1WAZA

Nmr structure determination of the bacterial mercury transporter, merf, in micelles
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
TPVLVILLGVVGLSALTGYLDYVLLPALAIFIGLTIYAIQRKRQAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MERF
publication title NMR Structure Determination of a Membrane Protein with Two Transmembrane Helices in Micelles: Merf of the Bacterial Mercury Detoxification System
pubmed doi rcsb
source organism Morganella morganii
molecule tags Transport protein
total genus 13
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2004-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11431 Transport_MerF Membrane transport protein MerF
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.910 Mainly Alpha Orthogonal Bundle Helix Hairpins bacterial mercury transporter, merf 1wazA00
2LJ2A 2H3OA 1WAZA
chains in the Genus database with same CATH superfamily
5EZYA 1FXKA 1IVSA 4NTWA 4I4TA 5JJJB 3DXRB 5LHGA 3B2EE 1OCCC 2ETNA 5L3DA 3ZRSA 1GKFA 5DN6G 2R9IA 1W2BU 2ZD9A 2R72A 2FL4A 5H9CA 1R6TA 1W59A 1S5JA 1MSDA 1QR9A 4KHPO 2A0LA 3JATA 4OPHA 4NR1A 4GCZA 1QVFU 4LF4O 1IBMO 3ZHSA 2WLIB 4O4IA 2CE4A 5BMVA 2UU9O 3TETA 2WSSG 2XT9A 5B3SB 4HAMA 4DUYB 2RQ6A 2RCVA 4BIUA 1XMQO 1PPJH 4R6ZA 4I9WA 3ZRWB 4JI4O 2P6JA 5LHHA 2QM4A 1PNKA 5LP6C 2JEUA 1GM7A 2WLKA 1BHAA 1XNRO 4DR5O 2YXLA 3OFNG 1B6QA 5L3CA 1Q90D 2W0XA 2BTOA 2EINC 4LF5B 2E76B 3ASOB 1A32A 1GAXA 3H1JH 4G28B 2EIMB 1P49A 2BSKA 2DWEC 1NH2B 1KYOF 1PD3A 4L87A 2HP8A 3FYIB 3FKSG 4X1YB 3HKBB 4PA7A 3Q4HA 4C7UA 4U3FH 2HJDA 3SPGA 4JGSA 1JVMA 3CHXA 1XMOO 1E1RG 1VQ6V 3CB2A 3QVNA 2QEXV 3CCUV 1NTZH 5LA6B 2EZOA 2RNBA 1PKXA 1YZBA 2WLMA 1Q86W 3CCQV 4O4JA 5FPOA 4GX2A 2EILB 4DR2O 3K58A 2Q6AA 2VQEB 5GONA 5CBHA 1XL6A 4WF9V 3OT7A 2D2CB 1M90W 2XASA 1I7FA 3B77A 1IX9A 5L3FA 1TUBA 2YC0A 4LWSA 2A9HA 5J2UA 4X62B 1HWYA 1HNZB 2AHYA 4DUZO 3WB0A 4I0XB 4NXMO 1JX9A 4LF7B 3BA9A 2YIAA 2QE7G 4X1IB 2JJ2G 4ZHQB 3W7UA 4JYYA 2PI4A 3H1KH 3CRQA 2ZE7A 4R7CA 5L3BA 1OZ0A 4LF6B 3FB6C 4UCOA 3ZHRA 2H94A 4GX5A 3N2GB 1FYJA 4LFBB 1FKAO 2LO1A 3EFFK 1S77D 1AI5A 1OCCB 5BR8B 4MVSA 4ZOLA 1BGYH 3RYIA 2WAMA 4J10A 4MW8A 2ZIMA 3RYHA 3ASNC 4MTFA 3MHSC 1K4CC 2Y4UA 2GSMB 4TV9B 5LXTB 1BL8A 2NR5A 2WPDG 2ZINA 4FLWA 5EC1C 2EIKC 3T4ZA 4LF8O 1RSOA 5KMGB 1SERA 5KUKA 4LBEC 3CC7V 4GKKO 1CXZB 2DN9A 4CS4A 4H0LB 4TT3G 2N04A 5FLXN 1NU1H 1BQ0A 4ZIBA 2VQFB 5LP6B 4O2AA 1K3EA 3APOA 3F7VC 2QA4V 5EYPB 1R6NA 1XHZA 1RM1C 1BS3A 4JZ2A 5KX5A 3ZS8C 3U10A 2EINB 2UUBO 3ETQA 2Q73A 4MTOA 2UUAB 1OHHG 3B09A 2EBOA 2KSDA 1K7DA 2XNDG 1MNGA 1WA8A 2P7TC 4CH6A 1HNWB 2HHHO 4JI5O 2P22C 4EFBA 4J7ZA 1D5AA 4MW3A 3CCJV 5LOVB 4PA3A 4JYAB 3CJHB 4N23A 2QJ1A 5TISZ 4LH6A 1ZL8A 3OUFA 1WAZA 4UCVA 1N0NA 4J41A 3MD0A 3ZRXA 1SA0A 1IBKB 2WLLB 4JI7O 4GYCB 3ZJZA 4MVUA 4O4HB 4ZKIA 3I5DA 2QWPB 4FK5C 1SQFA 2CH7A 5AG2A 5EBMC 5IJ9A 2ZIOA 3SPCA 2N74A 3QO8A 3H01A 3L70H 5GW7A 2FB5A 4JI0O 4TOIA 1H8HG 3A8TA 3F5WC 3WG7C 2DYRC 1K73W 4MVQA 4EKWA 3AG1C 5J2TA 4OXSA 3IFXA 4DV0O 4CZZA 2CTQA 3CS5A 4TV8A 4KL1A 4L8JA 3UQ8A 1FFXB 2XAHA 2P4VA 3STLC 2UUCB 4PDMA 1N0JA 3G4SV 3OMIB 1B06A 4CH4A 5JVDB 5IYZA 1VF5B 1SZTA 3M7MX 2OWOA 1KECA 1FJGO 1OJHA 2IM9A 1RP3B 4LF9O 4RAIA 1SRYA 3D8CA 4F6RA 4X66O 3OGCC 1AROP 3LSUA 4BIZA 3OEEG 3ASNB 5D5PA 2B5UA 2HFEC 3BA8A 4BW5A 1MZFA 1SQXH 1BT8A 4K0KO 1N34O 1YI2V 1KP3A 1G8MA 3RT3C 4PDVA 5JQGB 2DQ3A 2F95B 4D6TH 2EIKB 4PI2A 2ZXWC 2WLHA 3U11A 2UXXA 3QO5A 3TGUH 2N05A 3OR6C 5E1AC 3FD9A 3AG2C 3JSNA 2YDEA 3CCLV 3EXAA 3G6EV 2IW5A 1YIJV 2IH3C 1EN6A 1NBMG 2EX3A 2UXDB 4XBFA 2JGUA 4F4LA 1MMMA 1HR0B 1FS0G 2DE0X 3DXRA 3A0BZ 3C90A 1SQGA 3D36A 4RUFA 4EEQA 1RM1B 4LNUB 1WP7A 4PI0A 3A2FA 2YI9A 1G6UA 3CCVV 1MSWD 2F43G 2X7RB 4QIWF 4DV3B 4JTAB 4J11A 3CEIA 1JFFB 2Q7GA 2DWDC 3ZMVA 2F66C 3W7SA 4F6EA 1DTOA 4PA6A 1NQTA 