2KSDA

Backbone structure of the membrane domain of e. coli histidine kinase receptor arcb, center for structures of membrane proteins (csmp) target 4310c
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
75
structure length
75
Chain Sequence
b'MMKLGLVRFSMLLALALVVLAIVVQMAVTMVLHGQVESIDVIRSIFFGLLITPWAVYFLSVVVEQLEESRQRLSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aerobic respiration control sensor protein arcB
publication title Membrane domain structures of three classes of histidine kinase receptors by cell-free expression and rapid NMR analysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 21
structure length 75
sequence length 75
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2010-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18415 HKR_ArcB_TM Histidine kinase receptor ArcB trans-membrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.970 Mainly Alpha Orthogonal Bundle Helix Hairpins His Kinase A (phosphoacceptor) domain 2ksdA00
2KSDA
chains in the Genus database with same CATH superfamily
2XAQA 4QJFB 3FD9A 1U96A 1GMGA 1WB7A 4WF9V 3ZRVA 1NZ6A 3ZMUA 2X6BA 2QWOB 2AZ2A 2JK5C 4JYAO 4TOIA 4WFEA 4D7SA 4PDVA 4R50A 4PA4A 4UVCA 3ZMTA 1ZL8A 2QKSA 1A32A 3JD3A 2ZE6A 2HJDA 1MSWD 5JJJB 3CRQA 4FK5C 3IJ4A 2AZ0A 3CMEV 1YF2A 1BGYH 1WPBA 3CS5A 1S76D 5KHGA 4UV8A 2OTJV 1K7DA 3EFFK 1NBMG 3CE2A 3HKCB 5H6RA 3ZHVA 4DR4O 1BHAA 4X1YA 4FLVA 2R72A 4FLZA 2LGWA 5KAIZ 1K33A 4O4HB 2YXLA 4K8ZA 3SJQC 5KMGB 3W7TA 4B3MB 1HWYA 1HR0O 3N2KA 1I5XA 1OJHA 5J9PC 4LF4B 5IE9A 2HKOA 1OCZB 2WLLA 2Y0IA 1IBLO 2P4VA 1WNSA 4LNUB 1S3JA 4YJ3B 3OD4A 2A06H 3HKBA 1XBLA 4WBNA 5CB4B 5EBWC 3K5NA 2D2CB 2IJKA 1YSCA 2WPDG 4JTDB 4DR6O 3H1IH 4PA7A 1JOYA 5BR8O 4B7KA 3ZJZA 4EEQA 2L35A 2DYSC 4YY3B 5E79Z 3QF7A 4JI0O 3K58A 4UCTA 5H2FZ 1HNWB 3BEHA 3RYCA 3CXCU 4NYKA 2JVDA 5CN0A 2UUCO 2BE3A 1G4YB 2P90A 3HKEB 3OGCC 3K08A 2WSSG 4Z1VA 1ZX3A 3VQXA 3CWBH 2HVKC 4CH5A 4J42A 4MVSA 2XT9A 5J2UB 3PN1A 4AHCA 2OWOA 2VQFO 2LQTA 1P49A 2Q7EA 1R6KA 4J80A 5EZYA 2M7WA 3OTFA 3ZRWA 4BW5A 5K1PA 5CA1B 1K9MW 2PY5A 4JZ2A 1Q8IA 2HP8A 3BA8A 1TUBB 3CRMA 1GK9A 1PV0A 3TK1A 5KA6A 3JATB 3ZHUA 2ODMA 4FVMA 4QE7A 3E35A 5IWAO 2GTAA 1Y74A 5F2VO 4UFZA 4NXMO 4D6TH 4HNAB 1SQBH 3E8FA 1JCHA 5LA6B 2QM8A 2E74B 3F5WC 4DR4B 1QLEC 2LFSA 1FFXB 3SPCA 2A0LA 3CCQV 4GCZA 5JQGB 2KKWA 2HLDG 4I4TA 4DV6O 2PF4E 3VQYA 4DUZO 1HR0B 3OAAG 4UCSA 3DC5A 1I08A 3QTCA 1NVPB 3JAWB 1IBLB 5JH7A 3ASNC 3GWKC 1YI2V 1LNQA 1UPGA 1PKXA 1I0HA 1JR9A 3RYHA 1R3JC 1F23A 2Q67A 3OTOO 3DXRA 4DR6B 2X0LA 4LF9O 4B3RB 4DW1A 1W59A 1XL6A 3JAKA 5BR8B 1JMKC 2YIDA 4I55A 4A5UB 3RVYA 1H8HG 4GX2A 3KG2A 4HAMA 3A0HZ 4HYOA 3UO3A 2ZQMA 1Q43A 2XTAA 4UCOA 1QCEA 3FAVA 1I94O 2YXHA 3GWOA 1X4TA 2XUMA 3PJSK 2JGDA 2Y4UA 3AG4C 4ZKIA 1YZBA 2HG5C 2Q7GA 1SRYA 1FXHA 2CH7B 3SPGA 5KHIA 1UJWB 3G4SV 1AR1B 2JJ2G 1M9NA 1MG1A 2WLMA 2EZOA 3CEIA 4FLYA 1QR8A 4O2AA 1W0KG 2ADQB 3F7VC 1EBOA 2P06A 4CS4A 5IWAB 1MABG 4DV1B 4DV7O 3A8TA 3STLC 3ZCCA 4NXMB 1TVKB 3BY6A 3THOA 4EB6B 3ZN0A 1PL0A 1XREA 3ABLB 4NB5A 5LGNA 1O9HA 4JF3A 4UXNA 3SYOA 1RSOB 1NJIW 1YITV 5GW7A 1H8EG 2ZE5A 1P7BA 4KUMA 3P32A 4ZI7A 1ZSPA 4IHJB 2Z5UA 1YJ9V 3K9AA 4LR3A 3JALB 2EIJB 5B1AB 4MVRA 2E76B 4O4IB 4PHZA 1IVSA 3P30A 3ETEA 5KX5B 4KL1A 2QJ1A 1FXKB 5DM6V 3JAMN 2YEVB 1KU9A 1SC5B 3WG7C 4D7TA 4DV5O 1VQPV 4LF7O 1YJNV 3JYCA 4C7UA 4J11A 2DYRB 4JV5B 4L8JA 3K59A 5LOVA 3H1KH 2DE0X 5EYPB 1P84F 4DRXB 1ZWIC 3TJTA 2BSKA 4IL6Z 1BSMA 1S0VA 4AQYO 2FL4A 2EILC 3QNEA 4AI8A 3OTOB 3AG3C 4LF5O 1Q81W 1VQ8V 3EVKA 3D3IA 2GHYA 4CH4A 1XUQA 4DXWA 3SPIA 1MA1A 4LF8B 1AR4A 1QVGU 1MSDA 2Q9LA 3SR2C 3ZMZA 4Z2WA 4NR1A 1VMGA 5LP6C 2CK3G 3I5DA 1PNLA 3UCSC 4JAUA 3EXAA 2YI9A 3ABKC 4U3JB 5LL6Y 3RBZA 2OCCB 3MHSC 5LXTA 1WB8A 1AB3A 1IXMA 1IDSA 3N2GA 4K0KO 4ASUG 3UKMA 5IYZA 1SQPH 4ZOLA 2CGNA 