1WAZA

Nmr structure determination of the bacterial mercury transporter, merf, in micelles
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
TPVLVILLGVVGLSALTGYLDYVLLPALAIFIGLTIYAIQRKRQAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords MERF
publication title NMR Structure Determination of a Membrane Protein with Two Transmembrane Helices in Micelles: Merf of the Bacterial Mercury Detoxification System
pubmed doi rcsb
source organism Morganella morganii
total genus 13
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2004-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11431 Transport_MerF Membrane transport protein MerF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.910 Mainly Alpha Orthogonal Bundle Helix Hairpins bacterial mercury transporter, merf 1wazA00
2H3OA 2LJ2A 1WAZA
chains in the Genus database with same CATH superfamily
1Y76A 2LO1A 1PL4A 4NXNO 4UCRA 3M8AA 1YTFB 3BHPA 1Q43A 3Q4HB 4PELA 3K58A 1KECA 4IIJB 4FIPC 3BEHA 3CD6V 1SQGA 1S72V 1N34B 2UUCO 1V9PA 1OCCC 4WFEA 3AK3A 3E35A 3JD1A 4ZOLA 5KX5B 3ZRXA 4JV5B 1WPXA 1AJQA 2EZPA 4TOIA 3H1KH 1W0JG 2DQ3A 1XNQO 4LF6B 1BGYH 1VQ4V 3JCZA 4BW5A 1EFRG 2PI4A 3ZHSA 3CCJV 3CCVV 1P7BA 3OMAB 2JEXA 4FLXA 3ZRSA 1GO3F 2UXBO 5J2UB 4K8ZA 5TISZ 2JS5A 3ZHQA 3NR7A 1Y74B 2WLIA 2JJ1G 1W59A 4KL1A 3ABLC 2ZE7A 4A5UB 2CTPA 4NXMO 4MTXA 2UXDB 1R6TA 2QM8A 5CA3A 4NTXA 4Z2WA 3WU2Z 5KHJA 4JI2B 3T2MA 2DYRC 2JVDA 4X20A 4RUFA 1SQBH 4J11A 2FB5A 3B2EE 2C2AA 3DTUB 4PI2A 4FM1A 2CGNA 2YIBD 3L75H 3N27A 3OTOO 4B3TB 1F23A 5IE9A 2ARHA 2DOSA 4AQYO 1B06A 5IJ9B 4LF4B 4UUJC 1AILA 4N21A 4FZ1A 4P9OA 5H6RA 1QVFU 1JA8A 3QF7A 1PL0A 4WFGA 3BA9A 3IGAC 3SJQC 4XDLA 4ICGA 1Q3EA 5EIBC 4OX9O 1I5XA 3JCUZ 1ORQC 1AR5A 3CHXA 4O4IA 2VRZA 3P3NA 1IX9A 4MVMA 2R9AA 4JYAO 1OHHG 4PA6A 1ZLZA 2QKCA 3NXSA 4Z1VA 4LFAB 1XMOB 1N36B 5L3CA 5EBLC 5JQGA 5GTIZ 2YSUB 4O4HB 2JJ2G 1VF7A 4FFKA 4FFBA 4MTOA 1QVGU 1IBKB 2UUAB 5H6QA 4DUZO 2HFEC 4LH7A 2QM7A 4DK1A 4DR4O 3CJHB 2P4KA 4DV6O 1YSCA 4BW9A 1GM7A 1YI2V 5LHHA 2QTSA 5CBHA 3CRMA 2UXCB 3ZS8C 1TUBA 3WB2A 3CCRV 1N33B 2NLJC 1ZAUA 4CC6A 2QR4A 4O4JA 1D2DA 3JAWA 3C90A 1R3LC 5C8YA 1F7YA 3C3SA 3LDEA 1A32A 5L3EA 4X1IB 3BCCH 3H1HH 2Q9LA 1YDXA 2Y4UA 2VQFB 4H0LB 3TJTA 5HFMA 2YXLA 1VQ6V 1QLEC 5E1AC 2Q7HA 3CPWU 4IHJB 2Q7EA 3VQXA 2RCVA 3LSSA 1VQKV 1VQPV 4DV3O 3OE7G 4X9QA 2N74A 1H2MA 3ZJZA 1NH2B 3TETA 3KG2A 2QEXV 1EN4A 4JI5B 1M4UA 4MTFA 4LFBO 5JJJB 3CRRA 3RYHA 4GKJB 5DECA 1AVMA 3J80N 4UCSA 5KHGA 4FZ0A 2VWKA 5LP6B 1VEWA 4L87A 5HFLA 4O2BB 4DV4B 3OUFA 4DV7B 5GONB 2GSMB 2UUBO 4LCUC 3STLC 1S3JA 3A0HZ 1AI6A 3IC9A 4WFHA 4FPPA 3TXSA 4DYLA 5KHKA 5BY1A 3MDSA 3OM3B 2E76B 3K5OA 3SYQA 1OCZC 5LL6Y 4QE7A 5FL7G 2XOKG 4F6RB 2YI8A 3EHBB 3HKDB 1KYOF 4O4LA 1L1FA 3JAMN 3L73H 4FLUA 1NVPB 1F51A 2DJVA 3TXQA 4I9QA 1QLEB 1Q6HA 3B8NA 3DC5A 2QJ1A 4NXNB 1PNMA 5BMVB 1BZKA 5KLVH 5E79Z 2MK3A 3LDCA 2LFSA 1FXKC 4LNUA 3OT7A 1SQFA 5B1NA 1PV0A 4LC1A 1HR0O 4PDLA 3ZIAG 5KAIZ 3JYCA 4F6EA 1SC5B 1GTOA 3RVYA 3JD0A 4LF7B 1Q8IA 3D3IA 3CCUV 4ZI7A 1K4DC 3CE2A 3OGIB 1SZTA 2ZR3A 2P06A 2JDIG 3K06A 4UV9A 3E8FA 2YIBA 1H2SB 3FB8C 3X2QC 2EIJC 4C7UA 1MNGA 1RPOA 3CB2A 3JD4A 3SPHA 1MZEA 1QU7A 3ZX6A 2CH7A 1ZL8B 3FAVA 1U96A 2UXBB 1D5NA 3U0ZA 4KFMA 4UFZA 2EZOA 2P5OA 4JI0O 1SQXH 1OCZB 1Q5OA 1Q86W 4OGQB 2OCCC 2WLMA 2ZR2A 4LF8O 2LQTA 5KMGA 4TWKA 3SR2C 2Y69C 4YIOA 2OIEA 2YS8A 2IU0A 2XHBA 2Z0AA 3CRCA 1BMFG 3ABKB 3FX7A 3AG1C 3OTOB 4JAAA 2P90A 1FXKB 1E1QG 1Z2GA 1YVWA 4AQYB 4RQEA 2Q6AA 3TGUH 1PNKA 3RYCA 2JGDA 2WA4A 3N2KB 4MS2A 3PJSK 1LNQA 3ZMVA 1PNLA 3VQVA 3AK2A 3F5TA 3C3TA 2ATKC 4ZHQA 2BOCC 4K0KO 3WB0A 3X2QB 1UPGA 2EIJB 1XHZA 2UU9O 1R3JC 1SA0A 1K97A 4JI7O 5B1AC 5LGUA 1H2GA 4OX9B 2EINC 2OT5A 2BTQB 4DV5O 1KKDA 3K0DA 3AG3C 1M1KW 1QNMA 1IBLO 3P32A 2GV9A 2HR3A 1L0LH 2BSKB 3OMNB 