2KSDA

Backbone structure of the membrane domain of e. coli histidine kinase receptor arcb, center for structures of membrane proteins (csmp) target 4310c
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
75
structure length
75
Chain Sequence
MMKLGLVRFSMLLALALVVLAIVVQMAVTMVLHGQVESIDVIRSIFFGLLITPWAVYFLSVVVEQLEESRQRLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aerobic respiration control sensor protein arcB
publication title Membrane domain structures of three classes of histidine kinase receptors by cell-free expression and rapid NMR analysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 21
structure length 75
sequence length 75
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2010-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18415 HKR_ArcB_TM Histidine kinase receptor ArcB trans-membrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.970 Mainly Alpha Orthogonal Bundle Helix Hairpins His Kinase A (phosphoacceptor) domain 2ksdA00
2KSDA
chains in the Genus database with same CATH superfamily
1HNZO 4MTGA 4WFBV 4JZ2A 5CA3A 4GX0A 1BS3A 3D3IA 4PJ0Z 2P67A 1PNMA 3OMNB 4H44B 3ZN0A 1NI8A 3BAAA 4FFKA 3UQ8A 4B7EA 4AILC 3CYOA 4MTFA 3GB7C 3CCMV 4GKKB 5BR8O 1TVKB 4CS4A 1FXHA 5DEDA 3D3QA 2PI5A 2FMLA 2XTAA 3SJQC 4ZKIA 3AG4B 2ZNJA 3IGAC 1SF9A 1P4RA 1IBKB 4K0KO 4IT5A 3OUSA 4LF9B 5B1BB 3ABMB 2FL4A 3VQWA 1X4TA 3B8NA 3M99B 5JJNB 3OGIB 3SPIA 1I94B 3D8CA 2PY5A 3WB0A 4L87A 5IYZA 2F93B 1J95A 1K97A 4GKKO 3ZRWA 4FLVA 4P9OA 3CC4V 3FX7A 3ZS8C 2RMKB 3R65A 3T1HB 3D36A 4FJCC 1IBKO 4UVBA 3AG1C 4JTAB 1GN2A 4CH4A 4LF9O 2EIKB 1JMKC 1QU7A 4XDLA 2DQ3A 3Q4HB 2YICA 4FLUA 3AG2B 2ADQB 2WLLA 2ZR2A 4P9PA 5EIBC 2DOSA 1IURA 1Q86W 3TXSA 4TSFG 2Z0AA 4ZI7A 3WB1A 2Q68A 3B77A 2W0FC 4F6EA 2JJ2G 2OYQA 1S0VA 1JFFB 4YHHO 3KKYA 3KG2A 5D5PA 4JI6B 2ETNA 3BCCH 3T1HO 1YIJV 3AG4C 1FFTB 4N21A 3P32A 3UT5A 5BY1A 5B1BC 3ABMC 2CTRA 2LFSA 2QJ1A 4G2KA 2RJZA 1O9HA 3BRCA 1WP7A 4F6RB 5IYDO 2LJ2A 1VQMV 4HNAA 2HEPA 4JASA 4I50A 4LFAO 5K1XA 2H3OA 2KSDA 1AR5A 3OR6C 4X20A 2YS8A 4MTXA 3U11A 1YSCA 1MNGA 3TXQA 5IWAO 3FYEB 2ZQMA 3F7VC 1HWYA 1G8MA 4B3RB 4DRXA 2QM4A 2DQ0A 3GWOA 3K03A 1N0NA 2P4KA 4FFBB 2A79B 4KFMA 3TGUH 4OX9B 1CPYA 2EIKC 3FD9A 3OGCC 2D3OW 3IJ4A 1RPOA 4GLXA 3G6BA 1NQTA 3AG2C 3RYCB 4X1KB 1SQPH 1R3JC 3RGBA 1VQ8V 1QQCA 1F23A 2K1EA 1UJWB 4FPPA 2CGOA 4TQFA 5EBMC 1RFYA 1OCOB 2X0LA 2R70A 4GCZA 1YITV 4I5SA 1J5EB 4B3RO 1TGOA 1XMQB 1KECA 1V54C 2CE4A 4OX9O 4CH6A 4DW0A 2CH7B 2FYUH 5JQGA 1NR1A 1TA8A 3KCYA 4O2AA 1K73W 1KP3A 4MVZA 4X62B 1S77D 1B04A 4X65B 4TT3G 3MAQA 1KD1W 1W2BU 1G4YB 4R50A 3MHHC 2H8PC 3C3TA 3G4SV 3CCRV 3ZMSA 1H2KA 3A0RA 4HAMA 3JAKA 2A0LA 1J5EO 1MSDA 3ABLB 1Q81W 2EJRA 1XMQO 4NR1A 1FXKC 1NVPD 3ZMVA 1QHTA 1WB7A 3ZHSA 5CBHA 4GZRB 4FK5C 2XAFA 2EIJB 4X62O 2HVKC 4EFBA 2YIAA 2DMXA 3JAMN 3JSNA 1Q3EA 1L1FA 1Y74A 4Z2WA 1VQ9V 4I4TA 4NTXA 1NR7A 4IHJB 1OCOC 3CE2A 1MSWD 2ITCC 1KBHA 2F95B 3JARA 2QWOB 5JVDB 3F5WC 2E5LB 4DYLA 3CCLV 3HKCA 2WPDG 2AZ2A 3G67A 4F4LA 4CS2A 1VQOV 2B5UA 3CSXA 3STZC 1QCEA 2GTSA 3WG7B 3N2KB 3ASOB 3H1HH 2GUZA 3N27A 3QO5A 2WWWA 1SA0B 1H2LA 1GKFA 4ABMA 1N32O 5KUKA 1HW7A 2BSKA 4O4JB 5HFLA 3CJHA 4LF4O 2R9AA 3LSSA 4JI2B 1QVFU 3G6EV 2Y0PA 4DV3B 2QKSA 3K59A 2OTLV 5H5NA 3JASA 1U96A 3K9SA 4LFCB 2LFRA 2E5LO 3CXCU 3BA8A 3ABLC 5E79Z 1ZX3A 1MZEA 3JAWB 3HKDA 3ETQA 1GN4A 5ITZA 3I55V 2Y69B 4I9WA 2W0XA 4DR6B 2PZSA 2EIJC 3UM7A 2NLJC 2P6JA 1VQ5V 3CCQV 4J7JA 3EHBB 2YXHA 2Z3YA 1FAFA 2VWKA 4JI2O 4TQDA 1GTOA 3FB5C 2Q6AA 3OTFA 5LHGA 1P84F 4YJ3B 2XT9A 4JTDB 4I0XA 4MVUA 4XDKA 3K04A 4WFAV 1BQ0A 5H6QA 1R3LC 3THOA 2LP7A 1DF5A 4MW8A 3WG7C 1Q6IA 3OUFA 3ZX6A 3ASOC 4DR6O 4HYOA 1GRJA 2WA3A 3AEIA 2QA4V 4DR3B 1K9MW 4R8CA 1TUBB 4DV2B 2QEXV 4JI8B 2QTSA 1LUVA 3L9DA 3AK1A 4O2BB 1W59A 3B09A 1MZFA 1N36O 1I0HA 4NTWA 