4BIZA 1Y76A 3JD2A 4YJ2A 4KHPO 4B3SO 1DF4A 3CJHA 3A2FA 3AG1B 5J2TA 4ABMA 2PZSA 2IH1C 3B8NA 4QGPA 2VQEO 2UXDO 2GUZA 1J95A 2RN9A 4MVQA 1XNRO 2WLNA 3NR7A 4MTFA 4OXSA 3RYFA 4G2KA 2BCCH 4GKJO 3DC6A 4DV7B 4F4LA 5B1BB 1QLNA 1X59A 1NKDA 2JS3A 4GT1A 3HR0A 5FPRA 3QO7A 3CPWU 3CCRV 3FB5C 4QNHB 5JJNB 1NR7A 1OCOB 4FPPA 1TGOA 1NR1A 4UV9A 4UCUA 1I7FA 4P2ZA 4H0LB 1Q82W 1IXBA 4JI3O 5EK0A 2W6IG 2YDEA 2JRIA 4I50A 2Z3YA 5L3DA 5IY5C 1OCCC 4UVAA 2PI5A 2AGAA 2Q5ZA 3E22B 5IJ9A 1BCCH 4NVPA 2EIKB 2UXXA 5C93A 3AG2C 1KC8W 5EC2C 3ZMSA 4J10A 4TV8B 1AI6A 1PNKA 2QM7A 1VP7A 2ZDIC 3B8MA 1K73W 2XOKG 4W4KA 1URFA 3SGIA 5KUKA 4LF5B 5LYJA 1V55B 4B3MO 4CS2A 5E1AC 3E2EA 1YCIA 3APOA 4X65B 1Q5OA 3ETQA 2DWDC 4JPRA 3LSUA 5KHHA 1D5NA 1BT8A 3OEEG 3CCEV 5D5QA 1I5YA 4JI1B 1SA0B 2P7TC 4FM1A 1NQTA 2JS5A 1EFRG 5FPOA 5JVDB 3H01A 1M56B 4B3TB 2R9AA 1FPOA 4XDJA 2Y0PA 4DV3O 3SJAC 2HHHB 1AVMA 2Q68A 5H6QA 1AI7A 3IAYA 4KHPB 4B3SB 3K0DA 1HNWO 4DV4B 1GN6A 1V9PA 2E3CA 5CA0A 3LNNA 4DR3B 2VQEB 1JJ2U 2UXDB 1JPXA 4O2BA 1VQOV 4RO2A 3RW0A 1XNRB 1WLEA 1K92A 3DGEA 1S5LZ 1JQ0A 1KMIZ 2CUGA 3OUFA 3RYIB 3ZS8C 2BTOA 1THZA 1QQCA 4X88A 4NTYA 2AXTZ 2XASA 5B3SB 2XHBA 5BY1A 1Q7YW 1MZEA 4DR5O 1YIJV 2QEXV 3A0BZ 4H33A 4O4LA 3L71H 5JJEB 4RQEA 3I55V 1QR9A 4X20A 2F23A 4JI3B 2E75B 2CAZC 2HVJC 3T1YO 2UUBO 4IYHA 3L75H 1H2SB 1N0NA 4PDMA 3O9OA 1BMFG 4EFBA 4GKKO 1AJQA 1GM9A 2QKCA 1VF7A 5LP6A 1RPRA 1AP6A 3JATA 2R9RB 2CGOA 4NXNB 1M57C 2V1DA 4I0XB 3X2QC 2YXYA 2W0XA 2F93B 3H1HH 2QDOA 1K34A 3C3TA 4U7OA 2MK3A 2PYJA 1GKFA 3ABTA 3LSQA 5LA6A 2Y69C 3ZX6A 1V54C 3HPLC 4BIUA 2B1IA 2XAFA 1FFXA 1VEWA 5LMNB 1RFYA 2FYUH 5JQGA 2LO1A 5L3BA 5ITZA 2E5LB 3DSQA 2JDIG 1RM1C 3CRRA 3HKDA 1GM7A 3E83A 3ZBHA 1YEWA 3SJCC 4B3RO 4DV3B 1YTFB 4RWUA 5GTIZ 5EIBC 3CX5F 1YTFD 4RUFA 3UO2A 1GN4A 2RMKB 1ZAUA 3B40A 1NTZH 2KSDA 4GLXA 4QIWF 4MVMA 4JYYA 1SQFA 2FMLA 4I9WA 4YIPA 3KZIZ 1L8DA 3B4SA 1K5SA 4JI4O 4TUYB 2JJ1G 2AW9A 2WAMA 3G67A 5CBGA 2YC0A 4IIJA 5KUMA 2R70A 2GDSA 1VQ7V 1QU7A 4PV1B 2EIMB 2OCHA 2EIKC 3JD1A 2UUAO 4UCVA 1BHBA 1SZTA 4DR5B 1GTOA 1G1XB 4E4EA 5KHKA 1SQQH 2ZDIA 4DYLA 3W7XA 4GX0A 2QWNB 3G71V 4DR1O 4DV1O 3T1YB 1E79G 4DR2O 2UUBB 1WAZA 4GX1A 1W2BU 3LDEA 5FNVA 2CH7A 4EKWA 4GKKB 3OMNB 4TV9A 2ZXWB 4XBFA 3ASOB 4I7ZB 1SF9A 3L74H 3W7SA 3SPHA 1Q6HA 2CTQA 1CXZB 2IW5A 4LFBB 1M56C 4X1KA 3OFNG 1DLBA 1GN2A 3OT7A 2LW1A 3KCYA 1YJWV 4UVBA 1YHQV 4JI7O 3ABMC 3MHHC 1RP3B 3CXHF 2EINC 3N2KB 2P22C 2A7WA 5IJ0B 1E1QG 2UXBO 2W0FC 5AG2A 3BAAA 2Q6AA 2WLLB 1F4MA 1PNMA 5BZBA 2ZE7A 2YIBA 3E8BA 4JV5O 5CMUA 3HKBB 5H9CA 3M7MX 4DUYB 4YXWG 2CTRA 5KX5A 1N36O 1DTOA 1BZKA 3CCUV 3K5LA 3ZHRA 3K0GA 2KG7B 3UT5A 4LF8O 1JFFA 3FYEB 3RYCB 3FB8C 3SPJA 2DMXA 5L3FA 4JAAA 2KB1A 1EZVH 1CP9A 1NTKH 4JI4B 2UXNA 4MW8A 1SQVH 4P9OA 1PP9H 2ZR3A 4LH7A 1KYOF 2PYLA 2F4VO 1FYJA 2OTLV 1ENVA 4ZHQB 1E1RG 4JI8B 2UUAB 2X7RB 2GTSA 1N4CA 3R66A 4JASA 4JZGA 2ZD9A 2QSAA 4F6RB 4DR1B 4H13B 4DR2B 3SYCA 2RCVA 2Y4TA 1PM9A 4O4JB 2EX3A 2EULA 5GONA 1OCZC 1VQ9V 1WPXA 4FM0A 1FFTB 5BMVA 2PGGA 4KFMA 4MT8A 1H2MA 4Z1MG 4J7JA 1ROPA 5LMUB 4X66B 1R3LC 3L73H 1GO3F 1FKAO 1HDJA 1EN4A 4X64O 4P30A 4LC1A 4JI7B 5FL7G 1JJOA 4J41A 2ITCC 4MW3A 1IX9A 4DR7B 3CCJV 3H1LH 1OCRB 1US6A 2IJJA 4MTOA 3TXSA 3OEHG 3JASB 3CCVV 2UXBB 1Q6UA 4LP8A 5LGTA 2VS0A 2ZT9B 3MDSA 3CHXA 2RNBA 2ZM6O 2V4DA 5JH7B 3QG5A 4FFKA 5KHJA 1OV9A 3BRCA 5B1OA 4I5SA 1XMOB 1S5HC 2VRZA 1XI1A 3RYHB 4WFHA 3ZHQA 3LDCA 1XDCA 1N36B 3K3WA 3K5OA 3DXRB 3E22A 3T4ZA 3B77A 4ZBMA 3JAKB 1K5QA 3T1CA 1VIBA 4I55B 4YHHO 1B6QA 2QM4A 3ZHTA 4X65O 1BQ0A 1WP8A 4X1IA 2F95B 3T4DA 2YIAA 2BTQA 5CA3A 4TSFG 4I9QA 2Y48A 3W7WA 1M93A 1WA8A 1AILA 4JI1O 4GX5A 4LFCB 1VF6A 1PPJH 3SYQA 3ETGA 3ML0A 4P9PA 2GSMB 1IBMO 4B3TO 1VQ6V 1H2LA 3BVOA 5LHHA 2JGDB 3LNMB 4BIOA 3CRAA 2OYQA 2IJIA 2HHHO 2F4VB 3FYIB 1SQGA 3RGBA 2K9PA 2P6JA 2ZIOA 4DV4O 4NTXA 5IYBO 