1GN2A 5J2TA 4JYAB 3E22B 4MW8A 2QKAA 2B1GA 1E79G 2QM4A 2N05A 5IT9N 4RWUA 2KSDA 2P22C 1R6KA 2UXNA 2Y69B 1JJ2U 2OIGA 3CCQV 2Q73A 2ZE6A 3E8GA 5IJ0B 3T1HO 4PV1B 3S3WA 3A8TA 2AZ0A 2CGOA 3RVZA 1EN6A 3AG1B 4DUZB 2B5UA 1NZ6A 2Q5ZA 5JJNB 2Q68A 4I0XA 4DR4B 4TSFG 5JVDB 2XT9A 4DV6B 5CB4A 5BR8O 2GUZA 1DF5A 2BTOA 4LP8A 3JARB 2YI9A 3RYIA 1K9MW 5LBQA 2ZT9B 5EC2C 1FD9A 4LWSB 3CEIA 4TQFA 1S77D 3JD3A 5GW7A 3JAKA 4YXWG 2VQFO 3OTFA 1VF6C 5CA1B 2ZIOA 4J7KA 5B1AB 4GYCB 1SESA 5JCOC 2WLNA 4CH3A 2EINB 2CTQA 3AG3B 3FYEB 2O57A 1VQ9V 5DEDA 2LFRA 4PA7A 5EBMC 1NT2B 2X0LA 1SETA 4DV3B 2V1DA 2HJDA 2W0FC 4GT1A 1KP3A 3H9VA 1H2NA 4D7SA 1P7GA 1KU9A 2ZDIC 4LFBB 3LDDA 2D3OW 5JH7B 3ZHUA 4YJ3A 3RYFB 3AG4B 4DRXA 3K5LA 5CA0A 1EZJA 4CS2A 4UV8A 4B3SO 3WB1A 1YJWV 1HWYA 4DXWA 4PI0A 4DK0A 1H2KA 2E75B 2K1EA 3QO8A 3K5MA 2BOBC 3H01A 3J81N 2ZE8A 2UUBB 3FB5C 1MZFA 4O2AB 1XEQA 4X89A 5BXZA 3O9OA 1OCRC 1NTZH 5IJ9A 2OCHA 3N2GA 1Q82W 2DN9A 3ZMZA 2QWQB 2EIMC 1R3IC 5KHHA 3E8BA 3U10A 4WFAV 4X64O 1CPYA 2A3QA 3K0GA 5LYJA 2DWEC 1NQTA 4J10A 1WA8B 1ZX3A 1B6QA 3OMIB 3G6BA 4X62O 1L0NH 3RWRD 1DTOA 4PDMA 3WFVA 4LF7O 4MVZA 3FYIB 3BA8A 1GN6A 3BRCA 3MHSC 3VOUA 4QE9A 1HR0B 1IBMO 1HNWO 2Y4TA 2ZNJA 1XDCA 4LR3A 2Y0PA 4NVPA 2HKOA 2ADPA 3ABUA 2A7WA 3BFRA 3FB6C 2YXHA 4J9ZB 3SYCA 2LGWA 2Q4PA 4GX0A 3UT5B 2KG7A 3G67A 2X6BA 3H1LH 3QG5A 2CTWA 3OAAG 1LUVA 3ZRWB 4WFBV 4JTAB 4DR7O 3ETDA 3OW2U 1FPOA 4GX5A 1RM1B 1OCRB 4JI0B 2XAQA 1PPJH 2LJ2A 1BL8A 1JMKC 4EB6A 2IBZH 4JZ2A 1Y6XA 4LF8B 2EIMB 3ZCCA 3HKBB 2EILC 2AHYA 2YDEA 4CH5A 3SJAC 3HKEA 1FFXB 2QWRB 3KKYA 4F4LA 4GKKO 1AROP 4MVSA 1N0JA 3HKCA 4U3FH 2IW5A 1VQMV 2WLHA 3UM7A 1DK1A 1DLBA 1AR1B 5FNVB 1IZ3A 2HHHO 1XQ8A 4UVAA 3OR6C 1QQCA 2F93B 5F2VO 3JATA 1JFFB 4X1KA 4J9YB 4UCTA 4MTGA 3CC7V 4WFFA 3OUSA 4K0KB 1Y76B 4QJFB 1DF4A 2UU9B 3F7YC 3IFXA 3L70H 4R8CA 4JI7B 1Q7YW 3F7VC 5LXTA 4DV5B 4N23A 2P4VA 2Q69A 1GKFA 2YUAA 1IBLB 5EZYA 1K34A 2LGQA 3CCMV 1IXBA 4KHPO 4QPKA 4GCZA 4JPRA 4O2BA 5A9GA 2IJJA 4DV2O 1B3QA 4ZOLB 3KZIZ 4FLYA 4TV8A 1NR7A 2L35A 1SKVA 4GZRB 4H44B 4G27B 1FJGO 1ENVA 3CCSV 2EILB 4CZZA 2X7RB 1S0VA 4I4TA 3T1HB 3JASA 5LP6C 4E2LA 1US6A 2WLIB 3CC2V 1NTMH 3I56V 3K57A 3ETGA 3CX5F 5BR8B 3STZC 1Q6IA 2ILMA 4ZIBA 3SPCA 4DV1O 3DXRA 5BMVA 3W7WA 4JI4O 4HNAA 1WP8A 2F1MA 1SRYA 3ABMC 1S5JA 5B1BC 2H3OA 5CBGA 4U3JA 4OXSA 1G4YB 1WAZA 5EC1C 3K3WA 4RAIA 1WP7A 4QPJA 2E5LO 4TT3G 3BAAA 1GAXA 3TK1A 2VS0A 1QR9A 1RSOB 4JF3A 1FXVA 3SPJA 1AI5A 2PYJA 1BS3A 2ITDC 4UVBA 1M90W 3E83A 5LA6A 2XUMA 1HW7A 3SJCC 1N32O 2AW9A 3CP1A 5ITZB 2QSAA 3CYOA 2XNDG 4KXRA 1VQOV 1Z5WA 3M99B 1NS1A 1ZSPA 1SZXA 2EJ7A 5LHGA 4B7KA 4O4IB 2QE7G 4B3SB 2HVKC 1H8HG 2IU3A 3ML0A 1TVKB 2JIZG 2R9RB 4P30A 4MSWC 1YITV 4UVCA 3BVOA 2ZXWC 1M5IA 5B5EZ 2DE0X 1Q90D 1XL6A 3ABMB 3UO3A 1ZWIC 5B1BB 1YCIA 4FLZA 3CWBH 2ZKOA 1ZUQA 3T1YO 3K04A 5CBFA 4FFBB 1Q81W 1KKCA 1SQQH 4X8AA 2WA3A 1I94O 3ABKC 2QA4V 1MG1A 4YHHO 4X64B 3W7SA 1AI7A 2EJRA 1RPRA 4MVQA 3K79A 4NKGB 1HDJA 1K92A 4X62B 1V55C 2ITCC 1WN7A 5KA6A 3G6EV 5B3SC 2ZE5A 3JALB 2WPDG 2YC0A 2M7WA 2WSSG 4I50A 3ABTA 4O4JB 4TUYA 4CS4A 4ZBMA 1NBMG 1AJPA 1IBMB 1HNWB 4B3MO 2PF4E 2WLKA 3SYAA 3B77A 4IYIA 3T4ZA 4WBNB 2A9HA 3CMAV 2X6CA 3JSNA 4R50A 3O65A 3RN4A 1ROPA 3SYOA 2WLJA 1Z5VA 4JTCB 2HVJC 1NI8A 4BIZA 1I08A 4X65O 3AEIA 4DR7B 2GTSA 1TA8A 4LF5O 2ZXWB 1M9NA 3E86A 3CMEV 5LGNA 4UCUA 3D36C 3J7AU 2DW4A 3JARA 1I0HA 2QWNB 4JI8O 4DW0A 3GWKC 5IYZA 4XDJA 4LWSA 1OCOC 2WLLB 5IY5C 4H33A 2DYSC 4PDRA 5CA1A 2YEVA 1M57B 3AG7A 3AK1A 1V55B 4TV9A 1FYJA 4EEQA 4GKKB 3QTCA 2A06H 1MSDA 5B3SB 4K35A 4Z1MG 5D5QA 4DR2O 5L3GA 1KMIZ 2JGUA 2Y48A 4OPHA 3FFQA 2AZ2A 4I55A 1QCEA 2ZM6B 4R7CA 1JPXA 2HHHB 1VQ8V 2YIAA 5LMNO 1HNXO 4MVRA 1AJNA 4UB6Z 5LOVA 2NNUA 1YXBA 4H13B 2QDOA 4BIOA 4BIUA 2P67A 3E2EA 2E3CA 4HZ3A 4PJ0Z 4NR1A 4O4LB 1N0NA 2L6LA 5L3DA 2PTMA 