1Q5OA

Hcn2j 443-645 in the presence of camp, selenomethionine derivative
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
201
structure length
201
Chain Sequence
b'DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title STRUCTURAL BASIS FOR MODULATION AND AGONIST SPECIFICITY OF HCN PACEMAKER CHANNELS
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 57
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2003-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1q5oA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1q5oA02
2BEOA 3RPQA 2BNMA 3CEWA 5I0UA 3DN7A 1HW5A 1YHFA 5LEJA 1X82A 4A2UA 4J1WA 2XKPA 4XEZA 3U10A 4TLFA 1LB2A 1ZZ8A 2B9UA 3E6BA 3FJSA 4O9GA 4DINB 2UY8A 3S0MA 1UIKA 1Y9QA 3VHRA 1VP6A 3ES1A 1ZNPA 3IIAA 3D82A 3PNAA 4FT8A 4QGNA 1OD5A 4MGKE 5BY5A 4AQ2A 2CV6A 5JAXA 3KGZA 2BNNA 1YWKA 4KWLA 3RYRA 5I8YA 3CL1A 5KHJA 3SCGA 4F7ZA 3TNPB 5JSPA 3GYDA 1QWRA 1CAWA 4YRDA 3H8UA 4XFGA 2IXKA 3GBFA 3LZZA 2ETEA 1QY4A 2PA7A 2K9ZA 3H50A 1X8MA 1O3TA 4J1XA 2OZ6A 3LWCA 4X6QB 1DGWA 1EYBA 2IXCA 4KU8A 4PIYA 4I01A 2PAKA 3IDBB 3DL3A 1I6XA 2K0GA 2XL7A 3R6SA 3U11A 2CAUA 4LULA 2GZWA 4ZU5A 2BYVE 3IWZA 4YNIA 3B02A 3SCFA 4ORFA 2HJIA 4QM8A 1SEFA 4IEYA 4Q0QA 4IEZA 3RDIA 2EVXA 3SCHA 1ZRFA 1NE4A 2VPVA 1GQHA 1YFXA 1LKNA 4EWEA 2F4PA 4ZU4A 5C8WA 5F1RA 2P17A 3DV8A 3MDPA 4OLLA 1ZZ6A 2XHKA 2QJVA 4E2SA 5KHIA 3NW4A 4HZFA 5E1RA 3D0SA 4IEPA 3E6DA 1O7FA 3ZDSA 5FLIA 3WW3A 1LRHA 3WW1A 4FAGA 3UKNA 3LA2A 2C0ZA 3FFQA 2BNOA 4IESA 2OA2A 5CVRA 3M70A 1J3QA 4PIXA 1XE8A 4E2QA 4FBFA 2MHFA 3RZZA 3U0ZA 3BPZA 4ZU7A 4Q0VA 3USSA 1O3SA 1UCXA 1UW8A 1DGRA 3NVCA 2Q0AA 1UIJA 2IXLA 5KHGA 4HVQA 1O4TA 4AXOA 5FDBA 2QNKA 3LA3A 1RUOA 5HI0A 4WVZA 5FCCA 3H9AA 3KMHA 1ZRDA 1VR3A 2XL9A 2DCTA 5I0SA 3QACA 4Z82A 4H7LA 4AVCA 4KWJA 4XFCA 4PIZA 1VJ2A 2XLFA 4EROA 5I0TA 4L11A 1ZRCA 3EO6A 1CAUB 2PQQA 3H3ZA 4IETA 4KL1A 1CX4A 2Q4SA 4HLTA 4IERA 3HQXA 5FQ0B 2Z69A 1X8EA 1ZRRA 3CO2A 4N9IA 3SMHA 2O8QA 1TQ5A 3I7DA 2OPKA 3HT2A 1CAVB 1OMIA 2BGCA 4LA3A 4WZCA 4K8FA 3RNSA 3WW4A 4BIFA 1OI6A 5JCTA 1PM7A 3E6CC 1FT9A 3H1WA 2PYTA 2CAVA 2H0VA 4R8HA 3RYKA 1CAXA 5FLHA 4YSFA 4QGLA 1Q5OA 4HBNA 3BCWA 3NKTA 4KU7A 3EQEA 3MPBA 4XFBA 2PHLA 3EJKA 4IEWA 3UKTA 4D7TA 2OZJA 4EWAA 5C6CA 1NYWA 2D5HA 4HN1A 1H1MA 4MH0E 1YFUA 2UY9A 5KBFA 1WGPA 4XETA 1U12A 4KWKA 2HKXA 5I0RA 2GC3A 4RD7A 3HIFA 4UBHA 1Y3TA 1WA4A 2ZCWA 4JVAA 4YARA 3C3VA 4ONUA 4X6RB 4YYOA 2PAEA 2WFPA 4IEUA 3OF1A 3CLPA 2KXLA 5BUVA 2IC1A 3M3IA 5I93A 4L2NA 1DZRA 1RGSA 2CGPA 4MX3A 1RL3A 1QXJA 3OCPA 3MYXA 2FQPA 4HN0A 4R52A 1ZZ7A 4BH9A 3LAGA 1ZZBA 4AQ6A 2GC2A 3NJZA 4P9GA 2ZKLA 4B29A 1J3PA 4I3PA 3UKVA 2B8MA 4QX5A 2PHDA 4META 1FI2A 2UYBA 1I5ZA 2MNGA 2GU9A 3QOPA 4HVRA 1Q3EA 2VQAA 1CAUA 4IEVA 5I91A 4MUVA 5I8TA 3ST7A 1QXRA 5CU1A 1J3RA 2Q1ZB 1EY2A 5FQ0A 2N7GA 2XKOA 4XF9A 1RUNA 3H3UA 4MGZE 4JTNA 1XRUA 4I2OA 1CAVA 1JUHA 1O3RA 4UBGA 2PAMA 2ATFA 5FPZA 3LA7A 5BV6A 3D0JA 3G7DA 4XF4A 3SHRA 4EWDA 3BU7A 4QXKA 3SXWA 4AVAA 3ES4A 3ROUA 2Z2SB 3S7EA 1J59A 3FX3A 3OTFA 2GAUA 4GULA 4MZUA 4N9HA 3ELNA 5K8SA 3N4MA 5BPXA 4Q0UA 1O5UA 2VECA 4IEQA 2B5HA 2D5FA 3JZVA 2UYAA 2PTMA 3OGJA 4BHPA 4LUMA 3E5UA 5J48A 4XF1A 2GC0A 1RC6A 3H1MA 2IXJA 2XGXA 4HSLA 1SQ4A 1ZZCA 3E97A 4E2GA 4I02A 4MV2A 5I8SA 4FAHA 4D7SA 3I54A 5EFUA 2D40A 2IXHA 5KHHA 5JR7B 3ACLA 3H7JA 3L2HA 3I59B 3BB6A 1WLTA 2WC2A 3PVBB 3MZHA 1NZCA 4QGMA 3FWEA 5E16A 5LRRA 5CADA 5T3NA 2ET1A 4LLOA 4NVPA 1GQGA 3H1YA 4BYYA 5FLJA 1YLLA 4MGIE 1V70A 4XFFA 2XLGA 3HT1A 2QDRA 2EAAA 1G6NA 5EZWA 3PLQA 2D93A 5BXXA 1O5LA 4XFIA 4I09A 1IPKA 2O1QA 3EHKA 4O9EA 3BALA 1XE7A 2PFWA 4LTAA 4F8AA 1J58A 4XF3A 2ET7A 5J7MA 3CF6E 5D1IA 2QCSB 3ETQA 5JSOA 1IPJA 1EPZA 