1Y66A

Dioxane contributes to the altered conformation and oligomerization state of a designed engrailed homeodomain variant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
50
structure length
50
Chain Sequence
QWSEEVERKLKEFVRRHQEITQETLHEYAQKLGLNQQAIEQFFREFEQRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dioxane contributes to the altered conformation and oligomerization state of a designed engrailed homeodomain variant.
pubmed doi rcsb
source organism Escherichia coli
molecule tags De novo protein
molecule keywords engrailed homeodomain
total genus 24
structure length 50
sequence length 50
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1y66A00
2M7WA 1QCEA 3B8NA 3CYOA 2EZOA 1DLBA 5KA5A 1Y66A 2P6JA 4JPRA 3H01A 1DF5A 4FIPC 4N23A 2MK3A 3M99B 4E2LA 4JGSA 1MOFA 5HFLA 1QBZA 2X7RB 1MG1A 1QR8A 5H9CA 1I5XA 5CN0A 1JPXA 2LP7A 1SZTA 5HFMA 1DF4A 3MHHC 3WFVA 1EBOA 5CMUA 1JQ0A 2EZPA 3B77A 3CP1A 2OT5A 5KA6A 1ENVA 3GWOA 1QR9A 4FK5C 3K9AA 1F23A 4JF3A 2EBOA 1K34A 3B8MA 1I5YA 3MHSC 3P30A 4N21A 1K33A 4FJCC 1Y4MA 4G2KA
chains in the Genus database with same CATH superfamily
1TVKA 5B1AB 4J7JA 5BR8B 1IURA 2HLDG 2WLKA 3SYQA 2IM9A 1PPJH 3ABTA 3APQA 3JD2A 2ETNA 2IU0A 4DR7B 1N32O 2BTQA 3CRQA 2CTQA 1BE3H 4UXNA 3A0HZ 1V54C 4FK5C 1HR0B 3BAAA 4DV6B 1F4MA 4YHHB 4LF8B 2XT9A 5BY1A 2R70A 3K59A 4I9WA 4KL1A 4TSFG 1P49A 3DXRB 4I0XB 5LOVA 2NLJC 3WFVA 2DOSA 2D2CB 5IYZB 4J10A 4DV7O 5FL7G 2JS5A 1GRJA 3ABMC 4LF6O 2VQEB 4G2KA 5EBWC 3ZRWB 5B1OA 1W0JG 3CCQV 1KB9F 4TV9A 5LGNA 5JH7A 2QR4A 5KMGA 5LYJB 4I55A 3RYFA 5A9GA 2A06H 2DWEC 2PUSA 5CBGA 1GO3F 1ZX3A 2IJHA 3K5NA 4FM1A 1RFYA 4IGGA 4K8XA 4LFAO 4WF9V 1K7DA 3J81N 2CK3G 1ZLZA 4UVBA 5L3DA 1JR9A 2FB5A 1WNSA 3ZCCA 4ZHQB 3JYCA 2HVJC 1SQQH 1D5AA 1R3KC 2LFSA 4NTXA 1DGSA 2Q8VA 3UO3A 1T5EA 2VWKA 1R73A 4DUZB 2BSKA 1K92A 2CTWA 2A7WA 3G80A 3DC5A 5LHHA 4DV6O 2OTJV 1NR7A 3RWRD 1WP8A 2P4KA 4J41A 2QE7G 4LFBB 5TISZ 1Q8IA 4NYKA 4FPPA 4DUYB 3C3TA 5IJ0B 3I55V 4IIJA 3E35A 3FB8C 4BW9A 2OWOA 2QWNB 3OMIB 4JI2B 5IWAB 4NTYA 3MD0A 1FYJA 2NR5A 2P90A 2PGGA 1B3QA 3ABKC 3FYEB 2VS0A 1N34B 2BCCH 4X1YB 4YIOA 4K0KB 4JYCA 4CC5A 4CS2A 3AEIA 4C7UA 2F93B 1H8HG 3QVNA 1YIJV 3OAAG 1U97A 4XDLA 5CN0A 3THOA 1SQXH 3VQWA 3AG2B 1YEWA 2RDCA 3ASNC 1AILA 1FXKA 3OD4A 1P84F 4LF6B 3BEHA 4QJFB 2QM4A 4MVMA 4OX9B 3E86A 4YJ3A 1BS3A 3A0RA 1D2DA 4O4IB 1QQCA 2ZIOA 3VQYA 4WFEA 5LBQA 3ZN1A 4GYCB 1VQ9V 5H2FZ 5J2TA 1MABG 1XNQB 1GN4A 4GKJO 3L9DA 2X0LA 3OTOB 3GVMA 1K97A 2DYSC 4DR5B 4UVAA 1O9GA 3QG5A 1AR4A 5CA1B 1GTOA 4NVPA 3T1HB 3ZBHA 1I0HA 3B8NA 1N36O 1B6QA 5B3SC 2X6AA 2EINC 2HHHB 1VF7A 2BOCC 2QKSA 5JQGA 3CCMV 3RVZA 3RVYA 1SETA 4Q6GA 2LW1A 1AJNA 3H9VA 1HR0O 3W7SA 4R50A 4YJ2B 2GUZB 3FKSG 3ML0A 1VQKV 2ATKC 2P7TC 2JS3A 5LHGA 3L71H 1YITV 3HKBA 1Q7YW 4DYLA 5KAFZ 1QLEC 1AP5A 1AROP 4JI2O 5LHIA 4H13B 4MVZA 4BR6A 3SYOA 3FB6C 5GONB 4AHCA 1Q82W 3GWOA 2ZM6B 3JD0A 5KHGA 2ZCEA 3UCSC 4LNUB 3CSXA 4JI6B 3SPIA 2FMLA 4PDLA 1RP3B 4UFZA 3L70H 4JV5O 3OEEG 1I94B 4I5SA 4FVMA 2QGNA 4G28B 3P3PA 1JCHA 4DW0A 1EZVH 3T1YB 3M8AA 3I56V 1GKFA 5D5PA 3K5OA 2L6LA 5DECA 2F66C 4OXSA 4JI3O 3JAWB 2YIBD 5IY5B 1DLBA 5FPRA 4PDRA 1KBHA 2AHYA 1H2NA 4J80A 2FKXA 2VQFO 3CRRA 1OCRB 2ZE8A 4JZGA 5JCOC 1VQ6V 4I4TA 3DC6A 3CPWU 1YZBA 3OM3B 3HKCA 2QEXV 1K33A 4GX1A 4J42A 5KA5A 5K1PA 1CXZB 3OUSA 2LJ2A 4B3SO 4PELA 2E75B 2Q7GA 3D8CA 4JAAA 1QU7A 4FLTA 2DMXA 2OCHA 3TGUH 1NTZH 4LC1A 3ZHTA 1N32B 3U0ZA 3EHBB 4B3TO 2N74A 5CB4B 2Z3YA 1OCRC 1S5JA 1WAZA 1VQ4V 3ZEDA 4B7EA 1FFXA 1FXVA 3STZC 3OMNB 3BY6A 4B08A 4IL6Z 4LFBO 2GDSA 4KHPO 3BRCA 3ZRVA 3K57A 2EILB 3RYHA 3AG3B 4DV1O 5CBFA 4FLVA 5CA0A 4PA9A 4CZZA 1XMOB 3Q4HB 1BGYH 1URFA 1GM7A 5LMUO 1FFTB 4IHJB 3HKEA 4UCVA 4D7SA 3SYCA 1FAFA 2F1MA 3T4ZA 4TV8A 1HDJA 5J2UA 1AP6A 2UU9B 2UUBB 2ZR3A 3ZHSA 2HKOA 3G4SV 4X20B 3D3QA 1HNXB 3B2EE 1KKDA 2UXBO 2AZ0A 4MSWC 1H8EG 1SKVA 2PTMA 1NS1A 4X65O 3IAYA 1GM8A 2KG7A 4JI7B 5KAIZ 5LP6A 3MHSC 2YIBA 2Y0IA 2EZOA 3FAVB 3K0GA 3MAQA 3H1IH 2KB1A 2IJJA 4D6TH 2GUZA 3W7XA 5H5NA 4DUZO 1B04A 3JSLA 3CCUV 2DN9A 5LL6Y 3T4DA 1BZKA 2CH7A 4FLWA 4K0KO 1G6UA 2UXCO 3CX5F 4RO2A 2DYSB 3K08A 1XQ8A 3C3SA 2EIJC 1US6A 2ILMA 4DXWA 3N2GB 4OPAA 5E1AC 1JOYA 2MW2B 4YJ2A 4X20A 3CCVV 2GTAA 2OT5A 1ROPA 3RYIA 5K1XA 1UJWB 2ZE7A 3CRAA 3PJSK 1N4CA 3RFRA 3AG2C 4JI7O 1TUBA 4J9ZB 4TOIA 4E2LA 1JMKC 1EN6A 1I5XA 2BTQB 2DQ0A 3JATA 1K4CC 1YTFD 3JD1A 4EB6B 4TQFA 2Q9LA 3K5MA 1VQ7V 1M4UA 4LWSA 1WP7A 3ZMZA 1N36B 2OTLV 1GN6A 4IT5A 4UCUA 4DR4B 5BMVA 3ZX6A 5IJ9A 3JSNA 1BT8A 5DM6V 3JAMN 3NR7A 1QBZA 4FM2A 1QHTA 4JYAB 2UUAO 2LO1A 3RN4A 3F7VC 2PY5A 4RUEA 2EZPA 2K9PA 4DV1B 1R3JC 2ZDIA 3TCUA 2HHHO 4LF7O 4DV4O 3JD3A 3L72H 5KHKA 4R8CA 5KUMA 3E8GA 4YIPA 4FM0A 2YICA 1TUBB 1J95A 3H1KH 1FS0G 4MVOA 2UXDO 4CBCA 3QO5A 1FFXB 4LH7A 1WA8B 1HNWB 2UUCO 3O65A 4MW3A 1KP3A 1Z5WA 4RQEA 1XDCA 4ICGA 4F6EA 4FIPC 1IBLB 2P5OA 4PD4F 4MTGA 2LGWA 1K5QA 3ZRXA 1EN5A 4LF9O 4NXNB 4PI2A 1N0NA 4W4KA 4JI4B 2XNDG 3K04A 3HR0A 3AK2A 3Q4HA 1EZJA 1S72V 4TV9B 2E5LB 5IJ0A 1JFFA 4DV0B 1XILA 5B66Z 5EBMC 2VQFB 3ZHRA 1OCCB 4HZ3A 4GKJB 3BCCH 2OIGA 3BHPA 2YDEA 2YEVB 4U3JB 2RCVA 4UV8A 4DV2O 3W7TA 5EYPA 4O4LA 1SF9A 3SYAA 2XTAA 3MHHC 4QGPA 1H2SB 4G27B 3U10A 2WLIA 3CEIA 3C90A 2KQXA 1IDSA 3UO2A 3STLC 2JDIG 5H6QA 4X66O 3SPGA 2BSKB 1KYOF 1OCOB 2KG7B 1OJHA 1V9PA 5LP6B 2AW9A 2BOBC 3G6EV 3OR7C 1IBKB 4TV8B 1M56B 3BABA 5D5QA 4WCEV 