2F4VB 2X0LA 3SYCA 3SR2C 1H2GA 5IYBO 4OX9B 1U96A 4W4KA 4LF5O 2BOBC 1F4MA 1EM1A 2R9RB 4JYCA 1YXBA 2BE3A 2ZDIC 1AR4A 2Y48A 2YIBD 4JZGA 3MAQA 1GTOA 1Q6UA 1HP8A 2ARHA 1KMIZ 5A2QN 2LP7A 1AI7A 4ABMA 1J5EB 3AG3C 1K97A 4LP8A 3E86A 1X59A 3K3WA 5GTIZ 1VIBA 3HKEB 5LBQA 4I5SA 4X88A 4UB8Z 2GV9A 5B66Z 2B9ZA 3JALB 1XNQB 2Q9LA 4DV4B 3WG7B 2DYRB 3HKCA 2DOSA 3RW0A 5KHIA 1GMGA 3AG1B 3ABLC 4X1YA 2YEVB 4I50A 2QGNA 4Z2WA 3RYFB 2XAGA 3JAKB 2EJRA 3JCZA 2VQEO 1R6KA 1Q82W 1J95A 5LYJB 4X9QA 4A5UB 5CN0A 2IU0A 1K4DC 1XILA 4IHJB 4X62O 1KB9F 3HKDB 1V54C 2YUAA 1PL4A 2LGWA 4LFCO 4DK0A 1H2SB 3JD1A 3M99B 1AJQA 2R70A 3K5NA 4LF7O 5CA0B 4ICGA 5D5QA 3E8FA 4X89A 5IYCO 4X20B 4YHHB 1OCRC 3AG7A 3TK1A 2XAQA 4K35A 4YIOA 4NXNB 5B1NA 3SYOA 3OUSA 3BHPA 5JH7B 4LFBO 3OD4A 2ZT9B 1D2DA 4TQFA 3OM3B 2HLDG 2YICA 4WFFA 2ZXWB 4DR7B 1MZEA 1R3LC 1ZUQA 4BR6A 4X1IA 4ZHQA 4AI8A 5BR8O 1O9HA 5CB4B 4UCSA 3AG2B 1I0HA 1CP9A 1VF6C 4RWUA 3W7WA 2JEXA 4DW0A 3TXSA 3ZMTA 1AJPA 4FLUA 5GTHZ 2KG7B 2EJ7A 1WPBA 2P06A 2KB1A 2Z5UA 5KAFZ 4IT5A 3SJQC 4FLYA 5H5NA 2P4KA 3R66A 2AZ2A 5ITZA 1S5LZ 3G67A 4DV6B 4TV9A 2ZNIA 4RQFA 2P5OA 2FTKA 2VQFO 4DV7O 2P90A 4TUYB 3UO3A 1FPOA 3JAWB 2UXBB 3JARB 4JAAA 4LR3A 3AK2A 5FNVB 1JJOA 4RQEA 5EK0A 2QKCA 3ZN1A 3LSQA 1FAFA 4WBNB 1HDJA 3B4SA 2UUAO 3ZHTA 2Z3YA 4X8AA 1K92A 5LGUA 3JASB 3ZMUA 4LFAO 3ABKC 5LL6Y 1HNWO 1S5HC 5LP6A 2WLNA 1PV0A 2UXCB 2A06H 5IYDO 5EYPA 3AG3B 3THOA 1QBZA 4EB6A 5BY1A 4JYAO 3GVMA 1Y67A 5EBWC 4IIJA 2CGNA 4YXWG 4MVZA 2WLJA 3CRAA 5CA1A 1EZVH 3ZHUA 1IBKO 3ABLB 5JCOC 4QJFB 1BZKA 2IJHA 1N33B 3UT5B 4I7ZB 4CS3A 3O65A 3CJHA 4JI2B 1Q6IA 3KCXA 4IGGA 4KXRA 5JJNB 2QDOA 1GK9A 2CTWA 1UPGA 3VQVA 2VRZA 1HNXB 3FYEB 3STZC 1V54B 5H6QA 3CCRV 4X1KB 2NNUA 3CE2A 3E83A 2X6CA 5C8YB 2LW1A 4JI8B 3P30A 1OCRB 3ZHQA 1NZ6A 2UUCO 3AG4C 2JGDB 3ICXA 4CC5A 4DR6B 1L8DA 4GUNA 4U3JA 4P30A 1VQ9V 1XHXA 3D3QA 2Q68A 1L0LH 2LJ2A 3O9OA 3I56V 4DR4B 2ZR3A 1PP9H 1KQSU 3PJSK 4MVMA 2PI5A 2QTSA 4J7JA 4D7SA 1FFXA 3K9AA 2RMKB 1UJWB 1YF2A 2F1MA 4DXWA 3APQA 2M6YA 3BY6A 4BW9A 1COWG 4NTXA 4YJ2B 1US6A 3MDSA 1BE3H 3SGIA 1SZXA 1WNSA 1FXHA 5B1BC 4B7KA 3WB2A 1QLEC 3HB3B 2UXDO 2JS3A 3DC6A 5JQGA 4FM1A 1HR0O 1E1QG 1EBOA 1K33A 4DV2B 4Z1VA 1F51A 5CMUA 3TJTA 4WFGA 4CBCA 3VQYA 1Y6XA 2VWJA 5J9PC 4DV3O 4HNAB 3QO7A 2Q67A 1Y76A 1IURA 3KKYA 2A79B 1XDCA 5EZYB 4TSFG 2EZPA 3ABKB 4ZBMA 2F4VO 1OCZC 4EFEA 4I4TB 2A3QA 4WFEA 4KFMA 2QTOA 3CC2V 5FPRA 1R73A 3CYOA 3RVYA 1WPXA 4OX9O 2Q7EA 3ZCCA 2NN4A 1Z5WA 4B3SB 4UVBA 1DGSA 4W4LA 3GWKC 2PYLA 3OEHG 3BPZA 1YVWA 2CK3G 2IJJA 1M56C 3E22A 4HBNA 2WWWA 3ZHVA 3VBBA 3L72H 4O4IB 3W7TA 4JTDB 5BMVB 1IXBA 5B1OA 2JJ1G 2JS5A 1KKCA 4YIPA 1VQLV 3L74H 3ZIAG 1K9MW 1XNQO 4B3TB 4DV4O 3FB7C 3L71H 4RO2A 3BABA 1WP8A 3UCSC 1H2NA 3ZX6A 4B3MB 1BSMA 4JV5B 3B8MA 3JD0A 3HKEA 4DRXB 4DR1O 4AQYB 1WJZA 3AG4B 1N36B 2LFSA 1CPYA 5CBGA 3UM7A 3G80A 1KUQA 4MT8A 2ZR2A 2L35A 2E5LO 4QPKA 2YEVA 3P3PA 4N21A 4DR5B 2HEPA 3BCCH 1S0VA 4YHHO 1R3KC 4PDLA 1MABG 2MW2B 2QR4A 4X64B 5LYJA 1NVPD 1K5SA 1AJNA 1WB8A 1Z5VA 4UCUA 1ZSPA 2QWRB 1F4NA 4O4JB 4DR7O 3WU2Z 1JPXA 2HKOA 4X20A 5B1BB 5L3GA 2W6JG 4FPPA 4PA4A 1AB3A 4DV1B 1H38A 3L9DA 1QLEB 2AGAA 1XQ8A 1TUBB 3N27A 3GWOA 1VQ4V 3CWBH 4I55A 4LC1A 2ATKC 1SC5B 1Y74B 4MS2A 1VQNV 4NYKA 3KZIZ 4O4LA 5EIBC 2EIJC 1K34A 4UFZA 5CB4A 3K5OA 3CX5F 1Q5OA 3OW2U 4YJ3A 2Q8VA 1YTFD 5DECA 5E79Z 4P9PA 1SF9A 2KKWA 1AP5A 4DV6O 1BQZA 4TQDA 1NTKH 4NXMB 3AK3A 3VOUA 1OCZB 4FM0A 1MA1A 1MG1A 4FLTA 1TVKB 4X65B 4PA9A 2UXBO 1X4TA 3AK1A 4UCRA 5KLVH 4G27B 4FFKA 1R1BA 1V55C 3LNMB 5IT9N 4Q6GA 1KD1W 2QM7A 1MOFA 1I5XA 1M56B 3G6BA 3PN1A 2UXCO 1M4UA 1P4RA 3JAWA 2BTQB 4U7NA 5JJEB 3JARA 4H33A 2OCHA 5IDJA 3ZMSA 3RN4A 4DUYO 3ETGA 5FNVA 1Q43A 4R8CA 4WBNA 2Y69C 3B40A 2XOKG 4FLVA 1ZLZA 2WLIA 3JASA 1SQPH 1RFYA 4FLZA 1AI6A 3BAAA 1RPRA 3D36C 3LDEA 1QU7A 3CRMA 5KX5B 