1Q5OA

Hcn2j 443-645 in the presence of camp, selenomethionine derivative
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
201
structure length
201
Chain Sequence
b'DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
molecule tags Transport protein
source organism Mus musculus
publication title STRUCTURAL BASIS FOR MODULATION AND AGONIST SPECIFICITY OF HCN PACEMAKER CHANNELS
pubmed doi rcsb
total genus 57
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2003-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1q5oA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1q5oA02
2QJVA 3R6SA 4YSFA 1FI2A 3E97A 2XLGA 5JAXA 1DZTA 4LLOA 4XF4A 2PHDA 4AQ2A 2IXHA 3CLPA 4MZUA 5D1IA 4IEQA 3FJSA 1RGSA 3SCGA 1YFYA 5LEJA 1L3JA 4LUKA 4L2NA 4ZU7A 4HBNA 1Y3TA 5BY5A 5FQ0A 2ZKLA 4XFBA 5BPXA 1QY4A 2PAKA 2GZWA 1VP6A 2D5HA 2PYTA 4XFFA 3SCFA 3E6CC 3UKVA 1NYWA 4MGYE 4HMZA 4AVBA 2BNNA 3H1YA 2E9QA 3IWZA 2FQPA 2Q0AA 3CL1A 3KCCA 1ZRRA 3U11A 3KGLA 3FHIB 2ET1A 4IEOA 4EROA 3IDBB 2QNKA 4AVAA 5JSRA 3E5UA 4MGKE 5J3UA 2PQQA 2K0GA 4XF9A 1CGPA 1WA4A 1I6XA 3LZZA 4IEWA 5KHHA 4IEVA 4HVQA 5I0TA 4R52A 1QWRA 4ZU4A 4WBBA 1PM7A 5KHIA 1O5UA 1I5ZA 3ELNA 1YFWA 3NJZA 3LWCA 5KHJA 1ZZ8A 1DGWA 2BNMA 4I02A 1CAVA 1NE4A 3NSTA 5I93A 1UIKA 2OZ6A 5I0SA 1H1IA 1FT9A 3RYKA 1CAVB 2ATFA 2BEOA 1HW5A 1DGRA 3HT1A 2GC1A 5FCCA 3DV8A 1Q5OA 1UW8A 1XE7A 4FAGA 2OZJA 3I59B 4IEZA 3H50A 3D0JA 4I0AA 4HZFA 3ES4A 3EHKA 3S7IA 3EO6A 5CVRA 1SEFA 2Q30A 4QM9A 1O3TA 1UCXA 4Z07A 4KWJA 2Q4SA 2BGCA 5T3NA 4Q0SA 4LA3A 2I45A 4AQ6A 2IXJA 3H3UA 4ONUA 4AXOA 4F8AA 3HIFA 4HLTA 2PFWA 2UYAA 4FT8A 2KXLA 2H6CA 2UY9A 1EP0A 4N9IA 3RNSA 2IXKA 5BV6A 5I8TA 2OYZA 1CAUB 4P9GA 1H1MA 2HJIA 2XKOA 1EYBA 5BXXA 1VR3A 4JVAA 2V09A 2BNOA 1IPKA 4XFCA 2WFPA 3IBMA 4Q29A 3O14A 4BIFA 1OFNA 4Q0QA 4FBFA 2D40A 3PLQA 2Z2SB 3GYDA 3BALA 4E2SA 2PA7A 1ZRFA 4X6QB 1GQHA 3I54A 3CO2A 3I59A 2ETEA 3DN7A 3LOIA 3CEWA 4IEUA 2XLAA 1RL3A 4Q0UA 3IDCB 2PAMA 1J1LA 1ZNPA 4TLFA 1J58A 4MUVA 3BU7A 4O9EA 3BPZA 4PJYA 3MYXA 2GC0A 5JCTA 3ZDSA 3BCWA 3N4MA 2VPVA 4HVOA 3E6BA 2C0ZA 1QXRA 4FAHA 3I7DA 5FLIA 2MPFA 3WW1A 2Y0OA 2D5FA 2GH2A 1X82A 4D7SA 2H0VA 4A2UA 4UXAA 2OPKA 2EVXA 1YFUA 5FLJA 1YHFA 4PIZA 2D93A 3CJXA 3DKWA 4HN0A 4QXKA 2GC2A 3SHRA 4QGLA 5EFUA 2MHFA 4KL1A 4PIYA 2XKPA 4WZCA 5F1RA 2CGPA 3OGJA 4BH9A 1CAWA 4QMAA 3ROUA 1OI6A 3KGZA 4OFGA 3FFQA 2XLFA 3KSCA 1RUOA 1J59A 4QX5A 5LRRA 2VQAA 4K8FA 4MX3A 4OLLA 4XF0A 4J1WA 3LA2A 4UBGA 1GQGA 1YWKA 4NVPA 3WW3A 4BHPA 3H3ZA 1Q3EA 1IPJA 1XRUA 2IXCA 5BUVA 2QDRA 1O3QA 3U10A 1ZZBA 2O1QA 1LRHA 2WC2A 4XEZA 3LA3A 4HSJA 1ZVFA 5FPZA 3QOPA 4MGIE 4KU8A 3RDIA 1EPZA 3KMHA 1SFNA 5J7MA 3OD0A 1NE6A 4YYOA 2EAAA 3MPBA 3C3VA 2DCTA 2B5HA 4LULA 5FLHA 2MNGA 3FZ3A 4IEPA 4LA2A 4BYYA 1RC6A 3RZZA 2PAEA 5K8SA 4ORFA 4AVCA 2XL7A 3LA7A 5KHKA 3OCPA 3BB6A 1LKNA 2H6BA 2Z69A 3FE5A 5I0UA 2O8QA 4I0BA 3UKNA 1ZRCA 1ZZ7A 2CAUA 2K9ZA 1PMIA 2P17A 3E6DA 5FDBA 1YLLA 1YUDA 2GU9A 5HI0A 3RYRA 1X8MA 1U12A 1O3SA 4QM8A 4GULA 3TNQA 3H7JA 4XETA 3WW4A 1X8EA 5C8WA 2PHLA 4LTAA 3H1WA 4XF3A 1NZCA 4IERA 3VHRA 3MDPA 1EY2A 2XHKA 3NL1A 4IESA 1O3RA 5E16A 2Q1ZB 1LB2A 4YNIA 3SCHA 2QVSB 4D7TA 2N7GA 4EV0A 1ZZCA 4I3PA 2CV6A 4Q0VA 3H7YA 2VECA 4LUMA 4DINB 4HVRA 4ZU5A 5LRSA 1O4TA 3ES1A 1FXZA 3S7EA 1CAXA 2IXIA 2IXLA 5I0RA 3UKTA 4B29A 2UY8A 3GBFA 5KBFA 3E5XA 3CF6E 3NKTA 4KU7A 3NVCA 5LEKA 4KWKA 4I2OA 3ST7A 1ZZ6A 1V70A 4IETA 5FQ0B 2B8MA 4YARA 3HT2A 2IC1A 3RPQA 5I91A 4EWDA 4O9GA 3EBRA 1JUHA 2CAVA 2XGXA 3D82A 1ZREA 1QXJA 4H7LA 4R8HA 3OF1A 4IEYA 4JTNA 3JZVA 4F7ZA 4XFAA 3D0SA 2GC3A 2PTMA 3S0MA 3U0ZA 1X7NA 1OD5A 1CX4A 2HKXA 4YRDA 5I8YA 1WGPA 2B9UA 5CADA 2UYBA 2GAUA 3HQXA 4HN1A 3SMHA 4JV4A 3USSA 3E5QA 1J3RA 2QCSB 3H1MA 3SXWA 3H9AA 4QGNA 1CAXB 2FMYA 5FPXA 4E2QA 1TQ5A 3QACA 5C6CA 1SQ4A 1G6NA 4XF1A 5EZWA 2EA7A 4HSLA 1VJ2A 1LR5A 4I01A 4E2GA 3MZHA 4RD7A 4EWAA 1J3PA 1CAWB 3ETQA 4XFGA 1O5LA 4EWEA 4QGMA 4Z82A 1NXMA 1UIJA 3EQEA 1RUNA 5J48A 1RTVA 2BYVE 3PVBB 1CAUA 4X6RB 1UPIA 3OTFA 1O7FA 4CYDA 2XL9A 5KHGA 3M3IA 1OMIA 4XFHA 4IEXA 5CU1A 1J3QA 4L11A 5I8SA 2F4PA 2OA2A 4KWLA 1ZRDA 3B02A 4XFIA 3PNAA 3FWEA 3FX3A 1XE8A 4Q0PA 4UBHA 4PIXA 3LAGA 3WW2A 3H8UA 4MV2A 3RYPA 4J1XA 3IIAA 3EJKA 5E1RA 3ACLA 1Y9QA 5JSOA 4META 3G7DA 1DZRA 1Q43A 4I09A 2ZCWA 4MGZE 1WLTA 3L2HA 3M70A 4WVZA 2ET7A 5JSPA 1ZZ9A 3NW4A 1YFXA 4LEJA 3TNPB 4JTOA 1ZX5A 4MH0E 4N9HA 1UD1A 5JR7B 5AVPA 3DL3A
chains in the Genus database with same CATH superfamily
