2KSDA

Backbone structure of the membrane domain of e. coli histidine kinase receptor arcb, center for structures of membrane proteins (csmp) target 4310c
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
75
structure length
75
Chain Sequence
MMKLGLVRFSMLLALALVVLAIVVQMAVTMVLHGQVESIDVIRSIFFGLLITPWAVYFLSVVVEQLEESRQRLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Aerobic respiration control sensor protein arcB
publication title Membrane domain structures of three classes of histidine kinase receptors by cell-free expression and rapid NMR analysis.
pubmed doi rcsb
source organism Escherichia coli
total genus 21
structure length 75
sequence length 75
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2010-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18415 HKR_ArcB_TM Histidine kinase receptor ArcB trans-membrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.970 Mainly Alpha Orthogonal Bundle Helix Hairpins His Kinase A (phosphoacceptor) domain 2ksdA00
2KSDA
chains in the Genus database with same CATH superfamily
3JAWA 4HZ3A 3DGEA 1VQ5V 2AHYA 4YJ2A 3CYOA 3PJSK 1ZTEA 3BAAA 2PI4A 2F93B 1XNRO 4UB6Z 1CP9A 3H01A 4P2ZA 3BCCH 3CJHA 5J2TA 1U97A 4L8JA 2D3OW 4FFBB 4D7TA 4ZHQB 2UUBO 1HNWO 1US6A 2QE7G 5EZYA 1YZBA 2HHHO 1MA1A 4DV1B 1YSCA 5LGUA 1YITV 1LNQA 1BT8A 3L73H 1QLNA 5D5PA 3A2FA 5BR8B 4I50B 4XDKA 5KMGB 2RCVA 5KHJA 4UV8A 4Q6GA 3FAVB 1AVMA 1M93A 3ZHVA 4TSFG 4LF6B 4N23A 4B3MB 2AZ0A 5CN0A 2JRIA 2EILB 1ZAUA 3AG4B 3M99B 4K3AA 1HR0O 1KU9A 2IM9A 4NYKA 3HKEA 4PI0A 5DM6V 3ABKB 3OGCC 1NTZH 1QNMA 4GUNA 3VOUA 1RM1B 4DV7O 2DYRB 4O2BA 1P84F 4JI2B 4P9OA 2UUCO 1LR1A 1RPRA 1ROPA 2DWEC 2JIZG 5IYDO 5DEDA 2ZT9B 1O9HA 3JAKA 3JD4A 3OFNG 3CC4V 3SYOA 4PHZA 3DC5A 4DUYO 2CGOA 1WJZA 1OV9A 4LF8B 2Y4UA 5EC2C 3SJCC 1EN4A 5LOVB 2LO1A 4O4IB 4EB6B 3K0GA 2R9RB 4JPRA 4ZOLA 1AJNA 4TUYB 1GKFA 1FXHA 2Q4PA 3ASOB 3ABTA 5J2UB 1JCHA 1BQZA 2WWWA 1VF7A 3K06A 3RT3C 2GHYA 3S3WA 2EILC 1P49A 2PZSA 3OW2U 1EFRG 4GX0A 1JX9A 2B1IA 1NBMG 4JI5O 3ETEA 3ZN1A 2JS5A 4JI1B 1EM1A 5JCOA 2Q9LA 3ABKC 1OCZB 3H9VA 1AI7A 3APOA 3CWBH 1VQLV 1IXBA 1FAFA 1RM1C 2Z0AA 3ZRWB 2VWJA 2DYRC 1MSDA 3D3IA 1XEQA 3T2MA 1XOUA 4LWSB 2H3OA 1YTFD 3CPWU 1LUWA 4LNUA 3CCLV 4ZBMA 4J11A 3RN4A 2P4VA 1HP8A 5KA5A 2DOSA 4JAUA 1O9GA 1M57C 3CXHF 2AZ2A 4JV5B 3CCSV 1U96A 3K5MA 2UXXA 3U0ZA 1K33A 4NTXA 3SJBC 2ODMA 5B1AB 2ZE6A 2WLIA 5H6QA 3CRQA 4LF7B 2OT5A 1IDSA 3K04A 2P06A 1KECA 2XAFA 1XBLA 2LFSA 1PD3A 3FB8C 3OUSA 2Y4TA 3U11A 1ZWIC 5CMUA 2HP8A 2ITCC 3N2KB 2QJ1A 1OCZC 1WA8B 5JVDB 2N05A 1Q5OA 5IJ0A 3LSQA 5FNVA 5GTHZ 3OE7G 5E1AC 4NB5A 3VQYA 1E1QG 3E89A 4C7UA 3CCEV 4NXNB 3JCUZ 2BSKB 1AR4A 1NVPB 5CA1A 2E5LO 3CMAV 4CH5A 1XILA 3SYAA 4JI4O 3RYIB 1N32B 2EIJB 5IWAB 1Y6XA 2YXYA 4YJ3B 2AW9A 3H1KH 1WN7A 5LMUO 1I0HA 3TK1A 2EINB 4LFAB 3OEEG 2HKOA 5IT9N 4UVAA 2R70A 1K8AW 5GW7A 1BCCH 2PI5A 4WFGA 3SYPA 1S72V 2RNBA 5KHIA 2PYLA 5L3CA 2F95B 2ZXWC 4WCEV 1QBZA 1L1FA 4DV0O 1AI4A 1JJOA 4IL6Z 3AG2B 1Q7YW 2QSAA 4NXMO 1BHAA 4YIPA 4TV9A 1NQTA 2HLDG 1AP5A 3EVKA 5GONB 4J80A 1KP3A 4MW8A 1KB9F 4UCSA 2Q6AA 3M7MX 4AQYO 4HAMA 5EBWC 5KAFZ 1FJGO 2P90A 4X9QA 4GKJO 3P3PA 3CD6V 4RUEA 2RJZA 3P3NA 4DR1B 5B1OA 3HB3B 1VQ6V 1KQSU 1IBMO 2EIJC 3H1IH 1SS3A 3TETA 4J9YB 2OTJV 2LQTA 1MZFA 4FVMA 4AHCA 1ZSPA 5LP6B 1R3LC 3E2EA 1YF2A 1JJ2U 1HR0B 1HNZO 2PTMA 3JARA 2WLJA 5AG2A 4G2KA 4UCOA 1SZXA 5BMVA 2MK3A 4MTOA 4LFCB 4MS2A 3FB5C 2X6BA 3B09A 5C8YB 1NTKH 4UV9A 1SQQH 4F4LA 5EC1C 3R66A 3OMIB 2JEXA 4O4LA 4KFMA 1NR1A 3P30A 2LJ2A 4X8AA 1CEZA 4GX2A 4JI0O 5CA3A 1HWYA 4O2AA 1YCIA 3ZBHA 1FD9A 1ZUQA 1VQKV 4DK0A 1TAEA 4GKKB 3CX5F 5IDJA 2XNDG 3IAYA 3C3TA 1B6QA 1PV0A 1G6UA 1EZJA 4JI5B 4B3TB 4ICGA 1RFYA 3RVZA 3I55V 1B04A 4FM1A 3OTOB 3CHXA 4LF4O 2QM4A 3QNEA 2P7TC 4FMTA 1WB8A 2NLJC 5KHKA 4CC5A 2YDEA 3OEHG 3R65A 