2KSDA

Backbone structure of the membrane domain of e. coli histidine kinase receptor arcb, center for structures of membrane proteins (csmp) target 4310c
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
75
structure length
75
Chain Sequence
b'MMKLGLVRFSMLLALALVVLAIVVQMAVTMVLHGQVESIDVIRSIFFGLLITPWAVYFLSVVVEQLEESRQRLSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aerobic respiration control sensor protein arcB
publication title Membrane domain structures of three classes of histidine kinase receptors by cell-free expression and rapid NMR analysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 21
structure length 75
sequence length 75
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2010-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18415 HKR_ArcB_TM Histidine kinase receptor ArcB trans-membrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.970 Mainly Alpha Orthogonal Bundle Helix Hairpins His Kinase A (phosphoacceptor) domain 2ksdA00
2KSDA
chains in the Genus database with same CATH superfamily
1VQ7V 4FLWA 3RT3C 4MVOA 3QTCA 1DLBA 2WLIB 3RYIA 1Z2GA 4DV6B 3WB2A 3TXSA 1RPRA 4L8JA 3IGAC 4CS4A 3SYPA 1BQ0A 4JTCB 4QE9A 5IE9A 2W0XA 2ETNA 5CA1A 4QPJA 3OT7A 4OPAA 4AHCA 3A2FA 2G38A 4F4LA 2DYRC 2ZQMA 3SYOA 3JCUZ 4ZOLB 3OGCC 2ZE8A 1VQ9V 1XOUA 5EC1C 1AI4A 5L3EA 4P2ZA 2R9RB 2ZIOA 3CCQV 1CP9A 2EZPA 4JI8O 1Q8IA 2F66C 2X7RB 4MVRA 4PA9A 3T4ZA 2XAJA 2AGAA 3IC9A 4ZBMA 1M5IA 5IJ0A 5E1AC 4HNAB 3P30A 1OCZC 1Q5OA 1DF5A 1PV0A 1WA8A 3ZIAG 4NB5A 3N2GA 2IJKA 2ZDIA 2AHZA 3E2EA 5A9GA 2EINB 1G8MA 3U11A 5LOVB 1I0HA 4H0LB 5JCOC 5LP6A 1GO3F 1KKDA 1JR9A 5KHHA 3FYIB 3RWRD 4D7SA 1KBHA 3D8CA 3EHBB 4FLXA 4KHPB 2R70A 1B06A 1N36B 1GKFA 2GBOA 3CJHB 4UVAA 2ZT9B 2P5OA 1G6UA 3ICXA 3ASNB 1H2GA 1IBKO 4OPHA 4GX5A 5CA3A 3ZBHA 2NLJC 1IX9A 3Q4HA 4N21A 1WPXA 1QR8A 3ABLC 5JJNB 1VQOV 3P32A 4U7OA 2XAHA 2Y0PA 5H5NA 2ZXWC 5EIBC 5IY5B 2QKCA 3FAVB 1I94B 4O2AA 1RSOA 2XAGA 3CYOA 1K33A 3JAKB 4AQYB 4DR6B 1HNXO 4JI6O 1FFXA 4JAUA 4FVMA 4GKKO 4X65B 1CEZA 2EZOA 4ZIBA 4HYOA 1IBLO 4NKGB 3JD2A 4JASA 1AP5A 3DGEA 1FD9A 4I9QA 3ZEDA 4E4EA 3X2QC 2OWOA 2N74A 1PP9H 2Z3YA 3G6BA 4NYKA 1HR0B 4RAIA 4UCUA 4EKWA 2FMLA 5HFMA 4JAAA 5B66Z 4CC6A 1S3JA 3BA9A 4DV5B 3E89A 3ETEA 1AI6A 1HWYA 2ITDC 1YEWA 1EN6A 4LP8A 1QR9A 3RW0A 2BTQA 5KX5A 3W7SA 1PL0A 1XL4A 4NVPA 1JQ0A 1GH6A 1K8AW 2F1MA 2Q0OC 3BHPA 5J2UB 4X89A 1TUEB 2DE0X 4PDVA 3LNNA 1VQ6V 1XHXA 3LSSA 1VF7A 4DV4O 2AZ0A 4QGPA 1SA0A 4KL1A 1YTFD 3T1HB 3H1JH 5CMUA 2P67A 1VF6C 3E22A 3OGIB 4WFAV 2RNBA 2A79B 3R66A 1ZL8A 3T2MA 4WFEA 3ETQA 1OCRC 3ASNC 2EULA 2JGUA 4IGGA 3ZN0A 1WP7A 2V4DA 3MAQA 3CC7V 3H1IH 2UUAB 3W7TA 4MT8A 1YJ9V 4MVUA 4TV8A 5CBHA 1FS0G 1W0JG 1ROPA 2IW5A 3LDEA 3BA8A 4LF7B 3CEIA 1K4DC 2CAZC 4JTAB 1GM7A 5IY5C 3RGBA 3UO3A 2Y4UA 4P30A 1XL6A 1FXVA 1WLEA 2Q0AA 1WB8A 3J7AU 3ZN1A 1TUBB 3M8AA 4J42A 1K7DA 4JI5O 3ABMB 1B6QA 1R3KC 1YCIA 3P3NA 3ETDA 3LDDA 3FB8C 3TK1A 1VQ8V 3CE2A 1K73W 4LWSA 5KHJA 1IVSA 4NR1A 5EZYB 1E1RG 3IAYA 4B08A 4CH5A 2QJ1A 2IM9A 4GZRB 2FL4A 3RN4A 1F7YA 5JCOA 4FFBA 2PTMA 4PJ0Z 5LHHA 1Q7YW 5BY1A 1OV9A 4QE7A 3B8MA 3A0BZ 4EFBA 4LF6O 4E2LA 1I08A 2IBZH 4Z2WA 2ZE6A 2P06A 3UO2A 1KQSU 2K1EA 3K79A 4LFAO 1VEWA 4DV2O 4JI8B 5ITZA 1OCCB 2ZM6O 3M7MX 1NS1A 4I55A 1PL4A 1YITV 1MSWD 2BCCH 2WLIA 1VQKV 4DXWA 4BIZA 5K1XA 3D36C 4NTYA 2CE4A 1S77D 1CPYA 4DUZB 3K5NA 1MNGA 3BCCH 2GSMB 5LL6Y 4JPRA 3OD4A 5IT9N 4UVCA 1RM1B 1GN3A 4LF5O 2DN9A 2PI5A 4L87A 2ZIMA 4H33A 1PNKA 4ZOLA 3CCVV 1SQQH 1KU9A 3WG7C 1TVKA 1EM1A 3OEEG 4O4HB 1IBKB 3FYEB 1V9PA 1THZA 2Q7EA 2EILB 3IJ4A 5JJEB 4CH6A 4NXMO 5GTHZ 1SF9A 5FL7G 3OAAG 3F5WC 5LMNO 3ABMC 4UV8A 2Q5ZA 2D2CB 1GN2A 1QLEB 2CGNA 1P84F 1M57B 4KFMA 4PDMA 1YHQV 1W59A 5EBWC 2AHYA 2ILMA 5LOVA 1HNXB 4JI6B 3L72H 1MSDA 4GKKB 2QSAA 5J9PC 3L9DA 2BE3A 3OR6C 