1Q5OA

Hcn2j 443-645 in the presence of camp, selenomethionine derivative
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
201
structure length
201
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title STRUCTURAL BASIS FOR MODULATION AND AGONIST SPECIFICITY OF HCN PACEMAKER CHANNELS
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 57
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2003-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1q5oA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1q5oA02
4IEQA 2XKPA 3HIFA 5EZWA 4J1XA 4XF4A 3I59B 3ZDSA 4MX3A 4XFFA 1ZX5A 5BV6A 1H1MA 1CAVA 4PJYA 3D0JA 2XL9A 5EFUA 1UIJA 2BYVE 2IXCA 2H0VA 1RTVA 4JTNA 5LEJA 1YFYA 1WLTA 3FHIB 1ZRCA 2HKXA 5E16A 3B02A 1YFUA 5I0RA 1J3PA 4D7SA 3U0ZA 4IEXA 4XFAA 4AQ6A 1QXJA 5FQ0A 1QWRA 2V09A 3FZ3A 4K8FA 3WW2A 2KXLA 2D5FA 2BNNA 2PYTA 4IEYA 3OGJA 4N9HA 2BGCA 3MZHA 3BU7A 4L2NA 3ES1A 3UKVA 1EP0A 4RD7A 3H3ZA 4YARA 2QVSB 4F7ZA 3ES4A 1O4TA 1RGSA 5E1RA 1CAXA 5I93A 2EA7A 4KU7A 1O3QA 4B29A 3MYXA 1LB2A 3HQXA 2UYAA 4P9GA 1NE4A 5J7MA 4Q0VA 4IEOA 2ET7A 4WBBA 1PMIA 2CGPA 3S7EA 2Q0AA 5BY5A 2I45A 4MV2A 2CV6A 2CAVA 4Z82A 5LRSA 1ZZBA 5C6CA 1NZCA 2VPVA 5JCTA 4AQ2A 3S0MA 1O3SA 5JR7B 4AVBA 3SCFA 1SQ4A 2N7GA 4MGIE 2IC1A 1RUNA 2O8QA 2H6BA 4HVQA 2MPFA 2QJVA 4NVPA 2Y0OA 3SCGA 1RC6A 1OFNA 2K0GA 2UY9A 4ONUA 2D40A 4F8AA 4BIFA 2IXIA 2ZKLA 2XHKA 3NKTA 4O9EA 4XFCA 4AVAA 1ZZ7A 3KSCA 4E2QA 2B5HA 3EQEA 3H8UA 1CAUA 4IEPA 1ZZ6A 4IERA 4LEJA 5BPXA 1H1IA 2PQQA 2GC1A 1O3RA 3IDCB 1J58A 1XE7A 2ZCWA 4H7LA 3BALA 4IEZA 3OD0A 1ZNPA 4BHPA 1X7NA 4FAHA 2IXJA 5I91A 3O14A 3NL1A 3KGZA 4TLFA 1OMIA 5JAXA 3LA2A 1YUDA 3N4MA 1ZRDA 3M3IA 4XETA 4XF9A 3MPBA 1VJ2A 3PVBB 2XLFA 2EVXA 3H7JA 1VR3A 3M70A 1U12A 4ZU7A 3CEWA 4IEWA 1ZRFA 3L2HA 4EWAA 4I01A 3VHRA 1SFNA 4MGYE 2EAAA 4D7TA 3CL1A 3LAGA 1ZZ8A 3FFQA 3IDBB 3KGLA 1LRHA 3OTFA 5KHIA 3FE5A 3RDIA 2F4PA 1CAXB 1ZRRA 4AXOA 1NYWA 2XGXA 4LUKA 4MH0E 2QNKA 5LEKA 1X82A 3E6BA 4IETA 3FWEA 5FPXA 1YFXA 3QACA 1WGPA 2PAKA 1O7FA 3KMHA 1RUOA 3HT1A 3CO2A 3DL3A 4OFGA 3BCWA 1TQ5A 5FQ0B 1NE6A 2ETEA 5HI0A 4PIYA 1J1LA 4XEZA 3IWZA 3H50A 2D5HA 3RNSA 2D93A 2GAUA 4QXKA 2E9QA 3LA3A 1SEFA 3WW4A 3ETQA 3RZZA 3GBFA 3LA7A 2VQAA 3NW4A 5FLHA 4I0AA 2IXLA 3USSA 2CAUA 3G7DA 3DV8A 3S7IA 3E5UA 1G6NA 1DZRA 1ZREA 2FMYA 3I54A 2WFPA 4XFBA 4MZUA 2PA7A 3GYDA 3OCPA 5D1IA 4E2GA 3UKTA 3EJKA 5FPZA 4I3PA 4QX5A 2GH2A 4HN0A 2VECA 5KHGA 5BXXA 2K9ZA 2OZJA 3R6SA 2IXKA 4EROA 3RPQA 2OA2A 5CADA 4MGZE 3E97A 2BNMA 4MUVA 4Q29A 1UD1A 3SCHA 1VP6A 2BEOA 2GC0A 5FDBA 4I02A 1IPKA 1DGRA 1V70A 4HBNA 2HJIA 1GQHA 4GULA 3CJXA 4UBGA 3NJZA 3E6DA 4I2OA 1L3JA 2PFWA 4QMAA 2XL7A 1Y3TA 1GQGA 1UCXA 4BH9A 1Q5OA 4HVOA 4HZFA 1DGWA 4Q0SA 2B9UA 4FBFA 3H1YA 2GC2A 2P17A 2QDRA 5J3UA 1CX4A 3ACLA 1CAUB 4DINB 1YWKA 3ELNA 1UW8A 1O5UA 5JSPA 2UYBA 4KU8A 4X6QB 2WC2A 4QGNA 3RYPA 5I0UA 5I8SA 4R52A 4HMZA 1RL3A 2PAEA 4PIXA 1J3QA 4MGKE 1JUHA 4EWDA 4QM8A 5I0SA 1Q3EA 2GU9A 1FT9A 1NXMA 4KWKA 4UXAA 3EHKA 1QY4A 4L11A 2O1QA 1I6XA 3CF6E 4JVAA 1OI6A 4XFGA 2ET1A 2GC3A 2GZWA 2Q4SA 3H1WA 4HVRA 4YSFA 1X8EA 4YYOA 5I8TA 4IEUA 1ZVFA 1CAWB 4ORFA 4WZCA 3E6CC 5KHHA 3IBMA 5CU1A 1X8MA 2ATFA 1EY2A 3NVCA 4N9IA 3U10A 4EV0A 4AVCA 2IXHA 3D0SA 4LLOA 4HLTA 4XFIA 1QXRA 3DKWA 4YNIA 3ROUA 5KHJA 4BYYA 3H9AA 5BUVA 2B8MA 3DN7A 5K8SA 3JZVA 4FT8A 5AVPA 4XF3A 1OD5A 4JTOA 1O5LA 4IEVA 1O3TA 1YHFA 1LR5A 1UIKA 2Z69A 5FLJA 4KWLA 3NSTA 1LKNA 4Q0PA 5KBFA 1J59A 2H6CA 4LULA 4OLLA 4KWJA 3BB6A 2Q30A 2QCSB 4Q0UA 1EYBA 3KCCA 1CAWA 4ZU5A 4YRDA 4LA3A 2XKOA 3MDPA 3HT2A 4QM9A 1UPIA 2PHLA 4HSJA 3OF1A 3SXWA 2UY8A 4HSLA 4E2SA 2Z2SB 2OYZA 3EO6A 2DCTA 1CAVB 5C8WA 1DZTA 2C0ZA 3FJSA 1ZZCA 3LWCA 4HN1A 4XFHA 1FXZA 3TNPB 3U11A 1XE8A 4LTAA 5LRRA 4J1WA 5JSOA 1WA4A 3I59A 2FQPA 4QGMA 5FLIA 4A2UA 3E5XA 3H3UA 4IESA 3ST7A 1IPJA 3H1MA 4I09A 4UBHA 3BPZA 1J3RA 3E5QA 1HW5A 1I5ZA 2MHFA 2MNGA 4QGLA 4WVZA 5KHKA 3RYKA 4O9GA 3UKNA 3PNAA 4Z07A 1XRUA 3IIAA 4XF0A 1Q43A 4META 3EBRA 4Q0QA 4KL1A 1PM7A 3LOIA 3H7YA 4JV4A 5I8YA 5FCCA 5F1RA 2PTMA 4EWEA 3SMHA 5I0TA 4CYDA 5J48A 1CGPA 4PIZA 4FAGA 3WW1A 1YFWA 2PAMA 4R8HA 2XLGA 3CLPA 2OPKA 3PLQA 1EPZA 2PHDA 2XLAA 5CVRA 1ZZ9A 4ZU4A 3QOPA 1FI2A 2Q1ZB 3C3VA 2OZ6A 4LUMA 3LZZA 3SHRA 4X6RB 2BNOA 3I7DA 1YLLA 3FX3A 5T3NA 3TNQA 4XF1A 3D82A 3WW3A 3RYRA 4LA2A 5JSRA 1Y9QA 4I0BA
chains in the Genus database with same CATH superfamily