4CC5A 4UB8Z 2Q67A 3B40A 4FM2A 3G80A 1HNZO 1M56C 1AB3A 3HR0A 2XAFA 4LH6A 3ZMSA 5BZBA 4X1YA 2HJFC 3CSXA 1YF2A 1UJWB 1K33A 1BQZA 2KQXA 5LMUO 4KHPB 1JOYA 2NR5A 5EYPA 1BE3H 1G8MA 3B09A 3T4DA 2ZQMA 4HAMA 3CRAA 4ZI7B 4DV2B 1TAEA 4D6TH 1NJIW 1YJ9V 1VQ7V 1O9GA 1NH2D 1FJGB 4O2AA 2XTAA 1OCOB 3LNNA 2BE3A 5IY5B 1PKXA 1KQSU 2DYSB 3AG4C 1URFA 4YJ2A 3APQA 2AGAA 2CUGA 3QNEA 4AHCA 3G4SV 3ZHRA 1D5AA 1Q6UA 2FYUH 1G6UA 3W7TA 3ZEDA 1K5QA 2IH3C 3Q4HA 4PA9A 4JYYA 4HYOA 2Q8VA 4IIJA 3ZMUA 2KB1A 4DV1B 3ZMTA 1XNRO 4DR1O 2IJKA 4JI4B 1H8EG 2F4VO 5IYBO 5KMGB 5KX5A 2CDYA 1N4CA 1R6NA 2EULA 2FTKA 4UCOA 1NU1H 3MAQA 3I55V 2ZDIA 4K8XA 1KUQA 1BHBA 4TQDA 1M56B 5KHIA 2E5LB 3ETQA 3LNMB 4H37A 3UKMA 5J2UA 1Y74A 4G2KA 1SERA 4DR6O 4J7ZA 4LBEC 3RYCB 2JGDB 1XL4A 3ZRWA 1DGSA 4LFCO 2F66C 3P30A 3M7MX 4IT5A 1GM9A 1SS3A 1K8AW 3CCEV 2LW1A 1VARA 2DWDC 1N32B 2W0XA 4ZHQB 5L3FA 3R66A 3HPLC 2R72A 3FD9A 4AI8A 1FKAO 4B3RO 1I7FA 3QO7A 3SYPA 1FAFA 1FFXA 2RJZA 5J2TB 4JI1O 4P9PA 1F4NA 3U11A 1RM1C 1XI1A 2RNBA 5EK0A 4DR3O 1YEWA 2QKSA 4NYKA 4YIPA 4JGSA 5H2FZ 1XUQA 2D2CB 2KKWA 4JTDB 4GLXA 3OEHG 1NR1A 1AR4A 3T1YB 1COWG 4MVOA 4BAYA 4LF9O 5IWAO 2AHZA 1JFFA 1I5YA 5DM6V 2QGNA 1I94B 1BQ0A 4I0XB 4YHHB 2X6AA 5CMUA 5CB4B 2GUZB 2FKXA 2PY5A 3RYIB 2GDSA 1IURA 4QGPA 3MHHC 3SGIA 4DUYO 3JAKB 4JYBA 1TGOA 1KB9F 3T1CA 4B3MB 1KBHA 4O4HA 4YY3O 4DR5O 3BABA 4B08A 5B66Z 3WG7C 1Y67A 3SJBC 3EFFK 3CJHA 3CS5A 1JR9A 4X65B 3ASNC 4LF5B 2CAZC 2ZINA 1VIBA 2H8PC 1GK9A 4RO2A 1FXHA 1X59A 1P4RA 2PGGA 3D8CA 5FPRA 1VP7A 3FB7C 4JI8B 1BHAA 4YJ3B 4X1IA 2R70A 4DRXB 3VQYA 5CA0B 3F5WC 2XASA 2F23A 5FPOA 1L8DA 2YIDA 4OPAA 4X66O 5IDJA 2ZM6O 1RFYA 1BT8A 4IHJA 4DR2B 2Q0AA 2ETNA 4ABMA 1RSOA 4JI3O 1IXMA 3LUTB 4NB5A 1OCCB 3UO2A 1E1RG 3B8MA 3SPIA 3N2GB 4BWAA 1PM9A 3E8HA 5LMNB 1HNXB 3K08A 1WB7A 5KUMA 4ASUG 2ZD9A 1NTKH 4KP4A 5ITZA 5LYJB 4WCEV 3WG7B 1XMQO 1UFIA 1HNZB 4J80A 3H1IH 3HB3B 4GUNA 5LP6A 2GTAA 3ZN1A 3ASNB 4L8JA 5GONA 3W7XA 1CXZB 3ABLB 2A79B 4UXNA 2ADQB 5LMUB 1U97A 2Q0OC 4IGGA 3L9DA 4UCVA 2AXTZ 1TVKA 2F43G 1JVMA 1KD1W 4NTYA 2R9IA 4I9WA 3GWOA 4B7EA 2DYRB 3BPZA 1O9HA 1BCCH 4F6RA 3HKDA 2CTRA 2XAGA 2KG7B 4XBFA 4D7TA 4EFEA 2NN4A 3CCLV 4RQFA 1SQPH 1XOUA 3RT3C 3W7UA 1RP3B 3I5DA 4EFBA 3JD2A 3S3XA 3THOA 4P2ZA 3ETEA 4KUMA 1WLEA 2RMKB 4X20B 1XNRB 4DR1B 2RDCA 4EB6B 1OZ0A 1B04A 1VF5B 1J5EO 3JALA 1SQVH 1GM8A 2F4VB 3B4SA 1K73W 3KCXA 1PD3A 3RBZA 1OJHA 2H94A 3HKEB 4DV0O 5DN6G 4K3AA 4WBNA 2PUSA 3HKCB 2PI5A 1CP9A 3LSUA 1YTFD 1ZL8A 2Z3YA 5K1PA 5LHIA 1EM1A 1GN4A 3L71H 1K7DA 5KAFZ 1H2LA 3GVMA 4JAUA 4DR6B 1NKDA 1X4TA 1K4CC 4LFCB 3A2FA 2DMXA 1GN3A 2ZIMA 3JATB 3CRQA 1XREA 3K9AA 4X1KB 4GX1A 1ZTEA 2HP8A 2YXYA 2VQEO 4G28B 3GB7C 4Q20A 2LW7A 3E89A 4JI6O 1M93A 3ICXA 3A0RA 3PN1A 2G38A 4PD4F 1QBZA 1MABG 5LXTB 4MW3A 4B3RB 2V7QG 3SPGA 2WAMA 2WLLA 3OR7C 5EZYB 1FXKA 4PDVA 5JQGB 4Q6GA 4W4LA 2A0LA 2IH1C 4JI1B 2ZCEA 2P6JA 2OYQA 3N2KA 4TV8B 4DR3B 1P49A 4CH6A 4BR6A 4DW1A 2VWJA 2XAJA 3VQWA 1EBOA 4I4TB 5K1XA 1P84F 1AI4A 3RGBA 1S5LZ 1G1XB 1QHTA 3JASB 4CBCA 3DC6A 4LF9B 5IWAB 1MSWD 1M57C 4X88A 1WJZA 4IL6Z 2EX3A 2EIKC 1TUBB 3JSLA 1H38A 5CN0A 2BTQA 5KUKA 2N04A 2LP7A 4AILC 3DXRB 1N34O 4DO2A 2HLDG 3JAWB 5H9CA 2BSKA 4HNAB 5C8YB 2HEPA 5AG2A 3E22A 1AP5A 1R3KC 4JV5O 4U3JB 4DUYB 2RQ6A 2UUCB 1Y4MA 2CE4A 3D36A 4FLWA 1S76D 1K5SA 4MT8A 4YY3B 4LF6O 2IJIA 1N8RW 5IJ0A 4J42A 4DR5B 3K9SA 4JZGA 3L74H 3EXAA 4NTWA 1XHXA 3MD0A 2V4DA 2XAHA 1XNQB 2QWOB 4J41A 4WF9V 5JWPA 2FMLA 1R73A 5JVDA 5J9PC 1V54C 3OEEG 4IYHA 3OFNG 2GHYA 3DGEA 2UXDO 5LA6B 4MVUA 1BSMA 1FS0G 1T5EA 1YZBA 1QR8A 1GMGA 3RYHB 4JI2O 1FFTB 2RN9A 4NXMB 1JCHA 3G71V 4U7OA 2IJHA 2EIKB 4PHZA 1LUWA 3K5NA 4B3TO 4QNHB 1KP2A 1YJNV 1LR1A 2FL4A 1MMMA 4X66B 4FM0A 2OTLV 2ODMA 4LF4O 5B1OA 2GBOA 5JJEB 4R6ZA 1JQ0A 4JI3B 1YHQV 2WWWA 5C93A 1TUEB 2F95B 5D5PA 2OTJV 1MA1A 3K03A 