1Q5OA

Hcn2j 443-645 in the presence of camp, selenomethionine derivative
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
201
structure length
201
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title STRUCTURAL BASIS FOR MODULATION AND AGONIST SPECIFICITY OF HCN PACEMAKER CHANNELS
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 57
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2003-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1q5oA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1q5oA02
4QGLA 3LOIA 1UD1A 2EAAA 4PJYA 1YWKA 4XF4A 3IWZA 2ETEA 4XFCA 4JTOA 4LULA 2B5HA 3IDCB 4IEVA 4XFHA 2BNOA 5I8TA 2UY8A 1ZNPA 1ZZ9A 1CAWA 4YNIA 5JCTA 2QVSB 3M3IA 4Q0PA 4KL1A 4XFAA 4E2SA 3U10A 1RC6A 1QY4A 4F8AA 2MPFA 1EY2A 1SQ4A 4UBGA 4WBBA 3ROUA 4HMZA 2UY9A 4PIYA 4IEOA 3VHRA 1QWRA 3I59B 4RD7A 2EA7A 2ATFA 4MH0E 1DGWA 4Q29A 1QXRA 2BNNA 4XFIA 1LB2A 4R52A 1HW5A 1J59A 3GYDA 4IEZA 3E5QA 3TNQA 1J58A 1CGPA 1ZZCA 2PHDA 3E5UA 4BYYA 3ACLA 2IXKA 1OMIA 3BB6A 4XF1A 3FWEA 3OCPA 4JTNA 4I02A 3LA7A 1Q3EA 3MYXA 3NJZA 4I0AA 1X82A 1O3SA 3OF1A 1O5LA 3OD0A 1EYBA 3CJXA 2GC2A 1I5ZA 4XF3A 1O7FA 1CAXB 4AQ6A 2XLFA 4IEYA 5I0RA 4KWJA 3CF6E 3FE5A 3UKVA 2QCSB 1XRUA 2GH2A 3E97A 4F7ZA 3E5XA 1RUOA 4MUVA 3NSTA 4HZFA 4HVQA 2QJVA 4QX5A 2DCTA 4I2OA 4L11A 3FJSA 3H50A 1RUNA 5EZWA 1Q43A 2FQPA 4FAGA 1G6NA 4LLOA 4N9HA 3UKTA 1X7NA 2D5HA 3DN7A 4HSJA 2I45A 1YFWA 5JSRA 3DV8A 4YRDA 5E1RA 4QM9A 3E6CC 2ZKLA 1CAUB 2D93A 4E2GA 3DL3A 4NVPA 3E6DA 1QXJA 3KGZA 5KHKA 2VECA 3OGJA 4Q0QA 4CYDA 5LEKA 4HLTA 4OFGA 1VP6A 4LTAA 4XF0A 5J48A 3I59A 2QDRA 5T3NA 3PLQA 1LRHA 1TQ5A 1H1MA 3BALA 1PM7A 4L2NA 3EO6A 5FDBA 2V09A 3QACA 1GQHA 1NXMA 3PVBB 3CL1A 5BV6A 2HJIA 3SCHA 1H1IA 2PFWA 2VPVA 4J1WA 3UKNA 4AVAA 3D0SA 2P17A 2PHLA 1GQGA 1YLLA 1VR3A 1JUHA 3D82A 3E6BA 4Q0SA 5I0UA 3DKWA 4QXKA 2CV6A 4OLLA 5KHIA 1SEFA 3H7JA 2IXIA 4IETA 5I93A 2KXLA 4JV4A 4YARA 5KHJA 4Q0UA 1CAXA 1YFUA 3U0ZA 5FCCA 1V70A 1UCXA 1XE7A 1O4TA 1J3RA 4BIFA 4E2QA 5E16A 5C8WA 4LUMA 4UXAA 4ZU4A 4ZU5A 3RZZA 2GU9A 3NL1A 4Q0VA 3ES1A 3H7YA 1IPJA 2Z69A 1EPZA 1CAVB 5KHGA 5C6CA 1DZRA 2IXCA 1FT9A 2PA7A 2GC3A 3WW4A 1ZRCA 4ONUA 2OZJA 1SFNA 2PAMA 4PIXA 3KSCA 4META 5JSOA 2Y0OA 3O14A 3OTFA 1UIKA 1CAUA 4Z07A 3WW3A 3RNSA 1WA4A 4GULA 5CU1A 4IEPA 4YSFA 1RL3A 1RTVA 2PAKA 2XLAA 4IEUA 3RDIA 4IEXA 3JZVA 4EWAA 2O8QA 3HIFA 5BY5A 3BPZA 3GBFA 3H1YA 2H6CA 3R6SA 1YFYA 3QOPA 4BH9A 4IEQA 4JVAA 2GZWA 5BPXA 1Y9QA 4D7SA 2MNGA 3S7EA 3SMHA 3CLPA 4HVRA 1Q5OA 3D0JA 3I54A 1O3RA 4H7LA 2Z2SB 5I91A 2F4PA 2PAEA 3CEWA 5JR7B 4HN0A 3LA3A 3KGLA 4FBFA 3LAGA 4XEZA 1Y3TA 2BEOA 1O3QA 2K0GA 4KU8A 1OFNA 2CAUA 2GC1A 4IESA 2XL7A 4B29A 2CGPA 1ZRFA 4LEJA 4QM8A 1IPKA 4XETA 4AQ2A 3EQEA 5FLIA 3USSA 2WC2A 2Q4SA 4XFGA 3H3UA 5FLJA 4IEWA 1X8MA 3LZZA 5BXXA 2PTMA 4QMAA 1LKNA 3SXWA 3WW1A 1RGSA 2E9QA 3S7IA 1ZRDA 4HSLA 4I09A 4MGKE 3IDBB 2UYBA 1CAVA 4O9EA 3RYPA 1DZTA 3BCWA 2Q0AA 2IC1A 5FQ0B 5LEJA 3N4MA 1FI2A 4DINB 4D7TA 2ET7A 3HT1A 3RPQA 3ZDSA 1XE8A 5FPZA 1VJ2A 1WGPA 5JAXA 2XL9A 1U12A 5AVPA 5CADA 2UYAA 1FXZA 1ZZBA 4K8FA 4TLFA 1DGRA 4EWEA 4I3PA 1YHFA 3LA2A 4N9IA 1NYWA 2VQAA 3CO2A 4ORFA 5KHHA 5FLHA 3EBRA 2IXLA 5I0SA 3MDPA 3EJKA 4Z82A 4UBHA 4X6RB 3EHKA 4EWDA 2HKXA 4J1XA 2PYTA 3FFQA 4I0BA 3H1MA 1EP0A 3L2HA 3ETQA 5J7MA 2FMYA 4QGNA 2D40A 2BNMA 4XF9A 3H9AA 2OZ6A 5K8SA 3RYKA 4IERA 4MGYE 4MV2A 4HBNA 5F1RA 1ZVFA 4FT8A 2PQQA 1L3JA 2GC0A 1O5UA 4PIZA 5D1IA 4XFBA 3U11A 3ES4A 1YUDA 4LA2A 1O3TA 3B02A 4YYOA 1ZZ8A 2H6BA 3SCFA 5I8YA 1NZCA 1PMIA 2IXHA 2XGXA 1X8EA 3H1WA 3NVCA 4KWKA 2ZCWA 3M70A 5BUVA 5EFUA 5FPXA 3IIAA 4MZUA 1NE6A 1YFXA 1OI6A 4WVZA 1UIJA 3H3ZA 1LR5A 4MGIE 1OD5A 2C0ZA 1J1LA 3H8UA 3C3VA 2BGCA 1UPIA 2GAUA 4AVBA 5HI0A 2O1QA 2XKOA 3KMHA 2XKPA 1I6XA 4HVOA 5I0TA 5FQ0A 1CAWB 4WZCA 5J3UA 1ZZ7A 3FX3A 3PNAA 4MGZE 3LWCA 4EV0A 3ELNA 2Q30A 1ZRRA 5I8SA 2QNKA 2OYZA 2D5FA 2IXJA 4QGMA 4KWLA 4I01A 4R8HA 2H0VA 1ZZ6A 2EVXA 3BU7A 4KU7A 3KCCA 3RYRA 2XLGA 4A2UA 1J3QA 3SHRA 2OPKA 3FZ3A 1NE4A 2OA2A 4HN1A 3S0MA 4AVCA 3HQXA 4XFFA 2B8MA 4MX3A 3TNPB 4X6QB 2Q1ZB 1UW8A 2WFPA 3ST7A 3FHIB 3MPBA 4EROA 5CVRA 1ZX5A 2BYVE 3SCGA 2B9UA 1ZREA 4FAHA 2CAVA 5LRRA 1CX4A 3G7DA 3HT2A 1WLTA 2XHKA 3I7DA 2MHFA 3NW4A 4ZU7A 4O9GA 5LRSA 1J3PA 4LUKA 3WW2A 3NKTA 5JSPA 2K9ZA 3IBMA 2N7GA 2ET1A 3MZHA 4P9GA 5KBFA 4BHPA 4AXOA 4LA3A
chains in the Genus database with same CATH superfamily