3AFGA 1W6NB 1ND3B 4U3FH 5LYJB 4CDQA 1WZXA 3W7WA 2UUBB 3KHBA 4EN0A 4BQ5A 3WOGA 2P6HA 4J25A 4GWNA 4O4LA 2OCHA 3A0RA 5DAXA 1H2KA 4OZOA 1AUYA 5FAXA 2LGWA 4H55A 4UWDA 3WW2A 2ZGTA 1DCSA 1F8VA 1SERA 1YNAA 1FKAO 1DZQA 4CSWA 4JDNA 2ITDC 2OTLV 3VQVA 1Y74A 4RD7A 1Z7S2 1JI6A 4WFEA 2RM22 3RZKA 4GJYA 2W3JA 3T09A 1KC8W 4DUVA 4HG6B 1DYOA 3JASA 4DRXA 2YGMA 4J7ZA 3PTRB 1TME1 4DV1B 2BOJA 4E4HA 4DFSA 5A32A 1Q81W 3RW0A 1BEV2 4YW3A 4NOTA 4X9QA 5LK5A 2XR4A 4JI2B 4MO3M 5ACA3 1IS3A 5FMOS 3FB6C 3MIGA 4RS5B 3IM0A 1OFNA 5EYXA 1IBKO 5KX5A 3NKTA 3VBSC 3LNNA 1REDA 2HWF2 3WD5A 1U5YA 3ZX6A 2V73A 1I08A 3OY8A 4X64O 1VIWB 4W4KA 4PLMA 4CU9A 2WLIA 4UVCA 3ZVXA 2VBPA 2Y6LA 4JGZA 4C1XA 3VDDA 3T2TA 3W7TA 1T6BX 4WFGA 3OGRA 1QJX2 3HVDA 5DAWA 4IEWA 3HKCB 3L2HA 1IS4A 3AG4C 1XMQO 2EF6A 1QJFA 3H1IH 1UJWB 1HV0A 1GMGA 1SLIA 2XBO1 3CCEV 1LRHA 2F4PA 1FX5A 4UI9L 3NJVA 4MH0E 2ARHA 4KWUA 1FAFA 3LQCA 1RUE2 2VU9A 3VD3A 4BQ3A 3D36A 4NPLA 4DR4O 5DECA 4N53B 5FOJB 3DC5A 1R6TA 4J7KA 5J98B 1XHXA 1QVGU 2D5HA 5CZKA 3NNJA 1W8UA 2YYOA 3ZXFA 1W06A 2ZS6B 1APNA 2R063 4X89A 4GIQA 5J2TA 3GBFA 3NNFA 1I7FA 2K1EA 3GCWA 4NHYA 3SPIA 4A7ZA 4NTXA 5CKQA 1JH5A 3ZMZA 5DN2A 2E33A 5D1IA 2LS6A 4DUYB 3QBQA 4YG6A 4JZRA 4NRMA 4CDUB 3LDDA 1US3A 1D4M2 1AYN1 5FYZA 1N1TA 1EN5A 1DIWA 1VP6A 3SLIA 4RR3A 3ZHVA 3TOJA 3RGBA 5E89A 4CEWB 1Q8IA 2BGPA 3AJYA 1UCXA 3PL0A 1Q5OA 3ZSMA 3UM7A 2QDRA 3KLSA 5JZGA 4Q4Y3 1RP3B 4JI4B 3CC2V 3ELNA 1LGCA 2IBZH 2WC2A 5GLWA 4S2DA 5IT9N 3RYPA 4EN9B 1H2SB 3TETA 5A7QA 4PIXA 3JQXA 3UYJA 5LWBA 1Z78A 2BU9A 3S57A 2UU8A 2VULA 4K3UA 4JVAA 2JDZA 3JD71 4R9CA 4XFGA 3VKFC 4HVRA 4YSFA 3KG2A 1Q82W 1EAH1 3IMMA 1RVF3 1A34A 3FLPA 1XL6A 2Q8CA 4IGPA 4N9IA 2CAZC 2PLV3 2PLV1 4Y1YA 1AR93 5FRAA 1POV3 5BUVA 5IUQA 4I4TA 5KXBA 4LXLA 4ZOLB 4XF3A 2ODMA 3K03A 4DV2B 1C57A 1D5AA 2XUEA 1WN7A 1D4M1 2Q30A 4K8RB 2RDRA 5IY5B 2VOWA 4YRDA 4JV5B 4AQYO 4M3CA 1GM9A 2QE7G 2W0FC 4RWUA 2KD7A 3TEZA 1QQP2 2XJPA 4XW3A 4TLGA 5LK7B 1JS9A 3C90A 4PDWC 3PIJA 1HRV3 1O91A 2ARAA 3OUIA 4WM8A 3APQA 1VBB1 2J1UA 3WHTA 2QKSA 5CBLA 5FREA 4JI5B 3E5QA 3VZJA 3RYKA 1JN2P 4AI0A 1ZM1A 4QKDA 3A2FA 2P67A 2JICA 3ETPA 3VKMA 3KCXA 4PQQA 1CGPA 1C1LA 3F95A 1AVBA 5B1NA 4PIZA 1Y76B 3O12A 2DCKA 2DDUA 2VTFA 2QTSA 2VBDA 2WT0A 4LIVA 5LA2A 3V0AA 1GUIA 3AG2B 1GBGA 1GZ9A 4GB33 2YFUA 4UFLA 3ZHTA 1OKQA 2WPDG 1Y9QA 1V6KA 4L8JA 4RUFA 5JPMB 1L0NH 4JI0B 2UUAB 3MV11 4PF1A 2QQNA 3ZMOA 4LBQB 1VMJA 4B3MB 1SRYA 1OHHG 2RJZA 1UU4A 3C8XA 1OV9A 1H6YA 3B02A 3AG1B 1RPOA 4M3CF 3CRQA 1NVPB 1W2NA 2UUAO 4HXCA 5CG9A 4UYBA 2KXLA 3K51A 5A3PA 2LQTA 4X8NA 1W9TA 3OGJA 3J8F1 3TRSB 4L2NA 4YJ2A 3LSUA 3J8F3 2Y48A 3OJBA 3AZWA 4DR3O 1VRH2 1N4CA 3P30A 3VZOA 4JAVA 4FPEA 1WJZA 4JQTA 1K45A 1QU0A 2W6IG 1D7PM 1HB1A 2E5LO 3D3IA 3V65A 1V55B 1AR62 4QPGB 1UPGA 4WBBA 2FB5A 2I45A 2GN3A 4C90A 5JXGA 4M4RA 4WVMA 1LUVA 4Y5SA 3O1MA 1QDCA 4WM8C 2ZEYA 4MGIE 3CRRA 1YEWA 4A5UB 4QE7A 4XMIA 1ZWIC 2D40A 2YG0A 5IK4A 1OUSA 3OM3B 3D3QA 3PJQA 3ACFA 4KXRA 3RYHB 4Q4V1 1WBLA 1V9PA 2WNUC 3T1YB 1U96A 1F4AA 2VOXA 4E2LA 4LEJA 3FX7A 4AK3A 1E79G 2Q8DA 2C4XA 1XE7A 5KX5B 3BALA 5JWPA 2A3YA 3ZXGA 4IE0A 4U7OA 4RS5A 2A79B 4FAHA 3WEZA 2AGSA 3OE7G 1Q6HA 1XUQA 2Q9LA 4MVRA 4QPGC 2A70A 4JDOA 4ARXA 5FPUA 1AVMA 1K5JA 2BW8A 4ZU7A 1NT0A 2B7YA 4I01A 5GALA 1HV1A 5JVVA 3CL1A 4BISA 3ZMSA 1RM1C 3FFQA 1R1ZA 5KHIA 2UWBA 4BE3A 1XDCA 1XEQA 5FXXA 4O4IB 4XBQA 5FZKA 1RUOA 4FO9A 4OFGA 1H8TB 2YBPA 1UYYA 1SESA 5EWSA 3VB9A 2IU0A 3RSJA 2Q68A 2JS5A 4ABMA 1REEA 1Z5VA 2NN8A 3OUHA 3QH6A 5DM6V 1QH7A 5EC1C 2VG9A 2VS0A 1JQ0A 1VQNV 2IXLA 1BCCH 1HRV1 4CUGA 1G6NA 1TUBB 1R64A 2YSUB 1S55A 3T2QA 2EICA 4X1IB 2PA7A 1MQTC 3RMXA 3K9SA 3HQRA 2F66C 2BV4A 4UVBA 1HB2A 2EINB 1PM4A 4XYXA 1JU4A 2WA3A 2LW1A 4EROA 1ALYA 1YI2V 1I0HA 4I50A 2YB7A 4MGZE 4RGGA 4Q29A 3JYCA 1ULOA 3R65A 5KXDA 2LW8A 1JZ6A 3WNLA 3WDXA 4NHMA 1NI8A 5EC2C 1H4GA 5FXZA 2WLLB 3JCIA 2D6MA 5LCWL 2WZR3 1GANA 2PI4A 2SLIA 4WV8A 1ULEA 4JYAB 3VBFA 2DTWA 3BA9A 1DDLA 5FMDA 4DXZA 2YDEA 3E8BA 4PJ0Z 1GR3A 1NXMA 1WLCA 1N36B 5KMGA 1Q8QA 2W1QA 4TQDA 3POJA 4Y20B 3U37A 2ZT9B 1F4MA 2BBAA 4WBNB 1VRH1 1I1EA 1KP2A 3EVKA 3HB3B 4ZKIA 4WZCA 2EULA 1M1KW 4XQ4A 2WRAA 5EP9A 1MS3A 1HQLA 2XBO3 4MVQA 1C3HA 1T5EA 2Z5WA 1OCRC 4EN7B 5FO8B 2UXNA 4BYYA 5LBQA 2WS93 1N0JA 3HKBA 4FLTA 4ZONA 1O3TA 1UIKA 1W0KG 4GALA 4N43B 4KWLA 5A33B 1SS3A 3CBNA 5I0DA 5BNPA 3MLKA 4FSJA 1YQ2A 3IGAC 1ZBA2 1G4YB 3SPCA 4B3TB 4DR2B 2JB8A 5BR8B 3HT2A 4LOTA 3SXWA 3SKJE 2WL1A 1W9WA 4HN1A 1XNCA 2IJHA 3PMEA 1KP3A 2QZ2A 1W0PA 2RCVA 1IKQA 2QQMA 3JBG2 5GLVA 1W2OA 2WFF1 2XJVA 2VY0A 4FK5C 3FC0A 1J3RA 1K92A 2ZGUA 2MHFA 5E88A 4WVWA 4RGAA 5FZAA 3E8GA 3VBHA 4FPHA 1HLCA 1ZX3A 3QO5A 1HNWO 4Y22B 1Z7S1 3Q4HA 2OIIA 1ZBE1 4LF9B 3OFNG 2E6VA 3DPRA 4FLWA 3AP4A 4DV5B 2BRTA 4BMBA 4MVTA 2YHJA 2D6LX 1Y4MA 4JI7B 3RZJA 4GWMA 1OLMA 1FOD1 3G6EV 1A3KA 1G8MA 4AFMA 5DXDA 1M4UA 1HR0B 4D6TH 1S0CA 2VGDA 3HIFA 4ZS2A 1R082 1EV13 4AHZA 1M56B 3CRMA 3BTZA 4DXWA 1QLNA 3JATA 3MW2A 4O4JB 1W8ZA 4BOWA 1GU3A 1GKFA 3A21A 5GZGA 5I0RA 1J3PA 3RJRA 4NIDA 4FPFA 2UWAA 4TUYA 3L2YA 2V09A 3FHAA 5BNPB 4BWAA 2JDMA 4R7CA 1AR63 5A33A 4OI1A 1RUJ1 2VW0A 1CZTA 3ES1A 3DYOA 3ABLC 3X2QC 4Q2FA 1B35B 4I30A 1RGSA 3VN4A 3ZIWA 1TUEB 5FP8A 5JVDB 1KRIA 3UJOA 2UYAA 2DVFA 5HPOA 5IY5C 5IVEA 5J1XA 1BJQA 4IEOA 1OVPA 3C7HA 5LW9A 4YIOA 1RHI1 2PELA 4GXLA 5JR7B 4BXFA 4Y20A 5A70A 1GSLA 1SETA 1MQTB 5FPAA 1OSGA 2H6BA 4HVQA 4RYDA 3SCGA 3HN1A 4A3ZA 3OPZA 5F6KA 5L36A 5EV7A 5L3GA 2P1BA 4QNHB 5FZIA 2DURA 2ZGQA 2OVUA 5L19A 4B7KA 1RUI1 1OA2A 2DQ3A 5GZDA 1C28A 5FMOL 2WN2A 4YVSC 2D6NA 2ZGMA 3I2FA 4CC5A 5IVCA 2L6LA 3GXUA 3BIWE 3KB5A 4CE8A 5HFMA 1LHWA 2C2AA 3JALB 2XTAA 1K42A 1GM7A 3SITA 3BEHA 5AC93 2EALA 2AZ5A 1MACA 3H7JA 1FPOA 2FZ1A 3ACGA 4X88A 4Y1XA 3TN91 4FOYA 4FFKA 5FYCA 4YZ5A 2RS32 1GP5A 3KGLA 1RJ8A 1CX1A 3HAGA 1CAXB 1RSOB 4NXNB 3AP5A 4LF8B 1BMV1 2KR2A 1UMIA 1UF2C 3DCQA 2PUSA 