A;  2XUM A;  2ZIM A;  4WFG A;  2BOB C;  3JSN A;  4HYO A;  4YJ2 A;  3AG7 A;  2Q4P A;  4ICG A;  1Y4M A;  4I55 B;  3CYO A;  4GUN A;  4A5U B;  2Y69 C;  4UVB A;  3RYF B;  2KG7 A;  4X20 A;  4OX9 B;  2LW1 A;  3L75 H;  1IDS A;  5BR8 O;  2ZT9 B;  4GX0 A;  1RPO A;  2IBZ H;  2XAG A;  4KP4 A;  1RP3 B;  1Q6H A;  1BGY H;  2JGU A;  2NR5 A;  4ZHQ A;  3OR7 C;  4UCO A;  1JA8 A;  2ODM A;  3ML0 A;  2XT9 A;  1TGO A;  2NNU A;  4JZ2 A;  2GTA A;  3CSX A;  1FXK C;  1KB9 F;  5JQG B;  2JS5 A;  1V55 C;  1B04 A;  1E1Q G;  1TUB A;  3JAT A;  2Y4U A;  1K8A W;  1YEW A;  4HZ3 A;  2W6I G;  5L3C A;  1SQP H;  5IJ9 B;  4GYC B;  4U7N A;  3E22 A;  1XEQ A;  3BAA A;  3K58 A;  3K9S A;  3FB6 C;  2P06 A;  3LSS A;  3ZBH A;  1NI8 A;  1CXZ B;  4DR3 B;  3UO3 A;  5LA6 A;  3GWO A;  4PI0 A;  2PI4 A;  1Y6X A;  3P32 A;  1HR0 O;  4KL1 A;  5LOV B;  1TUE B;  2R9R B;  2Y48 A;  5IE9 A;  4JI7 B;  2ZNJ A;  1QLE B;  5JVD B;  4GKK B;  1AR4 A;  1OV9 A;  1PD3 A;  2CTR A;  1ZUQ A;  1EBO A;  1FFX B;  5IY5 B;  4IL6 Z;  2X7R B;  5GW7 A;  3JAR A;  4LWS A;  2LW7 A;  2GUZ B;  2Q7H A;  4UVA A;  3KG2 A;  5LGU A;  3SYP A;  4DR2 O;  4JYC A;  4EB6 A;  3SYO A;  1HDJ A;  2F4V O;  2ETN A;  4FVM A;  4X1I A;  1XNR O;  2PF4 E;  4DV0 O;  5CB4 B;  4B3M O;  3HKE B;  3C3T A;  2DE0 X;  1ZX3 A;  4BIZ A;  4P2Z A;  5LP6 B;  4HNA A;  3E2E A;  2ARH A;  3L74 H;  4JI6 O;  5JJN B;  4Q6G A;  2WSS G;  2QDO A;  3CCU V;  3H1I H;  1F7Y A;  4B3T O;  3FAV B;  4PDM A;  3D36 C;  2B5U A;  3G67 A;  4B3R O;  3ZIA G;  3E8H A;  1I5Y A;  5ITZ B;  1XNQ O;  4MSW C;  4R50 A;  1BE3 H;  5AG2 A;  4JI5 O;  3T1Y B;  4JTC B;  3B40 A;  2UUC B;  2H8P C;  4Z1V A;  5CA1 A;  2HVK C;  1OCZ B;  3SYQ A;  4J7Z A;  4CC6 A;  4I50 A;  1QR8 A;  3BY6 A;  3QVN A;  4FMT A;  1GK9 A;  1I7F A;  3E8G A;  2RMK B;  2CAZ C;  5KUM A;  4UCS A;  2P22 C;  3BRC A;  2JJ2 G;  1VF6 C;  4FLW A;  1RM1 C;  2O57 A;  4KHP B;  4MS2 A;  3SYC A;  4KUM A;  1D5A A;  2A3Q A;  4FPP A;  4QE7 A;  4TQF A;  3ZMU A;  3SJC C;  1IBM O;  3AEI A;  1WA8 B;  3K5O A;  3O65 A;  1Q6I A;  2EIM B;  2EIM C;  3G80 A;  4JI0 O;  4LF7 O;  1XQ8 A;  1VQK V;  3JAL B;  2NLJ C;  1KQS U;  3L72 H;  2AHZ A;  1H2M A;  5KHG A;  3CCQ V;  3ETG A;  4N21 A;  4GX2 A;  2A06 H;  4QPJ A;  2DMX A;  2Z0A A;  2AW9 A;  1R6K A;  3D8C A;  3ABK B;  2JGD B;  4UCU A;  2DWE C;  1SS3 A;  3CWB H;  3JD0 A;  4LF8 O;  1F51 A;  1KKD A;  3UT5 B;  5IYZ B;  1AJQ A;  5L3E A;  4ZOL A;  3ASO C;  2QWR B;  4HBN A;  2PY5 A;  4JV5 O;  3CC2 V;  4PDR A;  3HKD A;  2Z3Y A;  3LNM B;  