5HFMA 2F1MA 2N04A 4DR3O 1EZJA 5FLXN 3VQWA 3P3NA 1M90W 3H9VA 1FAFA 1P4RA 3CCSV 4CH6A 3Q4HA 5HFLA 1VQ5V 2VWJA 3FKSG 4MTXA 1AR5A 1B3QA 1N32B 2H8PC 4LWSA 2ADPA 4FFBA 2WA3A 3E86A 3J80N 1ORQC 3JSNA 1ZTEA 2LFRA 2EBOA 3AG7A 3L9DA 4ZI7B 1FXVA 4LF6O 3AK2A 2WA4A 5IYCO 2C2AA 1R3KC 4X64B 2IJHA 4H44B 2K1EA 4CH3A 4JI2O 1SESA 5LHGA 2JEXA 5EBMC 4H37A 1SKVA 2BOBC 1JA8A 4JGSA 3UM7A 2DYSB 2WLHA 3ZIAG 3C90A 1Y4MA 1KKCA 4JTAB 1L0LH 2KQXA 3J81N 1SQXH 5LGUA 3BFRA 2Q8VA 2ZM6B 1VARA 2ZKOA 3K9SA 1XNQB 2OIEA 3P3PA 4FM2A 4NXNO 4YIOA 2QA4V 3FX7A 2UU9B 2ZNJA 2BSKB 4OGQB 1KKDA 1MZFA 1GH6A 2WLIB 3F7YC 1Q86W 3JARB 1DGSA 3K79A 3JSLA 2QWPB 5DN6G 2XNDG 4YHHB 3HKCA 1NI8A 5TISZ 5BXZA 1KBHA 1S72V 1QHTA 2IU3A 2WLKA 2QWRB 5LMNO 3K03A 1XL4A 1SS3A 1FS0G 3M99B 3L70H 3LDDA 3AEIA 4PI2A 4O4HA 2MW2B 1KUQA 5KMGA 2O57A 3CMAV 1KECA 2P5OA 2E5LO 5LXTB 3N2GB 1IBMB 5IYZB 1N33O 3H1JH 3G80A 4N23A 4B7EA 1S77D 1VQKV 1Y76B 1KP3A 1PL4A 3ZMVA 3ABLC 3KKYA 2Q69A 2VWKA 2QGNA 5J2TB 1Q3EA 1BE3H 2V7QG 4LNUA 1D2DA 4YJ3A 3K04A 1QLEB 1CPYA 2ZCEA 3R65A 4FZ1A 2DOSA 2GV9A 2GUZB 2ZINA 3WU2Z 5CB4A 2EIJC 4MS2A 5B1AC 3CSXA 2NR5A 3BCCH 1FXKC 3WB0A 1TA8A 1QNMA 1RPOA 2Q0AA 3QVNA 2OIGA 2DYRC 4CC6A 3HKEA 1KB9F 3E8GA 2NNUA 3CYOA 4X62B 3ASNB 1N34O 2NLJC 3DTUB 4IT5A 4PDRA 2LJ2A 4CS3A 3OMIB 2M6YA 4N21A 5J2UA 1NTMH 4LF6B 4J9YB 2XAHA 4KP4A 4DK1A 2ATKC 1K4CC 1H2GA 4R6ZA 4JI2B 3CP1A 1Q6IA 3U0ZA 3BABA 4XDKA 3K5MA 3OW2U 5GTHZ 5IJ9B 5CA1A 3JD4A 3OGIB 2BOCC 1TUBA 3F5TA 1ZLZA 2LP7A 1YDXA 2OCCC 1XHXA 2PTMA 4U3FH 3IC9A 4LFBO 2EZPA 1SERA 4FZ0A 1DF5A 1S5JA 4FMTA 3AK1A 3AG4B 4HNAA 5LYJB 5A2QN 3OR6C 1XHZA 3AG1C 3TCUA 5B66Z 1G6UA 2F66C 3ETDA 3L72H 2UXCO 1OZ0A 4J9ZB 4JYBA 2RQ6A 4DUYO 1MMMA 3D3QA 1VQ4V 2DJVA 2ZIMA 1XMQO 1Y66A 1COWG 2ILMA 1R73A 2CTPA 1N33B 2AHZA 5B1BC 5IJ0A 2YS8A 3RT3C 4RAIA 1AI4A 2QE7G 2H3OA 5C8YB 4K3AA 4JAVA 1L0NH 3JAWA 5K1XA 3FB7C 4FLUA 1OCOC 1NT2B 4CZZA 2DQ0A 5CA0B 4LFAO 1HP8A 4O2BB 4WFAV 1YXBA 3U10A 4GYCB 2KG7A 3J7AU 2FB5A 4R8CA 2ZNIA 1XQ8A 3UQ8A 1AJPA 3GVMA 3VQVA 1F7YA 1MNGA 3VOUA 3WG7B 3GB7C 2LGQA 1K97A 1NU1H 3ZRXA 4JI8O 4U7NA 3LSSA 1J5EO 1LUVA 1HNXB 1N34B 4O4LB 1IZ3A 1WJZA 3WB2A 4R7CA 3D36C 1TUEB 4X20B 3B2EE 4PJ0Z 1VF6C 2EILB 2ETNA 3AG3B 1V55C 4PELA 1ZL8B 1D5AA 4ZHQA 5JWPA 3ZN1A 4LBEC 1WN7A 3I56V 4K35A 4OPHA 3OMAB 1ZUQA 3ZRSA 5LP6B 5LMUO 4X1YB 3WFVA 3MD0A 1KD1W 4X66O 4JYAB 3ABKB 2QWQB 4F6RA 1B04A 2IU0A 2IBZH 3G6BA 2QKAA 4O4JA 4JYCA 1T5EA 5D5PA 1TVKA 3NXSA 3HB3B 5JCOC 4EB6A 4DR7O 2CTWA 1P7GA 3RVZA 2JGUA 2DQ3A 2DWEC 5B1NA 1B06A 4MVUA 1RSOA 4WFBV 4FLXA 4J7KA 2UXCB 5ITZB 2L6LA 4IHJA 4RQFA 1LR1A 1XMOO 3JALA 4O4IA 4WBNB 1Y6XA 2OT5A 1XMQB 4PA9A 3B09A 1FXKA 3HKDB 4FIPC 1OHHG 3SDLA 2YEVA 4X9QA 4BWAA 3JASA 1Z5WA 1NH2B 1QVFU 4PD4F 5B3SC 1NH2D 1HNZO 2Q4PA 2IH3C 2D3OW 3QO8A 1NVPD 1YVWA 4NKGB 5EYPA 4LFAB 1VQNV 1AJNA 4QE9A 4DRXA 4TWKA 4LFCO 1EN5A 3RFRA 4DW0A 3RWRD 3M8AA 3IGAC 4X8AA 4B08A 2QTSA 3EHBB 5IY5B 1KQSU 1GN3A 4IIJB 3MAQA 1OCCB 4JI0B 4PDLA 4JI6O 2B9ZA 4F6EA 5EZYB 2UUCB 3ZRWB 5L3EA 1R6NA 3AG2B 1GRJA 4L87A 1J5EB 4U3JA 2X6CA 1L1FA 4J7ZA 4PI0A 3FFQA 4G28B 3N27A 2VQFB 1JX9A 4AILC 2HFEC 2WWWA 2Q7HA 1Y74B 4K8XA 5FNVB 1IURA 2FKXA 2PUSA 2F43G 3CRCA 5LBQA 3AK3A 1FJGO 1N32O 4FJCC 4TV9B 3G6EV 4MVZA 3D8CA 3ZEDA 1FD9A 4EFEA 2HEPA 3CCMV 1HW7A 4X1KB 4E2LA 4GZRB 2HJFC 2R9IA 3T2MA 4XDLA 1Q90D 4I4TB 1H38A 1LUWA 4W4LA 1AROP 1U97A 3OE7G 5B5EZ 3VBBA 3U11A 3CC7V 3OM3B 4JI5O 2P67A 2XAGA 4ZIBA 1M5IA 3TETA 2YIBD 1W0JG 1VQMV 3SYAA 1XNQO 4G27B 4OX9O 3E89A 4DV6B 1GAXA 2UU9O 4LH6A 4DUZB 5KLVH 3JCUZ 5LHIA 2EIMC 3T1HO 3UT5B 3BHPA 4PA6A 1MOFA 3TXQA 1HNZB 1JFFB 1EM1A 5EC1C 2P4KA 1O9GA 2FTKA 2QTOA 3JCZA 3JD0A 4TV8A 3A0RA 3K06A 2Q73A 3CB2A 4UUJC 4MVOA 3D36A 2H94A 5EBLC 3FAVB 4LCUC 2WLIA 4LF9B 2A3QA 3JARA 5IYDO 1NS1A 1K8AW 3O65A 2RJZA 2DW4A 1Z2GA 4JI6B 1VF5B 1JVMA 3FB6C 