1Y66A

Dioxane contributes to the altered conformation and oligomerization state of a designed engrailed homeodomain variant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
50
structure length
50
Chain Sequence
QWSEEVERKLKEFVRRHQEITQETLHEYAQKLGLNQQAIEQFFREFEQRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords engrailed homeodomain
publication title Dioxane contributes to the altered conformation and oligomerization state of a designed engrailed homeodomain variant.
pubmed doi rcsb
source organism Escherichia coli
molecule tags De novo protein
total genus 24
structure length 50
sequence length 50
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1y66A00
1K33A 5HFMA 3M99B 4G2KA 4FJCC 3WFVA 2EZPA 3B8MA 3H01A 2X7RB 3MHSC 2MK3A 5H9CA 4JF3A 1MOFA 5KA5A 1MG1A 1QCEA 1ENVA 1I5XA 1I5YA 2LP7A 2OT5A 2M7WA 3CP1A 4FIPC 5CN0A 5KA6A 1DF5A 3GWOA 3CYOA 1QR9A 1SZTA 1JPXA 3B77A 3P30A 3MHHC 1QBZA 1EBOA 2P6JA 2EZOA 1F23A 4JGSA 1Y66A 2EBOA 4N23A 1Y4MA 5CMUA 3K9AA 5HFLA 1DF4A 3B8NA 4E2LA 4FK5C 4N21A 4JPRA 1DLBA 1QR8A 1JQ0A 1K34A
chains in the Genus database with same CATH superfamily
5EK0A 2BSKB 3SR2C 3ABLC 5KHJA 5IJ0B 2HG5C 1N32O 2BCCH 2HEPA 3AG7A 4LF9B 5CA1A 2H94A 2HJFC 2WPDG 2UXBB 3TJTA 3WG7C 3N27A 5LMNO 5CA1B 1EZVH 2PF4E 4HAMA 1X59A 1R3KC 5B1NA 1NR7A 1GM9A 4JI8O 4TWKA 1JFFB 3G67A 1SQGA 2AHYA 3SJAC 4O4JA 1BHBA 3KG2A 4DV4O 2Q7EA 1XQ8A 4O4JB 1MSDA 3T1HO 1XNRO 2UUBB 1NVPB 1ZWIC 2A0LA 3SJBC 5JCOA 1PM9A 2ZIOA 4JI4O 3AG4B 2IU3A 5LHGA 2UXXA 1XMQO 3OAAG 1MG1A 1XMOB 1K73W 3AG2C 5GONA 3D3QA 1JPXA 2NLJC 2A7WA 1V55B 3RBZA 5J2UA 1K5QA 2AXTZ 3GWKC 2IJKA 5GONB 1FFTB 1RPOA 4I50A 2WLKA 4XDJA 1B6QA 1KC8W 5J2UB 2ZE6A 3ZRWA 4LF4B 2OIGA 5KUKA 4GKJB 5KX5A 2LO1A 2V4DA 1U97A 4DV2B 3ABTA 4CH3A 3HKCB 4RUEA 1SRYA 1OCZC 2ZNIA 3E2EA 2DYSB 3NXSA 1N36O 1F23A 1Y4MA 3JASA 3EVKA 3LSSA 2B1IA 3JAWA 1IBKB 1GO3F 1DLBA 3HKBA 3OTOB 3BHPA 4LF5B 4JZGA 2JGDB 3ZS8C 1IDSA 1WN7A 3K59A 3JASB 2UXCO 2GHYA 3JAWB 3HKBB 2CTPA 3JD3A 1NR1A 1DTOA 3OGIB 1KMIZ 5IDJA 3QO8A 1Q90D 2KKWA 3CRMA 5KAIZ 5BR8B 2LGQA 4UVAA 2WLNA 1N8RW 1KKCA 2GTSA 1MMMA 1QR8A 4FFBA 5EBWC 3K0GA 1HNXB 3OEEG 4IYIA 2XAGA 1VIBA 3W7TA 2RDCA 4OGQB 3C3TA 4MVZA 1Q8IA 5J2TA 1AVMA 2EIKB 2EZOA 5IYZB 1MZFA 4X65B 4DV3B 4X1YA 2UUAB 4AQYB 3LUTB 1IXMA 4IYHA 5J2TB 1VQPV 1YJ9V 3P32A 1QNMA 2UUCB 3JSLA 4J41A 2CDYA 3L71H 3B2EE 1I5YA 3J80N 4FFKA 4UB6Z 1QR9A 4JAAA 2YIBA 4JAVA 4ZI7A 1HNWB 4JV5O 5LBQA 2KG7B 4X1IB 5LHHA 4LFAB 3X2QC 1N34B 1K33A 1XL4A 2JJ1G 5BZBA 1P7GA 3H01A 4PD4F 4IIJA 3VQVA 3UO3A 4I4TB 1XUQA 4JI1O 4K8XA 4X8AA 2XOKG 4DW0A 3J81N 4XDKA 1XDCA 1FKAO 2QKAA 4CH6A 4TT3G 2K9PA 1KQSU 2P4KA 1ZX3A 4Z2WA 4D6TH 3W7WA 5HFMA 4BIOA 3T1YB 4I7ZB 4DW1A 2F66C 3ABLB 4KXRA 1N33B 5H9CA 1J95A 4I9WA 2HHHB 3ML0A 4UXNA 1S5HC 4FM0A 1NH2D 3ZRXA 4GKKB 1HR0B 4JI5B 2UXDO 3CCLV 1WJZA 2E75B 5JQGA 4LF6O 3QO7A 2JS5A 1IBLB 3WG7B 1JCHA 4JYAO 1I94O 5JQGB 4FZ0A 2AZ2A 3M7MX 3ETGA 3HR0A 3CP1A 3OW2U 4PA6A 1EZJA 2NN4A 4DO2A 4CS2A 1VQLV 3CEIA 3E8GA 3B40A 4LF9O 2D2CB 1O9HA 4FLYA 3I56V 4LF8B 1GM7A 3HKEA 3RN4A 4QGPA 2IH1C 1QU7A 4O2BB 2CAZC 4BAYA 2UXBO 3ABKC 5KA5A 3SJCC 3G71V 5F2VO 4P9PA 1COWG 1KP3A 3EXAA 1HW7A 1BE3H 4GX5A 4DV7B 4MVOA 1SETA 2P6JA 1Q43A 2LFRA 2QM4A 2Q4PA 5AG2A 4Q6GA 2MW2B 1VARA 5H5NA 4HYOA 3K9SA 3DXRA 3OGCC 3JAKA 1N0NA 1W2BU 4CC6A 2OTLV 4RWUA 3ZHUA 3E89A 1Q6UA 4NKGB 3HKDA 1DGSA 3DXRB 3JAKB 1OCZB 4TSFG 2Q6AA 1XMOO 2WLIA 3F7VC 4DR1B 1N32B 2MK3A 3RYIA 1F51A 4C7UA 4OXSA 1Q7YW 3T1CA 5H2FZ 3H1HH 1JJOA 2WLIB 1EN6A 2RQ6A 3SYQA 5JJJB 4B3MO 2NR5A 4WCEV 5LOVB 4B7EA 2YI8A 5LMNB 1OCOC 4GKJO 3FKSG 4DV2O 2QGNA 4E2LA 1JX9A 2EINC 4RUFA 1H2MA 2OTJV 5KHKA 3CXCU 2XNDG 1L1FA 5KHIA 3LDCA 5FNVA 5K1PA 4UCTA 4LF5O 4WFGA 1UPGA 1AROP 1XNRB 1GTOA 5FNVB 1S76D 5FPRA 4JI4B 2WA4A 4DR4B 2CGOA 4J7ZA 4O4LA 3OT7A 1JR9A 2QKSA 5BR8O 4DYLA 3C3SA 4GZRB 4PDMA 1F4NA 1WA8A 3CCMV 4PA3A 2P7TC 1EN5A 2VWKA 4DR2O 1V9PA 1WA8B 3X2QB 2H3OA 1JQ0A 1GN3A 3ASOC 4FJCC 4DV3O 1H2SB 2UUAO 3D36C 2PYJA 4B7KA 2CK3G 2IM9A 1N36B 3ZMSA 3N2KA 3WU2Z 2ZXWC 4RAIA 1RPRA 2Q7HA 2HKOA 3ABMC 4FZ1A 1RP3B 2DJVA 2X6BA 3CJHB 2GSMB 3CRAA 2UXCB 1T5EA 3N2KB 4IGGA 2IBZH 3OMIB 4DK0A 4H13B 2BTQB 1HNWO 3B8MA 1YVWA 2Z5UA 4L8JA 5LYJA 3ZJZA 1SKVA 4TQDA 2NNUA 5CN0A 4DUZB 2QEXV 2ITDC 5IYDO 2R70A 1BMFG 2ZNJA 1JOYA 1AR5A 2OCHA 1MNGA 3CXHF 3ZHQA 2DYRC 5B1BC 2CH7A 4I55A 1BSMA 3K58A 2R72A 1R73A 4LC1A 3ZHSA 4EKWA 1AP6A 3ZMUA 4FLTA 3E22A 1AR4A 1TA8A 1I5XA 3J7AU 5FLXN 2F95B 4I55B 1AI5A 4MW3A 3E22B 5IWAB 4ZOLA 3S3XA 4OX9O 1HR0O 4JI5O 5E1AC 3FB6C 1H2LA 4LFCB 5A9GA 2CTWA 3JARA 4ZOLB 1QCEA 3ABKB 4JV5B 1KYOF 3E86A 2QE7G 2E5LB 1XHXA 1V54C 3FB8C 3M8AA 2B5UA 5A2QN 4J11A 5IY5C 2F1MA 3K04A 4X1KA 2LP7A 1H8HG 2ZR3A 4YXWG 4GUNA 3I55V 1QBZA 2JS3A 2RMKB 4X1KB 3K5LA 2N74A 1Q6HA 2Q73A 4K3AA 4UCRA 4WFHA 4DV7O 5LXTA 2WLJA 2ZDIC 1WB7A 3BVOA 1SF9A 1UJWB 2Y0PA 4JI6B 3K06A 5LXTB 1SQXH 4Z1MG 1AR1B 1LUVA 3WB2A 1PD3A 2KQXA 1BQ0A 1OCOB 4JYAB 2EILC 2ZE8A 4U7NA 2QWRB 1I7FA 1I94B 1QQCA 3B4SA 3GVMA 2EINB 5JWPA 3UCSC 3TXQA 2V7QG 3LSQA 1URFA 1BCCH 3FAVA 3K5OA 1JVMA 3ABUA 3P3PA 4DR1O 3NR7A 3CD6V 3ETDA 3ZN0A 1A32A 1L0NH 1X4TA 1I08A 1E1RG 3FAVB 1EBOA 4X20B 2OWOA 4TOIA 4L87A 2GUZB 3MDSA 4MVRA 1JFFA 3A8TA 4G2KA 4LBEC 3E35A 4U3JB 2QWQB 2WSSG 1GMGA 1RSOA 3GWOA 3U10A 4IHJA 1G8MA 4QE7A 1FXHA 2QTOA 4KUMA 5LP6C 1RSOB 2X0LA 3FB7C 4IHJB 3SDLA 2W0XA 