5B1BC 4MTXA 2RN9A 3D3IA 3CJHB 1NVPB 4X62O 4H33A 3ZJZA 1K34A 1R6NA 2EIJB 3OR6C 5L3CA 4PDMA 4ASUG 1Q90D 3CYOA 3AK3A 5LOVB 5B5EZ 1WJZA 3ZMSA 3EFFK 1BQZA 3OGIB 4AILC 3JARB 5LXTA 1R3LC 4UCSA 1B06A 3U11A 4FZ0A 1FD9A 4J7KA 1GK9A 1KC8W 1OV9A 1SRYA 1W59A 4PA7A 2LGQA 2CUGA 3ZS8C 4K8ZA 4K3AA 5IE9A 2JEXA 3E22B 4TUYB 3LUTB 1EN4A 2OCCB 2AGAA 1XBLA 1NVPD 2ZQMA 1NR1A 1SC5B 1H38A 2JK5C 2R9AA 3JATB 2W6IG 4X62B 2ZIMA 3TETA 1DK1A 4LFCO 1FJGO 1YHQV 1DF5A 1M90W 3RYIB 3JAKB 1NQTA 1VMGA 2GTSA 1NI8A 1JJ2U 1XNRB 1MMMA 1IXBA 1R6TA 5L3BA 3KG2A 3K06A 3E8BA 4JI8B 4IIJB 3J7AU 4DV7B 4JZ2A 4ZOLA 2YI9A 3AG3C 1V55B 4OX9O 5BXZA 3LDCA 4WFGA 3SJAC 2YI8A 3CD6V 2Y69C 3X2QC 2EINB 1GM9A 4PV1B 4I7ZB 1AR5A 4B3SB 1KKCA 2ODMA 1P7BA 1S3JA 4TQDA 1VQ5V 1PNMA 4L87A 5GONA 2P06A 5ITZB 3OTFA 1V54B 4I4TB 1JJOA 3QTCA 1WPXA 2OCCC 1MA1A 5FNVB 2QTOA 4UUJC 4DR3O 1QR9A 4U3FH 4X66B 4NB5A 4ZI7A 4UCTA 4I9QA 2OYQA 3E8HA 5J2TB 1VF6C 4QPKA 2KSDA 1PM9A 1VIBA 4QE9A 2IW5A 2GV9A 4BW5A 1JFFB 3K9SA 2EJRA 4IYHA 5GTIZ 5CB4A 3F7YC 3CXCU 3BA8A 4X1IB 3IC9A 3RBZA 1YI2V 4PHZA 2FTKA 1NKDA 3WB0A 3SGIA 2QM7A 4ABMA 1I08A 3W7UA 3JASA 2JGDB 2F4VO 5C8YA 3M99B 2V1DA 2NN4A 1XNRO 1Y76A 3T1CA 2R9IA 3RYHB 2JJ1G 4ZHQA 1NJIW 3B77A 2UXBB 3OE7G 1NU1H 1TA8A 2LFRA 2IU3A 4CH3A 1S76D 1DTOA 1LNQA 1FXHA 4HNAB 3PN1A 4P9OA 1M57C 4BAYA 1TAEA 3AK1A 3CWBH 3WB1A 1PKXA 3VQVA 3IFXA 3JALA 4FMTA 2QWOB 1K3EA 2GBOA 3JARA 5LXTB 2UXNA 1EFRG 5CA3A 2WLLA 1N33O 4UB6Z 1F51A 1JA8A 4WFBV 4UB8Z 3CJHA 1YJ9V 4FFBA 1RSOB 1PP9H 1TVKB 3UM7A 5IY5C 5CMUA 4I50A 2YUAA 4JI1B 4AQYB 4TUYA 3SDLA 3B8MA 2ZNJA 1VQMV 1FXKB 1YF2A 2XOKG 3QF7A 4D7TA 4GUNA 1MOFA 1WLEA 3WB2A 3WU2Z 1WPBA 4BIZA 4PI0A 1VQPV 4K35A 1I94O 3TK1A 3UT5B 1IX9A 1Q43A 4DR4O 5JVDB 2WA4A 1N33B 1LUVA 3SJQC 3DXRA 3H1LH 4I0XA 1IXMA 4BIOA 3JALB 1OCZB 3CMEV 2CGNA 5IT9N 3E89A 1Q6IA 4RWUA 3ASNB 1KMIZ 4IYIA 3TXQA 2ZR2A 4DR6B 1XUQA 2YIDA 3R66A 1NBMG 3K9AA 4LF4B 3OW2U 3FB5C 5LYJA 4KUMA 3P32A 3CC2V 4LF4O 3RYFB 1GN3A 1S5HC 2WA3A 3DGEA 1YXBA 3ZIAG 4EEQA 1VQLV 4MVUA 1H2GA 2RNBA 3GWKC 2RQ6A 2B5UA 1XHXA 5B1NA 3N2KB 2B9ZA 2E76B 2XASA 1Y67A 3SR2C 4I55B 1GAXA 2HG5C 4DK0A 2YIAA 3H1JH 3ZMTA 4B3RB 3D36C 1XI1A 5HFMA 3M7MX 3QO8A 1R6KA 2E3CA 2QJ1A 3EVKA 2UXCB 2LW7A 1SA0B 4GX0A 5FPOA 3BPZA 5E79Z 3H01A 3KZIZ 4MVRA 1NZ6A 1PNLA 1PD3A 1V55C 1M5IA 1VQOV 1NH2D 1O9HA 4FZ1A 1SZXA 4NXMO 4DRXA 3JCUZ 1GH6A 4QIWF 4NXNO 4X88A 3JD4A 4UCOA 1E1QG 3ASOC 4NTWA 1XMOO 1K9MW 4J11A 1IBLO 4X1YA 2QKAA 1F7YA 5LMNO 5GW7A 1BL8A 2EBOA 4UVCA 5GTHZ 5C8YB 1Z2GA 5JJEB 1VF5B 1W0KG 2OIEA 1Q6UA 1QLEB 3B09A 4CH6A 4MTOA 2HVKC 3FYIB 3G6BA 2V7QG 1JX9A 4DR1B 4JV5B 1COWG 1NH2B 2A0LA 1RPRA 4O4JA 4JI6O 5KX5A 3OEHG 3A8TA 3QNEA 1SS3A 3IC7A 4EFBA 1SQPH 1VQNV 2YXLA 2YXYA 4UCRA 1FPOA 5B3SB 3L73H 5L3EA 3ZHQA 1XHZA 3P3NA 2Q4PA 2A3QA 3CHXA 1JQ0A 1M93A 2YEVA 4YY3O 4XBFA 2QA4V 3ZRWA 1F23A 5EYPB 3W7WA 1QLNA 3CCLV 3H1HH 5KHJA 2W6JG 5KMGB 1QVGU 4JTCB 1SQGA 2ZNIA 3FX7A 4CS3A 4LBEC 3CS5A 3E83A 2B1IA 5EBLC 3HB3B 4LH6A 4LFAB 1GMGA 2Y4TA 1N8RW 1SERA 4YHHO 4LF8O 1AJQA 2HEPA 1IZ3A 1OCOC 1R1BA 5CBHA 4WFFA 3UT5A 4MVQA 2CTPA 4DR1O 1OCCC 1ZTEA 4KXRA 1L8DA 1KU9A 2ZKOA 4PA3A 3BVOA 3X2QB 1D5NA 3RYCB 1NTKH 1ZWIC 2Q5ZA 2XAQA 1WN7A 2Q73A 3LSUA 2VQEO 1RM1B 4J7ZA 5LA6B 1HP8A 3K03A 3SJBC 4JI0B 5EK0A 1S77D 1MZEA 1Y66A 3ABMB 5FLXN 4X64O 2O57A 3L74H 1AI5A 3CCSV 1VF6A 1VP7A 2ADQB 1XREA 4O2BA 1J5EO 2YSUB 3N2GA 4ZOLB 4LCUC 2CDYA 4HAMA 4OPHA 1JVMA 1IBMB 2ZINA 1IVSA 2DW4A 2ZXWB 3LDDA 2WLNA 2YS8A 2C2AA 3ZRSA 2H8PC 3A0BZ 1YSCA 3HKDB 5KHIA 1EBOA 3D36A 4W4LA 2UU9O 2UUBO 2X6BA 5A2QN 5C93A 1ORQC 3CC7V 4RUFA 3RW0A 3GB7C 2BE3A 4JTDB 2EULA 3CCEV 1YJWV 3RT3C 4XDKA 2E74B 1NT2B 4CC6A 2JVDA 2UXXA 3ETQA 1SQFA 1K5SA 4FLZA 4O2BB 3OT7A 4LF5O 1BMFG 1HNWO 3SYPA 2P6JA 4JI5O 2XAGA 4DW1A 2WLHA 1RM1C 2GHYA 3CMAV 2WLJA 2XAHA 1M56C 1Y74B 3ETDA 4OGQB 2LQTA 1PL4A 5LP6C 1Z5VA 1XMQO 2ZE5A 4B3TB 4JASA 1K73W 2L35A 2E5LO 3K3WA 3LSQA 3OMAB 3RGBA 1VEWA 3ABUA 4FLYA 1AVMA 2Q7HA 2X6CA 3FAVA 1I7FA 2P4VA 4LNUA 4Z1VA 1TUEB 1U96A 2AZ2A 1IBMO 1NTMH 2DYRB 2W0XA 2CH7B 2QSAA 1X59A 4KHPB 4JPRA 2CTRA 1XNQO 4N23A 4B3RO 1SESA 1MG1A 2VRZA 4LFCB 1HW7A 1FJGB 2LP7A 3WG7B 1OHHG 1SZTA 1XEQA 1R3IC 2D3OW 2Q67A 2Z0AA 2Q7EA 3BA9A 5B1BB 1Y74A 4N21A 2M6YA 4AQYO 3LSSA 2EIKB 4FLXA 4LF7B 2Y48A 3N27A 2B1GA 4JYAO 1FKAO 4F4LA 3CRMA 3TXSA 2WSSG 3OTOO 4YJ3B 1ZL8B 1HNXO 1YCIA 4DR2B 4DV5B 3ETGA 2IBZH 1VQ8V 3AG4C 3OFNG 4U7NA 1PL0A 1M57B 4JAUA 5L3FA 3UKMA 2PZSA 3ASOB 3RYCA 4CS4A 5FNVA 1MSWD 4GT1A 3K79A 4PJ0Z 2UXDB 4DR6O 5JVDA 3B4SA 1Q5OA 1QR8A 3OUFA 2ARHA 1AI6A 2EIKC 5EIBD 2PF4E 4O2AB 3IJ4A 2W0FC 4B3MO 4JI0O 1YDXA 1RPOA 5J9PC 4HBNA 2VWJA 3IGAC 2XUMA 3VOUA 2UUCB 1QCEA 1AI4A 2JIZG 1YTFB 4BIUA 4MW8A 4LF9B 2ITCC 2K1EA 4X8AA 2EJ7A 2YXHA 3DTUB 5LA6A 1KQSU 4UV9A 4ZBMA 1ZUQA 5EIBC 3JCZA 2HJFC 2JGDA 2ZE6A 1BQ0A 1MNGA 3R65A 1Y4MA 4BWAA 1Y76B 1WA8A 4MVSA 1BHAA 4WFHA 4IHJA 1MSDA 4DR2O 2PYJA 2QWRB 2FYUH 5HFLA 1S0VA 3SPJA 1LUWA 4B7KA 3SJCC 4DV3O 3L75H 4H0LB 2HP8A 4NXMB 2DE0X 4HNAA 2QWQB 3F5TA 1BHBA 3AG7A 3G71V 1H2KA 3CRCA 5IDJA 5L3GA 4JF3A 2N04A 3ABLC 1I5YA 1P7GA 1H2MA 4F6RA 1W2BU 3E2EA 3FB7C 4CH4A 1M1KW 4Z1MG 2P22C 1OZ0A 4MT8A 4FFKA 4B3MB 1BSMA 4JGSA 4HYOA 3JAWA 4RAIA 1BCCH 5KUKA 1HNZB 3CP1A 4DK1A 3CE2A 3ZMUA 4NR1A 1N34O 1EM1A 5JQGB 1UFIA 5KHHA 5IYDO 4I50B 1G4YB 1J5EB 2BTOA 4EFEA 2X7RB 2F4VB 5H9CA 1OCZC 5BR8O 5ITZA 3T1HO 4QNHB 1ENVA 4DRXB 