3O14A 1CGPA 5JSRA 1NE6A 1J1LA 4LA2A 4PJYA 2H6BA 2EA7A 1ZX5A 4I0AA 4QM9A 4XFAA 3FHIB 1L3JA 4WBBA 1YFWA 4JV4A 3CJXA 1EP0A 1H1IA 4IEOA 4HVOA 1PMIA 3OD0A 5AVPA 4EV0A 5LRSA 3KCCA 2IXIA 3WW2A 3NL1A 2GC1A 1LR5A 4LUKA 3S7IA 1ZVFA 3TNQA 4CYDA 3E5QA 2QVSB 3H7YA 1CAXB 1CAWB 4I0BA 4UXAA 2MPFA 5FPXA 2FMYA 4OFGA 1FXZA 1YFYA 2XLAA 3FZ3A 2Y0OA 1Q43A 2GH2A 5J3UA 3E5XA 1O3QA 1ZZ9A 1ZREA 1RTVA 4XFHA 5KHKA 3RYPA 4Q0SA 4XF0A 4AVBA 2OYZA 1OFNA 1SFNA 4IEXA 4QMAA 4LEJA 2H6CA 3FE5A 3I59A 1YUDA 5LEKA 2Q30A 2V09A 3DKWA 4JTOA 4Z07A 1UD1A 3KSCA 3LOIA 4Q29A 3IDCB 1NXMA 4MGYE 1DZTA 2E9QA 4HMZA 3IBMA 3KGLA 3NSTA 4Q0PA 3EBRA 1UPIA 1X7NA 4HSJA 2I45A
chains in the Genus database with same CATH superfamily
2MEV2 3CEWA 5J9PC 2GNTA 3D3QA 2X7RB 4O4LA 4DK1A 1RUF3 5LL6Y 3ZXEA 3NV2A 2RM23 5FZHA 2FDKA 2ZNJA 4F6EA 1WA6X 4O4HA 1NVPB 1QF3A 1N3QA 5BNPC 4QGNA 5A7OA 1GU3A 1N1YA 3WT3A 2LW7A 4CP9B 1AR62 3ZMVA 3R4DB 1K5MA 1VRH2 1W8ZA 4DR7B 4FLTA 2Q4PA 4DV7O 5JQGB 3J7MA 2H8PC 1CAWA 4J9YB 4YRDA 2ETEA 4QX7A 3LDDA 3A7QA 2WLMA 2RR12 3W7UA 2ZS6B 3WNKA 2VQUA 5D8AC 2QKSA 4YHHO 4PIYA 2DVGA 3BY6A 1ONAA 1GM7A 3OD4A 2EZPA 1XMOO 4LULA 1S5JA 2VQEB 1TVKB 5KLVH 4ORFA 4MLOA 1VBE1 1GP6A 2P1BA 4S2DA 4DRVA 2W47A 1H2GA 3PUIA 3BYWA 2J1AA 2HJDA 4AGVA 1PL0A 2QJVA 2VW2A 3DXTA 4FFBA 1UZVA 1GMMA 3H8XA 1KRIA 5A3NA 1DF0A 4JI4O 5H9CA 4XDLA 1VMGA 4UF0A 1DQ0A 3ZHRA 1LRHA 3A0RA 3UKNA 4Y24A 4BIUA 3UM7A 2L35A 1I08A 4WCEV 5E89A 1I3HA 5CBGA 2ZX2A 3AKTA 4FXGB 4DY3A 2YG0A 4W65A 1WMXA 4YFZA 4F83A 1PKXA 2A9HA 5FCCA 2WZPP 1NTZH 1L0NH 2IFRA 2GSYA 2EXIA 4DV1O 1CR7A 1NA1A 4PIZA 2WN2A 5FYHA 1FMD3 4M4PA 1O6UA 3H3ZA 1DHKB 1YC61 2VUJA 5EZYA 2P5OA 4NROA 1X8EA 4XIOA 2QWOB 4U7OA 5FY1A 3JASB 4K8FA 1AXYA 3ZMOA 4HBNA 3N2GB 4CUGA 3EQEA 2TEPA 4V2WA 1XDCA 1LU2A 1GOFA 2OZJA 2HWF2 4ZZ5A 4XDOA 1VQ6V 2R072 2QWRB 1G4YB 1G7YA 3AM2A 5BNPA 1N3OA 3UO2A 4E4ZA 2TNFA 4LFAO 4CUBA 1XNQO 1ULCA 3BVOA 2WJSA 3VQWA 5LA6A 3O0XA 4JKLA 4MTOA 5FZ6A 3Q8EA 1BT8A 2JKBA 3KF5A 1G8WA 5D8AA 1VQ9V 3KVAA 3R4UA 4Q4W1 1JFFA 3A4UA 5B4XA 3T1LA 4HG6B 1LOFC 3POJA 2QM8A 3UKVA 2DOSA 1BYHA 5JXJA 1GSLA 1DQ4A 3LDBA 5IDJA 4BQ3A 4COUA 1HJFA 3QOPA 1CPYA 2VQAA 2ZAAA 2EXKA 3S30A 2P6JA 2JDUA 3ZXFA 1I0HA 4Y22A 3ASNC 1CAVA 3T1MA 5DZFA 3NQHA 4UBGA 4LC1A 2ATFA 1MS1A 1SQFA 3EXUA 2EIMB 4YGCA 2UU9O 2HWE1 4EJRA 1CN1A 4CS2A 1GZWB 1DCSA 1ST8A 3KLSA 4I4TB 3CHXA 2HEVF 3CP1A 3L72H 3K4ZA 1Q81W 2E5LO 4D6SA 2WAAA 3IC9A 1VQ7V 5ACA2 1VBB3 4XF1A 1JYXA 4EFEA 2AW9A 2VWKA 1RUF1 4QB6A 2RG4A 5IVYA 5IVJA 1BLZA 3K5OA 5LWBA 2AC1A 3PVBB 4QGMA 2WLPA 5CA1B 3PVNA 4ZZ8A 3N2KA 1OT5A 4DR7O 5FLJA 4RHV3 1EUUA 4MGIE 1QGLA 2UUAB 2AREA 1G6NA 4JI6B 1BZKA 5LBQA 4I09A 3K04A 2LW1A 4LTAA 4F8AA 5E8AA 1Y76A 4G2KA 3RFRA 2VXRA 2QJ1A 4DRRA 4M0HA 2LO1A 4EN7B 1WLCA 3VQVA 4N43B 5FZIA 4Y1XA 1ND3C 2VQEO 5LK5A 4JV4A 3CJXA 4RS5C 1KECA 5BNNB 2CTRA 4RQPC 1RUE2 5LRSA 4N53B 4TXWA 3WQ1A 2VQ0A 1NLSA 2J1RA 4Z1VA 3WU2Z 3MO4A 1QIQA 1DYOA 3BTYA 2ZX3A 3LPFA 4XAEA 4CUAA 5FXZA 1IG3A 2GH2A 3PJSK 1WMDA 4N8MA 4QHOA 1LOFA 1B04A 2VTXJ 5L3DA 1H2MA 2CGOA 1BQ0A 4XURA 1VBC3 4PDWB 3DECA 1UD1A 1SZXA 1XMQB 3G80A 4OHVA 3KT4A 4DXTA 1S0BA 5C70A 4JDOA 2Q9LA 5T5LA 5A7SA 5F2SA 2ZQMA 2GH8A 4TLFA 4DINB 4QQ2A 1G6UA 3AYCA 2Y69C 1NKGA 4FT8A 1PGL2 2OT5A 1FXKB 2R0HA 1WLDA 3TEXA 2V4AA 1FMD1 3KGZA 4G9SB 2WSUA 1IDSA 3O1PA 1QJFA 4F7ZA 4FTBA 3HJRA 1AR72 4O7XA 4BE3A 4GX1A 2QDOA 1EFRG 1HN0A 2EIKC 2EJ7A 5BR8B 5IK5A 2DWEC 2BW8A 5CNAA 4NXMO 5FY4A 5A32A 2K0GA 4FPKA 5CEHA 5GLTA 2A6YA 1O8SA 4P9WA 5B4NA 1AJNA 1EAH2 4A3ZA 2Y26A 1W04A 1RUD2 1UZYA 2VPVA 2F4PA 3AKRA 4CUCA 5FJHA 4HKWA 2PYLA 2XT9A 1ND3A 4IGGA 4RS5A 3ZR5A 4RQPA 4LF5B 1Y74B 4B3NA 3ZRSA 1QVGU 1W0PA 3OG2A 2VXJA 