1Q5OA

Hcn2j 443-645 in the presence of camp, selenomethionine derivative
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
201
structure length
201
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title STRUCTURAL BASIS FOR MODULATION AND AGONIST SPECIFICITY OF HCN PACEMAKER CHANNELS
pubmed doi rcsb
source organism Mus musculus
total genus 57
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2003-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1q5oA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1q5oA02
4EWDA 1FI2A 4WVZA 2EVXA 3H1MA 2IXLA 3LA3A 4IEQA 2I45A 2BNMA 1ZNPA 2XKPA 3G7DA 1CAVA 3PNAA 3S7EA 3FX3A 5FCCA 4XF1A 2QVSB 5I8YA 1RUOA 4BIFA 2O8QA 3H3UA 4MGYE 4XF0A 1NXMA 4TLFA 5BV6A 3C3VA 3SMHA 3E97A 3H1YA 3OTFA 4Z07A 3FFQA 3SCFA 3DKWA 3CJXA 1CAWB 2Q0AA 1NYWA 3GBFA 2DCTA 2QJVA 3HT2A 3MPBA 3L2HA 1RUNA 3H3ZA 1GQHA 1LB2A 4HMZA 1Q5OA 3I59B 2Q30A 1O3QA 3I7DA 4K8FA 3E6DA 2EAAA 1IPKA 1QXRA 4E2GA 3SXWA 2D93A 4HZFA 3U0ZA 2GC2A 2IXHA 4ZU5A 3LOIA 5JSRA 1EYBA 4X6QB 4IEPA 1Y9QA 2IXJA 4LUMA 4I01A 4I2OA 4MV2A 4ONUA 3MYXA 2H0VA 2Y0OA 4JVAA 4L11A 4AVBA 2MPFA 3WW4A 5C6CA 2WC2A 4QMAA 2CAVA 2GC3A 1O3TA 3RDIA 1O3RA 2XLGA 2XL9A 3RPQA 5KHKA 1QWRA 5I8TA 2PTMA 4RD7A 3ETQA 1FXZA 1ZZ7A 1RC6A 1V70A 4XF4A 3RYKA 4AQ2A 1UIJA 4JV4A 1J3PA 3NJZA 5I0TA 3ROUA 3SHRA 2PHDA 4I02A 5KHHA 2WFPA 4QXKA 4FAHA 5HI0A 1ZRFA 5FQ0A 2BNOA 3IDBB 1SFNA 1UIKA 1X8MA 5LRRA 2ATFA 4FBFA 1VP6A 1CAXA 4EWEA 3ACLA 2KXLA 2PFWA 4P9GA 1DZRA 1OD5A 3NW4A 5EZWA 3O14A 1NE4A 4IEVA 4HBNA 4HSJA 2N7GA 5I0UA 4KL1A 3IBMA 3EBRA 1RTVA 3WW2A 3NKTA 3LA2A 2XHKA 4LEJA 1XRUA 4A2UA 3LA7A 5CADA 5BPXA 1WGPA 3RYPA 5I0RA 3PLQA 4OFGA 3CF6E 3GYDA 2CV6A 2OYZA 3HQXA 1YFUA 1NE6A 4F7ZA 3DN7A 1ZZ8A 1X8EA 4FT8A 1ZREA 2HKXA 2ET7A 4XFGA 3ES1A 5KBFA 5FDBA 4QGLA 1XE7A 3LZZA 4XF3A 2BYVE 3MDPA 3H1WA 5JCTA 4KU7A 3RYRA 4IERA 1GQGA 3QOPA 5JSPA 4ZU7A 3ST7A 4HSLA 4IESA 3BU7A 3I54A 4I09A 2ZKLA 2UY8A 3H7YA 4I0AA 2PQQA 1Q3EA 5EFUA 2VQAA 2VECA 3R6SA 4XEZA 5LEKA 5KHGA 4KWKA 5LEJA 3CLPA 4OLLA 4QM9A 2MNGA 4MZUA 3OCPA 4IEZA 2CGPA 2IC1A 4YSFA 4XFHA 3S7IA 3TNPB 2GC0A 3KGLA 4EROA 3N4MA 1ZX5A 3SCHA 1YFXA 3JZVA 4YARA 3OF1A 2XKOA 4IETA 2IXKA 3EO6A 1PM7A 4HN0A 2EA7A 3H50A 2OPKA 3NVCA 4MGZE 2QDRA 1ZZCA 4O9EA 4Q0UA 4L2NA 4WZCA 4JTOA 3UKTA 4PIXA 1CAUA 3HT1A 4XFFA 4HLTA 2PHLA 3EJKA 4MH0E 4ORFA 3HIFA 3FJSA 4KU8A 2B9UA 4LUKA 3E6BA 2FMYA 4Z82A 3MZHA 1QXJA 4QGMA 4E2SA 5I91A 3TNQA 1CGPA 2XGXA 2O1QA 4FAGA 2GH2A 4PIZA 4Q29A 4KWLA 5CU1A 2D5FA 2Z2SB 1EPZA 4MGIE 1J59A 5KHJA 5I0SA 4GULA 4IEYA 5FPXA 4F8AA 5BY5A 3H9AA 5F1RA 5FLHA 4HN1A 5I8SA 3DV8A 5J3UA 4ZU4A 2UYAA 1CAVB 5FLIA 1H1IA 5E16A 4D7SA 2B5HA 3EQEA 1O5LA 1ZZ6A 3KGZA 4LA3A 4XFAA 5T3NA 2F4PA 4LA2A 1NZCA 2CAUA 3USSA 2GZWA 3B02A 2QCSB 1J3QA 5BXXA 4J1XA 4DINB 3H7JA 1CAWA 3NL1A 1OMIA 4LLOA 5E1RA 2D40A 4PIYA 1ZRDA 3KMHA 4XFCA 4YNIA 4XETA 2GC1A 2VPVA 1YFWA 1ZZBA 3S0MA 3KCCA 3I59A 3D0JA 3E6CC 5C8WA 4D7TA 3U11A 3EHKA 3LAGA 4I3PA 4BYYA 2UY9A 1YUDA 1EP0A 3RNSA 4YYOA 1VJ2A 2FQPA 4N9HA 1JUHA 2P17A 4Q0SA 4QGNA 4XFBA 1G6NA 2OZ6A 3D0SA 3NSTA 3IDCB 1RGSA 1UD1A 3M3IA 3ELNA 4J1WA 2QNKA 1HW5A 2IXIA 4MUVA 1O5UA 4N9IA 4NVPA 5D1IA 3VHRA 2D5HA 3ES4A 4AVAA 4Q0VA 1J1LA 1I6XA 4IEUA 4LTAA 1UPIA 3RZZA 2PA7A 3BALA 2H6CA 5FQ0B 4META 2BGCA 4UBHA 1TQ5A 2ETEA 5JAXA 1QY4A 2H6BA 2V09A 4HVRA 4YRDA 4B29A 1CAXB 4MGKE 4Q0QA 4BHPA 4X6RB 5J48A 2B8MA 3IIAA 1X7NA 2K0GA 3E5QA 5BUVA 4WBBA 2BEOA 4BH9A 4E2QA 1ZRCA 4AQ6A 2XLFA 5JSOA 2K9ZA 3OGJA 2GU9A 1ZZ9A 4Q0PA 2ET1A 2PAEA 4EWAA 1SEFA 3E5UA 1RL3A 3WW1A 3FZ3A 4QX5A 1PMIA 2Z69A 3ZDSA 1LKNA 1XE8A 4XF9A 4XFIA 2XL7A 3FHIB 2PAMA 4R52A 1DGRA 1X82A 2E9QA 4O9GA 5FLJA 4LULA 2Q1ZB 3BB6A 2ZCWA 1DZTA 4R8HA 1J3RA 1OFNA 4H7LA 4HVQA 1UCXA 1YFYA 1U12A 2OZJA 3QACA 1WA4A 4UXAA 1Y3TA 3LWCA 5JR7B 1ZRRA 4IEWA 3FWEA 4AXOA 2BNNA 2IXCA 1IPJA 1WLTA 3CEWA 1LRHA 3E5XA 1L3JA 1SQ4A 1O4TA 3OD0A 4IEXA 4EV0A 1YWKA 3BCWA 5KHIA 1DGWA 3PVBB 1YLLA 3IWZA 2C0ZA 3BPZA 1EY2A 3CL1A 1CX4A 3CO2A 1O3SA 1Q43A 1LR5A 2GAUA 4IEOA 3FE5A 4UBGA 4CYDA 4QM8A 2PYTA 4JTNA 4MX3A 4AVCA 3WW3A 1O7FA 4HVOA 3UKVA 3H8UA 5J7MA 1I5ZA 2MHFA 1CAUB 1ZVFA 4PJYA 2HJIA 5K8SA 1J58A 3M70A 1OI6A 2OA2A 3UKNA 1H1MA 4I0BA 5AVPA 3KSCA 5CVRA 3SCGA 1FT9A 5FPZA 5I93A 2PAKA 1YHFA 2UYBA 3DL3A 2Q4SA 3D82A 1VR3A 4KWJA 3U10A 5LRSA 2XLAA 1UW8A
chains in the Genus database with same CATH superfamily
