1WAZA

Nmr structure determination of the bacterial mercury transporter, merf, in micelles
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
TPVLVILLGVVGLSALTGYLDYVLLPALAIFIGLTIYAIQRKRQAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MERF
publication title NMR Structure Determination of a Membrane Protein with Two Transmembrane Helices in Micelles: Merf of the Bacterial Mercury Detoxification System
pubmed doi rcsb
source organism Morganella morganii
molecule tags Transport protein
total genus 13
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2004-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11431 Transport_MerF Membrane transport protein MerF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.910 Mainly Alpha Orthogonal Bundle Helix Hairpins bacterial mercury transporter, merf 1wazA00
1WAZA 2LJ2A 2H3OA
chains in the Genus database with same CATH superfamily
4UCUA 3E89A 4DUYB 2W0FC 2R9AA 1GM8A 2P4VA 1IBMB 2HP8A 5L3DA 4QJFB 5D5PA 5LP6C 3K9SA 2JRIA 4DR3B 1N34O 2HR3A 3E8FA 2XTAA 5IYDO 2WLKA 2GHYA 4MVUA 4G27B 5JQGB 5EC1C 2EBOA 3D3IA 1JOYA 3B8MA 1NS1A 2YI8A 1VQPV 1VQOV 4KHPO 1R6NA 2QWPB 2UU9O 4TSFG 1YJ9V 2KG7A 1PNKA 4MTGA 5JH7B 4QNHB 3AG2B 1B06A 1AI5A 1QNMA 1XREA 2UXCO 2CTPA 1XNRO 3RYIA 1K5QA 1Q3EA 4J10A 2P4KA 2XAQA 4LWSB 3N2KA 3X2QB 4TV9B 3LSSA 2LW7A 3BA8A 4KFMA 4DR1O 4U7NA 1W0KG 2FMLA 2VS0A 1NBMG 4UCSA 5LGUA 1WPBA 1WPXA 3IAYA 4OGQB 4GKKO 5KLVH 3CSXA 4H44B 5HFMA 2B1IA 1HNZO 4JV5B 3P3NA 1IBKO 1K34A 4JI5O 1SS3A 4X1IA 1ZTEA 3SYPA 2KG7B 2KKWA 4DV1O 2OCCB 1ENVA 3WB0A 2YS8A 2E76B 2UUAB 4CS2A 1UJWB 4P30A 1K8AW 2P90A 1AP6A 2P5OA 2IBZH 5LP6B 3UM7A 2WA3A 2DJVA 1KQSU 2DWEC 1GMGA 3OEHG 3SJBC 4X1KA 4LF7B 2Q4PA 1US6A 2NNUA 1VQ7V 5D5QA 1Y74A 4JI1O 3T1YO 2RQ6A 2VQEO 2YIDA 1N4CA 4DV3O 3MAQA 2MK3A 4JYYA 1QLNA 5LMUO 4B3RO 3MHSC 2C2AA 1W0JG 2X7RB 4FZ1A 4PI0A 5EIBC 5KHGA 4N21A 4B3MO 1J5EB 5LGTA 5GONA 5JJJB 3MD0A 1U96A 4ZHQB 1MOFA 1N33B 2ODMA 4FM0A 5AG2A 2Q0OC 1BHBA 5EBWC 1PP9H 4H37A 4JI3O 3STZC 1OCCB 1YJWV 2QM4A 5ITZB 5H9CA 3OUFA 4J42A 4FLWA 3BRCA 3DXRA 3OT7A 4FLVA 1U97A 4YJ2B 1V55C 3WB2A 3L75H 2WPDG 1PM9A 3RYCA 3B09A 5JVDB 2UXDB 1LNQA 3K59A 3A0RA 1H2LA 3BA9A 3QTCA 5E79Z 3FB5C 4JYAB 1H2GA 3E2EA 2BOBC 1WLEA 3UKMA 1MNGA 4FPPA 1IDSA 1PD3A 5IYCO 3L70H 4PA9A 2QEXV 4RWUA 2PTMA 4AI8A 1GN3A 3RFRA 2CH7A 5L3GA 3CB2A 3ZRWA 3SJAC 1EN6A 5IJ0B 3ABTA 3Q4HA 1GH6A 3K0DA 2XNDG 3JARB 1SQQH 4Q20A 1I5YA 3OW2U 5H6RA 1VF7A 1WNSA 1MSWD 4XDLA 3SYQA 2W0XA 3MHHC 2EX3A 2ZT9B 1D5NA 3D36A 4OX9B 2JK5C 1AP5A 4LF6O 1HNXO 4X65O 1VQNV 3VQWA 1H8HG 1V54B 1M56B 3HB3B 3R66A 4IHJA 4A5UB 4NXNO 1Y67A 3ZHUA 5EYPB 2QKSA 4QPJA 2LJ2A 1RM1B 1ZL8A 4GX1A 3A0HZ 4FM1A 4WFBV 1JMKC 1FJGO 2YXYA 2P67A 4FLTA 3CC2V 3FD9A 1MG1A 1YDXA 4K0KO 1IURA 3VBBA 3P3PA 4JI0B 1PKXA 3STLC 2PF4E 4GYCB 1S77D 4NVPA 4O4HA 3WU2Z 4O4IA 2CGOA 1K92A 4MTFA 2IH3C 2UXNA 4LFCB 4JI4O 3T1CA 2AZ0A 3ABLC 5L3BA 1PNLA 3ASOB 3L9DA 3CJHA 5DECA 1O9GA 3CXHF 3QNEA 5CB4A 4WF9V 4LF5B 3ZMVA 1KP2A 2YI9A 2LO1A 3OFNG 2ZIOA 3DTUB 3H01A 3WG7C 2EULA 4UCOA 4CH6A 3K57A 5JJEB 5GW7A 4U3JA 5BR8B 3HKBA 3JALA 3CC7V 1SQVH 1G1XB 2GSMB 2FTKA 1YTFB 4J9ZB 3CRAA 3QVNA 5J2UB 1Q43A 3CCSV 4BAYA 1BHAA 2NR5A 1F7YA 1XNQB 1R1BA 3ABMB 3RYFB 2CTQA 4LR3A 2JGUA 4DW0A 4YY3B 3CCQV 2GBOA 5CMUA 1NR1A 4B3SO 3CCLV 1RSOA 1S72V 1TUBB 5FNVA 5B66Z 3ETQA 4CC6A 2IJHA 2YICA 3CP1A 3OR7C 1AI7A 4BW9A 2QWRB 3K79A 2X6AA 1S0VA 3ICXA 1JJ2U 3ZRXA 4GX2A 3P32A 2Q8VA 4TWKA 4UCTA 4TV8B 1HR0O 1Y4MA 3VOUA 1AI6A 2UXBO 1FXKC 1GN2A 1B04A 1Q8IA 2RCVA 3TCUA 5K1XA 1ROPA 5EZYA 1K7DA 2Y4UA 3LNMB 4W4KA 3AG3C 4EB6B 4JTCB 1BE3H 1A32A 2F4VO 4X9QA 1R3IC 1BZKA 1VQ5V 1EN4A 2JIZG 1THZA 1G6UA 4NKGB 5DEDA 5LXTB 5BMVA 4DR7B 4FFBB 4I55B 4JI8B 1WJZA 1R3JC 4NTYA 4FFKA 1SA0B 3ZN1A 4YHHO 4HYOA 4JI7O 2H8PC 1NVPB 