1H0BA 3ETPA 1DFQA 2VE1A 3RYIB 2BU9A 2HWC3 2RS32 3OBZA 1OUXA 2RE9A 1NI8A 3BPZA 1VF7A 5FMOS 3FB6C 1JR9A 1JTZX 5L19A 5AC92 4YW7A 3OTOB 2NN4A 3JAMN 3I3MA 1O9HA 3ZMUA 5JPMB 5G04L 1OCRB 1LHOA 4R4ZA 5FZKA 1REFA 4XVHA 2XLFA 2YU1A 1W8OA 2YV8A 1NQJA 1OD3A 3S57A 2YBKA 1W0KG 1YIJV 3CO2A 1IKPA 3PMEA 1GANA 5GLWA 1TQ5A 2Y6GA 5JUVA 3RI8A 4DZGA 2ZGMA 1OI6A 2DTWA 3RVYA 2H0VA 1VIBA 1VQ8V 1SLBA 1RVF2 4XFBA 2HBTA 4IEWA 3O1RA 1UYPA 1YHQV 3KZ4C 2WQ4A 4XZUG 4MH0E 2VW0A 3T1CA 4Q20A 5LP6C 1UXZA 2W39A 1ZBE3 1ZRIA 2ADQB 4UBHA 1Y3TA 1MACA 2JGDA 1WA4A 2UUAO 4ONUA 3AMHA 5LA2A 2W6JG 4Q8LA 3BFRA 2BOCC 1W05A 2BVBA 1LHVA 1DZRA 4HK8A 3O1TA 2WLKA 1QEXA 5GZFA 1SBFA 1LCLA 4XJ9A 4B3TB 3HBZA 1RINA 1A32A 1PO21 5EJ3A 4K0KO 3VKOA 4NN0A 4P9OA 4L9BA 2XBO1 4MUVA 1JZ8A 3ST7A 3ZHVA 4QX0A 2EXJA 3BOPA 5IJ0A 4J80A 1GWKA 2GMMA 5FXVA 5FPZA 3WFVA 5BV6A 5FZEA 3AP4A 4ASLA 3H3LA 4X8NA 3I97A 3NJYA 1EPWA 2Q68A 2JB4A 5BMVB 5IK8A 1SF9A 1OJHA 1W8FA 4N7UA 3JD72 1RUI2 4TV9A 3VBSB 2Q8EA 1MS0A 2NP0A 1BBT3 5FMOL 1VBC1 4J7KA 3K5NA 5FXXA 3T2TA 4L99A 1XYOA 3E5UA 5IHRA 4W6YA 3OEBA 4QB1A 5FAXA 4XBQA 4URTA 4E2GA 2ODMA 3AP6A 2IU0A 2LS6A 4UXNA 1BHBA 2WZR2 2J42A 3ZHUA 2QQPA 5A3MA 1I94B 3B8MA 5LRRA 5T3NA 3WHUA 4GWJA 1RUG2 1W6MA 3TWIA 4LF8B 4I50B 4DYLA 4ES9A 2BV4A 1NAEA 5FUIA 1S77D 2UXBO 1EZJA 1SKVA 2WYFA 5BR8O 1NBMG 1VP7A 3UGGA 1DGWX 4FLWA 4W6XA 2V5DA 1QLEB 2QCSB 1ZL8B 3ETQA 3JUUA 3O14A 4HKLA 3VBUB 1J1LA 2ZMNA 4YLZA 3A0BZ 2RQ6A 5LP6A 3APOA 1GKFA 1T6BX 1U5ZA 4ASMB 3VGIA 4UCUA 4JI5O 1FAYA 3POGA 2Q8OA 4CCDA 2DBIA 3G67A 5JJNB 2DWRA 1VBD2 4JYAB 2XVGA 4OQ8A 1YITV 2DE0X 2XLAA 1GYKA 3APBA 1DLLA 1E57A 4YY3O 1EN6A 4AVVA 4OCTA 4QPJA 4D94A 3MW4A 1S72V 5EK0A 3DYOA 5FYZA 3K2OA 5FYTA 2NYYA 3IKWA 4R50A 4JYCA 3S5QA 2VS0A 1EN4A 4XDKA 3GCWA 4E4HA 4JTOA 1E5SA 1PGSA 4Z07A 4GLXA 1ORQC 2R49A 5A6QA 3IGAC 4QQPA 2ZD9A 1OQ1A 1J83A 1JJ2U 2PLV2 4JX0A 3LE0A 1Y4WA 4EN0A 3OTOO 2A6XA 3AFKA 2HWC1 4KI5M 3W20A 3OGIB 2YDEA 2XB6C 3JALA 2P3JA 1LB2A 3N35A 1F15A 2ZE6A 3J4UH 1FJGO 1BVP1 2YXSA 1MS8A 4QPGB 3CXHF 3KVBA 4MGKE 4FTSA 1HR0B 4FPOB 1TNRA 5K4LA 3HMYA 4BAYA 3G71V 2OVUA 2YPJA 2PA7A 3RWNA 3ILNA 4LNVA 4KWUA 3WUCA 5K9YA 3R65A 1MPXA 1DGWA 1OFSA 3JAKB 4LP8A 2ARHA 1R091 2OW4A 2PAKA 4IV3B 4HPKB 5IT9N 3DL3A 3PURA 3ZFFB 2PI5A 3SCFA 1KB9F 2WT1A 4I55A 5DZGA 2YBPA 1ZBE1 4RR3B 1BQZA 4A41A 1YQ8A 4IEZA 2JEUA 3ZHTA 2P67A 5JXHA 3ICXA 1JZ2A 1ROPA 4HETA 4EN8B 1UYXA 4JAAA 4Y20B 2VZ1A 4AF9A 1RUC1 1YRZA 2VCBA 3WDUA 1SQQH 2QGNA 2WAMA 1NQTA 4XUPA 2R9IA 1W59A 1POV3 5LW9A 5EBWC 1S55A 5DAPA 1ACCA 4XJZA 1K73W 3MW3A 1DIWA 1D4M3 1S5LZ 3D36C 5IVVA 2MHFA 1XHZA 4Q1RA 1VMHA 2VCCA 1H1AA 3MGUA 5KXDA 3IPVB 1RPRA 4UW6A 4PT6A 1QJU1 4DR2O 1HLCA 3AP9A 5LCWL 4CU9A 3LF7A 1HRI1 1Y43B 4YIOA 4X1YA 1VQMV 2E33A 4LFBB 5EBMC 5K0UB 5KC6A 4NWWA 4AFCA 3U78A 5LATA 1ENQA 5CFDC 5EJ1B 2Q4SA 1LEDA 3BTAA 5H9QA 3ABKC 4AHXA 1BBT1 2HWB3 2O8QA 4M3CE 4UW3A 1OMIA 1AYM3 4WZCA 1OOPB 4GWMA 1TVGA 5JCOC 3E6CC 2DF7A 2MEV3 2GTSA 2R042 4KU7A 2WNOA 3DPRB 4FPGA 1W8TA 4QXHA 3ZBHA 3SYQA 4JHZA 1GFF2 1HV1A 4XETA 5F5IA 4LJHA 3VBRC 3CQOA 4WM8C 1DF5A 1W99A 3C3VA 4XUNA 1QU0A 5JIAA 2NLJC 2RS12 1UFIA 1LUWA 1QKQA 2FZ1A 1JHNA 1UJWB 1AR63 5EP9A 1VRH3 2R30A 3CZJA 3GZUC 1KEXA 5C9AC 1XNTA 4XTPA 4XBNA 5L7OC 1F51A 4UYBA 2RR13 2C24A 1J95A 3IN9A 3AG4C 3M99B 4MXWA 4COYA 5JZGB 5EYPA 1NY71 3ZN6A 5H9RA 2O0OA 3I56V 4HVRA 3I55V 3JAWB 5I8TA 2PELA 2QTWB 3JXSA 1N1VA 3HOBA 1S0CA 2XQXA 2H3OA 3LDCA 2JG9C 4D6QA 3VLBB 4YVSB 1POV0 5DG1A 3ZYHA 4LF6O 3ZXAC 3WG7B 3FC0A 4OI2A 2W1UA 2YI9A 1B35C 3JD2A 4LBQA 1IOAA 3I4IA 4CC6A 2FCUA 4NIAA 5GZDA 2BVVA 3AG2B 3D36A 4NIGA 3HAGA 2C1FA 5IYYA 4ZI7A 3QO7A 2DCZA 4BHPA 1YIFA 2BUKA 2C5DA 2VVFA 5FMDA 