1WAZA

Nmr structure determination of the bacterial mercury transporter, merf, in micelles
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
b'TPVLVILLGVVGLSALTGYLDYVLLPALAIFIGLTIYAIQRKRQAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MERF
publication title NMR Structure Determination of a Membrane Protein with Two Transmembrane Helices in Micelles: Merf of the Bacterial Mercury Detoxification System
pubmed doi rcsb
source organism Morganella morganii
molecule tags Transport protein
total genus 13
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2004-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11431 Transport_MerF Membrane transport protein MerF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.910 Mainly Alpha Orthogonal Bundle Helix Hairpins bacterial mercury transporter, merf 1wazA00
2LJ2A 1WAZA 2H3OA
chains in the Genus database with same CATH superfamily
4C7UA 4G28B 3JARA 1PD3A 2LFRA 3ASNC 3HKDB 4KL1A 5B1AB 1NR7A 4U7NA 1DLBA 3IJ4A 3G6BA 1JX9A 4QIWF 1L0NH 1AI6A 1NJIW 4K35A 4DR3B 5IJ9B 1BGYH 3CEIA 4N23A 2IH3C 1VF6C 3BFRA 2LGWA 4NYKA 4YJ3A 4J7JA 2EX3A 4TT3G 4JF3A 5H5NA 1I5XA 1WP7A 2OIGA 2XOKG 4EB6A 2D3OW 5JH7B 4K0KO 1SZTA 5FPRA 1MNGA 5KA6A 2LP7A 4N21A 3JASB 1Q90D 3TETA 2UUAB 2HP8A 3ZJZA 1Q6IA 3ABLC 1M5IA 2ZQMA 3CSXA 5LP6C 1QR9A 3CJHB 2RQ6A 2YEVB 2UXNA 1P7GA 2NLJC 1IX9A 1YTFB 1HWYA 5LL6Y 1UJWB 2KKWA 2BE3A 2YS8A 3JD2A 5J2TA 2BSKB 5B1AC 4DO2A 3F5TA 1PL4A 2XAJA 3U0ZA 3E2EA 3GVMA 5KMGA 5IJ0A 3CRQA 2ETNA 4DR1O 2X6AA 1JQ0A 3FB5C 2P22C 1JJ2U 1F4NA 2QWQB 1YJWV 4HAMA 4X8AA 1VF5B 4TSFG 2GSMB 3FD9A 3JSLA 3FYEB 4GX5A 3L75H 3RYCB 4K0KB 2X0LA 4WFFA 2EILB 2FB5A 1VMGA 2DWEC 1OV9A 2ATKC 2LW1A 4X88A 2EBOA 3CXHF 4ZBMA 1BZKA 1NQTA 3ZRVA 2FL4A 2PGGA 3SPCA 2WLHA 4YJ2A 4H33A 2NR5A 1NU1H 2RJZA 1SQXH 1PP9H 3HPLC 4B3RO 3N2GA 4KXRA 3I56V 2JGDA 2P4KA 2V7QG 3B8NA 4JYCA 3QVNA 3UO2A 3CXCU 2H94A 3T4DA 4UUJC 2WLIB 1Q7YW 1FJGO 2A9HA 2ITDC 2G38A 4WFHA 2ZNIA 1XUQA 4O2BB 5BR8O 4UV9A 3HR0A 1J5EO 2GTAA 2N05A 4DR1B 1DK1A 3THOA 1SESA 1AJQA 1BCCH 2F95B 5GONA 4I50A 4QE7A 5J2UA 3RYIA 3BA9A 4QNHB 1FXKA 3SDLA 1P7BA 4O4JA 1QBZA 1X59A 4UVCA 1F23A 1FFTB 4G2KA 3E89A 4CH5A 2Q0OC 1W0KG 4BW5A 4JTAB 1V55B 4O4LB 2EILC 2VQEO 3G80A 3T4ZA 2UXBO 2ZD9A 2BTQB 1Y66A 1FD9A 2PYJA 2Z5UA 3S3WA 4H0LB 5DN6G 2QWPB 2WAMA 2JEUA 1P49A 5IY5B 4DW0A 1S5JA 4U3FH 3W7WA 4WFEA 2W6IG 3L72H 4LFAO 1SQVH 2HKOA 4BIOA 1SQGA 1RSOB 4K8XA 1NR1A 2AHYA 2Y0IA 4NXMO 2QM7A 1IVSA 1SC5B 1S77D 1OCRB 1NT2B 2ODMA 5GW7A 3SJAC 4WFAV 3APQA 1A32A 4GCZA 4D7SA 1YJNV 4I5SA 4GKKB 3FB6C 2D2CB 1B6QA 3K58A 2F23A 3JD4A 4CS3A 3ZN1A 1AP5A 2EJ7A 4JPRA 3AK2A 1IURA 2FMLA 1SA0A 1G8MA 4GYCB 3AG4C 3CCJV 4D7TA 5EK0A 1KECA 4FMTA 1MSDA 4J80A 4I7ZB 1NTKH 2VQEB 4DV1O 1E1QG 4BIZA 2UXBB 4JZ2A 3OMIB 4Z2WA 4Z1VA 4TV8B 1V55C 2QWOB 3W7UA 5K1XA 4MSWC 4JI1O 1S0VA 4GX0A 4KP4A 2QDOA 5EIBC 3RT3C 2QSAA 3FKSG 5LYJA 3KZIZ 4JTDB 4LFAB 4LH6A 3I5DA 4MT8A 4PA3A 4NXMB 5KUKA 1QNMA 1FFXA 1SQPH 3DGEA 5LOVB 4X20B 3ZS8C 2ZNJA 3C3SA 4UCOA 4B7KA 4JZGA 2PTMA 1HNXO 1THZA 1F4MA 1XDCA 5FNVB 3ZBHA 1MZEA 1GO3F 2IW5A 5JJEB 3SYPA 1Q82W 4PDVA 1D2DA 5EZYB 3T1HO 4GX1A 3U10A 1GK9A 4R6ZA 3CP1A 3SPIA 5ITZA 4O2AB 3GWKC 3WB0A 2H8PC 3LNMB 5L3BA 4JAVA 2WLJA 4FM2A 4DRXB 5B3SB 1R3JC 4DV1B 3K0GA 5L3FA 5K1PA 2UXXA 1GN3A 3JARB 4UVBA 1H2MA 1AP6A 3T1YO 1B06A 4JI1B 5LXTA 1JMKC 3G67A 4I55A 3RN4A 3K06A 3K5MA 2NNUA 1FAFA 1SQQH 1J95A 2IJJA 1WB8A 4FIPC 5JWPA 4JI7O 3QO8A 2QKSA 3B8MA 4FFBA 4DUYO 3K57A 3LNNA 3T2MA 3L73H 4LNUB 2FYUH 2B9ZA 4DV7O 4B3SB 2UXCB 1S3JA 3OUFA 2QEXV 3JCUZ 1HNXB 2PYLA 1YEWA 2DYSB 4EEQA 3CCSV 1YDXA 3IC9A 4MW3A 3G6EV 3A8TA 3UCSC 3L74H 3ZHQA 3T1HB 5JCOC 3UT5A 4BR6A 3NR7A 1K8AW 4JI6O 1S5LZ 4KUMA 4O4HA 1TUBA 3E83A 2ZE5A 2YXYA 4FZ0A 2HFEC 2WLLA 4LF9O 5DM6V 3C90A 5EBMC 