3FD9A 2RJZA 2HJDA 2Q0AA 2R72A 5EC2C 4U3JA 2AXTZ 4ZIBA 2Q69A 3MDSA 4JI1O 2ZT9B 3S3XA 3QO7A 4O4LB 4TT3G 1AR1B 1AJPA 1G1XB 2JEUA 2WLIB 5CA1A 3S3WA 4JAVA 2JJ2G 3CC4V 3KCYA 2QDOA 4P2ZA 4R7CA 1ZSPA 4JYYA 2NNUA 2WLMA 1KP2A 1WB7A 1FXKC 2GSMB 1CP9A 4X1IA 4RQFA 2EILC 5IYBO 5LMUB 2MK3A 4O4JB 4LP8A 4Q20A 4LWSB 2F23A 5KX5B 3NXSA 4P30A 1E79G 3HKBB 5CA0B 4DV2B 1XMQB 1MZFA 1TGOA 2A79B 2JGUA 1H2LA 5BMVB 2PI5A 1XOUA 5DEDA 4YY3B 2V4DA 1LR1A 4X1KB 3EXAA 2RMKB 3N2KA 2G38A 1WB8A 2F95B 1UPGA 5LGTA 4JI4O 1YJNV 2EIMC 3HKCB 4Z2WA 1KECA 4LR3A 4DO2A 1K4DC 4LF5B 5H6RA 3E8FA 3FFQA 4QPJA 4GKKB 1ZL8A 2Z5UA 2PYLA 1L0NH 4E4EA 1S5LZ 1E1RG 2DWDC 5AG2A 1QNMA 1Q86W 2WLLB 3K5LA 2HR3A 4XDJA 1HWYA 2QM8A 1SA0A 4EKWA 3ABKB 5KA6A 1L0LH 4FFBB 5LGUA 2F43G 3JAKA 1THZA 3LDEA 3CCJV 4QE7A 5IYCO 3DSQA 4JTAB 2ZM6O 2FL4A 4O2AA 4PA6A 5IYZA 4X1KA 3K58A 4X65B 4J9YB 3ZN0A 1CEZA 3CCRV 4DUYO 2JRIA 3ABLB 4X9QA 2DYRC 3OGCC 2P67A 3KCXA 2R9RB 3ZHUA 2IJKA 5BZBA 5EZYA 4WBNA 1P4RA 3CB2A 3HPLC 5JH7B 4MTFA 2IH3C 1F4NA 1Q81W 2ADPA 1JPXA 1GN2A 2WAMA 4F6RB 2QKCA 4P9PA 2EIMB 5J2UB 1VARA 4YXWG 4X64B 4ZKIA 4PA4A 5JCOA 3O9OA 3A2FA 3K0DA 1YVWA 3BFRA 2ZXWC 5LMNB 1SQBH 4GX2A 4DR5O 4CH5A 3G67A 2UUAB 2Y69B 2ZDIC 1AI7A 3KKYA 1N0JA 3AG1B 4DV3B 4FLUA 3B40A 4KFMA 3VBBA 4ZI7B 5DN6G 1X4TA 4JI5B 2XAJA 4KP4A 2Q68A 3WG7C 5JWPA 4AI8A 1XL4A 2YC0A 1K8AW 4O4HA 1Q3EA 4X89A 2EX3A 1ZAUA 3UQ8A 3TJTA 1A32A 4H37A 2QWPB 3HKEB 4GCZA 4PDVA 1G8MA 3AG1C 3ETEA 2XAFA 3F5WC 5EZYB 4WBNB 2CE4A 3ZHVA 3J80N 4O4IA 3CXHF 1CPYA 3ZMVA 1AB3A 2XHBA 2DQ3A 3SPHA 4GZRB 1XL6A 3JASB 2CGOA 4JYBA 4U7OA 3AG4B 3I5DA 2ITDC 3HKDA 4DV4B 3P30A 4DR7O 3E22A 2ZD9A 5IWAO 2KKWA 2M7WA 2A9HA 1IBKO 2HFEC 2AHZA 4DR3B 2Q0OC 5B1AC 3SPCA 1DF4A 2WWWA 5KLVH 2PI4A 4GLXA 4R6ZA 1Y6XA 3VQXA 1RSOA 3T2MA 1SQVH 2IJIA 3APOA 3T1YO 4FJCC 4GX5A 3LNMB 2H3OA 5EC1C 1PV0A 4TWKA 4JI3B 5F2VO 4A5UB 2H94A 2DJVA 4O4HB 4DV5O 4H44B 4EB6A 1HNZO 2Y0PA 1KD1W 2N05A 2WPDG 3LNNA 1QVFU 2CAZC 4WFAV 1KUQA 1L1FA 4L8JA 5JJNB 4JI8O 4GKKO 4MS2A 2QTSA 4NKGB 5IJ9B 1Q6HA 2Q6AA 4DV0O 1PNKA 1M9NA 3ICXA 2Y4UA 5JJJB 2IH1C
chains in the Genus database with same CATH topology
2EIKB 1VQMV 2EIJC 5B1AB 2Y48A 2B1GA 1FXKB 4DXWA 2XOKG 2HLDG 2WLKA 4F4LA 3SYQA 2WSSG 1MOFA 5E1AC 1JOYA 1WLEA 4BIZA 1VQPV 3ABTA 3CCVV 3ETGA 3TK1A 2OT5A 1VQ8V 1ROPA 3JD2A 3AG4C 3OFNG 4U7NA 2IU0A 1UJWB 3SJQC 1PL0A 1M57B 4UXNA 1V54C 3PJSK 1IXMA 4FK5C 3AG2C 4JAUA 5L3FA 3UKMA 1F4MA 1OCZB 4J9ZB 3CMEV 3ASOB 1MSWD 4GT1A 3K79A 3E89A 4I9WA 4E2LA 3ASNB 1QR8A 4TSFG 1I5XA 2DQ0A 3OUFA 1AI6A 2EIKC 2ZR2A 1K4CC 1YTFD 2NLJC 3JD1A 3WFVA 2W0FC 1NBMG 3K9AA 3OW2U 5FL7G 1VQ7V 3FB5C 1RPOA 5J9PC 4KUMA 3P32A 3ZMZA 3CC2V 3ABMC 2OTLV 3IGAC 4G2KA 5EBWC 3VOUA 1QCEA 1AI4A 2JIZG 1S5HC 3DGEA 3ZRWB 1YTFB 3ZIAG 1VQLV 5B1OA 1W0JG 4BIUA 4MW8A 2ITCC 4MVUA 3CCQV 5DM6V 2K1EA 4X8AA 1H2GA 1QBZA 5LGNA 3DTUB 1KQSU 2B5UA 5B1NA 3F7VC 4RUEA 2EZPA 4UV9A 5CBGA 2DWEC 4ZBMA 1GO3F 3JCZA 2IJHA 2HJFC 1R3JC 3R65A 2ZDIA 1K7DA 3TCUA 4WF9V 2XASA 1Y4MA 3JD3A 2CK3G 4UVBA 4R8CA 5L3DA 4MVSA 1BHAA 4WFHA 3ZCCA 3JYCA 2HVJC 2HG5C 5KUMA 1R3KC 3E8GA 2LFSA 5HFLA 1S0VA 3SPJA 3ZMTA 1J95A 1R73A 1FS0G 4MVOA 5HFMA 4CBCA 3QO5A 1K92A 3QO8A 1R6KA 5LHHA 1BHBA 3G71V 2OTJV 5IDJA 5L3GA 1NR7A 4JF3A 3ABLC 4MW3A 1KP3A 1I5YA 4RQEA 2QE7G 4GX0A 4FPPA 1W2BU 3FB7C 3E2EA 3H01A 4FIPC 1M1KW 4Z1MG 1OZ0A 4MT8A 4MVRA 4JGSA 3I55V 4HYOA 1PNLA 3E35A 3FB8C 4RAIA 1PD3A 1V55C 4MTGA 1K5QA 3OMIB 3ZRXA 5KUKA 1VQOV 2XNDG 3K04A 3CP1A 3MD0A 1NH2D 1EZJA 3ZMUA 2P90A 1S72V 3ABKC 3FYEB 5EBMC 5IYDO 1OCCB 4HZ3A 1G4YB 4QIWF 4JYCA 2YEVB 3AEIA 4X88A 1H8HG 4UV8A 2X7RB 3JD4A 1YIJV 5H9CA 1E1QG 3OAAG 3ASOC 4XDLA 1OCZC 5CN0A 3W7TA 3SYAA 3AG2B 1K9MW 3MHHC 4QNHB 1ENVA 4G27B 2WLIA 3ASNC 1FXKA 5EC2C 5GW7A 1BL8A 2EBOA 4UVCA 3BEHA 2JDIG 3STLC 5H6QA 4QJFB 4MVMA 3E86A 2Q69A 3A0RA 3SPGA 1OCOB 3QO7A 1W0KG 4TT3G 4WFEA 5LBQA 1AR1B 1QLEB 1AJPA 2JEUA 2HVKC 3FYIB 2WLIB 4MTOA 3ZN1A 2BOBC 3G6EV 1VQ9V 2V7QG 1JX9A 2JJ2G 4JAVA 3OR7C 3CC4V 1COWG 1MABG 1M56B 4WCEV 4P2ZA 4R7CA 5B1BC 2X0LA 1NH2B 4MTXA 2A0LA 1K97A 2DYSC 2NNUA 1RPRA 3D3IA 1NVPB 2WLMA 4H33A 1KP2A 4UVAA 3ZJZA 1K34A 1R6NA 1FXKC 2GSMB 1CP9A 1GTOA 2EIJB 3OEHG 3OR6C 5L3CA 4PDMA 4RQFA 4ASUG 3B8NA 3CYOA 1B6QA 5B3SC 2EILC 2EINC 2X6AA 3QNEA 3IC7A 3ZMSA 3EFFK 5IYBO 1VQNV 2MK3A 2BOCC 2QKSA 4LP8A 4Q20A 5B3SB 3CCMV 3NXSA 4P30A 1R3LC 5L3EA 3RVZA 1E79G 3RVYA 1SETA 1AJNA 1JQ0A 2YEVA 3W7SA 4R50A 2A79B 4XBFA 2QA4V 2PI5A 3ZRWA 1F23A 1GK9A 3W7WA 3FKSG 1KC8W 1QLNA 3ML0A 3CCLV 1VQKV 1SRYA 2W6JG 2ATKC 2P7TC 1QVGU 4JTCB 5LHGA 1YITV 4PA7A 1Q7YW 1QLEC 1AROP 4LBEC 5LHIA 2JEXA 3E83A 3LUTB 4MVZA 5LGTA 1YJNV 3SYOA 2EIMC 2OCCB 3FB6C 1KECA 2B1IA 5EBLC 1Q82W 3HB3B 1NVPD 2ZQMA 4DO2A 1K4DC 3GWOA 1GMGA 1NR1A 3JD0A 5H6RA 1H38A 2JK5C 3E8FA 1N8RW 1SERA 1AJQA 2W6IG 4QPJA 1OCOC 5CBHA 3SPIA 2Z5UA 3TETA 1YHQV 4PDLA 4WFFA 1DF5A 1M90W 2DWDC 1E1RG 1NQTA 4MVQA 1OCCC 3OEEG 1Q86W 2WLLB 4I5SA 2HR3A 4XDJA 4G28B 1HWYA 1JJ2U 2QM8A 4PA3A 1JCHA 4EKWA 3ABKB 3X2QB 5KA6A 1ZWIC 2XAQA 3I56V 1GKFA 1RM1B 5L3BA 5LGUA 3KG2A 2F43G 3E8BA 3K06A 3K03A 1THZA 3LDEA 4OXSA 3CCJV 5EK0A 1S77D 4QE7A 5IY5B 5IYCO 4JTAB 3AG3C 1V55B 1DLBA 1Y66A 3ABMB 4PDRA 3LDCA 4WFGA 4PA6A 2AHYA 3CD6V 2Y69C 1AI5A 3X2QC 2EINB 1GM9A 3CCSV 4J9YB 3ZN0A 1CEZA 3CCRV 1OCRB 2YSUB 1P7BA 3ABLB 2DYRC 3OGCC 1S3JA 1VQ6V 2P67A 1VQ5V 4LCUC 2R9RB 4HAMA 1PNMA 2IJKA 4L87A 5BZBA 