4I02A 2F17A 5B2GB 4YIPA 2VZVA 4LBMA 3T08A 1C1LA 2RDCA 1VMFA 4QPIC 5GZCA 2QTSA 5CFDA 4M4RA 5LXTB 3AYEA 4D6RA 4AFBA 1C3HA 3KCXA 5KXBA 3NNGA 4YZ2A 3K06A 4TOIA 1SLIA 4AI1A 5IVEA 3AKSA 4O9EA 4XF3A 3ECQA 4RA0A 4J41A 1BS3A 4C91A 2L9LA 3VBRA 1IHMA 2A0LA 2HWF3 1VBA3 2R073 4WM8A 3HKBA 3GZTB 2O14A 4MW3A 3RYFA 1JU3A 3ZKYA 1M4UA 1REDA 1CX1A 2ZCEA 3HPNA 1RIRA 2R9RB 5BY1A 4M3CB 1PNLA 3CCRV 4J7ZA 1ULEA 5CA6A 5C9AA 1XYPA 4ZHQB 1N33B 1A3KA 2B39A 1PZ8A 2JD9A 5L7OA 2BCCH 1MEC2 4JDNA 1QMJA 5ERLA 5LHIA 1LESA 2GNBA 1UXXX 4QXCA 3W58A 3IMMA 3WQBA 4LMFA 4XAAA 4CEYC 4NHLA 4ZXEA 4JI2O 1M56B 5BNOB 4RGGA 1KFXL 1QQCA 1W6QA 4AEMA 1DZTA 2E9QA 3M8LA 1IQDC 3ENRA 1PGW2 1D4M1 4JPRA 2JG9A 4P9YA 3ZFGC 2JDMA 4LBEC 4LO6B 3TBDA 1O59A 5FZ0A 1QOOA 4LFBO 4OZOA 3KT1A 3T4VA 2B9UA 1VP6A 4NAMA 1WLEA 5KUMA 2MK3A 1OLRA 1ULPA 4QDQA 4CDQB 4AQ2A 5FZBA 1OCOB 3LSEA 4M01A 3JU9A 2Q8DA 3P32A 1PVC2 1V55B 4LF4O 5FBJA 2HWB1 4IGQA 3LSSA 1LUVA 3RGBA 1AYM1 4EQVA 5ACA3 3O5SA 2VOWA 3ETGA 1TGOA 3STLC 4IQPA 4QPIA 2HHHB 2D6PA 2X5IB 4FIPC 1RPOA 3UNPA 3BTZA 2NR5A 4BCUA 1FFXA 3JATA 2XJSA 1LHWA 4TWTA 2E3CA 5J36A 1SEFA 2N74A 3ACGA 2RNBA 4JKKA 1AI7A 3K3OA 4MGSA 4MTGA 4ZU4A 5C8WA 2DFCA 4LF7B 1AR61 1MZ5A 4Q5OA 3I2KA 1VARA 1OF3A 1MQTB 4DRXB 4IT5A 4FM1A 2BTQA 2RR11 3UT5B 4AW7A 5HCBA 1SLLA 4AEDB 4WV8A 3VKLA 2FL4A 4LH7A 3VL9A 2EBOA 1J3QA 3DC6A 2Q7GA 1IS4A 3RZZA 4HNAA 3LSDA 4BMEA 2EIBA 4GKKB 3UKMA 4AI8A 1GWLA 3DYPA 3BUCA 4AXOA 5GALA 3VZJA 1PX3A 4LITA 1M57C 1CZTA 3KMHA 3ZYPA 4CEYA 5DDJ3 1ENSA 4XFCA 2Q73A 5I0TA 2VNGA 1NTMH 4AG4A 3HQXA 5FQ0B 3NNMA 5DXDA 5D2AA 4OGQB 2Q5ZA 2O57A 1Z2GA 4NTXA 3I7DA 2GALA 3ZFGA 1NVPD 1M4WA 2AGAA 2BZDA 3JQWA 4DV5B 3ZIAG 4NRQA 5H5NA 3BCWA 4OMDA 3JBG2 2ZXWC 4DOUA 1G9BA 2AEYA 2PHLA 5C8CB 3SH4A 5A3TA 5FNVB 1PNGA 4LO8A 4URAA 4JRLA 1K45A 3ABMB 1SETA 1FXHA 3JD1A 4YARA 3T2OA 4TSFG 5B1BC 2IC1A 3WV6A 4L2NA 4ARXA 1AR73 4QE7A 5AVAA 4HN0A 4YJ2A 3V0BB 1SBDA 5J2UB 2YB7A 3CPWU 2ARXA 3WDTA 1XNDA 5ISLA 3BIEA 1W2OA 1XYNA 1FNYA 2OQ6A 3Q8AA 2KG7B 1KD1W 2R071 4XF9A 2PGGA 4IE5A 4PQ9A 4QIWF 1N33O 1EAH3 4BLJA 3DKQA 2XOMA 1RUD3 4FO9A 1W90A 1CD3G 1Q8IA 3VKMA 5KX5B 3J7HA 5B5EZ 4AFDA 2JG8C 3ZYRA 2RVAA 2CK3G 1BK1A 1R082 3MF9A 4JGYC 4CDUC 3OR7C 1P49A 2F6BA 3K75B 1AR92 2Y0IA 4NHMA 3WNXA 2DCYA 4BQ2A 2JE8A 3N9PA 4IEQA 4B7KA 2VMCA 3K57A 3ZS8C 2ZE8A 3KF3A 1JOPA 3VBOC 3AZYA 1YQ6A 1CWPA 3V0AB 2JEXA 2RS33 3PU3A 3WVJA 5CA3A 4X66B 3WDWA 2XAHA 1STMA 3FX7A 3T1YO 3TB0A 3I54A 5KHHA 3OGGA 3S5AA 3K48A 5JVDA 1YQ2A 1AI5A 1COWG 2EAKA 1DLCA 2X53S 4LLOA 2LUWA 3W7TA 3UT0A 4X1IB 1SA0A 5FY9A 3VDCA 3B4SA 5DAVA 5CKNA 2KSDA 1SLTA 1OSGA 2YIBD 5IYZA 3MUY1 2JB8A 2EICA 2JRIA 4PLMA 1NX9A 5J7MA 1W3XA 3WR0A 1MNGA 5ACA1 3ZFEC 1WD4A 1RVF3 2D3SA 1OLQA 3I2GA 1NLQA 3OD0A 2J1UA 2GC1A 1ZVFA 1ZUQA 4HONA 4I0BA 3WG1A 3OUHA 2Y8KA 4HKOA 4ES8A 4OYUA 4DXRA 1RTVA 3RVZA 3RYPA 2VZSA 5L3CA 3VZNA 4XF0A 4NTWA 3ZHQA 3N2GA 1L7QA 3CCLV 1OFNA 2BRTA 4Y33A 2QFEA 2RS51 5HBAA 1NH2B 5FP8A 2DQ3A 5IVFA 2YUEA 2BTVC 1PHMA 2VNOA 2YIBA 3SYCA 1RUE1 4GKKO 2WZ8A 1JYVA 1W9YA 3T09A 1Y9GA 4U7NA 4B7EA 3P30A 2JG8A 1VRBA 3LNNA 4CDUA 4FZ1A 1BXHA 2RHPA 4JGYA 4AVSA 4PLOA 2VMGA 4I7ZB 1Y9QA 5L73A 5FREA 1ZNPA 5FWJA 3JD73 3O1VA 1S5HC 1RUI3 4FOWA 1W6NA 2VULA 3VBOA 2QM4A 2NM1A 2DUPA 2IU3A 4DV5O 3DGTA 3HKCB 4N90A 1IS3A 4WM7B 1W9SA 4R9AA 3I5DA 2AHYA 4I01A 5F37A 4TV8A 4J9ZB 2WZR3 2XWBB 1CZSA 1WMFA 2D43A 2FZ2A 3TN93 1PMHX 3B02A 2KM2A 2HJFC 3Q4HA 2XJPA 1QJY3 5LBEA 1V9PA 1RUG3 3ME2A 1XUQA 1JMUB 3PL0A 1PGL1 1WW5A 3WF4A 1X9PA 3SKJE 3QO5A 5A7QA 1KGYA 3DV8A 4J25A 3ZFEA 1WAZA 1UOBA 3ZKUA 5KHIA 3RBZA 2DYCA 4G4FA 4HZFA 5SV5A 1AI6A 1S0JA 1GWMA 4NOTA 3E6DA 1OCCB 1W2NA 2JDPA 4A7ZA 2ZMLA 4BK4A 