2OYQA 1XL4A 1FS0G 1M57C 2VWKA 5FL7G 3DC5A 3CXCU 3IFXA 2JEUA 4U3FH 3APOA 3AK3A 4DV7B 4TQDA 4FMTA 3VQXA 1AI4A 1W2BU 1L0NH 1FFTB 3K5MA 5IY5B 4LNUB 4NXMB 1JQ0A 1PL0A 5K1PA 2YC0A 1I94O 2DQ0A 2F66C 1VQKV 3CCMV 2EIJC 4C7UA 4MT8A 2W6JG 4GZRB 4X62O 1BGYH 1JR9A 3L73H 3RYHB 1QVFU 1PPJH 5FPOA 1S76D 5KMGA 3PN1A 2HVKC 5B1BB 1YHQV 4YIOA 2PUSA 3NR7A 3QG5A 5B3SC 2X6BA 3CS5A 3K5NA 5KAFZ 5LA6A 3B8NA 4IT5A 3GWKC 2EIKB 4UVAA 3T2MA 2PGGA 5KX5B 3K03A 4MVQA 4N23A 2ZXWB 2OCHA 2QKAA 1MMMA 5LHGA 1FXKB 2GTAA 3W7TA 4GKJB 3S3WA 4J41A 3ABKC 4LH6A 4UXNA 5JQGA 3LUTB 3JASB 4I5SA 1F4MA 1TGOA 5LMNB 1YSCA 2XAJA 4NTWA 1DF5A 1BS3A 2RJZA 4YJ3A 2IU3A 1X4TA 3E8GA 2M7WA 2P7TC 5JWPA 4LF9O 4JI6B 3H9VA 2YIBD 4JTDB 5JH7A 2YIAA 2ZE7A 2ZR2A 4FZ0A 4IL6Z 1P7GA 1PL4A 4CH4A 2PZSA 2ZINA 1GO3F 2IM9A 3JAMN 3HKCB 2OWOA 4DR2O 3ZJZA 2A3QA 3DSQA 1SQXH 4TUYB 3OMIB 3CWBH 4TV9A 3CX5F 3T1HB 2DW4A 4BIUA 4J7JA 1FFXB 1XBLA 2ILMA 2OIGA 2QM7A 1IBLB 2M6YA 1NR7A 1QLEC 2HJFC 4D7TA 3TJTA 2ITDC 1S5JA 2VRZA 2NN4A 2ZE5A 1D2DA 1HP8A 1FD9A 4LFAB 2YXLA 4LF8O 2ZE8A 1FAFA 1VEWA 1FKAO 2IU0A 3JATB 2UUCB 3LDDA 1NTKH 3UCSC 4DV4O 3CRRA 2PI5A 2CTRA 4DK0A 4UB6Z 4GX0A 2QM8A 2E74B 3BCCH 4YJ3B 2HHHO 2QTOA 4PELA 2AXTZ 4GKKB 4R7CA 1CXZB 3CC4V 4J7ZA 5B1OA 1K33A 1G8MA 2QWOB 4PA6A 2YUAA 1IBKB 2DMXA 5EC2C 3CMEV 3TETA 2RDCA 5LYJB 4DV1B 4PA7A 3OD4A 5LP6A 2R72A 3ZRVA 3IGAC 4NB5A 5KHIA 4DV5O 3SYCA 1BMFG 2WLLA 2UUBB 4TOIA 3TK1A 4UCVA 3FFQA 4RQFA 1NTMH 5A2QN 3UO2A 3JD2A 4D7SA 3O9OA 2DYSC 4DV2B 2R9IA 1J95A 4DUYO 3LSUA 1YCIA 2ZR3A 1IBMO 3H1HH 3O65A 2IW5A 4ZHQA 1NH2B 1I5XA 2ETNA 4EFBA 1YTFD 1I0HA 4DR3O 1XMOB 1RPOA 3JSNA 4F6RB 2PYLA 4R6ZA 2O57A 3JD1A 4RUEA 4UVBA 2EJRA 1Q81W 1YJNV 4B7EA 5B1AC 4BIOA 3HKDB 5ITZA 2WAMA 1K73W 2EINB 4X88A 3JD0A 1VF5B 1I7FA 3K06A 3QF7A 1SZTA 1WP7A 3K3WA 2EIMC 2FKXA 4YJ2A 3J81N 4X8AA 4MVSA 4X20A 2GV9A 4DYLA 1N0JA 2YIBA 1TAEA 5JVDA 4LF4O 1EFRG 2ADQB 1JFFB 2K1EA 1AR4A 3AG7A 1R3LC 1ZUQA 4O2BB 1QLEB 2CDYA 3K5LA 2YEVB 4DR6B 1CEZA 4PHZA 3BVOA 1G4YB 2WLLB 1KB9F 1XMQB 4JZGA 4NR1A 4CS3A 5IJ0A 4H0LB 4RQEA 5A9GA 1YZBA 3JARA 4PV1B 1KP3A 3DC6A 1QR8A 3LSQA 4RAIA 1JA8A 3H1KH 2RMKB 5C93A 3ZIAG 4DO2A 2AZ2A 1NVPD 5IT9N 3FKSG 2EILC 3CCJV 5LBQA 4DK1A 4K3AA 2D2CB 1B3QA 2F93B 1AJQA 4LF6B 2LFSA 3E22B 5EYPA 2EZOA 1COWG 4PD4F 1R6KA 3SPIA 4ZBMA 1R3KC 4O2AB 1Q6HA 4UUJC 4X20B 1Q7YW 4CS4A 5EBMC 4JV5O 1OCZC 2UUAO 1FJGB 1SF9A 1KKCA 3AG1C 2Y69C 1F23A 4XDJA 4X66B 5JJNB 3OGCC 4DV6B 3JYCA 2B5UA 3D36C 1LR1A 4R50A 4CC5A 4ZKIA 1GRJA 1M93A 2PI4A 4Q6GA 4MS2A 4DV0B 4H13B 4LF7O 3KZIZ 1OV9A 4JI4B 4X64B 1L8DA 2QGNA 3EXAA 5LHHA 1VF6C 1LUWA 3LDEA 2BSKA 1P49A 1PNMA 2ZM6B 3CRCA 1E1QG 1M1KW 2WLMA 1J5EO 1SETA 3ZMZA 1PV0A 5IYBO 4LFBB 2WLNA 5J2UA 1K97A 3J80N 4X1YA 4FLXA 1N33O 2QR4A 1SZXA 1HDJA 4B3TB 1DK1A 2DN9A 3RYFA 3ETEA 3VQVA 2QDOA 4E2LA 3HKEB 5CA0A 3ZCCA 4YIPA 1TUBA 3OTOB 3SPCA 2AW9A 2IJIA 4IYIA 1IXBA 2BE3A 4KXRA 1QBZA 3L72H 1MABG 4B3SB 2QA4V 2XASA 1KD1W 1H2MA 2F1MA 1ZSPA 3E83A 4JZ2A 4TV8A 4CH3A 3SR2C 3ZRSA 2UXDO 1YXBA 2GDSA 4JYAO 1XDCA 3RVZA 5KUKA 3SJQC 4EB6A 4UCRA 2F43G 2E75B 2IJJA 4W4LA 1QU7A 1RPRA 4RO2A 5LXTA 5EK0A 2BSKB 3OUSA 4DUZB 1HW7A 5B1NA 1V55B 2Y0IA 4FFBA 2N74A 2HJDA 4I55A 1SA0A 4R8CA 4RUFA 3BFRA 1OCZB 2LQTA 4MVOA 1YVWA 3IC9A 4X1YB 1D5AA 5F2VO 1NTZH 3UO3A 2WWWA 4OX9O 5TISZ 1XI1A 1ZAUA 2NLJC 1N32B 1Q6IA 2A06H 5CA0B 2XOKG 2QTSA 2G38A 1DTOA 4I0XB 1N36B 4AQYO 2PYJA 3K08A 2H3OA 2QSAA 2Q7EA 1P84F 1OCRC 3FAVA 2XAHA 4PA3A 4BWAA 5DM6V 4LNUA 1SRYA 3FYEB 3JCUZ 3A0BZ 3WB1A 3FYIB 5L3EA 3AG4C 4G2KA 1XL6A 3SYOA 1TVKB 2F95B 4I50B 4K35A 4PDLA 1L1FA 3RYHA 3ZHSA 2BTQB 4GLXA 1SQGA 1Y66A 2W6IG 5KAIZ 2E5LB 2L35A 1R6TA 4LFCO 2JGDB 1QCEA 3OTFA 2XAGA 3AK2A 5C8YB 2X0LA 4CH5A 1EN5A 4LF5O 4WFGA 4PDRA 1EZJA 1NQTA 5J9PC 1Y76A 3HR0A 4MVRA 1VMGA 1KUQA 5KX5A 1I08A 4DRXB 5BR8O 1XHZA 