3CPWU 1JVMA 3OM3B 2QEXV 1P4RA 1K33A 4GX1A 3HPLC 2DW4A 2ZXWB 4MTFA 2IH3C 5KA5A 1V54B 3LDDA 2WLNA 2C2AA 3OUSA 3ZRSA 4PELA 2H8PC 1F4NA 1YSCA 1WPXA 1Q81W 1JPXA 2WAMA 4P9PA 2EIMB 2OCCC 4YXWG 1EBOA 2QTOA 3D36A 4ZKIA 4UUJC 4LC1A 4PA4A 1QR9A 3EHBB 2X6BA 2Z3YA 3K0DA 3E8HA 1OCRC 2ZXWC 5C93A 4QPKA 1ORQC 4GX2A 3CC7V 1VQ4V 2Y69B 2IW5A 4QE9A 4RUFA 2ZDIC 3RW0A 1AI7A 3GB7C 4BW5A 4JTDB 3AG1B 2EJRA 4KFMA 3VBBA 5DN6G 3CCEV 1FXVA 2XAJA 1YJWV 3F7YC 4KP4A 2Q68A 3CXCU 3STZC 3OMNB 4XDKA 3WG7C 3BY6A 3RBZA 1YI2V 1XL4A 2UXXA 2FTKA 1K8AW 1NKDA 4X89A 1K5SA 2QM7A 3ZRVA 2EILB 3AG3B 3W7UA 4H37A 1BMFG 3SYPA 2P6JA 5CBFA 4GCZA 4PDVA 1G8MA 3AG1C 2XAGA 4PA9A 4CZZA 2WLHA 2XAFA 3F5WC 3ETEA 1RM1C 2GHYA 3M99B 3CMAV 2V1DA 2WLJA 1GM7A 1CPYA 2XAHA 3ZMVA 3T1CA 1M56C 2DQ3A 2R9IA 3SPHA 1FFTB 2JJ1G 1NJIW 3B77A 3ETDA 3OE7G 1XL6A 4JYBA 4U7OA 3SYCA 3AG4B 2LFRA 2ITDC 2IU3A 3T4ZA 3P30A 2ZD9A 1S76D 1DTOA 1LNQA 2M7WA 1FXHA 2ZR3A 4P9OA 4JASA 2HKOA 2A9HA 3G4SV 1K73W 1M57C 4BAYA 3K3WA 3LSQA 3OMAB 2HFEC 2AHZA 3ABUA 1KKDA 5B1AC 2X6CA 3SPCA 4MSWC 1H8EG 1PKXA 1DF4A 2WWWA 2PI4A 3IFXA 1TUEB 4FMTA 1GM8A 1K3EA 4R6ZA 2DYRB 3T2MA 3MHSC 2IJIA 2UXNA 1EFRG 4FJCC 4GX5A 3LNMB 5CA3A 2WLLA 5EC1C 4TWKA 2EZOA 3K0GA 2H94A 1F51A 4JPRA 2KB1A 4WFBV 4N23A 1KD1W 2IJJA 3W7XA 1SESA 1YJ9V 2WPDG 1MG1A 1QVFU 3CCUV 2LP7A 3UM7A 1OHHG 1SZTA 3WG7B 4WFAV 5IY5C 1L1FA 5CMUA 1R3IC 3T4DA 2D3OW 2Q67A 4MS2A 4RO2A 2DYSB 2Q6AA 1PNKA 3K08A 3B8MA 5B1BB 4N21A 1M9NA 3LSSA 2IH1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M7W A;  1QCE A;  3B8N A;  3CYO A;  2EZO A;  1DLB A;  5KA5 A;  1Y66 A;  2P6J A;  4JPR A;  3H01 A;  1DF5 A;  4FIP C;  4N23 A;  2MK3 A;  3M99 B;  4E2L A;  4JGS A;  1MOF A;  5HFL A;  1QBZ A;  2X7R B;  1MG1 A;  1QR8 A;  5H9C A;  1I5X A;  5CN0 A;  1JPX A;  2LP7 A;  1SZT A;  5HFM A;  1DF4 A;  3MHH C;  3WFV A;  1EBO A;  5CMU A;  1JQ0 A;  2EZP A;  3B77 A;  3CP1 A;  2OT5 A;  5KA6 A;  1ENV A;  3GWO A;  1QR9 A;  4FK5 C;  3K9A A;  1F23 A;  4JF3 A;  2EBO A;  1K34 A;  3B8M A;  1I5Y A;  3MHS C;  3P30 A;  4N21 A;  1K33 A;  4FJC C;  1Y4M A;  4G2K A; 
#chains in the Genus database with same CATH topology
 1TVK A;  5B1A B;  4J7J A;  5BR8 B;  1IUR A;  2HLD G;  2WLK A;  3SYQ A;  2IM9 A;  1PPJ H;  3ABT A;  3APQ A;  3JD2 A;  2ETN A;  2IU0 A;  4DR7 B;  1N32 O;  2BTQ A;  3CRQ A;  2CTQ A;  1BE3 H;  4UXN A;  3A0H Z;  1V54 C;  4FK5 C;  1HR0 B;  3BAA A;  4DV6 B;  1F4M A;  4YHH B;  4LF8 B;  2XT9 A;  5BY1 A;  2R70 A;  3K59 A;  4I9W A;  4KL1 A;  4TSF G;  1P49 A;  3DXR B;  4I0X B;  5LOV A;  2NLJ C;  3WFV A;  2DOS A;  2D2C B;  5IYZ B;  4J10 A;  4DV7 O;  5FL7 G;  2JS5 A;  1GRJ A;  3ABM C;  4LF6 O;  2VQE B;  4G2K A;  5EBW C;  3ZRW B;  5B1O A;  1W0J G;  3CCQ V;  1KB9 F;  4TV9 A;  5LGN A;  5JH7 A;  2QR4 A;  5KMG A;  5LYJ B;  4I55 A;  3RYF A;  5A9G A;  2A06 H;  2DWE C;  2PUS A;  5CBG A;  1GO3 F;  1ZX3 A;  2IJH A;  3K5N A;  4FM1 A;  1RFY A;  4IGG A;  4K8X A;  4LFA O;  4WF9 V;  1K7D A;  3J81 N;  2CK3 G;  1ZLZ A;  4UVB A;  5L3D A;  1JR9 A;  2FB5 A;  1WNS A;  3ZCC A;  4ZHQ B;  3JYC A;  2HVJ C;  1SQQ H;  1D5A A;  1R3K C;  2LFS A;  4NTX A;  1DGS A;  2Q8V A;  3UO3 A;  1T5E A;  2VWK A;  1R73 A;  4DUZ B;  2BSK A;  1K92 A;  2CTW A;  2A7W A;  3G80 A;  3DC5 A;  5LHH A;  4DV6 O;  2OTJ V;  1NR7 A;  3RWR D;  1WP8 A;  2P4K A;  4J41 A;  2QE7 G;  4LFB B;  5TIS Z;  1Q8I A;  4NYK A;  4FPP A;  4DUY B;  3C3T A;  5IJ0 B;  3I55 V;  4IIJ A;  3E35 A;  3FB8 C;  4BW9 A;  2OWO A;  2QWN B;  3OMI B;  4JI2 B;  5IWA B;  4NTY A;  3MD0 A;  1FYJ A;  2NR5 A;  2P90 A;  2PGG A;  1B3Q A;  3ABK C;  3FYE B;  2VS0 A;  1N34 B;  2BCC H;  4X1Y B;  4YIO A;  4K0K B;  4JYC A;  4CC5 A;  4CS2 A;  3AEI A;  4C7U A;  2F93 B;  1H8H G;  3QVN A;  1YIJ V;  3OAA G;  1U97 A;  4XDL A;  5CN0 A;  3THO A;  1SQX H;  3VQW A;  3AG2 B;  1YEW A;  2RDC A;  3ASN C;  1AIL A;  1FXK A;  3OD4 A;  1P84 F;  4LF6 B;  3BEH A;  4QJF B;  2QM4 A;  4MVM A;  4OX9 B;  3E86 A;  4YJ3 A;  1BS3 A;  3A0R A;  1D2D A;  4O4I B;  1QQC A;  2ZIO A;  3VQY A;  4WFE A;  5LBQ A;  3ZN1 A;  4GYC B;  1VQ9 V;  5H2F Z;  5J2T A;  1MAB G;  1XNQ B;  1GN4 A;  4GKJ O;  3L9D A;  2X0L A;  3OTO B;  3GVM A;  1K97 A;  2DYS C;  4DR5 B;  4UVA A;  1O9G A;  3QG5 A;  1AR4 A;  5CA1 B;  1GTO A;  4NVP A;  3T1H B;  3ZBH A;  1I0H A;  3B8N A;  1N36 O;  1B6Q A;  5B3S C;  2X6A A;  2EIN C;  2HHH B;  1VF7 A;  2BOC C;  2QKS A;  5JQG A;  3CCM V;  3RVZ A;  3RVY A;  1SET A;  4Q6G A;  2LW1 A;  1AJN A;  3H9V A;  1HR0 O;  3W7S A;  4R50 A;  4YJ2 B;  2GUZ B;  3FKS G;  3ML0 A;  1VQK V;  2ATK C;  2P7T C;  2JS3 A;  5LHG A;  3L71 H;  1YIT V;  3HKB A;  1Q7Y W;  4DYL A;  5KAF Z;  1QLE C;  1AP5 A;  1ARO P;  4JI2 O;  5LHI A;  4H13 B;  4MVZ A;  4BR6 A;  3SYO A;  3FB6 C;  5GON B;  4AHC A;  1Q82 W;  3GWO A;  2ZM6 B;  3JD0 A;  5KHG A;  2ZCE A;  3UCS C;  4LNU B;  3CSX A;  4JI6 B;  3SPI A;  2FML A;  4PDL A;  1RP3 B;  4UFZ A;  3L70 H;  4JV5 O;  3OEE G;  1I94 B;  4I5S A;  4FVM A;  2QGN A;  4G28 B;  3P3P A;  1JCH A;  4DW0 A;  1EZV H;  3T1Y B;  3M8A A;  3I56 V;  1GKF A;  5D5P A;  3K5O A;  2L6L A;  5DEC A;  2F66 C;  4OXS A;  4JI3 O;  3JAW B;  2YIB D;  5IY5 B;  1DLB A;  5FPR A;  4PDR A;  1KBH A;  2AHY A;  1H2N A;  4J80 A;  2FKX A;  2VQF O;  3CRR A;  1OCR B;  2ZE8 A;  4JZG A;  5JCO C;  1VQ6 V;  4I4T A;  3DC6 A;  3CPW U;  1YZB A;  3OM3 B;  3HKC A;  2QEX