4FZ0A 2HYXA 1WMXA 3LKJA 3KV5A 4X66O 3SJCC 2EICA 2UWAA 2D98A 2Q5ZA 4LFCO 5FZ4A 1QOSA 4PDWB 4J7JA 4MLOA 2PI5A 2DUOA 2VNGA 3AG1C 3I3EA 1D2QA 1SDWA 1W9YA 1SBEA 1M9NA 1XQNA 3N9MA 5D8AA 1CWPA 4JGSA 4GD4A 2BGOA 1W8TA 1UOFA 2W39A 4DPNA 3DC6A 1RUJ3 3SXWA 5IK4A 3U0ZA 2UUBO 2GMMA 1V6MA 4IEPA 2VC9A 2YC0A 4XW3A 2CDYA 4LBQA 2VMDA 1DYKA 4RSUA 4PI2A 5HV0A 1BE3H 4XUPA 2YXYA 5KHKA 4NHYA 5I8TA 3KT4A 3LUTB 3I2DA 1JOYA 3A2FA 2YIDA 1BEV3 3ETQA 5L3FA 2BWAA 5JI9A 4ZKTB 4DV2O 2GMPA 1GWKA 4U7OA 4IIJA 2WFPA 1HDKA 1SA0B 2W87A 4AAPA 1CAXA 3E1F1 3ACLA 2QWOB 1HR0B 4JDNA 3HWJA 5A3PA 3LF7A 4F83A 1QJX1 3FHQA 5C8CB 4A2UA 2HEYF 2J7MA 4XBLA 1EZJA 4RWUA 1YI2V 5KAFZ 3IB3A 3M3OA 3JASA 3VQWA 3WZ1A 3DN7A 1ZZ8A 4NRQA 2ARXA 2Q1MA 3GGLA 3V0BB 3LCPA 3MIGA 2ET7A 5CA0B 3DC5A 1HB4A 5JH7A 1KYOF 3FB8C 3N2GA 1SF9A 2QR4A 1NY71 5EP9A 3O1OA 3WG3A 1RM1B 4Q4X1 4XMAA 4OLLA 1OCCC 4YW7A 3OG2A 1APNA 4JV5B 2DW4A 4W65A 4B4PA 2RS33 2WO1A 1ZBA1 2VXJA 3LQCA 2FZ1A 3CRRA 4XDOA 3EMRA 1KD1W 3ITQA 4LBOA 1JYIA 4TQFA 4TSFG 4PT6A 5L3GA 5IJ0B 4ZY9A 4AI2A 4RGKA 4XAEA 4LUKA 1CJDA 2FMYA 4GA9A 3Q4HB 3H8RA 1D4M1 1XYOA 2ADPA 4JTCB 4R50A 3ZPOA 5I0SA 4Q8LA 1V6LA 5FOJB 1I7FA 1SLIA 5LK7B 3PL0A 3TEYA 4LA3A 1IKQA 4XHBA 1GNZA 1P7BA 3UETA 2AZ0A 1W59A 4NTWA 2DVAA 3ZEDA 1VMJA 1NTZH 2RDCA 1DFQA 2VBDA 1TUEB 3ZFGA 4TTGA 3ZHSA 1YQ5A 4DV6B 1VQLV 3SISA 5CN0A 1AB3A 5EQUA 4ES8A 4D7TA 3OGGA 3B77A 5DAPA 2OWOA 1QDCA 1RJ7A 3H3LA 3LSUA 4MTGA 1LENA 1JUHA 4YM2A 2RMU2 1M56C 5C9AC 2Y6KA 4XUNA 3WNNA 4XQWA 1BYHA 4Y3OA 4J1WA 1Y9GA 1VQNV 1UMIA 3QG5A 3OGRA 4AVAA 1SKVA 2W91A 4NRPA 1OQ1A 3L71H 2DE0X 4W4LA 5A7WB 1CXZB 2NMNA 5CKMA 2QTWB 4GZRB 4JI2B 3T2OA 2XBO3 4K1YA 4X6RB 3NV1A 1WCUA 1ODNA 4BH9A 1ZRCA 2HWF1 3SPJA 1W8UA 1JUIA 5DAWA 4JTAB 1CEZA 3JU9A 1TZOA 1UZ0A 2VJXA 4ZBMA 2NQYA 1XNTA 5FY4A 3OUIA 2XL7A 1ZL8B 3LOBA 2XASA 2J42A 3AL5A 3HKCA 3ICXA 4HVQA 1DF0A 3VBFB 1QQP1 3E86A 1H4GA 4FJCC 2YXHA 4Q1RA 4DV3B 3S5AA 1K34A 1SS3A 1QU0A 3HQRA 3P30A 1QF3A 1RUJ2 1DQ4A 1F4MA 5LGUA 3THDA 1E1QG 3FLRA 1KEXA 2GUZB 1SQ4A 3ZIAG 5EIYB 2HR3A 1EM1A 3D8CA 2F43G 1LOFA 2G19A 4ICGA 4XJUA 1JYNA 3RZHA 5F5CA 3A0KA 2ZBJA 2Q1FA 2RHPA 3IFXA 1BEV2 1WAZA 1GWMA 5A7SA 1ND2C 1CP9A 4UCOA 2IVJA 4LHNA 1XE0A 3PTYA 1JI6A 3CDZB 2X7RB 4I0BA 4AVTA 1FJGO 3ZYGA 3OBRA 3JBG3 4AW7A 1YHFA 3DL3A 1XMQO 3WF2A 1NZIA 3EHBB 1GFF2 4WVZA 1LHUA 2X10A 3E35A 2VWKA 1Y76B 5B1OA 3FX3A 2VQEO 4YXWG 4CU8A 4M00A 3C3VA 1WP7A 2Q6AA 3K58A 1F51A 3AZYA 1XBFA 4H3WA 2QM7A 3MGUA 2J22A 4QKDA 2EBOA 4YW1A 1BT8A 1OQDA 4ZZ5A 4JTDB 2RDNA 3ZN6A 4OUMA 1GKBA 2CWSA 2HJDA 3LOIA 1YIJV 5JIUA 1PNFA 1J5EB 2V4DA 4FK5C 4LFAB 1NKGA 1ULDA 2QQVA 3RRDA 3GCWA 1YJWV 2QM8A 1BGYH 4JGZB 3ZRVA 4CCMA 4JRAA 3SYPA 2Y60A 1HRI3 3M7AA 1W2OA 3VBHC 4FAHA 4DV0B 1S5HC 4ZOLA 1XL6A 3VDCA 5E8AA 5LBBA 2WYFA 3IDBB 1SFNA 2E7QA 4K8ZA 4CEYC 5L73A 3ABKB 2PFWA 3H1IH 2Y38A 4PBOA 4HBNA 3FB5C 4G28B 3JAKB 4COZA 1XNRB 1K4CC 3USUB 1RUD1 2XJVA 2Q67A 4D6TH 4IE7A 1UYYA 4LEJA 2X5IB 4J11A 4BE3A 5KMGB 4S2HA 2VZPA 2Q8DA 1GZCA 3KHBA 3VZKA 1S4CA 3UK9A 4XFGA 3FYEB 1AYM3 4PV1B 3P3PA 4ZKIA 3SPIA 3JARB 2Q8CA 1AL23 4RS5A 4MW8A 5IDJA 3QH7A 2BERA 5FO9B 3ZHUA 1S2BA 3BEHA 4BQYA 3OEEG 3ABLB 1LECA 3R6SA 4JDOA 1YHQV 4LKSA 3RWKX 3WVJA 1AYN1 4X1YA 1WCKA 5K7PA 4AI0A 2Z0AA 3TWIA 4E4HA 4COVA 1UPSA 3K3WA 4FQ4A 2ZHMA 4JQRA 3ZFEB 4NKGB 1HR0O 3HR0A 1OBNA 1ODMA 2A7WA 4HLTA 1WA8A 4ISQA 3MLLA 2XBO2 4QGMA 4E2SA 4PIZA 1EN6A 1S3JA 4MGIE 2JJ1G 1VMGA 4GULA 3R4UA 4LF8B 2E7TA 3KV4A 3NXSA 3AP6A 4ZU4A 5F2VO 4KQ7A 1SCSA 2HEVF 4CCNA 2AHYA 1S76D 4DR3B 1SACA 4AGVA 2R061 1HIXA 1HJGA 1EN5A 5T3NA 2QQIA 4XXAA 4D0QA 2HH9A 3T1YB 4CVUA 3E83A 1QBZA 5B1AB 3VGIA 5D8AB 5FP7A 4XFCA 2VPVA 2BV4A 5C4WC 2LGWA 1YFWA 4JV5O 1I5YA 1EAH3 1BMV1 4Y5Z0 1W06A 2EIJC 5FLXN 1AR63 5C8WA 1O9GA 2ZKNA 3OTOB 1FATA 4LBQB 1OPMA 2YGMA 1JHJA 4JI4B 1EP0A 3O7OA 1PVC1 1FMD1 4QGNA 4J25A 5GALA 1XL4A 3ZXAC 2VW2A 1OLME 3DPRA 1TME1 1MVEA 4DR4B 4YRDA 3MIDA 1CAXB 4PQQA 1SLCA 3JBG2 3N9QA 1MS5A 2JDNA 3ZSLA 1HRV1 4LBQD 4BJ0A 1SQFA 5L7OC 3K4ZA 4N43C 2ZCEA 1D2SA 3EXUA 1QDOA 3E5UA 2P3IA 1XYNA 1W2TA 1U5XA 3JASB 2OX0A 2DUQA 1C1FA 2PAMA 2QZ2A 4DV6O 2YPDA 3ZXKA 5HCFA 5JH7B 1PM4A 2ZGNA 2ZD9A 3UYJA 3B01A 1TNRA 5CA3A 4LXLA 1LUWA 2IJIA 2IJKA 2VOKA 5DZEA 1WLTA 3CEWA 1LRHA 1MPXA 4CZSA 2Q8OA 4UV9A 1JFFA 3DXUA 1D5AA 3BABA 3ZSEA 5HCHA 1KRIA 3TEZA 2E32A 2LGQA 4LE4A 4JI2O 3WY6A 2YHJA 3RYCA 5IYCO 1HRI2 3I8TA 1OF3A 1W9FA 2JX9A 4ZZ8A 4DO0A 3WHTA 3OUHA 5AVPA 4YIOA 1W2UA 5BNPC 1RHI2 5IWFA 3LDBA 1OCZB 1FAFA 4FP2A 5CBHA 5ABJA 3WP4A 1Y4WA 4Q20A 4DV3O 2E3CA 2CYFA 4PDRA 2K46A 4JGYA 4BIFA 3R66A 4QX1A 2VTFA 4UOJA 3OTFA 5FZGA 1AYM2 1KQRA 3GBFA 1RSOA 3VQYA 3N9OA 1X50A 3I3QA 1AL22 4V1PA 3ZFGB 2DCZA 3AYDA 2ADEA 1E5HA 1JHNA 2XHNA 3I7DA 2XPJA 4G9SB 3WF0A 5FZBA 1UL9A 2XVKA 1PIV3 2D93A 4XUOA 2L35A 3VN4A 4LUMA 3MDSA 1TNFA 1BKZA 1JYXA 1JPXA 3HNMA 2VO5A 3IAQA 5FY5A 4Y1VA 2XXZA 2AENA 2PTMA 3ZX7A 4B1MA 5JXHA 2P2KA 5DABA 3POYA 1UIJA 2D6PA 4QXHA 4RAIA 2JEMA 3T4HB 4DMIA 5M0TA 4ES9A 1UXZA 4YVSC 4NJ4A 1GLHA 4G27B 1FXKA 4K0KB 2XUEA 5EZWA 3OPTA 3K51A 2IH3C 1JYTA 3ZR6A 1RTVA 1Y67A 5FP4A 1HQLA 3MW3A 1N4CA 5IVVA 4B3NA 4MXVA 5FZIA 1HB1A 1SQVH 1U0AA 2FZ2A 1Z5VA 3ZRXA 1CD3G 1NE6A 4F7ZA 3BFRA 4FT8A 3HKCB 2ZHKA 1QJU1 1YO8A 3VKLA 5DDJ3 1LHVA 3KHCA 3N7KA 3BTXA 4JDMA 5L3EA 1OLRA 5JCTA 1J5EO 4KH9A 2WZR1 1EAH2 4FLUA 4IUGA 1P8JA 4LFAO 1AR62 1Z7S1 1AR93 1NT0A 2EIKB 3W21A 3Q9OA 1H8TA 1DG6A 1WCQA 3NNJA 4QM9A 2VUDA 4NXMB 1UZWA 4AYUA 2WS91 1C1LA 4XVHA 3KGLA 4MVOA 4XMIA 5IY5B 4DV0O 3JZVA 2PLV1 2QQKA 3QH6A 3H50A 4FPCA 1GP4A 3TCUA 2TEPA 3BN6A 2G1MA 3MEPA 3VLBB 1QH6A 2VVDA 2WDBA 3BKZA 4BQ2A 1XNRO 4HXCA 5JPNB 3C8XA 3JAMN 2XJQA 1WD3A 4YM3A 4EEQA 2QE7G 1K5JA 4MVUA 5GLVA 2ZXWB 3CZUA 2WZEA 4MVTA 2DWRA 4F6EA 3MW2A 5F1RA 1QR8A 5DEDA 1SLBA 2FKXA 4EE2A 3HPNA 3E22A 2YZ4A 2JDMA 2FTKA 5GLTA 3T09A 2XTAA 5JOWA 2NZ9A 2PHWA 1KJLA 3VHNA 5FPBA 