3LSUA 3T1YB 3MHHC 1VP7A 4DR7O 1YJ9V 3UO3A 2OT5A 2OCHA 1RPOA 2VQFB 3MDSA 4RO2A 2B1GA 1R73A 5J2TB 4B3MB 1NZ6A 3SPHA 1BQ0A 5D5PA 2Z0AA 2RN9A 3G4SV 4FLTA 2CTQA 1KMIZ 1B04A 4JI7B 4UB6Z 3JALB 4IYIA 5LMNO 4DUYB 1VIBA 1GH6A 1Z2GA 5BXZA 2GUZA 4DV7B 4DR2O 4HNAB 1VQ5V 2JIZG 2VWKA 1QVGU 5E79Z 4O4IB 5EBLC 1GMGA 1ZX3A 2A7WA 4J11A 3W7XA 4DUZO 3K5LA 2DN9A 4X1KA 4X89A 1US6A 4JI6B 3AG1B 2ZE8A 5CBGA 2ZE6A 2AW9A 2ILMA 1YTFD 3N2KB 3GWOA 2R70A 2WLKA 4PDMA 3F5WC 1YVWA 1BHAA 1M57B 5BZBA 3STLC 3OR7C 4UXNA 5A2QN 3K79A 5CA1A 3ETGA 2DJVA 4IL6Z 2Q4PA 1XNRO 3H1KH 4PA6A 3BABA 3VQXA 2RMKB 4YJ2B 3CC7V 2QWNB 3CRMA 4DR7B 3P32A 4J10A 3RYFA 3ZMZA 4YIPA 3SGIA 2EINB 3OMNB 1F51A 1GKFA 4MVUA 4AHCA 1ROPA 2IU3A 4NTXA 5F2VO 5LMNB 3ABLB 4MVSA 1PNMA 4DR2B 1MOFA 4GZRB 4UCSA 1TVKB 3EHBB 3B40A 2DYRB 4JAUA 4PHZA 1R6TA 4LF6B 4CC5A 1L0LH 5J2UB 3JSNA 3RYIB 1R1BA 1K97A 3ZRXA 2ADPA 1FXKB 4DUZB 2HVKC 4AQYO 4I9WA 3IGAC 3NXSA 2A79B 3F7VC 5DEDA 2DMXA 1E1RG 3A2FA 5JJNB 3AG1C 1R6KA 2QGNA 1WPBA 4YHHB 5EBWC 2AGAA 3FX7A 1M57C 1BHBA 2QWRB 2VS0A 4MS2A 2UU9B 4D6TH 2PY5A 3K5NA 3JYCA 4IIJA 4YXWG 1H2GA 5C8YA 1YZBA 4DK0A 1RPRA 2LGQA 1H38A 5D5QA 2WA3A 4TV9B 3SJQC 2EINC 2Q7EA 1G6UA 3AK3A 4P9OA 3GB7C 1DTOA 3RVYA 3JAKA 4LF5B 5KHJA 5KHGA 1GM7A 2JS3A 5BMVA 1VQ9V 4X1YA 1DF5A 3B77A 2EJRA 5EIBD 2YSUB 2DYRC 4PA9A 4AQYB 3QG5A 4JI2O 4WFBV 1SA0B 1HDJA 4DR6O 4UCVA 4KFMA 5CBFA 2KG7B 4LFCO 2BOBC 3CB2A 3JAWA 4JGSA 1FXKC 4U3JA 5A9GA 4GUNA 5LGUA 4CS4A 2RNBA 3JD0A 3SPJA 4I4TA 1K5QA 2HVJC 4NTYA 3FAVA 1ZSPA 1MZFA 1EBOA 5KLVH 2QJ1A 4JI8O 3KCXA 5E1AC 4LF7O 2F43G 5LYJB 4CZZA 1QQCA 2IJHA 3EXAA 3ABKB 1M93A 4IHJA 2DW4A 4ZHQA 4HZ3A 1R3KC 5KX5A 3CMAV 3ZHVA 2GV9A 1WNSA 1UPGA 1Y74A 3ZCCA 3N27A 2A0LA 5C93A 1ZL8B 2OYQA 3E8BA 3VOUA 1I08A 4P2ZA 1YI2V 3I55V 4DV6O 1WA8A 4JI2B 1N32O 4DR6B 5ITZB 1KBHA 2CTRA 1VQLV 2GHYA 2QTSA 2F93B 1YXBA 1P4RA 4I0XA 1BT8A 4LWSA 3J80N 1D5NA 2IBZH 4JI3O 1KKDA 3K9SA 4XDJA 5LXTB 4JI8B 3ZX6A 3ZRWA 4I55B 1Q86W 4LF7B 3HKCA 2ZE7A 4U7OA 3JATA 3JCZA 5L3EA 1VQMV 3AG4B 3K5OA 5IWAO 4JI4O 4TUYB 2IJKA 3DTUB 3E8FA 1MABG 4FFBB 2QR4A 4CC6A 2CGNA 4FVMA 3ABKC 3BPZA 4JI0O 3WB1A 5KHIA 1OCOB 1NH2B 5IDJA 2Y69C 1RP3B 2L6LA 1XILA 1AB3A 4NKGB 2ITCC 4DV6B 3A0RA 3APOA 3UT5B 3CCEV 1N32B 4QPJA 1IBKO 2OCCB 2WWWA 4I9QA 3Q4HA 1WLEA 1MSWD 3L71H 4B3RB 1EN4A 2YC0A 2EIJC 2EIKC 4WFGA 2WLLB 2CGOA 2IU0A 2BCCH 2BTOA 1BS3A 1FJGB 2PI4A 4RQEA 1IBLO 4JI3B 3H1JH 5GTHZ 2VWJA 4BWAA 5LHGA 2EULA 3O9OA 5BR8B 5KHKA 2XUMA 1XHXA 1XHZA 5CA3A 1J5EB 1VQOV 1WAZA 4NXNO 1ZAUA 1AJPA 4Q20A 3PN1A 1MMMA 5B5EZ 5IYZA 5IWAB 4JI4B 4X62O 4OXSA 3RGBA 1H2SB 1P84F 4PDLA 1LNQA 2GUZB 4HBNA 4JI0B 3QF7A 1AR4A 5JH7A 4AILC 3TK1A 2E5LO 3OTFA 2JS5A 3O65A 2UXDO 2Y48A 4W4KA 1CXZB 3SPGA 4B3TO 3JASA 2N04A 1WB7A 2HHHO 1GN2A 2QTOA 3ETQA 3ETDA 2ZIOA 2EZOA 1Q81W 1OCOC 1HP8A 2ZR2A 2Q67A 5B1NA 3CJHA 2YIBA 4X1KB 2E74B 3P3NA 2YEVA 3CYOA 2MW2B 5CA0A 1R6NA 3CRRA 4LF8O 3M7MX 4BAYA 3D3QA 5CA1B 4J7ZA 1ZLZA 2OCCC 3RW0A 3UQ8A 4X1IA 1BSMA 3S3XA 1IDSA 2BSKA 4X64O 4FLUA 1IBLB 2V1DA 1Q5OA 1QU7A 2M7WA 2ZINA 3DC5A 2Q68A 5KAFZ 2XASA 1L1FA 3WG7C 1GAXA 4NTWA 4P9PA 5GTIZ 4YY3O 1N4CA 4LC1A 1K34A 2XTAA 4NXNB 1SQBH 4MVOA 1BMFG 1CEZA 2YXLA 3CCQV 3DSQA 3WU2Z 4X62B 1KKCA 1XMOO 2Q0AA 3RYCA 1G1XB 3CRCA 1XL4A 3BEHA 2PZSA 3JD3A 2Q5ZA 4MTXA 1HR0O 4K8ZA 4F4LA 2IH1C 1U97A 1N0JA 3W7SA 1AI4A 1B3QA 1AI7A 1AI5A 2JK5C 2GDSA 4MTFA 5H9CA 4LF8B 3UKMA 1D5AA 5EC1C 4H13B 5JJJB 3UM7A 3ZMUA 5LGNA 3CE2A 4CH3A 4UCTA 1MG1A 1EZVH 4X64B 2WLIA 3VQVA 3P30A 3DXRA 3HKEA 2P6JA 3RFRA 5LHIA 4FM0A 4PV1B 4ASUG 4WF9V 4FLWA 4YJ3B 1K33A 1H8HG 4JYAO 1I94O 1N36O 4O2BA 4YY3B 2V4DA 2O57A 1VQ8V 5C8YB 2FKXA 3ML0A 4DR4O 4FJCC 4AI8A 1VQ7V 4LR3A 1KU9A 4EB6B 2Q6AA 3C3TA 1XMOB 3VQYA 3E22A 3MD0A 1FYJA 2X7RB 1IBMO 1EM1A 2KQXA 3JAKB 4R7CA 2LJ2A 3CCLV 3SYAA 1PM9A 4XBFA 5BMVB 