2OCCB 4PA7A 4DV6O 4D7SA 2FTKA 2LGWA 2QR4A 4FLWA 3ZRVA 4X64B 4ZHQA 2LO1A 2XNDG 2Y69C 1TVKA 1KC8W 1I7FA 2WLJA 2X6BA 2CDYA 1K5SA 4DR3O 2YIBD 2OIGA 3A0HZ 1FFXA 3ETDA 3SYCA 1UPGA 3TJTA 2A06H 3CCSV 2KQXA 5A9GA 1K4DC 1IXMA 2W6JG 4DV2O 4QPJA 5BMVB 4JI8O 3RVYA 1HDJA 4DR7B 3ABKB 1FS0G 2ADPA 2UXXA 1U97A 1YJNV 3L70H 1PKXA 1KP2A 1MA1A 2ARHA 4X64O 3K57A 5C8YA 1VQLV 1I5XA 4B3MB 1JJ2U 4O4IB 3ZHUA 1I08A 4E2LA 4LWSA 4LBEC 1Q6UA 5LYJB 3O65A 1N0JA 1WN7A 2XAJA 4YJ2B 4MVRA 1JX9A 3U10A 3JALA 2V7QG 2DWDC 3Q4HA 1KKCA 1GMGA 2JIZG 1IBMB 1F4MA 1IZ3A 4QJFB 2ZD9A 1WB8A 3M7MX 3ZRSA 1XHXA 3JCZA 1OZ0A 4LF5B 1JFFA 2Y48A 5EK0A 1WLEA 3SR2C 5KA5A 1TAEA 2EIMC 2F1MA 3CX5F 1AR4A 4UXNA 3B4SA 4NB5A 4MVQA 1Q43A 1ZL8B 1SC5B 2VWJA 5D5QA 4JAUA 3RYIB 3ABKC 2YIDA 3KZIZ 1JPXA 3I5DA 4PDLA 1URFA 1WPBA 4H0LB 4NXMO 3ZN1A 4LF5O 5L3BA 5B3SC 1B3QA 4XDJA 3IFXA 1VF5B 3CC7V 3IAYA 2N05A 4PDRA 3L75H 2GV9A 4YIPA 2YSUB 5JCOC 2QDOA 1ROPA 2P4VA 1FXKA 3HKBB 3SYQA 1XMOB 2CUGA 2WA4A 5CMUA 3APOA 3FB7C 4OPAA 5L3GA 3RYCA 3A0BZ 1EN4A 1YJ9V 4FLTA 5DM6V 4O4LB 3T1YB 1AI4A 1BQZA 1RM1B 4K8ZA 4H33A 3S3XA 5LL6Y 4J9YB 2ZT9B 2CTWA 1ZUQA 4PI0A 3HKEB 4X1IA 2B9ZA 4CS3A 1D5AA 1BHAA 1SRYA 1HNWB 1GN3A 1KU9A 1FJGB 2B1IA 4CBCA 4JI4B 2CH7A 1XMOO 4DV7B 1H2GA 4NVPA 2KB1A 4BW9A 5LXTB 3RYHB 1XEQA 5IJ9B 4TUYB 2EX3A 1VQNV 3T1YO 2YIBA 4PDVA 5JWPA 2IU3A 3TETA 2HG5C 3CXHF 4OXSA 2VS0A 4DR5B 5LBQA 2XASA 4N23A 1G6UA 3K0DA 1M4UA 3A8TA 1H2NA 3LSQA 1AI5A 1HNWO 2Q7HA 2GSMB 1R3IC 1FJGO 4JI4O 4DV7O 1XDCA 2Q7EA 5IT9N 3BVOA 4W4LA 1PM9A 2XAHA 1NTKH 5JJEB 4G27B 2V1DA 2YXLA 3JATB 4J7ZA 4YHHB 5KHGA 4ZOLA 3RYFA 4RUFA 1RM1C 4AI8A 2WLKA 4LF7O 4FM0A 4DR5O 2Y0IA 4QGPA 3ZCCA 2JS3A 3ZEDA 5JVDA 2OTJV 4FZ1A 3QVNA 1JA8A 1WNSA 1VQ4V 1BL8A 3T1CA 4JF3A 4NXNB 5J2TB 1M90W 1AJNA 1QNMA 1V9PA 4O4HB 2BTQA 3CD6V 4LFAB 1OCZB 4GKJB 1GM8A 2JEUA 1SA0A 2XAGA 3CEIA 2DYRB 4W4KA 1P7GA 4B7KA 4O4JA 3BEHA 3LDDA 1VQKV 4RAIA 2ZXWB 3VOUA 1SETA 5IWAB 1XBLA 3OEHG 1SQQH 1Y66A 1N4CA 4TV8B 4MT8A 2IBZH 2OT5A 3STLC 1A32A 4X8AA 4JI3B 1D2DA 2RN9A 4NXNO 2X6AA 4DV5O 1AB3A 5LMNB 2JEXA 4JI5O 1BHBA 2CTPA 1NT2B 4GKJO 2UUAO 4OGQB 2QE7G 5KHIA 1FPOA 4CZZA 4U3FH 2QWQB 2HLDG 3N2GB 5LP6A 4HZ3A 4QIWF 4WCEV 3T4ZA 3E86A 3JD4A 3ZHTA 1R3KC 1SESA 4JI3O 4YJ3A 1LNQA 4PDMA 2ZDIC 4MVOA 2WAMA 5LMNO 4J11A 4UCUA 1OCZC 1TUBA 2DYRC 2F23A 4PA9A 2YUAA 1YTFD 1BSMA 1EZVH 4WFHA 3DXRA 3HR0A 1GAXA 1MABG 5LA6B 4KL1A 4O2BA 4LC1A 2A3QA 3OR7C 1QR8A 1VEWA 4TWKA 3FYIB 4IIJB 5IE9A 4D7TA 1WJZA 2BOCC 2GTAA 5EIBD 4LNUB 3EFFK 1AR1B 2VQEB 4J10A 3GVMA 3E89A 3DTUB 3OTOB 2FKXA 2ZE5A 1MOFA 3H1JH 5EC1C 3H1IH 5IJ0B 1AJQA 3DSQA 2IH1C 1XL6A 1NJIW 2PF4E 4JYAB 4AHCA 5BMVA 3UO3A 4B3SO 4WFEA 3FFQA 1YHQV 1VF6C 1IDSA 5CB4B 4IYIA 4KP4A 1NTZH 5EYPA 4WF9V 4LFBB 3UCSC 3CRRA 4GUNA 2QTOA 4X89A 3U0ZA 1S72V 1Q6HA 4O4IA 1YF2A 1AJPA 2VQEO 1R73A 1N32B 3APQA 2Q7GA 3FB6C 2XHBA 2CK3G 3OTOO 4LF4B 4QE7A 3QF7A 2Q9LA 3ML0A 2UXCB 5JCOA 3H1KH 4OPHA 4YJ2A 1KB9F 4JYAO 1K34A 4JZGA 1QLEB 1NH2B 1F4NA 3K06A 1M5IA 1EN5A 3E35A 1V55B 2A7WA 1K4CC 4I55B 5J2UB 5C93A 3K58A 3UKMA 4UB8Z 4LFBO 4DO2A 3E8GA 3S3WA 2HJDA 3CRCA 2ZE6A 5LOVB 5KHHA 3GWKC 1THZA 3LNMB 2JGDA 2WLHA 5IYCO 4J42A 4EB6B 4BIOA 4K8XA 3E2EA 2UXCO 3K5MA 5KLVH 1AILA 4X9QA 1ZL8A 3WB2A 3F5TA 2E75B 1SQBH 2N74A 1Y76A 4UCSA 2IH3C 1ENVA 2NN4A 1XHZA 1H2MA 1AP6A 2IM9A 1H38A 3ZHRA 3K0GA 2YEVA 4ZBMA 3CMAV 2UXNA 3HPLC 2IJIA 1YZBA 3JCUZ 3JD3A 5KAIZ 1XL4A 1K5QA 3DGEA 1H8EG 2QKAA 1Y67A 4DUYO 3CCEV 5B1OA 3HKBA 3K08A 1N36B 2VRZA 4FLXA 3E22B 4DV6B 1HNXB 1WPXA 4UV8A 1LUWA 1V55C 1GO3F 2LGQA 5LMUB 4O4LA 1E1RG 3X2QB 4Z1VA 1JOYA 3CCUV 3SJCC 2HHHB 4CH3A 4DRXB 4X88A 3MHSC 1X59A 4TOIA 1SKVA 1NKDA 2AHYA 4JGSA 3WU2Z 1SQFA 2HVJC 4JYCA 2JDIG 4X1YB 1XUQA 2ZKOA 3CRQA 3ZMTA 2F66C 4PV1B 2QM8A 5DN6G 5J9PC 1DTOA 1IXBA 4JAVA 4UCRA 1Z5VA 5L3EA 1ORQC 1HNXO 3JD1A 3B8MA 