1VBD3 2HFEC 5JLVA 1QHTA 3FAVB 5KA5A 5IJ9A 1TA8A 1W6OA 2WFF1 3ZSEA 3MDSA 4PLNA 1IBMO 5FY5A 1RUD1 4DO2A 5LASA 3RYCB 2QKAA 2Z0AA 1ZRDA 1LU1A 2DCTA 2NMNA 2YXHA 4LHLA 3U1XA 2NLRA 4ZONA 4KQ7A 3AEIA 4EEQA 5E88A 5LYJA 3WSOA 3FMGA 4LA3A 4BIFA 3WW4A 5IYCO 1N36B 2Z5UA 2PYTA 4CTEA 4OUEA 3RYKA 4CU7A 2AZ0A 4CCOA 1UY3A 2RS31 4JC1A 1LOBA 1OA4A 4C8DA 5F39A 5AC91 3CCEV 4AWDA 5KMGB 4JDMA 3P5BA 4XBFA 3KCYA 4XBLA 1R6KA 2WLLA 2Y48A 3VBFB 2VL4A 4OX9O 2D6LX 1URXA 3J80N 5KC5A 3L75H 4BPZA 4WFEA 5JOZA 1W2AX 1XOYA 4GH4B 1HNWB 4NB5A 1E1QG 3VL8A 3SLIA 2ZKLA 3PHMA 2YI8A 2WWWA 2IJJA 1U5XA 1RVF1 4K8ZA 1H2KA 3LQCA 3UGHA 1JA8A 2EZOA 2A3YA 4UT5A 1K9MW 1W8HA 5B1AB 3HKEA 1C8NA 2P5BA 1ZAUA 1LAJA 4F6RB 1Y6XA 3ZXGA 3C7HA 2R72A 2ZX1A 3RG0A 3ES4A 4D0QA 2W1WA 3IAQA 5C3RA 2EX3A 2FYUH 2AYHA 4N9HA 2WIIB 3WG2A 1YXWA 5LA0A 2UXDB 1YQ5A 3B40A 4FLZA 3WQ7A 5F6KA 4XQWA 1HNXO 4KG8A 3ASOC 4HSLA 5C3QA 4FFHA 4ZOLA 5J2TA 4XHXA 3CJIB 4IYHA 2ZEWA 4COZA 1WLTA 2EILB 1RSOA 3FWEA 1YLLA 2HEPA 2RDQA 3JD71 2XLGA 1RUI1 1D4VB 3QNEA 1BL8A 4GAZA 1N0JA 5AFEA 4K21A 2UUBB 2WT0A 2R043 1Y7BA 5FJKA 2O8OA 5F3IA 3IDAA 4YZ3A 1QH7A 3OJBA 4I0AA 2DTYA 1AYN2 4EKWA 2VJXA 3NRUA 1H1IA 2IFWA 2Z4FA 3N7MA 2XWJB 4GB32 2WZR1 3V64A 3ABLB 1DQ2A 3RYHA 4O2BB 1TUEB 3J8F3 1TUBA 1O4YA 1TZOA 5FZ9A 4FLYA 3PUSA 3QTCA 4QPKA 1XNCA 2YGMA 4PBPA 4KGQA 5J3UA 3CB2A 4KXRA 3VN4A 1S0FA 1US6A 2QA4V 1OH3A 2M6YA 4LORA 3ZRWB 4NXNB 4CZSA 4IEXA 2CDYA 3WG4A 2R32A 3AL6A 2VRZA 3IC7A 2VMFA 4I9QA 3IBMA 5L3EA 4Y4RA 2Z3YA 1YVWA 3LDKA 4X64O 1XQ8A 2I45A 1GM9A 2BEOA 1MVQA 3J81N 1X82A 1VE0A 1VBD1 2RCVA 2EIGA 4CEWB 3FJSA 3VQXA 4RHV2 1NS1A 4LNUB 5LGUA 3D3AA 4JI1B 1PK6C 4CS3A 4PA9A 2VUDA 1OD5A 2B9VA 5EIBD 2Y33A 1BEV1 2DU0A 1VQOV 1YWKA 5T5JA 3VD5A 3HQRA 2C9KA 3RS6A 1M9NA 3RMXA 4DV4B 3SJAC 3ACFA 2JDYA 3H01A 4XJUA 3HNYM 2K9ZA 1UQXA 4J1XA 2PLV1 3H1JH 2PI4A 5DUUA 3DF0A 5C3PA 3H1IH 2YFZA 3F7VC 2AHZA 2AZ2A 1Q82W 4JTCB 2WLQA 2ZINA 3NMBA 3C3SA 5GLUA 5A3LA 2BYVE 2DUOA 2D6NA 4DB5A 2Q0OC 3SPJA 1K4CC 3AYAA 4X20B 3ZN4A 1HX6A 3OBRA 2NMOA 2ZABA 2LM3A 3SC7X 2CDPA 2LGQA 1HNWO 2KR2A 3MFAA 3O12A 1D5NA 1Q6UA 3SEPA 4CU6A 4W4LA 4XHBA 4DV6O 4K1ZA 3D0SA 1FPN2 2QQUA 4GJZA 4GMP1 4NPLA 3PN1A 2LW8A 4JV5B 3E22B 2BNOA 4IESA 3QG5A 4NHXA 4LO4B 5FOJB 3ZFFC 4NHYA 2GNMA 2QKDA 1EV11 5GONB 2OUHA 5FIXA 1KS5A 1RHI2 1JYTA 3FB7C 3SITA 2VZOA 2XHBA 1W6PB 1KJRA 1A6CA 5C5TA 3FBMA 4IETA 1CX4A 4IERA 2UXDO 4NO4A 4N9IA 2VNRA 3N3HA 5H9SA 1GICA 3JD4A 2OPKA 4TQFA 1K5SA 3G4SV 3BGAA 4RUFA 2ZOEB 5JCTA 2XH6A 5FLHA 1NU1H 1GRJA 3ZYJB 3M3OA 4DV0O 4H0LB 2ZGPA 2Z79A 4CCMA 3C7OA 4RFRB 4HYOA 4LIUA 1PK6A 5JJJB 5FP4A 2GC3A 4IV1B 1UY0A 5FZDA 4RUEA 3TYJA 1OPOA 4OPHA 4X6RB 5FYMA 2BGPA 3M3IA 3N9MA 2UUBO 4UAPA 3SJCC 2J7MA 4V1PA 1PVC3 1QDOA 4D3WA 1KP3A 2YC4A 3OCPA 3MYXA 3B8NA 2UU8A 1SBEA 2E75B 3H1LH 3LAGA 1W8NA 2AH2A 4UFHA 2GC2A 3O65A 2F4LA 2RMKB 2YIDA 2VY0A 2GN3A 4META 1CEZA 4DEQA 4IUGA 2JS5A 2BSKB 3SDLA 1RUJ3 4IEVA 4JYYA 1RM1C 1HNZO 4KUMA 2IVIB 2OCCB 2EXHA 1KC8W 1X33A 1O3RA 3VD7A 2ZHKA 4MVUA 3OB8A 2RS11 3WP3A 3UCSC 1CXZB 3SXWA 4ZXKA 5FO8B 1X50A 2OCHA 4X1KB 4KHPO 3FX3A 3F7YC 4N23A 2JXAA 1SQBH 1YJ9V 1XSRA 3ZFFA 3JZVA 3QVNA 2TUNA 4FCAA 5FLXN 1NT2B 1U5YA 2WABA 4JI8B 2ZNIA 2IXJA 2HLEA 1OF4A 2XNDG 3B93A 2VW1A 4V2VA 2IXHA 4YGBA 1YTFB 2P37A 3POBA 4NUBA 4CCNA 4U36A 2EINC 2GUZB 4EB6A 5ABJB 2BE3A 4Z2AA 3FHQA 3ZXLA 4RQFA 1M1KW 1QU7A 4UVAA 4FFFA 2QR4A 1LGBA 2RDNA 4O4LB 1XU1A 1SC5B 3AG2C 1XE7A 5FUNA 1J58A 5GW7A 3JBG3 5CN0A 2H6BA 5KR7A 3RSJA 4OHXA 4BQWA 1RUH2 1WUVA 3NJXA 1MS9A 4U3FH 3GBWA 3FLTA 2ZX0A 5IUQA 5FL7G 4K3UA 1CAWB 2VMEA 2MPFA 1OVPA 4MSVA 4QXBA 2FMYA 1HRV1 3BN6A 4ATEA 3DXUA 4AL9A 4CH5A 4W4ZA 4DUZB 2DN9A 1LOAA 