1FKAO 3A0HZ 3UT5A 1JFFB 3OM3B 1RP3B 4TV8B 4DR3O 4PD4F 2W6JG 1VQPV 4JI7O 4DW1A 4LF9B 2QM7A 1Z5WA 3ZHSA 3JSLA 5B5EZ 2GV9A 4XDJA 3RFRA 4LR3A 1S3JA 1FXKB 4FJCC 3SJAC 3LNMB 4I0XB 4QE9A 3LSUA 4JTDB 2OTLV 2OWOA 3X2QC 3E8BA 2XT9A 3BPZA 4NVPA 2Y69B 2AXTZ 3S3XA 1FFXB 1NS1A 3FFQA 3ZRXA 1XMQO 5JJNB 1K97A 2OIEA 1Q6UA 2JS3A 5FPOA 3F7YC 4Z1MG 3ZHUA 4O4HB 1XREA 3SR2C 5ITZB 2XASA 3QO7A 3IC9A 1KUQA 1VQ9V 2FKXA 2P22C 2GSMB 1UJWB 1BQ0A 4LH7A 2P67A 1M4UA 3L71H 3RYHB 3O65A 2Y0IA 3P32A 1N36B 1WP8A 3D36A 1SQXH 4H0LB 1NTMH 4BIZA 3T1HB 3STZC 5HFMA 1JOYA 2WPDG 4X64O 4RQEA 2UXCO 3SDLA 4O4JA 3FB6C 1CPYA 2Q7HA 3CCVV 1K4CC 3A8TA 4X1KA 4X65O 4K0KO 1YHQV 4DUZO 2XAQA 2E5LB 4B3RO 2EIMB 4QPKA 2QWPB 3OT7A 2ARHA 4H13B 1BE3H 1Q8IA 1W0JG 2F23A 2VQFO 4R7CA 1JA8A 4UCVA 3CCRV 2KG7B 5LMUB 2CGNA 3F5WC 3QO8A 4J7ZA 2YXHA 3H1LH 4ASUG 5IE9A 4X62O 2FB5A 1S77D 4PV1B 1Q43A 3BVOA 2WLLB 4ZI7B 2JK5C 4B7EA 3BHPA 2XHBA 1TUBB 1P7BA 2ZQMA 1Z5VA 5K1XA 4CZZA 3JAWB 1MG1A 4MVOA 2UXNA 2A0LA 2ZIMA 1AJQA 1TGOA 4PI2A 2UUAO 1RSOB 4GYCB 4WBNA 1N33O 4D7SA 1GK9A 3VQWA 1K92A 1FJGB 1HW7A 2F4VO 1XQ8A 4J41A 3BA9A 1OCOB 4U3JA 2Q7GA 5J2TB 3Q4HA 2EIMC 5JH7A 5CBGA 3SPJA 1G4YB 3TXSA 3NXSA 4D6TH 4DR5B 1IBMB 4IYIA 5F2VO 1KMIZ 1QR9A 1SQPH 4CH6A 1VF6C 3BY6A 1N34O 4DV6B 4UCRA 4R50A 3ZRSA 4X1IA 4YY3B 4DV4O 5JQGA 4DR2B 2ZD9A 2Q73A 2ZM6O 2WLNA 4YHHO 4DK1A 3RYCB 4UB8Z 3T4DA 2RMKB 4R6ZA 1HNZB 3ZX6A 1V55B 3I56V 1EBOA 1N0NA 3QVNA 1F23A 1JPXA 3LSSA 2UXDO 2V7QG 1OCRC 4R8CA 5LA6B 2Q67A 4DO2A 1KYOF 2QWRB 3N27A 3DC6A 3H1HH 1OJHA 3ETGA 1X4TA 3QTCA 1H8HG 2EBOA 3SPCA 5KUMA 3RYFA 1BZKA 3CC7V 3OMNB 1WAZA 2IJJA 4JYYA 4JTAB 1PNMA 4LFBO 3UCSC 1OCOC 4I7ZB 5IYZB 1VP7A 1AI5A 2QKAA 5EYPB 3KKYA 1THZA 2H94A 4JI0B 2ITDC 1IZ3A 1XHXA 3ZMZA 5LGNA 3TJTA 2FYUH 4X1YB 4FFBA 4ZHQA 4UCUA 2LP7A 3JAKB 2IW5A 4BIUA 4E4EA 5LGTA 4PELA 4MTXA 3K0DA 3LDEA 3D8CA 4KL1A 2AHZA 2XUMA 3WB0A 4EFBA 2L6LA 3HKDB 1XMOO 1V55C 4ZOLB 4I50A 4W4KA 5D5QA 4LF4B 1H38A 1LUVA 3B40A 1PNLA 3CP1A 1GM7A 1WP7A 1PKXA 2RN9A 3J80N 2EX3A 1R6TA 5KX5A 3FAVA 5LMNO 4ABMA 4JASA 3STLC 1M57B 1QCEA 4DV5O 1ZX3A 4J7KA 2HR3A 2WLMA 4JI7B 4BW9A 4DR6O 4DRXB 1SERA 2IH3C 2C2AA 4DV2B 4FZ1A 1YEWA 3W7WA 1KC8W 4H37A 2QGNA 1HNXO 4B3SB 5HFLA 1SRYA 3TGUH 1KBHA 4FLXA 3K59A 1MZEA 3C3SA 1MNGA 3RGBA 4PDRA 3SJQC 2YIDA 2BCCH 3UO3A 5CB4B 2H8PC 4LCUC 2CTPA 3E83A 3CCJV 2O57A 1YIJV 1Q90D 3ZMTA 1SQVH 1A32A 4WFEA 2CH7B 4FPPA 3F5TA 1TUEB 3KG2A 3ZCCA 1AP6A 3APQA 2JGUA 3LDCA 5LOVA 3K3WA 4O4IA 4J7JA 4U7NA 4WFFA 2BE3A 4UUJC 2FMLA 1K5QA 4X66O 2F66C 3CB2A 5J2UA 2DQ3A 3CSXA 2ATKC 2X6CA 2B1GA 3DSQA 2HVJC 2YEVB 1AILA 4PA7A 2UXCB 1H2SB 3AK1A 4DW0A 4FLVA 2OYQA 1R73A 1J5EO 3N2GB 3B4SA 4RUFA 1YDXA 5JCOC 4X65B 5BZBA 4K0KB 3KCXA 3K5NA 2DYSB 1SETA 1SA0B 2E3CA 4YIOA 4RQFA 2GUZB 2CUGA 4JYAO 3ZRWA 2QTOA 4LF5O 2HEPA 1EN6A 2OCHA 4MVUA 3WG7B 4G28B 2ZXWB 3MHHC 4X62B 1R6KA 3IC7A 2BOCC 3G6EV 3E8HA 1P7GA 4JYCA 2JEUA 4LC1A 1IX9A 4DR4O 3B8NA 2FTKA 1VQ4V 1QHTA 1FXVA 2ZR2A 2UU9O 3MD0A 1WPXA 2ZINA 1N33B 1MMMA 1V9PA 2ZDIC 2VQEO 1SZTA 1NU1H 3L74H 2UXBO 4RWUA 2F4VB 4FLYA 1GAXA 2QR4A 2WAMA 2DYSC 1I5YA 3N2KA 2V1DA 3TCUA 5B3SC 3MDSA 3ZN0A 2A06H 4ZKIA 1N34B 4MVMA 1B06A 1TVKB 4WFBV 5KHGA 4DV4B 1VQOV 4KP4A 4DV3O 2NR5A 1XNRB 3SPGA 2BSKA 3WG7C 4YHHB 3CC2V 1NH2B 3JASB 4F6RB 1GN4A 5L3FA 1SQBH 2KQXA 2UUBB 2WLHA 3EHBB 1HNWB 1GN3A 2HHHB 5LXTB 1K9MW 3T1CA 3HKCA 3RYIA 2YI8A 4YXWG 1JR9A 3T4ZA 3JD2A 1G8MA 4X20B 4B7KA 4YJ3A 4EKWA 3ZMVA 2CK3G 2P4KA 2BTQB 3E22B 4I55B 4X88A 4MTFA 4LFBB 4NR1A 2DJVA 1KP2A 3E35A 4UFZA 3HR0A 5KAIZ 4IIJB 4JZGA 1SQGA 3AG3C 3K03A 4OXSA 5DECA 1SQFA 3J7AU 4EEQA 5JJEB 1H2NA 5GONA 2YICA 2Y0PA 5DN6G 2BOBC 4DV7B 1XMOB 3CRCA 2UUCB 1ZL8B 2EZOA 2HJDA 1OCCB 5CBFA 3JCZA 3K08A 2ZCEA 3ZHQA 4DUYB 4DV1O 2QEXV 2DN9A 4CS3A 1UFIA 2M6YA 3K58A 2ZE8A 1NVPD 2EULA 1JMKC 3AEIA 5EIBD 1E1RG 