3ASNC 4JI2B 4JAAA 4EFEA 2ARHA 1FXKA 1NH2D 2FYUH 4B08A 1XNQO 4L87A 3CEIA 2E3CA 4BIZA 1KYOF 2Q9LA 3ABLB 5IDJA 3W7WA 3JASA 2GUZB 3B4SA 4YY3O 1BCCH 3FAVB 1QR9A 1NKDA 2Q68A 2B1GA 4LBEC 1KMIZ 2MW2B 4ICGA 4UV9A 4XBFA 2LGWA 3WG7B 3JCZA 2ZKOA 1QHTA 2VQFB 3OE7G 1N0NA 4DR5B 2Q69A 1DGSA 5IJ9A 1WB8A 5LHIA 4LF9B 3EFFK 4DR4B 3HKCA 4MW3A 4MTOA 2XUMA 2HLDG 2Z0AA 3G80A 3C3TA 2L6LA 2WLJA 3JAWB 2OTLV 3ZMTA 3FB6C 1VQ9V 4ZOLB 1AILA 2V1DA 2QWQB 4TUYA 1QVGU 3JAKB 3ZMSA 1Y76B 5IWAB 4LC1A 1HNWB 3E35A 1FFXA 4WFFA 1ZWIC 3FB8C 5GTHZ 2QKCA 4JI8O 2OIEA 4Z1MG 1T5EA 2RNBA 2Y0PA 2F23A 3AG2C 1K4CC 1N34B 1VQ6V 4OPHA 3I56V 3AG3B 1ZLZA 3JATA 4DV7O 1OZ0A 3E8BA 3UT5B 3N27A 3ETGA 1YIJV 2ZIMA 1HWYA 1XILA 2CAZC 4WFAV 2DE0X 4NXMO 4DV4B 5JCOA 3X2QC 1Z5VA 4KHPB 1P7BA 5H5NA 3GVMA 4JYBA 2BTOA 2UU9B 3B77A 5J2TA 1YITV 4OPAA 4UFZA 4JYCA 4FVMA 5IJ9B 2EJ7A 1SC5B 1M57B 5LYJA 4MSWC 4G28B 4J80A 3CCEV 4I7ZB 2ZE6A 3ABUA 5CA1B 2ZDIA 1NU1H 4HZ3A 3THOA 3C3SA 2UXCB 1XNRB 5IYZB 2Q67A 4E4EA 1H2SB 3OM3B 2ITCC 5KHKA 5LOVB 2ZNIA 5KHJA 1RFYA 4AILC 4I9QA 3SPHA 3K0GA 3R65A 1AROP 2EIJB 2VWJA 4DR1B 1WAZA 2JS3A 4HNAB 4Z1VA 1JCHA 1KU9A 1SESA 4I4TB 2OCCC 4TQFA 5HFLA 3G6BA 4F6RA 2DWDC 2H94A 4GKJO 2ZCEA 3U10A 2V4DA 5B3SB 3HKDA 1K3EA 2ATKC 5LMNO 3KCXA 4X89A 1L0LH 4ABMA 1RP3B 4BR6A 3S3XA 1HNZB 5CBFA 5J2TB 3GWOA 3OMNB 4JI5B 1CP9A 3ZHQA 1JFFA 3ZBHA 3CRMA 4JI6O 2DYRC 5EIBD 3RWRD 3OAAG 4AHCA 4O2BA 2JJ2G 3CHXA 4LF4B 1X59A 4NYKA 2YEVA 4KL1A 4P9OA 1CPYA 4FLZA 3ABKB 3QO8A 3E8HA 1WP8A 5DN6G 3C90A 3TGUH 4O4JA 1OCCC 4IYHA 4O4LB 4TT3G 2WLIA 2Q7HA 5GTIZ 4CZZA 2N04A 4JI1B 5BZBA 3T1YB 2VQEB 3N2GB 1GAXA 1WB7A 2JVDA 3T1HO 4DV3B 5LMUB 4B3RB 4QPKA 4ZI7B 1IBLO 3F7YC 1M4UA 5CA3A 4B3MB 3AEIA 4KP4A 1GN4A 4P9PA 1NJIW 2WSSG 3QO5A 5E1AC 3UQ8A 1Z2GA 1XEQA 1V9PA 1FYJA 3VQYA 3H1IH 1GK9A 3B2EE 1WA8A 3CCUV 1K5SA 3BY6A 3SJCC 4LFAO 3E22A 3CCVV 5CN0A 4PA4A 4EKWA 1Q5OA 3H1LH 2UUCO 4JI3B 2RN9A 4O2AA 3F7VC 1H2KA 3G4SV 4GCZA 2HKOA 4WBNA 4JTAB 1F4NA 2B9ZA 2CTWA 2XAFA 4LH7A 3RN4A 2P6JA 3OGIB 1BSMA 1OJHA 1KECA 2XT9A 4JAVA 3RW0A 4LCUC 1Q90D 4JAUA 3RBZA 1N8RW 1FXVA 1KBHA 2JEXA 4O4JB 1V54C 1M56C 2Q6AA 4YXWG 2UUBO 4HAMA 3RYIB 4U7OA 1MSDA 3H1JH 2WLIB 5H2FZ 2Z5UA 3KG2A 3U0ZA 1VP7A 1RM1C 3A8TA 1QQCA 3N2KB 3J7AU 2EZPA 1YEWA 4DV2O 1MZFA 1IZ3A 1OHHG 2IJKA 2KQXA 3CE2A 4PI2A 2DYRB 4MTXA 1MA1A 4MW8A 2P06A 3RVYA 2IH1C 1WA8B 1XMOO 1HNXB 4X65B 1K4DC 3L71H 4IGGA 2ZNJA 2GTSA 4ZIBA 1BQZA 3HKEA 3D3QA 4QE9A 1UPGA 1YF2A 4NXNB 3ZHRA 3ASOC 2ADPA 3SYAA 4WBNB 3T4ZA 5KA6A 5CBHA 2X6CA 4GT1A 2DYSB 3CRQA 2LP7A 5BXZA 1AVMA 1H2NA 2HFEC 2K9PA 1EBOA 1XUQA 4MVMA 3K58A 4X1IB 1H38A 4K0KB 4B7KA 1VQ4V 1KC8W 4QGPA 3LDCA 3CCRV 4H33A 5KUMA 4DR6O 2CK3G 5CBGA 5B5EZ 1ZX3A 1XMQO 4PDVA 3ABMC 5H6QA 5B1AB 4F6EA 2BCCH 3P30A 2A79B 4X1KB 4FIPC 3M99B 4FJCC 1Q86W 1NI8A 2EIMB 3BEHA 1KKDA 1Y74B 2N05A 5LL6Y 1UFIA 1Y6XA 1R73A 4MVZA 2R9RB 3W7XA 4ASUG 1BT8A 4L8JA 2WLHA 5GONB 4I0XA 1K9MW 2WA4A 1AJPA 4J11A 3G71V 2Q7GA 3EHBB 3OR6C 2CGNA 3A2FA 3M8AA 2JDIG 2ZD9A 4AQYB 3I55V 3GB7C 2P22C 3CMAV 1XQ8A 1VF6A 1AJNA 3DXRB 1TVKA 4I50A 1M5IA 3BAAA 3ZHTA 2FB5A 2BTQA 2Q0AA 1HR0B 1NZ6A 3RYCB 3I5DA 2UXBB 1FPOA 3IJ4A 3U11A 2EILB 1EM1A 4X66O 5L3CA 1SQFA 4JGSA 4DV6O 1S5HC 1AB3A 1JPXA 2JGDA 2YSUB 4DXWA 4BW5A 3ZN0A 3ZX6A 4DV0O 3BABA 5C8YA 2F4VB 3RT3C 2CH7B 4WFHA 1Q6UA 4X64O 3T4DA 3ZRWB 2JS5A 3ZS8C 3Q4HB 5IY5C 3APQA 2PY5A 1JJOA 1BL8A 3PJSK 4QIWF 4DRXA 2ZM6O 3CD6V 3AG1B 3BPZA 2Y69B 1IX9A 3ML0A 4YHHB 2OT5A 3SPGA 4JI7B 4LFBO 3F5TA 1VARA 3FX7A 2OTJV 3SPJA 4B3TO 4NTXA 2GUZA 1SKVA 5IE9A 3K5OA 2Y48A 2FL4A 5B1BC 3OTOO 1AR5A 4IHJB 3JSLA 2QWNB 2ZQMA 4IIJA 2DOSA 3ZHVA 3M7MX 1ZL8B 1F51A 2XHBA 2CE4A 4F4LA 3SDLA 1I94B 2EIKC 3KKYA 4JI0O 1M9NA 2LGQA 1BQ0A 4CBCA 2A0LA 4X62B 4UV8A 1IXMA 1GM7A 2ZXWC 5L3FA 5KA5A 3TXSA 4FK5C 1JX9A 3JAWA 2Q73A 4O4HB 3HPLC 