4X1YB 1I7FA 2L35A 5HFLA 1LR1A 2HJDA 1QVFU 1PKXA 4FLXA 1XBLA 3ABUA 2ADQB 1AILA 3HB3B 3U11A 2YIAA 2BTQA 2DQ3A 2Q7GA 4CH6A 5IYDO 3D8CA 3JAWB 2ZT9B 3SR2C 1EZJA 3F7YC 4DV3O 1GRJA 4DYLA 1F7YA 1JVMA 2Z3YA 1HW7A 1GN4A 2Q8VA 1SQFA 2CDYA 4I4TB 2JEXA 3TJTA 1GM9A 4H44B 1MA1A 3TCUA 1OCZB 3OAAG 2WPDG 3IC7A 4PA7A 5KMGB 1Q3EA 2R9IA 2JGUA 3A0BZ 4JTCB 4X9QA 5IJ0B 3WB2A 4JYAB 1N36B 3SYCA 2OTLV 4DR4B 4P30A 1JJOA 1SZXA 2JRIA 3BHPA 4GT1A 5IYCO 1QCEA 2RDCA 3SJCC 1URFA 1SKVA 1I5YA 5B1OA 1WJZA 2PF4E 3STZC 2YICA 2R9AA 1N33O 3SJBC 5CMUA 1JCHA 3TXSA 1EN5A 5JQGA 1WA8B 2LQTA 4LF9B 3CHXA 3CCRV 1VQNV 1QLNA 2AZ0A 1XREA 1R3LC 1BQZA 1K4CC 2XAFA 2W0XA 3H1LH 1PV0A 3LDCA 3N2GB 4DV3B 2F1MA 1NVPB 2JGDB 2P90A 4CH4A 4QJFB 1JFFA 2CAZC 3OMAB 2CUGA 3D36A 5EYPA 2ZR3A 2B1IA 1G4YB 3RYHA 1M56C 4LWSB 2F66C 1SERA 1K3EA 1IXMA 3KG2A 3ZMTA 3MAQA 1FS0G 4E2LA 4MTGA 3ZHTA 1FXHA 4MTOA 4X65O 4ZOLA 5JVDA 1V9PA 3ZIAG 3JATB 1NKDA 3FB7C 4X20A 3ZHRA 1L8DA 1OCZC 1SS3A 1K9MW 2C2AA 5GONB 4I50B 4WBNA 2K9PA 1OJHA 3R65A 4R50A 4GLXA 1DGSA 2A3QA 3AG2B 1YSCA 3H1IH 4O4JB 2ZIMA 5EZYA 1K7DA 4RUFA 3KKYA 5LBQA 3CX5F 1N33B 4OGQB 4K3AA 4EFEA 2E3CA 3BRCA 4NVPA 1N34O 1Y76A 5FL7G 1SETA 1H2KA 1XNRB 1W2BU 1AR1B 2X6CA 1X4TA 4DV2O 4TQFA 1YCIA 3QTCA 3Q4HB 1H8EG 1ENVA 1VQKV 2XT9A 2AZ2A 2W0FC 4J9ZB 3VBBA 3OUSA 4RAIA 2P7TC 3ASOB 2JVDA 1FKAO 4X65B 5IT9N 3AG3B 4LNUA 1NH2D 1Q8IA 3RWRD 1VF7A 4FZ1A 4JYBA 3K0DA 5IYZB 2CH7A 3W7TA 4UB8Z 5LHHA 2ZDIA 3QNEA 3M99B 1YITV 2WLNA 4PELA 3ZRSA 3SYOA 3BA8A 3AG2C 1N34B 1TA8A 2LO1A 5IE9A 1RM1B 4KHPO 3AG7A 1M9NA 4DV2B 1IZ3A 2B5UA 1LUWA 5CA0B 4IGGA 1N8RW 4Z1MG 4PDRA 4NB5A 3IFXA 3ABMB 2XAQA 2H3OA 5CB4A 1YIJV 4X1IB 3LDEA 3TGUH 2UUCO 3OW2U 2R9RB 2KSDA 3CWBH 2Y69B 2ZM6O 2CK3G 1E79G 1NBMG 2CTWA 1FFXB 3JALA 4RWUA 3LUTB 4DV0O 3J7AU 4HNAA 2XAHA 2IM9A 3JAMN 4ICGA 3ASOC 1XMQO 2YI8A 4XDLA 1XNQO 4O4IA 1NI8A 3EFFK 1KP2A 3AG3C 3SYQA 5H2FZ 2EIJB 1VQ4V 1SRYA 1FXVA 2EIKB 1UFIA 1OCCB 3FFQA 4RUEA 5KA5A 3IAYA 3FYIB 4LFCB 4DR5O 2PI5A 4ZI7A 1BE3H 3N2KA 4WCEV 1S76D 4EFBA 4KHPB 3B09A 3TXQA 4DXWA 1SF9A 1VF6A 3QO5A 3FB8C 3K03A 1O9HA 1RM1C 4L8JA 2YIDA 5DECA 4UV8A 3A0HZ 4FK5C 4Q6GA 4QPKA 2UUCB 3K3WA 4PI2A 2OTJV 3CD6V 3ABMC 3AEIA 4FFKA 3DXRB 5LA6A 3HKEB 2ZM6B 3OEHG 2RCVA 3WFVA 1ZTEA 1RFYA 1XQ8A 1KQSU 5LP6A 2DWDC 4DV0B 5HFMA 1TVKA 4GKKO 1W0JG 3HKBA 1TUEB 1KUQA 1XMQB 1QHTA 1XNQB 3E8HA 4LFBO 3E22B 2WSSG 2DE0X 2BOCC 3KCYA 4F6RA 4O4HB 4B7EA 1JOYA 1ZUQA 4DR5B 2QA4V 1PNLA 3QO7A 1TUBB 3HKDA 1NS1A 2FTKA 1AVMA 1CP9A 1OCCC 3WG7B 3CCUV 1Y6XA 3M8AA 5EC2C 4JI5O 3CMEV 2Y4TA 2XAGA 2ARHA 2YUAA 3CC4V 5L3CA 5IJ9A 2P67A 2W6JG 1EFRG 3H9VA 2WLMA 1M4UA 2ZXWB 4PI0A 1DF4A 3P3PA 4LBEC 5IYBO 4G27B 3JD1A 1HNZO 1GTOA 3K08A 4UCUA 1U96A 1K73W 3CS5A 4TV9A 2XHBA 3B2EE 2CTPA 4YIOA 1CPYA 4PA4A 1XI1A 2GBOA 2YDEA 4X66O 3BCCH 2ZCEA 5CBHA 4A5UB 3OEEG 3J81N 4LFBB 2NN4A 2CE4A 4FLVA 3OE7G 3ZMSA 4GX2A 2A06H 3ZN0A 4J41A 1IBKB 4LCUC 1O9GA 1EN6A 2QKCA 2YXHA 3L70H 4DV4O 3ICXA 3K04A 2KG7A 1NTZH 5FPOA 2LFSA 4IYHA 3R66A 1JA8A 5JQGB 1TAEA 2Q69A 4OPHA 3X2QB 4JAAA 5H6QA 2HR3A 2YI9A 2PUSA 4JI5B 4J42A 1AROP 3RYFB 3LSQA 3CCMV 1JFFB 4J7KA 5B66Z 1R3IC 5EYPB 1WPXA 3RYHB 2OWOA 2M6YA 2R72A 3CPWU 3OTOO 1Y4MA 1COWG 2AHZA 1HNZB 2JJ2G 4OX9O 4LP8A 4QGPA 5IY5C 1XOUA 4CS2A 1JR9A 2ZXWC 4ZOLB 5JVDB 5BY1A 4DK1A 4DV5O 4B3SO 2UXCO 2E5LB 2UXDB 3PJSK 4PJ0Z 4B08A 4B3TB 1KB9F 4MVMA 1ZL8A 4X66B 4WBNB 2HHHB 1OCRC 1S72V 3VQWA 3BY6A 4QE9A 2UUBO 3BAAA 1WN7A 5J9PC 1IXBA 4DV4B 1NVPD 1VEWA 2JDIG 4R8CA 3E8GA 5LGTA 3E86A 1Y76B 4ABMA 2DOSA 1OZ0A 1NTMH 2Y4UA 2HJFC 3D3IA 4W4LA 1KD1W 4MW8A 2LW7A 4HYOA 2Q9LA 2QM8A 3OFNG 3X2QC 4LF4O 2VQFO 4IIJB 4RQFA 4FPPA 4OPAA 4B3MO 3LSSA 3OTOB 3ZEDA 4E4EA 1K4DC 2QE7G 4XDKA 1QLEB 5KUMA 5FLXN 4OX9B 2AXTZ 3D36C 4TUYA 2KB1A 3OGCC 5LMUO 2E76B 4TOIA 4FLZA 3LDDA 5B1BB 4JV5O 4DV5B 1PNKA 