3CP1A 1AR5A 2V4DA 1N33O 1ZTEA 1YDXA 1TUEB 3ZRWA 3OTOB 2ZM6B 2K1EA 3T2MA 1HNXO 1B04A 1YITV 1VMGA 3JD3A 1IZ3A 4QNHB 2PY5A 4FFBB 2ZNJA 4K8XA 1WA8B 3P3NA 1JJ2U 1NTMH 1ZWIC 3LDCA 1I08A 3CD6V 5K1PA 1AVMA 2B1IA 4JI8O 4JF3A 2HVKC 4ZI7B 3L75H 1TGOA 4JI3B 4GT1A 2Y0PA 3U0ZA 3HKBA 3F7YC 5KUMA 3H9VA 4DR6O 4DR3B 1GH6A 4CC6A 5LGNA 4JASA 2YIBA 4CH3A 4YY3B 1FXVA 1SA0B 3N2KB 5C8YA 1Y4MA 5IWAB 1H2LA 4DR4O 2Q4PA 1M5IA 1K5QA 2O57A 4H44B 2CH7B 2Q7HA 2ZE5A 5LA6A 5IJ9B 3J81N 3DGEA 3ETDA 4FJCC 1HNZO 1YJ9V 1KC8W 3T4DA 3ZN0A 1QLNA 1QHTA 4GX0A 1GN3A 2OYQA 2XUMA 1QNMA 4PHZA 3IC7A 4JPRA 2JDIG 3FX7A 4J42A 5J2TB 1NR1A 4JI1B 4LF6O 3A0HZ 3SPIA 3JD4A 4WFAV 2EIJB 4TV8B 5F2VO 1JA8A 2ZQMA 3RWRD 2IH1C 4I0XA 4B7EA 2WA3A 2OTLV 3R65A 2Y4TA 1NVPB 3QF7A 5IYZB 1EZJA 4YJ2A 3HPLC 2JVDA 4O2BB 2FYUH 3VQWA 1VQMV 3QTCA 1P7BA 3E8BA 2QM8A 4F6RB 1V55B 1PM9A 3ZMZA 1M9NA 5LHIA 3N2GA 1K8AW 4B08A 1IBLB 1NT2B 5KHGA 2IU3A 4MVRA 3BVOA 4E4EA 3JCUZ 3SPHA 2PYJA 1FJGB 3JD2A 4I9QA 5A9GA 3SPJA 1XBLA 1RPOA 2YS8A 4LF9B 1LUVA 2PGGA 3IGAC 1XL4A 2ZE8A 1GRJA 3FAVB 2OCCC 5LXTA 2WA4A 1KBHA 4PV1B 1YHQV 1Q3EA 1U97A 2LW7A 1VEWA 3SYQA 2HJFC 4B3SO 3K5MA 2Y69B 2AHZA 2FKXA 1PL0A 1QQCA 2DYSC 4UB6Z 1YTFB 1N32B 5KMGA 2VS0A 2G38A 4J80A 3T1CA 2V7QG 3KG2A 1H8EG 3W7XA 1YJWV 4IYHA 1GN4A 2XHBA 3IAYA 1FXKC 3BEHA 1TA8A 2XAJA 4NVPA 3IJ4A 2CAZC 1P84F 4B3TO 2GUZB 4JYBA 2D3OW 1YSCA 3JSLA 5JCOA 2Q5ZA 2LGQA 4B3MO 4NKGB 5CBFA 4JV5O 3QG5A 5CA3A 5KA5A 5KHHA 3K79A 4DV5B 2OTJV 2W0FC 5K1XA 3OMAB 4K8ZA 1P7GA 1Q81W 4AQYO 1XOUA 4QPJA 3UO2A 3K59A 1N36O 1N8RW 2LFRA 2IBZH 2PUSA 2ZKOA 2QKAA 2KQXA 3K03A 1IDSA 5LOVA 4QE9A 2ITDC 3I55V 1GN2A 2CGOA 3RBZA 2DMXA 2H8PC 4HYOA 4UVCA 4BWAA 3JAMN 1VQKV 2PZSA 4GKJB 3K08A 4DRXA 3CC4V 3RYCB 4X64O 1AI4A 3DC5A 2QWQB 1UFIA 2CTRA 3CMAV 2WLLA 1GO3F 2DJVA 3H1IH 4O4HA 5BZBA 1BHBA 2X6BA 1KKDA 2M7WA 3HKCB 2ADQB 1AP6A 5LMNB 4I50B 1AR1B 4MTXA 3QNEA 4WFBV 3T1HB 3S3XA 4JI6B 4XDJA 4J9YB 4DV1O 1ENVA 3L73H 1NJIW 4XDLA 2B1GA 2E75B 2PTMA 3FFQA 2Z0AA 3M8AA 3H1HH 4MVOA 3CXHF 1S76D 1ZAUA 2K9PA 5JVDA 3S3WA 1CEZA 1S3JA 3OE7G 3T1YB 3ZBHA 3SJBC 3ZRVA 2ADPA 3CMEV 2YI8A 4DW1A 4Z1MG 3F5TA 1EN5A 5LMUB 2FMLA 1WB7A 1R3JC 1NKDA 1M93A 4LFCB 2AXTZ 4AILC 5L3EA 4X65O 1Y74A 3MHHC 1F23A 4J9ZB 1I94B 5EBLC 2OCCB 1S72V 4B3RB 1ROPA 1M57C 2ZE6A 3BFRA 5IJ0B 1PNLA 2UXNA 2GTSA 1DF4A 1VARA 2E74B 2P67A 4D7TA 2DYSB 4FLXA 3X2QC 1E79G 1N4CA 1SQVH 4QGPA 2X6AA 3ZEDA 1TVKA 1EFRG 4P2ZA 2XAFA 2QKSA 4UCTA 4WCEV 4UV8A 3C3SA 4IYIA 1EN4A 1FXKB 1IXMA 2IJKA 3G71V 1DK1A 2IJIA 4UV9A 5ITZB 3AEIA 4NTYA 2HVJC 4LNUA 5KHKA 3GB7C 1BCCH 2F93B 3E89A 3K0DA 1XREA 3LDDA 3CCEV 2BTQA 1JFFA 3OR7C 3CCMV 4J7KA 1XEQA 3OMNB 1PNMA 1FFTB 4JAVA 3JATB 1YEWA 1KU9A 3FB5C 3OTOO 2ZM6O 4FZ0A 1J5EO 1BMFG 1SKVA 4H13B 2RJZA 3CRRA 3EVKA 2BCCH 3D3IA 4DV7B 1KP2A 1OCOC 3WFVA 2PF4E 4EB6B 4G2KA 2JIZG 4CS2A 4JI3O 4KHPB 2YIDA 2ILMA 2R9AA 1JMKC 4LF4B 5HFMA 1IBMB 4LH7A 2JRIA 4IIJB 4DR3O 1XUQA 2OIEA 4YY3O 4FFBA 1Y66A 3B8NA 4LFAB 5CA1B 2JK5C 5BXZA 4MTGA 2UU9B 2GTAA 5IWAO 4GLXA 3RFRA 3JALA 1XI1A 2BSKB 5HFLA 4ZI7A 5DM6V 1XMQB 4PELA 4H37A 4JI4B 3FB8C 4HZ3A 4BIOA 3Q4HB 1XNRB 5EIBD 3RYFA 1NS1A 3JAKA 2BOCC 1NI8A 2EULA 3N2KA 5KAIZ 3E8HA 2CDYA 4JI1O 4RUEA 4JTCB 4NXNO 2C2AA 3WB1A 1I5YA 5JWPA 3K0GA 4IHJA 4PDRA 3K9SA 3HKDA 2XTAA 3DSQA 3E2EA 1T5EA 3SJCC 1L1FA 5CA0A 3OTFA 4KUMA 3LUTB 4P9OA 1FD9A 4U3JB 2YXHA 4BAYA 2GDSA 5GONB 1VQOV 1SESA 3OGIB 1XMOB 1YCIA 2F23A 1H2MA 5J2UB 4LWSB 5JH7A 1M57B 2W6IG 1IBLO 3TCUA 3CXCU 3JYCA 3TXQA 2QWNB 3K04A 3A0RA 2NLJC 3K5LA 4DR2B 3X2QB 1JQ0A 1QR8A 4Q20A 1JCHA 4O2BA 4LCUC 4ASUG 1W0JG 3KCYA 1ORQC 1W0KG 2HR3A 2V1DA 4DUZB 2DQ0A 2GHYA 2KG7A 5IE9A 3J7AU 4TWKA 3C3TA 1SQBH 4PJ0Z 1N32O 4FM2A 4ZOLB 3RYIB 2Q69A 2ITCC 3RYHB 5C93A 1O9GA 3P32A 3CPWU 2GBOA 2DW4A 4FVMA 4XDKA 3FAVA 5IY5C 1Q6HA 1JR9A 1D5NA 4TUYA 