1BGYH 5A3TA 4U3JA 4AQTA 1AR82 3WDVA 3JXSA 4E9KA 2BTQB 4N53C 1LHNA 4HKLA 3GZTB 1JJOA 1HIXA 4W6YA 4CUAA 3NQHA 1DGWX 4P9WA 1MS1A 4XJWA 4BA6A 5CA6A 4CPBD 2VBBA 4GKKO 1ZYBA 4RFRB 3THDA 1L7QA 3D5OA 4G27B 1Y66A 3GWKC 2JEXA 4J80A 3G6JB 3N9MA 2Y64A 2LP7A 2RS52 3EMRA 1AR1B 1A6CA 4NWWA 4AE2A 1KU9A 5B3SC 4GKKB 3AKSA 2WLNA 5EYPA 3I2DA 5C9AC 2QJ1A 3U78A 3IPVA 4AEKA 3CU7A 4D94A 2D3RA 4QB6A 2QA4V 4RS5C 1AR4A 3K06A 5KXCA 1EN4A 4QX5A 3FUQA 4LBMA 3HNBM 4MS2A 2B5UA 5BNPC 2VQFB 2DCYA 4XUPA 1VIBA 4QPWA 2WNEA 4JX0A 4UF0B 3OAAG 1QJEA 2F6BA 1S5LZ 3E6DA 3K4AA 4J9ZB 5DDJ1 3ZRXA 2XJQA 3DKQA 4DV6B 1KFXL 5FZGA 3NV2A 4YFWA 1W2UA 4GLXA 4YY3B 4MSVA 3K0GA 4AEJA 2Q1FA 4O4HB 2R72A 4ARYA 1OQ1A 4G28B 1N47A 1ZBE2 4COWA 1UY0A 2XJSA 3OR6C 3SYOA 3MIBA 4J10A 1O9GA 4AAXA 2GZWA 1BVVA 3ZYPA 4NTWA 1GZWB 2VNOA 3BI3A 3UGFA 4CU8A 5C3QA 1AJQA 5CBFA 2JJ1G 5A3UA 4H14A 3MGUA 2JGUA 4MXWA 5CFDA 1SZXA 5LASA 4BCUA 1PVC2 1PX3A 4WFAV 1OD5A 1KEXA 3MHHC 4LLFA 3POEA 1DLCA 5JI7A 4KWJA 1HXS3 2ZIMA 4IDZA 3HN3A 4MOAA 4DEQA 2VQ0A 3MFCA 4NKGB 3KCYA 4HSJA 4NJ4A 1KQSU 1JOYA 3GB7C 3N9OA 3VZMA 1ZZCA 4LKFA 4FIPC 5IFTA 5LRRA 5JSOA 2WKKA 2P34A 4YG0A 2BWAA 4GX1A 2ADDA 2ZXQA 5GTHZ 3A4UA 4XVHA 1RUI3 1XE0A 2WO2A 4RR3C 5KHKA 2WNUB 1HRI3 2AENA 3PNAA 2XUMA 1RMU2 2R072 2R061 4JGYA 1YXWA 4JGYC 3K4ZA 4XUNA 4W6WA 3ZXDA 5A7WB 4WF9V 1VQ4V 2HLDG 2MEV1 5IJ0B 2PAMA 2XLGA 3CMAV 3B5LB 2OQ6A 2EIDA 3JUUA 3LSEA 5DUUA 3TNQA 1M57C 2XJUA 1GN3A 1XL4A 3HKDB 4RQPB 3OEHG 2A6WA 5F5AA 4YZ2A 4MSWC 5IJ9B 3LIHA 5FZ0A 5F9TA 2FDFA 1UYPA 2RDSA 4XFFA 2DMXA 4CP1A 2UXXA 4FPPA 1KBHA 3SNMA 2ZXWC 2P22C 1OOPA 1WAZA 1MABG 3S6PA 5ACA2 3POGA 1GH6A 3Q8AA 2H94A 4KG8A 4HYOA 3APBA 4AQ6A 1XNKA 4CTEA 3OGSA 2V4DA 1QQP3 1RUH3 4LFAB 2OS2A 4LF5B 1A32A 2CDPA 1X9PA 3K59A 5FWJA 4LBOA 3I55V 4DUXA 5BZBA 5F2VO 2PLV2 1F2NA 1FMD1 1YI7A 5BY5A 5E79Z 3WNOA 2VZOA 1AI5A 1VBD1 2XMLA 1FXKC 2XQRA 1MS9A 3JAMN 2VTXA 3C3TA 4LHLA 2Z0AA 4K0KB 5C3RA 1Q8PA 4R8CA 4LFBB 2QJVA 2X09A 4Y1ZA 1VQ7V 3ABKB 4GA9A 1BE3H 3J7AU 2DVDA 2F4LA 1L0LH 2WQ8A 4O9EA 4EFBA 4DV3O 4H44B 5C4WB 2ZEXA 2FKXA 3F7VC 4IEPA 5JZGB 1OLQA 3B3QE 3GJBA 5J2UB 1W9YA 1YZBA 4BHPA 1X7NA 1NQJA 1VF6A 2QWPB 5I91A 3T0DA 3RG0A 2WABA 4YPJA 3RWRD 2DOSA 4Z8BA 1SG3A 4XBNA 3PVBB 2EVXA 2ZAAA 3E22A 5FZLA 3VHRA 3T4HB 2DF7A 4GX2A 3H1LH 5A3OA 2A3XA 5FIXA 3HJRA 1NYWA 5EYPB 2EZOA 3AG4B 3RVHA 3CRCA 2A6ZA 2C9AA 2XAQA 3RZMA 3FWEA 3LPFA 1WGPA 3IDEA 4DS0A 1R73A 3CO2A 3DL3A 4AVTA 3V56A 5H9RA 4QXHA 3OGCC 1SCSA 5ITZB 5CISA 3M8AA 1NUKA 5C8YA 1UNBA 3B69A 1OD3A 4L8QA 5IVYA 3U07A 1VBC1 1SZBA 5DUVA 4F6EA 5GW7A 4V1PA 3LE0A 3WCSA 3LA3A 3GDBA 1B3QA 1GV9A 4CUBA 2A75A 2VQAA 5L3DA 2JGDA 3OUJA 4BM8A 3OTOO 1M57B 3VDBA 1YJLA 1K5MC 3HQUA 1SFPA 1X36A 3PJSK 4NB5A 1GWLA 2ORZA 4FLZA 3TN92 4H0LB 1H38A 4LITA 3BTYA 2WAOA 4XXAA 5A6QA 4LWSA 3CCQV 3G71V 4A44A 1IZ3A 5JOYA 2JG9A 2BNMA 4JHZA 5F2SA 1BZKA 2GC0A 2VWJA 1I5XA 4NHKA 4QQLA 2HJIA 3KT4A 3OW2U 4E4DX 4FJCC 5D5QA 5IW0A 1AILA 4LO5B 2O0OA 5L3FA 1W6QB 4GKJO 3UKMA 3PTYA 1FFTB 3V0BB 5KC5A 2VWKA 1BQZA 3CD6V 1MG1A 2IM9A 3SYPA 5GZCA 4X66O 4HNAB 1J5EO 1C8M1 2VMDA 4QX1A 4LHKA 1LOEA 3NAPC 4QM8A 3AKPA 1N1VA 5BNQA 1I6XA 1FXKB 4EQVA 1FD9A 3M2MA 2XHNA 1X8EA 4IHJB 3MO4A 4YYOA 2Y60A 5KHHA 4YXWG 1VBD3 3NO8A 4QDSA 4FFHA 4GH4B 1QXRA 2HJFC 1KB9F 4IV3C 4J9YB 1VPHA 3H9AA 2JVDA 3EHBB 2RM23 2YU1A 2ZGPA 3GALA 2Z69A 1SMVA 3VBRC 2WFF2 1EM1A 2Q4PA 3BPSA 2EIMB 4GD4A 2XH6A 1ONAA 2AW9A 4IHJA 1RUD1 3CJHB 1R3JC 2YXLA 5HCBA 4O4JA 1Q8SA 3KZIZ 2OUJA 2R70A 2R042 3DXRA 2RS12 3I3BA 1JYTA 1DGRN 5AFBA 5FYSA 4U36A 1W6NA 2HH9A 4HNAA 1IPJA 2RS11 1GKBA 2WFF3 2XWBB 2AHYA 2EJRA 1V54C 2WLKA 4FFIA 3AG3C 1KD1W 5HCHA 3ZN5A 3NWKA 5CFCC 3VBBA 2O57A 3POIA 1MZ5A 1XMQB 3INAA 3D36C 5CBHA 4PDLA 2AC1A 4A41A 1VBD2 3PUHA 1KUQA 2Q67A 2D6KA 1C5HA 3I2HA 5LXTA 2OCCB 1FI2A 3OMNB 4MTOA 3WG3A 5JJJB 3ZXKA 3I2OA 4I0BA 2ZX1A 4OMCA 4XHXA 2XKPA 1OH4A 4NWVA 1LODA 2WBKA 1OPOA 1E5SA 2R062 2JGDB 1WW6A 1MEC2 1RMU1 4WM7A 4J7JA 1SBFA 3GJAA 1NTKH 2I07B 2Y26A 4JI8B 3S5QA 1W03A 2QQVA 2ZCEA 1IBLO 3PVNA 4GB31 1CPMA 2HEYF 4K8FA 4QPIC 4CCMA 3H01A 4I9QA 2X8KA 4PELA 2W1UA 2NNUA 4X8AA 3CXHF 1WA8B 2GUZA 1Y43B 1KECA 2GTSA 1W59A 5F3GA 1XC6A 2W1WA 5C9AB 3N2GA 3NJXA 5DABA 4PBOA 5FZMA 1WWYA 3KS7A 3E22B 3WV6A 2W94A 3IC9A 2VNGA 1WP7A 2TUNA 4LKDA 2CV6A 3FB7C 1PGL2 4OYUA 5DAQA 1TG7A 4NRPA 4DV7B 1DP0A 3FHQA 4FMTA 3AM2A 3WB2A 4JI4O 4UUJC 4RAIA 4NVPA 1RC6A 3AP9A 5FJKA 2Y4UA 2K0GA 3FN9A 2Y69C 4FPOB 2CWSA 2YS8A 3OGVA 3ZFEC 2Q5TA 1FJGB 3LDBA 5FYYA 2P5BA 5FXVA 3SH5A 1CPYA 2PQQA 3CS5A 4DY3A 4XBFA 1AX1A 1SACA 3U4SA 1J58A 3WF1A 2YXSA 3MBWA 4LH7A 1FJGO 1N3PA 2F17A 2EXHA 4CDQC 2JDYA 4I50B 1HNWB 5A3LA 2MEV3 4CP0A 5DAVA 2AUYA 3M70A 1PZ9A 3C7EA 4BQ1A 4LQRA 2ZHNA 2OT5A 2WLPA 1SFNA 4EZ4A 2ADQB 4MGYE 4AI3A 3RMYA 3W9AA 5LBFA 3IDBB 1FMD2 4MTGA 5FZ9A 1S2EA 4GQ7A 2F93B 1Q8OA 1XYOA 2W68A 1JOBA 4P9YA 4JV5O 1TME2 4DW0A 3VBFC 1XYNA 1NA1B 2RN9A 4KH9A 5CFCB 2Y0IA 1NE6A 4Z92B 4QB2A 1PPJH 3MIHA 2BFUS 4OX9B 3I49A 2WIIB 4IV3B 4FXKB 1WNSA 1H8TA 4DOUA 3LA7A 1W6OB 1HQNA 4Y33A 3K5NA 1X4TA 1IGOA 4LNVA 2G19A 1SKVA 3KHCA 4MVMA 2EAKA 2RMKB 4XC9A 3ABZA 4QU2A 4QXCA 