1IBLB 2P6JA 2W0FC 4EB6A 5KUKA 3HKDB 2AZ2A 1VF6A 4IIJB 2LGQA 3CJHA 2BOCC 1SQPH 4FLZA 4X64O 1WAZA 1K9MW 3SJAC 2EIKC 5KMGA 2QWNB 3A8TA 5LA6B 3RYFB 4O4LA 1IXBA 1H2SB 4O2BB 1OZ0A 2H8PC 3F7YC 3K57A 3UT5B 1QVFU 4B3MO 1YVWA 5FNVA 3VOUA 2UU9O 5L3GA 3JAKA 4HAMA 4J41A 1M9NA 1AP6A 5CN0A 1SQXH 4DV4B 5BR8B 2UUBO 1RM1C 4JI3O 1SRYA 5JVDB 5CA0B 2N04A 4DR7O 4B3SO 2X6BA 3K0DA 3ML0A 3W7UA 4X1YA 1Z5VA 4U3FH 4B3TO 3C3TA 2EILC 1LR1A 4BR6A 2UXBO 4F6RB 2PUSA 2Q7GA 2RJZA 2Y48A 1XBLA 1M56B 4MTOA 2VS0A 1QLEC 1AJPA 1NZ6A 3DTUB 3JAMN 1UJWB 1AR5A 4CS3A 4X66B 1UPGA 1Q6IA 3OTFA 4K0KO 4G28B 5J2UA 1BZKA 2ZR3A 1P49A 3SPJA 3E8BA 1Y76B 1ZAUA 1YZBA 5KA6A 1NJIW 3D36A 4JI2O 3VQWA 4BIUA 4DW0A 2PF4E 4GLXA 2RCVA 4RWUA 3AEIA 4WFBV 3UCSC 4WFGA 3LNMB 1IURA 3BABA 4JI1O 4DK0A 2QM8A 5JH7B 2QWOB 1RFYA 1P4RA 5B5EZ 4JAVA 1QHTA 1Q43A 5BZBA 3HKCB 3CD6V 3SYCA 4MVMA 2YC0A 3A0RA 1K3EA 3FD9A 1AR4A 3AG4B 3N2KB 2FB5A 3JASB 4UB8Z 1SESA 4PA4A 4LF6B 1JFFA 1XEQA 1VF5B 4X1IB 4DV1O 1Y4MA 4PI0A 4YIPA 4YJ3B 1V54C 5KLVH 1NVPB 4J80A 3JCZA 3EVKA 3OR7C 4DV2B 3AK3A 1TUBA 4DR1O 2ZM6B 4FLYA 1OCOB 2QWQB 3K59A 1KUQA 1GRJA 4GT1A 4UUJC 4TSFG 3CWBH 4YY3O 3CP1A 3WB1A 1JVMA 2WPDG 4I4TA 3VQYA 5LHIA 5CB4B 5EZYA 2QEXV 3STLC 2QM7A 3ZHUA 1Y74A 3AG7A 5IYZB 1U96A 2YSUB 3MDSA 3LUTB 2EIMC 5AG2A 2ZNJA 3SPHA 2QTOA 3K08A 3M99B 3E83A 4IHJB 4Q20A 4LF5B 2XNDG 2OTJV 5B3SB 2YUAA 2PZSA 2PYJA 3KZIZ 2Q67A 2A3QA 5EK0A 2IH3C 1KP3A 1BQZA 1MMMA 3APQA 2YIDA 3STZC 1L0NH 3GB7C 3ZMTA 4I0XA 5JWPA 4NXMB 3TJTA 3K5LA 1MOFA 3AG2C 4LFBB 5LMNB 3ABUA 2HFEC 1LUVA 4IYIA 3K3WA 3U10A 4JI0B 1BGYH 1UFIA 1I7FA 1XNQB 4O4JB 3QF7A 1WP8A 2CGOA 4AILC 4DR2O 4PI2A 1GTOA 1F4MA 1S5HC 2PGGA 2ITCC 4I7ZB 1B3QA 2D3OW 2W6IG 3ZHTA 3J80N 1R6TA 1D5AA 5BXZA 1GAXA 2CDYA 5C8YA 5HFLA 2CH7A 3AG1B 4WF9V 3S3XA 4O4HA 4X64B 4X20B 2M6YA 5L3BA 4KXRA 1IZ3A 4IYHA 2DYSB 4FLUA 3UQ8A 4TUYB 1OCOC 3T1YO 3C90A 5LXTB 1IBMB 2YEVB 2E5LO 3OTOB 2GDSA 2EIJB 4B3MB 4X88A 2BSKB 2AXTZ 2QR4A 2UU9B 2LW7A 4O4IB 1PPJH 4LFCO 3BRCA 1WJZA 1BHAA 1QCEA 4CH3A 1SZTA 2YI9A 3JATB 3CX5F 2UUBB 1NTMH 3KG2A 1O9GA 4ZKIA 1PNMA 4JI3B 4MS2A 3HKDA 4IIJA 5B3SC 1BSMA 3R65A 4B3SB 4MVSA 3K9AA 4HBNA 5KUMA 3RVZA 1AJNA 2YICA 1JCHA 5LA6A 4JYYA 3K9SA 3APOA 4N23A 4A5UB 1EZVH 3EXAA 2UXBB 2YXHA 4FM1A 1NU1H 4X9QA 3CCEV 1N34O 4MSWC 4DW1A 3H01A 4LBEC 3SDLA 1KECA 3CSXA 2QA4V 1R6NA 4JI7B 1K97A 1YDXA 3UT5A 4R6ZA 3JSLA 5JQGB 4JTDB 1AB3A 2CTPA 3W7XA 3G67A 3JD1A 3OW2U 4K0KB 2EINC 3ZRWA 2Z0AA 1Q86W 4ZI7B 1V55B 1XILA 3K5OA 5IYCO 4X62O 1XHZA 1P7BA 3RVYA 5GONB 1NT2B 2P4VA 4BAYA 2P4KA 4JI2B 5JVDA 3CS5A 3P3PA 3SYQA 2E74B 1S0VA 5IYBO 4NTXA 3FKSG 5E79Z 4IT5A 2HKOA 1I5XA 4R8CA 1U97A 1M1KW 3D3QA 2DYSC 3S3WA 2OTLV 4F6RA 2Q6AA 1JPXA 3B09A 4UXNA 5B1NA 5DM6V 2JIZG 4EEQA 2F43G 4UV9A 2X6AA 4GCZA 2EIJC 4DV1B 1ENVA 4DV0O 4U3JB 2JGDB 4FJCC 4YIOA 4R50A 5BMVB 2UXXA 4DR1B 3ASOB 3CRMA 1J95A 5DECA 1Y76A 3ZRXA 4H44B 3VQVA 4YY3B 3QO7A 4W4KA 1FJGO 1S72V 2CTRA 1GN6A 3OM3B 3CCLV 4J10A 5F2VO 3RFRA 5JH7A 4FPPA 2NR5A 4X8AA 1L1FA 2QGNA 2F4VO 5KHKA 3RYIB 4DYLA 2Q8VA 3NXSA 4WFFA 3SPGA 4FK5C 3N2KA 2OCHA 4B7KA 3JASA 4F6EA 3CCSV 4MVQA 1BS3A 3ABTA 3SR2C 4X1IA 4HZ3A 3G4SV 1YIJV 4PDRA 1FFTB 1ORQC 4YJ3A 1AVMA 3THOA 2YIBA 2EX3A 1QNMA 3ABKB 4H13B 1V55C 3LSQA 3DC5A 1NVPD 1SZXA 2YIBD 1YF2A 3IC7A 5A2QN 4RUEA 4FM0A 4JYAO 3CRRA 3E8GA 2OYQA 2HVKC 1ZUQA 1H2MA 2WLMA 4JGSA 4LNUB 5IYZA 2DWDC 1QU7A 4DR2B 1IXMA 4DK1A 4YHHO 3U0ZA 5H9CA 5KHGA 2XAFA 2IJIA 1Q82W 3G6EV 4LF8O 4YXWG 2ZE7A 4IHJA 3E8FA 4BWAA 5IJ0B 5EYPB 2UXDO 1PM9A 1EFRG 2VQFO 4QPKA 4B3RO 5L3FA 1Y67A 5LHGA 1FXKB 2XASA 5LP6B 1EN5A 2EBOA 4GX1A 4OGQB 2HJFC 3GWKC 1KD1W 1MABG 2O57A 2GTAA 4RO2A 3T1YB 3WFVA 3QG5A 4JYBA 5LGTA 1NR7A 2E5LB 4HNAA 2V1DA 4GKJO 1VQ5V 2DJVA 4O4JA 4MVZA 1JJOA 2QE7G 3Q4HB 3BAAA 1H8HG 4LFCB 3DSQA 3CHXA 2B1IA 2W6JG 2HHHO 1XI1A 3RYCB 4WCEV 