V;  1K33 A;  4GX1 A;  4J42 A;  5KA5 A;  5K1P A;  1CXZ B;  3OUS A;  2LJ2 A;  4B3S O;  4PEL A;  2E75 B;  2Q7G A;  3D8C A;  4JAA A;  1QU7 A;  4FLT A;  2DMX A;  2OCH A;  3TGU H;  1NTZ H;  4LC1 A;  3ZHT A;  1N32 B;  3U0Z A;  3EHB B;  4B3T O;  2N74 A;  5CB4 B;  2Z3Y A;  1OCR C;  1S5J A;  1WAZ A;  1VQ4 V;  3ZED A;  4B7E A;  1FFX A;  1FXV A;  3STZ C;  3OMN B;  3BY6 A;  4B08 A;  4IL6 Z;  4LFB O;  2GDS A;  4KHP O;  3BRC A;  3ZRV A;  3K57 A;  2EIL B;  3RYH A;  3AG3 B;  4DV1 O;  5CBF A;  4FLV A;  5CA0 A;  4PA9 A;  4CZZ A;  1XMO B;  3Q4H B;  1BGY H;  1URF A;  1GM7 A;  5LMU O;  1FFT B;  4IHJ B;  3HKE A;  4UCV A;  4D7S A;  3SYC A;  1FAF A;  2F1M A;  3T4Z A;  4TV8 A;  1HDJ A;  5J2U A;  1AP6 A;  2UU9 B;  2UUB B;  2ZR3 A;  3ZHS A;  2HKO A;  3G4S V;  4X20 B;  3D3Q A;  1HNX B;  3B2E E;  1KKD A;  2UXB O;  2AZ0 A;  4MSW C;  1H8E G;  1SKV A;  2PTM A;  1NS1 A;  4X65 O;  3IAY A;  1GM8 A;  2KG7 A;  4JI7 B;  5KAI Z;  5LP6 A;  3MHS C;  2YIB A;  2Y0I A;  2EZO A;  3FAV B;  3K0G A;  3MAQ A;  3H1I H;  2KB1 A;  2IJJ A;  4D6T H;  2GUZ A;  3W7X A;  5H5N A;  4DUZ O;  1B04 A;  3JSL A;  3CCU V;  2DN9 A;  5LL6 Y;  3T4D A;  1BZK A;  2CH7 A;  4FLW A;  4K0K O;  1G6U A;  2UXC O;  3CX5 F;  4RO2 A;  2DYS B;  3K08 A;  1XQ8 A;  3C3S A;  2EIJ C;  1US6 A;  2ILM A;  4DXW A;  3N2G B;  4OPA A;  5E1A C;  1JOY A;  2MW2 B;  4YJ2 A;  4X20 A;  3CCV V;  2GTA A;  2OT5 A;  1ROP A;  3RYI A;  5K1X A;  1UJW B;  2ZE7 A;  3CRA A;  3PJS K;  1N4C A;  3RFR A;  3AG2 C;  4JI7 O;  1TUB A;  4J9Z B;  4TOI A;  4E2L A;  1JMK C;  1EN6 A;  1I5X A;  2BTQ B;  2DQ0 A;  3JAT A;  1K4C C;  1YTF D;  3JD1 A;  4EB6 B;  4TQF A;  2Q9L A;  3K5M A;  1VQ7 V;  1M4U A;  4LWS A;  1WP7 A;  3ZMZ A;  1N36 B;  2OTL V;  1GN6 A;  4IT5 A;  4UCU A;  4DR4 B;  5BMV A;  3ZX6 A;  5IJ9 A;  3JSN A;  1BT8 A;  5DM6 V;  3JAM N;  3NR7 A;  1QBZ A;  4FM2 A;  1QHT A;  4JYA B;  2UUA O;  2LO1 A;  3RN4 A;  3F7V C;  2PY5 A;  4RUE A;  2EZP A;  2K9P A;  4DV1 B;  1R3J C;  2ZDI A;  3TCU A;  2HHH O;  4LF7 O;  4DV4 O;  3JD3 A;  3L72 H;  5KHK A;  4R8C A;  5KUM A;  3E8G A;  4YIP A;  4FM0 A;  2YIC A;  1TUB B;  1J95 A;  3H1K H;  1FS0 G;  4MVO A;  2UXD O;  4CBC A;  3QO5 A;  1FFX B;  4LH7 A;  1WA8 B;  1HNW B;  2UUC O;  3O65 A;  4MW3 A;  1KP3 A;  1Z5W A;  4RQE A;  1XDC A;  4ICG A;  4F6E A;  4FIP C;  1IBL B;  2P5O A;  4PD4 F;  4MTG A;  2LGW A;  1K5Q A;  3ZRX A;  1EN5 A;  4LF9 O;  4NXN B;  4PI2 A;  1N0N A;  4W4K A;  4JI4 B;  2XND G;  3K04 A;  3HR0 A;  3AK2 A;  3Q4H A;  1EZJ A;  1S72 V;  4TV9 B;  2E5L B;  5IJ0 A;  1JFF A;  4DV0 B;  1XIL A;  5B66 Z;  5EBM C;  2VQF B;  3ZHR A;  1OCC B;  4HZ3 A;  4GKJ B;  3BCC H;  2OIG A;  3BHP A;  2YDE A;  2YEV B;  4U3J B;  2RCV A;  4UV8 A;  4DV2 O;  3W7T A;  5EYP A;  4O4L A;  1SF9 A;  3SYA A;  2XTA A;  3MHH C;  4QGP A;  1H2S B;  4G27 B;  3U10 A;  2WLI A;  3CEI A;  3C90 A;  2KQX A;  1IDS A;  3UO2 A;  3STL C;  2JDI G;  5H6Q A;  4X66 O;  3SPG A;  2BSK B;  1KYO F;  1OCO B;  2KG7 B;  1OJH A;  1V9P A;  5LP6 B;  2AW9 A;  2BOB C;  3G6E V;  3OR7 C;  1IBK B;  4TV8 B;  1M56 B;  3BAB A;  5D5Q A;  4WCE V;  5B1B C;  4MTX A;  2RN9 A;  3D3I A;  3CJH B;  1NVP B;  4X62 O;  4H33 A;  3ZJZ A;  1K34 A;  1R6N A;  2EIJ B;  3OR6 C;  5L3C A;  4PDM A;  4ASU G;  1Q90 D;  3CYO A;  3AK3 A;  5LOV B;  5B5E Z;  1WJZ A;  3ZMS A;  3EFF K;  1BQZ A;  3OGI B;  4AIL C;  3JAR B;  5LXT A;  1R3L C;  4UCS A;  1B06 A;  3U11 A;  4FZ0 A;  1FD9 A;  4J7K A;  1GK9 A;  1KC8 W;  1OV9 A;  1SRY A;  1W59 A;  4PA7 A;  2LGQ A;  2CUG A;  3ZS8 C;  4K8Z A;  4K3A A;  5IE9 A;  2JEX A;  3E22 B;  4TUY B;  3LUT B;  1EN4 A;  2OCC B;  2AGA A;  1XBL A;  1NVP D;  2ZQM A;  1NR1 A;  1SC5 B;  1H38 A;  2JK5 C;  2R9A A;  3JAT B;  2W6I G;  4X62 B;  2ZIM A;  3TET A;  1DK1 A;  4LFC O;  1FJG O;  1YHQ V;  1DF5 A;  1M90 W;  3RYI B;  3JAK B;  1NQT A;  1VMG A;  2GTS A;  1NI8 A;  1JJ2 U;  1XNR B;  1MMM A;  1IXB A;  1R6T A;  5L3B A;  3KG2 A;  3K06 A;  3E8B A;  4JI8 B;  4IIJ B;  3J7A U;  4DV7 B;  4JZ2 A;  4ZOL A;  2YI9 A;  3AG3 C;  1V55 B;  4OX9 O;  5BXZ A;  3LDC A;  4WFG A;  3SJA C;  2YI8 A;  3CD6 V;  2Y69 C;  3X2Q C;  2EIN B;  1GM9 A;  4PV1 B;  4I7Z B;  1AR5 A;  4B3S B;  1KKC A;  2ODM A;  1P7B A;  1S3J A;  4TQD A;  1VQ5 V;  1PNM A;  4L87 A;  5GON A;  2P06 A;  5ITZ B;  3OTF A;  1V54 B;  4I4T B;  1JJO A;  3QTC A;  1WPX A;  2OCC C;  1MA1 A;  5FNV B;  2QTO A;  4UUJ C;  4DR3 O;  1QR9 A;  4U3F H;  4X66 B;  4NB5 A;  4ZI7 A;  4UCT A;  4I9Q A;  2OYQ A;  3E8H A;  5J2T B;  1VF6 C;  4QPK A;  2KSD A;  1PM9 A;  1VIB A;  4QE9 A;  2IW5 A;  2GV9 A;  4BW5 A;  1JFF B;  3K9S A;  2EJR A;  4IYH A;  5GTI Z;  5CB4 A;  3F7Y C;  3CXC U;  3BA8 A;  4X1I B;  3IC9 A;  3RBZ A;  1YI2 V;  4PHZ A;  2FTK A;  1NKD A;  3WB0 A;  3SGI A;  2QM7 A;  4ABM A;  1I08 A;  3W7U A;  3JAS A;  2JGD B;  2F4V O;  5C8Y A;  3M99 B;  2V1D A;  2NN4 A;  1XNR O;  1Y76 A;  3T1C A;  2R9I A;  3RYH B;  2JJ1 G;  4ZHQ A;  1NJI W;  3B77 A;  2UXB B;  3OE7 G;  1NU1 H;  1TA8 A;  2LFR A;  2IU3 A;  4CH3 A;  1S76 D;  1DTO A;  1LNQ A;  1FXH A;  4HNA B;  3PN1 A;  4P9O A;  1M57 C;  4BAY A;  1TAE A;  3AK1 A;  3CWB H;  3WB1 A;  1PKX A;  3VQV A;  3IFX A;  3JAL A;  4FMT A;  2QWO B;  1K3E A;  2GBO A;  3JAR A;  5LXT B;  2UXN A;  1EFR G;  5CA3 A;  2WLL A;  1N33 O;  4UB6 Z;  1F51 A;  1JA8 A;  4WFB V;  4UB8 Z;  3CJH A;  1YJ9 V;  4FFB