2DTYA 3BVCA 3SJQC 3RQ0A 3GXUA 4I0WB 3CXCU 2EJ7A 4MTXA 1F31A 4KL1A 3DGTA 3VBUB 4AEDB 1ASJ2 1H30A 3CU7A 2ETNA 4WBBA 5BNPA 1GYKA 5IVBA 2H0BA 3I2JA 1A3KA 1YHQV 4XIKA 2JE7A 1YI7A 5EYPA 3E8GA 1NTKH 2Z4FA 3TNQA 1I94O 5LP6B 1VMJA 3WDYA 4GAZA 1DYOA 5EBMC 2EJRA 3WF1A 1BSMA 4I02A 2JIJA 2A6YA 1O3SA 2DUQA 4DV4B 2QR4A 1L8DA 1O7FA 4Q27A 4KWJA 1YDXA 3JCUZ 4FSJA 1V6IA 3RWKX 5FPRA 5LMNO 2VVEA 4ISQA 2E33A 3N2KB 3VQYA 5CN0A 2E5LO 1SLBA 4HSJA 2X05A 3VBHC 1URXA 3AG3C 2F23A 1OCOB 1RSOA 4KG0A 1OHFA 1CN1A 5C5UA 5FOBB 3VBUC 4BLIA 3CX5F 2HG5C 4QPYA 1TQ5A 2FMDA 3ABMB 3D3AA 3ZPOA 3PVBB 3RWNA 5GZEA 2R9RB 2PFWA 1RVF2 1GQGA 4X65B 4QB2A 1Y74B 4LF4O 2RJLA 2P6JA 3JBG2 3MDSA 1SEFA 4KNCA 4COZA 1COV2 1OXCA 1HDJA 4B3SO 1VBC2 1YXBA 1W04A 2GDFA 1I1EA 2ZM6O 3APBA 4JGYA 3ZRWA 4YW5A 4IV1B 2CHHA 5FYCA 2YICA 1AJQA 4UF0B 4NPRA 3WCRA 5LBEA 2QWQB 2ID4A 1QNMA 1XBLA 2ZGNA 2VG9A 1IGOA 1IVSA 3K3NA 2BGPA 5I0DA 4A42A 1R1A1 5JWPA 5L7OB 1OCOC 1VF6A 1XI1A 3RDIA 4JF3A 1AR63 2QWRB 4XZPA 4KXRA 3ZIWA 5IAVA 1QJZA 3GBFA 4MVMA 4ATEA 4MLOA 1AR5A 1W2BU 2ORXA 3SMHA 5EV7A 1WP8A 5B1BC 3WQ7A 2F4PA 2PAEA 5J1XA 5JJEB 4DV6B 1UKGA 1UKRA 3ZPYA 5DUWA 4BMBA 2EF6A 4Y33A 1O9GA 3VBSB 3WF4A 4EKWA 2W1SA 4LLFA 1GZWB 4Q4W1 4LORA 3ON7A 2JJ2G 4CRQA 4PI0A 1KS4A 5F6KA 1KBHA 4RHV3 1W6NA 1N0NA 2PHXA 4IEWA 4ZXKA 2RQ6A 4XHBA 3ZN6B 4IE6A 2LFSA 4OUEA 5FY9A 3VBFB 4YHHO 1XNQB 1MZ5A 1XUQA 1UPGA 5HFMA 5CADA 4TLFA 3QVNA 3K58A 1KDMA 4PDMA 5FLHA 5FZEA 3RYIB 1EPWA 4IV3B 5L7OC 4UBHA 1ENSA 4CP1A 3STZC 3H1MA 5IYBO 2BNMA 1XMOO 4D7YA 1T2XA 1DQ0A 4BQ3A 4AR2A 2F17A 3WINE 1SACA 4MGYE 3CD6V 1ZVFA 2PQQA 1WCKA 4PIZA 4FLWA 3H8RA 1L1FA 3ZRXA 4DV3B 3VQWA 1H38A 1S0DA 1M93A 2IZWA 2XJSA 1MEC1 2X6BA 4Z1VA 2M6YA 3I2FA 2XH6A 1V6JA 3RYHA 3B09A 1NE6A 1UIJA 3H3ZA 2CK3G 5C8YB 3AP5A 3HQRA 4NRQA 2Y33A 3RZKA 1J1LA 4UXNA 3ECQA 5T54A 1YQCA 4JI7B 3THOA 4QU1A 4WV8A 3K0DA 2EIGA 5A3TA 3OEHG 1CAWB 3PVOA 4MGZE 3LWCA 2PHWA 4MW3A 2QNKA 3J26N 1W6OA 3JD71 2CDYA 3VBFC 2YPDA 1OT5A 1VRH2 1SQPH 3RYCA 3IGAC 1MNGA 2RNBA 3ZSEA 2NN8A 1SQFA 4NR1A 3TXQA 5DZEA 1XNTA 5A3UA 2E7QA 2OIGA 4GLXA 2KR2A 3PUQA 4IV3C 2QA4V 3F5WC 2WFPA 5J96B 2A70A 2Z0AA 4WFEA 3H42B 3CCEV 1VAKA 3UJOA 2PLV3 3JUUA 5JZGB 3KB5A 5ABJB 2Q0OC 1D4M2 1F4NA 3IPVB 4K8RB 1BVVA 3K5MA 4JZ2A 1UU5A 1ZBA1 2E63A 2PHTA 4LA3A 3OY8A 3T1YO 3K4DA 4BISA 3MI8A 1GMGA 2ZGTA 3K5NA 3M3IA 2JGDA 4XFAA 3U10A 1U5IA 1DBNA 5A1LA 2EULA 5KA6A 3MHHC 4PA7A 1S5HC 1B04A 1RFYA 4BPZA 1Y76A 4J41A 4WFHA 3H1IH 5FPVA 2B46X 2DU1A 1GNYA 1QJY2 4W8JA 4DR1B 5FOJB 4OXSA 2JECA 4GH4C 1HJFA 2IXKA 2YU2A 4MGTA 3ZLIA 3BB6A 2HEWF 1POQA 4W6YA 3GBGA 2FB5A 2AUYA 2VQUA 2YHJA 4B3MO 2J1SA 1TNRA 5T55A 3WFVA 3OF1A 5A3NA 2XBO3 4EN0A 3EVKA 3W20A 5KR7A 3VKOA 3L2YA 1AI7A 1F4MA 4LO7A 1V54C 1ENQA 1TME2 5JZGC 1CIWA 2Q7GA 4CS2A 5ABJC 5L3CA 1BCCH 2VZSA 3HEIA 3FJSA 3H50A 3I8TA 1M4UA 3T4ZA 4LCUC 1JHJA 5IYZA 3K4ZA 5A32A 1NR1A 1C8NA 2QKDA 3LDRA 3H1JH 2ADEA 3HVDA 2G1MA 5LA6A 1VMGA 4JI1B 2B9VA 3KGZA 1C8M1 5F9TA 1EUTA 4FZ0A 4EFBA 1GK9A 3P1IA 2HJFC 1RUE1 4CEWA 1D5AA 3I3QA 2BTOA 1IBLO 3E8HA 3FLTA 2WLIB 5F5CA 3IN9A 2FTKA 3SR2C 3EB7A 1R3JC 5CFDA 1G1XB 1PGL2 4IE5A 5JOZA 5FZ3A 2IXIA 4HKLA 4HKOA 5BR8B 4NPMA 3TJTA 1N34B 2RDCA 3NV3A 4CP2A 2SLIA 1W8OA 1HWYA 3SYAA 4WVVA 2GU9A 2C6SA 1V55B 4XUQA 1SESA 1FYJA 4J25A 2IVIB 4PLOA 5A6XA 5FZOA 4QE7A 4MGSA 1HNWB 2PELA 1LUVA 4OQ8A 2VTXA 3ZFEA 4GULA 4HYOA 1VE0A 1VRBA 4IEXA 3VBRA 3JYCA 1XHZA 1YFYA 3BHPA 2VW2A 2XHNA 5T5JA 1CZTA 3FHQA 3NNFA 4M3CF 4PA4A 4CEYC 3O9OA 5A33B 1W8HA 1PK6B 2ZTNA 1SDWA 1Y9MA 4FBFA 1XSQA 3AK3A 4AQTA 2CAUA 5D2AA 4IESA 3O65A 1W6QB 5FPBA 4RR3A 4ISRA 1JYTA 2VCMA 4O4LA 1NUKA 3LNMB 4XDLA 4AEKA 3IDBB 5DN2A 2NLRA 2EICA 1E5IA 3OGVA 1V55C 2UWAA 4HFSA 5LEJA 1OV9A 4D7TA 4QQHA 5FZ7A 5FPZA 2JXAA 1JOJA 4CH5A 4XW3A 1FXKA 2W47A 5A3PA 4WBNB 3PUAA 4M0HA 5HCAA 3DTUB 1JOYA 4A45A 3WDXA 3CO2A 4LR3A 4BWAA 3WQBA 2FDJA 4DEQA 2IXLA 1YZBA 4BQ4A 3MDPA 3MLKA 5JIAA 3TEWA 1OKQA 2VMHA 3Q8CA 4XF9A 1KKDA 3G67A 4CCJA 3NNJA 3KG2A 2CSGA 4TV8B 1A32A 4U36A 3OBZA 3SKVA 3NR7A 4FTEA 1PK6C 5IY5C 1SLCA 2VZVA 1DGSA 4QB6A 3IIAA 2JGUA 1AR61 3CQOA 2VMGA 4QX0A 1OLRA 4LF6O 1BBT2 1XBFA 1LR5A 1N33O 4LOSA 3P32A 1VQKV 4C90A 2FD8A 3KT7A 2WLHA 5C9AA 2VCBA 2WDBA 1HXS2 3HKBA 4JDOA 3WVJA 2HLEA 5DAPA 1S0IA 1IKQA 3B4SA 4FFKA 1B09A 2P67A 2R49A 3PIJA 4YZ4A 4RHV1 1KC8W 3D3QA 3POIA 1DTOA 5DDJ2 2LJ2A 3FZ3A 2VOVA 4DK1A 3TN93 1JVMA 4DR4O 4CZZA 3S3XA 1DZQA 1URFA 2DDUA 1QDCA 4GKKO 5IWFA 3ZSLA 3KV4A 2PYLA 4X64B 5LBBA 3WP3A 1UY3A 3ZJZA 1M56B 4LNVA 4FPYA 4O9GA 2EXIA 5KXCA 4MG2A 1MOFA 1NQTA 4UUJC 3IC7A 3SEEA 2N7GA 2YZ4A 3ZR6A 3SH3A 1SQVH 3OPZA 5LGTA 3JCZA 3F95A 1S77D 2BSKA 1H8TA 3LFIA 1S3JA 3CP1A 3WHUA 1ODMA 1G4YB 3IWZA 3PU3A 4X8NA 3CMAV 4FP3A 1WBLA 4O4JB 4I55A 2WJSA 5JDBA 1SMVA 2QVSB 5FYYA 4GJZA 1DHKB 5JQGA 3I2GA 1YQ5A 3H1LH 4FLVA 4IHJB 5CBFA 2ODMA 4Y4RA 4DK0A 3J7NA 5IWAO 4Q29A 2ARXA 5BMVB 4IE7A 4FPJA 2GN3A 1HW5A 4M4PA 3HMYA 4YW1A 1HN0A 4V1PA 2VM9A 5JLVA 2JG8B 3D3IA 3FWEA 3OCPA 3HQUA 3O0XA 2PI5A 3I2KA 2D6MA 5EP9A 4JDMA 4IXLA 3DXUA 1NZIA 4IL7A 4P5YA 1OFSA 4JYAB 5C4WC 3FAVA 4ZONA 5IK8A 3U4SA 4AL9A 4N53A 1XU1A 4GB32 3IDAA 3L73H 2V73A 2JDUA 3LEMA 5FK8A 1AR72 4J10A 1QGLA 2ZGOA 3MHZA 3UO3A 1W9FA 1WLDA 1ORQC 4M01A 2FDKA 3BOWA 3S57A 3PVNA 2Y69B 1D2QA 3VZJA 2ZJCA 3HPNA 2F66C 4HNAB 3RMYA 2PLV1 2WWWA 4GYCB 5LOVB 3I59A 2ZHLA 1F9KA 1LUWA 2YI8A 2GNDA 4WVMA 2X09A 1PMJX 4YJ2A 4L2NA 3HKDA 4BQYA 2OYQA 2PN5A 3JATB 4XTPA 1REEA 4E2LA 1AX1A 5E8AA 3CJHA 4EZHA 2P5BA 4FFHA 4H3WA 2HWC3 3LCPA 3ABKC 2XMLA 4BZ4A 3MIBA 4HAMA 4NHXA 2VCCA 1ULCA 1FNZA 5KC5A 3BCCH 3FYEB 1QQCA 4BIFA 1N1SA 5E16A 4W4ZA 5BNOB 4GKJO 1MS3A 2VJXA 1TVKB 4ZU4A 1NCRB 4M0NA 4XXPA 3NL1A 3J8F3 4NB5A 3BVOA 1RINA 5KWRA 3DEMA 3H0OA 4ONUA 2E75B 4Q1PA 2OUJA 1U5XA 2VS0A 2Y0OA 5CA6A 3THTA 2XBO1 4UFLA 1Q7YW 5CU1A 3MF6A 2PAKA 2E7TA 1IQDC 5ACA3 1LOEA 1NZ6A 3WB0A 3QBQA 2O8QA 