1Y66A

Dioxane contributes to the altered conformation and oligomerization state of a designed engrailed homeodomain variant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
50
structure length
50
Chain Sequence
b'QWSEEVERKLKEFVRRHQEITQETLHEYAQKLGLNQQAIEQFFREFEQRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords engrailed homeodomain
publication title Dioxane contributes to the altered conformation and oligomerization state of a designed engrailed homeodomain variant.
pubmed doi rcsb
source organism Escherichia coli
molecule tags De novo protein
total genus 24
structure length 50
sequence length 50
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1y66A00
1QR9A 3B8MA 3H01A 4N23A 1DF5A 1DLBA 1JQ0A 3P30A 2LP7A 5CMUA 3M99B 1ENVA 5KA5A 2EZOA 4G2KA 3GWOA 1EBOA 1QCEA 2M7WA 4FK5C 3MHHC 1F23A 4N21A 3B77A 5H9CA 2OT5A 2EBOA 4JGSA 2EZPA 5HFLA 1SZTA 4FIPC 1MG1A 1I5XA 5KA6A 3MHSC 1I5YA 1Y66A 1DF4A 4JF3A 3WFVA 1K34A 1K33A 1QR8A 4FJCC 3K9AA 2X7RB 1Y4MA 4JPRA 1JPXA 4E2LA 5HFMA 2MK3A 1MOFA 3CP1A 2P6JA 3CYOA 1QBZA 5CN0A 3B8NA
chains in the Genus database with same CATH superfamily
1UFIA 3SPIA 2HFEC 3WB0A 4UCTA 3PJSK 1QVGU 5D5PA 2ZM6O 2V1DA 3CMEV 2QWOB 4IIJA 1Y76B 3FYEB 5KA6A 5LL6Y 2NR5A 1K5SA 2XASA 4UFZA 2X7RB 4DR3B 2LQTA 3ABMB 2L35A 3WG7B 1BQ0A 3JYCA 3TXQA 2JGDA 3TETA 2UUBO 3P3NA 1V54C 2OCHA 1N34B 5LGNA 1M1KW 4WFHA 1R3LC 2F4VB 1PNMA 5KHIA 1FAFA 4HAMA 3AG3B 1XDCA 1AILA 3IC9A 2JK5C 2QWQB 3UQ8A 1PL4A 2P4VA 2HR3A 3CXHF 1JFFA 1DLBA 1ZAUA 2WPDG 1XNQB 2EX3A 4H0LB 5KHHA 5LGUA 4JI6O 3ZRSA 1SETA 1YJWV 4KP4A 3K5NA 4KUMA 4UB8Z 4PI0A 3ETDA 1M4UA 2GDSA 2IJJA 1ZTEA 2KKWA 3STZC 4XDLA 5LOVB 3EFFK 3ZEDA 1X59A 4UXNA 4JTCB 2UXBB 1VF6C 2DQ0A 5KHKA 3OEHG 4CZZA 3SYAA 4ZOLB 4O4LB 4CH4A 4WFAV 2FB5A 5EBWC 3QTCA 2X6BA 5CB4B 4CH6A 1VQNV 1WPXA 1D5AA 4B3RO 2AHZA 1NH2D 1RPOA 3JASB 3DSQA 3CX5F 3JSNA 3ASOB 3L9DA 1XNRB 4NTYA 4RUEA 5DECA 2HHHO 4K0KB 2R9AA 1MG1A 3GB7C 1P84F 1NR1A 2PI5A 4DRXA 1DF4A 1UPGA 1S5JA 1G6UA 1SC5B 3OFNG 2JS3A 3RYFA 1TVKA 4MVUA 2VQFB 4FZ0A 3ZN1A 4I50B 1A32A 4LF8O 1WP7A 1SA0A 5J2UA 1IBMB 2CE4A 1O9HA 5H5NA 1K92A 3SYPA 1N33B 1KD1W 3GWOA 4GKJB 1AB3A 1OCOC 3CMAV 1PM9A 2QA4V 4DV4O 1XILA 4LH6A 4YJ3A 2YIBD 1VQLV 4LBEC 2W6IG 3H1IH 3IGAC 2YIAA 1VEWA 2NLJC 2Q8VA 4DV2B 4IYHA 3LDEA 4ZI7A 5C93A 1T5EA 4HBNA 3G80A 4JI0O 2DYSC 5JJEB 2BTQB 4PELA 4I0XB 4DR5O 4FM2A 4EB6B 4UCRA 2Y4TA 3GWKC 1IXMA 1F4NA 3BA8A 1YF2A 4AILC 4WBNB 3L71H 3JD3A 4GKKB 1P7GA 2PUSA 2H94A 4X9QA 1H2MA 1XHXA 3ZHRA 3E83A 4X88A 3SJBC 4R6ZA 3L74H 1YTFB 3S3WA 1YITV 3CJHB 2H8PC 1QHTA 2ZM6B 2R9RB 2ZCEA 3D8CA 2DJVA 2Y0PA 5IWAO 5L3GA 4CC5A 5IYZA 4FLZA 3MDSA 2YUAA 4IGGA 4BR6A 5LYJB 4E2LA 2QTSA 1QBZA 5B1AC 4LNUB 4GLXA 1VQPV 2A9HA 5E79Z 2EINB 2Q67A 2YC0A 4KL1A 2UUBB 2Y48A 4PDVA 1L8DA 2FMLA 4PA6A 3ICXA 5KUKA 2QM4A 3G6BA 3CCVV 5CBGA 3OE7G 4X66O 3ETGA 2HP8A 4O4LA 4EFEA 1YJNV 3BRCA 4ASUG 5IDJA 2GUZB 5CB4A 4LWSB 2GHYA 2ADPA 3FFQA 3K59A 3ZJZA 3R65A 2YI9A 3X2QC 2EIMC 4JI6B 3ZHQA 5EK0A 3CWBH 3CS5A 5CA1A 1YJ9V 3SJCC 1VQKV 1W2BU 1R3IC 4CC6A 3CCJV 3AEIA 2Z0AA 2B1GA 1Z5WA 3RWRD 4BIOA 4CS4A 5BR8O 3I56V 3ABLC 4I50A 1KKCA 4DYLA 1BT8A 4WCEV 3K58A 4ZKIA 1YDXA 4TUYA 3RT3C 2HKOA 1Y66A 3U10A 3M8AA 1FXVA 4LF9O 1QVFU 2HJFC 4B3RB 5IJ9B 4J7KA 3B8MA 4BAYA 2NN4A 4GX1A 1SRYA 2ZD9A 1OJHA 2CAZC 3FAVB 1CXZB 2HHHB 5L3DA 5EIBC 4DUYO 1HP8A 1SQQH 4NR1A 1J5EO 1V9PA 4I5SA 4FM1A 3ZHTA 3AK2A 5LMNO 1SQBH 1HNZO 4TT3G 4LF8B 4FLYA 1GKFA 3A0BZ 5B66Z 4K3AA 4JI5O 5FL7G 1K5QA 2Y4UA 3QO5A 1OCOB 3ABMC 1Q81W 3WG7C 4Q6GA 4DV4B 4WBNA 2WAMA 3U0ZA 2P67A 1JX9A 1W0KG 5EBLC 4QPKA 3ZCCA 2AZ0A 2YSUB 2KQXA 1AI6A 2LFSA 3AG3C 3SR2C 3OM3B 4ABMA 3G6EV 3WB2A 3CRAA 3OT7A 1BQZA 3LSSA 1R3KC 4JI0B 4GX2A 4DR5B 4JAAA 3OEEG 1XNQO 1K9MW 2UXXA 1EBOA 1VF7A 1Q8IA 2D3OW 1M56B 3MAQA 2FTKA 4EFBA 3JATA 3UO3A 3JALA 4LNUA 1I5XA 3JAKA 1COWG 5FPOA 4JYAO 2XAFA 5JQGA 3N2KB 4MVMA 1HWYA 3JD1A 2RCVA 5KX5A 2XTAA 1BCCH 2E3CA 1NVPB 2VS0A 1NTMH 3HPLC 1M9NA 2H3OA 4JI1O 3E8FA 2RQ6A 4J9YB 1WNSA 3APQA 1KB9F 2VQEO 2Q4PA 1K3EA 3NR7A 2DN9A 4LWSA 1JFFB 4NTXA 3SPGA 4IHJA 3NXSA 3ASOC 5IYBO 4H44B 4DR6O 2Q6AA 3F7VC 5C8YA 4TWKA 1N0NA 4MW8A 3ETEA 1ZX3A 3VQWA 1Q6HA 4ZHQB 2DW4A 1N0JA 4BWAA 1SQFA 1EN6A 4X66B 2R72A 1OZ0A 3ETQA 2LGQA 2WLJA 3OAAG 3CCEV 5KA5A 4QPJA 2QWRB 4GKJO 1M90W 5IJ9A 3IFXA 3K5MA 4WFFA 1ORQC 1YTFD 2XAGA 1NU1H 1IDSA 3FAVA 3W7WA 4MVZA 5JVDA 4DR2O 4PDLA 3W7SA 1CP9A 1AJNA 1DTOA 2YXLA 4DRXB 5BMVB 3BA9A 4AHCA 1FFTB 2P22C 1TVKB 3AK3A 4UV8A 2ZNJA 4NXMB 1SS3A 1SA0B 2LO1A 3VQYA 1YVWA 4LF9B 3DC5A 5L3FA 2CTPA 2QR4A 2Q73A 4OPHA 1H38A 4H37A 3GVMA 3FD9A 1XL6A 4JZGA 3L75H 1SQXH 1I08A 4P30A 3MD0A 4YJ3B 4DUYB 2HJDA 5BZBA 1VQ5V 4HYOA 3CC2V 1XEQA 1J5EB 1NR7A 1GN6A 1OCRB 2OCCB 1SQPH 1VQOV 4DV6O 1W0JG 5LMNB 3OUFA 4UB6Z 4GZRB 1HNZB 3T4ZA 3JCUZ 1VP7A 4ZI7B 2ZDIA 4X64B 1K73W 1S3JA 5H2FZ 2OT5A 3E89A 2YDEA 4DW0A 2WLLB 2CDYA 1WLEA 4JI5B 4WFBV 2EIKB 4JYCA 5CBHA 1N32O 5KHGA 3BAAA 2CH7A 4RO2A 1VQ9V 3SPHA 4I4TB 3CRRA 2UU9B 2EINC 4UVAA 3P30A 3N2KA 2IJHA 3P3PA 3FB5C 3E35A 3A0RA 1JJOA 3RGBA 3TXSA 1P49A 4WFEA 1TUBB 3K57A 4K8ZA 3IC7A 5BXZA 1X4TA 2F43G 2AHYA 4QNHB 2P6JA 4GYCB 3TCUA 1Q6UA 1Z2GA 2ZE7A 2F23A 3KZIZ 5D5QA 1S77D 5IYZB 2VWKA 2EJ7A 4JTDB 4UCVA 4YJ2A 1MSWD 3RN4A 1L1FA 4DV3O 1CPYA 2P06A 2WWWA 2PF4E 1Q5OA 3ZRXA 3H1HH 2V4DA 3K06A 3AG2B 3WFVA 3FB6C 1M57B 4JYAB 2RNBA 1BE3H 4U7OA 