1BQ0A 5J37A 2GH8A 3E97A 1PNFA 4OUEA 3SC7X 1M06G 3J7AU 1MABG 1NBMG 3BIEA 1UYPA 1BBT3 1RUI2 3N3HA 4Y22A 4RA0A 4LF9O 2ZD9A 3EB7A 2ZKLA 3PDQA 1VQMV 3I3DA 1N33B 3RGBA 2WLLB 1FPN3 2WNVA 4MGYE 1H8HG 1AZDA 4A7KA 1IS3A 3ASNC 1SESA 1ZTEA 1PGW2 1COV3 3OPWA 4AGVA 2PQQA 3VL8A 1WAZA 1V9U2 3LPFA 3LZZA 4YY3O 1KXGA 3T0AA 3CRRA 4R52A 4FM2A 3IJ4A 2X6BA 3CQOA 5FV3A 3ENRA 2JDNA 2GDFA 5FO7B 1W2AX 2QDNA 3JARB 3WQ0A 1CZSA 4OQ8A 2BBVA 3GXUA 1KS5A 3PMSA 5GLUA 4OQ9A 1IXMA 5C71A 1Q5OA 5HV4A 5BNPA 2JXAA 3I59B 2EF6A 4MS2A 2HG5C 3ABMB 3CJIC 4FTSA 1HRV3 4Z07A 3BTXA 1FOD1 2MEV2 1OVPA 4OHZA 2UYAA 3WF0A 3W7UA 1S0BA 2UY9A 4QB2A 1S4CA 1KMIZ 1CAUB 1OA4A 1EYBA 4Q26A 1ND2C 3MF9A 2FBEA 3E8BA 1IPKA 4CU7A 4WM7B 2D40A 1GICA 3PLQA 5D8AA 4DFSA 3T1HO 4RS5C 1Q6HA 1ULGA 4HYOA 1QNMA 4O2AB 1NTZH 2O57A 5A7OA 5K0UA 2PAMA 3J9SA 1B35B 3MD0A 3U78A 1AR62 4G28B 4DNYA 4BR6A 2VPVA 2NQYA 4CZSA 2W94A 3JUUA 1S0DA 5JQGA 2P4EA 2VMFA 1NJIW 3K9SA 3OMIB 1TAEA 1N1SA 4ES8A 5LA9A 2QQNA 5IYYA 3O0WA 2ETNA 3W21A 2BTVC 2YIDA 4MXVA 3CWBH 1W3VA 3RI9A 3B9IA 4A3XA 3NAPB 3FFQA 2VQTA 4LORA 3BA9A 2G19A 4XJZA 2Y69B 4J1WA 3EXAA 2P3KA 5IJRA 4LK7A 2W08A 3T4ZA 2VUCA 3ECQA 2LQTA 3U10A 2V5YA 2LW8A 1LRHA 5FBZA 1PMHX 2VBPA 4NKGB 1RUG1 4MGIE 1RVF2 3VZNA 3T08A 3O1SA 4RFRB 1DQ5A 4BA6A 2WS92 1Z5VA 5FPRA 1B06A 5LWBA 1OCCB 4Y1ZA 3OEAA 4DR3B 5FZ1A 5KMGA 2CYFA 3JD2A 3RZZA 4ORFA 4B1LA 1BMV1 3D8CA 3OCPA 4B3RO 1OOPB 4YHHO 2D97A 3DXRB 4UCRA 1K12A 3VBSA 2GDSA 2D6LX 2VNVA 1AP5A 4GULA 2AZ0A 1X8EA 5LBCA 4ZKIA 1OOPC 1XNRB 1N0NA 2VO5A 4JHTA 2OS2A 1DQ4A 5E16A 3X2QB 4E4EA 5FZDA 5FZ4A 3ZR6A 1ZSPA 4P5HA 2QKCA 2CV6A 5F2WA 1BLZA 1JZ4A 3CCLV 3ZKYA 1QJX2 3RJ2X 3B69A 1TA8A 3DKQA 3UETA 3P5BA 1AYM2 2LTNA 3WLUA 3M7MX 5CFCB 1JOPA 3I2KA 3N2KB 4GKXA 3ZN0A 2RR11 4XTMA 4ZHNA 1BEV3 1ZBA3 5J2TA 1X7NA 1DBNA 2JKXA 4GA9A 2YEVB 1FJGB 4G2KA 3USUA 4XBQA 5HPOA 2EZOA 2E63A 3ZN4A 2NYYA 5HCFA 2EIJC 3VBOC 2B9ZA 2W0XA 4GKKB 4L8JA 4QKFA 3WG4A 3R05A 4QPGB 5LATA 4MXWB 1V00A 3MW3A 1VBB1 1RTVA 5FPBA 1T5EA 1O7FA 1V9U3 3RW0A 2HBUA 3K46A 3N7LA 4WZFA 1FX5A 4A45A 1G9FA 3CXHF 1H0BA 3CZUA 2DFCA 1H8TA 4OUMA 4CS4A 5LMUO 1Q8QA 3WW2A 4CCKA 4FSJA 4JI1O 4NO4A 1PZ7A 1N32O 2Y48A 2W91A 1YQ8A 3WNOA 1THZA 1BL8A 1ST8A 3AJZA 3CCQV 5K0UC 4P9YA 5FP7A 3BABA 5EZYA 3K4DA 1R1ZA 1FD9A 2BOJA 2D3SA 4IGOA 4AQ2A 4YW6A 1VBE1 1T2XA 3VOUA 2XWJB 3DYMA 3QH7A 3T1YO 3W5NA 2QKAA 2WZR3 5L3EA 5BPXA 4Z8BA 3MDSA 2VVEA 4JGZA 3SCFA 1VBD3 4CZZA 3FHAA 2FDHA 4GH4A 3H1YA 1NG0A 5BMVB 1TEIA 5C8CA 4AVAA 4JZRA 4XHBA 4I55B 4MGKE 1GKFA 3J7HA 4IDZA 3CNAA 1WBFA 1JYCA 4IGQA 2PHXA 3JATA 2QQIA 1QWRA 2WR9A 2X7RB 2Y4TA 3H1LH 2JGUA 1RUD1 3A0BZ 3AYCA 3K5LA 1DGWA 1QJEA 3ML0A 3RYKA 4DR6O 2Y60A 4RFT0 5CA0A 4FAGA 4IEZA 5EPAA 3QF7A 1IOAA 2OX0A 3UT5A 1EV13 2DURA 3EO6A 5CB4A 1QKQA 5FKCA 1CESA 5KX5A 1AR73 2ZX2A 1ND3B 4Q0SA 5BNOB 4NTWA 2AEZA 3OEEG 3UKMA 4YIPA 3ICXA 4IQPA 5FZCA 1BVP1 4OHYA 4KP4A 5BV6A 2OYZA 4OYUA 3MV01 5A3TA 2W47A 3A7QA 3UL2A 2F95B 1VMGA 2CUGA 3BUCA 4B3TB 1D5AA 4J41A 4RQPA 4X6QB 1GANA 2L35A 3CO2A 4HONA 2EIJB 3VBOB 4LIUA 2HWC2 3FLTA 4YG6A 1J1LA 2OCCB 1AJNA 4DRRA 1AR1B 4AG4A 5BZBA 1SPPA 1GOFA 3G6BA 5J96B 3JBG2 3ZPYA 1MMMA 1VAVA 2EVXA 4DR4B 5L73A 5CBLA 4SLIA 3HAGA 1LHVA 2ZQMA 4ZONA 3RG0A 1VIBA 1OLQA 4JI3O 1NH2D 2DW4A 4TV8B 3QO5A 4ZS3A 3UGGA 2BFUL 5DG1A 1LEDA 3WVJA 2YU1A 4WBNB 4KI5M 3KQ4B 1UAIA 1GQPA 1VBB2 4UW3A 4AW7A 3AP5A 1FPOA 3S5QA 3IB3A 1AYN2 4EZHA 1V6IA 5E89A 3A0KA 2K2SA 1UFIA 4FFBB 3SEEA 4XUPA 4KU8A 1VLNA 1JXNA 2UU8A 4AFCA 1PM9A 2DUOA 4RGGA 3DPRC 5EJZB 3VGIA 3CSXA 1SFYA 1MEC2 3WP3A 2XJSA 3BYWA 2Z5UA 5FP3A 5DABA 4QQLA 1COV1 3KV5A 2G38A 2R9AA 1LKNA 4JGYA 5L3CA 1PIV3 4SBVA 2BU9A 5IY5B 5JI9A 1TNRA 2QQWA 3RT3C 1QNYA 2H94A 3O1VA 4AGRA 5A3OA 1W0KG 2WWWA 1SZBA 4YZ5A 1XEQA 4NRMA 5LP6B 1LNSA 3AZYA 4GH4C 1AJKA 4X1YB 4TWKA 1SERA 3NAPC 5LRSA 1KKDA 1AR71 2VQ0A 5JJEB 1PVC2 2B1GA 5A7QA 2ZIMA 4CTEA 4JKKA 3NVCA 1QIQA 5A3MA 1LJ7A 2IC1A 4GYCB 3ZYFA 4U3FH 3AYDA 1D7PM 2PTMA 1OD5A 2ID4A 2C9AA 5D21A 1MVEA 1K34A 4O4IB 2OW4A 1V55C 2UYBA 4JGZC 3FAVA 2CDOA 3USSA 3J4UH 5B3SB 4LO8A 4B1MA 1SZXA 2AENA 4FP3A 3ZSEA 1I5XA 1OKQA 1SMVA 2JJ1G 2ERFA 3JU9A 3BAAA 3A0RA 4LBQB 1APNA 2XJQA 1HNWO 4CYDA 2I74A 1QOTA 4IW3A 1ODNA 2K46A 4JAAA 4QPYA 4Q0PA 2GNDA 3L73H 1HRV2 4C1XA 3VD3A 4J1XA 4U3JA 3AZWA 1QQP1 5DUVA 2F23A 2JE8A 3POGA 4XXAA 4CCMA 3K79A 3QNEA 2JDHA 4BQ5A 4NXMB 3G67A 3MPPG 5ANQA 3VBFB 4LLFA 2YUEA 2XBO1 2CH7B 4NXNO 4HBNA 1IQAA 2EBOA 1WUVA 2R1BA 2N05A 4OMCA 3AMNA 2PAKA 4AEDB 3RMXA 4FOYA 3BCCH 3I3QA 2AXTZ 3B93A 2RDCA 3ABUA 1ZWIC 3IWZA 4ZOLA 2WT1A 2UXCO 3ZX6A 1DF4A 1R1A3 4DUXA 1DLCA 1M1KW 4I9WA 5J3UA 2C1FA 1SLLA 3L2YA 3POSA 4ATEA 3O1UA 3ZVXA 3USUB 2B1IA 1WB7A 2JJ2G 4B7KA 2UU9O 5FAXA 1TUBB 4EE2A 1RP3B 5FZ7A 2JB8A 1QDOA 1NE4A 3M3QA 3ZFEB 3NNMA 5IHRA 3OBAA 5F3IA 4NPLA 2IWGB 5FK7A 2ZGTA 2C24A 1PK6B 3L71H 3VZJA 1W0OA 3WG2A 3C7OA 3WHUA 4DIQA 2HWB3 4C0HA 4L92A 2Q30A 5JMCA 5LL6Y 4FFBA 1PIV2 4E4HA 2B42B 3HQUA 1PX4A 1UZ0A 2V72A 3C2UA 1VQ6V 4D69A 1JU4A 4NTYA 3ASNB 2E76B 3NV2A 1XMOB 1RM1B 2K9PA 3LDCA 1ACCA 3E22B 1W9WA 4XFCA 1RUH1 4Q0QA 1CJDA 5DAPA 3BALA 1DGWX 1XC6A 3DN7A 4CE8A 1QNWA 1VE0A 2XLAA 1PZ9A 4OCTA 2KR2A 1FJGO 3N7KA 2BBAA 3SJQC 1AR81 2DUQA 2JDPA 3AXDA 1H8TB 3GZTB 4DPNA 2AR6A 4QDQA 4ZKTB 4UXAA 2OPKA 1FYUA 4FIPC 1D2DA 2EXKA 1V6MA 2P2KA 2ZDIC 5J36A 3OGJA 3CEIA 2LW1A 2X53S 2DE0X 2X6CA 4R9CA 4MVUA 2WINB 1VQ4V 3PUQA 4XIOA 2CSGA 2DTYA 1JBCA 2OIGA 1C5IA 4KG8A 1S2KA 5K1PA 4K7JA 2X0LA 5AVAA 2BCCH 4BHPA 3T1LA 1NT0A 3BHPA 2IXCA 5CEHA 1N3QA 4DOUA 1BHGA 2FTKA 4DR4O 1EPZA 5H6QA 3J26N 2ITDC 1KEXA 3T09A 3C3VA 5G04L 1HJFA 2R041 4LA2A 1X59A 3V56A 5FL7G 3QLQA 3AK1A 2PLV3 2NMOA 4H2AA 4UV8A 1XL4A 3T2QA 1AI7A 1RM1C 2O8QA 3ACGA 4AI0A 4K8XA 4DV0B 4HAMA 5FP4A 3N2GA 2PHUA 4LO7A 2JB4A 3RYRA 4LF7O 4CU8A 3ZPOA 5C8WA 2CGNA 2QQVA 1QJY1 1GU3A 