1AB3A 2GTAA 4BW5A 3ASOB 4HZ3A 2YIBD 3TETA 3MHSC 5KUMA 5EIBD 4DR4O 1WNSA 2QA4V 2OT5A 2HJDA 3SYAA 2ARHA 2Y69C 3KCYA 2LFSA 3B77A 2ZXWB 5L3FA 5EZYA 4CBCA 3ABMB 3ASNC 3QG5A 2ETNA 5EC2C 2AW9A 5EZYB 3RYCB 1FJGB 1S5JA 4B3MB 3UT5A 3FX7A 3LNNA 3HKCA 2BTOA 1B04A 2IJHA 5K1XA 1R3JC 2EIMC 3VOUA 4G27B 1NT2B 4H37A 3UT5B 5L3EA 2Q9LA 4NR1A 4R7CA 2JGDA 5CMUA 1RM1C 3B8NA 1NJIW 1GKFA 3GB7C 3SPGA 2DYRB 5B1BB 3A0RA 1VF7A 1KB9F 5JVDA 2RCVA 4NTWA 4CS3A 4MVSA 1K4CC 4H0LB 1K5SA 3QVNA 4PDLA 3ZMVA 1OHHG 4N23A 5JVDB 4O4HA 1J5EO 4DUZO 1PV0A 1YXBA 3OMNB 4DV1B 3QNEA 4QIWF 2E76B 4O4HB 4B3RO 3OMAB 5IYZA 4DR2B 1SC5B 2OCCC 4CS4A 4I0XB 2JK5C 3JYCA 2P22C 3ZHRA 1V54B 4X89A 4DV5B 4U3FH 2DWEC 4FK5C 3CRCA 2DOSA 1IXBA 1MZEA 4FVMA 2RNBA 5IY5B 1Z2GA 5IWAO 3IC9A 2IW5A 1VQ5V 4KHPB 1NTKH 1PL4A 2FYUH 2KG7A 4X1IA 2JEXA 2UXNA 4LFCO 5L3GA 4DRXA 3RT3C 2LGWA 1YITV 4DR3O 4EFBA 1SQFA 2YICA 4LNUB 2E5LO 1Q81W 1E79G 4DRXB 2M6YA 5TISZ 2PI5A 4I4TA 2R9IA 4MW8A 2X7RB 1XBLA 1S5LZ 3E8HA 4OPHA 4J10A 4GX0A 4EB6A 2YEVA 1NU1H 1KU9A 3QF7A 5HFLA 3RGBA 1W0JG 2EILB 1RFYA 4B3TO 1QLNA 1Y66A 4R8CA 4NVPA 4EB6B 2XUMA 2YEVB 5B66Z 1D2DA 2B1GA 4ZHQA 3BABA 1S3JA 1US6A 1VQ4V 3RYFB 1SQBH 3BA9A 5DECA 4JI2O 5LGUA 4ZHQB 2ITCC 4JI6O 1AP5A 3L74H 5CBGA 3FB5C 5KHHA 1YF2A 1EM1A 2CTQA 1AI4A 1CXZB 4UCSA 4X88A 3CCEV 4BR6A 3UQ8A 4DR6B 4LCUC 2L6LA 2YUAA 2Y4TA 5ITZA 2VQFO 1YI2V 3BAAA 5LP6A 3KCXA 4YIOA 1VP7A 5CA3A 4MTFA 5ITZB 3OTFA 4O2BA 1TUBB 2HVJC 2D3OW 3SYOA 5LP6B 4FPPA 4JI3B 1KBHA 2OYQA 2DW4A 2JDIG 1MA1A 5JH7A 3CS5A 1XEQA 2Y69B 4JASA 4X9QA 4BIUA 2HVKC 2HFEC 2Y4UA 5IYBO 1GN2A 1AJNA 3T2MA 5IE9A 5JH7B 3ASNB 2QR4A 3E83A 1PNMA 2B9ZA 4B3SB 3G80A 2P67A 1FXKC 4PA7A 3FYIB 1NS1A 3RFRA 4NXNO 3L72H 4JI0B 3U11A 5JJNB 2EIMB 1MABG 4TQFA 3CYOA 4R6ZA 4MTXA 4NYKA 5KMGA 2PZSA 3VQYA 4TUYA 4J7KA 1WP7A 1R6NA 1RM1B 4PA4A 2VS0A 4XBFA 2ZE5A 5KMGB 4UVBA 1M9NA 4TUYB 4F4LA 3U0ZA 5LOVA 2CGNA 2N05A 4WFEA 1F4MA 1FXVA 5CB4B 2DQ3A 4G28B 4PA9A 1S72V 2PUSA 1FJGO 3F5WC 3H1KH 3A0HZ 1VQKV 5E79Z 2OIEA 4PV1B 2ZCEA 1ZLZA 4PDVA 2FMLA 2XT9A 2QJ1A 2FKXA 1EFRG 5LA6B 3G4SV 1P49A 3ICXA 1YDXA 2H8PC 3LDDA 1PNLA 3K3WA 1G6UA 1OZ0A 3SJQC 2OCCB 2X6AA 2XASA 3RYHB 3OE7G 3EHBB 3S3WA 3W7XA 3CX5F 1TGOA 1G4YB 1KUQA 3H1LH 4AI8A 4MS2A 5IT9N 4K35A 3PN1A 1YJNV 1NH2B 1BL8A 1SS3A 3SPCA 4PDRA 4MVQA 4DV1O 3TGUH 3STZC 2Q5ZA 1NQTA 5GW7A 2F23A 2ADQB 3T4DA 4YHHB 1QVFU 2FTKA 2O57A 1I0HA 2CE4A 4DV5O 1M5IA 1ROPA 3LDEA 1VQ7V 3CJHA 4FM2A 1IURA 1R1BA 1VMGA 2LQTA 2P4VA 3RWRD 1IBMB 1GRJA 3N2GB 2XTAA 3BY6A 4KHPO 2BTQA 4JYCA 4J9ZB 1KP2A 2Q8VA 2A79B 1WPBA 1THZA 3APQA 3DTUB 3UO2A 4JI7B 3K79A 4HNAB 5D5QA 2FL4A 4LP8A 1WLEA 5KLVH 5IJ9B 2GV9A 5JCOC 1L0LH 1J5EB 1DF5A 1D5NA 3DGEA 3D8CA 1YEWA 5DEDA 3W7UA 2QWOB 3LSUA 5D5PA 4UCOA 1K92A 4N21A 4B3RB 4O4IB 1WP8A 4X64B 4LWSA 1E1QG 2ODMA 4ZKIA 1JA8A 2Z3YA 3CCUV 4Z1VA 1MSWD 4LWSB 1TUEB 4CZZA 4PJ0Z 2QWPB 4TV9B 5L3BA 3VQWA 1JMKC 1Q82W 5LHIA 3H1JH 1YSCA 2L35A 2YXLA 2YI9A 4GT1A 4PHZA 1NBMG 1AILA 3JD2A 2PI4A 1NVPD 4GLXA 1GM8A 1GN6A 4DR3B 2ZE7A 5GTIZ 1OCCC 4Q20A 4PI0A 2YXHA 4DR6O 1FXKA 3VQXA 2N04A 1DK1A 3ZBHA 1AJQA 1FXKB 1NTZH 3BFRA 1HNZO 4DXWA 4JI3O 4U7OA 4B3TB 4FMTA 1VF5B 3CCSV 1TAEA 1Q6IA 5B5EZ 2XAQA 3D3IA 2QTSA 3QTCA 1YJWV 2KSDA 1BQZA 2W0FC 4P9OA 5EC1C 1SQPH 2A9HA 4JI2B 3AK3A 3CPWU 3HPLC 4JTAB 1O9GA 4B3SO 1NZ6A 2HLDG 3CC7V 1D5AA 3ETEA 2K1EA 1TVKA 3CRQA 4JI0O 1DF4A 3T4ZA 3ZX6A 2IH3C 2VQFB 3K5NA 4LFBO 1TVKB 1M57C 2F93B 1VQ6V 3CWBH 2V1DA 4QJFB 4K0KB 4X20A 1R3IC 5KA6A 4NXMO 4PELA 2XHBA 1N0JA 2GUZA 3CCVV 1CEZA 3AG1C 2WLMA 2WLLB 3SPIA 4U3JA 1GAXA 3AG3C 3ZRVA 1BZKA 3RW0A 1Y74B 3WFVA 3RVZA 1N4CA 1YTFB 3OUSA 3K03A 2DMXA 3P3NA 1ENVA 3F7YC 5DM6V 3OEHG 3OM3B 4RQEA 4MT8A 2RN9A 2IJJA 3B09A 3G6BA 2XAJA 3A2FA 2ZM6B 3ZHTA 2EBOA 3JD4A 4TV8A 2DWDC 5C93A 1BT8A 2AZ0A 1K4DC 2ZT9B 1LR1A 1R3LC 3D36A 4NXNB 1SERA 4ZIBA 2EZPA 4TV8B 3ZN1A 3CMAV 3R66A 2QDOA 1XREA 1NTMH 2W6IG 5BY1A 2ATKC 3RYCA 2QM8A 4K8ZA 1AJPA 2PY5A 3L9DA 5EBMC 4ABMA 4MVMA 4UCUA 1QLEC 1XHZA 1OJHA 4YIPA 4ZBMA 4MVUA 1ZAUA 4LF7B 1VQNV 4YHHO 3JALA 1L8DA 4UB8Z 3CCRV 3TCUA 1PPJH 3O65A 4DUYB 1GK9A 3JALB 3WB1A 4X62O 1VF6C 1HWYA 1GN4A 3HB3B 5BMVA 3UM7A 1M4UA 1OCRC 4GYCB 1Y76A 2ZR2A 1IBMO 1SESA 5BMVB 1F7YA 1Y76B 4J80A 1M90W 4FLVA 2EJ7A 4JI7O 4I50B 3SPHA 1K3EA 5L3CA 5B3SC 3K08A 1ZTEA 3ZRWB 5KX5B 1KD1W 4JGSA 3BPZA 3ETQA 3H9VA 4JYYA 4DV0B 2ZKOA 2PYLA 1YHQV 4UCVA 4JPRA 3DSQA 3JATA 2Q0AA 2KB1A 4I0XA 1S0VA 3JCZA 4YY3O 3OUFA 3WB0A 3ZMTA 2C2AA 3ZEDA 4D7SA 1S77D 4X64O 3JATB 1IX9A 3P30A 2AGAA 1OCCB 4I9QA 2JEUA 4RQFA 3FYEB 3BA8A 2R9RB 4WF9V 2W6JG 1UFIA 1M93A 4DK1A 4X66B 3SYPA 1AI6A 4FFBB 1B06A 2HP8A 4DR7O 4KFMA 1QHTA 3MD0A 5EBLC 2XAHA 2P90A 4LNUA 2A06H 3OR6C 4QNHB 1XILA 4QPKA 1IVSA 4RO2A 5JJEB 4QE9A 3PJSK 4I5SA 5L3DA 3ZHVA 2ZDIA 1H8EG 4NB5A 2F43G 4X1YB 2WWWA 4WBNA 2UU9B 2ZQMA 2LJ2A 1MOFA 2F4VB 3BRCA 4UV9A 2Z0AA 4W4KA 1BS3A 4YJ3A 3L75H 4WBNB 5FL7G 4OPAA 4BWAA 3KKYA 2EIJC 3CCQV 3ZCCA 4YJ3B 4B08A 3RYFA 4ZI7B 4ASUG 1VQ9V 2YIAA 2WA3A 2GDSA 1M57B 4FLXA 4ICGA 1M1KW 4E4EA 3IFXA 2QKCA 1VQ8V 3CB2A 4IIJB 3OD4A 3UKMA 4JZ2A 4WFBV 1VEWA 2WLHA 3AG1B 3C90A 4KL1A 2VRZA 3LNMB 5LMUO 2YSUB 1BGYH 3IJ4A 3AG3B 1K8AW 4PI2A 1ORQC 1AI7A 3IC7A 2ILMA 1XNQO 1B3QA 2WAMA 5CA0A 1P4RA 2QWNB 4FIPC 1TUBA 1H38A 3Q4HA 4K0KO 5B1AC 4J42A 1HDJA 5CA0B 3K9AA 2Y48A 3AEIA 1CPYA 1YZBA 2VQEO 3Q4HB 1K7DA 1HNZB 2DQ0A 4GX1A 4UVCA 3JD1A 4LH6A 1ZSPA 