4FM0 A;  3LNN A;  1QBZ A;  4Z1M G;  4KXR A;  4DV1 B;  1AI6 A;  3E8B A;  2HKO A;  1T5E A;  4U3J B;  3X2Q B;  5LHH A;  3SPH A;  3X2Q C;  2B1G A;  1BL8 A;  2ZNI A;  4YHH O;  3SJA C;  1IUR A;  1XMO B;  1IBL B;  4IGG A;  5B1N A;  4XBF A;  3K59 A;  5DN6 G;  2IJK A;  1K9M W;  2Q67 A;  2EIK B;  4H0L B;  3TCU A;  1PL0 A;  4J9Z B;  5IWA B;  1R73 A;  4CH4 A;  3N2G A;  1COW G;  3CRA A;  3K03 A;  1WPB A;  2N05 A;  4JYB A;  3SPC A;  2CGO A;  3C90 A;  2EZP A;  4IHJ A;  3L73 H;  4BAY A;  3CJH B;  4CS2 A;  3JYC A;  4I55 A;  3H1H H;  1KYO F;  1Q8I A;  1MZE A;  3B4S A;  3RYF A;  1SQG A;  2IU0 A;  3CE2 A;  1GN3 A;  1ORQ C;  3B8M A;  1VMG A;  1YIT V;  3J81 N;  2QTS A;  2YC0 A;  3CRR A;  4YJ2 B;  5C8Y A;  4D7T A;  4JI8 B;  4IYI A;  2OWO A;  2EIN C;  1ZAU A;  2KQX A;  4XDJ A;  5LMU O;  1ZSP A;  4J11 A;  1EN4 A;  3MHH C;  4X20 B;  1FS0 G;  2UXX A;  2LGQ A;  2XAH A;  5EC2 C;  5LMN B;  2YSU B;  1PNM A;  4H44 B;  3W7T A;  1NU1 H;  3THO A;  3G6E V;  1BCC H;  1TAE A;  3FB5 C;  4NVP A;  2ATK C;  3KCX A;  4MVU A;  5LXT A;  2P5O A;  4R6Z A;  3SYA A;  1JR9 A;  2UU9 O;  3K5M A;  3PN1 A;  4PA9 A;  4ZHQ B;  1BHA A;  1W2B U;  3K08 A;  3D3I A;  1LR1 A;  3OTF A;  1M57 C;  4LF5 B;  2PZS A;  2Q8V A;  2PYJ A;  5EBL C;  3JAK B;  4QJF B;  5A9G A;  4RAI A;  5B1A C;  3SPG A;  4R8C A;  2HFE C;  3L9D A;  2Q73 A;  4YXW G;  4JTD B;  1R6T A;  3OEH G;  1Q3E A;  4MVO A;  4F6R A;  3CCM V;  3SR2 C;  3E22 B;  4WFE A;  4X88 A;  5JVD A;  3F5W C;  1BT8 A;  3MDS A;  1Y67 A;  5B3S C;  4JI7 O;  2E3C A;  4TV8 B;  5LA6 B;  2VRZ A;  1WP7 A;  3HKC A;  3OTO B;  3H01 A;  1NR1 A;  5JH7 A;  1NH2 D;  5KA5 A;  2LQT A;  2LFS A;  5CB4 A;  4DV6 B;  2QM4 A;  4FFB A;  4JI1 O;  2AGA A;  3AG2 B;  4B7E A;  3JAR B;  4LWS B;  1JPX A;  1WP8 A;  1BSM A;  1YHQ V;  2LO1 A;  5BY1 A;  4JI2 B;  1MZF A;  5IYC O;  2F1M A;  3JCU Z;  4B7K A;  2M7W A;  3FAV A;  1IXM A;  4EB6 B;  2KSD A;  1X4T A;  5IT9 N;  2E5L B;  4O2B A;  4D7S A;  4DK0 A;  3F7Y C;  5KHI A;  1QNM A;  4DR5 O;  4HNA B;  5ITZ A;  4I0X A;  1N0N A;  1QLN A;  4RWU A;  1Q81 W;  5LHG A;  1FXH A;  3E89 A;  2L6L A;  4UUJ C;  1XMQ B;  2DYR C;  4JPR A;  2QJ1 A;  1V9P A;  4QIW F;  4F4L A;  4UV8 A;  3DGE A;  2BOC C;  1EZJ A;  2HHH O;  1PPJ H;  2JDI G;  1DK1 A;  1Q90 D;  3ETD A;  2C2A A;  5B1O A;  3APQ A;  1N4C A;  5CA1 B;  4J7J A;  2PUS A;  5FNV B;  2KB1 A;  3LUT B;  4WFB V;  3ZRW A;  4I50 B;  4AIL C;  3DC5 A;  3LDD A;  4WFF A;  4PV1 B;  4LF6 O;  1SES A;  2Q7G A;  4KHP O;  4MW8 A;  1YTF B;  