3G6BA 4R50A 2Y69C 4GZRB 3ZDVA 4CVUA 2GZWA 2EXKA 2A75A 3MIGA 4H7LA 3T30A 4X66O 4YM2A 5H9QA 4NWWA 3KV5A 2P2KA 1MG1A 4YVWB 2UUCO 2OS2A 1HRI3 3PUIA 1H9WA 1TUBA 4DV7B 1ZRFA 2RJ2A 2YGLA 3UO2A 4JZRA 2Q4SA 5IJ9B 4XJ9A 2P90A 2I74A 2JDIG 2D44A 4NROA 1OOPA 3ZHUA 1YQ2A 2F4VO 3B69A 4JI8B 2VUAA 3OOXA 5GONA 4Y20A 4WM7C 4FOVA 5K1PA 1L0LH 1HNZB 3UGFA 3CRCA 2UXCB 2WFF3 4LF5B 2LM3A 4ORFA 4JGSA 4I0XB 1KRIA 3LOBA 1WMXA 3EXUA 4JX0A 4CH3A 5SV5A 4FK5C 2OCCB 4TQDA 5CBHA 3J7AU 3TWIA 2JE8A 3H9AA 1VBB2 1FFXB 3K06A 4QKNA 5A9GA 1QOSA 2QZ2A 1SPPB 4LA2A 2UWBA 4ARYA 5LA9A 1YJNV 3DC5A 2VZ1A 5ITZA 1A78A 4D0QA 5E6HA 1VAVA 2YXSA 4K7JA 1FMD2 3H1KH 1BYHA 4MGIE 1SG3A 4XDKA 1YTFB 1QVFU 4AI2A 4BOWA 4PA3A 3N3HA 2EAKA 1RUH2 4QQ2A 1XMQO 2VVFA 2VCAA 5FUIA 3WG2A 1ZRRA 4PJ0Z 2VW1A 4FP2A 5GLVA 5BNPB 1AX0A 4G9SB 1C4RA 3BA9A 4OMDA 1M1KW 5FBZA 2QKAA 3ZSJA 2QUOA 3NJXA 2ZGPA 5EYPB 3M4FA 1NE4A 2NPIA 5DECA 1S2KA 3HNBM 2Q1ZB 4QPGB 2WAOA 3ST7A 2CYFA 1VQ5V 3FHIB 3SH4A 4LFBB 4LBKA 4YW2A 4AQYB 4FAHA 1UXZA 2CAVA 4DR3B 3N9QA 4JYBA 2WR9A 5EC1C 3SC7X 1K92A 2YFUA 2YXHA 4TT3G 1XNKA 2W0FC 2Q1FA 3WW2A 3NKTA 3S5QA 3QO7A 2JENA 2ET1A 2DWRA 4J9YB 1W05A 4AGVA 2R073 4DY5A 2BTQA 3MF9A 3KKYA 1BHBA 3C7OA 4A7YA 5FPAA 5FY1A 4LULA 1WB7A 5B1AC 1W9YA 2HWF3 3KZ4C 1RSOB 3OR6C 2WN3A 5FWEA 1AYM2 3WDUA 4NHLA 1ENXA 4RQFA 4JPRA 4HOOA 1DYKA 4IEOA 3X2QB 3WSOA 1PVXA 1OJHA 5FMBA 2DBNA 4CC5A 5IYCO 2PHRA 1RP3B 3APOA 2AC1A 4DV4O 2UXBO 1CGPA 2WUHA 4FXGB 4PELA 3OUIA 2X6CA 1APNA 3WG7B 2DF7A 5IT6A 3NXSA 4X9QA 4F4LA 2GC2A 2WZR3 2RM23 4P9JA 5FWJA 1W03A 3VD3A 5FL7G 1AUYA 1P8JA 4B4RA 1IG0A 1SCSA 2QCSB 2P34A 3DPRA 5FY5A 2GTAA 4JGYB 4L97A 1WLEA 3ZRWB 2TBVA 3OBAA 4H13B 2GMEA 3L75H 5B1OA 1UZ0A 1K34A 3TN91 2A79B 3UKTA 1X7NA 1VBD2 1BS3A 4NRMA 3AZYA 2WWSA 2R32A 3M3QA 1ZLZA 1S0JA 2XXZA 3DL3A 4LITA 4XUTA 5FNVA 3H8OA 2AZ2A 4HT1T 3JD4A 3UCSC 4AEMA 2KA3A 1WMFA 3CRAA 2VOXA 3R05A 3L70H 4X65O 1F8VA 5KAFZ 2JJ6A 1PIV2 3X2QC 5FPUA 4CSWA 3FB7C 2FDFA 5JOWA 1NXMA 5BV6A 2VPVA 2IJIA 3AG4B 3POSA 2GUZB 2B39A 3MO4A 2WS92 4DW1A 2AZ0A 2RR13 3W21A 1C5HA 3U0ZA 3KQ4B 1BVP1 2YMZA 2VZUA 5EJZB 1W6NB 3RMXA 3GGLA 5FYMA 2GHYA 1GM9A 5C6CA 2ZNJA 4MS2A 3KT1A 2XAGA 4UCUA 2DQ3A 1HNXO 2A6ZA 3M1HA 3O14A 2P4EA 1ROPA 1REDA 1YQ6A 3RNSA 4XDJA 4QQPA 5DXDA 4JI4B 4J42A 1T6GC 2DQ0A 4JV5B 4DV6O 5LYJA 1VF6C 2RE9A 2VNOA 4JVAA 2WNUC 1HV1A 1NG0A 5JPMB 1I3HA 2XQXA 4QPKA 3RYFA 5H2FZ 2VBPA 2MEV3 1SERA 4NHMA 5IK7A 1O4ZA 2K0GA 1K5SA 4WFGA 2R0FA 4LEJA 1WA8A 4FFBA 5LMUB 2OXBA 1DGRN 3JALA 3RYHB 2AREA 2D3OW 3N7JA 3EXAA 4GKYA 1UO9A 3BU0A 1FXVA 1JUIA 1UNBA 1MS0A 1AL22 4GX1A 3RYPA 1QCEA 4P9PA 2D6NA 3R4SA 2WLQA 3N4MA 1TZOA 3BAAA 1VQ7V 2HWC1 4CXXA 4FPEA 3AC0A 3AZWA 2XL9A 5EK0A 3I3EA 1XL4A 5A7WA 3IMMA 1YHFA 3A8TA 3RYCB 2VQAA 3UJQA 3EBRA 4MXWB 5H9PA 1LJ7A 1UYZA 2ITCC 1O59A 3FD9A 3P5BA 3NQHA 3N7MA 2LW1A 4XCAA 3QTCA 2HBTA 2UXDO 1GP6A 1NCQB 2YIDA 3ME2A 3J8F1 4G2KA 2V4DA 4JI2B 2Z79A 3TBDA 4M4RA 4UV9A 4H44B 1L7QA 1UU4A 2QQNA 3SJBC 2OTLV 3U11A 3B02A 4C7UA 4KHPO 3VV1A 4WCEV 5EFUA 5ACA1 4IL6Z 3VD7A 3ZOIA 1T6BX 4DV2B 4ZBMA 3H8UA 3OY8B 4AGRA 4P08A 1I6XA 3LSEA 4HG6B 5J3UA 2JGDB 2Y6FA 1D2DA 4Q8LA 4EN9B 4QGMA 3WLUA 2ZA9A 1HRI1 3G4SV 2VMDA 2AGAA 2SBAA 1I7FA 3MICA 5FYUA 1HJGA 4LPLA 1Y76B 3ZMZA 2JX9A 2XLGA 1PD3A 4YW3A 3VBHA 1CP9A 4IQPA 1IXBA 4QKDA 4FO9A 3JAWA 1RUF3 1IBMO 3LPGA 2Q8CA 2PGGA 1W3XA 3P3NA 5AC93 5A3OA 5LMNB 4DXTA 1Z2GA 3UETA 3F5TA 3SEPA 4EN8B 4CS3A 1SF9A 3BI3A 3LQCA 4UW4A 5FYTA 2E5LB 4OZXA 4EB6A 3G7DA 1Y7BA 4BWOA 3NJVA 5LRSA 1K33A 1TNFA 2WFF1 2YC0A 2Z5WA 3IBMA 4RQPA 4L87A 3PURA 3MLJA 5KA5A 1UY4A 1QLEB 3NNMA 4ZY9A 1Q8VA 1RJ8A 1KITA 5IYZB 5A32B 5JCTA 3MIEA 1R1A2 4PDVA 1BZKA 4V2WA 3CC2V 5LA6B 4DR1O 2GNMA 1SQ4A 4UBGA 4CUCA 2UY9A 4LF4B 1H8EG 5F5IA 1QWRA 3C3TA 2ZZJA 2RCVA 2EXHA 1GLHA 3F7VC 4CEWB 4TTGA 4B3SB 3OBTA 4NXNB 1JZ3A 1UPSA 3H3LA 1AR4A 1AYN3 3D5OA 3ZXDA 1DCSA 5E1AC 2R70A 3WP5A 3IAYA 4Q4W2 1X82A 5GZDA 5A1AA 1HB1A 3WCSA 1QXPA 3JAKA 3ZYIB 4J7ZA 3LD8A 3OMIB 3CF6E 1GFF2 1BGYH 2HWB3 5FYIA 1UY0A 1TGOA 4EYUA 4JI1O 5JJJB 5FZOB 1FJGO 1F35A 1XYNA 1KUQA 2Y6KA 2JVDA 3J7HA 1R3KC 3ZMUA 1Q56A 3ZFEB 1FFTB 1C1LA 4O4HA 3CXHF 2YSUB 2C24A 1MS1A 2O0OA 1WAZA 3WOGA 3VBRB 4F3JA 4YM0A 4FXKB 1WJZA 4GIQA 1PM7A 4H0LB 1G9FA 2R071 4UB8Z 3IZOA 2A5ZA 5BR8O 4ASLA 4HK9A 1VPHA 4CEWC 1MA1A 2VD7A 1JU3A 1UMIA 1VR3A 1JUHA 3I4IA 1M9NA 1AF9A 1A34A 2HWF1 1MEC2 1CEZA 5HFLA 4AQSA 1FXHA 5CFDC 2XHBA 2IH1C 4DR2B 4KG8A 3L71H 4YHHB 4LH6A 4RR3B 1PL0A 1XQNA 1NY71 3AX4A 2C5DA 2FDHA 4ZHQA 1HNWO 4O4LB 5C8WA 1W59A 4LUMA 1JYWA 1KKCA 4R9AA 2ORZA 1QHDA 3VHNA 4OHWA 3AKPA 1E1RG 4NIAA 4P9LA 5F32A 4RFT0 2QWNB 2V1DA 5DAXA 3JD72 5DG1A 1FOD3 5FZ9A 3M8LA 5LCWL 4XBLA 5A70A 3DYPA 3VBOA 3UT5B 3KSCA 5JSOA 3E8BA 1FXKB 1PO23 3T0BA 2WZR1 1JOPA 2RM21 2ZGLA 4XUOA 4YZ1A 1ZUQA 4K8ZA 4NRPA 2DWEC 3BPZA 1MABG 2JDNA 1TAEA 3CJIC 4YGBA 2RMU3 5A80A 4AHCA 4DPNA 4FOQA 3W5MA 3GVMA 4CZSA 4E8CA 1HQWA 1OA4A 4C1WA 3JD2A 3MW2A 5CISA 4LH7A 1NH2D 2TUNA 2WRAA 2VTXJ 4LE4A 5CBGA 1VQLV 3ITQA 3B9IA 3AKRA 4CH6A 3ICXA 5BXXA 4QMAA 5HV4A 3NV1A 2EIMB 5FZ0A 1LOGA 2G9ZA 3MV01 2OVUA 4DUZB 5C9AB 4DINB 3ACFA 2RR11 4LKDA 