3T0BA 2WNUC 1RFYA 2YSUB 3ZN6B 4LKEA 3OSDA 3ZHVA 4BA6A 1I94B 1DDLA 3VD4A 2HBUA 3K9AA 3WV6A 4HAMA 1ND3C 3OMAB 1VJ2A 3HOBA 5KC6A 1G6NA 2OZ6A 4QB6A 1SPPA 2VH9A 2OPWA 2DU0A 4GMP1 2JDHA 2DDUA 2D5HA 3X29B 3ES4A 2W5FA 4Q0VA 1J1LA 3U14A 1VB2A 4HK8A 1QLEC 4ZOLB 4LF8O 1TQ5A 4RR3A 3BRCA 4HKWA 4DR3O 5CBLA 1ASJ3 1QU7A 1DTOA 2W2IA 4C0BA 4UF0A 2RR11 5GLZA 4QD2A 3EFFK 5IVFA 2UWBA 3T1YO 4CDQB 4B3SB 1ALYA 2JG8A 1TMF1 4XF9A 5C5TA 1X82A 5A3NA 1NCRA 2WWUA 1T6GC 2VUAA 3OTOO 4R4XA 5CAZA 3VZMA 2JVDA 4AVVA 1OFNA 1NQJA 4JI4O 4RS5B 1GKFA 3UESA 4EFBA 2RS53 2ZGSA 4JYYA 2RVAA 2CNAA 4OQ9A 5H6QA 3SH3A 1AP6A 5J96B 3PIGA 2BNNA 5IVCA 4X1YB 4JYAB 4K7JA 5KC5A 1YWKA 4MVSA 1SQXH 1X4TA 1MA1A 1DGRN 1W0PA 1EY2A 1RUC1 2WLNA 3KT7A 1KGYA 3TN91 1PGSA 3R4DB 2BW8A 4CH4A 1Z5WA 1O91A 3VBRC 1G9CA 4DR4O 2KB1A 4KWUA 5GZGA 3AP4A 1O7FA 4J9ZB 1V6IA 1WA8B 1W2AX 2WO2A 2HG5C 2P34A 4YM0A 3AG4C 3WP3A 2ZGLA 1N34B 4IE0A 1GNHA 5LA0A 1WD4A 4PBPA 3H1KH 3KG2A 1DBNA 1WUVA 4IL6Z 2WWSA 2JENA 3U4SA 4EZ4A 2Y48A 4K20A 4S2DA 3NAPA 2F6BA 4EWDA 5AC91 4FM2A 3VD3A 2BNMA 3FLTA 4WM8B 3OD4A 3T1LA 2W1SA 4JYCA 2KD7A 2O8QA 3B94A 4TLFA 3JB8A 3SMHA 2ZM6B 5ITZA 3MBWA 2E75B 4B3MB 5DDJ2 2RS11 3QO7A 2HYKA 4QQHA 4FZ1A 1ZX3A 1X33A 2ZR2A 2WPDG 4EFEA 2BJSA 1VIBA 3WQ1A 1PNKA 1AR92 2ZQMA 3WSOA 1IPKA 2B9ZA 2IXHA 4N90A 3CRQA 4DS0A 2ZX1A 3NQHA 1N3QA 4I2OA 2JJ2G 4X1KA 3LPGA 2NLRA 4D6QA 2ARBA 4UCVA 3CCRV 2GC3A 1QJX3 3TB0A 4CEWC 1DU3D 5GZFA 3M8LA 3DPRB 2Y69C 2DYRB 2DYSB 4B7EA 3NO8A 2C2AA 5EYPA 1FV2A 1RJ8A 4IL7A 4FIPC 4O61A 2WNVC 1OH3A 1GM9A 4FBFA 5EZYA 1IS3A 5A70A 4Y33A 2VVFA 2KXLA 5A33A 4LHLA 1OD5A 3J7AU 2ADDA 2WKKA 2R49A 4DUXA 1RVF1 1YQ2A 4H37A 5CFCC 3D3IA 1AXKA 4E4DX 2IWGB 1Q8IA 4PI0A 2DVGA 3RZLA 4IV3A 2OUJA 3PVEA 3LB9A 2E6VA 2ZGUA 1ZBA3 2FDFA 3OY8A 3RZKA 2VTXA 2OT5A 2BOBC 1IS5A 1LESA 3CD6V 4IERA 3AP9A 3BU7A 4I09A 3VD9A 3VZNA 2Y6JA 3FYIB 3SEPA 5IATA 1JFFB 1YTFB 4O4IB 2CH7A 2MNGA 4E8DA 5JXJA 5FFOC 4AFAA 3TNPB 1HN0A 1NS1A 3WDVA 2BVVA 3RYCB 5EJ1B 4K0KO 2VZ1A 1GICA 4XFFA 2JE8A 1H1AA 1L0NH 1ASJ2 2VUJA 5FPAA 2ZE5A 1M57B 5CU1A 1DP0A 5FYZA 2Z2SB 1S0DA 2MEV1 1YIFA 4YY3B 3J9SA 2Y34A 1JN2P 4LBMA 1FKAO 5ABJB 1H2MA 3VKOA 1OLQA 2VUCA 2ORZA 5LL6Y 4JGYB 2B5HA 5B3SC 4B7KA 4Y20A 4XFAA 1JYWA 3BODA 4CCKA 1N1SA 2F4PA 3LDDA 1RSOB 1ULOA 1HNXB 3T2TA 5CIRA 3M1HA 1UKGA 4J1XA 4BU2A 1SESA 1S0GA 4E4SA 4XDPA 4JQTA 3N7JA 5LBFA 1J84A 3IAYA 2Z79A 3I59A 3D0JA 4MGTA 4UVBA 3RMXA 2A7AA 5CFDC 1YUDA 5JQGA 2JDKA 1LJ7A 3WQ0A 3E8HA 1FOD1 4S2GA 1MS4A 3K3NA 3VZLA 3HPLC 3PUIA 1RGSA 3M3IA 3LSQA 1ENVA 1ULFA 1QKQA 2E53A 1VQ5V 2A0LA 5DZFA 1R1BA 2PQSA 4QPIC 2EIBA 3STLC 4LTAA 3OM3B 4NIAA 5LBCA 1R3IC 1BK0A 1URXA 3WR0A 1I1EA 4D6SA 3PUAA 1HNWB 1PNGA 1AILA 1I08A 1FXKB 2D3PA 1RMU1 5J48A 2B8MA 4YG0A 5C33A 4GB31 4UFKA 4E4ZA 2ZR3A 3OGJA 1MS3A 3H1JH 2YPJA 2QZ3A 4IW3A 2Q7EA 1Q6IA 2M6YA 4U3JA 1OD3A 1YXWA 2UUCB 3CEIA 2QA4V 2ZPXA 4LBNA 2E9QA 5IJ9A 1UY3A 1I94O 3AVSA 3UQ8A 3HKEA 5T5PA 3QACA 2VW1A 1A6CA 1TVKB 5LOVA 5A7PA 2V1DA 2VZRA 5JOXA 1H8TB 2JGDA 1IPJA 2TBVA 4DR2B 3ZXJA 4DXZA 1NQTA 3PUHA 2DFBA 3OMIB 1QJX2 1WMFA 3PMEA 1O3SA 2WBKA 4BPZA 5F7UA 4HZ3A 4CC5A 3GJBA 4KFMA 4OYUA 5FUNA 2YV8A 1XNCA 2RN9A 4PA7A 2QKSA 4PJYA 3DXTA 3B3QE 3NRUA 2CTPA 2SLIA 4B3SO 3AM2A 1NY72 1OCOC 3LD8A 5FPUA 3KQRA 2XLAA 5JJEB 4TV9A 2Y8KA 2HWC1 3MF6A 4JKMA 2Y6HA 4QQPA 5F3GA 1PX4A 2ZMNA 1N8RW 1GN2A 2C5DA 3B8NA 3WG7B 1NG0A 3AKQA 2ZNJA 3E22B 3VBUA 1GO3F 1NR7A 2J1RA 2NP0A 1ZBA2 1EPWA 5LP6C 5EK0A 4ARXA 1IQAA 4JYAO 3PJSK 4OHVA 1VIWB 1C4RA 1H9PA 4B4RA 2VAUA 5GM0A 2HWD1 2ZMKA 4BDVB 3JD2A 3H0OA 4EN6B 5HPOA 1W9WA 3QNEA 1K97A 4CDUA 2NPIA 5C5UA 2KQXA 4UFHA 5FWJA 2V4AA 1QIQA 4UW5A 4DZGA 1SPPB 4TZDA 4QMAA 5A3OA 1RUD3 5LA1A 1N34O 2CAVA 3L70H 1R091 2XL9A 4NB5A 2QDNA 1GP6A 1Q81W 1F35A 2E26A 3VKFC 2UXNA 3CC2V 4N53A 4YGBA 3ZXLA 4ATEA 2D97A 1AI4A 1J3PA 4RR3B 2J1VA 5FQ0A 4UVCA 4XDLA 3BI3A 5LRRA 4UF0B 2ZDIA 2ZM6O 1PZ9A 2O14A 2JKBA 1WB8A 4B3MO 3IBMA 5DZGA 2JG8B 1J1TA 1AYN3 3ON7A 4CDWA 2NN8A 3CF6E 2CV6A 2W1WA 5FO8B 5B1BB 1NCRB 2C9KA 1FYUA 2EIMB 4A4AA 1IS6A 2ORXA 1MQTC 1F4HA 4XCAA 5A6QA 2BYVE 1XOUA 4NPRA 4QKFA 1P4RA 1POV1 5JSPA 4ZU7A 3PVOA 4HSLA 2BTOA 4A7KA 2ZKLA 2J1EA 3I3MA 1Q3EA 1G86A 3A0BZ 4XDKA 4Q8KA 4A42A 5FZ3A 2CGPA 3ZPYA 2IU3A 3LDKA 5FZOA 3VDDC 2P6HA 3GALA 3FX7A 3EO6A 4UW3A 4MGQA 5E89A 5BNNA 2W92A 4FFFA 4L2NA 4MTXA 3CIHA 3ZFFA 1H6XA 1UX7A 1CPMA 5EIBD 5TSWA 3WDTA 2BSKA 1KP3A 5C3QA 2XVGA 5BXZA 1CGPA 1EUUA 4ZIBA 1I9RA 1KJRA 1CN1A 3NAPB 4WVMA 1GMMA 2QQOA 5JZGC 4NR1A 2AEZA 3VOUA 3FMGA 4NO4A 5FY9A 1PVC3 2ZMLA 3T1MA 1RUF3 2Y64A 3OGVA 1TA8A 2XJRA 3HN1A 3IKWA 3K77A 3VBUC 5BXXA 5GTIZ 3ACIA 3JALA 4GZ9A 1TME3 4CU6A 4YVWC 1UU5A 3IMMA 2DURA 4X1KB 4WFEA 2YS8A 1OUXA 1DQ1A 1GYKA 1HRV3 1RUH1 4AHZA 4TQDA 4Z2AA 2IJJA 1O59A 4N8MA 5E88A 4CDXA 2ZGRA 4HG6B 4UCUA 1N32B 4FTEA 3KLSA 4WBNA 5EYPB 4YY3O 3RZZA 4IDZA 1JZ5A 5JVVA 1STMA 3WB2A 3LIGA 1F2NA 2F4LA 2V09A 5EZYB 1NCQA 1H2GA 3VL8A 1QEXA 5A33B 2WLIA 3VBSA 4E2QA 2YIBA 2XLFA 3OGIB 2VMGA 3PVNA 5F2SA 1HNXO 4JI7B 2FYUH 4EWAA 5FY7A 4FXKB 3FZ3A 5FY0A 4IV3B 1GZ9A 3AJYA 1PMIA 3PJYA 1T5EA 2DCJA 1Q86W 1AR71 3OY8B 4BXSV 3X2QB 5A1AA 