2KSDA

Backbone structure of the membrane domain of e. coli histidine kinase receptor arcb, center for structures of membrane proteins (csmp) target 4310c
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
75
structure length
75
Chain Sequence
MMKLGLVRFSMLLALALVVLAIVVQMAVTMVLHGQVESIDVIRSIFFGLLITPWAVYFLSVVVEQLEESRQRLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Membrane domain structures of three classes of histidine kinase receptors by cell-free expression and rapid NMR analysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Aerobic respiration control sensor protein arcB
total genus 21
structure length 75
sequence length 75
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2010-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18415 HKR_ArcB_TM Histidine kinase receptor ArcB trans-membrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.970 Mainly Alpha Orthogonal Bundle Helix Hairpins His Kinase A (phosphoacceptor) domain 2ksdA00
2KSDA
chains in the Genus database with same CATH superfamily
4H37A 5H6RA 1WB7A 3E8FA 3WB2A 5KHGA 4JTCB 4OX9B 3SPIA 3ASOB 2F93B 2YSUB 5LL6Y 1Y76A 1Z2GA 1XBLA 4DV4B 3LSUA 3JAWB 5IYDO 1VMGA 2K9PA 4J41A 4I0XB 1BE3H 3U11A 1PKXA 5FL7G 3OT7A 2XAGA 5IJ0A 3L72H 1JCHA 1JQ0A 2QWOB 2ZD9A 2ZNJA 4O4HA 4QIWF 1VQMV 4GT1A 5LP6C 5C93A 1COWG 4H33A 1OCRB 2ODMA 4GYCB 1JPXA 1T5EA 5LOVB 4X88A 3WG7B 5KMGA 3OGIB 1YTFD 2HJDA 1I94O 3ZRSA 3QTCA 4UVBA 5J2TB 2QTOA 3SR2C 5LP6A 2Q0AA 3SPCA 4FLVA 4QGPA 5GTIZ 1B06A 5LXTB 3FKSG 1I5XA 2CDYA 2DJVA 3T1HB 4LNUA 2DYSB 4FM2A 3BA9A 2P4KA 4X89A 5KHHA 4LF6B 1N32O 2R9IA 1BL8A 5EZYB 3VBBA 3LNNA 1BHAA 4X65B 4JI4O 5L3FA 1N34B 3APQA 3VQWA 3ZHQA 1KKDA 5CA1B 5LBQA 4DO2A 2L6LA 3TXQA 3FB6C 1ROPA 3D3QA 3WFVA 2GV9A 2UXXA 1K33A 2KG7A 5JH7A 2MW2B 3OMAB 1ZL8A 3F7YC 3BABA 5EYPA 2LFRA 1N36O 3RBZA 5CB4A 2ADQB 3OUSA 4TOIA 4RUEA 4NTXA 4DV5B 5JQGB 1ZUQA 1SQXH 4WBNB 3TGUH 3D36C 4JYYA 3ABTA 1H2SB 1MG1A 4LFCB 3ZIAG 2X6CA 1KU9A 2ZXWB 4NR1A 3CX5F 4MVOA 2W0FC 5LYJA 4CH5A 2H3OA 3HKDA 1SQPH 1SC5B 4XDKA 4K35A 1Q6HA 3CP1A 1QLEC 4ABMA 2CGNA 4WFFA 3IJ4A 1GRJA 4B3MB 3ZCCA 4LH7A 3ZHTA 4PI2A 4UVCA 1YVWA 4DXWA 5EK0A 3CCMV 1I5YA 2WLKA 4LF8B 4X1KA 1IXMA 1TVKB 3N27A 2OCCC 3E83A 2YEVA 3BY6A 3DC6A 1D2DA 2ATKC 1P84F 1Z5WA 2ZNIA 2QKAA 2GSMB 4NB5A 3FYIB 3OR7C 2NNUA 1N4CA 3QVNA 3UT5A 4PA3A 3B40A 2PGGA 4FM0A 5E79Z 2CH7B 4QPKA 4X66O 1JVMA 4CH3A 2P4VA 3ZMZA 2CTRA 1N33O 2CUGA 3ZRXA 3T4DA 2LGQA 4X66B 4MT8A 1P7GA 1PNLA 3ZRWA 3ABUA 3K59A 4FLXA 3ETGA 4FIPC 1RSOB 3U0ZA 2EINB 4EB6B 1GN6A 5KX5B 5JJEB 2Y48A 4B7EA 1IBLB 4C7UA 4NXNO 3UT5B 5IE9A 4LWSA 4R50A 2R70A 2D3OW 2F1MA 1GM8A 1DGSA 2UXNA 1UPGA 3BHPA 4JI1O 3ASNC 4J10A 5LOVA 2EX3A 1IBKO 2UUBO 1GMGA 2ZDIA 1SRYA 5CB4B 2WLNA 3K5NA 5JCOA 5C8YB 1HNZO 4B3MO 1NVPD 2UXCO 1P4RA 5IJ9B 2W0XA 2FMLA 3Q4HB 4G27B 4O2AB 4KHPO 4AI8A 5EIBD 1IDSA 4J11A 3DGEA 2ZE6A 1NBMG 2UXBB 2YIBD 4OPHA 3JCZA 3OTFA 2M7WA 3L9DA 4FZ0A 4TV8B 4GKJO 4HNAA 4KP4A 2VQFB 4DR6B 3JD4A 2V7QG 1JJOA 3ZHVA 3RYCA 4O4LA 2OTJV 4BWAA 3GB7C 1N0NA 5JVDB 1WN7A 2WAMA 4QE9A 4K8XA 5EIBC 2AXTZ 4L87A 4YJ2B 1R3IC 4I9QA 3FB7C 4ZOLA 4BIUA 3M8AA 1JX9A 4GUNA 2QKCA 3E8HA 1VQOV 2BSKA 2IU0A 2JS5A 2LFSA 2QWNB 1GK9A 4FJCC 2VWJA 3ICXA 4JI7O 1OJHA 1TAEA 1NH2B 2ZKOA 1M56C 2QWRB 5HFMA 4HYOA 1V9PA 3K06A 3KG2A 3FB5C 1GN3A 1RM1C 2DQ0A 1PL4A 3FFQA 1XI1A 4TUYB 2VQEO 4W4KA 1TA8A 2BTOA 2EINC 1LNQA 5EBWC 4X9QA 1O9HA 3M99B 5IY5B 2XT9A 4ZHQA 3VQYA 5LA6A 1E79G 4RWUA 1VF7A 1FFTB 1BMFG 3UO2A 2Y69B 2KSDA 5CMUA 4F6EA 4K8ZA 1YSCA 3I56V 2EILB 1VQLV 4IHJB 1AR1B 1WAZA 2RMKB 2B1GA 4RQEA 1NZ6A 4I5SA 1XQ8A 3CYOA 2GBOA 2PI4A 3JCUZ 2B9ZA 2ZM6O 3N2GB 2KB1A 1S0VA 5LA6B 1NT2B 4ZIBA 2DWEC 4LF8O 2R9RB 4DUZO 1BQ0A 4LFAO 2PF4E 5L3GA 3ETEA 4HAMA 1RM1B 4QE7A 3SGIA 1R6NA 2F95B 3H1LH 3OM3B 4HNAB 2HEPA 