4TWKA 1T5EA 1PPJH 2QKAA 2VRZA 2CH7B 2Q7HA 1HR0B 4CBCA 4J9YB 4O4LA 4BW9A 2IJIA 4GKJO 3ZMVA 2HEPA 3H01A 2UUBB 1V54B 2P5OA 1W59A 2MK3A 3L9DA 4F6EA 1M56B 1VQ6V 2JJ1G 1Q6UA 1N0NA 1Q43A 4U3JB 1YHQV 3ETEA 3ZHUA 2F4VO 1PL0A 2HLDG 2Q73A 2Y0PA 4NR1A 3ZHSA 1Q6HA 2N74A 1GM8A 2EZPA 3FAVB 1RSOA 3T1CA 1H2LA 1WP8A 4JASA 5B3SC 1GN6A 4ZIBA 5CB4B 5AG2A 4LF4B 1I94B 5KHHA 2GTSA 3H1HH 4FM1A 3CC2V 3B4SA 4TQDA 2EIMB 4IHJB 4ZHQB 1KYOF 4L87A 4LH7A 4MVRA 3EVKA 5KX5B 4BIUA 2P06A 4UVAA 1Y74B 2X6BA 1HNWO 5LMUB 4MVQA 1OHHG 1Z5WA 1XEQA 1KP3A 2P4VA 1YF2A 1IBMB 4JV5B 5L3DA 1QLEC 2XNDG 1FPOA 4LF6O 2WA4A 3OM3B 3ASNB 1VQPV 4GKJB 2YIBD 5B1BC 4MVZA 1K92A 1TGOA 1I0HA 3CCVV 2DYSC 1Z5VA 4JYYA 5H6RA 5TISZ 4TV8A 2ZDIC 4ZI7B 3OGIB 4IT5A 2F4VB 2ZKOA 1V54C 4I0XB 1XL6A 1LUVA 5KAIZ 4YHHO 1AJNA 3RBZA 1VARA 1KC8W 4DW1A 3CRAA 4DR3O 1M90W 1AR5A 3G71V 3ZRWB 2DQ0A 2HG5C 3E35A 2UU9O 3HKCB 4UCRA 5LOVA 2OIEA 3DC6A 5JCOA 4H37A 1BL8A 1M1KW 3RVZA 1S5HC 3K59A 5FNVA 5LA6B 3K9AA 3OT7A 5CN0A 1JPXA 1H2NA 1HNWB 3ABTA 1ZWIC 2EIMC 1ORQC 4UFZA 4ZKIA 5LP6B 2K1EA 2QM4A 1K5SA 3HKBB 3BVOA 1QR8A 4FLYA 2UUAO 4O2AA 4LF5O 4EKWA 3OR6C 2E75B 3AK1A 3OD4A 1Y67A 3MHSC 4DRXA 4F6RB 5L3GA 4PD4F
chains in the Genus database with same CATH topology
2LJ2A 1WAZA 2H3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJ2 A;  1WAZ A;  2H3O A; 
#chains in the Genus database with same CATH topology
 4C7U A;  4G28 B;  3JAR A;  1PD3 A;  2LFR A;  3ASN C;  3HKD B;  4KL1 A;  5B1A B;  1NR7 A;  4U7N A;  1DLB A;  3IJ4 A;  3G6B A;  1JX9 A;  4QIW F;  1L0N H;  1AI6 A;  1NJI W;  4K35 A;  4DR3 B;  5IJ9 B;  1BGY H;  3CEI A;  4N23 A;  2IH3 C;  1VF6 C;  3BFR A;  2LGW A;  4NYK A;  4YJ3 A;  4J7J A;  2EX3 A;  4TT3 G;  4JF3 A;  5H5N A;  1I5X A;  1WP7 A;  2OIG A;  2XOK G;  4EB6 A;  2D3O W;  5JH7 B;  4K0K O;  1SZT A;  5FPR A;  1MNG A;  5KA6 A;  2LP7 A;  4N21 A;  3JAS B;  1Q90 D;  3TET A;  2UUA B;  2HP8 A;  3ZJZ A;  1Q6I A;  3ABL C;  1M5I A;  2ZQM A;  3CSX A;  5LP6 C;  1QR9 A;  3CJH B;  2RQ6 A;  2YEV B;  2UXN A;  1P7G A;  2NLJ C;  1IX9 A;  1YTF B;  1HWY A;  5LL6 Y;  1UJW B;  2KKW A;  2BE3 A;  2YS8 A;  3JD2 A;  5J2T A;  2BSK B;  5B1A C;  4DO2 A;  3F5T A;  1PL4 A;  2XAJ A;  3U0Z A;  3E2E A;  3GVM A;  5KMG A;  5IJ0 A;  3CRQ A;  2ETN A;  4DR1 O;  2X6A A;  1JQ0 A;  3FB5 C;  2P22 C;  1JJ2 U;  1F4N A;  2QWQ B;  1YJW V;  4HAM A;  4X8A A;  1VF5 B;  4TSF G;  2GSM B;  3FD9 A;  3JSL A;  3FYE B;  4GX5 A;  3L75 H;  3RYC B;  4K0K B;  2X0L A;  4WFF A;  2EIL B;  2FB5 A;  1VMG A;  2DWE C;  1OV9 A;  2ATK C;  2LW1 A;  4X88 A;  2EBO A;  3CXH F;  4ZBM A;  1BZK A;  1NQT A;  3ZRV A;  2FL4 A;  2PGG A;  3SPC A;  2WLH A;  4YJ2 A;  4H33 A;  2NR5 A;  1NU1 H;  2RJZ A;  1SQX H;  1PP9 H;  3HPL C;  4B3R O;  3N2G A;  4KXR A;  3I56 V;  2JGD A;  2P4K A;  2V7Q G;  3B8N A;  4JYC A;  3QVN A;  3UO2 A;  3CXC U;  2H94 A;  3T4D A;  4UUJ C;  2WLI B;  1Q7Y W;  1FJG O;  2A9H A;  2ITD C;  2G38 A;  4WFH A;  2ZNI A;  1XUQ A;  4O2B B;  5BR8 O;  4UV9 A;  3HR0 A;  1J5E O;  2GTA A;  2N05 A;  4DR1 B;  1DK1 A;  3THO A;  1SES A;  1AJQ A;  1BCC H;  2F95 B;  5GON A;  4I50 A;  4QE7 A;  5J2U A;  3RYI A;  3BA9 A;  4QNH B;  1FXK A;  3SDL A;  1P7B A;  4O4J A;  1QBZ A;  1X59 A;  4UVC A;  1F23 A;  1FFT B;  4G2K A;  3E89 A;  4CH5 A;  2Q0O C;  1W0K G;  4BW5 A;  4JTA B;  1V55 B;  4O4L B;  2EIL C;  2VQE O;  3G80 A;  3T4Z A;  2UXB O;  2ZD9 A;  2BTQ B;  1Y66 A;  1FD9 A;  2PYJ A;  2Z5U A;  3S3W A;  4H0L B;  5DN6 G;  2QWP B;  2WAM A;  2JEU A;  1P49 A;  5IY5 B;  4DW0 A;  1S5J A;  4U3F H;  3W7W A;  4WFE A;  2W6I G;  3L72 H;  4LFA O;  1SQV H;  2HKO A;  4BIO A;  1SQG A;  1RSO B;  4K8X A;  1NR1 A;  2AHY A;  2Y0I A;  4NXM O;  2QM7 A;  1IVS A;  1SC5 B;  1S77 D;  1OCR B;  1NT2 B;  2ODM A;  5GW7 A;  3SJA C;  4WFA V;  3APQ A;  1A32 