1WAZA

Nmr structure determination of the bacterial mercury transporter, merf, in micelles
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
TPVLVILLGVVGLSALTGYLDYVLLPALAIFIGLTIYAIQRKRQAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure Determination of a Membrane Protein with Two Transmembrane Helices in Micelles: Merf of the Bacterial Mercury Detoxification System
pubmed doi rcsb
source organism Morganella morganii
molecule tags Transport protein
molecule keywords MERF
total genus 13
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2004-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11431 Transport_MerF Membrane transport protein MerF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.910 Mainly Alpha Orthogonal Bundle Helix Hairpins bacterial mercury transporter, merf 1wazA00
2H3OA 2LJ2A 1WAZA
chains in the Genus database with same CATH superfamily
4YHHB 3JCUZ 2IJIA 1HW7A 2JK5C 3L70H 4KXRA 1VQPV 1TUBA 1K97A 4GX0A 4O4HA 2CTWA 2QKCA 4CS3A 1CPYA 3K79A 2P90A 1V9PA 2N04A 2F1MA 3AK2A 4GX1A 4JYCA 4B3TB 1JCHA 1XEQA 4PDRA 4FJCC 5EC1C 1OCOC 4DR4O 3QO7A 3ZHQA 1H2MA 2DYRB 3H1KH 3FAVA 1Q5OA 1IURA 3IC7A 3EFFK 5IJ0A 3AG7A 5KHJA 1NVPB 2PYJA 2HEPA 1TGOA 3OGCC 2KB1A 3LUTB 4JI7B 3CMAV 4G27B 4Q6GA 1BSMA 1M4UA 2UXDO 4QJFB 5K1PA 4JF3A 5LYJA 3M8AA 2Q67A 3D3QA 5A2QN 1VF7A 5B5EZ 4IL6Z 3NXSA 3FD9A 4ZI7A 3W7WA 3DC6A 4DV7B 5CBGA 1P49A 4B3TO 1MA1A 3T1CA 4HYOA 3OR6C 3EVKA 2GTSA 5GONB 4FLXA 1I94O 3N2KA 3JATA 4CS2A 3DSQA 4JAVA 5JH7B 1R6NA 5IYZA 1PV0A 3H1HH 2OWOA 4JZGA 3WB2A 4K8ZA 1FXKA 5K1XA 1VQLV 2Q5ZA 4J10A 4I50A 1I5XA 2R72A 2VRZA 1JA8A 3E8BA 3K3WA 3G67A 3WG7B 4PI0A 4X1YB 4GKJO 5BZBA 1VQNV 4LBEC 5KAFZ 2Q69A 2YICA 4YY3O 4KL1A 2BTQB 2EIKB 2EINB 5J2TB 3S3WA 3BA9A 3K9SA 4LWSB 4TOIA 1F51A 3K5MA 3JALA 4OX9O 2ZNJA 1SKVA 3NR7A 4R8CA 4B3RB 2PUSA 5LGTA 1R6TA 1AB3A 1V54C 5KX5B 5B1AB 1KKCA 4X9QA 1IBKO 4PA6A 3CRQA 4L87A 5KA5A 1XOUA 2R9AA 1PNLA 2JVDA 4JTAB 1WJZA 5KUKA 2Q9LA 4MW8A 4U3JB 1IBLO 2BCCH 5D5QA 1AP5A 4YJ3A 5B1BB 2V7QG 3IGAC 3L71H 1JR9A 1RFYA 3CXCU 4TQDA 1THZA 1JQ0A 1L1FA 1I0HA 4ABMA 5CA0B 1VF6A 1I94B 4FFBA 1NVPD 2BTOA 4BW9A 1K9MW 1QLEB 3JASA 3CPWU 1M1KW 5B1BC 3J80N 2EJRA 3EHBB 3K5OA 2R9RB 2UUAO 4JYYA 1VP7A 4DUYO 2ZINA 3K58A 3J81N 3OUFA 3C3SA 3G4SV 4JI4O 5GTHZ 2CGOA 3ETDA 4I9QA 3BFRA 4DW0A 5KHGA 3E83A 4AQYB 2HLDG 1ZTEA 3OM3B 1KP3A 1KMIZ 3E8FA 4RAIA 3ZJZA 4OPHA 5LA6B 4FIPC 3OE7G 4DR3O 4LFBO 4PELA 1VARA 3K06A 5LHIA 4DV5O 1HNZO 3JSLA 1IX9A 1N32B 2DJVA 3CE2A 3H1IH 1WA8B 4JV5B 1N0NA 2AXTZ 1WP7A 2BSKA 3WB1A 3I5DA 4ZBMA 1VF5B 5IWAB 4B3SB 2XAQA 4J7JA 4LFCO 1F23A 4YJ2A 1GO3F 2E75B 4DV3B 2KG7B 1UJWB 2ZIMA 4IIJB 4J42A 1AI7A 4QPJA 1WB8A 4O2BA 1GK9A 2X6BA 5KA6A 1PNMA 1OCRC 4DV0O 4FLZA 3CXHF 1EN4A 3QTCA 4JAAA 1P7GA 2ZD9A 4OXSA 4K3AA 4DXWA 5BR8O 3B2EE 2XHBA 2LW7A 3FB8C 4P9PA 3TCUA 3A2FA 2VQFB 4JV5O 4EKWA 4LF4B 3JCZA 5JWPA 4NTWA 1Y74A 4X20B 3BVOA 4IYHA 5EZYA 1GN6A 4TV9B 1Q86W 3SYQA 4K35A 1KC8W 1MOFA 2Q73A 3E22B 3OMIB 2AHZA 5H6QA 2FTKA 2V1DA 2CE4A 5E1AC 3JAWB 1JVMA 1OZ0A 1QVGU 3VQWA 1YXBA 3R66A 2WLMA 3B8MA 3A8TA 1VQ5V 2E5LB 5LMNO 4UVAA 2JS5A 1Q6IA 3E2EA 2PYLA 4HZ3A 4X64B 2NR5A 4UCSA 4EFEA 3SPHA 2ZNIA 4FZ0A 2O57A 4U3JA 4MW3A 2LFSA 4UVCA 1W2BU 4DV4O 2Z3YA 3SYOA 2QWOB 4X62O 1MMMA 2GV9A 2P06A 3ZHTA 5CB4B 1VQ6V 2Q8VA 1FXVA 4KFMA 3I55V 4B3MB 2F23A 4CZZA 1TUEB 3KCYA 1KU9A 4C7UA 3JASB 1OCZB 4GT1A 2E74B 1EN5A 4R7CA 5LXTB 3IAYA 4O2AB 2HHHB 2A7WA 2MK3A 4LR3A 3HKCB 2CK3G 4BIOA 2AGAA 2EZOA 2V4DA 3N27A 3ZRWA 2UUCO 1JOYA 4WFHA 5JQGB 2EINC 1K4DC 1XMOB 3HPLC 4UV8A 1JFFA 5DM6V 2YIBD 3OEEG 5LA6A 3CCMV 4JASA 2XT9A 2RN9A 4XDLA 3AK1A 1YCIA 4O4IA 3CCRV 2B5UA 2P7TC 3A0HZ 1KUQA 4YY3B 5B3SB 1YITV 3K0GA 2ZR2A 3ETEA 1JMKC 2EILB 4WFBV 4UCUA 3CRRA 1NZ6A 3JAKB 2QJ1A 5B1OA 1HP8A 1PP9H 3T1HO 