4TT3G 2A9HA 2ZXWC 4X89A 3BA9A 2JEUA 3ASOC 4IYIA 1BS3A 4DV2O 4HBNA 1SA0A 1I94B 3CCLV 1M57B 5JVDA 1UFIA 3X2QB 4O2AB 2DN9A 2EJ7A 2PI4A 5KA5A 1AP5A 2W6JG 3OUSA 1IBKO 3LUTB 4CC5A 4MTGA 5JCOA 2Y69B 2ARHA 1R3IC 1V54B 4QPJA 5GONB 1FJGB 5BMVB 4DV0O 2IM9A 2GBOA 4X62O 1N8RW 2LW7A 2JIZG 1K3EA 2NN4A 1M1KW 1AI5A 4DK0A 3ABUA 3RYIA 3TGUH 1RM1B 2Z0AA 2Q0OC 3KCXA 2ZR2A 1R6TA 4JTCB 2CDYA 3C3SA 4ICGA 5CBFA 4OPAA 5EIBD 4IGGA 4DO2A 4UCRA 4JI5B 4TQDA 1BL8A 4QPKA 3IFXA 2CE4A 5IT9N 4RUEA 5LOVB 3QO5A 2B5UA 1XEQA 4OX9B 1H2NA 4BAYA 4Q6GA 2RDCA 4UB8Z 1SETA 1GM8A 1XOUA 1PD3A 3ICXA 2N05A 2WLJA 3T1HB 4DV5B 4LF7B 5A9GA 3WB1A 5DECA 2B1GA 2A79B 3E8HA 4X1IB 1WP7A 3RN4A 2BTQB 1WA8B 4PA3A 4I0XA 2EJRA 4AQYB 1XILA 3CD6V 4BR6A 1Y67A 1F51A 2HR3A 3STZC 1F4NA 4LF4O 1G8MA 5KAFZ 1QBZA 4ZOLB 3OR7C 2YUAA 4WCEV 4MSWC 1M4UA 2QR4A 2X6AA 4YJ2B 3SJBC 4TQFA 5IDJA 3SYPA 4BW9A 1R1BA 3CJHB 3W7UA 1Z5VA 1DK1A 4DV2B 4Q20A 3BPZA 1BQZA 1K4DC 3CC4V 2G38A 1N0JA 4K0KB 2ITDC 2YI8A 3S3WA 5L3CA 4FLTA 3RYFB 5DEDA 3ABMB 3K57A 3Q4HB 4FLWA 1EN6A 5C8YA 4YY3O 5H5NA 2EINB 5CBHA 1OCRC 1IBKB 2N74A 2YICA 3S3XA 4CBCA 4WFGA 3ZHSA 4KXRA 2ZE8A 4HZ3A 1TAEA 4LWSB 4FFBB 4UB6Z 4WFFA 4DV0B 1H2KA 3CC2V 1HNXO 1KP2A 2AHYA 1VQLV 1CEZA 3APQA 4TUYA 4GKJB 2XAJA 1SZXA 4NTWA 5L3GA 4I50B 4GUNA 2YSUB 3IC7A
chains in the Genus database with same CATH topology
2KSDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KSD A; 
#chains in the Genus database with same CATH topology
 2XAQ A;  4QJF B;  3FD9 A;  1U96 A;  1GMG A;  1WB7 A;  4WF9 V;  3ZRV A;  1NZ6 A;  3ZMU A;  2X6B A;  2QWO B;  2AZ2 A;  2JK5 C;  4JYA O;  4TOI A;  4WFE A;  4D7S A;  4PDV A;  4R50 A;  4PA4 A;  4UVC A;  3ZMT A;  1ZL8 A;  2QKS A;  1A32 A;  3JD3 A;  2ZE6 A;  2HJD A;  1MSW D;  5JJJ B;  3CRQ A;  4FK5 C;  3IJ4 A;  2AZ0 A;  3CME V;  1YF2 A;  1BGY H;  1WPB A;  3CS5 A;  1S76 D;  5KHG A;  4UV8 A;  2OTJ V;  1K7D A;  3EFF K;  1NBM G;  3CE2 A;  3HKC B;  5H6R A;  3ZHV A;  4DR4 O;  1BHA A;  4X1Y A;  4FLV A;  2R72 A;  4FLZ A;  2LGW A;  5KAI Z;  1K33 A;  4O4H B;  2YXL A;  4K8Z A;  3SJQ C;  5KMG B;  3W7T A;  4B3M B;  1HWY A;  1HR0 O;  3N2K A;  1I5X A;  1OJH A;  5J9P C;  4LF4 B;  5IE9 A;  2HKO A;  1OCZ B;  2WLL A;  2Y0I A;  1IBL O;  2P4V A;  1WNS A;  4LNU B;  1S3J A;  4YJ3 B;  3OD4 A;  2A06 H;  3HKB A;  1XBL A;  4WBN A;  5CB4 B;  5EBW C;  3K5N A;  2D2C B;  2IJK A;  1YSC A;  2WPD G;  4JTD B;  4DR6 O;  3H1I H;  4PA7 A;  1JOY A;  5BR8 O;  4B7K A;  3ZJZ A;  4EEQ A;  2L35 A;  2DYS C;  4YY3 B;  5E79 Z;  3QF7 A;  4JI0 O;  3K58 A;  4UCT A;  5H2F Z;  1HNW B;  3BEH A;  3RYC A;  3CXC U;  4NYK A;  2JVD A;  5CN0 A;  2UUC O;  2BE3 A;  1G4Y B;  2P90 A;  3HKE B;  3OGC C;  3K08 A;  2WSS G;  4Z1V A;  1ZX3 A;  3VQX A;  3CWB H;  2HVK C;  4CH5 A;  4J42 A;  4MVS A;  2XT9 A;  5J2U B;  3PN1 A;  4AHC A;  2OWO A;  2VQF O;  2LQT A;  1P49 A;  2Q7E A;  1R6K A;  4J80 A;  5EZY A;  2M7W A;  3OTF A;  3ZRW A;  4BW5 A;  5K1P A;  5CA1 B;  1K9M W;  2PY5 A;  4JZ2 A;  1Q8I A;  2HP8 A;  3BA8 A;  1TUB B;  3CRM A;  1GK9 A;  1PV0 A;  3TK1 A;  5KA6 A;  3JAT B;  3ZHU A;  2ODM A;  4FVM A;  4QE7 A;  3E35 A;  5IWA O;  2GTA A;  1Y74 A;  5F2V O;  4UFZ A;  4NXM O;  4D6T H;  4HNA B;  1SQB H;  3E8F A;  1JCH A;  5LA6 B;  2QM8 A;  2E74 B;  3F5W C;  4DR4 B;  1QLE C;  2LFS A;  1FFX B;  3SPC A;  2A0L A;  3CCQ V;  4GCZ A;  5JQG B;  2KKW A;  2HLD G;  4I4T A;  4DV6 O;  2PF4 E;  3VQY A;  4DUZ O;  1HR0 B;  3OAA G;  4UCS A;  3DC5 A;  1I08 A;  3QTC A;  1NVP B;  3JAW B;  1IBL B;  5JH7 A;  3ASN C;  3GWK C;  1YI2 V;  1LNQ A;  1UPG A;  1PKX A;  1I0H A;  1JR9 A;  3RYH A;  1R3J C;  1F23 A;  2Q67 A;  3OTO O;  3DXR A;  4DR6 B;  2X0L A;  4LF9 O;  4B3R B;  4DW1 A;  1W59 A;  1XL6 A;  3JAK A;  5BR8 B;  1JMK C;  2YID A;  4I55 A;  4A5U B;  3RVY A;  1H8H G;  4GX2 A;  3KG2 