5CBH A;  2QA4 V;  1EM1 A;  1WLE A;  1WPX A;  1S77 D;  3RYH B;  3VQV A;  4K8X A;  4DXW A;  4NXM O;  1UFI A;  3AG4 C;  4DUY O;  2AHY A;  3CCS V;  4K0K O;  2FKX A;  1XL6 A;  1FD9 A;  2FL4 A;  1YCI A;  1Z5W A;  4EFE A;  3JD3 A;  1WN7 A;  4FLU A;  4EEQ A;  3RYC A;  4LFB B;  1QVG U;  4TQD A;  1FYJ A;  3T4Z A;  1VIB A;  2XTA A;  3G71 V;  1J5E O;  2ZE8 A;  4X1K A;  2EJ7 A;  3I5D A;  1S0V A;  1YDX A;  4J10 A;  1SET A;  2HG5 C;  4W4L A;  5JCO C;  2UXN A;  4DV7 B;  5LHI A;  2ZM6 B;  2UUA O;  2IH1 C;  3VQY A;  3ABL C;  4PD4 F;  5IJ0 A;  3ZCC A;  3ZS8 C;  4ZOL B;  4EFB A;  3J7A U;  4MVZ A;  3Q4H B;  3STZ C;  3UQ8 A;  1S5L Z;  3U11 A;  2RDC A;  3HKD B;  4P9O A;  4ZKI A;  4DUZ B;  2LFR A;  4UCV A;  3JCZ A;  5IDJ A;  4Q20 A;  4JI3 O;  1IBK O;  4L8J A;  2ADQ B;  2WLH A;  1SQF A;  4DYL A;  3A0H Z;  2Q9L A;  1VQ4 V;  3ASN B;  2WA3 A;  2Q68 A;  1N32 O;  4DR4 O;  4JAU A;  2UXB O;  1TA8 A;  2YXH A;  4OPA A;  1FJG B;  5EYP A;  3N2G B;  4KFM A;  1P49 A;  4MTX A;  2V4D A;  3EVK A;  3N2K B;  4DRX A;  4IHJ B;  2MW2 B;  2QKA A;  1DLB A;  4LFA B;  4IT5 A;  4G28 B;  4DR1 B;  4TV9 A;  2X0L A;  2QWP B;  3RN4 A;  1VQO V;  4JTA B;  2NN4 A;  1GMG A;  5C8Y B;  2QKC A;  5L3B A;  3K06 A;  1YIJ V;  2B1I A;  2V7Q G;  5J9P C;  5H6Q A;  1XL4 A;  2VQF B;  4K35 A;  1KD1 W;  3TJT A;  2Q7E A;  2QGN A;  2EZO A;  4E2L A;  3JAK A;  3UKM A;  4UCR A;  3VQW A;  5LXT B;  2VQE B;  5D5P A;  4UCT A;  2Y0P A;  3OMA B;  1NS1 A;  2JRI A;  2N04 A;  1JCH A;  3VQX A;  2GHY A;  4PI2 A;  2ZXW B;  1VQ6 V;  3R66 A;  2WLL B;  3SPJ A;  3L70 H;  2YIC A;  3JD1 A;  1H8H G;  4X1Y A;  1L1F A;  1Q82 W;  4UV9 A;  3WB1 A;  5F2V O;  1AVM A;  3VBB A;  5KHH A;  4TV8 A;  4CH5 A;  1I94 B;  3WU2 Z;  3HPL C;  2E76 B;  3DXR B;  4F6R B;  3H1K H;  3BA8 A;  5JJE B;  3OUF A;  1QLE C;  4CC5 A;  5KA6 A;  1RPR A;  5IY5 C;  4GT1 A;  4DV4 O;  2GDS A;  4RUF A;  2BTQ A;  4B08 A;  1F23 A;  3B77 A;  1R3I C;  3CXC U;  4GX1 A;  5CA0 A;  3HKC B;  2ILM A;  2JS3 A;  5JH7 B;  3IJ4 A;  3QNE A;  3RVY A;  3GB7 C;  4X89 A;  1WB7 A;  4GKJ B;  4FFB B;  1PM9 A;  3AK1 A;  2EIJ B;  2LP7 A;  5LP6 C;  2RQ6 A;  3AK3 A;  1N34 O;  2FB5 A;  1SF9 A;  5DED A;  2N74 A;  4FLV A;  3AG1 B;  1ROP A;  4LF4 B;  1XUQ A;  1JFF A;  1NR7 A;  3FYE B;  2R70 A;  3ZN0 A;  4O2B B;  1HNZ O;  4ABM A;  4P30 A;  3R65 A;  1VQ7 V;  1E79 G;  2FML A;  2UXD B;  5KUK A;  4I0X B;  3BHP A;  4DV2 B;  3QO5 A;  2Q69 A;  2EJR A;  3FKS G;  1KP2 A;  4B3S B;  3T1H O;  2X6C A;  1OCZ C;  5FNV A;  2OCH A;  4NB5 