A;  1RSO B;  1PP9 H;  1TVK B;  3UM7 A;  5IY5 C;  5CMU A;  4I50 A;  2YUA A;  4JI1 B;  4AQY B;  4TUY A;  3SDL A;  3B8M A;  2ZNJ A;  1VQM V;  1FXK B;  1YF2 A;  2XOK G;  3QF7 A;  4D7T A;  4GUN A;  1MOF A;  1WLE A;  3WB2 A;  3WU2 Z;  1WPB A;  4BIZ A;  4PI0 A;  1VQP V;  4K35 A;  1I94 O;  3TK1 A;  3UT5 B;  1IX9 A;  1Q43 A;  4DR4 O;  5JVD B;  2WA4 A;  1N33 B;  1LUV A;  3SJQ C;  3DXR A;  3H1L H;  4I0X A;  1IXM A;  4BIO A;  3JAL B;  1OCZ B;  3CME V;  2CGN A;  5IT9 N;  3E89 A;  1Q6I A;  4RWU A;  3ASN B;  1KMI Z;  4IYI A;  3TXQ A;  2ZR2 A;  4DR6 B;  1XUQ A;  2YID A;  3R66 A;  1NBM G;  3K9A A;  4LF4 B;  3OW2 U;  3FB5 C;  5LYJ A;  4KUM A;  3P32 A;  3CC2 V;  4LF4 O;  3RYF B;  1GN3 A;  1S5H C;  2WA3 A;  3DGE A;  1YXB A;  3ZIA G;  4EEQ A;  1VQL V;  4MVU A;  1H2G A;  2RNB A;  3GWK C;  2RQ6 A;  2B5U A;  1XHX A;  5B1N A;  3N2K B;  2B9Z A;  2E76 B;  2XAS A;  1Y67 A;  3SR2 C;  4I55 B;  1GAX A;  2HG5 C;  4DK0 A;  2YIA A;  3H1J H;  3ZMT A;  4B3R B;  3D36 C;  1XI1 A;  5HFM A;  3M7M X;  3QO8 A;  1R6K A;  2E3C A;  2QJ1 A;  3EVK A;  2UXC B;  2LW7 A;  1SA0 B;  4GX0 A;  5FPO A;  3BPZ A;  5E79 Z;  3H01 A;  3KZI Z;  4MVR A;  1NZ6 A;  1PNL A;  1PD3 A;  1V55 C;  1M5I A;  1VQO V;  1NH2 D;  1O9H A;  4FZ1 A;  1SZX A;  4NXM O;  4DRX A;  3JCU Z;  1GH6 A;  4QIW F;  4NXN O;  4X88 A;  3JD4 A;  4UCO A;  1E1Q G;  3ASO C;  4NTW A;  1XMO O;  1K9M W;  4J11 A;  1IBL O;  4X1Y A;  2QKA A;  1F7Y A;  5LMN O;  5GW7 A;  1BL8 A;  2EBO A;  4UVC A;  5GTH Z;  5C8Y B;  1Z2G A;  5JJE B;  1VF5 B;  1W0K G;  2OIE A;  1Q6U A;  1QLE B;  3B09 A;  4CH6 A;  4MTO A;  2HVK C;  3FYI B;  3G6B A;  2V7Q G;  1JX9 A;  4DR1 B;  4JV5 B;  1COW G;  1NH2 B;  2A0L A;  1RPR A;  4O4J A;  4JI6 O;  5KX5 A;  3OEH G;  3A8T A;  3QNE A;  1SS3 A;  3IC7 A;  4EFB A;  1SQP H;  1VQN V;  2YXL A;  2YXY A;  4UCR A;  1FPO A;  5B3S B;  3L73 H;  5L3E A;  3ZHQ A;  1XHZ A;  3P3N A;  2Q4P A;  2A3Q A;  3CHX A;  1JQ0 A;  1M93 A;  2YEV A;  4YY3 O;  4XBF A;  2QA4 V;  3ZRW A;  1F23 A;  5EYP B;  3W7W A;  1QLN A;  3CCL V;  3H1H H;  5KHJ A;  2W6J G;  5KMG B;  1QVG U;  4JTC B;  1SQG A;  2ZNI A;  3FX7 A;  4CS3 A;  4LBE C;  3CS5 A;  3E83 A;  2B1I A;  5EBL C;  3HB3 B;  4LH6 A;  4LFA B;  1GMG A;  2Y4T A;  1N8R W;  1SER A;  4YHH O;  4LF8 O;  1AJQ A;  2HEP A;  1IZ3 A;  1OCO C;  1R1B A;  5CBH A;  4WFF A;  3UT5 A;  4MVQ A;  2CTP A;  4DR1 O;  1OCC C;  1ZTE A;  4KXR A;  1L8D A;  1KU9 A;  2ZKO A;  4PA3 A;  3BVO A;  3X2Q B;  1D5N A;  3RYC B;  1NTK H;  1ZWI C;  2Q5Z A;  2XAQ A;  1WN7 A;  2Q73 A;  3LSU A;  2VQE O;  1RM1 B;  4J7Z A;  5LA6 B;  1HP8 A;  3K03 A;  3SJB C;  4JI0 B;  5EK0 A;  1S77 D;  1MZE A;  1Y66 A;  3ABM B;  5FLX N;  4X64 O;  2O57 A;  3L74 H;  1AI5 A;  3CCS V;  1VF6 A;  1VP7 A;  2ADQ B;  1XRE A;  4O2B A;  1J5E O;  2YSU B;  3N2G A;  4ZOL B;  4LCU C;  2CDY A;  4HAM A;  4OPH A;  1JVM A;  1IBM B;  2ZIN A;  1IVS A;  2DW4 A;  2ZXW B;  3LDD A;  2WLN A;  2YS8 A;  2C2A A;  3ZRS A;  2H8P C;  3A0B Z;  1YSC A;  3HKD B;  5KHI A;  1EBO A;  3D36 A;  4W4L A;  2UU9 O;  2UUB O;  2X6B A;  5A2Q N;  5C93 A;  1ORQ C;  3CC7 V;  4RUF A;  3RW0 A;  3GB7 C;  2BE3 A;  4JTD B;  2EUL A;  3CCE V;  1YJW V;  3RT3 C;  4XDK A;  2E74 B;  1NT2 B;  4CC6 A;  2JVD A;  2UXX A;  3ETQ A;  1SQF A;  1K5S A;  4FLZ A;  4O2B B;  3OT7 A;  4LF5 O;  1BMF G;  1HNW O;  3SYP A;  2P6J A;  4JI5 O;  2XAG A;  4DW1 A;  2WLH A;  1RM1 C;  2GHY A;  3CMA V;  2WLJ A;  2XAH A;  1M56 C;  1Y74 B;  3ETD A;  4OGQ B;  2LQT A;  1PL4 A;  5LP6 C;  1Z5V A;  1XMQ O;  2ZE5 A;  4B3T B;  4JAS A;  1K73 W;  2L35 A;  2E5L O;  3K3W A;  3LSQ A;  3OMA B;  3RGB A;  1VEW A;  3ABU A;  4FLY A;  1AVM A;  2Q7H A;  2X6C A;  3FAV A;  1I7F A;  2P4V A;  4LNU A;  4Z1V A;  1TUE B;  1U96 A;  2AZ2 A;  1IBM O;  1NTM H;  2DYR B;  2W0X A;  2CH7 B;  2QSA A;  1X59 A;  4KHP B;  4JPR A;  2CTR A;  1XNQ O;  4N23 A;  4B3R O;  1SES A;  1MG1 A;  2VRZ A;  4LFC B;  1HW7 A;  1FJG B;  2LP7 A;  3WG7 B;  1OHH G;  1SZT A;  1XEQ A;  1R3I C;  2D3O W;  2Q67 A;  2Z0A A;  2Q7E A;  3BA9 A;  5B1B B;  1Y74 A;  4N21 A;  2M6Y A;  4AQY O;  3LSS A;  2EIK B;  4FLX A;  4LF7 B;  2Y48 A;  3N27 A;  2B1G A;  4JYA O;  1FKA O;  4F4L A;  3CRM A;  3TXS A;  2WSS G;  3OTO O;  4YJ3 B;  1ZL8 B;  1HNX O;  1YCI A;  4DR2 B;  4DV5 B;  3ETG A;  2IBZ H;  1VQ8 V;  3AG4 C;  3OFN G;  4U7N A;  1PL0 A;  1M57 B;  4JAU A;  5L3F A;  3UKM A;  2PZS A;  3ASO B;  3RYC A;  4CS4 A;  5FNV A;  1MSW D;  4GT1 A;  3K79 A;  4PJ0 Z;  2UXD B;  4DR6 O;  5JVD A;  3B4S A;  1Q5O A;  1QR8 A;  3OUF A;  2ARH A;  1AI6 A;  2EIK C;  5EIB D;  2PF4 E;  4O2A B;  3IJ4 A;  2W0F C;  4B3M O;  4JI0 O;  1YDX A;  1RPO A;  5J9P C;  4HBN A;  2VWJ A;  3IGA C;  2XUM A;  3VOU A;  2UUC B;  1QCE A;  1AI4 A;  2JIZ G;  1YTF B;  4BIU A;  4MW8 A;  4LF9 B;  2ITC C;  2K1E A;  4X8A A;  2EJ7 A;  2YXH A;  3DTU B;  5LA6 A;  1KQS U;  4UV9 A;  4ZBM A;  1ZUQ A;  5EIB C;  3JCZ A;  2HJF C;  2JGD A;  2ZE6 A;  1BQ0 A;  1MNG A;  3R65 A;  1Y4M A;  4BWA A;  1Y76 B;  1WA8 A;  4MVS A;  1BHA A;  4WFH A;  4IHJ A;  1MSD A;  4DR2 O;  2PYJ A;  2QWR B;  2FYU H;  5HFL A;  1S0V A;  3SPJ A;  1LUW A;  4B7K A;  3SJC C;  4DV3 O;  3L75 H;  4H0L B;  2HP8 A;  4NXM B;  2DE0 X;  4HNA A;  2QWQ B;  3F5T A;  1BHB A;  3AG7 A;  3G71 V;  1H2K A;  3CRC A;  5IDJ A;  5L3G A;  4JF3 A;  2N04 A;  3ABL C;  1I5Y A;  1P7G A;  1H2M A;  