1Q5OA

Hcn2j 443-645 in the presence of camp, selenomethionine derivative
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
201
structure length
201
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title STRUCTURAL BASIS FOR MODULATION AND AGONIST SPECIFICITY OF HCN PACEMAKER CHANNELS
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 57
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2003-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1q5oA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1q5oA02
2Q30A 4HVOA 2P17A 4QGMA 2QNKA 3QOPA 4LTAA 2OYZA 3DV8A 1RTVA 1VJ2A 3SCGA 2UYBA 1G6NA 4N9HA 3TNQA 3WW4A 3LZZA 3I59A 3OCPA 4AQ2A 3H3ZA 2OZ6A 2PAEA 3QACA 3ROUA 4XF3A 4MGKE 1J58A 4AQ6A 5LRRA 3HT1A 1IPJA 4I01A 3B02A 3SCFA 3UKTA 4QGLA 4P9GA 1CAUB 1ZZ7A 1YFYA 2EAAA 3E6DA 4IEOA 4R8HA 3MYXA 4LEJA 4EV0A 2D93A 3BALA 3OF1A 4IERA 4LA2A 1EYBA 4HBNA 4IEUA 4LA3A 4DINB 2KXLA 4FAGA 2IXKA 5EFUA 1CAXA 2Q4SA 4XFGA 1X8EA 3NKTA 1FXZA 5FQ0B 3LA7A 2Q0AA 4AVCA 3OD0A 5F1RA 5FQ0A 4JTNA 1I5ZA 4KWKA 2UY9A 3HQXA 5EZWA 2PTMA 1ZRRA 4PIYA 1EY2A 4HSLA 5LEKA 5D1IA 2ATFA 1CGPA 2QJVA 1OD5A 1O4TA 3FWEA 5AVPA 1PMIA 1FI2A 3E5QA 1HW5A 3EQEA 3NVCA 1NXMA 3WW3A 4ZU5A 3OTFA 4H7LA 3FZ3A 4NVPA 3D82A 1J59A 4I0BA 2PFWA 1SQ4A 4XFHA 1YFWA 2CGPA 2HKXA 2QCSB 2XL9A 2UY8A 3G7DA 3IBMA 3I54A 3KCCA 1LB2A 4MH0E 1ZRFA 3CEWA 2HJIA 2IXIA 1O3QA 3I59B 4I0AA 2EVXA 4Z82A 4L2NA 4UBHA 2B9UA 3CO2A 1ZRCA 3BB6A 5I8YA 4IEQA 2IC1A 4YARA 2MNGA 4D7SA 3NSTA 5JR7B 2IXCA 4F7ZA 4PIXA 2PYTA 3EO6A 4META 3VHRA 3ACLA 5T3NA 4I02A 3PLQA 3JZVA 5KHGA 5BY5A 2GC2A 2PA7A 3LA2A 5I8SA 2Z69A 3NJZA 1Q43A 5FLHA 2C0ZA 4YNIA 3MPBA 4YRDA 2VQAA 3OGJA 4Q0VA 4MX3A 1RC6A 2O8QA 2OZJA 3I7DA 5LRSA 4QXKA 4OLLA 3BU7A 3NW4A 4IEXA 2XKPA 3E5XA 4EWEA 4UBGA 2H6CA 3FE5A 4HSJA 3CF6E 1VR3A 1ZZ6A 3RNSA 1OI6A 4XFAA 1PM7A 1X8MA 5KHKA 2QDRA 3WW2A 4E2SA 2PAKA 4D7TA 3EBRA 1OFNA 3BCWA 5E16A 2GU9A 1O5LA 2PHLA 3KSCA 3DL3A 2Y0OA 3U0ZA 3FX3A 1WGPA 5J7MA 5JSPA 1CX4A 3MDPA 3ST7A 1LKNA 3H7YA 4Q0SA 3N4MA 4HZFA 5JCTA 2OA2A 4XFFA 2BYVE 5J3UA 3L2HA 3LA3A 1U12A 1L3JA 2GC0A 4AVBA 2VECA 1O3RA 4IETA 3LWCA 4IEWA 1V70A 5CADA 2XLFA 4QX5A 3U11A 2DCTA 5I0TA 1ZZ8A 4XF1A 3BPZA 1RL3A 2CV6A 3SMHA 1CAWB 2O1QA 2PHDA 2BNNA 4R52A 3FFQA 3KGZA 4K8FA 2Z2SB 3UKVA 4YYOA 5BUVA 4ONUA 3CL1A 3M70A 5KHHA 1GQHA 3USSA 1RUOA 1Q3EA 2XLGA 5I8TA 4XEZA 2BEOA 3FJSA 4XF4A 1ZZ9A 4RD7A 3IWZA 3HIFA 2XLAA 3LOIA 4KWLA 3RYRA 1DGWA 1Y9QA 4ZU7A 4O9GA 4A2UA 3IDBB 3ES1A 1X7NA 4IEYA 3E6CC 3MZHA 2EA7A 2MHFA 2WC2A 4YSFA 4OFGA 1ZRDA 1O3TA 1QXRA 2K9ZA 5FLJA 5JSRA 2FQPA 1VP6A 2XKOA 1OMIA 4EROA 2ZCWA 3M3IA 4Z07A 3SXWA 3ELNA 4LULA 1CAVB 4LUKA 3KGLA 5BXXA 4JVAA 2CAVA 4HN1A 4IESA 3SHRA 5JSOA 2GZWA 1SEFA 1J3QA 5J48A 4AXOA 3C3VA 3H8UA 3DKWA 4MZUA 1DGRA 2ZKLA 5HI0A 5FPZA 3RYPA 4I2OA 1DZTA 1UPIA 1UW8A 4LLOA 4E2QA 4I3PA 5BV6A 3TNPB 3U10A 2I45A 2D40A 1RGSA 4MV2A 4QM8A 4Q0QA 1UCXA 4F8AA 1LRHA 2XHKA 1WLTA 1YLLA 3H1MA 1ZVFA 2ET1A 4Q0UA 3H50A 4WZCA 4AVAA 2N7GA 5KHIA 4XETA 4XF0A 4BHPA 1O5UA 5I0SA 4Q0PA 1GQGA 1H1MA 2FMYA 4EWDA 4L11A 4IEVA 1NYWA 1CAWA 3H1YA 1NE4A 3KMHA 3GBFA 1QWRA 2BNMA 2GH2A 3SCHA 3RYKA 4CYDA 1DZRA 5KHJA 3RDIA 1O3SA 1YUDA 5K8SA 2PQQA 2GAUA 1UIKA 4J1WA 2H0VA 1EP0A 1XE8A 1UD1A 2XGXA 5CVRA 4MGZE 3S7IA 5C6CA 1CAUA 1YFXA 4E2GA 4JV4A 1YFUA 4BIFA 3CLPA 1NE6A 2GC3A 4HVQA 3PNAA 4HN0A 4N9IA 1Q5OA 1Y3TA 5FDBA 3H1WA 2V09A 4HMZA 1NZCA 1J3RA 4KU8A 2ET7A 4BH9A 3E5UA 3CJXA 2D5FA 2B5HA 3GYDA 4MUVA 1YWKA 1XE7A 4IEZA 4X6QB 4FBFA 2GC1A 1FT9A 3IIAA 3R6SA 3H7JA 3RPQA 4IEPA 2PAMA 4JTOA 3EHKA 4GULA 5I0UA 1SFNA 4UXAA 1UIJA 2XL7A 5FPXA 4LUMA 3O14A 5I91A 2BGCA 4EWAA 3H9AA 2ETEA 4HVRA 1IPKA 4WBBA 3LAGA 3S0MA 4FAHA 1CAVA 1ZX5A 3ES4A 3IDCB 3ZDSA 3RZZA 1ZREA 1J3PA 4TLFA 4J1XA 4QMAA 5I93A 2OPKA 4BYYA 4XFIA 1I6XA 3NL1A 4KWJA 4MGIE 4XFBA 4XF9A 3UKNA 3FHIB 2K0GA 2QVSB 2WFPA 4ORFA 2MPFA 1ZNPA 5JAXA 1LR5A 1ZZBA 1QY4A 1QXJA 3D0JA 4FT8A 1TQ5A 2IXJA 5FCCA 4I09A 1JUHA 2IXLA 4ZU4A 4WVZA 5BPXA 1O7FA 2E9QA 3H3UA 5I0RA 3S7EA 4O9EA 1X82A 5LEJA 4QGNA 3HT2A 5E1RA 4X6RB 1YHFA 3E97A 2IXHA 2F4PA 4Q29A 3ETQA 3DN7A 3EJKA 1EPZA 3D0SA 1WA4A 2H6BA 5CU1A 3WW1A 4HLTA 4QM9A 2VPVA 4KL1A 2CAUA 3PVBB 5C8WA 2BNOA 1XRUA 2Q1ZB 1J1LA 4PIZA 4MGYE 4XFCA 4B29A 1H1IA 1ZZCA 5FLIA 5KBFA 3E6BA 1RUNA 2D5HA 2B8MA 2UYAA 4KU7A 1CAXB 4PJYA
chains in the Genus database with same CATH superfamily