A;  4HAM A;  3A0H Z;  4HYO A;  3UO3 A;  2ZQM A;  1Q43 A;  2XTA A;  4UCO A;  1QCE A;  3FAV A;  1I94 O;  2YXH A;  3GWO A;  1X4T A;  2XUM A;  3PJS K;  2JGD A;  2Y4U A;  3AG4 C;  4ZKI A;  1YZB A;  2HG5 C;  2Q7G A;  1SRY A;  1FXH A;  2CH7 B;  3SPG A;  5KHI A;  1UJW B;  3G4S V;  1AR1 B;  2JJ2 G;  1M9N A;  1MG1 A;  2WLM A;  2EZO A;  3CEI A;  4FLY A;  1QR8 A;  4O2A A;  1W0K G;  2ADQ B;  3F7V C;  1EBO A;  2P06 A;  4CS4 A;  5IWA B;  1MAB G;  4DV1 B;  4DV7 O;  3A8T A;  3STL C;  3ZCC A;  4NXM B;  1TVK B;  3BY6 A;  3THO A;  4EB6 B;  3ZN0 A;  1PL0 A;  1XRE A;  3ABL B;  4NB5 A;  5LGN A;  1O9H A;  4JF3 A;  4UXN A;  3SYO A;  1RSO B;  1NJI W;  1YIT V;  5GW7 A;  1H8E G;  2ZE5 A;  1P7B A;  4KUM A;  3P32 A;  4ZI7 A;  1ZSP A;  4IHJ B;  2Z5U A;  1YJ9 V;  3K9A A;  4LR3 A;  3JAL B;  2EIJ B;  5B1A B;  4MVR A;  2E76 B;  4O4I B;  4PHZ A;  1IVS A;  3P30 A;  3ETE A;  5KX5 B;  4KL1 A;  2QJ1 A;  1FXK B;  5DM6 V;  3JAM N;  2YEV B;  1KU9 A;  1SC5 B;  3WG7 C;  4D7T A;  4DV5 O;  1VQP V;  4LF7 O;  1YJN V;  3JYC A;  4C7U A;  4J11 A;  2DYR B;  4JV5 B;  4L8J A;  3K59 A;  5LOV A;  3H1K H;  2DE0 X;  5EYP B;  1P84 F;  4DRX B;  1ZWI C;  3TJT A;  2BSK A;  4IL6 Z;  1BSM A;  1S0V A;  4AQY O;  2FL4 A;  2EIL C;  3QNE A;  4AI8 A;  3OTO B;  3AG3 C;  4LF5 O;  1Q81 W;  1VQ8 V;  3EVK A;  3D3I A;  2GHY A;  4CH4 A;  1XUQ A;  4DXW A;  3SPI A;  1MA1 A;  4LF8 B;  1AR4 A;  1QVG U;  1MSD A;  2Q9L A;  3SR2 C;  3ZMZ A;  4Z2W A;  4NR1 A;  1VMG A;  5LP6 C;  2CK3 G;  3I5D A;  1PNL A;  3UCS C;  4JAU A;  3EXA A;  2YI9 A;  3ABK C;  4U3J B;  5LL6 Y;  3RBZ A;  2OCC B;  3MHS C;  5LXT A;  1WB8 A;  1AB3 A;  1IXM A;  1IDS A;  3N2G A;  4K0K O;  4ASU G;  3UKM A;  5IYZ A;  1SQP H;  4ZOL A;  2CGN A;  4BIZ A;  1Y76 A;  3JD2 A;  4YJ2 A;  4KHP O;  4B3S O;  1DF4 A;  3CJH A;  3A2F A;  3AG1 B;  5J2T A;  4ABM A;  2PZS A;  2IH1 C;  3B8N A;  4QGP A;  2VQE O;  2UXD O;  2GUZ A;  1J95 A;  2RN9 A;  4MVQ A;  1XNR O;  2WLN A;  3NR7 A;  4MTF A;  4OXS A;  3RYF A;  4G2K A;  2BCC H;  4GKJ O;  3DC6 A;  4DV7 B;  4F4L A;  5B1B B;  1QLN A;  1X59 A;  1NKD A;  2JS3 A;  4GT1 A;  3HR0 A;  5FPR A;  3QO7 A;  3CPW U;  3CCR V;  3FB5 C;  4QNH B;  5JJN B;  1NR7 A;  1OCO B;  4FPP A;  1TGO A;  1NR1 A;  4UV9 A;  4UCU A;  1I7F A;  4P2Z A;  4H0L B;  1Q82 W;  1IXB A;  4JI3 O;  5EK0 A;  2W6I G;  2YDE A;  2JRI A;  4I50 A;  2Z3Y A;  5L3D A;  5IY5 C;  1OCC C;  4UVA A;  2PI5 A;  2AGA A;  2Q5Z A;  3E22 B;  5IJ9 A;  1BCC H;  4NVP A;  2EIK B;  2UXX A;  5C93 A;  3AG2 C;  1KC8 W;  5EC2 C;  3ZMS A;  4J10 A;  4TV8 B;  1AI6 A;  1PNK A;  2QM7 A;  1VP7 A;  2ZDI C;  3B8M A;  1K73 W;  2XOK G;  4W4K A;  1URF A;  3SGI A;  5KUK A;  4LF5 B;  5LYJ A;  1V55 B;  4B3M O;  4CS2 A;  5E1A C;  3E2E A;  1YCI A;  3APO A;  4X65 B;  1Q5O A;  3ETQ A;  2DWD C;  4JPR A;  3LSU A;  5KHH A;  1D5N A;  1BT8 A;  3OEE G;  3CCE V;  5D5Q A;  1I5Y A;  4JI1 B;  1SA0 B;  2P7T C;  4FM1 A;  1NQT A;  2JS5 A;  1EFR G;  5FPO A;  5JVD B;  3H01 A;  1M56 B;  4B3T B;  2R9A A;  1FPO A;  4XDJ A;  2Y0P A;  4DV3 O;  3SJA C;  2HHH B;  1AVM A;  2Q68 A;  5H6Q A;  1AI7 A;  3IAY A;  4KHP B;  4B3S B;  3K0D A;  1HNW O;  4DV4 B;  1GN6 A;  1V9P A;  2E3C A;  5CA0 A;  3LNN A;  4DR3 B;  2VQE B;  1JJ2 U;  2UXD B;  1JPX A;  4O2B A;  1VQO V;  4RO2 A;  3RW0 A;  1XNR B;  1WLE A;  1K92 A;  3DGE A;  1S5L Z;  1JQ0 A;  1KMI Z;  2CUG A;  3OUF A;  3RYI B;  3ZS8 C;  2BTO A;  1THZ A;  1QQC A;  4X88 A;  4NTY A;  2AXT Z;  2XAS A;  5B3S B;  2XHB A;  5BY1 A;  1Q7Y W;  1MZE A;  4DR5 O;  1YIJ V;  2QEX V;  3A0B Z;  4H33 A;  4O4L A;  3L71 H;  5JJE B;  4RQE A;  3I55 V;  1QR9 A;  4X20 A;  2F23 A;  4JI3 B;  2E75 B;  2CAZ C;  2HVJ C;  3T1Y O;  2UUB O;  4IYH A;  3L75 H;  1H2S B;  1N0N A;  4PDM A;  3O9O A;  1BMF G;  4EFB A;  4GKK O;  1AJQ A;  1GM9 A;  2QKC