5EIBD 4FVMA 1WB8A 4FJCC 1XBLA 2W6JG 5JH7A 1OV9A 3RYFA 2CK3G 1XMQB 4LNUB 3IJ4A 1V54B 1HP8A 2B9ZA 3ZN0A 1J95A 2EBOA 3RW0A 2Z5UA 4I7ZB 1R1BA 4RUEA 4I50B 4TUYB 4LFAO 1IDSA 5A2QN 4PA4A 2BCCH 1XMOO 1N36O 3TCUA 1MOFA 2HG5C 2P7TC 1WPBA 2OCCB 3QVNA 2YICA 4PA3A 1WNSA 3D3QA 3ZRVA 1VF6A 5FLXN 5GTHZ 1IBKO 2UUAO 2CH7B 3DSQA 3FKSG 3FAVB 1VQ5V 5JCOA 3CC4V 2JS3A 2JRIA 2E74B 2OWOA 3RFRA 1WA8A 1PP9H 1K3EA 4JASA 4CH4A 1SF9A 2UXXA 4HBNA 4I5SA 4QIWF 1JX9A 3EVKA 2UXCO 1W0KG 3ASOC 3IC7A 1VMGA 1N33O 2JK5C 4ZKIA 1VQNV 1YIJV 1QLNA 3L72H 1CEZA 1J5EB 3AG2C 5IYCO 5IYZB 4FLVA 4GX2A 4FK5C 3UCSC 1IVSA 2W6IG 4EKWA 1W2BU 2DQ0A 1GRJA 1NVPD 4DV0B 1XILA 3OD4A 3BY6A 2YEVB 3CXCU 1THZA 4TV9B 3UT5A 4CS3A 2PYLA 3VBBA 1EZVH 2IM9A 1Y66A 4JAVA 4FMTA 4I55B 1EN5A 5H5NA 1AP6A 2K9PA 2Q7GA 2Y0IA 3ZHTA 5L3BA 5LOVB 4JI5O 1SA0B 1S5HC 2JEUA 3H1JH 2B1IA 5IYDO 3UQ8A 3HKBA 4GKJO 2VQEB 2QWPB 4JYCA 4U7NA 1GH6A 4JI6B 1F4MA 5KA5A 4X1YB 4E4EA 3SDLA 3LSQA 3ZHVA 2MW2B 4DV4O 4DV7O 3ASOB 4J7JA 3QO5A 5LGTA 2M6YA 5EYPB 3IAYA 2PZSA 1VQLV 5FNVA 4FLTA 3APOA 3ZBHA 3AG2B 3OGCC 4XDKA 3R65A 3P3PA 2QTOA 3K59A 3CXHF 1JJOA 3A0BZ 4YJ2B 3KCYA 1KC8W 5EBWC 4W4KA 2ZNIA
chains in the Genus database with same CATH topology
2H3OA 2LJ2A 1WAZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3O A;  2LJ2 A;  1WAZ A; 
#chains in the Genus database with same CATH topology
 1Y76 A;  2LO1 A;  1PL4 A;  4NXN O;  4UCR A;  3M8A A;  1YTF B;  3BHP A;  1Q43 A;  3Q4H B;  4PEL A;  3K58 A;  1KEC A;  4IIJ B;  4FIP C;  3BEH A;  3CD6 V;  1SQG A;  1S72 V;  1N34 B;  2UUC O;  1V9P A;  1OCC C;  4WFE A;  3AK3 A;  3E35 A;  3JD1 A;  4ZOL A;  5KX5 B;  3ZRX A;  4JV5 B;  1WPX A;  1AJQ A;  2EZP A;  4TOI A;  3H1K H;  1W0J G;  2DQ3 A;  1XNQ O;  4LF6 B;  1BGY H;  1VQ4 V;  3JCZ A;  4BW5 A;  1EFR G;  2PI4 A;  3ZHS A;  3CCJ V;  3CCV V;  1P7B A;  3OMA B;  2JEX A;  4FLX A;  3ZRS A;  1GO3 F;  2UXB O;  5J2U B;  4K8Z A;  5TIS Z;  2JS5 A;  3ZHQ A;  3NR7 A;  1Y74 B;  2WLI A;  2JJ1 G;  1W59 A;  4KL1 A;  3ABL C;  2ZE7 A;  4A5U B;  2CTP A;  4NXM O;  4MTX A;  2UXD B;  1R6T A;  2QM8 A;  5CA3 A;  4NTX A;  4Z2W A;  3WU2 Z;  5KHJ A;  4JI2 B;  3T2M A;  2DYR C;  2JVD A;  4X20 A;  4RUF A;  1SQB H;  4J11 A;  2FB5 A;  3B2E E;  2C2A A;  3DTU B;  4PI2 A;  4FM1 A;  2CGN A;  2YIB D;  3L75 H;  3N27 A;  3OTO O;  4B3T B;  1F23 A;  5IE9 A;  2ARH A;  2DOS A;  4AQY O;  1B06 A;  5IJ9 B;  4LF4 B;  4UUJ C;  1AIL A;  4N21 A;  4FZ1 A;  4P9O A;  5H6R A;  1QVF U;  1JA8 A;  3QF7 A;  1PL0 A;  4WFG A;  3BA9 A;  3IGA C;  3SJQ C;  4XDL A;  4ICG A;  1Q3E A;  5EIB C;  4OX9 O;  1I5X A;  3JCU Z;  1ORQ C;  1AR5 A;  3CHX A;  4O4I A;  2VRZ A;  3P3N A;  1IX9 A;  4MVM A;  2R9A A;  4JYA O;  1OHH G;  4PA6 A;  1ZLZ A;  2QKC A;  3NXS A;  4Z1V A;  4LFA B;  1XMO B;  1N36 B;  5L3C A;  5EBL C;  5JQG A;  5GTI Z;  2YSU B;  4O4H B;  2JJ2 G;  1VF7 A;  4FFK A;  4FFB A;  4MTO A;  1QVG U;  1IBK B;  2UUA B;  5H6Q A;  4DUZ O;  2HFE C;  4LH7 A;  2QM7 A;  4DK1 A;  4DR4 O;  3CJH B;  2P4K A;  4DV6 O;  1YSC A;  4BW9 A;  1GM7 A;  1YI2 V;  5LHH A;  2QTS A;  5CBH A;  3CRM A;  2UXC B;  3ZS8 C;  1TUB A;  3WB2 A;  3CCR V;  1N33 B;  2NLJ C;  1ZAU A;  4CC6 A;  2QR4 A;  4O4J A;  1D2D A;  3JAW A;  3C90 A;  1R3L C;  5C8Y A;  1F7Y A;  3C3S A;  3LDE A;  1A32 A;  5L3E A;  4X1I B;  3BCC H;  3H1H H;  2Q9L A;  1YDX A;  2Y4U A;  2VQF B;  4H0L B;  3TJT A;  5HFM A;  2YXL A;  1VQ6 V;  1QLE C;  5E1A C;  2Q7H A;  3CPW U;  4IHJ B;  2Q7E A;  3VQX A;  2RCV A;  3LSS A;  1VQK V;  1VQP V;  4DV3 O;  3OE7 G;  4X9Q A;  2N74 A;  1H2M A;  3ZJZ A;  1NH2 B;  3TET A;  3KG2 A;  2QEX V;  1EN4 A;  4JI5 B;  1M4U A;  4MTF A;  4LFB O;  5JJJ B;  3CRR A;  3RYH A;  4GKJ B;  5DEC A;  1AVM A;  3J80 N;  4UCS A;  5KHG A;  4FZ0 A;  2VWK A;  5LP6 B;  1VEW A;  4L87 A;  