1N8RW 4ZBMA 2XUMA 1PD3A 4YIOA 2ATKC 4FLUA 3BEHA 1US6A 4ZHQA 4LF5B 3ZMSA 1Z5VA 1F23A 1GM8A 4N21A 4AQYO 1MABG 2OIEA 3K79A 4B08A 3ZS8C 4P2ZA 4JI1B 2OTJV 3JD4A 2DMXA 2VQEB 2QWPB 3B40A 2LGWA 1AR4A 4MVRA 2A0LA 3OUSA 3C90A 4X62O 2ILMA 5LA6B 2E5LO 4DR6B 1WA8A 5CA1B 5LP6A 1AVMA 1NTZH 3BHPA 1OHHG 1HNXO 1DK1A 1V55B 4DR7O 4LP8A 1URFA 5BMVA 3E8BA 1JJ2U 2JEXA 5A9GA 4X89A 4DV1O 1UJWB 1XBLA 3DGEA 1FXHA 5B1BB 2Q68A 4TUYB 4FLTA 3CPWU 1THZA 4UCOA 1LUWA 4JASA 3K08A 2CGOA 3T4DA 4LR3A 1R73A 4JF3A 3ZMZA 1NVPD 2Y0IA 2P4KA 2WLMA 2R70A 4UVBA 2Q0AA 2KB1A 2IW5A 4DR2B 1DF5A 4GX0A 3EHBB 3M99B 4W4KA 4JV5O 5CA0B 1I7FA 3QO7A 1FYJA 1SERA 4O4HA 3JD2A 1WB7A 1XL4A 5KLVH 3CCSV 1U96A 5JH7A 2WLLA 2MW2B 1G4YB 1QLEB 5FNVA 4DR1B 4JYBA 3SYQA 3UO2A 5IT9N 1AI4A 2YEVA 2PYJA 1YEWA 1OCCB 1M56C 5GONB 4TQDA 1OCZB 5L3EA 4I4TA 2UUAB 5K1XA 2QE7G 3DTUB 1TGOA 4NTWA 5EC1C 3SPCA 3D36A 3E86A 2N74A 1Y6XA 2KSDA 3E22B 1IBLO 1XUQA 4O2BB 1TUBA 4FLVA 4DV6B 5A2QN 1QU7A 2M7WA 3VOUA 4X65O 3C3TA 2PYLA 2QGNA 4J42A 3SYOA 2CTWA 1AP5A 1WB8A 3ASNB 4I55A 1QLNA 2IJKA 2A7WA 3THOA 3E8GA 1N32B 2ZIMA 1GN4A 1L0NH 5FLXN 3JATB 4RQFA 5EBMC 4PA3A 3ZX6A 3JALB 2DQ3A 3JAKB 2Q0OC 5JQGB 1KUQA 5H9CA 1XOUA 2F93B 1H2KA 1RSOA 2XHBA 5KX5B 1XREA 1N4CA 4J9ZB 4RUFA 4QIWF 2YICA 2QJ1A 3RFRA 3U11A 4FFBB 2ZT9B 4LF6O 5EIBD 5L3BA 5GW7A 3HKDB 2WA3A 1DGSA 4DV3B 3T1YO 1SF9A 1LUVA 4IHJB 3BVOA 4C7UA 5LA6A 1IBKB 2V7QG 5B5EZ 1K34A 4J7JA 2HG5C 3CD6V 2IU0A 1YSCA 2EILB 1L0LH 2BTOA 2ZE5A 4D7TA 5IYCO 2HEPA 4WF9V 5C8YB 2QSAA 3N2GB 4QGPA 1BHBA 1SZXA 1AR5A 4AQYB 3OR7C 2DYRB 1H8HG 4NXMO 4X1YB 1Y4MA 2Q9LA 1H8EG 3VBBA 1MA1A 3CB2A 3CYOA 5EC2C 4D7SA 1VQ7V 4MVQA 1PKXA 2A3QA 4N23A 4X62B 4PDMA 4I7ZB 2E5LB 4LFBO 2HVJC 3T1HO 4X8AA 4YIPA 4AI8A 4CH3A 5JVDB 1XMQB 5B3SB 2RJZA 1HNXB 1OCRC 2OCCC 5CA3A 4DR7B 5CA0A 4B7EA 2C2AA 3JCZA 4DK1A 1VIBA 4NKGB 1S76D 2ADQB 3TK1A 4FFKA 1BSMA 5EYPB 1KP2A 1F4MA 4G28B 4DV1B 1KKDA 1HDJA 3PN1A 1AJQA 4X64O 3T2MA 1H2NA 1F7YA 1BL8A 4DV7O 2EIKC 1R6KA 3D3QA 2GTAA 1FPOA 5GONA 1FD9A 1YCIA 4JI4O 5DM6V 2Q7GA 4TSFG 3OTOO 2LW1A 2AGAA 2UU9O 3D36C 1RM1B 4EKWA 1FXKA 3E22A 2X6CA 3HKCA 4B3MO 4JV5B 2PY5A 3L73H 4O2BA 5HFLA 3K5LA 2OWOA 2X6AA 5L3CA 3CE2A 4MTXA 3OR6C 4UVCA 2XOKG 1AI7A 3APOA 4A5UB 2GTSA 1Q7YW 4H33A 2OTLV 3CRQA 1H2GA 1JCHA 4JI2O 2ETNA 3QO8A 3J7AU 5JCOA 4PD4F 4X1KA 2QM8A 2CK3G 2HLDG 2EULA 5EZYA 1S5HC 2CH7B 3AG2C 3JARB 2CUGA 1M57C 3H1JH 3RYIA 1I0HA 1K33A 3AG7A 1BZKA 1GM7A 2PTMA 2QKAA 3BY6A 4DV0O 2WSSG 1IBLB 3H1LH 5J2TA 4LF5O 4I9WA 1NT2B 3E8HA 1W59A 2UUCO 1NZ6A 3ML0A 3SDLA 1NTKH 1H2SB 4X65B 3ZMVA 4FFBA 3KG2A 4UV9A 3A2FA 3DC6A 4NXNB 1EN5A 4ZIBA 4EEQA 1R6NA 4FJCC 5HFMA 1PNKA 3E2EA 3HKDA 3CP1A 4YJ2B 4JI8B 5JWPA 4LC1A 3H01A 2WLHA 2A06H 4DR4O 3OW2U 2W0FC 4LFAO 1VQMV 2IH3C 1I94O 4JGSA 3TGUH 1V55C 3FYIB 1LNQA 4LF7O 3EVKA 4J11A 3N2GA 1I5YA 1GN2A 2LJ2A 1FKAO 3STLC 1B6QA 1WPBA 5CN0A 4KFMA 2BOBC 5B1BC 1R3JC 4X1YA 2GV9A 3M7MX 3FX7A 3I5DA 4O2AB 3SPJA 1K4CC 3ZHVA 4LF6B 2QM7A 2Q5ZA 4YHHO 1KMIZ 4JAUA 2Z5UA 3T1YB 4R8CA 3K04A 3ZRWB 3CRCA 5BY1A 3K9AA 4PA4A 5J9PC 1E79G 1VF6A 2W0XA 1WA8B 1ZUQA 3UM7A 5KAFZ 2ZNIA 5LP6B 2BE3A 3CCQV 2JGUA 4OX9O 4J41A 2IBZH 1CEZA 5CMUA 3B77A 2JRIA 1NJIW 1R6TA 1KBHA 3ZMUA 5EYPA 1PP9H 4F6EA 3Q4HA 1QLEC 4DR1O 1SQVH 1OCCC 3DXRA 1AJPA 3K3WA 3SYCA 1SKVA 1OCZC 2ZR2A 3H9VA 3ABKB 1LR1A 4LFBB 2BOCC 2UUAO 2WLIA 3T1HB 1YIJV 3CEIA 1B04A 4F6RA 2UXNA 1IZ3A 1GK9A 1QR8A 4MS2A 1RP3B 2ZIOA 2EIJB 1S5LZ 3LUTB 1Q6IA 2BSKA 1XMOO 4O4HB 2UXCO 5H6RA 3O65A 1GH6A 1QCEA 4RWUA 5ITZB 3ASNC 5JH7B 4DV7B 4K35A 5FNVB 2YEVB 4W4LA 4NVPA 3JARA 4JI4B 5JJNB 1ZSPA 3OTOB 4FMTA 2PI4A 2W6JG 1GO3F 2K1EA 2L6LA 1E1RG 1KQSU 4O4JA 3VQXA 3BFRA 4LF4O 4B3MB 2ODMA 4J7ZA 4UCSA 3FKSG 3QNEA 4IT5A 3G4SV 2ZINA 1VF5B 1SQGA 4FZ1A 2XT9A 5AG2A 3ZMTA 1JA8A 4OGQB 2YI8A 5GTIZ 4JI2B 1G1XB 2EZOA 3O9OA 4I55B 3L72H 3MHHC 2EBOA 3C3SA 4GT1A 1IBKO 3MHSC 2JJ1G 4GX5A 4CBCA 2EILC 5K1PA 2Q69A 2YIBA 1XI1A 1AROP 1S0VA 4JYYA 2FL4A 4DV0B 1BMFG 1JR9A 5LHHA 1RSOB 1GRJA 5IY5B 1QQCA 3BCCH 2Y69B 3F5WC 2DYRC 4O4IB 4PHZA 4B3TO 3LDCA 4MTGA 2UUCB 4XDKA 1IXBA 3SGIA 1K7DA 1VQ4V 4G27B 1GMGA 1WN7A 4O2AA 4J10A 5LGTA 1JPXA 4DV5O 4DUZO 2CTQA 2X0LA 1ZL8B 3B8NA 3ZRWA 1FJGB 1MZEA 2CTRA 2UXDO 3S3XA 4DR4B 1R1BA 2B1IA 2ZXWB 1EZJA 1RPRA 1HNWB 4LFAB 4JI3O 5B3SC 1I94B 4DXWA 2AW9A 4LF7B 1XMQO 3B2EE 1GAXA 5LMUO 3ZRVA 3SJAC 1KC8W 4JPRA 2XNDG 1HW7A 3CCLV 4QJFB 4L87A 2BCCH 5LXTA 4PDRA 1K8AW 1FS0G 4TV9A 3W7TA 3JSLA 2N05A 5KAIZ 3AG1B 3B4SA 3H1KH 4YHHB 1NQTA 1RFYA 3L70H 2G38A 4BW5A 2A79B 3LNMB 4H13B 2MK3A 4RQEA 3WB1A 3UKMA 4JZ2A 4IYIA 1RM1C 2QTOA 4LCUC 2P5OA 4JI7O 4OX9B 4E4EA 3FB7C 4KHPO 2RMKB 4LFCO 4NYKA 3JD0A 4X1IA 4BIZA 4YXWG 2IH1C 1N36B 1G8MA 3AG4B 2ZDIC 3W7UA 2P90A 4FLXA 3F7YC 5ITZA 1B3QA 3CCMV 2IM9A 1PL0A 1JQ0A 2LP7A 4MTFA 3TJTA 4LH7A 1Q3EA 1MMMA 2EZPA 1K97A 3CRMA 1U97A 2YIDA 1Y76A 1FXKB 3HKCB 4TOIA 3IJ4A 1Q90D 1ENVA 1XMOB 5IE9A 1O9GA 3OGIB 2UXCB 4R50A 3CXCU 1GM9A 2AZ2A 4B3SO 5DN6G 3RYHB 3HKEB 1ZLZA 4NXNO 1Q86W 1XHZA 4DO2A 4KXRA 4OPAA 3N27A 3K5OA 4X1KB 2E76B 2YS8A 3D3IA 4JTAB 4XBFA 4JI8O 5EZYB 3BPZA 4GUNA 1VARA 3JAWB 2LW7A 4PA7A 3RYIB 1AI5A 1H2LA 1YZBA 2QKCA 1EFRG 1VMGA 4LF4B 4BW9A 2O57A 2QEXV 4X20B 3WU2Z 5J2TB 2YXHA 4WFGA 3K03A 4O4IA 1TAEA 1GTOA 2OIGA 3P32A 1XQ8A 4FM0A 4F4LA 3W7XA 4DK0A 5LOVA 1TUEB 3I55V 4MT8A 1ZL8A 2WA4A 1V54B 3AK1A 1FFXB 1MSDA 2ZR3A 3G67A 3OMNB 3G71V 2P7TC 2KG7B 