1NJIW 1FYJA 3X2QB 1PPJH 5LP6A 4PA3A 5BR8O 1NR7A 2YSUB 2CTRA 3ETDA 1HNXB 1GTOA 1QU7A 3CCUV 1QVGU 1Y76B 2KB1A 4MT8A 4OPHA 3VBBA 4WFAV 5EBMC 4UXNA 3UO2A 1R3KC 5CA0B 1E79G 3IGAC 3O9OA 2HFEC 1VQ8V 5JJJB 2E74B 4LF6O 2IU3A 4JF3A 4G27B 1AR5A 5KA6A 3MHSC 5H2FZ 4I4TB 3IFXA 2Z3YA 2W0FC 5C8YA 4TQFA 1AB3A 4JAAA 3KCYA 5JWPA 4JYBA 3RBZA 4LH6A 4WFHA 5IJ9B 4MSWC 2LFRA 3RVYA 1Q6IA 1OCCC 4MVSA 2HVKC 4IYHA 4JTCB 4BWAA 3JD3A 3DXRB 3B2EE 3AG7A 3K9SA 1I94O 5A2QN 3ZHRA 1L8DA 4K35A 5FPRA 5KHHA 2ZKOA 1PL4A 1XI1A 3FB7C 5H9CA 3NR7A 5LYJA 5FL7G 3W7UA 1X59A 5B66Z 3MAQA 4J10A 3E8FA 4JYAB 1JFFA 1XL6A 2IU0A 5LHIA 4TV8A 4LF5B 4GLXA 4X1KB 4GCZA 2JGDB 3OGIB 1YXBA 4IT5A 4JI1O 3GB7C 3L70H 1ENVA 1FXKA 1XL4A 4I0XA 3JALB 3SYCA 1SESA 3FYEB 3OAAG 4PJ0Z 5H5NA 3HKBB 4DR4B 1YVWA 4FM2A 1I08A 2CTQA 3ABMB 1FFXA 1GM9A 4JI4B 3K9AA 3JATB 4MVZA 2VQEB 2QWQB 4JV5O 4O4HA 2UXBB 5ITZA 1QLEB 1BHBA 2QA4V 4Z1VA 2W0XA 4Q20A 1VARA 3ZRVA 3ZS8C 1Y74A 1D5AA 2X7RB 2WA4A 4LF7O 1JVMA 4DR7O 3RYHA 4TT3G 3G6BA 3L75H 3UKMA 4IHJB 1RPOA 4DV3B 4NTWA 2P6JA 4HNAB 1OCRB 4U3JB 3CCQV 4N21A 4QE7A 2JJ1G 2YIAA 3BRCA 4FM0A 4DV0B 2PUSA 4J42A 1TA8A 4NXMB 3W7SA 1PM9A 1F7YA 1DF4A 4JI3O 2R9IA 3L72H 1FS0G 2JDIG 4B08A 1QR8A 1VQNV 4YJ2B 2X0LA 2ZR3A 3AK3A 4AQYB 4QIWF 4W4LA 4QNHB 4NXNO 1GO3F 2KG7A 1M1KW 3ABMC 4X89A 4I5SA 3CJHB 1GN6A 3FYIB 1IVSA 4GKJB 1XUQA 1KKCA 4MVRA 1QLEC 1FFTB 4FLZA 5EZYB 3ZMUA 2QKSA 2WLLA 1N32O 4ZI7A 3ML0A 4Z2WA 4PA9A 4PDVA 1TUBA 4KXRA 1F4NA 1IBKO 4LFAO 1V54B 1GMGA 2F43G 4BIOA 1RSOA 3K5LA 4AILC 2EJRA 1YJ9V 3VQVA 3RW0A 3E86A 1YTFB 3QG5A 4HBNA 3ASNB 1QQCA 4H33A 1R1BA 2NNUA 2WSSG 5L3EA 3HKEB 2E76B 1QVFU 3ZMSA 4F6EA 2OIGA 2XTAA 1WNSA 3OMAB 1MSWD 3OUFA 1W0KG 4O2BB 3ABLB 1IBLO 5B1BC 3RYCA 1NKDA 4L87A 4PDMA 4JGSA 2DWDC 4DR1O 3HPLC 5KX5B 3RWRD 4CBCA 3WU2Z 4BR6A 5LA6A 3K57A 4E2LA 4WF9V 1F51A 1N0JA 1N8RW 2VRZA 1BGYH 1W2BU 2CAZC 1V54C 5LBQA 5KMGA 3CMEV 2A79B 2GTSA 2WA3A 2M7WA 3WFVA 3QF7A 4DR3B 5IYZA 2ZE7A 3H1JH 2ZNJA 1EN5A 3PN1A 5EYPA 3ASNC 3JSNA 1D5NA 3ZEDA 1J95A 4LFCO 2ADPA 1Q3EA 2PGGA 4X1YA 2ILMA 1SKVA 3J81N 1Q6HA 1H2MA 2KKWA 5J9PC 2CDYA 4UCTA 4EFEA 4RO2A 3W7XA 3G80A 1VQ7V 1I94B 4UVCA 1XNQO 2ZE5A 3ABLC 2QWOB 4QGPA 2Q7EA 4FLUA 4DXWA 2QM8A 3HKDA 4LNUB 1XMQB 4OX9O 3CRMA 5LL6Y 1MOFA 1GH6A 1VQMV 4GKKO 4MVQA 2HJFC 1AROP 3AG4C 1AJPA 5IYBO 4FFKA 3WB1A 4DRXA 2WLIB 4B3TO 4NTYA 4EB6A 3OTOO 4TUYA 1UPGA 3B8MA 4X64B 4JI8O 3BFRA 4FK5C 2EJ7A 4AI8A 2FL4A 4DUZB 4B3RB 4LF9O 4KHPO 5IJ0B 5CB4A 2XOKG 5FNVB 2IH1C 5KLVH 5B3SB 4IGGA 3CRRA 1DK1A 2Q68A 5TISZ 3F7VC 2VQFB 3UM7A 2A7WA 3GVMA 4JZ2A 3VQXA 2RQ6A 4PA6A 2CH7A 1K7DA 1YJNV 4LWSA 1H2KA 1Y4MA 5CA1B 3ASOC 1L0NH 1YJWV 4JI6O 1P4RA 3T1YO 4DR7B 5LHHA 2ETNA 5B1NA 2YC0A 3WB2A 1VEWA 2YEVA 3CXCU 4HYOA 2ZDIA 2GBOA 3N2GA 1IXMA 5GTIZ 5C93A 2UUAB 4JI3B 2IBZH 1SA0A 2GTAA 2HG5C 1I7FA 3TXQA 3GWOA 2GUZA 4U7OA 3CE2A 1H8EG 1N36O 2A3QA 1H2LA 5LHGA 3T1HO 1Q86W 3B77A 1M5IA 3SGIA 2EIKB 3FX7A 4JAVA 4GX1A 1K4DC 3UQ8A 1VF5B 3CS5A 2ADQB 1WA8A 2ZIOA 4MW3A 1CXZB 3AG3B 5JVDA 2OCCB 2JJ2G 3OD4A 4TV9B 4CS4A 5A9GA 4I9WA 3HKCB 5L3GA 2YXLA 4RAIA 2F1MA 2R72A 2EZPA 4KUMA 5B1AC 3G67A 3ZIAG 2ZM6B 1IBKB 2LGQA 1GRJA 2R9AA 1G1XB 3THOA 4FLTA 2UXDB 1BSMA 2QTSA 3M8AA 1GM8A 3I5DA 5L3BA 3ICXA 3CCMV 2IJKA 1BMFG 4U3FH 3L9DA 5KUKA 5EK0A 3K79A 2JVDA 1BL8A 3OR6C 2N04A 5EIBC 1TVKA 3JARB 2EIKC 4GX5A 5BMVB 1Q82W 2YIBA 1IBLB 3G71V 2OCCC 3AG1B 1Y67A 4QJFB 3JASA 4F6RA 1PNKA 2Q5ZA 1Y66A 2L35A 2LGWA 4K8XA 1KD1W 4DR5O 1S5JA 1OHHG 5LXTA 3C90A 4DV6O 1F4MA 4O4LB 4P30A 4YY3O 4X20A 2EINC 4DR2O 2KSDA 4QPJA 3JYCA 1K73W 2LW7A 4O2AB 3U10A 2BTQA 1S5LZ 2IJHA 3E22A 4XBFA 4I55A 1L0LH 5LMNB 2Q8VA 1AR1B 2Q0AA 4TOIA 4DV5B 4BW5A 4DR6B 3A0BZ 4IIJA 1YI2V 1OZ0A 3JD1A 4XDLA 1VIBA 3AG2C 4CS2A 1EZVH 3FKSG 1Z2GA 4H44B 1FPOA 2B5UA 2N74A 2YS8A 3UT5B 2QKCA 3ETQA 1XNQB 4NKGB 1SF9A 3AG1C 