4LULA 2HWE1 2ZCWA 1O8SA 2ZIMA 1AR4A 2ZXQA 4EZHA 4LJHA 4XJ8A 2V73A 3B9CA 2UXBB 4E4EA 1ZRRA 5CKQA 4R4ZA 3ZLIA 1OVPA 2PXJA 5F32A 3AKSA 4A45A 2PUSA 1O4TA 4BIOA 2GH8A 3BPZA 3W7XA 3CL1A 5DAXA 1RUD2 1QQCA 1HNWO 5DQ0A 2R16A 4MTOA 1RPOA 4UV8A 1G8WA 4OULA 1ZSPA 4YJ3A 5C3RA 2R0HA 3WW3A 4RO2A 4X62B 1LUVA 5JXIA 3SKJE 3PMSA 5LK5A 3FFZA 5C7GA 4L99A 1OFSA 3JCZA 4GT1A 5GZDA 3C7FA 1QNWA 5BNNC 5SV5A 5IWAB 5IAXA 4LMFA 3R65A 1R3KC 2UUCO 1FT9A 2WRAA 3ILFA 5T52A 1ENQA 1ZBE1 2GDFA 3CMAV 2EVXA 1NTMH 5F3IA 4LR3A 3S3WA 3HNBM 1BBT3 5FZKA 2I45A 2C9AA 4L97A 4D94A 4Y20B 1HW7A 3UJOA 1OXCA 3AYCA 1PK6A 1W6QA 3RMYA 3JD71 2Q0AA 4DR2O 5LMUB 2AHZA 2DCTA 4B1LA 1X59A 1Q5OA 1WBFA 3I59B 2PYJA 1HLCA 3VDBA 4Q1PA 4UFJA 5IVYA 4I55B 3I4IA 3JXSA 2GC2A 1R73A 1V9U1 1CJPA 1PPJH 5A7NA 2D6OX 1WBLA 3WW4A 2Z4FA 2WC2A 3V64A 4MVMA 3B8MA 4KBZA 4OZXA 1JVMA 4NWWA 3QVNA 4I50A 2WYSA 4XF4A 3RYKA 1ZRIA 1QH7A 4FTBA 2KA3A 2I74A 3UJQA 1VQ7V 3M3CA 3GM8A 1QJU3 1XDCA 5T5OA 4QXKA 5IT9N 4JRLA 1PZ8A 4Q4Y1 3OFNG 4GWIA 5H9CA 4CUCA 1UIKA 3CJHA 3CMGA 2WZR3 1NE4A 5JWPA 4RUFA 1Z7S3 4J41A 2KKWA 2V4VA 3EBRA 4LK6A 1UWWA 3VL9A 4U3JB 4Y4YA 4WM7A 1W8NA 2YB7A 1PVC2 5CADA 3LA7A 3RYPA 2CDOA 1RUF2 2VNVA 3K75B 2FDHA 1NVPB 5IJ9B 3O0VA 2PLV3 3DXRA 3HKEB 3KCYA 1V54B 5FZFA 4WCEV 2W1UA 3C2UA 5K4LA 4Q4W3 3KD4A 1MS8A 1US2A 3ZIXA 2XWJB 1IURA 5LOVB 1S2EA 1H2LA 1FD9A 1TME2 2DN9A 3LFIA 3WB0A 3ST7A 1VP7A 2JGDB 5FBJA 3M3QA 2ZE7A 4I0AA 2NR5A 3INAA 1HRV2 3L72H 1BL8A 2ARAA 4R9CA 4GYCB 4EROA 2JGUA 4L0PA 1SQPH 5FMDA 1NVPD 4BISA 4O7XA 2DMXA 1E57A 2EA7A 3NVCA 4ASUG 3N7MA 1NA1A 4EN8B 2ZJCA 1YF2A 4PA9A 2WL1A 4AI3A 3B5LB 3M99B 3GHNA 1Q6HA 4GKKB 4HNAB 3K5MA 2Q73A 1MZEA 4TV9B 3OT7A 3E8GA 3VBOA 3UKMA 4F8AA 3H9AA 1KB9F 5GTHZ 1XNDA 5FLIA 4NN0A 4DUYB 5IYZA 3TXSA 3KV9A 1Q8PA 5CA1A 2VQTA 2MK3A 4MTFA 4QX8A 4GMP3 3LEIA 2AW9A 4B3RB 3SGIA 1YRZA 2D40A 4PIYA 3AP5A 2H0BA 2A73B 5CBGA 4CDUB 3CYOA 2VR4A 3EHKA 3LAGA 1AI6A 3RNSA 2Y6FA 2DCYA 3AP7A 5A7OA 2G9FA 1PMJX 1AJQA 2P67A 3UCSC 4XYXA 1LEDA 2YDEA 5CB4A 5C71A 3PHMA 1XMOB 2EF6A 5L9BA 4N53B 1W9SA 3K0GA 3A0NA 1TMF3 4DQAA 5HCAA 3TEWA 4IEUA 2JE7A 1OT5A 4COWA 3MLJA 3H8OA 2JS5A 5FQ0B 1IVSA 4META 2VRZA 2WAMA 1N1TA 3GWOA 5HFMA 4HYOA 2GALA 1W8OA 1GH6A 1AXZA 1X7NA 2ZINA 1VAMA 2NN4A 4DR6B 1NH2D 5JSOA 3KZ4C 1Y43B 4CDWB 1BBT2 4MVZA 4C1XA 3L2YA 1UU4A 3MI8A 4QX5A 4HOOA 5EV7A 1W39A 4M01A 2X6CA 2V5DA 4R52A 2XR4A 4WM7C 5FLJA 4O9GA 2LTNA 5CEHA 4SLIA 5FYVA 2ZGPA 3I5DA 1BQZA 3P6BA 4UCRA 1NR1A 3ZYJB 3NNGA 1YQ8A 3B40A 3P3NA 4IEWA 1WPBA 3K4DA 4K1ZA 4GUNA 4DY3A 3TEXA 2RQ6A 2A5ZA 2JKXA 4YW3A 4F3JA 5FZOB 2ZS6B 2Q8VA 3WDXA 3CCJV 4NXNB 1HB3A 1MS0A 4DXRA 2XONA 2B1IA 1K5MA 4AFMA 5L3CA 4V2VA 1JMKC 3ZFFB 1GUIA 3UKVA 1QJU2 3HMYA 4IXLA 1VBD3 1WLCA 2BSKB 2RS13 4JI7O 3GDBA 5ACA3 2NLJC 3ZXFA 2B46X 1KC8W 2WZR2 1N0JA 4WVMB 2BFUL 4JKLA 1VQ8V 1Z7S2 3NNMA 4JZGA 3POWA 2C1FA 3VQVA 4D6RA 1N1YA 4XJ9A 4YPJA 4QU1A 4A6OA 3AB0A 2JG9A 4W8JA 1AX1A 5I8YA 2LFRA 5J2TA 2PLV2 2OW4A 3AVRA 2XT9A 5J36A 4Q4W2 3QF7A 5FZ9A 5F9TA 3JALB 3HT2A 3MPBA 4HMZA 4E9KA 3V65A 3CCMV 2Q30A 4GMP0 4CP9B 4K8FA 5A6YA 4P00B 2QWPB 4CUGA 3DTUB 1RIRA 4NHLA 4X62O 4AGGA 2XJPA 2ZTNA 4OPHA 4JVAA 1JXNA 1RVF3 1VRH1 4CDXB 1SZBA 3RDIA 3JD3A 3A8TA 5IWAO 4LLFA 1OF4A 2B39A 3RWNA 2Z5UA 4WBNB 3HQUA 4PA4A 4JI5B 3ASNB 3S30A 4HPKA 3ZIWA 2ENRA 2BP6A 4JHZA 1NCQB 4I02A 4INDA 5FIXA 1JBCA 2WLIB 4W4ZA 1VBC3 3AMNA 4KXRA 3VBSB 4Z2WA 4M4PA 2ZEWA 1PVXA 4FPKA 1DZRA 2VOXA 3NW4A 2JIGA 4GAZA 4K3AA 1XNAA 4GIQA 4M3CE 1K73W 3ABUA 1REFA 3WW2A 2X05A 5LMUO 2JD9A 4I0WB 4Y5SA 3U75A 4ZONA 4RFT0 4FVVA 2RMU1 4XF3A 2EINC 1S77D 2RJ2A 1UZVA 3HEIA 1N3PA 4J9YB 4EJRA 5EYXA 3I3DA 3NWKA 3T08A 4C8DA 3H7YA 2YIBD 3L9DA 1BCXA 2XWBB 3GWKC 2RG4A 1W03A 2MEV3 1ORQC 1WPXA 1RINA 3CLPA 2VMFA 4SBVA 3OJBA 3OCPA 4YM1A 4Y26A 4PA6A 2LW1A 4MOAA 3T1CA 3ETGA 3J7NA 4P2ZA 4YJ3B 4LNVA 1CONA 2ARCA 2R32A 3DYMA 5BYNA 3EVKA 1TMF2 4FPGA 2E33A 4K8RB 4Q2FA 1AVBA 2W68A 1AHSA 4IT5A 1CAUA 1OUSA 2EALA 4ORFA 4WFBV 3MZHA 2QWNB 2O1QA 3A0RA 4FCAA 5C93A 2GP5A 2P22C 2HEWF 1V55C 4CUBA 5FMBA 3BCCH 1OVSA 4G2KA 1YJNV 4AEJA 1PK6B 3E8FA 3L9JT 1QVGU 1RUJ1 3NJVA 2VCCA 1W6QB 4A3XA 3I2IA 4LA2A 2WSSG 2DTWA 4CS3A 2PI4A 1H2SB 2WNOA 4P14A 3O65A 4DK1A 2F95B 5JJNB 5BNQA 1Q90D 1AR81 5FYSA 1K8AW 1RMU3 5BMVA 3ZVXA 3AK3A 2VVEA 3U11A 3WNLA 4GB33 1IXMA 3CCVV 3ABMC 1W0JG 3M4FA 4KNCA 2JE9A 2YYOA 1RUI1 2VMEA 1UOJA 4ASKA 4ZS3A 4I50B 2R073 5H9RA 4GKKO 2OQ7A 3ASIA 1VQOV 1VBD2 3ETDA 4IV1A 5KXCA 5A7QA 4TOIA 2RS12 1V6NA 5KX5A 4LT5A 5ACA2 1SBFA 1QY4A 2K2SA 4OXSA 3OMNB 4DUYO 4Z8BA 2PHTA 5FY8A 1C28A 4WBBA 4DOUA 3FKSG 4O4HA 3SQOA 2LRPA 2WFF1 2K9ZA 4Y24A 1YQCA 2ZAHA 1KKCA 3WINE 4B3RO 4LF5B 2PAEA 2ITDC 3BVCA 1VE0A 3WUDA 2GNBA 2KM2A 3GCXA 4DXWA 1Z78A 4CCLA 3IGAC 5GLWA 4TT3G 3UO3A 5C9AA 5DM6V 4XCBA 2CE4A 3UGFA 2JEXA 3MIFA 3TETA 3ASOC 1R6KA 3PUSA 4EB6A 3ZKUA 5DPNA 3T3YA 5FYHA 1JMUB 2XNDG 1WW6A 3CCSV 3ORJA 1K5QA 4DUVA 1XMOO 3POJA 3POBA 5A6XA 3RGBA 3AFGA 3MFAA 4S2FA 1B6QA 1RUG1 2HWC3 1IBKB 2EZPA 1OLMA 1RVF2 4YG3A 4IEOA 4XDJA 1UOGA 5FK8A 4H14A 3ZMSA 1NA1B 2MHFA 5B2GB 4OHWA 1JZ2A 2WZPP 4DR6O 1OSGA 2OTJV 1VALA 4LNUA 3BIWE 2JK5C 