1Y76B 2YSUB 1GM9A 2OIGA 4AHCA 3BRCA 1RSOB 2YXYA 2RN9A 5H6RA 4UVAA 5B1AC 1OCOB 4FIPC 2CUGA 3H1LH 5EC2C 2ZDIA 2ODMA 1QCEA 1F7YA 5KA6A 4DV5O 3ABMC 2VWKA 4JAUA 3HR0A 4O2AB 1R3IC 1SS3A 2GUZA 4LF8B 4NB5A 1Z2GA 1GN6A 4R50A 2QSAA 3E22B 4JI2O 3OAAG 4DO2A 1NH2D 4GKKB 1VP7A 5H2FZ 2Q0AA 2Y0IA 1NR7A 1Q8IA 1LR1A 4GKJO 1QVGU 5LGTA 4GZRB 3RVZA 1LUWA 2LQTA 3LNNA 3UT5A 4FMTA 4UUJC 5LMNO 3NR7A 3ETEA 2UUBB 4GX1A 5B3SC 1ZL8B 3SYAA 1L0NH 4WFHA 1LNQA 1ZX3A 4QE7A 3T1HO 4JI6O 4OGQB 3RYCA 4X1KA 4JI5B 2HHHB 1AILA 3ABTA 1VF7A 2AZ0A 1VQPV 2H3OA 1SETA 3ASOC 4K3AA 3E35A 4U7OA 2EIMC 2JGDA 2RDCA 3CSXA 3J80N 4DK1A 3SDLA 2A7WA 3VQXA 4DR1B 3T1YO 4IL6Z 2OT5A 3CCSV 1YJNV 3DTUB 5KHJA 4JI7B 3CRCA 3UKMA 5LMUO 3LSSA 1THZA 4UXNA 3EHBB 4E2LA 2E5LB 1HW7A 2ZCEA 1B3QA 1Q7YW 1G4YB 1VF6A 4KP4A 2E3CA 5FL7G 3K06A 1JOYA 1I94O 4JI0B 4B3RO 1M1KW 2CTPA 2QWOB 5DEDA 1DLBA 3NXSA 1VQ5V 3ML0A 1WN7A 4DV2O 2Q0OC 1VQ8V 4DV0B 2EILC 3SJAC 2L6LA 4MSWC 1G1XB 2MK3A 4I55B 1SQQH 1TAEA 1WLEA 4O4LB 5IY5B 3SYPA 4YJ3B 1DF5A 4OPAA 2HG5C 5IJ0A 3ABUA 3K57A 4PD4F 4CH5A 4DYLA 3E8GA 1VQ7V 1GM8A 4FZ1A 3RGBA 1OV9A 2AW9A 4X66B 1H2KA 5B1AB 1URFA 4HNAA 1V9PA 5B5EZ 3IC9A 4K0KB 1N34B 3ABMB
chains in the Genus database with same CATH topology
2LJ2A 2H3OA 1WAZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJ2 A;  2H3O A;  1WAZ A; 
#chains in the Genus database with same CATH topology
 5EZY A;  1FXK A;  1IVS A;  4NTW A;  4I4T A;  5JJJ B;  3DXR B;  5LHG A;  3B2E E;  1OCC C;  2ETN A;  5L3D A;  3ZRS A;  1GKF A;  5DN6 G;  2R9I A;  1W2B U;  2ZD9 A;  2R72 A;  2FL4 A;  5H9C A;  1R6T A;  1W59 A;  1S5J A;  1MSD A;  1QR9 A;  4KHP O;  2A0L A;  3JAT A;  4OPH A;  4NR1 A;  4GCZ A;  1QVF U;  4LF4 O;  1IBM O;  3ZHS A;  2WLI B;  4O4I A;  2CE4 A;  5BMV A;  2UU9 O;  3TET A;  2WSS G;  2XT9 A;  5B3S B;  4HAM A;  4DUY B;  2RQ6 A;  2RCV A;  4BIU A;  1XMQ O;  1PPJ H;  4R6Z A;  4I9W A;  3ZRW B;  4JI4 O;  2P6J A;  5LHH A;  2QM4 A;  1PNK A;  5LP6 C;  2JEU A;  1GM7 A;  2WLK A;  1BHA A;  1XNR O;  4DR5 O;  2YXL A;  3OFN G;  1B6Q A;  5L3C A;  1Q90 D;  2W0X A;  2BTO A;  2EIN C;  4LF5 B;  2E76 B;  3ASO B;  1A32 A;  1GAX A;  3H1J H;  4G28 B;  2EIM B;  1P49 A;  2BSK A;  2DWE C;  1NH2 B;  1KYO F;  1PD3 A;  4L87 A;  2HP8 A;  3FYI B;  3FKS G;  4X1Y B;  3HKB B;  4PA7 A;  3Q4H A;  4C7U A;  4U3F H;  2HJD A;  3SPG A;  4JGS A;  1JVM A;  3CHX A;  1XMO O;  1E1R G;  1VQ6 V;  3CB2 A;  3QVN A;  2QEX V;  3CCU V;  1NTZ H;  5LA6 B;  2EZO A;  2RNB A;  1PKX A;  1YZB A;  2WLM A;  1Q86 W;  3CCQ V;  4O4J A;  5FPO A;  4GX2 A;  2EIL B;  4DR2 O;  3K58 A;  2Q6A A;  2VQE B;  5GON A;  5CBH A;  1XL6 A;  4WF9 V;  3OT7 A;  2D2C B;  1M90 W;  2XAS A;  1I7F A;  3B77 A;  1IX9 A;  5L3F A;  1TUB A;  2YC0 A;  4LWS A;  2A9H A;  5J2U A;  4X62 B;  1HWY A;  1HNZ B;  2AHY A;  4DUZ O;  3WB0 A;  4I0X B;  4NXM O;  1JX9 A;  4LF7 B;  3BA9 A;  2YIA A;  2QE7 G;  4X1I B;  2JJ2 G;  4ZHQ B;  3W7U A;  4JYY A;  2PI4 A;  3H1K H;  3CRQ A;  2ZE7 A;  4R7C A;  5L3B A;  1OZ0 A;  4LF6 B;  3FB6 C;  4UCO A;  3ZHR A;  2H94 A;  4GX5 A;  3N2G B;  1FYJ A;  4LFB B;  1FKA O;  2LO1 A;  3EFF K;  1S77 D;  1AI5 A;  1OCC B;  5BR8 B;  4MVS A;  4ZOL A;  1BGY H;  3RYI A;  2WAM A;  4J10 A;  4MW8 A;  2ZIM A;  3RYH A;  3ASN C;  4MTF A;  3MHS C;  1K4C C;  2Y4U A;  2GSM B;  4TV9 B;  5LXT B;  1BL8 A;  2NR5 A;  2WPD G;  2ZIN A;  4FLW A;  5EC1 C;  2EIK C;  3T4Z A;  4LF8 O;  1RSO A;  5KMG B;  1SER A;  5KUK A;  4LBE C;  3CC7 V;  4GKK O;  1CXZ B;  2DN9 A;  4CS4 A;  4H0L B;  4TT3 G;  2N04 A;  5FLX N;  1NU1 H;  1BQ0 A;  4ZIB A;  2VQF B;  5LP6 B;  4O2A A;  1K3E A;  3APO A;  3F7V C;  2QA4 V;  5EYP B;  1R6N A;  1XHZ A;  1RM1 C;  1BS3 A;  4JZ2 A;  5KX5 A;  3ZS8 C;  3U10 A;  2EIN B;  2UUB O;  3ETQ A;  2Q73 A;  4MTO A;  2UUA B;  1OHH G;  3B09 