1KECA 5LGTA 2FB5A 2M7WA 2JRIA 2PTMA 1PNKA 4AHCA 1M56C 1QLEB 4DV6B 4FLUA 2R9AA 2ZM6O 3W7SA 3JSNA 2RJZA 3JCUZ 4UUJC 2P5OA 3OFNG 2BE3A 3HKEB 4LR3A 1VF6A 3AG2B 4DR5B 4NTYA 1ZUQA 4LFBB 1XL6A 3K0DA 3L73H 5CBHA 1OCRB 3ZIAG 1P7BA 2ADPA 5CB4A 3BEHA 2ZINA 4NXMB 4FLWA 3MAQA 2A3QA 3I5DA 2YS8A 4JF3A 2UUBO 1VQMV 1EN4A 1Q86W 3VBBA 3ZMZA 4LF7O 4P30A 5B3SB 3AK1A 3K5MA 4OX9B 2P06A 1Z5VA 5LA6A 4WFAV 1G1XB 2LW7A 3HKDB 5KHGA 4EEQA 4DUYO 2JJ2G 3APOA 3K57A 3M99B 3F5TA 5CBFA 4BIZA 3CRRA 3JD0A 3L70H 3RYIB 4J9YB 1W59A 2PGGA 4R50A 3RYHA 1H2NA 4LF4O 1Y6XA 5H6RA 4O2AA 2QM7A 3R65A 2JVDA 5LGNA 4JI8B 1NKDA 4O2AB 4IL6Z 5KAFZ 4FM1A 4DV0O 1XI1A 2LW1A 1SQVH 3STLC 2BOCC 1IBKO 1YIJV 4IT5A 4DV4B 3OTOO 2EULA 1FFXA 5J9PC 1OV9A 3SYCA 3E8BA 4BW9A 1LNQA 4JTCB 3T1HB 2QSAA 3AK2A 3SPJA 4CH4A 1SZXA 1FFXB 3TK1A 3IAYA 4MTGA 5BXZA 1XMQB 5EYPA 3E8FA 3ZRSA 1KKDA 5B1OA 2Q67A 4D7TA 3CCJV 3N2GA 3O9OA 5EYPB 4X62B 4O4LB 1HNXO 4X66O 3CSXA 4GX2A 4HNAA 5IJ9A 2EIJB 2EX3A 5C8YA 2AHZA 1K34A 2CTRA 2IU0A 4X65O 3AG4C 3CHXA 2Q69A 4AQYO 1XOUA 5C8YB 2Y0IA 2XAFA 1H2GA 4JAUA 2YXYA 3TXSA 2UUCO 2UU9O 1V55C 3IGAC 4O4IA 2F4VO 2EJRA 4JYBA 1WB8A 2DN9A 1SA0A 2G38A 4YY3B 2GBOA 4MTOA 1Q5OA 4LFAO 1N34O 5LL6Y 4J7JA 1SA0B 1YTFD 4TV9A 1PL0A 1YCIA 2E3CA 4WFFA 4YJ2A 1Y67A 4H33A 4MSWC 2DYSC 1PKXA 3A0BZ 5LYJB 1R6KA 2YIDA 5B1AB 1K9MW 4YJ2B 1ZL8A 4LH7A 1VQOV 1WPXA 4XDLA 4H44B 1LUWA 4DR7B 1Q3EA 4F6EA 2Q0OC 1NI8A 5GTHZ 1ZL8B 3CC4V 2IJIA 1SQQH 4A5UB 3T1YO 3JAMN 2CH7B 1HP8A 1N33O 1PP9H 4AILC 4UFZA 2YC0A 3CC2V 4CC5A 2HHHO 1JJ2U 1FD9A 4HBNA 2BOBC 2HR3A 4GKKO 1M56B 1FS0G 3SGIA 1IBLO 3DC5A 4UV8A 2CUGA 4CH5A 1P84F 4P2ZA 2EIKC 2Q68A 4W4LA 3MHHC 1IZ3A 3JARB 1U96A 3CMEV 4F6RA 3QO5A 2X6CA 1BHAA 2DE0X 5IYCO 2YDEA 4JI1B 3THOA 4F6RB 3H1IH 4KP4A 5DN6G 3RVYA 1Z5WA 2E74B 1GH6A 4LF8O 4FLZA 3OR7C 4DV6O 1FAFA 2JIZG 2VWJA 3KZIZ 4JTDB 1SZTA 3FFQA 2ZIMA 5LMUB 3EFFK 4NTXA 3BCCH 1W0KG 5FPOA 2ZD9A 4QPJA 4DR5O 5H6QA 1XNQB 1K97A 3G6EV 5EIBC 1CP9A 3CE2A 3FD9A 3DC6A 1R6TA 2UXDB 2Q7GA 4LF6B 2WLLA 1FPOA 1WAZA 1H2KA 2BSKA 2VQEB 4GCZA 2JGUA 1Y74A 5IJ0A 1FYJA 4EFEA 1QVGU
chains in the Genus database with same CATH topology
5EK0A 3OMIB 2R9RB 4WF9V 2W6JG 3ABLC 2P67A 1FXKC 3B8MA 2Z5UA 4PA7A 2HG5C 3FYIB 3SYPA 3ZJZA 1AI6A 2NNUA 4KFMA 5CN0A 2EIMB 2QEXV 1MABG 2ITDC 3MD0A 3CYOA 2XAHA 5EBLC 5IYDO 2P90A 4R6ZA 2H94A 3OR6C 4MTXA 2HJFC 4QNHB 2WPDG 1BMFG 4QPKA 1JOYA 4RO2A 4QE9A 3PJSK 4I5SA 5L3DA 2ZDIA 1H8EG 1R6NA 3WG7C 1RM1B 4PA4A 2F43G 4XBFA 2DYRC 4HAMA 4UVBA 5B1BC 1M9NA 4F4LA 2WWWA 1R3KC 4WFEA 1R73A 4LC1A 4EKWA 5B1NA 2ZQMA 1NR7A 1GM9A 1F4MA 1MOFA 1FXVA 3ZMUA 4TWKA 2DQ3A 4G28B 4PA9A 1S72V 4UV9A 1I5XA 2AHYA 3F5WC 1BHBA 5FL7G 1VQKV 1AI5A 3KG2A 4MW3A 2EIJC 4PDVA 3CCQV 3ZCCA 5E1AC 1ZWIC 1NVPB 2A0LA 1EFRG 4ASUG 3FB6C 1VQ9V 3AG4B 2IU3A 5LHGA 2UXXA 1M57B 3G4SV 3OAAG 1MG1A 2H8PC 1QCEA 3LDDA 3ABKB 1M1KW 1PNLA 3K3WA 1K73W 3AG2C 3E86A 3IFXA 1OZ0A 2QE7G 2OCCB 3SJQC 1VQ8V 1JPXA 3UKMA 1V54C 4WFBV 2NLJC 3FB8C 2X6AA 1V55B 3RBZA 2XASA 2WLHA 3AG1B 1K5QA 3OE7G 3LNMB 2IJKA 3EHBB 3W7XA 1FFTB 2YSUB 2B5UA 1G4YB 3AG3B 1RPOA 1KC8W 2WLKA 4XDJA 1B6QA 5IY5C 1K8AW 4MS2A 1ORQC 3ZRWA 1AI7A 3IC7A 5KUKA 1YJNV 1NH2B 1BL8A 3K04A 3SPCA 4PDRA 2WAMA 4MVQA 2LP7A 1P4RA 4FIPC 1H8HG 2ZR3A 3ABTA 4YXWG 4RUEA 1SRYA 3I55V 1OCZC 1H38A 1QBZA 3E2EA 2DYSB 3STZC 3NXSA 5B1AC 1F23A 1NQTA 1Y4MA 3K9AA 2Y48A 5GW7A 3T4DA 3AEIA 3LSSA 2B1IA 1QVFU 1GO3F 1CPYA 2FTKA 4WFHA 1DLBA 2WLJA 1K7DA 2DQ0A 2ZDIC 4GX1A 4UVCA 3JD1A 1ROPA 2GHYA 1UJWB 3LDEA 1KECA 1VQ7V 3K06A 3JD3A 5LGTA 1NR1A 2M7WA 4Z1MG 1AR1B 1DTOA 1PNKA 1PD3A 5IDJA 3QO8A 3BY6A 1OCOB 4JYCA 4J9ZB 1KP2A 2EILC 4U7NA 1M56C 2A79B 4UVAA 2WLNA 1N8RW 1THZA 3DTUB 1QLEB 1QR8A 2EINB 3K79A 3W7SA 2V7QG 3LSQA 4LP8A 5EBWC 3K0GA 1WLEA 4UUJC 3OEEG 1JVMA 3ABUA 2XAGA 3OFNG 3W7TA 3CD6V 3ETDA 3ZN0A 3AG2B 1DF5A 4MVZA 3DGEA 1E1RG 2EIKB 1EBOA 2EZOA 3W7UA 4L87A 1XL6A 3LUTB 3K0DA 1IXMA 5CBHA 1K92A 4N21A 4MVRA 1OCRB 3ZIAG 1P7BA 3BEHA 4G2KA 1VQPV 4LBEC 1YJ9V 3P32A 1E1QG 3E35A 4ZKIA 4JF3A 2Z3YA 3CCUV 1I5YA 1VQMV 1MSWD 1Q86W 2WSSG 1GMGA 3GWOA 3VBBA 1QR9A 3ZMZA 4P30A 5B3SB 1TUEB 1G8MA 4CZZA 4QE7A 4JAVA 5L3BA 5LBQA 1FXHA 5LHHA 1Q82W 2QTOA 4WFAV 5LHIA 3X2QC 4KUMA 2X0LA 3FB7C 1YSCA 2JJ2G 1K33A 3M99B 4GT1A 1XL4A 2JJ1G 4BW5A 5BZBA 1NBMG 3ASOB 3JD2A 2PI4A 4HZ3A 3TETA 5CBFA 3H01A 1NVPD 3MHSC 4BIZA 3JD0A 5KUMA 4J9YB 1GM8A 4R50A 2OT5A 2QA4V 3SYAA 2Y69C 4X8AA 2XOKG 1OCCC 2LFSA 4Q20A 3B77A 4XDKA 5H6RA 2ZXWB 5L3FA 2QM7A 3R65A 4CBCA 5LGNA 3ABMB 3ASNC 1FXKA 4TT3G 1KQSU 5EC2C 3W7WA 1NKDA 5HFMA 3ABLB 5H9CA 2IJHA 3STLC 1J95A 1AJQA 1FXKB 2BOCC 1YIJV 4I9WA 1R3JC 3ML0A 4UXNA 2EIMC 3VOUA 4DXWA 1S5HC 4G27B 5J9PC 1NH2D 3SYCA 3ZRXA 3E8BA 4H37A 1LNQA 5L3EA 4JTCB 4U7OA 4FMTA 4R7CA 3CCLV 3CCSV 3SPJA 5CMUA 1RM1C 3TK1A 3B8NA 4MTGA 2XAQA 3D3IA 1NJIW 3QO7A 1GKFA 3GB7C 3WG7B 3SPGA 1YJWV 1JCHA 3E8FA 3ZRSA 2W0FC 4P9OA 1KKDA 2DYRB 5EC1C 5B1OA 5B1BB 2A9HA 2Q67A 3CPWU 3CCJV 3HPLC 3A0RA 3ETGA 4JTAB 3CP1A 3OW2U 4PA6A 1EZJA 4MVSA 1K4CC 2HLDG 3CC7V 4DO2A 1K5SA 3ETEA 4PDLA 3ZMVA 4GX2A 2K1EA 1OHHG 4N23A 1VQLV 1DF4A 3E8GA 2EIJB 3OMNB 2AHZA 3T4ZA 1K34A 3I56V 1GM7A 2IU0A 2IH1C 2IH3C 3AG4C 1M57C 2Q69A 4BAYA 1VQ6V 3QNEA 4QIWF 2V1DA 4QJFB 3ABKC 5KA5A 3OMAB 3G71V 4P9PA 2XAFA 1COWG 1KP3A 1R3IC 1H2GA 2OCCC 5KA6A 4GX5A 4JAUA 4PELA 2JK5C 3JYCA 3CCVV 1CEZA 4MVOA 1V55C 3AG1C 1SETA 2P6JA 3IGAC 1V54B 2EJRA 2WLMA 