1TA8A 4P9PA 3OMIB 5LP6C 2D2CB 4L8JA 4ZOLA 1M5IA 2ZKOA 4B7KA 4P9OA 1E1QG 1Y74B 3RYCB 3CC7V 4YY3O 1HR0O 1EM1A 3A8TA 3HR0A 5KMGB 4B3TB 2RN9A 3JASA 3CSXA 2M6YA 1BGYH 1MNGA 2DWEC 1EZVH 2ITDC 2HVKC 4ICGA 2B5UA 1VQ6V 4U7NA 1YHQV 1YXBA 4HZ3A 4QE9A 4DV5B 3OD4A 4DUZB 2F1MA 3HKBB 3RBZA 3LSUA 1IURA 1Y67A 3BABA 1JVMA 3ABKC 1PNLA 2UXDB 4QE7A 3SJQC 1MZFA 5DEDA 4JI3B 1Q82W 1KU9A 2WLNA 4CS3A 4UCUA 4K8XA 5LMUB 4GCZA 4DW1A 2EIJC 4MVSA 2F66C 4TV8B 5CBFA 5FPRA 2JEUA 3CC4V 4RAIA 3J81N 1D2DA 2FKXA 1NI8A 4MVOA 1WJZA 4U3JB 5H6QA 1BHAA 4G2KA 2VRZA 3Q4HB 1PV0A 4FLWA 1NBMG 2JDIG 3CCRV 1ROPA 2IU3A 3DXRB 3OGCC 4UUJC 2DE0X 4PA9A 2FYUH 2NNUA 2JJ2G 3CCUV 1JOYA 2WLIB 2E75B 5IJ0B 1PPJH 2B9ZA 3QVNA 3CHXA 4HNAB 1OV9A 4JI7B 4Q20A 3ZHUA 5LHGA 4F6RB 1S72V 4PV1B 2BTQA 3R66A 1JMKC 4I0XA 5GTHZ 3LDDA 3FB8C 4IL6Z 2PZSA 3QF7A 4EB6A 3UT5B 4KHPB 4LFCB 2Q7EA 2Q7HA 4FVMA 4DR3O 4PJ0Z 3ZN0A 2XAQA 1BS3A 2BSKB 3ZIAG 5JJJB 2ZE8A 3HKEA 3RYHA 1J95A 1VQ8V 1AP6A 3ZBHA 3JAMN 1KP3A 2LFRA 2OYQA 4FK5C 1N34O 4Z1MG 1NH2B 4U3FH 2F4VO 2YXYA 3JAWA 5KHJA 3CJHA 3J80N 4FPPA 3A0HZ 4O4JB 3K9SA 4IIJB 1NKDA 1QR9A 3UCSC 5IY5C 2DYSB 4X20A 1AR1B 5LYJA 3T1CA 2Y69C 2JIZG 5E1AC 3K0DA 5KUMA 3RW0A 1D5NA 1EN4A 2AXTZ 4B3SB 4FIPC 1M93A 2JGDB 2GSMB 5B1NA 3RVYA 1FFXA 4JAVA 2ZE6A 4NB5A 1FJGO 2ARHA 2ZXWC 2UXBO 3ABTA 2KG7A 1HNWO 3KCYA 1GN3A 3ZHSA 1Y74A 4Z2WA 3RYCA 5IWAB 5B1OA 2GUZA 3OTFA 3KKYA 1KYOF 2R9IA 2GBOA 5KMGA 1B06A 5LHIA 1XNRO 5B1AB 3AG1C 4K0KO 1Q43A 4XDJA 1ZWIC 2F95B 3HKBA 2PGGA 3K0GA 2QDOA 2XAJA 4PI2A 1IVSA 3B09A 1WP8A 2RDCA 3ABUA 1SESA 3LNNA 5IYDO 2VQFO 2QWNB 2E74B 2DWDC 2CGNA 1IBMO 4R7CA 1N33O 3OMAB 1WAZA 4YY3B 4CS2A 2VWJA 4TV8A 1HR0B 5F2VO 1SZTA 2WLKA 3AG4C 2DOSA 1QNMA 5LXTB 4I9QA 4U3JA 3LSQA 1N36O 3X2QB 2EIMB 4TV9B 4BIUA 3EXAA 2N04A 1P4RA 3IAYA 1F51A 1K4DC 2K9PA 2EJRA 1YI2V 4DV2O 2ZQMA 2ITCC 5BR8B 1NS1A 3QG5A 3RYFB 3ABLB 5IJ0A 3HB3B 4HNAA 5J2UB 4OXSA 1FXKC 2JVDA 1MOFA 3UT5A 3VQVA 2Z3YA 3F5TA 2JS5A 4D6TH 4MSWC 1KECA 4X1IB 3KCXA 1P7BA 4Z1VA 4TQFA 3RVZA 4GKKO 4MTOA 2QKSA 5JCOC 4MW3A 1IX9A 5LBQA 2XAHA 2IJIA 5TISZ 4CH5A 4J80A
chains in the Genus database with same CATH topology
3SPIA 2HFEC 1NVPB 2QTOA 4LCUC 3PJSK 1QVGU 1BHBA 3HPLC 3FB7C 2V1DA 3CMEV 1M9NA 3E8FA 3FYEB 3OR7C 2DYRB 4J9YB 5KA6A 3JD0A 1H8HG 4BIZA 4YXWG 1K5SA 2IH1C 1K3EA 2XASA 1G8MA 2X7RB 1Y4MA 3AG4B 3SPGA 2ZDIC 3W7UA 2P90A 1H8EG 3F7YC 3VBBA 3CYOA 3ABMB 3NXSA 5EC2C 3ASOC 3WG7B 1VQ7V 4MVQA 3CCMV 1PKXA 5IYBO 3JYCA 4N23A 1PL0A 1JQ0A 4PDMA 2LP7A 3TETA 2Q6AA 4MTFA 3F7VC 1V54C 2HVJC 4TWKA 5LGNA 1M1KW 2EZPA 4X8AA 4WFHA 1R3LC 4MW8A 1K97A 1PNMA 5B3SB 3ETEA 4HAMA 1OCRC 2OCCC 2DW4A 3AG3B 5CA3A 2C2AA 2JK5C 1FXKB 3JCZA 1S76D 1OZ0A 2HR3A 3TK1A 2WLJA 1DLBA 1KP2A 1F4MA 2WPDG 4G28B 3OAAG 3CCEV 1KKDA 5KA5A 1ENVA 1AJQA 3T2MA 4QPJA 4R50A 3CXCU 1GM9A 1M90W 1BL8A 5DN6G 2EIKC 5LGUA 1R6KA 3ZRSA 1SETA 3IFXA 1YJWV 1Q86W 4WFFA 1ORQC 4KP4A 4DO2A 1YTFD 2XAGA 4KUMA 3ETDA 3W7WA 2IJJA 3D3IA 5DM6V 4MVZA 4JTAB 4TSFG 4PDLA 4XBFA 3STZC 4XDLA 3W7SA 3EFFK 1RM1B 1CP9A 4EKWA 1AJNA 4UXNA 4JTCB 1FXKA 4PA7A 1DTOA 1AI5A 2X6CA 2DQ0A 1FFTB 1EFRG 5HFLA 3OEHG 4CZZA 2X6AA 3SYAA 4UV8A 5L3CA 2QEXV 4MTXA 3OR6C 4UVCA 2XOKG 1AI7A 4WFAV 5EBWC 4WFGA 3K03A 1Q7YW 2X6BA 4H33A 1VQNV 1WPXA 2OTLV 5L3FA 1GTOA 2AHZA 1NH2D 1H2GA 1RPOA 1JCHA 3P32A 1H38A 3QO8A 4H37A 3ASOB 1XL6A 2QM8A 4RUEA 2CK3G 4F4LA 2HLDG 3W7XA 4P30A 3MD0A 1TUEB 3I55V 4MT8A 1S5HC 1V54B 3AG2C 1MG1A 2ZR3A 3GB7C 1M57C 1NR1A 5BZBA 1VQ5V 2PI5A 4HYOA 1DF4A 3CC2V 3OMNB 1K33A 3G71V 2P7TC 1GM7A 1NR7A 1OCRB 2OCCB 3BY6A 3OMIB 3OFNG 4P9PA 4MVUA 1VQOV 3ZN1A 2WSSG 4P9OA 1E1QG 1W0JG 3CC7V 3OUFA 4I9WA 1K92A 3SYPA 3T4ZA 3E8HA 1KD1W 2ZDIA 3GWOA 1K73W 1S3JA 2OT5A 3E89A 3ML0A 2WLLB 1WLEA 3ZMVA 1OCOC 4UV9A 3KG2A 4WFBV 2EIKB 2DWEC 2ITDC 4JYCA 3CMAV 2HVKC 5CBHA 1R6NA 2B5UA 4FJCC 2QA4V 1VQ6V 4U7NA 5HFMA 1PNKA 1YHQV 3E2EA 4HZ3A 4RO2A 4QE9A 3CP1A 1VQ9V 1VQLV 3SPHA 3RBZA 2EINC 4LBEC 4LC1A 3H01A 2W6IG 2WLHA 3IGAC 4UVAA 1JVMA 3ABKC 3P30A 2NLJC 1PNLA 3OW2U 2IJHA 2W0FC 4QE7A 3SJQC 3FB5C 1VQMV 3LDEA 3E35A 3A0RA 2IH3C 4JGSA 1V55C 3FYIB 1LNQA 4WFEA 1Q82W 2WLNA 1I5YA 5C93A 4GCZA 2EIJC 3IC7A 4MVSA 2F43G 3STLC 2AHYA 5CBFA 3CC4V 2JEUA 4QNHB 1B6QA 4RAIA 2DYSC 2P6JA 3TCUA 4PELA 5CN0A 4KFMA 2BOBC 5B1BC 1R3JC 4MVOA 1S77D 5H6QA 1BHAA 1IXMA 1F4NA 1K4CC 4G2KA 3SPJA 2QM7A 4JTDB 1MSWD 1L1FA 4JAUA 1CPYA 2WWWA 1NBMG 2Z5UA 4R8CA 2JDIG 3JD3A 3K04A 3ZRXA 1ROPA 3CCRV 3ZRWB 3WFVA 3K06A 2IU3A 3AG2B 3FB6C 3OGCC 1M57B 3K9AA 4PA4A 2H94A 4UUJC 5J9PC 4U7OA 1N8RW 1E79G 4PA9A 4ZBMA 2NNUA 1PD3A 3UM7A 2JJ2G 2ATKC 3CCUV 3E83A 4X88A 3CCQV 4R6ZA 1JOYA 2WLIB 3BEHA 1YTFB 1CEZA 1YITV 5CMUA 3ZMSA 4Q20A 5LHGA 1S72V 2H8PC 1F23A 1GM8A 3B77A 4N21A 3LDDA 2R9RB 1MABG 3FB8C 3K79A 1NJIW 2OTJV 4P2ZA 3ZMUA 5L3GA 3JD4A 3ZN0A 2XAQA 4E2LA 3ZIAG 1QLEC 4MVRA 2A0LA 3OUSA 1J95A 1QBZA 1VQ8V 5B1AC 1OCCC 1AJPA 3K3WA 3SYCA 1VQPV 2A9HA 1OCZC 2EINB 2Q67A 2ZR2A 1KP3A 2LFRA 3ABKB 4FK5C 2BOCC 2Y48A 4PDVA 4Z1MG 2WLIA 1NH2B 4PA6A 1OHHG 5KUKA 1YIJV 1V55B 2UXNA 1GK9A 4LP8A 1QR8A 3E8BA 4FPPA 1JJ2U 3CCVV 4MS2A 5CBGA 2JEXA 2EIJB 3OE7G 4X89A 3ETGA 3LUTB 1NKDA 1QR9A 5IY5C 2DYSB 1UJWB 1AR1B 1YJNV 3T1CA 2Y69C 1FXHA 3DGEA 5B1BB 4ASUG 2Q68A 2JIZG 5E1AC 5H6RA 5IDJA 3K0DA 5KUMA 3RW0A 3CPWU 1THZA 1QCEA 2GHYA 4JASA 3K08A 3ZJZA 3R65A 3T4DA 3ASNC 4FIPC 3X2QC 1R73A 2EIMC 5EK0A 4JF3A 3ZMZA 1NVPD 2YEVB 2WLMA 