2P67A 1EUTA 3L9DA 1QHDA 1WPXA 4GQ7A 1PX3A 5KWRA 2JE7A 1I08A 1GWLA 4OX9B 2A6WA 3RZLA 2IXIA 5FY5A 1YQ2A 3ABKB 5EXOA 1QEXA 4XJWA 2VQUA 3LSSA 2B8MA 5GLWA 2CWMA 1YCIA 2RM21 2W1QA 1XQNA 4TWTA 3OD4A 2JDYA 3EBRA 4JDNA 5JOXA 5JVDA 1ZREA 1OLME 1UYYA 5ACA2 4XOGA 4NRQA 3D0SA 1WCDJ 3VB9A 3MI8A 2P1BA 4C90A 5LGNA 3WY6A 1IVSA 4JI1B 3RYCB 5LW9A 5CN0A 2ZXWC 3R65A 5F6KA 3HWJA 1AL21 1TQ5A 3ZCCA 3QACA 4XAEA 1FXKB 4U3JB 1NU1H 1WA8B 5ERLA 5GLZA 4FOVA 2IJKA 2RE9A 5GONA 4LKEA 2GMPA 3SGIA 1IX9A 1PIV1 1GRJA 2ADPA 1CQ9A 1OQDA 1X50A 2WO2A 1V6LA 3ZXFA 4Q4V3 1SLIA 1SQBH 3GWKC 5LY2A 5JZGB 5FREA 4DR3O 2CAZC 5E88A 3INAA 2F4PA 2RR12 2NZ9A 5A9GA 2JDKA 1W8FA 1UOJA 2GP5A 1XYPA 1XE8A 4AI1A 1L0LH 2UUCB 1US3A 2JKBA 4MV2A 4QPGA 5DN6G 1URFA 3ACLA 4QE9A 1NCRC 4AWDA 3K5OA 4WVZA 1ZZ9A 5FZ6A 4QPWA 5IDJA 5EIYB 2QJVA 5J2TB 3GM8A 2XAGA 2Q5ZA 4XILA 4BAYA 5CAZA 4Y4YA 1AR82 3BI3A 3RYIA 3I2JA 3CHXA 1FMD1 3FJSA 4IEQA 2P06A 3AG4B 3HPNA 1HW7A 1A8DA 2YYOA 5F32A 2ZIOA 2BZDA 2PYTA 4YVWC 4NTXA 4C8DA 4AFDA 4FLZA 5FUIA 4DR6B 2VJXA 3FB7C 2WQ8A 2ADDA 3JQWA 2WZ8A 3HVDA 5FOBB 1JZ5A 2ZHNA 2WNVB 2QA4V 3BOPA 4N7IA 4AHXA 5GONB 1N33O 1WA4A 4P9IA 2VW2A 3ZYRA 5KX5B 4CH5A 3JB8A 4MW8A 3LWCA 4NHLA 1L0NH 4Q27A 2RNBA 3VHOA 2EALA 4JGYB 1ZZ8A 2F93B 2YBSA 2VZ3A 3WHTA 1CAVB 3BIWE 1WP7A 5B66Z 3AVRA 5KXEA 5KUMA 2VCAA 1K5QA 1LU1A 1ULOA 5FY1A 5IVYA 2RR13 2YG0A 1CWPA 4JKMA 4QQ2A 4P30A 2QWOB 2FDJA 1LCLA 3UYJA 3ZHSA 1AXKA 4ZZ5A 1X33A 4O4JA 1CN1A 4FT8A 2OIEA 1EP0A 2ZGRA 5LB6A 1CPMA 5DEDA 3ZXAC 2D6MA 4IV3B 2ZX4A 3IBMA 1AL0G 1AJQA 1POV0 4XJ9A 1JYVA 2K1EA 3PUHA 1FS0G 2HEPA 3HKEA 3RJRA 2JWPA 5A3WA 1LOBA 1RL3A 5IYDO 3MIDA 3U14A 1UF2C 3HNYM 1W8WA 3PU8A 4WCEV 4LFAB 5F5IA 3RZKA 3JAWB 2X5IC 4FAHA 2F4VB 4X1KB 1NTKH 1S5HC 2JDZA 3OBTA 2GALA 1N1TA 1POV3 4FPJA 2ZX1A 1UX6A 5A6QA 1C28A 4S2DA 3M7AA 1YI7A 1S76D 2MHFA 2QQLA 1L7QA 1ZA7A 3ZMSA 4RR3B 4DK0A 3BTYA 1HNWB 4JC1A 3ROUA 1DK1A 4OFGA 4N43B 1REDA 2Y6HA 4BXFA 2R0HA 3B7MA 5BNOC 5LGUA 2UXBO 4DR7O 1HX6A 1IKPA 1REFA 4LBNA 3TN92 2Y0PA 2ARHA 5KAFZ 1S0VA 1FFTB 3P6BA 4A44A 5IK4A 2D3OW 4QPKA 1UZWA 2HR3A 2O1QA 1W9TA 2I2SA 4UVBA 1O91A 5DUUA 5HCHA 2OKXA 2R062 5GTHZ 3MPBA 3WT3A 4OMDA 1PNMA 3RYHA 4I4TA 1BHBA 3IAYA 4BMBA 2DVDA 2RG4A 4H37A 2JG9B 2PN5A 3N2KA 2PAEA 1W9YA 5FY7A 3MGUA 4GCZA 3BY6A 2ZNIA 1CEZA 5I0UA 3LSQA 3WCRA 1KB9F 2EINB 3I2FA 2WZPP 2P90A 2XJUA 4GX0A 1O3SA 1DP0A 3WW4A 1NA1C 4L8QA 3AL5A 2X8KA 3H1WA 4UV9A 1Q6IA 3WV6A 2GN3A 4IESA 1K5MA 3NO8A 3WF3A 3ZXDA 4XDQA 3S7EA 3GJBA 4NIGA 4XHXA 2IXLA 1P7BA 3UKTA 4D94A 5FOJB 2DYSB 3GBFA 3E5XA 3IAQA 3I5DA 1JN2P 1GR3A 2V5DA 5FUNA 4FTEA 2GSYA 2EULA 1JUHA 3D36C 1W05A 3JZVA 3ZJZA 5FYHA 3H1KH 5L3BA 3N9MA 4UFZA 4X8PA 1SLAA 4OUSA 1STMA 3OGSA 2RN9A 1KQRA 4YVWA 4TSFG 2DQ3A 3E8GA 4Y1YA 2FMYA 4L9BA 2YIBD 3M2MA 4TTGA 2YGMA 5FPOA 1ULEA 3QVNA 1W9FA 1WMDA 5JH7A 2YB7A 3I3BA 1KS4A 4H13B 3BVCA 3VHPA 4KFMA 4D7YA 1N34O 3ORJA 4YXWG 2B7YA 5FIXA 2WYFA 4YZ3A 4H3WA 1OMIA 5CU1A 4K3AA 1J3QA 2XG3A 4AAXA 5A7PA 5FXVA 4RR3A 1ZRDA 5FZ0A 1UY4A 1JZ8A 2AH2A 1AR93 2GUZB 5F2VO 4ZZ8A 2W3JA 3RYPA 2VBDA 1TMF1 3IAPA 1TME3 5CKMA 1RITA 1LECA 4FCAA 2XAFA 1W6OA 2YHJA 1R6KA 1X4TA 3JD3A 2RQ6A 3VKLA 4DR2B 4ES9A 1XSQA 4JTOA 4MH0E 4FPGA 2W1UA 4IV3C 2JG8C 3ZEDA 2LS6A 4YM2A 4ET7A 4Q5OA 5A32B 1DCSA 1ASJ2 5EWSA 3SCGA 4PT6A 5LEJA 1L3JA 4QGPA 1VBA2 2VQFB 5EYPA 1KFUL 2JD9A 3P30A 2HEVF 1C1FA 1RXFA 3E6CC 3JCZA 3NWKA 2WS93 4DUZB 3VHNA 2F4VO 5CKNA 4NWWA 4EROA 4E9KA 3OMAB 2QNKA 3RWRD 1RUJ2 2WLIA 3UV9A 2Z42A 3R0RA 4FOWA 1E5SA 3H8RA 4H44B 4GMP1 4WVMB 5C5UA 4XAAA 4WBBA 2Q73A 5IT9N 2UXNA 5T52A 3F5WC 1LUWA 2W6IG 1Y9MA 1OQ1A 4OI4A 2HWD1 4I30A 2BNMA 3T2TA 2ATKC 4BIZA 2ZR3A 4YW1A 1OCRB 5ITZB 1L7LA 5IATA 4UB6Z 1HXS2 4CUAA 2KM2A 4YVSA 2W95A 3FYIB 3DC6A 3HT1A 5FCCA 4WFEA 3MAQA 1QF3A 2HVKC 4RHV2 2IH1C 5J2UB 1DFQA 2QE7G 1O3TA 1S3JA 4YW4A 3QBQA 3RVZA 2YBKA 5K1XA 1F35A 1U0AA 4FVVA 4AFAA 4H14A 4GKKO 2RJKA 1VBB3 4QAWA 5L19A 4IUGA 4HANA 2EIEA 4RO2A 4Q4Y1 3MIEA 1VR3A 5FZIA 3URFA 4IXLA 5C93A 3NAPA 4AILC 2AHZA 3MFCA 2VQEO 4YG3A 3GYDA 1S0EA 5DAXA 3WDVA 1W6MB 2LFSA 5FYVA 1GKBA 4CCJA 5IJ9B 5LK7B 5DM6V 2XVLA 3ACFA 3SPHA 2A73B 3AG1C 1QXRA 3NV3A 2MPFA 3GZUC 1LENA 2MW2B 3HKCB 3DKWA 1UU5A 1FAFA 4QXKA 4RQFA 4PIYA 3WXPA 3HKBB 1D5NA 2CGPA 1FV3A 3R4UA 3KSCA 2EIGA 1ZLZA 1OZ0A 4FMTA 4LR4A 2RJZA 1F4NA 5FYIA 3STLC 5CYYA 2VNRA 3CYOA 3HOBA 4WBNA 5IAXA 3K9AA 3H3ZA 2ZAAA 2HHHO 5B4NA 1OCOB 2D6PA 1COV2 2VMCA 4LF7B 3VV1A 1PD3A 4FFHA 4YJ3A 5GLVA 2X09A 1QJY2 1L1FA 5GZDA 3ABLB 4GJZA 2XNDG 4N7UA 4GB31 4XJAA 3H9VA 1NAEA 1O59A 4X64O 2PI4A 3FZ3A 2Q1MA 1HV1A 1FATA 3WNKA 2WT2A 1OLMA 2A75A 4BDVB 4BM8A 5JIUA 5CFCA 1TZOA 1WW7A 2H6BA 2OCCC 4LC1A 4X89A 1AYM3 3K4AA 3M1HA 3POEA 3KHCA 1KD1W 1B6QA 1YUDA 1HB1A 3N2GB 1Y76A 2AC1A 1WN7A 4O61A 5LP6A 2P34A 4LHLA 4HOOA 3FBYA 4DV7B 1GOHA 2PHLA 1RXGA 4QB6A 3TEZA 2AGSA 1N34B 2VCMA 4PA7A 1C5HA 2Q8VA 3FMGA 3JALA 4X1IB 2UXCB 4XURA 2GBOA 1FXZA 1OBNA 1OCZB 4B29A 2QQPA 2Q7GA 4ZI7B 3LSDA 4V2VA 5FZOB 4YARA 2EX3A 3BU0A 2PHTA 2PZSA 2E26A 4HNAB 4XABA 4BW9A 4IIJB 5FYBA 4W4ZA 1XSRA 2X5IA 2PXJA 1TUBA 5GKAC 2VOKA 5LXTB 1JH5A 4IYHA 4PA3A 1RJ7A 4TN7A 3ZSJA 4NOTA 1KDKA 