1VBC2 2OA2A 5BNOC 1PO21 5LYJA 1IOAA 3VBOB 3GHMA 4QT6A 2JDPA 4QPWA 2HWD3 3K08A 1IKPA 1VBE1 1DCSA 2BBAA 1KS4A 5JMOA 3OUFA 1XHZA 3C7GA 5IYZB 3OGCC 3O1PA 3KF3A 2YROA 3G7DA 2YXLA 4X88A 5CA1B 2XH6A 2QVSB 5IW0A 4MGYE 4K40A 3GZTB 1NXMA 1R093 3CBNA 1UOBA 2A6WA 5BV6A 2PZSA 4RN5A 3LNNA 1CIYA 3ACFA 3KF5A 1VPHA 3ZYHA 4AHWA 3AG2C 2OXBA 5FTTC 2W46A 3WT3A 1ND2A 1ZAUA 2OCCB 4TV8A 4NXNO 3QTCA 3E6DA 1FNZA 5D2AA 1QXRA 2MEV2 1SQGA 2VZSA 3JQXA 4HFSA 1EV13 1GN3A 4AVBA 1EFRG 2XBO1 5FYIA 1XSQA 5CB4B 3KQ4B 3RPQA 1NTKH 5EBMC 1RP3B 3K5OA 4XBFA 4DV5B 1H2KA 1GU3A 4DY5A 4A41A 1A34A 4AR2A 3NJZA 2D3SA 3RJ2X 4LF7B 4HL0A 4H2AA 2GMEA 2ZGTA 1X8MA 4IV1C 2QGNA 1VP6A 4EWEA 1POV3 3ZN0A 5TISZ 4D3WA 4AEKA 1F4NA 4D7YA 4DO2A 3I97A 3VBBA 4K21A 4JCKA 4N7IA 3LEKA 4KL1A 4AQTA 3O1RA 2P7TC 1IBLO 1B3QA 3PLQA 4P9PA 3CCQV 1V6KA 1RUE1 4L8QA 4RGGA 3RYHA 5J98B 3W9AA 2JXAA 1I0HA 3RT3C 2DOSA 2Q4PA 5KBFA 4LWSA 4LE3A 2QQMA 5CA6A 1PP9H 3H1WA 4PELA 1OC1A 2R041 4F6RA 2JDAA 1RMU2 3Q8EA 2N74A 2LM3A 3VBHA 2VQAA 5G04L 4GLXA 1BQPA 4GB32 3Q8BA 2X6AA 3ZSJA 4FPYA 5LEKA 2VBBA 4JI5O 1OOPA 4CEYA 2ZKOA 4FPEA 2DVDA 4RQPC 3O1SA 3SNMA 3WNPA 1K5MB 2R072 4LF6B 2D7FA 4IETA 2WLQA 3VV1A 3QD6A 3OW2U 1AROP 1NI8A 5E79Z 4MVRA 4X64B 3SYAA 2XHBA 1UX6A 5KXDA 2ODMA 2B9UA 2R1DA 2ZACA 5K0UB 1NQDA 2YUEA 1ULCA 2YFZA 3LSDA 2GH2A 3OOXA 2VD7A 5T50A 1MSWD 1E79G 4MXWA 4GH4A 2VG9A 5FZHA 2PELA 3CE2A 4BWOA 4XQDA 3CJIC 5I8SA 2JG9B 1UN1A 1RUH3 1VF7A 3K2OA 4GX1A 1V0AA 1O5LA 4H13B 1RYYA 1LGBA 1IX9A 3NJYA 3SITA 1QR9A 3Q8CA 3KMHA 3IN9A 3E8BA 3B7MA 1R3LC 4UFIA 1NLRA 2AREA 2EILB 4JX0A 5FZ0A 4X9QA 3E6CC 2WAAA 4CC6A 4GKJB 4BWAA 4BQ3A 4OVEA 1HRI1 5JOZA 1YITV 2HWC2 4OI0A 4YYOA 3ZMTA 4N9HA 4Y22A 3THTA 4XFBA 2Q0OC 1G1XB 5JCOC 1UD1A 1BMFG 4N21A 2QNKA 2R9RB 1RHI1 4MUVA 5D1IA 1N36B 5IK5A 1AR73 2CY6A 2PA7A 2YGLA 2WQZC 4QHBA 3ZKYA 5ANNA 3AG1B 5FZAA 4B29A 3T1HB 4MS2A 1XNQB 2R7EB 3UGHA 2WQ4A 2HWD2 4YW2A 4X8NA 3N9NA 3AG3C 1LCLA 1W6MB 3V0AA 5C4WA 1US6A 1POV0 4QQ2A 2JS3A 4TLGA 1N3OA 1XJAA 1OCRC 1W2NA 2XAQA 4WVVA 3SLIA 1R092 2P06A 4XFIA 1ZWIC 2WO7A 4GALA 1DZTA 3LGRA 4R9DA 2ERFA 1J3RA 4EQVA 4EN7B 4UXNA 5F6KA 2A3WA 2WAOA 1W9TA 3AZZA 2RS32 3CMEV 3C3TA 1MSDA 5FJKA 2D3RA 3J4UH 1PGW1 1EN4A 3JUUA 1R6TA 4H7MA 4IEXA 5EC1C 3OD0A 1EV12 5FZ7A 1GM8A 2E5LB 1DGWA 3DECA 3PUQA 2W52A 1UY2A 2IH1C 2X09A 3WF4A 5L7OA 2ZZQA 4N43A 1OOPC 4C0HA 3R4SA 2AZ2A 4AL9A 4RYDA 3G4SV 3G71V 4DRVA 1I5ZA 2VL4A 1CAUB 1S0FA 5EXOA 2BFUS 3THCA 4RA0A 4XTMA 3JATA 3JD73 4LF5O 1JODA 3BOWA 4KUMA 4P9YA 1OZ0A 4H44B 2JDIG 2LP7A 1KD7A 4NOTA 4KWJA 5J1XA 5FPRA 4TUYA 2R9AA 1UF2C 4I9WA 2J1AA 1V9U3 5DUUA 4I5SA 4IEQA 1OCCB 1QOTA 1B06A 1B35C 4GH4C 2EXKA 3IAPA 3MD0A 4I4TA 3C3SA 1AR61 1PL4A 3UL2A 1YDXA 4BW5A 2F23A 1H30A 1F5JA 3FFQA 5LGNA 4OMDA 5D21A 4CSWA 4NE9A 2QJVA 5LZ6A 4FOQA 3H3ZA 1MS9A 1IBKO 5A32A 1YNAA 5FP3A 3T2MA 5BMVB 4Q4Y3 3U07A 4BZ4A 1WWYA 3ZMZA 4HZFA 3EXAA 2CDPA 5BNPA 3V0BA 4BR6A 3WUCA 3BA8A 3IPVA 1A78A 2ZX2A 2VS0A 2DWEC 4LFCB 4JHTA 2O0OA 1D0HA 1IPSA 1C8M1 4AQ2A 5LASA 5KX5B 4UCSA 3VD5A 2WINB 4JC1A 3POSA 2VQFB 2OYQA 4NHKA 1D2DA 5KHHA 3MAQA 3F7VC 5A3LA 1V6OA 5IAVA 3WLUA 4ET7A 4O4HB 3T4ZA 3O1VA 1H6YA 4HANA 3D5OA 1H0BA 3IT8A 3AMMA 4QPGC 5A3WA 1POQA 2CTWA 4Q6GA 1DQ0A 2LW8A 1L7RA 1RUH2 3K5NA 4XUTA 2XHKA 5H6RA 5FZMA 3ZDVA 1WGPA 4OFGA 3APBA 1M56B 2W3JA 3HQXA 5C9AB 1W0NA 3BA9A 1ENSA 3I56V 1QJY1 2YU2A 4R8CA 5BY1A 4AEDC 5FR3A 4Z1VA 1RPRA 1BQ0A 3LZZA 1BSMA 5LWBA 2ZGOA 5EPAA 5T55A 2CWMA 1R1A1 4Q4V1 1BZKA 1BJQA 2A71A 3HKDA 1WCSA 1MR5A 3JCIA 4CA9A 4DV5O 4YVSA 4FVMA 5LEJA 4IIJB 5KWRA 4CP0A 2IC1A 4NAOA 4YSFA 4XFHA 3U4XA 2IUWA 4LF7O 2WN2A 5HXMA 4PDWC 1KDMA 2IXKA 2HLDG 1AR72 4ASMB 1OKOA 3BY6A 2R9IA 3POIA 4JTOA 3UKTA 4LNUB 5DECA 2ZA9A 4CTEA 3P32A 2GDSA 5LYJB 3EYPA 4Z82A 3S3XA 5F5QA 3LFMA 3VUOA 3S5QA 4CH5A 1K9MW 1COV1 2D5FA 3CB2A 1G8MA 1YYNA 3N2GB 4QXCA 4GCZA 2F17A 2ZHNA 2LQTA 1BZWA 1GR3A 1M90W 1SQBH 1R64A 5A7WA 4U7NA 2ZNIA 3K03A 3IZOA 2ZAAA 2HVJC 4O2AA 2WLJA 5FV3A 1KFUL 4JAVA 3C7EA 3AK1A 2AACA 1J3QA 1W6NA 4DINB 1ND2B 3J7HA 4TV8B 4AZZA 1PO11 3ZYPA 3W7UA 1US3A 2GV9A 1W8WA 3NNFA 3I2FA 4L8JA 5LGTA 1VQ9V 4LF6O 2V7QG 4NWVA 4K9SA 3SPCA 5LA2A 1PV0A 4X64O 2P4EA 5C8CC 2JEUA 5KR7A 3CCEV 1KECA 2K9PA 3IDCB 3ELNA 5B1NA 1BK1A 4DV1B 4ZHNA 1GOGA 1VF5B 5JR2A 4FPHA 3SJAC 1SBDA 3O1TA 2Q68A 4LKFA 1S0CA 3H1HH 1VBA1 3GVMA 3JD72 4RHV1 1DQ6A 4FOVA 1ZTEA 1XU2A 1Q82W 1CESA 1RM1C 4MGKE 4BHPA 2ZE8A 2A3YA 3IIAA 4O65A 4UCTA 1K7DA 2WNUA 2A6XA 5IYBO 4XURA 1V9U2 1JYVA 1ZZ9A 2ET1A 2ZEXA 2VY0A 3T4DA 4P9XA 1ND3A 1AR91 1LKNA 4ITCA 1DGRA 4CZZA 2YEVA 4LWSB 4CRQA 4GKJO 4H7LA 1YFYA 3K46A 3JD0A 3ZMVA 1Y3TA 4CP1A 4X89A 4F6RB 1MS1A 1TG7A 3VBHB 4Q4Y2 2UXCB 2UU9B 3KB5A 4P02B 4XC9A 4UI9L 4EN9B 4LH7A 1N33B 3E5XA 4CEYB 5FZCA 3AJZA 1S72V 1N36O 1HQWA 1LOBA 3IWZA 3RYFA 5F5AA 1UKRA 1UNBA 3TRSB 1XYPA 1O4ZA 3T1HO 1XNQO 4QM8A 2PYTA 4AVCA 1D0GA 4HVOA 4L9BA 4JASA 3N9PA 5K8SA 3H9VA 3M70A 3K57A 1K12A 1LHOA 4JI1B 2VCBA 2YU1A 4WVWA 4JYBA 3ACHA 4MXWB 2PAKA 2UYBA 1Z2GA 2OTLV 1XXNA 3B2EE 2BOIA 1FI2A 2LROA 4MVQA 1H38A 4KI5M 3WNMA 1X9TA 1VRH3 5JMCA 5CB7A 2EXJA 4O4JA 1XREA 3SCFA 3VBRA 4LHSA 1JH5A 4W6WA 