A;  1VF7 A;  5LP6 A;  1RPR A;  1AP6 A;  3JAT A;  2R9R B;  2CGO A;  4NXN B;  1M57 C;  2V1D A;  4I0X B;  3X2Q C;  2YXY A;  2W0X A;  2F93 B;  3H1H H;  2QDO A;  1K34 A;  3C3T A;  4U7O A;  2MK3 A;  2PYJ A;  1GKF A;  3ABT A;  3LSQ A;  5LA6 A;  2Y69 C;  3ZX6 A;  1V54 C;  3HPL C;  4BIU A;  2B1I A;  2XAF A;  1FFX A;  1VEW A;  5LMN B;  1RFY A;  2FYU H;  5JQG A;  2LO1 A;  5L3B A;  5ITZ A;  2E5L B;  3DSQ A;  2JDI G;  1RM1 C;  3CRR A;  3HKD A;  1GM7 A;  3E83 A;  3ZBH A;  1YEW A;  3SJC C;  4B3R O;  4DV3 B;  1YTF B;  4RWU A;  5GTI Z;  5EIB C;  3CX5 F;  1YTF D;  4RUF A;  3UO2 A;  1GN4 A;  2RMK B;  1ZAU A;  3B40 A;  1NTZ H;  2KSD A;  4GLX A;  4QIW F;  4MVM A;  4JYY A;  1SQF A;  2FML A;  4I9W A;  4YIP A;  3KZI Z;  1L8D A;  3B4S A;  1K5S A;  4JI4 O;  4TUY B;  2JJ1 G;  2AW9 A;  2WAM A;  3G67 A;  5CBG A;  2YC0 A;  4IIJ A;  5KUM A;  2R70 A;  2GDS A;  1VQ7 V;  1QU7 A;  4PV1 B;  2EIM B;  2OCH A;  2EIK C;  3JD1 A;  2UUA O;  4UCV A;  1BHB A;  1SZT A;  4DR5 B;  1GTO A;  1G1X B;  4E4E A;  5KHK A;  1SQQ H;  2ZDI A;  4DYL A;  3W7X A;  4GX0 A;  2QWN B;  3G71 V;  4DR1 O;  4DV1 O;  3T1Y B;  1E79 G;  4DR2 O;  2UUB B;  1WAZ A;  4GX1 A;  1W2B U;  3LDE A;  5FNV A;  2CH7 A;  4EKW A;  4GKK B;  3OMN B;  4TV9 A;  2ZXW B;  4XBF A;  3ASO B;  4I7Z B;  1SF9 A;  3L74 H;  3W7S A;  3SPH A;  1Q6H A;  2CTQ A;  1CXZ B;  2IW5 A;  4LFB B;  1M56 C;  4X1K A;  3OFN G;  1DLB A;  1GN2 A;  3OT7 A;  2LW1 A;  3KCY A;  1YJW V;  4UVB A;  1YHQ V;  4JI7 O;  3ABM C;  3MHH C;  1RP3 B;  3CXH F;  2EIN C;  3N2K B;  2P22 C;  2A7W A;  5IJ0 B;  1E1Q G;  2UXB O;  2W0F C;  5AG2 A;  3BAA A;  2Q6A A;  2WLL B;  1F4M A;  1PNM A;  5BZB A;  2ZE7 A;  2YIB A;  3E8B A;  4JV5 O;  5CMU A;  3HKB B;  5H9C A;  3M7M X;  4DUY B;  4YXW G;  2CTR A;  5KX5 A;  1N36 O;  1DTO A;  1BZK A;  3CCU V;  3K5L A;  3ZHR A;  3K0G A;  2KG7 B;  3UT5 A;  4LF8 O;  1JFF A;  3FYE B;  3RYC B;  3FB8 C;  3SPJ A;  2DMX A;  5L3F A;  4JAA A;  2KB1 A;  1EZV H;  1CP9 A;  1NTK H;  4JI4 B;  2UXN A;  4MW8 A;  1SQV H;  4P9O A;  1PP9 H;  2ZR3 A;  4LH7 A;  1KYO F;  2PYL A;  2F4V O;  1FYJ A;  2OTL V;  1ENV A;  4ZHQ B;  1E1R G;  4JI8 B;  2UUA B;  2X7R B;  2GTS A;  1N4C A;  3R66 A;  4JAS A;  4JZG A;  2ZD9 A;  2QSA A;  4F6R B;  4DR1 B;  4H13 B;  4DR2 B;  3SYC A;  2RCV A;  2Y4T A;  1PM9 A;  4O4J B;  2EX3 A;  2EUL A;  5GON A;  1OCZ C;  1VQ9 V;  1WPX A;  4FM0 A;  1FFT B;  5BMV A;  2PGG A;  4KFM A;  4MT8 A;  1H2M A;  4Z1M G;  4J7J A;  1ROP A;  5LMU B;  4X66 B;  1R3L C;  3L73 H;  1GO3 F;  1FKA O;  1HDJ A;  1EN4 A;  4X64 O;  4P30 A;  4LC1 A;  4JI7 B;  5FL7 G;  1JJO A;  4J41 A;  2ITC C;  4MW3 A;  1IX9 A;  4DR7 B;  3CCJ V;  3H1L H;  1OCR B;  1US6 A;  2IJJ A;  4MTO A;  3TXS A;  3OEH G;  3JAS B;  3CCV V;  2UXB B;  1Q6U A;  4LP8 A;  5LGT A;  2VS0 A;  2ZT9 B;  3MDS A;  3CHX A;  2RNB A;  2ZM6 O;  2V4D A;  5JH7 B;  3QG5 A;  4FFK A;  5KHJ A;  1OV9 A;  3BRC A;  5B1O A;  4I5S A;  1XMO B;  1S5H C;  2VRZ A;  1XI1 A;  3RYH B;  4WFH A;  3ZHQ A;  3LDC A;  1XDC A;  1N36 B;  3K3W A;  3K5O A;  3DXR B;  3E22 A;  3T4Z A;  3B77 A;  4ZBM A;  3JAK B;  1K5Q A;  3T1C A;  1VIB A;  4I55 B;  4YHH O;  1B6Q A;  2QM4 A;  3ZHT A;  4X65 O;  1BQ0 A;  1WP8 A;  4X1I A;  2F95 B;  3T4D A;  2YIA A;  2BTQ A;  5CA3 A;  4TSF G;  4I9Q A;  2Y48 A;  3W7W A;  1M93 A;  1WA8 A;  1AIL A;  4JI1 O;  4GX5 A;  4LFC B;  1VF6 A;  1PPJ H;  3SYQ A;  3ETG A;  3ML0 A;  4P9P A;  2GSM B;  1IBM O;  4B3T O;  1VQ6 V;  1H2L A;  3BVO A;  5LHH A;  2JGD B;  3LNM B;  4BIO A;  3CRA A;  2OYQ A;  2IJI A;  2HHH O;  2F4V B;  3FYI B;  1SQG A;  3RGB A;  2K9P A;  2P6J A;  2ZIO A;  4DV4 O;  4NTX A;  5IYB O;  5HFM A;  2F1M A;  2N04 A;  4DR3 O;  1EZJ A;  5FLX N;  3VQW A;  3P3N A;  1M90 W;  3H9V A;  1FAF A;  1P4R A;  3CCS V;  4CH6 A;  3Q4H A;  5HFL A;  1VQ5 V;  