2QQUA 4J42A 3BN6A 2P5OA 4BJ0A 4N90A 3G80A 1OCOB 2V72A 1BT8A 3RYFB 4JTCB 1IPKA 3Q9OA 1U5IA 4K8ZA 1DK1A 1Q8VA 2F95B 1H1AA 4DR1B 4ZZ5A 4JHTA 4FCAA 1OLRA 2YXYA 3LSSA 1SPPA 2N04A 4HK9A 4QGNA 3H8RA 2W91A 1P7GA 2W0XA 1CWPA 3W5MA 4FPCA 1SDDB 3CDZB 4UXAA 1A78A 3U75A 1NR7A 2HWE2 2KA3A 2DBIA 3O1VA 1QDOA 3BA8A 4BLJA 3ZKUA 3IBMA 1FYJA 1U5ZA 1EY2A 1H4HA 1RUC2 4OHZA 3CX5F 4IE4A 3Q8EA 2GMPA 4AFDA 2GMEA 3RS6A 2JEMA 1QOSA 3LEGA 2PHXA 3GBWA 4FTEA 1G6UA 5CFDB 4GCZA 4OZXA 4CDXC 1BK1A 2J1AA 1WLWA 2AZ0A 2YV8A 3CRAA 4HKWA 5C70A 5DZEA 3LUTB 1EYBA 2HWE3 3VHOA 2RG4A 2IZWA 1KKCA 4CCEA 3LB9A 4NIGA 1DHKB 1HWYA 5CN0A 4JI1B 1JMUB 2OYZA 3I2KA 3WP6A 1LOFA 4QPJA 3BVCA 2J42A 5DEDA 4LTAA 5H9CA 1N3OA 2WLJA 1IX9A 3ZM8A 2KG7B 4O2AB 2EXJA 1V9U1 1NA1C 3OUFA 3QO8A 2RDCA 3L73H 4DO2A 2MNGA 1RINA 1V54B 1XNQB 5A80A 1LCLA 1S0IA 1OH3A 3AG3B 2VW2A 4TN7A 4CZZA 5LMUO 4Q0QA 1QF3A 3IAQA 1HX6A 3TJTA 1KQRA 3NV1A 5FCCA 2VQEB 2JG9C 1UOGA 2ARCA 4S2GA 5FKCA 4Y26A 3WW1A 1YITV 3KZ4C 3W21A 3ASOC 4D0QA 2RDNA 4XUOA 1YIFA 1URXA 3FX3A 1YIJV 4EZHA 1Z7S3 5FMCA 4JI0O 1OCOC 1QQP1 1RB8G 1JHJA 2FCTA 1VB4A 3AFKA 4UW3A 2Y69B 2WNVB 3ZPYA 3OD4A 3D0JA 4LF7B 2JDIG 1QBZA 1WCUA 1PNKA 1SC5B 1UY4A 3K57A 4LE4A 2R49A 4JTNA 1ZRCA 3JQWA 1AROP 5CYYA 3PVEA 1FMD3 2ZGRA 2HHHO 1AI4A 1Z0HA 1LNSA 2BNNA 4K20A 3ZRSA 2OPWA 3VKNA 2HWC2 3SJQC 2DVGA 5A2QN 1KJRA 1RSOA 5E1RA 3J26N 1IBMO 4IGOA 4XCBA 2JG8C 3WG2A 1LOCA 4YG3A 2E51A 4OPHA 4UXNA 1S0DA 4IV1A 1S5JA 2QQWA 4PDWA 3AKTA 2RS31 2ZBJA 2VPVA 3O1UA 1CONA 4AVBA 4MADA 3JALA 1G9DA 2YC0A 3VDDC 5IDJA 2BVBA 2GHYA 4X1KB 2VAUA 4BW5A 2VNVA 1F5FA 1QR8A 1ASJ3 4YJ3A 5IWAB 1ASJ1 1HNZB 1WCDJ 1ZZ6A 4IERA 5T50A 1R3LC 5DG2A 4FM1A 4PCRA 4CH3A 1FPN1 3APOA 5IWAO 4MTXA 2UU9B 1VQPV 5EJZB 1LAJA 4KFMA 4LK6A 3M7MX 1POV0 1E1QG 2HWB1 2B42B 1V00A 3ZYHA 3MPBA 2UU9O 1VJ2A 4MG2A 1U12A 3WQ0A 3RYIA 3BKZA 2UUCO 2R073 4DZGA 3OG2A 4CCDA 5A1FA 1RIRA 1S0EA 4NHLA 3RDIA 5DZFA 1NLRA 2PQSA 4GH4C 3AXEA 1AHSA 3OYWB 2X6BA 4HL0A 1SBDA 4P02B 5LBCA 2WUHA 2P3KA 3K0DA 2VR4A 2NZ9A 2XVGA 5KA6A 1EUUA 5FQ0B 2PYLA 5E1AC 1TE1B 3R4SA 2YBKA 2ETEA 3B00A 2CWMA 3T0AA 3VBOA 2EIMC 4QXKA 3JATB 2E32A 4AEMA 4N53A 1MNGA 5BXZA 3USSA 3DV8A 2XJTA 5H6RA 1Q86W 3AP7A 4A7KA 5K0UC 3RYCB 3WP5A 4LF9O 4WFFA 4B4PA 2RR13 2JEUA 5IVJA 5L7OC 4D8MA 1YQ6A 1QJU1 1QJY3 2E74B 3IZOA 4HANA 3SDLA 3ZYGA 5A6ZA 1WP8A 2GH2A 5CAZA 5BXXA 4BB3A 2WT2A 4A45A 3JSLA 1OT5A 4AGGA 4CEWC 3CCLV 3JCZA 4UW4A 1R3KC 3SH4A 4ICGA 4TZDA 4QD2A 3WLUA 3JAKB 5JZGC 4MUVA 3SCHA 2R9AA 5FDBA 1DQ5A 4JGZB 3DPRB 1X33A 2WLIB 4L99A 3CJXA 2L35A 2OIEA 1QKQA 2HWD2 4HVOA 4G2KA 3LFIA 2GC2A 2H8PC 1K33A 2QKDA 4B3RO 1KITA 4HPKA 4QT6A 2XJRA 1GP6A 5JSPA 4GX5A 5FPOA 1RUH1 4QAWA 4V2VA 5I0UA 3KQRA 5FKBA 1RL3A 4GYCB 1UZYA 2HEPA 2X6AA 4KWKA 4FFBA 1QY4A 2VUAA 5DUXA 4R9DA 5LY2A 3CJHA 2GC3A 1VBE1 3ABTA 4P00B 4RFT0 1US2A 3CJIC 1NZ6A 3WDUA 3SKVA 3NNGA 4SLIA 5A7SA 2AXTZ 4N43A 1BBT2 3N9PA 3MICA 1W8WA 4ZXKA 5KA5A 3H42B 3BFRA 3D8CA 4N8MA 1PKXA 4P9LA 3AX4A 2YEVB 4QHZA 3ZX7A 4CVUA 4OQ9A 1LKNA 2BP6A 5LA1A 2UXCO 4RQEA 4CDWC 3VD5A 4AEDB 1MS0A 4HONA 1XXNA 1QHDA 1LNQA 5FWEA 2P3IA 1JOPA 1IHMA 3EO6A 4S2HA 4WZFA 4BDVB 3I3MA 2K2SA 1GWMA 4YM0A 4IIJA 3NMBA 2JDNA 3AMHA 5FP7A 4NIAA 3G67A 4WM7C 5JXIA 5D8AC 1SQPH 3OTOB 3BOPA 1W6QA 4E4SA 4H13B 1PM7A 1DU3D 2WS92 2VCAA 3SMHA 2IJIA 4KGQA 5AC92 2JG9B 4YWAA 1QJZA 3T2MA 3A22A 4JDMA 2ADPA 1YQ8A 4BQ2A 4BIUA 4LWSB 4ISRA 4R50A 1EPZA 1XHZA 3ASOB 4ZU4A 3TN93 2Q1ZB 4YM1A 2EIBA 4LUMA 3I7DA 1VMFA 4X1IA 3CCRV 3WW3A 4JPRA 5H2FZ 5C3SA 3OGGA 4DV0B 4P9OA 4GKJB 2HG5C 1BL8A 4Y1VA 3I59B 2J1TA 4ZS3A 1VQMV 1RUC1 4JC1A 2A06H 3AYCA 3ETDA 5FZBA 2QTOA 4DO0A 4CU7A 5FY8A 3THTA 1WLTA 3ZYBA 3NJYA 4NR1A 4PA4A 1XJAA 4PDMA 3ZXEA 1MEC3 1WA6X 3VBRB 1MR5A 2YPDA 1OA3A 2BGCA 3RJ2X 3ES4A 1W6PA 3HNMA 4AQSA 2HWC3 2J22A 5JIUA 5EBLC 4JTDB 1K73W 4XJ9A 3O0VA 2R9IA 2VO5A 4L92A 4PLNA 3DF0A 2CGPA 5JI9A 2Q0AA 3D3AA 3CJIA 1LUWA 4O61A 3AK3A 4Y4YA 3L71H 2VQTA 5F3CA 5B1BB 4AILC 4DV1O 4FFBB 1W39A 1EN6A 4DYLA 1UOBA 1H8VA 4GMP3 5J2UA 4F8AA 1LHVA 1VBE3 2CH7A 4GMP1 4BIOA 4OI0A 3ABMC 2EXIA 2B5HA 5FMBA 3BIEA 1SQFA 1CAUA 1KMIZ 1VBA2 5C4WA 4OULA 4WFBV 4K21A 4CRQA 3A0NA 3I4IA 4BIZA 1I3HA 3AZYA 2JD9A 3MIEA 4Q8LA 3HBZA 1GAXA 3JAKA 2WQ4A 1PO13 3DTUB 3SPHA 1L8DA 1HXS1 1EPWA 2QGNA 4EWAA 4RHV3 2D6OX 2VD7A 4NRQA 2LM3A 4LOSA 1AJPA 1K12A 3K75B 4AXOA 5FZOA 3VBUA 3E83A 2Y34A 2RR12 3DPRC 3K3OA 1G8WA 5LEKA 1X82A 1WD3A 3AK2A 1OA4A 3AVRA 3HT1A 3K2OA 1VF5B 1C5IA 2Y4TA 1TQ5A 2EIKB 1B04A 3BABA 4XEZA 1QOOA 5LP6C 2GAUA 1SEFA 1XNDA 4IUGA 2ZEZA 4RSUA 4JI8O 4X65B 5IFPA 2JJ2G 3NW4A 2BFUL 4OVEA 2E7TA 1WPBA 2WZPP 2FMYA 4MZUA 2F43G 4YVWB 5FUPA 5H9SA 1XI1A 3CP1A 5GONA 5KHGA 5IJ0A 1O8SA 1Y76A 1NH2D 1YDXA 2IXKA 4AHWA 2E26A 2OA2A 5A7WA 4ASKA 3E97A 1ZL8A 1HNXB 1N33O 3DC6A 3KV4A 4DV6O 4I02A 2QM7A 1S0VA 1GQHA 4BMEA 2ZTNA 1LOBA 2X10A 4JKMA 2C1FA 4QMAA 2IJJA 4HZFA 4ITCA 3LEMA 4CCNA 1QJX1 3H1YA 2VZTA 1LJ7A 2ZDIC 1W6MA 2I2SA 5EXOA 3DSQA 2H0BA 2QE3A 3R4UA 3UGGA 3GCXA 1AI6A 3B7MA 2Q7GA 4MGKE 2RJKA 5FP3A 3HKEA 4DV4B 1O59A 2XVKA 5IT6A 3JCUZ 4MW8A 4FZ1A 1YJKA 2YIBD 2UXDB 1QNMA 2Q8OA 1NTMH 1NLQA 3T1HO 3EB7A 5B1BC 