A;  1AI5 A;  2IJJ A;  3I56 V;  4DV3 O;  1N33 O;  1K4C C;  3G6B A;  3ZN1 A;  4NKG B;  4GCZ A;  3ZMS A;  3ICX A;  1IZ3 A;  1W0K G;  2ZE7 A;  3OMN B;  2H3O A;  2DQ3 A;  5JJJ B;  4DV5 B;  3RYH A;  1J95 A;  1ZLZ A;  2OT5 A;  3ZRW B;  4FZ0 A;  4AHC A;  3OD4 A;  1B3Q A;  1P4R A;  2Y4T A;  1LUW A;  4H37 A;  4JI4 O;  3K5N A;  4YY3 B;  1R6N A;  2OTJ V;  2Q6A A;  1KUQ A;  4HAM A;  4FM2 A;  3WG7 B;  4X65 B;  3N27 A;  2Y0I A;  3CC4 V;  5J2T B;  1Z2G A;  1HNX B;  3G4S V;  1A32 A;  4QGP A;  1TVK B;  2F93 B;  1SQV H;  4X66 O;  2GSM B;  4X62 B;  4LFC B;  2ZE5 A;  3ABK C;  2RNB A;  2QWN B;  3OW2 U;  1F4M A;  3RYC B;  4L87 A;  1O9H A;  2UXC B;  2ZM6 O;  3K57 A;  4LF9 B;  2YEV B;  2QM7 A;  4X1K B;  3ZHU A;  3Q4H A;  4XDK A;  3C3S A;  4N23 A;  2CUG A;  1F4N A;  4YJ3 A;  3JAS A;  4OXS A;  1VP7 A;  3SGI A;  2AXT Z;  3QG5 A;  3ZMV A;  2BE3 A;  4H33 A;  2WA4 A;  1VF5 B;  5IJ0 B;  3BA9 A;  2BTO A;  4NTY A;  1SQQ H;  4DR6 O;  2KKW A;  4UB6 Z;  4EKW A;  2DQ0 A;  3ETE A;  2A79 B;  2EIK C;  2F43 G;  2F95 B;  2HP8 A;  1H2G A;  3LDE A;  3IC9 A;  5IYD O;  2UUB B;  3RGB A;  3CRM A;  1Y66 A;  4WFH A;  3ABT A;  3N2K A;  1VF7 A;  4PDL A;  1QCE A;  2ZDI A;  1N0J A;  1KEC A;  4X64 B;  1PP9 H;  2YID A;  2LJ2 A;  2A7W A;  1AI4 A;  3OFN G;  1Q5O A;  4DR7 B;  3IAY A;  5FPR A;  5FL7 G;  1HNW B;  2P4K A;  5EYP B;  3ABM B;  3P3P A;  4BW9 A;  3CCJ V;  2IH3 C;  4DW0 A;  1VQN V;  4FLZ A;  5B1B B;  4DRX B;  4OX9 O;  4J9Y B;  2XND G;  2D3O W;  3JAW A;  3ZHT A;  1XRE A;  2CH7 A;  1SER A;  1ZTE A;  4TV9 B;  1Y76 A;  3T1C A;  4JAS A;  4MW3 A;  1K4D C;  3CXH F;  1H2N A;  1NH2 B;  1MG1 A;  1B06 A;  4MTF A;  5BR8 B;  3DTU B;  3BFR A;  4I5S A;  2VQE O;  2WLL A;  1KKC A;  5CMU A;  1FXK A;  1S76 D;  1MSW D;  1WNS A;  4E4E A;  1GH6 A;  1VQP V;  1MSD A;  1NQT A;  1I5X A;  5EBM C;  1PKX A;  1KU9 A;  4AQY B;  4J80 A;  1XI1 A;  3K0G A;  1YJN V;  2VWK A;  3DXR A;  5H9C A;  4PEL A;  3MAQ A;  3BPZ A;  5E79 Z;  3RVZ A;  4GLX A;  2AZ2 A;  4BIU A;  4X1Y B;  4DR3 O;  5CN0 A;  3B09 A;  3OEE G;  1GM8 A;  2XAS A;  2JEX A;  2YUA A;  3DSQ A;  2A0L A;  3LSU A;  4GKK O;  3MD0 A;  1NKD A;  1K5Q A;  2OCC B;  4D6T H;  1NTZ H;  3CEI A;  2ITC C;  1N36 B;  1XHZ A;  2GTS A;  2ZD9 A;  5KHK A;  3AG2 C;  5GTI Z;  2BTQ B;  3FX7 A;  1YJ9 V;  1FAF A;  5CA0 B;  3ZJZ A;  1OCR B;  1K5S A;  5BMV A;  5DEC A;  4LF4 O;  2ZCE A;  2PTM A;  2DN9 A;  4PA3 A;  1AIL A;  3KZI Z;  3H1J H;  2GV9 A;  1O9G A;  5FPO A;  5H2F Z;  1XNR B;  2F4V B;  2XAQ A;  4DV0 