5BXZA 4B3MO 4J9ZB 2XAHA 1WB7A 4OX9B 1H2GA 2YUAA 2XAJA 4FIPC 5IYCO 1ZL8A 2V4DA 1NI8A 1S5HC 3IJ4A 3G4SV 2DMXA 1KKDA 5CBHA 1SC5B 2IJIA 2D2CB 4BAYA 4CH4A 1AI6A 5LP6C 2YIBD 3ZHTA 5IY5B 1NH2D 3JAMN 5LYJB 4JI2O 4X66B 1Y76A 2MW2B 2GDSA 4JI8B 5CA0A 3LNNA 1J5EB 2PF4E 3JD0A 2B9ZA 1I5XA 4LF8O 1W59A 1XHZA 3CEIA 4KHPB 2VWKA 1XDCA 2DE0X 4DV2O 3KZIZ 2LW1A 5FLXN 4I4TA 1S0VA 1D2DA 4GZRB 3BEHA 1M56B 4B3SO 3EXAA 3OTFA 2CE4A 4O4JB 5H6RA 5K1PA 3EFFK 5IJ9A 2WLKA 1ORQC 4JI6B 4MTGA 2G38A 3SYQA 4CH3A 3T1YB 3SPIA 2RDCA 1DGSA 3W7TA 2QWNB 2Q69A 1MABG 2W6IG 5IY5C 3DXRA 1K3EA 1R3IC 1DTOA 4FLWA 3A0RA 1Y74B 2Q0OC 3BA8A 1ZLZA 2X6AA 1M9NA 2UU9B 2A9HA 5BY1A 3ZJZA 3SPHA 1HDJA 1COWG 4LBEC 1DLBA 3FD9A 2DQ0A 4DYLA 4OPAA 3GWKC 2PY5A 3CRAA 4TWKA 2DW4A 1S76D 4OGQB 4CC6A 1GN2A 1URFA 4GT1A 1FXKC 4I9QA 4LP8A 1WPBA 2JGDA 3D36C 1BS3A 1M56C 2CTWA 3LDDA 5EBLC 4WBNB 1VMGA 2Z5UA 3DTUB 1WLEA 2Y69C 1JQ0A 3JALA 3QO5A 4FZ0A 3HKBA 2P5OA 1R6NA 1PL0A 2NN4A 1K34A 3Q4HB 1M90W 1IURA 5JH7B 2PYJA 4UVBA 1N4CA 3K5OA 2E75B 5E79Z 2Y48A 2QDOA 1DF5A 2XAGA 3JATA 4ZIBA 1R3JC 2BTOA 3OR7C 3BABA 4X1IB 1K5SA 1VF6A 5JQGB 3AK2A 5L3DA 4P9PA 1T5EA 3D3QA 3ABUA 2YI9A 1Q81W 2K9PA 5B1BB 2VS0A 1NT2B 2AGAA 4K8ZA 1B3QA 4PA4A 4IHJA 4TQDA 5IWAO 4HNAA 1PP9H 4A5UB 2ZNIA 3LUTB 1NZ6A 3RYFB 3E8GA 2K1EA 4PDLA
chains in the Genus database with same CATH topology
2KSDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KSD A; 
#chains in the Genus database with same CATH topology
 3JAW A;  4HZ3 A;  3DGE A;  1VQ5 V;  2AHY A;  4YJ2 A;  3CYO A;  3PJS K;  1ZTE A;  3BAA A;  2PI4 A;  2F93 B;  1XNR O;  4UB6 Z;  1CP9 A;  3H01 A;  4P2Z A;  3BCC H;  3CJH A;  5J2T A;  1U97 A;  4L8J A;  2D3O W;  4FFB B;  4D7T A;  4ZHQ B;  2UUB O;  1HNW O;  1US6 A;  2QE7 G;  5EZY A;  1YZB A;  2HHH O;  1MA1 A;  4DV1 B;  1YSC A;  5LGU A;  1YIT V;  1LNQ A;  1BT8 A;  3L73 H;  1QLN A;  5D5P A;  3A2F A;  5BR8 B;  4I50 B;  4XDK A;  5KMG B;  2RCV A;  5KHJ A;  4UV8 A;  4Q6G A;  3FAV B;  1AVM A;  1M93 A;  3ZHV A;  4TSF G;  4LF6 B;  4N23 A;  4B3M B;  2AZ0 A;  5CN0 A;  2JRI A;  2EIL B;  1ZAU A;  3AG4 B;  3M99 B;  4K3A A;  1HR0 O;  1KU9 A;  2IM9 A;  4NYK A;  3HKE A;  4PI0 A;  5DM6 V;  3ABK B;  3OGC C;  1NTZ H;  1QNM A;  4GUN A;  3VOU A;  1RM1 B;  4DV7 O;  2DYR B;  4O2B A;  1P84 F;  4JI2 B;  4P9O A;  2UUC O;  1LR1 A;  1RPR A;  1ROP A;  2DWE C;  2JIZ G;  5IYD O;  5DED A;  2ZT9 B;  1O9H A;  3JAK A;  3JD4 A;  3OFN G;  3CC4 V;  3SYO A;  4PHZ A;  3DC5 A;  4DUY O;  2CGO A;  1WJZ A;  1OV9 A;  4LF8 B;  2Y4U A;  5EC2 C;  3SJC C;  1EN4 A;  5LOV B;  2LO1 A;  4O4I B;  4EB6 B;  3K0G A;  2R9R B;  4JPR A;  4ZOL A;  1AJN A;  4TUY B;  1GKF A;  1FXH A;  2Q4P A;  3ASO B;  3ABT A;  5J2U B;  1JCH A;  1BQZ A;  2WWW A;  1VF7 A;  3K06 A;  3RT3 C;  2GHY A;  3S3W A;  2EIL C;  1P49 A;  2PZS A;  3OW2 U;  1EFR G;  4GX0 A;  1JX9 A;  2B1I A;  1NBM G;  4JI5 O;  3ETE A;  3ZN1 A;  2JS5 A;  4JI1 B;  1EM1 A;  5JCO A;  2Q9L A;  3ABK C;  1OCZ B;  3H9V A;  1AI7 A;  3APO A;  3CWB H;  1VQL V;  1IXB A;  1FAF A;  1RM1 C;  2Z0A A;  3ZRW B;  2VWJ A;  2DYR C;  1MSD A;  3D3I A;  1XEQ A;  3T2M A;  1XOU A;  4LWS B;  2H3O A;  1YTF D;  3CPW U;  1LUW A;  4LNU A;  3CCL V;  4ZBM A;  4J11 A;  3RN4 A;  2P4V A;  1HP8 A;  5KA5 A;  2DOS A;  4JAU A;  1O9G A;  1M57 C;  3CXH F;  2AZ2 A;  4JV5 B;  3CCS V;  1U96 A;  3K5M A;  2UXX A;  3U0Z A;  1K33 A;  4NTX A;  3SJB C;  2ODM A;  5B1A B;  2ZE6 A;  2WLI A;  5H6Q A;  3CRQ A;  4LF7 B;  2OT5 A;  1IDS A;  3K04 A;  2P06 A;  1KEC A;  2XAF A;  1XBL A;  2LFS A;  1PD3 A;  3FB8 C;  3OUS A;  2Y4T A;  3U11 A;  1ZWI C;  5CMU A;  2HP8 A;  2ITC C;  3N2K B;  2QJ1 A;  1OCZ C;  1WA8 B;  5JVD B;  2N05 A;  1Q5O A;  5IJ0 A;  3LSQ A;  5FNV A;  5GTH Z;  3OE7 G;  5E1A C;  4NB5 A;  3VQY A;  1E1Q G;  3E89 A;  4C7U A;  3CCE V;  