3L74H 2XOKG 2V7QG 1NH2B 2IJHA 2L35A 2WLKA 1ZLZA 1G4YB 1Z5WA 4FLTA 3CRCA 4JV5O 4GYCB 4X20A 1FFXB 1NR1A 2OCCB 4OX9O 1AILA 1VQLV 3SGIA 1X4TA 4JI4O 1KKCA 3B2EE 2YDEA 1RP3B 1OCCC 2IJJA 3CB2A 4TUYA 3ZJZA 3CCJV 3ABKC 2HVJC 1N34B 4DR5O 3B4SA 3JD3A 1F23A 2YEVA 1AI7A 2RN9A 3UM7A 3FAVA 1Q90D 3TXQA 3CC2V 2F95B 2BSKA 1N0JA 1JMKC 2XT9A 2DWEC 4O4IA 2CTQA 1HNZO 1BMFG 4DRXB 4DV7O 3RYHB 3WB0A 5B1BB 4XDJA 1H2KA 4X62B 2ATKC 2XTAA 2H3OA 1HP8A 2EJRA 3N27A 1FPOA 2QDOA 1E79G 2KG7B 5EC2C 4J9ZB 1GN4A 3BEHA 2R9IA 1MZFA 4CZZA 4Z1VA 4WBNB 3I5DA 4QIWF 3JALB 2IU0A 5DEDA 4K3AA 4QNHB 2NN4A 4W4LA 1XUQA 2WWWA 4MW3A 5B1AB 4D6TH 2E3CA 3ZS8C 1SETA 4P9PA 1M57C 4ICGA 1GM9A 4DV0B 2ZKOA 4XBFA 4LF9O 2DYRB 1XDCA 5D5PA 4DR4O 3T1CA 4JI5B 3H9VA 4DV5O 2WA4A 5GONA 4K35A 1HDJA 1BCCH 1COWG 3FB6C 1SS3A 3EFFK 1H2NA 4UB6Z 1FJGB 3K58A 1RPOA 4NTWA 1QLNA 5K1PA 1Q81W 1TAEA 3CRAA 5LMUO 2B5UA 3HPLC 4X1KB 4JZGA 3CCMV 3TCUA 2F4VB 2KB1A 2P7TC 2LP7A 3LDCA 1PNLA 1YJNV 5H2FZ 4IL6Z 2VRZA 2ZR2A 2LW1A 3BVOA 2WA3A 5IWAO 4BW5A 3JAWB 3L70H 2IU3A 4U3JA 4LFAB 5BMVA 2DOSA 2ADPA 4RQFA 4JYCA 1N33O 5B1BC 3C3SA 1X59A 1FAFA 5IYDO 2WLLB 2F23A 2LO1A 3JARB 3A0HZ 4U7NA 1FKAO 4JYAB 1VP7A 2FYUH 3CPWU 3DC6A 2KSDA 4FLVA 4UVBA 1K5QA 5FLXN 1NI8A 5ITZB 4OXSA 4YHHB 3CXHF 4I5SA 4TWKA 3ABLB 3CMEV 4I55B 3G71V 1XMOO 1K5SA 1MA1A 1FYJA 4LF8B 4GX2A 2ZXWB 4GX0A 1BHBA 3UKMA 2UXDB 5C93A 3F7VC 1PD3A 1M56C 2VQFB 5B1AC 3FB5C 4B3RB 2X0LA 5FPOA 2JS5A 3ZMZA 1S5LZ 3PJSK 3ZHSA 3E86A 3MHHC 1JA8A 2VWKA 2RDCA 1KC8W 3ZRSA 3O9OA 3TGUH 5GW7A 2B1GA 2JJ2G 3X2QB 1TVKB 2GV9A 2VQEO 2FKXA 4GKJB 1US6A 5L3DA 2Q73A 3O65A 4LNUA 4QJFB 1AI5A 3L73H 2QTSA 1VARA 2HHHB 1KYOF 3ZHVA 1VMGA 5EYPA 1N4CA 3AG4C 4DV3O 4LH6A 5LYJB 1Q3EA 4DUZO 4JV5B 5H6QA 1N32O 1WNSA 4CC5A 4Z1MG 4KP4A 1KP2A 2JEXA 4OX9B 1FXKA 1GM8A 3PN1A 4BIOA 4JI4B 3H1LH 4BW9A 5IJ9B 2FTKA 1N0NA 4DO2A 4J7KA 2MK3A 4EB6B 3DXRB 1SKVA 5LGNA 3FB7C 4DR5B 4TQFA 3E35A 5J2TB 3SYAA 3G80A 1OCRB 5KMGB 1T5EA 2JS3A 3H1KH 3CC4V 2HJDA 3CCRV 4O4LB 4TT3G 2CUGA 2YXYA 4YJ2B 1Y6XA 1NTZH 5KHIA 1HNZB 4DV7B 1NQTA 2A06H 2ZNIA 3RYCA 1DF4A 2LFSA 2VWJA 1J5EO 4LF4O 4J7ZA 4DR7B 1AJQA 5FNVB 1W0KG 3K06A 3ZMSA 4I9WA 1Y66A 1NH2D 3I56V 4LR3A 1ZX3A 4I50B 4PDLA 3L71H 4B3TB 3SJQC 3RYFA 4ABMA 4UCTA 1OJHA 1ZTEA 2H94A 3MD0A 3OFNG 2BTOA 4O2BA 1H2LA 3ETGA 4JZ2A 1EBOA 2GUZB 5EBLC 1BT8A 1FXHA 1P7GA 2QKSA 4X1YB 4FFKA 1HNWO 1OHHG 2Y69B 1R3JC 3QO8A 3AK1A 1XMQO 4LF9B 4MTXA 4DRXA 4DR4B 3WU2Z 1VQMV 3K03A 3RYHA 4PV1B 1NKDA 3JD4A 4DUYO 1WN7A 4ZHQB 2ODMA 2A9HA 2KG7A 5CA0A 5KAFZ 3LSUA 1DK1A 1SQVH 4GUNA 1QBZA 3AG1C 4JI1B 3SJBC 4RQEA 5LMUB 1QVGU 4UCVA 1L8DA 4WBNA 4NXNO 5BR8O 3JALA 4J9YB 5KAIZ 4FZ0A 5JJJB 1SC5B 1YI2V 5D5QA 3HKEB 4LC1A 3OMIB 5CBFA 4JF3A 3HKBB 2UUCO 1E1QG 4TQDA 1VQ4V 2YS8A 2XAQA 1F4NA 1A32A 1S76D 5IWAB 1NTKH 3ZHQA 1XNRO 1R3LC 5B1OA 2PYLA 1JX9A 3I55V 4PELA 4D7TA 1NBMG 1N33B 1YXBA 3NR7A 2HLDG 2EJ7A 3W7WA 2HG5C 3WG7B 5KA5A 1SQFA 1MZEA 2HP8A 1JFFB 4TV9B 4X66O 1IDSA 3ZMUA 2LGWA 1WB7A 2LJ2A 4C7UA 3OMNB 4X1KA 1XMOB 5LGUA 5DN6G 3HKCA 4KUMA 4MW8A 1QQCA 3K0GA 2LQTA 4DR3O 4I4TB 2DQ3A 2P90A 4MTGA 1TA8A 1Y74B 2HEPA 1KMIZ 2JEUA 5CA1B 1BL8A 5LBQA 3KCYA 2QKAA 2JK5C 3JAWA 4XDLA 4CBCA 2Y69C 2C2AA 1H8EG 2ZD9A 2K9PA 1KB9F 2JDIG 2JVDA 4G2KA 1D2DA 3GVMA 2A0LA 1CXZB 1VIBA 3BY6A 2WLLA 2ZE5A 3JYCA 3JARA 2EIKB 2VQEB 1XREA 4P9OA 3CRQA 3VQXA 4FZ1A 5CB4A 3HR0A 4UCSA 4I0XB 1R3IC 4FIPC 2PI4A 2UXCO 3F5TA 2CK3G 2R72A 4DV6O 2NNUA 1WA8B 1EN4A 3N2GB 4DV3B 2YIAA 1LNQA 4UCOA 1LUWA 4LH7A 1N32B 5EIBD 5CBGA 2N05A 1K4CC 1ZWIC 2RQ6A 4TOIA 1SQBH 2Y0IA 1G1XB 2DQ0A 2B9ZA 1EZJA 3B77A 3ASOC 1URFA 2WLJA 5C8YB 3ZX6A 2GHYA 2CH7B 5TISZ 3K5MA 1M4UA 1MG1A 2E75B 3HB3B 3JD0A 2OIEA 3FFQA 4FM2A 2JJ1G 2E76B 4Q6GA 2Q4PA 3K04A 4UFZA 3GWOA 4LFBO 1O9HA 3BFRA 4PA6A 2A7WA 2R9AA 5EBMC 1M90W 1W2BU 3T4DA 1D5NA 1BE3H 1J5EB 4O2AB 