3ZRWB 3ZS8C 2NN4A 1P49A 3ABLC 4FLYA 4LF9O 3ABMC 4BR6A 4MTFA 1HNZB 4QNHB 2QKSA 3JD0A 3AK2A 1RPRA 3OTOB 3L75H 4QJFB 1OCOC 4DRXB 1AP5A 2QSAA 3ABKB 2Q73A 1XMQB 2BE3A 1EN6A 1F4MA 3AG3B 4DV2B 3RGBA 2EZOA 4R8CA 1NR1A 1PNMA 2YIDA 1KD1W 2L35A 4GZRB 4JAVA 4I4TB 1BS3A 1IBLO 4BIOA 1Z5VA 3RYHB 5A9GA 3IC9A 1SQQH 1AROP 5CA1A 1SA0B 1Q82W 5EC1C 1E1RG 3SPHA 3CCRV 5IYZB 3JATB 1FXKC 1SZXA 4Q6GA 2PYJA 2QA4V 2Q69A 3CCJV 1IURA 4KHPB 3JALB 2P6JA 2PZSA 1R6KA 3WB0A 2BCCH 3EHBB 4E4EA 3RFRA 1SZTA 2CTWA 5KHJA 3OMIB 1MSWD 2Y0PA 4JI6B 1B3QA 2Q8VA 2PUSA 2WSSG 4FZ1A 2DN9A 5IYBO 1IXBA 3RYFB 1JA8A 1K8AW 3WG7C 5F2VO 1G6UA 4ZKIA 3MHHC 1VQKV 2LJ2A 3G80A 1WP8A 4TWKA 4B7KA 2F23A 1H8HG 2HHHO 4UV9A 3SYCA 3CCSV 1Y76B 1BQZA 2XAFA 3UO3A 5IDJA 1Q8IA 4WFAV 1Q7YW 1TVKA 1PNKA 2QM7A 4L8JA 5EZYA 1ZTEA 5EBLC 4IIJB 2V1DA 4FMTA 2O57A 2BOBC 4PELA 5KA5A 1EBOA 4JI6O 3NR7A 1DF5A 4B3TB 5J2UA 3AG7A 2R9AA 4LF5O 2EJRA 4DV6B 2DWDC 2Y4UA 1WPXA 3STLC 1VQ9V 4JASA 1HWYA 1P7BA 4B08A 4H13B 5ITZA 3I55V 4FLWA 2IJKA 4RQFA 5A2QN 3RYHA 1Y74B 2ZR3A 1IBMB 4JI3O 1WPBA 1BCCH 1VQ4V 3CC4V 2EILC 2YXLA 1R3KC 1QR9A 1YF2A 4OPAA 2GTAA 2IH1C 1XL6A 3CRRA 3S3XA 4X20B 1YZBA 1I0HA 1YIJV 2H8PC 3W7WA 3H01A 3HKBB 3A0BZ 3L73H 3CMAV 1MZFA 1NJIW 2CGOA 1XL4A 3N2KA 4F6RA 5B66Z 3SJAC 1OCZC 1BSMA 2VS0A 4JTDB 4PDRA 5LMNO 4DR7B 3JYCA 2YI8A 3CSXA 4U7OA 2BTQA 5KLVH 5LGUA 1JOYA 4P2ZA 4MTXA 1GAXA 2DYRB 1EZVH 2HVKC 4LFBB 3DSQA 3A0HZ 2A0LA 2Y4TA 4JI0O 2ZINA 3G67A 1DF4A 3F5WC 3CE2A 4Z2WA 4DR1O 1J5EO 1G1XB 5IT9N 3KKYA 4DR3O 4B3RB 1D5NA 4JV5B 2LQTA 4X1IA 3NXSA 4DV4O 4E2LA 3LDEA 3RYIB 3VOUA 4UCTA 1M93A 1SERA 4X64B 5BY1A 1AR5A 4CH4A 2M6YA 2BSKB 1G4YB 2EZPA 2KQXA 1NTMH 3RT3C 2DMXA 4UCOA 2OIEA 4U7NA 2WLIB 4BW5A 5FLXN 5GW7A 2QWPB 2JK5C 3JAMN 2Q7EA 1OCRC 4UB6Z 1EM1A 3CCEV 2OYQA 3WB1A 1RFYA 3OD4A 4PHZA 5BMVB 1AJQA 5J9PC 2VRZA 1XEQA 1F23A 3PJSK 4X1KB 4MTGA 1H38A 1H2GA 4MVUA 2EIKC 1H2NA 1XNQO 1F7YA 3ABLB 5AG2A 4OGQB 3OAAG 1YJWV 1AP6A 4UCUA 2VQEB 2IJIA 2W6IG 2ITCC 4NXNB 3DTUB 2LP7A 5CBHA 4MVRA 4BAYA 2WLLB 1FKAO 5B1OA 2FL4A 3ZJZA 1W59A 5CBGA 2WWWA 2XUMA 3L70H 4O2BB 4JI0B 2UU9B 1M56B 3MD0A 4FK5C 4DV7O 1ZX3A 3T4ZA 3K0GA 1AVMA 2XAHA 4IYHA 2DYSC 1JJ2U 3KZIZ 5CBFA 5KA6A 1QQCA 3D3IA 2IJJA 3HKBA 4WFBV 3I5DA 4PV1B 5LMNB 4FFBA 2P7TC 1JR9A 2CTPA 3TK1A 1VF6A 1PV0A 1H2LA 2RNBA 4J80A 3BRCA 1VQPV 3ML0A 4NXMO 1IBKB 3QF7A 3CPWU 4LFAB 1K73W 2K1EA 5TISZ 3W7SA 4OXSA 4GKKO 1W0KG 5DN6G 1XNQB 3ZMVA 4DR1B 2E76B 3EVKA 1X59A 1Y66A 3HKCA 1GH6A 4LF9B 1WB8A 1L0NH 2V4DA 2P67A 2B5UA 1H2MA 1TUBA 1W0JG 4CBCA 4DV1B 1KBHA 1KP2A 1AJPA 2LGWA 3E89A 3BA8A 4MVMA 4X20A 4DV1O 2JVDA 3HR0A 1SQGA 1VQNV 1K5SA 1SF9A 3E22B 3FD9A 1FYJA 4GX0A 5JQGA 1CEZA 2EIKB 4F4LA 1SQVH 3H1HH 2UUBB 1HDJA 1OV9A 4PA7A 4P9PA 2EJ7A 2CAZC 4JV5O 2Q9LA 5H6QA 3OMNB 5JJNB 5LHIA 3LSQA 1MA1A 2DQ3A 4DR5O 5L3DA 1NTKH 3DXRB 4IYIA 3WU2Z 5IYZA 3CHXA 4KL1A 4IL6Z 1R3JC 1YI2V 1XMOB 1N33B 5BZBA 1XNRB 1F51A 2B1IA 1AB3A 2ITDC 1DLBA 2KG7B 4NTYA 4DW0A 1KC8W 2JRIA 3LUTB 3K3WA 2IM9A 4YHHB 2A9HA 1FFXB 3T2MA 4GKKB 1HNWO 2E75B 2ZIMA 1M5IA 3MAQA 5B3SC 2QM8A 4O2BA 1N32B 1AJNA 1SETA 2CTQA 3JARB 2F4VB 1HR0O 1HNXB 5LMUB 3K03A 3UM7A 1KP3A 3D8CA 3ABMB 5IJ0B 1MMMA 1IZ3A 4AQYB 4CC5A 1EFRG 2EIMC 4CS4A 5B1AB 1FFXA 1FPOA 1THZA 2HKOA 1KQSU 4JI3B 4UVAA 4WFEA 3ZX6A 3SDLA 2QE7G 4PI0A 4PA9A 2QJ1A 2FTKA 4NYKA 4TV9A 3JAKA 4Q20A 2Q67A 1QR8A 4GCZA 5LP6B 4FVMA 5KUKA 4F6RB 1Q3EA 3VQXA 3AG3C 2X0LA 3RVZA 3JD2A 1GM9A 3BPZA 3JASB 3EFFK 4JPRA 2BTQB 2Y69C 4JZGA 3FX7A 5LGNA 2OWOA 1H2KA 2HVJC 2YEVB 3CMEV 4MTOA 2AZ2A 1N0JA 1R3LC 4TQFA 5GONB 3AG2C 1ZSPA 4TT3G 3HKDB 2JIZG 4J9ZB 4GLXA 1VARA 1YCIA 3AG4C 4FFBB 4MVZA 1M90W 1Q81W 4D7SA 1NU1H 1M9NA 3L74H 4DV3O 3IGAC 3ZHRA 4J42A 1XOUA 2XASA 5FPOA 3CRAA 2YICA 4YXWG 3W7XA 5GONA 4JI8B 4DV0O 1AR4A 5J2TA 4TSFG 3HKEB 1QLEB 4DK0A 2QDOA 2MK3A 2EBOA 3E86A 