4WBNB 5FNVB 1G1XB 4Z1MG 1S3JA 3RYHA 3J81N 1M57B 5IJ9A 4TUYA 2MK3A 3LNNA 2R9IA 5LMUO 3MD0A 3T2MA 4KHPB 3AG7A 3FAVB 3RBZA 1Q8IA 2HHHO 4QNHB 1BMFG 2QGNA 4DK1A 3I56V 3UO2A 2DWEC 3JSLA 2P5OA 5KHJA 4DUZB 1OCCB 1Z2GA 2F43G 2P90A 2P06A 4FMTA 3VQYA 1SERA 3M8AA 4WFFA 5TISZ 1AP5A 2D2CB 3QO8A 1XQ8A 2ILMA 2G38A 1AROP 3F7YC 3IC7A 4MS2A 1W0KG 1PD3A 2JK5C 4KHPO 2Q73A 4CC6A 3CHXA 3X2QC 1YJWV 3JAKB 2ZINA 4UCVA 2ZM6O 2AW9A 4UUJC 1TUEB 5CA1B 3SJBC 3OAAG 2UUCB 4DUZO 4BAYA 3H1LH 1SS3A 2ZDIA 1BT8A 2OCCC 2DYSB 2WSSG 4U7OA 1S76D 2NNUA 2WLIB 3SPGA 3BHPA 1WP8A 1EN6A 3P3PA 1Y74B 3SJAC 4X66B 4NXMB 1M57C 2B1GA 3SPJA 4QE9A 4FLZA 4BW5A 5IDJA 2V4DA 2Q67A 4R6ZA 3G71V 1PL0A 2AHZA 5BZBA 1VF7A 4I9QA 1WA8B 3J7AU 2QSAA 2EINB 5KMGB 2ATKC 1GM7A 2XAQA 1K33A 2UUCO 4KUMA 4FM2A 1MG1A 1OCCC 2H94A 1KMIZ 2IJHA 2GHYA 2GUZB 3BABA 5DECA 4WFGA 4IGGA 1XNQB 3SDLA 2UXDB 1VIBA 2BSKB 1QLNA 3CJHB 4F6RA 4DR1B 4K35A 1N33O 2KG7B 4C7UA 4X66O 4J7KA 3CP1A 1VMGA 4DV4B 2M7WA 4DW1A 1K3EA 3P30A 2DJVA 3ZIAG 3E8HA 2XOKG 1VF6A 4EEQA 3HKDB 4TV9B 5GONB 1RSOB 4FFBA 3L73H 2A9HA 1FKAO 2IU0A 3JD0A 3CRMA 4DV1O 4U3JB 4MSWC 4KXRA 3RFRA 1XNQO 4XBFA 2UXDO 2HFEC 5AG2A 1D5NA 2DYSC 5GW7A 3VQVA 4JYYA 2UUBB 4X1KA 4DR1O 1PPJH 2X7RB 4U7NA 2QWPB 4DV4O 4LF6B 1KUQA 3LDCA 1FD9A 5KAFZ 4UV9A 4UB6Z 5IY5B 3J80N 4GYCB 1S5JA 4CC5A 2ZNIA 2DW4A 5LGUA 2EINC 5LA6A 4BR6A 3B40A 4LH7A 1QVGU 4BIUA 4BIZA 1L0LH 1YTFB 4ZIBA 3W7UA 5H9CA 2UU9B 1QBZA 2RQ6A 4L8JA 2UUBO 1XNRB 1RPRA 2KKWA 1CXZB 1KKDA 4LF6O 4LF7B 5IJ0A 1Y4MA 5KX5B 1RP3B 2F4VB 1YI2V 5CB4A 3K79A 4ZHQB 1O9GA 3K5OA 4PELA 3VBBA 4FIPC 4MVMA 1OJHA 5FPRA 4BWAA 1VP7A 4YIOA 1FFXB 2OCHA 2UU9O 1P7BA 1JCHA 1K7DA 1XNRO 2MW2B 2PI4A 4UFZA 2GBOA 1NVPB 2L35A 3BFRA 3RWRD 2ZE7A 3BY6A 3OE7G 3E8BA 3SPHA 5IY5C 5A2QN 2F4VO 4IHJA 4PHZA 1MMMA 1SQXH 3QNEA 1YDXA 5EZYB 1ZSPA 5C8YB 1EBOA 4LWSB 4DV5B 5J2UA 2Q8VA 4I55A 3ZMZA 3MDSA 1JR9A 3E8FA 4JI5B 3N2KA 1Q82W 4J9ZB 1IVSA 5LOVA 2CGNA 2WLNA 2UUAB 5FPOA 1JVMA 3PN1A 1CP9A 3JALB 4EB6A 3CMEV 1YVWA 2EULA 2JVDA 3T4DA 5CA0B 1NTMH 1PL4A 3KCXA 1I94O 1QR9A 3W7WA 2YDEA 1PP9H 3W7TA 1GK9A 3DC6A 3LSUA 4H37A 3JAWA 4RUEA 2AZ0A 4FVMA 3QO7A 4A5UB 3HB3B 4Q6GA 2EZOA 3AG3B 2HKOA 4NYKA 5B5EZ 1V54B 2RDCA 5LHIA 1SZTA 5EBWC 5CN0A 2Z5UA 1BGYH 3K9AA 4MW3A 1N8RW 3NR7A 2VQFB 2L6LA 1JQ0A 3ZHQA 1UFIA 4HBNA 3E22A 3ZHVA 3EVKA 4CH5A 1M93A 3CCJV 1FYJA 3CCVV 4JI6O 2JS5A 4K3AA 4UCTA 1Z5WA 2CTQA 5LGTA 3QTCA 3TK1A 3SYAA 3JYCA 1CEZA 1FXKB 1SZXA 1KYOF 3NXSA 5KHKA 3LDEA 1R6NA 2JGUA 3R66A 3JD2A 2ZXWC 2QKCA 4B3SB 2PYJA 4X1YA 3ETEA 1M1KW 5BXZA 2VQFO 1EZJA 3CS5A 5JH7B 4PD4F 5KA6A 4GX2A 4WBNA 5FNVA 1I5YA 1P49A 2PGGA 4LR3A 5L3CA 1YCIA 3LUTB 4RWUA 1R6TA 3FAVA 4X1IB 2OWOA 3BA9A 3AG3C 3RN4A 1VQ7V 3O9OA 4YY3B 1PNKA 4FM1A 4GT1A 5GTHZ 4LH6A 3IC9A 3ZMUA 2ZCEA 3C3SA 4JYBA 1K8AW 4ASUG 2BOBC 1IBLB 4JV5B 2RNBA 1H2SB 2YI8A 4EFEA 4JAAA 2E76B 3WFVA 2R72A 1YEWA 3OW2U 1YXBA 2RCVA 1Q7YW 5LYJA 1KQSU 2HR3A 4J80A 5CA1A 4B3TB 3ICXA 4YY3O 3W7XA 5LGNA 2EBOA 3L74H 4JI1B 2OIEA 5IYZB 4X65O 4ZOLB 3RYFB 4I7ZB 3ASNB 4PA4A 3ZRWB 2WLIA 1IBLO 1ZAUA 4JV5O 1BCCH 3OMAB 4H13B 1GN6A 1AI6A 1ZWIC 5CBFA 1JJOA 3DC5A 5EC2C 1AVMA 2ITDC 2YXYA 4EKWA 1SQVH 1R1BA 1WA8A 5GTIZ 5F2VO 5KMGA 3SYPA 5L3FA 4B3TO 3BPZA 2WLLB 4DUYB 2BE3A 2UXBB 1M56B 4JI1O 1PV0A 2BTQB 2Q0OC 4ZI7B 1XILA 3ABTA 3RYIA 3OFNG 2GDSA 1S5HC 1EM1A 4PA6A 4PA3A 1K92A 2KG7A 1DK1A 3VQXA 2JRIA 1T5EA 4GX1A 3FKSG 2Q69A 1XOUA 4JI0B 2ODMA 3UT5B 1EFRG 1WAZA 3P3NA 4AQYB 5H6RA 1Q90D 4RO2A 4DR4B 4TV9A 2EZPA 4Q20A 5GONA 4DK0A 4FLYA 3SPCA 4LF8B 2UXBO 2QM7A 3OM3B 1RSOA 1QLEC 4LCUC 4HNAB 4I50B 2LW1A 4D6TH 4U3JA 1IX9A 3AK2A 3CC2V 3ASNC 3H01A 1DLBA 4X20B 4QPKA 2NR5A 3ABUA 5LP6B 3D36C 4DV3O 2P7TC 4RQFA 4JI0O 4J41A 2QWNB 4LFCO 3A2FA 1VQ6V 3RW0A 1DF4A 3HKEA 4AQYO 3K3WA 2Y4UA 1ZTEA 4DR4O 2FB5A 4LF8O 1M56C 3C90A 4NTYA 2HJFC 1S5LZ 