2Q30A 1JYIA 1LUWA 5DN6G 1G6NA 4AQ2A 4FK5C 1QJU1 4NHKA 1UNBA 2PAEA 3ZRVA 1BLZA 4UCSA 3C7HA 2Y26A 2VW0A 4FCAA 4D7YA 3SCFA 1F7YA 2ZX1A 4CDXC 4LBJA 5LBCA 3ZMUA 1RUE2 3FLTA 1GOGA 2D93A 3VDAA 2JENA 4CA9A 3OJBA 5BMVA 2W68A 1R1A2 4LA3A 1N1VA 2BQPA 4XFGA 5A3UA 3L72H 5IK7A 3ZOIA 2P4VA 3OUJA 1RXFA 4QGPA 2BW8A 4ZI7A 4E4DX 2J1TA 1X4TA 1L8DA 2PTMA 2YPJA 2O14A 3WNXA 2VOXA 1LESA 2Q1FA 1OD5A 4IE5A 1Q56A 1Y9GA 3OTFA 1M1KW 1W6NA 2A73B 1PL4A 3SPGA 1ND2A 1VBE3 1GNHA 2Y8KA 4U7NA 1YFWA 3PUAA 4GH4B 3O1SA 4NR1A 4OYUA 3VD7A 5GONB 1VMHA 3K0DA 3G7DA 1K5MB 4MH0E 4RA0A 3WEZA 1DDLA 5M0TA 2AZ2A 1RFYA 4X88A 3N35A 5I8YA 4TWKA 1SESA 4Q26A 4UI9L 1BGYH 4DR2O 4I02A 3NAPC 2WNUC 4D3WA 4DNYA 5EYPA 2PQSA 3WNMA 1Z7S2 3O1UA 4MX3A 4IV3B 3ZSLA 2KA3A 1OHFA 5LBQA 1CPMA 4XAEA 4QXKA 1Q8SA 1V55B 2FB5A 1FXKC 2BOCC 1DQ5A 4LORA 4PJ0Z 4LNUA 1ZM1A 2HWB1 3DXTA 1QHTA 4YHHB 5B5EZ 1YI2V 4CEYB 4A3ZA 4P9JA 4D7TA 5BNOC 4ZIBA 1D4M1 1YRZA 4WVVA 3HEIA 5IT6A 1V6JA 5JIAA 4PDWA 1BMV2 4ZXEA 3JAKB 2XTAA 2WA3A 4D0QA 2YROA 5LZ6A 3UJQA 3DF0A 1O3RA 1E1RG 4QPIA 5D8AC 1WAZA 1OCZC 1XXNA 4G3YC 5I0TA 5CZKA 1ENQA 4NXMO 3IAQA 3OR6C 1MS0A 3VL8A 4XZUG 3D36C 2E74B 2BPA2 4A4AA 3SJCC 3WDWA 5FBZA 4UFLA 3FX7A 3OPWA 4PQ9A 1JN2P 3IC9A 1GQHA 1K4CC 1Q3EA 3M8AA 4F3JA 1GU3A 3E8BA 4HAMA 1ZZ9A 1Y9QA 1H2KA 3JCUZ 4KG8A 4UFJA 2N04A 3HOBA 4JI4O 5C9AA 1FPN3 1SHWB 3KCXA 5GALA 4Z07A 4RR3B 5FO9B 1HRV2 4YZ4A 4COVA 3FFZA 1VQ7V 3OR7C 5J48A 5H9QA 2VY0A 4E8DA 3KS7A 2QFEA 1OA2A 4FQ4A 1NUKA 3B00A 4NAOA 3AG4C 1S5JA 1AJNA 1O59A 4HYOA 1XMQB 4AFBA 1RXGA 3IT8A 4DV0B 3W7WA 3ACFA 1YIFA 5AC92 1PO21 2R062 2HLDG 3ENRA 1AVMA 4E8CA 5J2TB 4L99A 3OW2U 3SPHA 1Q7YW 4JKMA 4XCAA 1WCSA 3LPGA 4CYDA 5KHJA 4G27B 5K8SA 2HWF1 1UIKA 3R4SA 2LGWA 5CA1A 4XBNA 1DU3D 2WFF2 2XGXA 1G8MA 3POYA 3M99B 2D3RA 4LO4B 2WIIB 3CLPA 3W5MA 3WT3A 2P6HA 2FBEA 1VE0A 1F5JA 1WUVA 3WDVA 1KU9A 1TMF2 3CJXA 2ZKNA 1Q81W 5L7OA 1GZCA 4WM8A 4Q1RA 1TEIA 4BPZA 2UWAA 4MLOA 1DLBA 4TV9A 1AR81 2GV9A 4YW6A 5FREA 1GLHA 3TCUA 1U5IA 4QAWA 4LUMA 2YS8A 1E5HA 4EWAA 1AUYA 1DIWA 2ETEA 1PZ8A 5TSWA 1SLAA 1BBT3 2VZPA 1GP5A 1IBKB 1ULPA 4XF9A 4X89A 4QXHA 2MEV2 5JAXA 4W65A 1HB3A 4Q4V2 5FZDA 5J96B 3W7UA 2W87A 1NLRA 1W39A 2HWD3 1ZA4A 4AFCA 3ZYFA 4D8MA 4DUVA 4BW9A 4HKOA 4UAPA 1GKFA 3ABKB 5KMGB 3N9OA 2AW9A 1JHNA 2ORZA 1JTZX 2JDIG 3QNEA 3G6JB 4KG0A 3PMSA 4QM9A 2CYFA 2GUZA 4E4HA 3ZSJA 4MTGA 1IBLO 4UCOA 3DYOA 3ZN1A 2VZVA 4NIIA 4X20B 1QJU2 4NIGA 4QB6A 3KF5A 4COYA 4NTXA 2A6WA 4YG3A 5JMCA 2XG3A 3DV8A 5KXDA 3ZYJB 1Q8QA 2P6CA 2R071 2QKDA 3FC0A 2LJ2A 1RUF3 4K3UA 2E7QA 1JYNA 1FAFA 3ZCCA 3CC7V 3O1PA 2J1SA 1DGWX 4Q8LA 3AG7A 4PELA 1IPJA 3AFGA 3UKTA 2MEV3 4P9GA 3E6DA 1DHKB 2ZX2A 5EIYB 3CXCU 5F3IA 2QQMA 1YIPA 4CDQC 2ZDIC 1ND3B 3ZPOA 1JZ5A 3SPJA 1HP8A 1X8EA 4B3TB 2FYUH 2UU9B 4FLWA 2PI5A 2A0LA 1CESA 4B3MB 5KX5B 4AVCA 3PUIA 3OSDA 1OC1A 2UY9A 5C3RA 4QQLA 4DUWA 1S77D 4LHKA 3ZXAC 5ABJA 5D2AA 5AVPA 1QJY3 2EXJA 1YQ6A 4K6BA 3AMPA 1Y43B 3WW3A 1AF9A 1GV9A 4XDQA 1AR73 4LF8B 5TISZ 3UETA 4I0BA 2PFWA 3CCRV 2CGPA 2XL9A 5FXWA 2JDKA 2YXSA 5DUWA 4CCKA 1GOHA 4RR3A 4KP4A 4I0AA 4AGGA 2JIZG 3AL6A 2CGOA 1DFQA 2Q8EA 2XB6C 5I0DA 1ENVA 1J1TA 3BTXA 5FZBA 1N34O 4PIXA 2PYTA 5L36A 3HKCB 1ULFA 1WN7A 1VQKV 4DV4B 5ERLA 1M5IA 2HYXA 5EPAA 5CAZA 3VHNA 5BNOA 2J7MA 3ZVXA 3FD9A 4Q4V3 2F4VB 4EEQA 1N36O 2IM9A 2RDRA 3K59A 1CPNA 5LRSA 2OXBA 2EF6A 5LY1A 1BEV2 1E79G 2BTQB 1ZL8A 1UMIA 2J22A 4BIOA 3LEGA 4P2ZA 5C8CA 2L9LA 4Y1YA 5E1AC 4DR5O 3FB8C 2AREA 4PDRA 4E2SA 3VKMA 2QGNA 3SJBC 1C28A 1OFNA 2WNOA 1A78A 4HONA 1W2OA 2G9FA 4CU8A 4OI0A 3AJZA 2ZE8A 3F5TA 4DEQA 2R32A 1QNWA 2OA2A 5FXVA 4IL7A 1LU2A 4KGGA 3HKDA 2IH3C 1Y67A 1WMXA 5F7UA 4LF6B 3C7GA 4O4JB 3WB1A 2CL2A 3VBSC 4E4ZA 5BMVB 3GHMA 1W9YA 2P3YA 1YTFB 1AP6A 4XQ4A 1W8NA 2FHRA 4XF1A 1AVBA 3ICXA 2PXJA 2WNVC 4CDUA 4GD4A 4EB6B 4CS2A 3QD6A 4AF9A 4R52A 3C8XA 1HDJA 2IBZH 5LK5A 3MO4A 2QE7G 2W94A 3WY6A 1R091 1L7RA 1FOD2 5LYJA 1MACA 3BYWA 2G4IA 3N2KA 4MSWC 2GP5A 3DC6A 3ON7A 5FPRA 5BNNB 1O91A 1DCSA 3E6CC 1AR83 1BEV3 4ZS2A 2GMMA 3PTYA 3KGLA 4URTA 5JSOA 4CDXA 2K9PA 3DKWA 4HFSA 5FPZA 2VBPA 4IXLA 5FZMA 3T4VA 4KGQA 1H8EG 4UWDA 5LATA 1N0NA 4A42A 3U78A 2DOSA 4FFHA 3WOGA 5C3OA 1PK6B 1VP7A 3CRQA 1QJX2 1C1FA 1SFPA 4EWDA 4IEVA 1V54B 4JTDB 5F5QA 5JUVA 1XNQB 1RVF3 2GH2A 3NAPA 1OOPB 4DV2B 2WLNA 4CDWB 2XBO1 3BY6A 1J5EO 4FMTA 2P37A 3POEA 1JOYA 1TGOA 4NXNO 1OSGA 4LFCO 2YB7A 1ONAA 4LHNA 4RHV3 4JI3B 1D5NA 4CUCA 2R073 1Q5OA 5FDBA 1C5IA 3VZNA 3A0RA 2CNAA 2D5FA 1STMA 1CIWA 4D94A 2X6AA 5A1LA 4YIOA 3CJHB 5IATA 1GKBA 4NIDA 2VQEB 3W7SA 1C4RA 4NXNB 5FNVB 3IIAA 3H7JA 1L0LH 3GNEA 4JAUA 4JTOA 1RUG3 5IWAO 5I91A 4I4TA 3OBAA 4TZDA 2GN7A 1SBFA 3IDCB 4FPYA 4Q4V1 4BLIA 3WLUA 2HEWF 4XAAA 4BYYA 3LCPA 2K1EA 3ZO0B 4LFBO 4MHRA 4LJHA 2NN4A 4CUGA 2P3JA 2IXLA 4L97A 5BPXA 3AP9A 1RUC1 4AWDA 1TME1 5EYYA 4RHV1 4B3NA 5ITZB 1IS4A 5DAXA 2ID4A 5GLZA 3S5QA 3WP3A 2OUJA 4CPBD 1EPZA 1LNQA 2IVIB 5A6XA 1OOPC 4KL1A 3PVBB 4GWMA 1UN1A 1AR5A 1JU4A 1GN2A 2VQ0A 4R8CA 1B35C 3AG1C 3B8MA 1SQXH 3MD0A 2VW2A 2YSUB 4XUPA 5K7PA 2ZR3A 1HRV3 3WSOA 1LGCA 4TUYB 4LKDA 1AL22 2D6MA 3ZRWA 2R6QA 2YIBA 3TETA 4KHPO 3N9LA 1UL9A 1BSMA 1K9MW 5ABJB 5T5LA 3I59A 3B2EE 4BK5A 4XF3A 4INDA 3DC5A 1H9PA 1U0AA 1RUH3 5B2GB 5H9SA 4JI7O 1W6OA 2VG9A 4JV5O 2ZT9B 1H2NA 3RYHB 3ZFEB 3O1VA 2GMPA 1ZBA2 3GWKC 4QD2A 2M6YA 5ISLA 5IWFA 1W8WA 5J98B 3W7TA 4LO5B 1MZ5A 3WV6A 1OV9A 2VTXA 4LFCB 5JPNB 5FZHA 3WX5A 3ZYGA 1AI7A 1R64A 2HJFC 2A6YA 4RR3C 1O4TA 1DQ0A 3AMMA 2RM21 3E22B 4JV5B 2XQRA 5IHRA 1H2LA 5CFCB 3OBZA 4LBQA 4R9CA 5IT9N 3APQA 1ENSA 2OQ6A 1RUG1 2Y6FA 3EVKA 1YIJV 3CCLV 2AGAA 1NAEA 1FFXA 4DOUA 2XBO3 2GALA 3ACLA 3VBUA 3GBGA 3LDBA 3PLQA 4XBLA 4ZPIA 1I0HA 4IGPA 1BEV1 4YNIA 3OGJA 2Y4UA 3K2OA 4Q0VA 4DFSA 4Z1VA 1TG7A 4FPOB 1A8DA 3CJIA 3NW4A 2XKPA 4LBQB 2VNVA 1WB8A 4DK0A 2HWE2 2CGNA 1JXNA 1Y4MA 5KHKA 2PHTA 1B04A 2B1GA 1M9NA 3LNMB 2UXNA 5JSPA 1D4M3 4CRQA 4QE7A 2CE4A 3WFVA 5BNPC 3MICA 3BEHA 4ATEA 1GN4A 3RYFB 1HNZB 4B08A 1D0GA 5HCBA 1RUC3 1RHI1 2ZGRA 4FPLA 4MHUA 4UB6Z 3ZEDA 1UU4A 3ZN6A 3VGIA 2D3SA 2RJ2A 5BNPA 4NWVA 4YW3A 3FFQA 4BIZA 3JATA 1EBOA 3I2DA 2XLGA 3VBRC 3FL7A 3BA9A 1PPJH 5LA9A 3WG3A 2DN9A 4DXSA 2EXKA 4JHTA 4LBEC 2YC2A 3VBHB 3SPCA 1WLEA 2J1VA 4FOQA 3MAQA 4ZHQA 2ZX3A 4FPKA 4RYDA 2V73A 1HB2A 1ZBE2 3T1CA 2Q69A 3RW0A 4HN1A 3WG1A 3VQXA 1Q6HA 3WQ1A 3NV2A 3JAMN 1WP8A 1XNKA 3WF0A 3TN93 3ZFFC 1F2NA 4B3SB 2NLRA 2XHBA 1R3KC 4QX2A 2XONA 4J42A 2OYQA 1O9HA 2QQUA 4FQZA 1F5FA 1LGBA 1ZVFA 5A7QA 2DU1A 1F8VA 4AVAA 4XETA 4XXPA 3KCYA 2HR3A 4ITCA 4U7OA 1DF0A 3ZN6B 3PL0A 3RYKA 1LHUA 4B4QA 2KD7A 2YZ4A 3CC2V 1WBFA 4ZHNA 3B93A 2R9RB 5C6CA 4DV5B 3DPRC 1ZBE3 3SH5A 3AK0A 1OBNA 3JYCA 1SQVH 4BH9A 1O8PA 3IM0A 3GYDA 4EYUA 2ZGUA 5FZKA 4NROA 1IS5A 4GA9A 3B77A 1L7LA 2WRAA 2LW8A 5FKBA 4LQRA 4L0PA 1J83A 2JJ6A 1ZSPA 3AP5A 2RV9A 3CZJA 4KNCA 4GULA 3K57A 1W0OA 2XL7A 1HNWB 1UU5A 4MGSA 1Q6IA 1ALYA 2EIMB 4YJ3B 1YEWA 1VQ6V 4RWUA 4YZ3A 2XOKG 4UOJA 4GKKO 3WDUA 5KX5A 1N36B 1X50A 1NH2D 1S3JA 3A2FA 4YW7A 5DZEA 2AXTZ 3ZBHA 2QKAA 1H2MA 1XE0A 2P67A 3V0AA 1JUHA 2Y60A 1UOBA 4UW5A 1NA1C 2JG8C 1YJKA 2H6BA 1PO12 4DUXA 1LEDA 3OY8B 4I5SA 2OW4A 1AR4A 2XASA 4X66B 5KBFA 3VBBA 1CAXB 3H3LA 1Q8PA 4CCJA 2QNKA 3WW4A 1KRIA 4AEMA 3H1LH 5KUKA 5FP9A 4WM7A 4DR1B 1Q8VA 3POBA 4JQTA 1D2DA 3J9SA 4IEOA 4W4LA 4WVMA 3RMXA 3MYXA 4LBNA 2BRTA 3BALA 2RS31 2AGSA 4AHWA 1YNAA 4DUZO 3C7FA 3OGCC 4MW8A 5CFDB 4AW7A 3ZN5A 1RUH2 1XSRA 2A6ZA 3THPA 4EFEA 4AI9A 2FZ2A 2W6IG 1BCCH 2D3OW 1SLIA 2VXRA 1I5ZA 2Z5WA 4XQDA 3WF1A 1AR72 4CH4A 5A32A 1S2BA 1BVVA 4ZOLB 1REFA 2YGLA 1P7BA 1RSOB 2JG8B 3FZ3A 1NU1H 1BE3H 5FP4A 1CPYA 4H33A 1J59A 2XHNA 1SQ4A 2X6BA 3POGA 1RUG2 1JFFA 4B3SO 4CVUA 1OUSA 2W52A 1GANA 1ZRFA 4FLYA 1XMQO 3I59B 5L3FA 4GB33 1XHZA 2PYLA 2DTWA 3I55V 2B9UA 1PZ7A 2AEYA 1XNTA 4XXAA 1AR1B 2LP7A 4ET7A 5IJ9B 1N8RW 4KFMA 5EC1C 4OHZA 5LXTB 2NQYA 3OEEG 3WG7C 4JASA 2RJKA 4TQFA 1IDSA 4J7ZA 4YRDA 4ZONA 2HWE1 3HMYA 2O8QA 1R73A 2CTQA 3ZKYA 3N2GB 3A22A 1AR93 5LBEA 3FB6C 3K5OA 1IXMA 3N3HA 2FDJA 2DUPA 4XMAA 3K3WA 2JVDA 3KD4A 3DPRA 3J7LA 3LQCA 1PGL1 2IVJA 5FY7A 1PD3A 3KSCA 3OTOO 5EV7A 1BT8A 1FMD3 4Q0SA 3L9DA 3ZYPA 4HZFA 5JCTA 2GUZB 3J7HA 1F9KA 2R70A 2XWBB 4NB5A 3ZKUA 5FMOL 3ZFGC 2AH2A 4GMP0 1DYKA 1VMGA 2RS11 3WP5A 2ZGMA 1H8VA 4JGYB 1NVPB 2HH9A 1C8M3 4K35A 1QVFU 3KWVA 2JXAA 1N47A 2G19A 4F6EA 5E88A 2PHDA 2UU8A 5E8AA 1U97A 5T50A 4K3AA 3V56A 3SISA 4WF9V 5I8TA 2W1UA 2AUYA 3PJSK 4A7KA 4NJ4A 4IYHA 1HQNA 4YW1A 1XOUA 1O3TA 1VBD1 4OX9B 5KA6A 4K40A 3UKMA 1OVSA 3AXDA 1MPXA 5JIUA 4LULA 4TYSA 2XWJB 3VBOB 3B69A 3CMAV 2YHJA 3APOA 3VD5A 1QDOA 4B3TO 2WWUA 3WDYA 4NTWA 3H8UA 4MZUA 4Y1VA 4FM0A 3SDLA 4YZ2A 2ES3A 3S3WA 4B3RO 5EBMC 1GYKA 4I3PA 4YJ2A 3P3PA 2HBTA 5JXHA 2JJ2G 3ABMC 1US6A 3BFRA 1WA6X 4Q0UA 3HPLC 2XUMA 1KP2A 4L11A 3FUOA 3S30A 3KMHA 2BERA 3QH7A 1LECA 3SKVA 2X53S 2EIKB 3VQWA 4QDRA 1Z7S1 3KG2A 2Q9LA 1XE8A 2JS3A 4DR4B 5CVRA 3S7IA 1XQ8A 4JRLA 3CQOA 4J9ZB 4X9QA 1XNDA 3OMIB 4DEVA 2HHHO 2JEMA 2TUNA 1VAMA 4LBLA 2ZGOA 1J3RA 3GZEA 2WT0A 1N33O 1TVKA 2B5HA 5FUPA 1Q82W 1FXKA 4WFBV 5LMNB 5JOXA 4GH4A 3TOJA 1D4M2 5LGNA 1L7QA 4LWSB 5JMOA 5LMUB 5J1XA 5EYPB 1QU7A 5T54A 4QT6A 1GN3A 5FNVA 2Y4TA 1XJAA 2KKWA 5LA6A 1HXS3 4UW6A 3BI3A 4YWAA 1SFYA 2WT1A 2ZNJA 1NCRA 2BVBA 3C90A 4GALA 1JZ7A 4UV9A 3K3NA 4Y20B 4NOTA 4DZGA 4FSJA 4E4EA 3FHIB 3JB4C 1DTOA 1JA8A 2QVSB 4FT8A 1E5SA 1TQ5A 1S5HC 2QQLA 3PMEA 3MIFA 4AI1A 4RSUA 4N53C 3VV1A 2JKBA 1SCRA 3QH6A 1JOBA 1DGLA 3F5WC 4IIJB 3EXUA 5JVVA 4TSFG 1TVKB 4S2FA 2EIKC 3FLRA 5DG1A 4R6ZA 2VS0A 4XDOA 5B66Z 1PNLA 2F95B 3T2MA 2DCJA 4XFCA 2DFBA 2HWC3 1RUNA 4NPMA 3OOXA 4ZXKA 1JBCA 1HRV1 2CUGA 5JJEB 1RTVA 4CP9B 2JICA 3TNQA 1BVP1 1QOSA 3LZZA 4IE6A 3H3ZA 2OZ6A 3QACA 2AHZA 1J58A 5SV5A 3MIGA 3W7XA 4FOVA 2UU9O 1AROP 2WWJA 2PHUA 1PKXA 1M57B 2K2SA 2Q4PA 4YW5A 5DECA 3I49A 1G9FA 1M90W 2QDNA 5FY1A 4W6XA 4LA2A 2OWOA 4HBNA 1XDCA 2UWBA 4DK1A 4M3CA 1G86A 1CR7A 5HCFA 5FP3A 5F1RA 2DYSC 1U5ZA 4CDQA 1D7PM 3AMQA 2ZX0A 2WFF1 1S0FA 1XEQA 1IG3A 2QJVA 3N9QA 2R49A 1AJKA 4MTFA 1VBC3 5FO8B 3I3EA 1GOFA 3JD0A 4XC9A 2FKXA 3MHZA 4NVPA 3IB3A 4COUA 3T1YB 4MGQA 2XNDG 3ASNB 4W4KA 5L9VA 3WNLA 4GT1A 2JIJA 2XT9A 1QJX3 2E51A 2EVXA 3LIGA 3UESA 2D6NA 1ZUQA 5KAFZ 1WLDA 4QPWA 1AYN2 3ZIXA 4GKXA 4WFEA 1RMU2 3CO2A 3Q8EA 4AFAA 4CEYC 1MQTA 5IVFA 1SDDB 4D7SA 2W39A 2EALA 3EHBB 1OCRC 3VHRA 5CFCC 3TBDA 3VBUB 5BY5A 5K0UB 1GZTA 3HNBM 2Z69A 5G04L 2E7TA 5CBGA 5FLHA 3UQ8A 2V5DA 2C0ZA 3RSJA 3BVOA 3STZC 3VQYA 2HYKA 4UVCA 5CKMA 3I7DA 5FIXA 2VMGA 5LA0A 3OEAA 1UQXA 2LO1A 2BVVA 4HSJA 4X62O 2C1FA 2E3CA 1U5XA 1F4HA 4CE8A 4Z8BA 5C70A 5FOJB 3N9NA 2XUEA 4JDNA 3K75B 2IU3A 1LENA 5IW0A 2WO2A 2PHRA 1W9WA 4R9BA 5CB4B 2FMDA 2B9VA 2PHLA 1G8WA 5C93A 1WCUA 1SMVA 1RMU3 4OVEA 1ZAUA 2Y0IA 2N05A 1GZWA 2R072 1AJPA 1Z5WA 3WCRA 4FLZA 2GHYA 2XXZA 4E9KA 5FPAA 2UUBB 3EYPA 1RUD2 4G2KA 2VVEA 3KGZA 4LF4B 1VBD2 2C24A 3VDBA 4JDMA 1W2NA 1DGWA 2UXCO 2VQUA 1R082 2VGDA 3KVBA 4BAYA 3WUDA 1VF5B 5CA6A 1I5PA 1W28A 5LCWL 4I50A 1CZTA 4PI0A 3POIA 3OGSA 2ZDIA 3RBZA 4LF4O 3NWKA 1SDWA 1HV1A 3OPZA 2W3JA 