3HKBB 3A21A 4XJWA 5E89A 4K8FA 4JI3B 4OUMA 4DO0A 4RN5A 4N9IA 5IYDO 3JD3A 2ZE7A 2UU9B 4MTOA 3EHKA 2YPJA 3OUSA 2PHFA 3CCSV 1EP0A 4X20A 4YPJA 5FY4A 2D98A 2XT9A 2Y34A 3AG2C 4QGPA 3L9JT 3T0AA 4HBNA 5LA0A 1ST8A 2HHHB 2N74A 2VNGA 1H2NA 1O91A 2PY5A 1VQMV 3M70A 1GZ9A 4A5UB 4GH4A 1YI2V 4WVZA 5HXVA 2BSKB 1H8TB 4FPKA 5IVVA 5FZKA 1W28A 3T0DA 3M8AA 4QXCA 4B3TB 2PF4E 4PT6A 4I55B 4XABA 2EIMC 2MEV1 2ZEXA 1UYXA 2GSMB 5I8SA 5JQGB 2EINB 3KVAA 1RUE2 1I0HA 5C9AC 3VOUA 3ZN5A 3VUOA 1TUEB 1KD7A 3C2UA 1XL6A 4LK7A 3WHTA 2TEPA 4KGGA 4QX7A 1U0AA 2QTOA 3CC4V 2Q8EA 4RUEA 1AI4A 3PUSA 3RI8A 3GHMA 1XREA 4K1ZA 2DFCA 1ULOA 4OI2A 4X1IA 3TGUH 2DURA 1UZYA 2Y6HA 3APQA 4LNUA 4NIIA 2XHKA 3S30A 4ES9A 1JBCA 1SCRA 2C4XA 3FAVB 1BL8A 4CCLA 4AZZA 4N53B 4QHZA 4AVSA 2HWD3 2XAJA 1EZJA 1DGLA 1HIXA 4ASUG 2K9PA 2OKXA 3VZOA 1YWKA 3B8MA 3JCIA 3G6EV 4XF4A 5K4LA 2DWDC 1V6NA 2UY8A 1WLCA 5LASA 1IBLB 2JEXA 4FLTA 2MPFA 1K12A 3RT3C 5FO9B 3BABA 3VHRA 4YG6A 3VZMA 2P06A 3I59B 4RGGA 2WT1A 5F39A 3DECA 1BT8A 1QJFA 3SGIA 4WVMB 4YJ2B 3CPWU 3TAYA 4Z92B 3E5QA 2ARBA 1K5MA 3GF6A 4N7IA 3CJHB 1OMIA 1OLQA 4CPBA 1POV3 2FDIA 2WA3A 3VZKA 2FDGA 1E5RA 2BRTA 1O5LA 2Q4PA 1LOCA 4Q5OA 2AEZA 2Y4UA 4LWSA 4YXWG 5FP9A 3POBA 3D8CA 4DRXA 2XTAA 3TRSB 5BNQA 3KCXA 4O2BA 2ZKOA 4HVQA 2XJRA 1OH3A 1RUF1 4Q4X3 1Q43A 4GX5A 2ZHKA 1NI8A 3A22A 4N53C 5AC91 1QIQA 1KEXA 4B08A 3N2GA 1UMZA 2RJZA 2YDEA 2YXLA 5GTIZ 1H9PA 1U97A 2QWPB 3SNMA 2CL2A 4A6SA 1PNGA 3B00A 3PLQA 4H33A 3NRUA 1H1MA 2RMKB 1BQPA 1R73A 1VRH3 4F6EA 5IYYA 3UYJA 4LC1A 1PGW2 2NR5A 1BCXA 4OGQB 3D0SA 3UKMA 2CV6A 1Q90D 5KHIA 1HV0A 2VZ3A 5I93A 2W1QA 1HLCA 4FPLA 3BKZA 1TUBB 1GTOA 1H8HG 2ZXQA 4ZKIA 5C71A 1LHVA 4AEJA 1W8UA 2CUGA 4LXLA 3BFRA 1S0BA 4UXAA 3T2PA 1DZRA 2C9KA 1OOPB 4QDRA 1AYN1 1CZSA 1YRZA 5FR3A 4PIXA 2XJQA 5GONB 4Z07A 2RHPA 4RHV2 2Q73A 3CMEV 1ULDA 2G9FA 4A7ZA 2DOSA 2NQYA 1NLQA 2CNAA 2YS8A 2GV9A 5BY5A 3H1YA 2BDRA 2HWB1 3PVEA 5DM6V 1DF4A 1O3RA 1NAEA 1ZYBA 1JX9A 1BQZA 3LKJA 3T1HB 4CUBA 1VIBA 2E6VA 2KD7A 1W8FA 4LF8B 3HKCA 2Z3YA 3RI9A 4DEVA 1LULA 4RWUA 1GN2A 2WAAA 2WNEA 5ITZB 1QOOA 1X59A 3CRRA 1W2TA 3WU2Z 3ZYJB 2GMPA 4OCTA 1V6MA 1LKNA 3ZHQA 1FAFA 5APAA 1EV13 2UXCO 1SQBH 3C7EA 1J1TA 2KSDA 4DR4B 1WWYA 3QLQA 3ZXGA 1WGPA 2WN2A 4GKKB 4XQDA 1UL9A 4JZGA 1H2LA 4CXWA 4JCKA 4PHZA 4UFMA 4Q8KA 2Q68A 5FO8B 2FMYA 1XXNA 3K04A 3T2TA 2YBPA 2VQEO 5L9BA 1GRJA 1FOD1 1K73W 5LXTA 1GBGA 3OEBA 4IT5A 1VBA3 2YBSA 4QE9A 1PO21 4FZ1A 4KWKA 4Z2AA 1XYPA 5BUVA 5FPXA 3ZX6A 2C26A 5CKNA 4DV5B 1Q8OA 3AKTA 3OEAA 3M7AA 2RN9A 2LW8A 2BTQB 2O57A 5IJRA 2RMU1 2XJPA 5F5AA 5IWAB 4LBLA 1U96A 2AR6A 1MVQA 3LEKA 1P7BA 3ML0A 5FQ0A 5C4WA 3QD6A 3FX3A 2G19A 4QDQA 5FAXA 2XUEA 4U3FH 2PLV2 4L99A 1Q86W 2OYZA 3WNLA 3BIEA 5DN6G 3JU9A 3UM7A 1GN4A 4Q26A 4I4TA 4OUSA 3STLC 2HYKA 5GZFA 4A6OA 1WW6A 4LR4A 2EZPA 4LFBO 4AQYO 4RS5A 3AG1B 2WLPA 1O9HA 5C3SA 4DR3O 4O65A 3CS5A 1GH6A 1WW5A 2OA2A 1G9AA 4HN1A 2JS5A 4C1XA 1RPOA 4JHTA 4BW5A 2EIBA 4DRVA 3JSLA 4YFZA 4MVZA 2A6WA 1ZREA 1OC1A 1LGNA 1CX4A 5DAWA 2MHFA 2RDSA 3BN6A 3SYPA 2ADDA 2ATKC 1E5SA 2W1WA 2UURA 3OYWA 1UZZA 1WKYA 3DPRB 3MIDA 5A3MA 2E76B 4FM1A 4CCMA 4HANA 2H8PC 1PVC3 4XFCA 4ZS2A 2XBO2 3DXTA 1ZZ9A 2WLMA 1RMU3 1UX6A 1SS3A 2W6IG 5F2VO 1EY2A 5FNVB 3IIIA 1GKBA 1PP9H 2OT5A 2A71A 1NT0A 1COV1 4R52A 3U78A 1Q81W 4AFBA 1AJNA 1IS3A 1WZXA 1TVGA 4TOIA 4GKJB 1FPN3 3AG1C 3WP4A 2IWGB 4PLNA 1LGCA 1G8WA 4NIDA 1QU0A 2ZS6B 2VVDA 2XLFA 5J98B 4QKFA 1OCZB 3WQ1A 1HRV3 4NAOA 1DDLA 4DUYO 1AZDA 1MPXA 3OD4A 5EJ1B 3H9VA 3ABLB 5EZWA 3NV4A 1HQLA 4R7CA 4FAGA 3I3MA 3HOBA 5B4NA 1R6KA 1NQDA 4UWDA 5E1RA 3ZKUA 3ACGA 1AX2A 2LTNA 4X66B 3ABUA 4WZFA 3GJBA 4OFGA 4LTAA 5J48A 4CDUA 4RGKA 3DC6A 2HR3A 3WQ0A 5FKBA 1QMJA 5J36A 4I3GA 4YIOA 4S2GA 2IH3C 1P4RA 3CL1A 2HWD1 3O0VA 3RYFB 1GSLA 5DDJ3 4AHWA 2ZZQA 4G28B 4QXKA 1BK1A 2VH9A 4N23A 1Z7S2 3UV9A 2Q69A 4IGPA 1WA8B 4FFBB 5JVDA 1U5YA 1SBDA 3JALB 1ENRA 2UWCA 1RUC3 4BIUA 3T09A 2VULA 3OM3B 3LSDA 5FJHA 3ZX7A 1XNRB 2PA7A 1HB4A 2BOCC 3JB4C 1UY2A 1POV1 5CAZA 1S5LZ 4JV5O 2PAMA 3ZXFA 1RUG3 5K0UC 5JCOA 3NKGA 3ZM8A 4YY3O 5A7WB 1L0NH 4UVCA 4YSFA 1KQRA 4HETA 3PMEA 3RRDA 1COWG 3SPHA 2PI4A 1UAIA 3KD4A 5D8AA 3S7EA 4UCOA 5L36A 1GV9A 4Q4X1 2RG4A 1YEWA 1FYUA 5IT9N 4LQRA 2B5UA 2Z5UA 1IQAA 4RQEA 4B1LA 1DLLA 2RS12 3KQRA 3K46A 3T4VA 3ZIAG 2CTPA 1Q8SA 4AG4A 4BE3A 3VKMA 3JARA 3VDDC 3TYJA 3USSA 3OGIB 3ZHSA 2C2AA 5CG9A 2JIZG 1D0HA 1S72V 4JDNA 4FM2A 3LEGA 1DF0A 1AXYA 3GCXA 3ABZA 1N1TA 1VRH1 4O9EA 2ZAAA 2VUJA 3O1PA 5BYNA 5EQUA 3CRMA 2ZGRA 4H37A 1XE8A 5IHRA 4YZ3A 2DVDA 5FBJA 4K8XA 3O7OA 4Q20A 2X6AA 3IAQA 1CX1A 2ZNIA 5KHHA 4AI9A 4I50A 2WO1A 4JI2O 1PHMA 3VBHB 3GHNA 3EJKA 1R083 3JAWB 4X6RB 3B9CA 1JCHA 2V7QG 3FFQA 1CJDA 4I0BA 4D6QA 4ZI7A 3WZ1A 2JKXA 2WL1A 1SDDB 1MSWD 3ES4A 1YUDA 3J81N 3KVBA 4NN0A 4DV2O 1XC6A 3SCFA 2DVAA 2LW7A 1N4CA 4JRLA 3NVCA 1GWMA 4RQPB 4J80A 4N21A 3TN92 1Q6UA 3AJZA 2VOTA 3IKWA 5FMDA 3OB8A 1SRYA 2Q7HA 4XBNA 1ND2C 3ZVXA 2XG3A 1UPIA 5HI0A 1XDCA 3HD8B 4OI1A 1GU3A 5F7UA 4YG0A 2UXBB 2WO2A 2HEPA 5EHDA 1A8MA 4OI4A 2RDQA 1WLWA 5JI7A 1LESA 4JRAA 1GKFA 3ZS8C 3A0KA 3OPWA 2EVXA 3FYIB 5FZGA 3BU7A 3W9AA 3IM0A 2EILC 3AK0A 1UYPA 2QFEA 