2LFRA 4JYBA 4X89A 2WLLB 2DWEC 3SPIA 4FK5C 3AG3C 3ZRVA 3RW0A 4MTOA 4HYOA 3WFVA 3RVZA 5IY5B 1YTFB 3OGCC 3OUSA 2IW5A 1VQ5V 3K03A 1W2BU 1YTFD 2OTLV 1ENVA 3F7YC 1PL0A 5DM6V 3OEHG 3OM3B 2JEXA 4RQEA 4WFFA 2UXNA 4H33A 3E89A 4MSWC 4MT8A 2DYSC 5L3GA 1PKXA 2IJJA 2XAJA 1R6KA 1OCZB 4TSFG 1YITV 2Q6AA 2EBOA 2WLIA 3F7VC 5B1AB 3JD4A 1K9MW 2DWDC 5C93A 1Q81W 1VQOV 1WPXA 1K4DC 2MK3A 1R3LC 1E79G 1F51A 3D36A 4XDLA 2PI5A 4OXSA 1SERA 1Q7YW 2R9IA 3T1CA 2EZPA 2WLIB 4MW8A 2X7RB 3ZN1A 3CMAV 3SYQA 3CC4V 2IJIA 3E8HA 4WCEV 2W6IG 1OCOC 4GX0A 3CC2V 2YEVA 1JJ2U 2ATKC 2QM8A 1AJPA 3FKSG 5EBMC 4MVMA 2BOBC 5HFLA 4E2LA 1JX9A 1QLEC 1W0JG 2EILB 2HR3A 2EINC 1M56B 1QLNA 4RUFA 1FS0G 1Y66A 4R8CA 2YEVB 4ZBMA 4MVUA 2OTJV 2B1GA 3CXCU 2XNDG 1VQNV 1S3JA 1L1FA 1VQ4V 3LDCA 4UV8A 4WFGA 3CCRV 3TCUA 4P2ZA 1AROP 2EIKC 5LGUA 2Q68A 2ITCC 1GK9A 3MHHC 3CMEV 1GTOA 3QO5A 2X6CA 1BHAA 1S76D 1HWYA 5IYCO 3HB3B 3UM7A 1OCRC 5CBGA 2ZR2A 3FB5C 4KP4A 1AI4A 5DN6G 1SESA 2QKSA 4X88A 3CCEV 3RVYA 1M90W 4LCUC 3OR7C 2JIZG 3SPHA 4PDMA 1YI2V 1F4NA 1K3EA 5L3CA 5B3SC 4PA3A 3CCMV 3K08A 4JTDB 3ZRWB 1SZTA 2P7TC 3EFFK 1KD1W 5CA3A 4JGSA 4MTFA 1W0KG 2ZD9A 4QPJA 1YHQV 2HVJC 5H6QA 3X2QB 4JPRA 2D3OW 3SYOA 1JQ0A 1K97A 4FPPA 3ASOC 3G6EV 4FJCC 1CP9A 2KB1A 1S0VA 3JCZA 3OUFA 3ZMTA 2DW4A 2C2AA 2CK3G 2JDIG 3ZMSA 1S77D 2WLLA 2ZXWC 2Y69B 4JASA 3P30A 1OCCB 1RPRA 4GCZA 4RAIA 2HKOA 3ABMC 4BIUA 2X6BA 2HVKC 2JEUA 2HFEC 5IYBO 1AJNA 3T2MA 2GSMB 3ASNB 4RQFA 3FYEB 3E83A 1PNMA 1QVGU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K33 A;  5HFM A;  3M99 B;  4G2K A;  4FJC C;  3WFV A;  2EZP A;  3B8M A;  3H01 A;  2X7R B;  3MHS C;  2MK3 A;  5H9C A;  4JF3 A;  1MOF A;  5KA5 A;  1MG1 A;  1QCE A;  1ENV A;  1I5X A;  1I5Y A;  2LP7 A;  2OT5 A;  2M7W A;  3CP1 A;  4FIP C;  5CN0 A;  5KA6 A;  1DF5 A;  3GWO A;  3CYO A;  1QR9 A;  1SZT A;  1JPX A;  3B77 A;  3P30 A;  3MHH C;  1QBZ A;  1EBO A;  2P6J A;  2EZO A;  1F23 A;  4JGS A;  1Y66 A;  2EBO A;  4N23 A;  1Y4M A;  5CMU A;  3K9A A;  5HFL A;  1DF4 A;  3B8N A;  4E2L A;  4FK5 C;  4N21 A;  4JPR A;  1DLB A;  1QR8 A;  1JQ0 A;  1K34 A; 
#chains in the Genus database with same CATH topology
 5EK0 A;  2BSK B;  3SR2 C;  3ABL C;  5KHJ A;  5IJ0 B;  2HG5 C;  1N32 O;  2BCC H;  2HEP A;  3AG7 A;  4LF9 B;  5CA1 A;  2H94 A;  2HJF C;  2WPD G;  2UXB B;  3TJT A;  3WG7 C;  3N27 A;  5LMN O;  5CA1 B;  1EZV H;  2PF4 E;  4HAM A;  1X59 A;  1R3K C;  5B1N A;  1NR7 A;  1GM9 A;  4JI8 O;  4TWK A;  1JFF B;  3G67 A;  1SQG A;  2AHY A;  3SJA C;  4O4J A;  1BHB A;  3KG2 A;  4DV4 O;  2Q7E A;  1XQ8 A;  4O4J B;  1MSD A;  3T1H O;  1XNR O;  2UUB B;  1NVP B;  1ZWI C;  2A0L A;  3SJB C;  5JCO A;  1PM9 A;  2ZIO A;  4JI4 O;  3AG4 B;  2IU3 A;  5LHG A;  2UXX A;  1XMQ O;  3OAA G;  1MG1 A;  1XMO B;  1K73 W;  3AG2 C;  5GON A;  3D3Q A;  1JPX A;  2NLJ C;  2A7W A;  1V55 B;  3RBZ A;  5J2U A;  1K5Q A;  2AXT Z;  3GWK C;  2IJK A;  5GON B;  1FFT B;  1RPO A;  4I50 A;  2WLK A;  4XDJ A;  1B6Q A;  1KC8 W;  5J2U B;  2ZE6 A;  3ZRW A;  4LF4 B;  2OIG A;  5KUK A;  4GKJ B;  5KX5 A;  2LO1 A;  2V4D A;  1U97 A;  4DV2 B;  3ABT A;  4CH3 A;  3HKC B;  4RUE A;  1SRY A;  1OCZ C;  2ZNI A;  3E2E A;  2DYS B;  3NXS A;  1N36 O;  1F23 A;  1Y4M A;  3JAS A;  3EVK A;  3LSS A;  2B1I A;  3JAW A;  1IBK B;  1GO3 F;  1DLB A;  3HKB A;  3OTO B;  3BHP A;  4LF5 B;  4JZG A;  2JGD B;  3ZS8 C;  1IDS A;  1WN7 A;  3K59 A;  3JAS B;  2UXC O;  2GHY A;  3JAW B;  3HKB B;  2CTP A;  3JD3 A;  1NR1 A;  1DTO A;  3OGI B;  1KMI Z;  5IDJ A;  3QO8 A;  1Q90 D;  2KKW A;  3CRM A;  5KAI Z;  5BR8 B;  2LGQ A;  4UVA A;  2WLN A;  1N8R W;  1KKC A;  2GTS A;  1MMM A;  1QR8 A;  4FFB A;  5EBW C;  3K0G A;  1HNX B;  3OEE G;  4IYI A;  2XAG A;  1VIB A;  3W7T A;  2RDC A;  4OGQ B;  3C3T A;  4MVZ A;  1Q8I A;  5J2T A;  1AVM A;  2EIK B;  2EZO A;  5IYZ B;  1MZF A;  4X65 B;  4DV3 B;  4X1Y A;  2UUA B;  4AQY B;  3LUT B;  1IXM A;  4IYH A;  5J2T B;  1VQP V;  1YJ9 V;  3P32 A;  1QNM A;  2UUC B;  3JSL A;  4J41 A;  2CDY A;  3L71 H;  3B2E E;  1I5Y A;  3J80 N;  4FFK A;  4UB6 Z;  1QR9 A;  4JAA A;  2YIB A;  4JAV A;  4ZI7 A;  1HNW B;  4JV5 O;  5LBQ A;  2KG7 B;  4X1I B;  5LHH A;  4LFA B;  3X2Q C;  1N34 B;  1K33 A;  1XL4 A;  2JJ1 G;  5BZB A;  1P7G A;  3H01 A;  4PD4 F;  4IIJ A;  3VQV A;  3UO3 A;  4I4T B;  1XUQ A;  4JI1 O;  4K8X A;  4X8A A;  2XOK G;  4DW0 A;  3J81 N;  4XDK A;  1XDC A;  1FKA O;  2QKA A;  4CH6 A;  4TT3 G;  2K9P A;  1KQS U;  2P4K A;  1ZX3 A;  4Z2W A;  4D6T H;  3W7W A;  5HFM A;  4BIO A;  3T1Y B;  4I7Z B;  4DW1 A;  2F66 C;  3ABL B;  4KXR A;  1N33 B;  5H9C A;  1J95 A;  4I9W A;  2HHH B;  3ML0 A;  4UXN A;  1S5H C;  4FM0 A;  1NH2 D;  3ZRX A;  4GKK B;  1HR0 B;  4JI5 B;  2UXD O;  3CCL V;  1WJZ A;  2E75 B;  5JQG A;  4LF6 O;  3QO7 A;  2JS5 A;  1IBL B;  3WG7 B;  1JCH A;  4JYA O;  1I94 O;  5JQG B;  4FZ0 A;  2AZ2 A;  3M7M X;  3ETG A;  3HR0 A;  3CP1 A;  3OW2 U;  4PA6 A;  1EZJ A;  2NN4 A;  4DO2 A;  4CS2 A;  1VQL V;  3CEI A;  3E8G A;  3B40 A;  4LF9 O;  2D2C B;  1O9H A;  4FLY A;  3I56 V;  4LF8 B;  1GM7 A;  3HKE A;  3RN4 A;  4QGP A;  2IH1 C;  1QU7 A;  4O2B B;  2CAZ C;  4BAY A;  2UXB O;  3ABK C;  5KA5 A;  3SJC C;  3G71 V;  5F2V O;  4P9P A;  1COW G;  1KP3 A;  3EXA A;  1HW7 A;  1BE3 H;  4GX5 A;  4DV7 B;  4MVO A;  1SET A;  2P6J A;  1Q43 A;  2LFR A;  2QM4 A;  2Q4P A;  5AG2 A;  4Q6G A;  2MW2 B;  1VAR A;  5H5N A;  