3L75H 1RSOB 4FMTA 4JI0O 1M93A 4LF4B 3BPZA 1XNQO 1TGOA 1K34A 1WPBA 3AG3B 5LYJA 1YJWV 2YXLA 1DGSA 2HR3A 4MTFA 2WLHA 2F93B 2OT5A 2QWRB 1ZSPA 5IJ9A 3B8NA 1R6KA 4H37A 4KHPO 2Y4TA 2JRIA 3DXRA 1JJ2U 1SERA 1PKXA 1N36O 5LXTA 2Q7HA 2RMKB 5J2TA 3E8HA 3ZMVA 3J81N 2ZCEA 4J7JA 1Q6UA 3VBBA 3OUFA 1HNWB 1VQPV 2GTSA 3FX7A 1XMQB 4CS2A 4YJ2A 1AROP 1L0LH 2CTWA 3JATA 3OE7G 4DUYB 4R7CA 1IBMO 3OTOO 2WSSG 1I94O 2PY5A 3TETA 2X6CA 2BTQB 5KX5B 1V54B 3KCXA 2WAMA 2ZDIC 2DW4A 1GMGA 4K8ZA 4AQYO 1YTFB 3ZRWB 4DR6O 1K92A 4PA7A 5H6RA 2MW2B 3KKYA 4G27B 4I50A 4X65O 1FXKC 1I5YA 5LP6C 4XDKA 2Q9LA 1AR1B 2XHBA 4NXNB 5IDJA 1SA0B 3CCUV 3OMAB 3QO5A 3E22B 1XQ8A 2Q69A 3QNEA 2GUZA 2UUCB 1ZL8B 5JQGA 2EIMB 4PHZA 2BOBC 2ZINA 5FPRA 1HR0O 2M7WA 1YSCA 1XNRB 2KKWA 3D3IA 1JOYA 2Q68A 1R73A 4ZI7A 5GTIZ 1H38A 3OUSA 4TV8B 4ZHQA 4WFHA 4JI7O 1F51A 1SQGA 1VQNV 2P22C 3MHSC 1HW7A 3IFXA 3B40A 3RBZA 2OIGA 3AG3C 3AG2B 2IH1C 2WLNA 2OCCC 2KQXA 4EFEA 3SJCC 1R1BA 1DTOA 1GK9A 4DR3B 2QWPB 1OCZB 3AK2A 3T1HO 3ZRVA 2DMXA 3ZHRA 3HKEA 4LWSB 2L6LA 1N8RW 2UXNA 3HKBA 4UCRA 4PA3A 3CMAV 4K8XA 4PD4F 4FFBB 4ASUG 4LCUC 4J11A 2Z5UA 2JGDA 1S5JA 3SPCA 3H1HH 5L3CA 2UUAO 1B04A 4B7EA 4CH4A 2ARHA 2AW9A 3CXCU 3SPIA 2YI8A 4LF7O 1Q6HA 4RUFA 4AI8A 4TV9A 2LFRA 3QVNA 3JSNA 2ADQB 2QM4A 2XUMA 3ZCCA 3OEHG 2UXCB
chains in the Genus database with same CATH topology
2KSDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KSD A; 
#chains in the Genus database with same CATH topology
 1VQ7 V;  4FLW A;  3RT3 C;  4MVO A;  3QTC A;  1DLB A;  2WLI B;  3RYI A;  1Z2G A;  4DV6 B;  3WB2 A;  3TXS A;  1RPR A;  4L8J A;  3IGA C;  4CS4 A;  3SYP A;  1BQ0 A;  4JTC B;  4QE9 A;  5IE9 A;  2W0X A;  2ETN A;  5CA1 A;  4QPJ A;  3OT7 A;  4OPA A;  4AHC A;  3A2F A;  2G38 A;  4F4L A;  2DYR C;  2ZQM A;  3SYO A;  3JCU Z;  4ZOL B;  3OGC C;  2ZE8 A;  1VQ9 V;  1XOU A;  5EC1 C;  1AI4 A;  5L3E A;  4P2Z A;  2R9R B;  2ZIO A;  3CCQ V;  1CP9 A;  2EZP A;  4JI8 O;  1Q8I A;  2F66 C;  2X7R B;  4MVR A;  4PA9 A;  3T4Z A;  2XAJ A;  2AGA A;  3IC9 A;  4ZBM A;  1M5I A;  5IJ0 A;  5E1A C;  4HNA B;  3P30 A;  1OCZ C;  1Q5O A;  1DF5 A;  1PV0 A;  1WA8 A;  3ZIA G;  4NB5 A;  3N2G A;  2IJK A;  2ZDI A;  2AHZ A;  3E2E A;  5A9G A;  2EIN B;  1G8M A;  3U11 A;  5LOV B;  1I0H A;  4H0L B;  5JCO C;  5LP6 A;  1GO3 F;  1KKD A;  1JR9 A;  5KHH A;  3FYI B;  3RWR D;  4D7S A;  1KBH A;  3D8C A;  3EHB B;  4FLX A;  4KHP B;  2R70 A;  1B06 A;  1N36 B;  1GKF A;  2GBO A;  3CJH B;  4UVA A;  2ZT9 B;  2P5O A;  1G6U A;  3ICX A;  3ASN B;  1H2G A;  1IBK O;  4OPH A;  4GX5 A;  5CA3 A;  3ZBH A;  2NLJ C;  1IX9 A;  3Q4H A;  4N21 A;  1WPX A;  1QR8 A;  3ABL C;  5JJN B;  1VQO V;  3P32 A;  4U7O A;  2XAH A;  2Y0P A;  5H5N A;  2ZXW C;  5EIB C;  5IY5 B;  2QKC A;  3FAV B;  1I94 B;  4O2A A;  1RSO A;  2XAG A;  3CYO A;  1K33 A;  3JAK B;  4AQY B;  4DR6 B;  1HNX O;  4JI6 O;  1FFX A;  4JAU A;  4FVM A;  4GKK O;  4X65 B;  1CEZ A;  2EZO A;  4ZIB A;  4HYO A;  1IBL O;  4NKG B;  3JD2 A;  4JAS A;  1AP5 A;  3DGE A;  1FD9 A;  4I9Q A;  3ZED A;  4E4E A;  3X2Q C;  2OWO A;  2N74 A;  1PP9 H;  2Z3Y A;  3G6B A;  4NYK A;  1HR0 B;  4RAI A;  4UCU A;  4EKW A;  2FML A;  5HFM A;  4JAA A;  5B66 Z;  4CC6 A;  1S3J A;  3BA9 A;  4DV5 B;  3E89 A;  3ETE A;  1AI6 A;  1HWY A;  2ITD C;  1YEW A;  1EN6 A;  4LP8 A;  1QR9 A;  3RW0 A;  2BTQ A;  5KX5 A;  3W7S A;  1PL0 A;  1XL4 A;  4NVP A;  1JQ0 A;  1GH6 A;  1K8A W;  2F1M A;  2Q0O C;  3BHP A;  5J2U B;  4X89 A;  1TUE B;  2DE0 X;  4PDV A;  3LNN A;  1VQ6 V;  1XHX A;  3LSS A;  1VF7 A;  4DV4 O;  2AZ0 A;  4QGP A;  1SA0 A;  4KL1 A;  1YTF D;  3T1H B;  3H1J H;  5CMU A;  2P67 A;  1VF6 C;  3E22 A;  3OGI B;  4WFA V;  2RNB A;  2A79 B;  3R66 A;  1ZL8 A;  3T2M A;  4WFE A;  3ETQ A;  1OCR C;  3ASN C;  2EUL A;  2JGU A;  4IGG A;  3ZN0 A;  1WP7 A;  2V4D A;  3MAQ A;  3CC7 V;  3H1I H;  2UUA B;  3W7T A;  4MT8 A;  1YJ9 V;  4MVU A;  4TV8 A;  5CBH A;  1FS0 G;  1W0J G;  1ROP A;  2IW5 A;  3LDE A;  3BA8 A;  4LF7 B;  3CEI A;  1K4D C;  2CAZ C;  4JTA B;  1GM7 A;  5IY5 C;  3RGB A;  3UO3 A;  2Y4U A;  4P30 A;  1XL6 A;  1FXV A;  1WLE A;  2Q0A A;  1WB8 A;  3J7A U;  3ZN1 A;  1TUB B;  3M8A A;  4J42 A;  1K7D A;  4JI5 O;  3ABM B;  1B6Q A;  1R3K C;  1YCI A;  3P3N A;  3ETD A;  3LDD A;  3FB8 C;  3TK1 A;  1VQ8 V;  3CE2 A;  1K73 W;  4LWS A;  5KHJ A;  1IVS A;  4NR1 A;  5EZY B;  1E1R G;  3IAY A;  4B08 A;  4CH5 A;  2QJ1 A;  2IM9 A;  4GZR B;  2FL4 A;  3RN4 A;  1F7Y A;  5JCO A;  4FFB A;  2PTM A;  4PJ0 Z;  5LHH A;  1Q7Y W;  5BY1 A;  1OV9 A;  4QE7 A;  3B8M A;  3A0B Z;  4EFB A;  4LF6 O;  4E2L A;  1I08 A;  2IBZ H;  4Z2W A;  2ZE6 A;  2P06 A;  3UO2 A;  1KQS U;  2K1E A;  3K79 A;  4LFA O;  1VEW A;  4DV2 O;  4JI8 B;  5ITZ A;  1OCC B;  2ZM6 O;  3M7M X;  1NS1 A;  4I55 A;  1PL4 A;  1YIT V;  1MSW D;  2BCC H;  2WLI A;  1VQK V;  4DXW A;  4BIZ A;  5K1X A;  3D36 C;  4NTY A;  2CE4 A;  1S77 D;  1CPY A;  4DUZ B;  3K5N A;  1MNG A;  3BCC H;  2GSM B;  5LL6 Y;  4JPR A;  3OD4 A;  5IT9 N;  4UVC A;  1RM1 B;  1GN3 A;  4LF5 O;  2DN9 A;  2PI5 A;  4L87 A;  2ZIM A;  4H33 A;  1PNK A;  4ZOL A;  3CCV V;  1SQQ H;  1KU9 A;  3WG7 C;  1TVK A;  1EM1 A;  3OEE G;  4O4H B;  1IBK B;  3FYE B;  1V9P A;  1THZ A;  2Q7E A;  2EIL B;  3IJ4 A;  5JJE B;  4CH6 A;  4NXM O;  5GTH Z;  1SF9 A;  5FL7 G;  3OAA G;  3F5W C;  5LMN O;  3ABM C;  4UV8 A;  2Q5Z A;  2D2C B;  1GN2 A;  1QLE B;  2CGN A;  1P84 F;  1M57 B;  4KFM A;  4PDM A;  1YHQ V;  1W59 A;  5EBW C;  2AHY A;  2ILM A;  5LOV A;  1HNX B;  4JI6 B;  3L72 H;  1MSD A;  4GKK B;  2QSA A;  5J9P C;  3L9D A;  2BE3 A;  3OR6 C;  1IBL B;  2P6J A;  2W0F C;  4EB6 A;  5KUK A;  3HKD B;  2AZ2 A;  1VF6 A;  4IIJ B;  2LGQ A;  3CJH A;  2BOC C;  1SQP H;  4FLZ A;  4X64 O;  1WAZ A;  1K9M W;  3SJA C;  2EIK C;  5KMG A;  2QWN B;  3A8T A;  5LA6 B;  3RYF B;  4O4L A;  1IXB A;  1H2S B;  4O2B B;  1OZ0 A;  2H8P C;  3F7Y C;  3K57 A;  3UT5 B;  1QVF U;  4B3M O;  1YVW A;  5FNV A;  3VOU A;  2UU9 O;  5L3G A;  3JAK A;  4HAM A;  4J41 A;  1M9N A;  1AP6 A;  5CN0 A;  1SQX H;  4DV4 B;  5BR8 B;  2UUB O;  1RM1 C;  4JI3 O;  1SRY A;  5JVD B;  5CA0 B;  2N04 A;  4DR7 O;  4B3S O;  2X6B A;  3K0D A;  3ML0 A;  3W7U A;  4X1Y A;  1Z5V A;  4U3F H;  4B3T O;  3C3T A;  2EIL C;  1LR1 A;  4BR6 A;  2UXB O;  4F6R B;  2PUS A;  2Q7G A;  2RJZ A;  2Y48 A;  1XBL A;  1M56 B;  4MTO A;  2VS0 A;  1QLE C;  1AJP A;  1NZ6 A;  3DTU B;  3JAM N;  1UJW B;  1AR5 A;  4CS3 A;  4X66 B;  1UPG A;  1Q6I A;  3OTF A;  4K0K O;  4G28 B;  5J2U A;  1BZK A;  2ZR3 A;  1P49 A;  3SPJ A;  3E8B A;  1Y76 B;  1ZAU A;  1YZB A;  5KA6 A;  1NJI W;  3D36 A;  4JI2 O;  3VQW A;  4BIU A;  4DW0 A;  2PF4 E;  4GLX A;  2RCV A;  4RWU A;  3AEI A;  4WFB V;  3UCS C;  4WFG A;  3LNM B;  1IUR A;  3BAB A;  4JI1 O;  4DK0 A;  2QM8 A;  5JH7 B;  2QWO B;  1RFY A;  1P4R A;  5B5E Z;  4JAV A;  1QHT A;  1Q43 A;  5BZB A;  3HKC B;  3CD6 V;  3SYC A;  4MVM A;  2YC0 A;  3A0R A;  1K3E A;  3FD9 A;  1AR4 A;  3AG4 B;  3N2K B;  2FB5 A;  3JAS B;  4UB8 Z;  1SES A;  4PA4 A;  4LF6 B;  1JFF A;  1XEQ A;  1VF5 B;  4X1I B;  4DV1 O;  1Y4M A;  4PI0 A;  4YIP A;  4YJ3 B;  1V54 C;  5KLV H;  1NVP B;  4J80 A;  3JCZ A;  3EVK A;  3OR7 C;  4DV2 B;  3AK3 A;  1TUB A;  4DR1 O;  2ZM6 B;  4FLY A;  1OCO B;  2QWQ B;  3K59 A;  1KUQ A;  1GRJ A;  4GT1 A;  4UUJ C;  4TSF G;  3CWB H;  4YY3 O;  3CP1 A;  3WB1 A;  1JVM A;  2WPD G;  4I4T A;  3VQY A;  5LHI A;  5CB4 B;  5EZY A;  2QEX V;  3STL C;  2QM7 A;  3ZHU A;  1Y74 A;  3AG7 A;  5IYZ B;  1U96 A;  2YSU B;  3MDS A;  3LUT B;  2EIM C;  5AG2 A;  2ZNJ A;  3SPH A;  2QTO A;  3K08 A;  3M99 B;  3E83 A;  4IHJ B;  4Q20 A;  4LF5 B;  2XND G;  2OTJ V;  5B3S B;  2YUA A;  2PZS