2GSMB 4UVBA 5B1NA 1YJ9V 3RVYA 2KB1A 2IW5A 4JAVA 1VQKV 1W2BU 1R3IC 3CCJV 3AEIA 4FMTA 1DF5A 2ZXWC 2PI4A 2W6JG 3ABTA 4GX0A 2B1GA 3EHBB 3M99B 1GO3F 2K1EA 1KQSU 1E1RG 3I56V 3ABLC 3QO7A 1SERA 4WCEV 3JD2A 4ZKIA 5B1OA 3FKSG 2HKOA 1XL4A 1Y66A 3QNEA 3G4SV 1FXVA 2R9IA 3CCSV 2WLLA 3ZMTA 1G4YB 1QLEB 1QVFU 4JYBA 2HJFC 3SYQA 2YEVA 1AI4A 5LHIA 3B8MA 4BAYA 4GX1A 1SRYA 5B1AB 1OCCB 2ZD9A 3AG1C 1M56C 2EZOA 1OCZB 3MHHC 5L3DA 2EBOA 4XDJA 1ZWIC 5L3EA 3K0GA 4GT1A 2QE7G 2XAJA 3MHSC 3DTUB 2JJ1G 4GX5A 4CBCA 2EILC 5EC1C 3ABUA 3D36A 3SPCA 1SESA 2Q69A 4I5SA 3E86A 1AROP 5IYDO 1S0VA 2DWDC 1BMFG 4R7CA 5LHHA 3OMAB 4TT3G 5IY5B 1GKFA 2M7WA 2Y69B 3F5WC 3VOUA 2DYRC 3LDCA 4MTGA 4XDKA 1SZTA 1K7DA 2WLKA 3SYOA 5FL7G 3AG4C 1K5QA 3ASNB 1VQ4V 4G27B 1GMGA 3QO5A 1QLNA 3LSQA 2IJKA 3X2QB 1OCOB 3E8GA 2EIMB 5LGTA 1JPXA 3ABMC 1Q81W 3WG7C 4BIUA 2X0LA 2WAMA 1P4RA 3B8NA 3ZRWA 2P67A 4RQFA 4PA3A 1JX9A 5EBMC 1F51A 1K4DC 2DQ3A 1W0KG 2EJRA 5EBLC 4QPKA 1YI2V 2B1IA 3ZCCA 2ZQMA 2ITCC 2ZXWB 1EZJA 1RPRA 5H9CA 2YSUB 1AI6A 5B3SC 4DXWA 3ABLB 2LFSA 3HB3B 3AG3C 3ZRVA 4OXSA 1FXKC 3OM3B 1KC8W 4J9ZB 4JPRA 2XNDG 3G6EV 4RUFA 4QIWF 1MOFA 3LSSA 4QJFB 3CCLV 1R3KC 4L87A 2Z3YA 4GX2A 3OEEG 4MSWC 4PDRA 1K8AW 1FS0G 1KECA 3W7TA 5L3BA 1K9MW 5GW7A 2UXXA 1EBOA 2D3OW 3AG1B 1M56B 1P7BA 2FTKA 1NQTA 4BW5A 1I5XA 3RVZA 2A79B 2V7QG 4MTOA 3LNMB 1COWG 2QKSA 1K34A 2HG5C 3CD6V 2XAFA 2IU0A 4MW3A 4MVMA 2MK3A 1YSCA 2EILB 5LBQA 4RQEA 2XAHA 2IJIA 1HWYA 3UKMA 5IYCO 3JD1A 1RM1C 4WF9V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QR9 A;  3B8M A;  3H01 A;  4N23 A;  1DF5 A;  1DLB A;  1JQ0 A;  3P30 A;  2LP7 A;  5CMU A;  3M99 B;  1ENV A;  5KA5 A;  2EZO A;  4G2K A;  3GWO A;  1EBO A;  1QCE A;  2M7W A;  4FK5 C;  3MHH C;  1F23 A;  4N21 A;  3B77 A;  5H9C A;  2OT5 A;  2EBO A;  4JGS A;  2EZP A;  5HFL A;  1SZT A;  4FIP C;  1MG1 A;  1I5X A;  5KA6 A;  3MHS C;  1I5Y A;  1Y66 A;  1DF4 A;  4JF3 A;  3WFV A;  1K34 A;  1K33 A;  1QR8 A;  4FJC C;  3K9A A;  2X7R B;  1Y4M A;  4JPR A;  1JPX A;  4E2L A;  5HFM A;  2MK3 A;  1MOF A;  3CP1 A;  2P6J A;  3CYO A;  1QBZ A;  5CN0 A;  3B8N A; 
#chains in the Genus database with same CATH topology
 1UFI A;  3SPI A;  2HFE C;  3WB0 A;  4UCT A;  3PJS K;  1QVG U;  5D5P A;  2ZM6 O;  2V1D A;  3CME V;  2QWO B;  4IIJ A;  1Y76 B;  3FYE B;  5KA6 A;  5LL6 Y;  2NR5 A;  1K5S A;  2XAS A;  4UFZ A;  2X7R B;  4DR3 B;  2LQT A;  3ABM B;  2L35 A;  3WG7 B;  1BQ0 A;  3JYC A;  3TXQ A;  2JGD A;  3TET A;  2UUB O;  3P3N A;  1V54 C;  2OCH A;  1N34 B;  5LGN A;  1M1K W;  4WFH A;  1R3L C;  2F4V B;  1PNM A;  5KHI A;  1FAF A;  4HAM A;  3AG3 B;  1XDC A;  1AIL A;  3IC9 A;  2JK5 C;  2QWQ B;  3UQ8 A;  1PL4 A;  2P4V A;  2HR3 A;  3CXH F;  1JFF A;  1DLB A;  1ZAU A;  2WPD G;  1XNQ B;  2EX3 A;  4H0L B;  5KHH A;  5LGU A;  4JI6 O;  3ZRS A;  1SET A;  1YJW V;  4KP4 A;  3K5N A;  4KUM A;  4UB8 Z;  4PI0 A;  3ETD A;  1M4U A;  2GDS A;  2IJJ A;  1ZTE A;  2KKW A;  3STZ C;  4XDL A;  5LOV B;  3EFF K;  3ZED A;  1X59 A;  4UXN A;  4JTC B;  2UXB B;  1VF6 C;  2DQ0 A;  5KHK A;  3OEH G;  4CZZ A;  3SYA A;  4ZOL B;  4O4L B;  4CH4 A;  4WFA V;  2FB5 A;  5EBW C;  3QTC A;  2X6B A;  5CB4 B;  4CH6 A;  1VQN V;  1WPX A;  1D5A A;  4B3R O;  2AHZ A;  1NH2 D;  1RPO A;  3JAS B;  3DSQ A;  3CX5 F;  3JSN A;  3ASO B;  3L9D A;  1XNR B;  4NTY A;  4RUE A;  5DEC A;  2HHH O;  4K0K B;  2R9A A;  1MG1 A;  3GB7 C;  1P84 F;  1NR1 A;  2PI5 A;  4DRX A;  1DF4 A;  1UPG A;  1S5J A;  1G6U A;  1SC5 B;  3OFN G;  2JS3 A;  3RYF A;  1TVK A;  4MVU A;  2VQF B;  4FZ0 A;  3ZN1 A;  4I50 B;  1A32 A;  4LF8 O;  1WP7 A;  1SA0 A;  5J2U A;  1IBM B;  2CE4 A;  1O9H A;  5H5N A;  1K92 A;  3SYP A;  1N33 B;  1KD1 W;  3GWO A;  4GKJ B;  1AB3 A;  1OCO C;  3CMA V;  1PM9 A;  2QA4 V;  4DV4 O;  1XIL A;  4LH6 A;  4YJ3 A;  2YIB D;  1VQL V;  4LBE C;  2W6I G;  3H1I H;  3IGA C;  2YIA A;  1VEW A;  2NLJ C;  2Q8V A;  4DV2 B;  4IYH A;  3LDE A;  4ZI7 A;  5C93 A;  1T5E A;  4HBN A;  3G80 A;  4JI0 O;  2DYS C;  5JJE B;  2BTQ B;  4PEL A;  4I0X B;  4DR5 O;  4FM2 A;  4EB6 B;  4UCR A;  2Y4T A;  3GWK C;  1IXM A;  1F4N A;  3BA8 A;  1YF2 A;  4AIL C;  4WBN B;  3L71 H;  3JD3 A;  4GKK B;  1P7G A;  2PUS A;  2H94 A;  4X9Q A;  1H2M A;  1XHX A;  3ZHR A;  3E83 A;  4X88 A;  3SJB C;  4R6Z A;  3L74 H;  1YTF B;  3S3W A;  1YIT V;  3CJH B;  2H8P C;  1QHT A;  2ZM6 B;  2R9R B;  2ZCE A;  3D8C A;  2DJV A;  2Y0P A;  5IWA O;  5L3G A;  4CC5 A;  5IYZ A;  4FLZ A;  3MDS A;  2YUA A;  4IGG A;  4BR6 A;  5LYJ B;  4E2L A;  2QTS A;  1QBZ A;  5B1A C;  4LNU B;  4GLX A;  1VQP V;  2A9H A;  5E79 Z;  2EIN B;  2Q67 A;  2YC0 A;  4KL1 A;  2UUB B;  2Y48 A;  4PDV A;  1L8D A;  2FML A;  4PA6 A;  3ICX A;  5KUK A;  2QM4 A;  3G6B A;  3CCV V;  5CBG A;  3OE7 G;  4X66 O;  3ETG A;  2HP8 A;  4O4L A;  4EFE A;  1YJN V;  3BRC A;  4ASU G;  5IDJ A;  2GUZ B;  5CB4 A;  4LWS B;  2GHY A;  2ADP A;  3FFQ A;  3K59 A;  3ZJZ A;  3R65 A;  2YI9 A;  3X2Q C;  2EIM C;  4JI6 B;  3ZHQ A;  5EK0 A;  3CWB H;  3CS5 A;  5CA1 A;  1YJ9 V;  3SJC C;  1VQK V;  1W2B U;  1R3I C;  4CC6 A;  3CCJ V;  3AEI A;  2Z0A A;  2B1G A;  1Z5W A;  3RWR D;  4BIO A;  4CS4 A;  5BR8 O;  3I56 V;  3ABL C;  4I50 A;  1KKC A;  4DYL A;  1BT8 A;  4WCE V;  3K58 A;  4ZKI A;  1YDX A;  4TUY A;  3RT3 C;  2HKO A;  1Y66 A;  3U10 A;  3M8A A;  1FXV A;  4LF9 O;  1QVF U;  2HJF C;  4B3R B;  5IJ9 B;  4J7K A;  3B8M A;  4BAY A;  