4QAWA 2VQFO 4JKKA 1YJWV 2R063 3T2QA 2WINB 4YGEA 1EV11 1WA6X 2BQPA 4E9KA 5A7QA 3SCGA 4UVBA 2GNTA 1SLTA 3JAKB 3AL6A 2RS53 1UY1A 2P6HA 3DUIA 3IMNA 4DUXA 5B3SC 5B1BB 2N05A 4CU8A 2MK3A 4JAVA 2Y4TA 2O8OA 1F7YA 4RQPC 3Q8EA 3WDWA 3C90A 1ND3A 1XOUA 3AL5A 4GD4A 5I8TA 2DUOA 2QDNA 1D0GA 5IVFA 4DXWA 1W9SA 3K4AA 4HMZA 1VBA1 4NXNO 4O4HB 1H2SB 1QXRA 2A6VA 2D3SA 3HKEA 2QQIA 1LU1A 4URTA 4LFAB 3E5UA 3NV2A 4DIQA 4JGZA 3K03A 3UQ8A 3AXDA 1OLME 5EZYA 4XF3A 1HP8A 4AQ6A 2WNUA 1HNXB 2CTQA 4ZOLB 4L8QA 4ZHQB 4PLMA 1ZTEA 2IVJA 4H7MA 2ZHNA 2Y0PA 1PNFA 4X1KA 1S0GA 4P2ZA 3X29B 3WY6A 1FV2A 5BNNC 2HWC2 3PHMA 2A7AA 3DN7A 2I45A 1R093 1YFWA 3I56V 3VBOB 3ZYFA 5JMOA 3Q8BA 1W8WA 1Q6HA 2D93A 1EUUA 4KBBA 3J8F2 2A3WA 1BEV2 4DNYA 1GQHA 4DR2O 2QM4A 1PGSA 2JRIA 1GP4A 4PDWA 3SCHA 2DVGA 4J1WA 3ZXJA 2VL4A 1JHNA 1PVC1 2EBOA 3E6BA 2IJKA 3KV9A 1B35A 1THZA 5B66Z 1NVPD 1RMU1 5L3EA 5ACA2 3OJBA 2WT2A 3AP7A 4QQOA 4JQRA 1J3RA 3V65A 1IG3A 2QQUA 1TMF3 2DYSC 2E51A 5FY8A 2BPA2 5JI9A 3W7SA 2DBIA 1X36A 4XIOA 2Y6JA 4JI0O 5KHGA 1FT9A 1FPN1 4KWUA 3SPJA 1SQGA 5LGUA 1HRI2 5A3WA 3VDCA 2UXDB 4QX1A 3BUCA 1US6A 4O4IA 3VBOC 1NKDA 2CGNA 1RTVA 3AFKA 5F3EA 3GZUC 1US2A 2CAZC 1BE3H 3H1HH 4KHPB 1HRV1 3R6SA 3QOPA 2FYUH 4X20B 3PN1A 1Y9QA 4F83A 2GNBA 2JB4A 1QQP3 3FL7A 3CLPA 3LB9A 4B3NA 4QT6A 5JR7B 5HBAA 3KGLA 4LHSA 1PX4A 2F4LA 2WFF2 3LUTB 5GLWA 1MR5A 3D6EA 4KU8A 2WQZC 4GH4B 4H14A 4AQ2A 4DUZO 2B7YA 3K08A 1UJWB 2Y6GA 2Q8DA 1HB3A 2ZEWA 1KECA 3S7IA 3SISA 3C8XA 5HXMA 4JI3O 2PHUA 2RJKA 4N43A 4P9YA 1EN6A 1IBMB 4BM8A 2ZE8A 1JZ4A 5DDJ1 2UU9O 1V54B 5JH7A 1VQPV 1XHXA 3N36A 5AVPA 1F5JA 4EWEA 3HBKA 4GT1A 2XAFA 2DV9A 3VZNA 1QJEA 1BXHA 4E8DA 1UFIA 1KFUL 2K46A 2HHHO 5GW7A 5FZCA 1HX6A 1RUC1 4LBNA 2BFUL 4JTCB 2D40A 2VXRA 3AJYA 2B1GA 3QCWA 3M99B 2P1BA 4HZ3A 4D6RA 1AVMA 2JDKA 4X1IB 2XDVA 1PM9A 4CXYA 2R9IA 1GWKA 4S2HA 3CRQA 1RUG1 2Q9LA 4LNUB 2PMWB 4ATFA 5I8YA 1NH2B 3VQXA 4PBPA 4LOTA 4AWDA 2ZCWA 4J6GA 1SZBA 4B3TO 1YXWA 2J42A 1WN7A 2LGWA 3VHPA 1LCLA 2WZEA 4BQ1A 2ZT9B 4X89A 2FHRA 1F4HA 5L73A 2XKPA 2W92A 1SZXA 4NHYA 1LOFC 4EV0A 1W0PA 2C9AA 5FZHA 4I01A 4JI6O 1SHWB 5C3RA 5ANQA 5LK7B 2R072 5DMYA 3WF0A 4BU2A 1J3QA 4BB3A 1LHUA 4RYDA 1TA8A 3UT0A 4QDSA 2W68A 1K5MB 1DF5A 1MZ6A 4U2AA 4XFFA 2P4VA 1GOGA 3ZYPA 4X6QB 1UW8A 3AG7A 4AFMA 3CE2A 5A2QN 1NY72 1FJGB 5L9RA 3S5AA 1WLTA 2Z42A 1N0JA 3K5OA 3I7DA 2WLJA 4BXSV 2EX3A 4LWSB 4CEYB 2BU9A 4DRXB 4GWIA 1S0FA 2ZMNA 5KAIZ 4O2BB 3MZHA 3AKSA 3UL2A 4QHOA 3DSQA 1R081 1WCDJ 5JXHA 5C3OA 2EAAA 2W5FA 3W7WA 3N2GB 2BNOA 1DU3D 5A33A 4PQ9A 2WZR2 2RM22 4JTAB 1QY4A 1AL23 5JPNB 2ZX1A 1ZWIC 1EBOA 1DG6A 2AYHA 4K1YA 2WA4A 5EIBC 1W0JG 2DVBA 3LIHA 1SFYA 4MH0E 2HKOA 3CC7V 3CCLV 3JXSA 2QZ3A 4DR5O 1BZWA 2PHDA 3I2OA 2C1FA 3ILFA 4DUVA 2VBDA 2DN9A 1K5MC 1Q3EA 3NJZA 4I0AA 3ZHVA 4QB1A 3CJIA 3DGEA 4E4ZA 1XPWA 1M5IA 1IXMA 1N3QA 4WBNA 3POJA 1RUOA 4MUVA 4AVVA 2QJVA 2DCTA 5T50A 1MACA 2IW5A 4UVAA 3OGGA 5IY5B 3H01A 2QM7A 2RR12 5J37A 2LUWA 2R061 4XJ8A 2WNVA 5A6YA 5EBWC 2N04A 3O0WA 4GWMA 3BEHA 2VUDA 1YI9A 1Z78A 1X33A 5CB4A 4Q0QA 5FUNA 1VAMA 1WNSA 1VP6A 2VR4A 2RS51 1CIYA 4HXCA 3K79A 3AMQA 1JMUB 4ASMB 2WWUA 1R1ZA 3QACA 4Y4YA 1MQTA 5D5QA 5J2UA 4AVAA 4MHUA 1EN4A 1YLLA 5I0UA 2W39A 4AI3A 2P6CA 1PZ9A 3WD5A 4MXVA 3HKCB 4UT5A 2BWAA 4JV4A 4AI8A 5FXXA 5BXZA 1PO13 3GZEA 1V70A 5CKMA 1QR8A 4YJ3A 1LTEA 1L7RA 3PJSK 1ODNA 3IAPA 4Y24A 3SLIA 1U5ZA 1CPMA 2DYRB 3GWKC 1DQ1A 3D4KA 4CBCA 5EYXA 4UFIA 2WLNA 3ES1A 1IPJA 2Z69A 1EPZA 3LGRA 1OZ0A 1YIJV 4BQ2A 1AXZA 3WW4A 2BZDA 1P49A 2CDOA 2VZPA 1N1VA 5GZCA 3ZBHA 1IS5A 4YVSC 1POV0 2VZQA 5K7PA 1GUIA 2R16A 3EHBB 2R043 3T1HO 4TSVA 1IZ3A 3WDVA 4FMTA 3AP6A 4BH9A 4LF8O 5D21A 3MD0A 5GALA 1YYNA 5JXGA 3VQVA 5FYVA 1WMEA 4HVRA 3I54A 1F51A 3AZXA 5HPOA 4MW8A 2GALA 2CGOA 1R091 1X9PA 5LXTB 1K97A 4B3RB 3J7MA 4LBQD 1OVSA 4NO4A 3I5DA 2GC1A 5GLTA 2CGPA 2WLLA 3AXEA 1IPKA 1IS4A 4K6BA 1KQSU 2JDHA 4KGQA 2R1BA 5HCBA 1QJU3 1B6QA 2IM9A 1SKVA 2IFRA 2ZKNA 3WW1A 4MTFA 2AXTZ 2WQ8A 4MGKE 2UYBA 1T5EA 5LHGA 5FZ4A 2DYRC 4K3AA 4D94A 5FQ0B 1JJ2U 3JQWA 5C4WB 1N32O 3ZDSA 4TWKA 5A6QA 2VOKA 4GQ7A 1UWWA 2EXJA 4I4TB 3ZMOA 3B01A 3MW4A 2ENRA 3B8NA 2DJVA 4PV1B 4FQ4A 5CNAA 1RXFA 1NA1C 1BK0A 1TMF1 4RS5B 4Z82A 2A73B 2HKXA 3VLBB 5J9PC 4QKBA 2M7WA 4EEQA 3ETQA 2WPDG 4FPHA 1FX5A 5A3LA 3I3BA 3THCA 1H4GA 2GDSA 4DV5O 1IPSA 2GC0A 2WO7A 5KLVH 4TWTA 4XFBA 3QNEA 1K4CC 4YYOA 2H6BA 4TZDA 5FRAA 2OX0A 5GTHZ 3L74H 3TB0A 3H1WA 3OYWB 4B1MA 4ZKTB 1RUF2 4JI5B 3R0RA 1DQ2A 5FP7A 1W8NA 3ABKB 2DMXA 5AC92 2DW4A 3OT7A 2ARAA 4TN7A 3ZN4A 1QJX3 2BVBA 3B40A 4QIWF 4AE2A 1QQP1 5DUVA 2E31A 2Q7EA 3WG3A 1I5YA 3BA8A 4GA9A 1UX7A 4QD2A 5L3DA 4R8HA 5CMUA 3Q4HA 1O8PA 4XQ4A 2QJ1A 4R4ZA 2NZ9A 2IBZH 1J5EO 3K3WA 4R6ZA 2ZCEA 4OZOA 5LGNA 3PJQA 2WZ8A 4DR6O 4NOTA 3MIFA 3K0GA 4RS5C 2AHZA 1Z0HA 1WPXA 4LJHA 2CTRA 5CVRA 4FLYA 4P00B 5SV8A 1JYIA 2JDMA 4LBQA 1K8AW 3AVSA 1CVNA 5KMGA 4OVEA 4UFJA 2QKSA 3DYOA 3SYOA 3PMSA 2L35A 2VZRA 2ZMKA 3ZRSA 1QNYA 1AYN2 3HN1A 4W4LA 1HDKA 4BXFA 2ETEA 3IDCB 3ZMVA 4FJCC 3DYMA 1QVGU 1L7LA 1WD4A 4Y5TA 5EYYA 5LWBA 2G4IA 1NBMG 1RUJ3 2X8KA 3LDEA 5LY2A 1DIWA 2AACA 3POYA 3I2HA 2HWB2 3WEZA 3HAGA 3K2OA 3ZYRA 