B;  2HJD A;  4B3M B;  1M4U A;  1JFF B;  3QO8 A;  1KMI Z;  1IVS A;  4DV2 O;  5EIB D;  2IW5 A;  5B66 Z;  4JI6 B;  3T1Y O;  3D36 A;  2UUC O;  1M90 W;  3WB2 A;  3AG3 B;  1S5H C;  1GRJ A;  4B3T B;  2HEP A;  1W0J G;  3CME V;  3ZHQ A;  3K9A A;  4PHZ A;  4BR6 A;  2VWJ A;  1VEW A;  3F7V C;  2WWW A;  4B3R B;  1GAX A;  4JZG A;  4JYA B;  1FFT B;  3EFF K;  1XNQ B;  3IC7 A;  4JI5 B;  2B9Z A;  4CBC A;  3K04 A;  5GON B;  1YI2 V;  1OCO B;  4NXN B;  5EK0 A;  1VQ9 V;  1MNG A;  4LNU A;  4O4J A;  4PA7 A;  4FLX A;  4OGQ B;  1D2D A;  1GO3 F;  2BSK A;  2ZQM A;  2FTK A;  1BS3 A;  4RQE A;  1ZL8 A;  4PA4 A;  4RQF A;  1THZ A;  5J2T A;  2A9H A;  3W7X A;  3CCR V;  2OYQ A;  1K92 A;  4JF3 A;  1VQ5 V;  3S3W A;  1TVK A;  2WPD G;  4MVM A;  1W59 A;  5LGT A;  2W0F C;  2WLM A;  1DF4 A;  3CX5 F;  1WB8 A;  4YIP A;  1RFY A;  5LYJ B;  3T4D A;  1IBM B;  3AK2 A;  1OCC B;  1HP8 A;  2YDE A;  2YEV A;  1H2K A;  2K1E A;  1YSC A;  1GM9 A;  1I08 A;  2RCV A;  4LF7 B;  1V54 B;  3F5T A;  4TT3 G;  3OGC C;  1NTK H;  1SKV A;  1K7D A;  4AI8 A;  1P84 F;  4U3F H;  1SQB H;  2HJF C;  2Q0A A;  5EZY A;  1VQL V;  3QO7 A;  4DV1 O;  3OAA G;  4LF8 B;  4ZI7 A;  1NBM G;  5KMG B;  2ZIN A;  1H2S B;  1SRY A;  4YJ3 B;  1XMO O;  1NVP B;  1IBL O;  3JAS B;  1XOU A;  5JWP A;  4NTW A;  1YVW A;  3M99 B;  5L3G A;  1SC5 B;  3CMA V;  2YI9 A;  4I7Z B;  1I0H A;  4YIO A;  2IU3 A;  2QSA A;  2G38 A;  1MA1 A;  5IWA O;  4FM1 A;  3ASN C;  4FK5 C;  1DTO A;  1AP6 A;  1E1R G;  5H5N A;  4YHH B;  1AP5 A;  4FZ1 A;  4BW5 A;  2R9I A;  1M1K W;  2EIL B;  1ENV A;  2OIG A;  1YF2 A;  2JJ1 G;  2WLK A;  4O4L B;  4UVC A;  1VAR A;  5KAI Z;  1Y74 B;  4JI8 O;  4NR1 A;  2P6J A;  4OPH A;  1FKA O;  3TGU H;  1PNL A;  2DJV A;  1R3K C;  2CE4 A;  1X59 A;  3SDL A;  2ADP A;  3EHB B;  1NVP D;  3NR7 A;  5LMN O;  3JAW B;  1ARO P;  2HVJ C;  2CTP A;  2Y69 B;  1CEZ A;  3H1L H;  2CH7 B;  2XOK G;  1S5J A;  1Q7Y W;  1RSO A;  1Y76 B;  1WJZ A;  2ZR2 A;  4TSF G;  2CGN A;  5LMU B;  1L0L H;  5D5Q A;  3BAB A;  4GZR B;  4LF5 O;  3OR6 C;  1GKF A;  1EN5 A;  3PJS K;  3A0R A;  1XBL A;  2YXY A;  2ZXW C;  3BEH A;  1FXK B;  3TXQ A;  4AQY O;  2UU9 B;  1V55 B;  4NYK A;  1FXV A;  4TUY A;  2YS8 A;  1UPG A;  5CBF A;  5E1A C;  5KAF Z;  3UO2 A;  2BCC H;  2PYL A;  5L3D A;  1B6Q A;  2EX3 A;  2E74 B;  1R3J C;  4LBE C;  3K79 A;  3OTO O;  1GM7 A;  4H13 B;  2ZIO A;  4X9Q A;  3WFV A;  4O2A A;  3A0B Z;  4PA6 A;  3QTC A;  3ZHV A;  4FLY A;  4DV6 O;  4JAA A;  5IYB O;  1N36 O;  3ZRV A;  2HLD G;  4JI2 O;  2DW4 A;  