2NN4 A;  4GX1 A;  1SRY A;  2ZD9 A;  1OJH A;  2CAZ C;  3FAV B;  1CXZ B;  2HHH B;  5L3D A;  5EIB C;  4DUY O;  1HP8 A;  1SQQ H;  4NR1 A;  1J5E O;  1V9P A;  4I5S A;  4FM1 A;  3ZHT A;  3AK2 A;  5LMN O;  1SQB H;  1HNZ O;  4TT3 G;  4LF8 B;  4FLY A;  1GKF A;  3A0B Z;  5B66 Z;  4K3A A;  4JI5 O;  5FL7 G;  1K5Q A;  2Y4U A;  3QO5 A;  1OCO B;  3ABM C;  1Q81 W;  3WG7 C;  4Q6G A;  4DV4 B;  4WBN A;  2WAM A;  3U0Z A;  2P67 A;  1JX9 A;  1W0K G;  5EBL C;  4QPK A;  3ZCC A;  2AZ0 A;  2YSU B;  2KQX A;  1AI6 A;  2LFS A;  3AG3 C;  3SR2 C;  3OM3 B;  4ABM A;  3G6E V;  3WB2 A;  3CRA A;  3OT7 A;  1BQZ A;  3LSS A;  1R3K C;  4JI0 B;  4GX2 A;  4DR5 B;  4JAA A;  3OEE G;  1XNQ O;  1K9M W;  2UXX A;  1EBO A;  1VF7 A;  1Q8I A;  2D3O W;  1M56 B;  3MAQ A;  2FTK A;  4EFB A;  3JAT A;  3UO3 A;  3JAL A;  4LNU A;  1I5X A;  3JAK A;  1COW G;  5FPO A;  4JYA O;  2XAF A;  5JQG A;  3N2K B;  4MVM A;  1HWY A;  3JD1 A;  2RCV A;  5KX5 A;  2XTA A;  1BCC H;  2E3C A;  1NVP B;  2VS0 A;  1NTM H;  3HPL C;  1M9N A;  2H3O A;  4JI1 O;  3E8F A;  2RQ6 A;  4J9Y B;  1WNS A;  3APQ A;  1KB9 F;  2VQE O;  2Q4P A;  1K3E A;  3NR7 A;  2DN9 A;  4LWS A;  1JFF B;  4NTX A;  3SPG A;  4IHJ A;  3NXS A;  3ASO C;  5IYB O;  4H44 B;  4DR6 O;  2Q6A A;  3F7V C;  5C8Y A;  4TWK A;  1N0N A;  4MW8 A;  3ETE A;  1ZX3 A;  3VQW A;  1Q6H A;  4ZHQ B;  2DW4 A;  1N0J A;  4BWA A;  1SQF A;  1EN6 A;  4X66 B;  2R72 A;  1OZ0 A;  3ETQ A;  2LGQ A;  2WLJ A;  3OAA G;  3CCE V;  5KA5 A;  4QPJ A;  2QWR B;  4GKJ O;  1M90 W;  5IJ9 A;  3IFX A;  3K5M A;  4WFF A;  1ORQ C;  1YTF D;  2XAG A;  1NU1 H;  1IDS A;  3FAV A;  3W7W A;  4MVZ A;  5JVD A;  4DR2 O;  4PDL A;  3W7S A;  1CP9 A;  1AJN A;  1DTO A;  2YXL A;  4DRX B;  5BMV B;  3BA9 A;  4AHC A;  1FFT B;  2P22 C;  1TVK B;  3AK3 A;  4UV8 A;  2ZNJ A;  4NXM B;  1SS3 A;  1SA0 B;  2LO1 A;  3VQY A;  1YVW A;  4LF9 B;  3DC5 A;  5L3F A;  2CTP A;  2QR4 A;  2Q73 A;  4OPH A;  1H38 A;  4H37 A;  3GVM A;  3FD9 A;  1XL6 A;  4JZG A;  3L75 H;  1SQX H;  1I08 A;  4P30 A;  3MD0 A;  4YJ3 B;  4DUY B;  2HJD A;  5BZB A;  1VQ5 V;  4HYO A;  3CC2 V;  1XEQ A;  1J5E B;  1NR7 A;  1GN6 A;  1OCR B;  2OCC B;  1SQP H;  1VQO V;  4DV6 O;  1W0J G;  5LMN B;  3OUF A;  4UB6 Z;  4GZR B;  1HNZ B;  3T4Z A;  3JCU Z;  1VP7 A;  4ZI7 B;  2ZDI A;  4X64 B;  1K73 W;  1S3J A;  5H2F Z;  2OT5 A;  3E89 A;  2YDE A;  4DW0 A;  2WLL B;  2CDY A;  1WLE A;  4JI5 B;  4WFB V;  2EIK B;  4JYC A;  5CBH A;  1N32 O;  5KHG A;  3BAA A;  2CH7 A;  4RO2 A;  1VQ9 V;  3SPH A;  4I4T B;  3CRR A;  2UU9 B;  2EIN C;  4UVA A;  3P30 A;  3N2K A;  2IJH A;  3P3P A;  3FB5 C;  3E35 A;  3A0R A;  1JJO A;  3RGB A;  3TXS A;  1P49 A;  4WFE A;  1TUB B;  3K57 A;  4K8Z A;  3IC7 A;  5BXZ A;  1X4T A;  2F43 G;  2AHY A;  4QNH B;  2P6J A;  4GYC B;  3TCU A;  1Q6U A;  1Z2G A;  2ZE7 A;  2F23 A;  3KZI Z;  5D5Q A;  1S77 D;  5IYZ B;  2VWK A;  2EJ7 A;  4JTD B;  4UCV A;  4YJ2 A;  1MSW D;  3RN4 A;  1L1F A;  4DV3 O;  1CPY A;  2P06 A;  2WWW A;  2PF4 E;  1Q5O A;  3ZRX A;  3H1H H;  2V4D A;  3K06 A;  3AG2 B;  3WFV A;  3FB6 C;  1M57 B;  4JYA B;  2RNB A;  1BE3 H;  4U7O A;  1N8R W;  4ZBM A;  2XUM A;  1PD3 A;  4YIO A;  2ATK C;  4FLU A;  3BEH A;  1US6 A;  4ZHQ A;  4LF5 B;  3ZMS A;  1Z5V A;  1F23 A;  1GM8 A;  4N21 A;  4AQY O;  1MAB G;  2OIE A;  3K79 A;  4B08 A;  3ZS8 C;  4P2Z A;  4JI1 B;  2OTJ V;  3JD4 A;  2DMX A;  2VQE B;  2QWP B;  3B40 A;  2LGW A;  1AR4 A;  4MVR A;  2A0L A;  3OUS A;  3C90 A;  4X62 O;  2ILM A;  5LA6 B;  2E5L O;  4DR6 B;  1WA8 A;  5CA1 B;  5LP6 A;  1AVM A;  1NTZ H;  3BHP A;  1OHH G;  1HNX O;  1DK1 A;  1V55 B;  4DR7 O;  4LP8 A;  1URF A;  5BMV A;  3E8B A;  1JJ2 U;  2JEX A;  5A9G A;  4X89 A;  4DV1 O;  1UJW B;  1XBL A;  3DGE A;  1FXH A;  5B1B B;  2Q68 A;  4TUY B;  4FLT A;  3CPW U;  1THZ A;  4UCO A;  1LUW A;  4JAS A;  3K08 A;  2CGO A;  3T4D A;  4LR3 A;  1R73 A;  4JF3 A;  3ZMZ A;  1NVP D;  2Y0I A;  2P4K A;  2WLM A;  2R70 A;  4UVB A;  2Q0A A;  2KB1 A;  2IW5 A;  4DR2 B;  1DF5 A;  4GX0 A;  3EHB B;  3M99 B;  4W4K A;  4JV5 O;  5CA0 B;  1I7F A;  3QO7 A;  1FYJ A;  1SER A;  4O4H A;  3JD2 A;  1WB7 A;  1XL4 A;  5KLV H;  3CCS V;  1U96 A;  5JH7 A;  2WLL A;  2MW2 B;  1G4Y B;  1QLE B;  5FNV A;  4DR1 B;  4JYB A;  3SYQ A;  3UO2 A;  5IT9 N;  1AI4 A;  2YEV A;  2PYJ A;  1YEW A;  1OCC B;  1M56 C;  5GON B;  4TQD A;  1OCZ B;  5L3E A;  4I4T A;  2UUA B;  5K1X A;  2QE7 G;  3DTU B;  1TGO A;  4NTW A;  5EC1 C;  3SPC A;  3D36 A;  3E86 A;  2N74 A;  1Y6X A;  2KSD A;  3E22 B;  1IBL O;  1XUQ A;  4O2B B;  1TUB A;  4FLV A;  4DV6 B;  5A2Q N;  1QU7 A;  2M7W A;  3VOU A;  4X65 O;  3C3T A;  2PYL A;  2QGN A;  4J42 A;  3SYO A;  2CTW A;  1AP5 A;  1WB8 A;  3ASN B;  4I55 A;  1QLN A;  2IJK A;  2A7W A;  3THO A;  3E8G A;  1N32 B;  2ZIM A;  1GN4 A;  1L0N H;  5FLX N;  3JAT B;  4RQF A;  5EBM C;  4PA3 A;  3ZX6 A;  3JAL B;  2DQ3 A;  3JAK B;  2Q0O C;  5JQG B;  1KUQ A;  5H9C A;  1XOU A;  2F93 B;  1H2K A;  1RSO A;  2XHB A;  5KX5 B;  1XRE A;  1N4C A;  4J9Z B;  4RUF A;  4QIW F;  2YIC A;  2QJ1 A;  3RFR A;  3U11 A;  4FFB B;  2ZT9 B;  4LF6 O;  5EIB D;  5L3B A;  5GW7 A;  3HKD B;  2WA3 A;  1DGS A;  4DV3 B;  3T1Y O;  1SF9 A;  1LUV A;  4IHJ B;  3BVO A;  4C7U A;  5LA6 A;  1IBK B;  2V7Q G;  5B5E Z;  1K34 A;  4J7J A;  2HG5 C;  3CD6 V;  2IU0 A;  1YSC A;  2EIL B;  1L0L H;  2BTO A;  2ZE5 A;  4D7T A;  5IYC O;  2HEP A;  4WF9 