A;  4GCZ A;  4D7S A;  1YJN V;  4I5S A;  4GKK B;  3FB6 C;  2D2C B;  1B6Q A;  3K58 A;  2F23 A;  3JD4 A;  4CS3 A;  3ZN1 A;  1AP5 A;  2EJ7 A;  4JPR A;  3AK2 A;  1IUR A;  2FML A;  1SA0 A;  1G8M A;  4GYC B;  3AG4 C;  3CCJ V;  4D7T A;  5EK0 A;  1KEC A;  4FMT A;  1MSD A;  4J80 A;  4I7Z B;  1NTK H;  2VQE B;  4DV1 O;  1E1Q G;  4BIZ A;  2UXB B;  4JZ2 A;  3OMI B;  4Z2W A;  4Z1V A;  4TV8 B;  1V55 C;  2QWO B;  3W7U A;  5K1X A;  4MSW C;  4JI1 O;  1S0V A;  4GX0 A;  4KP4 A;  2QDO A;  5EIB C;  3RT3 C;  2QSA A;  3FKS G;  5LYJ A;  3KZI Z;  4JTD B;  4LFA B;  4LH6 A;  3I5D A;  4MT8 A;  4PA3 A;  4NXM B;  5KUK A;  1QNM A;  1FFX A;  1SQP H;  3DGE A;  5LOV B;  4X20 B;  3ZS8 C;  2ZNJ A;  3C3S A;  4UCO A;  4B7K A;  4JZG A;  2PTM A;  1HNX O;  1THZ A;  1F4M A;  1XDC A;  5FNV B;  3ZBH A;  1MZE A;  1GO3 F;  2IW5 A;  5JJE B;  3SYP A;  1Q82 W;  4PDV A;  1D2D A;  5EZY B;  3T1H O;  4GX1 A;  3U10 A;  1GK9 A;  4R6Z A;  3CP1 A;  3SPI A;  5ITZ A;  4O2A B;  3GWK C;  3WB0 A;  2H8P C;  3LNM B;  5L3B A;  4JAV A;  2WLJ A;  4FM2 A;  4DRX B;  5B3S B;  1R3J C;  4DV1 B;  3K0G A;  5L3F A;  5K1P A;  2UXX A;  1GN3 A;  3JAR B;  4UVB A;  1H2M A;  1AP6 A;  3T1Y O;  1B06 A;  4JI1 B;  5LXT A;  1JMK C;  3G67 A;  4I55 A;  3RN4 A;  3K06 A;  3K5M A;  2NNU A;  1FAF A;  1SQQ H;  1J95 A;  2IJJ A;  1WB8 A;  4FIP C;  5JWP A;  4JI7 O;  3QO8 A;  2QKS A;  3B8M A;  4FFB A;  4DUY O;  3K57 A;  3LNN A;  3T2M A;  3L73 H;  4LNU B;  2FYU H;  2B9Z A;  4DV7 O;  4B3S B;  2UXC B;  1S3J A;  3OUF A;  2QEX V;  3JCU Z;  1HNX B;  2PYL A;  1YEW A;  2DYS B;  4EEQ A;  3CCS V;  1YDX A;  3IC9 A;  4MW3 A;  3G6E V;  3A8T A;  3UCS C;  3L74 H;  3ZHQ A;  3T1H B;  5JCO C;  3UT5 A;  4BR6 A;  3NR7 A;  1K8A W;  4JI6 O;  1S5L Z;  4KUM A;  4O4H A;  1TUB A;  3E83 A;  2ZE5 A;  2YXY A;  4FZ0 A;  2HFE C;  2WLL A;  4LF9 O;  5DM6 V;  3C90 A;  5EBM C;  3LSU A;  3T1Y B;  3MHH C;  1VP7 A;  4DR7 O;  1YJ9 V;  3UO3 A;  2OT5 A;  2OCH A;  1RPO A;  2VQF B;  3MDS A;  4RO2 A;  2B1G A;  1R73 A;  5J2T B;  4B3M B;  1NZ6 A;  3SPH A;  1BQ0 A;  5D5P A;  2Z0A A;  2RN9 A;  3G4S V;  4FLT A;  2CTQ A;  1KMI Z;  1B04 A;  4JI7 B;  4UB6 Z;  3JAL B;  4IYI A;  5LMN O;  4DUY B;  1VIB A;  1GH6 A;  1Z2G A;  5BXZ A;  2GUZ A;  4DV7 B;  4DR2 O;  4HNA B;  1VQ5 V;  2JIZ G;  2VWK A;  1QVG U;  5E79 Z;  4O4I B;  5EBL C;  1GMG A;  1ZX3 A;  2A7W A;  4J11 A;  3W7X A;  4DUZ O;  3K5L A;  2DN9 A;  4X1K A;  4X89 A;  1US6 A;  4JI6 B;  3AG1 B;  2ZE8 A;  5CBG A;  2ZE6 A;  2AW9 A;  2ILM A;  1YTF D;  3N2K B;  3GWO A;  2R70 A;  2WLK A;  4PDM A;  3F5W C;  1YVW A;  1BHA A;  1M57 B;  5BZB A;  3STL C;  3OR7 C;  4UXN A;  5A2Q N;  3K79 A;  5CA1 A;  3ETG A;  2DJV A;  4IL6 Z;  2Q4P A;  1XNR O;  3H1K H;  4PA6 A;  3BAB A;  3VQX A;  2RMK B;  4YJ2 B;  3CC7 V;  2QWN B;  3CRM A;  4DR7 B;  3P32 A;  4J10 A;  3RYF A;  3ZMZ A;  4YIP A;  3SGI A;  2EIN B;  3OMN B;  1F51 A;  1GKF A;  4MVU A;  4AHC A;  1ROP A;  2IU3 A;  4NTX A;  5F2V O;  5LMN B;  3ABL B;  4MVS A;  1PNM A;  4DR2 B;  1MOF A;  4GZR B;  4UCS A;  1TVK B;  3EHB B;  3B40 A;  2DYR B;  4JAU A;  4PHZ A;  1R6T A;  4LF6 B;  4CC5 A;  1L0L H;  5J2U B;  3JSN A;  3RYI B;  1R1B A;  1K97 A;  3ZRX A;  2ADP A;  1FXK B;  4DUZ B;  2HVK C;  4AQY O;  4I9W A;  3IGA C;  3NXS A;  2A79 B;  3F7V C;  5DED A;  2DMX A;  1E1R G;  3A2F A;  5JJN B;  3AG1 C;  1R6K A;  2QGN A;  1WPB A;  4YHH B;  5EBW C;  2AGA A;  3FX7 A;  1M57 C;  1BHB A;  2QWR B;  2VS0 A;  4MS2 A;  2UU9 B;  4D6T H;  2PY5 A;  3K5N A;  3JYC A;  4IIJ A;  4YXW G;  1H2G A;  5C8Y A;  1YZB A;  4DK0 A;  1RPR A;  2LGQ A;  1H38 A;  5D5Q A;  2WA3 A;  4TV9 B;  3SJQ C;  2EIN C;  2Q7E A;  1G6U A;  3AK3 A;  4P9O A;  3GB7 C;  1DTO A;  3RVY A;  3JAK A;  4LF5 B;  5KHJ A;  5KHG A;  1GM7 A;  2JS3 A;  5BMV A;  1VQ9 V;  4X1Y A;  1DF5 A;  3B77 A;  2EJR A;  5EIB D;  2YSU B;  2DYR C;  4PA9 A;  4AQY B;  3QG5 A;  4JI2 O;  4WFB V;  1SA0 B;  1HDJ A;  4DR6 O;  4UCV A;  4KFM A;  5CBF A;  2KG7 B;  4LFC O;  2BOB C;  3CB2 A;  3JAW A;  4JGS A;  1FXK C;  4U3J A;  5A9G A;  4GUN A;  5LGU A;  4CS4 A;  2RNB A;  3JD0 A;  3SPJ A;  4I4T A;  1K5Q A;  2HVJ C;  4NTY A;  3FAV A;  1ZSP A;  1MZF A;  1EBO A;  5KLV H;  2QJ1 A;  4JI8 O;  3KCX A;  5E1A C;  4LF7 O;  2F43 G;  5LYJ B;  4CZZ A;  1QQC A;  2IJH A;  3EXA A;  3ABK B;  1M93 A;  4IHJ A;  2DW4 A;  4ZHQ A;  4HZ3 A;  1R3K C;  5KX5 A;  3CMA V;  3ZHV A;  2GV9 A;  1WNS A;  1UPG A;  1Y74 A;  3ZCC A;  3N27 A;  2A0L A;  5C93 A;  1ZL8 B;  2OYQ A;  3E8B A;  3VOU A;  1I08 A;  4P2Z A;  1YI2 V;  3I55 V;  4DV6 O;  1WA8 A;  4JI2 B;  1N32 O;  4DR6 B;  5ITZ B;  1KBH A;  2CTR A;  1VQL V;  2GHY A;  2QTS A;  2F93 B;  1YXB A;  1P4R A;  4I0X A;  1BT8 A;  4LWS A;  3J80 N;  1D5N A;  2IBZ H;  4JI3 O;  1KKD A;  3K9S A;  4XDJ A;  5LXT B;  4JI8 B;  3ZX6 A;  3ZRW A;  4I55 B;  1Q86 W;  4LF7 B;  3HKC A;  2ZE7 A;  4U7O A;  3JAT A;  3JCZ A;  5L3E A;  1VQM V;  3AG4 B;  3K5O A;  5IWA O;  4JI4 O;  4TUY B;  2IJK A;  3DTU B;  3E8F A;  1MAB G;  4FFB B;  2QR4 A;  4CC6 A;  2CGN A;  4FVM A;  3ABK C;  3BPZ A;  4JI0 O;  3WB1 A;  5KHI A;  1OCO B;  1NH2 B;  5IDJ A;  2Y69 C;  1RP3 B;  2L6L A;  1XIL A;  1AB3 A;  4NKG B;  2ITC C;  4DV6 B;  3A0R A;  3APO A;  3UT5 B;  3CCE V;  1N32 B;  4QPJ A;  1IBK O;  2OCC B;  2WWW A;  4I9Q A;  3Q4H A;  1WLE A;  1MSW D;  3L71 H;  4B3R B;  1EN4 A;  2YC0 A;  2EIJ C;  2EIK C;  4WFG A;  2WLL B;  2CGO A;  2IU0 A;  2BCC H;  2BTO A;  1BS3 A;  1FJG B;  2PI4 A;  4RQE A;  1IBL O;  4JI3 B;  3H1J H;  5GTH Z;  2VWJ A;  4BWA A;  5LHG A;  2EUL A;  3O9O A;  5BR8 B;  5KHK A;  2XUM A;  1XHX A;  1XHZ A;  5CA3 A;  1J5E B;  1VQO V;  1WAZ A;  4NXN O;  1ZAU A;  1AJP A;  4Q20 A;  3PN1 A;  1MMM A;  5B5E Z;  5IYZ A;  5IWA B;  4JI4 B;  4X62 O;  4OXS A;  3RGB A;  1H2S B;  1P84 F;  4PDL A;  1LNQ A;  2GUZ B;  4HBN A;  4JI0 B;  3QF7 A;  1AR4 A;  5JH7 A;  4AIL C;  3TK1 A;  2E5L O;  3OTF A;  2JS5 A;  3O65 A;  2UXD O;  2Y48 A;  4W4K A;  1CXZ B;  3SPG A;  4B3T O;  3JAS A;  2N04 A;  1WB7 A;  2HHH O;  1GN2 A;  2QTO A;  3ETQ A;  3ETD A;  2ZIO A;  2EZO A;  1Q81 W;  1OCO C;  1HP8 A;  2ZR2 A;  2Q67 A;  5B1N A;  3CJH A;  2YIB A;  4X1K B;  2E74 B;  3P3N A;  2YEV A;  3CYO A;  2MW2 B;  5CA0 A;  1R6N A;  3CRR A;  4LF8 O;  3M7M X;  4BAY A;  3D3Q A;  5CA1 B;  4J7Z A;  1ZLZ A;  2OCC C;  3RW0 A;  3UQ8 A;  4X1I A;  1BSM A;  3S3X A;  1IDS A;  2BSK A;  4X64 O;  4FLU A;  1IBL B;  2V1D A;  1Q5O A;  1QU7 A;  2M7W A;  2ZIN A;  3DC5 A;  2Q68 A;  5KAF Z;  2XAS A;  1L1F A;  3WG7 C;  1GAX A;  4NTW A;  4P9P A;  5GTI Z;  4YY3 O;  1N4C A;  4LC1 A;  1K34 A;  2XTA A;  4NXN B;  1SQB H;  4MVO A;  1BMF G;  1CEZ A;  2YXL A;  3CCQ V;  3DSQ A;  3WU2 Z;  4X62 B;  1KKC A;  1XMO O;  2Q0A A;  3RYC A;  1G1X B;  3CRC A;  1XL4 A;  3BEH A;  2PZS A;  3JD3 A;  2Q5Z A;  4MTX A;  1HR0 O;  4K8Z A;  4F4L A;  2IH1 C;  1U97 A;  1N0J A;  3W7S A;  1AI4 A;  1B3Q A;  1AI7 A;  1AI5 A;  2JK5 C;  2GDS A;  4MTF A;  5H9C A;  4LF8 B;  3UKM A;  1D5A A;  5EC1 C;  4H13 B;  5JJJ B;  3UM7 A;  3ZMU A;  5LGN A;  3CE2 A;  4CH3 A;  4UCT A;  1MG1 A;  1EZV H;  4X64 B;  2WLI A;  3VQV A;  3P30 A;  3DXR A;  3HKE A;  2P6J A;  3RFR A;  5LHI A;  4FM0 A;  4PV1 B;  4ASU G;  4WF9 V;  4FLW A;  4YJ3 B;  1K33 A;  1H8H G;  4JYA O;  1I94 O;  1N36 O;  4O2B A;  4YY3 B;  2V4D A;  2O57 A;  1VQ8 V;  5C8Y B;  2FKX A;  3ML0 A;  4DR4 O;  4FJC C;  4AI8 A;  1VQ7 V;  4LR3 A;  1KU9 A;  4EB6 B;  2Q6A A;  3C3T A;  1XMO B;  3VQY A;  3E22 A;  3MD0 A;  1FYJ A;  2X7R B;  1IBM O;  1EM1 A;  2KQX A;  3JAK B;  4R7C A;  2LJ2 A;  3CCL V;  3SYA A;  1PM9 A;  4XBF A;  5BMV B;  4X1Y B;  1I7F A;  2L35 