4F6R A;  1W2B U;  3E2E A;  3FB7 C;  4CH4 A;  1M1K W;  4Z1M G;  2P22 C;  1OZ0 A;  4MT8 A;  4FFK A;  4B3M B;  1BSM A;  4JGS A;  4HYO A;  3JAW A;  4RAI A;  1BCC H;  5KUK A;  1HNZ B;  3CP1 A;  4DK1 A;  3CE2 A;  3ZMU A;  4NR1 A;  1N34 O;  1EM1 A;  5JQG B;  1UFI A;  5KHH A;  5IYD O;  4I50 B;  1G4Y B;  1J5E B;  2BTO A;  4EFE A;  2X7R B;  2F4V B;  5H9C A;  1OCZ C;  5BR8 O;  5ITZ A;  3T1H O;  4QNH B;  1ENV A;  4DRX B;  3FD9 A;  2RJZ A;  2HJD A;  2Q0A A;  2R72 A;  5EC2 C;  4U3J A;  2AXT Z;  4ZIB A;  2Q69 A;  3MDS A;  4JI1 O;  2ZT9 B;  3S3X A;  3QO7 A;  4O4L B;  4TT3 G;  1AR1 B;  1AJP A;  1G1X B;  2JEU A;  2WLI B;  5CA1 A;  3S3W A;  4JAV A;  2JJ2 G;  3CC4 V;  3KCY A;  2QDO A;  4P2Z A;  4R7C A;  1ZSP A;  4JYY A;  2NNU A;  2WLM A;  1KP2 A;  1WB7 A;  1FXK C;  2GSM B;  1CP9 A;  4X1I A;  4RQF A;  2EIL C;  5IYB O;  5LMU B;  2MK3 A;  4O4J B;  4LP8 A;  4Q20 A;  4LWS B;  2F23 A;  5KX5 B;  3NXS A;  4P30 A;  1E79 G;  3HKB B;  5CA0 B;  4DV2 B;  1XMQ B;  1MZF A;  1TGO A;  2A79 B;  2JGU A;  1H2L A;  5BMV B;  2PI5 A;  1XOU A;  5DED A;  4YY3 B;  2V4D A;  1LR1 A;  4X1K B;  3EXA A;  2RMK B;  3N2K A;  2G38 A;  1WB8 A;  2F95 B;  1UPG A;  5LGT A;  4JI4 O;  1YJN V;  2EIM C;  3HKC B;  4Z2W A;  1KEC A;  4LR3 A;  4DO2 A;  1K4D C;  4LF5 B;  5H6R A;  3E8F A;  3FFQ A;  4QPJ A;  4GKK B;  1ZL8 A;  2Z5U A;  2PYL A;  1L0N H;  4E4E A;  1S5L Z;  1E1R G;  2DWD C;  5AG2 A;  1QNM A;  1Q86 W;  2WLL B;  3K5L A;  2HR3 A;  4XDJ A;  1HWY A;  2QM8 A;  1SA0 A;  4EKW A;  3ABK B;  5KA6 A;  1L0L H;  4FFB B;  5LGU A;  2F43 G;  3JAK A;  1THZ A;  3LDE A;  3CCJ V;  4QE7 A;  5IYC O;  3DSQ A;  4JTA B;  2ZM6 O;  2FL4 A;  4O2A A;  4PA6 A;  5IYZ A;  4X1K A;  3K58 A;  4X65 B;  4J9Y B;  3ZN0 A;  1CEZ A;  3CCR V;  4DUY O;  2JRI A;  3ABL B;  4X9Q A;  2DYR C;  3OGC C;  2P67 A;  3KCX A;  2R9R B;  3ZHU A;  2IJK A;  5BZB A;  5EZY A;  4WBN A;  1P4R A;  3CB2 A;  3HPL C;  5JH7 B;  4MTF A;  2IH3 C;  1F4N A;  1Q81 W;  2ADP A;  1JPX A;  1GN2 A;  2WAM A;  4F6R B;  2QKC A;  4P9P A;  2EIM B;  5J2U B;  1VAR A;  4YXW G;  4X64 B;  4ZKI A;  4PA4 A;  5JCO A;  3O9O A;  3A2F A;  3K0D A;  1YVW A;  3BFR A;  2ZXW C;  5LMN B;  1SQB H;  4GX2 A;  4DR5 O;  4CH5 A;  3G67 A;  2UUA B;  2Y69 B;  2ZDI C;  1AI7 A;  3KKY A;  1N0J A;  3AG1 B;  4DV3 B;  4FLU A;  3B40 A;  4KFM A;  3VBB A;  4ZI7 B;  5DN6 G;  1X4T A;  4JI5 B;  2XAJ A;  4KP4 A;  2Q68 A;  3WG7 C;  5JWP A;  4AI8 A;  1XL4 A;  2YC0 A;  1K8A W;  4O4H A;  1Q3E A;  4X89 A;  2EX3 A;  1ZAU A;  3UQ8 A;  3TJT A;  1A32 A;  4H37 A;  2QWP B;  3HKE B;  4GCZ A;  4PDV A;  1G8M A;  3AG1 C;  3ETE A;  2XAF A;  3F5W C;  5EZY B;  4WBN B;  2CE4 A;  3ZHV A;  3J80 N;  4O4I A;  3CXH F;  1CPY A;  3ZMV A;  1AB3 A;  2XHB A;  2DQ3 A;  3SPH A;  4GZR B;  1XL6 A;  3JAS B;  2CGO A;  4JYB A;  4U7O A;  3AG4 B;  3I5D A;  2ITD C;  3HKD A;  4DV4 B;  3P30 A;  4DR7 O;  3E22 A;  2ZD9 A;  5IWA O;  2KKW A;  2M7W A;  2A9H A;  1IBK O;  2HFE C;  2AHZ A;  4DR3 B;  2Q0O C;  5B1A C;  3SPC A;  1DF4 A;  2WWW A;  5KLV H;  2PI4 A;  4GLX A;  4R6Z A;  1Y6X A;  3VQX A;  1RSO A;  3T2M A;  1SQV H;  2IJI A;  3APO A;  3T1Y O;  4FJC C;  4GX5 A;  3LNM B;  2H3O A;  5EC1 C;  1PV0 A;  4TWK A;  4JI3 B;  5F2V O;  4A5U B;  2H94 A;  2DJV A;  4O4H B;  4DV5 O;  4H44 B;  4EB6 A;  1HNZ O;  2Y0P A;  1KD1 W;  2N05 A;  2WPD G;  3LNN A;  1QVF U;  2CAZ C;  4WFA V;  1KUQ A;  1L1F A;  4L8J A;  5JJN B;  4JI8 O;  4GKK O;  4MS2 A;  2QTS A;  4NKG B;  5IJ9 B;  1Q6H A;  2Q6A A;  4DV0 O;  1PNK A;  1M9N A;  3ICX A;  2Y4U A;  5JJJ B;  2IH1 C; 
#chains in the Genus database with same CATH homology
 2EIK B;  1VQM V;  2EIJ C;  5B1A B;  2Y48 A;  2B1G A;  1FXK B;  4DXW A;  2XOK G;  2HLD G;  2WLK A;  4F4L A;  3SYQ A;  2WSS G;  1MOF A;  5E1A C;  1JOY A;  1WLE A;  4BIZ A;  1VQP V;  3ABT A;  3CCV V;  3ETG A;  3TK1 A;  2OT5 A;  1VQ8 V;  1ROP A;  3JD2 A;  3AG4 C;  3OFN G;  4U7N A;  2IU0 A;  1UJW B;  3SJQ C;  1PL0 A;  1M57 B;  4UXN A;  1V54 C;  3PJS K;  1IXM A;  4FK5 C;  3AG2 C;  4JAU A;  5L3F A;  3UKM A;  1F4M A;  1OCZ B;  4J9Z B;  3CME V;  3ASO B;  1MSW D;  4GT1 A;  3K79 A;  3E89 A;  4I9W A;  4E2L A;  3ASN B;  1QR8 A;  4TSF G;  1I5X A;  2DQ0 A;  3OUF A;  1AI6 A;  2EIK C;  2ZR2 A;  1K4C C;  1YTF D;  2NLJ C;  3JD1 A;  3WFV A;  2W0F C;  1NBM G;  3K9A A;  3OW2 U;  5FL7 G;  1VQ7 V;  3FB5 C;  1RPO A;  5J9P C;  4KUM A;  3P32 A;  3ZMZ A;  3CC2 V;  3ABM C;  2OTL V;  3IGA C;  4G2K A;  5EBW C;  3VOU A;  1QCE A;  1AI4 A;  2JIZ G;  1S5H C;  3DGE A;  3ZRW B;  1YTF B;  3ZIA G;  1VQL V;  5B1O A;  1W0J G;  4BIU A;  4MW8 A;  2ITC C;  4MVU A;  3CCQ V;  5DM6 V;  2K1E A;  4X8A A;  1H2G A;  1QBZ A;  5LGN A;  3DTU B;  1KQS U;  2B5U A;  5B1N A;  3F7V C;  4RUE A;  2EZP A;  4UV9 A;  5CBG A;  2DWE C;  4ZBM A;  1GO3 F;  3JCZ A;  2IJH A;  2HJF C;  1R3J C;  3R65 A;  2ZDI A;  1K7D A;  3TCU A;  4WF9 V;  2XAS A;  1Y4M A;  3JD3 A;  2CK3 G;  4UVB A;  4R8C A;  5L3D A;  4MVS A;  1BHA A;  4WFH A;  3ZCC A;  3JYC A;  2HVJ C;  2HG5 C;  5KUM A;  1R3K C;  3E8G A;  2LFS A;  5HFL A;  1S0V A;  3SPJ A;  3ZMT A;  1J95 A;  1R73 A;  1FS0 G;  4MVO A;  5HFM A;  4CBC A;  3QO5 A;  1K92 A;  3QO8 A;  1R6K A;  5LHH A;  1BHB A;  3G71 V;  2OTJ V;  5IDJ A;  5L3G A;  1NR7 A;  4JF3 A;  3ABL C;  4MW3 A;  1KP3 A;  1I5Y A;  4RQE A;  2QE7 G;  4GX0 A;  4FPP A;  1W2B U;  3FB7 C;  3E2E