5LW9A 2XOMA 1VMHA 5LY2A 4AE2A 3ZN1A 2G4IA 5EWSA 2E5LO 5GKAC 3L2HA 1GQHA 2YMZA 1WB7A 1LB2A 3CP1A 3CXHF 2C6SA 3J8F3 4E2GA 4FLZA 1ST8A 4FM1A 1WMDA 5JSRA 2QKAA 4IYHA 4HETA 5B5EZ 5JOYA 4ONUA 3APQA 5A6ZA 4AAXA 2ZHLA 2VNOA 4QNHB 2HWB1 1ASJ1 3G6JB 1QWRA 2Y6GA 2QE3A 2VW0A 3OR7C 2TUNA 3BYWA 3VBFC 3ROUA 5IFTA 2BTQA 3D36C 3RI8A 2W47A 1K3IA 4O2BA 2BRTA 4AI1A 1C5IA 1RXFA 2ATFA 3V0AB 1OPOA 1TGOA 2UUAB 1UXXX 3NV4A 5C4WB 2CTQA 3AC0A 1O8PA 4NMIA 1XOYA 2EIJB 3HBZA 3ZFEA 2NMOA 2QWQB 4FLYA 1UYZA 1MZ6A 1OV9A 2WIIB 1UYPA 2R70A 4WFHA 1YFUA 1REDA 3GZUC 1X8EA 2WT2A 5CISA 3W5NA 2Y26A 4UB8Z 3W7SA 3WU2Z 2A6VA 5KLVH 1KITA 2X6BA 1YCIA 2F1MA 4CEWA 3CC4V 4BMEA 1GQGA 5BR8B 1UMZA 3QOPA 4OPAA 1LODA 1PM9A 4BW9A 2HEPA 3MW4A 5IVBA 1XC6A 4CXWA 1V00A 2WNVA 3O12A 4QJFB 3GBGA 4KWKA 3FBMA 4GJZA 3IC7A 5L7OB 3AEIA 2QJ1A 4N43B 2DVFA 4QAWA 2VQFO 1BVVA 2VM9A 3LSSA 4OUSA 3ILNA 5CFCA 4ARYA 2CGOA 4Q0UA 4QX2A 1PL0A 2OQ6A 4JZRA 2FDGA 3JATB 4PIXA 3THPA 2FHRA 3RZMA 2SBAA 1IS4A 2XGXA 1Q8QA 2JDYA 3IM0A 2WLKA 3RWRD 4MG2A 3LNMB 1HKDA 1PX3A 4TUYB 1AR83 4OMCA 1W0KG 5FLHA 3NKGA 2L6LA 3E2EA 1AX2A 1CPYA 4JI3B 2UYAA 3LDRA 3POEA 2B1GA 4I4TB 2FDIA 2LS6A 4D7SA 3ZN5A 3ZS8C 1W2BU 3KGZA 4JGZC 4HT1T 1PIV2 1OHHG 2B7YA 1RUI3 1KXGA 3CSXA 4AF9A 1OA4A 2CK3G 1FS0G 3ALQA 1HWYA 5A32B 1CAWA 3NL1A 4XIOA 1JJ2U 4LK7A 1DQ2A 2GC1A 1MVQA 3ABKC 2EAKA 1ZZBA 3KWVA 4D69A 3S0MA 3WG2A 1IG3A 1VAVA 5BNPB 4AK3A 2Y4UA 2X5IC 2WFF3 3IPVB 2FQPA 4PLNA 3TOJA 5K1XA 3DYOA 1L0LH 3C7OA 3P1IA 3FLPA 2IXIA 4URAA 1VEWA 4N9IA 1DYOA 1W05A 2BBVA 3RBZA 1R6NA 3SC7X 3BALA 5FYMA 4OX9B 5E1AC 2Q8EA 2E76B 1HNZB 3ABLC 3ECQA 1HJFA 1W3XA 2BEOA 2P3JA 4YLZA 1ULEA 3AZXA 3U1XA 5FYCA 4N23A 2ZEZA 5JIAA 2RE9A 4PDVA 1SC5B 1RUG3 4WFFA 2WSVA 5CFDA 1VRH2 1JTZX 2Z69A 3ETPA 3ZDSA 3ZFEC 1XE8A 1U5IA 3WXPA 3C7HA 2RNBA 2M7WA 2VWJA 1E5IA 2Q1ZB 4A7YA 5FKBA 5F5IA 4LOSA 1G9AA 4ZHQA 1KP2A 2G9ZA 4QPIA 4DB5A 4MHUA 3K4AA 5KUMA 3HKDB 5JPMB 4CP2A 2BQPA 3J8F2 2E63A 4DV1O 4YVSB 4J10A 4QIWF 1PO23 1NKDA 2BDRA 2YG0A 2ZABA 3BCWA 1VBE3 4JKKA 2GNDA 3NV2A 3GBWA 1CX4A 4YHHB 2WLLA 2UXDB 2VXRA 4P9OA 1JZ7A 4UBGA 3CPWU 4MX3A 1F31A 1HXS1 5B1AC 3KZIZ 4Q4X3 1W6PA 5D8AC 4QPJA 3SPGA 5L3BA 1OH4A 2WZ8A 1OI6A 5JDBA 3N36A 1H2NA 3KSCA 4IGPA 4XTPA 2PY5A 1KQSU 3D82A 5G05L 3FUQA 2XAJA 3PU3A 2RCVA 3CCLV 3H1MA 4ZI7A 3QLQA 4EKWA 3AG7A 4O4LA 5FJHA 1K3EA 4O2AB 4XF1A 4FPPA 4CCOA 1D4M3 2UXCO 1YC61 2UU9O 1W28A 1CZSA 4LIVA 1HB2A 2UU8A 1W6NB 4IQPA 1NYWA 1N33O 3BTYA 2AR6A 2ZGKA 2ATKC 3A0HZ 2P6CA 5IFPA 3CU7A 2J1TA 1O3QA 2EAAA 2VZOA 3I2JA 2C24A 5HXVA 1LGNA 4EYUA 5DMYA 3AXDA 4I01A 3MYXA 3URFA 2WT0A 2MPFA 1LOGA 5EC2C 1SFYA 4DUZB 5A1FA 2XB6C 3AX4A 1JJOA 5GLUA 2BZDA 2DV9A 4JI1O 1RUE3 3VDAA 3J7MA 1V70A 4AFCA 4AEMA 3JCUZ 1JS9A 5I0TA 1QMJA 1IG0A 5LP6A 3STZC 3THOA 4YZ1A 1E1RG 1DZQA 2WNUB 2RM21 2R043 4M4RA 1AR82 3OGSA 3WP5A 2AH2A 2HLEA 3BOPA 4PF5A 2RS52 4NXMO 1ND3B 4FO9A 1CPNA 2BE3A 2YEVB 1RUI2 4X20A 2QEXV 4QDSA 5IHRA 2FD8A 4WV8A 2HWF3 3AZWA 1LGCA 3LEMA 4XQ4A 5FZ1A 3N35A 1QLEB 2BGPA 1DLLA 2AYHA 3CKHA 4XE9A 4AG4A 1OCZC 2E7AA 1FFXA 4DRRA 4LKDA 2VECA 1JR9A 2WFF2 4I7ZB 4AFDA 3W5MA 3RYFB 1HV0A 1CX1A 3RI9A 3APOA 1QQP3 2X29A 4A5UB 4YARA 3DKQA 2LALA 4AQYB 1MOFA 1X36A 3L75H 4QKBA 2UUAO 4WZCA 4OZOA 3ZFGC 3P5BA 2ZT9B 4COUA 3A7QA 4YJ2A 1HP8A 3K5LA 2RJKA 2PHLA 4MH0E 4NIDA 5F3CA 4KU8A 4FPJA 4NYKA 3MF9A 1MQTA 3CX5F 1FV3A 2P6JA 4OHYA 4E27A 3C90A 5FZ8A 4QU2A 3WCSA 2GN3A 3WDUA 4QPYA 1RUG2 1WW5A 4LO4B 1C5HA 5E16A 4O4JB 1PD3A 1URFA 5BR8O 2ZGQA 1LU1A 1XSRA 3ABZA 3VBRB 1YJLA 3WG1A 2XDVA 4E8CA 1RHI3 3VDDA 2GZWA 3OEBA 4QX0A 3VB9A 1JU4A 5L9VA 1WZXA 4QE9A 3AKPA 2Y4TA 1VAKA 4IE5A 1XHXA 2JIZG 1RB8G 3AG4B 1LHNA 4AOCA 4CDQA 2XQRA 4NTXA 5DN2A 1PO22 2JECA 4YFWA 4OCTA 1QVFU 4QQOA 1VBE2 2Q69A 1UY0A 4Q0SA 2OUHA 5JZGA 4FFIA 1L7LA 4GJYA 1YQ6A 2VZQA 1RITA 1SLAA 4LBLA 4H33A 4L87A 3MIHA 4Q4X2 1JZ4A 2BTQB 4O2BB 2JB8A 3B00A 4JI3O 1UZYA 3U37A 4Q0QA 2EIKC 4W4KA 1PMHX 4GX2A 4UB6Z 3I2OA 2A70A 1LOFC 2X0LA 2C4XA 2CTRA 2VZVA 1H8VA 4PF1A 1XQ8A 4YVWA 5LXTA 5IY5C 4Q0PA 3SYOA 3BUCA 4KMQA 2ZOEB 1H8EG 1D4M2 1P84F 1E5RA 3BB6A 5A3MA 5IYYA 2FDKA 2OCHA 4W50A 4CEWB 2Y69B 4Y4RA 2ZXWC 1GNYA 4JI0B 4AWDA 1S0VA 5HFLA 4BB3A 5LBQA 1W99A 3Q8FA 1THZA 4WM8A 2DVBA 2WNVB 1AJNA 3BAAA 4YWAA 4A3ZA 1S5LZ 5KHIA 1ZA4A 1L8DA 2JRIA 4OX9O 2FCUA 2XJTA 5CFCB 1Q43A 2VZUA 1HNZO 1R081 1RUE2 2VULA 3WNXA 1YJKA 4COYA 3HJRA 3SKVA 3SDLA 1AUYA 1LHWA 1RUF1 4CS4A 3UKNA 3QO5A 1H1MA 2R042 5FXVA 4BM8A 4LH6A 2JDUA 1VQ6V 5C3OA 5JXGA 1W90A 1JQ0A 4TWKA 2XUMA 5B4XA 5LA6A 1GWLA 3AZVA 3TBDA 5FCCA 5FMOL 5T54A 4FFKA 3W20A 2JIJA 4Z07A 2HWF2 1GZWA 1CAWB 1C8M3 1R3JC 2DF7A 1UY4A 4YHHO 5CMUA 4BK4A 2UXDO 4ZXKA 4JZ2A 3D3QA 3LEGA 1QHDA 4NIGA 2R063 1MZ5A 5FXZA 4X6QB 4CDQC 3CNAA 2D6LX 2H0VA 4DYLA 1AR1B 3ZXEA 1QQP2 2GNMA 2WLHA 1H9WA 5FP9A 4QHZA 3OR6C 5APAA 1F4AA 2XLGA 4LOTA 1HV1A 3OBTA 5KXBA 1NX9A 2WLPA 5B3SB 1G7YA 3IDEA 1VBB1 3R0RA 3RYIA 3AL6A 4OI4A 4RS5C 1QJY3 1JYCA 4U2AA 2R72A 4O4IA 4AI9A 4AHXA 4RGAA 1FMD3 1WLDA 5ITZB 1C57A 2D6NA 1RXGA 1R1A3 4Q4V3 4URTA 2HBTA 5FRAA 4WF9V 2N7GA 4Y1XA 1WJZA 4Y1UA 3O9OA 5CFDB 5BPXA 1MNGA 3F5TA 3AKRA 4YW5A 1W6OA 