5EBLC 5KUMA 5LXTA 4MVSA 2DE0X 3TCUA 2PUSA 4UVCA 4UVAA 2EILB 3DXRB 1F51A 1NBMG 4E4EA 1GM9A 2IW5A 5FLXN 3OD4A 3RVZA 2ZM6B 2IJKA 2X6CA 5KX5A 3E83A 5FL7G 2Q5ZA 1F7YA 5B66Z 2HP8A 2Q4PA 5JQGB 3PJSK 4MTOA 4O2AB 5L3DA 3FB8C 1ZLZA 4PI2A 1B6QA 4DXWA 5LHHA 2CAZC 2EIMB 3SYOA 4UCOA 2QWRB 3QG5A 4DR2B 3JATA 1VARA 3SGIA 5LP6C 2K9PA 1OHHG 1DGSA 4P2ZA 5K1PA 5EYPB 2P22C 1W0JG 5CBGA 3ZBHA 5JJJB 5EZYA 3OEEG 1BE3H 5B3SB 3K5LA 4B08A 1NH2D 5J2TA 2AGAA 2M6YA 3EXAA 2XUMA 3CB2A 1GH6A 3K5NA 1B06A 3OT7A 4DV0B 1N33B 4I4TB 4O4HA 2DN9A 4GX5A 4DR2O 1FXVA 2EJ7A 1OCRB 1XREA 4ICGA 1HR0B 2EILC 1US6A 3JARB 2LW7A 4DR7O 2Y4TA 5E1AC 2BTOA 2O57A 1SQGA 5B1AB 4JTCB 2WLMA 2ZR3A 5CA0A 3ZJZA 3HKCB 3G80A 2ZE8A 3RT3C 4P30A 1NU1H 3OMIB 4TV8A 3ZRXA 1AI7A 2LQTA 1Q5OA 4JI7B 1NZ6A 4LP8A 4B3MO 1VQPV 4DV1B 1COWG 2IJJA 2ZIMA 3AK3A 1L8DA 2JGDB 1R6KA 4IL6Z 4DV0O 5IYBO 2YC0A 1XI1A 1HR0O 3JASB 5HFMA 1Y76B 2N04A 2PTMA 3N2GA 3CRAA 1BZKA 2ZIOA 1N34B 1IBMO 5B1NA 4NKGB 5H2FZ 2C2AA 5ITZB 2YEVB 4JI7O 2JJ1G 3W7SA 1E1QG 3L72H 2AXTZ 4RQEA 4IYHA 4G28B 2Q0AA 1Y6XA 1HNZB 3CPWU 1OCRC 2R9RB 2E74B 4YXWG 2W6IG 1PNLA 1H8HG 1OV9A 4FZ0A 5B1AC 1M9NA 4I0XB 1N34O 1NS1A 2PYLA 1LR1A 4JPRA 1HP8A 3CWBH 5BR8B 5JH7A 2BCCH 2E3CA 3B2EE 4IIJA 3L71H 1E79G 4LNUA 3H9VA 3AG1B 4K0KB 1L0NH 3ETGA 4R7CA 2YI9A
chains in the Genus database with same CATH topology
2KSDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KSD A; 
#chains in the Genus database with same CATH topology
 1HNZ O;  4MTG A;  4WFB V;  4JZ2 A;  5CA3 A;  4GX0 A;  1BS3 A;  3D3I A;  4PJ0 Z;  2P67 A;  1PNM A;  3OMN B;  4H44 B;  3ZN0 A;  1NI8 A;  3BAA A;  4FFK A;  3UQ8 A;  4B7E A;  4AIL C;  3CYO A;  4MTF A;  3GB7 C;  3CCM V;  4GKK B;  5BR8 O;  1TVK B;  4CS4 A;  1FXH A;  5DED A;  3D3Q A;  2PI5 A;  2FML A;  2XTA A;  3SJQ C;  4ZKI A;  3AG4 B;  2ZNJ A;  3IGA C;  1SF9 A;  1P4R A;  1IBK B;  4K0K O;  4IT5 A;  3OUS A;  4LF9 B;  5B1B B;  3ABM B;  2FL4 A;  3VQW A;  1X4T A;  3B8N A;  3M99 B;  5JJN B;  3OGI B;  3SPI A;  1I94 B;  3D8C A;  2PY5 A;  3WB0 A;  4L87 A;  5IYZ A;  2F93 B;  1J95 A;  1K97 A;  4GKK O;  3ZRW A;  4FLV A;  4P9O A;  3CC4 V;  3FX7 A;  3ZS8 C;  2RMK B;  3R65 A;  3T1H B;  3D36 A;  4FJC C;  1IBK O;  4UVB A;  3AG1 C;  4JTA B;  1GN2 A;  4CH4 A;  4LF9 O;  2EIK B;  1JMK C;  1QU7 A;  4XDL A;  2DQ3 A;  3Q4H B;  2YIC A;  4FLU A;  3AG2 B;  2ADQ B;  2WLL A;  2ZR2 A;  4P9P A;  5EIB C;  2DOS A;  1IUR A;  1Q86 W;  3TXS A;  4TSF G;  2Z0A A;  4ZI7 A;  3WB1 A;  2Q68 A;  3B77 A;  2W0F C;  4F6E A;  2JJ2 G;  2OYQ A;  1S0V A;  1JFF B;  4YHH O;  3KKY A;  3KG2 A;  5D5P A;  4JI6 B;  2ETN A;  3BCC H;  3T1H O;  1YIJ V;  3AG4 C;  1FFT B;  4N21 A;  3P32 A;  3UT5 A;  5BY1 A;  5B1B C;  3ABM C;  2CTR A;  2LFS A;  2QJ1 A;  4G2K A;  2RJZ A;  1O9H A;  3BRC A;  1WP7 A;  4F6R B;  5IYD O;  2LJ2 A;  1VQM V;  4HNA A;  2HEP A;  4JAS A;  4I50 A;  4LFA O;  5K1X A;  2H3O A;  2KSD A;  1AR5 A;  3OR6 C;  4X20 A;  2YS8 A;  4MTX A;  3U11 A;  1YSC A;  1MNG A;  3TXQ A;  5IWA O;  3FYE B;  2ZQM A;  3F7V C;  1HWY A;  1G8M A;  4B3R B;  4DRX A;  2QM4 A;  2DQ0 A;  3GWO A;  3K03 A;  1N0N A;  2P4K A;  4FFB B;  2A79 B;  4KFM A;  3TGU H;  4OX9 B;  1CPY A;  2EIK C;  3FD9 A;  3OGC C;  2D3O W;  3IJ4 A;  1RPO A;  4GLX A;  3G6B A;  1NQT A;  3AG2 C;  3RYC B;  4X1K B;  1SQP H;  1R3J C;  3RGB A;  1VQ8 V;  1QQC A;  1F23 A;  2K1E A;  1UJW B;  4FPP A;  2CGO A;  4TQF A;  5EBM C;  1RFY A;  1OCO B;  2X0L A;  2R70 A;  4GCZ A;  1YIT V;  4I5S A;  1J5E B;  4B3R O;  1TGO A;  1XMQ B;  1KEC A;  1V54 C;  2CE4 A;  4OX9 O;  4CH6 A;  4DW0 A;  2CH7 B;  2FYU H;  5JQG A;  1NR1 A;  1TA8 A;  3KCY A;  4O2A A;  1K73 W;  1KP3 A;  4MVZ A;  4X62 B;  1S77 D;  1B04 A;  4X65 B;  4TT3 G;  3MAQ A;  1KD1 W;  1W2B U;  1G4Y B;  4R50 A;  3MHH C;  2H8P C;  3C3T A;  3G4S V;  3CCR