1P7BA 3E8GA 3H9VA 5FNVB 1N33O 2YSUB 5B1AC 1R73A 4OPAA 3CCJV 3RYFA 2EIJB 4YHHO 2NNUA 1VQ7V 2YIDA 5KAIZ 2Y4UA 3OW2U 2KG7A 3LDDA 3IJ4A 4NTXA 4BIUA 1OCOB 2IM9A 3ZHVA 2OIGA 1IBLB 4IHJA 1N0JA 1URFA 3SJCC 3JD4A 3VQVA 5L3GA 1P84F 3K9AA 5EIBC 5CA1A 1TVKB 3OTOB 4KHPO 1NTZH 1IXBA 1EBOA 4MTFA 1AR4A 3STLC 5H5NA 1RM1B 4NTYA 1UFIA 5IJ9A 2DYRC 4X66O 2XASA 5FPRA 2QM8A 1QLNA 3LDEA 1Y76B 4DR6B 2CUGA 2P5OA 1PKXA 2YI9A 5EYPA 3ZEDA 1KBHA 1XNRO 3FYEB 1GH6A 4TQFA 3X2QB 1LNQA 3OR7C 4MS2A 4FM1A 2UUBO 2WLHA 2H8PC 3ASNC 4LNUB 3LSQA 4MVZA 1VIBA 5KMGB 4O4JB 2ZCEA 3L74H 4QE7A 4FM2A 1HNXB 2DE0X 1I08A 1YSCA 2HVKC 2X6CA 2AW9A 3DGEA 3OAAG 1AJQA 4MVUA 2HJDA 2WLLA 5LMUB 4HAMA 3UO3A 1RP3B 3K5LA 1KB9F 3CCLV 3T4DA 2E5LO 3AG4C 4DR2O 2YDEA 4B08A 4LP8A 3BAAA 1AR5A 1UPGA 2NLJC 3OMNB 2HR3A 3C3TA 4J41A 1VQKV 4RQEA 1TAEA 5LXTA 4LF5B 1BL8A 4DV6B 2ZQMA 4O2AA 4GKKO 3CJHB 3FB5C 2DOSA 4HNAA 4R6ZA 4P2ZA 1Z5VA 4TT3G 3P3PA 4JI6O 1XL4A 3T1YO 2D2CB 3RVZA 3HKBA 4I4TB 4JI4B 4TUYA 1TUBB 3EXAA 2M7WA 5H9CA 4ICGA 3CB2A 4X62B 2GUZA 2DYSB 4LF9B 3MAQA 3ZRSA 2VQFO 1JJOA 2OTLV 4MVRA 5IE9A 3F5WC 3FB6C 3N2KB 3JATB 4CBCA 4K8XA 3B77A 1YJNV 3OEHG 2YUAA 2OIEA 4LF5O 4NVPA 1BCCH 3ZHRA 2UXNA 1FXKB 4JI0B 2DMXA 3GWKC 1YF2A 1SQQH 1H8EG 4AI8A 3HKEB 1XILA 1N33B 4RUEA 5HFLA 4W4LA 4AILC 1W0JG 3D36A 1N32O 4DV3O 1QR8A 3L75H 3RYIB 2WLJA 3WG7C 1ORQC 3LDCA 2ZDIC 1SQGA 3OTOO 3DTUB 2PZSA 3BEHA 1ZX3A 3SJBC 1SETA 1K4CC 2LGQA 5F2VO 1XMQO 3PN1A 2DWEC 4LC1A 1WB7A 1US6A 4X65B 1QVFU 4ZOLA 4DR1O 1BQZA 1AJPA 3AK3A 1E79G 1WNSA 3BPZA 5GONA 4LF7O 5GTIZ 2LFRA 3D8CA 3FYIB 4J9ZB 3P3NA 2HHHO 3PJSK 1JJ2U 1T5EA 3AG1C 2PGGA 5IYZB 3CD6V 1YVWA 3SPIA 3ZRVA 4O4JA 1L0NH 1EFRG 1HR0B 4I55B 4X8AA 4QE9A 3TXSA 1AILA 4NXNB 3C90A 3ZMSA 3G71V 4X1YA 4RWUA 3ZIAG 4LF6B 2UU9B 2EULA 3SPCA 3ETQA 2B9ZA 5E79Z 1SERA 3BA8A 1S5LZ 4YIPA 4CS4A 1KD1W 1YJWV 3OFNG 1HDJA 1MSDA 2E76B 4JI7O 1N34B 1AI5A 5LP6C 3W7SA 2QTSA 3BY6A 2Y48A 3RW0A 1S0VA 1B3QA 2QWQB 3QO5A 4GCZA 2AZ0A 1IDSA 1FYJA 3Q4HA 1H2KA 2QR4A 3BABA 2IU0A 4PJ0Z 4FLVA 4UV9A 4X65O 3CCSV 3SPJA 1Q6UA 1IBMO 1WA8A 1M56B 2LQTA 4NYKA 4TV8B 1M90W 1KYOF 4DV1O 1Q6HA 2P4VA 3UO2A 4F4LA 2M6YA 2FYUH 1WP8A 3JYCA 1P4RA 1LUWA 1OJHA 4EB6B 2Q68A 2F93B 2Q0OC 2LP7A 3L73H 2RDCA 1FXHA 2OTJV 5LBQA 3B8NA 4H13B 1J5EB 1TA8A 1GTOA 3SYAA 1K33A 3QVNA 4JTDB 5CN0A 3O9OA 1RSOB 2ADPA 2WLIA 2B1IA 3TXQA 1GKFA 5EBLC 1SA0A 4NXNO 1XDCA 1IZ3A 4J7ZA 1NH2D 2A9HA 4P9OA 5L3CA 3HKEA 2QDOA 3ZHSA 2ADQB 2H3OA 2HJFC 2P67A 2Q7HA 4GX5A 5EIBD 4A5UB 3K03A 4X20A 3ETGA 4PHZA 4F6RA 2CTQA 4ZKIA 4DV6O 1Y6XA 3R65A 2YS8A 3E22A 3HR0A 3RBZA 2IJKA 2XNDG 2ZE7A 4H33A 3SR2C 3KKYA 1SQFA 4K0KB 3JD0A 2JGDA 4X88A 1SRYA 2QWNB 4F6EA 2ZR3A 3B4SA 3ZHUA 4J11A 4X1IB 1XQ8A 1S3JA 4DR6O 3AG4B 4CH6A 1AROP 1KQSU 4LH7A 3TJTA 4XBFA 4UXNA 3LNMB 3RWRD 2ITCC 3DXRA 3ASNB 1XI1A 1QNMA 5B66Z 2JGUA 5C8YB 3BCCH 5IT9N 2WAMA 4J7KA 5LGNA 5CB4A 1EZVH 1LR1A 1H2NA 1DK1A 3FFQA 4GX2A 4X64O 3CCVV 4PV1B 1ZL8B 4DRXA 3APQA 3G6BA 4EFBA 4FMTA 4FPPA 1KKDA 3CCQV 1VF6C 4PA9A 5EZYB 3SYCA 4BW5A 4TV9A 4FLWA 1FS0G 5EBMC 1XMQB 4Q20A 5CA3A 4MTXA 4DW1A 3ABLC 1QHTA 3G6EV 2DQ3A 2Z5UA 5EBWC 5L3EA 5J2UA 4DK1A 1K73W 3JD3A 2F95B 1FXKC 3D3IA 1WPXA 2HFEC 3SJAC 3U10A 4PDVA 2W0XA 3UT5B 1M5IA 2K9PA 4W4KA 3F5TA 4ZI7B 4O4HB 1BE3H 2ZXWB 3UM7A 1MZEA 2Y0IA 2Q7GA 2JEUA 5BR8B 1NTKH 1Z5WA 4JI3O 2EIKC 4X66B 1GRJA 5ITZB 2X7RB 1V55B 2CH7A 5A9GA 5B3SC 1BQ0A 2WSSG 4GLXA 4PD4F 4I0XA 1CP9A 2GTAA 2DN9A 2RCVA 5IJ0B 2ZM6B 2QKAA 3ZMUA 3E86A 2ZKOA 5EK0A 1PL0A 2UXBO 4O4LB 2LJ2A 2DW4A 1N36O 2EIJC 2QWRB 3HKCA 4LFCB 1QQCA 5CBHA 1K5QA 3UKMA 5J2TA 1NH2B 2QM4A 3CP1A 3FB7C 3H01A 2VQEO 1KP2A 1HR0O 3RYHB 3STZC 2G38A 2WPDG 2XOKG 1H2SB 4LF8O 1R1BA 1XL6A 2ZIOA 3OT7A 3CS5A 1X4TA 1SQXH 3TGUH 4WFFA 4DV4B 1YHQV 5KX5A 3MDSA 5FLXN 2OT5A 3FKSG 4JGSA 2ILMA 5B1NA 3N2GA 4QNHB 2P22C 