5HFL A;  4O2B B;  4DV4 B;  3OUF A;  4DV7 B;  5GON B;  2GSM B;  2UUB O;  4LCU C;  3STL C;  1S3J A;  3A0H Z;  1AI6 A;  3IC9 A;  4WFH A;  4FPP A;  3TXS A;  4DYL A;  5KHK A;  5BY1 A;  3MDS A;  3OM3 B;  2E76 B;  3K5O A;  3SYQ A;  1OCZ C;  5LL6 Y;  4QE7 A;  5FL7 G;  2XOK G;  4F6R B;  2YI8 A;  3EHB B;  3HKD B;  1KYO F;  4O4L A;  1L1F A;  3JAM N;  3L73 H;  4FLU A;  1NVP B;  1F51 A;  2DJV A;  3TXQ A;  4I9Q A;  1QLE B;  1Q6H A;  3B8N A;  3DC5 A;  2QJ1 A;  4NXN B;  1PNM A;  5BMV B;  1BZK A;  5KLV H;  5E79 Z;  2MK3 A;  3LDC A;  2LFS A;  1FXK C;  4LNU A;  3OT7 A;  1SQF A;  5B1N A;  1PV0 A;  4LC1 A;  1HR0 O;  4PDL A;  3ZIA G;  5KAI Z;  3JYC A;  4F6E A;  1SC5 B;  1GTO A;  3RVY A;  3JD0 A;  4LF7 B;  1Q8I A;  3D3I A;  3CCU V;  4ZI7 A;  1K4D C;  3CE2 A;  3OGI B;  1SZT A;  2ZR3 A;  2P06 A;  2JDI G;  3K06 A;  4UV9 A;  3E8F A;  2YIB A;  1H2S B;  3FB8 C;  3X2Q C;  2EIJ C;  4C7U A;  1MNG A;  1RPO A;  3CB2 A;  3JD4 A;  3SPH A;  1MZE A;  1QU7 A;  3ZX6 A;  2CH7 A;  1ZL8 B;  3FAV A;  1U96 A;  2UXB B;  1D5N A;  3U0Z A;  4KFM A;  4UFZ A;  2EZO A;  2P5O A;  4JI0 O;  1SQX H;  1OCZ B;  1Q5O A;  1Q86 W;  4OGQ B;  2OCC C;  2WLM A;  2ZR2 A;  4LF8 O;  2LQT A;  5KMG A;  4TWK A;  3SR2 C;  2Y69 C;  4YIO A;  2OIE A;  2YS8 A;  2IU0 A;  2XHB A;  2Z0A A;  3CRC A;  1BMF G;  3ABK B;  3FX7 A;  3AG1 C;  3OTO B;  4JAA A;  2P90 A;  1FXK B;  1E1Q G;  1Z2G A;  1YVW A;  4AQY B;  4RQE A;  2Q6A A;  3TGU H;  1PNK A;  3RYC A;  2JGD A;  2WA4 A;  3N2K B;  4MS2 A;  3PJS K;  1LNQ A;  3ZMV A;  1PNL A;  3VQV A;  3AK2 A;  3F5T A;  3C3T A;  2ATK C;  4ZHQ A;  2BOC C;  4K0K O;  3WB0 A;  3X2Q B;  1UPG A;  2EIJ B;  1XHZ A;  2UU9 O;  1R3J C;  1SA0 A;  1K97 A;  4JI7 O;  5B1A C;  5LGU A;  1H2G A;  4OX9 B;  2EIN C;  2OT5 A;  2BTQ B;  4DV5 O;  1KKD A;  3K0D A;  3AG3 C;  1M1K W;  1QNM A;  1IBL O;  3P32 A;  2GV9 A;  2HR3 A;  1L0L H;  2BSK B;  3OMN B;  1GN2 A;  5J2T A;  4JYA B;  3E22 B;  4MW8 A;  2QKA A;  2B1G A;  1E79 G;  2QM4 A;  2N05 A;  5IT9 N;  4RWU A;  2KSD A;  2P22 C;  1R6K A;  2UXN A;  2Y69 B;  1JJ2 U;  2OIG A;  3CCQ V;  2Q73 A;  2ZE6 A;  3E8G A;  5IJ0 B;  3T1H O;  4PV1 B;  3S3W A;  3A8T A;  2AZ0 A;  2CGO A;  3RVZ A;  1EN6 A;  3AG1 B;  4DUZ B;  2B5U A;  1NZ6 A;  2Q5Z A;  5JJN B;  2Q68 A;  4I0X A;  4DR4 B;  4TSF G;  5JVD B;  2XT9 A;  4DV6 B;  5CB4 A;  5BR8 O;  2GUZ A;  1DF5 A;  2BTO A;  4LP8 A;  3JAR B;  2YI9 A;  3RYI A;  1K9M W;  5LBQ A;  2ZT9 B;  5EC2 C;  1FD9 A;  4LWS B;  3CEI A;  4TQF A;  1S77 D;  3JD3 A;  5GW7 A;  3JAK A;  4YXW G;  2VQF O;  3OTF A;  1VF6 C;  5CA1 B;  2ZIO A;  4J7K A;  5B1A B;  4GYC B;  1SES A;  5JCO C;  2WLN A;  4CH3 A;  2EIN B;  2CTQ A;  3AG3 B;  3FYE B;  2O57 A;  1VQ9 V;  5DED A;  2LFR A;  4PA7 A;  5EBM C;  1NT2 B;  2X0L A;  1SET A;  4DV3 B;  2V1D A;  2HJD A;  2W0F C;  4GT1 A;  1KP3 A;  3H9V A;  1H2N A;  4D7S A;  1P7G A;  1KU9 A;  2ZDI C;  4LFB B;  3LDD A;  2D3O W;  5JH7 B;  3ZHU A;  4YJ3 A;  3RYF B;  3AG4 B;  4DRX A;  3K5L A;  5CA0 A;  1EZJ A;  4CS2 A;  4UV8 A;  4B3S O;  3WB1 A;  1YJW V;  1HWY A;  4DXW A;  4PI0 A;  4DK0 A;  1H2K A;  2E75 B;  2K1E A;  3QO8 A;  3K5M A;  2BOB C;  3H01 A;  3J81 N;  2ZE8 A;  2UUB B;  3FB5 C;  1MZF A;  4O2A B;  1XEQ A;  4X89 A;  5BXZ A;  3O9O A;  1OCR C;  1NTZ H;  5IJ9 A;  2OCH A;  3N2G A;  1Q82 W;  2DN9 A;  3ZMZ A;  2QWQ B;  2EIM C;  1R3I C;  5KHH A;  3E8B A;  3U10 A;  4WFA V;  4X64 O;  1CPY A;  2A3Q A;  3K0G A;  5LYJ A;  2DWE C;  1NQT A;  4J10 A;  1WA8 B;  1ZX3 A;  1B6Q A;  3OMI B;  3G6B A;  4X62 O;  1L0N H;  3RWR D;  1DTO A;  4PDM A;  3WFV A;  4LF7 O;  4MVZ A;  3FYI B;  3BA8 A;  1GN6 A;  3BRC A;  3MHS C;  3VOU A;  4QE9 A;  1HR0 B;  1IBM O;  1HNW O;  2Y4T A;  2ZNJ A;  1XDC A;  4LR3 A;  2Y0P A;  4NVP A;  2HKO A;  2ADP A;  3ABU A;  2A7W A;  3BFR A;  