5FY7A 2DCKA 4XFHA 2LTNA 2QTOA 2CWSA 1M93A 4DUYO 1HN1A 1W03A 5FZ1A 4BLIA 2P22C 1GKBA 3DKWA 1GN2A 4JV5O 3F95A 1OKQA 2OUJA 4XZPA 4LIVA 3RPQA 3NAPC 4YG0A 2RMU1 4AAPA 2ATKC 5LMNB 2B1GA 4JQRA 4FFBB 2BQPA 4KMQA 3T0BA 2QWPB 1GOHA 4UF0B 4FJCC 3MEPA 5LOVA 1R083 1H8TC 1MEC1 1SFYA 1O4ZA 2F43G 2W9XA 2HWD2 3BU0A 1US3A 4COVA 2ZE5A 2W1SA 5I8YA 4NE9A 3V65A 1KP2A 2XTAA 4MW8A 1IS5A 4QX8A 4B4PA 4XFGA 2IVJA 1BQPA 4LR4A 3GVMA 3ZIXA 1PP9H 1PGW1 3J26N 1NA1B 2ERFA 4Y1UA 3UJQA 2ZEXA 2D6KA 4LWSA 5FZ7A 2PQSA 1GN6A 4IE7A 4YZ5A 5FYCA 1OXCA 2CY6A 1UMHA 1IXMA 1FYUA 1WW4A 2Q1MA 1XNAA 3BI3A 4AGGA 2P6CA 3KZIZ 4AHZA 1ZZ6A 5FZ8A 4FQ4A 3LEKA 4C0HA 3GXUA 5BNPB 4CVUA 4ASUG 4FAGA 2WO2A 2P3YA 2SBAA 3OUJA 5LXTA 2A3XA 4PIXA 1XE8A 1PD3A 5LA6B 4YVWB 2AENA 5FZ4A 5D8AB 3OEHG 5J96B 4HVQA 3VDAA 1JFFB 2CTQA 4GZ9A 4JGZC 1RUOA 5GJ6A 1VR3A 3SYPA 3PTRB 3H8OA 4AVCA 3OGSA 1CJPA 2YICA 2OT7A 1JN2P 4P5HA 1ZRCA 1SERA 1PIV2 1JJOA 1DQ1A 5DPNA 2Z69A 1YYNA 4UOJA 3ZMTA 4Y22B 4K9SA 3NAPA 4MGQA 4JI8O 1CAVB 1JS9A 2AR6A 2QSAA 4CXWA 3WCSA 1BE3H 2CAVA 2PHWA 4P00B 1AP5A 2QE3A 1G9AA 1H8HG 4WVWA 5FZOA 4I0XA 4UFIA 4XUTA 1H8TA 5IK4A 2YGLA 5A1LA 1X4TA 2UY9A 4AI9A 3SJQC 1K7DA 1KQSU 1QNYA 3VBHC 1YSCA 4P5YA 5IATA 3CCMV 2DYSC 4FI9A 1UOJA 1V54C 1ASJ1 2C26A 2VMDA 3SH5A 2Y34A 1HXS2 1RMU3 2FKXA 1CVNA 3ZXDA 4YW3A 2P4VA 1C5HA 1LOGA 3U4SA 1JYIA 3E8GA 3MD0A 4QX5A 4LBOA 5F7UA 3JBG1 3N2KB 2UYBA 3PJQA 4BM8A 3L73H 2D98A 2PXJA 1CAUA 3VBBA 5C8CC 5FPOA 2Y6JA 4JASA 5ANQA 3B9IA 4QPWA 1XRUA 1QOTA 1WA8A 1JUHA 4CDWC 3RZMA 2YC0A 2X6AA 3LA7A 4DUZO 1Y76B 5IE9A 4EWDA 3BU7A 1F8VA 3ZLIA 1MS3A 4CH6A 3P3NA 3S7EA 2AXTZ 4OI4A 3W5MA 5L36A 3ZSJA 2VVDA 2VO5A 4QX1A 1AB3A 1H4GA 2DVBA 1K34A 1AROP 1NCRC 5B66Z 2EF6A 4LUMA 4CSWA 5LMNO 4P14A 3FLPA 4B1LA 4JGZA 3ACHA 1SZBA 3H8RA 2XAQA 4QGPA 2XOKG 3ACLA 1VAKA 4ET7A 3VQYA 4H7MA 4UB6Z 3DUIA 4GZRB 1VIWB 5A6YA 1WP8A 4AFAA 3WB0A 4YWAA 4YPJA 1LHNA 3ASNB 1A34A 3HT1A 1AR91 4LBNA 3BPSA 4WFHA 3EHKA 3BALA 2R9AA 1XXNA 2G9FA 4IHJB 3USUA 5DECA 5ANNA 5A3OA 3HEIA 2EA7A 3ORJA 5F2VO 2W94A 3VBHA 5T54A 4Y5Z0 1EP0A 1REEA 2JKXA 2GDFA 4EV0A 1W2BU 3ZDVA 1JUIA 1LR5A 3W7WA 3PDQA 4CA9A 2BOIA 3TNQA 1GR3A 3J7LA 2CSGA 2WL1A 5CFCB 4OFGA 5A2QN 2FDHA 1QR8A 3FZ3A 1MSDA 1ZZ9A 4DY5A 1HDKA 3V56A 4DO0A 1AUYA 1UMZA 1PO11 5A32B 2FCVA 4RQEA 5LK7B 1PMJX 1GLHA 3ZYFA 5E79Z 3KKYA 5C8CA 4B3MO 2FDJA 2RV9A 4RN5A 4MGYE 3DXRA 4JKMA 4CDXC 4QQHA 5CA0A 3HR9A 1LEMA 3EBRA 4CDWA 1X7NA 4BWOA 4NJ4A 3ZXJA 3MIHA 3DN7A 5LEJA 4R7CA 4G28B 2XKPA 1MR5A 2DV9A 4MADA 1ND3B 2IJKA 3MAQA 5CKMA 4Q4X3 4RS5B 3K9SA 4RQPB 5JPNB 4GIQA 1W28A 2R062 5BY5A 1YZBA 5JAXA 3ZRXA 1NCRA 4J42A 3MHHC 1NJIW 4PI2A 2K46A 3GYDA 2KG7A 3F5TA 2WWJA 2BBAA 1KJLA 4UFKA 5IYDO 3ZMSA 4HK9A 2Y6FA 1VBA2 2NNUA 1EYBA 5GTHZ 2IXCA 4KU8A 3M8AA 3E1F1 1Z0HA 2ZM6B 4PCRA 2V1DA 3K58A 2OKXA 3AG7A 4KBZA 2DU1A 3ZO0B 4GALA 2ILMA 4CH4A 3TJTA 4LKDA 1PNMA 2P17A 3GJBA 4TUYA 4GWNA 4E2SA 1RP3B 2Y69B 3JARA 3SQOA 4DW1A 4NMIA 4J11A 4UFJA 1QDCA 2WLHA 5FLIA 1AI4A 1AYN3 4AK3A 3LSQA 2W91A 3N9NA 4C0BA 4LR3A 4DR4B 4GB33 4E2QA 1ULGA 4WFGA 4FPEA 1JQ0A 3OPWA 3I2HA 2EIKB 4X1IA 1T6GC 4X65B 1NH2D 4JI7O 4FQZA 1UCXA 1O3SA 1DGRA 2W68A 3AZZA 1AR5A 5KHGA 3ZVXA 4PDRA 2E7TA 4DUVA 1WBLA 1YJKA 4LKSA 3C7GA 3KB5A 4GKJB 2LQTA 3MF6A 4Z82A 1KQRA 5FWEA 2JK5C 3A8TA 3CBNA 2QE7G 2WS91 4CDXA 4UWDA 2G19A 5IJ0B 4RYDA 3HKDA 2BGCA 3POSA 2QQLA 1MS4A 1UNBA 4XW3A 1IGOA 1SMVA 4UCOA 2I2SA 4KBBA 1WCSA 4IW3A 4KG0A 1R73A 1SDWA 2PHTA 3W7SA 5C6CA 1VB4A 2VBBA 4TV9B 2RM21 2IH3C 2IJIA 5KBFA 4WBNA 2JIGA 1WBFA 3E2EA 2LFRA 1COV2 5FP9A 5IY5C 3SJBC 1H2NA 4LK7A 4H55A 2P06A 5I93A 4DV2B 2VZ3A 3WD5A 3CXCU 2CGPA 5A33A 1QXJA 1B09A 5FV3A 2J1SA 4IGOA 4P9XA 1IG0A 5FYSA 