V;  3ZMS A;  1H2K A;  3A0R A;  4HAM A;  3JAK A;  2A0L A;  1J5E O;  1MSD A;  3ABL B;  1Q81 W;  2EJR A;  1XMQ O;  4NR1 A;  1FXK C;  1NVP D;  3ZMV A;  1QHT A;  1WB7 A;  3ZHS A;  5CBH A;  4GZR B;  4FK5 C;  2XAF A;  2EIJ B;  4X62 O;  2HVK C;  4EFB A;  2YIA A;  2DMX A;  3JAM N;  3JSN A;  1Q3E A;  1L1F A;  1Y74 A;  4Z2W A;  1VQ9 V;  4I4T A;  4NTX A;  1NR7 A;  4IHJ B;  1OCO C;  3CE2 A;  1MSW D;  2ITC C;  1KBH A;  2F95 B;  3JAR A;  2QWO B;  5JVD B;  3F5W C;  2E5L B;  4DYL A;  3CCL V;  3HKC A;  2WPD G;  2AZ2 A;  3G67 A;  4F4L A;  4CS2 A;  1VQO V;  2B5U A;  3CSX A;  3STZ C;  1QCE A;  2GTS A;  3WG7 B;  3N2K B;  3ASO B;  3H1H H;  2GUZ A;  3N27 A;  3QO5 A;  2WWW A;  1SA0 B;  1H2L A;  1GKF A;  4ABM A;  1N32 O;  5KUK A;  1HW7 A;  2BSK A;  4O4J B;  5HFL A;  3CJH A;  4LF4 O;  2R9A A;  3LSS A;  4JI2 B;  1QVF U;  3G6E V;  2Y0P A;  4DV3 B;  2QKS A;  3K59 A;  2OTL V;  5H5N A;  3JAS A;  1U96 A;  3K9S A;  4LFC B;  2LFR A;  2E5L O;  3CXC U;  3BA8 A;  3ABL C;  5E79 Z;  1ZX3 A;  1MZE A;  3JAW B;  3HKD A;  3ETQ A;  1GN4 A;  5ITZ A;  3I55 V;  2Y69 B;  4I9W A;  2W0X A;  4DR6 B;  2PZS A;  2EIJ C;  3UM7 A;  2NLJ C;  2P6J A;  1VQ5 V;  3CCQ V;  4J7J A;  3EHB B;  2YXH A;  2Z3Y A;  1FAF A;  2VWK A;  4JI2 O;  4TQD A;  1GTO A;  3FB5 C;  2Q6A A;  3OTF A;  5LHG A;  1P84 F;  4YJ3 B;  2XT9 A;  4JTD B;  4I0X A;  4MVU A;  4XDK A;  3K04 A;  4WFA V;  1BQ0 A;  5H6Q A;  1R3L C;  3THO A;  2LP7 A;  1DF5 A;  4MW8 A;  3WG7 C;  1Q6I A;  3OUF A;  3ZX6 A;  3ASO C;  4DR6 O;  4HYO A;  1GRJ A;  2WA3 A;  3AEI A;  2QA4 V;  4DR3 B;  1K9M W;  4R8C A;  1TUB B;  4DV2 B;  2QEX V;  4JI8 B;  2QTS A;  1LUV A;  3L9D A;  3AK1 A;  4O2B B;  1W59 A;  3B09 A;  1MZF A;  1N36 O;  1I0H A;  4NTW A;  2OCC B;  4PA7 A;  4DV6 O;  4D7S A;  2FTK A;  2LGW A;  2QR4 A;  4FLW A;  3ZRV A;  4X64 B;  4ZHQ A;  2LO1 A;  2XND G;  2Y69 C;  1TVK A;  1KC8 W;  1I7F A;  2WLJ A;  2X6B A;  2CDY A;  1K5S A;  4DR3 O;  2YIB D;  2OIG A;  3A0H Z;  1FFX A;  3ETD A;  3SYC A;  1UPG A;  3TJT A;  2A06 H;  3CCS V;  2KQX A;  5A9G A;  1K4D C;  1IXM A;  2W6J G;  4DV2 O;  4QPJ A;  5BMV B;  4JI8 O;  3RVY A;  1HDJ A;  4DR7 B;  3ABK B;  1FS0 G;  2ADP A;  2UXX A;  1U97 A;  1YJN V;  3L70 H;  1PKX A;  1KP2 A;  1MA1 A;  2ARH A;  4X64 O;  3K57 A;  5C8Y A;  1VQL V;  1I5X A;  4B3M B;  1JJ2 U;  4O4I B;  3ZHU A;  1I08 A;  4E2L A;  4LWS A;  4LBE C;  1Q6U A;  5LYJ B;  3O65 A;  1N0J A;  1WN7 A;  2XAJ A;  4YJ2 B;  4MVR A;  1JX9 A;  3U10 A;  3JAL A;  2V7Q G;  2DWD C;  3Q4H A;  1KKC A;  1GMG A;  2JIZ G;  1IBM B;  1F4M A;  1IZ3 A;  4QJF B;  2ZD9 A;  1WB8 A;  3M7M X;  3ZRS A;  1XHX A;  3JCZ A;  1OZ0 A;  4LF5 B;  1JFF A;  2Y48 A;  5EK0 A;  1WLE A;  3SR2 C;  5KA5 A;  1TAE A;  2EIM C;  2F1M A;  3CX5 F;  1AR4 A;  4UXN A;  3B4S A;  4NB5 A;  4MVQ A;  1Q43 A;  1ZL8 B;  1SC5 B;  2VWJ A;  5D5Q A;  4JAU A;  3RYI B;  3ABK C;  2YID A;  3KZI Z;  1JPX A;  3I5D A;  4PDL A;  1URF A;  1WPB A;  4H0L B;  4NXM O;  3ZN1 A;  4LF5 O;  5L3B A;  5B3S C;  1B3Q A;  4XDJ A;  3IFX A;  1VF5 B;  3CC7 V;  3IAY A;  2N05 A;  4PDR A;  3L75 H;  2GV9 A;  4YIP A;  2YSU B;  5JCO C;  2QDO A;  1ROP A;  2P4V A;  1FXK A;  3HKB B;  3SYQ A;  1XMO B;  2CUG A;  2WA4 A;  5CMU A;  3APO A;  3FB7 C;  4OPA A;  5L3G A;  3RYC A;  3A0B Z;  1EN4 A;  1YJ9 V;  4FLT A;  5DM6 V;  4O4L B;  3T1Y B;  1AI4 A;  1BQZ A;  1RM1 B;  4K8Z A;  4H33 A;  3S3X A;  5LL6 Y;  4J9Y B;  2ZT9 B;  2CTW A;  1ZUQ A;  4PI0 A;  3HKE B;  4X1I A;  2B9Z A;  4CS3 A;  1D5A A;  1BHA A;  1SRY A;  1HNW B;  1GN3 A;  1KU9 A;  1FJG B;  2B1I A;  4CBC A;  4JI4 B;  2CH7 A;  1XMO O;  4DV7 B;  1H2G A;  4NVP A;  2KB1 A;  4BW9 A;  5LXT B;  3RYH B;  1XEQ A;  5IJ9 B;  4TUY B;  2EX3 A;  1VQN V;  3T1Y O;  2YIB A;  4PDV A;  5JWP A;  2IU3 A;  3TET A;  2HG5 C;  3CXH F;  4OXS A;  2VS0 A;  