V;  5C8Y B;  2QSA A;  3N2G B;  4QGP A;  1BHB A;  1SZX A;  1AR5 A;  4AQY B;  3OR7 C;  2DYR B;  1H8H G;  4NXM O;  4X1Y B;  1Y4M A;  2Q9L A;  1H8E G;  3VBB A;  1MA1 A;  3CB2 A;  3CYO A;  5EC2 C;  4D7S A;  1VQ7 V;  4MVQ A;  1PKX A;  2A3Q A;  4N23 A;  4X62 B;  4PDM A;  4I7Z B;  2E5L B;  4LFB O;  2HVJ C;  3T1H O;  4X8A A;  4YIP A;  4AI8 A;  4CH3 A;  5JVD B;  1XMQ B;  5B3S B;  2RJZ A;  1HNX B;  1OCR C;  2OCC C;  5CA3 A;  4DR7 B;  5CA0 A;  4B7E A;  2C2A A;  3JCZ A;  4DK1 A;  1VIB A;  4NKG B;  1S76 D;  2ADQ B;  3TK1 A;  4FFK A;  1BSM A;  5EYP B;  1KP2 A;  1F4M A;  4G28 B;  4DV1 B;  1KKD A;  1HDJ A;  3PN1 A;  1AJQ A;  4X64 O;  3T2M A;  1H2N A;  1F7Y A;  1BL8 A;  4DV7 O;  2EIK C;  1R6K A;  3D3Q A;  2GTA A;  1FPO A;  5GON A;  1FD9 A;  1YCI A;  4JI4 O;  5DM6 V;  2Q7G A;  4TSF G;  3OTO O;  2LW1 A;  2AGA A;  2UU9 O;  3D36 C;  1RM1 B;  4EKW A;  1FXK A;  3E22 A;  2X6C A;  3HKC A;  4B3M O;  4JV5 B;  2PY5 A;  3L73 H;  4O2B A;  5HFL A;  3K5L A;  2OWO A;  2X6A A;  5L3C A;  3CE2 A;  4MTX A;  3OR6 C;  4UVC A;  2XOK G;  1AI7 A;  3APO A;  4A5U B;  2GTS A;  1Q7Y W;  4H33 A;  2OTL V;  3CRQ A;  1H2G A;  1JCH A;  4JI2 O;  2ETN A;  3QO8 A;  3J7A U;  5JCO A;  4PD4 F;  4X1K A;  2QM8 A;  2CK3 G;  2HLD G;  2EUL A;  5EZY A;  1S5H C;  2CH7 B;  3AG2 C;  3JAR B;  2CUG A;  1M57 C;  3H1J H;  3RYI A;  1I0H A;  1K33 A;  3AG7 A;  1BZK A;  1GM7 A;  2PTM A;  2QKA A;  3BY6 A;  4DV0 O;  2WSS G;  1IBL B;  3H1L H;  5J2T A;  4LF5 O;  4I9W A;  1NT2 B;  3E8H A;  1W59 A;  2UUC O;  1NZ6 A;  3ML0 A;  3SDL A;  1NTK H;  1H2S B;  4X65 B;  3ZMV A;  4FFB A;  3KG2 A;  4UV9 A;  3A2F A;  3DC6 A;  4NXN B;  1EN5 A;  4ZIB A;  4EEQ A;  1R6N A;  4FJC C;  5HFM A;  1PNK A;  3E2E A;  3HKD A;  3CP1 A;  4YJ2 B;  4JI8 B;  5JWP A;  4LC1 A;  3H01 A;  2WLH A;  2A06 H;  4DR4 O;  3OW2 U;  2W0F C;  4LFA O;  1VQM V;  2IH3 C;  1I94 O;  4JGS A;  3TGU H;  1V55 C;  3FYI B;  1LNQ A;  4LF7 O;  3EVK A;  4J11 A;  3N2G A;  1I5Y A;  1GN2 A;  2LJ2 A;  1FKA O;  3STL C;  1B6Q A;  1WPB A;  5CN0 A;  4KFM A;  2BOB C;  5B1B C;  1R3J C;  4X1Y A;  2GV9 A;  3M7M X;  3FX7 A;  3I5D A;  4O2A B;  3SPJ A;  1K4C C;  3ZHV A;  4LF6 B;  2QM7 A;  2Q5Z A;  4YHH O;  1KMI Z;  4JAU A;  2Z5U A;  3T1Y B;  4R8C A;  3K04 A;  3ZRW B;  3CRC A;  5BY1 A;  3K9A A;  4PA4 A;  5J9P C;  1E79 G;  1VF6 A;  2W0X A;  1WA8 B;  1ZUQ A;  3UM7 A;  5KAF Z;  2ZNI A;  5LP6 B;  2BE3 A;  3CCQ V;  2JGU A;  4OX9 O;  4J41 A;  2IBZ H;  1CEZ A;  5CMU A;  3B77 A;  2JRI A;  1NJI W;  1R6T A;  1KBH A;  3ZMU A;  5EYP A;  1PP9 H;  4F6E A;  3Q4H A;  1QLE C;  4DR1 O;  1SQV H;  1OCC C;  3DXR A;  1AJP A;  3K3W A;  3SYC A;  1SKV A;  1OCZ C;  2ZR2 A;  3H9V A;  3ABK B;  1LR1 A;  4LFB B;  2BOC C;  2UUA O;  2WLI A;  3T1H B;  1YIJ V;  3CEI A;  1B04 A;  4F6R A;  2UXN A;  1IZ3 A;  1GK9 A;  1QR8 A;  4MS2 A;  1RP3 B;  2ZIO A;  2EIJ B;  1S5L Z;  3LUT B;  1Q6I A;  2BSK A;  1XMO O;  4O4H B;  2UXC O;  5H6R A;  3O65 A;  1GH6 A;  1QCE A;  4RWU A;  5ITZ B;  3ASN C;  5JH7 B;  4DV7 B;  4K35 A;  5FNV B;  2YEV B;  4W4L A;  4NVP A;  3JAR A;  4JI4 B;  5JJN B;  1ZSP A;  3OTO B;  4FMT A;  2PI4 A;  2W6J G;  1GO3 F;  2K1E A;  2L6L A;  1E1R G;  1KQS U;  4O4J A;  3VQX A;  3BFR A;  4LF4 O;  4B3M B;  2ODM A;  4J7Z A;  4UCS A;  3FKS G;  3QNE A;  4IT5 A;  3G4S V;  2ZIN A;  1VF5 B;  1SQG A;  4FZ1 A;  2XT9 A;  5AG2 A;  3ZMT A;  1JA8 A;  4OGQ B;  2YI8 A;  5GTI Z;  4JI2 B;  1G1X B;  2EZO A;  3O9O A;  4I55 B;  3L72 H;  3MHH C;  2EBO A;  3C3S A;  4GT1 A;  1IBK O;  3MHS C;  2JJ1 G;  4GX5 A;  4CBC A;  2EIL C;  5K1P A;  2Q69 A;  2YIB A;  1XI1 A;  1ARO P;  1S0V A;  4JYY A;  2FL4 A;  4DV0 B;  1BMF G;  1JR9 A;  5LHH A;  1RSO B;  1GRJ A;  5IY5 B;  1QQC A;  3BCC H;  2Y69 B;  3F5W C;  2DYR C;  4O4I B;  4PHZ A;  4B3T O;  3LDC A;  4MTG A;  2UUC B;  4XDK A;  1IXB A;  3SGI A;  1K7D A;  1VQ4 V;  4G27 B;  1GMG A;  1WN7 A;  4O2A A;  4J10 A;  5LGT A;  1JPX A;  4DV5 O;  4DUZ O;  2CTQ A;  2X0L A;  1ZL8 B;  3B8N A;  3ZRW A;  1FJG B;  1MZE A;  2CTR A;  2UXD O;  3S3X A;  4DR4 B;  1R1B A;  2B1I A;  2ZXW B;  1EZJ A;  1RPR A;  1HNW B;  4LFA B;  4JI3 O;  5B3S C;  1I94 B;  4DXW A;  2AW9 A;  4LF7 B;  1XMQ O;  3B2E E;  1GAX A;  5LMU O;  3ZRV A;  3SJA C;  1KC8 W;  4JPR A;  2XND G;  1HW7 A;  3CCL V;  4QJF B;  4L87 A;  2BCC H;  5LXT A;  4PDR A;  1K8A W;  1FS0 G;  4TV9 A;  3W7T A;  3JSL A;  2N05 A;  5KAI Z;  3AG1 B;  3B4S A;  3H1K H;  4YHH B;  1NQT A;  1RFY A;  3L70 H;  2G38 A;  4BW5 A;  2A79 B;  3LNM B;  4H13 B;  2MK3 A;  4RQE A;  3WB1 A;  3UKM A;  4JZ2 A;  4IYI A;  1RM1 C;  2QTO A;  4LCU C;  2P5O A;  4JI7 O;  4OX9 B;  4E4E A;  3FB7 C;  4KHP O;  2RMK B;  4LFC O;  4NYK A;  3JD0 A;  4X1I A;  4BIZ A;  4YXW G;  2IH1 C;  1N36 B;  1G8M A;  3AG4 B;  2ZDI C;  3W7U A;  2P90 A;  4FLX A;  3F7Y C;  5ITZ A;  1B3Q A;  3CCM V;  2IM9 A;  1PL0 A;  1JQ0 A;  2LP7 A;  4MTF A;  3TJT A;  4LH7 A;  1Q3E A;  1MMM A;  2EZP A;  1K97 A;  3CRM A;  1U97 A;  2YID A;  1Y76 A;  1FXK B;  3HKC B;  4TOI A;  3IJ4 A;  1Q90 D;  1ENV A;  1XMO B;  5IE9 A;  1O9G A;  3OGI B;  2UXC B;  4R50 A;  3CXC U;  1GM9 A;  2AZ2 A;  4B3S O;  5DN6 G;  3RYH B;  3HKE B;  1ZLZ A;  4NXN O;  1Q86 W;  1XHZ A;  4DO2 A;  4KXR A;  4OPA A;  3N27 A;  3K5O A;  4X1K B;  2E76 B;  2YS8 A;  3D3I A;  4JTA B;  4XBF A;  4JI8 O;  5EZY B;  3BPZ A;  4GUN A;  1VAR A;  3JAW B;  