4ASLA 1CAXB 3VD7A 1J1TA 4JI0O 1SQ4A 4GWIA 5EZWA 2WNUC 3C7GA 1J3PA 3K5NA 1CAWB 4PDVA 4JYAB 2QQJA 2BTQA 1NQTA 1AX0A 1NA1B 1PO22 2XQXA 2KA3A 5DAQA 1FKAO 2QM8A 2P22C 3O1TA 1H8TC 1R091 4LF9B 4TLGA 5A80A 4YZ1A 2RVAA 3FB5C 2A71A 1DZRA 4CA9A 1H2NA 2VH9A 3M70A 2JG9C 4AI8A 3ZHQA 4P9JA 3Q4HA 1AI5A 1DF5A 2ET7A 3QH6A 4OPAA 2ZEYA 3FUOA 5AVPA 2Y26A 4RSUA 1N3OA 2IW5A 3VBUC 2YXHA 1B35A 2WQ4A 5K0UB 2BUKA 2ZMKA 3DXUA 4X65O 4ASUG 5IW0A 3K5MA 4OI2A 1YTFD 4UF0B 4LJHA 2GZWA 1K3EA 4OXSA 2JIZG 4Y1XA 4JI6B 1ENSA 3JD4A 2BNNA 3NQHA 4JZGA 1Q86W 5GALA 3ZMOA 3OOXA 2P5BA 3N27A 2YIBA 4J80A 3LIHA 2K0GA 3J8F2 3SH3A 1CIYA 5C9AC 4A7YA 1GN4A 3VUOA 3ELNA 4MOAA 3PL0A 3JD71 3RN4A 2HVJC 3OM3B 4V1PA 1QJX1 1I9RA 4CDQA 5I0SA 4F6EA 1DF0A 4RGKA 3FBMA 1Y43B 2ORZA 1DGRA 5A33B 2GC1A 2A79B 1FFXB 2VZRA 3G80A 2HWD2 4DEVA 1IS4A 4JRLA 1GN2A 3S7IA 1SEFA 1MZ5A 4X1IA 3N36A 3WD5A 4ISRA 1UCXA 1DGRN 1HNZB 2XJPA 2KKWA 3KWVA 3J8F3 4BIOA 4DY3A 4AXOA 2XPJA 4HLTA 1DQ0A 3JAKB 1XI1A 2CK3G 2JVDA 3IKWA 3KLSA 2IXKA 3CJHB 1H1MA 3IPVA 2VTFA 1EZJA 4QPIC 2IFRA 4JVAA 3B8NA 4QPIA 2KG7A 3FHQA 3PJQA 2VOVA 2Z2SB 3WDUA 4UW6A 1SA0A 4FO9A 1ZRFA 3I8TA 2RMU3 4WM8C 1Z78A 4IEUA 3MUZ1 2ORXA 1C8NA 1AYN3 4TLFA 4QKDA 2PELA 4H33A 3KT4A 4XIKA 5J1XA 4R4ZA 1OLRA 4U7OA 4BE3A 4JGYC 2A6YA 3OMNB 4CU6A 3B4SA 3LDBA 2R042 3I7DA 2D5FA 4B4RA 4A2UA 1DG6A 4IV1A 2P5OA 4PIZA 2DDUA 2R061 3JSNA 4AI9A 5EFUA 5APAA 3T4HB 2D7FA 3JD73 2WNVC 4BH9A 1WCUA 5LY1A 3CPWU 4X9QA 4M00A 1K7DA 4PJ0Z 3JQXA 1TME2 4QX5A 4QQHA 2Y69C 1Q3EA 1XRUA 1YQCA 2XB6C 3WB2A 1QLEB 4DR5O 2WC2A 2VM9A 4ZIBA 4LNVA 3LA3A 4J7JA 4EJRA 1L8DA 4DRVA 1RUC1 1M56C 4KNCA 5K7PA 1GNYA 2V4AA 3J8F1 2W46A 4YGBA 3POBA 1XDCA 1OUXA 4PD4F 4QXCA 5FLHA 2R7EB 3LD8A 4Z1MG 1ODMA 4DR5B 2E53A 1H30A 1WKYA 1HRI3 2R9RB 4CDWB 3T1YB 4FPLA 1RSOA 2WLHA 2A1XA 3LA7A 1QJY3 2QTWB 1CVNA 3FE5A 5LK5A 3CD6V 3A0HZ 4TOIA 2A6XA 1WA6X 3UKNA 3TAYA 2YXSA 2R30A 3ABKC 3QG5A 4EFBA 1BQZA 5JZGC 1JX9A 4B4PA 5A6XA 4YZ2A 4NRPA 4W4KA 4XF3A 5EHDA 3V0AA 1W8ZA 1RUH2 1VBC2 1VQKV 4D7TA 4W50A 4YM3A 5J2UA 2OYQA 1UPGA 4N53C 2UY8A 1Y74B 2VWKA 4Q4W2 4KWKA 1ZZ6A 5C8YA 4WM8B 4YFWA 4BK5A 3AK3A 3C7EA 1QXJA 5FZBA 3E8FA 4F7ZA 1VF6C 1TUEB 2QM7A 4JI2B 4ARXA 1BZKA 1IG0A 2ZE8A 2VC9A 4DY5A 5LASA 2WN2A 3ZMNA 2VBBA 1NT2B 2GAUA 3AP4A 4P14A 3H1MA 5A1AA 1NVPD 3SQOA 5C4WB 3CRMA 4XPVA 4CH3A 1W0JG 1VB2A 2EA7A 1XMQB 4ZY9A 4CCCA 3A21A 2DBNA 4FVMA 2A0LA 2O14A 4XFGA 4QGMA 3QTCA 1M5IA 3R4DB 2XL9A 4CXXA 4GWJA 2E5LB 3KZ4C 2Q9LA 1G9AA 5IJ0A 4UCSA 1SPPB 3ILRA 2IUWA 2TBVA 1HDKA 3H8UA 4TUYB 1GV9A 3VBUB 3D3AA 3LPGA 4RHV3 4G27B 4DV3O 4M3CB 1WLTA 2ADQB 2V4DA 3MLJA 2QUOA 5EK0A 1RUH3 3VDAA 3TNPB 2MK3A 3WP5A 5F5CA 5KC6A 4CH4A 2PYJA 4YSFA 1FI2A 5L7OB 4LH6A 4FFIA 1ZBE1 3D36A 2RDSA 1OHFA 4ASMB 5IVBA 1IKQA 1AI4A 4KHPB 2QM4A 1M57B 1Y3TA 5BY5A 4EQVA 2ZBJA 1AR72 1U97A 5J9PC 5IVVA 2EIDA 1ND3C 1Q8PA 2ZACA 4GMP0 1BEV1 4R7CA 1HRI2 5FP8A 3T0BA 1CJPA 3VDDB 1NI8A 3VLBB 5JSRA 4RUFA 3VQXA 4JDOA 2WLJA 5HXVA 1VQ8V 4UFJA 4QX0A 4I5SA 3HKBA 2G9FA 5EC1C 3AP6A 5LYJA 1EAH3 3AP9A 2E74B 1TVGA 1PM7A 1VBE2 1V6KA 3CZJA 2VZPA 1SS3A 2HH9A 5A7WA 2FB5A 4I02A 2Y4UA 1H4GA 1WD3A 2JEXA 1ZBA1 1EN4A 2WWJA 4D6QA 5IK5A 4FM0A 1GO3F 1A78A 2BEOA 1VQLV 1DQ1A 4P00B 4P5YA 2GMMA 1BGYH 3H3LA 3H50A 3PVOA 1SA0B 3O12A 1SZTA 3UT0A 4EFEA 1RMU1 1HRV1 3JB4C 3ZMZA 5T3NA 3THPA 1PGL2 2WNUB 1QOOA 2PI5A 3LEKA 3ZSKA 5F3EA 2ZXQA 2QDOA 5ANNA 3UK9A 5KXBA 4L87A 1JYWA 1AVMA 2UUAO 5F7UA 1RB8G 4BIFA 1W8NA 4GX5A 5L9VA 1IBMO 2OT7A 2PA7A 5HCAA 3JSLA 1MEC3 1KKCA 2CH7A 1Q8SA 2WFF1 3S30A 5CBGA 1S77D 1M4UA 3CEWA 3RWNA 1IG3A 1LEMA 3HN3A 1ASJ3 3VBFC 4MADA 2DVFA 1W2NA 1HQWA 3BU7A 4PJYA 3KT1A 2RS51 3ZDSA 1HQNA 5LYJB 1AR4A 1VMJA 4K6BA 1IBKO 3VBBA 1TVKB 4QNHB 1N1VA 3WF2A 4JI5B 1RJ8A 3WW1A 4X20B 1CPNA 4LT5A 4D7SA 1F2NA 1YC61 5FLJA 1HV0A 1XQ8A 4P08A 1JOJA 4QGLA 2Y6GA 3I3MA 1GAXA 1VBD2 1US6A 1SLTA 1F4HA 1W0PA 4DXZA 1I94B 4TV8A 3POJA 3SITA 3ZFGC 1YIFA 3LA2A 1K45A 1H6YA 1WW4A 4GKJB 1C4RA 4IHJA 1LGNA 5FYSA 3CBNA 1VF5B 5FY4A 3ABTA 3AM2A 4EN9B 3AKQA 1TE1B 2XHNA 3MV11 3FN9A 5KA6A 4Q4V1 1SDWA 2Y38A 5D8AC 3ALQA 1AF9A 1K33A 2ZOEB 1DTOA 1MSWD 4YVSC 2B5HA 3Q8EA 4LBMA 1I0HA 1NX9A 1WLCA 2OT5A 1FNYA 4JQTA 2ZHMA 2YU2A 5DXDA 5LBFA 3WSOA 2P6JA 1ZRCA 2YI8A 1ZZ7A 2CAUA 1XE0A 2WBKA 2WNOA 1X8MA 1YNAA 1XBFA 3IT8A 1W8UA 5DZFA 5IWFA 1Y7BA 1NKGA 3IFXA 3OB8A 4QHBA 3E83A 4DV4B 4OI1A 1MQTC 3TCUA 2Q1ZB 4OPHA 2N7GA 1ORQC 2XT9A 1TG7A 1BCXA 4D6RA 2VECA 4ZU5A 1O4TA 3LF7A 2JK5C 3KZIZ 4UFHA 3K3OA 1CAXA 2HP8A 2QZ3A 5KBFA 3I2GA 3GB7C 3NKTA 1D4M3 2J1VA 1JUIA 3WEZA 3I2HA 5EJ1B 2XTAA 2DYCA 3HT2A 4XBFA 1LULA 5I91A 2LALA 3J7LA 1BK0A 3OUIA 3KG2A 1BBT1 5TSWA 4LF5O 4Y1UA 4Q6GA 4UVCA 1PO11 2VZQA 3SMHA 4TUYA 4Y5SA 3B01A 5CBFA 5LA2A 3W7WA 1RUE3 5C6CA 2J7MA 4XQDA 5DDJ3 2EILC 2BVBA 5SV5A 4EN6B 5JPNB 1AHSA 1R64A 2R72A 2BWCA 5C9AB 1O5LA 2Y6LA 2BSKA 4ARYA 2Q7EA 3W7XA 3JD1A 1MS3A 2VOTA 4CP1A 3GCXA 1GM8A 3CU7A 4AHYA 3B02A 3PTYA 4UCVA 1F51A 5CIRA 5FMBA 4K0KB 3FX7A 3GF6A 4NHMA 3AKSA 3LKJA 1GWKA 4HK9A 4NYKA 1YIJV 4JI6O 1ENVA 4N90A 4XQ4A 2YROA 4B3TO 2D6NA 1H4HA 3WQBA 2JG9A 1VMFA 1LOFA 3NW4A 2CNAA 2A3XA 1AL23 3T30A 1UD1A 4WM7C 