4YHHO 3N2KB 5L3CA 1J5EB 2UUCB 1O9GA 4I50A 5LYJB 3UKMA 1K92A 3SYPA 5CA0B 2P22C 1Q5OA 3ZBHA 3AG1B 1FS0G 3O65A 4FPPA 1N34O 2RJZA 1VEWA 4I55A 3E35A 4B3SB 4IIJA 4K0KB 1VQ7V 3ZMSA 2A7WA 1XHXA 4RO2A 1MOFA 2JGDA 2ZE5A 3UCSC 4JAUA 2FYUH 4W4LA 4FLZA 2Z0AA 4R6ZA 4LBEC 4J9YB 3RYFA 1TGOA 3CCUV 4JYAB 1N8RW 1S5LZ 2E3CA 3BFRA 2RDCA 4DR6O 3VQVA 1FXKB 5LGTA 4H0LB 1OZ0A 3FB8C 1Y74A 2DOSA 4IGGA 4ZOLB 3SYOA 1N36B 1OCZB 3ASOC 2IBZH 1NVPB 3CXHF 4DYLA 4YJ3A 4DUYB 3AG4B 3JD1A 4U3JA 3K04A 1XREA 3TCUA 3H9VA 2EIMB 1PD3A 2OT5A 1V54C 1US6A 1RSOA 2RN9A 1CPYA 1Y6XA 4MVQA 1B6QA 2ZE7A 1SQFA 3GWKC 5L3EA 3T1YB 1MZEA 4B3SO 1K7DA 4LR3A 3TXSA 1JMKC 1HNWB 1PPJH 4YJ3B 3ZN0A 1Q86W 1NR7A 2F43G 4CC6A 3JAKB 1I7FA 5IWAB 3RVYA 4LH6A 1MNGA 1S76D 5LHGA 3APOA 1ZAUA 1Q43A 2A06H 1MABG 3K58A 3JD3A 3E22A 1DTOA 4FLUA 2PY5A 5CN0A 3MHSC 4UB8Z 1GN2A 4JYBA 1ZLZA 2LW1A 1Q6IA 5FNVA 4DR2O 2QGNA 2YXYA 1CXZB 5HFLA 3G71V 3OFNG 3T1HO 2D2CB 3U10A 4IHJA 1M57B 2A3QA 1KKCA 4LFBO 2XOKG 3DXRA 4EB6A 3K5OA 2R72A 4O4LB 3OEEG 5B3SB 3HKCB 2ZXWC 1GN4A 3HB3B 4I55B 4DR3B 4B3RO 3K57A 2ETNA 2N04A 5H9CA 5IY5C 2N05A 1QCEA 1URFA 3BVOA 5B1BB 4ZI7B 4Z1VA 1K4CC 3B4SA 3HKEA 5DEDA 2LO1A 1G8MA 3JARA 3CEIA 4XBFA 5CA3A 1GTOA 2Z3YA 1XHZA 2HG5C 2Q7GA 3B8MA 4O4IA 3IAYA 1EN4A 1LUWA 3OE7G 4X1IB 3QNEA 5LHHA 4JTAB 5B1NA 4RUFA 4JI1B 1QVGU 3THOA 3ABKC 3RYIA 2XAJA 2QWQB 4DV5O 3CRQA 1I94B 1QVFU 3FAVB 3CRCA 3K5MA 2UXCB 1XMQO 3RWRD 4EKWA 1L1FA 3BEHA 2GHYA 3ASNB 5C8YA 5KAFZ 1S5JA 3OTOO 2A79B 3TJTA 2H94A 3QG5A 3CJHA 4O4HB 1IVSA 4UFZA 3JASA 1IBMO 4U3FH 4JI2B 1CP9A 3LSSA 4EFEA 2JGUA 1GKFA 3LNMB 4JZ2A 1SKVA 4XDLA 4X1YA 4CS2A 4DR4O 2CH7A 2HR3A 4UCSA 1AI4A 4KFMA 2WLMA 3AG2B 5KMGB 3PN1A 2IU3A 5JVDA 1TUBB 3J7AU 1X4TA 2PI5A 3CJHB 2ADPA 2Q0OC 3K79A 2RQ6A 2PYLA 3F7VC 4LNUB 4BIZA 2CK3G 2YXHA 2E5LB 4LF4B 4AILC 3C90A 1OHHG 4N21A 4DV3B 3E2EA 1S3JA 5DECA 4DUYO 4KUMA 2IH3C 1FAFA 1BHBA 3CC2V 3M7MX 4DK1A 4RAIA 3CC7V 2Q5ZA 3J80N 4DR7O 3K9AA 3CS5A 1KUQA 4ZHQB 2AW9A 3C3SA 1YTFB 4FLTA 2WLJA 4MW8A 3IFXA 4N23A 1NS1A 2AZ0A 3Q4HA 4O2AA 1NH2D 5B1BC 2UUAO 3AEIA 1L0LH 2UUCO 2YIAA 4JYAO 2ZCEA 1W2BU 4CS3A 3F5TA 3H1JH 1J95A 4JF3A 3OEHG 3CCLV 4PA4A 4DV6O 2UUAB 2OIGA 3JSLA 1SQBH 3A8TA 3T1YO 1V55C 2YDEA 3E8BA 3A0RA 1GO3F 4WBNA 1VF5B 3N2GA 1PL0A 4DV0B 2Q4PA 2YC0A 2XHBA 2WPDG 3OR6C 4A5UB 3RYCB 1BT8A 4PA6A 1IX9A 4CH6A 5LMUO 3JSNA 1M4UA 2OTLV 4JI7B 5IWAO 1MSDA 4PDLA 1FXVA 1K5QA 1WNSA 4J7JA 3R65A 1QNMA 3G6EV 2WA3A 1M1KW 2JGDB 3S3WA 4DR5B 2XNDG 2UXDB 4O4JB 3T1CA 3FAVA 4LF5B 1QU7A 5KUMA 4DV7B 4R7CA 4NTWA 4LF7O 1NI8A 1HP8A 4JI5B 2FB5A 1S5HC 1K4DC 4MS2A 1FXKA 1OCCB 3GWOA 4DRXA 4LF6O 2KKWA 2P90A 3SPJA 2ZR2A 4ICGA 5BR8O 3TETA 1GM7A 3K9SA 4UUJC 1NKDA 1UFIA 4DR4B 3SYAA 3CCVV 2X6BA 3SJCC 5BR8B 4DV2O 3UQ8A 5CA0A 2HLDG 4TUYA 3X2QB 2ILMA 4UCVA 3E8GA 3D36A 1VP7A 2C2AA 4D7TA 2JS3A 4GX5A 3K5LA 4J7KA 4BW9A 1YEWA 3ZHSA 1WJZA 4PJ0Z 4AQYO 1U97A 1QLNA 3CB2A 2WA4A 1ORQC 3H1KH 1HW7A 1DK1A 1BGYH 4X8AA 1HNXO 4NXMB 1JFFB 4GX1A 1VF6C 2VWKA 2E5LO 4LF4O 1VQ8V 5B1AC 1F4NA 2LW7A 1K9MW 5K1XA 3ETQA 1U96A 1PM9A 1H8EG 2RCVA 5D5PA 1PP9H 5L3BA 4I7ZB 2WLHA 1R73A 4I9WA 5FNVB 2AHZA 2E74B 2W6JG 2ZQMA 2G38A 3ZN1A 3W7TA 1K34A 2ZM6B 1SESA 3LDDA 2BOCC 1OCCC 3CWBH 3JAWA 1KYOF 5J2UB 1YITV 4HBNA 4JI2O 4U3JB 1R1BA 4MSWC 1V54B 1WA8A 1ENVA 3P3NA 4P30A 1AI6A 2QEXV 2XAQA 5EC2C 3JALA 4ZBMA 5BXZA 2AHYA 1NQTA 4DW1A 5JH7B 2PTMA 4JYCA 5H2FZ 1YJ9V 1KB9F 1FXHA 4P9OA 1XDCA 2FKXA 2AGAA 3A2FA 4XDJA 4PDMA 4UV8A 3SJBC 3J81N 5IYCO 4TV8A 1AILA 4X65O 4JI4B 4X64O 1WA8B 2NR5A 3BAAA 3KCXA 3FYEB 2QM4A 2P06A 2UXDO 3CCQV 3B77A 3ZRVA 1I08A 4JAAA 5LXTA 3W7UA 4YY3B 3C3TA 3ZMUA 4YJ2A 4O4IB 2ZIOA 1BZKA 4GX2A 4LP8A 4ASUG 5B5EZ 1AI5A 3SJQC 3R66A 2JJ1G 4NVPA 5KHIA 4YIPA 2EIJC 1QBZA 4ZI7A 1SS3A 3ETDA 4EEQA 1VQ5V 3AK3A 1D5AA 1VIBA 3AG1C 3MDSA 2HP8A 3QO5A 1B04A 2WLLA 1XUQA 