4GZRB 1N32O 1X8MA 1H2MA 2ATFA 2LALA 2Y0PA 1Q6UA 1MEC1 3OGIB 2IH3C 1CJDA 1NX9A 4HLTA 5K0UA 1WW5A 4ZOLA 5EYYA 4G3YC 5LOVA 3POSA 1EFRG 2VM9A 4CDXB 2GP3A 1KS4A 2DCZA 4BR6A 3HWJA 5L9BA 4QX7A 4CCCA 3BU0A 2DYRB 2YUEA 1HN0A 2R0FA 1WMXA 2C0ZA 4XFHA 3U11A 3R66A 1ULPA 1NOVA 5FPRA 4JAAA 5T5PA 2RS13 3ILNA 3AK1A 1W28A 3ZFFB 4NYKA 2BJSA 1CPNA 3UKNA 2GNBA 4Y24A 5CBGA 1WB8A 1NTZH 1PGSA 5LP6B 3VD7A 4Z2WA 4META 4CEWA 4QDQA 2VMCA 4LO4B 1AR92 4CDUA 4UW5A 4FAGA 1HDJA 1VF7A 2ARXA 2G1MA 2PHDA 3OR7C 4H37A 5KXEA 2YXHA 2WLMA 4UFIA 4E4ZA 2JKBA 1BYHA 3IPVB 2HVJC 2VMFA 5C7GA 1WMEA 3WUDA 1L1FA 4LBNA 5SV8A 2JDPA 1N8RW 1NBMG 5J2TB 2IFWA 4QDRA 1RM1B 1LEMA 2H0VA 1J84A 2ZE6A 4LFAO 5LEJA 3FHIB 1VBC3 1MSWD 2WWWA 3QH7A 1V6NA 4CP2A 2A3QA 1K97A 5F6LB 3U4XA 4TOIA 4H2AA 1BS3A 1QVFU 2CL2A 3J81N 2HBUA 2BSKA 4UT5A 1VAKA 1JODA 5LZ6A 1CAXA 2R30A 1O3QA 3FLRA 4GKXA 1ENXA 5IAXA 4R4ZA 3UL2A 3B09A 4MGTA 4MT8A 5FY4A 4LHNA 2CU5A 3ZHQA 2XBO2 4ZKTB 2TBVA 3K4DA 2O14A 3O0WA 1F15A 4PA9A 4Y4RA 3MEPA 4O7XA 3TGUH 3VQWA 5BNOA 2VMEA 3VDDB 1SQ4A 2N7GA 2G9GA 4URAA 2XT9A 1M9NA 3HKEB 2HYKA 4JGZC 2RHPA 2J1EA 5GZFA 2QQPA 1GM8A 2WO3A 3HD8B 2QSAA 3MF9A 2GC1A 5M0TA 5IYYA 5LHIA 3SPJA 1O3RA 1J95A 2ZCWA 2D2CB 3OD0A 1ZNPA 1T6GC 3D6EA 5A9GA 2GNMA 1VAVA 4UFMA 3H1JH 4XDPA 3NL1A 2VZSA 1POQA 1XNQO 2ENRA 2IU3A 3RYFA 3M3IA 1W3XA 2FZ2A 1SFYA 1ZRFA 2AYHA 3T08A 2VQEO 3K5MA 1FPN2 1TNRA 3LAGA 3ZLIA 5HXVA 4WCEV 5JMOA 5JVDA 4YM2A 1PVC3 1QHTA 1RUJ2 2A7WA 2OW4A 2XGXA 3E6BA 1FFXB 4BQ4A 2RM21 3RVYA 2ZX0A 4LBQD 1W6OA 3N3HA 5L3EA 3BCWA 5GKAC 2AH2A 4INDA 4M0NA 1XREA 4O4LB 4ZI7A 1NH2B 1OQEA 1Q6IA 3AKRA 4URTA 3KF3A 3MAQA 2V5YA 2DQ0A 1AL23 2PHUA 4I0AA 5LYJA 4LO6B 1DZRA 1ZREA 3HR0A 3VBUB 3J7LA 2VZRA 2GMMA 4JI3O 3UETA 4FFGA 2QQOA 2BVVA 1XNAA 4ZXEA 1NCRB 3H8XA 2OZJA 3PUQA 3ZEDA 1I5PA 1N0NA 4LJHA 5FNVA 1AJOA 2G38A 1M93A 4H7MA 1DF5A 4UBGA 3IT8A 4I2OA 1L3JA 1RFYA 3CMEV 2HFEC 5JIAA 4Q0SA 3QCWA 3K79A 1REFA 3T0BA 3I2GA 5F3EA 3SJAC 1YWKA 4L0PA 1W0JG 2ZHMA 5I8SA 2A0LA 2CH7B 3RWKX 3NAPA 1G9AA 2VUDA 1Q3EA 3ML0A 5JH7B 1OPMA 3EHKA 5EJ3A 3I97A 1ZBA3 4XJUA 4BZ4A 1OI6A 3BCCH 1ZVFA 4HKOA 4Q5OA 4AL9A 1JOJA 1CAWB 4AI8A 1JYCA 2MW2B 3NVCA 3IAPA 1S2BA 3J9SA 2NLJC 2NP0A 1QH6A 5BNNC 4YNIA 4K40A 5K8SA 2A6XA 3VBOC 1MS8A 4XIKA 1VQ5V 5IJRA 5A7NA 1YHFA 3WG1A 4B3TO 1GNHA 4Q0PA 1WBFA 5LA6A 2Y33A 1J59A 3CEIA 2QBXA 2ZJCA 2QR4A 3ZSJA 4KHPB 5CFDC 2XKOA 3ZMTA 1SLLA 1PO23 4UOJA 4DUZO 5HFLA 5JH7A 1CAVB 2TEPA 4WM7B 1XE8A 2NN4A 3LKJA 4J1WA 4CS3A 2DJVA 1W2AX 1NU1H 1H8HG 5BR8O 2V5DA 3I59A 3UNPA 4X64B 1AP5A 3ZOIA 4QX3A 3GM8A 1GRJA 2VCCA 3QNEA 5KC6A 3UQ8A 1T2XA 3ZIAG 4O9GA 2WLLA 1YXBA 3H1KH 1NQDA 4JI7O 4XF0A 3WF2A 5FYVA 1GZCA 2Y38A 3P3NA 1NCQB 3CKHA 4I7ZB 3ZYIB 2J1VA 3CLPA 4DV5O 5FYMA 1AJKA 5DDJ2 3VL8A 1MMMA 3K48A 3MUZ1 2BNOA 1BBT1 4P9JA 3D82A 1YSCA 3A0KA 3RYRA 4EEQA 1YC61 4BWOA 2ERFA 1OZ0A 2CNAA 1VQ6V 4OX9O 4M01A 1FYUA 4DR7O 4Z1VA 5FZHA 2ZOEB 4CEYC 3T2PA 1RUD2 3DXRB 3USUB 1LEDA 3W5NA 1OQDA 4NPMA 2W47A 3JD1A 3ICXA 4K1ZA 2BYVE 4IE5A 2B1GA 3L74H 2Q69A 1BEV3 1KDKA 4A7YA 3U0ZA 3N7JA 1G9BA 1GN2A 4Q1RA 3ALQA 4Q4X1 4YGBA 1BQ0A 3N9NA 1NCQC 2D5FA 3JD0A 2QDOA 1IQDC 4FOWA 4QKBA 1H2GA 1S0BA 1XBFA 5B2GB 1EZVH 1O4TA 1S2KA 1IG0A 4XAEA 1OXCA 1IVSA 2X29A 5I93A 3NNLA 3THPA 5C5UA 2F23A 5E6HA 1LECA 4GH4A 5DPNA 1LR1A 3R05A 5EPAA 2KM2A 2N05A 2ET7A 1ND3C 3RWNA 4MV2A 2XDVA 4XABA 4DR1O 3CB2A 1HDKA 1F7YA 3I2JA 1GTOA 3ZFGC 3B93A 2VZQA 3G6BA 4DR2O 3SJCC 1P4RA 1AXYA 1M4WA 5ERLA 4XFCA 4QJFB 1ZZ7A 4Q20A 3UK9A 3K5OA 3EQEA 2J1RA 4DNYA 1AYM1 3MW3A 1H1IA 1DQ4A 1XILA 3V0BA 2DYCA 2RS51 4H7LA 3BODA 1XOYA 3SISA 1NR1A 4K1YA 4CCJA 1YTFD 4LNUB 4EE2A 2XASA 2D44A 3K04A 4AEDC 1TZOA 1VRH3 2XHBA 2UURA 4DMIA 3CEWA 1IDSA 4QGPA 5IE9A 4AFAA 4D69A 1V55C 4L9BA 1ACCA 1BXHA 1OCZB 2QKAA 4XILA 4C0HA 4B4QA 4BK5A 3BVOA 4JZ2A 3J8F2 3UCSC 4LUKA 2Y6GA 4J11A 4TTGA 5FPXA 3KT1A 3GHMA 4C0BA 2PAKA 4F83A 2JIGA 3UT5A 1W8FA 1DF4A 2A6VA 1DF0A 2GALA 4EN6B 1SBEA 2X05A 3R0RA 5ITZA 3ZMNA 2E9QA 2ZQMA 4NMIA 1XMOB 1D0GA 2P3JA 5FLHA 2JIZG 1ASJ2 1QU7A 1F31A 2ZNIA 5GLZA 2IVJA 3OYWA 1YHQV 1LTEA 4UCTA 2IVIB 1AL0G 4JCKA 5ISLA 4KNCA 4QHBA 4FOVA 4Q4W2 5FPZA 2VECA 1F9KA 2PHRA 2GN7A 4G9SB 4NAMA 5E8AA 3FB8C 4LKEA 2HWF1 1OC1A 2BEOA 1SF9A 1G9FA 1PM9A 3KV5A 5FTTC 4YY3O 4IE7A 5HV4A 3AZVA 2PFWA 4EB6A 1WD4A 2XL7A 1Y3TA 5LP6A 4V2WA 1JFFA 2HWC1 1VBC2 5CA0A 1DGWA 4NXMB 4FBFA 3ZFFA 2UWCA 1GWKA 1O5UA 4Q4Y1 2UYBA 4X6QB 5FZDA 3VD4A 3A8TA 4C91A 2JD4A 3L9JT 4B3MO 1YJNV 1JUHA 1GYKA 3O0XA 1JZ8A 3AG7A 5TSWA 2FCVA 1N3QA 4L11A 4B3SB 3JD73 3ZJZA 1DGSA 3I5DA 3C7FA 1R083 3ZIXA 4M3CB 3T1MA 3JARB 1RXFA 4CZSA 1ULGA 4PDWB 4IV1B 4B3SO 1QXPA 2HKOA 1ENRA 2LTNA 3D4KA 4SBVA 3PUIA 3PN1A 2AACA 3A23A 4LK7A 3M4FA 1VE0A 5LGTA 2ZAHA 3GHNA 4FT8A 5AVPA 4IEVA 4LMFA 1LR5A 2Y6KA 5JPNB 4UB8Z 1US6A 5CMUA 2H6CA 4ISQA 1WCKA 1FOD2 2PHWA 4PA7A 3E86A 4GMP0 2BOCC 3ZN0A 3MDPA 4P2ZA 3IC7A 3QO7A 2DYRC 1LESA 4HSLA 1K4CC 1KD7A 2QM4A 2FDGA 3T1YO 4IYHA 3CCSV 2WNVC 5C8WA 1RUF3 2WNVA 1ODMA 1NLSA 2Q73A 3GVMA 5FZCA 1JYXA 4YGCA 2D97A 1A8MA 2NM1A 3RFRA 3OMIB 5F39A 2ZM6O 4RQPA 2YGLA 1YTFB 1P84F 1G1XB 4KP4A 2QUOA 2QWNB 4XZPA 4EB6B 