4DR5 B;  5LBQ A;  2XAS A;  4N23 A;  1G6U A;  3K0D A;  1M4U A;  3A8T A;  1H2N A;  3LSQ A;  1AI5 A;  1HNW O;  2Q7H A;  2GSM B;  1R3I C;  1FJG O;  4JI4 O;  4DV7 O;  1XDC A;  2Q7E A;  5IT9 N;  3BVO A;  4W4L A;  1PM9 A;  2XAH A;  1NTK H;  5JJE B;  4G27 B;  2V1D A;  2YXL A;  3JAT B;  4J7Z A;  4YHH B;  5KHG A;  4ZOL A;  3RYF A;  4RUF A;  1RM1 C;  4AI8 A;  2WLK A;  4LF7 O;  4FM0 A;  4DR5 O;  2Y0I A;  4QGP A;  3ZCC A;  2JS3 A;  3ZED A;  5JVD A;  2OTJ V;  4FZ1 A;  3QVN A;  1JA8 A;  1WNS A;  1VQ4 V;  1BL8 A;  3T1C A;  4JF3 A;  4NXN B;  5J2T B;  1M90 W;  1AJN A;  1QNM A;  1V9P A;  4O4H B;  2BTQ A;  3CD6 V;  4LFA B;  1OCZ B;  4GKJ B;  1GM8 A;  2JEU A;  1SA0 A;  2XAG A;  3CEI A;  2DYR B;  4W4K A;  1P7G A;  4B7K A;  4O4J A;  3BEH A;  3LDD A;  1VQK V;  4RAI A;  2ZXW B;  3VOU A;  1SET A;  5IWA B;  1XBL A;  3OEH G;  1SQQ H;  1Y66 A;  1N4C A;  4TV8 B;  4MT8 A;  2IBZ H;  2OT5 A;  3STL C;  1A32 A;  4X8A A;  4JI3 B;  1D2D A;  2RN9 A;  4NXN O;  2X6A A;  4DV5 O;  1AB3 A;  5LMN B;  2JEX A;  4JI5 O;  1BHB A;  2CTP A;  1NT2 B;  4GKJ O;  2UUA O;  4OGQ B;  2QE7 G;  5KHI A;  1FPO A;  4CZZ A;  4U3F H;  2QWQ B;  2HLD G;  3N2G B;  5LP6 A;  4HZ3 A;  4QIW F;  4WCE V;  3T4Z A;  3E86 A;  3JD4 A;  3ZHT A;  1R3K C;  1SES A;  4JI3 O;  4YJ3 A;  1LNQ A;  4PDM A;  2ZDI C;  4MVO A;  2WAM A;  5LMN O;  4J11 A;  4UCU A;  1OCZ C;  1TUB A;  2DYR C;  2F23 A;  4PA9 A;  2YUA A;  1YTF D;  1BSM A;  1EZV H;  4WFH A;  3DXR A;  3HR0 A;  1GAX A;  1MAB G;  5LA6 B;  4KL1 A;  4O2B A;  4LC1 A;  2A3Q A;  3OR7 C;  1QR8 A;  1VEW A;  4TWK A;  3FYI B;  4IIJ B;  5IE9 A;  4D7T A;  1WJZ A;  2BOC C;  2GTA A;  5EIB D;  4LNU B;  3EFF K;  1AR1 B;  2VQE B;  4J10 A;  3GVM A;  3E89 A;  3DTU B;  3OTO B;  2FKX A;  2ZE5 A;  1MOF A;  3H1J H;  5EC1 C;  3H1I H;  5IJ0 B;  1AJQ A;  3DSQ A;  2IH1 C;  1XL6 A;  1NJI W;  2PF4 E;  4JYA B;  4AHC A;  5BMV A;  3UO3 A;  4B3S O;  4WFE A;  3FFQ A;  1YHQ V;  1VF6 C;  1IDS A;  5CB4 B;  4IYI A;  4KP4 A;  1NTZ H;  5EYP A;  4WF9 V;  4LFB B;  3UCS C;  3CRR A;  4GUN A;  2QTO A;  4X89 A;  3U0Z A;  1S72 V;  1Q6H A;  4O4I A;  1YF2 A;  1AJP A;  2VQE O;  1R73 A;  1N32 B;  3APQ A;  2Q7G A;  3FB6 C;  2XHB A;  2CK3 G;  3OTO O;  4LF4 B;  4QE7 A;  3QF7 A;  2Q9L A;  3ML0 A;  2UXC B;  5JCO A;  3H1K H;  4OPH A;  4YJ2 A;  1KB9 F;  4JYA O;  1K34 A;  4JZG A;  1QLE B;  1NH2 B;  1F4N A;  3K06 A;  1M5I A;  1EN5 A;  3E35 A;  1V55 B;  2A7W A;  1K4C C;  4I55 B;  5J2U B;  5C93 A;  3K58 A;  3UKM A;  4UB8 Z;  4LFB O;  4DO2 A;  3E8G A;  3S3W A;  2HJD A;  3CRC A;  2ZE6 A;  5LOV B;  5KHH A;  3GWK C;  1THZ A;  3LNM B;  2JGD A;  2WLH A;  5IYC O;  4J42 A;  4EB6 B;  4BIO A;  4K8X A;  3E2E A;  2UXC O;  3K5M A;  5KLV H;  1AIL A;  4X9Q A;  1ZL8 A;  3WB2 A;  3F5T A;  2E75 B;  1SQB H;  2N74 A;  1Y76 A;  4UCS A;  2IH3 C;  1ENV A;  2NN4 A;  1XHZ A;  1H2M A;  1AP6 A;  2IM9 A;  1H38 A;  3ZHR A;  3K0G A;  2YEV A;  4ZBM A;  3CMA V;  2UXN A;  3HPL C;  2IJI A;  1YZB A;  3JCU Z;  3JD3 A;  5KAI Z;  1XL4 A;  1K5Q A;  3DGE A;  1H8E G;  2QKA A;  1Y67 A;  4DUY O;  3CCE V;  5B1O A;  3HKB A;  3K08 A;  1N36 B;  2VRZ A;  4FLX A;  3E22 B;  4DV6 B;  1HNX B;  1WPX A;  4UV8 A;  1LUW A;  1V55 C;  1GO3 F;  2LGQ A;  5LMU B;  4O4L A;  1E1R G;  3X2Q B;  4Z1V A;  1JOY A;  3CCU V;  3SJC C;  2HHH B;  4CH3 A;  4DRX B;  4X88 A;  3MHS C;  1X59 A;  4TOI A;  1SKV A;  1NKD A;  2AHY A;  4JGS A;  3WU2 Z;  1SQF A;  2HVJ C;  4JYC A;  2JDI G;  4X1Y B;  1XUQ A;  2ZKO A;  3CRQ A;  3ZMT A;  2F66 C;  4PV1 B;  2QM8 A;  5DN6 G;  5J9P C;  1DTO A;  1IXB A;  4JAV A;  4UCR A;  1Z5V A;  5L3E A;  1ORQ C;  1HNX O;  3JD1 A;  3B8M A;  4WBN B;  5FNV B;  1G1X B;  4Z1M G;  1S3J A;  3RYH A;  3J81 N;  1M57 B;  5IJ9 A;  4TUY A;  2MK3 A;  3LNN A;  2R9I A;  5LMU O;  3MD0 A;  3T2M A;  4KHP B;  