A;  3H01 A;  4FIP C;  1M1K W;  4Z1M G;  1OZ0 A;  4MT8 A;  4MVR A;  4JGS A;  3I55 V;  4HYO A;  1PNL A;  3E35 A;  3FB8 C;  4RAI A;  1PD3 A;  1V55 C;  4MTG A;  1K5Q A;  3OMI B;  3ZRX A;  5KUK A;  1VQO V;  2XND G;  3K04 A;  3CP1 A;  3MD0 A;  1NH2 D;  1EZJ A;  3ZMU A;  2P90 A;  1S72 V;  3ABK C;  3FYE B;  5EBM C;  5IYD O;  1OCC B;  4HZ3 A;  1G4Y B;  4QIW F;  4JYC A;  2YEV B;  3AEI A;  4X88 A;  1H8H G;  4UV8 A;  2X7R B;  3JD4 A;  1YIJ V;  5H9C A;  1E1Q G;  3OAA G;  3ASO C;  4XDL A;  1OCZ C;  5CN0 A;  3W7T A;  3SYA A;  3AG2 B;  1K9M W;  3MHH C;  4QNH B;  1ENV A;  4G27 B;  2WLI A;  3ASN C;  1FXK A;  5EC2 C;  5GW7 A;  1BL8 A;  2EBO A;  4UVC A;  3BEH A;  2JDI G;  3STL C;  5H6Q A;  4QJF B;  4MVM A;  3E86 A;  2Q69 A;  3A0R A;  3SPG A;  1OCO B;  3QO7 A;  1W0K G;  4TT3 G;  4WFE A;  5LBQ A;  1AR1 B;  1QLE B;  1AJP A;  2JEU A;  2HVK C;  3FYI B;  2WLI B;  4MTO A;  3ZN1 A;  2BOB C;  3G6E V;  1VQ9 V;  2V7Q G;  1JX9 A;  2JJ2 G;  4JAV A;  3OR7 C;  3CC4 V;  1COW G;  1MAB G;  1M56 B;  4WCE V;  4P2Z A;  4R7C A;  5B1B C;  2X0L A;  1NH2 B;  4MTX A;  2A0L A;  1K97 A;  2DYS C;  2NNU A;  1RPR A;  3D3I A;  1NVP B;  2WLM A;  4H33 A;  1KP2 A;  4UVA A;  3ZJZ A;  1K34 A;  1R6N A;  1FXK C;  2GSM B;  1CP9 A;  1GTO A;  2EIJ B;  3OEH G;  3OR6 C;  5L3C A;  4PDM A;  4RQF A;  4ASU G;  3B8N A;  3CYO A;  1B6Q A;  5B3S C;  2EIL C;  2EIN C;  2X6A A;  3QNE A;  3IC7 A;  3ZMS A;  3EFF K;  5IYB O;  1VQN V;  2MK3 A;  2BOC C;  2QKS A;  4LP8 A;  4Q20 A;  5B3S B;  3CCM V;  3NXS A;  4P30 A;  1R3L C;  5L3E A;  3RVZ A;  1E79 G;  3RVY A;  1SET A;  1AJN A;  1JQ0 A;  2YEV A;  3W7S A;  4R50 A;  2A79 B;  4XBF A;  2QA4 V;  2PI5 A;  3ZRW A;  1F23 A;  1GK9 A;  3W7W A;  3FKS G;  1KC8 W;  1QLN A;  3ML0 A;  3CCL V;  1VQK V;  1SRY A;  2W6J G;  2ATK C;  2P7T C;  1QVG U;  4JTC B;  5LHG A;  1YIT V;  4PA7 A;  1Q7Y W;  1QLE C;  1ARO P;  4LBE C;  5LHI A;  2JEX A;  3E83 A;  3LUT B;  4MVZ A;  5LGT A;  1YJN V;  3SYO A;  2EIM C;  2OCC B;  3FB6 C;  1KEC A;  2B1I A;  5EBL C;  1Q82 W;  3HB3 B;  1NVP D;  2ZQM A;  4DO2 A;  1K4D C;  3GWO A;  1GMG A;  1NR1 A;  3JD0 A;  5H6R A;  1H38 A;  2JK5 C;  3E8F A;  1N8R W;  1SER A;  1AJQ A;  2W6I G;  4QPJ A;  1OCO C;  5CBH A;  3SPI A;  2Z5U A;  3TET A;  1YHQ V;  4PDL A;  4WFF A;  1DF5 A;  1M90 W;  2DWD C;  1E1R G;  1NQT A;  4MVQ A;  1OCC C;  3OEE G;  1Q86 W;  2WLL B;  4I5S A;  2HR3 A;  4XDJ A;  4G28 B;  1HWY A;  1JJ2 U;  2QM8 A;  4PA3 A;  1JCH A;  4EKW A;  3ABK B;  3X2Q B;  5KA6 A;  1ZWI C;  2XAQ A;  3I56 V;  1GKF A;  1RM1 B;  5L3B A;  5LGU A;  3KG2 A;  2F43 G;  3E8B A;  3K06 A;  3K03 A;  1THZ A;  3LDE A;  4OXS A;  3CCJ V;  5EK0 A;  1S77 D;  4QE7 A;  5IY5 B;  5IYC O;  4JTA B;  3AG3 C;  1V55 B;  1DLB A;  1Y66 A;  3ABM B;  4PDR A;  3LDC A;  4WFG A;  4PA6 A;  2AHY A;  3CD6 V;  2Y69 C;  1AI5 A;  3X2Q C;  2EIN B;  1GM9 A;  3CCS V;  4J9Y B;  3ZN0 A;  1CEZ A;  3CCR V;  1OCR B;  2YSU B;  1P7B A;  3ABL B;  2DYR C;  3OGC C;  1S3J A;  1VQ6 V;  2P67 A;  1VQ5 V;  4LCU C;  2R9R B;  4HAM A;  1PNM A;  2IJK A;  4L87 A;  5BZB A;  3CPW U;  1JVM A;  3OM3 B;  2QEX V;  1P4R A;  1K33 A;  4GX1 A;  3HPL C;  2DW4 A;  2ZXW B;  4MTF A;  2IH3 C;  5KA5 A;  1V54 B;  3LDD A;  2WLN A;  2C2A A;  3OUS A;  3ZRS A;  4PEL A;  2H8P C;  1F4N A;  1YSC A;  1WPX A;  1Q81 W;  1JPX A;  2WAM A;  4P9P A;  2EIM B;  2OCC C;  4YXW G;  1EBO A;  2QTO A;  3D36 A;  4ZKI A;  4UUJ C;  4LC1 A;  4PA4 A;  1QR9 A;  3EHB B;  2X6B A;  2Z3Y A;  3K0D A;  3E8H A;  1OCR C;  2ZXW C;  5C93 A;  4QPK A;  1ORQ C;  4GX2 A;  3CC7 V;  1VQ4 V;  2Y69 B;  2IW5 A;  4QE9 A;  4RUF A;  2ZDI C;  3RW0 A;  1AI7 A;  3GB7 C;  4BW5 A;  4JTD B;  3AG1 B;  2EJR A;  4KFM A;  3VBB A;  5DN6 G;  3CCE V;  1FXV A;  2XAJ A;  1YJW V;  3F7Y C;  4KP4 A;  2Q68 A;  3CXC U;  3STZ C;  3OMN B;  4XDK A;  3WG7 C;  3BY6 A;  3RBZ A;  1YI2 V;  1XL4 A;  2UXX A;  2FTK A;  1K8A W;  1NKD A;  4X89 A;  1K5S A;  2QM7 A;  3ZRV A;  2EIL B;  3AG3 B;  3W7U A;  4H37 A;  1BMF G;  3SYP A;  2P6J A;  5CBF A;  4GCZ A;  4PDV A;  1G8M A;  3AG1 C;  2XAG A;  4PA9 A;  4CZZ A;  2WLH A;  2XAF A;  3F5W C;  3ETE A;  1RM1 C;  2GHY A;  3M99 B;  3CMA V;  2V1D A;  2WLJ A;  1GM7 A;  1CPY A;  2XAH A;  3ZMV A;  3T1C A;  1M56 C;  2DQ3 A;  2R9I A;  3SPH A;  1FFT B;  2JJ1 G;  1NJI W;  3B77 A;  3ETD A;  3OE7 G;  1XL6 A;  4JYB A;  4U7O A;  3SYC A;  3AG4 B;  2LFR A;  2ITD C;  2IU3 A;  3T4Z A;  3P30 A;  2ZD9 A;  1S76 D;  1DTO A;  1LNQ A;  2M7W A;  1FXH A;  2ZR3 A;  4P9O A;  4JAS A;  2HKO A;  2A9H A;  3G4S V;  1K73 W;  1M57 C;  4BAY A;  3K3W A;  3LSQ A;  3OMA B;  2HFE C;  2AHZ A;  3ABU A;  1KKD A;  5B1A C;  2X6C A;  3SPC A;  4MSW C;  1H8E G;  1PKX A;  1DF4 A;  2WWW A;  2PI4 A;  3IFX A;  1TUE B;  4FMT A;  1GM8 A;  1K3E A;  4R6Z A;  2DYR B;  3T2M A;  3MHS C;  2IJI A;  2UXN A;  1EFR G;  4FJC C;  4GX5 A;  3LNM B;  5CA3 A;  2WLL A;  5EC1 C;  4TWK A;  2EZO A;  3K0G A;  2H94 A;  1F51 A;  4JPR A;  2KB1 A;  4WFB V;  4N23 A;  1KD1 W;  2IJJ A;  3W7X A;  1SES A;  1YJ9 V;  2WPD G;  1MG1 A;  1QVF U;  3CCU V;  2LP7 A;  3UM7 A;  1OHH G;  1SZT A;  3WG7 B;  4WFA V;  5IY5 C;  1L1F A;  5CMU A;  1R3I C;  3T4D A;  2D3O W;  2Q67 A;  4MS2 A;  4RO2 A;  2DYS B;  2Q6A A;  1PNK A;  3K08 A;  3B8M A;  5B1B B;  4N21 A;  1M9N A;  3LSS A;  2IH1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...