4O4IB 2D3OW 2CUGA 4ZOLA 4UB8Z 3ZMUA 3JAKA 2Z3YA 3CJHB 1WN7A 2V7QG 3ZEDA 2AHZA 4GX5A 5CB4B 3OEEG 2BOCC 3AK1A 2Q5ZA 4DUZO 2HVJC 4P2ZA 5KHHA 4PJ0Z 5EBLC 2HG5C 1AR1B 2LFRA 4U3JB 1FXHA 3CYOA 3HKBB 3JALB 3QO7A 1SQBH 4GUNA 2UXXA 1IVSA 3B40A 3LNNA 1N32O 2HEPA 4J9YB 4FM2A 1SERA 3UT5A 1N36O 1OCOC 1TUEB 1NT2B 4IIJB 3RGBA 3F5WC 1RSOB 3IC7A 5FNVB 1URFA 1VQLV 3L74H 3CPWU 3K04A 1LUVA 5FLXN 4KUMA 2JJ1G 3TXQA 3ETDA 4K8ZA 2QJ1A 3W7SA 1VQ8V 2KSDA 3MDSA 4JPRA 3OMAB 5CA1A 2E5LO 1MZEA 4LP8A 1H8EG 5FPRA 1VIBA 5EZYB 5IYZA 2AHYA 3G6EV 4WFEA 2QE7G 1W59A 4DR2B 1M90W 3JD3A 1S5LZ 1DLBA 1OCRB 5LOVA 2R70A 3KCYA 1GN6A 4JASA 3WFVA 4FLUA 4DR7O 4QE7A 1E1RG 3AG4B 2Y4TA 4HNAA 5JCOC 2DQ3A 4I4TA 3K9AA 2YDEA 2YXHA 5BMVB 4JI2O 1ORQC 4DW1A 3W7UA 1S3JA 3D8CA 1E79G 4EEQA 3NXSA 1Q82W 3BHPA 4LF8B 2LW1A 2ZDIC 1VQMV 4FLYA 4I9WA 3SGIA 4OXSA 4UVCA 3E86A 4JF3A 1O9HA 1SQPH 3FB7C 2HHHB 5BY1A 4Z2WA 2KB1A 1Z5WA 1YI2V 3EVKA 1GKFA 2A7WA 1B6QA 4WCEV 3ASNB 2VQFO 3JD4A 4DR5O 3G67A 1DF4A 1JVMA 1P4RA 1XHXA 1XOUA 4DR4O 1TA8A 1GM9A 4HBNA 5KMGB 3DGEA 4PDMA 1EZVH 4K8XA 4DV5B 4J7KA 4O4LA 4D6TH 2A9HA 1OCOB 3N2GA 2EINC 5LGNA 2AGAA 5IWAO 5LA6B 4LWSA 1GTOA 4XDKA 1HNWO 4ZI7A
chains in the Genus database with same CATH topology
1WAZA 2LJ2A 2H3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WAZ A;  2LJ2 A;  2H3O A; 
#chains in the Genus database with same CATH topology
 4UCU A;  3E89 A;  4DUY B;  2W0F C;  2R9A A;  1GM8 A;  2P4V A;  1IBM B;  2HP8 A;  5L3D A;  4QJF B;  5D5P A;  5LP6 C;  3K9S A;  2JRI A;  4DR3 B;  1N34 O;  2HR3 A;  3E8F A;  2XTA A;  5IYD O;  2WLK A;  2GHY A;  4MVU A;  4G27 B;  5JQG B;  5EC1 C;  2EBO A;  3D3I A;  1JOY A;  3B8M A;  1NS1 A;  2YI8 A;  1VQP V;  1VQO V;  4KHP O;  1R6N A;  2QWP B;  2UU9 O;  4TSF G;  1YJ9 V;  2KG7 A;  1PNK A;  4MTG A;  5JH7 B;  4QNH B;  3AG2 B;  1B06 A;  1AI5 A;  1QNM A;  1XRE A;  2UXC O;  2CTP A;  1XNR O;  3RYI A;  1K5Q A;  1Q3E A;  4J10 A;  2P4K A;  2XAQ A;  4LWS B;  3N2K A;  3X2Q B;  4TV9 B;  3LSS A;  2LW7 A;  3BA8 A;  4KFM A;  4DR1 O;  4U7N A;  1W0K G;  2FML A;  2VS0 A;  1NBM G;  4UCS A;  5LGU A;  1WPB A;  1WPX A;  3IAY A;  4OGQ B;  4GKK O;  5KLV H;  3CSX A;  4H44 B;  5HFM A;  2B1I A;  1HNZ O;  4JV5 B;  3P3N A;  1IBK O;  1K34 A;  4JI5 O;  1SS3 A;  4X1I A;  1ZTE A;  3SYP A;  2KG7 B;  2KKW A;  4DV1 O;  2OCC B;  1ENV A;  3WB0 A;  2YS8 A;  2E76 B;  2UUA B;  4CS2 A;  1UJW B;  4P30 A;  1K8A W;  2P90 A;  1AP6 A;  2P5O A;  2IBZ H;  5LP6 B;  3UM7 A;  2WA3 A;  2DJV A;  1KQS U;  2DWE C;  1GMG A;  3OEH G;  3SJB C;  4X1K A;  4LF7 B;  2Q4P A;  1US6 A;  2NNU A;  1VQ7 V;  5D5Q A;  1Y74 A;  4JI1 O;  3T1Y O;  2RQ6 A;  2VQE O;  2YID A;  1N4C A;  4DV3 O;  3MAQ A;  2MK3 A;  4JYY A;  1QLN A;  5LMU O;  4B3R O;  3MHS C;  2C2A A;  1W0J G;  2X7R B;  4FZ1 A;  4PI0 A;  5EIB C;  5KHG A;  4N21 A;  4B3M O;  1J5E B;  5LGT A;  5GON A;  5JJJ B;  3MD0 A;  1U96 A;  4ZHQ B;  1MOF A;  1N33 B;  2ODM A;  4FM0 A;  5AG2 A;  2Q0O C;  1BHB A;  5EBW C;  1PP9 H;  4H37 A;  4JI3 O;  3STZ C;  1OCC B;  1YJW V;  2QM4 A;  5ITZ B;  5H9C A;  3OUF A;  4J42 A;  4FLW A;  3BRC A;  3DXR A;  3OT7 A;  4FLV A;  1U97 A;  4YJ2 B;  1V55 C;  3WB2 A;  3L75 H;  2WPD G;  1PM9 A;  3RYC A;  3B09 A;  5JVD B;  2UXD B;  1LNQ A;  3K59 A;  3A0R A;  1H2L A;  3BA9 A;  3QTC A;  5E79 Z;  3FB5 C;  4JYA B;  1H2G A;  3E2E A;  2BOB C;  1WLE A;  3UKM A;  1MNG A;  4FPP A;  1IDS A;  1PD3 A;  5IYC O;  3L70 H;  4PA9 A;  2QEX V;  4RWU A;  2PTM A;  4AI8 A;  1GN3 A;  3RFR A;  2CH7 A;  5L3G A;  3CB2 A;  3ZRW A;  3SJA C;  1EN6 A;  5IJ0 B;  3ABT A;  3Q4H A;  1GH6 A;  3K0D A;  2XND G;  3JAR B;  1SQQ H;  4Q20 A;  1I5Y A;  3OW2 U;  5H6R A;  1VF7 A;  1WNS A;  1MSW D;  4XDL A;  3SYQ A;  2W0X A;  3MHH C;  2EX3 A;  2ZT9 B;  1D5N A;  3D36 A;  4OX9 B;  2JK5 