4UFZA 2FL4A 1Z2GA 1ZAUA 2UXDB 2UXXA 5KUMA 1B04A 4WBNA 3T1YB 3I56V 3SPGA 3AG2C 3CCEV 1XREA 1WPBA 3JARB 1FFXA 3K0DA 3SGIA 1VQ9V 1DF5A 2YIBA 1K7DA 4Z1MG 2Q7EA 5JJEB 4FK5C 4R50A 2IU3A 2GBOA 2JS3A 2ITDC 2XAGA 3ZMVA 1K5SA 2Q4PA 2IJJA 3ZMZA 3DC5A 1E1QG 5LP6B 2CAZC 2X0LA 1K92A 1CXZB 1VQMV 2LO1A 1VQ4V 5CBFA 4WFAV 1FD9A 3E89A 2BTQA 2IW5A 3UQ8A 4DR2B 3G80A 4U7OA 1F7YA 1VQ8V 1D5NA 1JPXA 2EJ7A 1KECA 4U3FH 1ZWIC 1R3JC 3JALB 2QSAA 1S72V 3WB0A 3AG1B 5IDJA 3W7TA 3B09A 4GKJB 3E8HA 1L8DA 1S5HC 2DQ0A 1QU7A 4DR5O 2A79B 3ABTA 1M9NA 5C93A 2W6JG 1SQPH 3IC9A 5KHHA 5EYPB 1HNXO 5DEDA 1IBKB 5JVDA 2RNBA 3K04A 3CJHA 1MABG 2YXHA 2QM7A 4GUNA 4BAYA 4I5SA 1AR1B 2EIMB 5KMGA 4PA4A 2UUBB 4OX9B 5CA0A 1S76D 5J2UB 4FFBB 3GVMA 3HB3B 1M57B 1HNWO 4FLUA 3RN4A 4XDKA 4LF4O 4IIJA 4AHCA 1GM9A 3ZBHA 5GW7A 2WA3A 3IFXA 4WCEV 4P30A 4ZIBA 3J7AU 4MVMA 1R3IC 5ITZA 4I7ZB 1J5EO 2GHYA 2IH3C 5BY1A 1LUVA 2B1GA 3ABKC 1SC5B 4DV0B 1YTFD 2QE7G 4IT5A 4B3MO 3RYCA 2CGNA 3QG5A 1H2GA 3FX7A 3M7MX 5KLVH 3QF7A 1YDXA 2MW2B 3RYIA 2UU9O 1NJIW 1G4YB 1MG1A 1SQVH 3A0RA 3U0ZA 3ZN0A 2BSKB 1K8AW 4JYBA 4LFBB 3W7XA 4JI1B 4FM0A 3AEIA 1OV9A 1EZJA 2GSMB 1SF9A 1YZBA 4LFAB 1I7FA 4JI2O 1XNRB 3ASOB 2VS0A 4ZOLB 4JI8O 3N2GB 4DV5B 1HNZB 1O9GA 3QNEA 1M57C 2H94A 4B7KA 1D2DA 4WBNB 1DTOA 4UUJC 5IYDO 1BMFG 5BMVB 2R70A 2OCHA 2EIMC 4LFAO 2BE3A 4JI3B 3ABLB 4OGQB 1RPOA 2GDSA 4I55A 2LW1A 2Y69B 2Y69C 1O9HA 1U97A 1D5AA 4D7SA 1S77D 2VQEB 5LP6A 1GMGA 2P6JA 3KCXA 1SZXA 2RJZA 1GM7A 4X1KB 3W7UA 2DWDC 5IYCO 1DLBA 3VBBA 1G8MA 2L6LA 4DYLA 3ML0A 1FPOA 4D7TA 2VWJA 4PA7A 4LF7B 3E35A 4ZHQB 3ZRWB 4J9YB 3K08A 4DR5B 4N21A 1YJ9V 1V54B 1G1XB 1JFFB 5KHKA 3KG2A 2LGWA 5HFMA 4WFEA 4BR6A 4DR7B 4NB5A 3UCSC 1NR7A 1WN7A 3F7YC 3K5NA 2KKWA 2AHYA 1Q82W 4LF9O 5JVDB 1BHBA 4EEQA 1H8HG 3JSNA 5CMUA 3RGBA 3CX5F 2W6IG 4YIOA 3SJQC 2BOBC 3JAKA 4MVSA 1PNKA 2DYSC 4UCRA 1Q7YW 3VQXA 1YEWA 1Q90D 3B40A 3FAVB 3ZCCA 1RM1C 3CCUV 3X2QC 5L3DA 4JI0O 1N34O 4JI6B 3K57A 2YXYA 1I5YA 1ZLZA 3LSUA 1BS3A 1V55C 3LSSA 1YI2V 1IVSA 1U96A 3BHPA 2VWKA 4PDMA 4DV7O 4XDJA 5J9PC 4GZRB 1FAFA 5JQGA 2N74A 5JCOA 2ZT9B 2WLIB 4Z2WA 3AG3B 2HKOA 2P4KA 2FKXA 4RO2A 5IJ9B 5JJJB 1GAXA 2FB5A 4JYAO 4G2KA 3Q4HB 3RYCB 5LOVA 4WFGA 2PTMA 3MHSC 3AG2B 4DV2B 1ROPA 4KP4A 2E3CA 2N05A 2UXBB 3K59A 4YXWG 3CSXA 1XBLA 4TV8A 4F6RB 2JRIA 2CTRA 2ZXWC 1CEZA 4UB8Z 1SZTA 5FNVA 4FLTA 2PY5A 1BHAA 3BRCA 3ZS8C 3CEIA 4I50B 2UUCB 3RYFB 1OCCC 2Y4TA 3MHHC 2F4VB 5JJNB 3VQYA 1AI6A 2XAFA 1R3KC 1Y4MA 4B3RO 3CWBH 4JPRA 2WLLB 4IHJB 1Y66A 3LNNA 1AJNA 1G6UA 2EBOA 1M93A 2JJ1G 4LWSA 4JI1O 3ZMTA 2BOCC 1WAZA 3DXRB 4N23A 4JI5B 1RSOA 2HVJC 5KHIA 2IH1C 3SYPA 3VOUA 4BWAA 4ASUG 2A06H 1SS3A 1A32A 4HBNA 2ZM6O 4X89A 2K1EA 2RQ6A 1GN3A 3OGIB 3MD0A 1FJGO 4JZ2A 5DECA 4CC6A 1DGSA 1JX9A 2R9IA 2RMKB 1H38A 3HKDB 2YC0A 1R3LC 1F4MA 4YJ3B 4B7EA 1X59A 2YI8A 4HNAB 2Q0AA 4KUMA 2L35A 1XHZA 1W0KG 4E4EA 4I4TA 2JJ2G 2CTPA 4ZHQA 4NXMB 4DV1B 1NBMG 1WLEA 1W59A 2YIAA 3UT5A 3WFVA 5IYBO 2JGDB 3F7VC 3O65A 4UVBA 2CDYA 4YJ2B 3ZN1A 1FKAO 2GUZB 1OCCB 3ZRXA 2XUMA 4JI5O 2WLNA 1E1RG 2QEXV 1MZFA 5IWAO 1NS1A 2EZPA 3QO8A 3JAMN 2AZ2A 3CC7V 1SQBH 3CC4V 2ZDIA 3ICXA 3P32A 4J80A 4DR7O 3S3XA 4DK0A 1XNQB 4U7NA 1QR9A 1N8RW 2ZE5A 4UCVA 3KZIZ 1YTFB 1R6KA 1GN2A 4I0XB 2JDIG 4Z1VA 3T2MA 4FVMA 4JTCB 3RFRA 1SESA 2D3OW 1XHXA 3A0BZ 1Y74B 1ZUQA 4LF8B 3HKBB 3CHXA 4DV2O 4RQFA 5LMUO 1K34A 1VMGA 1VEWA 4PDLA 4TUYB 4UCTA 4TWKA 3CRAA 3ASOC 4PI2A 4QPKA 1NKDA 5BXZA 4NXMO 3U11A 4PA3A 4IYIA 5LOVB 3ABMB 2W0FC 3H1JH 4O2BB 2HP8A 2YEVB 4MTGA 5LMNB 2F4VO 1B06A 1PD3A 3WU2Z 1Q8IA 4JI8B 3GWOA 1PPJH 2IJHA 5IY5B 4JI2B 2C2AA 2CH7B 1N36B 4WF9V 5LGUA 1S5JA 5AG2A 2YXLA 1HWYA 4LCUC 2UXCO 3SDLA 1L0LH 5JCOC 1ZSPA 2ARHA 4O4LA 3P30A 1QLEC 2QA4V 3CC2V 1DF4A 2WLKA 4MTOA 1AVMA 4CH4A 4DUZO 1AP6A 2WWWA 4UCOA 1HNWB 3ABUA 2UXCB 2QGNA 3RYHA 3CMEV 3ZX6A 