4A6SA 4EZ4A 3DL3A 4WM7A 5JR2A 3AKPA 3ACIA 2XLGA 5E79Z 2BGOA 4UFMA 5D1IA 3OJBA 2A5ZA 4U7NA 3WP6A 2DOSA 4H55A 5B4XA 4UFIA 2UUCO 3THDA 1QY4A 2N74A 1V54C 5JZGA 3CC7V 1HR0O 3ZLIA 1H1AA 4XFFA 2DVBA 3N7MA 1CXZB 2GTSA 3B9CA 1RUF3 3BODA 4JI5O 4AE2A 1SC5B 3PIGA 4IEOA 4FQ4A 1H38A 1W6PA 2VD7A 1QU7A 2W1WA 2XJVA 1AI6A 4CP9B 5C7GA 2XONA 1GM9A 4XF9A 4MVZA 3AZVA 4OZXA 5B1BC 1HXS1 3SLIA 4IEWA 1QJU2 4LHKA 4N21A 1YYNA 2MEV1 4ZU4A 3KCXA 5KHIA 2VMHA 1IBMB 1AL22 3QO7A 1P7GA 4J6GA 1CAVA 3KVAA 1GZWA 3WG7C 2QWPB 5J98B 1F31A 1HW5A 2CGOA 3OTOB 1OXCA 5CFDB 2QWQB 3LNMB 2OZJA 1NCQA 5EIBD 3VBRA 4WFBV 4HZFA 4EYUA 4AQYB 2OWOA 3VQVA 1Y67A 4FPFA 3WDWA 3SYQA 4RYDA 1J95A 3SH5A 1G9CA 5BNOA 1T6BX 4BQ1A 2J1EA 4LA3A 2EXHA 4YGDA 1BT8A 3OEBA 1UWWA 2KXLA 5CKQA 3HBKA 3RI8A 2Q4PA 5EC2C 3HKDA 3OUHA 1DYPA 4JTCB 4LMFA 2NN4A 4BLIA 1W6QA 4AFBA 2W2IA 3NRUA 1SQFA 3NXSA 4GLXA 2AZ2A 3MEPA 4XJUA 1XNCA 4CXYA 1JFFB 3F7YC 3B40A 3MLLA 4IL7A 4AVTA 1A8MA 1SDDB 4GMP3 5JXIA 3MW4A 5C3SA 3SJAC 3VBHB 3W7SA 1A32A 3JATB 1AYM1 1VRH1 4FTBA 2D98A 1G9DA 3SYOA 2FHRA 3AP7A 3KD4A 5FZKA 2WQZC 2ZHLA 2D6OX 1LR1A 4X62B 3OUFA 3WDTA 5AFEA 2ZM6O 1YHFA 4OULA 4ZOLB 3A0NA 4QX3A 2WS91 2YI9A 4CCOA 3O1MA 5BYNA 3O7OA 4QMAA 5AFBA 4XUTA 1OI6A 4FOQA 2KB1A 2F6BA 3VZLA 1S0GA 2QBXA 2IVIB 1N8RW 1KGYA 3E35A 3JAKA 2VMIA 3DEMA 5FUPA 1KQSU 5LOVA 1V54B 4K20A 2HYKA 4BMEA 5LBQA 2QDRA 1FAYA 1PNGA 1CP9A 5T5OA 4HSJA 4YM1A 2BRTA 3O1RA 1V9PA 3KMHA 3ZKUA 4F4LA 4XDKA 3LDKA 3AB0A 3GGLA 4Y26A 1NTMH 3MF6A 3ACHA 5CA6A 3HNBM 1XOYA 3CDZB 3LOBA 3LSUA 2ZR2A 4CPBA 1UMHA 1XXNA 1VAKA 1IPSA 2A3YA 2KSDA 4RQPB 4R50A 1AJOA 1YDXA 1EPWA 3VL9A 2BE3A 3CXCU 1ENRA 2CDPA 5CB4B 1EY2A 4QPGC 2R071 1ENXA 1JOYA 4YNIA 4EV0A 2BV4A 1MOFA 4AAPA 1J5EO 1FYJA 1LHOA 2B46X 3KQRA 4P9OA 3DTUB 5ACA3 2VZTA 1EM1A 1W6NA 4K0KO 4PHZA 3CF6E 3VBSB 1W6OB 2VTXJ 4HNAA 5CA3A 2VAUA 4MTOA 3VDCA 4JYCA 3HBZA 1OQEA 1OCCC 2J1TA 2LM3A 3S0MA 4NIIA 4LE3A 2Y64A 3VBHA 4QX7A 1RYYA 4K35A 4JZ2A 4PA4A 5I8YA 3THOA 2HWD3 4J7KA 2Y8KA 2HLDG 4JV4A 3E5QA 4X66B 3KF3A 3AG2B 2CY6A 5FPXA 2FZ2A 1UOGA 1WMFA 1Q8IA 3CJIA 4I50A 4HSLA 1VJ2A 4E2GA 2R043 2XVGA 4LO6B 3K77A 4QDSA 3GHMA 4JTDB 4JPRA 4PQ9A 2EJ7A 5CBHA 1C3HA 3DC5A 1F8VA 2BTQB 2PY5A 3WB1A 2VNOA 4QHZA 4KH9A 4IE6A 4X8NA 1XNBA 4BIUA 2ZE7A 4W4LA 1YQ6A 5ACA1 4DEQA 4UBHA 5JDBA 5FZ9A 4K40A 4UCUA 2FYUH 5E1RA 1FXVA 4R4XA 1IQDC 1O9HA 3LUTB 3GBGA 4PI0A 1GZCA 2WZR2 4P02B 1QVFU 5BNPC 4YVSB 4N9HA 3NNJA 3H8XA 2ZGMA 1CIWA 5KUKA 5ITZA 2OVUA 3HQRA 1OCRC 1W2BU 1QR8A 4DUVA 3D3IA 4O4LB 2ZGPA 1IDSA 3Q4HB 4LNUA 3P32A 4G9SB 4JYBA 2R1DA 4KXRA 3ZS8C 1KD7A 1Z2GA 1JVMA 2C6SA 2OTLV 3VN4A 2ZABA 2Q5TA 3UKVA 2W92A 1UY3A 4INDA 3T1MA 4IHJB 3AG4C 3DXTA 2OPWA 4A4AA 1W8HA 1LESA 5FXXA 1UY2A 4WFFA 4HVQA 4HK8A 2XBO3 1W90A 3AX4A 4Y24A 1I5ZA 4PELA 4X65B 5IJ9A 4PF1A 4DV1O 2VW1A 3W9AA 4MTFA 3T3YA 5KHJA 4TQFA 1GFF2 4CDQC 4HXCA 5I93A 4CEWB 2EIMC 4MO3M 1OJHA 1OF3A 2ATFA 1XILA 1FPN2 5BR8B 2JDMA 1Y9GA 1SLCA 1UYZA 3TK1A 1POV1 3UQ8A 1S2EA 3D0JA 1SETA 3SYPA 1VRBA 2RJLA 1MNGA 4C0BA 2V4VA 4BU2A 1QGLA 2Q4SA 4NHKA 3EMRA 2DYSC 4FK5C 3H3UA 2YC0A 3LEIA 1IBKB 1VBE3 3SH4A 2JS5A 4LNUB 4HG6B 4KMQA 2H6CA 1R1A2 5C3PA 1WJZA 3F2ZA 2ZXWB 4P9LA 2QQKA 1NQDA 2QQUA 3S57A 2WLLA 1G8MA 2ARXA 2PLV2 3AJYA 3UO2A 1OFNA 2ZEWA 2DFBA 4M4PA 1W39A 3K2OA 2GNBA 3B2EE 1GP6A 1SQPH 3SKJE 4AQTA 2VZ1A 1ASJ1 5L3GA 3RZHA 1FNZA 3LOIA 1F15A 1PK6A 3HKEB 4LOSA 4GIQA 4Q0UA 1Q82W 1MA1A 4LBQD 3ETPA 1QJU3 4YIOA 3WG1A 2L6LA 4EN8B 2A6ZA 4XBNA 5FY9A 4R9DA 2Y0OA 2WZR1 1VQ9V 2EIKB 4K9SA 1Z7S2 2ZAHA 3AKTA 1RUJ1 3PHMA 2D93A 3CJXA 2O8OA 2E33A 1KUQA 4WZCA 4CDXC 5F1RA 2ZS6B 4GWMA 1VMHA 1W3XA 4MVSA 1S1AA 5K9YA 4O4HA 3D5OA 2ARBA 2VZVA 2WNUA 1EV11 2UWCA 1HN1A 4YW2A 1RHI3 3ZX7A 2UXDB 4JASA 4X66O 2EZPA 2HEWF 3CE2A 1RSOB 5JQGB 5F37A 1ULCA 2YC4A 4JAVA 4JGSA 1FXHA 1B3QA 1UYXA 5HFMA 3RDIA 5SV8A 1Y4WA 3LGRA 5A6YA 3CMGA 3KVBA 5L7OC 4NROA 1G6UA 5L7OA 1XOUA 4YYOA 2W52A 1W2TA 5FZEA 4C1WA 3W5MA 1RMU3 2X29A 2WSSG 4CP9A 1Z7S3 5C5TA 4BYYA 4URAA 3I56V 4AVCA 1QLNA 2ZPXA 4RAIA 3BFRA 3ZDVA 2JD4A 4XYXA 4I0BA 1U5ZA 2WO7A 1DYKA 2P17A 4EKWA 1PPJH 4P9PA 3NV4A 2ILMA 1W04A 4X1YA 3VDDC 3I2IA 1I5PA 4TYSA 4D6SA 4Q20A 2FCVA 4K1YA 4IERA 2Q69A 4MHUA 4DUWA 4RGAA 2ZZJA 3FKSG 3APOA 1GP5A 1LHNA 4LBLA 4LUMA 2YPJA 1YJKA 2BWAA 4N8MA 5LXTA 4BQ2A 2VTXA 3L72H 2DJVA 3H1HH 1XNRO 4HT1T 1R093 2RM23 4IIJA 4TQDA 4IEYA 4HETA 4AVVA 4Z2AA 3LDEA 4Q4W3 2IU0A 4LKSA 1G1XB 3P3PA 5F2SA 1UL9A 1K5MB 1WGPA 5JXGA 1J3RA 1WCQA 2WT0A 4L99A 1M9NA 2DU1A 3N9LA 5C4WA 2JECA 3ITQA 3Q9OA 1CZVA 4MT8A 3FB6C 1NXMA 3EQEA 1UMZA 1ZUQA 1GP4A 2BSKB 2ZEZA 3CRAA 4FPKA 3BTAA 1R1BA 4I9QA 3IC9A 5BMVA 1ZRIA 2B9VA 2ZINA 1R082 3STZC 2VQFO 3JD0A 3U4XA 3DUIA 3ZMVA 5JXJA 1GMMA 3IIAA 4YVWB 3G7DA 1YF2A 5AG2A 4CDQB 5H2FZ 3V65A 1D0GA 4S2FA 3PVEA 2PGGA 4LEJA 4Q4X2 3CCJV 4IL6Z 3PUSA 4AR2A 4ZXKA 4EEQA 2DYRB 1GSLA 4LLOA 1HRI1 2FMDA 2WLMA 4GZ9A 4FXKB 3V0AB 2F1MA 3WX5A 1RGSA 2VY0A 2P3YA 3DCQA 3HJRA 5A2QN 4XFBA 3SR2C 1JI6A 3NJYA 4CDUA 1RMU2 3FUQA 1URXA 4DV3B 1Y6XA 1K5SA 1VBC1 5T5PA 1SQGA 5E8AA 5CNAA 5HV0A 5GZGA 3VKMA 1GN3A 3E5UA 5CG8A 2RS12 3M4FA 1KBHA 1AR92 5KHHA 3ZBHA 3HPLC 4J10A 4CEYB 