5CB4A 3C7OA 3CCQV 5D21A 3WD5A 3RYPA 5F5CA 1C3HA 1WNSA 3PIJA 3ZXJA 2GNDA 1ODMA 4DQAA 2ET1A 3HR0A 5JOYA 3RVYA 4DO0A 2W0XA 1VBE1 1FATA 2FMYA 1CQ9A 5IVYA 1OKQA 2ZACA 5KLVH 1I5XA 4AEDB 2WN2A 1YJWV 3WF3A 3HKEA 2KQXA 2H94A 2VMDA 3GJAA 2KR2A 4WVMB 2NMOA 4JCKA 1QJY2 1H8HG 2HG5C 1JODA 1MR5A 4HKLA 4MT8A 4HPKA 4KU8A 4Q8KA 3JSNA 4ATFA 1YWKA 4AFDA 3UO2A 1ACCA 1UF2C 4CSWA 2ZE7A 3ABKC 2C26A 4N90A 2JGUA 2D6KA 4X1IB 1PIV3 3K4ZA 2A3WA 2VAUA 2W9XA 3E1F1 3K4AA 4ABMA 4XCBA 5FZGA 3I3DA 4QX8A 2RJLA 4FVVA 1C8M2 1BJQA 4QMAA 2OPKA 2ZZQA 1KS5A 1SLCA 3SH4A 3CMGA 3IDAA 4YXWG 5GM0A 2IXJA 3OB8A 1E1QG 5J37A 3H3UA 1G7YA 4OHVA 2FDGA 2RHPA 4OZOA 4UVBA 3ETGA 4D6TH 1S4CA 2J1EA 4DUYB 2O8OA 4N43B 1FOD1 3CCSV 4H2AA 5C8WA 2BNOA 3QG5A 3JU9A 3RYIA 3I3BA 2Y38A 5JCOA 4LH6A 4C90A 3H42B 3E6BA 3PUSA 1Z5VA 3MF6A 4RGAA 4HVOA 4QGMA 5EZYA 1VBD3 4IGOA 2VCCA 2N74A 3OCPA 2YIDA 4IV1C 4XJZA 4KBBA 1ULGA 3O0XA 1NLQA 4Y4RA 3JD72 2M7WA 2VMIA 5FZ9A 1NZ6A 2X10A 4M3CB 1VB2A 4AI3A 2JE9A 3KQRA 2WINB 4JZRA 1MSWD 3WF2A 4LR4A 5FPOA 2W5FA 4YVWA 5CB7A 4JZ2A 1QJX1 4XQWA 3VZMA 1R6TA 1P7GA 1LAJA 1CAXA 1MQTB 2VZTA 3V64A 1GM9A 4U2AA 2RVAA 5LOVB 3B5LB 4KWKA 2WR9A 4AZZA 4CS4A 5LA6B 5D1IA 2AZ5A 2R063 4ZU5A 3G67A 1QDCA 2LQTA 4WCEV 2CH7A 4N43C 4JC1A 1SQBH 4LKEA 4LNUB 2DVGA 4M0NA 1XNAA 3JAWA 1R3LC 2HJIA 4RQFA 1QF3A 4UBHA 3T0AA 4ICGA 4IEQA 1BHGA 1C57A 3EO6A 1N0JA 1JPXA 2ZGTA 1PP9H 2D97A 3ASOB 4QKNA 3R4DB 1EV13 4QPIB 2BCCH 4XDKA 2GTAA 5B3SC 3G80A 2VQAA 4ZI7B 5FYTA 2A3YA 4FO9A 2VW1A 3UL2A 5JZGA 4FFIA 1VAKA 2OZJA 1RUC2 2ZCEA 1VEWA 2OVUA 4P9OA 5GONA 5B1AB 1DBNA 2HP8A 2WWSA 3LKJA 3WG7B 5FZ4A 2XAHA 3LFIA 2RR12 2WNVB 2PY5A 1ZBA3 4LF6O 2XDVA 3CD6V 3AK2A 1VQ9V 1E57A 1V9U3 4QU2A 2CK3G 3DL3A 4CTEA 2DYCA 5FYZA 1AL21 5BNNC 2ZXWB 5FZLA 4I3GA 3B3QE 2GH8A 5IY5B 3LA3A 1U12A 3T0BA 4BWAA 2L35A 2V72A 3APBA 3KB5A 4ASMB 3LEMA 1RL3A 3SMHA 1W0JG 1ASJ2 1VQ5V 5FZ7A 1VF6A 4C1XA 2R043 2RDCA 1HQWA 5GZCA 4J80A 3IPVA 4FXGB 5C5UA 1MOFA 3ASOC 5CIRA 1SC5B 5B3SB 3RT3C 2K9ZA 4YG0A 2ZCWA 4EFBA 1TUBA 4EZHA 2WS91 1XBFA 3K9AA 4JVAA 4X8NA 4YFWA 2GZWA 1YDXA 2HWE3 3ZXKA 1QJEA 4BQ1A 2JRIA 3UCSC 2ZGNA 5FY4A 4K21A 1VBE2 5EQUA 3LF7A 3PJYA 3HKEB 3W58A 1Y76A 1CN1A 1QXPA 4MYEA 4JGSA 2OX0A 1BYHA 4DXWA 4BHPA 1JMUB 3LIHA 5D8AA 5GZFA 4CEWC 3VD4A 2AACA 5FZIA 1SS3A 3SPIA 1O4YA 4DUYO 1D4VB 4IW3A 4CXXA 4NPLA 1HNXB 5L9RA 5LXTA 2FTKA 2ZEXA 5FPVA 3ABMB 1O6UA 1L0NH 4MG2A 3ZXLA 1QBZA 3T1MA 5A3MA 2LTNA 1R1A3 4JV4A 1YFUA 4LKSA 3J8F2 1N3OA 2LM3A 4HN0A 5C3SA 1OD3A 3U75A 5HFMA 1XNQO 1LOFC 4GKYA 4K7JA 4DV3O 4I4TB 2RDNA 2YI8A 1LHOA 2EILC 1P8JA 3K0GA 1FT9A 4FFFA 3DSQA 1WMEA 1K5QA 1MA1A 1V54C 1EUTA 3K03A 3V0BB 1AR61 4UXAA 3PDQA 4HKWA 4UFZA 3LUTB 4CDWC 1NTZH 2WPDG 4ZS3A 3ZYIB 3ZDSA 3AG1B 2VTFA 3VBUC 4XABA 5IFTA 1J3PA 3OPTA 1W8UA 2VBDA 1REEA 5APAA 4XFIA 1I6XA 1AI6A 4KWJA 1N3PA 4MGIE 4WM7C 3CZUA 4QQ2A 2QWQB 3RWRD 2DWDC 3N7MA 1ZNPA 3BAAA 4JDOA 1QY4A 1QXJA 4F6RA 1RJ7A 4TV8A 3OM3B 2WSUA 4KUMA 2WLIB 4O4IB 3BABA 2ZQMA 1J95A 2QJ1A 5IYYA 2IXHA 1RPOA 4Y1ZA 2ZM6B 3CCEV 4R50A 3O1RA 1U96A 1JCHA 1PM4A 2JECA 2W2IA 1NVPD 5A6ZA 1OF4A 5FFOC 4BU2A 2YMZA 1WW7A 3K3OA 1MZ6A 2RMU1 5FP8A 3MLKA 4PJYA 1WD4A 3MEPA 3FMGA 1COV2 1W6PB 4BQ2A 4AILC 1IHMA 1KD7A 1O4ZA 1EV11 2VVFA 5FXXA 4Q4Y3 2YUAA 2UUCO 3B02A 3VKLA 3SYOA 1SLTA 3NJVA 4JKKA 3JD1A 1QR8A 2PLV3 2Q8VA 2VUJA 2GP3A 4OGQB 1KB9F 3ABLB 1KMIZ 2WLHA 1AZDA 4PA6A 5F5IA 1DQ2A 3PU3A 4CCOA 1FXZA 4NKGB 2Q0AA 2J1UA 2VL4A 5EJ3A 4FLXA 5LA1A 2D6LX 2H0BA 1DF4A 5H5NA 4Z2WA 3ZRSA 5JWPA 3NVCA 3ZMVA 2X6CA 3POSA 1XBLA 2YIBD 2A3XA 1GWMA 3BTZA 4RQEA 2QCSB 2RE9A 3KV5A 2V7QG 1FV3A 5JZGB 3RZGA 4H14A 1YCIA 1SERA 3AFKA 1COWG 4YVSB 3IAYA 3SEEA 4CCMA 4G28B 4K0KB 3ASNC 3K51A 4AOCA 4A45A 5JXJA 3SYQA 5T3NA 2Y0PA 2Z4FA 3GHNA 4AEDC 1TNRA 1IZ3A 1AYN3 4YVWC 3OY8A 4O4JA 3B40A 3NJZA 4FLTA 3AM2A 5LGUA 1GR3A 3W9AA 2RR11 4J11A 1OUXA 1XU2A 1MEC3 3M7AA 2R7EB 2IU0A 1HNWO 3BU7A 5FZCA 2VUDA 3E5XA 4EWEA 4PBPA 4BQYA 1AXYA 1XYPA 4XFAA 4OHYA 1VIBA 4ZZ8A 5FZAA 1HN0A 2O0OA 5A2QN 3A0KA 5IYZB 4IYIA 2Y0OA 4CU7A 2Y6GA 1LKNA 3X29B 1Y74A 2EIDA 2YDEA 3CRAA 3NJXA 3MF9A 2RS53 4IETA 5DXDA 4X64B 1V9U2 4YGCA 1KDKA 4C7UA 4Q4Y1 3TXSA 5EP9A 5KC6A 3LDCA 4UVAA 3PUHA 2BTQA 2E53A 3OG2A 5FKCA 2AZ0A 1Y66A 1H30A 1AJOA 3CDZB 3LB9A 4LXLA 2BGPA 3KHBA 1S0CA 4D6QA 4W50A 2A70A 4FTBA 3F7YC 3A4UA 5LMNO 4RD7A 3IWZA 2P7TC 1WBLA 4YVWB 2WZEA 2QR4A 1X7NA 3P1IA 2WS92 3KLSA 2MHFA 4NYKA 5B1BB 3LSUA 2BDRA 3UT5A 4XUNA 4N8MA 3T08A 1VP6A 1Y74B 3AG4B 4EROA 4O4HB 5LYJB 1REDA 3L9JT 4IV1B 1MZEA 1NQJA 3M2MA 1J3QA 4RQPC 3CKHA 3ZLIA 1CEZA 5HI0A 3SGIA 1GM8A 5AVAA 4GH4C 4PA7A 2Z79A 1A8MA 5EJ1B 2I45A 2ZMLA 4Q0QA 3ZHQA 3BRCA 5DAWA 1TZOA 4XIKA 1KBHA 1MQTC 5ANNA 1S2EA 1ZBA1 2A3QA 4BQWA 1H1MA 2SBAA 1UOJA 2DF7A 4XDPA 3UNPA 5F3CA 2F43G 2ADQB 3J8F1 4UW3A 1MVQA 3ZMSA 1VQLV 1FJGO 3JALA 1TMF3 4KMQA 3ECQA 2JEXA 3VDDC 1RUJ3 5F37A 3ZMNA 4EJRA 1V9PA 5IYDO 1NZCA 1UU6A 2FCUA 2JDAA 3HD8B 3FUQA 4P5HA 1LHVA 3NR7A 4E4SA 3T4DA 4PV1B 3DYPA 2B42B 4YM2A 1PGL2 1AX1A 5KC5A 2EICA 4IEPA 1XYNA 2TBVA 2DJVA 3WDTA 4B1LA 1W06A 4N7IA 4EN9B 3QO5A 2Q1MA 1H38A 1VQOV 3HPNA 4AVVA 1HKDA 2VM9A 3X2QB 2PYJA 1WD3A 