A;  2PYJ A;  3KZI Z;  2Q67 A;  2A3Q A;  5EK0 A;  2IH3 C;  1KP3 A;  1BQZ A;  1MMM A;  3APQ A;  2YID A;  3STZ C;  1L0N H;  3GB7 C;  3ZMT A;  4I0X A;  5JWP A;  4NXM B;  3TJT A;  3K5L A;  1MOF A;  3AG2 C;  4LFB B;  5LMN B;  3ABU A;  2HFE C;  1LUV A;  4IYI A;  3K3W A;  3U10 A;  4JI0 B;  1BGY H;  1UFI A;  1I7F A;  1XNQ B;  4O4J B;  3QF7 A;  1WP8 A;  2CGO A;  4AIL C;  4DR2 O;  4PI2 A;  1GTO A;  1F4M A;  1S5H C;  2PGG A;  2ITC C;  4I7Z B;  1B3Q A;  2D3O W;  2W6I G;  3ZHT A;  3J80 N;  1R6T A;  1D5A A;  5BXZ A;  1GAX A;  2CDY A;  5C8Y A;  5HFL A;  2CH7 A;  3AG1 B;  4WF9 V;  3S3X A;  4O4H A;  4X64 B;  4X20 B;  2M6Y A;  5L3B A;  4KXR A;  1IZ3 A;  4IYH A;  2DYS B;  4FLU A;  3UQ8 A;  4TUY B;  1OCO C;  3T1Y O;  3C90 A;  5LXT B;  1IBM B;  2YEV B;  2E5L O;  3OTO B;  2GDS A;  2EIJ B;  4B3M B;  4X88 A;  2BSK B;  2AXT Z;  2QR4 A;  2UU9 B;  2LW7 A;  4O4I B;  1PPJ H;  4LFC O;  3BRC A;  1WJZ A;  1BHA A;  1QCE A;  4CH3 A;  1SZT A;  2YI9 A;  3JAT B;  3CX5 F;  2UUB B;  1NTM H;  3KG2 A;  1O9G A;  4ZKI A;  1PNM A;  4JI3 B;  4MS2 A;  3HKD A;  4IIJ A;  5B3S C;  1BSM A;  3R65 A;  4B3S B;  4MVS A;  3K9A A;  4HBN A;  5KUM A;  3RVZ A;  1AJN A;  2YIC A;  1JCH A;  5LA6 A;  4JYY A;  3K9S A;  3APO A;  4N23 A;  4A5U B;  1EZV H;  3EXA A;  2UXB B;  2YXH A;  4FM1 A;  1NU1 H;  4X9Q A;  3CCE V;  1N34 O;  4MSW C;  4DW1 A;  3H01 A;  4LBE C;  3SDL A;  1KEC A;  3CSX A;  2QA4 V;  1R6N A;  4JI7 B;  1K97 A;  1YDX A;  3UT5 A;  4R6Z A;  3JSL A;  5JQG B;  4JTD B;  1AB3 A;  2CTP A;  3W7X A;  3G67 A;  3JD1 A;  3OW2 U;  4K0K B;  2EIN C;  3ZRW A;  2Z0A A;  1Q86 W;  4ZI7 B;  1V55 B;  1XIL A;  3K5O A;  5IYC O;  4X62 O;  1XHZ A;  1P7B A;  3RVY A;  5GON B;  1NT2 B;  2P4V A;  4BAY A;  2P4K A;  4JI2 B;  5JVD A;  3CS5 A;  3P3P A;  3SYQ A;  2E74 B;  1S0V A;  5IYB O;  4NTX A;  3FKS G;  5E79 Z;  4IT5 A;  2HKO A;  1I5X A;  4R8C A;  1U97 A;  1M1K W;  3D3Q A;  2DYS C;  3S3W A;  2OTL V;  4F6R A;  2Q6A A;  1JPX A;  3B09 A;  4UXN A;  5B1N A;  5DM6 V;  2JIZ G;  4EEQ A;  2F43 G;  4UV9 A;  2X6A A;  4GCZ A;  2EIJ C;  4DV1 B;  1ENV A;  4DV0 O;  4U3J B;  2JGD B;  4FJC C;  4YIO A;  4R50 A;  5BMV B;  2UXX A;  4DR1 B;  3ASO B;  3CRM A;  1J95 A;  5DEC A;  1Y76 A;  3ZRX A;  4H44 B;  3VQV A;  4YY3 B;  3QO7 A;  4W4K A;  1FJG O;  1S72 V;  2CTR A;  1GN6 A;  3OM3 B;  3CCL V;  4J10 A;  5F2V O;  3RFR A;  5JH7 A;  4FPP A;  2NR5 A;  4X8A A;  1L1F A;  2QGN A;  2F4V O;  5KHK A;  3RYI B;  4DYL A;  2Q8V A;  3NXS A;  4WFF A;  3SPG A;  4FK5 C;  3N2K A;  2OCH A;  4B7K A;  3JAS A;  4F6E A;  3CCS V;  4MVQ A;  1BS3 A;  3ABT A;  3SR2 C;  4X1I A;  4HZ3 A;  3G4S V;  1YIJ V;  4PDR A;  1FFT B;  1ORQ C;  4YJ3 A;  1AVM A;  3THO A;  2YIB A;  2EX3 A;  1QNM A;  3ABK B;  4H13 B;  1V55 C;  3LSQ A;  3DC5 A;  1NVP D;  1SZX A;  2YIB D;  1YF2 A;  3IC7 A;  5A2Q N;  4RUE A;  4FM0 A;  4JYA O;  3CRR A;  3E8G A;  2OYQ A;  2HVK C;  1ZUQ A;  1H2M A;  2WLM A;  4JGS A;  4LNU B;  5IYZ A;  2DWD C;  1QU7 A;  4DR2 B;  1IXM A;  4DK1 A;  4YHH O;  3U0Z A;  5H9C A;  5KHG A;  2XAF A;  2IJI A;  1Q82 W;  3G6E V;  4LF8 O;  4YXW G;  2ZE7 A;  4IHJ A;  3E8F A;  4BWA A;  5IJ0 B;  5EYP B;  2UXD O;  1PM9 A;  1EFR G;  2VQF O;  4QPK A;  4B3R O;  5L3F A;  1Y67 A;  5LHG A;  1FXK B;  2XAS A;  5LP6 B;  1EN5 A;  2EBO A;  4GX1 A;  4OGQ B;  2HJF C;  3GWK C;  1KD1 W;  1MAB G;  2O57 A;  2GTA A;  4RO2 A;  3T1Y B;  3WFV A;  3QG5 A;  4JYB A;  5LGT A;  1NR7 A;  2E5L B;  4HNA A;  2V1D A;  4GKJ O;  1VQ5 V;  2DJV A;  4O4J A;  4MVZ A;  1JJO A;  2QE7 G;  3Q4H B;  3BAA A;  1H8H G;  4LFC B;  3DSQ A;  3CHX A;  2B1I A;  2W6J G;  2HHH O;  1XI1 A;  3RYC B;  4WCE V;  3L74 H;  2XOK G;  2V7Q G;  1NH2 B;  2IJH A;  2L35 A;  2WLK A;  1ZLZ A;  1G4Y B;  1Z5W A;  4FLT A;  3CRC A;  4JV5 O;  4GYC B;  4X20 A;  1FFX B;  1NR1 A;  