2PI5A 3JAWA 4H0LB 1Q43A 5FPOA 1ENVA 1PM9A 1EN6A 2ETNA 2OCCC 1H2LA 4RUFA 4NR1A 2A3QA 1OHHG 3JD2A 1BZKA 1QCEA 1M56C 2OYQA 1FJGB 4O4IB 1NT2B 3RVYA 2QWPB 3HKDA 4FZ1A 2ZE6A 1MNGA 2X6AA 4I9WA 2QTOA 3JARA 4FLYA 1FFXB 5TISZ 3T1HB 3OTFA 2Y0PA 1YIJV 1F4NA 4NKGB 4JAUA 5H2FZ 3GB7C 4GYCB 3OUSA 4CC5A 4JYAB 4UB6Z 1NR1A 2Z0AA 1Y67A 4DUZB 2Q6AA 5FL7G 1NTMH 1FFTB 2JEXA 1XMOO 2XTAA 4QIWF 1GM8A 3OD4A 3OMAB 4MT8A 3CYOA 1TVKA 5LYJB 5L3BA 1XNQO 2F43G 1XUQA 1Q3EA 4AQYO 1BT8A 3CRCA 2QKSA 1K3EA 1AI4A 4MVQA 2EX3A 3ABMC 1OCRB 3T4ZA 5LHHA 4K0KO 1B6QA 5EC2C 2EILC 2ZE8A 3TETA 2NN4A 4DUYB 2KSDA 3TK1A 4G28B 4B3SO 3ABKB 4H44B 5L3FA 5IY5C 3RT3C 1IXMA 2JIZG 1EM1A 5JH7A 2XAJA 1VQOV 4KHPB 4LF6O 4IGGA 4BIZA 5LHGA 4H37A 3L72H 2FMLA 4CH3A 2KQXA 3D36C 1MSWD 2PF4E 4EB6A 2F66C 4DR3B 2IBZH 3M99B 5LL6Y 5DN6G 1GN4A 1J95A 1NI8A 3L9DA 3THOA 2XAHA 1NQTA 2A0LA 4X1IA 1PL4A 1Q81W 2HG5C 2YEVA 5H6RA 4LH6A 5CA1B 3JD1A 4MSWC 4DR1B 4DR4B 1IBMB 2WA4A 5BMVA 2UUAB 5C8YA 2PI4A 4D6TH 4FFKA 4QGPA 2OCCB 1SA0B 1N4CA 1RPRA 4MVOA 3APOA 3CRMA 1QBZA 4L8JA 4E2LA 1Y76A 4CH5A 1ZL8A 4DRXB 1BGYH 1COWG 3H1LH 2ATKC 4X1KA 3AG3C 1OCZC 4TSFG 4DO2A 1NU1H 4GKKB 4LNUA 2ODMA 5D5PA
chains in the Genus database with same CATH topology
2H3OA 2LJ2A 1WAZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3O A;  2LJ2 A;  1WAZ A; 
#chains in the Genus database with same CATH topology
 4YHH B;  3JCU Z;  2IJI A;  1HW7 A;  2JK5 C;  3L70 H;  4KXR A;  1VQP V;  1TUB A;  1K97 A;  4GX0 A;  4O4H A;  2CTW A;  2QKC A;  4CS3 A;  1CPY A;  3K79 A;  2P90 A;  1V9P A;  2N04 A;  2F1M A;  3AK2 A;  4GX1 A;  4JYC A;  4B3T B;  1JCH A;  1XEQ A;  4PDR A;  4FJC C;  5EC1 C;  1OCO C;  4DR4 O;  3QO7 A;  3ZHQ A;  1H2M A;  2DYR B;  3H1K H;  3FAV A;  1Q5O A;  1IUR A;  3IC7 A;  3EFF K;  5IJ0 A;  3AG7 A;  5KHJ A;  1NVP B;  2PYJ A;  2HEP A;  1TGO A;  3OGC C;  2KB1 A;  3LUT B;  4JI7 B;  3CMA V;  4G27 B;  4Q6G A;  1BSM A;  1M4U A;  2UXD O;  4QJF B;  5K1P A;  4JF3 A;  5LYJ A;  3M8A A;  2Q67 A;  3D3Q A;  5A2Q N;  1VF7 A;  5B5E Z;  4IL6 Z;  3NXS A;  3FD9 A;  4ZI7 A;  3W7W A;  3DC6 A;  4DV7 B;  5CBG A;  1P49 A;  4B3T O;  1MA1 A;  3T1C A;  4HYO A;  3OR6 C;  3EVK A;  2GTS A;  5GON B;  4FLX A;  1I94 O;  3N2K A;  3JAT A;  4CS2 A;  3DSQ A;  4JAV A;  5JH7 B;  1R6N A;  5IYZ A;  1PV0 A;  3H1H H;  2OWO A;  4JZG A;  3WB2 A;  4K8Z A;  1FXK A;  5K1X A;  1VQL V;  2Q5Z A;  4J10 A;  4I50 A;  1I5X A;  2R72 A;  2VRZ A;  1JA8 A;  3E8B A;  3K3W A;  3G67 A;  3WG7 B;  4PI0 A;  4X1Y B;  4GKJ O;  5BZB A;  1VQN V;  4LBE C;  5KAF Z;  2Q69 A;  2YIC A;  4YY3 O;  4KL1 A;  2BTQ B;  2EIK B;  2EIN B;  5J2T B;  3S3W A;  3BA9 A;  3K9S A;  4LWS B;  4TOI A;  1F51 A;  3K5M A;  3JAL A;  4OX9 O;  2ZNJ A;  1SKV A;  3NR7 A;  4R8C A;  4B3R B;  2PUS A;  5LGT A;  1R6T A;  1AB3 A;  1V54 C;  5KX5 B;  5B1A B;  1KKC A;  4X9Q A;  1IBK O;  4PA6 A;  3CRQ A;  4L87 A;  5KA5 A;  1XOU A;  2R9A A;  1PNL A;  2JVD A;  4JTA B;  1WJZ A;  5KUK A;  2Q9L A;  4MW8 A;  4U3J B;  1IBL O;  2BCC H;  5D5Q A;  1AP5 A;  4YJ3 A;  5B1B B;  2V7Q G;  3IGA C;  3L71 H;  1JR9 A;  1RFY A;  3CXC U;  4TQD A;  1THZ A;  1JQ0 A;  1L1F A;  1I0H A;  4ABM A;  5CA0 B;  1VF6 A;  1I94 B;  4FFB A;  1NVP D;  2BTO A;  4BW9 A;  1K9M W;  1QLE B;  3JAS A;  3CPW U;  1M1K W;  5B1B C;  3J80 N;  2EJR A;  3EHB B;  3K5O A;  2R9R B;  2UUA O;  4JYY A;  1VP7 A;  4DUY O;  2ZIN A;  3K58 A;  3J81 N;  3OUF A;  3C3S A;  3G4S V;  4JI4 O;  5GTH Z;  2CGO A;  3ETD A;  4I9Q A;  3BFR A;  4DW0 A;  5KHG A;  3E83 A;  4AQY B;  2HLD G;  1ZTE A;  3OM3 B;  1KP3 A;  1KMI Z;  3E8F A;  4RAI A;  3ZJZ A;  4OPH A;  5LA6 B;  4FIP C;  3OE7 G;  4DR3 O;  4LFB O;  4PEL A;  1VAR A;  3K06 A;  5LHI A;  4DV5 O;  1HNZ O;  3JSL A;  1IX9 A;  1N32 B;  2DJV A;  3CE2 A;  3H1I H;  1WA8 B;  4JV5 B;  