1K97A 5AG2A 2CDOA 1EZJA 2XJRA 1K3IA 2ZIOA 1V6KA 5FYUA 3NV1A 4Y26A 4YW4A 2IJIA 2P34A 4PI2A 1PGSA 1O7FA 3O0VA 1X33A 1R6NA 3HT2A 3USUA 4Y33A 3ETQA 3DN7A 2Q8CA 4LITA 4HPKB 2PGGA 1IBLB 3W59A 1UY1A 1WW6A 1ZZCA 3WZ1A 1XUQA 3QOPA 4LTAA 3L71H 4U36A 4HG6B 5FY8A 1OZ0A 1FFTB 5AC93 5B1OA 3ALQA 1RHI2 2VZRA 1GAXA 2ZHMA 2Q8OA 5FZ0A 3SQOA 5ITZA 1NZIA 3USUB 1YITV 3ZHTA 1BKZA 3T1HO 1EYBA 3DGEA 4Z1MG 1UO9A 4JI7B 2DBNA 2J1AA 5JI9A 5FZ3A 4GX2A 1POV0 4I0WB 2PN5A 1NTMH 4YM1A 3GVMA 1ZRRA 3VBRA 1VRH2 2ATFA 4HNAA 5LHHA 2YXLA 3FWEA 4Q4W2 1QHDA 5JH7B 1ZTEA 1FPN1 1RUD3 1SQQH 5HV0A 4TXWA 2JE7A 1HNZO 3I2FA 5FJHA 2PHXA 3D82A 1MS1A 1OA4A 2Y34A 3M3CA 3R65A 2HHHB 4BMBA 4PQQA 3T09A 4GX1A 1ROPA 3B01A 5A6YA 5L3GA 1MS8A 4Y24A 4Z82A 4CEWA 4NXMB 1FOD3 1XU1A 3RVHA 1KJRA 2I74A 3DXUA 2IC1A 3ZXFA 3CE2A 1LEMA 4IGQA 3JBG3 4AYUA 4K1YA 1OOPA 1VQ4V 1X59A 4FI9A 4JTAB 1CWPA 1VQPV 1OH4A 3OUIA 4CU9A 2ZEZA 1QLEC 1PK6A 2RG4A 1V6MA 5A80A 1KS4A 4WM8C 1XC6A 4JGYC 2NMNA 5IWAB 2UXDO 5JQGA 3AYCA 4NHXA 5SV8A 4JAVA 2H6CA 1JYTA 4F83A 3VUOA 2NYYA 1TA8A 5JJJB 1PM7A 3KF3A 5CG8A 3SEPA 1VBC1 5GLVA 1G9AA 1GZWB 4DW1A 1OCCC 4TSVA 2EIBA 1LTEA 5FY5A 4GB31 4TN7A 2UUAB 3K77A 2WN3A 3RZKA 1H8TB 3D5OA 4O61A 5CA3A 4Q4Y2 3U14A 4GLXA 3CWBH 3AK1A 5FMDA 3L2HA 3G6EV 3DKQA 3ABTA 2VECA 2XVLA 4DXZA 2ZABA 5L3DA 3WR0A 4JF3A 3LWCA 3WQ7A 3N2KB 1SKVA 1LOEA 4I55A 2XLFA 3VN4A 3BVCA 2ZGQA 1OPOA 5CFDA 3MDSA 1QH6A 3CPWU 4BZ4A 2CV6A 2WO3A 3P5BA 5C3PA 2XJTA 1BZKA 5JOZA 2FDFA 3LSQA 1R3JC 5BUVA 3GZAA 1GUIA 4XBFA 1EFRG 2BV4A 2Q73A 3K4DA 1ND3C 4CP1A 4O4HA 1HW7A 1PO11 2AYHA 4I9QA 4ZU7A 1SA0B 3IDBB 4FOWA 1MSDA 4QKDA 4DYLA 1I9RA 3VHPA 4ZKTB 3QVNA 2ZX4A 2XMLA 4Z2AA 3T2PA 1WLCA 3WINE 3A23A 3KQ4B 3G6BA 4AGVA 4PF1A 1H8TA 3ZN4A 2WAAA 1CAVB 2CAVA 3CX5F 3D8CA 3GJBA 1BMFG 4KQ7A 1PK6C 1XPWA 3CRMA 2EBOA 2D6OX 3ZDVA 2PHWA 4D6SA 1UPIA 2QTOA 1HB1A 4FZ0A 3ZMZA 1KEXA 1S0JA 2E26A 3K58A 3MFAA 2I07B 2E7AA 4UFKA 1O5UA 3ZSEA 5I0SA 3SNMA 4YLZA 5CA0B 2Q5ZA 2NP0A 1RUH1 3B8NA 2CAZC 4P9PA 1NT2B 1ND3A 1XNCA 1PNGA 2QA4V 4CP9A 3ABZA 1UYZA 4CEYA 4AEKA 5FYYA 2F1MA 4CEWB 5FMOS 1WPBA 4WFFA 1SPPA 1W2TA 4BA6A 3JAWB 2R0HA 1UJWB 3DTUB 1F51A 3N27A 2AR6A 5D5QA 3O0WA 1FAYA 4AI0A 5CBLA 4IEZA 4U3FH 4IE7A 4AEJA 1XILA 5G05L 3RPQA 4WVWA 1LOAA 5DEDA 2QSAA 2QQIA 3PURA 4CH5A 2WLLA 2JDUA 3LAGA 3S0MA 1UOGA 4LF9B 2JDMA 2UURA 4GWJA 4LCUC 2I2SA 4KH9A 3H1IH 4JI3O 4K8ZA 1FMD1 5A7WB 5A1FA 1BXHA 5IJRA 3SKJE 1WW5A 4I09A 4JGYA 1RUD1 1MG1A 2VNOA 1B35B 3HBKA 5LEJA 3RYFA 5B4XA 3D3AA 3E97A 2CU5A 3W20A 3H8OA 1GO3F 1W8ZA 4QXCA 1VARA 4XTMA 2W1SA 4B8EA 3LEIA 3AKQA 4A6SA 1DYPA 3VD3A 3T4ZA 2Y6HA 1N1TA 4DV1O 2X5IC 1BCXA 5ANQA 1G1XB 4DPNA 4KU7A 3RZMA 4X20A 1W3XA 1TUEB 3ETEA 1NA1A 1BK0A 2IJJA 2P17A 1PIV2 1KQSU 1I7FA 3M8LA 4AL9A 4Y22B 4RFT0 2XH6A 1Z78A 5C4WC 3VBOA 1RJ8A 1LULA 4N53B 1D5AA 4IE0A 1YF2A 1COV3 4EQVA 3WB2A 2WZR2 2IH1C 4Q20A 5IE9A 4V2WA 4FZ1A 4URAA 5T5JA 3MUY1 1EUUA 4Q6GA 2ZMNA 3AZVA 2IUWA 4LMFA 3SYAA 1AL0G 5KR7A 4FAGA 5EFUA 2Q4SA 4FPCA 5A1AA 3MBWA 1X36A 5J2TA 2VO5A 3OGRA 2WKKA 4NWWA 5IVBA 2VUCA 2WT2A 1GN6A 1WZXA 5LP6B 2G1MA 2ZA9A 5L7OC 5AFBA 3OEBA 3LFMA 1XL4A 5DQ0A 5JPMB 1I94O 4J10A 1W6PA 1KYOF 1NXMA 2EINC 3R4UA 2UUBO 3L70H 5DN2A 3OUFA 1YTFD 1HDKA 4OI4A 3RS6A 5JH7A 5DAVA 4XFHA 3D3IA 3WB0A 4LIVA 5DMYA 2Q6AA 4QWNA 1UFIA 2IW5A 1ZRCA 3RWNA 3FB7C 1GP4A 1EN5A 4NHYA 5JR7B 4LO7A 1YZBA 1DYOA 4FTSA 1T6GC 5H6RA 3JZVA 5A32B 2GNBA 5C5TA 3LA2A 1LJ7A 4UCUA 4YVSC 1HQLA 1RC6A 4BMEA 1GRJA 3HQRA 3ZN0A 4L8JA 1HRI1 1PVC1 1VBA2 1WWYA 2DUOA 2OQ7A 4LNVA 1AX0A 1SBDA 4GB32 4LP8A 1KDMA 2WQZC 3WW2A 2BU9A 1V0AA 3B94A 1AILA 1I08A 4LK7A 5GKAC 3HN1A 3M7MX 3SH3A 4UCTA 3ST7A 3UGGA 1HR0B 3MIBA 2VCBA 2KG7B 1K73W 4RAIA 2W0FC 4IE4A 3ILRA 4DR5B 2JGDA 3JXSA 4AHXA 4PDMA 1K5MC 1UKGA 3ZSMA 3BPZA 4JI2O 5H2FZ 1IQAA 2IZWA 2XAJA 1PMJX 4YM3A 5A3LA 3ZMOA 3LSEA 2P22C 4EN6B 4P14A 3UKVA 1BBT1 4ONUA 3VOUA 2CHHA 4S2HA 4X64O 2R9AA 3FJSA 4JQRA 3KV9A 4XF4A 4MXWB 3RYRA 1E5IA 2CTVA 1QIQA 3L73H 5DUVA 1JZ3A 1VBB1 4M3CF 4JGZB 3KKYA 4CPBA 2D44A 1BHAA 3SXWA 2E5LO 2ITDC 1L1FA 2YGMA 1URFA 3ZIWA 2RR13 2EAKA 3C3VA 5F9TA 5LA2A 1KITA 3NNGA 4C91A 3F7VC 1RVF2 2B45X 2PMWB 4U3JB 4HXCA 1W6QA 4QM8A 1OH3A 4MV2A 2CY6A 3ILNA 2L6LA 2VCMA 5FXZA 4XTPA 4Y5SA 4X8AA 4XF0A 2VCAA 1NYWA 1CAWA 5C9AB 1QWRA 3LDKA 1OQDA 4A6OA 2ADPA 1OHHG 2BFUS 4PA4A 2LS6A 4PA3A 3AYAA 3TEZA 1UD1A 1DQ6A 4MGZE 1RSOA 4MVZA 4X62B 3N9PA 4QX7A 1XNRB 3WCSA 1OCOC 2JIGA 2MK3A 3CJHA 5FUIA 2BZDA 2V09A 4H55A 2V1DA 1XOYA 2ET7A 2QTSA 4CBCA 1OJHA 1W9TA 4MUVA 4JI6B 4U3JA 2EIMC 1SLBA 1IOAA 3FAVB 4COWA 3R6SA 5FYBA 4QQPA 1XNRO 3K46A 5CBFA 3EHKA 4EN8B 4Q5OA 2VQFO 3O14A 1LNSA 4M00A 1N33B 4CDQB 5FBJA 1ZX5A 3C7EA 3ZJZA 3RZZA 1WB7A 5C3QA 3JATB 3C2UA 4JTCB 1IBMO 4IDZA 3KT4A 1RUI2 2GNMA 4XFBA 3C3SA 1RUE3 3MLJA 4ORFA 2F17A 4CDUB 3RJ2X 5FCCA 3QF7A 3CP1A 4PA9A 1FKAO 5GTHZ 4BCUA 3LDRA 3S7EA 3POFA 3HKBB 1F15A 2WL1A 3SJAC 3B09A 4X6RB 3RFRA 3FAVA 2OS2A 4AAPA 3BCCH 2KM2A 4IV1A 4A44A 1XQNA 1NCQB 2ZAAA 4DO2A 4TT3G 4O2BB 3H1JH 4OMDA 4XJ9A 5B4NA 4OQ8A 1NS1A 1H1IA 4B4PA 4FVMA 1W8FA 4NN0A 4QU1A 1CD3G 4HK8A 3W5NA 5JCOC 1S2KA 4N9HA 3VZKA 1NXD1 1W9SA 