2XQRA 1Z7S2 1HQNA 3ABUA 1WN7A 2WQ8A 4NRPA 1FATA 3OW2U 3NV1A 1FOD2 1W6MB 4YW4A 3AMQA 2YIAA 1EY2A 1GN4A 1WCUA 2X10A 2G4IA 2NN8A 3UL2A 3ZHSA 2P7TC 3U4XA 2F1MA 3CRRA 2DMXA 4XCBA 5DDJ2 4GWIA 2OYQA 2ZE7A 2PYJA 2B45X 2YUAA 5C8YA 3HPLC 1MZFA 1J59A 2Z2SB 5LP6B 4YGDA 2WRAA 5IK7A 2CU5A 4FK5C 4GH4C 1ENVA 3AJZA 1FPN3 3AMNA 4UFMA 1SQPH 1JOYA 4XQDA 4R4XA 3LOBA 4E4EA 3JCIA 5J1XA 2XR4A 5JH7A 3QLQA 3PJYA 5BZBA 1SQ4A 1FPOA 1AR4A 4P9JA 2A75A 1PO22 2CYFA 3L9DA 2E7AA 5EFUA 2GBOA 4AGRA 3IAPA 3AB0A 1IBKB 1RHI3 3AMMA 1PZ9A 1OKOA 3W21A 1UZWA 4CXXA 1OPMA 2AACA 3GB7C 3H1YA 4BYYA 4PA7A 5APAA 3POIA 1HIXA 1XEQA 2K2SA 3OY8A 5EZWA 3RN4A 4B3RB 3JALB 1OQEA 5A70A 4TWKA 1CZVA 3S3WA 2ZM6O 1ZA7A 4WBBA 1FX5A 4QX2A 4FP2A 5A9GA 3O0VA 2QKCA 4NRMA 3S7IA 2CTWA 3I8TA 4L8JA 5LZ6A 4U3JB 1XC6A 1CAXB 3W59A 1ALYA 2ZGRA 3IT8A 4FM2A 2Q7HA 2OWOA 4K8XA 2GHYA 5F32A 5E6HA 1H30A 3IZOA 2PF4E 3CSXA 1R1A2 1ZSPA 2WAOA 3A0HZ 2P6HA 5L3FA 4GX0A 4H13B 2VBPA 4AHWA 2RJKA 4XDPA 4CPBD 4I55B 1TG7A 2BGOA 2P34A 1AYN1 3QD6A 5C71A 3KGLA 1GTOA 3Q8CA 1DYPA 1V6NA 3CRQA 2VC9A 4EZ4A 4XXPA 3L2HA 2AGSA 1N4CA 2WWSA 1D7PM 1RYYA 1R64A 3O1SA 4J1WA 4DUXA 5K7PA 2V5YA 1N0NA 3ZYGA 4E4SA 2WKKA 3MFCA 4GH4A 3VHRA 1LGCA 3AKQA 5FUPA 3IIAA 2D2CB 3SYOA 1PVXA 1K5QA 1SQXH 1HDJA 1QNMA 4KWLA 1V6LA 5LY2A 1TNFA 5CISA 4N7IA 4BDVB 5JSPA 5E1AC 1QWRA 1UAIA 3GBFA 5F8PA 5AFBA 1VBB1 3OOXA 4J6GA 1X8MA 3SGIA 4YZ4A 3AK2A 2NQYA 2DJVA 4E8CA 4JI6O 3AZWA 1OVSA 4RHV1 4DIQA 3G6EV 4DV2O 1N47A 2PHXA 1JI6A 1GQHA 2R16A 1LKNA 2QQMA 2ZR3A 1ZWIC 3MDPA 4RFT0 3ZSLA 2HP8A 2ZBJA 2Y6KA 2A6ZA 5KWRA 4MVTA 4Q27A 3OFNG 5CB4A 3VD9A 1XNRB 4PA4A 3WW3A 1LENA 3WY6A 3WOGA 1RUH3 1P7BA 1L7LA 4DR6B 2XHNA 4UVBA 1GM8A 1SS3A 4Q0VA 1HW7A 2GNDA 1HQLA 1YJLA 1BGYH 1O4TA 2K1EA 3CC2V 5F5QA 1I5XA 3MIEA 1NG0A 2X09A 5EYPB 3SPGA 3QACA 4H7LA 3ZN6B 4BXSV 2WLJA 3FL7A 1XMQO 2BWCA 4ISRA 5FYBA 4KL1A 2OIGA 3CC4V 1WLWA 4P02B 2ADPA 1MA1A 2WNVC 4Z2WA 3H1WA 3K9AA 1RUC2 1HB2A 5ITZB 2IJHA 2ZR2A 1RFYA 3TN92 4EWAA 4Y1YA 4ZY9A 4LBQB 1NYWA 5HCHA 1H1MA 1QJY2 1AL0G 1K12A 2A79B 1L0LH 1IBLB 1U12A 2HWD3 1M5IA 1V6KA 1GZ9A 4ZI7B 2LRPA 3C3TA 3ZIWA 4YJ3A 1QJU2 2JJ2G 1UZZA 4D7YA 1XPWA 3MHZA 1ZYBA 1V0AA 1RL3A 2YYOA 2A6WA 4BH9A 5DUXA 3WF3A 3VZOA 5CFDB 2JX9A 1URFA 4MXVA 3OAAG 1W9TA 3CWBH 3ABKB 4BQ4A 5FKCA 4XPVA 5C4WC 1RUNA 1B06A 2F93B 3DCQA 5LGNA 2GTAA 3K3WA 4PHZA 4LF5O 4JRAA 4BW5A 1H4HA 3VBRB 4LH6A 1YCIA 4PELA 2G9GA 3ELNA 4A45A 3HD8B 1VEWA 1H38A 2JDKA 4WM8B 3HKBB 3RYFB 3OE7G 4TN7A 3RVHA 2A5ZA 4TSVA 4FFGA 3ILRA 4BB3A 2HYXA 2LALA 1H9WA 1AR82 2UYAA 1KBHA 3KS7A 3WDVA 3WINE 5C9AB 4XMIA 1WW7A 3CCUV 3C7EA 1AXZA 2GC0A 5L7OB 3WNMA 4X20A 1JBCA 4MV2A 3AG4B 1XBFA 4GKYA 3MV11 4YM3A 2XJQA 2UUCB 1CONA 2FDFA 3MHSC 3A23A 5A7WA 1W6QB 2RDSA 1JZ3A 3CJHA 3CX5F 4JZRA 2WNVA 3QF7A 1PIV3 1VBE3 1V70A 2QDRA 1K8AW 1WJZA 2JG9B 4LHKA 4DQAA 4R9BA 5GTIZ 1O5LA 5IW0A 2O1QA 1OUSA 3J7AU 4JCKA 2E51A 3AK3A 2ITCC 2QDNA 3ABZA 1POQA 1B35B 1IPJA 2B9ZA 4FPFA 4LA2A 3OEEG 4DMIA 4K1YA 4CU8A 2QZ2A 5L3GA 2VG9A 2B42B 1QJEA 1AL22 3JCUZ 4JI4B 1YI9A 2ORXA 3L71H 5C33A 2Q7EA 4FPCA 4QJFB 4CYDA 4Y4YA 3ZOIA 3B3QE 1QBZA 4B3TO 5ABJC 2V72A 3UV9A 4B8EA 1HXS3 1V6IA 4QPIB 4O4IA 1SPPA 4XDJA 1ZREA 4S2HA 4Q4V2 1JMKC 5KHKA 3H0OA 2JJ6A 2CH7A 4DUWA 5LEKA 1S0VA 1GNZA 3M7MX 1FFXB 3JATB 4FMTA 5C4WA 1B3QA 5EIYB 4DV1B 3FKSG 5EJZB 2VGDA 2EIJC 3B77A 1PX4A 2VTFA 1X9TA 3M4FA 3B69A 1KUQA 4A2UA 2VZPA 2WNUC 1AP6A 4XEZA 5FPAA 3U10A 3OR6C 4RGAA 4ASKA 3JQXA 2H0BA 1D0HA 4A7KA 2UY8A 3ILFA 4XUOA 4JHTA 2A7AA 3PNAA 4AEKA 1QJX2 1YTFD 2UWAA 3CL1A 2N05A 4HNAB 4X8PA 3E8FA 2JDHA 1OBNA 5B1NA 4LK6A 4IL6Z 4LFAB 4C7UA 1XNQB 3H50A 4BW9A 1I94O 2WA4A 3T4HB 4NIHA 3AG3C 3TEYA 4Z1MG 5FR3A 