2VWJ A;  3FKS G;  4MTX A;  1AR5 A;  1B3Q A;  1N32 B;  2H8P C;  4LWS A;  2ADP A;  4FFB A;  2WA3 A;  3E86 A;  3J80 N;  1ORQ C;  3JSN A;  1ZTE A;  2LFR A;  2EBO A;  3AG7 A;  3L9D A;  4ZI7 B;  1FXV A;  4LF6 O;  3AK2 A;  2WA4 A;  5IYC O;  2C2A A;  1R3K C;  4X64 B;  2IJH A;  4H44 B;  2K1E A;  4CH3 A;  4JI2 O;  1SES A;  5LHG A;  2JEX A;  5EBM C;  4H37 A;  1SKV A;  2BOB C;  1JA8 A;  4JGS A;  3UM7 A;  2DYS B;  2WLH A;  3ZIA G;  3C90 A;  1Y4M A;  1KKC A;  4JTA B;  1L0L H;  2KQX A;  3J81 N;  1SQX H;  5LGU A;  3BFR A;  2Q8V A;  2ZM6 B;  1VAR A;  2ZKO A;  3K9S A;  1XNQ B;  2OIE A;  3P3P A;  4FM2 A;  4NXN O;  4YIO A;  2QA4 V;  3FX7 A;  2UU9 B;  2ZNJ A;  2BSK B;  4OGQ B;  1KKD A;  1MZF A;  1GH6 A;  2WLI B;  3F7Y C;  1Q86 W;  3JAR B;  1DGS A;  3K79 A;  3JSL A;  2QWP B;  5DN6 G;  2XND G;  4YHH B;  3HKC A;  1NI8 A;  5TIS Z;  5BXZ A;  1KBH A;  1S72 V;  1QHT A;  2IU3 A;  2WLK A;  2QWR B;  5LMN O;  3K03 A;  1XL4 A;  1SS3 A;  1FS0 G;  3M99 B;  3L70 H;  3LDD A;  3AEI A;  4PI2 A;  4O4H A;  2MW2 B;  1KUQ A;  5KMG A;  2O57 A;  3CMA V;  1KEC A;  2P5O A;  2E5L O;  5LXT B;  3N2G B;  1IBM B;  5IYZ B;  1N33 O;  3H1J H;  3G80 A;  4N23 A;  4B7E A;  1S77 D;  1VQK V;  1Y76 B;  1KP3 A;  1PL4 A;  3ZMV A;  3ABL C;  3KKY A;  2Q69 A;  2VWK A;  2QGN A;  5J2T B;  1Q3E A;  1BE3 H;  2V7Q G;  4LNU A;  1D2D A;  4YJ3 A;  3K04 A;  1QLE B;  1CPY A;  2ZCE A;  3R65 A;  4FZ1 A;  2DOS A;  2GV9 A;  2GUZ B;  2ZIN A;  3WU2 Z;  5CB4 A;  2EIJ C;  4MS2 A;  5B1A C;  3CSX A;  2NR5 A;  3BCC H;  1FXK C;  3WB0 A;  1TA8 A;  1QNM A;  1RPO A;  2Q0A A;  3QVN A;  2OIG A;  2DYR C;  4CC6 A;  3HKE A;  1KB9 F;  3E8G A;  2NNU A;  3CYO A;  4X62 B;  3ASN B;  1N34 O;  2NLJ C;  3DTU B;  4IT5 A;  4PDR A;  2LJ2 A;  4CS3 A;  3OMI B;  2M6Y A;  4N21 A;  5J2U A;  1NTM H;  4LF6 B;  4J9Y B;  2XAH A;  4KP4 A;  4DK1 A;  2ATK C;  1K4C C;  1H2G A;  4R6Z A;  4JI2 B;  3CP1 A;  1Q6I A;  3U0Z A;  3BAB A;  4XDK A;  3K5M A;  3OW2 U;  5GTH Z;  5IJ9 B;  5CA1 A;  3JD4 A;  3OGI B;  2BOC C;  1TUB A;  3F5T A;  1ZLZ A;  2LP7 A;  1YDX A;  2OCC C;  1XHX A;  2PTM A;  4U3F H;  3IC9 A;  4LFB O;  2EZP A;  1SER A;  4FZ0 A;  1DF5 A;  1S5J A;  4FMT A;  3AK1 A;  3AG4 B;  4HNA A;  5LYJ B;  5A2Q N;  3OR6 C;  1XHZ A;  3AG1 C;  3TCU A;  5B66 Z;  1G6U A;  2F66 C;  3ETD A;  3L72 H;  2UXC O;  1OZ0 A;  4J9Z B;  4JYB A;  2RQ6 A;  4DUY O;  1MMM A;  3D3Q A;  1VQ4 V;  2DJV A;  2ZIM A;  1XMQ O;  1Y66 A;  1COW G;  2ILM A;  1R73 A;  2CTP A;  1N33 B;  2AHZ A;  5B1B C;  5IJ0 A;  2YS8 A;  3RT3 C;  4RAI A;  1AI4 A;  2QE7 G;  2H3O A;  5C8Y B;  4K3A A;  4JAV A;  1L0N H;  3JAW A;  5K1X A;  3FB7 C;  4FLU A;  1OCO C;  1NT2 B;  4CZZ A;  2DQ0 A;  5CA0 B;  4LFA O;  1HP8 A;  4O2B B;  4WFA V;  1YXB A;  3U10 A;  4GYC B;  2KG7 A;  3J7A U;  2FB5 A;  4R8C A;  2ZNI A;  1XQ8 A;  3UQ8 A;  1AJP A;  3GVM A;  3VQV A;  1F7Y A;  1MNG A;  3VOU A;  3WG7 B;  3GB7 C;  2LGQ A;  1K97 A;  1NU1 H;  3ZRX A;  4JI8 O;  4U7N A;  3LSS A;  1J5E O;  1LUV A;  1HNX B;  1N34 B;  4O4L B;  1IZ3 A;  1WJZ A;  3WB2 A;  4R7C A;  3D36 C;  1TUE B;  4X20 B;  3B2E E;  4PJ0 Z;  1VF6 C;  2EIL B;  2ETN A;  3AG3 B;  1V55 C;  4PEL A;  1ZL8 B;  1D5A A;  4ZHQ A;  5JWP A;  3ZN1 A;  4LBE C;  1WN7 A;  3I56 V;  4K35 A;  4OPH A;  3OMA B;  1ZUQ A;  3ZRS A;  5LP6 B;  5LMU O;  4X1Y B;  3WFV A;  3MD0 A;  1KD1 W;  4X66 O;  4JYA B;  3ABK B;  2QWQ B;  4F6R A;  1B04 A;  2IU0 A;  2IBZ H;  3G6B A;  2QKA A;  4O4J A;  4JYC A;  1T5E A;  5D5P A;  1TVK A;  3NXS A;  3HB3 B;  5JCO C;  4EB6 A;  4DR7 O;  2CTW A;  1P7G A;  3RVZ A;  2JGU A;  2DQ3 A;  2DWE C;  5B1N A;  1B06 A;  4MVU A;  1RSO A;  4WFB V;  4FLX A;  4J7K A;  2UXC B;  5ITZ B;  2L6L A;  4IHJ A;  4RQF A;  1LR1 A;  1XMO O;  3JAL A;  4O4I A;  4WBN B;  1Y6X A;  2OT5 A;  1XMQ B;  4PA9 A;  3B09 A;  1FXK