4CS4 A;  1LNQ A;  4QE9 A;  4I4T A;  2P90 A;  2EIJ C;  5KLV H;  1KC8 W;  2CTQ A;  4ASU G;  1M9N A;  4WCE V;  3B8N A;  2E5L O;  1MOF A;  5TIS Z;  3AG1 C;  3CC7 V;  2FYU H;  3U10 A;  4JI1 B;  4WBN B;  4IYH A;  1N8R W;  5BMV B;  2M6Y A;  4MVQ A;  1JJ2 U;  1EN6 A;  4QPK A;  1JVM A;  1XMQ O;  5KHJ A;  2DWD C;  1MMM A;  3ZED A;  3K0D A;  1PNK A;  1CPY A;  4FLT A;  4RO2 A;  1DF5 A;  4DR5 B;  1QU7 A;  4DO2 A;  3SJQ C;  5GON A; 
#chains in the Genus database with same CATH homology
 1EZJ A;  1HWY A;  4J9Y B;  2XND G;  1VQ8 V;  2JDI G;  4LCU C;  2D3O W;  4G27 B;  3ETD A;  2C2A A;  1Y4M A;  4FIP C;  5EC1 C;  3CYO A;  5B1O A;  2Y69 C;  4GX5 A;  4UVB A;  1SER A;  1AI7 A;  1S72 V;  3K3W A;  3T1C A;  2KB1 A;  3LUT B;  4GX0 A;  4JAS A;  4WFB V;  1RPO A;  3ZRW A;  4MW3 A;  1K4D C;  3LDD A;  4WFF A;  2XAG A;  4KP4 A;  1YJW V;  1SES A;  1VQM V;  1NH2 B;  1MG1 A;  4MTF A;  3DTU B;  1K33 A;  4MW8 A;  4G2K A;  1YTF B;  3OR7 C;  5CBH A;  2QA4 V;  3ML0 A;  3LSQ A;  4I5S A;  1H8E G;  3RW0 A;  1WLE A;  1WPX A;  2WLL A;  1RM1 B;  5CMU A;  5HFL A;  1S77 D;  2NNU A;  3WG7 C;  1FXK A;  3ZRX A;  1G4Y B;  1FXK C;  2QTO A;  2ZR3 A;  1S76 D;  1MSW D;  4DXW A;  1BMF G;  1VQP V;  1V55 C;  3AG4 C;  1E1Q G;  1NQT A;  1I5X A;  5EBM C;  2AHY A;  1K8A W;  3CCS V;  1PKX A;  1XL6 A;  4HZ3 A;  2W6I G;  1H38 A;  5L3C A;  3K0G A;  1YJN V;  2DYS B;  5H9C A;  2DYS C;  3JD3 A;  4PEL A;  1AJN A;  1P7B A;  4U7N A;  3RVZ A;  1K34 A;  4BIU A;  2WLJ A;  5CN0 A;  3FB6 C;  3OEE G;  3SPI A;  1QVG U;  2XAF A;  1GM8 A;  3T4Z A;  3LSS A;  4MVR A;  3G71 V;  2XAS A;  2JEX A;  2P67 A;  2A0L A;  1S0V A;  5CA3 A;  1SET A;  2HG5 C;  3ZMZ A;  4MVS A;  3MHS C;  3MD0 A;  1NKD A;  3GWO A;  3NXS A;  2UXN A;  2PI4 A;  5LHI A;  3P32 A;  2IH1 C;  1TUE B;  2R9R B;  2Y48 A;  2IJI A;  1KP3 A;  3ABL C;  1QLE B;  3ZCC A;  1K5Q A;  2OCC B;  1GTO A;  1G8M A;  2ITC C;  3ASO B;  3IGA C;  3I55 V;  4MVZ A;  1PD3 A;  2ZD9 A;  1EBO A;  5IY5 B;  3AG2 C;  3STZ C;  2V1D A;  3ZMT A;  2X7R B;  5GW7 A;  3JD2 A;  3CCE V;  4P9O A;  4ZKI A;  1YJ9 V;  2LFR A;  4MT8 A;  2WLI A;  4UVA A;  5LGN A;  3JCZ A;  3KG2 A;  3ZJZ A;  5LGU A;  1OCR B;  3TET A;  5IDJ A;  4Q20 A;  5HFM A;  3SYP A;  3ZRS A;  4JYC A;  2WLH A;  3SYO A;  1K5S A;  4XDL A;  5DM6 V;  5CBG A;  3FB7 C;  4BIZ A;  1VQ4 V;  4P2Z A;  3ASN B;  3E2E A;  4PA3 A;  2Q68 A;  2MK3 A;  2WSS G;  2XAQ A;  4JAU A;  3CCU V;  3QO8 A;  3ABM C;  4KFM A;  2IW5 A;  4PDM A;  4MTX A;  3D36 A;  4MTG A;  3LDC A;  