1EUTA 2BOJA 5GZCA 1LAJA 1IDSA 2FBEA 3SR2C 2XVLA 4ZHQB 3GB7C 1QJFA 5FDBA 4QPIB 1DIWA 1FFTB 3ZHRA 3MIEA 2DBNA 4LFBB 3FD9A 3RYRA 1OURA 2XAGA 4B4QA 2BVBA 4DUZO 5DN6G 4BLJA 5DG1A 4PCRA 1AJPA 2ARHA 1SZTA 2PQQA 3WF3A 5EFUA 1COV3 3WB1A 2NM1A 3W7WA 4B08A 4WM8C 3OEHG 2CHHA 2WLLB 2OIIA 2QQUA 1GTOA 1ZX5A 1XEQA 1N1VA 4UWDA 3MO4A 4H55A 4CCJA 4R7CA 3FC0A 2P3KA 1PM7A 4ASLA 3CCUV 5F39A 1PGL1 1W6PB 1E5SA 2QDRA 2IFWA 1ZZCA 4O9EA 5FUIA 5A80A 4H0LB 2FCVA 1VQKV 1OHFA 1BBT1 5KXEA 3JSNA 5EYYA 3HT1A 1SRYA 4M3CA 1EZVH 3FJSA 4YGEA 3CQOA 4GWMA 3E6BA 3RS6A 4BQXA 1PO13 1N47A 3CWBH 3HR9A 4CCEA 1Q7YW 2ZZJA 2J1UA 1PGW2 4KGGA 4BIUA 2R0FA 4ZI7B 5BY5A 4O4LB 4K35A 2O57A 1MEC1 3OYWA 1JOBA 1S0JA 2BTVC 4QDQA 5EJ3A 3ZSKA 2CH7B 1KU9A 3DPRC 2V72A 2DYRC 2DYSC 3EB7A 1OJHA 3DF0A 4Q26A 3N2KA 1DK1A 1OMIA 3BPSA 4P9LA 1VBA3 2IM9A 5AG2A 1YXBA 2P5OA 2GN7A 4RHV3 3TXQA 4FP3A 3IIIA 3OUJA 2EIEA 2RV9A 2X8KA 2Q7HA 4AQYO 4CUAA 1OCOB 3LE0A 1M4WA 5LY1A 4OUEA 2P3YA 2QQLA 4AQSA 5FNVA 4J7KA 3J80N 4OI2A 3VZOA 2CUGA 2CSGA 1SG3A 1TVKA 5K9YA 1HW5A 1NLSA 4NROA 1O5UA 4W6XA 4UUJC 5CNAA 1Y7BA 1V6JA 4OGQB 1AF9A 2WUHA 3H42B 5LP6B 1AYN2 2H6CA 2IBZH 4UBHA 2BGCA 5FK7A 3OE7G 1FAYA 3RQ0A 2JWPA 3AFKA 4YW4A 1WW4A 5LCWL 1DGSA 5EHDA 3WDWA 4Q4W1 3POFA 1S0IA 1EBOA 2F93B 2GU9A 1YVWA 1S55A 5L19A 2H94A 1FXVA 1SERA 4X20B 2EIDA 5FYUA 4BLIA 5T5JA 5A1LA 3NJXA 2ZX4A 5JQGB 2VBPA 4R8HA 1C8M2 2EX3A 2OZJA 4X8AA 1WA4A 4UXAA 3LWCA 1M57C 2LUWA 3M7MX 3J81N 4FPFA 1FFXB 3FWEA 2R062 1KS5A 5A3UA 3ABTA 4A6SA 3LDEA 2IXCA 4JI8B 3I2GA 5ABJC 2QQPA 4LBJA 1QJZA 3V56A 3AK2A 2C0ZA 4FSJA 1VQ4V 4JGYC 2N05A 4RQFA 3LDCA 4IE4A 1SLLA 2IZWA 2QUOA 2QKCA 2WO3A 2GAUA 1O4YA 1UY1A 1BMV2 4JTNA 1A32A 5FP8A 4YFZA 2RJLA 3GF6A 1BXHA 1T6BX 5ERLA 1AZDA 1QJY2 1ZVFA 4YJ2B 3ZMNA 2P4KA 1MQTB 1FMD2 1UFIA 2B45X 4XIKA 4B3TB 2WS93 1WA6X 1M06G 1A3KA 4QX7A 1R1A2 2VE1A 4Q4V2 2YI9A 1I5XA 3B9IA 1P49A 4DFSA 2IJHA 5I93A 2ZIOA 1ZUQA 5LRSA 3WX5A 5DUWA 2R30A 2PYLA 1GN4A 2AUYA 4AHYA 4FFHA 2XKPA 1CAVA 3ZYBA 2HWB3 4JI0O 3H3UA 3RJRA 2WQ8A 3VDDB 2W9XA 4YZ3A 3TAYA 1WN7A 2W0XA 4YGDA 3CJXA 2ETNA 5L3DA 4AVSA 1U5YA 4TXWA 1FXKC 3ZXDA 1LULA 3LIHA 1Y6XA 1CVNA 5LMNB 2RDSA 3VHPA 4X65B 3DUIA 5FREA 3IJ4A 1COV2 4FPOB 1KFXL 1W8FA 2YIAA 2IXJA 1F23A 4MV2A 2Y0OA 1ZYBA 5JZGB 1P7GA 4WFGA 1UJWB 5FYTA 3ZOIA 5E6HA 1FXZA 4WZFA 4MGSA 4CBCA 2ES3A 4I0XA 2P90A 4V2WA 3GZEA 4Y1YA 1NAEA 3VBUB 3D3AA 5HI0A 4Y1ZA 3SH4A 5H9SA 1PO12 1H8TC 2BPA2 1GOFA 2E74B 4FM0A 5J2UA 4YZ2A 4P9GA 5FPVA 3ZYFA 1NOVA 4YVWB 3JSLA 3WFVA 5LXTB 4K6BA 1FPOA 3ZRWA 4BQ5A 3W59A 1XNKA 1Y66A 3M3EA 3UT5A 4QWNA 3N3HA 4OQ8A 1F5FA 4DR1B 2OYZA 4P30A 2EIGA 4UVAA 1QNYA 5F3EA 4QQLA 2LJ2A 1ZREA 2QKDA 2DU1A 2O8OA 1NH2B 2B4KA 3HAGA 1FPN1 2AC1A 4QGLA 4PA3A 2YBSA 3MDPA 2RR13 1VBA2 4NPLA 2GSYA 2CU5A 4KU7A 4P9JA 5FZDA 4RHV2 3UGGA 1XU1A 4P5YA 3ACGA 4IESA 1G9FA 1XILA 2UY8A 4LPLA 5GW7A 4LBKA 4OHXA 2YBPA 1VLNA 4QHOA 1VBD1 2RDRA 4GX5A 3WG7C 1WKYA 5ACA1 2VOTA 4MYEA 1KDKA 5ISLA 4LC1A 5EJZB 3ZCCA 4UT5A 4ABMA 2QQNA 1HDJA 4JAAA 5FWEA 2OPKA 4KBBA 1QGLA 4MGZE 3JAWA 3CXCU 4GXLA 1UU6A 3EJKA 2RDQA 4JI6B 3PTRB 1OQEA 5FPLA 1RUC3 4CH3A 5KUKA 1IXBA 1QXJA 5I91A 1IQDC 3TN93 4U3FH 3K9SA 4Q29A 1N0NA 2QBXA 3G6EV 4UYBA 2YC4A 5LA6B 1PZ7A 5FPXA 2Q9LA 3B69A 3K0DA 4HN1A 2GNTA 1NLQA 4X8PA 4XBNA 4LFBO 5CG8A 2Y6LA 2VTXJ 5ANQA 2QSAA 1GZWB 1AI7A 2YUAA 1Q6UA 2CAUA 3OAAG 1N32O 4RR3C 2Y33A 4MHRA 5AC93 3HN3A 3T2QA 5E1RA 1MZFA 1LTEA 1ZRDA 4YNIA 3I55V 3ILRA 3RSJA 5A2QN 5BNNB 1OKQA 5T5LA 2BCCH 4IGGA 2PMWB 3UM7A 4I3PA 2OKXA 4FLXA 2JG8C 4CU9A 3BU0A 2OVUA 3AYEA 3H8XA 2Q7GA 1VBC1 3CZJA 5B1BC 1NCRC 4YG6A 5K1PA 1BHAA 2EIMC 2QQWA 1LOCA 3VD7A 3RYIB 2N04A 1UPGA 2DTYA 1VQPV 2D44A 1O9HA 5EIBC 1NXD1 4FFBA 1GMGA 2VOWA 4CH6A 5FZ6A 2YC2A 2WS92 4BQ4A 4IGOA 2Z3YA 5LHHA 2UXBO 4DW0A 4ISRA 4LF9B 5BUVA 3WNKA 4AQ6A 3H01A 3UO2A 5J9PC 2WSUA 3KM5A 1Q8SA 2ZGMA 1W6OB 4PDLA 2ADQB 2HWB2 1YEWA 2IW5A 4HK9A 3ML0A 4CXXA 1M1KW 4ZS2A 4BXFA 1YTFD 5FKCA 5IJRA 1HXS3 2PHXA 3N27A 2Q5TA 1JX9A 4YZ4A 5JR7B 1XB9A 5HCBA 2WWJA 2KR2A 3NAPC 1JOPA 1TUBA 2DCKA 1V9PA 3M2MA 2ID4A 5FUPA 4AHCA 2I2SA 4EV0A 1I3HA 1DF5A 4LF4B 3PVBB 3OPWA 2ILMA 4GX0A 1SCRA 5DG2A 1L7QA 2ZX0A 4GWJA 3TK1A 4CYDA 1S0EA 3CHXA 5GZEA 5J7MA 3R05A 4I55A 4M3CB 2HJIA 5FZLA 1J58A 2TNFA 3AXEA 1JU3A 4XXPA 2VU9A 4DV7B 2KG7A 5F2WA 4LP8A 4DEVA 2EJ7A 2QWRB 4N7UA 2UXXA 4LIUA 3HVDA 3O1MA 1B04A 4BMBA 4P9IA 5FMOS 5FY1A 4LBEC 3OEAA 3OYWB 2LW7A 3ZX6A 4LITA 2QDOA 1TE1B 1XBLA 1JCHA 3VZJA 2IU0A 1QNMA 1H4HA 3N2KB 2EULA 5DXDA 4JI8O 1O6UA 2F4VB 2RR12 4PQ9A 2R071 3PIJA 4AILC 3ME2A 3QCWA 5HBAA 5EBWC 5KA6A 2QFEA 2RM23 3PJQA 5JVDA 1SHWB 5BNOA 4DXSA 5FNVB 2LO1A 4G3YC 4IV3C 4CS2A 4L11A 4CPBA 3BHPA 1AXYA 3L73H 4YGCA 4XZUG 5IVJA 1FX5A 3X2QC 4B3TO 4QGPA 5CKNA 2A6YA 1SQQH 1ONAA 2X53S 2BWCA 4ZXEA 1WCDJ 5CBFA 1S5JA 4C1WA 4JF3A 1RUC2 2A6ZA 1FOD3 2VMIA 3TN92 2WN3A 3UV9A 2BU9A 1QCEA 1YI7A 3ZM8A 3ZSMA 3MFCA 1REEA 2WABA 1UAIA 1QOOA 5D5QA 4QE7A 4HSJA 1K92A 4CCDA 4BIZA 2MW2B 2A79B 3SYQA 3JD1A 3DGEA 2QTOA 4DR5B 2DYCA 1BEV1 2K1EA 2XAFA 5LMNO 2VGDA 3A22A 4X65O 2CL2A 4HNAA 1XNBA 5AC92 3K48A 2OS2A 5H9QA 1G6UA 5IE9A 3W7TA 3KVAA 3ATGA 3WOGA 5CYYA 2ZEYA 1KMIZ 1SLTA 2A1XA 3CRMA 4MZUA 3AYAA 3BTZA 3S7IA 5LHIA 3CJHB 2RJZA 1KUQA 3MPPG 5LBEA 3W58A 4GKXA 4MSWC 5IK7A 1W8HA 4DXTA 4HKLA 2XKOA 1GSLA 4HN0A 3QBQA 2PHRA 4IGQA 3E89A 3AMHA 2PN5A 4DR7B 4X1IA 2LFSA 4WM7B 3RFRA 1X9PA 1WW7A 3RVYA 3HIFA 4KGQA 5L9RA 2P1BA 1OA3A 3VHOA 4CU7A 3DXRB 1NT2B 1PNLA 4DR1O 4FAGA 4M0HA 4P9WA 3DEMA 1J59A 3AMQA 4J7ZA 1DF4A 2A3XA 5J09A 3IDAA 4GQ7A 2QM4A 1CAVB 4F4LA 2RS31 1H1IA 1ZZ6A 3BGAA 4Q5OA 2XAHA 3MHZA 4XABA 4BAYA 4RQPA 2F66C 4DV4B 3D6EA 1EV11 2AGAA 3KT1A 1HXS2 2QCSB 1YJ9V 1UO9A 4I3GA 4TSVA 1W04A 5FPOA 1J83A 2VCAA 1ULGA 5J37A 2E51A 1UZZA 3AMPA 4A7ZA 2FCTA 3K3OA 2DUPA 3FN9A 2P17A 3JB4C 3HKBA 1W3VA 3MUY1 4JI6O 3QO8A 5JI7A 1AI5A 3CJIA 1V54C 5F8PA 3J26N 4I0XB 1GM7A 4MT8A 1XI1A 1VARA 3WEZA 5F6LB 2ZE6A 2ETEA 5JAXA 2H6BA 5GJ6A 5AFBA 4HVRA 2JB4A 4IHJA 2VCMA 5J2UB 4RL7A 4FOYA 4QPKA 2K0GA 3E5QA 3ZRWB 2G9GA 3WCRA 1WP8A 3UT5B 4QB1A 1SEFA 1RL3A 2NNUA 1UMHA 1NZ6A 4OI1A 1DHKB 1JOJA 2DQ0A 1D4VB 2ITCC 3FHIB 4YZ5A 3DGTA 3ZRSA 2HHHB 3SEEA 1R083 5JCOA 1SMVA 1AVMA 3IMNA 1ZLZA 4QXBA 2GP3A 1ZM1A 4LO7A 4AGRA 1OA2A 2DJVA 1Z0HA 2XJUA 1NBMG 1LOAA 2RM22 4TWTA 1C8NA 3OUSA 1BS3A 2QTSA 3B09A 3OBAA 4CCCA 2E31A 2W08A 3NV3A 3RVHA 1MMMA 3T30A 1VMFA 4UFZA 5FL7G 1CIWA 3UNPA 2W94A 4CP9A 3JAWB 1LNQA 2W0FC 4LF9O 4NHMA 5C8YA 3SH5A 1JZ8A 2AZ5A 4Y5TA 1AJOA 2WR9A 1FOD2 3KV6A 4DW1A 1AP5A 2EINB 1SDDB 4CDUC 3M8AA 1HX6A 5FPZA 2Q4SA 2DBIA 3I2KA 4NIIA 5DAQA 4PLOA 5CG9A 1UW8A 2JICA 2I07B 3WQBA 4IE6A 1J95A 2FMLA 1W8ZA 3F95A 4WFAV 1ZNPA 3ZXGA 4N53C 3PNAA 5HV4A 4TN7A 1GQPA 1RUOA 4LORA 1IHMA 1LU2A 3GJAA 2YY1A 3ZBHA 3E97A 2GTSA 3H1YA 1WLWA 3DKWA 2WA4A 1VBB3 4J80A 3WD5A 4LF4O 2P37A 1RUNA 1DQ5A 3FUOA 3MHSC 1I5PA 5FAXA 3JBG1 2ZDIC 3BTAA 4I9QA 2PHFA 4K8XA 5LATA 1DLBA 3DYPA 4CDWC 1Y9QA 2WA3A 1V55B 4LO6B 3HBKA 1L1FA 4XDQA 3WG4A 1O3RA 1SFPA 1UYXA 5H5NA 4DV7O 1IGOA 2YXSA 3TYJA 1Y74A 4Z92B 4FFBB 1ZZ7A 1RC6A 1B35A 4PDMA 4QDRA 5FZEA 3ZN4A 3FBYA 4JV4A 4XBQA 3SHRA 1COWG 5J2TB 3LPFA 4ATFA 2BNOA 2VZTA 3TGUH 4NUBA 2WT1A 5FOBB 3K04A 2UWCA 4U36A 4KHPB 3O14A 3BIEA 3T0DA 5I0UA 4JPRA 4R9AA 2F4VO 3LA2A 4FPLA 3ABMB 3I3BA 3GYDA 1H8HG 1DGLA 3UT0A 2R1BA 2L9LA 1HQNA 3ZFFC 1Q8OA 3J7LA 1G9BA 3MUZ1 3A23A 1QHTA 2HKXA 3WF1A 5A3TA 3O5SA 4FTSA 3FB7C 2YFUA 3HB3B 1S1AA 1TUBB 5LHGA 3I54A 5EBLC 1AR5A 4PLMA 1SZXA 4HPKB 2OIGA 2HWE3 4XUQA 1YZBA 1Q56A 4IEZA 3FAVA 2PGGA 1D7PM 4LHKA 2H8PC 1K45A 3SCHA 4QPGA 3RVZA 2Z42A 2VOVA 4UW6A 1ROPA 3JQWA 4OHZA 3T2PA 1MEC3 1YI9A 1AYM1 2WWWA 2H3OA 3NMBA 4XZPA 1AL21 3ZO0B 4GKYA 2KG7B 3ASOB 3RW0A 4DRXA 4UFMA 4AEDA 4NPMA 2AEYA 3FL7A 3TNQA 1GRJA 1PKXA 1NUKA 4DR5O 4KWLA 3U78A 3B4SA 2C26A 1S2KA 2EJRA 2DQ3A 2CAZC 5GONA 3N7LA 4CDXC 4TYSA 3DV8A 5J3UA 2Y0PA 4IYIA 1MABG 3JD4A 2WNEA 5DAVA 3ASNC 4DK0A 1R082 1NZCA 3RG0A 1NCQC 4PDWA 2UURA 3S6PA 4M0NA 2YICA 2VZ3A 1ZBE3 3VBSC 4XAAA 4LLOA 1FYJA 3MV11 4XETA 5I0DA 3G80A 4MO3M 5IK8A 1Q8VA 1YIPA 5C3PA 1F7YA 1T2XA 1VRBA 3KCCA 5JVDB 5BNOB 1LOEA 4GWNA 1M5IA 4BYYA 2AGSA 5F37A 4DR7O 3ENRA 3NNLA 1BHBA 1XUQA 1D5NA 3MLKA 3NSTA 1K4DC 3G6BA 4LR4A 4BOWA 1QXPA 2GTAA 4EN0A 4HONA 4RUEA 2EZOA 1S0BA 3G67A 3AK0A 3DCQA 1I6XA 4RQEA 4Z1MG 3O1UA 2GSMB 1QLNA 1EAH1 3MICA 4I30A 1BLZA 5IUQA 4QX3A 2XG3A 3AG2B 1SA0A 1ENXA 2D43A 2KSDA 3GZAA 4A44A 2FL4A 3PDQA 4CPBD 4DV4O 2FDJA 2FB5A 3OBZA 2Y0IA 1IBMB 1FXHA 3WW1A 3PU8A 4G4FA 3RZJA 5C8CA 1BHGA 3VKNA 3O0WA 2D6KA 3O0XA 1VBB2 3KCXA 4C90A 4X66B 1UCXA 4L92A 1U12A 3BVOA 5CA0A 1BVP1 4K3UA 2XOKG 3I49A 1TAEA 2OT7A 4AXOA 4IV1B 2BOCC 3LSEA 2BUKA 4FQZA 1GV9A 5DUXA 1YLLA 1F15A 3SYCA 1PK6C 4FXGB 2CGNA 4C91A 5IVEA 3CO2A 4XJAA 1LNSA 1GP5A 3FE5A 4NTYA 4M3CF 4FLWA 1YSCA 2UUBB 4X1IB 1ENRA 1GBGA 4YW6A 3H8UA 5H9PA 4XPVA 4PHZA 3POGA 2DFCA 3ZJZA 1DGWX 1HN1A 3KKYA 2FMDA 5IJ0A 2D2CB 1G4YB 3K59A 1GZTA 3ETEA 5C70A 3F5WC 5KA5A 2PHUA 3SCGA 5IT6A 1W0OA 2HP8A 3Q4HA 4DV2B 4EB6B 5FXXA 4QB2A 2R6QA 2HHHO 4XILA 2IXLA 4MADA 3LA3A 4W6YA 3S7EA 3SJBC 2WLMA 4J6GA 4RQPB 2OIEA 4C7UA 4XF0A 2B9VA 4YIPA 5H2FZ 1PNMA 1PGL2 3K79A 1GK9A 2GHYA 4FLTA 2B42B 1VQMV 2HVKC 4XOGA 5A9GA 3F7YC 1CQ9A 1LEMA 3WP6A 2D6MA 1ZA7A 1JA8A 2AXTZ 5JUVA 5FYYA 2YBKA 1TVGA 4ZU5A 1EYBA 2HWE2 2W95A 1SETA 3WHUA 1G9DA 3HKBB 2XJSA 1U97A 3A21A 3WDYA 5BZBA 2VQ0A 5C6CA 1Y4MA 1GN6A 1O3TA 3CJIB 4B8EA 3T0AA 1JZ3A 4R9BA 4E2LA 1MEC2 2V5YA 4RD7A 1B09A 4BCUA 3JYCA 2NYYA 2W6IG 3K06A 3ZHQA 1CZTA 1BCCH 2PHDA 1FPN3 1DYPA 4IHJB 3A4UA 1AJKA 1ZRFA 5FMCA 4P5HA 5FYBA 2DWDC 1PIV1 3FB6C 3GNEA 5AVAA 4D8MA 1AX0A 4IEVA 4UFLA 4FOWA 3NKTA 3RZGA 1XRUA 5I0RA 4XJZA 2W1QA 1NA1C 5K0UA 3VQXA 3D4KA 1LR1A 4LCUC 1ZL8A 1QJEA 4RFRB 3B93A 3ES1A 1PHMA 4FI9A 3KS7A 3Q8AA 1ZBE2 1XE7A 4NAMA 2J1SA 4UW4A 4BQWA 2IFRA 3VBOC 3VBFA 1U96A 3HD8B 4PD4F 2G38A 3MIBA 3D36A 2EXHA 4CXYA 2VMHA 1UQXA 5SV8A 4XEZA 4DUWA 2JJ6A 4FLVA 5KHGA 5B4NA 4UAPA 1IZ3A 2VQUA 4AI8A 1VF6A 3AG3B 2GUZA 4LO5B 1IBLB 4DIQA 3KVBA 2GC0A 3N4MA 1FNYA 1YFXA 5JLVA 1WMEA 3OF1A 5C8YB 1OCRB 1A8DA 3PN1A 3OPZA 3ZHTA 4XJWA 4QKNA 2XQXA 3CRAA 5DDJ1 4KHPO 5LA9A 2A06H 2CTVA 5FXWA 2OCCC 2RMKB 3NR7A 4PJ0Z 2IVIB 4NRMA 2JD4A 3RYHB 4KG8A 2QQJA 1VB4A 2EXIA 1EPZA 5KHJA 4IEYA 4P08A 3ZMOA 4R6ZA 4MSVA