4Y20B 1LNQA 3K04A 1PO13 4N23A 4PV1B 1DHKB 3RYIB 4DR7B 2OZ6A 1K4CC 4W8JA 5FTTC 4LCUC 4LBEC 1BYHA 5DDJ2 4CPBD 4MSWC 1QQP3 2BW8A 3ZFFB 1W8TA 3AYAA 3NR7A 4QT6A 2ZA9A 2Q8EA 5HFLA 2BVVA 4URTA 4JX0A 1UX7A 5IFPA 5CVRA 2ARCA 5J09A 4QM9A 5H9QA 3G4SV 5AC91 2JGDA 1YIPA 4QPIB 2RS33 5BNNC 3POIA 3CCMV 5LOVB 4AQ6A 2IXJA 1RHI2 4ONUA 5C33A 2GTAA 2Q8DA 4QKNA 2R70A 4E4SA 4CCLA 2WFF3 4IV1B 3ZHVA 5D2AA 5B3SC 4XJ8A 4QJFB 3IDAA 3OEHG 4P9GA 4JGZB 1RPOA 1H6XA 2WNEA 1EBOA 4FQZA 3K58A 2WFPA 4J25A 4UFLA 4BLJA 2M7WA 2ZZQA 1FXKC 3C7HA 1SCSA 3WDXA 2VZUA 5FYCA 3IDCB 3ZRWA 3ZN1A 4WF9V 1WCKA 2Y6KA 3HN1A 2W68A 3JBG3 1JU3A 2OUHA 2RV9A 3PMEA 1KP3A 2WL1A 3R4SA 3H42B 4Q4Y3 1QDCA 3KF5A 1XNAA 1PNLA 4KHPO 2ZMLA 2GSMB 2H0VA 1D2QA 1JODA 5JI7A 2CE4A 2ZE5A 4UCOA 4QE7A 2YXYA 3K08A 2Q0OC 2UUAB 2BOIA 1ZX3A 1YI9A 3M3OA 4H0LB 5JOWA 1RIRA 3VQWA 1IS5A 4ISQA 4R9AA 3W7TA 1D2SA 5LBEA 3M8AA 2YBPA 2NN8A 5C8CC 2E6VA 5A7SA 5LRRA 3HKDB 1E57A 2CL2A 1IGOA 5IWAO 4UBGA 4CXWA 1JYNA 1ONAA 2DQ0A 2HLEA 4BOWA 3FD9A 3K3NA 1UZZA 4MVMA 3MFAA 4XEZA 1FFXA 1DU3D 5A7WB 3AMMA 3AMPA 2RS32 5ABJC 3RFRA 1R081 3ZRXA 5ABJA 5JPMB 4LH7A 4UF0A 3ZXLA 4JTAB 4CEWA 3HB3B 4CCDA 1BE3H 2MNGA 2CTRA 3ZOIA 4LKFA 4L97A 2XL7A 3I97A 4UT5A 2A3WA 3W59A 1I7FA 1AR83 4LP8A 4DR1B 1PO12 1N4CA 1FV2A 1PMIA 3E6DA 3ZYGA 5FDBA 4Y4RA 5F8PA 3FLPA 3OFNG 1KDMA 4GUNA 2FCTA 3TNQA 1PM4A 1GYKA 4UI9L 4BZ4A 5AC92 5FPVA 4QIWF 1ZZCA 2EXIA 1F9KA 5GZFA 1P49A 4CC6A 1B04A 2NM1A 1H2GA 4I2OA 3PUIA 5K4LA 4IE7A 4DMIA 1DYOA 3RPQA 1AR61 3SJBC 3B3QE 4WVWA 4R8HA 1X36A 2ZCEA 4X62O 4UOJA 1BMV2 3CX5F 2LP7A 1DGSA 1CX4A 5H9PA 2ZEXA 3ZRWB 2B39A 4AHZA 3NNGA 4DV4O 2B9UA 1OCZC 1KJRA 1H2KA 4P2ZA 3H9AA 1JOBA 1XNQO 2CWSA 2VW0A 5H9RA 4YWAA 2NMNA 4XF1A 4I01A 5GM0A 4EWAA 2Z0AA 4EWEA 4Z82A 2W9XA 1QVGU 1ZAUA 5J48A 2CHHA 3OTFA 4BW5A 3NMBA 1VQPV 1XNQB 5FBJA 5C9AA 1XU2A 2E31A 1E1RG 1S0IA 1SHWB 4COZA 3BVOA 2UXBB 3VQYA 4PIXA 5T5LA 2XMLA 4CDXB 3Q8CA 1AB3A 5GW7A 3KV4A 4MGZE 2C2AA 4B3SB 2R073 1H9WA 1M90W 1YI2V 2VOXA 1S55A 3WNPA 3OGIB 2LO1A 3ZFEA 5JLVA 1UU6A 2JENA 4K3UA 1UY0A 4BISA 4LK6A 3ZMTA 2R9IA 3JASA 3L70H 5FQ0A 1X9TA 5FPAA 1SQXH 1W8OA 1VP6A 5JOZA 1W9SA 2D5HA 5EP9A 1DQ6A 1F5JA 1HQLA 3GWOA 3KHBA 3F95A 5CZKA 2C4XA 5FNVB 2JIGA 5F9TA 4IYIA 1R73A 2VU9A 2NNUA 4JHZA 1H2MA 1R6TA 2IJJA 4MG2A 3LEGA 3R66A 1I6XA 4DK1A 1JMUB 3EXUA 3P3NA 3GJAA 4XDJA 2VCBA 5I0TA 1ZBE3 3E2EA 3IM0A 3RSJA 1GZTA 2HHHB 5FRAA 1YFWA 5FFOC 5FY0A 3GBWA 4Q8KA 2IBZH 3UESA 4NHYA 1H8VA 1VF6A 4Q4W1 2RS11 5B1BB 1XNDA 3ABLC 1HNZO 1XL6A 2EIMB 3LSEA 3TEYA 4UCTA 3ZXKA 3OYWB 1MS4A 4FLWA 1DLBA 4ASKA 1XE7A 1OCOC 2WA3A 3ZN5A 3MIGA 5FYYA 4DO0A 1V6NA 4HZ3A 2ZKOA 1EUUA 3POWA 2JEUA 3IZOA 5H5NA 4UYBA 3OW2U 3KB5A 3B09A 2XJRA 4AFMA 1VQOV 1WPBA 4BK4A 1R6NA 2IH3C 1UJWB 3B77A 3M3CA 4LF4O 2PF4E 2HWC3 5IAVA 2BNOA 4DR1O 4GALA 4Q29A 3O14A 1A6CA 1R3LC 3ASOC 3EVKA 1PP9H 5DMYA 1MS8A 3AG1B 1W2UA 1GOGA 2QWRB 1V55B 1RVF3 4MUVA 2SLIA 4XACA 1IXBA 3ZIAG 2WAOA 3BCWA 1NLQA 5BNPB 4PBPA 1XYNA 2HWE1 3WNNA 3TJTA 3I55V 3VKOA 2RS53 2O0OA 4ATFA 2PMWB 4CC5A 4QX1A 4XW3A 4HN0A 4RN5A 5FYZA 3CRCA 3C90A 1KJLA 1XNTA 4DO2A 3MICA 4MVOA 2YDEA 4YZ4A 4KBZA 2EILB 1XU1A 3K0GA 1UXXX 5HCBA 5KC5A 5CA1A 4ABMA 2J1SA 4GZRB 2YFZA 4O4HB 2HWC1 3OR6C 4GH4B 4MX3A 1COWG 1XNKA 4N53A 4YHHB 1YWKA 4YY3B 3WW3A 3CMEV 4MTXA 3CCUV 2Y34A 5FKBA 4M01A 4FM1A 3THCA 2HJFC 4CBCA 2DCKA 3RYHB 5FPZA 1PMJX 4DS0A 3WF4A 5EYPB 4L0PA 4I3GA 2RJ2A 1YRZA 4GB33 1HB2A 2WYSA 2BFUS 5FR3A 1YEWA 2D44A 3JBG1 4GAZA 1UKRA 1U5XA 5F5QA 5D5QA 1A3KA 1MQTB 1PO23 2JG8A 3ZYBA 3BB6A 2R32A 3I49A 3OGVA 2ITCC 4DV2O 1AYN1 2VOWA 4DRXA 1VARA 3RVHA 4BJ0A 3CCRV 3S3WA 4DW1A 1RUC2 4HKWA 2W5FA 1MVQA 4FPOB 2D3PA 2VUAA 1P8JA 5FJHA 2CU5A 1Y66A 2CTPA 3ABMC 1O3RA 1U96A 2DTWA 2VQEB 2Q7HA 1NLRA 3H7YA 3B5LB 1VEWA 1NCRA 4COWA 1CR7A 1XYOA 1O8PA 1U5IA 5I0RA 1ZL8B 2A6VA 4FPYA 2JJ6A 1R083 4IETA 1YHQV 5FQ0B 1TMF2 4JV5B 2QTOA 3Q8FA 5DZEA 5EBMC 2R49A 2WRAA 2G9GA 3AFKA 4HFSA 4FLYA 4H7LA 1EFRG 3E1F1 4JTNA 2JIJA 2XUMA 5IVFA 3U0ZA 1N36O 2VMDA 1K3IA 4ZPIA 5LMUB 1LAJA 2FMLA 4MGSA 4WFGA 2HKXA 3VBHC 1GM7A 1O6UA 3GZEA 1SQQH 3HQXA 2QCSB 3AVSA 3UJQA 4NIDA 4AHCA 3CCEV 4O65A 4XUNA 4RUEA 4RHV1 4NXNB 4NR1A 3U37A 2B45X 5A3PA 1VAMA 4TSVA 3OUJA 4AF9A 2RHPA 1WLDA 1FOD2 4X6RB 3P1IA 5KHGA 3VZMA 5GJ6A 2Q8OA 2VMGA 1NZIA 4TV9A 4CCEA 3LE0A 1LOCA 3A4UA 4FPPA 2ES3A 5EYXA 2DMXA 3WCSA 3KM5A 4I0XA 4MW3A 5FXZA 1MEC1 2ZJCA 3RZGA 4GX1A 4BQYA 4E8CA 5JSPA 4BQ3A 3ZN6A 3S6PA 1PGW1 1XMOO 1RUE1 5L9BA 4LF5B 3A22A 3AC0A 1SFPA 5JAXA 2A06H 5FZOA 1E5HA 1DLLA 1ZM1A 1WB8A 4E8DA 2VMEA 2Q8CA 4C7UA 3WNXA 5EBLC 2DBIA 1UKGA 5LA0A 1VPHA 5LA1A 4PQQA 1K97A 2XJTA 1RUJ3 2C26A 1B09A 4NHXA 2R072 4QXHA 4FLXA 5A7NA 3FB8C 4BQWA 1WD4A 2CTVA 1KU9A 2Q0AA 1M57C 5JCOC 3U11A 3MW2A 5H9SA 3IDBB 2FZ1A 3ILNA 3WZ1A 1Q8VA 2JDIG 1BBT2 1RUI3 4PBOA 4LF4B 3RVYA 2BP6A 1RUC3 4LFBO 4NXMO 2ZGLA 4F83A 4MGTA 4A6OA 5EYYA 1RHI1 4LWSB 3SEPA 1O5UA 1NZ6A 4QU1A 1H2SB 2HWB2 4Y20A 4FP2A 5CFDC 1UIKA 2FL4A 2XDVA 4F3JA 5BXZA 2VCCA 3ATGA 4KUMA 3WG7B 3N9OA 2WLQA 2DF7A 2E3CA 3RBZA 3WNMA 4QPJA 1VRH3 5DUXA 4LBJA 3DF0A 4I0AA 5CFCC 3IPVB 2ODMA 4QU2A 5F5AA 3OPTA 2GN7A 1F7YA 3RMYA 