5B1B C;  1M90 W;  3AG3 B;  2B5U A;  5C93 A;  1S5H C;  3CPW U;  3ZIA G;  3E8H A;  1W0J G;  3CME V;  1I5Y A;  4MSW C;  4R50 A;  3K9A A;  2QM8 A;  1DLB A;  4X8A A;  4JTC B;  3F7V C;  2H8P C;  2WWW A;  2HVK C;  3OUS A;  4G28 B;  1OCZ B;  2X0L A;  1FFT B;  3EFF K;  1VQO V;  4JTA B;  3IC7 A;  1K3E A;  3SYQ A;  4CBC A;  1GMG A;  3K04 A;  1QR8 A;  5L3B A;  3BY6 A;  2JEU A;  4FMT A;  1YI2 V;  3K06 A;  1OCO B;  2EIN B;  1YIJ V;  2B1I A;  2V7Q G;  5EK0 A;  1GK9 A;  3E86 A;  5J9P C;  1VQ9 V;  3E8G A;  5H6Q A;  1XL4 A;  2W6J G;  4LC1 A;  5KUM A;  4CZZ A;  1KD1 W;  4PA7 A;  3VOU A;  1GO3 F;  2JJ2 G;  2ZQM A;  1RM1 C;  2EZO A;  2FTK A;  4MS2 A;  3SYC A;  4RQE A;  4E2L A;  4PA4 A;  4KUM A;  4RQF A;  1R3L C;  3UKM A;  1THZ A;  4QE7 A;  4FPP A;  3ZMU A;  2A9H A;  3W7X A;  3CCR V;  1K92 A;  4JF3 A;  4U7O A;  3HB3 B;  1VQ5 V;  2WPD G;  3OMA B;  4MVM A;  1Q86 W;  3AEI A;  1JCH A;  5LGT A;  2GHY A;  2W0F C;  2WLM A;  2OTL V;  1DF4 A;  2ZXW B;  1VQ6 V;  2EIM B;  2WAM A;  2EIM C;  2WLL B;  3SPJ A;  1VQK V;  2NLJ C;  3JD1 A;  3T4D A;  1KQS U;  1M57 B;  1H8H G;  2AHZ A;  1OCC B;  1L1F A;  3CCQ V;  1Q82 W;  4UV9 A;  3ETG A;  5B1A B;  2YEV A;  2K1E A;  4GX2 A;  4N21 A;  1YSC A;  4QPJ A;  1GM9 A;  5EBW C;  3VBB A;  1V54 B;  4TT3 G;  5BZB A;  1R6K A;  3HPL C;  3ABK B;  3OGC C;  1EFR G;  1K7D A;  2DWE C;  3JD0 A;  1F51 A;  1QR9 A;  3OUF A;  1KKD A;  2JIZ G;  2HJF C;  1QLE C;  2OCC C;  4LP8 A;  3QO7 A;  3E83 A;  1VQL V;  2PI5 A;  1AJQ A;  5L3E A;  1ZWI C;  2QKS A;  3ASO C;  5KA6 A;  3OAA G;  1RPR A;  5B3S B;  1S3J A;  5IY5 C;  3CC2 V;  1NBM G;  4PDR A;  4GT1 A;  2Z3Y A;  3LNM B;  4RUF A;  1SRY A;  3STL C;  1F23 A;  3B77 A;  1QBZ A;  1R3I C;  4Z1M G;  3CXC U;  1NVP B;  3IFX A;  4GX1 A;  1AI6 A;  3E8B A;  2HKO A;  1OCR C;  3M99 B;  4TWK A;  4UV8 A;  5L3G A;  3X2Q B;  3CMA V;  5LHH A;  3SPH A;  3X2Q C;  2B1G A;  1BL8 A;  3QNE A;  3RVY A;  2X6B A;  2IU3 A;  3GB7 C;  3E35 A;  3P30 A;  2XAJ A;  4X89 A;  5B1N A;  2EIJ B;  2LP7 A;  4XBF A;  3ASN C;  3OM3 B;  4FK5 C;  3UM7 A;  5DN6 G;  2IJK A;  1K9M W;  1DTO A;  1E1R G;  2Q67 A;  2EIK B;  3AG1 B;  4BW5 A;  1ROP A;  3TCU A;  1PL0 A;  2R9I A;  4J9Z B;  1R73 A;  1NR7 A;  1AR1 B;  1M1K W;  1COW G;  3FYE B;  2EIL B;  1JOY A;  1ENV A;  3K03 A;  1SZT A;  3ZN0 A;  4P30 A;  3R65 A;  4JYB A;  3OMI B;  1VQ7 V;  3AG3 C;  3SPC A;  1E79 G;  2P7T C;  2EZP A;  4FJC C;  5KUK A;  1CP9 A;  2JJ1 G;  1JX9 A;  4BAY A;  2WLK A;  1NJI W;  4MTO A;  4UVC A;  3JYC A;  3QO5 