A;  2EBO A;  2KSD A;  1K7D A;  2XND G;  1MNG A;  1WA8 A;  2P7T C;  4CH6 A;  1HNW B;  2HHH O;  4JI5 O;  2P22 C;  4EFB A;  4J7Z A;  1D5A A;  4MW3 A;  3CCJ V;  5LOV B;  4PA3 A;  4JYA B;  3CJH B;  4N23 A;  2QJ1 A;  5TIS Z;  4LH6 A;  1ZL8 A;  3OUF A;  1WAZ A;  4UCV A;  1N0N A;  4J41 A;  3MD0 A;  3ZRX A;  1SA0 A;  1IBK B;  2WLL B;  4JI7 O;  4GYC B;  3ZJZ A;  4MVU A;  4O4H B;  4ZKI A;  3I5D A;  2QWP B;  4FK5 C;  1SQF A;  2CH7 A;  5AG2 A;  5EBM C;  5IJ9 A;  2ZIO A;  3SPC A;  2N74 A;  3QO8 A;  3H01 A;  3L70 H;  5GW7 A;  2FB5 A;  4JI0 O;  4TOI A;  1H8H G;  3A8T A;  3F5W C;  3WG7 C;  2DYR C;  1K73 W;  4MVQ A;  4EKW A;  3AG1 C;  5J2T A;  4OXS A;  3IFX A;  4DV0 O;  4CZZ A;  2CTQ A;  3CS5 A;  4TV8 A;  4KL1 A;  4L8J A;  3UQ8 A;  1FFX B;  2XAH A;  2P4V A;  3STL C;  2UUC B;  4PDM A;  1N0J A;  3G4S V;  3OMI B;  1B06 A;  4CH4 A;  5JVD B;  5IYZ A;  1VF5 B;  1SZT A;  3M7M X;  2OWO A;  1KEC A;  1FJG O;  1OJH A;  2IM9 A;  1RP3 B;  4LF9 O;  4RAI A;  1SRY A;  3D8C A;  4F6R A;  4X66 O;  3OGC C;  1ARO P;  3LSU A;  4BIZ A;  3OEE G;  3ASN B;  5D5P A;  2B5U A;  2HFE C;  3BA8 A;  4BW5 A;  1MZF A;  1SQX H;  1BT8 A;  4K0K O;  1N34 O;  1YI2 V;  1KP3 A;  1G8M A;  3RT3 C;  4PDV A;  5JQG B;  2DQ3 A;  2F95 B;  4D6T H;  2EIK B;  4PI2 A;  2ZXW C;  2WLH A;  3U11 A;  2UXX A;  3QO5 A;  3TGU H;  2N05 A;  3OR6 C;  5E1A C;  3FD9 A;  3AG2 C;  3JSN A;  2YDE A;  3CCL V;  3EXA A;  3G6E V;  2IW5 A;  1YIJ V;  2IH3 C;  1EN6 A;  1NBM G;  2EX3 A;  2UXD B;  4XBF A;  2JGU A;  4F4L A;  1MMM A;  1HR0 B;  1FS0 G;  2DE0 X;  3DXR A;  3A0B Z;  3C90 A;  1SQG A;  3D36 A;  4RUF A;  4EEQ A;  1RM1 B;  4LNU B;  1WP7 A;  4PI0 A;  3A2F A;  2YI9 A;  1G6U A;  3CCV V;  1MSW D;  2F43 G;  2X7R B;  4QIW F;  4DV3 B;  4JTA B;  4J11 A;  3CEI A;  1JFF B;  2Q7G A;  2DWD C;  3ZMV A;  2F66 C;  3W7S A;  4F6E A;  1DTO A;  4PA6 A;  1NQT A;  2F4V B;  2X0L A;  3SYC A;  3SR2 C;  1H2G A;  5IYB O;  4OX9 B;  1U96 A;  4W4K A;  4LF5 O;  2BOB C;  1F4M A;  1EM1 A;  2R9R B;  4JYC A;  1YXB A;  2BE3 A;  2ZDI C;  1AR4 A;  2Y48 A;  2YIB D;  4JZG A;  3MAQ A;  1GTO A;  1Q6U A;  1HP8 A;  2ARH A;  1KMI Z;  5A2Q N;  2LP7 A;  1AI7 A;  4ABM A;  1J5E B;  3AG3 C;  1K97 A;  4LP8 A;  3E86 A;  1X59 A;  3K3W A;  5GTI Z;  1VIB A;  3HKE B;  5LBQ A;  4I5S A;  4X88 A;  4UB8 Z;  2GV9 A;  5B66 Z;  2B9Z A;  3JAL B;  1XNQ B;  2Q9L A;  4DV4 B;  3WG7 B;  2DYR B;  3HKC A;  2DOS A;  3RW0 A;  5KHI A;  1GMG A;  3AG1 B;  3ABL C;  4X1Y A;  2YEV B;  4I50 A;  2QGN A;  4Z2W A;  3RYF B;  2XAG A;  3JAK B;  2EJR A;  3JCZ A;  2VQE O;  1R6K A;  1Q82 W;  1J95 A;  5LYJ B;  4X9Q A;  4A5U B;  5CN0 A;  2IU0 A;  1K4D C;  1XIL A;  4IHJ B;  4X62 O;  1KB9 F;  3HKD B;  1V54 C;  2YUA A;  1PL4 A;  2LGW A;  4LFC O;  4DK0 A;  1H2S B;  3JD1 A;  3M99 B;  1AJQ A;  2R70 A;  3K5N A;  4LF7 O;  5CA0 B;  4ICG A;  5D5Q A;  3E8F A;  4X89 A;  5IYC O;  4X20 B;  4YHH B;  1OCR C;  3AG7 A;  3TK1 A;  2XAQ A;  4K35 A;  4YIO A;  4NXN B;  5B1N A;  3SYO A;  3OUS A;  3BHP A;  5JH7 B;  4LFB O;  3OD4 A;  2ZT9 B;  1D2D A;  4TQF A;  3OM3 B;  2HLD G;  2YIC A;  4WFF A;  2ZXW B;  4DR7 B;  1MZE A;  1R3L C;  1ZUQ A;  4BR6 A;  4X1I A;  4ZHQ A;  4AI8 A;  5BR8 O;  1O9H A;  5CB4 B;  4UCS A;  3AG2 B;  1I0H A;  1CP9 A;  1VF6 C;  4RWU A;  3W7W A;  2JEX A;  4DW0 A;  3TXS A;  3ZMT A;  1AJP A;  4FLU A;  5GTH Z;  2KG7 B;  2EJ7 A;  1WPB A;  2P06 A;  2KB1 A;  2Z5U A;  5KAF Z;  4IT5 A;  3SJQ C;  4FLY A;  5H5N A;  2P4K A;  3R66 A;  2AZ2 A;  5ITZ A;  1S5L Z;  3G67 A;  4DV6 B;  4TV9 A;  2ZNI A;  4RQF A;  2P5O A;  2FTK A;  2VQF O;  4DV7 O;  2P90 A;  4TUY B;  3UO3 A;  1FPO A;  3JAW B;  2UXB B;  3JAR B;  4JAA A;  4LR3 A;  3AK2 A;  5FNV B;  1JJO A;  4RQE A;  5EK0 A;  2QKC A;  3ZN1 A;  3LSQ A;  1FAF A;  4WBN B;  1HDJ A;  3B4S A;  2UUA