3AG7 A;  3FAV B;  3RBZ A;  1Q8I A;  2HHH O;  4QNH B;  1BMF G;  2QGN A;  4DK1 A;  3I56 V;  3UO2 A;  2DWE C;  3JSL A;  2P5O A;  5KHJ A;  4DUZ B;  1OCC B;  1Z2G A;  2F43 G;  2P90 A;  2P06 A;  4FMT A;  3VQY A;  1SER A;  3M8A A;  4WFF A;  5TIS Z;  1AP5 A;  2D2C B;  3QO8 A;  1XQ8 A;  2ILM A;  2G38 A;  1ARO P;  3F7Y C;  3IC7 A;  4MS2 A;  1W0K G;  1PD3 A;  2JK5 C;  4KHP O;  2Q73 A;  4CC6 A;  3CHX A;  3X2Q C;  1YJW V;  3JAK B;  2ZIN A;  4UCV A;  2ZM6 O;  2AW9 A;  4UUJ C;  1TUE B;  5CA1 B;  3SJB C;  3OAA G;  2UUC B;  4DUZ O;  4BAY A;  3H1L H;  1SS3 A;  2ZDI A;  1BT8 A;  2OCC C;  2DYS B;  2WSS G;  4U7O A;  1S76 D;  2NNU A;  2WLI B;  3SPG A;  3BHP A;  1WP8 A;  1EN6 A;  3P3P A;  1Y74 B;  3SJA C;  4X66 B;  4NXM B;  1M57 C;  2B1G A;  3SPJ A;  4QE9 A;  4FLZ A;  4BW5 A;  5IDJ A;  2V4D A;  2Q67 A;  4R6Z A;  3G71 V;  1PL0 A;  2AHZ A;  5BZB A;  1VF7 A;  4I9Q A;  1WA8 B;  3J7A U;  2QSA A;  2EIN B;  5KMG B;  2ATK C;  1GM7 A;  2XAQ A;  1K33 A;  2UUC O;  4KUM A;  4FM2 A;  1MG1 A;  1OCC C;  2H94 A;  1KMI Z;  2IJH A;  2GHY A;  2GUZ B;  3BAB A;  5DEC A;  4WFG A;  4IGG A;  1XNQ B;  3SDL A;  2UXD B;  1VIB A;  2BSK B;  1QLN A;  3CJH B;  4F6R A;  4DR1 B;  4K35 A;  1N33 O;  2KG7 B;  4C7U A;  4X66 O;  4J7K A;  3CP1 A;  1VMG A;  4DV4 B;  2M7W A;  4DW1 A;  1K3E A;  3P30 A;  2DJV A;  3ZIA G;  3E8H A;  2XOK G;  1VF6 A;  4EEQ A;  3HKD B;  4TV9 B;  5GON B;  1RSO B;  4FFB A;  3L73 H;  2A9H A;  1FKA O;  2IU0 A;  3JD0 A;  3CRM A;  4DV1 O;  4U3J B;  4MSW C;  4KXR A;  3RFR A;  1XNQ O;  4XBF A;  2UXD O;  2HFE C;  5AG2 A;  1D5N A;  2DYS C;  5GW7 A;  3VQV A;  4JYY A;  2UUB B;  4X1K A;  4DR1 O;  1PPJ H;  2X7R B;  4U7N A;  2QWP B;  4DV4 O;  4LF6 B;  1KUQ A;  3LDC A;  1FD9 A;  5KAF Z;  4UV9 A;  4UB6 Z;  5IY5 B;  3J80 N;  4GYC B;  1S5J A;  4CC5 A;  2ZNI A;  2DW4 A;  5LGU A;  2EIN C;  5LA6 A;  4BR6 A;  3B40 A;  4LH7 A;  1QVG U;  4BIU A;  4BIZ A;  1L0L H;  1YTF B;  4ZIB A;  3W7U A;  5H9C A;  2UU9 B;  1QBZ A;  2RQ6 A;  4L8J A;  2UUB O;  1XNR B;  1RPR A;  2KKW A;  1CXZ B;  1KKD A;  4LF6 O;  4LF7 B;  5IJ0 A;  1Y4M A;  5KX5 B;  1RP3 B;  2F4V B;  1YI2 V;  5CB4 A;  3K79 A;  4ZHQ B;  1O9G A;  3K5O A;  4PEL A;  3VBB A;  4FIP C;  4MVM A;  1OJH A;  5FPR A;  4BWA A;  1VP7 A;  4YIO A;  1FFX B;  2OCH A;  2UU9 O;  1P7B A;  1JCH A;  1K7D A;  1XNR O;  2MW2 B;  2PI4 A;  4UFZ A;  2GBO A;  1NVP B;  2L35 A;  3BFR A;  3RWR D;  2ZE7 A;  3BY6 A;  3OE7 G;  3E8B A;  3SPH A;  5IY5 C;  5A2Q N;  2F4V O;  4IHJ A;  4PHZ A;  1MMM A;  1SQX H;  3QNE A;  1YDX A;  5EZY B;  1ZSP A;  5C8Y B;  1EBO A;  4LWS B;  4DV5 B;  5J2U A;  2Q8V A;  4I55 A;  3ZMZ A;  3MDS A;  1JR9 A;  3E8F A;  4JI5 B;  3N2K A;  1Q82 W;  4J9Z B;  1IVS A;  5LOV A;  2CGN A;  2WLN A;  2UUA B;  5FPO A;  1JVM A;  3PN1 A;  1CP9 A;  3JAL B;  4EB6 A;  3CME V;  1YVW A;  2EUL A;  2JVD A;  3T4D A;  5CA0 B;  1NTM H;  1PL4 A;  3KCX A;  1I94 O;  1QR9 A;  3W7W A;  2YDE A;  1PP9 H;  3W7T A;  1GK9 A;  3DC6 A;  3LSU A;  4H37 A;  3JAW A;  4RUE A;  2AZ0 A;  4FVM A;  3QO7 A;  4A5U B;  3HB3 B;  4Q6G A;  2EZO A;  3AG3 B;  2HKO A;  4NYK A;  5B5E Z;  1V54 B;  2RDC A;  5LHI A;  1SZT A;  5EBW C;  5CN0 A;  2Z5U A;  1BGY H;  3K9A A;  4MW3 A;  1N8R W;  3NR7 A;  2VQF B;  2L6L A;  1JQ0 A;  3ZHQ A;  1UFI A;  4HBN A;  3E22 A;  3ZHV A;  3EVK A;  4CH5 A;  1M93 A;  3CCJ V;  1FYJ A;  3CCV V;  4JI6 O;  2JS5 A;  4K3A A;  4UCT A;  1Z5W A;  2CTQ A;  5LGT A;  3QTC A;  3TK1 A;  3SYA A;  3JYC A;  1CEZ A;  1FXK B;  1SZX A;  1KYO F;  3NXS A;  5KHK A;  3LDE A;  1R6N A;  2JGU A;  3R66 A;  3JD2 A;  2ZXW C;  2QKC A;  4B3S B;  2PYJ A;  4X1Y A;  3ETE A;  1M1K W;  5BXZ A;  2VQF O;  1EZJ A;  3CS5 A;  5JH7 B;  4PD4 F;  5KA6 A;  4GX2 A;  4WBN A;  5FNV A;  1I5Y A;  1P49 A;  2PGG A;  4LR3 A;  5L3C A;  1YCI A;  3LUT B;  4RWU