4NXN B;  3JCU Z;  2BSK B;  1AR4 A;  1NVP B;  5CA1 A;  2E5L O;  3CMA V;  4CH5 A;  1XIL A;  3SYA A;  4JI4 O;  3RYI B;  1N32 B;  2EIJ B;  5IWA B;  1Y6X A;  2YXY A;  4YJ3 B;  2AW9 A;  3H1K H;  1WN7 A;  5LMU O;  1I0H A;  3TK1 A;  2EIN B;  4LFA B;  3OEE G;  2HKO A;  5IT9 N;  4UVA A;  2R70 A;  1K8A W;  5GW7 A;  1BCC H;  2PI5 A;  4WFG A;  3SYP A;  1S72 V;  2RNB A;  5KHI A;  2PYL A;  5L3C A;  2F95 B;  2ZXW C;  4WCE V;  1QBZ A;  1L1F A;  4DV0 O;  1AI4 A;  1JJO A;  4IL6 Z;  3AG2 B;  1Q7Y W;  2QSA A;  4NXM O;  1BHA A;  4YIP A;  4TV9 A;  1NQT A;  2HLD G;  1AP5 A;  3EVK A;  5GON B;  4J80 A;  1KP3 A;  4MW8 A;  1KB9 F;  4UCS A;  2Q6A A;  3M7M X;  4AQY O;  4HAM A;  5EBW C;  5KAF Z;  1FJG O;  2P90 A;  4X9Q A;  4GKJ O;  3P3P A;  3CD6 V;  4RUE A;  2RJZ A;  3P3N A;  4DR1 B;  5B1O A;  3HB3 B;  1VQ6 V;  1KQS U;  1IBM O;  2EIJ C;  3H1I H;  1SS3 A;  3TET A;  4J9Y B;  2OTJ V;  2LQT A;  1MZF A;  4FVM A;  4AHC A;  1ZSP A;  5LP6 B;  1R3L C;  3E2E A;  1YF2 A;  1JJ2 U;  1HR0 B;  1HNZ O;  2PTM A;  3JAR A;  2WLJ A;  5AG2 A;  4G2K A;  4UCO A;  1SZX A;  5BMV A;  2MK3 A;  4MTO A;  4LFC B;  4MS2 A;  3FB5 C;  2X6B A;  3B09 A;  5C8Y B;  1NTK H;  4UV9 A;  1SQQ H;  4F4L A;  5EC1 C;  3R66 A;  3OMI B;  2JEX A;  4O4L A;  4KFM A;  1NR1 A;  3P30 A;  2LJ2 A;  4X8A A;  1CEZ A;  4GX2 A;  4JI0 O;  5CA3 A;  1HWY A;  4O2A A;  1YCI A;  3ZBH A;  1FD9 A;  1ZUQ A;  1VQK V;  4DK0 A;  1TAE A;  4GKK B;  3CX5 F;  5IDJ A;  2XND G;  3IAY A;  3C3T A;  1B6Q A;  1PV0 A;  1G6U A;  1EZJ A;  4JI5 B;  4B3T B;  4ICG A;  1RFY A;  3RVZ A;  3I55 V;  1B04 A;  4FM1 A;  3OTO B;  3CHX A;  4LF4 O;  2QM4 A;  3QNE A;  2P7T C;  4FMT A;  1WB8 A;  2NLJ C;  5KHK A;  4CC5 A;  2YDE A;  3OEH G;  3R65 A;  1FKA O;  3A0H Z;  3UT5 A;  1JFF B;  3OM3 B;  1RP3 B;  4TV8 B;  4DR3 O;  4PD4 F;  2W6J G;  1VQP V;  4JI7 O;  4DW1 A;  4LF9 B;  2QM7 A;  1Z5W A;  3ZHS A;  3JSL A;  5B5E Z;  2GV9 A;  4XDJ A;  3RFR A;  4LR3 A;  1S3J A;  1FXK B;  4FJC C;  3SJA C;  3LNM B;  4I0X B;  4QE9 A;  3LSU A;  4JTD B;  2OTL V;  2OWO A;  3X2Q C;  3E8B A;  2XT9 A;  3BPZ A;  4NVP A;  2Y69 B;  2AXT Z;  3S3X A;  1FFX B;  1NS1 A;  3FFQ A;  3ZRX A;  1XMQ O;  5JJN B;  1K97 A;  2OIE A;  1Q6U A;  2JS3 A;  5FPO A;  3F7Y C;  4Z1M G;  3ZHU A;  4O4H B;  1XRE A;  3SR2 C;  5ITZ B;  2XAS A;  3QO7 A;  3IC9 A;  1KUQ A;  1VQ9 V;  2FKX A;  2P22 C;  2GSM B;  1UJW B;  1BQ0 A;  4LH7 A;  2P67 A;  1M4U A;  3L71 H;  3RYH B;  3O65 A;  2Y0I A;  3P32 A;  1N36 B;  1WP8 A;  3D36 A;  1SQX H;  4H0L B;  1NTM H;  4BIZ A;  3T1H B;  3STZ C;  5HFM A;  1JOY A;  2WPD G;  4X64 O;  4RQE A;  2UXC O;  3SDL A;  4O4J A;  3FB6 C;  1CPY A;  2Q7H A;  3CCV V;  1K4C C;  3A8T A;  4X1K A;  4X65 O;  4K0K O;  1YHQ V;  4DUZ O;  2XAQ A;  2E5L B;  4B3R O;  2EIM B;  4QPK A;  2QWP B;  3OT7 A;  2ARH A;  4H13 B;  1BE3 H;  1Q8I A;  1W0J G;  2F23 A;  2VQF O;  4R7C A;  1JA8 A;  4UCV A;  3CCR V;  2KG7 B;  5LMU B;  2CGN A;  3F5W C;  3QO8 A;  4J7Z A;  2YXH A;  3H1L H;  4ASU G;  5IE9 A;  4X62 O;  2FB5 A;  1S77 D;  4PV1 B;  1Q43 A;  3BVO A;  2WLL B;  4ZI7 B;  2JK5 C;  4B7E A;  3BHP A;  2XHB A;  1TUB B;  1P7B A;  2ZQM A;  1Z5V A;  5K1X A;  4CZZ A;  3JAW B;  1MG1 A;  4MVO A;  2UXN A;  2A0L A;  2ZIM A;  1AJQ A;  1TGO A;  4PI2 A;  2UUA O;  1RSO B;  4GYC B;  4WBN A;  1N33 O;  4D7S A;  1GK9 A;  3VQW A;  1K92 A;  1FJG B;  1HW7 A;  2F4V O;  1XQ8 A;  4J41 A;  3BA9 A;  1OCO B;  4U3J A;  2Q7G A;  5J2T B;  3Q4H A;  2EIM C;  5JH7 A;  5CBG A;  3SPJ A;  1G4Y B;  3TXS A;  3NXS A;  4D6T H;  4DR5 B;  1IBM B;  4IYI A;  5F2V O;  1KMI Z;  1QR9 A;  1SQP H;  4CH6 A;  1VF6 C;  3BY6 A;  1N34 O;  4DV6 B;  4UCR A;  4R50 A;  3ZRS A;  4X1I A;  4YY3 B;  4DV4 O;  5JQG A;  4DR2 B;  2ZD9 A;  2Q73 A;  2ZM6 O;  2WLN A;  4YHH O;  4DK1 A;  3RYC B;  4UB8 Z;  3T4D A;  2RMK