O;  3ZHT A;  2Z3Y A;  4X8A A;  1K92 A;  5LGU A;  3JAS B;  3ZMU A;  4LFA O;  3ABK C;  5LL6 Y;  1HNW O;  1S5H C;  5LP6 A;  2WLN A;  1PV0 A;  2UXC B;  2A06 H;  5IYD O;  5EYP A;  3AG3 B;  3THO A;  1QBZ A;  4EB6 A;  5BY1 A;  4JYA O;  3GVM A;  1Y67 A;  5EBW C;  4IIJ A;  2CGN A;  4YXW G;  4MVZ A;  2WLJ A;  3CRA A;  5CA1 A;  1EZV H;  3ZHU A;  1IBK O;  3ABL B;  5JCO C;  4QJF B;  1BZK A;  2IJH A;  1N33 B;  3UT5 B;  4I7Z B;  4CS3 A;  3O65 A;  3CJH A;  4JI2 B;  1Q6I A;  3KCX A;  4IGG A;  4KXR A;  5JJN B;  2QDO A;  1GK9 A;  2CTW A;  1UPG A;  3VQV A;  2VRZ A;  1HNX B;  3FYE B;  3STZ C;  1V54 B;  5H6Q A;  3CCR V;  4X1K B;  2NNU A;  3CE2 A;  3E83 A;  2X6C A;  5C8Y B;  2LW1 A;  4JI8 B;  3P30 A;  1OCR B;  3ZHQ A;  1NZ6 A;  2UUC O;  3AG4 C;  2JGD B;  3ICX A;  4CC5 A;  4DR6 B;  1L8D A;  4GUN A;  4U3J A;  4P30 A;  1VQ9 V;  1XHX A;  3D3Q A;  2Q68 A;  1L0L H;  2LJ2 A;  3O9O A;  3I56 V;  4DR4 B;  2ZR3 A;  1PP9 H;  1KQS U;  3PJS K;  4MVM A;  2PI5 A;  2QTS A;  4J7J A;  4D7S A;  1FFX A;  3K9A A;  2RMK B;  1UJW B;  1YF2 A;  2F1M A;  4DXW A;  3APQ A;  2M6Y A;  3BY6 A;  4BW9 A;  1COW G;  4NTX A;  4YJ2 B;  1US6 A;  3MDS A;  1BE3 H;  3SGI A;  1SZX A;  1WNS A;  1FXH A;  5B1B C;  4B7K A;  3WB2 A;  1QLE C;  3HB3 B;  2UXD O;  2JS3 A;  3DC6 A;  5JQG A;  4FM1 A;  1HR0 O;  1E1Q G;  1EBO A;  1K33 A;  4DV2 B;  4Z1V A;  1F51 A;  5CMU A;  3TJT A;  4WFG A;  4CBC A;  3VQY A;  1Y6X A;  2VWJ A;  5J9P C;  4DV3 O;  4HNA B;  3QO7 A;  2Q67 A;  1Y76 A;  1IUR A;  3KKY A;  2A79 B;  1XDC A;  5EZY B;  4TSF G;  2EZP A;  3ABK B;  4ZBM A;  2F4V O;  1OCZ C;  4EFE A;  4I4T B;  2A3Q A;  4WFE A;  4KFM A;  2QTO A;  3CC2 V;  5FPR A;  1R73 A;  3CYO A;  3RVY A;  1WPX A;  4OX9 O;  2Q7E A;  3ZCC A;  2NN4 A;  1Z5W A;  4B3S B;  4UVB A;  1DGS A;  4W4L A;  3GWK C;  2PYL A;  3OEH G;  3BPZ A;  1YVW A;  2CK3 G;  2IJJ A;  1M56 C;  3E22 A;  4HBN A;  2WWW A;  3ZHV A;  3VBB A;  3L72 H;  4O4I B;  3W7T A;  4JTD B;  5BMV B;  1IXB A;  5B1O A;  2JJ1 G;  2JS5 A;  1KKC A;  4YIP A;  1VQL V;  3L74 H;  3ZIA G;  1K9M W;  1XNQ O;  4B3T B;  4DV4 O;  3FB7 C;  3L71 H;  4RO2 A;  3BAB A;  1WP8 A;  3UCS C;  1H2N A;  3ZX6 A;  4B3M B;  1BSM A;  4JV5 B;  3B8M A;  3JD0 A;  3HKE A;  4DRX B;  4DR1 O;  4AQY B;  1WJZ A;  3AG4 B;  1N36 B;  2LFS A;  1CPY A;  5CBG A;  3UM7 A;  3G80 A;  1KUQ A;  4MT8 A;  2ZR2 A;  2L35 A;  2E5L O;  4QPK A;  2YEV A;  3P3P A;  4N21 A;  4DR5 B;  2HEP A;  3BCC H;  1S0V A;  4YHH O;  1R3K C;  4PDL A;  1MAB G;  2MW2 B;  2QR4 A;  4X64 B;  5LYJ A;  1NVP D;  1K5S A;  1AJN A;  1WB8 A;  1Z5V A;  4UCU A;  1ZSP A;  2QWR B;  1F4N A;  4O4J B;  4DR7 O;  3WU2 Z;  1JPX A;  2HKO A;  4X20 A;  5B1B B;  5L3G A;  2W6J G;  4FPP A;  4PA4 A;  1AB3 A;  4DV1 B;  1H38 A;  3L9D A;  1QLE B;  2AGA A;  1XQ8 A;  1TUB B;  3N27 A;  3GWO A;  1VQ4 V;  3CWB H;  4I55 A;  4LC1 A;  2ATK C;  1SC5 B;  1Y74 B;  4MS2 A;  1VQN V;  4NYK A;  3KZI Z;  4O4L A;  5EIB C;  2EIJ C;  1K34 A;  4UFZ A;  5CB4 A;  3K5O A;  3CX5 F;  1Q5O A;  3OW2 U;  4YJ3 A;  2Q8V A;  1YTF D;  5DEC A;  5E79 Z;  4P9P A;  1SF9 A;  2KKW A;  1AP5 A;  4DV6 O;  1BQZ A;  4TQD A;  1NTK H;  4NXM B;  3AK3 A;  3VOU A;  1OCZ B;  4FM0 A;  1MA1 A;  1MG1 A;  4FLT A;  1TVK B;  4X65 B;  4PA9 A;  2UXB O;  1X4T A;  3AK1 A;  4UCR A;  5KLV H;  4G27 B;  4FFK A;  1R1B A;  1V55 C;  3LNM B;  5IT9 N;  4Q6G A;  1KD1 W;  2QM7 A;  1MOF A;  1I5X A;  1M56 B;  3G6B A;  3PN1 A;  2UXC O;  1M4U A;  1P4R A;  3JAW A;  2BTQ B;  4U7N A;  5JJE B;  3JAR A;  4H33 A;  2OCH A;  5IDJ A;  3ZMS A;  3RN4 A;  4DUY O;  3ETG A;  5FNV A;  1Q43 A;  4R8C A;  4WBN A;  2Y69 C;  3B40 A;  2XOK G;  4FLV A;  1ZLZ A;  2WLI A;  3JAS A;  1SQP H;  1RFY A;  4FLZ A;  1AI6 A;  3BAA A;  1RPR A;  3D36 C;  3LDE A;  1QU7 A;  3CRM A;  5KX5 B;  3CP1 A;  1AR5 