5FWJA 3K57A 5I0DA 3LEMA 4N43A 1MPXA 5F6LB 3I3EA 2HJIA 2XKOA 5L36A 2C5DA 3BTZA 4WFAV 2XOMA 5FZ8A 2R16A 1QQCA 2VVDA 3VZOA 5EIBC 1FMD2 2ETEA 3ON7A 2YV8A 4AQYO 5JUVA 4KBBA 4JI4O 5FZMA 2PHWA 1ZNPA 1J58A 1W03A 3MYXA 4BWOA 3RZJA 3OTOO 2GC0A 3OPZA 3E6BA 2B4KA 1SKVA 2JEMA 3O0VA 3HMYA 1JFFA 1SRYA 5H9CA 2A7WA 2VG9A 3TOJA 3A8TA 1M93A 1OA3A 1WBLA 2BJSA 4JI4B 3AXEA 4CP2A 4TT3G 2A3QA 2XKPA 3NV1A 2KQXA 4QWNA 4X88A 1CAWA 4O4JB 1IZ3A 1XPWA 5C4WC 4XXPA 2D2CB 1SCRA 4J9ZB 2XLFA 1J59A 2VQAA 4OLLA 1RINA 3G71V 4NVPA 1EAH2 5C3QA 1ZYBA 1YJNV 1X9PA 4XE9A 5BUVA 2VUJA 1LUVA 3S5AA 3KCYA 3JARA 2Y33A 3W58A 5FPUA 1YXBA 2BOCC 4CDWA 4DQAA 5B1NA 1R092 3KS7A 2PQSA 3OYWA 1ZVFA 2FCUA 2DWEC 2BTOA 3AMQA 4DV6O 1FPN1 4WVMA 1NE6A 4YLZA 4J42A 4LULA 2VGDA 2FKXA 1RUI1 1QLEC 3C3SA 3AEIA 1DQ2A 3DECA 1WCSA 4LBOA 4CRQA 1B35C 3NNFA 1NR7A 2TNFA 3RWKX 5IYZB 4M0HA 2QWNB 5E6HA 4IV1C 1O4YA 1G7YA 3NKGA 2RMU2 2OXBA 4AVSA 1UU4A 1TMF3 4QM8A 1IHMA 2WIIB 1BHAA 3KV9A 4Z92B 4Y5Z0 1MSDA 5EBWC 4DINB 1K5JA 4LBQA 3LCPA 3N35A 2R063 4RS5A 2YUAA 5DECA 1US2A 3IGAC 1WA8A 5IK7A 4E27A 1AP6A 5D5PA 3NJXA 3D82A 4A41A 4CEYA 4ITCA 4CEYC 1OHHG 1MACA 2Y6FA 4OHXA 2ZX3A 5LMNB 2H8PC 1HN0A 3O0XA 4XMAA 2QKDA 1P4RA 1JJOA 2W0FC 1VQ5V 1BS3A 5F3CA 1C1LA 1BVVA 2DN9A 4OX9O 3OUSA 1HXS3 1OUSA 2FDFA 3M3EA 1UPSA 3ILFA 4OZOA 5BNQA 3K4ZA 4DUYO 1Y74A 4IGGA 3O5SA 1ND2B 3MUY1 4JV5O 4P9WA 2WWUA 2RDNA 3VKFC 4JI7O 4COUA 4NPRA 5A3LA 3H01A 2IVJA 4YGCA 5FO8B 3LAGA 1S0FA 4ZHQB 1K5MC 2IU3A 1AR91 3N9NA 2LGQA 1W2OA 2X6AA 3VDBA 1BSMA 1NUKA 4PDWA 1OV9A 1L7RA 1PV0A 1ZX5A 2WLKA 5JR7B 3VBRC 4Q4Y2 3OBRA 1IBLB 2UUBB 3J7MA 3H1IH 5EZYB 2YICA 4MZUA 1S0JA 1F4AA 2WZEA 3KV6A 4IE5A 1DDLA 3IMMA 4ZU7A 5FZ3A 4CSWA 1KECA 1BK1A 4FFKA 1MG1A 4ZI7A 4YW7A 2LW7A 1KC8W 1T6GC 1CPYA 3E89A 1UNBA 4CDUC 4DB5A 4K8ZA 4AVBA 4LHNA 5JCOA 2HWE3 2FQPA 4AI2A 2QEXV 3M99B 1GNHA 3KGLA 2IJIA 3ETGA 3RYFB 1NKDA 3EHBB 2LRPA 4Q8LA 1CGPA 4NIHA 2NR5A 1JTZX 5DDJ1 2N04A 4GKJO 1I1EA 2YGLA 1JJ2U 4O2AA 2PYLA 1LTEA 4JF3A 3CCSV 3U07A 4K1ZA 3TETA 4W65A 3ZFFA 1Z5WA 3SJCC 4M3CE 5E1AC 1LOFC 1GUIA 1Q8OA 1PL4A 3N9PA 4W6WA 1BZWA 4XTPA 3O65A 3RZMA 5A1FA 4JI2O 3ES4A 4PF5A 3L75H 1RVF1 2VZSA 1JMKC 4B4QA 1BXHA 2YZ4A 3WOGA 4EN0A 1BCCH 3BKZA 5FNVA 4OVEA 2J22A 3RYFA 2E5LO 5CISA 2KG7B 1JHJA 4YW3A 4FFFA 3AZZA 4LPLA 4YGEA 4XCBA 4JYYA 2Q1FA 5JH7B 2NLRA 5JVVA 3WUCA 1ULFA 1FXKA 5DZGA 3GHNA 4X20A 1GQHA 3ZYJB 2TEPA 3ZIXA 2JS3A 1PVC1 1HP8A 1PK6C 3DGEA 3VD5A 3V0BA 2DCJA 1DIWA 3AYEA 5FZGA 3JAWA 1Q56A 3ZFEC 3S3XA 5JCTA 3SPGA 2W39A 4LFCO 1LOEA 2I07B 5FLIA 2CDYA 4XDLA 1LODA 3GVMA 1LGBA 1Q6UA 4OGQB 3CS5A 3AK0A 3A2FA 2DWDC 5FYTA 4O2BA 1OF4A 2XUEA 3LFMA 4PDRA 2AEYA 2P37A 3M8LA 3WR0A 1KYOF 2JICA 4LIVA 5IUQA 4Y3OA 3MHZA 1HJGA 1K42A 2WABA 2ZGQA 2AGAA 2WAMA 1HIXA 2LROA 4DXRA 4R9BA 1NXD1 1OT5A 3CMAV 2F4LA 2D6KA 4H7MA 2VS0A 5L9RA 4B8EA 2UWBA 3ETDA 3ZHTA 4GJYA 4FZ0A 3EFFK 3K51A 3PTRB 4PDWB 5F39A 4GKYA 5EV7A 3OT7A 2LUWA 3VBRB 1OVSA 4CEWC 2P4KA 2DCTA 4FLTA 1G9BA 3B8MA 1JR9A 3AK2A 1JYTA 1YVWA 4JI7B 1NR1A 2QE3A 4LITA 5FK8A 4DZGA 1EN5A 4WVVA 3T0DA 3EYPA 1ZL8A 1ZBE2 3WQ1A 2LJ2A 1M56B 2XR4A 4JI8O 3MLKA 4MTGA 3FFZA 5HI0A 4COVA 2X10A 5IYCO 1U12A 2ZGSA 2QSAA 1UY1A 2ZNJA 4IE0A 4MXWA 2P6HA 1W99A 4LFBB 3L74H 5LHGA 3ZHUA 1XJAA 4DV6B 5A3NA 3NL1A 4A3ZA 1LB2A 3B00A 2QVSB 4P9XA 4QHOA 1AROP 4HVRA 3OGRA 3ES1A 1G8WA 1R1A1 1K8AW 3L9JT 1UXZA 1XMQO 4ZXEA 1ROPA 4BCUA 1Z7S1 3WUDA 4DV7O 4QX8A 3U75A 5L3FA 2WA4A 3ST7A 3MIBA 2YSUB 5T5JA 5BR8O 3K75B 4DV5O 4W6YA 1KP2A 3BGAA 1R3IC 2CAVA 4S2HA 3OF1A 4A42A 1BMFG 1REEA 3THTA 5FMOS 3PJYA 2GC3A 3ZFFC 1TNFA 2FDIA 3ASIA 3POFA 4YRDA 3RS6A 3AG3C 2VULA 4BQ4A 3UO3A 5CADA 3F7VC 2AHYA 4JI3B 3WP4A 5IK8A 2CTQA 3ABZA 4HPKA 1RUD2 1KRIA 3GNEA 2ENRA 1S72V 4RD7A 3Q8AA 3AL6A 4BQXA 4QQOA 3CCVV 1UPIA 2LFRA 5B2GB 3JALB 2HFEC 4QQPA 5B1OA 2XBO2 2OA2A 4KWLA 2RS31 1EV12 4XFIA 1PVXA 3FX3A 3BOWA 4FPCA 4XVHA 1SACA 2AZ5A 1D4M2 1UMIA 2E7QA 4YG0A 5KXCA 3OY8A 3WFVA 2G9ZA 2EJRA 3DYOA 3HKCA 1NY72 1K4DC 3L2HA 2OQ6A 3ETEA 2W6JG 4A5UB 3U4SA 5FP9A 1I5YA 2B5UA 2BQPA 1HB4A 2EICA 5FWEA 1OSGA 2WWSA 2XH6A 3NJVA 2DYRC 1YJ9V 5JOYA 5LHHA 2MEV3 3DPRB 1S2BA 2VVFA 1BKZA 4Y33A 3CC4V 4DV2B 2HBTA 5DQ0A 2GMEA 4L2NA 1FOD3 2QKSA 4QXBA 5B5EZ 1WLEA 1MZEA 2YFUA 2ZT9B 4UUJC 4J9YB 2RCVA 4IE4A 4Q1RA 1QBZA 5LP6C 2IJHA 1H9PA 4HMZA 4NIAA 2VNGA 4ZBMA 2E9QA 4YJ2B 5AC93 1OD3A 1ZRRA 3JCIA 4AGGA 3FHIB 2XHBA 2ET1A 4XZUG 5IFTA 2P3JA 3HNMA 1MZFA 5IY5C 2X05A 4LO4B 2JDUA 2XAQA 1OH4A 1RUG3 2AW9A 5FMOL 4DRXB 1SBEA 2WAAA 5DG2A 4O7XA 2HEYF 2QZ2A 3UGHA 1XBLA 2F66C 2AREA 1QHTA 2P4VA 1AXYA 2Z4FA 2ZDIA 4FPEA 3VBOA 2JDAA 1UW8A 4PLOA 4CCNA 1W6PB 1NCQC 2XXZA 4W6XA 2Z79A 3HEIA 1QMJA 4MHRA 2SBAA 1TGOA 4Y1VA 3KT7A 2OCHA 2GHYA 3HIFA 4Z1VA 5JXHA 4OHWA 2LGWA 1PNKA 4GD4A 3RNSA 3K48A 2R0FA 5I8TA 3ZM8A 5L3DA 2RS13 3JCUZ 2E51A 3APQA 4AEJA 3ZXGA 1K9MW 1S5JA 5BXXA 1M4WA 2JG8B 2V09A 2F43G 4AL9A 4JI8B 1O9GA 4UW5A 1XB9A 1AILA 1UO9A 2QGNA 3K0DA 5DUWA 4FLUA 2YPDA 1VQNV 3I54A 5DAWA 3F5TA 5A32A 4O4LA 4M3CA 1CONA 4Q4V2 2TUNA 2Q67A 4LOTA 5A6ZA 1J84A 2ZKNA 2OIIA 4YFZA 3UT5B 1LGCA 2RM22 1C8M1 1VQ7V 2UXDO 1RPRA 1R3KC 1Q90D 2XAJA 1EN6A 