2LW7 A;  4PA7 A;  3RYI B;  1AI5 A;  1H2L A;  1YZB A;  2QKC A;  1EFR G;  1VMG A;  4LF4 B;  4BW9 A;  2O57 A;  2QEX V;  4X20 B;  3WU2 Z;  5J2T B;  2YXH A;  4WFG A;  3K03 A;  4O4I A;  1TAE A;  1GTO A;  2OIG A;  3P32 A;  1XQ8 A;  4FM0 A;  4F4L A;  3W7X A;  4DK0 A;  5LOV A;  1TUE B;  3I55 V;  4MT8 A;  1ZL8 A;  2WA4 A;  1V54 B;  3AK1 A;  1FFX B;  1MSD A;  2ZR3 A;  3G67 A;  3OMN B;  3G71 V;  2P7T C;  2KG7 B;  1TA8 A;  4P9P A;  3OMI B;  5LP6 C;  2D2C B;  4L8J A;  4ZOL A;  1M5I A;  2ZKO A;  4B7K A;  4P9O A;  1E1Q G;  1Y74 B;  3RYC B;  3CC7 V;  4YY3 O;  1HR0 O;  1EM1 A;  3A8T A;  3HR0 A;  5KMG B;  4B3T B;  2RN9 A;  3JAS A;  3CSX A;  2M6Y A;  1BGY H;  1MNG A;  2DWE C;  1EZV H;  2ITD C;  2HVK C;  4ICG A;  2B5U A;  1VQ6 V;  4U7N A;  1YHQ V;  1YXB A;  4HZ3 A;  4QE9 A;  4DV5 B;  3OD4 A;  4DUZ B;  2F1M A;  3HKB B;  3RBZ A;  3LSU A;  1IUR A;  1Y67 A;  3BAB A;  1JVM A;  3ABK C;  1PNL A;  2UXD B;  4QE7 A;  3SJQ C;  1MZF A;  5DED A;  4JI3 B;  1Q82 W;  1KU9 A;  2WLN A;  4CS3 A;  4UCU A;  4K8X A;  5LMU B;  4GCZ A;  4DW1 A;  2EIJ C;  4MVS A;  2F66 C;  4TV8 B;  5CBF A;  5FPR A;  2JEU A;  3CC4 V;  4RAI A;  3J81 N;  1D2D A;  2FKX A;  1NI8 A;  4MVO A;  1WJZ A;  4U3J B;  5H6Q A;  1BHA A;  4G2K A;  2VRZ A;  3Q4H B;  1PV0 A;  4FLW A;  1NBM G;  2JDI G;  3CCR V;  1ROP A;  2IU3 A;  3DXR B;  3OGC C;  4UUJ C;  2DE0 X;  4PA9 A;  2FYU H;  2NNU A;  2JJ2 G;  3CCU V;  1JOY A;  2WLI B;  2E75 B;  5IJ0 B;  1PPJ H;  2B9Z A;  3QVN A;  3CHX A;  4HNA B;  1OV9 A;  4JI7 B;  4Q20 A;  3ZHU A;  5LHG A;  4F6R B;  1S72 V;  4PV1 B;  2BTQ A;  3R66 A;  1JMK C;  4I0X A;  5GTH Z;  3LDD A;  3FB8 C;  4IL6 Z;  2PZS A;  3QF7 A;  4EB6 A;  3UT5 B;  4KHP B;  4LFC B;  2Q7E A;  2Q7H A;  4FVM A;  4DR3 O;  4PJ0 Z;  3ZN0 A;  2XAQ A;  1BS3 A;  2BSK B;  3ZIA G;  5JJJ B;  2ZE8 A;  3HKE A;  3RYH A;  1J95 A;  1VQ8 V;  1AP6 A;  3ZBH A;  3JAM N;  1KP3 A;  2LFR A;  2OYQ A;  4FK5 C;  1N34 O;  4Z1M G;  1NH2 B;  4U3F H;  2F4V O;  2YXY A;  3JAW A;  5KHJ A;  3CJH A;  3J80 N;  4FPP A;  3A0H Z;  4O4J B;  3K9S A;  4IIJ B;  1NKD A;  1QR9 A;  3UCS C;  5IY5 C;  2DYS B;  4X20 A;  1AR1 B;  5LYJ A;  3T1C A;  2Y69 C;  2JIZ G;  5E1A C;  3K0D A;  5KUM A;  3RW0 A;  1D5N A;  1EN4 A;  2AXT Z;  4B3S B;  4FIP C;  1M93 A;  2JGD B;  2GSM B;  5B1N A;  3RVY A;  1FFX A;  4JAV A;  2ZE6 A;  4NB5 A;  1FJG O;  2ARH A;  2ZXW C;  2UXB O;  3ABT A;  2KG7 A;  1HNW O;  3KCY A;  1GN3 A;  3ZHS A;  1Y74 A;  4Z2W A;  3RYC A;  5IWA B;  5B1O A;  2GUZ A;  3OTF A;  3KKY A;  1KYO F;  2R9I A;  2GBO A;  5KMG A;  1B06 A;  5LHI A;  1XNR O;  5B1A B;  3AG1 C;  4K0K O;  1Q43 A;  4XDJ A;  1ZWI C;  2F95 B;  3HKB A;  2PGG A;  3K0G A;  2QDO A;  2XAJ A;  4PI2 A;  1IVS A;  3B09 A;  1WP8 A;  2RDC A;  3ABU A;  1SES A;  3LNN A;  5IYD O;  2VQF O;  2QWN B;  2E74 B;  2DWD C;  2CGN A;  1IBM O;  4R7C A;  1N33 O;  3OMA B;  1WAZ A;  4YY3 B;  4CS2 A;  2VWJ A;  4TV8 A;  1HR0 B;  5F2V O;  1SZT A;  2WLK A;  3AG4 C;  2DOS A;  1QNM A;  5LXT B;  4I9Q A;  4U3J A;  3LSQ A;  1N36 O;  3X2Q B;  2EIM B;  4TV9 B;  4BIU A;  3EXA A;  2N04 A;  1P4R A;  3IAY A;  1F51 A;  1K4D C;  2K9P A;  2EJR A;  1YI2 V;  4DV2 O;  2ZQM A;  2ITC C;  5BR8 B;  1NS1 A;  3QG5 A;  3RYF B;  3ABL B;  5IJ0 A;  3HB3 B;  4HNA A;  5J2U B;  4OXS A;  1FXK C;  2JVD A;  1MOF A;  3UT5 A;  3VQV A;  2Z3Y A;  3F5T A;  2JS5 A;  4D6T H;  4MSW C;  1KEC A;  4X1I B;  3KCX A;  1P7B A;  4Z1V A;  4TQF A;  3RVZ A;  4GKK O;  4MTO A;  2QKS A;  5JCO C;  4MW3 A;  1IX9 A;  5LBQ A;  2XAH A;  2IJI A;  5TIS Z;  4CH5 A;  4J80 A; 
#chains in the Genus database with same CATH homology
 3SPI A;  2HFE C;  1NVP B;  2QTO A;  4LCU C;  3PJS K;  1QVG U;  1BHB A;  3HPL C;  3FB7 C;  2V1D A;  3CME V;  1M9N A;  3E8F A;  3FYE B;  3OR7 C;  2DYR B;  4J9Y B;  5KA6 A;  3JD0 A;  1H8H G;  4BIZ A;  4YXW G;  1K5S A;  2IH1 C;  1K3E A;  2XAS A;  1G8M A;  2X7R B;  1Y4M A;  3AG4 B;  3SPG A;  2ZDI C;  3W7U A;  2P90 A;  1H8E G;  3F7Y C;  3VBB A;  3CYO A;  3ABM B;  3NXS A;  5EC2 C;  3ASO C;  3WG7 B;  1VQ7 V;  4MVQ A;  3CCM V;  1PKX A;  5IYB O;  3JYC A;  4N23 A;  1PL0 A;  1JQ0 A;  4PDM A;  2LP7 A;  3TET A;  2Q6A A;  4MTF A;  3F7V C;  1V54 C;  2HVJ C;  4TWK A;  5LGN A;  1M1K W;  2EZP A;  4X8A A;  4WFH A;  1R3L C;  4MW8 A;  1K97 A;  1PNM A;  5B3S B;  3ETE A;  4HAM A;  1OCR C;  2OCC C;  2DW4 A;  3AG3 B;  5CA3 A;  2C2A A;  2JK5 C;  1FXK B;  3JCZ A;  1S76 D;  1OZ0 A;  2HR3 A;  3TK1 A;  2WLJ A;  1DLB A;  1KP2 A;  1F4M A;  2WPD G;  4G28 B;  3OAA G;  3CCE V;  1KKD A;  5KA5 A;  1ENV A;  1AJQ A;  3T2M A;  4QPJ A;  4R50 A;  3CXC U;  1GM9 A;  1M90 W;  1BL8 A;  5DN6 G;  2EIK C;  5LGU A;  1R6K A;  3ZRS A;  1SET A;  3IFX A;  1YJW V;  1Q86 W;  4WFF A;  1ORQ C;  4KP4 A;  4DO2 A;  1YTF D;  2XAG A;  4KUM A;  3ETD A;  3W7W A;  2IJJ A;  3D3I A;  5DM6 V;  4MVZ A;  4JTA B;  4TSF G;  4PDL A;  4XBF A;  3STZ C;  4XDL A;  3W7S A;  3EFF K;  1RM1 B;  1CP9 A;  4EKW A;  1AJN A;  4UXN A;  4JTC B;  1FXK A;  4PA7 A;  1DTO A;  1AI5 A;  2X6C A;  2DQ0 A;  1FFT B;  1EFR G;  5HFL A;  3OEH G;  4CZZ A;  2X6A A;  3SYA A;  4UV8 A;  5L3C A;  2QEX V;  4MTX A;  3OR6 C;  4UVC A;  2XOK G;  1AI7 A;  4WFA V;  5EBW C;  4WFG A;  3K03 A;  1Q7Y W;  2X6B A;  4H33 A;  1VQN V;  1WPX A;  2OTL V;  5L3F A;  1GTO A;  2AHZ A;  1NH2 D;  1H2G A;  1RPO A;  1JCH A;  3P32 A;  1H38 A;  3QO8 