4Q4W3 1Q43A 4PBPA 2YIDA 1DBNA 4FLVA 4RR3B 3OEBA 2W39A 1BVP1 2GSMB 4TQFA 1W04A 3J80N 2CGNA 1BHBA 2N74A 4JGYB 1D5NA 1RYYA 3PLQA 4N43C 3N27A 3WXPA 4F6RB 1GN4A 4YVWA 5D8AA 1O4YA 1QLEB 1EZJA 2DBNA 2ZE7A 5LMNO 2EIEA 3A0BZ 1XPWA 1FV2A 2QTWB 2GSYA 3WQBA 3OBZA 4J1XA 5FL7G 1RMU3 2Q7HA 5BV6A 1VQKV 1BLZA 4PJYA 3VBSB 1XQNA 1Z5WA 2B45X 3THCA 5FZ8A 5DQ0A 1RTVA 5IVFA 1IPSA 1QMJA 4C8DA 2WZR2 2VUCA 1PIV3 1RHI3 3B8NA 1JX9A 3POBA 1PIV1 3T1HB 3B4SA 4IGQA 3NKGA 2CSGA 3OEAA 2NR5A 4QKNA 1JZ4A 3LCPA 2DU1A 5FZOB 2HEVF 2EX3A 3STLC 1HXS2 2GNDA 1MS4A 4WFHA 5EJ1B 4LKSA 1YIPA 1ORQC 1GZWA 1ZZBA 1IS6A 3S0MA 3ZS8C 3H9VA 2WLHA 3AMMA 5HBAA 2E31A 4LNUA 3DXUA 1BK0A 3BHPA 3O7OA 2FL4A 5B5EZ 4FLXA 1FV3A 1V6IA 5F3IA 2A71A 4Q4V3 3LSQA 3O1SA 2P4VA 1SLTA 1MS5A 4AVAA 4LO8A 4E2QA 2P3YA 1N36O 5JUVA 4PI0A 5BPXA 3VLBB 4Q4X2 1AR73 3AJZA 1CEZA 4XE9A 5LL6Y 1RUF2 3ABMB 2JS3A 4I0XA 2IXJA 1LOFC 2UUCB 1OBNA 3WDTA 2B9VA 2JECA 4XF9A 5A32B 1V9U3 1NKDA 1ND2A 1KGYA 1PO12 2WYSA 4QU1A 3FE5A 3OBAA 5FV3A 1UMHA 4DRVA 4YGDA 1AL21 4EFEA 1IKPA 5FY9A 1I9RA 1PL0A 4XIOA 5TISZ 5A6XA 5IVBA 5J36A 4LHSA 2HYXA 2FHRA 1B35C 5GZEA 2ZE5A 3NXSA 3RNSA 4IV3A 1C8NA 3WNPA 1RUD3 4Q4X3 1D4VB 5J37A 1CZVA 3ACIA 2R32A 4JI6B 4DR6B 3J7MA 1WLEA 3F5TA 4YM3A 2BTQA 4LPLA 1GOGA 5A6YA 1W2BU 1VAMA 1M90W 3E5UA 4YZ4A 2OTJV 3HR9A 4DW1A 4GZ9A 5DDJ3 4OI4A 2YC2A 4DR5B 4R9AA 4DR3B 1TMF1 4N7UA 5ABJC 1M56C 2CYFA 1AR83 1HB4A 2K9ZA 1OF3A 1QNWA 3AMQA 1D2SA 4LFCB 4AHCA 1UD1A 4LBLA 3WCRA 1HRI2 4BH9A 3UESA 1RUI2 1UAIA 2K9PA 1KS5A 1IXBA 1UW8A 4UFKA 4B3NA 2WR9A 4IIJB 2OWOA 5DZGA 4FLUA 2GTAA 4QQPA 3GZEA 4X66B 1ENSA 3BTXA 2DUOA 1JCHA 3RZLA 1GOFA 1W05A 2TNFA 3AL6A 2B46X 5FZ6A 5I8TA 3WF4A 4Q1PA 4TSFG 3LPGA 3IAYA 3UGHA 1GFF2 1E5IA 5IVVA 3DECA 4IL7A 4DQAA 1GLHA 3PVOA 3T2OA 2HBTA 3DKWA 1J83A 1UXZA 5KHJA 1QEXA 4JAUA 4PD4F 1B35A 5BYNA 1KDMA 4FFFA 2YBSA 1W8NA 3TCUA 3ASNB 4NTYA 2RMU1 3OBTA 5F2WA 1N1SA 5KBFA 3B2EE 4RQFA 3BAAA 1W9SA 3T30A 1ZA4A 3NRUA 4I55A 1YQCA 3ZR6A 5FLXN 4IQPA 4LA3A 1IBKB 3E2EA 5FP4A 1VARA 4CXWA 2XQXA 3SR2C 2WT1A 2JKXA 4BQXA 1OCCC 2WO1A 5JXJA 4E2SA 4CH4A 2DCJA 3AEIA 1HRV2 1RUG3 1SHWB 2VCMA 5FZ3A 4QGMA 3KT7A 1F5JA 3LSDA 1DQ1A 4MGQA 1YO8A 1FOD3 4HPKB 3X29B 4WVZA 3K9AA 2YZ4A 2WAMA 1AR71 1AJNA 2F4VO 3MD0A 1XRUA 4GKYA 1GO3F 5IYZB 4KL1A 2KSDA 4JI3B 4FPGA 2W1SA 4MLOA 3LDCA 5F7UA 4FPYA 3WT3A 1AXKA 3MHZA 1QOTA 5IYZA 1ULDA 4Y22A 2YROA 4YVSA 2CHHA 1YLLA 2ORXA 3FBYA 3POWA 3MI8A 2QWQB 5D2AA 1YCIA 4XDKA 5FYTA 5GLTA 2XG3A 4UFHA 1RUH2 3ZFFC 4A42A 3AZZA 1IBLB 2PHTA 1ZX5A 2CY6A 3OPTA 1U97A 4ZI7B 3TBDA 3VBOB 1EAH2 2HKXA 1ZRIA 1YFUA 3W7XA 3PHMA 4I55B 1N1YA 2ZEWA 1QXJA 1VQ8V 5FQ0A 1PK6B 2JG8A 4DPNA 2PXJA 3T4DA 3WU2Z 1CR7A 1OVSA 4XJAA 2ZKNA 4FM2A 1V6LA 4N9HA 2AZ2A 4DXSA 3ZYFA 3M7AA 5LGNA 5LHGA 2Z79A 4YARA 4FOQA 2E3CA 1AZDA 3WDYA 1CESA 2RMU2 4O2BB 2VQFO 1OOPC 1LB2A 4RO2A 3HQXA 3IMNA 1PV0A 1WLDA 3ZN6A 4UV8A 3GNEA 2LO1A 4NPRA 4AI1A 4DV7O 1PMHX 2X7RB 3RYIB 2A5ZA 4YW1A 1PMIA 1JR9A 3S7EA 1MZEA 3CE2A 4ZIBA 2ZIOA 1NZCA 4X1YB 3KKYA 3W20A 1WW7A 2KKWA 2DYSC 5KMGB 5L9RA 3N7LA 2ZGLA 5KAIZ 1UPSA 1HJFA 2Y0OA 4ZZ8A 4NIIA 1OCRB 1UXXX 4DUZB 2XWJB 3FLTA 1D0HA 1Q56A 2ZGSA 4YW5A 3M3EA 2ZGOA 1R1A1 3ZFEA 3SJBC 4YJ3B 2Y8KA 3WNNA 2NYYA 1RUE3 4K6BA 2VE1A 1UKGA 4LE3A 2BQPA 3KM5A 4X1KA 3WY6A 4D6QA 4AFCA 5BNOB 2P06A 3ZR5A 4XETA 4TYSA 1LU1A 2BDRA 3DYMA 2YUAA 2E7AA 3IIIA 4FVMA 1KJLA 2EAAA 4BU2A 1QLEC 2WINB 1NZIA 3CSXA 5C33A 1PVC1 4UAPA 4CU6A 3IN9A 1YJ9V 5IWFA 1YFXA 3QACA 1R1BA 1DTOA 4AQYB 1SDWA 1YI9A 2YMZA 4QPIA 2C6SA 4HOOA 5EIBC 1HR0O 1WPXA 5LATA 3EFFK 1JA8A 2P2KA 2JE7A 1J1LA 2AEZA 2IW5A 2R7EB 4K8XA 2D3OW 3WSOA 3FYEB 1ZAUA 4PA3A 1EV12 4I5SA 1V6JA 3JB8A 4DUWA 5FUNA 2QWRB 4MGSA 3K3NA 1WUVA 4FPJA 3URFA 5EIBD 1FNYA 4XFBA 3ASIA 1WW4A 3ZFGB 3P32A 4I3PA 4LORA 4AGRA 2WSVA 3RN4A 5C4WC 2LRPA 3NV4A 1W9FA 4JKLA 1ZLZA 3OSDA 1QNYA 3ASNC 1LHUA 1U0AA 3AMNA 4I0XB 1XSRA 2D43A 3BUCA 2X0LA 1V9U2 1RVF1 3ON7A 1UZZA 4KBZA 4ASLA 2KG7A 2RS53 4YW2A 2ITCC 2DUPA 4XOGA 2HJDA 4R52A 2R1DA 1J3QA 2IFRA 4GWJA 1K34A 5FOBB 2NLRA 1MZFA 3N2KA 3JAWA 3T4ZA 1QQCA 1AR72 5LBBA 3CF6E 3GZAA 4AG4A 2ZGKA 1F4NA 4WVMB 4IEUA 1SLCA 5AVAA 3K46A 3A7QA 3AK0A 1PNGA 4ORFA 1UN1A 2BUKA 5FPBA 3I56V 4QPGA 3CWBH 3T1LA 2ES3A 2CDYA 4W8JA 4DXRA 5CG8A 1LGBA 1KKDA 3WNMA 4EKWA 1VALA 4AVSA 5FJHA 4X8PA 4EYUA 5FLJA 3KV9A 4YW4A 5H5NA 4AR2A 4LF8O 4W6XA 3OBRA 1COV2 4LFBO 3SYCA 4PV1B 1BQPA 5FZ7A 5T54A 1M06G 3JD3A 2VXRA 2P4KA 4PQ9A 1UPIA 2PHLA 3WX5A 3VBSA 1YVWA 1OOPB 1UQXA 3GGLA 1YRZA 2C24A 4LR4A 1K5MA 3LF7A 2W5FA 2YICA 1SPPB 1F51A 2RDQA 3HKDA 4QB1A 3M1HA 4AVVA 1PO22 2LROA 4YHHO 3PJYA 3O1OA 2PZSA 4CBCA 5F32A 1S76D 3CC7V 4GWIA 5LHHA 5C3PA 1S5HC 1SLAA 1CP9A 3WG4A 1XOUA 4QX8A 2BCCH 1Y6XA 2CTWA 2E76B 1PZ7A 3ZHSA 5C8CC 4DRRA 1NT2B 4UCVA 1PMJX 5JOZA 2FCUA 3KD4A 4MVZA 2XLAA 3QOPA 4XDLA 3EXUA 1HRI1 3EYPA 2CK3G 5B1AC 3FYIB 3LZZA 2X5IB 1QJY1 3ORJA 4X6RB 5T3NA 1SQBH 4B08A 1MSDA 5FPLA 1IG3A 4IEQA 2X53S 4IV1C 4AI9A 5JCOC 4HFSA 3ZDSA 1HN1A 1H1MA 2BE3A 4QQHA 3RI8A 4D7YA 3CCUV 1UIJA 1XNRB 2WA4A 3VHPA 2G4IA 1XQ8A 1R6KA 2NQYA 1VMGA 3DGEA 3KWVA 1ODNA 1R093 2FMDA 4XFAA 1SQQH 3W58A 3FZ3A 4HT1T 1H0BA 4B8EA 4XHBA 5C5TA 4IEYA 1IBMB 1UMZA 2QFEA 1K3EA 1AR91 2VXJA 4BXSV 3UT0A 5FR3A 1S77D 4AOCA 3K77A 3CCMV 1MVQA 2RJ2A 4ES9A 1JZ3A 2RR11 3C7OA 2WWJA 2KB1A 1AI7A 2GDFA 1BEV1 2ZABA 4CPBA 5LRSA 2VZUA 2FMLA 1ND2C 2GDSA 5GM0A 1U5XA 3I8TA 4AQ2A 1O3SA 4XURA 4N7IA 1XBLA 2Q0OC 3AXDA 4KMQA 2IC1A 1UX6A 3ZRWB 3JAWB 2E7QA 3AYDA 1J5EB 2UY9A 4JYAO 4BIFA 4X20A 2ZKLA 2SBAA 4XCAA 1RVF2 1S4CA 1VBE2 2ZMLA 3JBG3 4E8CA 1ZUQA 2VZ3A 4N23A 4YFZA 1Y7BA 3V64A 3Q8FA 4COUA 3ITQA 2DVBA 1G7YA 2OCCC 4BPZA 3RZHA 3PU3A 1AXZA 2XONA 5FBZA 3O14A 3FAVA 1OMIA 3ILRA 3P3PA 2QDNA 3VBUC 3N4MA 1W0NA 2DUQA 2PGGA 5LGUA 1FS0G 1VR3A 3WP4A 1AX0A 3TWIA 2Z4FA 1PNFA 5D5PA 1NCRC 3N2GB 3ZSKA 4OGQB 4GUNA 1CXZB 1JU3A 1R092 1ZRRA 2ZKOA 4JKKA 3ABKC 1W6PB 4AW7A 2GUZB 2ZACA 3OPWA 4K3AA 2GNTA 2JE8A 2IH1C 3ZN1A 3POFA 1S3JA 5AC91 1W2TA 1BHAA 5LMNB 1H8EG 4PIYA 4XTMA 3IWZA 3TB0A 1PK6C 2YY1A 2X5IC 5LBEA 2D93A 1FNZA 5FPVA 3WW4A 3RZZA 2DN9A 4TSVA 1H30A 4A3XA 5FBJA 2VVFA 3IFXA 4JASA 5FO7B 3ZHUA 4B7EA 3GF6A 2WFPA 3HMYA 2VZ1A 3CXCU 4E2GA 4LF5O 1UX7A 4XAAA 4MXVA 1PVXA 1K9MW 3PUAA 3O1TA 3E35A 2EILB 1LGNA 2FBEA 2GH8A 3MF6A 2VMIA 4HAMA 4GULA 3ZPOA 5KUMA 4W65A 3LGRA 4PDVA 4BLIA 3UO3A 3NJZA 5FZFA 4XACA 1X9TA 2EIJC 2JE9A 3O1PA 1QJX3 3OY8B 2V4VA 5KR7A 2EZPA 1UZ0A 4CCLA 2HP8A 5IYCO 4DINB 2HWB2 4KU8A 4XBLA 2WDBA 3RI9A 2AHZA 1N34B 1UZWA 1J1TA 5BNOC 1OHFA 1UY1A 1FT9A 1MQTA 2VCBA 1W8TA 4NN0A 2XB6C 3WG7B 4IYIA 5FY5A 4RA0A 3B94A 3TYJA 3K58A 4X1YA 1R081 4MHUA 4AEDA 1LU2A 4CDUC 4JRLA 3DXTA 3P5BA 4AVCA 4YW7A 1THZA 4XFIA 5K1XA 2GV9A 3C7GA 2YIAA 2EIJB 1K4DC 3ABLB 4OHYA 3M3QA 1GNYA 4KHPO 2B39A 1VBA1 1HQWA 4OLLA 4Y5Z0 2C9KA 2ID4A 1SQXH 4TUYB 2QCSB 2JG8B 2JXAA 3WF0A 4Q0UA 4ZU5A 3VOUA 1B06A 4PT6A 2D7FA 1Q7YW 2DWEC 5A3NA 5D21A 2A73B 4CXXA 5FYUA 4CP9B 3USUA 3LWCA 2G9ZA 2ZHKA 4UCRA 4CDQB 1WA4A 4W4ZA 3ETGA 1JPXA 2ZR3A 4IESA 2CGOA 2ZE8A 2HVKC 2ZHLA 1I5ZA 3LOBA 1TNFA 5F5CA 4YVSB 1FPN3 1E5RA 2D3PA 5ANQA 1P8JA 1E1RG 4FP3A 4EWEA 1K5SA 5FY7A 2OIGA 5T55A 1JVMA 1ENVA 1QJY2 3ENRA 2J1SA 4LBEC 4LFCO 3O1RA 2OZ6A 3N9LA 1VQLV 3RBZA 5H9PA 4LA2A 1UU5A 3RYCA 1QJU2 5FYHA 2EILC 4MHRA 2P7TC 1GICA 4OPAA 2BERA 4PA6A 2FDJA 3ZXAC 2P6CA 4FTBA 1CAVA 2VVDA 4AHYA 4H3WA 2RNBA 4YGEA 3BTAA 4QKFA 5K7PA 4GX0A 1PGL1 2UUBO 5C8YB 3X2QB 3QF7A 4JGSA 3NR7A 3F5WC 2RS33 2PI5A 3ZCCA 3MPPG 2PYTA 1AYN3 1VRBA 3N35A 1XU1A 4CC6A 2Z3YA 1OKOA 5J7MA 3QD6A 4Q0VA 4K7JA 2F1MA 4FZ0A 1R1A3 1DLLA 1KFUL 4Z82A 2CTPA 1PGW2 5GLUA 1DYKA 1GN6A 4WBNA 1K8AW 4NXMO 3P1IA 5IYBO 1JYVA 2HLEA 4A4AA 3OT7A 1NKGA 1RUG1 5JR2A 2XHKA 4TV8A 5L3BA 4JI2O 2LFRA 3FD9A 4OUSA 2Y6JA 3RZGA 3SH3A 2RQ6A 5HV0A 4W50A 5FZ4A 2HWE1 3AL5A 5A3WA 3IDCB 2JDKA 1NVPD 1ZBE3 1NQTA 2VRZA 3FB5C 1IURA 2XVLA 3P6BA 2JJ6A 3KGZA 1PNMA 4TLFA 5ABJA 1E5HA 3AMPA 3MHSC 2BZDA 5FNVB 3C3SA 1PO11 4IT5A 2XLFA 1COV1 1PL4A 4AI2A 4IL6Z 2LJ2A 4QQ2A 4D7TA 4YIPA 3B01A 2OX0A 1UL9A 4RHV2 4XZUG 2WZEA 1B6QA 2Q1MA 2VUJA 4JYCA 4XDQA 2QNKA 1CJPA 3HPNA 2PMWB 3SPGA 2E53A 2R041 3O9OA 1VBA3 1GK9A 1P49A 3NV3A 1B09A 4OHWA 4P14A 1ZTEA 4PF5A 4DR4B 3FL7A 4TWKA 4CDWB 3JD72 1H8TC 5C3OA 3SC7X 1AL22 2ILMA 1K3IA 4Q4V2 5G05L 5EBWC 5IHRA 3M99B 4O4IA 1XYPA 3JB4C 2CE4A 3GZUC 4PHZA 4X65O 3BRCA 2X5IA 4ES8A 4P9IA 1CVNA 1BZWA 3N7KA 4IXLA 2C5DA 1ND2B 5K1PA 1WMDA 3R6SA 3RPQA 1QGLA 3BGAA 2VH9A 2VQUA 3UV9A 3JSNA 1FATA 1GZTA 2V7QG 2DV9A 3WINE 4CEYB 1YF2A 1DGRA 2W6JG 3TXSA 2JENA 1V70A 1RUG2 2R6QA 4YZ1A 1HKDA 5T5OA 1WMFA 2B9UA 2IWGB 2WAAA 4GT1A 2P17A 1I5YA 3ZXLA 3ACLA 3ILFA 1HP8A 4O2AA 5EZYB 3TXQA 5DAPA 2EBOA 2FTKA 3RT3C 2ZD9A 1UFIA 4P5YA 3CCVV 2GU9A 4KQ7A 3ZRVA 2WZ8A 2QM8A 2HHHB 4KBBA 4DEVA 2RVAA 2ET1A 1OF4A 3VQXA 5BNNB 3WF3A 1GQPA 4B1LA 1NS1A 1AF9A 4LCUC 4PDRA 2VL4A 4COYA 2FDHA 3O5SA 4WVVA 1AYM3 1ZSPA 3U10A 2ZINA 2YPJA 4H33A 3ZSEA 3WZ1A 5HXMA 3ROUA 3HBKA 2XNDG 2OQ7A 3Q8CA 4M4PA 2HEWF 2B8MA 3WDWA 5G04L 2QWOB 1R3IC 2Z5UA 2OXBA 4HK8A 4MXWB 4CH5A 3EXAA 1SA0A 5CB7A 4JZGA 3NSTA 3LDRA 4XTPA 3STZC 5HCFA 2BOIA 2W08A 2DVAA 3H8OA 5BNNA 1Z2GA 1PO21 4X62B 3HNYM 2NPIA 4CS2A 2AREA 3N2KB 4XJ8A 3BY6A 1JYNA 2J7MA 2QQKA 5T5JA 4LIUA 3F7YC 4D3WA 1QIQA 3J4UH 3E5XA 4O4HA 4UB6Z 4X62O 3H3UA 3ST7A 5B66Z 2JIJA 2P4EA 3ZN4A 4UBHA 3CNAA 1TVKA 5D8AB 5KLVH 2DWRA 3PU8A 1OCZC 4F6RA 1TMF2 4UF0A 3LOIA 2D98A 5I8YA 5F1RA 2PTMA 2OUHA 1URFA 3L72H 4CEYA 3O65A 5J48A 2CTVA 4M0HA 2ARBA 4Q26A 4YW6A 5FK8A 3MLLA 4R8HA 5CVRA 1N33B 3L70H 3L75H 3WFVA 3PMSA 4COZA 4MTFA 1BBT3 2BTOA 1HJGA 3MUY1 2ZXWB 3TEYA 4WM8B 3CC4V 1DYPA 1QR9A 4HZ3A 2Q6AA 3MLJA 1I94O 2W2IA 5A3MA 2HWD1 4XF4A 4W4LA 3FMGA 2XAFA 1C4RA 5FZ1A 5JCOA 1P7BA 4CDWA 3BYWA 1I94B 4ZHNA 3PIGA 1YFYA 5T5LA 2EIKC 1JZ5A 4DV4O 1AR81 3DEMA 4UVAA 4QXBA 1S0FA 4R9BA 1BSMA 4QPIB 4MW3A 4QQOA 4CDXA 2HWD3 4U3JB 3WNKA 3UKVA 4CCOA 1EP0A 1JZ2A 3VZKA 2OYQA 1SQVH 2QVSB 3GBGA 2O8OA 2P90A 5H6QA 2EA7A 4B29A 2ZZQA 4P9GA 5J09A 1D4M3 2DE0X 2L9LA 4P30A 5IK8A 3TK1A 1WCSA 2CAVA 3JARA 5C6CA 3VZNA 4LF4O 3WVJA 3S3WA 5ACA1 5JDBA 3JU9A 5KAFZ 3LD8A 4OQ8A 4XQWA 5FFOC 4LO7A 4OXSA 4FXGB 2DW4A 5FUIA 5JJEB 3IB3A 3S5AA 1O8PA 3ZFEB 4JI1O 3WHUA 3B77A 1W6MB 4E4EA 3IJ4A 3PURA 5FP9A 3AG1C 5F37A 1JJ2U 2R1BA 1R1A2 2VMHA 2A3WA 