4HYO A;  3K9S A;  3DXR A;  3OGC C;  3JAK A;  1N0N A;  1W2B U;  4CC6 A;  2OTL V;  4RWU A;  3ZHU A;  3E89 A;  1Q6U A;  4NKG B;  3HKD A;  1DGS A;  3DXR B;  3JAK B;  1OCZ B;  4TSF G;  2Q6A A;  1XMO O;  2WLI A;  3F7V C;  4DR1 B;  1N32 B;  2MK3 A;  3RYI A;  1F51 A;  4C7U A;  4OXS A;  1Q7Y W;  3T1C A;  5H2F Z;  3H1H H;  1JJO A;  2WLI B;  1EN6 A;  2RQ6 A;  3SYQ A;  5JJJ B;  4B3M O;  2NR5 A;  4WCE V;  5LOV B;  4B7E A;  2YI8 A;  5LMN B;  1OCO C;  4GKJ O;  3FKS G;  4DV2 O;  2QGN A;  4E2L A;  1JX9 A;  2EIN C;  4RUF A;  1H2M A;  2OTJ V;  5KHK A;  3CXC U;  2XND G;  1L1F A;  5KHI A;  3LDC A;  5FNV A;  5K1P A;  4UCT A;  4LF5 O;  4WFG A;  1UPG A;  1ARO P;  1XNR B;  1GTO A;  5FNV B;  1S76 D;  5FPR A;  4JI4 B;  2WA4 A;  4DR4 B;  2CGO A;  4J7Z A;  4O4L A;  3OT7 A;  1JR9 A;  2QKS A;  5BR8 O;  4DYL A;  3C3S A;  4GZR B;  4PDM A;  1F4N A;  1WA8 A;  3CCM V;  4PA3 A;  2P7T C;  1EN5 A;  2VWK A;  4DR2 O;  1V9P A;  1WA8 B;  3X2Q B;  2H3O A;  1JQ0 A;  1GN3 A;  3ASO C;  4FJC C;  4DV3 O;  1H2S B;  2UUA O;  3D36 C;  2PYJ A;  4B7K A;  2CK3 G;  2IM9 A;  1N36 B;  3ZMS A;  3N2K A;  3WU2 Z;  2ZXW C;  4RAI A;  1RPR A;  2Q7H A;  2HKO A;  3ABM C;  4FZ1 A;  1RP3 B;  2DJV A;  2X6B A;  3CJH B;  2GSM B;  3CRA A;  2UXC B;  1T5E A;  3N2K B;  4IGG A;  2IBZ H;  3OMI B;  4DK0 A;  4H13 B;  2BTQ B;  1HNW O;  3B8M A;  1YVW A;  2Z5U A;  4L8J A;  5LYJ A;  3ZJZ A;  1SKV A;  4TQD A;  2NNU A;  5CN0 A;  4DUZ B;  2QEX V;  2ITD C;  5IYD O;  2R70 A;  1BMF G;  2ZNJ A;  1JOY A;  1AR5 A;  2OCH A;  1MNG A;  3CXH F;  3ZHQ A;  2DYR C;  5B1B C;  2CH7 A;  4I55 A;  1BSM A;  3K58 A;  2R72 A;  1R73 A;  4LC1 A;  3ZHS A;  4EKW A;  1AP6 A;  3ZMU A;  4FLT A;  3E22 A;  1AR4 A;  1TA8 A;  1I5X A;  3J7A U;  5FLX N;  2F95 B;  4I55 B;  1AI5 A;  4MW3 A;  3E22 B;  5IWA B;  4ZOL A;  3S3X A;  4OX9 O;  1HR0 O;  4JI5 O;  5E1A C;  3FB6 C;  1H2L A;  4LFC B;  5A9G A;  2CTW A;  3JAR A;  4ZOL B;  1QCE A;  3ABK B;  4JV5 B;  1KYO F;  3E86 A;  2QE7 G;  2E5L B;  1XHX A;  1V54 C;  3FB8 C;  3M8A A;  2B5U A;  5A2Q N;  4J11 A;  5IY5 C;  2F1M A;  3K04 A;  4X1K A;  2LP7 A;  1H8H G;  2ZR3 A;  4YXW G;  4GUN A;  3I55 V;  1QBZ A;  2JS3 A;  2RMK B;  4X1K B;  3K5L A;  2N74 A;  1Q6H A;  2Q73 A;  4K3A A;  4UCR A;  4WFH A;  4DV7 O;  5LXT A;  2WLJ A;  2ZDI C;  1WB7 A;  3BVO A;  1SF9 A;  1UJW B;  2Y0P A;  4JI6 B;  3K06 A;  5LXT B;  1SQX H;  4Z1M G;  1AR1 B;  1LUV A;  3WB2 A;  1PD3 A;  2KQX A;  1BQ0 A;  1OCO B;  4JYA B;  2EIL C;  2ZE8 A;  4U7N A;  2QWR B;  1I7F A;  1I94 B;  1QQC A;  3B4S A;  3GVM A;  2EIN B;  5JWP A;  3UCS C;  3TXQ A;  2V7Q G;  3LSQ A;  1URF A;  1BCC H;  3FAV A;  3K5O A;  1JVM A;  3ABU A;  3P3P A;  4DR1 O;  3NR7 A;  3CD6 V;  3ETD A;  3ZN0 A;  1A32 A;  1L0N H;  1X4T A;  1I08 A;  1E1R G;  3FAV B;  1EBO A;  4X20 B;  2OWO A;  4TOI A;  4L87 A;  2GUZ B;  3MDS A;  4MVR A;  1JFF A;  3A8T A;  4G2K A;  4LBE C;  3E35 A;  4U3J B;  2QWQ B;  2WSS G;  1GMG A;  1RSO A;  3GWO A;  3U10 A;  4IHJ A;  1G8M A;  4QE7 A;  1FXH A;  2QTO A;  4KUM A;  5LP6 C;  1RSO B;  2X0L A;  3FB7 C;  4IHJ B;  3SDL A;  2W0X A;  1AB3 A;  2GTA A;  4BW5 A;  3ASO B;  4HZ3 A;  2YIB D;  3TET A;  3MHS C;  5KUM A;  5EIB D;  4DR4 O;  1WNS A;  2QA4 V;  2OT5 A;  2HJD A;  3SYA A;  2ARH A;  2Y69 C;  3KCY A;  2LFS A;  3B77 A;  2ZXW B;  5L3F A;  5EZY A;  4CBC A;  3ABM B;  3ASN C;  3QG5 A;  2ETN A;  5EC2 C;  2AW9 A;  5EZY B;  3RYC B;  1FJG B;  1S5J A;  4B3M B;  3UT5 A;  3FX7 A;  3LNN A;  3HKC A;  2BTO A;  1B04 A;  2IJH A;  5K1X A;  1R3J C;  2EIM C;  3VOU A;  4G27 B;  1NT2 B;  4H37 A;  3UT5 B;  5L3E A;  2Q9L A;  4NR1 A;  4R7C A;  2JGD A;  5CMU A;  1RM1 C;  3B8N A;  1NJI W;  1GKF A;  3GB7 C;  3SPG A;  2DYR B;  5B1B B;  3A0R A;  1VF7 A;  1KB9 F;  5JVD A;  2RCV A;  4NTW A;  4CS3 A;  4MVS A;  1K4C C;  4H0L B;  1K5S A;  3QVN A;  4PDL A;  3ZMV A;  1OHH G;  4N23 A;  5JVD B;  4O4H A;  1J5E O;  4DUZ O;  1PV0 A;  1YXB A;  3OMN B;  4DV1 B;  3QNE A;  4QIW F;  2E76 B;  4O4H B;  4B3R O;  3OMA B;  5IYZ A;  4DR2 B;  1SC5 B;  2OCC C;  4CS4 A;  4I0X B;  2JK5 C;  3JYC A;  2P22 C;  3ZHR A;  1V54 B;  4X89 A;  4DV5 B;  4U3F H;  2DWE C;  4FK5 C;  3CRC A;  2DOS A;  1IXB A;  1MZE A;  4FVM A;  2RNB A;  5IY5 B;  1Z2G A;  5IWA O;  3IC9 A;  2IW5 A;  1VQ5 V;  4KHP B;  1NTK H;  1PL4 A;  2FYU H;  2KG7 A;  4X1I A;  2JEX A;  2UXN A;  4LFC O;  5L3G A;  4DRX A;  3RT3 C;  2LGW A;  1YIT V;  4DR3 O;  4EFB A;  1SQF A;  2YIC A;  4LNU B;  2E5L O;  1Q81 W;  1E79 G;  4DRX B;  2M6Y A;  5TIS Z;  2PI5 A;  4I4T A;  2R9I A;  4MW8 A;  2X7R B;  1XBL A;  1S5L Z;  3E8H A;  4OPH A;  4J10 A;  4GX0 A;  4EB6 A;  2YEV A;  1NU1 H;  1KU9 A;  3QF7 A;  5HFL A;  3RGB A;  1W0J G;  2EIL B;  1RFY A;  4B3T O;  1QLN A;  1Y66 A;  4R8C A;  4NVP A;  4EB6 B;  2XUM A;  2YEV B;  5B66 Z;  1D2D A;  2B1G A;  4ZHQ A;  3BAB A;  1S3J A;  1US6 A;  1VQ4 V;  3RYF B;  1SQB H;  3BA9 A;  5DEC A;  4JI2 O;  5LGU A;  4ZHQ B;  2ITC C;  4JI6 O;  1AP5 A;  3L74 H;  5CBG A;  3FB5 C;  5KHH A;  1YF2 A;  1EM1 A;  2CTQ A;  1AI4 A;  1CXZ B;  4UCS A;  4X88 A;  3CCE V;  4BR6 A;  3UQ8 A;  4DR6 B;  4LCU C;  2L6L A;  2YUA A;  2Y4T A;  5ITZ A;  2VQF O;  1YI2 V;  3BAA A;  5LP6 A;  3KCX A;  4YIO A;  1VP7 A;  5CA3 A;  4MTF A;  5ITZ B;  3OTF A;  4O2B A;  1TUB B;  2HVJ C;  2D3O W;  3SYO A;  5LP6 B;  4FPP A;  4JI3 B;  1KBH A;  2OYQ A;  2DW4 