A;  3HKD B;  4FIP C;  1OHH G;  3SDL A;  2YEV A;  4X9Q A;  4BWA A;  3JAS A;  1Z5W A;  1NH2 B;  1QVF U;  4PD4 F;  5B3S C;  1NH2 D;  1HNZ O;  2Q4P A;  2IH3 C;  2D3O W;  3QO8 A;  1NVP D;  1YVW A;  4NKG B;  5EYP A;  4LFA B;  1VQN V;  1AJN A;  4QE9 A;  4DRX A;  4TWK A;  4LFC O;  1EN5 A;  3RFR A;  4DW0 A;  3RWR D;  3M8A A;  3IGA C;  4X8A A;  4B08 A;  2QTS A;  3EHB B;  5IY5 B;  1KQS U;  1GN3 A;  4IIJ B;  3MAQ A;  1OCC B;  4JI0 B;  4PDL A;  4JI6 O;  2B9Z A;  4F6E A;  5EZY B;  2UUC B;  3ZRW B;  5L3E A;  1R6N A;  3AG2 B;  1GRJ A;  4L87 A;  1J5E B;  4U3J A;  2X6C A;  1L1F A;  4J7Z A;  4PI0 A;  3FFQ A;  4G28 B;  3N27 A;  2VQF B;  1JX9 A;  4AIL C;  2HFE C;  2WWW A;  2Q7H A;  1Y74 B;  4K8X A;  5FNV B;  1IUR A;  2FKX A;  2PUS A;  2F43 G;  3CRC A;  5LBQ A;  3AK3 A;  1FJG O;  1N32 O;  4FJC C;  4TV9 B;  3G6E V;  4MVZ A;  3D8C A;  3ZED A;  1FD9 A;  4EFE A;  2HEP A;  3CCM V;  1HW7 A;  4X1K B;  4E2L A;  4GZR B;  2HJF C;  2R9I A;  3T2M A;  4XDL A;  1Q90 D;  4I4T B;  1H38 A;  1LUW A;  4W4L A;  1ARO P;  1U97 A;  3OE7 G;  5B5E Z;  3VBB A;  3U11 A;  3CC7 V;  3OM3 B;  4JI5 O;  2P67 A;  2XAG A;  4ZIB A;  1M5I A;  3TET A;  2YIB D;  1W0J G;  1VQM V;  3SYA A;  1XNQ O;  4G27 B;  4OX9 O;  3E89 A;  4DV6 B;  1GAX A;  2UU9 O;  4LH6 A;  4DUZ B;  5KLV H;  3JCU Z;  5LHI A;  2EIM C;  3T1H O;  3UT5 B;  3BHP A;  4PA6 A;  1MOF A;  3TXQ A;  1HNZ B;  1JFF B;  1EM1 A;  5EC1 C;  2P4K A;  1O9G A;  2FTK A;  2QTO A;  3JCZ A;  3JD0 A;  4TV8 A;  3A0R A;  3K06 A;  2Q73 A;  3CB2 A;  4UUJ C;  4MVO A;  3D36 A;  2H94 A;  5EBL C;  3FAV B;  4LCU C;  2WLI A;  4LF9 B;  2A3Q A;  3JAR A;  5IYD O;  1NS1 A;  1K8A W;  3O65 A;  2RJZ A;  2DW4 A;  1Z2G A;  4JI6 B;  1VF5 B;  1JVM A;  3FB6 C;  4TT3 G;  2A9H A;  2ZXW C;  4X89 A;  3BA9 A;  2JEU A;  3ASO C;  4IYI A;  1BS3 A;  4DV2 O;  4HBN A;  1SA0 A;  1I94 B;  3CCL V;  1M57 B;  5JVD A;  1UFI A;  3X2Q B;  4O2A B;  2DN9 A;  2EJ7 A;  2PI4 A;  5KA5 A;  1AP5 A;  2W6J G;  3OUS A;  1IBK O;  3LUT B;  4CC5 A;  4MTG A;  5JCO A;  2Y69 B;  2ARH A;  1R3I C;  1V54 B;  4QPJ A;  5GON B;  1FJG B;  5BMV B;  4DV0 O;  2IM9 A;  2GBO A;  4X62 O;  1N8R W;  2LW7 A;  2JIZ G;  1K3E A;  2NN4 A;  1M1K W;  1AI5 A;  4DK0 A;  3ABU A;  3RYI A;  3TGU H;  1RM1 B;  2Z0A A;  2Q0O C;  3KCX A;  2ZR2 A;  1R6T A;  4JTC B;  2CDY A;  3C3S A;  4ICG A;  5CBF A;  4OPA A;  5EIB D;  4IGG A;  4DO2 A;  4UCR A;  4JI5 B;  4TQD A;  1BL8 A;  4QPK A;  3IFX A;  2CE4 A;  5IT9 N;  4RUE A;  5LOV B;  3QO5 A;  2B5U A;  1XEQ A;  4OX9 B;  1H2N A;  4BAY A;  4Q6G A;  2RDC A;  4UB8 Z;  1SET A;  1GM8 A;  1XOU A;  1PD3 A;  3ICX A;  2N05 A;  2WLJ A;  3T1H B;  4DV5 B;  4LF7 B;  5A9G A;  3WB1 A;  5DEC A;  2B1G A;  2A79 B;  3E8H A;  4X1I B;  1WP7 A;  3RN4 A;  2BTQ B;  1WA8 B;  4PA3 A;  4I0X A;  2EJR A;  4AQY B;  1XIL A;  3CD6 V;  4BR6 A;  1Y67 A;  1F51 A;  2HR3 A;  3STZ C;  1F4N A;  4LF4 O;  1G8M A;  5KAF Z;  1QBZ A;  4ZOL B;  3OR7 C;  2YUA A;  4WCE V;  4MSW C;  1M4U A;  2QR4 A;  2X6A A;  4YJ2 B;  3SJB C;  4TQF A;  5IDJ A;  3SYP A;  4BW9 A;  1R1B A;  3CJH B;  3W7U A;  1Z5V A;  1DK1 A;  4DV2 B;  4Q20 A;  3BPZ A;  1BQZ A;  1K4D C;  3CC4 V;  2G38 A;  1N0J A;  4K0K B;  2ITD C;  2YI8 A;  3S3W A;  5L3C A;  4FLT A;  3RYF B;  5DED A;  3ABM B;  3K57 A;  3Q4H B;  4FLW A;  1EN6 A;  5C8Y A;  4YY3 O;  5H5N A;  2EIN B;  5CBH A;  1OCR C;  1IBK B;  2N74 A;  2YIC A;  3S3X A;  4CBC A;  4WFG A;  3ZHS A;  4KXR A;  2ZE8 A;  4HZ3 A;  1TAE A;  4LWS B;  4FFB B;  4UB6 Z;  4WFF A;  4DV0 B;  1H2K A;  3CC2 V;  1HNX O;  1KP2 A;  2AHY A;  1VQL V;  1CEZ A;  3APQ A;  4TUY A;  4GKJ B;  2XAJ A;  1SZX A;  4NTW A;  5L3G A;  4I50 B;  4GUN A;  2YSU B;  3IC7 A; 
#chains in the Genus database with same CATH homology
 2KSD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...