3FB6C 3NNLA 2VZTA 3CCQV 2OUHA 4IEZA 3UESA 4NPLA 4WM7B 3KLSA 1BMFG 4K0KB 3R4UA 3POWA 2JDZA 3ZSKA 3OD0A 3AK2A 1UMHA 1SBFA 4KFMA 4ZHNA 5JVDB 2XAHA 2WABA 4GWNA 3U37A 3UKVA 3E22A 1S0CA 2RS33 2LS6A 2GH2A 2OCHA 4Y5SA 1Y43B 1JYVA 4TUYA 2ZE6A 2EZOA 4FFGA 5FZFA 4LBEC 1RUD3 1KXGA 1BQ0A 2HEYF 2VMEA 1PKXA 4QPJA 1YVWA 2JWPA 1QR9A 3R66A 4FLUA 1Y67A 2FCUA 2DTWA 1NX9A 4XUPA 4WM8A 1PZ7A 5FZ6A 1Y6XA 4IYIA 3OGJA 1ZSPA 4MGQA 3OMAB 1JYXA 2V4VA 2ZHMA 2QDRA 2HVKC 5LA2A 4DO2A 1LAJA 2PZSA 3BALA 4CDUC 1W90A 3EO6A 5FDBA 4NHKA 2DYCA 1QU7A 5J2TA 2D6PA 1DYPA 1SLLA 1AJOA 2X53S 4XOGA 5D8AB 2WZPP 1FOD2 1H1IA 1GANA 2J1TA 2P17A 1PO22 3H7JA 1YNAA 1MS5A 4Q2FA 4IETA 2IUWA 2E7AA 2KXLA 1AL21 1WCSA 5KHJA 1JA8A 1PV0A 1FKAO 2VY0A 1XNRO 3OW2U 5F5QA 3JARB 4LHLA 1JZ7A 2Y6LA 4P9OA 3JASA 2RMU2 5T5OA 4QU2A 3IDEA 2MW2B 2QTSA 4QX2A 3WX5A 3T1LA 3LDBA 5FZBA 4K40A 4Q4Y3 2IXCA 3WF3A 3UGGA 2P22C 4CU7A 3GNEA 5CFCA 4META 4QPGA 1UIKA 1CAUA 2E26A 1WD3A 3FX7A 2W0XA 2VQEB 1K5JA 3GZTB 4I50B 5JCOC 3MUY1 5B1AB 4QPWA 3N9OA 1C5IA 3BODA 2F1MA 1FAYA 3I2DA 4DRRA 4CS4A 4ZI7B 4XBQA 1C3HA 5I91A 2EIDA 5D8AC 3PTYA 2HP8A 4XEZA 4MVUA 1Y3TA 3ZO0B 2OPWA 4PDLA 4IDZA 1FD9A 2XL7A 5IAXA 4WVWA 2F95B 1N36O 2WYSA 4AEDC 1RHI3 5C3QA 2B1IA 1V9U3 2ZGMA 3RSJA 3RJRA 3SXWA 2GN7A 1OPOA 5F3CA 1LECA 5D5PA 3SYQA 1QOTA 2ET7A 4FPOB 2HYXA 2ZOEB 4XCBA 5LP6C 4AW7A 2JD4A 2ES3A 1PO11 1HN1A 1VQ9V 3CIHA 4RA0A 2VAUA 1GOFA 4W50A 2JG9A 4EWDA 3SQOA 4J1XA 1D4VB 3L2HA 3LPFA 4QGNA 4Y26A 5FP4A 4COUA 1AXKA 4MADA 2OZ6A 2GTSA 3PJYA 1XNAA 2Y26A 3I2IA 1VQ4V 3HWJA 1P84F 2XJTA 4D6TH 3VKFC 2KG7A 3O1UA 4E4EA 4A44A 3E83A 4G3YC 4UFHA 4UFZA 4LO4B 2R041 3WR0A 4CCOA 2YV8A 4JKLA 3POFA 1E57A 4AI0A 2YEVA 3CNAA 5AFBA 4AVBA 1ND3B 2O1QA 1JMKC 5ANNA 1ZZ7A 5JJNB 4NXMO 3ABMC 2GUZA 5FY7A 1JXNA 4BA6A 1WB8A 2D7FA 5EC2C 2J1UA 4X1YA 2GP5A 2J7MA 3ZXLA 1Y4WA 1KU9A 2YFZA 5L9VA 2ZEYA 3RYRA 4XJAA 2A0LA 1W06A 2HWD2 2Q5TA 3BTYA 2OPKA 3HKEB 1QJU1 1OF3A 3IFXA 1G9DA 3MW3A 3S0MA 3S6PA 1DLBA 3MPPG 4PBOA 4DUYB 2UXNA 1QLNA 3V64A 2QE3A 2CE4A 3B3QE 3K9SA 3W7UA 1WMDA 4JGZB 4BQ5A 3WUDA 4IV1C 2VMFA 5EZYB 3TEYA 1HR0B 1SLAA 2WNUB 4RAIA 2DCYA 2B4KA 4ARXA 2ADPA 3LDDA 3AYEA 4PCRA 4JAAA 3N7LA 5DPNA 4X1KB 1JI6A 5F2SA 4I5SA 3JQXA 2FBEA 4QGLA 1QNWA 1UD1A 3FUOA 4PJYA 2BCCH 5CA0A 2RV9A 5H5NA 3JAMN 4YNIA 1NLSA 4Q0PA 2ZPXA 3WNNA 1ND3C 4F8AA 2W3JA 3ZKYA 1UOJA 1ZBE3 2V72A 4LFAO 2Q6AA 3J80N 2XB6C 4BDVB 4XFIA 2ZX3A 4Q4X2 3USUA 2E32A 3VBSC 4LBMA 4L8JA 4EN6B 5K0UA 4HKWA 4PDWB 1J58A 1SQQH 1QJX1 1ZZCA 4BYYA 2KB1A 1B35B 3OSDA 2ZEZA 4DFSA 3LA7A 1UZWA 3WXPA 4LF7B 3CJXA 3CZJA 3URFA 4JGZC 4SBVA 4NIGA 4IEYA 3FBMA 2JK5C 2BBAA 5LBQA 1CPYA 3BIWE 3GCWA 5FMCA 3E97A 4YY3B 1VB2A 1SLIA 3NSTA 5LA1A 4MXWA 3RG0A 4L11A 3SDLA 5A7PA 3M7MX 2VC9A 4GMP3 1JZ8A 2H94A 2YC2A 1A6CA 1NCQA 3VDDA 3DV8A 4ZXEA 1ULEA 2ZQMA 4QM9A 4INDA 1US3A 3FLRA 1EAH3 4CYDA 5C33A 2YBKA 4O4IB 4JYYA 4OI0A 1VF5B 3VKLA 2XONA 2XOMA 1XQ8A 4Z8BA 4HONA 4D3WA 1DGWX 4DR7O 2BJSA 2YY1A 5TSWA 2BBVA 4A7KA 4ES8A 5LL6Y 2HJIA 1VF7A 1AR83 3FHAA 2CH7A 2PHLA 3PUHA 4L0PA 1W6OB 1XJAA 4PDWC 5DG2A 3RZLA 5FXZA 3NO8A 4X62O 1RUJ1 1B35C 2A1XA 3OFNG 2NM1A 1N47A 4LK6A 4G27B 5IVCA 3CWBH 4YM1A 2AH2A 4MT8A 1DLCA 2KM2A 1PNKA 5DZFA 3QO8A 1NT2B 1VQ6V 4I9WA 4N43B 1ZRCA 3DCQA 2OZJA 1SFNA 3UGHA 5JH7B 3V0BA 3OTFA 2KKWA 3G6JB 2HEVF 2XVGA 1ND2A 5B1NA 5KX5A 1MSDA 3ACHA 3ZMTA 4C0HA 1X9TA 3OMNB 1VQ8V 2RS31 3M2MA 3TK1A 1EV12 1RITA 4C91A 1V6OA 1PM4A 1Q5OA 2QM8A 1RUD1 3SYCA 4WFFA 3I49A 1SFPA 1KD1W 4AK3A 4HN0A 4CP0A 1NVPB 2ZX0A 4IE4A 3NAPA 2LQTA 3ZFGA 3LSSA 3BPSA 2NP0A 4R9BA 1QKQA 5FLIA 3MHSC 1X50A 4CP9A 1RUI3 4UW5A 4XBFA 1RGSA 4ICGA 2X29A 1IKPA 2P3JA 1KJLA 4CC6A 2ZXWB 1FI2A 1D7PM 1VBA2 4R4XA 4FM0A 2VQFB 4YGDA 4N43C 1DK1A 1PPJH 3I55V 2Y60A 5IJ0A 3VL8A 4LMFA 5HV0A 3R4DB 3W58A 2ILMA 2DU0A 4YW4A 4JQTA 1W2UA 4LFCB 4LT5A 5L3GA 2HWE3 4Q4Y1 5IFPA 5K8SA 1L3JA 1O5UA 3RGBA 4CUAA 2JD9A 4D69A 2W87A 1AR93 2XGXA 1Z7S3 3AZVA 2NNUA 5HCHA 1NJIW 5T52A 1F4AA 2WYFA 2D2CB 1OD5A 2C0ZA 4MSWC 4Q4V3 3BTXA 5CFDB 4UW6A 4SLIA 3IC9A 3W7XA 4AILC 3BTAA 3O1MA 2ARCA 4WZCA 2WLKA 2FZ2A 3W7TA 1JYCA 3AK1A 5IK4A 4AHZA 3P30A 4KWLA 2ZXWC 2NN4A 3AKQA 5BNNA 2XAQA 2GMMA 4R9CA 1RHI1 4X8PA 2GSYA 1PVC2 1V9U1 4AI1A 3OTOB 2GBOA 4MX3A 1RMU2 4RL7A 4MVOA 2W6JG 4EROA 2YUEA 2F6BA 3K48A 2P7TC 1OKOA 2UUBB 3CJIB 1N3PA 3VBBA 3UT5A 1VBE3 2D97A 5DAVA 1CJPA 5JSPA 2K9ZA 2E53A 1CESA 1UOFA 4FFIA 3D36A 4Y22A 3KCYA 2RS13 4N8MA 3G80A 2ZGKA 5DZGA 1H2GA 4M00A 4R8CA 1FPN2 2OIEA 1IOAA 2XASA 3H8XA 4J7JA 4XPVA 2AEYA 4QX8A 2Y38A 2WNVB 4XVHA 3NNGA 1SETA 2ZDIC 5KXBA 2RVAA 4P9XA 2LO1A 5CB4B 3JB8A 1PGW1 4PIYA 1OF4A 1HRV2 4RD7A 5C7GA 1DGWA 2K2SA 3UNPA 4B4PA 1CWPA 1IHMA 2EIEA 1MQTB 3LDCA 5J2UB 5A7OA 2BP6A 1RJ7A 3ASNB 4CDXA 3MYXA 3IT8A 4JI0B 2J1VA 1UOBA 4CA9A 2AGSA 4FTBA 5FYSA 4B7EA 1ASJ3 1XOYA 4MVQA 1CPNA 3N7KA 5I0RA 4OHVA 4YJ3B 3AG2B 3ZSMA 3ZFFA 3U4XA 1GNHA 3J9SA 2W52A 4NAMA 3L9DA 5IATA 3AYDA 3E2EA 1BMV1 1G6NA 2D5HA 2F43G 3T1CA 4N90A 1LNSA 4K3UA 3LE0A 4FOWA 3E6CC 3EFFK 1QXJA 1JQ0A 1ZBA2 2WNVC 1DQ5A 5LEKA 3O1VA 5A6ZA 1HQNA 5T3NA 1RUC2 1R6TA 3BY6A 4PA9A 1CQ9A 3AMMA 4P30A 1GMMA 3UKNA 1VMFA 