A;  4H37 A;  3ASO B;  1XL6 A;  2QM8 A;  4RUE A;  2CK3 G;  4F4L A;  2HLD G;  3W7X A;  4P30 A;  3MD0 A;  1TUE B;  3I55 V;  4MT8 A;  1S5H C;  1V54 B;  3AG2 C;  1MG1 A;  2ZR3 A;  3GB7 C;  1M57 C;  1NR1 A;  5BZB A;  1VQ5 V;  2PI5 A;  4HYO A;  1DF4 A;  3CC2 V;  3OMN B;  1K33 A;  3G71 V;  2P7T C;  1GM7 A;  1NR7 A;  1OCR B;  2OCC B;  3BY6 A;  3OMI B;  3OFN G;  4P9P A;  4MVU A;  1VQO V;  3ZN1 A;  2WSS G;  4P9O A;  1E1Q G;  1W0J G;  3CC7 V;  3OUF A;  4I9W A;  1K92 A;  3SYP A;  3T4Z A;  3E8H A;  1KD1 W;  2ZDI A;  3GWO A;  1K73 W;  1S3J A;  2OT5 A;  3E89 A;  3ML0 A;  2WLL B;  1WLE A;  3ZMV A;  1OCO C;  4UV9 A;  3KG2 A;  4WFB V;  2EIK B;  2DWE C;  2ITD C;  4JYC A;  3CMA V;  2HVK C;  5CBH A;  1R6N A;  2B5U A;  4FJC C;  2QA4 V;  1VQ6 V;  4U7N A;  5HFM A;  1PNK A;  1YHQ V;  3E2E A;  4HZ3 A;  4RO2 A;  4QE9 A;  3CP1 A;  1VQ9 V;  1VQL V;  3SPH A;  3RBZ A;  2EIN C;  4LBE C;  4LC1 A;  3H01 A;  2W6I G;  2WLH A;  3IGA C;  4UVA A;  1JVM A;  3ABK C;  3P30 A;  2NLJ C;  1PNL A;  3OW2 U;  2IJH A;  2W0F C;  4QE7 A;  3SJQ C;  3FB5 C;  1VQM V;  3LDE A;  3E35 A;  3A0R A;  2IH3 C;  4JGS A;  1V55 C;  3FYI B;  1LNQ A;  4WFE A;  1Q82 W;  2WLN A;  1I5Y A;  5C93 A;  4GCZ A;  2EIJ C;  3IC7 A;  4MVS A;  2F43 G;  3STL C;  2AHY A;  5CBF A;  3CC4 V;  2JEU A;  4QNH B;  1B6Q A;  4RAI A;  2DYS C;  2P6J A;  3TCU A;  4PEL A;  5CN0 A;  4KFM A;  2BOB C;  5B1B C;  1R3J C;  4MVO A;  1S77 D;  5H6Q A;  1BHA A;  1IXM A;  1F4N A;  1K4C C;  4G2K A;  3SPJ A;  2QM7 A;  4JTD B;  1MSW D;  1L1F A;  4JAU A;  1CPY A;  2WWW A;  1NBM G;  2Z5U A;  4R8C A;  2JDI G;  3JD3 A;  3K04 A;  3ZRX A;  1ROP A;  3CCR V;  3ZRW B;  3WFV A;  3K06 A;  2IU3 A;  3AG2 B;  3FB6 C;  3OGC C;  1M57 B;  3K9A A;  4PA4 A;  2H94 A;  4UUJ C;  5J9P C;  4U7O A;  1N8R W;  1E79 G;  4PA9 A;  4ZBM A;  2NNU A;  1PD3 A;  3UM7 A;  2JJ2 G;  2ATK C;  3CCU V;  3E83 A;  4X88 A;  3CCQ V;  4R6Z A;  1JOY A;  2WLI B;  3BEH A;  1YTF B;  1CEZ A;  1YIT V;  5CMU A;  3ZMS A;  4Q20 A;  5LHG A;  1S72 V;  2H8P C;  1F23 A;  1GM8 A;  3B77 A;  4N21 A;  3LDD A;  2R9R B;  1MAB G;  3FB8 C;  3K79 A;  1NJI W;  2OTJ V;  4P2Z A;  3ZMU A;  5L3G A;  3JD4 A;  3ZN0 A;  2XAQ A;  4E2L A;  3ZIA G;  1QLE C;  4MVR A;  2A0L A;  3OUS A;  1J95 A;  1QBZ A;  1VQ8 V;  5B1A C;  1OCC C;  1AJP A;  3K3W A;  3SYC A;  1VQP V;  2A9H A;  1OCZ C;  2EIN B;  2Q67 A;  2ZR2 A;  1KP3 A;  2LFR A;  3ABK B;  4FK5 C;  2BOC C;  2Y48 A;  4PDV A;  4Z1M G;  2WLI A;  1NH2 B;  4PA6 A;  1OHH G;  5KUK A;  1YIJ V;  1V55 B;  2UXN A;  1GK9 A;  4LP8 A;  1QR8 A;  3E8B A;  4FPP A;  1JJ2 U;  3CCV V;  4MS2 A;  5CBG A;  2JEX A;  2EIJ B;  3OE7 G;  4X89 A;  3ETG A;  3LUT B;  1NKD A;  1QR9 A;  5IY5 C;  2DYS B;  1UJW B;  1AR1 B;  1YJN V;  3T1C A;  2Y69 C;  1FXH A;  3DGE A;  5B1B B;  4ASU G;  2Q68 A;  2JIZ G;  5E1A C;  5H6R A;  5IDJ A;  3K0D A;  5KUM A;  3RW0 A;  3CPW U;  1THZ A;  1QCE A;  2GHY A;  4JAS A;  3K08 A;  3ZJZ A;  3R65 A;  3T4D A;  3ASN C;  4FIP C;  3X2Q C;  1R73 A;  2EIM C;  5EK0 A;  4JF3 A;  3ZMZ A;  1NVP D;  2YEV B;  2WLM A;  2GSM B;  4UVB A;  5B1N A;  1YJ9 V;  3RVY A;  2KB1 A;  2IW5 A;  4JAV A;  1VQK V;  1W2B U;  1R3I C;  3CCJ V;  3AEI A;  4FMT A;  1DF5 A;  2ZXW C;  2PI4 A;  2W6J G;  3ABT A;  4GX0 A;  2B1G A;  3EHB B;  3M99 B;  1GO3 F;  2K1E A;  1KQS U;  1E1R G;  3I56 V;  3ABL C;  3QO7 A;  1SER A;  4WCE V;  3JD2 A;  4ZKI A;  5B1O A;  3FKS G;  2HKO A;  1XL4 A;  1Y66 A;  3QNE A;  3G4S V;  1FXV A;  2R9I A;  3CCS V;  2WLL A;  3ZMT A;  1G4Y B;  1QLE B;  1QVF U;  4JYB A;  2HJF C;  3SYQ A;  2YEV A;  1AI4 A;  5LHI A;  3B8M A;  4BAY A;  4GX1 A;  1SRY A;  5B1A B;  1OCC B;  2ZD9 A;  3AG1 C;  1M56 C;  2EZO A;  1OCZ B;  3MHH C;  5L3D A;  2EBO A;  4XDJ A;  1ZWI C;  5L3E A;  3K0G A;  4GT1 A;  2QE7 G;  2XAJ A;  3MHS C;  3DTU B;  2JJ1 G;  4GX5 A;  4CBC A;  2EIL C;  5EC1 C;  3ABU A;  3D36 A;  3SPC A;  1SES A;  2Q69 A;  4I5S A;  3E86 A;  1ARO P;  5IYD O;  1S0V A;  2DWD C;  1BMF G;  4R7C A;  5LHH A;  3OMA B;  4TT3 G;  5IY5 B;  1GKF A;  2M7W A;  2Y69 B;  3F5W C;  3VOU A;  2DYR C;  3LDC A;  4MTG A;  4XDK A;  1SZT A;  1K7D A;  2WLK A;  3SYO A;  5FL7 G;  3AG4 C;  1K5Q A;  3ASN B;  1VQ4 V;  4G27 B;  1GMG A;  3QO5 A;  1QLN A;  3LSQ A;  2IJK A;  3X2Q B;  1OCO B;  3E8G A;  2EIM B;  5LGT A;  1JPX A;  3ABM C;  1Q81 W;  3WG7 C;  4BIU A;  2X0L A;  2WAM A;  1P4R A;  3B8N A;  3ZRW A;  2P67 A;  4RQF A;  4PA3 A;  1JX9 A;  5EBM C;  1F51 A;  1K4D C;  2DQ3 A;  1W0K G;  2EJR A;  5EBL C;  4QPK A;  1YI2 V;  2B1I A;  3ZCC A;  2ZQM A;  2ITC C;  2ZXW B;  1EZJ A;  1RPR A;  5H9C A;  2YSU B;  1AI6 A;  5B3S C;  4DXW A;  3ABL B;  2LFS A;  3HB3 B;  3AG3 C;  3ZRV A;  4OXS A;  1FXK C;  3OM3 B;  1KC8 W;  4J9Z B;  4JPR A;  2XND G;  3G6E V;  4RUF A;  4QIW F;  1MOF A;  3LSS A;  4QJF B;  3CCL V;  1R3K C;  4L87 A;  2Z3Y A;  4GX2 A;  3OEE G;  4MSW C;  4PDR A;  1K8A W;  1FS0 G;  1KEC A;  3W7T A;  5L3B A;  1K9M W;  5GW7 A;  2UXX A;  1EBO A;  2D3O W;  3AG1 B;  1M56 B;  1P7B A;  2FTK A;  1NQT A;  4BW5 A;  1I5X A;  3RVZ A;  2A79 B;  2V7Q G;  4MTO A;  3LNM B;  1COW G;  2QKS A;  1K34 A;  2HG5 C;  3CD6 V;  2XAF A;  2IU0 A;  4MW3 A;  4MVM A;  2MK3 A;  1YSC A;  2EIL B;  5LBQ A;  4RQE A;  2XAH A;  2IJI A;  1HWY A;  3UKM A;  5IYC O;  3JD1 A;  1RM1 C;  4WF9 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...