1R3JC 2GH2A 1X82A 4Q4X1 4QDRA 1VBA1 1YFUA 4BB3A 3SYAA 3OSDA 3MHHC 3UJOA 1BJQA 2GC2A 3SHRA 4GX2A 1AR5A 5IYBO 5IJ0B 3Q8BA 3OE7G 3KGZA 2EXJA 3OAAG 5G05L 3JD72 3QD6A 3UM7A 2ZGUA 2EINC 1YSCA 5FZLA 1W0NA 1N47A 1GK9A 4EB6B 4DUYB 2D3RA 1NH2B 3TBDA 1MZ6A 4O2BB 3AG7A 2QQOA 5IT6A 4KGQA 1O3QA 4YJ2A 5FPLA 1SBDA 3LNNA 2QFEA 3ZN6B 4DR2O 1YQ5A 3B94A 1SFNA 3BA8A 4NJ4A 3GDBA 5J7MA 2UUBO 2E32A 2RDRA 4I0XB 3TXSA 4HKOA 1RC6A 4ZHQA 2YS8A 5KHKA 4JAUA 1JW6A 2C9KA 4DYLA 3TEWA 1QCEA 2IFWA 4UXNA 4NAMA 4NE9A 4QX2A 3G6EV 1JS9A 3PIJA 1GMGA 3OY8B 1LU2A 4N43C 4CUGA 4UFKA 4PLNA 3OGGA 4RR3C 4S2GA 2P3IA 5KAIZ 1BQPA 4LTAA 4NWVA 4DW0A 2GUZA 1NZCA 4F6RA 5FO9B 3VHRA 3FL7A 5LA6A 2PLV1 3LQCA 3N7JA 4YW5A 1NLSA 4X64B 1XUQA 5KLVH 1DZQA 3C3TA 1NQJA 2M6YA 4XCAA 3BN6A 1E5IA 2EIBA 1HDJA 3MHSC 3DYPA 4Y5TA 1AVBA 5KA5A 4XMIA 5FJKA 1Q81W 3HD8B 3CIHA 4AQSA 2RMKB 2Y0IA 4XDPA 3TRSB 1GH6A 1I94O 3PU3A 2WO1A 3J80N 1RUE2 1YO8A 2H3OA 1GBGA 4FXGB 3ZSLA 1QJX3 2J1UA 1H8EG 3WDYA 3SPIA 1CX1A 5B1AB 3IIIA 3OR7C 1GNZA 1D4VB 2Q68A 2QTSA 1CZTA 1G6NA 1AJPA 3MZHA 2VR4A 1GTOA 3RRDA 3TB0A 5CG9A 3LDRA 1QXPA 4ZS2A 4LF8B 3PVBB 4G4FA 3CJHA 4O4IA 4R6ZA 4B3NA 2OQ7A 4GT1A 4DV5B 5I8SA 5T50A 3PNAA 4D0QA 4KWUA 3TGUH 1QH7A 4KG0A 1WW5A 3DXRA 3H0OA 2DCYA 4META 3WF1A 1Q43A 1QJU1 4CS3A 2J42A 5HXMA 1G86A 2OUJA 2ZCWA 4RL7A 2VWJA 3MIFA 4TZDA 1YJLA 2UURA 3U1XA 5JWPA 3CKHA 5GLTA 3FC0A 1JA8A 1JQ0A 3ZYIB 3GZAA 3R6SA 5C8YB 1C8M2 4TXWA 1YTFB 4M4RA 4LFCB 4XBLA 4CH6A 1PO21 1YFYA 4PCRA 1MS9A 1ZA4A 5A3UA 4Z2WA 1UQXA 3J81N 3ASOB 3X2QC 5CMUA 1ULDA 5FZFA 4U2AA 1F4MA 3OG2A 1OKOA 3UGFA 2WPDG 2DUPA 2QR4A 1AX1A 4I55A 3LFIA 1ND2A 4EB6A 1Y4MA 1Y76B 2A7AA 2Q6AA 3KCCA 4I0WB 4B3SO 3TYJA 3PJSK 4JKLA 3AFGA 3ZFGA 5DN2A 1OC1A 5DAVA 5GZCA 4LO5B 3H1JH 4UVAA 5TISZ 4QD2A 5IVCA 3TN91 2ZX0A 3AG3B 1S0CA 1UN1A 1ENQA 1E1QG 4M0NA 2RDQA 3NJZA 4I4TB 1W06A 4YJ3B 1GZ9A 4LKDA 2FD8A 1SQVH 1QOSA 1NOVA 5LGTA 1XHZA 1MR5A 4XZPA 3NSTA 2G1MA 3FLRA 1V6OA 5CFDA 1F5FA 1H1IA 3ZYHA 4MGQA 4Q4X3 2E7TA 1GZWB 2A70A 4JRAA 3ZR5A 1DGLA 1PGSA 4RS5B 3MBWA 2XQRA 1F23A 4AK3A 3FYEB 4KWJA 1V9U1 3VBSC 2XWBB 1K73W 4CS2A 3V64A 5IVJA 2PFWA 1HNXB 2VZOA 4N9IA 1N32B 2YIAA 1UZYA 4LE4A 3ZMUA 4MSVA 2AUYA 3HR9A 2JX9A 4E2SA 1W59A 4RQPC 2KD7A 3TEXA 3I59A 4CP0A 1W6MA 3OGCC 5B1AC 1XHXA 4MVRA 4U36A 4PA9A 2WJSA 4B3MO 3BPZA 1AR63 3VBUA 2ADEA 2IM9A 5H6RA 1I3HA 5LZ6A 2C0ZA 4AEMA 4D8MA 3ZYPA 2UWAA 3ZXJA 2WKKA 1HWYA 3ZRSA 2DWRA 3IDEA 2ZE6A 1W6QB 4CU9A 2DCZA 1H2LA 2E7AA 2DVGA 3X29B 4KL1A 5KR7A 4CDXA 3E22A 2V7QG 4K21A 1YZBA 5CA1B 2DV9A 1RUOA 4D6TH 3FAVB 4XF0A 1ZBA2 1GQGA 1PZ8A 4C91A 2ZMNA 3CJIB 4G3YC 3IN9A 5FZHA 1IPJA 3C7FA 3PVNA 1ZZBA 1VIWB 2D43A 3QOPA 5CA0B 3DPRA 3OD0A 1POQA 5T55A 3QO8A 4A7ZA 4PDWC 5LCWL 1LHWA 2ZGOA 3K03A 2IZWA 2VE1A 1JYXA 2WLIB 2GV9A 5K8SA 4KGGA 1N36B 3AKRA 1RUF1 2Z69A 5LHIA 1C8M3 2K9ZA 2HKOA 2W1SA 3C8XA 2WSUA 4XUQA 1LOGA 3T4VA 1OURA 1TME1 4XETA 4E2LA 4I7ZB 2JGDB 4BWAA 2BDRA 4COYA 3CC2V 1RUD3 4MLOA 3SCHA 3SKVA 1JZ7A 5GZEA 2Z3YA 4I3PA 4LBKA 4Q0VA 1OA2A 1YITV 2GP3A 3D3QA 4JI0B 2J1AA 1VP7A 4LF6O 5KXDA 4KU7A 5LEKA 1AUYA 1V70A 4WV8A 1N3PA 2WO3A 4EWDA 4O9GA 2AYHA 1NCQB 2XGXA 4PLMA 4B08A 1U5YA 4EN7B 4XFAA 5IVEA 3RYCA 2V73A 1N0JA 4AOCA 4PI2A 1IURA 3MO4A 3D4KA 3D6EA 3SPJA 4HN1A 3DGTA 1CD3G 5ABJB 2HWE2 3WNLA 4OHVA 1WNSA 2NPIA 3NNLA 4MYEA 1LR5A 4DXWA 4WFHA 3ETQA 4AYUA 4R8CA 3E8HA 4M3CF 3J7NA 1UIJA 4CDUB 4YM0A 2BYVE 1EAH1 1CAUA 1SLBA 2BERA 4XUOA 3TN93 1C57A 3M3IA 4IEXA 2NLJC 5FMCA 3K59A 3FWEA 5LMNO 3VZKA 4AZZA 2HWF3 1VB4A 1MQTA 1K92A 4ICGA 1VBC3 5M0TA 4LR3A 4J7ZA 1UOBA 4IGPA 4I09A 3JAMN 3WQ7A 2YEVA 5JJJB 5JVDB 2PHRA 4E4ZA 5IYZA 3BPSA 4XQWA 2X5IB 1XREA 1WP8A 2L9LA 1TVKA 2YXLA 3T2PA 5EJ3A 1DZTA 3JXSA 4LF8O 1O4ZA 2PHDA 2DVAA 4XF4A 2IXHA 3CLPA 3JYCA 4N53B 1D0HA 4DV1B 2UU9B 1A34A 4LUKA 1QR9A 4NB5A 1MS1A 3AZXA 1RUF2 1ND3A 4AEDC 1NYWA 4TV9B 4FPHA 4AEDA 2V1DA 2BPA2 1HKDA 1OOPA 3ZXEA 1EZVH 5C8CB 3BRCA 3CL1A 4K8RB 5EQUA 3CB2A 1YJWV 1VBA3 1NS1A 3SISA 4HKLA 5KMGB 4E4DX 2BGPA 3I2DA 4PA6A 5GTIZ 4CUCA 4IEVA 1PL0A 4IT5A 4Y22B 4UB8Z 1Z0HA 1LHUA 4CDWC 4PDMA 2OTJV 5FY8A 2J1RA 4HL0A 2Y6JA 3IC7A 1JYIA 3O1OA 1FT9A 2NP0A 3SYCA 4GB32 4B3MB 1HLCA 4DUZO 1N1YA 3APBA 2XOKG 3SPCA 3DV8A 5FYUA 4DXTA 2HJDA 1JCHA 1JZ2A 1ALYA 3GCWA 3EHKA 1NCRB 5FLXN 3WB0A 2WDBA 1IS6A 1BEV2 2BGCA 3UCSC 4DV0O 2I45A 4JDMA 4FLVA 2DU0A 1V0AA 4Q1PA 3T2OA 4F8AA 4FFGA 2WSVA 1Q7YW 1AXZA 1PVC3 4FJCC 5A70A 4FI9A 3N9QA 2BOBC 4AEKA 3W20A 5BNNB 1QH6A 3O9OA 1HB3A 2H0BA 1P84F 3I2OA 4FBFA 3TXQA 3WG3A 1GN6A 4XC9A 2WLPA 4X1KA 4XDOA 4RQEA 4AHWA 3V0BB 5FMDA 4Q2FA 3LDDA 4BXSV 1WLWA 4CUBA 3VBFA 4O9EA 2ZGNA 3VD9A 4IV3A 1SBFA 3N4MA 4UAPA 3I4IA 4HVOA 1OPOA 4LXLA 2HWF1 3MIHA 2P7TC 2ZTNA 4LHSA 5JJNB 5C3OA 3DSQA 4QB1A 3VDDA 1OFSA 2VRZA 1JZ6A 2WUHA 5LA6B 5D8AB 4CVUA 2EAKA 4F6RB 2W87A 4NN0A 4PDLA 5FXWA 3A23A 4LWSA 1MS5A 3T2MA 4I50B 5C70A 3QCWA 3POYA 1OH3A 3HR0A 3AG2C 3JASB 2Z5WA 2ZM6B 4K8FA 2JRIA 3WINE 5A1LA 1GWMA 3ZFGB 3GALA 3T1CA 4NPMA 3T1HB 5FZAA 3PURA 5BY1A 3ZO0B 4AI3A 2PUSA 4LF6B 3K06A 1W28A 2WLNA 3CP1A 1NVPB 5T54A 1ULPA 1VBD1 4JCKA 1VALA 2EAAA 4LFAO 1WW6A 1MS0A 1V6JA 4IEPA 2VL4A 2HWB1 4YPJA <