2ZAHA 1SA0A 1RUG2 5EIBD 5CEHA 3GWOA 1MQTC 3HR9A 1CAXA 4IIJA 3ASNC 1ZBE1 2WLLB 1XE7A 5LZ6A 4Y1VA 4LKSA 3LEIA 1GOHA 2JDPA 1RIRA 3BOPA 4PI2A 4FPCA 2ZACA 5FPLA 4GKXA 1VALA 3HBZA 4CPBD 4LIVA 3WNPA 2XJVA 5FXWA 1O6UA 1ALYA 2K1EA 1K45A 1RVF3 4EZ4A 4DZGA 1BHAA 2WT0A 3JBG3 1PNLA 4ASKA 4Y3OA 4IEPA 3WNXA 1NOVA 1QH7A 1N8RW 1COV3 3C7HA 2BUKA 3B94A 4QPIA 3B2EE 4EWAA 3N9NA 5C8CA 2HJDA 1VBC3 4FVVA 1GAXA 4PQQA 1LOFA 4B3RO 2WNOA 1M56C 4IEQA 1B3QA 4D7SA 5K9YA 3M3CA 4JYCA 1C8M2 4GMP1 2RDRA 1GN3A 2BERA 4P9WA 1JFFA 5F37A 4V2VA 1KP2A 3LAGA 4J11A 2BEOA 2BFUS 2FCVA 3MV11 1O3QA 2XWJB 3VL9A 4DXRA 3B93A 4B29A 1EAH1 1EZVH 4XAEA 3BRCA 5LHIA 1R082 5AVAA 3EQEA 4WFBV 4MYEA 3DXRA 3SKJE 4JI6B 1W6MA 4TV9A 1YSCA 2XWBB 3A23A 2QQPA 4DV0O 1H1AA 1AROP 2UU8A 2X7RB 1YIPA 1CXZB 1XILA 5IUQA 1AR81 4W65A 3ATGA 3W5NA 4S2FA 3QH6A 3KF3A 4LBOA 3OAAG 2XVLA 1FATA 2UYAA 3CEIA 1GO3F 3Q4HB 2WO3A 2JG8C 1NYWA 3ETEA 3J7LA 3ZR5A 2R9AA 2OIIA 1KMIZ 2FMLA 1KP3A 1K5QA 4EJRA 2PYTA 3A0RA 1LU2A 3ZHTA 1BKZA 2QGNA 3VN4A 4A3XA 4O2AA 5FMOS 5F1RA 4IERA 3BTZA 3K57A 3S3WA 1BEV3 4JI5O 2BOBC 5CZKA 2R1DA 4LBQB 3TOJA 1N1YA 1NKGA 5F2WA 5FTTC 2IFWA 2PXJA 5L19A 1JYNA 5KMGB 2ADQB 3SH5A 2IXHA 1AP5A 3QO5A 1ZAUA 1OBNA 4QXBA 1M57B 4MZUA 3HKDB 1JN2P 3B7MA 4OQ9A 1W0OA 2R062 4W6WA 2AW9A 2XQRA 3O5SA 2PUSA 2JKBA 4E4HA 1XNBA 2VU9A 3PNAA 4DR5B 4P5HA 4FLZA 2Q30A 2RS52 2P4KA 5CA1A 2IXJA 5EBLC 4AOCA 1OVPA 3AMPA 1M4WA 2A06H 3ETDA 2OQ7A 3RZMA 4OHZA 2H0VA 1V6KA 2O14A 5B2GB 3JD1A 4DQAA 5FP3A 3F2ZA 3GJAA 1TEIA 3SHRA 3L72H 1RUI1 1LHWA 4DYLA 3HQXA 4AVCA 1H2KA 3KZIZ 1MS8A 3ETPA 2B8MA 3TCUA 5FZ8A 2R30A 5BNOC 1I9RA 1NCRC 2BYVE 4CDWA 1XEQA 4AF9A 4LUKA 2QQLA 4CCDA 3E22B 4DV1B 3E89A 3A0BZ 5EWSA 2QEXV 2J22A 4TUYB 3PL0A 1M57C 1UQXA 4BMEA 1DFQA 3QH7A 2BTVC 3MUZ1 4JTOA 1OCCB 2HWE1 1ZNPA 4GALA 1JS9A 4JKMA 1O4YA 1RC6A 1AR62 4WM8B 3CSXA 4XZUG 4AAXA 3ROUA 1WBFA 5H9SA 3A0NA 4PF1A 1GICA 1AR91 4CDQA 4K0KO 2ATFA 1C57A 2UUAO 4Y1ZA 4YVWC 5FXVA 1Z7S1 3CCJV 3LIGA 1ONAA 1D4M3 4XTMA 1J59A 1FNYA 1S76D 5J2TB 4LF9O 4OHXA 4Q4V1 2YI9A 1ZX3A 1R092 2YU1A 3N27A 4YVSA 4M3CE 4Y20B 2W94A 4KH9A 3K75B 2X5IA 4FTSA 1GR3A 5JIUA 1I5ZA 4GX0A 3KS7A 3PTRB 1XNDA 4TLGA 2XPJA 2ZINA 1KJRA 3HNMA 3HN3A 3JASB 1B06A 4OX9B 3POGA 4EN7B 5CKQA 3E5XA 5BZBA 4OHYA 1NLRA 5IVEA 5K1XA 1RUNA 1QJY3 4LLOA 4IUGA 1C1FA 2ZGUA 4GWJA 3B77A 4UFKA 3ZMSA 5CFCB 1WCQA 4YW7A 4YRDA 2OCCC 4TSFG 3ENRA 2VGDA 3KHCA 5JMCA 2ZKLA 1CAUB 1H8VA 4K21A 4NVPA 1OCCC 3E6DA 4LO6B 3KF5A 4KUMA 1VBE1 1TMF2 4WM8C 3RVZA 5KC6A 3ZXEA 2RS11 2BGOA 4AGGA 2ZX4A 2VWJA 1TME3 5CB7A 5FIXA 3AM2A 3V0AA 1LR1A 4GUNA 3D82A 4LE3A 2VNRA 2BE3A 3GZAA 1NA1A 2VMIA 4IE0A 2D43A 4MHRA 1JOBA 1N32B 3AFGA 3C7FA 3ASIA 2G9GA 2D6KA 1YIFA 2OWOA 3KHBA 1IX9A 1QQP2 5BNPC 5C3PA 1XSRA 3LFMA 2VE1A 2GC3A 4FQZA 4BLJA 3R65A 3K3OA 3P3PA 2XVKA 5DEDA 2W08A 1JH5A 1Y4MA 5C70A 5CFCC 1ASJ1 3WV6A 4QX3A 4QPGC 3ZXKA 3NJYA 3FB8C 2JG9B 1R1BA 3OEEG 5IE9A 5M0TA 2B42B 3VKNA 2CDPA 4RGAA 4LKFA 3SPIA 4OYUA 2IJHA 4LHKA 4S2DA 2KG7B 3VZLA 4CTEA 2XNDG 1K42A 1JW6A 5FYZA 4CCEA 1S5JA 1X8MA 2A3YA 5AG2A 5HCFA 1MMMA 4LKEA 2YEVB 1GN6A 4HK8A 4I09A 1NR7A 3LDKA 1CAVA 1J5EB 2IC1A 3UK9A 4MVTA 1W8TA 5CA3A 2ARHA 2XJUA 2VNVA 2J1RA 4DR6B 1UZVA 1GQPA 3INAA 3HB3B 1GWLA 1Z5VA 5JXJA 4X1YB 1VMHA 4CH4A 4E4SA 5FUPA 3WG7C 1RM1B 3AYAA 3MFAA 3QF7A 4U3JA 2F93B 3CZUA 1OD3A 1MVEA 2JG9C 4MV2A 4JGYC 2CU5A 1R3LC 2E3CA 4W6XA 1X4TA 1RVF1 3HNYM 3JBG1 4CCKA 4P02B 1AJPA 1PMIA 4D8MA 4CE8A 4M3CA 1E1QG 3MEPA 3Q8FA 3VD9A 1OI6A 1NXD1 4NTYA 1VBC1 4GX2A 3RJ2X 1QHTA 2JS3A 2GAUA 4TQFA 4XJUA 2XKOA 3KMHA 5CA0B 3SJAC 1Q6IA 4HVOA 4RFRB 2VQTA 1I08A 4XACA 1ACCA 2D5FA 1WUVA 2P37A 4XURA 3AG4C 3HR0A 4BQXA 2BWCA 4B8EA 1M06G 3KCCA 3I3DA 2AHYA 3USUB 2ZD9A 3Q9OA 4PDRA 5K0UB 1XNQO 4JHZA 1HR0O 4IGQA 1BBT3 2OW4A 1ZRIA 1OHHG 1RM1C 4F6RA 1OUXA 3OGCC 3ZYBA 5L3BA 5KUMA 2B9UA 1G86A 1IBKB 4HPKA 5FZDA 4COYA 1HXS3 3N9LA 1D5NA 3E86A 2NLJC 5LYJB 4EE2A 1H2MA 4P9GA 2JDAA 1FV3A 1OQDA 1S0EA 2WWJA 1ZL8A 4AAPA 3ASOB 4AXOA 3WDTA 2ZMLA 3LSQA 2ZIOA 2B9ZA 1NTZH 4K9SA 3LF7A 5DQ0A 4DV3O 4JAUA 3KM5A 1AILA 4XFHA 2V5YA 3VDDB 3T1MA 4GZ9A 1OPMA 1BEV1 2W91A 2RDNA 2IU0A 3AP9A 3WP6A 2Q5ZA 3ALQA 5H9CA 4CUGA 4IW3A 1VLNA 4O7XA 4JI7O 2BNNA 1G6UA 1LB2A 4LF7O 5CG8A 3CKHA 4UCTA 1DQ4A 5FLXN 3CB2A 3CBNA 2ZGQA 1KGYA 4QQLA 1JJOA 1W6PA 1S1AA 4EQVA 2CH7B 4AHXA 3BYWA 2HFEC 1YC61 4JTNA 3ZXAC 2DCZA 1AP6A 3C3SA 1WW4A 4UW3A 2QWOB 3O1RA 5FK7A 1I94B 2JEUA 4E27A 1YO8A 2P3KA 3EYPA 3ZN0A 2BVVA 3OUHA 5IVJA 4H55A 1XRUA 4F7ZA 3T3YA 3ABTA 2NYYA 3RVYA 2IJJA 2FQPA 2YYOA 2GP3A 2HH9A 3ZN1A 3ASOC 1XE0A 3ZIXA 5JSRA 4AEDA 3VBUA 1PO12 3V0BB 3O1TA 4E2GA 2WBKA 2ZE5A 2VECA 4UCSA 3VD5A 1TG7A 1NCQC 1ENVA 2JE9A 1S2EA 1W99A 5FKCA 4I30A 1W3VA 1ND2B 5KX5B 1OA2A 4XDOA 4B4QA 5JOYA 1VB4A 2V09A 2CWSA 4QWNA 1AL0G 3CYOA 1N36B 4GB33 4J7KA 5LP6A 1H6YA 1WPBA 4YLZA 5G04L 3T2MA 1AR73 3DKWA 1Z5WA 2EILB 1JR9A 5IK5A 2BW8A 4IGGA 5A7NA 1V0AA 3NAPB 1K9MW 5FYBA 4YARA 2VXJA 3RN4A 1UCXA 3ZFGB 2R042 2CTWA 3A2FA 4CU6A 1SZTA 2YIAA 2P5OA 3T4HB 4DXZA 4CP9B 3RZZA 1ULPA 1D4M1 4DY3A 1V00A 3A4UA 3G71V 3H7YA 3N2KA 1J95A 5EPAA 2EIJB 1XU2A 3DF0A 1Q8IA 4MVSA 5FO7B 