B;  4R6Z A;  1HNZ B;  3ZX6 A;  1V55 B;  3I56 V;  1EBO A;  1N0N A;  3QVN A;  1F23 A;  1JPX A;  3LSS A;  2UXD O;  2V7Q G;  1OCR C;  4R8C A;  5LA6 B;  2Q67 A;  4DO2 A;  1KYO F;  2QWR B;  3N27 A;  3DC6 A;  3H1H H;  1OJH A;  3ETG A;  1X4T A;  3QTC A;  1H8H G;  2EBO A;  3SPC A;  5KUM A;  3RYF A;  1BZK A;  3CC7 V;  3OMN B;  1WAZ A;  2IJJ A;  4JYY A;  4JTA B;  1PNM A;  4LFB O;  3UCS C;  1OCO C;  4I7Z B;  5IYZ B;  1VP7 A;  1AI5 A;  2QKA A;  5EYP B;  3KKY A;  1THZ A;  2H94 A;  4JI0 B;  2ITD C;  1IZ3 A;  1XHX A;  3ZMZ A;  5LGN A;  3TJT A;  2FYU H;  4X1Y B;  4FFB A;  4ZHQ A;  4UCU A;  2LP7 A;  3JAK B;  2IW5 A;  4BIU A;  4E4E A;  5LGT A;  4PEL A;  4MTX A;  3K0D A;  3LDE A;  3D8C A;  4KL1 A;  2AHZ A;  2XUM A;  3WB0 A;  4EFB A;  2L6L A;  3HKD B;  1XMO O;  1V55 C;  4ZOL B;  4I50 A;  4W4K A;  5D5Q A;  4LF4 B;  1H38 A;  1LUV A;  3B40 A;  1PNL A;  3CP1 A;  1GM7 A;  1WP7 A;  1PKX A;  2RN9 A;  3J80 N;  2EX3 A;  1R6T A;  5KX5 A;  3FAV A;  5LMN O;  4ABM A;  4JAS A;  3STL C;  1M57 B;  1QCE A;  4DV5 O;  1ZX3 A;  4J7K A;  2HR3 A;  2WLM A;  4JI7 B;  4BW9 A;  4DR6 O;  4DRX B;  1SER A;  2IH3 C;  2C2A A;  4DV2 B;  4FZ1 A;  1YEW A;  3W7W A;  1KC8 W;  4H37 A;  2QGN A;  1HNX O;  4B3S B;  5HFL A;  1SRY A;  3TGU H;  1KBH A;  4FLX A;  3K59 A;  1MZE A;  3C3S A;  1MNG A;  3RGB A;  4PDR A;  3SJQ C;  2YID A;  2BCC H;  3UO3 A;  5CB4 B;  2H8P C;  4LCU C;  2CTP A;  3E83 A;  3CCJ V;  2O57 A;  1YIJ V;  1Q90 D;  3ZMT A;  1SQV H;  1A32 A;  4WFE A;  2CH7 B;  4FPP A;  3F5T A;  1TUE B;  3KG2 A;  3ZCC A;  1AP6 A;  3APQ A;  2JGU A;  3LDC A;  5LOV A;  3K3W A;  4O4I A;  4J7J A;  4U7N A;  4WFF A;  2BE3 A;  4UUJ C;  2FML A;  1K5Q A;  4X66 O;  2F66 C;  3CB2 A;  5J2U A;  2DQ3 A;  3CSX A;  2ATK C;  2X6C A;  2B1G A;  3DSQ A;  2HVJ C;  2YEV B;  1AIL A;  4PA7 A;  2UXC B;  1H2S B;  3AK1 A;  4DW0 A;  4FLV A;  2OYQ A;  1R73 A;  1J5E O;  3N2G B;  3B4S A;  4RUF A;  1YDX A;  5JCO C;  4X65 B;  5BZB A;  4K0K B;  3KCX A;  3K5N A;  2DYS B;  1SET A;  1SA0 B;  2E3C A;  4YIO A;  4RQF A;  2GUZ B;  2CUG A;  4JYA O;  3ZRW A;  2QTO A;  4LF5 O;  2HEP A;  1EN6 A;  2OCH A;  4MVU A;  3WG7 B;  4G28 B;  2ZXW B;  3MHH C;  4X62 B;  1R6K A;  3IC7 A;  2BOC C;  3G6E V;  3E8H A;  1P7G A;  4JYC A;  2JEU A;  4LC1 A;  1IX9 A;  4DR4 O;  3B8N A;  2FTK A;  1VQ4 V;  1QHT A;  1FXV A;  2ZR2 A;  2UU9 O;  3MD0 A;  1WPX A;  2ZIN A;  1N33 B;  1MMM A;  1V9P A;  2ZDI C;  2VQE O;  1SZT A;  1NU1 H;  3L74 H;  2UXB O;  4RWU A;  2F4V B;  4FLY A;  1GAX A;  2QR4 A;  2WAM A;  2DYS C;  1I5Y A;  3N2K A;  2V1D A;  3TCU A;  5B3S C;  3MDS A;  3ZN0 A;  2A06 H;  4ZKI A;  1N34 B;  4MVM A;  1B06 A;  1TVK B;  4WFB V;  5KHG A;  4DV4 B;  1VQO V;  4KP4 A;  4DV3 O;  2NR5 A;  1XNR B;  3SPG A;  2BSK A;  3WG7 C;  4YHH B;  3CC2 V;  1NH2 B;  3JAS B;  4F6R B;  1GN4 A;  5L3F A;  1SQB H;  2KQX A;  2UUB B;  2WLH A;  3EHB B;  1HNW B;  1GN3 A;  2HHH B;  5LXT B;  1K9M W;  3T1C A;  3HKC A;  3RYI A;  2YI8 A;  4YXW G;  1JR9 A;  3T4Z A;  3JD2 A;  1G8M A;  4X20 B;  4B7K A;  4YJ3 A;  4EKW A;  3ZMV A;  2CK3 G;  2P4K A;  2BTQ B;  3E22 B;  4I55 B;  4X88 A;  4MTF A;  4LFB B;  4NR1 A;  2DJV A;  1KP2 A;  3E35 A;  4UFZ A;  3HR0 A;  5KAI Z;  4IIJ B;  4JZG A;  1SQG A;  3AG3 C;  3K03 A;  4OXS A;  5DEC A;  1SQF A;  3J7A U;  4EEQ A;  5JJE B;  1H2N A;  5GON A;  2YIC A;  2Y0P A;  5DN6 G;  2BOB C;  4DV7 B;  1XMO B;  3CRC A;  2UUC B;  1ZL8 B;  2EZO A;  2HJD A;  1OCC B;  5CBF A;  3JCZ A;  3K08 A;  2ZCE A;  3ZHQ A;  4DUY B;  4DV1 O;  2QEX V;  2DN9 A;  4CS3 A;  1UFI A;  2M6Y A;  3K58 A;  2ZE8 A;  1NVP D;  2EUL A;  1JMK C;  3AEI A;  5EIB D;  1E1R G;  1NJI W;  1FYJ A;  3X2Q B;  1PPJ H;  5LP6 A;  4PA3 A;  5BR8 O;  1NR7 A;  2YSU B;  2CTR A;  3ETD A;  1HNX B;  1GTO A;  1QU7 A;  3CCU V;  1QVG U;  1Y76 B;  2KB1 A;  