A;  2JDI G;  1MA1 A;  5JH7 A;  3CS5 A;  1XEQ A;  2Y69 B;  4JAS A;  4X9Q A;  4BIU A;  2HVK C;  2HFE C;  2Y4U A;  5IYB O;  1GN2 A;  1AJN A;  3T2M A;  5IE9 A;  5JH7 B;  3ASN B;  2QR4 A;  3E83 A;  1PNM A;  2B9Z A;  4B3S B;  3G80 A;  2P67 A;  1FXK C;  4PA7 A;  3FYI B;  1NS1 A;  3RFR A;  4NXN O;  3L72 H;  4JI0 B;  3U11 A;  5JJN B;  2EIM B;  1MAB G;  4TQF A;  3CYO A;  4R6Z A;  4MTX A;  4NYK A;  5KMG A;  2PZS A;  3VQY A;  4TUY A;  4J7K A;  1WP7 A;  1R6N A;  1RM1 B;  4PA4 A;  2VS0 A;  4XBF A;  2ZE5 A;  5KMG B;  4UVB A;  1M9N A;  4TUY B;  4F4L A;  3U0Z A;  5LOV A;  2CGN A;  2N05 A;  4WFE A;  1F4M A;  1FXV A;  5CB4 B;  2DQ3 A;  4G28 B;  4PA9 A;  1S72 V;  2PUS A;  1FJG O;  3F5W C;  3H1K H;  3A0H Z;  1VQK V;  5E79 Z;  2OIE A;  4PV1 B;  2ZCE A;  1ZLZ A;  4PDV A;  2FML A;  2XT9 A;  2QJ1 A;  2FKX A;  1EFR G;  5LA6 B;  3G4S V;  1P49 A;  3ICX A;  1YDX A;  2H8P C;  3LDD A;  1PNL A;  3K3W A;  1G6U A;  1OZ0 A;  3SJQ C;  2OCC B;  2X6A A;  2XAS A;  3RYH B;  3OE7 G;  3EHB B;  3S3W A;  3W7X A;  3CX5 F;  1TGO A;  1G4Y B;  1KUQ A;  3H1L H;  4AI8 A;  4MS2 A;  5IT9 N;  4K35 A;  3PN1 A;  1YJN V;  1NH2 B;  1BL8 A;  1SS3 A;  3SPC A;  4PDR A;  4MVQ A;  4DV1 O;  3TGU H;  3STZ C;  2Q5Z A;  1NQT A;  5GW7 A;  2F23 A;  2ADQ B;  3T4D A;  4YHH B;  1QVF U;  2FTK A;  2O57 A;  1I0H A;  2CE4 A;  4DV5 O;  1M5I A;  1ROP A;  3LDE A;  1VQ7 V;  3CJH A;  4FM2 A;  1IUR A;  1R1B A;  1VMG A;  2LQT A;  2P4V A;  3RWR D;  1IBM B;  1GRJ A;  3N2G B;  2XTA A;  3BY6 A;  4KHP O;  2BTQ A;  4JYC A;  4J9Z B;  1KP2 A;  2Q8V A;  2A79 B;  1WPB A;  1THZ A;  3APQ A;  3DTU B;  3UO2 A;  4JI7 B;  3K79 A;  4HNA B;  5D5Q A;  2FL4 A;  4LP8 A;  1WLE A;  5KLV H;  5IJ9 B;  2GV9 A;  5JCO C;  1L0L H;  1J5E B;  1DF5 A;  1D5N A;  3DGE A;  3D8C A;  1YEW A;  5DED A;  3W7U A;  2QWO B;  3LSU A;  5D5P A;  4UCO A;  1K92 A;  4N21 A;  4B3R B;  4O4I B;  1WP8 A;  4X64 B;  4LWS A;  1E1Q G;  2ODM A;  4ZKI A;  1JA8 A;  2Z3Y A;  3CCU V;  4Z1V A;  1MSW D;  4LWS B;  1TUE B;  4CZZ A;  4PJ0 Z;  2QWP B;  4TV9 B;  5L3B A;  3VQW A;  1JMK C;  1Q82 W;  5LHI A;  3H1J H;  1YSC A;  2L35 A;  2YXL A;  2YI9 A;  4GT1 A;  4PHZ A;  1NBM G;  1AIL A;  3JD2 A;  2PI4 A;  1NVP D;  4GLX A;  1GM8 A;  1GN6 A;  4DR3 B;  2ZE7 A;  5GTI Z;  1OCC C;  4Q20 A;  4PI0 A;  2YXH A;  4DR6 O;  1FXK A;  3VQX A;  2N04 A;  1DK1 A;  3ZBH A;  1AJQ A;  1FXK B;  1NTZ H;  3BFR A;  1HNZ O;  4DXW A;  4JI3 O;  4U7O A;  4B3T B;  4FMT A;  1VF5 B;  3CCS V;  1TAE A;  1Q6I A;  5B5E Z;  2XAQ A;  3D3I A;  2QTS A;  3QTC A;  1YJW V;  2KSD A;  1BQZ A;  2W0F C;  4P9O A;  5EC1 C;  1SQP H;  2A9H A;  4JI2 B;  3AK3 A;  3CPW U;  3HPL C;  4JTA B;  1O9G A;  4B3S O;  1NZ6 A;  2HLD G;  3CC7 V;  1D5A A;  3ETE A;  2K1E A;  1TVK A;  3CRQ A;  4JI0 O;  1DF4 A;  3T4Z A;  3ZX6 A;  2IH3 C;  2VQF B;  3K5N A;  4LFB O;  1TVK B;  1M57 C;  2F93 B;  1VQ6 V;  3CWB H;  2V1D A;  4QJF B;  4K0K B;  4X20 A;  1R3I C;  5KA6 A;  4NXM O;  4PEL A;  2XHB A;  1N0J A;  2GUZ A;  3CCV V;  1CEZ A;  3AG1 C;  2WLM A;  2WLL B;  3SPI A;  4U3J A;  1GAX A;  3AG3 C;  3ZRV A;  1BZK A;  3RW0 A;  1Y74 B;  3WFV A;  3RVZ A;  1N4C A;  1YTF B;  3OUS A;  3K03 A;  2DMX A;  3P3N A;  1ENV A;  3F7Y C;  5DM6 V;  3OEH G;  3OM3 B;  4RQE A;  4MT8 A;  2RN9 A;  2IJJ A;  3B09 A;  3G6B A;  2XAJ A;  3A2F A;  2ZM6 B;  3ZHT A;  2EBO A;  3JD4 A;  4TV8 A;  2DWD C;  5C93 A;  1BT8 A;  2AZ0 A;  1K4D C;  2ZT9 B;  1LR1 A;  1R3L C;  3D36 A;  4NXN B;  1SER A;  4ZIB A;  2EZP A;  4TV8 B;  3ZN1 A;  3CMA V;  3R66 A;  2QDO A;  1XRE A;  1NTM H;  2W6I G;  5BY1 A;  2ATK C;  3RYC A;  2QM8 A;  4K8Z A;  1AJP A;  2PY5 A;  3L9D A;  5EBM C;  4ABM A;  4MVM A;  4UCU A;  1QLE C;  1XHZ A;  1OJH A;  4YIP A;  4ZBM A;  4MVU A;  1ZAU A;  4LF7 B;  1VQN V;  4YHH O;  3JAL A;  1L8D A;  4UB8 Z;  3CCR V;  3TCU A;  1PPJ H;  3O65 A;  4DUY B;  1GK9 A;  3JAL B;  3WB1 A;  4X62 O;  1VF6 C;  1HWY A;  1GN4 A;  3HB3 B;  5BMV A;  3UM7 A;  1M4U A;  1OCR C;  4GYC B;  1Y76 A;  2ZR2 A;  1IBM O;  1SES A;  5BMV B;  1F7Y A;  1Y76 B;  4J80 A;  1M90 W;  4FLV A;  2EJ7 A;  4JI7 O;  4I50 B;  3SPH A;  1K3E A;  5L3C A;  5B3S C;  3K08 A;  1ZTE A;  3ZRW B;  5KX5 B;  1KD1 W;  4JGS A;  3BPZ A;  3ETQ A;  3H9V A;  4JYY A;  4DV0 B;  2ZKO A;  2PYL A;  1YHQ V;  4UCV A;  4JPR A;  3DSQ A;  3JAT A;  2Q0A A;  2KB1 A;  4I0X A;  1S0V A;  3JCZ A;  4YY3 O;  3OUF A;  3WB0 A;  3ZMT A;  2C2A A;  3ZED A;  4D7S A;  1S77 D;  4X64 O;  3JAT B;  1IX9 A;  3P30 A;  2AGA A;  1OCC B;  4I9Q A;  2JEU A;  4RQF A;  3FYE B;  3BA8 A;  2R9R B;  4WF9 V;  2W6J G;  1UFI A;  1M93 A;  4DK1 A;  4X66 B;  3SYP A;  1AI6 A;  4FFB B;  1B06 A;  2HP8 A;  4DR7 O;  4KFM A;  1QHT A;  3MD0 A;  5EBL C;  2XAH A;  2P90 A;  4LNU A;  2A06 H;  3OR6 C;  4QNH B;  1XIL A;  4QPK A;  1IVS A;  4RO2 A;  5JJE B;  4QE9 A;  3PJS K;  4I5S A;  5L3D A;  3ZHV A;  2ZDI A;  1H8E G;  4NB5 A;  2F43 G;  4X1Y B;  2WWW A;  4WBN A;  2UU9 B;  2ZQM A;  2LJ2 A;  1MOF A;  2F4V B;  3BRC A;  4UV9 A;  2Z0A A;  4W4K A;  1BS3 A;  4YJ3 A;  3L75 H;  4WBN B;  5FL7 G;  4OPA A;  4BWA A;  3KKY A;  2EIJ C;  3CCQ V;  3ZCC A;  4YJ3 B;  4B08 A;  3RYF A;  4ZI7 B;  4ASU G;  1VQ9 V;  2YIA A;  2WA3 A;  2GDS A;  1M57 B;  4FLX A;  4ICG A;  1M1K W;  4E4E A;  3IFX A;  2QKC A;  1VQ8 V;  3CB2 A;  4IIJ B;  3OD4 A;  3UKM A;  4JZ2 A;  4WFB V;  1VEW A;  2WLH A;  3AG1 B;  