1N0N A;  2AXT Z;  1WP7 A;  2BSK A;  3WB1 A;  3I5D A;  4ZBM A;  1VF5 B;  5IWA B;  4B3S B;  2XAQ A;  4J7J A;  4LFC O;  1F23 A;  4YJ2 A;  1GO3 F;  2E75 B;  4DV3 B;  2KG7 B;  1UJW B;  2ZIM A;  4IIJ B;  4J42 A;  1AI7 A;  4QPJ A;  1WB8 A;  4O2B A;  1GK9 A;  2X6B A;  5KA6 A;  1PNM A;  1OCR C;  4DV0 O;  4FLZ A;  3CXH F;  1EN4 A;  3QTC A;  4JAA A;  1P7G A;  2ZD9 A;  4OXS A;  4K3A A;  4DXW A;  5BR8 O;  3B2E E;  2XHB A;  2LW7 A;  3FB8 C;  4P9P A;  3TCU A;  3A2F A;  2VQF B;  4JV5 O;  4EKW A;  4LF4 B;  3JCZ A;  5JWP A;  4NTW A;  1Y74 A;  4X20 B;  3BVO A;  4IYH A;  5EZY A;  1GN6 A;  4TV9 B;  1Q86 W;  3SYQ A;  4K35 A;  1KC8 W;  1MOF A;  2Q73 A;  3E22 B;  3OMI B;  2AHZ A;  5H6Q A;  2FTK A;  2V1D A;  2CE4 A;  5E1A C;  3JAW B;  1JVM A;  1OZ0 A;  1QVG U;  3VQW A;  1YXB A;  3R66 A;  2WLM A;  3B8M A;  3A8T A;  1VQ5 V;  2E5L B;  5LMN O;  4UVA A;  2JS5 A;  1Q6I A;  3E2E A;  2PYL A;  4HZ3 A;  4X64 B;  2NR5 A;  4UCS A;  4EFE A;  3SPH A;  2ZNI A;  4FZ0 A;  2O57 A;  4U3J A;  4MW3 A;  2LFS A;  4UVC A;  1W2B U;  4DV4 O;  2Z3Y A;  3SYO A;  2QWO B;  4X62 O;  1MMM A;  2GV9 A;  2P06 A;  3ZHT A;  5CB4 B;  1VQ6 V;  2Q8V A;  1FXV A;  4KFM A;  3I55 V;  4B3M B;  2F23 A;  4CZZ A;  1TUE B;  3KCY A;  1KU9 A;  4C7U A;  3JAS B;  1OCZ B;  4GT1 A;  2E74 B;  1EN5 A;  4R7C A;  5LXT B;  3IAY A;  4O2A B;  2HHH B;  2A7W A;  2MK3 A;  4LR3 A;  3HKC B;  2CK3 G;  4BIO A;  2AGA A;  2EZO A;  2V4D A;  3N27 A;  3ZRW A;  2UUC O;  1JOY A;  4WFH A;  5JQG B;  2EIN C;  1K4D C;  1XMO B;  3HPL C;  4UV8 A;  1JFF A;  5DM6 V;  2YIB D;  3OEE G;  5LA6 A;  3CCM V;  4JAS A;  2XT9 A;  2RN9 A;  4XDL A;  3AK1 A;  1YCI A;  4O4I A;  3CCR V;  2B5U A;  2P7T C;  3A0H Z;  1KUQ A;  4YY3 B;  5B3S B;  1YIT V;  3K0G A;  2ZR2 A;  3ETE A;  1JMK C;  2EIL B;  4WFB V;  4UCU A;  3CRR A;  1NZ6 A;  3JAK B;  2QJ1 A;  5B1O A;  1HP8 A;  1PP9 H;  3T1H O;  1P7B A;  3E8G A;  3H9V A;  5FNV B;  1N33 O;  2YSU B;  5B1A C;  1R73 A;  4OPA A;  3CCJ V;  3RYF A;  2EIJ B;  4YHH O;  2NNU A;  1VQ7 V;  2YID A;  5KAI Z;  2Y4U A;  3OW2 U;  2KG7 A;  3LDD A;  3IJ4 A;  4NTX A;  4BIU A;  1OCO B;  2IM9 A;  3ZHV A;  2OIG A;  1IBL B;  4IHJ A;  1N0J A;  1URF A;  3SJC C;  3JD4 A;  3VQV A;  5L3G A;  1P84 F;  3K9A A;  5EIB C;  5CA1 A;  1TVK B;  3OTO B;  4KHP O;  1NTZ H;  1IXB A;  1EBO A;  4MTF A;  1AR4 A;  3STL C;  5H5N A;  1RM1 B;  4NTY A;  1UFI A;  5IJ9 A;  2DYR C;  4X66 O;  2XAS A;  5FPR A;  2QM8 A;  1QLN A;  3LDE A;  1Y76 B;  4DR6 B;  2CUG A;  2P5O A;  1PKX A;  2YI9 A;  5EYP A;  3ZED A;  1KBH A;  1XNR O;  3FYE B;  1GH6 A;  4TQF A;  3X2Q B;  1LNQ A;  3OR7 C;  4MS2 A;  4FM1 A;  2UUB O;  2WLH A;  2H8P C;  3ASN C;  4LNU B;  3LSQ A;  4MVZ A;  1VIB A;  5KMG B;  4O4J B;  2ZCE A;  3L74 H;  4QE7 A;  4FM2 A;  1HNX B;  2DE0 X;  1I08 A;  1YSC A;  2HVK C;  2X6C A;  2AW9 A;  3DGE A;  3OAA G;  1AJQ A;  4MVU A;  2HJD A;  2WLL A;  5LMU B;  4HAM A;  3UO3 A;  1RP3 B;  3K5L A;  1KB9 F;  3CCL V;  3T4D A;  2E5L O;  3AG4 C;  4DR2 O;  2YDE A;  4B08 A;  4LP8 A;  3BAA A;  1AR5 A;  1UPG A;  2NLJ C;  3OMN B;  2HR3 A;  3C3T A;  4J41 A;  1VQK V;  4RQE A;  1TAE A;  5LXT A;  4LF5 B;  1BL8 A;  4DV6 B;  2ZQM A;  4O2A A;  4GKK O;  3CJH B;  3FB5 C;  2DOS A;  4HNA A;  4R6Z A;  4P2Z A;  1Z5V A;  4TT3 G;  3P3P A;  4JI6 O;  1XL4 A;  3T1Y O;  2D2C B;  3RVZ A;  3HKB A;  4I4T B;  4JI4 B;  4TUY A;  1TUB B;  3EXA A;  2M7W A;  5H9C A;  4ICG A;  3CB2 A;  4X62 B;  2GUZ A;  2DYS B;  4LF9 B;  3MAQ A;  3ZRS A;  2VQF O;  1JJO A;  2OTL V;  4MVR A;  5IE9 A;  3F5W C;  3FB6 C;  3N2K B;  3JAT B;  4CBC A;  4K8X A;  3B77 A;  1YJN V;  3OEH G;  2YUA A;  2OIE A;  4LF5 O;  4NVP A;  1BCC H;  3ZHR A;  2UXN A;  1FXK B;  4JI0 B;  2DMX A;  3GWK C;  1YF2 A;  1SQQ H;  1H8E G;  4AI8 A;  3HKE B;  1XIL A;  1N33 B;  4RUE A;  