C;  1AP5 A;  4LF6 O;  1HNX O;  4X65 O;  1VQN V;  3VQW A;  1H8H G;  1V54 B;  1M56 B;  3HB3 B;  3R66 A;  4IHJ A;  4A5U B;  4NXN O;  1Y67 A;  3ZHU A;  5EYP B;  2QKS A;  4QPJ A;  2LJ2 A;  1RM1 B;  1ZL8 A;  4GX1 A;  3A0H Z;  4FM1 A;  4WFB V;  1JMK C;  1FJG O;  2YXY A;  2P67 A;  4FLT A;  3CC2 V;  3FD9 A;  1MG1 A;  1YDX A;  4K0K O;  1IUR A;  3VBB A;  3P3P A;  4JI0 B;  1PKX A;  3STL C;  2PF4 E;  4GYC B;  1S77 D;  4NVP A;  4O4H A;  3WU2 Z;  4O4I A;  2CGO A;  1K92 A;  4MTF A;  2IH3 C;  2UXN A;  4LFC B;  4JI4 O;  3T1C A;  2AZ0 A;  3ABL C;  5L3B A;  1PNL A;  3ASO B;  3L9D A;  3CJH A;  5DEC A;  1O9G A;  3CXH F;  3QNE A;  5CB4 A;  4WF9 V;  4LF5 B;  3ZMV A;  1KP2 A;  2YI9 A;  2LO1 A;  3OFN G;  2ZIO A;  3DTU B;  3H01 A;  3WG7 C;  2EUL A;  4UCO A;  4CH6 A;  3K57 A;  5JJE B;  5GW7 A;  4U3J A;  5BR8 B;  3HKB A;  3JAL A;  3CC7 V;  1SQV H;  1G1X B;  2GSM B;  2FTK A;  1YTF B;  4J9Z B;  3CRA A;  3QVN A;  5J2U B;  1Q43 A;  3CCS V;  4BAY A;  1BHA A;  2NR5 A;  1F7Y A;  1XNQ B;  1R1B A;  3ABM B;  3RYF B;  2CTQ A;  4LR3 A;  2JGU A;  4DW0 A;  4YY3 B;  3CCQ V;  2GBO A;  5CMU A;  1NR1 A;  4B3S O;  3CCL V;  1RSO A;  1S72 V;  1TUB B;  5FNV A;  5B66 Z;  3ETQ A;  4CC6 A;  2IJH A;  2YIC A;  3CP1 A;  3OR7 C;  1AI7 A;  4BW9 A;  2QWR B;  3K79 A;  2X6A A;  1S0V A;  3ICX A;  1JJ2 U;  3ZRX A;  4GX2 A;  3P32 A;  2Q8V A;  4TWK A;  4UCT A;  4TV8 B;  1HR0 O;  1Y4M A;  3VOU A;  1AI6 A;  2UXB O;  1FXK C;  1GN2 A;  1B04 A;  1Q8I A;  2RCV A;  3TCU A;  5K1X A;  1ROP A;  5EZY A;  1K7D A;  2Y4U A;  3LNM B;  4W4K A;  3AG3 C;  4EB6 B;  4JTC B;  1BE3 H;  1A32 A;  2F4V O;  4X9Q A;  1R3I C;  1BZK A;  1VQ5 V;  1EN4 A;  2JIZ G;  1THZ A;  1G6U A;  4NKG B;  5DED A;  5LXT B;  5BMV A;  4DR7 B;  4FFB B;  4I55 B;  4JI8 B;  1WJZ A;  1R3J C;  4NTY A;  4FFK A;  1SA0 B;  3ZN1 A;  4YHH O;  4HYO A;  4JI7 O;  2H8P C;  1NVP B;  2OYQ A;  1XL4 A;  1FS0 G;  1M57 C;  2VWK A;  5FL7 G;  3DC5 A;  3CXC U;  3IFX A;  2JEU A;  4U3F H;  3APO A;  3AK3 A;  4DV7 B;  4TQD A;  4FMT A;  3VQX A;  1AI4 A;  1W2B U;  1L0N H;  1FFT B;  3K5M A;  5IY5 B;  4LNU B;  4NXM B;  1JQ0 A;  1PL0 A;  5K1P A;  2YC0 A;  1I94 O;  2DQ0 A;  2F66 C;  1VQK V;  3CCM V;  2EIJ C;  4C7U A;  4MT8 A;  2W6J G;  4GZR B;  4X62 O;  1BGY H;  1JR9 A;  3L73 H;  3RYH B;  1QVF U;  1PPJ H;  5FPO A;  1S76 D;  5KMG A;  3PN1 A;  2HVK C;  5B1B B;  1YHQ V;  4YIO A;  2PUS A;  3NR7 A;  3QG5 A;  5B3S C;  2X6B A;  3CS5 A;  3K5N A;  5KAF Z;  5LA6 A;  3B8N A;  4IT5 A;  3GWK C;  2EIK B;  4UVA A;  3T2M A;  2PGG A;  5KX5 B;  3K03 A;  4MVQ A;  4N23 A;  2ZXW B;  2OCH A;  2QKA A;  1MMM A;  5LHG A;  1FXK B;  2GTA A;  3W7T A;  4GKJ B;  3S3W A;  4J41 A;  3ABK C;  4LH6 A;  4UXN A;  5JQG A;  3LUT B;  3JAS B;  4I5S A;  1F4M A;  1TGO A;  5LMN B;  1YSC A;  2XAJ A;  4NTW A;  1DF5 A;  1BS3 A;  2RJZ A;  4YJ3 A;  2IU3 A;  1X4T A;  3E8G A;  2M7W A;  2P7T C;  5JWP A;  4LF9 O;  4JI6 B;  3H9V A;  2YIB D;  4JTD B;  5JH7 A;  2YIA A;  2ZE7 A;  2ZR2 A;  4FZ0 A;  4IL6 Z;  1P7G A;  1PL4 A;  4CH4 A;  2PZS A;  2ZIN A;  1GO3 F;  2IM9 A;  3JAM N;  3HKC B;  2OWO A;  4DR2 O;  3ZJZ A;  2A3Q A;  3DSQ A;  1SQX H;  4TUY B;  3OMI B;  3CWB H;  4TV9 A;  3CX5 F;  3T1H B;  2DW4 A;  4BIU A;  4J7J A;  1FFX B;  1XBL A;  2ILM A;  2OIG A;  2QM7 A;  1IBL B;  2M6Y A;  1NR7 A;  1QLE C;  2HJF C;  4D7T A;  3TJT A;  2ITD C;  1S5J A;  2VRZ A;  2NN4 A;  2ZE5 A;  1D2D A;  1HP8 A;  1FD9 A;  4LFA B;  2YXL A;  4LF8 O;  2ZE8 A;  1FAF A;  1VEW A;  1FKA O;  2IU0 A;  3JAT B;  2UUC B;  3LDD A;  1NTK H;  3UCS C;  4DV4 O;  3CRR A;  2PI5 A;  2CTR A;  4DK0 A;  4UB6 Z;  4GX0 A;  2QM8 A;  2E74 B;  3BCC H;  4YJ3 B;  2HHH O;  2QTO A;  4PEL A;  2AXT Z;  4GKK B;  4R7C A;  1CXZ B;  3CC4 V;  4J7Z A;  5B1O A;  1K33 A;  1G8M A;  2QWO B;  4PA6 A;  2YUA