4MT8 A;  4OPH A;  3VBB A;  4WFA V;  5EBM C;  4UXN A;  3UO2 A;  1R3K C;  5CA0 B;  1E79 G;  3IGA C;  3O9O A;  2HFE C;  1VQ8 V;  5JJJ B;  2E74 B;  4LF6 O;  2IU3 A;  4JF3 A;  4G27 B;  1AR5 A;  5KA6 A;  3MHS C;  5H2F Z;  4I4T B;  3IFX A;  2Z3Y A;  2W0F C;  5C8Y A;  4TQF A;  1AB3 A;  4JAA A;  3KCY A;  5JWP A;  4JYB A;  3RBZ A;  4LH6 A;  4WFH A;  5IJ9 B;  4MSW C;  2LFR A;  3RVY A;  1Q6I A;  1OCC C;  4MVS A;  2HVK C;  4IYH A;  4JTC B;  4BWA A;  3JD3 A;  3DXR B;  3B2E E;  3AG7 A;  3K9S A;  1I94 O;  5A2Q N;  3ZHR A;  1L8D A;  4K35 A;  5FPR A;  5KHH A;  2ZKO A;  1PL4 A;  1XI1 A;  3FB7 C;  5H9C A;  3NR7 A;  5LYJ A;  5FL7 G;  3W7U A;  1X59 A;  5B66 Z;  3MAQ A;  4J10 A;  3E8F A;  4JYA B;  1JFF A;  1XL6 A;  2IU0 A;  5LHI A;  4TV8 A;  4LF5 B;  4GLX A;  4X1K B;  4GCZ A;  2JGD B;  3OGI B;  1YXB A;  4IT5 A;  4JI1 O;  3GB7 C;  3L70 H;  1ENV A;  1FXK A;  1XL4 A;  4I0X A;  3JAL B;  3SYC A;  1SES A;  3FYE B;  3OAA G;  4PJ0 Z;  5H5N A;  3HKB B;  4DR4 B;  1YVW A;  4FM2 A;  1I08 A;  2CTQ A;  3ABM B;  1FFX A;  1GM9 A;  4JI4 B;  3K9A A;  3JAT B;  4MVZ A;  2VQE B;  2QWQ B;  4JV5 O;  4O4H A;  2UXB B;  5ITZ A;  1QLE B;  1BHB A;  2QA4 V;  4Z1V A;  2W0X A;  4Q20 A;  1VAR A;  3ZRV A;  3ZS8 C;  1Y74 A;  1D5A A;  2X7R B;  2WA4 A;  4LF7 O;  1JVM A;  4DR7 O;  3RYH A;  4TT3 G;  3G6B A;  3L75 H;  3UKM A;  4IHJ B;  1RPO A;  4DV3 B;  4NTW A;  2P6J A;  4HNA B;  1OCR B;  4U3J B;  3CCQ V;  4N21 A;  4QE7 A;  2JJ1 G;  2YIA A;  3BRC A;  4FM0 A;  4DV0 B;  2PUS A;  4J42 A;  1TA8 A;  4NXM B;  3W7S A;  1PM9 A;  1F7Y A;  1DF4 A;  4JI3 O;  2R9I A;  3L72 H;  1FS0 G;  2JDI G;  4B08 A;  1QR8 A;  1VQN V;  4YJ2 B;  2X0L A;  2ZR3 A;  3AK3 A;  4AQY B;  4QIW F;  4W4L A;  4QNH B;  4NXN O;  1GO3 F;  2KG7 A;  1M1K W;  3ABM C;  4X89 A;  4I5S A;  3CJH B;  1GN6 A;  3FYI B;  1IVS A;  4GKJ B;  1XUQ A;  1KKC A;  4MVR A;  1QLE C;  1FFT B;  4FLZ A;  5EZY B;  3ZMU A;  2QKS A;  2WLL A;  1N32 O;  4ZI7 A;  3ML0 A;  4Z2W A;  4PA9 A;  4PDV A;  1TUB A;  4KXR A;  1F4N A;  1IBK O;  4LFA O;  1V54 B;  1GMG A;  2F43 G;  4BIO A;  1RSO A;  3K5L A;  4AIL C;  2EJR A;  1YJ9 V;  3VQV A;  3RW0 A;  3E86 A;  1YTF B;  3QG5 A;  4HBN A;  3ASN B;  1QQC A;  4H33 A;  1R1B A;  2NNU A;  2WSS G;  5L3E A;  3HKE B;  2E76 B;  1QVF U;  3ZMS A;  4F6E A;  2OIG A;  2XTA A;  1WNS A;  3OMA B;  1MSW D;  3OUF A;  1W0K G;  4O2B B;  3ABL B;  1IBL O;  5B1B C;  3RYC A;  1NKD A;  4L87 A;  4PDM A;  4JGS A;  2DWD C;  4DR1 O;  3HPL C;  5KX5 B;  3RWR D;  4CBC A;  3WU2 Z;  4BR6 A;  5LA6 A;  3K57 A;  4E2L A;  4WF9 V;  1F51 A;  1N0J A;  1N8R W;  2VRZ A;  1BGY H;  1W2B U;  2CAZ C;  1V54 C;  5LBQ A;  5KMG A;  3CME V;  2A79 B;  2GTS A;  2WA3 A;  2M7W A;  3WFV A;  3QF7 A;  4DR3 B;  5IYZ A;  2ZE7 A;  3H1J H;  2ZNJ A;  1EN5 A;  3PN1 A;  5EYP A;  3ASN C;  3JSN A;  1D5N A;  3ZED A;  1J95 A;  4LFC O;  2ADP A;  1Q3E A;  2PGG A;  4X1Y A;  2ILM A;  1SKV A;  3J81 N;  1Q6H A;  1H2M A;  2KKW A;  5J9P C;  2CDY A;  4UCT A;  4EFE A;  4RO2 A;  3W7X A;  3G80 A;  1VQ7 V;  1I94 B;  4UVC A;  1XNQ O;  2ZE5 A;  3ABL C;  2QWO B;  4QGP A;  2Q7E A;  4FLU A;  4DXW A;  2QM8 A;  3HKD A;  4LNU B;  1XMQ B;  4OX9 O;  3CRM A;  5LL6 Y;  1MOF A;  1GH6 A;  1VQM V;  4GKK O;  4MVQ A;  2HJF C;  1ARO P;  3AG4 C;  1AJP A;  5IYB O;  4FFK A;  3WB1 A;  4DRX A;  2WLI B;  4B3T O;  4NTY A;  4EB6 A;  3OTO O;  4TUY A;  1UPG A;  3B8M A;  4X64 B;  4JI8 O;  3BFR A;  4FK5 C;  2EJ7 A;  4AI8 A;  2FL4 A;  4DUZ B;  4B3R B;  4LF9 O;  4KHP O;  5IJ0 B;  5CB4 A;  2XOK G;  5FNV B;  2IH1 C;  5KLV H;  5B3S B;  4IGG A;  3CRR A;  1DK1 A;  2Q68 A;  5TIS Z;  3F7V C;  2VQF B;  3UM7 A;  2A7W A;  3GVM A;  4JZ2 A;  3VQX A;  2RQ6 A;  4PA6 A;  2CH7 A;  1K7D A;  1YJN V;  4LWS A;  1H2K A;  1Y4M A;  5CA1 B;  3ASO C;  1L0N H;  1YJW V;  4JI6 O;  1P4R