1IS6A 3OBRA 4MGKE 1UXZA 4IIJA 1RM1C 5DPNA 2WLQA 1UY0A 4NIAA 3TGUH 2VOWA 4GMP1 4CC6A 5F5AA 2PUSA 2XPJA 1QNMA 4JI2B 4PBOA 3QCWA 4JI5O 1AHSA 3WUCA 2RS33 3ASIA 4AEDA 5T5OA 3INAA 3N7LA 5FPLA 1CZSA 4LF8O 1RUF2 5J2UA 2FDKA 4GAZA 2E63A 5EZWA 2EULA 1G6UA 2BGOA 5HPOA 4MVTA 3P30A 4S2DA 2ILMA 4NPRA 3VZOA 5FYCA 3VBFA 2G9ZA 1CJPA 5DAQA 1UZVA 3BOPA 3AG2C 3MIHA 1YHQV 1Q8IA 1DG6A 1LOCA 2VQTA 3E8HA 2IXIA 1UYPA 1PM9A 3K5LA 4L2NA 1OKOA 4QQOA 4FP3A 4RL7A 3FN9A 1A34A 2BOIA 3F2ZA 4YARA 5K9YA 5K1PA 3A0HZ 2A06H 4F7ZA 1HIXA 4META 5EYXA 4HK9A 1BQZA 2OIGA 3C3TA 2NZ9A 1H4HA 4NE9A 4JI0O 5I8SA 2ZXWC 2CDYA 3PVOA 1Q43A 4COZA 2HWB2 1YQ5A 3H1KH 1NY72 4DUZB 5LGTA 3WDXA 3ZHVA 5DABA 3GZUC 4UBGA 4C0BA 2DCKA 4J25A 2P6JA 4FPEA 2VNGA 4WM8B 3UJOA 3FX3A 3CJIB 1XI1A 3T3YA 2UXBB 3H7YA 3RYIB 2WZ8A 4N23A 5LP6A 3IJ4A 4BXSV 3EFFK 1MZFA 1VBB3 4ISRA 1AXKA 3V0BA 2WLIA 3CRCA 1AYM1 4DS0A 1OCCB 2C5DA 4QPGC 1M4UA 3ETDA 2ZKOA 1QVGU 1HX6A 2WZR3 3U07A 4JI5B 2A5ZA 4V1PA 2A7AA 2A6VA 3ZFGA 2UUCB 2QWRB 1YQ2A 2VZOA 4KWLA 2QWOB 2VUAA 2P3IA 3M1HA 2EA7A 3I2HA 2WC2A 1TME3 1UOFA 2QQWA 2OTJV 3M3IA 2ZHLA 5FYHA 2AHYA 1JOPA 4LF5B 1SEFA 2E33A 3H9VA 2VZUA 4F4LA 4O4IA 3RYCB 5HBAA 3N9MA 3UK9A 2ZBJA 3CIHA 2BSKA 5FZFA 1A3KA 5CA1B 3BTYA 3JD2A 1UZZA 2E76B 3CYOA 3QO7A 3H1MA 1UPSA 1S76D 3OD4A 5KHIA 4RS5A 1GM7A 2CDPA 4X1YA 4OUEA 2OT5A 4P9XA 4J7JA 1W8TA 2ZJCA 2HWD1 3RDIA 5CKNA 3POJA 1JVMA 2PHFA 1JS9A 4YGEA 5F2WA 1H2SB 4LFAO 4LE3A 1CAUA 5JLVA 4TV9B 3E89A 4WM7B 3VBFC 4BIFA 2F66C 2JB8A 3AX4A 2ZGKA 3NKGA 4DV2O 4MO3M 2D98A 4N53A 5ABJC 3FYIB 1AL23 2JK5C 2XAGA 3AP6A 3E5UA 1GP6A 4AHCA 2JWPA 2OCCC 1QJU3 1XE7A 1W0PA 3T0DA 3RZLA 2QZ3A 2P5BA 2XAFA 2WO7A 3BKZA 1AI5A 3TB0A 1PX3A 1ULCA 1G9CA 3AYEA 3MHHC 3ZX7A 4MVMA 2WBKA 4WBBA 2IFRA 3SC7X 3NAPB 2DVAA 3O1MA 5GLTA 1JZ4A 3QLQA 1ZREA 5FO7B 4M01A 2DVFA 5A7OA 1R093 3UO3A 3M3EA 3HKBA 4RGKA 1SF9A 1Z2GA 3G71V 5LASA 1LODA 2VZQA 4ZBMA 1SA0A 1ASJ3 3ACGA 1GFF2 1IVSA 3IPVB 2VOKA 4O9EA 1CP9A 2WAMA 3NXSA 4AHYA 3D6EA 3S6PA 3ILFA 4DR6O 4OPAA 2V5YA 5BNOB 3JQWA 1W04A 1Z7S3 2PI4A 2Q1ZB 1GSLA 3JSLA 2WLLB 5JVDB 2Q68A 3AL5A 2IJKA 1ZYBA 2BWCA 2Q7EA 3UGFA 3K04A 3KZIZ 3AZXA 5J09A 1B35A 2ARHA 2YG0A 1T2XA 3AYDA 4ASLA 3WNKA 4AQ6A 3JB8A 5J2UB 2X5IB 4N43A 1UY2A 4DR1O 1PVXA 1SQPH 2BBAA 2RDSA 2Y6KA 1ASJ1 4LEJA 3QTCA 2GDSA 4EV0A 5EIBD 3OTOB 5C4WB 1S0EA 3Q8FA 1CJDA 3O1OA 1JX9A 1I1EA 4QKBA 2LGQA 1S0DA 4CDXB 5LK7B 3K79A 5JVDA 1SQFA 5FQ0A 1PO13 2WLMA 5C7GA 3HQXA 1JZ8A 1SG3A 4QDQA 1KQRA 4A3XA 2HKOA 4RUEA 2VULA 2EZPA 3H8RA 1O8SA 4AVSA 3E8FA 2P4KA 2ARXA 4WFHA 2QQNA 3I2OA 3L75H 3ABLC 5FR3A 2HKXA 3OGVA 1UMHA 2C9AA 1QQP2 1SPPB 2DTYA 2YU2A 1KKDA 2XVKA 4OX9O 2BUKA 3LEKA 3MLLA 5A6QA 1RYYA 3FBYA 4I55B 4CZSA 1LU1A 1NY71 5KHGA 1F4NA 2ZGSA 1TE1B 4PD4F 4MVSA 3ZXDA 5KMGA 3WQBA 1A32A 3OE7G 4GUNA 3O7OA 4XJ8A 1HJGA 3ACIA 4GQ7A 1GTOA 3IGAC 3MW4A 2RS52 4XJAA 4FPJA 2Q7HA 1DK1A 3FE5A 3CF6E 4UB8Z 2CH7B 4CZZA 4XYXA 2PAKA 1FD9A 2WDBA 3EBRA 5EBLC 3ZHSA 2VZSA 1GNZA 1FXKB 1GMMA 1CX4A 2F4LA 3O1TA 4ARXA 2ADEA 3TYJA 1L3JA 2GC0A 1APNA 4EB6A 4D6RA 4BB3A 1PO23 3HNYM 2UUAO 1W99A 1C8NA 3VDCA 1K92A 2BOJA 2Q7GA 5GW7A 1ZZ8A 4B4RA 4JRAA 5JQGB 2QWPB 1CAWB 2O1QA 1K7DA 1SRYA 4LIUA 3WU2Z 3IAPA 1Q8OA 3JQXA 1KGYA 2YBSA 3RGBA 3THCA 1NCQC 4XOGA 2JG9B 2XLAA 3LOIA 5EZYB 2WSSG 1ULEA 3MZHA 4ASKA 4I7ZB 4YSFA 1ZRDA 5LL6Y 4PLNA 5C8CB 1S5LZ 5F3GA 2FQPA 3RI9A 5L9BA 3FLPA 2ZGLA 4Q4W1 2OUHA 2RMU2 1QKQA 4OCTA 1K4DC 3WG4A 4IESA 4FFBB 2OIEA 4XHBA 1F35A 2VWJA 1EV12 2BFUL 2YY1A 4JGZC 3J7AU 4O4LB 1QH7A 3K06A 3AP4A 4BW5A 4DRRA 3I3MA 4MS2A 1UW8A 4EN7B 4MXWA 2B4KA 1S0GA 4QB2A 4NHLA 2R72A 5EHDA 4LF5O 1KUQA 2XHKA 2HWC2 3KT1A 2LROA 4WZCA 4QPGA 4WV8A 1VALA 1NE4A 2YFZA 4YFZA 3ZHRA 2PELA 4PLMA 1YUDA 3HB3B 1DGRN 2GAUA 2YICA 1NR7A 1EP0A 1UKRA 4H3WA 2WO1A 5A3WA 4MVQA 2OCHA 3AG2B 2YPDA 5DDJ2 3BIWE 1W3VA 1NQTA 3VBRB 4OULA 4XACA 4GXLA 2FCTA 3NV3A 1VBC2 4AQYO 2ZTNA 3WP6A 4BQ5A 2AENA 3VKNA 4FBFA 3PIGA 2QZ2A 3LPFA 4BOWA 5L19A 1OCOB 2PAMA 4LT5A 4MTXA 3HWJA 2JG9A 4KXRA 2QQOA 1JOJA 4BLJA 1W03A 4AVTA 2VD7A 2QM4A 1IPKA 4DMIA 3P32A 5JI7A 1Q86W 3FB5C 2TNFA 4TLFA 1UX6A 2B9ZA 4MGTA 2EZOA 3U1XA 2IWGB 3NL1A 2KSDA 3GXUA 1PNKA 3UT5B 1OLME 1JH5A 4RHV2 4X1KB 3RI8A 2HEPA 4A7ZA 4LF7B 3TWIA 3IC7A 4ZU4A 4WVZA 4LPLA 2VWKA 2BJSA 1S55A 4QX0A 3OGIB 3JARB 2PLV1 5E1RA 4MSVA 2C9KA 4L9BA 2F23A 3K48A 4Q29A 3JAKA 4JI4B 1GQPA 1K8AW 4PDWB 4CDUC 4NRQA 2VPVA 2CAUA 1RITA 5IDJA 4BQ4A 2ZEWA 1EAH3 3VBSA 2YU1A 4PLOA 3GB7C 1QLNA 2YUEA 1WMDA 1JR9A 2ZM6O 5F8PA 2JD4A 1YC61 1F31A 2BOBC 2LFRA 3PVEA 3LNNA 3ROUA 1V9U1 4FJCC 5LY2A 2WS93 1QOTA 4I01A 2HEVF 3AKPA 5H9RA 1Y7BA 1ZZ7A 4TTGA 2RMU3 1VMJA 2EIJC 1UPGA 4JYCA 4CDWA 5J36A 2X0LA 1JYCA 1NTKH 5F6KA 3WHTA 3OMAB 5FQ0B 3TEXA 3LA7A 3OEHG 1CONA 2YC0A 4P00B 5E89A 4YJ3A 4HSLA 1R1ZA 4HOOA 4DV3B 4WBNA 1K5JA 3HNMA 3BU0A 1HW5A 1DLCA 4CP2A 2JDNA 2WLJA 2X09A 3JALB 4CU6A 4PCRA 2VXJA 2PF4E 1UXXX 4DR2B 4UFMA 5F2VO 3J8F3 3ZPYA 1K45A 2UY8A 3A21A 2R1DA 3AVSA 3LGRA 4DR4O 4QPIC 2P1BA 5FP7A 4AG4A 2B5UA 5B1NA 3RWKX 3RG0A 1WPXA 1WP7A 2MNGA 5T55A 3WG2A 1WLWA 2E32A 2RMKB 3A8TA 2HWB3 3Q4HB 3SYPA 5A70A 1GK9A 1FMD2 1YI9A 3QBQA 