A;  1IBK B;  2DMX A;  5EC2 C;  3CME V;  3TET A;  2RDC A;  5LYJ B;  4DV1 B;  4PA7 A;  3OD4 A;  5LP6 A;  2R72 A;  3ZRV A;  3IGA C;  4NB5 A;  5KHI A;  4DV5 O;  3SYC A;  1BMF G;  2WLL A;  2UUB B;  4TOI A;  3TK1 A;  4UCV A;  3FFQ A;  4RQF A;  1NTM H;  5A2Q N;  3UO2 A;  3JD2 A;  4D7S A;  3O9O A;  2DYS C;  4DV2 B;  2R9I A;  1J95 A;  4DUY O;  3LSU A;  1YCI A;  2ZR3 A;  1IBM O;  3H1H H;  3O65 A;  2IW5 A;  4ZHQ A;  1NH2 B;  1I5X A;  2ETN A;  4EFB A;  1YTF D;  1I0H A;  4DR3 O;  1XMO B;  1RPO A;  3JSN A;  4F6R B;  2PYL A;  4R6Z A;  2O57 A;  3JD1 A;  4RUE A;  4UVB A;  2EJR A;  1Q81 W;  1YJN V;  4B7E A;  5B1A C;  4BIO A;  3HKD B;  5ITZ A;  2WAM A;  1K73 W;  2EIN B;  4X88 A;  3JD0 A;  1VF5 B;  1I7F A;  3K06 A;  3QF7 A;  1SZT A;  1WP7 A;  3K3W A;  2EIM C;  2FKX A;  4YJ2 A;  3J81 N;  4X8A A;  4MVS A;  4X20 A;  2GV9 A;  4DYL A;  1N0J A;  2YIB A;  1TAE A;  5JVD A;  4LF4 O;  1EFR G;  2ADQ B;  1JFF B;  2K1E A;  1AR4 A;  3AG7 A;  1R3L C;  1ZUQ A;  4O2B B;  1QLE B;  2CDY A;  3K5L A;  2YEV B;  4DR6 B;  1CEZ A;  4PHZ A;  3BVO A;  1G4Y B;  2WLL B;  1KB9 F;  1XMQ B;  4JZG A;  4NR1 A;  4CS3 A;  5IJ0 A;  4H0L B;  4RQE A;  5A9G A;  1YZB A;  3JAR A;  4PV1 B;  1KP3 A;  3DC6 A;  1QR8 A;  3LSQ A;  4RAI A;  1JA8 A;  3H1K H;  2RMK B;  5C93 A;  3ZIA G;  4DO2 A;  2AZ2 A;  1NVP D;  5IT9 N;  3FKS G;  2EIL C;  3CCJ V;  5LBQ A;  4DK1 A;  4K3A A;  2D2C B;  1B3Q A;  2F93 B;  1AJQ A;  4LF6 B;  2LFS A;  3E22 B;  5EYP A;  2EZO A;  1COW G;  4PD4 F;  1R6K A;  3SPI A;  4ZBM A;  1R3K C;  4O2A B;  1Q6H A;  4UUJ C;  4X20 B;  1Q7Y W;  4CS4 A;  5EBM C;  4JV5 O;  1OCZ C;  2UUA O;  1FJG B;  1SF9 A;  1KKC A;  3AG1 C;  2Y69 C;  1F23 A;  4XDJ A;  4X66 B;  5JJN B;  3OGC C;  4DV6 B;  3JYC A;  2B5U A;  3D36 C;  1LR1 A;  4R50 A;  4CC5 A;  4ZKI A;  1GRJ A;  1M93 A;  2PI4 A;  4Q6G A;  4MS2 A;  4DV0 B;  4H13 B;  4LF7 O;  3KZI Z;  1OV9 A;  4JI4 B;  4X64 B;  1L8D A;  2QGN A;  3EXA A;  5LHH A;  1VF6 C;  1LUW A;  3LDE A;  2BSK A;  1P49 A;  1PNM A;  2ZM6 B;  3CRC A;  1E1Q G;  1M1K W;  2WLM A;  1J5E O;  1SET A;  3ZMZ A;  1PV0 A;  5IYB O;  4LFB B;  2WLN A;  5J2U A;  1K97 A;  3J80 N;  4X1Y A;  4FLX A;  1N33 O;  2QR4 A;  1SZX A;  1HDJ A;  4B3T B;  1DK1 A;  2DN9 A;  3RYF A;  3ETE A;  3VQV A;  2QDO A;  4E2L A;  3HKE B;  5CA0 A;  3ZCC A;  4YIP A;  1TUB A;  3OTO B;  3SPC A;  2AW9 A;  2IJI A;  4IYI A;  1IXB A;  2BE3 A;  4KXR A;  1QBZ A;  3L72 H;  1MAB G;  4B3S B;  2QA4 V;  2XAS A;  1KD1 W;  1H2M A;  2F1M A;  1ZSP A;  3E83 A;  4JZ2 A;  4TV8 A;  4CH3 A;  3SR2 C;  3ZRS A;  2UXD O;  1YXB A;  2GDS A;  4JYA O;  1XDC A;  3RVZ A;  5KUK A;  3SJQ C;  4EB6 A;  4UCR A;  2F43 G;  2E75 B;  2IJJ A;  4W4L A;  1QU7 A;  1RPR A;  4RO2 A;  5LXT A;  5EK0 A;  2BSK B;  3OUS A;  4DUZ B;  1HW7 A;  5B1N A;  1V55 B;  2Y0I A;  4FFB A;  2N74 A;  2HJD A;  4I55 A;  1SA0 A;  4R8C A;  4RUF A;  3BFR A;  1OCZ B;  2LQT A;  4MVO A;  1YVW A;  3IC9 A;  4X1Y B;  1D5A A;  5F2V O;  1NTZ H;  3UO3 A;  2WWW A;  4OX9 O;  5TIS Z;  1XI1 A;  1ZAU A;  2NLJ C;  1N32 B;  1Q6I A;  2A06 H;  5CA0 B;  2XOK G;  2QTS A;  2G38 A;  1DTO A;  4I0X B;  1N36 B;  4AQY O;  2PYJ A;  3K08 A;  2H3O A;  2QSA A;  2Q7E A;  1P84 F;  1OCR C;  3FAV A;  2XAH A;  4PA3 A;  4BWA A;  5DM6 V;  4LNU A;  1SRY A;  3FYE B;  3JCU Z;  3A0B Z;  3WB1 A;  3FYI B;  5L3E A;  3AG4 C;  4G2K A;  1XL6 A;  3SYO A;  1TVK B;  2F95 B;  4I50 B;  4K35 A;  4PDL A;  1L1F A;  3RYH A;  3ZHS A;  2BTQ B;  4GLX A;  1SQG A;  1Y66 A;  2W6I G;  5KAI Z;  2E5L B;  2L35 A;  1R6T A;  4LFC O;  2JGD B;  1QCE A;  3OTF A;  2XAG A;  3AK2 A;  5C8Y B;  2X0L A;  4CH5 A;  1EN5 A;  4LF5 O;  4WFG A;  4PDR A;  1EZJ A;  1NQT A;  5J9P C;  1Y76 A;  3HR0 A;  4MVR A;  1VMG A;  1KUQ A;  5KX5 A;  1I08 A;  4DRX B;  5BR8 O;  1XHZ A;  3ASN C;  4JI2 