3C90 A;  4KL1 A;  2VRZ A;  3LNM B;  5LMU O;  2YSU B;  1BGY H;  3IJ4 A;  3AG3 B;  1K8A W;  4PI2 A;  1ORQ C;  1AI7 A;  3IC7 A;  2ILM A;  1XNQ O;  1B3Q A;  2WAM A;  5CA0 A;  1P4R A;  2QWN B;  4FIP C;  1TUB A;  1H38 A;  3Q4H A;  4K0K O;  5B1A C;  4J42 A;  1HDJ A;  5CA0 B;  3K9A A;  2Y48 A;  3AEI A;  1CPY A;  1YZB A;  2VQE O;  3Q4H B;  1K7D A;  1HNZ B;  2DQ0 A;  4GX1 A;  4UVC A;  3JD1 A;  4LH6 A;  1ZSP A;  1KEC A;  5LGT A;  2FB5 A;  2M7W A;  2JRI A;  2PTM A;  1PNK A;  4AHC A;  1M56 C;  1QLE B;  4DV6 B;  4FLU A;  2R9A A;  2ZM6 O;  3W7S A;  3JSN A;  2RJZ A;  3JCU Z;  4UUJ C;  2P5O A;  3OFN G;  2BE3 A;  3HKE B;  4LR3 A;  1VF6 A;  3AG2 B;  4DR5 B;  4NTY A;  1ZUQ A;  4LFB B;  1XL6 A;  3K0D A;  3L73 H;  5CBH A;  1OCR B;  3ZIA G;  1P7B A;  2ADP A;  5CB4 A;  3BEH A;  2ZIN A;  4NXM B;  4FLW A;  3MAQ A;  2A3Q A;  3I5D A;  2YS8 A;  4JF3 A;  2UUB O;  1VQM V;  1EN4 A;  1Q86 W;  3VBB A;  3ZMZ A;  4LF7 O;  4P30 A;  5B3S B;  3AK1 A;  3K5M A;  4OX9 B;  2P06 A;  1Z5V A;  5LA6 A;  4WFA V;  1G1X B;  2LW7 A;  3HKD B;  5KHG A;  4EEQ A;  4DUY O;  2JJ2 G;  3APO A;  3K57 A;  3M99 B;  3F5T A;  5CBF A;  4BIZ A;  3CRR A;  3JD0 A;  3L70 H;  3RYI B;  4J9Y B;  1W59 A;  2PGG A;  4R50 A;  3RYH A;  1H2N A;  4LF4 O;  1Y6X A;  5H6R A;  4O2A A;  2QM7 A;  3R65 A;  2JVD A;  5LGN A;  4JI8 B;  1NKD A;  4O2A B;  4IL6 Z;  5KAF Z;  4FM1 A;  4DV0 O;  1XI1 A;  2LW1 A;  1SQV H;  3STL C;  2BOC C;  1IBK O;  1YIJ V;  4IT5 A;  4DV4 B;  3OTO O;  2EUL A;  1FFX A;  5J9P C;  1OV9 A;  3SYC A;  3E8B A;  4BW9 A;  1LNQ A;  4JTC B;  3T1H B;  2QSA A;  3AK2 A;  3SPJ A;  4CH4 A;  1SZX A;  1FFX B;  3TK1 A;  3IAY A;  4MTG A;  5BXZ A;  1XMQ B;  5EYP A;  3E8F A;  3ZRS A;  1KKD A;  5B1O A;  2Q67 A;  4D7T A;  3CCJ V;  3N2G A;  3O9O A;  5EYP B;  4X62 B;  4O4L B;  1HNX O;  4X66 O;  3CSX A;  4GX2 A;  4HNA A;  5IJ9 A;  2EIJ B;  2EX3 A;  5C8Y A;  2AHZ A;  1K34 A;  2CTR A;  2IU0 A;  4X65 O;  3AG4 C;  3CHX A;  2Q69 A;  4AQY O;  1XOU A;  5C8Y B;  2Y0I A;  2XAF A;  1H2G A;  4JAU A;  2YXY A;  3TXS A;  2UUC O;  2UU9 O;  1V55 C;  3IGA C;  4O4I A;  2F4V O;  2EJR A;  4JYB A;  1WB8 A;  2DN9 A;  1SA0 A;  2G38 A;  4YY3 B;  2GBO A;  4MTO A;  1Q5O A;  4LFA O;  1N34 O;  5LL6 Y;  4J7J A;  1SA0 B;  1YTF D;  4TV9 A;  1PL0 A;  1YCI A;  2E3C A;  4WFF A;  4YJ2 A;  1Y67 A;  4H33 A;  4MSW C;  2DYS C;  1PKX A;  3A0B Z;  5LYJ B;  1R6K A;  2YID A;  5B1A B;  1K9M W;  4YJ2 B;  1ZL8 A;  4LH7 A;  1VQO V;  1WPX A;  4XDL A;  4H44 B;  1LUW A;  4DR7 B;  1Q3E A;  4F6E A;  2Q0O C;  1NI8 A;  5GTH Z;  1ZL8 B;  3CC4 V;  2IJI A;  1SQQ H;  4A5U B;  3T1Y O;  3JAM N;  2CH7 B;  1HP8 A;  1N33 O;  1PP9 H;  4AIL C;  4UFZ A;  2YC0 A;  3CC2 V;  4CC5 A;  2HHH O;  1JJ2 U;  1FD9 A;  4HBN A;  2BOB C;  2HR3 A;  4GKK O;  1M56 B;  1FS0 G;  3SGI A;  1IBL O;  3DC5 A;  4UV8 A;  2CUG A;  4CH5 A;  1P84 F;  4P2Z A;  2EIK C;  2Q68 A;  4W4L A;  3MHH C;  1IZ3 A;  3JAR B;  1U96 A;  3CME V;  4F6R A;  3QO5 A;  2X6C A;  1BHA A;  2DE0 X;  5IYC O;  2YDE A;  4JI1 B;  3THO A;  4F6R B;  3H1I H;  4KP4 A;  5DN6 G;  3RVY A;  1Z5W A;  2E74 B;  1GH6 A;  4LF8 O;  4FLZ A;  3OR7 C;  4DV6 O;  1FAF A;  2JIZ G;  2VWJ A;  3KZI Z;  4JTD B;  1SZT A;  3FFQ A;  2ZIM A;  5LMU B;  3EFF K;  4NTX A;  3BCC H;  1W0K G;  5FPO A;  2ZD9 A;  4QPJ A;  4DR5 O;  5H6Q A;  1XNQ B;  1K97 A;  3G6E V;  5EIB C;  1CP9 A;  3CE2 A;  3FD9 A;  3DC6 A;  1R6T A;  2UXD B;  2Q7G A;  4LF6 B;  2WLL A;  1FPO A;  1WAZ A;  1H2K A;  2BSK A;  2VQE B;  4GCZ A;  2JGU A;  1Y74 A;  5IJ0 A;  1FYJ A;  4EFE A;  1QVG U; 
#chains in the Genus database with same CATH homology
 5EK0 A;  3OMI B;  2R9R B;  4WF9 V;  2W6J G;  3ABL C;  2P67 A;  1FXK C;  3B8M A;  2Z5U A;  4PA7 A;  2HG5 C;  3FYI B;  3SYP A;  3ZJZ A;  1AI6 A;  2NNU A;  4KFM A;  5CN0 A;  2EIM B;  2QEX V;  1MAB G;  2ITD C;  3MD0 A;  3CYO A;  2XAH A;  5EBL C;  5IYD O;  2P90 A;  4R6Z A;  2H94 A;  3OR6 C;  4MTX A;  2HJF C;  4QNH B;  2WPD G;  1BMF G;  4QPK A;  1JOY A;  4RO2 A;  4QE9 A;  3PJS K;  4I5S A;  5L3D A;  2ZDI A;  1H8E G;  1R6N A;  3WG7 C;  1RM1 B;  4PA4 A;  2F43 G;  4XBF A;  2DYR C;  4HAM A;  4UVB A;  5B1B C;  1M9N A;  4F4L A;  2WWW A;  1R3K C;  4WFE A;  1R73 A;  4LC1 A;  4EKW A;  5B1N A;  2ZQM A;  1NR7 A;  1GM9 A;  1F4M A;  1MOF A;  1FXV A;  3ZMU A;  4TWK A;  2DQ3 A;  4G28 B;  4PA9 A;  1S72 V;  4UV9 A;  1I5X A;  2AHY A;  3F5W C;  1BHB A;  5FL7 G;  1VQK V;  1AI5 A;  3KG2 A;  4MW3 A;  2EIJ C;  4PDV A;  3CCQ V;  3ZCC A;  5E1A C;  1ZWI C;  1NVP B;  2A0L A;  1EFR G;  4ASU G;  3FB6 C;  1VQ9 V;  3AG4 B;  2IU3 A;  5LHG A;  2UXX A;  1M57 B;  3G4S V;  3OAA G;  1MG1 A;  2H8P C;  1QCE A;  3LDD A;  3ABK B;  1M1K W;  1PNL A;  3K3W A;  1K73 W;  3AG2 C;  3E86 A;  3IFX A;  1OZ0 A;  2QE7 G;  2OCC B;  3SJQ C;  1VQ8 V;  1JPX A;  3UKM A;  1V54 C;  4WFB V;  2NLJ C;  3FB8 C;  2X6A A;  1V55 B;  3RBZ A;  2XAS A;  2WLH A;  3AG1 B;  1K5Q A;  3OE7 G;  3LNM B;  2IJK A;  3EHB B;  3W7X A;  1FFT B;  2YSU B;  2B5U A;  1G4Y B;  3AG3 B;  1RPO A;  1KC8 W;  2WLK A;  4XDJ A;  1B6Q A;  5IY5 C;  1K8A W;  4MS2 A;  1ORQ C;  3ZRW A;  1AI7 A;  3IC7 A;  5KUK A;  1YJN V;  1NH2 B;  1BL8 A;  3K04 A;  3SPC A;  4PDR A;  2WAM A;  4MVQ A;  2LP7 A;  1P4R A;  4FIP C;  1H8H G;  2ZR3 A;  3ABT A;  4YXW G;  4RUE A;  1SRY A;  3I55 V;  1OCZ C;  1H38 A;  1QBZ A;  3E2E A;  2DYS B;  3STZ C;  3NXS A;  5B1A C;  1F23 A;  1NQT A;  1Y4M A;  3K9A A;  2Y48 A;  5GW7 A;  3T4D A;  3AEI A;  3LSS A;  2B1I A;  1QVF U;  1GO3 F;  1CPY A;  2FTK A;  4WFH A;  1DLB A;  2WLJ A;  1K7D A;  2DQ0 A;  2ZDI C;  4GX1 A;  4UVC A;  3JD1 A;  1ROP A;  2GHY A;  1UJW B;  3LDE A;  1KEC A;  1VQ7 V;  3K06 A;  3JD3 A;  5LGT A;  1NR1 A;  2M7W A;  4Z1M G;  1AR1 B;  1DTO A;  1PNK A;  1PD3 A;  5IDJ A;  3QO8 A;  3BY6 A;  1OCO B;  4JYC A;  4J9Z B;  1KP2 A;  2EIL C;  4U7N A;  1M56 C;  2A79 B;  4UVA A;  2WLN A;  1N8R W;  1THZ A;  3DTU B;  1QLE B;  1QR8 A;  2EIN B;  3K79 A;  3W7S A;  2V7Q G;  3LSQ A;  4LP8 A;  5EBW C;  3K0G A;  1WLE A;  4UUJ C;  3OEE G;  1JVM A;  3ABU A;  2XAG A;  3OFN G;  3W7T A;  3CD6 V;  3ETD A;  3ZN0 A;  3AG2 B;  1DF5 A;  4MVZ A;  3DGE A;  1E1R G;  2EIK B;  1EBO A;  2EZO A;  3W7U A;  4L87 A;  1XL6 A;  3LUT B;  3K0D A;  1IXM A;  5CBH A;  1K92 A;  4N21 A;  4MVR A;  1OCR B;  3ZIA G;  1P7B A;  3BEH A;  4G2K A;  1VQP V;  4LBE C;  1YJ9 V;  3P32 A;  1E1Q G;  3E35 A;  4ZKI A;  4JF3 A;  2Z3Y A;  3CCU V;  1I5Y A;  1VQM V;  1MSW D;  1Q86 W;  2WSS G;  1GMG A;  3GWO A;  3VBB A;  1QR9 A;  3ZMZ A;  4P30 A;  5B3S B;  1TUE B;  1G8M A;  4CZZ A;  4QE7 A;  4JAV A;  5L3B A;  5LBQ A;  1FXH A;  5LHH A;  1Q82 W;  2QTO A;  4WFA V;  5LHI A;  3X2Q C;  4KUM A;  2X0L A;  3FB7 C;  1YSC A;  2JJ2 G;  1K33 A;  3M99 B;  4GT1 A;  1XL4 A;  2JJ1 G;  4BW5 A;  5BZB A;  1NBM G;  3ASO B;  3JD2 A;  2PI4 A;  4HZ3 A;  3TET A;  5CBF A;  3H01 A;  1NVP D;  3MHS C;  4BIZ A;  3JD0 A;  5KUM A;  4J9Y B;  1GM8 A;  4R50 A;  2OT5 A;  2QA4 V;  3SYA A;  2Y69 C;  4X8A A;  2XOK G;  1OCC C;  2LFS A;  4Q20 A;  3B77 A;  4XDK A;  5H6R A;  2ZXW B;  5L3F A;  2QM7 A;  3R65 A;  4CBC A;  5LGN A;  3ABM B;  3ASN C;  1FXK A;  4TT3 G;  1KQS U;  5EC2 C;  3W7W A;  1NKD A;  5HFM A;  3ABL B;  5H9C A;  2IJH A;  3STL C;  1J95 A;  1AJQ A;  1FXK B;  2BOC C;  1YIJ V;  4I9W A;  1R3J C;  3ML0 A;  4UXN A;  2EIM C;  3VOU A;  4DXW A;  1S5H C;  4G27 B;  5J9P C;  1NH2 D;  3SYC A;  3ZRX A;  3E8B A;  4H37 A;  1LNQ A;  5L3E A;  4JTC B;  4U7O A;  4FMT A;  4R7C A;  3CCL V;  3CCS V;  3SPJ A;  5CMU A;  1RM1 C;  3TK1 A;  3B8N A;  4MTG A;  2XAQ A;  3D3I A;  1NJI W;  3QO7 A;  1GKF A;  3GB7 C;  3WG7 B;  3SPG A;  1YJW V;  1JCH A;  3E8F A;  3ZRS A;  2W0F C;  4P9O A;  1KKD A;  2DYR B;  5EC1 C;  5B1O A;  5B1B B;  2A9H A;  2Q67 A;  3CPW U;  3CCJ V;  3HPL C;  3A0R A;  3ETG A;  4JTA B;  3CP1 A;  3OW2 U;  4PA6 A;  1EZJ A;  4MVS A;  1K4C C;  2HLD G;  3CC7 V;  4DO2 A;  1K5S A;  3ETE A;  4PDL A;  3ZMV A;  4GX2 A;  2K1E A;  1OHH G;  4N23 A;  1VQL V;  1DF4 A;  3E8G A;  2EIJ B;  3OMN B;  2AHZ A;  3T4Z A;  1K34 A;  3I56 V;  1GM7 A;  2IU0 A;  2IH1 C;  2IH3 C;  3AG4 C;  1M57 C;  2Q69 A;  4BAY A;  1VQ6 V;  3QNE A;  4QIW F;  2V1D A;  4QJF B;  3ABK C;  5KA5 A;  3OMA B;  3G71 V;  4P9P A;  2XAF A;  1COW G;  1KP3 A;  1R3I C;  1H2G A;  2OCC C;  5KA6 A;  4GX5 A;  4JAU A;  4PEL A;  2JK5 C;  3JYC A;  3CCV V;  1CEZ A;  4MVO A;  1V55 C;  3AG1 C;  1SET A;  2P6J A;  3IGA C;  1V54 B;  2EJR A;  2WLM A;  2LFR A;  4JYB A;  4X89 A;  2WLL B;  2DWE C;  3SPI A;  4FK5 C;  3AG3 C;  3ZRV A;  3RW0 A;  4MTO A;  4HYO A;  3WFV A;  3RVZ A;  5IY5 B;  1YTF B;  3OGC C;  3OUS A;  2IW5 A;  1VQ5 V;  3K03 A;  1W2B U;  1YTF D;  2OTL V;  1ENV A;  3F7Y C;  1PL0 A;  5DM6 V;  3OEH G;  3OM3 B;  2JEX A;  4RQE A;  4WFF A;  2UXN A;  4H33 A;  3E89 A;  4MSW C;  4MT8 A;  2DYS C;  5L3G A;  1PKX A;  2IJJ A;  2XAJ A;  1R6K A;  1OCZ B;  4TSF G;  1YIT V;  2Q6A A;  2EBO A;  2WLI A;  3F7V C;  5B1A B;  3JD4 A;  1K9M W;  2DWD C;  5C93 A;  1Q81 W;  1VQO V;  1WPX A;  1K4D C;  2MK3 A;  1R3L C;  1E79 G;  1F51 A;  3D36 A;  4XDL A;  2PI5 A;  4OXS A;  1SER A;  1Q7Y W;  2R9I A;  3T1C A;  2EZP A;  2WLI B;  4MW8 A;  2X7R B;  3ZN1 A;  3CMA V;  3SYQ A;  3CC4 V;  2IJI A;  3E8H A;  4WCE V;  2W6I G;  1OCO C;  4GX0 A;  3CC2 V;  2YEV A;  1JJ2 U;  2ATK C;  2QM8 A;  1AJP A;  3FKS G;  5EBM C;  4MVM A;  2BOB C;  5HFL A;  4E2L A;  1JX9 A;  1QLE C;  1W0J G;  2EIL B;  2HR3 A;  2EIN C;  1M56 B;  1QLN A;  4RUF A;  1FS0 G;  1Y66 A;  4R8C A;  2YEV B;  4ZBM A;  4MVU A;  2OTJ V;  2B1G A;  3CXC U;  2XND G;  1VQN V;  1S3J A;  1L1F A;  1VQ4 V;  3LDC A;  4UV8 A;  4WFG A;  3CCR V;  3TCU A;  4P2Z A;  1ARO P;  2EIK C;  5LGU A;  2Q68 A;  2ITC C;  1GK9 A;  3MHH C;  3CME V;  1GTO A;  3QO5 A;  2X6C A;  1BHA A;  1S76 D;  1HWY A;  5IYC O;  3HB3 B;  3UM7 A;  1OCR C;  5CBG A;  2ZR2 A;  3FB5 C;  4KP4 A;  1AI4 A;  5DN6 G;  1SES A;  2QKS A;  4X88 A;  3CCE V;  3RVY A;  1M90 W;  4LCU C;  3OR7 C;  2JIZ G;  3SPH A;  4PDM A;  1YI2 V;  1F4N A;  1K3E A;  5L3C A;  5B3S C;  4PA3 A;  3CCM V;  3K08 A;  4JTD B;  3ZRW B;  1SZT A;  2P7T C;  3EFF K;  1KD1 W;  5CA3 A;  4JGS A;  4MTF A;  1W0K G;  2ZD9 A;  4QPJ A;  1YHQ V;  2HVJ C;  5H6Q A;  3X2Q B;  4JPR A;  2D3O W;  3SYO A;  1JQ0 A;  1K97 A;  4FPP A;  3ASO C;  3G6E V;  4FJC C;  1CP9 A;  2KB1 A;  1S0V A;  3JCZ A;  3OUF A;  3ZMT A;  2DW4 A;  2C2A A;  2CK3 G;  2JDI G;  3ZMS A;  1S77 D;  2WLL A;  2ZXW C;  2Y69 B;  4JAS A;  3P30 A;  1OCC B;  1RPR A;  4GCZ A;  4RAI A;  2HKO A;  3ABM C;  4BIU A;  2X6B A;  2HVK C;  2JEU A;  2HFE C;  5IYB O;  1AJN A;  3T2M A;  2GSM B;  3ASN B;  4RQF A;  3FYE B;  3E83 A;  1PNM A;  1QVG U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...