2LALA 1XSQA 1GMGA 1JYVA 4RN5A 5CEHA 1I3HA 2H3OA 3P6BA 4LC1A 3J80N 2ZGPA 1JZ2A 4OI1A 5KXCA 1QNYA 2JE8A 4JI8O 3STLC 2ZPXA 2F93B 1SCSA 4OZXA 1EM1A 1FNZA 3NJYA 2QDRA 3VDDA 4E2LA 5K4LA 1MEC2 2QM8A 3BCWA 2GNTA 4CUBA 4P5YA 1WGPA 1LCLA 4JI6O 5FWJA 4MXVA 2NR5A 1DP0A 3N4MA 4CXWA 4Y3OA 1MS5A 2ZXQA 3KV4A 4XFFA 3CC4V 1PIV1 1AX2A 1NKDA 1JHJA 1AR92 2Q5TA 5CG9A 1GNYA 2ZD9A 2DV9A 1YJ9V 3ZSKA 1ZL8B 5DUXA 4QX5A 1AR63 3AXEA 3SITA 2WZR1 1EAH2 2JDZA 4P30A 4AQSA 4FIPC 5FZOA 5EC2C 1LUVA 2ZHKA 1K5MA 4DR7B 2P4EA 3FKSG 1Y4WA 1PGW1 2BEOA 3SJQC 5J9PC 4QKFA 1RHI3 1WCKA 1M56C 4F6RB 4GJYA 4DV7O 1ZBE1 5EWSA 4IEYA 4XUOA 1FFXB 2C6SA 3K9SA 3AJYA 3CSXA 4K20A 3THDA 1OMIA 3DXRA 3MPPG 2VTXJ 1K42A 1R081 1W6MA 4PF5A 3EMRA 1PHMA 3SHRA 2TEPA 5CMUA 4H13B 1YXWA 3VLBB 3MW2A 2LUWA 2HWC1 2OPWA 3BODA 1DZTA 3T1HB 5A3PA 4YGBA 3ZRXA 1OLQA 5FRAA 3ZFEC 4EN0A 4FXKB 5EK0A 3P3NA 3ETPA 1PL0A 4UFHA 1OF3A 2ZS6B 1LRHA 3U37A 3ZFGB 4JPRA 5GZEA 4H0LB 2N7GA 2QKCA 2Y69C 1URXA 1NCRB 2X5IA 4BWOA 5KA5A 3D3QA 1K34A 1WW4A 3SCHA 1HNXO 3E8GA 5HV4A 2Y48A 2W95A 2P90A 3PTRB 3V65A 4QDSA 3I5DA 1RB8G 1VRH1 2OT7A 2JGDB 4YY3B 1HRI2 1PVC2 1IQDC 1YFXA 4HVQA 3AKSA 3PNAA 3JBG2 2VZ3A 2WNEA 3VD9A 5EIBC 4N9IA 3B4SA 5IVVA 2E75B 2ZMKA 4DXTA 4R7CA 3BPSA 3JASA 4YJ2B 1IG0A 3MW3A 5L3EA 3S5AA 1LR1A 2WA4A 5JXGA 3M4FA 4YW2A 4GWNA 4L92A 2C2AA 1V6NA 4FOYA 4A7YA 2X7RB 4CC5A 4HVRA 1V6IA 2ZAHA 4Q4X1 1G9BA 2DQ0A 1S0BA 4P9YA 2OCCB 3ES4A 1V00A 2EJRA 4LF9O 4LR3A 2YXHA 2QWNB 4LBMA 3WP4A 4SLIA 2WFPA 4HT1T 2WSVA 2MPFA 3GCXA 4JI1B 3O9OA 1QU0A 4J9YB 4UV8A 4GKJO 4O4LA 3CMEV 4ES8A 3HAGA 3GDBA 2VOVA 1OXCA 4LE4A 1QJZA 4K9SA 4FP2A 2RN9A 1XRUA 1THZA 1AB3A 4P9LA 2DW4A 1VBB2 3NNFA 1Y6XA 3DYMA 3SYCA 5CNAA 3AMHA 3ORJA 1JJ2U 1NBMG 1FJGB 2VR4A 3RVZA 1N3QA 5L7OB 2OYZA 4AHZA 2UYBA 3BUCA 1XREA 1XHXA 3S57A 1QCEA 5IJ0B 2EINB 2RS32 2DYRC 4UCVA 4DW0A 2XVGA 4V2VA 4QGLA 2EAAA 4UCRA 1SACA 4DRXB 2R16A 5FZ6A 4W6YA 1PO22 2DFCA 4IERA 2BSKB 4Y5TA 5KWRA 1UZ0A 2HFEC 2J42A 3O12A 3UGHA 1IX9A 4LBKA 5L3BA 3JCIA 2ENRA 1DLLA 2VNRA 5FMCA 2HWF2 5DDJ3 1W6OB 4I30A 1W05A 2E5LB 1RUJ2 4AR2A 1JI6A 2WQ4A 2JEUA 4JI8B 1SZBA 2D6PA 3KV6A 2GSYA 3EQEA 4OI2A 5IK5A 2Q67A 3DCQA 4RO2A 1VF6C 2ADDA 3OFNG 4IV3C 4ASUG 4ZOLA 1TMF1 1JZ6A 4NO4A 1GWKA 4ISQA 3I2KA 4O2BA 5C33A 4NRMA 2WJSA 1LB2A 2QE3A 1NQDA 5T52A 5BNQA 3ZS8C 1O3QA 1AR82 3ATGA 2WYFA 4GWIA 1KP3A 4FPGA 3R0RA 1SQGA 3ZHUA 1JYXA 2DWEC 5LP6C 3OGGA 2NNUA 3FHAA 1NX9A 3U4XA 5DUUA 4NHMA 1RIRA 1W59A 2EIEA 3DEMA 1BZWA 4JI1O 1RUI1 5IJ9A 2DU0A 2GC2A 1FV2A 2WUHA 3I3QA 4LO6B 3MPBA 1M57C 3N7JA 5D8AB 5A33A 5H9PA 4BR6A 2Y64A 4OQ9A 1OCZB 1VPHA 4QPKA 2R0FA 2J1RA 3T2TA 2AEZA 2BTVC 3V0AB 2Y6JA 1UAIA 1VR3A 1JUIA 3CXHF 1BHBA 4LBQD 1FYUA 1GWLA 3B7MA 3BN6A 3E2EA 1PNFA 4XDLA 2RQ6A 5E16A 3R66A 2DQ3A 4DB5A 2QUOA 2FZ1A 4XBQA 5DM6V 3KT7A 2WNUB 4IGGA 5J3UA 5CA0A 5C71A 1F4MA 3THOA 1JMKC 3GWOA 1EAH1 5FZOB 3HBZA 5H6QA 4IEWA 2X05A 4BQ3A 2E6VA 4AI8A 1RUI3 1RP3B 5FZ1A 3ZR6A 2F6BA 1MABG 5EBWC 3ZIAG 1PGW2 4Y5Z0 5FTTC 5B1BC 5BNPB 4XDJA 1BK1A 1OLMA 4Y20A 4YYOA 1ENXA 1OCRB 4IHJA 4GX5A 4AQTA 3USSA 1W0KG 4X65O 3AKRA 1WCDJ 3DXRB 2YIAA 4I0XA 3TEYA 5K0UC 4O9GA 1P84F 4GJZA 4A2UA 1RUF1 1FYJA 3BOWA 3T4HB 2UXXA 3MUZ1 1YQCA 3OUSA 1IGOA 2FD8A 4QNHB 2K46A 1MMMA 3E86A 1LOGA 1OA3A 3GF6A 3A7QA 3VBHC 2G9GA 4AXOA 1RINA 4XJUA 1WJZA 5C8CC 5HCAA 2ZKLA 3IMMA 4LLOA 1WA8B 1TVGA 2YEVB 3TNPB 1VQNV 1RGSA 2BTOA 1WMFA 1V6OA 1POV1 4F8AA 5CFDC 5JZGC 4FPPA 5LHIA 4HETA 1OPMA 1YLLA 3K08A 3H50A 1SLLA 1GQGA 1ZRIA 3H1YA 3GBFA 4DY5A 2BNMA 1QMJA 1D2SA 3JBG1 4DRXA 2OTLV 3TRSB 2H0VA 4UF0B 2GBOA 1S0VA 4IHJB 4LHLA 4E2GA 4TLGA 1DF5A 3KM5A 1BQ0A 4LWSA 1M4WA 1LHWA 1Y3TA 1OQEA 2B46X 3H1WA 2W91A 4CH3A 4BK4A 4DV6O 1IBMB 2EXIA 3CRRA 1HV0A 3WNOA 5KAIZ 3AZYA 1PX4A 4CS3A 4Q4X2 3X2QC 4GX0A 2W46A 2CTPA 1OURA 4RFRB 3AG3C 5C9AC 3CCVV 3RJRA 5I0UA 2EIGA 3WHUA 3OMNB 3H9AA 2VRZA 2WABA 1AYM2 3PVNA 2RM23 3TN91 5A3NA 1AR62 1JYWA 2A7WA 2VMHA 1TAEA 2BBVA 4M4RA 1LOBA 2RCVA 4Q27A 3JD4A 1LR5A 1ZZBA 4DV0O 5FUNA 1HXS1 3UV9A 2UXBO 2VMFA 3MHSC 1K3EA 3A0BZ 2VQEO 4YVSA 5AFEA 5LMUO 2P06A 1ENRA 1ZWIC 2F4PA 5GLWA 3BGAA 3LDEA 4C1WA 5CU1A 2BWAA 4TWTA 5FJKA 5FYSA 3MV01 3VZJA 4HZ3A 4ZZ5A 5LOVA 1J1LA 4PIZA 1SETA 5HXVA 4CXYA 4B29A 3E22A 4JYYA 5FY0A 1R3IC 3JARA 2DVDA 4J6GA 2WYSA 1F4AA 2XAQA 1YI7A 4NUBA 2R30A 2NM1A 4X1KA 1VRBA 1VF7A 4DV6B 1LHNA 1R083 5LRRA 3HT1A 1M06G 3VL9A 4JHZA 3WNNA 3Q9OA 1H1AA 4R9DA 1MVEA 1UY4A 1VBA3 4QIWF 5FK7A 3CCJV 3WF4A 2LW1A 3OF1A 1BBT2 4IEUA 4QPJA 2IXKA 1RUJ1 3NKTA 5E79Z 4H37A 4G4FA 4DV5O 2XBO2 4DRVA 1JW6A 3RZHA 2FMLA 2V4VA 4LHSA 1PMIA 2AC1A 2RJZA 4H7LA 4CCEA 2QEXV 4AI2A 2DMXA 3Q8BA 4FM1A 2X8KA 3I8TA 3TXQA 5LBBA 2V4AA 1AYN1 1RMU1 3BTAA 4O2AA 1KXGA 2Z5UA 4JX0A 3KCCA 4KBZA 1GBGA 3CS5A 4Y4YA 5IAXA 3IZOA 3BB6A 1H6XA 5FY9A 1QLEB 2Y69B 1I5YA 3NSTA 5AC91 4LH7A 3JD3A 3BHPA 3JD73 2DUQA 2B7YA 4CCLA 1MS9A 2PA7A 2XJUA 4LF7O 2X29A 3HN3A 3AEIA 1SZTA 4CCCA 1KFUL 1K33A 3HVDA 2F4VO 1QOOA 2JX9A 4OLLA 1TME2 3VKFC 5CN0A 1H8TC 1ZZ6A 3RNSA 1OI6A 1X8MA 3G4SV 3SLIA 4RQPA 5LBFA 5LW9A 2GSMB 2GU9A 1W6MB 1G9DA 4W6WA 1O5LA 3UYJA 2YBKA 5DZFA 3U0ZA 4FFBA 3H1HH 4QPYA 2JKXA 4KWUA 