A;  5HFL A;  1LR1 A;  2HJD A;  1QVF U;  1PKX A;  4FLX A;  1XBL A;  3ABU A;  2ADQ B;  1AIL A;  3HB3 B;  3U11 A;  2YIA A;  2BTQ A;  2DQ3 A;  2Q7G A;  4CH6 A;  5IYD O;  3D8C A;  3JAW B;  2ZT9 B;  3SR2 C;  1EZJ A;  3F7Y C;  4DV3 O;  1GRJ A;  4DYL A;  1F7Y A;  1JVM A;  2Z3Y A;  1HW7 A;  1GN4 A;  2Q8V A;  1SQF A;  2CDY A;  4I4T B;  2JEX A;  3TJT A;  1GM9 A;  4H44 B;  1MA1 A;  3TCU A;  1OCZ B;  3OAA G;  2WPD G;  3IC7 A;  4PA7 A;  5KMG B;  1Q3E A;  2R9I A;  2JGU A;  3A0B Z;  4JTC B;  4X9Q A;  5IJ0 B;  3WB2 A;  4JYA B;  1N36 B;  3SYC A;  2OTL V;  4DR4 B;  4P30 A;  1JJO A;  1SZX A;  2JRI A;  3BHP A;  4GT1 A;  5IYC O;  1QCE A;  2RDC A;  3SJC C;  1URF A;  1SKV A;  1I5Y A;  5B1O A;  1WJZ A;  2PF4 E;  3STZ C;  2YIC A;  2R9A A;  1N33 O;  3SJB C;  5CMU A;  1JCH A;  3TXS A;  1EN5 A;  5JQG A;  1WA8 B;  2LQT A;  4LF9 B;  3CHX A;  3CCR V;  1VQN V;  1QLN A;  2AZ0 A;  1XRE A;  1R3L C;  1BQZ A;  1K4C C;  2XAF A;  2W0X A;  3H1L H;  1PV0 A;  3LDC A;  3N2G B;  4DV3 B;  2F1M A;  1NVP B;  2JGD B;  2P90 A;  4CH4 A;  4QJF B;  1JFF A;  2CAZ C;  3OMA B;  2CUG A;  3D36 A;  5EYP A;  2ZR3 A;  2B1I A;  1G4Y B;  3RYH A;  1M56 C;  4LWS B;  2F66 C;  1SER A;  1K3E A;  1IXM A;  3KG2 A;  3ZMT A;  3MAQ A;  1FS0 G;  4E2L A;  4MTG A;  3ZHT A;  1FXH A;  4MTO A;  4X65 O;  4ZOL A;  5JVD A;  1V9P A;  3ZIA G;  3JAT B;  1NKD A;  3FB7 C;  4X20 A;  3ZHR A;  1L8D A;  1OCZ C;  1SS3 A;  1K9M W;  2C2A A;  5GON B;  4I50 B;  4WBN A;  2K9P A;  1OJH A;  3R65 A;  4R50 A;  4GLX A;  1DGS A;  2A3Q A;  3AG2 B;  1YSC A;  3H1I H;  4O4J B;  2ZIM A;  5EZY A;  1K7D A;  4RUF A;  3KKY A;  5LBQ A;  3CX5 F;  1N33 B;  4OGQ B;  4K3A A;  4EFE A;  2E3C A;  3BRC A;  4NVP A;  1N34 O;  1Y76 A;  5FL7 G;  1SET A;  1H2K A;  1XNR B;  1W2B U;  1AR1 B;  2X6C A;  1X4T A;  4DV2 O;  4TQF A;  1YCI A;  3QTC A;  3Q4H B;  1H8E G;  1ENV A;  1VQK V;  2XT9 A;  2AZ2 A;  2W0F C;  4J9Z B;  3VBB A;  3OUS A;  4RAI A;  2P7T C;  3ASO B;  2JVD A;  1FKA O;  4X65 B;  5IT9 N;  3AG3 B;  4LNU A;  1NH2 D;  1Q8I A;  3RWR D;  1VF7 A;  4FZ1 A;  4JYB A;  3K0D A;  5IYZ B;  2CH7 A;  3W7T A;  4UB8 Z;  5LHH A;  2ZDI A;  3QNE A;  3M99 B;  1YIT V;  2WLN A;  4PEL A;  3ZRS A;  3SYO A;  3BA8 A;  3AG2 C;  1N34 B;  1TA8 A;  2LO1 A;  5IE9 A;  1RM1 B;  4KHP O;  3AG7 A;  1M9N A;  4DV2 B;  1IZ3 A;  2B5U A;  1LUW A;  5CA0 B;  4IGG A;  1N8R W;  4Z1M G;  4PDR A;  4NB5 A;  3IFX A;  3ABM B;  2XAQ A;  2H3O A;  5CB4 A;  1YIJ V;  4X1I B;  3LDE A;  3TGU H;  2UUC O;  3OW2 U;  2R9R B;  2KSD A;  3CWB H;  2Y69 B;  2ZM6 O;  2CK3 G;  1E79 G;  1NBM G;  2CTW A;  1FFX B;  3JAL A;  4RWU A;  3LUT B;  4DV0 O;  3J7A U;  4HNA A;  2XAH A;  2IM9 A;  3JAM N;  4ICG A;  3ASO C;  1XMQ O;  2YI8 A;  4XDL A;  1XNQ O;  4O4I A;  1NI8 A;  3EFF K;  1KP2 A;  3AG3 C;  3SYQ A;  5H2F Z;  2EIJ B;  1VQ4 V;  1SRY A;  1FXV A;  2EIK B;  1UFI A;  1OCC B;  3FFQ A;  4RUE A;  5KA5 A;  3IAY A;  3FYI B;  4LFC B;  4DR5 O;  2PI5 A;  4ZI7 A;  1BE3 H;  3N2K A;  4WCE V;  1S76 D;  4EFB A;  4KHP B;  3B09 A;  3TXQ A;  4DXW A;  1SF9 A;  1VF6 A;  3QO5 A;  3FB8 C;  3K03 A;  1O9H A;  1RM1 C;  4L8J A;  2YID A;  5DEC A;  4UV8 A;  3A0H Z;  4FK5 C;  4Q6G A;  4QPK A;  2UUC B;  3K3W A;  4PI2 A;  2OTJ V;  3CD6 V;  3ABM C;  3AEI A;  4FFK A;  3DXR B;  5LA6 A;  3HKE B;  2ZM6 B;  3OEH G;  2RCV A;  3WFV A;  1ZTE A;  1RFY A;  1XQ8 A;  1KQS U;  5LP6 A;  2DWD C;  4DV0 B;  5HFM A;  1TVK A;  4GKK O;  1W0J G;  3HKB A;  1TUE B;  1KUQ A;  1XMQ B;  1QHT A;  1XNQ B;  3E8H A;  4LFB O;  3E22 B;  2WSS G;  2DE0 X;  2BOC C;  3KCY A;  4F6R A;  4O4H B;  4B7E A;  1JOY A;  1ZUQ A;  4DR5 B;  2QA4 V;  1PNL A;  3QO7 A;  1TUB B;  3HKD A;  1NS1 A;  2FTK A;  1AVM A;  1CP9 A;  1OCC C;  3WG7 B;  3CCU V;  1Y6X A;  3M8A A;  5EC2 C;  4JI5 O;  3CME V;  2Y4T A;  2XAG