2OCC B;  4OX9 O;  1AIL A;  1VQL V;  3SGI A;  1X4T A;  4JI4 O;  1KKC A;  3B2E E;  2YDE A;  1RP3 B;  1OCC C;  2IJJ A;  3CB2 A;  4TUY A;  3ZJZ A;  3CCJ V;  3ABK C;  2HVJ C;  1N34 B;  4DR5 O;  3B4S A;  3JD3 A;  1F23 A;  2YEV A;  1AI7 A;  2RN9 A;  3UM7 A;  3FAV A;  1Q90 D;  3TXQ A;  3CC2 V;  2F95 B;  2BSK A;  1N0J A;  1JMK C;  2XT9 A;  2DWE C;  4O4I A;  2CTQ A;  1HNZ O;  1BMF G;  4DRX B;  4DV7 O;  3RYH B;  3WB0 A;  5B1B B;  4XDJ A;  1H2K A;  4X62 B;  2ATK C;  2XTA A;  2H3O A;  1HP8 A;  2EJR A;  3N27 A;  1FPO A;  2QDO A;  1E79 G;  2KG7 B;  5EC2 C;  4J9Z B;  1GN4 A;  3BEH A;  2R9I A;  1MZF A;  4CZZ A;  4Z1V A;  4WBN B;  3I5D A;  4QIW F;  3JAL B;  2IU0 A;  5DED A;  4K3A A;  4QNH B;  2NN4 A;  4W4L A;  1XUQ A;  2WWW A;  4MW3 A;  5B1A B;  4D6T H;  2E3C A;  3ZS8 C;  1SET A;  4P9P A;  1M57 C;  4ICG A;  1GM9 A;  4DV0 B;  2ZKO A;  4XBF A;  4LF9 O;  2DYR B;  1XDC A;  5D5P A;  4DR4 O;  3T1C A;  4JI5 B;  3H9V A;  4DV5 O;  2WA4 A;  5GON A;  4K35 A;  1HDJ A;  1BCC H;  1COW G;  3FB6 C;  1SS3 A;  3EFF K;  1H2N A;  4UB6 Z;  1FJG B;  3K58 A;  1RPO A;  4NTW A;  1QLN A;  5K1P A;  1Q81 W;  1TAE A;  3CRA A;  5LMU O;  2B5U A;  3HPL C;  4X1K B;  4JZG A;  3CCM V;  3TCU A;  2F4V B;  2KB1 A;  2P7T C;  2LP7 A;  3LDC A;  1PNL A;  1YJN V;  5H2F Z;  4IL6 Z;  2VRZ A;  2ZR2 A;  2LW1 A;  3BVO A;  2WA3 A;  5IWA O;  4BW5 A;  3JAW B;  3L70 H;  2IU3 A;  4U3J A;  4LFA B;  5BMV A;  2DOS A;  2ADP A;  4RQF A;  4JYC A;  1N33 O;  5B1B C;  3C3S A;  1X59 A;  1FAF A;  5IYD O;  2WLL B;  2F23 A;  2LO1 A;  3JAR B;  3A0H Z;  4U7N A;  1FKA O;  4JYA B;  1VP7 A;  2FYU H;  3CPW U;  3DC6 A;  2KSD A;  4FLV A;  4UVB A;  1K5Q A;  5FLX N;  1NI8 A;  5ITZ B;  4OXS A;  4YHH B;  3CXH F;  4I5S A;  4TWK A;  3ABL B;  3CME V;  4I55 B;  3G71 V;  1XMO O;  1K5S A;  1MA1 A;  1FYJ A;  4LF8 B;  4GX2 A;  2ZXW B;  4GX0 A;  1BHB A;  3UKM A;  2UXD B;  5C93 A;  3F7V C;  1PD3 A;  1M56 C;  2VQF B;  5B1A C;  3FB5 C;  4B3R B;  2X0L A;  5FPO A;  2JS5 A;  3ZMZ A;  1S5L Z;  3PJS K;  3ZHS A;  3E86 A;  3MHH C;  1JA8 A;  2VWK A;  2RDC A;  1KC8 W;  3ZRS A;  3O9O A;  3TGU H;  5GW7 A;  2B1G A;  2JJ2 G;  3X2Q B;  1TVK B;  2GV9 A;  2VQE O;  2FKX A;  4GKJ B;  1US6 A;  5L3D A;  2Q73 A;  3O65 A;  4LNU A;  4QJF B;  1AI5 A;  3L73 H;  2QTS A;  1VAR A;  2HHH B;  1KYO F;  3ZHV A;  1VMG A;  5EYP A;  1N4C A;  3AG4 C;  4DV3 O;  4LH6 A;  5LYJ B;  1Q3E A;  4DUZ O;  4JV5 B;  5H6Q A;  1N32 O;  1WNS A;  4CC5 A;  4Z1M G;  4KP4 A;  1KP2 A;  2JEX A;  4OX9 B;  1FXK A;  1GM8 A;  3PN1 A;  4BIO A;  4JI4 B;  3H1L H;  4BW9 A;  5IJ9 B;  2FTK A;  1N0N A;  4DO2 A;  4J7K A;  2MK3 A;  4EB6 B;  3DXR B;  1SKV A;  5LGN A;  3FB7 C;  4DR5 B;  4TQF A;  3E35 A;  5J2T B;  3SYA A;  3G80 A;  1OCR B;  5KMG B;  1T5E A;  2JS3 A;  3H1K H;  3CC4 V;  2HJD A;  3CCR V;  4O4L B;  4TT3 G;  2CUG A;  2YXY A;  4YJ2 B;  1Y6X A;  1NTZ H;  5KHI A;  1HNZ B;  4DV7 B;  1NQT A;  2A06 H;  2ZNI A;  3RYC A;  1DF4 A;  2LFS A;  2VWJ A;  1J5E O;  4LF4 O;  4J7Z A;  4DR7 B;  1AJQ A;  5FNV B;  1W0K G;  3K06 A;  3ZMS A;  4I9W A;  1Y66 A;  1NH2 D;  3I56 V;  4LR3 A;  1ZX3 A;  4I50 B;  4PDL A;  3L71 H;  4B3T B;  3SJQ C;  3RYF A;  4ABM A;  4UCT A;  1OJH A;  1ZTE A;  2H94 A;  3MD0 A;  3OFN G;  2BTO A;  4O2B A;  1H2L A;  3ETG A;  4JZ2 A;  1EBO A;  2GUZ B;  5EBL C;  1BT8 A;  1FXH A;  1P7G A;  2QKS A;  4X1Y B;  4FFK A;  1HNW O;  1OHH G;  2Y69 B;  1R3J C;  3QO8 A;  3AK1 A;  1XMQ O;  4LF9 B;  4MTX A;  4DRX A;  4DR4 B;  3WU2 Z;  1VQM V;  3K03 A;  3RYH A;  4PV1 B;  1NKD A;  3JD4 A;  4DUY O;  1WN7 A;  4ZHQ B;  2ODM A;  2A9H A;  2KG7 A;  5CA0 A;  5KAF Z;  3LSU A;  1DK1 A;  1SQV H;  4GUN A;  1QBZ A;  3AG1 C;  4JI1 B;  3SJB C;  4RQE A;  5LMU B;  1QVG U;  4UCV A;  1L8D A;  4WBN A;  4NXN O;  5BR8 O;  3JAL A;  4J9Y B;  5KAI Z;  4FZ0 