A;  1R6T A;  3FAV A;  4X1I B;  2OWO A;  3BA9 A;  3AG3 C;  3RN4 A;  1VQ7 V;  3O9O A;  4YY3 B;  1PNK A;  4FM1 A;  4GT1 A;  5GTH Z;  4LH6 A;  3IC9 A;  3ZMU A;  2ZCE A;  3C3S A;  4JYB A;  1K8A W;  4ASU G;  2BOB C;  1IBL B;  4JV5 B;  2RNB A;  1H2S B;  2YI8 A;  4EFE A;  4JAA A;  2E76 B;  3WFV A;  2R72 A;  1YEW A;  3OW2 U;  1YXB A;  2RCV A;  1Q7Y W;  5LYJ A;  1KQS U;  2HR3 A;  4J80 A;  5CA1 A;  4B3T B;  3ICX A;  4YY3 O;  3W7X A;  5LGN A;  2EBO A;  3L74 H;  4JI1 B;  2OIE A;  5IYZ B;  4X65 O;  4ZOL B;  3RYF B;  4I7Z B;  3ASN B;  4PA4 A;  3ZRW B;  2WLI A;  1IBL O;  1ZAU A;  4JV5 O;  1BCC H;  3OMA B;  4H13 B;  1GN6 A;  1AI6 A;  1ZWI C;  5CBF A;  1JJO A;  3DC5 A;  5EC2 C;  1AVM A;  2ITD C;  2YXY A;  4EKW A;  1SQV H;  1R1B A;  1WA8 A;  5GTI Z;  5F2V O;  5KMG A;  3SYP A;  5L3F A;  4B3T O;  3BPZ A;  2WLL B;  4DUY B;  2BE3 A;  2UXB B;  1M56 B;  4JI1 O;  1PV0 A;  2BTQ B;  2Q0O C;  4ZI7 B;  1XIL A;  3ABT A;  3RYI A;  3OFN G;  2GDS A;  1S5H C;  1EM1 A;  4PA6 A;  4PA3 A;  1K92 A;  2KG7 A;  1DK1 A;  3VQX A;  2JRI A;  1T5E A;  4GX1 A;  3FKS G;  2Q69 A;  1XOU A;  4JI0 B;  2ODM A;  3UT5 B;  1EFR G;  1WAZ A;  3P3N A;  4AQY B;  5H6R A;  1Q90 D;  4RO2 A;  4DR4 B;  4TV9 A;  2EZP A;  4Q20 A;  5GON A;  4DK0 A;  4FLY A;  3SPC A;  4LF8 B;  2UXB O;  2QM7 A;  3OM3 B;  1RSO A;  1QLE C;  4LCU C;  4HNA B;  4I50 B;  2LW1 A;  4D6T H;  4U3J A;  1IX9 A;  3AK2 A;  3CC2 V;  3ASN C;  3H01 A;  1DLB A;  4X20 B;  4QPK A;  2NR5 A;  3ABU A;  5LP6 B;  3D36 C;  4DV3 O;  2P7T C;  4RQF A;  4JI0 O;  4J41 A;  2QWN B;  4LFC O;  3A2F A;  1VQ6 V;  3RW0 A;  1DF4 A;  3HKE A;  4AQY O;  3K3W A;  2Y4U A;  1ZTE A;  4DR4 O;  2FB5 A;  4LF8 O;  1M56 C;  3C90 A;  4NTY A;  2HJF C;  1S5L Z;  5EBL C;  5KUM A;  5LXT A;  4MVS A;  2DE0 X;  3TCU A;  2PUS A;  4UVC A;  4UVA A;  2EIL B;  3DXR B;  1F51 A;  1NBM G;  4E4E A;  1GM9 A;  2IW5 A;  5FLX N;  3OD4 A;  3RVZ A;  2ZM6 B;  2IJK A;  2X6C A;  5KX5 A;  3E83 A;  5FL7 G;  2Q5Z A;  1F7Y A;  5B66 Z;  2HP8 A;  2Q4P A;  5JQG B;  3PJS K;  4MTO A;  4O2A B;  5L3D A;  3FB8 C;  1ZLZ A;  4PI2 A;  1B6Q A;  4DXW A;  5LHH A;  2CAZ C;  2EIM B;  3SYO A;  4UCO A;  2QWR B;  3QG5 A;  4DR2 B;  3JAT A;  1VAR A;  3SGI A;  5LP6 C;  2K9P A;  1OHH G;  1DGS A;  4P2Z A;  5K1P A;  5EYP B;  2P22 C;  1W0J G;  5CBG A;  3ZBH A;  5JJJ B;  5EZY A;  3OEE G;  1BE3 H;  5B3S B;  3K5L A;  4B08 A;  1NH2 D;  5J2T A;  2AGA A;  2M6Y A;  3EXA A;  2XUM A;  3CB2 A;  1GH6 A;  3K5N A;  1B06 A;  3OT7 A;  4DV0 B;  1N33 B;  4I4T B;  4O4H A;  2DN9 A;  4GX5 A;  4DR2 O;  1FXV A;  2EJ7 A;  1OCR B;  1XRE A;  4ICG A;  1HR0 B;  2EIL C;  1US6 A;  3JAR B;  2LW7 A;  4DR7 O;  2Y4T A;  5E1A C;  2BTO A;  2O57 A;  1SQG A;  5B1A B;  4JTC B;  2WLM A;  2ZR3 A;  5CA0 A;  3ZJZ A;  3HKC B;  3G80 A;  2ZE8 A;  3RT3 C;  4P30 A;  1NU1 H;  3OMI B;  4TV8 A;  3ZRX A;  1AI7 A;  2LQT A;  1Q5O A;  4JI7 B;  1NZ6 A;  4LP8 A;  4B3M O;  1VQP V;  4DV1 B;  1COW G;  2IJJ A;  2ZIM A;  3AK3 A;  1L8D A;  2JGD B;  1R6K A;  4IL6 Z;  4DV0 O;  5IYB O;  2YC0 A;  1XI1 A;  1HR0 O;  3JAS B;  5HFM A;  1Y76 B;  2N04 A;  2PTM A;  3N2G A;  3CRA A;  1BZK A;  2ZIO A;  1N34 B;  1IBM O;  5B1N A;  4NKG B;  5H2F Z;  2C2A A;  5ITZ B;  2YEV B;  4JI7 O;  2JJ1 G;  3W7S A;  1E1Q G;  3L72 H;  2AXT Z;  4RQE A;  4IYH A;  4G28 B;  2Q0A A;  1Y6X A;  1HNZ B;  3CPW U;  1OCR C;  2R9R B;  2E74 B;  4YXW G;  2W6I G;  1PNL A;  1H8H G;  1OV9 A;  4FZ0 A;  5B1A C;  1M9N A;  4I0X B;  1N34 O;  1NS1 A;  2PYL A;  1LR1 A;  4JPR A;  1HP8 A;  3CWB H;  5BR8 B;  5JH7 A;  2BCC H;  2E3C A;  3B2E E;  4IIJ A;  3L71 H;  1E79 G;  4LNU A;  3H9V A;  3AG1 B;  4K0K B;  1L0N H;  3ETG A;  4R7C A;  2YI9 A; 
#chains in the Genus database with same CATH homology
 2KSD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...