A;  2ARH A;  2YUA A;  3CC4 V;  5L3C A;  5IJ9 A;  2P67 A;  2W6J G;  1EFR G;  3H9V A;  2WLM A;  1M4U A;  2ZXW B;  4PI0 A;  1DF4 A;  3P3P A;  4LBE C;  5IYB O;  4G27 B;  3JD1 A;  1HNZ O;  1GTO A;  3K08 A;  4UCU A;  1U96 A;  1K73 W;  3CS5 A;  4TV9 A;  2XHB A;  3B2E E;  2CTP A;  4YIO A;  1CPY A;  4PA4 A;  1XI1 A;  2GBO A;  2YDE A;  4X66 O;  3BCC H;  2ZCE A;  5CBH A;  4A5U B;  3OEE G;  3J81 N;  4LFB B;  2NN4 A;  2CE4 A;  4FLV A;  3OE7 G;  3ZMS A;  4GX2 A;  2A06 H;  3ZN0 A;  4J41 A;  1IBK B;  4LCU C;  1O9G A;  1EN6 A;  2QKC A;  2YXH A;  3L70 H;  4DV4 O;  3ICX A;  3K04 A;  2KG7 A;  1NTZ H;  5FPO A;  2LFS A;  4IYH A;  3R66 A;  1JA8 A;  5JQG B;  1TAE A;  2Q69 A;  4OPH A;  3X2Q B;  4JAA A;  5H6Q A;  2HR3 A;  2YI9 A;  2PUS A;  4JI5 B;  4J42 A;  1ARO P;  3RYF B;  3LSQ A;  3CCM V;  1JFF B;  4J7K A;  5B66 Z;  1R3I C;  5EYP B;  1WPX A;  3RYH B;  2OWO A;  2M6Y A;  2R72 A;  3CPW U;  3OTO O;  1Y4M A;  1COW G;  2AHZ A;  1HNZ B;  2JJ2 G;  4OX9 O;  4LP8 A;  4QGP A;  5IY5 C;  1XOU A;  4CS2 A;  1JR9 A;  2ZXW C;  4ZOL B;  5JVD B;  5BY1 A;  4DK1 A;  4DV5 O;  4B3S O;  2UXC O;  2E5L B;  2UXD B;  3PJS K;  4PJ0 Z;  4B08 A;  4B3T B;  1KB9 F;  4MVM A;  1ZL8 A;  4X66 B;  4WBN B;  2HHH B;  1OCR C;  1S72 V;  3VQW A;  3BY6 A;  4QE9 A;  2UUB O;  3BAA A;  1WN7 A;  5J9P C;  1IXB A;  4DV4 B;  1NVP D;  1VEW A;  2JDI G;  4R8C A;  3E8G A;  5LGT A;  3E86 A;  1Y76 B;  4ABM A;  2DOS A;  1OZ0 A;  1NTM H;  2Y4U A;  2HJF C;  3D3I A;  4W4L A;  1KD1 W;  4MW8 A;  2LW7 A;  4HYO A;  2Q9L A;  2QM8 A;  3OFN G;  3X2Q C;  4LF4 O;  2VQF O;  4IIJ B;  4RQF A;  4FPP A;  4OPA A;  4B3M O;  3LSS A;  3OTO B;  3ZED A;  4E4E A;  1K4D C;  2QE7 G;  4XDK A;  1QLE B;  5KUM A;  5FLX N;  4OX9 B;  2AXT Z;  3D36 C;  4TUY A;  2KB1 A;  3OGC C;  5LMU O;  2E76 B;  4TOI A;  4FLZ A;  3LDD A;  5B1B B;  4JV5 O;  4DV5 B;  1PNK A;  4TWK A;  1T5E A;  1PPJ H;  2QKA A;  2VRZ A;  2CH7 B;  2Q7H A;  1HR0 B;  4CBC A;  4J9Y B;  4O4L A;  4BW9 A;  2IJI A;  4GKJ O;  3ZMV A;  2HEP A;  3H01 A;  2UUB B;  1V54 B;  2P5O A;  1W59 A;  2MK3 A;  3L9D A;  4F6E A;  1M56 B;  1VQ6 V;  2JJ1 G;  1Q6U A;  1N0N A;  1Q43 A;  4U3J B;  1YHQ V;  3ETE A;  3ZHU A;  2F4V O;  1PL0 A;  2HLD G;  2Q73 A;  2Y0P A;  4NR1 A;  3ZHS A;  1Q6H A;  2N74 A;  1GM8 A;  2EZP A;  3FAV B;  1RSO A;  3T1C A;  1H2L A;  1WP8 A;  4JAS A;  5B3S C;  1GN6 A;  4ZIB A;  5CB4 B;  5AG2 A;  4LF4 B;  1I94 B;  5KHH A;  2GTS A;  3H1H H;  4FM1 A;  3CC2 V;  3B4S A;  4TQD A;  2EIM B;  4IHJ B;  4ZHQ B;  1KYO F;  4L87 A;  4LH7 A;  4MVR A;  3EVK A;  5KX5 B;  4BIU A;  2P06 A;  4UVA A;  1Y74 B;  2X6B A;  1HNW O;  5LMU B;  4MVQ A;  1OHH G;  1Z5W A;  1XEQ A;  1KP3 A;  2P4V A;  1YF2 A;  1IBM B;  4JV5 B;  5L3D A;  1QLE C;  2XND G;  1FPO A;  4LF6 O;  2WA4 A;  3OM3 B;  3ASN B;  1VQP V;  4GKJ B;  2YIB D;  5B1B C;  4MVZ A;  1K92 A;  1TGO A;  1I0H A;  3CCV V;  2DYS C;  1Z5V A;  4JYY A;  5H6R A;  5TIS Z;  4TV8 A;  2ZDI C;  4ZI7 B;  3OGI B;  4IT5 A;  2F4V B;  2ZKO A;  1V54 C;  4I0X B;  1XL6 A;  1LUV A;  5KAI Z;  4YHH O;  1AJN A;  3RBZ A;  1VAR A;  1KC8 W;  4DW1 A;  3CRA A;  4DR3 O;  1M90 W;  1AR5 A;  3G71 V;  3ZRW B;  2DQ0 A;  2HG5 C;  3E35 A;  2UU9 O;  3HKC B;  4UCR A;  5LOV A;  2OIE A;  3DC6 A;  5JCO A;  4H37 A;  1BL8 A;  1M1K W;  3RVZ A;  1S5H C;  3K59 A;  5FNV A;  5LA6 B;  3K9A A;  3OT7 A;  5CN0 A;  1JPX A;  1H2N A;  1HNW B;  3ABT A;  1ZWI C;  2EIM C;  1ORQ C;  4UFZ A;  4ZKI A;  5LP6 B;  2K1E A;  2QM4 A;  1K5S A;  3HKB B;  3BVO A;  1QR8 A;  4FLY A;  2UUA O;  4O2A A;  4LF5 O;  4EKW A;  3OR6 C;  2E75 B;  3AK1 A;  3OD4 A;  1Y67 A;  3MHS C;  4DRX A;  4F6R B;  5L3G A;  4PD4 F; 
#chains in the Genus database with same CATH homology
 2LJ2 A;  1WAZ A;  2H3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...