5BMVB 5BY1A 4P9XA 1ULFA 5B1AB 1PGW1 4MVUA 4JI5O 2D6PA 5JAXA 5JXHA 5CA3A 1YUDA 1A8DA 4D6RA 1UKRA 1UOFA 5LMUB 3TAYA 2R071 3WNXA 1Y9GA 1AYN2 1JZ7A 4AF9A 1ZZ8A 4O2BA 2XOKG 3VZLA 2ADEA 4JRAA 3FFZA 1E57A 1H2NA 1TEIA 2ZDIA 4O65A 3HOBA 2IJKA 3WUCA 1RUC3 4XJZA 2BGOA 1PK6A 3B9CA 4BQWA 1O6UA 2QZ3A 3N9QA 3H50A 1DQ0A 4RGKA 2G9FA 3I3EA 1R091 3W7SA 4GB32 1NY72 4NUBA 1XNTA 2WYFA 4NIHA 1O4ZA 3ETQA 5KUKA 3BOWA 4QPKA 5ANNA 3E8FA 4AFBA 4QX0A 3G7DA 2F4VB 3S7IA 3PDQA 5JLVA 1K5QA 1DLBA 3QVNA 4RN5A 3E8HA 2WSSG 4I0WB 4BAYA 5LXTB 2AR6A 1BCXA 2JDHA 1AB3A 1C8M3 5FY0A 4ATFA 1UZVA 5L9VA 5CADA 1KXGA 1W8HA 4JYYA 2Z42A 5F8PA 4DXTA 3UO2A 1CZSA 3W7UA 2ZX3A 3Q4HB 5L73A 3ACHA 1W99A 3LIGA 1EAH3 4FM0A 4E8DA 2LW7A 2E63A 3M3CA 3VBHC 3T3YA 2BPA2 1GP4A 2M7WA 4I3GA 1D2DA 5B3SB 3T4VA 1COWG 4TV9A 4EWDA 5I0SA 4CP9A 3K5LA 5IK5A 5L7OA 2BWCA 2M6YA 2P37A 2CUGA 4Y5TA 4LR3A 1UYZA 4XPVA 2XOMA 3HEIA 1WKYA 4A6SA 4M3CE 2BTVC 4P9PA 1JHNA 3SQOA 1C8M2 4K35A 1OUXA 4DRXB 4EV0A 5FK7A 1JBCA 1BKZA 2LUWA 2LGQA 2KQXA 3HKBB 1S0GA 2P6JA 5AG2A 4Y1UA 4I9WA 4Q27A 5T52A 3U14A 3AZXA 3J7HA 3H3LA 4LULA 4R4XA 3WB0A 3KCCA 2JK5C 5FYBA 3R4DB 3CZJA 2Q7EA 1FXKA 4CCKA 3MV01 5FYIA 3AG2C 3FUOA 3Q8BA 1PIV2 5HCAA 3FJSA 1BHGA 2ZMNA 2HWB3 1RUF1 1ND3A 4LH6A 5JOXA 2VTXJ 2UXBB 3H1MA 1V6OA 4UCOA 3CIHA 4I09A 5C8CA 1VBB3 4DB5A 1NXD1 1HW5A 3ZYJB 1OLME 2UXBO 3WR0A 4Z2AA 2RE9A 4NO4A 1XSQA 1FXHA 2WNOA 3EBRA 4EN8B 1YYNA 4JV4A 2YFZA 2W52A 4YLZA 1NCQA 1JW6A 2WN3A 4OMDA 4PLOA 3MFAA 1SQGA 3ZSLA 4XQDA 1VMHA 1JYWA 3E1F1 5C93A 2GBOA 4LP8A 3OB8A 2ZX4A 3VQYA 4IW3A 4DR7B 4TWTA 4JQRA 1AYM2 3DUIA 5C8CB 1IS5A 5A1LA 2NMOA 5FO9B 5J96B 4CXYA 4GAZA 3ZO0B 1JMKC 5EZWA 1RJ7A 1W0OA 1XU2A 5GJ6A 4XDJA 1F35A 2XL9A 4ZHQB 2V4AA 5EFUA 2IXCA 1V0AA 3OUSA 1VF6C 3H0OA 5E16A 1GOHA 2VOKA 4D7SA 1VB2A 3CCJV 1UOJA 3S30A 2EIGA 4BW9A 1QWRA 5LY1A 5K4LA 1LHOA 5LA6B 3POYA 3J7NA 3BU7A 2YEVA 1X59A 5JQGB 1DGLA 4LBJA 4DY5A 4DUYO 3H3ZA 2BOBC 3AP6A 4NHXA 3MYXA 4K9SA 1HNXO 4LC1A 5DUWA 3AKQA 2R16A 4U7NA 3ECQA 2E75B 3W59A 1S72V 2HWF3 4CH6A 3FKSG 3MDSA 1VEWA 3FAVB 1HW7A 2UXCB 5APAA 1RUNA 5L7OB 1W8OA 2MPFA 4AHXA 4NAOA 2IXIA 2QEXV 3OMAB 3AVSA 3RRDA 4TV9B 4ZBMA 4PI2A 3HPLC 1Y4WA 4JYBA 4DIQA 2W46A 3H8UA 5CA1B 1SCRA 3RYHA 4S2FA 2UXDO 4X20B 4LBKA 1XNBA 4IEZA 5KWRA 3ZRWA 4ASUG 2ZR2A 2K46A 2QQLA 2VW1A 3ZMVA 3LA2A 5JOWA 4Q4Y2 4N21A 2ZGNA 2CTRA 2JB4A 1PD3A 2PHFA 5CNAA 3ABUA 3ETEA 1TAEA 4DV2O 1GMMA 1F4HA 5B4XA 4OHVA 4AWDA 3OTFA 1DQ6A 1Y9MA 3FBMA 5EQUA 1JYIA 2ZNJA 2VZPA 2MEV2 4IETA 4YJ2B 3RQ0A 1PNLA 1M5IA 3KVBA 2DYSB 1G9CA 1V6MA 1O7FA 1HB3A 4U2AA 1OURA 2A1XA 5F5IA 5HI0A 4UV9A 3OEEG 4COVA 4NROA 4LBQA 1DFQA 1PX4A 3M8LA 3PUSA 1WCQA 5JMCA 5A7PA 3DYPA 4A6OA 2OKXA 3WP3A 3VL9A 5IJ9A 1FFXA 1YQ5A 3AC0A 3AYEA 1PZ8A 2EINC 1ST8A 3I54A 4AAPA 4CUCA 3CPWU 3GYDA 3B8MA 3OCPA 3SEEA 3UKTA 3EJKA 3V0AB 3N7MA 3LDEA 1YJWV 2R9RB 3LNMB 2Q5ZA 5IAVA 2D3SA 3A0HZ 3H1HH 2VOTA 4FQZA 1X50A 2FYUH 3QLQA 4LT5A 3VUOA 1TGOA 1RXGA 1L7LA 4NE9A 2ZMKA 1VBB2 5BMVA 2WNUA 2A9HA 3JD4A 2LFSA 5J3UA 1CX4A 2WZR1 4LF7O 2Q8VA 1K5MB 5LA9A 1XNRO 1UO9A 4J6GA 2VVEA 4HMZA 1PP9H 3LDKA 3LEKA 1NG0A 1STMA 2JRIA 4IE6A 4QPYA 1NJIW 5DG1A 3RVZA 3K3WA 2Q4SA 3H1WA 4CS4A 5CU1A 3MIFA 1CIWA 4P08A 4FLYA 5SV5A 4UCSA 3ZXJA 2ATKC 2E5LB 5C71A 2QQJA 4I4TB 3DN7A 3JZVA 2BSKB 2DTYA 2RMU3 2X6CA 3KF5A 4JTOA 1K7DA 5JJNB 1LULA 1JXNA 1CN1A 3U1XA 1BMFG 4UW6A 3BB6A 4FPLA 1SZTA 5DMYA 3TEXA 1D2QA 2V1DA 3GWOA 4XDOA 3LEIA 4QM9A 3WG7C 2FDIA 3VV1A 2A6YA 1EUTA 2YU2A 2DCTA 5DN6G 2YC4A 1DZTA 1GNZA 4HETA 3TNPB 4ATEA 2ZZJA 4YHHB 2DWDC 2FQPA 3OOXA 4DK0A 4A2UA 5B4NA 2R043 1KYOF 1IXMA 3QTCA 1XMOO 2VZVA 4QGLA 5A7OA 1FXVA 3JBG1 5CA0B 1JFFB 1MOFA 4Z07A 4UCUA 2W9XA 1VP7A 4OHXA 5FXWA 5EIYB 3ZYRA 1UU6A 4CYDA 4MVOA 3VDAA 3I3QA 2WSUA 4XUTA 4LF6O 2I74A 1ENQA 4G4FA 2OPKA 4YVWC 1ZZ9A 3S3XA 3DGTA 4RHV1 1NY71 3ZFGA 3SHRA 1WB7A 1TMF3 1TVKB 4LF6B 4Q4W1 1ZA7A 1UYXA 1EV11 2OT7A 3UJQA 4MX3A 3SEPA 5F5QA 2FDKA 4QE9A 4QHOA 1CD3G 3NNMA 1H6XA 5CKMA 2XXZA 4IEXA 3ME2A 1S1AA 1AR61 2RV9A 3UT5B 4FI9A 3LFMA 1G86A 2JWPA 4FPKA 1SA0B 3L9DA 3MZHA 3MW4A 4D6SA 3ZMUA 1N32B 5LOVB 4F7ZA 2WWUA 1XB9A 1ZBA1 4KU7A 5K0UB 1NE4A 4JTAB 4F4LA 1BMV2 3SYAA 1MA1A 1RHI2 3C2UA 3HKCA 4L97A 1OFSA 1DQ2A 1C1FA 1O9HA 1AP6A 5JCTA 4UFZA 4EJRA 4RQPC 4GJZA 3SCFA 2XPJA 2YI8A 4B3RB 1HNZO 2O8QA 2IUWA 4XXPA 3B40A 1S0JA 4ONUA 2DU0A 1NAEA 3ZKYA 1N34O 3SGIA 3WQ1A 3KV6A 5EZYA 4K0KO 2C26A 3KSCA 2VMGA 2WJSA 5LA0A 3E89A 2B1IA 4MVSA 2W92A 2YI9A 1RUE1 2VJXA 3SYQA 4DV3B 2VOVA 2B9ZA 2ZM6B 3CHXA 4FQ4A 2XAJA 1SLBA 1ZRDA 1ZL8B 4L87A 1UWWA 2WWSA 2W87A 1COV3 4RL7A 3G4SV 5GONB 3JASB 2GP5A 3ZN6B 4Q8KA 4AGVA 3KQ4B 4OUEA 5L3CA 3AB0A 4AYUA 3WB1A 3AYAA 1POV1 4QWNA 2ETNA 1Y74B 3CMGA 3I2IA 3KMHA 4FVVA 4R6ZA 3TEWA 1MVEA 2DFBA 4RUEA 2ZX2A 2PYJA 4C7UA 1VQOV 2ZA9A 1FAYA 5FY1A 2EJ7A 5CFCA 4MYEA 1NA1A 3ZDVA 1LENA 2R0HA 3CYOA 4B1MA 2CAUA 4OCTA 4B4RA 4Y3OA 1AX2A 1W90A 3B9IA 1RPRA 1TVGA 4ET7A 4JI6O 4DR6O 2XAGA 4YZ3A 2DFCA 2Q8EA 3I3DA 3F2ZA 5B1OA 2H3OA 2AGAA 4P5HA 5CB4A 1TME3 3N36A 4HN0A 5CKNA 1CQ9A 4Q6GA 2WLQA 1PHMA 4C1WA 5IATA 2QQIA 4TXWA 1RUJ3 4DR5O 2EXKA 5IK7A 1UY2A 1JTZX 5ABJB 4UFJA