B;  4JAA A;  4EFE A;  2ARH A;  1FXK A;  1NH2 D;  2FYU H;  4B08 A;  1XNQ O;  4L87 A;  3CEI A;  2E3C A;  4BIZ A;  1KYO F;  2Q9L A;  3ABL B;  5IDJ A;  3W7W A;  3JAS A;  2GUZ B;  3B4S A;  4YY3 O;  1BCC H;  3FAV B;  1QR9 A;  1NKD A;  2Q68 A;  2B1G A;  4LBE C;  1KMI Z;  2MW2 B;  4ICG A;  4UV9 A;  4XBF A;  2LGW A;  3WG7 B;  3JCZ A;  2ZKO A;  1QHT A;  2VQF B;  3OE7 G;  1N0N A;  4DR5 B;  2Q69 A;  1DGS A;  5IJ9 A;  1WB8 A;  5LHI A;  4LF9 B;  3EFF K;  4DR4 B;  3HKC A;  4MW3 A;  4MTO A;  2XUM A;  2HLD G;  2Z0A A;  3G80 A;  3C3T A;  2L6L A;  2WLJ A;  3JAW B;  2OTL V;  3ZMT A;  3FB6 C;  1VQ9 V;  4ZOL B;  1AIL A;  2V1D A;  2QWQ B;  4TUY A;  1QVG U;  3JAK B;  3ZMS A;  1Y76 B;  5IWA B;  4LC1 A;  1HNW B;  3E35 A;  1FFX A;  4WFF A;  1ZWI C;  3FB8 C;  5GTH Z;  2QKC A;  4JI8 O;  2OIE A;  4Z1M G;  1T5E A;  2RNB A;  2Y0P A;  2F23 A;  3AG2 C;  1K4C C;  1N34 B;  1VQ6 V;  4OPH A;  3I56 V;  3AG3 B;  1ZLZ A;  3JAT A;  4DV7 O;  1OZ0 A;  3E8B A;  3UT5 B;  3N27 A;  3ETG A;  1YIJ V;  2ZIM A;  1HWY A;  1XIL A;  2CAZ C;  4WFA V;  2DE0 X;  4NXM O;  4DV4 B;  5JCO A;  3X2Q C;  1Z5V A;  4KHP B;  1P7B A;  5H5N A;  3GVM A;  4JYB A;  2BTO A;  2UU9 B;  3B77 A;  5J2T A;  1YIT V;  4OPA A;  4UFZ A;  4JYC A;  4FVM A;  5IJ9 B;  2EJ7 A;  1SC5 B;  1M57 B;  5LYJ A;  4MSW C;  4G28 B;  4J80 A;  3CCE V;  4I7Z B;  2ZE6 A;  3ABU A;  5CA1 B;  2ZDI A;  1NU1 H;  4HZ3 A;  3THO A;  3C3S A;  2UXC B;  1XNR B;  5IYZ B;  2Q67 A;  4E4E A;  1H2S B;  3OM3 B;  2ITC C;  5KHK A;  5LOV B;  2ZNI A;  5KHJ A;  1RFY A;  4AIL C;  4I9Q A;  3SPH A;  3K0G A;  3R65 A;  1ARO P;  2EIJ B;  2VWJ A;  4DR1 B;  1WAZ A;  2JS3 A;  4HNA B;  4Z1V A;  1JCH A;  1KU9 A;  1SES A;  4I4T B;  2OCC C;  4TQF A;  5HFL A;  3G6B A;  4F6R A;  2DWD C;  2H94 A;  4GKJ O;  2ZCE A;  3U10 A;  2V4D A;  5B3S B;  3HKD A;  1K3E A;  2ATK C;  5LMN O;  3KCX A;  4X89 A;  1L0L H;  4ABM A;  1RP3 B;  4BR6 A;  3S3X A;  1HNZ B;  5CBF A;  5J2T B;  3GWO A;  3OMN B;  4JI5 B;  1CP9 A;  3ZHQ A;  1JFF A;  3ZBH A;  3CRM A;  4JI6 O;  2DYR C;  5EIB D;  3RWR D;  3OAA G;  4AHC A;  4O2B A;  2JJ2 G;  3CHX A;  4LF4 B;  1X59 A;  4NYK A;  2YEV A;  4KL1 A;  4P9O A;  1CPY A;  4FLZ A;  3ABK B;  3QO8 A;  3E8H A;  1WP8 A;  5DN6 G;  3C90 A;  3TGU H;  4O4J A;  1OCC C;  4IYH A;  4O4L B;  4TT3 G;  2WLI A;  2Q7H A;  5GTI Z;  4CZZ A;  2N04 A;  4JI1 B;  5BZB A;  3T1Y B;  2VQE B;  3N2G B;  1GAX A;  1WB7 A;  2JVD A;  3T1H O;  4DV3 B;  5LMU B;  4B3R B;  4QPK A;  4ZI7 B;  1IBL O;  3F7Y C;  1M4U A;  5CA3 A;  4B3M B;  3AEI A;  4KP4 A;  1GN4 A;  4P9P A;  1NJI W;  2WSS G;  3QO5 A;  5E1A C;  3UQ8 A;  1Z2G A;  1XEQ A;  1V9P A;  1FYJ A;  3VQY A;  3H1I H;  1GK9 A;  3B2E E;  1WA8 A;  3CCU V;  1K5S A;  3BY6 A;  3SJC C;  4LFA O;  3E22 A;  3CCV V;  5CN0 A;  4PA4 A;  4EKW A;  1Q5O A;  3H1L H;  2UUC O;  4JI3 B;  2RN9 A;  4O2A A;  3F7V C;  1H2K A;  3G4S V;  4GCZ A;  2HKO A;  4WBN A;  4JTA B;  1F4N A;  2B9Z A;  2CTW A;  2XAF A;  4LH7 A;  3RN4 A;  2P6J A;  3OGI B;  1BSM A;  1OJH A;  1KEC A;  2XT9 A;  4JAV A;  3RW0 A;  4LCU C;  1Q90 D;  4JAU A;  3RBZ A;  1N8R W;  1FXV A;  1KBH A;  2JEX A;  4O4J B;  1V54 C;  1M56 C;  2Q6A A;  4YXW G;  2UUB O;  4HAM A;  3RYI B;  4U7O A;  1MSD A;  3H1J H;  2WLI B;  5H2F Z;  2Z5U A;  3KG2 A;  3U0Z A;  1VP7 A;  1RM1 C;  3A8T A;  1QQC A;  3N2K B;  3J7A U;  2EZP A;  1YEW A;  4DV2 O;  1MZF A;  1IZ3 A;  1OHH G;  2IJK A;  2KQX A;  3CE2 A;  4PI2 A;  2DYR B;  4MTX A;  1MA1 A;  4MW8 A;  2P06 A;  3RVY A;  2IH1 C;  1WA8 B;  1XMO O;  1HNX B;  4X65 B;  1K4D C;  3L71 H;  4IGG A;  2ZNJ A;  2GTS A;  4ZIB A;  1BQZ A;  3HKE A;  3D3Q A;  4QE9 A;  1UPG A;  1YF2 A;  4NXN B;  3ZHR A;  3ASO C;  2ADP A;  3SYA A;  4WBN B;  3T4Z A;  5KA6 A;  5CBH A;  2X6C A;  4GT1 A;  2DYS B;  3CRQ A;  2LP7 A;  5BXZ A;  1AVM A;  1H2N A;  2HFE C;  2K9P A;  1EBO A;  1XUQ A;  4MVM A;  3K58 A;  4X1I B;  1H38 A;  4K0K B;  4B7K A;  1VQ4 V;  1KC8 W;  4QGP A;  3LDC A;  3CCR V;  4H33 A;  5KUM A;  4DR6 O;  2CK3 G;  5CBG A;  5B5E Z;  1ZX3 A;  1XMQ O;  4PDV A;  3ABM C;  5H6Q A;  5B1A B;  4F6E A;  2BCC H;  3P30 A;  2A79 B;  4X1K B;  4FIP C;  3M99 B;  4FJC C;  1Q86 W;  1NI8 A;  2EIM B;  3BEH A;  1KKD A;  1Y74 B;  2N05 A;  5LL6 Y;  1UFI A;  1Y6X A;  1R73 A;  4MVZ A;  2R9R B;  3W7X A;  4ASU G;  1BT8 A;  4L8J A;  2WLH A;  5GON B;  4I0X A;  1K9M W;  2WA4 A;  1AJP A;  4J11 A;  3G71 V;  2Q7G A;  3EHB B;  3OR6 C;  2CGN A;  3A2F A;  3M8A A;  2JDI G;  2ZD9 A;  4AQY B;  3I55 V;  3GB7 C;  2P22 C;  3CMA V;  1XQ8 A;  1VF6 A;  1AJN A;  3DXR B;  1TVK A;  4I50 A;  1M5I A;  3BAA A;  3ZHT A;  2FB5 A;  2BTQ A;  2Q0A A;  1HR0 B;  1NZ6 A;  3RYC B;  3I5D A;  2UXB B;  1FPO A;  3IJ4 A;  3U11 A;  2EIL B;  1EM1 A;  4X66 O;  5L3C A;  1SQF A;  4JGS A;  4DV6 O;  1S5H C;  1AB3 A;  1JPX A;  2JGD A;  2YSU B;  4DXW A;  4BW5 A;  3ZN0 A;  3ZX6 A;  4DV0 O;  3BAB A;  5C8Y A;  2F4V B;  3RT3 C;  2CH7 B;  4WFH A;  1Q6U A;  4X64 O;  3T4D A;  3ZRW B;  2JS5 A;  3ZS8 C;  3Q4H B;  5IY5 C;  3APQ A;  2PY5 A;  1JJO A;  1BL8 A;  3PJS K;  4QIW F;  4DRX A;  2ZM6 O;  3CD6 V;  3AG1 B;  3BPZ A;  2Y69 B;  1IX9 A;  3ML0 A;  4YHH B;  2OT5 A;  3SPG A;  4JI7 B;  4LFB O;  3F5T A;  1VAR A;  3FX7 A;  2OTJ V;  3SPJ A;  4B3T O;  4NTX A;  2GUZ A;  1SKV A;  5IE9 A;  3K5O A;  2Y48 A;  2FL4 A;  5B1B C;  3OTO O;  1AR5 A;  4IHJ B;  3JSL A;  2QWN B;  2ZQM A;  4IIJ A;  2DOS A;  3ZHV A;  3M7M X;  1ZL8 B;  1F51 A;  2XHB A;  2CE4 A;  4F4L A;  3SDL A;  1I94 B;  2EIK C;  3KKY A;  4JI0 O;  1M9N A;  2LGQ A;  1BQ0 A;  4CBC A;  2A0L A;  4X62 B;  4UV8 A;  1IXM A;  1GM7 A;  2ZXW C;  5L3F A;  5KA5 A;  3TXS A;  4FK5 C;  1JX9 A;  3JAW A;  2Q73 A;  4O4H B;  3HPL C;  4O4I B;  2D3O W;  2CUG A;  4ZOL A;  4UB8 Z;  3ZMU A;  3JAK A;  2Z3Y A;  3CJH B;  1WN7 A;  2V7Q G;  3ZED A;  2AHZ A;  4GX5 A;  5CB4 B;  3OEE G;  2BOC C;  3AK1 A;  2Q5Z A;  4DUZ O;  2HVJ C;  4P2Z A;  5KHH A;  4PJ0 Z;  5EBL C;  2HG5 C;  1AR1 B;  2LFR A;  4U3J B;  1FXH A;  3CYO A;  3HKB B;  3JAL B;  3QO7 A;  1SQB H;  4GUN A;  2UXX A;  1IVS A;  3B40 A;  3LNN A;  1N32 O;  2HEP A;  4J9Y B;  4FM2 A;  1SER A;  3UT5 A;  1N36 O;  1OCO C;  1TUE B;  1NT2 B;  4IIJ B;  3RGB A;  3F5W C;  1RSO B;  3IC7 A;  5FNV B;  1URF A;  1VQL V;  3L74 H;  3CPW U;  3K04 A;  1LUV A;  5FLX N;  4KUM A;  2JJ1 G;  3TXQ A;  3ETD A;  4K8Z A;  2QJ1 A;  3W7S A;  1VQ8 V;  2KSD A;  3MDS A;  4JPR A;  3OMA B;  5CA1 A;  2E5L O;  1MZE A;  4LP8 A;  1H8E G;  5FPR A;  1VIB A;  5EZY B;  5IYZ A;  2AHY A;  3G6E V;  4WFE A;  2QE7 G;  1W59 A;  4DR2 B;  1M90 W;  3JD3 A;  1S5L Z;  1DLB A;  1OCR B;  5LOV A;  2R70 A;  3KCY A;  1GN6 A;  4JAS A;  3WFV A;  4FLU A;  4DR7 O;  4QE7 A;  1E1R G;  3AG4 B;  2Y4T A;  4HNA A;  5JCO C;  2DQ3 A;  4I4T A;  3K9A A;  2YDE A;  2YXH A;  5BMV B;  4JI2 O;  1ORQ C;  4DW1 A;  3W7U A;  1S3J A;  3D8C A;  1E79 G;  4EEQ A;  3NXS A;  1Q82 W;  3BHP A;  4LF8 B;  2LW1 A;  2ZDI C;  1VQM V;  4FLY A;  4I9W A;  3SGI A;  4OXS A;  4UVC A;  3E86 A;  4JF3 A;  1O9H A;  1SQP H;  3FB7 C;  2HHH B;  5BY1 A;  4Z2W A;  2KB1 A;  1Z5W A;  1YI2 V;  3EVK A;  1GKF A;  2A7W A;  1B6Q A;  4WCE V;  3ASN B;  2VQF O;  3JD4 A;  4DR5 O;  3G67 A;  1DF4 A;  1JVM A;  1P4R A;  1XHX A;  1XOU A;  4DR4 O;  1TA8 A;  1GM9 A;  4HBN A;  5KMG B;  3DGE A;  4PDM A;  1EZV H;  4K8X A;  4DV5 B;  4J7K A;  4O4L A;  4D6T H;  2A9H A;  1OCO B;  3N2G A;  2EIN C;  5LGN A;  2AGA A;  5IWA O;  5LA6 B;  4LWS A;  1GTO A;  4XDK A;  1HNW O;  4ZI7 A; 
#chains in the Genus database with same CATH homology
 1WAZ A;  2LJ2 A;  2H3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...