3FB6 C;  2YXH A;  4J9Z B;  3SYC A;  2LGW A;  2Q4P A;  4GX0 A;  3UT5 B;  2KG7 A;  3G67 A;  2X6B A;  3H1L H;  3QG5 A;  2CTW A;  3OAA G;  1LUV A;  3ZRW B;  4WFB V;  4JTA B;  4DR7 O;  3ETD A;  3OW2 U;  1FPO A;  4GX5 A;  1RM1 B;  1OCR B;  4JI0 B;  2XAQ A;  1PPJ H;  2LJ2 A;  1BL8 A;  1JMK C;  4EB6 A;  2IBZ H;  4JZ2 A;  1Y6X A;  4LF8 B;  2EIM B;  3ZCC A;  3HKB B;  2EIL C;  2AHY A;  2YDE A;  4CH5 A;  3SJA C;  3HKE A;  1FFX B;  2QWR B;  3KKY A;  4F4L A;  4GKK O;  1ARO P;  4MVS A;  1N0J A;  3HKC A;  4U3F H;  2IW5 A;  1VQM V;  2WLH A;  3UM7 A;  1DK1 A;  1DLB A;  1AR1 B;  5FNV B;  1IZ3 A;  2HHH O;  1XQ8 A;  4UVA A;  3OR6 C;  1QQC A;  2F93 B;  5F2V O;  3JAT A;  1JFF B;  4X1K A;  4J9Y B;  4UCT A;  4MTG A;  3CC7 V;  4WFF A;  3OUS A;  4K0K B;  1Y76 B;  4QJF B;  1DF4 A;  2UU9 B;  3F7Y C;  3IFX A;  3L70 H;  4R8C A;  4JI7 B;  1Q7Y W;  3F7V C;  5LXT A;  4DV5 B;  4N23 A;  2P4V A;  2Q69 A;  1GKF A;  2YUA A;  1IBL B;  5EZY A;  1K34 A;  2LGQ A;  3CCM V;  1IXB A;  4KHP O;  4QPK A;  4GCZ A;  4JPR A;  4O2B A;  5A9G A;  2IJJ A;  4DV2 O;  1B3Q A;  4ZOL B;  3KZI Z;  4FLY A;  4TV8 A;  1NR7 A;  2L35 A;  1SKV A;  4GZR B;  4H44 B;  4G27 B;  1FJG O;  1ENV A;  3CCS V;  2EIL B;  4CZZ A;  2X7R B;  1S0V A;  4I4T A;  3T1H B;  3JAS A;  5LP6 C;  4E2L A;  1US6 A;  2WLI B;  3CC2 V;  1NTM H;  3I56 V;  3K57 A;  3ETG A;  3CX5 F;  5BR8 B;  3STZ C;  1Q6I A;  2ILM A;  4ZIB A;  3SPC A;  4DV1 O;  3DXR A;  5BMV A;  3W7W A;  4JI4 O;  4HNA A;  1WP8 A;  2F1M A;  1SRY A;  3ABM C;  1S5J A;  5B1B C;  2H3O A;  5CBG A;  4U3J A;  4OXS A;  1G4Y B;  1WAZ A;  5EC1 C;  3K3W A;  4RAI A;  1WP7 A;  4QPJ A;  2E5L O;  4TT3 G;  3BAA A;  1GAX A;  3TK1 A;  2VS0 A;  1QR9 A;  1RSO B;  4JF3 A;  1FXV A;  3SPJ A;  1AI5 A;  2PYJ A;  1BS3 A;  2ITD C;  4UVB A;  1M90 W;  3E83 A;  5LA6 A;  2XUM A;  1HW7 A;  3SJC C;  1N32 O;  2AW9 A;  3CP1 A;  5ITZ B;  2QSA A;  3CYO A;  2XND G;  4KXR A;  1VQO V;  1Z5W A;  3M99 B;  1NS1 A;  1ZSP A;  1SZX A;  2EJ7 A;  5LHG A;  4B7K A;  4O4I B;  2QE7 G;  4B3S B;  2HVK C;  1H8H G;  2IU3 A;  3ML0 A;  1TVK B;  2JIZ G;  2R9R B;  4P30 A;  4MSW C;  1YIT V;  4UVC A;  3BVO A;  2ZXW C;  1M5I A;  5B5E Z;  2DE0 X;  1Q90 D;  1XL6 A;  3ABM B;  3UO3 A;  1ZWI C;  5B1B B;  1YCI A;  4FLZ A;  3CWB H;  2ZKO A;  1ZUQ A;  3T1Y O;  3K04 A;  5CBF A;  4FFB B;  1Q81 W;  1KKC A;  1SQQ H;  4X8A A;  2WA3 A;  1I94 O;  3ABK C;  2QA4 V;  1MG1 A;  4YHH O;  4X64 B;  3W7S A;  1AI7 A;  2EJR A;  1RPR A;  4MVQ A;  3K79 A;  4NKG B;  1HDJ A;  1K92 A;  4X62 B;  1V55 C;  2ITC C;  1WN7 A;  5KA6 A;  3G6E V;  5B3S C;  2ZE5 A;  3JAL B;  2WPD G;  2YC0 A;  2M7W A;  2WSS G;  4I50 A;  3ABT A;  4O4J B;  4TUY A;  4CS4 A;  4ZBM A;  1NBM G;  1AJP A;  1IBM B;  1HNW B;  4B3M O;  2PF4 E;  2WLK A;  3SYA A;  3B77 A;  4IYI A;  3T4Z A;  4WBN B;  2A9H A;  3CMA V;  2X6C A;  3JSN A;  4R50 A;  3O65 A;  3RN4 A;  1ROP A;  3SYO A;  2WLJ A;  1Z5V A;  4JTC B;  2HVJ C;  1NI8 A;  4BIZ A;  1I08 A;  4X65 O;  3AEI A;  4DR7 B;  2GTS A;  1TA8 A;  4LF5 O;  2ZXW B;  1M9N A;  3E86 A;  3CME V;  5LGN A;  4UCU A;  3D36 C;  3J7A U;  2DW4 A;  3JAR A;  1I0H A;  2QWN B;  4JI8 O;  4DW0 A;  3GWK C;  5IYZ A;  4XDJ A;  4LWS A;  1OCO C;  2WLL B;  5IY5 C;  4H33 A;  2DYS C;  4PDR A;  5CA1 A;  2YEV A;  1M57 B;  3AG7 A;  3AK1 A;  1V55 B;  4TV9 A;  1FYJ A;  4EEQ A;  4GKK B;  3QTC A;  2A06 H;  1MSD A;  5B3S B;  4K35 A;  4Z1M G;  5D5Q A;  4DR2 O;  5L3G A;  1KMI Z;  2JGU A;  2Y48 A;  4OPH A;  3FFQ A;  2AZ2 A;  4I55 A;  1QCE A;  2ZM6 B;  4R7C A;  1JPX A;  2HHH B;  1VQ8 V;  2YIA A;  5LMN O;  1HNX O;  4MVR A;  1AJN A;  4UB6 Z;  5LOV A;  2NNU A;  1YXB A;  4H13 B;  2QDO A;  4BIO A;  4BIU A;  2P67 A;  3E2E A;  2E3C A;  4HZ3 A;  4PJ0 Z;  4NR1 A;  4O4L B;  1N0N A;  2L6L A;  5L3D A;  2PTM