2EULA 1YDXA 2CE4A 1WLEA 4K3AA 2ZE8A 3LDCA 2X6AA 1JFFA 4LC1A 2WLIA 3HPLC 1FJGB 2UXBO 5KAIZ 3B8NA 5ITZB 1L8DA 2P5OA 1M57C 2DYRC 2GTSA 1K97A 2IJHA 1TUEB 1WP7A 2JJ2G 3ZEDA 2JEXA 1EZJA 2OCHA 5BMVA 1Q6UA 3K08A 4WF9V 4LFCO 2YUAA 3AK1A 4JI5O 3OUFA 5JCOC 4B3TO 2DE0X 1NTZH 3B2EE 3P32A 3ZMTA 2NLJC 2ZT9B 2ZDIC 3RW0A 2JDIG 4CZZA 2YI9A 4OX9O 2GDSA 4JI8O 1XMOO 5D5QA 2Q7HA 5KHKA 2YS8A 4MVSA 3STZC 1A32A 3DC5A 4YIOA 4X1YB 3L71H 4TV9B 2IW5A 3P3PA 5JJJB 1KMIZ 5GTHZ 2Z5UA 1VQ6V 1FD9A 1Y67A 4G2KA 2YIBA 2XTAA 2HHHB 1V55B 1RP3B 4YY3O 3GVMA 2F66C 2GUZB 5IJ9A 3ZHUA 1Y4MA 4UCRA 2QR4A 4UXNA 4WFHA 1AI7A 3QO8A 3CRMA 4GKJB 4JGSA 3G4SV 3CXCU 2VQFO 4LF7B 2Y0IA 1XILA 3H1IH 1FJGO 4MW3A 3QO7A 5E1AC 4I4TA 3X2QC 1E1QG 1YJNV 4O4JA 4J7ZA 3O9OA 4LWSB 1UJWB 5H5NA 2GUZA 2F4VO 2JEUA 1XNRO 2X7RB 5KX5A 1LUVA 1Q90D 4X62B 4WFGA 3OW2U 1SA0A 5K1PA 4FFKA 1ZWIC 4NKGB 5DM6V 3P30A 4PD4F 4QPJA 3SYQA 4H44B 3CD6V 4X62O 3SPGA 3JATA 1K3EA 2EIJB 1EN5A 2UU9O 4Z1MG 2Q6AA 3G6BA 1QHTA 2HJFC 4PDVA 3EXAA 4EFBA 1HR0B 4D6TH 4DUZB 5FPRA 3K0DA 1YXBA 3IC7A 3RN4A 2OCCB 4WCEV 4IT5A 4LCUC 1R6TA 2ARHA 4KXRA 4G28B 3OGCC 1ZL8B 4I50B 1KECA 2Q68A 5EYPB 1OCOB 1S72V 4HZ3A 3KCYA 4DR2B 5JWPA 4AHCA 4FM1A 3BCCH 5EBMC 1LR1A 1RPOA 3B09A 2N74A 2HFEC 4I0XA 1YHQV 4K0KO 2QTSA 4TQDA 2DW4A 1S77D
chains in the Genus database with same CATH topology
2KSDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KSD A; 
#chains in the Genus database with same CATH topology
 4H37 A;  5H6R A;  1WB7 A;  3E8F A;  3WB2 A;  5KHG A;  4JTC B;  4OX9 B;  3SPI A;  3ASO B;  2F93 B;  2YSU B;  5LL6 Y;  1Y76 A;  1Z2G A;  1XBL A;  4DV4 B;  3LSU A;  3JAW B;  5IYD O;  1VMG A;  2K9P A;  4J41 A;  4I0X B;  1BE3 H;  3U11 A;  1PKX A;  5FL7 G;  3OT7 A;  2XAG A;  5IJ0 A;  3L72 H;  1JCH A;  1JQ0 A;  2QWO B;  2ZD9 A;  2ZNJ A;  4O4H A;  4QIW F;  1VQM V;  4GT1 A;  5LP6 C;  5C93 A;  1COW G;  4H33 A;  1OCR B;  2ODM A;  4GYC B;  1JPX A;  1T5E A;  5LOV B;  4X88 A;  3WG7 B;  5KMG A;  3OGI B;  1YTF D;  2HJD A;  1I94 O;  3ZRS A;  3QTC A;  4UVB A;  5J2T B;  2QTO A;  3SR2 C;  5LP6 A;  2Q0A A;  3SPC A;  4FLV A;  4QGP A;  5GTI Z;  1B06 A;  5LXT B;  3FKS G;  1I5X A;  2CDY A;  2DJV A;  3T1H B;  4LNU A;  2DYS B;  4FM2 A;  3BA9 A;  2P4K A;  4X89 A;  5KHH A;  4LF6 B;  1N32 O;  2R9I A;  1BL8 A;  5EZY B;  3VBB A;  3LNN A;  1BHA A;  4X65 B;  4JI4 O;  5L3F A;  1N34 B;  3APQ A;  3VQW A;  3ZHQ A;  1KKD A;  5CA1 B;  5LBQ A;  4DO2 A;  2L6L A;  3TXQ A;  3FB6 C;  1ROP A;  3D3Q A;  3WFV A;  2GV9 A;  2UXX A;  1K33 A;  2KG7 A;  5JH7 A;  2MW2 B;  3OMA B;  1ZL8 A;  3F7Y C;  3BAB A;  5EYP A;  2LFR A;  1N36 O;  3RBZ A;  5CB4 A;  2ADQ B;  3OUS A;  4TOI A;  4RUE A;  4NTX A;  4DV5 B;  5JQG B;  1ZUQ A;  1SQX H;  4WBN B;  3TGU H;  3D36 C;  4JYY A;  3ABT A;  1H2S B;  1MG1 A;  4LFC B;  3ZIA G;  2X6C A;  1KU9 A;  2ZXW B;  4NR1 A;  3CX5 F;  4MVO A;  2W0F C;  5LYJ A;  4CH5 A;  2H3O A;  3HKD A;  1SQP H;  1SC5 B;  4XDK A;  4K35 A;  1Q6H A;  3CP1 A;  1QLE C;  4ABM A;  2CGN A;  4WFF A;  3IJ4 A;  1GRJ A;  4B3M B;  3ZCC A;  4LH7 A;  3ZHT A;  4PI2 A;  4UVC A;  1YVW A;  4DXW A;  5EK0 A;  3CCM V;  1I5Y A;  2WLK A;  4LF8 B;  4X1K A;  1IXM A;  1TVK B;  3N27 A;  2OCC C;  3E83 A;  2YEV A;  3BY6 A;  3DC6 A;  1D2D A;  2ATK C;  1P84 F;  1Z5W A;  2ZNI A;  2QKA A;  2GSM B;  4NB5 A;  3FYI B;  3OR7 C;  2NNU A;  1N4C A;  3QVN A;  3UT5 A;  4PA3 A;  3B40 A;  2PGG A;  4FM0 A;  5E79 Z;  2CH7 B;  4QPK A;  4X66 O;  1JVM A;  4CH3 A;  2P4V A;  3ZMZ A;  2CTR A;  1N33 O;  2CUG A;  3ZRX A;  3T4D A;  2LGQ A;  4X66 B;  4MT8 A;  1P7G A;  1PNL A;  3ZRW A;  3ABU A;  3K59 A;  4FLX A;  3ETG A;  4FIP C;  1RSO B;  3U0Z A;  2EIN B;  4EB6 B;  1GN6 A;  5KX5 B;  5JJE B;  2Y48 A;  4B7E A;  1IBL B;  4C7U A;  4NXN O;  3UT5 B;  5IE9 A;  4LWS A;  4R50 A;  2R70 A;  