A;  5JJJ B;  1SC5 B;  1YI2 V;  5D5Q A;  3HKE B;  4LC1 A;  3OMI B;  5CBF A;  4JF3 A;  3HKB B;  2UUC O;  1E1Q G;  4TQD A;  1VQ4 V;  2YS8 A;  2XAQ A;  1F4N A;  1A32 A;  1S76 D;  5IWA B;  1NTK H;  3ZHQ A;  1XNR O;  1R3L C;  5B1O A;  2PYL A;  1JX9 A;  3I55 V;  4PEL A;  4D7T A;  1NBM G;  1N33 B;  1YXB A;  3NR7 A;  2HLD G;  2EJ7 A;  3W7W A;  2HG5 C;  3WG7 B;  5KA5 A;  1SQF A;  1MZE A;  2HP8 A;  1JFF B;  4TV9 B;  4X66 O;  1IDS A;  3ZMU A;  2LGW A;  1WB7 A;  2LJ2 A;  4C7U A;  3OMN B;  4X1K A;  1XMO B;  5LGU A;  5DN6 G;  3HKC A;  4KUM A;  4MW8 A;  1QQC A;  3K0G A;  2LQT A;  4DR3 O;  4I4T B;  2DQ3 A;  2P90 A;  4MTG A;  1TA8 A;  1Y74 B;  2HEP A;  1KMI Z;  2JEU A;  5CA1 B;  1BL8 A;  5LBQ A;  3KCY A;  2QKA A;  2JK5 C;  3JAW A;  4XDL A;  4CBC A;  2Y69 C;  2C2A A;  1H8E G;  2ZD9 A;  2K9P A;  1KB9 F;  2JDI G;  2JVD A;  4G2K A;  1D2D A;  3GVM A;  2A0L A;  1CXZ B;  1VIB A;  3BY6 A;  2WLL A;  2ZE5 A;  3JYC A;  3JAR A;  2EIK B;  2VQE B;  1XRE A;  4P9O A;  3CRQ A;  3VQX A;  4FZ1 A;  5CB4 A;  3HR0 A;  4UCS A;  4I0X B;  1R3I C;  4FIP C;  2PI4 A;  2UXC O;  3F5T A;  2CK3 G;  2R72 A;  4DV6 O;  2NNU A;  1WA8 B;  1EN4 A;  3N2G B;  4DV3 B;  2YIA A;  1LNQ A;  4UCO A;  1LUW A;  4LH7 A;  1N32 B;  5EIB D;  5CBG A;  2N05 A;  1K4C C;  1ZWI C;  2RQ6 A;  4TOI A;  1SQB H;  2Y0I A;  1G1X B;  2DQ0 A;  2B9Z A;  1EZJ A;  3B77 A;  3ASO C;  1URF A;  2WLJ A;  5C8Y B;  3ZX6 A;  2GHY A;  2CH7 B;  5TIS Z;  3K5M A;  1M4U A;  1MG1 A;  2E75 B;  3HB3 B;  3JD0 A;  2OIE A;  3FFQ A;  4FM2 A;  2JJ1 G;  2E76 B;  4Q6G A;  2Q4P A;  3K04 A;  4UFZ A;  3GWO A;  4LFB O;  1O9H A;  3BFR A;  4PA6 A;  2A7W A;  2R9A A;  5EBM C;  1M90 W;  1W2B U;  3T4D A;  1D5N A;  1BE3 H;  1J5E B;  4O2A B;  3L75 H;  1RSO B;  4FMT A;  4JI0 O;  1M93 A;  4LF4 B;  3BPZ A;  1XNQ O;  1TGO A;  1K34 A;  1WPB A;  3AG3 B;  5LYJ A;  1YJW V;  2YXL A;  1DGS A;  2HR3 A;  4MTF A;  2WLH A;  2F93 B;  2OT5 A;  2QWR B;  1ZSP A;  5IJ9 A;  3B8N A;  1R6K A;  4H37 A;  4KHP O;  2Y4T A;  2JRI A;  3DXR A;  1JJ2 U;  1SER A;  1PKX A;  1N36 O;  5LXT A;  2Q7H A;  2RMK B;  5J2T A;  3E8H A;  3ZMV A;  3J81 N;  2ZCE A;  4J7J A;  1Q6U A;  3VBB A;  3OUF A;  1HNW B;  1VQP V;  2GTS A;  3FX7 A;  1XMQ B;  4CS2 A;  4YJ2 A;  1ARO P;  1L0L H;  2CTW A;  3JAT A;  3OE7 G;  4DUY B;  4R7C A;  1IBM O;  3OTO O;  2WSS G;  1I94 O;  2PY5 A;  3TET A;  2X6C A;  2BTQ B;  5KX5 B;  1V54 B;  3KCX A;  2WAM A;  2ZDI C;  2DW4 A;  1GMG A;  4K8Z A;  4AQY O;  1YTF B;  3ZRW B;  4DR6 O;  1K92 A;  4PA7 A;  5H6R A;  2MW2 B;  3KKY A;  4G27 B;  4I50 A;  4X65 O;  1FXK C;  1I5Y A;  5LP6 C;  4XDK A;  2Q9L A;  1AR1 B;  2XHB A;  4NXN B;  5IDJ A;  1SA0 B;  3CCU V;  3OMA B;  3QO5 A;  3E22 B;  1XQ8 A;  2Q69 A;  3QNE A;  2GUZ A;  2UUC B;  1ZL8 B;  5JQG A;  2EIM B;  4PHZ A;  2BOB C;  2ZIN A;  5FPR A;  1HR0 O;  2M7W A;  1YSC A;  1XNR B;  2KKW A;  3D3I A;  1JOY A;  2Q68 A;  1R73 A;  4ZI7 A;  5GTI Z;  1H38 A;  3OUS A;  4TV8 B;  4ZHQ A;  4WFH A;  4JI7 O;  1F51 A;  1SQG A;  1VQN V;  2P22 C;  3MHS C;  1HW7 A;  3IFX A;  3B40 A;  3RBZ A;  2OIG A;  3AG3 C;  3AG2 B;  2IH1 C;  2WLN A;  2OCC C;  2KQX A;  4EFE A;  3SJC C;  1R1B A;  1DTO A;  1GK9 A;  4DR3 B;  2QWP B;  1OCZ B;  3AK2 A;  3T1H O;  3ZRV A;  2DMX A;  3ZHR A;  3HKE A;  4LWS B;  2L6L A;  1N8R W;  2UXN A;  3HKB A;  4UCR A;  4PA3 A;  3CMA V;  4K8X A;  4PD4 F;  4FFB B;  4ASU G;  4LCU C;  4J11 A;  2Z5U A;  2JGD A;  1S5J A;  3SPC A;  3H1H H;  5L3C A;  2UUA O;  1B04 A;  4B7E A;  4CH4 A;  2ARH A;  2AW9 A;  3CXC U;  3SPI A;  2YI8 A;  4LF7 O;  1Q6H A;  4RUF A;  4AI8 A;  4TV9 A;  2LFR A;  3QVN A;  3JSN A;  2ADQ B;  2QM4 A;  2XUM A;  3ZCC A;  3OEH G;  2UXC B; 
#chains in the Genus database with same CATH homology
 2KSD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...