A;  4CC5 A;  4UB8 Z;  2Q67 A;  3B40 A;  4FM2 A;  3G80 A;  1HNZ O;  1M56 C;  1AB3 A;  3HR0 A;  2XAF A;  4LH6 A;  3ZMS A;  5BZB A;  4X1Y A;  2HJF C;  3CSX A;  1YF2 A;  1UJW B;  1K33 A;  1BQZ A;  2KQX A;  5LMU O;  4KHP B;  1JOY A;  2NR5 A;  5EYP A;  1BE3 H;  1G8M A;  3B09 A;  3T4D A;  2ZQM A;  4HAM A;  3CRA A;  4ZI7 B;  4DV2 B;  1TAE A;  4D6T H;  1NJI W;  1YJ9 V;  1VQ7 V;  1O9G A;  1NH2 D;  1FJG B;  4O2A A;  2XTA A;  1OCO B;  3LNN A;  2BE3 A;  5IY5 B;  1PKX A;  1KQS U;  2DYS B;  3AG4 C;  1URF A;  4YJ2 A;  3APQ A;  2AGA A;  2CUG A;  3QNE A;  4AHC A;  3G4S V;  3ZHR A;  1D5A A;  1Q6U A;  2FYU H;  1G6U A;  3W7T A;  3ZED A;  1K5Q A;  2IH3 C;  3Q4H A;  4PA9 A;  4JYY A;  4HYO A;  2Q8V A;  4IIJ A;  3ZMU A;  2KB1 A;  4DV1 B;  3ZMT A;  1XNR O;  4DR1 O;  2IJK A;  4JI4 B;  1H8E G;  2F4V O;  5IYB O;  5KMG B;  5KX5 A;  2CDY A;  1N4C A;  1R6N A;  2EUL A;  2FTK A;  4UCO A;  1NU1 H;  3MAQ A;  3I55 V;  2ZDI A;  4K8X A;  1KUQ A;  1BHB A;  4TQD A;  1M56 B;  5KHI A;  2E5L B;  3ETQ A;  3LNM B;  4H37 A;  3UKM A;  5J2U A;  1Y74 A;  4G2K A;  1SER A;  4DR6 O;  4J7Z A;  4LBE C;  3RYC B;  2JGD B;  1XL4 A;  3ZRW A;  1DGS A;  4LFC O;  2F66 C;  3P30 A;  3M7M X;  4IT5 A;  1GM9 A;  1SS3 A;  1K8A W;  3CCE V;  2LW1 A;  1VAR A;  2DWD C;  1N32 B;  2W0X A;  4ZHQ B;  5L3F A;  3R66 A;  3HPL C;  2R72 A;  3FD9 A;  4AI8 A;  1FKA O;  4B3R O;  1I7F A;  3QO7 A;  3SYP A;  1FAF A;  1FFX A;  2RJZ A;  5J2T B;  4JI1 O;  4P9P A;  1F4N A;  3U11 A;  1RM1 C;  1XI1 A;  2RNB A;  5EK0 A;  4DR3 O;  1YEW A;  2QKS A;  4NYK A;  4YIP A;  4JGS A;  5H2F Z;  1XUQ A;  2D2C B;  2KKW A;  4JTD B;  4GLX A;  3OEH G;  1NR1 A;  1AR4 A;  3T1Y B;  1COW G;  4MVO A;  4BAY A;  4LF9 O;  5IWA O;  2AHZ A;  1JFF A;  1I5Y A;  5DM6 V;  2QGN A;  1I94 B;  1BQ0 A;  4I0X B;  4YHH B;  2X6A A;  5CMU A;  5CB4 B;  2GUZ B;  2FKX A;  2PY5 A;  3RYI B;  2GDS A;  1IUR A;  4QGP A;  3MHH C;  3SGI A;  4DUY O;  3JAK B;  4JYB A;  1TGO A;  1KB9 F;  3T1C A;  4B3M B;  1KBH A;  4O4H A;  4YY3 O;  4DR5 O;  3BAB A;  4B08 A;  5B66 Z;  3WG7 C;  1Y67 A;  3SJB C;  3EFF K;  3CJH A;  3CS5 A;  1JR9 A;  4X65 B;  3ASN C;  4LF5 B;  2CAZ C;  2ZIN A;  1VIB A;  2H8P C;  1GK9 A;  4RO2 A;  1FXH A;  1X59 A;  1P4R A;  2PGG A;  3D8C A;  5FPR A;  1VP7 A;  3FB7 C;  4JI8 B;  1BHA A;  4YJ3 B;  4X1I A;  2R70 A;  4DRX B;  3VQY A;  5CA0 B;  3F5W C;  2XAS A;  2F23 A;  5FPO A;  1L8D A;  2YID A;  4OPA A;  4X66 O;  5IDJ A;  2ZM6 O;  1RFY A;  1BT8 A;  4IHJ A;  4DR2 B;  2Q0A A;  2ETN A;  4ABM A;  1RSO A;  4JI3 O;  1IXM A;  3LUT B;  4NB5 A;  1OCC B;  3UO2 A;  1E1R G;  3B8M A;  3SPI A;  3N2G B;  4BWA A;  1PM9 A;  3E8H A;  5LMN B;  1HNX B;  3K08 A;  1WB7 A;  5KUM A;  4ASU G;  2ZD9 A;  1NTK H;  4KP4 A;  5ITZ A;  5LYJ B;  4WCE V;  3WG7 B;  1XMQ O;  1UFI A;  1HNZ B;  4J80 A;  3H1I H;  3HB3 B;  4GUN A;  5LP6 A;  2GTA A;  3ZN1 A;  3ASN B;  4L8J A;  5GON A;  3W7X A;  1CXZ B;  3ABL B;  2A79 B;  4UXN A;  2ADQ B;  5LMU B;  1U97 A;  2Q0O C;  4IGG A;  3L9D A;  4UCV A;  2AXT Z;  1TVK A;  2F43 G;  1JVM A;  1KD1 W;  4NTY A;  2R9I A;  4I9W A;  3GWO A;  4B7E A;  2DYR B;  3BPZ A;  1O9H A;  1BCC H;  4F6R A;  3HKD A;  2CTR A;  2XAG A;  2KG7 B;  4XBF A;  4D7T A;  4EFE A;  2NN4 A;  3CCL V;  4RQF A;  1SQP H;  1XOU A;  3RT3 C;  3W7U A;  1RP3 B;  3I5D A;  4EFB A;  3JD2 A;  3S3X A;  3THO A;  4P2Z A;  3ETE A;  4KUM A;  1WLE A;  2RMK B;  4X20 B;  1XNR B;  4DR1 B;  2RDC A;  4EB6 B;  1OZ0 A;  1B04 A;  1VF5 B;  1J5E O;  3JAL A;  1SQV H;  1GM8 A;  2F4V B;  3B4S A;  1K73 W;  3KCX A;  1PD3 A;  3RBZ A;  1OJH A;  2H94 A;  3HKE B;  4DV0 O;  5DN6 G;  4K3A A;  4WBN A;  2PUS A;  3HKC B;  2PI5 A;  1CP9 A;  3LSU A;  1YTF D;  1ZL8 A;  2Z3Y A;  5K1P A;  5LHI A;  1EM1 A;  1GN4 A;  3L71 H;  1K7D A;  5KAF Z;  1H2L A;  