2HJDA 5BXZA 4E27A 4X8PA 2LRPA 2BYVE 4Y1UA 4GMP3 4I50B 4JYBA 3WVJA 1VRH3 1OT5A 5FAXA 4YM0A 5BZBA 4H44B 1Q6UA 2ARCA 5IVEA 1HJFA 2VU9A 2MEV1 2EX3A 1IKPA 4LOTA 2JB4A 5HFLA 5CYYA 2QQVA 1DZQA 2HWF3 4XVHA 1S72V 4UYBA 4XEZA 4IQPA 5GJ6A 1O9GA 3HIFA 4Q4X3 5EXOA 4Q1PA 1X9TA 1RPRA 4GKJB 1ULOA 2PZSA 2LW7A 2GTSA 5JSRA 2XKOA 2D2CB 4ZKIA 5B1AC 5BR8O 2RM22 3AVRA 3NQHA 3SR2C 1ZLZA 4PT6A 4OUSA 1F23A 2A71A 3VBFB 2VVDA 1QQP1 4WBNB 2QQPA 1FXHA 1VAVA 5C4WA 5BV6A 5FZEA 5LHGA 1DQ1A 4YGDA 3VBOC 1EZVH 3T1YO 2D40A 2HVKC 3PHMA 1UCXA 4A5UB 2W08A 5IVCA 4DV4O 4WZFA 3M3QA 4XJWA 3K5NA 1ST8A 2XJPA 5T5PA 3ZYRA 4OMCA 1QJY1 1OLRA 1W0NA 4XURA 2Z0AA 2Z3YA 4R4XA 2EXHA 4A41A 4JAAA 4YY3O 3HKDB 1EN6A 4L87A 4R9AA 1OFSA 1NE6A 1ORQC 1AI4A 4Y1XA 3LD8A 3T2QA 5KUMA 4FM2A 4XW3A 2ZHNA 4YPJA 4JKLA 2RS13 4YZ5A 3U4SA 5JOWA 1MS4A 4X6QB 1NT0A 4DR3B 2FCVA 2VMEA 2KB1A 2XQXA 1FXVA 3TN92 2ZE6A 1C8M1 4XMIA 4BM8A 5FPXA 2BGCA 4AQYB 4UUJC 4DIQA 5F2SA 4FAHA 1CAVA 3QO8A 2UXCB 4B1MA 4P9WA 2VE1A 4J1XA 2QTWB 2XJVA 1R6KA 2XR4A 1QJFA 4QQHA 2RDQA 1HXS2 1XL6A 2R041 2JJ1G 1YSCA 3D0JA 1NJIW 1HR0O 2QKSA 2E9QA 5I0RA 2YI9A 1X82A 4QGNA 2HEYF 1JJOA 2WQ8A 1UYXA 1YHFA 5IYBO 5IK8A 1SBEA 1A6CA 5FPUA 1WA4A 2ERFA 4FPFA 5FLXN 4M4PA 1EPWA 2ZINA 4EE2A 1G4YB 4LFAB 2WLKA 3HKCA 3CCMV 2BE3A 3IFXA 3WQ0A 4C0HA 4LLFA 3VHOA 4O65A 3W21A 3JD71 2WLPA 1US2A 2YV8A 1KJLA 3AB0A 2VH9A 2FL4A 1TNFA 4QHZA 1GH6A 4M0HA 4EKWA 4RS5B 2JD9A 3IMNA 4XPVA 1CAUB 1YFYA 4R8HA 1PNMA 3TEWA 2EJ7A 3E83A 3BIEA 4TOIA 4QXBA 2QQJA 2JDPA 1KD1W 1R092 3I2GA 1PZ9A 2ODMA 2W1QA 1AJQA 4WFGA 1XNBA 1KFXL 1CIYA 2NPIA 2R1BA 1WKYA 5FYVA 4QX3A 2GMEA 2Z42A 4JTNA 1CZVA 4PIYA 4PHZA 3K5MA 1EY2A 2WNUA 5LEKA 1J5EB 2HBUA 4NMIA 5ACA3 2VMCA 5KXBA 5CFCA 1K12A 5BY1A 1FI2A 5IYZA 1VB4A 1AYM3 1MNGA 5FYIA 2DYSB 5GTIZ 1HWYA 4HNAB 1KKCA 1BQPA 1FPN2 3ZX6A 3JCZA 4AGRA 3FHQA 2W1WA 3IKWA 3VZLA 2C4XA 1FNYA 5IAVA 3VKOA 1H2GA 3NMBA 4M3CE 4QJFB 2WZPP 3LDDA 2DE0X 4KHPB 4DR6B 2IXCA 3T1LA 1H4GA 4BDVB 1HLCA 2XJQA 3GCWA 3O5SA 2XJSA 3POWA 2HWD2 4B7KA 4RS5C 5FL7G 1MS3A 5FPBA 3N7KA 4GYCB 3H01A 2A79B 3FYEB 2ZOEB 3OAAG 4N21A 3CEIA 4ARYA 1P49A 1VIWB 5ACA1 2ARAA 3MIEA 1NKGA 1HRI3 1PVC3 3I2IA 3NNLA 3T30A 3MV11 3ABUA 3AC0A 4RQPB 3Q8CA 3GBWA 3ZRWB 2BP6A 1V6LA 1VQ8V 4TUYA 4BE3A 1NH2B 4MVOA 4AK3A 1POQA 3NO8A 5J7MA 5FMBA 1NG0A 3E35A 5A7PA 4OXSA 2JG9C 3MDPA 2R9IA 5IVJA 4XILA 4O2AB 5JDBA 5F3EA 4X66O 1IPSA 4J7KA 2B39A 3I97A 3N36A 2CWSA 5C8YA 4XE9A 4XIOA 4AVBA 4K8XA 1C5HA 2JG8A 2JS5A 1JQ0A 3EXAA 4FFGA 5CADA 2B1IA 3U11A 2YYOA 5LB6A 1XMOO 3NRUA 3N2GA 1K5SA 3RYCA 2VJXA 3L74H 4QHOA 3RYHA 3ZFEA 1N4CA 2BNNA 4DY3A 3L2YA 1KECA 4AE2A 3VB9A 3OYWB 2V4DA 4R4ZA 3CL1A 3M70A 5KHHA 2CWMA 1LGNA 5IUQA 5BYNA 1N34B 4CCDA 5FYMA 4MVUA 4GKKB 4TQDA 4CCNA 5C8YB 4OFGA 4FPHA 5LWBA 1QXRA 3ZXGA 3GALA 4S2GA 1SZXA 2DCYA 5FLJA 3NNJA 1W8HA 1W2BU 2YC4A 3S3XA 4IUGA 1PV0A 4LUKA 1US3A 4FLUA 4MOAA 4KI5M 4JYAB 3DPRB 4Z92B 3RMYA 1EN4A 3MGUA 4I2OA 2QBXA 5E6HA 1UWWA 3T2OA 3U10A 4P08A 2GDFA 1S1AA 1LOFA 4PDVA 3ML0A 4IT5A 5FV3A 2IJHA 2LFSA 1W2AX 3BA8A 3O65A 1HN1A 5KXEA 3CB2A 2VZ1A 5D5PA 2UWCA 3AK3A 3OUHA 3UM7A 1D0HA 1T6BX 2YEVA 3ZMTA 4I0XB 2PQQA 3GZTB 4W8JA 3Q8AA 2P3KA 4MADA 3CBNA 1N32O 1ND2C 4SBVA 2HVJC 4Q4W3 2WWWA 2DCZA 2QM7A 3ZFFB 4BXFA 5F39A 1V55C 5DAPA 1AXZA 4EZ4A 4OPHA 1BL8A 3CU7A 3DUIA 1HB4A 4ZY9A 4XHXA 1JFFB 1NA1B 2DDUA 2GC1A 1H0BA 1W6NB 1IXBA 3TJTA 1BS3A 1R1BA 4PDWC 1SFNA 2R042 2A9HA 4P9IA 1B06A 5A7NA 1AR91 3I2JA 2RS12 1NCQA 4DR3O 1YJNV 1NOVA 5I93A 2ETNA 3WXPA 3M3OA 3AG3B 3D36A 5DG2A 2DWRA 3DGTA 3UKNA 1FPOA 2CTWA 3ZR5A 2H8PC 1X9PA 4GIQA 4NRPA 3F95A 4BJ0A 5A7WA 1DGSA 1NI8A 3Q4HA 5FOBB 4RGGA 1GZ9A 3I4IA 5EJZB 1D2QA 5FWEA 2RS51 5F6LB 5IYCO 3MIDA 2YXYA 4MTOA 4CP0A 3D0SA 5L3CA 3WW1A 4NAMA 4K1ZA 3I56V 3HQUA 2ZZJA 4QHBA 4UFIA 3J7MA 2OIIA 1VQMV 3D4KA 4MGYE 4ZHQB 1COV1 3ME2A 1ND2B 4XUQA 1H6YA 1RM1B 2WAOA 5FLIA 4BISA 1AP5A 2D5HA 2B8MA 2D43A 2UYAA 1IBKO 3VDDB 2G38A 4K8RB 1FX5A 3LSSA 2A1XA 1VJ2A 3SCGA 5BNNA 4FFKA 1GICA 1JU3A 5A3OA 5BR8B 3IIIA 3GM8A 4IV3A 4LOSA 3KZ4C 1T5EA 4DV1B 2JDYA 3NV4A 4YIPA 2MW2B 2ARBA 1DQ4A 2RNBA 1XMOB 4H7MA 5HCHA 4DINB 2KXLA 4DXRA 1RUE1 1W2UA 5F32A 1YVWA 3IDEA 4YZ1A 5A33B 2FDIA 3IN9A 3R05A 3OD0A 2P5OA 1N1YA 1YO8A 1R1A1 4UW4A 2W47A 1IKQA 5K1XA 1CGPA 1OVPA 1U5YA 3E5QA 2ITCC 1WA8A 1Q90D 2E31A 4LO8A 1S0IA 1CX1A 3RZJA 2CSGA 4IL6Z 4JYAO 2YFUA 4UF0A 4OHWA 3ZYBA 2EIJB 3IBMA 4GZRB 3I54A 4LBOA 3UT0A 2VBBA 3CEWA 3PU8A 2ZNIA 3WNPA 1ODNA 4NTYA 5GLUA 2Q8DA 1YJLA 1POV3 1KC8W 1W8OA 3LOBA 1ZA7A 4ES9A 4DR7O 1CVNA 2WFF3 4OHXA 4X1IA 5ACA2 4L8QA 4LKFA 5GZGA 1YQ8A 3HJRA 3URFA 5GZDA 5IJ0A 5HXMA 4O7XA 2QQKA 4BIUA 4JI0B 4N7UA 4IEXA 3CJIC 4QE9A 5DDJ1 1WCQA 3ZFFA 3CHXA 1I94B 1W6QB 3GGLA 2W92A 2EILB 4JGZA 4OUMA 3ITQA 1YXBA 3MI8A 2DBIA 1VBA1 3RQ0A 3B9IA 4B7EA 3VBHA 4C8DA 4K0KO 1C1LA 3VBSB 2NLJC 2D3PA 5IK4A 5IFPA 2CTRA 5JJNB 4CH6A 4B3RB 3AMNA 1M56B 4WFAV 5L73A 3OYWA 4MVRA 4DV7B 4YHHO 4G9SB 2FDHA 1UX7A 1H9WA 4W4ZA 5JXIA 1QR9A 3CNAA 1BMV1 4QB1A 1V70A 4RUFA 1YYNA 1PMHX 2DCTA 1Z0HA 3RN4A 2P2KA 4QX1A 5A3TA 4D69A 5IY5C 3ZM8A 4UT5A 4HL0A 1P4RA 2ZR2A 4MW3A 2KG7A 4K8FA 2Z2SB 3JUUA