5B3SB 2EALA 2ZM6B 5G05L 4AVTA 1JPXA 4EB6B 2V5DA 4MTGA 3AVRA 2VRZA 1WA4A 3V56A 4JC1A 2QSAA 1RL3A 4ZZ8A 5IJ0B 1P7GA 1GZCA 1QJU2 3JZVA 4X8AA 5BY1A 5T5PA 2JIGA 4MVRA 3SITA 3N9MA 2TNFA 3VDBA 5H6QA 4RUFA 1ZM1A 2GH8A 1WP7A 4XYXA 2Z2SB 1JU4A 1QJY1 5GLZA 1Y74A 4LIUA 2Q67A 2YXYA 1LEDA 1NQJA 5GLUA 4BW9A 4PD4F 3ORJA 1QLEC 2LROA 4LP8A 1OUSA 3K59A 4GMP0 4NWVA 1BHGA 1CR7A 4NXMB 3LNNA 1O8SA 2LALA 3NAPC 3WB2A 3E35A 1KFXL 5FLJA 2P3YA 3ZFGC 1LHOA 3LZZA 4IV1A 3ZYGA 1W2OA 1TME1 4FVMA 4LO8A 1DZTA 5LBFA 4UF0A 4QNHB 1ZA7A 2Q0AA 3O1SA 4K20A 2XOKG 1IS6A 2EIJC 1VJ2A 1G8MA 1N34O 3U07A 5JAXA 2VQ0A 3GB7C 3MBWA 4LFCO 1DGRA 3AZZA 5L7OA 3MGUA 2DCKA 3LA2A 1K4DC 3RFRA 2YB7A 4ITCA 5BNNB 1OA3A 4L92A 2EIKB 1QJX2 4ZOLA 2VOWA 5DAQA 3ILRA 5ERLA 3MAQA 4A41A 2WSUA 1XNCA 4FT8A 5D1IA 1PGL1 3VBSA 2OQ6A 5JUVA 1GZWA 1XMOB 4W4KA 4NIHA 1REFA 3AMHA 2YUAA 1QH6A 3K77A 4BK4A 4Y22B 3AP4A 3ZFEC 1HKDA 3RZGA 5F3GA 5LY1A 2P3IA 4FI9A 2CY6A 4Q6GA 5F8PA 3ZN6A 5LBCA 3VBRC 4R9DA 5FZIA 3VBFA 5DUUA 2DYSB 1VBB3 3ELNA 3RWRD 5B4XA 2W95A 3OTOO 1G7YA 5EXOA 3RYIA 4IV3A 3OGSA 4DW0A 3ACIA 2J1AA 3CCMV 3E8FA 5FZLA 2UUBO 2EIKC 1FMD3 1YITV 3ZEDA 4RR3C 2G38A 2QBXA 1UN1A 1Q8PA 1W2NA 4O61A 1RUJ2 3GALA 4CDXB 4X88A 1ZX5A 1Q82W 1RUH3 4AHYA 4FPFA 5FV3A 3WNKA 1QBZA 4DUWA 2D6LX 2KQXA 3ZFFB 4U7OA 5KBFA 3BGAA 1FXKC 4BHPA 2UXXA 5FFOC 5C8YA 2NMNA 1JZ2A 2BOIA 3D36C 2AZ5A 5A1FA 1JZ5A 3K51A 4COWA 4YWAA 4DR7B 2QDOA 1CAWA 5KUKA 3EMRA 3THPA 2JICA 4E2SA 3I97A 4UV8A 1LHNA 2JEMA 2WIIB 4FFFA 3WF2A 3T1YB 3SPCA 2RS32 2EA7A 4I9QA 3TEXA 3PDQA 4X62B 3GBWA 3ZHRA 1SBEA 3MLLA 1RUD2 3AB0A 3U14A 4D6SA 1SC5B 2W1UA 4QJFB 3TXSA 4YFWA 1SA0B 4XF1A 2DUPA 3CCRV 2QKCA 1WW7A 1E5HA 4ZIBA 4LBJA 4YZ2A 1CAXB 4IIJB 4CDXC 3FC0A 5FYHA 5JZGA 1AYM3 5ABJA 3IPVA 3M3EA 4B3MB 2FKXA 2NMOA 3POEA 4I7ZB 1W9WA 4UI9L 4HZFA 5F6LB 5IDJA 1QDOA 1F5FA 4X64O 3ZFFC 4Y1UA 1BBT1 4N9HA 2JDYA 3MIHA 2ZR3A 1I5XA 3FBYA 4ZS3A 4K35A 5KHKA 1G9CA 4HLTA 4XF0A 1HXS1 4XILA 4QPIB 5GM0A 1MS4A 4NYKA 3DKQA 4L9BA 4BIOA 1LRHA 5C8CB 1OURA 4NE9A 2IU3A 3TETA 4Q4Y2 1S55A 2VW0A 4MOAA 3RBZA 1KS5A 4RSUA 1R3IC 2LGQA 2LFRA 3FFZA 4TYSA 3CHXA 2Y48A 4C0BA 1JFFB 4OLLA 1VBD3 2QQVA 1H8TC 1ULFA 4Z1MG 2QQKA 1YFUA 5FCCA 1AVBA 4AFAA 1N3OA 5FJKA 4AYUA 5H9RA 4E2QA 2DFBA 3DXRB 1W6MB 4TV9B 4ZU5A 2EINC 1H0BA 1RPRA 1PIV3 1NTMH 2YC4A 1VEWA 3Q8AA 2R72A 3OG2A 1R64A 1RB8G 3P6BA 2ZABA 2WQ4A 4JYAO 2WS93 3ZMNA 1CONA 2VTFA 1H6XA 4FPPA 1F15A 4PF5A 1RHI2 1UU6A 3B5LB 1VQOV 1V9U2 3O12A 1OLMA 3K9AA 4XAAA 4CEYA 2H6CA 4ZPIA 2WLIA 4QPIC 5LATA 2MNGA 1C28A 4BQWA 3ZCCA 5C8CC 3QG5A 1UOGA 4IGOA 2HBUA 1V9PA 4IYHA 2ZX2A 4O2AB 2VZOA 4KQ7A 1W39A 4YW6A 1JODA 2B45X 4XXAA 2Y0IA 4ABMA 1J83A 1Y9GA 1OFNA 2VWKA 4ET7A 2A3QA 1LENA 5FMOL 1HB2A 1UF2C 4XETA 2WC2A 4XFGA 4FOYA 4YIPA 2DCJA 2HWF2 2XR4A 3F7YC 5FP8A 3TEZA 1ZRDA 4XE9A 2I07B 2QQOA 5IFTA 5H6RA 1VQNV 1DQ6A 4GB31 4MO3M 5GJ6A 3BCWA 2FZ1A 2WAMA 3OR7C 4Q1RA 1AR71 5CA1B 1W0NA 4XMAA 1GP5A 4P9IA 4XDPA 1GM8A 1FXZA 1ZZBA 3IJ4A 4XHXA 3W59A 5JVVA 2W2IA 1A8DA 4OPHA 4CU9A 1LOBA 4COVA 2ZDIA 4BK5A 3CCUV 1AB3A 1PZ8A 4JASA 5J7MA 1IDSA 5EIYB 3VDAA 3HJRA 4FPGA 2WSVA 1S4CA 3RYKA 1PK6A 2DE0X 4ZZ5A 4NKGB 1XB9A 5FZ1A 1W2AX 1O3TA 1YF2A 5IVYA 1ZZ8A 4CDWB 1NZCA 3PIGA 1W6QA 3WNMA 2A6XA 2VMCA 5IW0A 4UCVA 4XMIA 1BMV2 1ZA4A 1JTZX 1RXGA 4TXWA 5B5EZ 2L9LA 2I2SA 1OQEA 1AHSA 1OQ1A 1FPOA 3ILNA 4DV7O 3MFCA 4H2AA 2D3RA 4LF6B 5DUXA 1EN5A 1N33B 3U1XA 2QTWB 4DMIA 3VHOA 1KB9F 4CDQB 4Y5Z0 5C93A 3ZYHA 4A2UA 2FCTA 1PL4A 4JI8O 1PX3A 1YQ8A 4KI5M 2YROA 3OBRA 4Y1XA 4B7KA 3FB5C 4YVSB 1HNZO 1MZFA 1ZBE2 4UAPA 4DV1O 5JR2A 2X5IB 4LF5O 4NMIA 4TV8A 4YG3A 3M3OA 2Y8KA 5LRRA 3NW4A 1D2SA 1OOPC 5C5TA 1J3PA 1QF3A 4CDWC 2R7EB 4Y1YA 4UCRA 2WSSG 4LO5B 1VP7A 3LOIA 3AYCA 1NU1H 2B5HA 4IEVA 3N35A 4KP4A 2DVFA 4MSVA 4A3ZA 4XUNA 2Q8OA 2R0HA 4BAYA 4G4FA 1LNQA 4OULA 3T4DA 3N9PA 1Q8QA 1IURA 4YGCA 4NJ4A 1H4HA 3RZHA 3RS6A 5E79Z 1I5PA 2WKKA 1KYOF 3CMGA 3K5LA 3CCVV 2D6OX 2MEV2 4GXLA 4CDQC 3GYDA 3FN9A 1S0VA 3V0AB 3OUJA 3ACLA 2JB8A 1AI6A 2H3OA 4XQWA 4OX9O 1PNMA 1KDKA 1EAH2 1NA1B 4URAA 3AMNA 1EYBA 1VBB1 1R1A3 2ITDC 3JSNA 3OPTA 4OPAA 2JJ1G 2X5IC 3FE5A 5F3IA 4DXSA 2VUCA 4N7UA 3LSUA 1UXXX 4C8DA 2CTVA 3OGRA 5FPOA 4QX5A 1Y66A 4CCNA 4I2OA 1AR82 4EFEA 4WFAV 4UYBA 4CCCA 1LEMA 1FMD1 2BOJA 4BJ0A 4Z2WA 1ULGA 4DS0A 4O4JA 5LK5A 1K3EA 3PU8A 1RUH1 3WNOA 4KMQA 4IHJA 4Q4W3 2A9HA 3WG1A 5EJ3A 4YM3A 2Q1MA 5L3FA 5BMVA 3VB9A 4DOUA 1W0KG 5LHHA 3THDA 1FS0G 2JG8A 4Q0SA 3ZRVA 3T2OA 2E74B 1DP0A 4DV0B 3O1OA 3ETGA 1OH4A 5ISLA 3U75A 1WCUA 4U7NA 1CD3G 2L6LA 4Q0UA 2Y64A 1V6LA 3FMGA 4XJZA 1F23A 2QE7G 1O4TA 4FLXA 4E4DX 5GZGA 2QQWA 2ZR2A 1MS9A 2ZBJA 1VIWB 5FZMA 4Q0VA 2XUMA 5KXDA 1GZTA 1CAVB 1PMHX 5AFEA 1F2NA 3FLPA 1LGBA 2X10A 3JD0A 2LP7A 3GM8A 4JTDB 1OCRB 2HVJC 1YJLA 3WW3A 1AR1B 1MEC3 4UB6Z 2J1EA 1XYOA 4HNAA 5LOVA 2XLAA 4IEUA 1AYM1 1AJKA 1MZEA 1RUI2 2W9XA 3HIFA 2PYJA 4PA6A 4U3JB 3CDZB 3IB3A 5BPXA 3JATA 1EM1A 4NTWA 1BJQA 3D0JA 3J4UH 3WG4A 3SPGA 2HLDG 4WF9V 5CBLA 3DPRC 4XDQA 3VGIA 1BLZA 3CEWA 1QEXA 3C7GA 2YIBD 3LA3A 5E88A 1EFRG 3JD73 3RW0A 1SQXH 1YJKA 5DABA 2Q8VA 4QM8A 1TE1B 4M3CB 3T08A 2ZIMA 2ZGSA 5BNOA 3H3UA 4UOJA