3GVM A;  4JAU A;  4DR6 B;  1NKD A;  1X4T A;  1K4C C;  4LFC B;  3A2F A;  2DMX A;  1GN3 A;  2ZIM A;  3JAT B;  3CRQ A;  1XRE A;  3K9A A;  4X1K B;  4GX1 A;  1ZTE A;  2HP8 A;  2YXY A;  2VQE O;  4G28 B;  3GB7 C;  4Q20 A;  2LW7 A;  3E89 A;  4JI6 O;  1M93 A;  3ICX A;  3A0R A;  3PN1 A;  2G38 A;  4PD4 F;  1QBZ A;  1MAB G;  5LXT B;  4MW3 A;  4B3R B;  2V7Q G;  3SPG A;  2WAM A;  2WLL A;  3OR7 C;  5EZY B;  1FXK A;  4PDV A;  5JQG B;  4Q6G A;  4W4L A;  2A0L A;  2IH1 C;  4JI1 B;  2ZCE A;  2P6J A;  2OYQ A;  3N2K A;  4TV8 B;  4DR3 B;  1P49 A;  4CH6 A;  4BR6 A;  4DW1 A;  2VWJ A;  2XAJ A;  3VQW A;  1EBO A;  4I4T B;  5K1X A;  1P84 F;  1AI4 A;  3RGB A;  1S5L Z;  1G1X B;  1QHT A;  3JAS B;  4CBC A;  3DC6 A;  4LF9 B;  5IWA B;  1MSW D;  1M57 C;  4X88 A;  1WJZ A;  4IL6 Z;  2EX3 A;  2EIK C;  1TUB B;  3JSL A;  1H38 A;  5CN0 A;  2BTQ A;  5KUK A;  2N04 A;  2LP7 A;  4AIL C;  3DXR B;  1N34 O;  4DO2 A;  2HLD G;  3JAW B;  5H9C A;  2BSK A;  4HNA B;  5C8Y B;  2HEP A;  5AG2 A;  3E22 A;  1AP5 A;  1R3K C;  4JV5 O;  4U3J B;  4DUY B;  2RQ6 A;  2UUC B;  1Y4M A;  2CE4 A;  3D36 A;  4FLW A;  1S76 D;  1K5S A;  4MT8 A;  4YY3 B;  4LF6 O;  2IJI A;  1N8R W;  5IJ0 A;  4J42 A;  4DR5 B;  3K9S A;  4JZG A;  3L74 H;  3EXA A;  4NTW A;  1XHX A;  3MD0 A;  2V4D A;  2XAH A;  1XNQ B;  2QWO B;  4J41 A;  4WF9 V;  5JWP A;  2FML A;  1R73 A;  5JVD A;  5J9P C;  1V54 C;  3OEE G;  4IYH A;  3OFN G;  2GHY A;  3DGE A;  2UXD O;  5LA6 B;  4MVU A;  1BSM A;  1FS0 G;  1T5E A;  1YZB A;  1QR8 A;  1GMG A;  3RYH B;  4JI2 O;  1FFT B;  2RN9 A;  4NXM B;  1JCH A;  3G71 V;  4U7O A;  2IJH A;  2EIK B;  4PHZ A;  1LUW A;  3K5N A;  4B3T O;  4QNH B;  1KP2 A;  1YJN V;  1LR1 A;  2FL4 A;  1MMM A;  4X66 B;  4FM0 A;  2OTL V;  2ODM A;  4LF4 O;  5B1O A;  2GBO A;  5JJE B;  4R6Z A;  1JQ0 A;  4JI3 B;  1YHQ V;  2WWW A;  5C93 A;  1TUE B;  2F95 B;  5D5P A;  2OTJ V;  1MA1 A;  3K03 A;  5EIB D;  4FVM A;  1WB8 A;  4FJC C;  1XBL A;  2W6J G;  5JH7 A;  1OV9 A;  3RYF A;  2CK3 G;  1XMQ B;  4LNU B;  3IJ4 A;  1V54 B;  1HP8 A;  2B9Z A;  3ZN0 A;  1J95 A;  2EBO A;  3RW0 A;  2Z5U A;  4I7Z B;  1R1B A;  4RUE A;  4I50 B;  4TUY B;  4LFA O;  1IDS A;  5A2Q N;  4PA4 A;  2BCC H;  1XMO O;  1N36 O;  3TCU A;  1MOF A;  2HG5 C;  2P7T C;  1WPB A;  2OCC B;  3QVN A;  2YIC A;  4PA3 A;  1WNS A;  3D3Q A;  3ZRV A;  1VF6 A;  5FLX N;  5GTH Z;  1IBK O;  2UUA O;  2CH7 B;  3DSQ A;  3FKS G;  3FAV B;  1VQ5 V;  5JCO A;  3CC4 V;  2JS3 A;  2JRI A;  2E74 B;  2OWO A;  3RFR A;  1WA8 A;  1PP9 H;  1K3E A;  4JAS A;  4CH4 A;  1SF9 A;  2UXX A;  4HBN A;  4I5S A;  4QIW F;  1JX9 A;  3EVK A;  2UXC O;  1W0K G;  3ASO C;  3IC7 A;  1VMG A;  1N33 O;  2JK5 C;  4ZKI A;  1VQN V;  1YIJ V;  1QLN A;  3L72 H;  1CEZ A;  1J5E B;  3AG2 C;  5IYC O;  5IYZ B;  4FLV A;  4GX2 A;  4FK5 C;  3UCS C;  1IVS A;  2W6I G;  4EKW A;  1W2B U;  2DQ0 A;  1GRJ A;  1NVP D;  4DV0 B;  1XIL A;  3OD4 A;  3BY6 A;  2YEV B;  3CXC U;  1THZ A;  4TV9 B;  3UT5 A;  4CS3 A;  2PYL A;  3VBB A;  1EZV H;  2IM9 A;  1Y66 A;  4JAV A;  4FMT A;  4I55 B;  1EN5 A;  5H5N A;  1AP6 A;  2K9P A;  2Q7G A;  2Y0I A;  3ZHT A;  5L3B A;  5LOV B;  4JI5 O;  1SA0 B;  1S5H C;  2JEU A;  3H1J H;  2B1I A;  5IYD O;  3UQ8 A;  3HKB A;  4GKJ O;  2VQE B;  2QWP B;  4JYC A;  4U7N A;  1GH6 A;  4JI6 B;  1F4M A;  5KA5 A;  4X1Y B;  4E4E A;  3SDL A;  3LSQ A;  3ZHV A;  2MW2 B;  4DV4 O;  4DV7 O;  3ASO B;  4J7J A;  3QO5 A;  5LGT A;  2M6Y A;  5EYP B;  3IAY A;  2PZS A;  1VQL V;  5FNV A;  4FLT A;  3APO A;  3ZBH A;  3AG2 B;  3OGC C;  4XDK A;  3R65 A;  3P3P A;  2QTO A;  3K59 A;  3CXH F;  1JJO A;  3A0B Z;  4YJ2 B;  3KCY A;  1KC8 W;  5EBW C;  4W4K A;  2ZNI A; 
#chains in the Genus database with same CATH homology
 2H3O A;  2LJ2 A;  1WAZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...