2D3O W;  2F1M A;  1GM8 A;  1DGS A;  2UXN A;  1UPG A;  3BHP A;  4JI1 O;  3ASN C;  4J10 A;  5LOV A;  2EX3 A;  1IBK O;  2UUB O;  1GMG A;  2ZDI A;  1SRY A;  5CB4 B;  2WLN A;  3K5N A;  5JCO A;  5C8Y B;  1HNZ O;  4B3M O;  1NVP D;  2UXC O;  1P4R A;  5IJ9 B;  2W0X A;  2FML A;  3Q4H B;  4G27 B;  4O2A B;  4KHP O;  4AI8 A;  5EIB D;  1IDS A;  4J11 A;  3DGE A;  2ZE6 A;  1NBM G;  2UXB B;  2YIB D;  4OPH A;  3JCZ A;  3OTF A;  2M7W A;  3L9D A;  4FZ0 A;  4TV8 B;  4GKJ O;  4HNA A;  4KP4 A;  2VQF B;  4DR6 B;  3JD4 A;  2V7Q G;  1JJO A;  3ZHV A;  3RYC A;  4O4L A;  2OTJ V;  4BWA A;  3GB7 C;  1N0N A;  5JVD B;  1WN7 A;  2WAM A;  4QE9 A;  4K8X A;  5EIB C;  2AXT Z;  4L87 A;  4YJ2 B;  1R3I C;  4I9Q A;  3FB7 C;  4ZOL A;  4BIU A;  3M8A A;  1JX9 A;  4GUN A;  2QKC A;  3E8H A;  1VQO V;  2BSK A;  2IU0 A;  2JS5 A;  2LFS A;  2QWN B;  1GK9 A;  4FJC C;  2VWJ A;  3ICX A;  4JI7 O;  1OJH A;  1TAE A;  1NH2 B;  2ZKO A;  1M56 C;  2QWR B;  5HFM A;  4HYO A;  1V9P A;  3K06 A;  3KG2 A;  3FB5 C;  1GN3 A;  1RM1 C;  2DQ0 A;  1PL4 A;  3FFQ A;  1XI1 A;  4TUY B;  2VQE O;  4W4K A;  1TA8 A;  2BTO A;  2EIN C;  1LNQ A;  5EBW C;  4X9Q A;  1O9H A;  3M99 B;  5IY5 B;  2XT9 A;  4ZHQ A;  3VQY A;  5LA6 A;  1E79 G;  4RWU A;  1VF7 A;  1FFT B;  1BMF G;  3UO2 A;  2Y69 B;  2KSD A;  5CMU A;  4F6E A;  4K8Z A;  1YSC A;  3I56 V;  2EIL B;  1VQL V;  4IHJ B;  1AR1 B;  1WAZ A;  2RMK B;  2B1G A;  4RQE A;  1NZ6 A;  4I5S A;  1XQ8 A;  3CYO A;  2GBO A;  2PI4 A;  3JCU Z;  2B9Z A;  2ZM6 O;  3N2G B;  2KB1 A;  1S0V A;  5LA6 B;  1NT2 B;  4ZIB A;  2DWE C;  4LF8 O;  2R9R B;  4DUZ O;  1BQ0 A;  4LFA O;  2PF4 E;  5L3G A;  3ETE A;  4HAM A;  1RM1 B;  4QE7 A;  3SGI A;  1R6N A;  2F95 B;  3H1L H;  3OM3 B;  4HNA B;  2HEP A;  3ZRW B;  3ZS8 C;  2NN4 A;  1P49 A;  3ABL C;  4FLY A;  4LF9 O;  3ABM C;  4BR6 A;  4MTF A;  1HNZ B;  4QNH B;  2QKS A;  3JD0 A;  3AK2 A;  1RPR A;  3OTO B;  3L75 H;  4QJF B;  1OCO C;  4DRX B;  1AP5 A;  2QSA A;  3ABK B;  2Q73 A;  1XMQ B;  2BE3 A;  1EN6 A;  1F4M A;  3AG3 B;  4DV2 B;  3RGB A;  2EZO A;  4R8C A;  1NR1 A;  1PNM A;  2YID A;  1KD1 W;  2L35 A;  4GZR B;  4JAV A;  4I4T B;  1BS3 A;  1IBL O;  4BIO A;  1Z5V A;  3RYH B;  5A9G A;  3IC9 A;  1SQQ H;  1ARO P;  5CA1 A;  1SA0 B;  1Q82 W;  5EC1 C;  1E1R G;  3SPH A;  3CCR V;  5IYZ B;  3JAT B;  1FXK C;  1SZX A;  4Q6G A;  2PYJ A;  2QA4 V;  2Q69 A;  3CCJ V;  1IUR A;  4KHP B;  3JAL B;  2P6J A;  2PZS A;  1R6K A;  3WB0 A;  2BCC H;  3EHB B;  4E4E A;  3RFR A;  1SZT A;  2CTW A;  5KHJ A;  3OMI B;  1MSW D;  2Y0P A;  4JI6 B;  1B3Q A;  2Q8V A;  2PUS A;  2WSS G;  4FZ1 A;  2DN9 A;  5IYB O;  1IXB A;  3RYF B;  1JA8 A;  1K8A W;  3WG7 C;  5F2V O;  1G6U A;  4ZKI A;  3MHH C;  1VQK V;  2LJ2 A;  3G80 A;  1WP8 A;  4TWK A;  4B7K A;  2F23 A;  1H8H G;  2HHH O;  4UV9 A;  3SYC A;  3CCS V;  1Y76 B;  1BQZ A;  2XAF A;  3UO3 A;  5IDJ A;  1Q8I A;  4WFA V;  1Q7Y W;  1TVK A;  1PNK A;  2QM7 A;  4L8J A;  5EZY A;  1ZTE A;  5EBL C;  4IIJ B;  2V1D A;  4FMT A;  2O57 A;  2BOB C;  4PEL A;  5KA5 A;  1EBO A;  4JI6 O;  3NR7 A;  1DF5 A;  4B3T B;  5J2U A;  3AG7 A;  2R9A A;  4LF5 O;  2EJR A;  4DV6 B;  2DWD C;  2Y4U A;  1WPX A;  3STL C;  1VQ9 V;  4JAS A;  1HWY A;  1P7B A;  4B08 A;  4H13 B;  5ITZ A;  3I55 V;  4FLW A;  2IJK A;  4RQF A;  5A2Q N;  3RYH A;  1Y74 B;  2ZR3 A;  1IBM B;  4JI3 O;  1WPB A;  1BCC H;  1VQ4 V;  3CC4 V;  2EIL C;  2YXL A;  1R3K C;  1QR9 A;  1YF2 A;  4OPA A;  2GTA A;  2IH1 C;  1XL6 A;  3CRR A;  3S3X A;  4X20 B;  1YZB A;  1I0H A;  1YIJ V;  2H8P C;  3W7W A;  3H01 A;  3HKB B;  3A0B Z;  3L73 H;  3CMA V;  1MZF A;  1NJI W;  2CGO A;  1XL4 A;  3N2K A;  4F6R A;  5B66 Z;  3SJA C;  1OCZ C;  1BSM A;  2VS0 A;  4JTD B;  4PDR A;  5LMN O;  4DR7 B;  3JYC A;  2YI8 A;  3CSX A;  4U7O A;  2BTQ A;  5KLV H;  5LGU A;  1JOY A;  4P2Z A;  