A;  3T1Y O;  4DR7 B;  5LHH A;  2ETN A;  5B1N A;  2YC0 A;  3WB2 A;  1VEW A;  2YEV A;  3CXC U;  4HYO A;  2ZDI A;  2GBO A;  3N2G A;  1IXM A;  5GTI Z;  5C93 A;  2UUA B;  4JI3 B;  2IBZ H;  1SA0 A;  2GTA A;  2HG5 C;  1I7F A;  3TXQ A;  3GWO A;  2GUZ A;  4U7O A;  3CE2 A;  1H8E G;  1N36 O;  2A3Q A;  1H2L A;  5LHG A;  3T1H O;  1Q86 W;  3B77 A;  1M5I A;  3SGI A;  2EIK B;  3FX7 A;  4JAV A;  4GX1 A;  1K4D C;  3UQ8 A;  1VF5 B;  3CS5 A;  2ADQ B;  1WA8 A;  2ZIO A;  4MW3 A;  1CXZ B;  3AG3 B;  5JVD A;  2OCC B;  2JJ2 G;  3OD4 A;  4TV9 B;  4CS4 A;  5A9G A;  4I9W A;  3HKC B;  5L3G A;  2YXL A;  4RAI A;  2F1M A;  2R72 A;  2EZP A;  4KUM A;  5B1A C;  3G67 A;  3ZIA G;  2ZM6 B;  1IBK B;  2LGQ A;  1GRJ A;  2R9A A;  1G1X B;  3THO A;  4FLT A;  2UXD B;  1BSM A;  2QTS A;  3M8A A;  1GM8 A;  3I5D A;  5L3B A;  3ICX A;  3CCM V;  2IJK A;  1BMF G;  4U3F H;  3L9D A;  5KUK A;  5EK0 A;  3K79 A;  2JVD A;  1BL8 A;  3OR6 C;  2N04 A;  5EIB C;  1TVK A;  3JAR B;  2EIK C;  4GX5 A;  5BMV B;  1Q82 W;  2YIB A;  1IBL B;  3G71 V;  2OCC C;  3AG1 B;  1Y67 A;  4QJF B;  3JAS A;  4F6R A;  1PNK A;  2Q5Z A;  1Y66 A;  2L35 A;  2LGW A;  4K8X A;  1KD1 W;  4DR5 O;  1S5J A;  1OHH G;  5LXT A;  3C90 A;  4DV6 O;  1F4M A;  4O4L B;  4P30 A;  4YY3 O;  4X20 A;  2EIN C;  4DR2 O;  2KSD A;  4QPJ A;  3JYC A;  1K73 W;  2LW7 A;  4O2A B;  3U10 A;  2BTQ A;  1S5L Z;  2IJH A;  3E22 A;  4XBF A;  4I55 A;  1L0L H;  5LMN B;  2Q8V A;  1AR1 B;  2Q0A A;  4TOI A;  4DV5 B;  4BW5 A;  4DR6 B;  3A0B Z;  4IIJ A;  1YI2 V;  1OZ0 A;  3JD1 A;  4XDL A;  1VIB A;  3AG2 C;  4CS2 A;  1EZV H;  3FKS G;  1Z2G A;  4H44 B;  1FPO A;  2B5U A;  2N74 A;  2YS8 A;  3UT5 B;  2QKC A;  3ETQ A;  1XNQ B;  4NKG B;  1SF9 A;  3AG1 C;  5BXZ A;  4B3M O;  4J9Z B;  2XAH A;  1WB7 A;  4OX9 B;  1H2G A;  2YUA A;  2XAJ A;  4FIP C;  5IYC O;  1ZL8 A;  2V4D A;  1NI8 A;  1S5H C;  3IJ4 A;  3G4S V;  2DMX A;  1KKD A;  5CBH A;  1SC5 B;  2IJI A;  2D2C B;  4BAY A;  4CH4 A;  1AI6 A;  5LP6 C;  2YIB D;  3ZHT A;  5IY5 B;  1NH2 D;  3JAM N;  5LYJ B;  4JI2 O;  4X66 B;  1Y76 A;  2MW2 B;  2GDS A;  4JI8 B;  5CA0 A;  3LNN A;  1J5E B;  2PF4 E;  3JD0 A;  2B9Z A;  1I5X A;  4LF8 O;  1W59 A;  1XHZ A;  3CEI A;  4KHP B;  2VWK A;  1XDC A;  2DE0 X;  4DV2 O;  3KZI Z;  2LW1 A;  5FLX N;  4I4T A;  1S0V A;  1D2D A;  4GZR B;  3BEH A;  1M56 B;  4B3S O;  3EXA A;  3OTF A;  2CE4 A;  4O4J B;  5H6R A;  5K1P A;  3EFF K;  5IJ9 A;  2WLK A;  1ORQ C;  4JI6 B;  4MTG A;  2G38 A;  3SYQ A;  4CH3 A;  3T1Y B;  3SPI A;  2RDC A;  1DGS A;  3W7T A;  2QWN B;  2Q69 A;  1MAB G;  2W6I G;  5IY5 C;  3DXR A;  1K3E A;  1R3I C;  1DTO A;  4FLW A;  3A0R A;  1Y74 B;  2Q0O C;  3BA8 A;  1ZLZ A;  2X6A A;  1M9N A;  2UU9 B;  2A9H A;  5BY1 A;  3ZJZ A;  3SPH A;  1HDJ A;  1COW G;  4LBE C;  1DLB A;  3FD9 A;  2DQ0 A;  4DYL A;  4OPA A;  3GWK C;  2PY5 A;  3CRA A;  4TWK A;  2DW4 A;  1S76 D;  4OGQ B;  4CC6 A;  1GN2 A;  1URF A;  4GT1 A;  1FXK C;  4I9Q A;  4LP8 A;  1WPB A;  2JGD A;  3D36 C;  1BS3 A;  1M56 C;  2CTW A;  3LDD A;  5EBL C;  4WBN B;  1VMG A;  2Z5U A;  3DTU B;  1WLE A;  2Y69 C;  1JQ0 A;  3JAL A;  3QO5 A;  4FZ0 A;  3HKB A;  2P5O A;  1R6N A;  1PL0 A;  2NN4 A;  1K34 A;  3Q4H B;  1M90 W;  1IUR A;  5JH7 B;  2PYJ A;  4UVB A;  1N4C A;  3K5O A;  2E75 B;  5E79 Z;  2Y48 A;  2QDO A;  1DF5 A;  2XAG A;  3JAT A;  4ZIB A;  1R3J C;  2BTO A;  3OR7 C;  3BAB A;  4X1I B;  1K5S A;  1VF6 A;  5JQG B;  3AK2 A;  5L3D A;  4P9P A;  1T5E A;  3D3Q A;  3ABU A;  2YI9 A;  1Q81 W;  2K9P A;  5B1B B;  2VS0 A;  1NT2 B;  2AGA A;  4K8Z A;  1B3Q A;  4PA4 A;  4IHJ A;  4TQD A;  5IWA O;  4HNA A;  1PP9 H;  4A5U B;  2ZNI A;  3LUT B;  1NZ6 A;  3RYF B;  3E8G A;  2K1E A;  4PDL A; 
#chains in the Genus database with same CATH homology
 2KSD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...