5HFL A;  4W4L A;  4AIL C;  1W0J G;  3D36 A;  1N32 O;  4DV3 O;  1QR8 A;  3L75 H;  3RYI B;  2WLJ A;  3WG7 C;  1ORQ C;  3LDC A;  2ZDI C;  1SQG A;  3OTO O;  3DTU B;  2PZS A;  3BEH A;  1ZX3 A;  3SJB C;  1SET A;  1K4C C;  2LGQ A;  5F2V O;  1XMQ O;  3PN1 A;  2DWE C;  4LC1 A;  1WB7 A;  1US6 A;  4X65 B;  1QVF U;  4ZOL A;  4DR1 O;  1BQZ A;  1AJP A;  3AK3 A;  1E79 G;  1WNS A;  3BPZ A;  5GON A;  4LF7 O;  5GTI Z;  2LFR A;  3D8C A;  3FYI B;  4J9Z B;  3P3N A;  2HHH O;  3PJS K;  1JJ2 U;  1T5E A;  3AG1 C;  2PGG A;  5IYZ B;  3CD6 V;  1YVW A;  3SPI A;  3ZRV A;  4O4J A;  1L0N H;  1EFR G;  1HR0 B;  4I55 B;  4X8A A;  4QE9 A;  3TXS A;  1AIL A;  4NXN B;  3C90 A;  3ZMS A;  3G71 V;  4X1Y A;  4RWU A;  3ZIA G;  4LF6 B;  2UU9 B;  2EUL A;  3SPC A;  3ETQ A;  2B9Z A;  5E79 Z;  1SER A;  3BA8 A;  1S5L Z;  4YIP A;  4CS4 A;  1KD1 W;  1YJW V;  3OFN G;  1HDJ A;  1MSD A;  2E76 B;  4JI7 O;  1N34 B;  1AI5 A;  5LP6 C;  3W7S A;  2QTS A;  3BY6 A;  2Y48 A;  3RW0 A;  1S0V A;  1B3Q A;  2QWQ B;  3QO5 A;  4GCZ A;  2AZ0 A;  1IDS A;  1FYJ A;  3Q4H A;  1H2K A;  2QR4 A;  3BAB A;  2IU0 A;  4PJ0 Z;  4FLV A;  4UV9 A;  4X65 O;  3CCS V;  3SPJ A;  1Q6U A;  1IBM O;  1WA8 A;  1M56 B;  2LQT A;  4NYK A;  4TV8 B;  1M90 W;  1KYO F;  4DV1 O;  1Q6H A;  2P4V A;  3UO2 A;  4F4L A;  2M6Y A;  2FYU H;  1WP8 A;  3JYC A;  1P4R A;  1LUW A;  1OJH A;  4EB6 B;  2Q68 A;  2F93 B;  2Q0O C;  2LP7 A;  3L73 H;  2RDC A;  1FXH A;  2OTJ V;  5LBQ A;  3B8N A;  4H13 B;  1J5E B;  1TA8 A;  1GTO A;  3SYA A;  1K33 A;  3QVN A;  4JTD B;  5CN0 A;  3O9O A;  1RSO B;  2ADP A;  2WLI A;  2B1I A;  3TXQ A;  1GKF A;  5EBL C;  1SA0 A;  4NXN O;  1XDC A;  1IZ3 A;  4J7Z A;  1NH2 D;  2A9H A;  4P9O A;  5L3C A;  3HKE A;  2QDO A;  3ZHS A;  2ADQ B;  2H3O A;  2HJF C;  2P67 A;  2Q7H A;  4GX5 A;  5EIB D;  4A5U B;  3K03 A;  4X20 A;  3ETG A;  4PHZ A;  4F6R A;  2CTQ A;  4ZKI A;  4DV6 O;  1Y6X A;  3R65 A;  2YS8 A;  3E22 A;  3HR0 A;  3RBZ A;  2IJK A;  2XND G;  2ZE7 A;  4H33 A;  3SR2 C;  3KKY A;  1SQF A;  4K0K B;  3JD0 A;  2JGD A;  4X88 A;  1SRY A;  2QWN B;  4F6E A;  2ZR3 A;  3B4S A;  3ZHU A;  4J11 A;  4X1I B;  1XQ8 A;  1S3J A;  4DR6 O;  3AG4 B;  4CH6 A;  1ARO P;  1KQS U;  4LH7 A;  3TJT A;  4XBF A;  4UXN A;  3LNM B;  3RWR D;  2ITC C;  3DXR A;  3ASN B;  1XI1 A;  1QNM A;  5B66 Z;  2JGU A;  5C8Y B;  3BCC H;  5IT9 N;  2WAM A;  4J7K A;  5LGN A;  5CB4 A;  1EZV H;  1LR1 A;  1H2N A;  1DK1 A;  3FFQ A;  4GX2 A;  4X64 O;  3CCV V;  4PV1 B;  1ZL8 B;  4DRX A;  3APQ A;  3G6B A;  4EFB A;  4FMT A;  4FPP A;  1KKD A;  3CCQ V;  1VF6 C;  4PA9 A;  5EZY B;  3SYC A;  4BW5 A;  4TV9 A;  4FLW A;  1FS0 G;  5EBM C;  1XMQ B;  4Q20 A;  5CA3 A;  4MTX A;  4DW1 A;  3ABL C;  1QHT A;  3G6E V;  2DQ3 A;  2Z5U A;  5EBW C;  5L3E A;  5J2U A;  4DK1 A;  1K73 W;  3JD3 A;  2F95 B;  1FXK C;  3D3I A;  1WPX A;  2HFE C;  3SJA C;  3U10 A;  4PDV A;  2W0X A;  3UT5 B;  1M5I A;  2K9P A;  4W4K A;  3F5T A;  4ZI7 B;  4O4H B;  1BE3 H;  2ZXW B;  3UM7 A;  1MZE A;  2Y0I A;  2Q7G A;  2JEU A;  5BR8 B;  1NTK H;  1Z5W A;  4JI3 O;  2EIK C;  4X66 B;  1GRJ A;  5ITZ B;  2X7R B;  1V55 B;  2CH7 A;  5A9G A;  5B3S C;  1BQ0 A;  2WSS G;  4GLX A;  4PD4 F;  4I0X A;  1CP9 A;  2GTA A;  2DN9 A;  2RCV A;  5IJ0 B;  2ZM6 B;  2QKA A;  3ZMU A;  3E86 A;  2ZKO A;  5EK0 A;  1PL0 A;  2UXB O;  4O4L B;  2LJ2 A;  2DW4 A;  1N36 O;  2EIJ C;  2QWR B;  3HKC A;  4LFC B;  1QQC A;  5CBH A;  1K5Q A;  3UKM A;  5J2T A;  1NH2 B;  2QM4 A;  3CP1 A;  3FB7 C;  3H01 A;  2VQE O;  1KP2 A;  1HR0 O;  3RYH B;  3STZ C;  2G38 A;  2WPD G;  2XOK G;  1H2S B;  4LF8 O;  1R1B A;  1XL6 A;  2ZIO A;  3OT7 A;  3CS5 A;  1X4T A;  1SQX H;  3TGU H;  4WFF A;  4DV4 B;  1YHQ V;  5KX5 A;  3MDS A;  5FLX N;  2OT5 A;  3FKS G;  4JGS A;  2ILM A;  5B1N A;  3N2G A;  4QNH B;  2P22 C;  4UFZ A;  