A;  2V4D A;  1N33 O;  1ZTE A;  1YDX A;  1TUE B;  3ZRW A;  3OTO B;  2ZM6 B;  2K1E A;  3T2M A;  1HNX O;  1B04 A;  1YIT V;  1VMG A;  3JD3 A;  1IZ3 A;  4QNH B;  2PY5 A;  4FFB B;  2ZNJ A;  4K8X A;  1WA8 B;  3P3N A;  1JJ2 U;  1NTM H;  1ZWI C;  3LDC A;  1I08 A;  3CD6 V;  5K1P A;  1AVM A;  2B1I A;  4JI8 O;  4JF3 A;  2HVK C;  4ZI7 B;  3L75 H;  1TGO A;  4JI3 B;  4GT1 A;  2Y0P A;  3U0Z A;  3HKB A;  3F7Y C;  5KUM A;  3H9V A;  4DR6 O;  4DR3 B;  1GH6 A;  4CC6 A;  5LGN A;  4JAS A;  2YIB A;  4CH3 A;  4YY3 B;  1FXV A;  1SA0 B;  3N2K B;  5C8Y A;  1Y4M A;  5IWA B;  1H2L A;  4DR4 O;  2Q4P A;  1M5I A;  1K5Q A;  2O57 A;  4H44 B;  2CH7 B;  2Q7H A;  2ZE5 A;  5LA6 A;  5IJ9 B;  3J81 N;  3DGE A;  3ETD A;  4FJC C;  1HNZ O;  1YJ9 V;  1KC8 W;  3T4D A;  3ZN0 A;  1QLN A;  1QHT A;  4GX0 A;  1GN3 A;  2OYQ A;  2XUM A;  1QNM A;  4PHZ A;  3IC7 A;  4JPR A;  2JDI G;  3FX7 A;  4J42 A;  5J2T B;  1NR1 A;  4JI1 B;  4LF6 O;  3A0H Z;  3SPI A;  3JD4 A;  4WFA V;  2EIJ B;  4TV8 B;  5F2V O;  1JA8 A;  2ZQM A;  3RWR D;  2IH1 C;  4I0X A;  4B7E A;  2WA3 A;  2OTL V;  3R65 A;  2Y4T A;  1NVP B;  3QF7 A;  5IYZ B;  1EZJ A;  4YJ2 A;  3HPL C;  2JVD A;  4O2B B;  2FYU H;  3VQW A;  1VQM V;  3QTC A;  1P7B A;  3E8B A;  2QM8 A;  4F6R B;  1V55 B;  1PM9 A;  3ZMZ A;  1M9N A;  5LHI A;  3N2G A;  1K8A W;  4B08 A;  1IBL B;  1NT2 B;  5KHG A;  2IU3 A;  4MVR A;  3BVO A;  4E4E A;  3JCU Z;  3SPH A;  2PYJ A;  1FJG B;  3JD2 A;  4I9Q A;  5A9G A;  3SPJ A;  1XBL A;  1RPO A;  2YS8 A;  4LF9 B;  1LUV A;  2PGG A;  3IGA C;  1XL4 A;  2ZE8 A;  1GRJ A;  3FAV B;  2OCC C;  5LXT A;  2WA4 A;  1KBH A;  4PV1 B;  1YHQ V;  1Q3E A;  1U97 A;  2LW7 A;  1VEW A;  3SYQ A;  2HJF C;  4B3S O;  3K5M A;  2Y69 B;  2AHZ A;  2FKX A;  1PL0 A;  1QQC A;  2DYS C;  4UB6 Z;  1YTF B;  1N32 B;  5KMG A;  2VS0 A;  2G38 A;  4J80 A;  3T1C A;  2V7Q G;  3KG2 A;  1H8E G;  3W7X A;  1YJW V;  4IYH A;  1GN4 A;  2XHB A;  3IAY A;  1FXK C;  3BEH A;  1TA8 A;  2XAJ A;  4NVP A;  3IJ4 A;  2CAZ C;  1P84 F;  4B3T O;  2GUZ B;  4JYB A;  2D3O W;  1YSC A;  3JSL A;  5JCO A;  2Q5Z A;  2LGQ A;  4B3M O;  4NKG B;  5CBF A;  4JV5 O;  3QG5 A;  5CA3 A;  5KA5 A;  5KHH A;  3K79 A;  4DV5 B;  2OTJ V;  2W0F C;  5K1X A;  3OMA B;  4K8Z A;  1P7G A;  1Q81 W;  4AQY O;  1XOU A;  4QPJ A;  3UO2 A;  3K59 A;  1N36 O;  1N8R W;  2LFR A;  2IBZ H;  2PUS A;  2ZKO A;  2QKA A;  2KQX A;  3K03 A;  1IDS A;  5LOV A;  4QE9 A;  2ITD C;  3I55 V;  1GN2 A;  2CGO A;  3RBZ A;  2DMX A;  2H8P C;  4HYO A;  4UVC A;  4BWA A;  3JAM N;  1VQK V;  2PZS A;  4GKJ B;  3K08 A;  4DRX A;  3CC4 V;  3RYC B;  4X64 O;  1AI4 A;  3DC5 A;  2QWQ B;  1UFI A;  2CTR A;  3CMA V;  2WLL A;  1GO3 F;  2DJV A;  3H1I H;  4O4H A;  5BZB A;  1BHB A;  2X6B A;  1KKD A;  2M7W A;  3HKC B;  2ADQ B;  1AP6 A;  5LMN B;  4I50 B;  1AR1 B;  4MTX A;  3QNE A;  4WFB V;  3T1H B;  3S3X A;  4JI6 B;  4XDJ A;  4J9Y B;  4DV1 O;  1ENV A;  3L73 H;  1NJI W;  4XDL A;  2B1G A;  2E75 B;  2PTM A;  3FFQ A;  2Z0A A;  3M8A A;  3H1H H;  4MVO A;  3CXH F;  1S76 D;  1ZAU A;  2K9P A;  5JVD A;  3S3W A;  1CEZ A;  1S3J A;  3OE7 G;  3T1Y B;  3ZBH A;  3SJB C;  3ZRV A;  2ADP A;  3CME V;  2YI8 A;  4DW1 A;  4Z1M G;  3F5T A;  1EN5 A;  5LMU B;  2FML A;  1WB7 A;  1R3J C;  1NKD A;  1M93 A;  4LFC B;  2AXT Z;  4AIL C;  5L3E A;  4X65 O;  1Y74 A;  3MHH C;  1F23 A;  4J9Z B;  1I94 B;  5EBL C;  2OCC B;  1S72 V;  4B3R B;  1ROP A;  1M57 C;  2ZE6 A;  3BFR A;  5IJ0 B;  1PNL A;  2UXN A;  2GTS A;  1DF4 A;  1VAR A;  2E74 B;  2P67 A;  4D7T A;  2DYS B;  4FLX A;  3X2Q C;  1E79 G;  1N4C A;  1SQV H;  4QGP A;  2X6A A;  3ZED A;  1TVK A;  1EFR G;  4P2Z A;  2XAF A;  2QKS A;  4UCT A;  4WCE V;  4UV8 A;  3C3S A;  4IYI A;  1EN4 A;  1FXK B;  1IXM A;  2IJK A;  3G71 V;  1DK1 A;  2IJI A;  4UV9 A;  5ITZ B;  3AEI A;  4NTY A;  2HVJ C;  4LNU A;  5KHK A;  3GB7 C;  1BCC H;  2F93 B;  3E89 A;  3K0D A;  1XRE A;  3LDD A;  3CCE V;  2BTQ A;  1JFF A;  3OR7 C;  3CCM V;  4J7K A;  1XEQ A;  3OMN B;  1PNM A;  1FFT B;  4JAV A;  3JAT B;  1YEW A;  1KU9 A;  3FB5 C;  3OTO O;  2ZM6 O;  4FZ0 A;  1J5E O;  1BMF G;  1SKV A;  4H13 B;  2RJZ A;  3CRR A;  3EVK A;  2BCC H;  3D3I A;  4DV7 B;  1KP2 A;  1OCO C;  3WFV A;  2PF4 E;  4EB6 B;  4G2K A;  2JIZ G;  4CS2 A;  4JI3 O;  4KHP B;  2YID A;  2ILM A;  2R9A A;  1JMK C;  4LF4 B;  5HFM A;  1IBM B;  4LH7 A;  2JRI A;  4IIJ B;  4DR3 O;  1XUQ A;  2OIE A;  4YY3 O;  4FFB A;  1Y66 A;  3B8N A;  4LFA B;  5CA1 B;  2JK5 C;  5BXZ A;  4MTG A;  2UU9 B;  2GTA A;  5IWA O;  4GLX A;  3RFR A;  3JAL A;  1XI1 A;  2BSK B;  5HFL A;  4ZI7 A;  5DM6 V;  1XMQ B;  4PEL A;  4H37 A;  4JI4 B;  3FB8 C;  4HZ3 A;  4BIO A;  3Q4H B;  1XNR B;  5EIB D;  3RYF A;  1NS1 A;  3JAK A;  2BOC C;  1NI8 A;  2EUL A;  3N2K A;  5KAI Z;  3E8H A;  2CDY A;  4JI1 O;  4RUE A;  4JTC B;  4NXN O;  2C2A A;  3WB1 A;  1I5Y A;  5JWP A;  3K0G A;  4IHJ A;  4PDR A;  3K9S A;  3HKD A;  2XTA A;  3DSQ A;  3E2E A;  1T5E A;  3SJC C;  1L1F A;  5CA0 A;  3OTF A;  4KUM A;  3LUT B;  4P9O A;  1FD9 A;  4U3J B;  2YXH A;  4BAY A;  2GDS A;  5GON B;  1VQO V;  1SES A;  3OGI B;  1XMO B;  1YCI A;  2F23 A;  1H2M A;  5J2U B;  4LWS B;  5JH7 A;  1M57 B;  2W6I G;  1IBL O;  3TCU A;  3CXC U;  3JYC A;  3TXQ A;  2QWN B;  3K04 A;  3A0R A;  2NLJ C;  3K5L A;  4DR2 B;  3X2Q B;  1JQ0 A;  1QR8 A;  4Q20 A;  1JCH A;  4O2B A;  4LCU C;  4ASU G;  1W0J G;  3KCY A;  1ORQ C;  1W0K G;  2HR3 A;  2V1D A;  4DUZ B;  2DQ0 A;  2GHY A;  2KG7 A;  5IE9 A;  3J7A U;  4TWK A;  3C3T A;  1SQB H;  4PJ0 Z;  1N32 O;  4FM2 A;  4ZOL B;  3RYI B;  2Q69 A;  2ITC C;  3RYH B;  5C93 A;  1O9G A;  3P32 A;  3CPW U;  2GBO A;  2DW4 A;  4FVM A;  4XDK A;  3FAV A;  5IY5 C;  1Q6H A;  1JR9 A;  1D5N A;  4TUY A;  1Y76 B;  2YSU B;  1GM9 A;  2OIG A;  4AHC A;  3BRC A;  1RSO B;  2YXY A;  2RN9 A;  5H6R A;  4UVA A;  5B1A C;  1OCO B;  4FIP C;  2CUG A;  3H1L H;  5EC2 C;  2ZDI A;  2ODM A;  1QCE A;  1F7Y A;  5KA6 A;  4DV5 O;  3ABM C;  2VWK A;  4JAU A;  3HR0 A;  4O2A B;  1R3I C;  1SS3 A;  2GUZ A;  4LF8 B;  4NB5 A;  1Z2G A;  1GN6 A;  4R50 A;  2QSA A;  3E22 B;  4JI2 O;  3OAA G;  4DO2 A;  1NH2 D;  4GKK B;  1VP7 A;  5H2F Z;  2Q0A A;  2Y0I A;  1NR7 A;  1Q8I A;  1LR1 A;  4GKJ O;  1QVG U;  5LGT A;  4GZR B;  3RVZ A;  1LUW A;  2LQT A;  3LNN A;  3UT5 A;  4FMT A;  4UUJ C;  5LMN O;  3NR7 A;  3ETE A;  2UUB B;  4GX1 A;  5B3S C;  1ZL8 B;  3SYA A;  1L0N H;  4WFH A;  1LNQ A;  1ZX3 A;  4QE7 A;  3T1H O;  4JI6 O;  4OGQ B;  3RYC A;  4X1K A;  4JI5 B;  2HHH B;  1AIL A;  3ABT A;  1VF7 A;  2AZ0 A;  1VQP V;  2H3O A;  1SET A;  3ASO C;  4K3A A;  3E35 A;  4U7O A;  2EIM C;  2JGD A;  2RDC A;  3CSX A;  3J80 N;  4DK1 A;  3SDL A;  2A7W A;  3VQX A;  4DR1 B;  3T1Y O;  4IL6 Z;  2OT5 A;  3CCS V;  1YJN V;  3DTU B;  5KHJ A;  4JI7 B;  3CRC A;  3UKM A;  5LMU O;  3LSS A;  1THZ A;  4UXN A;  3EHB B;  4E2L A;  2E5L B;  1HW7 A;  2ZCE A;  1B3Q A;  1Q7Y W;  1G4Y B;  1VF6 A;  4KP4 A;  2E3C A;  5FL7 G;  3K06 A;  1JOY A;  1I94 O;  4JI0 B;  4B3R O;  1M1K W;  2CTP A;  2QWO B;  5DED A;  1DLB A;  3NXS A;  1VQ5 V;  3ML0 A;  1WN7 A;  4DV2 O;  2Q0O C;  1VQ8 V;  4DV0 B;  2EIL C;  3SJA C;  2L6L A;  4MSW C;  1G1X B;  2MK3 A;  4I55 B;  1SQQ H;  1TAE A;  1WLE A;  4O4L B;  5IY5 B;  3SYP A;  4YJ3 B;  1DF5 A;  4OPA A;  2HG5 C;  5IJ0 A;  3ABU A;  3K57 A;  4PD4 F;  4CH5 A;  4DYL A;  3E8G A;  1VQ7 V;  1GM8 A;  4FZ1 A;  3RGB A;  1OV9 A;  2AW9 A;  4X66 B;  1H2K A;  5B1A B;  1URF A;  4HNA A;  1V9P A;  5B5E Z;  3IC9 A;  4K0K B;  1N34 B;  3ABM B; 
#chains in the Genus database with same CATH homology
 2LJ2 A;  2H3O A;  1WAZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...