4MTX A;  1GAX A;  2DYR B;  1EZV H;  2HVK C;  4LFB B;  3DSQ A;  3A0H Z;  2A0L A;  2Y4T A;  4JI0 O;  2ZIN A;  3G67 A;  1DF4 A;  3F5W C;  3CE2 A;  4Z2W A;  4DR1 O;  1J5E O;  1G1X B;  5IT9 N;  3KKY A;  4DR3 O;  4B3R B;  1D5N A;  4JV5 B;  2LQT A;  4X1I A;  3NXS A;  4DV4 O;  4E2L A;  3LDE A;  3RYI B;  3VOU A;  4UCT A;  1M93 A;  1SER A;  4X64 B;  5BY1 A;  1AR5 A;  4CH4 A;  2M6Y A;  2BSK B;  1G4Y B;  2EZP A;  2KQX A;  1NTM H;  3RT3 C;  2DMX A;  4UCO A;  2OIE A;  4U7N A;  2WLI B;  4BW5 A;  5FLX N;  5GW7 A;  2QWP B;  2JK5 C;  3JAM N;  2Q7E A;  1OCR C;  4UB6 Z;  1EM1 A;  3CCE V;  2OYQ A;  3WB1 A;  1RFY A;  3OD4 A;  4PHZ A;  5BMV B;  1AJQ A;  5J9P C;  2VRZ A;  1XEQ A;  1F23 A;  3PJS K;  4X1K B;  4MTG A;  1H38 A;  1H2G A;  4MVU A;  2EIK C;  1H2N A;  1XNQ O;  1F7Y A;  3ABL B;  5AG2 A;  4OGQ B;  3OAA G;  1YJW V;  1AP6 A;  4UCU A;  2VQE B;  2IJI A;  2W6I G;  2ITC C;  4NXN B;  3DTU B;  2LP7 A;  5CBH A;  4MVR A;  4BAY A;  2WLL B;  1FKA O;  5B1O A;  2FL4 A;  3ZJZ A;  1W59 A;  5CBG A;  2WWW A;  2XUM A;  3L70 H;  4O2B B;  4JI0 B;  2UU9 B;  1M56 B;  3MD0 A;  4FK5 C;  4DV7 O;  1ZX3 A;  3T4Z A;  3K0G A;  1AVM A;  2XAH A;  4IYH A;  2DYS C;  1JJ2 U;  3KZI Z;  5CBF A;  5KA6 A;  1QQC A;  3D3I A;  2IJJ A;  3HKB A;  4WFB V;  3I5D A;  4PV1 B;  5LMN B;  4FFB A;  2P7T C;  1JR9 A;  2CTP A;  3TK1 A;  1VF6 A;  1PV0 A;  1H2L A;  2RNB A;  4J80 A;  3BRC A;  1VQP V;  3ML0 A;  4NXM O;  1IBK B;  3QF7 A;  3CPW U;  4LFA B;  1K73 W;  2K1E A;  5TIS Z;  3W7S A;  4OXS A;  4GKK O;  1W0K G;  5DN6 G;  1XNQ B;  3ZMV A;  4DR1 B;  2E76 B;  3EVK A;  1X59 A;  1Y66 A;  3HKC A;  1GH6 A;  4LF9 B;  1WB8 A;  1L0N H;  2V4D A;  2P67 A;  2B5U A;  1H2M A;  1TUB A;  1W0J G;  4CBC A;  4DV1 B;  1KBH A;  1KP2 A;  1AJP A;  2LGW A;  3E89 A;  3BA8 A;  4MVM A;  4X20 A;  4DV1 O;  2JVD A;  3HR0 A;  1SQG A;  1VQN V;  1K5S A;  1SF9 A;  3E22 B;  3FD9 A;  1FYJ A;  4GX0 A;  5JQG A;  1CEZ A;  2EIK B;  4F4L A;  1SQV H;  3H1H H;  2UUB B;  1HDJ A;  1OV9 A;  4PA7 A;  4P9P A;  2EJ7 A;  2CAZ C;  4JV5 O;  2Q9L A;  5H6Q A;  3OMN B;  5JJN B;  5LHI A;  3LSQ A;  1MA1 A;  2DQ3 A;  4DR5 O;  5L3D A;  1NTK H;  3DXR B;  4IYI A;  3WU2 Z;  5IYZ A;  3CHX A;  4KL1 A;  4IL6 Z;  1R3J C;  1YI2 V;  1XMO B;  1N33 B;  5BZB A;  1XNR B;  1F51 A;  2B1I A;  1AB3 A;  2ITD C;  1DLB A;  2KG7 B;  4NTY A;  4DW0 A;  1KC8 W;  2JRI A;  3LUT B;  3K3W A;  2IM9 A;  4YHH B;  2A9H A;  1FFX B;  3T2M A;  4GKK B;  1HNW O;  2E75 B;  2ZIM A;  1M5I A;  3MAQ A;  5B3S C;  2QM8 A;  4O2B A;  1N32 B;  1AJN A;  1SET A;  2CTQ A;  3JAR B;  2F4V B;  1HR0 O;  1HNX B;  5LMU B;  3K03 A;  3UM7 A;  1KP3 A;  3D8C A;  3ABM B;  5IJ0 B;  1MMM A;  1IZ3 A;  4AQY B;  4CC5 A;  1EFR G;  2EIM C;  4CS4 A;  5B1A B;  1FFX A;  1FPO A;  1THZ A;  2HKO A;  1KQS U;  4JI3 B;  4UVA A;  4WFE A;  3ZX6 A;  3SDL A;  2QE7 G;  4PI0 A;  4PA9 A;  2QJ1 A;  2FTK A;  4NYK A;  4TV9 A;  3JAK A;  4Q20 A;  2Q67 A;  1QR8 A;  4GCZ A;  5LP6 B;  4FVM A;  5KUK A;  4F6R B;  1Q3E A;  3VQX A;  3AG3 C;  2X0L A;  3RVZ A;  3JD2 A;  1GM9 A;  3BPZ A;  3JAS B;  3EFF K;  4JPR A;  2BTQ B;  2Y69 C;  4JZG A;  3FX7 A;  5LGN A;  2OWO A;  1H2K A;  2HVJ C;  2YEV B;  3CME V;  4MTO A;  2AZ2 A;  1N0J A;  1R3L C;  4TQF A;  5GON B;  3AG2 C;  1ZSP A;  4TT3 G;  3HKD B;  2JIZ G;  4J9Z B;  4GLX A;  1VAR A;  1YCI A;  3AG4 C;  4FFB B;  4MVZ A;  1M90 W;  1Q81 W;  4D7S A;  1NU1 H;  1M9N A;  3L74 H;  4DV3 O;  3IGA C;  3ZHR A;  4J42 A;  1XOU A;  2XAS A;  5FPO A;  3CRA A;  2YIC A;  4YXW G;  3W7X A;  5GON A;  4JI8 B;  4DV0 O;  1AR4 A;  5J2T A;  4TSF G;  3HKE B;  1QLE B;  4DK0 A;  2QDO A;  2MK3 A;  2EBO A;  3E86 A;  4YHH O;  3N2K B;  5L3C A;  1J5E B;  2UUC B;  1O9G A;  4I50 A;  5LYJ B;  3UKM A;  1K92 A;  3SYP A;  5CA0 B;  2P22 C;  1Q5O A;  3ZBH A;  3AG1 B;  1FS0 