2FL4 A;  1Z2G A;  1ZAU A;  2UXD B;  2UXX A;  5KUM A;  1B04 A;  4WBN A;  3T1Y B;  3I56 V;  3SPG A;  3AG2 C;  3CCE V;  1XRE A;  1WPB A;  3JAR B;  1FFX A;  3K0D A;  3SGI A;  1VQ9 V;  1DF5 A;  2YIB A;  1K7D A;  4Z1M G;  2Q7E A;  5JJE B;  4FK5 C;  4R50 A;  2IU3 A;  2GBO A;  2JS3 A;  2ITD C;  2XAG A;  3ZMV A;  1K5S A;  2Q4P A;  2IJJ A;  3ZMZ A;  3DC5 A;  1E1Q G;  5LP6 B;  2CAZ C;  2X0L A;  1K92 A;  1CXZ B;  1VQM V;  2LO1 A;  1VQ4 V;  5CBF A;  4WFA V;  1FD9 A;  3E89 A;  2BTQ A;  2IW5 A;  3UQ8 A;  4DR2 B;  3G80 A;  4U7O A;  1F7Y A;  1VQ8 V;  1D5N A;  1JPX A;  2EJ7 A;  1KEC A;  4U3F H;  1ZWI C;  1R3J C;  3JAL B;  2QSA A;  1S72 V;  3WB0 A;  3AG1 B;  5IDJ A;  3W7T A;  3B09 A;  4GKJ B;  3E8H A;  1L8D A;  1S5H C;  2DQ0 A;  1QU7 A;  4DR5 O;  2A79 B;  3ABT A;  1M9N A;  5C93 A;  2W6J G;  1SQP H;  3IC9 A;  5KHH A;  5EYP B;  1HNX O;  5DED A;  1IBK B;  5JVD A;  2RNB A;  3K04 A;  3CJH A;  1MAB G;  2YXH A;  2QM7 A;  4GUN A;  4BAY A;  4I5S A;  1AR1 B;  2EIM B;  5KMG A;  4PA4 A;  2UUB B;  4OX9 B;  5CA0 A;  1S76 D;  5J2U B;  4FFB B;  3GVM A;  3HB3 B;  1M57 B;  1HNW O;  4FLU A;  3RN4 A;  4XDK A;  4LF4 O;  4IIJ A;  4AHC A;  1GM9 A;  3ZBH A;  5GW7 A;  2WA3 A;  3IFX A;  4WCE V;  4P30 A;  4ZIB A;  3J7A U;  4MVM A;  1R3I C;  5ITZ A;  4I7Z B;  1J5E O;  2GHY A;  2IH3 C;  5BY1 A;  1LUV A;  2B1G A;  3ABK C;  1SC5 B;  4DV0 B;  1YTF D;  2QE7 G;  4IT5 A;  4B3M O;  3RYC A;  2CGN A;  3QG5 A;  1H2G A;  3FX7 A;  3M7M X;  5KLV H;  3QF7 A;  1YDX A;  2MW2 B;  3RYI A;  2UU9 O;  1NJI W;  1G4Y B;  1MG1 A;  1SQV H;  3A0R A;  3U0Z A;  3ZN0 A;  2BSK B;  1K8A W;  4JYB A;  4LFB B;  3W7X A;  4JI1 B;  4FM0 A;  3AEI A;  1OV9 A;  1EZJ A;  2GSM B;  1SF9 A;  1YZB A;  4LFA B;  1I7F A;  4JI2 O;  1XNR B;  3ASO B;  2VS0 A;  4ZOL B;  4JI8 O;  3N2G B;  4DV5 B;  1HNZ B;  1O9G A;  3QNE A;  1M57 C;  2H94 A;  4B7K A;  1D2D A;  4WBN B;  1DTO A;  4UUJ C;  5IYD O;  1BMF G;  5BMV B;  2R70 A;  2OCH A;  2EIM C;  4LFA O;  2BE3 A;  4JI3 B;  3ABL B;  4OGQ B;  1RPO A;  2GDS A;  4I55 A;  2LW1 A;  2Y69 B;  2Y69 C;  1O9H A;  1U97 A;  1D5A A;  4D7S A;  1S77 D;  2VQE B;  5LP6 A;  1GMG A;  2P6J A;  3KCX A;  1SZX A;  2RJZ A;  1GM7 A;  4X1K B;  3W7U A;  2DWD C;  5IYC O;  1DLB A;  3VBB A;  1G8M A;  2L6L A;  4DYL A;  3ML0 A;  1FPO A;  4D7T A;  2VWJ A;  4PA7 A;  4LF7 B;  3E35 A;  4ZHQ B;  3ZRW B;  4J9Y B;  3K08 A;  4DR5 B;  4N21 A;  1YJ9 V;  1V54 B;  1G1X B;  1JFF B;  5KHK A;  3KG2 A;  2LGW A;  5HFM A;  4WFE A;  4BR6 A;  4DR7 B;  4NB5 A;  3UCS C;  1NR7 A;  1WN7 A;  3F7Y C;  3K5N A;  2KKW A;  2AHY A;  1Q82 W;  4LF9 O;  5JVD B;  1BHB A;  4EEQ A;  1H8H G;  3JSN A;  5CMU A;  3RGB A;  3CX5 F;  2W6I G;  4YIO A;  3SJQ C;  2BOB C;  3JAK A;  4MVS A;  1PNK A;  2DYS C;  4UCR A;  1Q7Y W;  3VQX A;  1YEW A;  1Q90 D;  3B40 A;  3FAV B;  3ZCC A;  1RM1 C;  3CCU V;  3X2Q C;  5L3D A;  4JI0 O;  1N34 O;  4JI6 B;  3K57 A;  2YXY A;  1I5Y A;  1ZLZ A;  3LSU A;  1BS3 A;  1V55 C;  3LSS A;  1YI2 V;  1IVS A;  1U96 A;  3BHP A;  2VWK A;  4PDM A;  4DV7 O;  4XDJ A;  5J9P C;  4GZR B;  1FAF A;  5JQG A;  2N74 A;  5JCO A;  2ZT9 B;  2WLI B;  4Z2W A;  3AG3 B;  2HKO A;  2P4K A;  2FKX A;  4RO2 A;  5IJ9 B;  5JJJ B;  1GAX A;  2FB5 A;  4JYA O;  4G2K A;  3Q4H B;  3RYC B;  5LOV A;  4WFG A;  2PTM A;  3MHS C;  3AG2 B;  4DV2 B;  1ROP A;  4KP4 A;  2E3C A;  2N05 A;  2UXB B;  3K59 A;  4YXW G;  3CSX A;  1XBL A;  4TV8 A;  4F6R B;  2JRI A;  2CTR A;  2ZXW C;  1CEZ A;  4UB8 Z;  1SZT A;  5FNV A;  4FLT A;  2PY5 A;  1BHA A;  3BRC A;  3ZS8 C;  3CEI A;  4I50 B;  2UUC B;  3RYF B;  1OCC C;  2Y4T A;  3MHH C;  2F4V B;  5JJN B;  3VQY A;  1AI6 A;  2XAF A;  1R3K C;  1Y4M A;  4B3R O;  3CWB H;  4JPR A;  2WLL B;  4IHJ B;  1Y66 A;  3LNN A;  1AJN A;  1G6U A;  2EBO A;  1M93 A;  2JJ1 G;  4LWS A;  