A;  2Q69 A;  2EJR A;  3FKS G;  3RBZ A;  1KP2 A;  2EBO A;  2IU0 A;  4PDV A;  2P6J A;  2X6C A;  1OCZ C;  4ZBM A;  1ORQ C;  1PNL A;  2DYR B;  3CP1 A;  3B8M A;  1YIT V;  1R3K C;  1AI5 A;  2IJJ A;  2QEX V;  3I56 V;  4QNH B;  1K4C C;  3EHB B;  1NVP D;  1OCO C;  2EIN C;  3ZN1 A;  4GCZ A;  4XDJ A;  3ZMS A;  1ARO P;  2HVJ C;  1W0K G;  2Y69 B;  1CEZ A;  3OMN B;  3E8F A;  2H94 A;  2DQ3 A;  2XOK G;  3MHH C;  1Q7Y W;  1FS0 G;  2UXX A;  3CD6 V;  2XAH A;  2ZR2 A;  5EC2 C;  4TSF G;  2YSU B;  2HR3 A;  1J95 A;  1K73 W;  1PNM A;  2OT5 A;  3ZRW B;  3W7T A;  3G6E V;  3FB5 C;  2QE7 G;  2WLN A;  2ATK C;  4MVU A;  1OHH G;  4WF9 V;  1P4R A;  4R6Z A;  3SYA A;  4I9W A;  2ITD C;  3OR6 C;  4H37 A;  1GKF A;  3PJS K;  3A0R A;  4PA9 A;  1BHA A;  1W2B U;  1R6N A;  3K08 A;  3D3I A;  2OTJ V;  2ZXW C;  2Q6A A;  4HAM A;  2IJH A;  1UJW B;  3BEH A;  3WG7 B;  1BHB A;  1FXK B;  3FB8 C;  1M57 C;  3ABU A;  1OCC C;  1V55 B;  2Z5U A;  3AG4 B;  5EBL C;  5L3F A;  1AJP A;  1FXV A;  4QJF B;  3CC4 V;  4RAI A;  1MAB G;  3CCV V;  3CCL V;  5B1A C;  3SPG A;  4R8C A;  3G4S V;  2HFE C;  5CBF A;  1V54 C;  5E1A C;  2GSM B;  4YXW G;  4JTD B;  3ABK C;  3OEH G;  4MVO A;  5L3D A;  1B6Q A;  3CCM V;  3OE7 G;  4R7C A;  3OW2 U;  4WFE A;  1F4M A;  4X88 A;  4L87 A;  3F5W C;  3W7W A;  1R3J C;  4LBE C;  2JK5 C;  3K79 A;  2YEV B;  3FYI B;  2QM7 A;  1GM7 A;  5B3S C;  4P9P A;  4XDK A;  4N23 A;  2CK3 G;  3WFV A;  1F4N A;  4JAV A;  4PA6 A;  4JGS A;  5IYB O;  4OXS A;  3ZRV A;  3ZMV A;  3H01 A;  4H33 A;  3ABL B;  1NR1 A;  2HLD G;  1NH2 D;  5KA5 A;  3W7S A;  1QVF U;  2DW4 A;  2LFS A;  5LBQ A;  1LNQ A;  4QE9 A;  1YTF D;  2P90 A;  4RUE A;  2EIJ C;  3AG2 B;  1KC8 W;  4EKW A;  4ASU G;  1JPX A;  1M9N A;  1OZ0 A;  2DQ0 A;  3B8N A;  5H6R A;  4WCE V;  1MOF A;  1YHQ V;  3ETE A;  2A79 B;  2WLI B;  3AG1 C;  2EIK C;  2F43 G;  5IYC O;  3CC7 V;  1H2G A;  3JD4 A;  2M7W A;  3LDE A;  5IYD O;  1IXM A;  3W7U A;  1N8R W;  2EIL C;  2X6A A;  4MVQ A;  1Y66 A;  1JJ2 U;  4UXN A;  1JQ0 A;  4WFH A;  3ABT A;  4QPK A;  3F7Y C;  3T2M A;  1JVM A;  3TK1 A;  4WFA V;  4PDL A;  1QCE A;  2ZDI A;  1KEC A;  2ZDI C;  1M56 B;  1QLN A;  1M56 C;  1AI4 A;  2DWD C;  1Q81 W;  5LHG A;  3OFN G;  1FXH A;  3E89 A;  3K0D A;  1PNK A;  4UUJ C;  1K97 A;  1CPY A;  4RO2 A;  5FL7 G;  1DF5 A;  3ABM B;  3CCJ V;  2IH3 C;  4WFG A;  4DO2 A;  2DYR C;  4JPR A;  1VQN V;  2BOB C;  3SJQ C;  4QIW F;  5B1B B;  4HYO A;  4F4L A;  3DGE A;  2BOC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...