G;  3O65 A;  4FPP A;  1N34 O;  2RJZ A;  1VEW A;  4I55 A;  3E35 A;  4B3S B;  4IIJ A;  4K0K B;  1VQ7 V;  3ZMS A;  2A7W A;  1XHX A;  4RO2 A;  1MOF A;  2JGD A;  2ZE5 A;  3UCS C;  4JAU A;  2FYU H;  4W4L A;  4FLZ A;  2Z0A A;  4R6Z A;  4LBE C;  4J9Y B;  3RYF A;  1TGO A;  3CCU V;  4JYA B;  1N8R W;  1S5L Z;  2E3C A;  3BFR A;  2RDC A;  4DR6 O;  3VQV A;  1FXK B;  5LGT A;  4H0L B;  1OZ0 A;  3FB8 C;  1Y74 A;  2DOS A;  4IGG A;  4ZOL B;  3SYO A;  1N36 B;  1OCZ B;  3ASO C;  2IBZ H;  1NVP B;  3CXH F;  4DYL A;  4YJ3 A;  4DUY B;  3AG4 B;  3JD1 A;  4U3J A;  3K04 A;  1XRE A;  3TCU A;  3H9V A;  2EIM B;  1PD3 A;  2OT5 A;  1V54 C;  1US6 A;  1RSO A;  2RN9 A;  1CPY A;  1Y6X A;  4MVQ A;  1B6Q A;  2ZE7 A;  1SQF A;  3GWK C;  5L3E A;  3T1Y B;  1MZE A;  4B3S O;  1K7D A;  4LR3 A;  3TXS A;  1JMK C;  1HNW B;  1PPJ H;  4YJ3 B;  3ZN0 A;  1Q86 W;  1NR7 A;  2F43 G;  4CC6 A;  3JAK B;  1I7F A;  5IWA B;  3RVY A;  4LH6 A;  1MNG A;  1S76 D;  5LHG A;  3APO A;  1ZAU A;  1Q43 A;  2A06 H;  1MAB G;  3K58 A;  3JD3 A;  3E22 A;  1DTO A;  4FLU A;  2PY5 A;  5CN0 A;  3MHS C;  4UB8 Z;  1GN2 A;  4JYB A;  1ZLZ A;  2LW1 A;  1Q6I A;  5FNV A;  4DR2 O;  2QGN A;  2YXY A;  1CXZ B;  5HFL A;  3G71 V;  3OFN G;  3T1H O;  2D2C B;  3U10 A;  4IHJ A;  1M57 B;  2A3Q A;  1KKC A;  4LFB O;  2XOK G;  3DXR A;  4EB6 A;  3K5O A;  2R72 A;  4O4L B;  3OEE G;  5B3S B;  3HKC B;  2ZXW C;  1GN4 A;  3HB3 B;  4I55 B;  4DR3 B;  4B3R O;  3K57 A;  2ETN A;  2N04 A;  5H9C A;  5IY5 C;  2N05 A;  1QCE A;  1URF A;  3BVO A;  5B1B B;  4ZI7 B;  4Z1V A;  1K4C C;  3B4S A;  3HKE A;  5DED A;  2LO1 A;  1G8M A;  3JAR A;  3CEI A;  4XBF A;  5CA3 A;  1GTO A;  2Z3Y A;  1XHZ A;  2HG5 C;  2Q7G A;  3B8M A;  4O4I A;  3IAY A;  1EN4 A;  1LUW A;  3OE7 G;  4X1I B;  3QNE A;  5LHH A;  4JTA B;  5B1N A;  4RUF A;  4JI1 B;  1QVG U;  3THO A;  3ABK C;  3RYI A;  2XAJ A;  2QWQ B;  4DV5 O;  3CRQ A;  1I94 B;  1QVF U;  3FAV B;  3CRC A;  3K5M A;  2UXC B;  1XMQ O;  3RWR D;  4EKW A;  1L1F A;  3BEH A;  2GHY A;  3ASN B;  5C8Y A;  5KAF Z;  1S5J A;  3OTO O;  2A79 B;  3TJT A;  2H94 A;  3QG5 A;  3CJH A;  4O4H B;  1IVS A;  4UFZ A;  3JAS A;  1IBM O;  4U3F H;  4JI2 B;  1CP9 A;  3LSS A;  4EFE A;  2JGU A;  1GKF A;  3LNM B;  4JZ2 A;  1SKV A;  4XDL A;  4X1Y A;  4CS2 A;  4DR4 O;  2CH7 A;  2HR3 A;  4UCS A;  1AI4 A;  4KFM A;  2WLM A;  3AG2 B;  5KMG B;  3PN1 A;  2IU3 A;  5JVD A;  1TUB B;  3J7A U;  1X4T A;  2PI5 A;  3CJH B;  2ADP A;  2Q0O C;  3K79 A;  2RQ6 A;  2PYL A;  3F7V C;  4LNU B;  4BIZ A;  2CK3 G;  2YXH A;  2E5L B;  4LF4 B;  4AIL C;  3C90 A;  1OHH G;  4N21 A;  4DV3 B;  3E2E A;  1S3J A;  5DEC A;  4DUY O;  4KUM A;  2IH3 C;  1FAF A;  1BHB A;  3CC2 V;  3M7M X;  4DK1 A;  4RAI A;  3CC7 V;  2Q5Z A;  3J80 N;  4DR7 O;  3K9A A;  3CS5 A;  1KUQ A;  4ZHQ B;  2AW9 A;  3C3S A;  1YTF B;  4FLT A;  2WLJ A;  4MW8 A;  3IFX A;  4N23 A;  1NS1 A;  2AZ0 A;  3Q4H A;  4O2A A;  1NH2 D;  5B1B C;  2UUA O;  3AEI A;  1L0L H;  2UUC O;  2YIA A;  4JYA O;  2ZCE A;  1W2B U;  4CS3 A;  3F5T A;  3H1J H;  1J95 A;  4JF3 A;  3OEH G;  3CCL V;  4PA4 A;  4DV6 O;  2UUA B;  2OIG A;  3JSL A;  1SQB H;  3A8T A;  3T1Y O;  1V55 C;  2YDE A;  3E8B A;  3A0R A;  1GO3 F;  4WBN A;  1VF5 B;  3N2G A;  1PL0 A;  4DV0 B;  2Q4P A;  2YC0 A;  2XHB A;  2WPD G;  3OR6 C;  4A5U B;  3RYC B;  1BT8 A;  4PA6 A;  1IX9 A;  4CH6 A;  5LMU O;  3JSN A;  1M4U A;  2OTL V;  4JI7 B;  5IWA O;  1MSD A;  4PDL A;  1FXV A;  1K5Q A;  1WNS A;  4J7J A;  3R65 A;  1QNM A;  3G6E V;  2WA3 A;  1M1K W;  2JGD B;  3S3W A;  4DR5 B;  2XND G;  2UXD B;  4O4J B;  3T1C A;  3FAV A;  4LF5 B;  1QU7 A;  5KUM A;  4DV7 B;  4R7C A;  4NTW A;  4LF7 O;  1NI8 A;  1HP8 A;  4JI5 B;  2FB5 A;  1S5H C;  1K4D C;  4MS2 A;  1FXK A;  1OCC B;  3GWO A;  4DRX A;  4LF6 O;  2KKW A;  2P90 A;  3SPJ A;  2ZR2 A;  4ICG