4JI1 O;  3ZMT A;  2BOC C;  1WAZ A;  3DXR B;  4N23 A;  4JI5 B;  1RSO A;  2HVJ C;  5KHI A;  2IH1 C;  3SYP A;  3VOU A;  4BWA A;  4ASU G;  2A06 H;  1SS3 A;  1A32 A;  4HBN A;  2ZM6 O;  4X89 A;  2K1E A;  2RQ6 A;  1GN3 A;  3OGI B;  3MD0 A;  1FJG O;  4JZ2 A;  5DEC A;  4CC6 A;  1DGS A;  1JX9 A;  2R9I A;  2RMK B;  1H38 A;  3HKD B;  2YC0 A;  1R3L C;  1F4M A;  4YJ3 B;  4B7E A;  1X59 A;  2YI8 A;  4HNA B;  2Q0A A;  4KUM A;  2L35 A;  1XHZ A;  1W0K G;  4E4E A;  4I4T A;  2JJ2 G;  2CTP A;  4ZHQ A;  4NXM B;  4DV1 B;  1NBM G;  1WLE A;  1W59 A;  2YIA A;  3UT5 A;  3WFV A;  5IYB O;  2JGD B;  3F7V C;  3O65 A;  4UVB A;  2CDY A;  4YJ2 B;  3ZN1 A;  1FKA O;  2GUZ B;  1OCC B;  3ZRX A;  2XUM A;  4JI5 O;  2WLN A;  1E1R G;  2QEX V;  1MZF A;  5IWA O;  1NS1 A;  2EZP A;  3QO8 A;  3JAM N;  2AZ2 A;  3CC7 V;  1SQB H;  3CC4 V;  2ZDI A;  3ICX A;  3P32 A;  4J80 A;  4DR7 O;  3S3X A;  4DK0 A;  1XNQ B;  4U7N A;  1QR9 A;  1N8R W;  2ZE5 A;  4UCV A;  3KZI Z;  1YTF B;  1R6K A;  1GN2 A;  4I0X B;  2JDI G;  4Z1V A;  3T2M A;  4FVM A;  4JTC B;  3RFR A;  1SES A;  2D3O W;  1XHX A;  3A0B Z;  1Y74 B;  1ZUQ A;  4LF8 B;  3HKB B;  3CHX A;  4DV2 O;  4RQF A;  5LMU O;  1K34 A;  1VMG A;  1VEW A;  4PDL A;  4TUY B;  4UCT A;  4TWK A;  3CRA A;  3ASO C;  4PI2 A;  4QPK A;  1NKD A;  5BXZ A;  4NXM O;  3U11 A;  4PA3 A;  4IYI A;  5LOV B;  3ABM B;  2W0F C;  3H1J H;  4O2B B;  2HP8 A;  2YEV B;  4MTG A;  5LMN B;  2F4V O;  1B06 A;  1PD3 A;  3WU2 Z;  1Q8I A;  4JI8 B;  3GWO A;  1PPJ H;  2IJH A;  5IY5 B;  4JI2 B;  2C2A A;  2CH7 B;  1N36 B;  4WF9 V;  5LGU A;  1S5J A;  5AG2 A;  2YXL A;  1HWY A;  4LCU C;  2UXC O;  3SDL A;  1L0L H;  5JCO C;  1ZSP A;  2ARH A;  4O4L A;  3P30 A;  1QLE C;  2QA4 V;  3CC2 V;  1DF4 A;  2WLK A;  4MTO A;  1AVM A;  4CH4 A;  4DUZ O;  1AP6 A;  2WWW A;  4UCO A;  1HNW B;  3ABU A;  2UXC B;  2QGN A;  3RYH A;  3CME V;  3ZX6 A;  2PI5 A;  3JAW A;  4H0L B;  1Q43 A;  5FPO A;  1ENV A;  1PM9 A;  1EN6 A;  2ETN A;  2OCC C;  1H2L A;  4RUF A;  4NR1 A;  2A3Q A;  1OHH G;  3JD2 A;  1BZK A;  1QCE A;  1M56 C;  2OYQ A;  1FJG B;  4O4I B;  1NT2 B;  3RVY A;  2QWP B;  3HKD A;  4FZ1 A;  2ZE6 A;  1MNG A;  2X6A A;  4I9W A;  2QTO A;  3JAR A;  4FLY A;  1FFX B;  5TIS Z;  3T1H B;  3OTF A;  2Y0P A;  1YIJ V;  1F4N A;  4NKG B;  4JAU A;  5H2F Z;  3GB7 C;  4GYC B;  3OUS A;  4CC5 A;  4JYA B;  4UB6 Z;  1NR1 A;  2Z0A A;  1Y67 A;  4DUZ B;  2Q6A A;  5FL7 G;  1NTM H;  1FFT B;  2JEX A;  1XMO O;  2XTA A;  4QIW F;  1GM8 A;  3OD4 A;  3OMA B;  4MT8 A;  3CYO A;  1TVK A;  5LYJ B;  5L3B A;  1XNQ O;  2F43 G;  1XUQ A;  1Q3E A;  4AQY O;  1BT8 A;  3CRC A;  2QKS A;  1K3E A;  1AI4 A;  4MVQ A;  2EX3 A;  3ABM C;  1OCR B;  3T4Z A;  5LHH A;  4K0K O;  1B6Q A;  5EC2 C;  2EIL C;  2ZE8 A;  3TET A;  2NN4 A;  4DUY B;  2KSD A;  3TK1 A;  4G28 B;  4B3S O;  3ABK B;  4H44 B;  5L3F A;  5IY5 C;  3RT3 C;  1IXM A;  2JIZ G;  1EM1 A;  5JH7 A;  2XAJ A;  1VQO V;  4KHP B;  4LF6 O;  4IGG A;  4BIZ A;  5LHG A;  4H37 A;  3L72 H;  2FML A;  4CH3 A;  2KQX A;  3D36 C;  1MSW D;  2PF4 E;  4EB6 A;  2F66 C;  4DR3 B;  2IBZ H;  3M99 B;  5LL6 Y;  5DN6 G;  1GN4 A;  1J95 A;  1NI8 A;  3L9D A;  3THO A;  2XAH A;  1NQT A;  2A0L A;  4X1I A;  1PL4 A;  1Q81 W;  2HG5 C;  2YEV A;  5H6R A;  4LH6 A;  5CA1 B;  3JD1 A;  4MSW C;  4DR1 B;  4DR4 B;  1IBM B;  2WA4 A;  5BMV A;  2UUA B;  5C8Y A;  2PI4 A;  4D6T H;  4FFK A;  4QGP A;  2OCC B;  1SA0 B;  1N4C A;  1RPR A;  4MVO A;  3APO A;  3CRM A;  1QBZ A;  4L8J A;  4E2L A;  1Y76 A;  4CH5 A;  1ZL8 A;  4DRX B;  1BGY H;  1COW G;  3H1L H;  2ATK C;  4X1K A;  3AG3 C;  1OCZ C;  4TSF G;  4DO2 A;  1NU1 H;  4GKK B;  4LNU A;  2ODM A;  5D5P A; 
#chains in the Genus database with same CATH homology
 2H3O A;  2LJ2 A;  1WAZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...