A;  5BR8 O;  3TET A;  1GM7 A;  3K9S A;  4UUJ C;  1NKD A;  1UFI A;  4DR4 B;  3SYA A;  3CCV V;  2X6B A;  3SJC C;  5BR8 B;  4DV2 O;  3UQ8 A;  5CA0 A;  2HLD G;  4TUY A;  3X2Q B;  2ILM A;  4UCV A;  3E8G A;  3D36 A;  1VP7 A;  2C2A A;  4D7T A;  2JS3 A;  4GX5 A;  3K5L A;  4J7K A;  4BW9 A;  1YEW A;  3ZHS A;  1WJZ A;  4PJ0 Z;  4AQY O;  1U97 A;  1QLN A;  3CB2 A;  2WA4 A;  1ORQ C;  3H1K H;  1HW7 A;  1DK1 A;  1BGY H;  4X8A A;  1HNX O;  4NXM B;  1JFF B;  4GX1 A;  1VF6 C;  2VWK A;  2E5L O;  4LF4 O;  1VQ8 V;  5B1A C;  1F4N A;  2LW7 A;  1K9M W;  5K1X A;  3ETQ A;  1U96 A;  1PM9 A;  1H8E G;  2RCV A;  5D5P A;  1PP9 H;  5L3B A;  4I7Z B;  2WLH A;  1R73 A;  4I9W A;  5FNV B;  2AHZ A;  2E74 B;  2W6J G;  2ZQM A;  2G38 A;  3ZN1 A;  3W7T A;  1K34 A;  2ZM6 B;  1SES A;  3LDD A;  2BOC C;  1OCC C;  3CWB H;  3JAW A;  1KYO F;  5J2U B;  1YIT V;  4HBN A;  4JI2 O;  4U3J B;  1R1B A;  4MSW C;  1V54 B;  1WA8 A;  1ENV A;  3P3N A;  4P30 A;  1AI6 A;  2QEX V;  2XAQ A;  5EC2 C;  3JAL A;  4ZBM A;  5BXZ A;  2AHY A;  1NQT A;  4DW1 A;  5JH7 B;  2PTM A;  4JYC A;  5H2F Z;  1YJ9 V;  1KB9 F;  1FXH A;  4P9O A;  1XDC A;  2FKX A;  2AGA A;  3A2F A;  4XDJ A;  4PDM A;  4UV8 A;  3SJB C;  3J81 N;  5IYC O;  4TV8 A;  1AIL A;  4X65 O;  4JI4 B;  4X64 O;  1WA8 B;  2NR5 A;  3BAA A;  3KCX A;  3FYE B;  2QM4 A;  2P06 A;  2UXD O;  3CCQ V;  3B77 A;  3ZRV A;  1I08 A;  4JAA A;  5LXT A;  3W7U A;  4YY3 B;  3C3T A;  3ZMU A;  4YJ2 A;  4O4I B;  2ZIO A;  1BZK A;  4GX2 A;  4LP8 A;  4ASU G;  5B5E Z;  1AI5 A;  3SJQ C;  3R66 A;  2JJ1 G;  4NVP A;  5KHI A;  4YIP A;  2EIJ C;  1QBZ A;  4ZI7 A;  1SS3 A;  3ETD A;  4EEQ A;  1VQ5 V;  3AK3 A;  1D5A A;  1VIB A;  3AG1 C;  3MDS A;  2HP8 A;  3QO5 A;  1B04 A;  2WLL A;  1XUQ A;  2EUL A;  1YDX A;  2CE4 A;  1WLE A;  4K3A A;  2ZE8 A;  3LDC A;  2X6A A;  1JFF A;  4LC1 A;  2WLI A;  3HPL C;  1FJG B;  2UXB O;  5KAI Z;  3B8N A;  5ITZ B;  1L8D A;  2P5O A;  1M57 C;  2DYR C;  2GTS A;  1K97 A;  2IJH A;  1TUE B;  1WP7 A;  2JJ2 G;  3ZED A;  2JEX A;  1EZJ A;  2OCH A;  5BMV A;  1Q6U A;  3K08 A;  4WF9 V;  4LFC O;  2YUA A;  3AK1 A;  4JI5 O;  3OUF A;  5JCO C;  4B3T O;  2DE0 X;  1NTZ H;  3B2E E;  3P32 A;  3ZMT A;  2NLJ C;  2ZT9 B;  2ZDI C;  3RW0 A;  2JDI G;  4CZZ A;  2YI9 A;  4OX9 O;  2GDS A;  4JI8 O;  1XMO O;  5D5Q A;  2Q7H A;  5KHK A;  2YS8 A;  4MVS A;  3STZ C;  1A32 A;  3DC5 A;  4YIO A;  4X1Y B;  3L71 H;  4TV9 B;  2IW5 A;  3P3P A;  5JJJ B;  1KMI Z;  5GTH Z;  2Z5U A;  1VQ6 V;  1FD9 A;  1Y67 A;  4G2K A;  2YIB A;  2XTA A;  2HHH B;  1V55 B;  1RP3 B;  4YY3 O;  3GVM A;  2F66 C;  2GUZ B;  5IJ9 A;  3ZHU A;  1Y4M A;  4UCR A;  2QR4 A;  4UXN A;  4WFH A;  1AI7 A;  3QO8 A;  3CRM A;  4GKJ B;  4JGS A;  3G4S V;  3CXC U;  2VQF O;  4LF7 B;  2Y0I A;  1XIL A;  3H1I H;  1FJG O;  4MW3 A;  3QO7 A;  5E1A C;  4I4T A;  3X2Q C;  1E1Q G;  1YJN V;  4O4J A;  4J7Z A;  3O9O A;  4LWS B;  1UJW B;  5H5N A;  2GUZ A;  2F4V O;  2JEU A;  1XNR O;  2X7R B;  5KX5 A;  1LUV A;  1Q90 D;  4X62 B;  4WFG A;  3OW2 U;  1SA0 A;  5K1P A;  4FFK A;  1ZWI C;  4NKG B;  5DM6 V;  3P30 A;  4PD4 F;  4QPJ A;  3SYQ A;  4H44 B;  3CD6 V;  4X62 O;  3SPG A;  3JAT A;  1K3E A;  2EIJ B;  1EN5 A;  2UU9 O;  4Z1M G;  2Q6A A;  3G6B A;  1QHT A;  2HJF C;  4PDV A;  3EXA A;  4EFB A;  1HR0 B;  4D6T H;  4DUZ B;  5FPR A;  3K0D A;  1YXB A;  3IC7 A;  3RN4 A;  2OCC B;  4WCE V;  4IT5 A;  4LCU C;  1R6T A;  2ARH A;  4KXR A;  4G28 B;  3OGC C;  1ZL8 B;  4I50 B;  1KEC A;  2Q68 A;  5EYP B;  1OCO B;  1S72 V;  4HZ3 A;  3KCY A;  4DR2 B;  5JWP A;  4AHC A;  4FM1 A;  3BCC H;  5EBM C;  1LR1 A;  1RPO A;  3B09 A;  2N74 A;  2HFE C;  4I0X A;  1YHQ V;  4K0K O;  2QTS A;  4TQD A;  2DW4 A;  1S77 D; 
#chains in the Genus database with same CATH homology
 2KSD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...