3DSQA 2VMIA 2WBKA 4LF8O 2XL7A 3J8F2 3R6SA 2YS8A 5D21A 3ALQA 2GZWA 4LBLA 1XI1A 1APNA 2CE4A 4B4QA 2JGUA 1LJ7A 1WW6A 2FDGA 1UZ0A 2W3JA 4F3JA 2W95A 5KXCA 3TOJA 3E86A 3ZFGB 4BOWA 3PIGA 3MLKA 3QBQA 1UY4A 3VZKA 3SCHA 2WINB 2H94A 4IIJB 4WFBV 4CC5A 5F1RA 2UWBA 3OSDA 1U0AA 2XJTA 5E1RA 4FXKB 2UU9B 4GUNA 2VOXA 4JYAO 3MW2A 3U14A 1VQ5V 1ODMA 3A21A 5FPRA 1OHHG 2VCMA 5ABJA 2DVAA 5I0DA 2W2IA 1AJQA 1ND2C 3USSA 2E5LB 2ZDIC 4YJ2B 4Q6GA 3AZXA 2J1EA 5HI0A 3VKNA 4MVMA 2XL9A 2ARAA 4XQ4A 1NLRA 2C6SA 1VJ2A 3FB5C 4WVMB 2YEVA 1L1FA 3JD3A 3K0DA 3X2QC 4XDQA 2BFUS 3I2FA 1ZRRA 2ZACA 1FXVA 1OLMA 2WA3A 4ICGA 4XIKA 3AFGA 1VQ4V 1CQ9A 5FMBA 2WNUA 3NKGA 5FZAA 3N7JA 3T0DA 2WLIA 3WQ0A 2XJRA 2RN9A 3DTUB 2UUCO 1E1RG 1UO9A 4YVWC 1HR0O 4QQLA 2DQ0A 1AR1B 5C93A 1R1ZA 4BISA 2HKXA 3UYJA 4ZS3A 4JTDB 3GJAA 4FM0A 2R063 5EC2C 2QWNB 5A1FA 1OCZC 1MSWD 1Y4MA 4N21A 5BUVA 3VDDC 1IZ3A 1PIV1 2ARBA 5A7PA 4CCJA 1WPBA 2CDOA 2EJRA 3R66A 4D69A 5JMOA 1M57B 3LEGA 4YFWA 1F31A 3LD8A 4B3SB 3K4AA 1QH6A 5JVDB 5CG8A 2XG3A 1C57A 1UOFA 1GV9A 2PZSA 1WPXA 3OUSA 1KYOF 4P30A 3KV5A 4P9LA 1T2XA 3U07A 4EYUA 1SCSA 3VOUA 1SA0B 2DYRC 5LA9A 1Z5WA 3E35A 4AEJA 1Q8PA 5IYZB 2J22A 1G9DA 1SRYA 2ZXWB 1PV0A 2E76B 3ATGA 2W6IG 3K5MA 3ZN1A 3IB3A 2D97A 1DYKA 1C5IA 1HXS1 1S3JA 1BCXA 2P4KA 3DYMA 2YXYA 2W1QA 2E53A 5K8SA 1LOCA 1POV1 4O2AA 1MG1A 1CP9A 3THTA 1DQ6A 1VF6C 5B1BB 2B5HA 1QXPA 2D5FA 5CZKA 3KD4A 3AG1C 4A7YA 3IFXA 2JE7A 4CCLA 5IFPA 1ND2A 3HR0A 4TQDA 2ZDIA 1ZZCA 2HKOA 1LNSA 2VR4A 1D2DA 4D7SA 3M3QA 2BFUL 4XE9A 3G6BA 1H9PA 5DG2A 2KB1A 1F4MA 5E16A 3B94A 1CESA 2ET1A 2X8KA 4CCKA 1GQGA 1Q86W 2VQFB 1FV2A 2Q6AA 2BPA2 3ZEDA 4NXMB 4TYSA 1JXNA 2VOVA 2ZKOA 4NWVA 3PLQA 5EXOA 4AR2A 2JG8B 2MEV1 4CDUB 4JGYB 2YZ4A 5FZFA 5C3SA 5B3SB 1DGRN 1N3PA 3POFA 4YVWA 4JZ2A 1EPZA 1EBOA 5JSRA 5FPUA 1G9FA 1RUJ2 2P3KA 3BRCA 4FOQA 4QM9A 1L3JA 4HAMA 5FZCA 2LP7A 1C1FA 4IEOA 5AVPA 2IXIA 4FOYA 3D5OA 2XDVA 1ZM1A 4HZ3A 2VWJA 1W6NB 3VBOB 2R7EB 5JVVA 3VDDA 3ZMNA 2WSVA 1COV3 4S2FA 2ZGOA 1VRH1 3WF2A 1Q8VA 3OGVA 1Q8QA 4PA6A 1O9GA 3DC5A 3OYWA 1NUKA 3RZHA 3AVSA 3RI9A 4TV8B 4Q0SA 4D6TH 2H6CA 3I59A 1VMJA 1Z7S3 3KM5A 3IDCB 3Q4HB 5L9BA 3VDBA 2QQVA 1FOD3 3GDBA 3ZJZA 3FN9A 4IE4A 1HW5A 1GNYA 2BOJA 2PHFA 3ZFEB 1MOFA 2WDBA 1UL9A 4MO3M 2YROA 4MHRA 5L3BA 2ADEA 3AYDA 2XJVA 1ZZ8A 5CFCC 1UIKA 4I0WB 1V9U2 4DV3B 1LOEA 1VF6A 3E8HA 4O4JA 2CV6A 2JVDA 4NIIA 2Q8VA 3EB7A 3M7AA 1PNKA 4L87A 4A3XA 2BP6A 1OURA 5IJ9B 1NOVA 1W6OB 1QY4A 3HN1A 1F5JA 1PO23 2RS52 1JODA 3R05A 5CKQA 1I6XA 2XBO3 3U11A 3MIDA 3IWZA 2Q5TA 2V4VA 4K0KB 5LYJB 2WO7A 1OZ0A 2HJIA 3ML0A 3LSUA 2OX0A 4FP3A 4QNHB 4LBKA 3WXPA 3RDIA 2EVXA 2R061 3FB8C 4ZPIA 4EWEA 2OIEA 1SACA 4B3SO 1HV0A 2XHKA 4PF1A 4RO2A 5FY0A 1IPSA 3EXAA 1R3LC 3RZJA 2HWF1 1VBA1 2WLLB 2C0ZA 1IURA 4K6BA 1S0GA 3OBAA 3WG3A 4ZIBA 4CP9A 3WLUA 4DEVA 2DURA 5JQGA 1P7GA 4ZU7A 4BQYA 2WNEA 1JVMA 4PF5A 3WNLA 2LJ2A 4COWA 2FBEA 1N1SA 1Q8SA 4OI1A 5I0SA 3T1HB 1R1A3 1XSQA 4KWJA 5F2WA 1BK0A 4IHJA 1VQPV 3APQA 4FFKA 1SLCA 5A3UA 1TVKA 1Q90D 3GNEA 3HKEB 4A44A 2E7QA 2IWGB 1VPHA 2BBVA 5A1AA 1THZA 2A06H 5F5AA 3POWA 4H44B 2JENA 4JYBA 3LCPA 4LCUC 2GP3A 5CFCA 2UXBB 4D7TA 2EIMC 3SPCA 5IAVA 1GOGA 1YFUA 5FYVA 4DPNA 2VQFO 1WGPA 4ITCA 4XOGA 4JVAA 1YO8A 3FBYA 3SH3A 4H3WA 2WO3A 3WB2A 2WFF2 3B7MA 2M7WA 4JI5B 1AVBA 2HHHO 4Q1PA 3LB9A 4HANA 4ZOLB 5J2TB 1K3IA 2HH9A 4BIZA 4NKGB 4B29A 1BHGA 1RSOB 4YY3B 3EVKA 2D6OX 3J9SA 2CNAA 4YM2A 5CMUA 3K77A 2MNGA 4H2AA 4R9DA 1Q3EA 3NNLA 2OTJV 1H2SB 3O1OA 2HLDG 4LF7O 4MGZE 1J1TA 1YIPA 5H6QA 4FLVA 2D3OW 4I2OA 3JASA 1H8VA 4OZXA 3ZPOA 1COV1 3URFA 1AJKA 3D0JA 3SHRA 4AVAA 3HNMA 3T2QA 2D3PA 1K92A 3HB3B 1LTEA 3ROUA 4NIDA 2EIDA 1VLNA 3M3CA 2J1TA 1BJQA 4N43C 3BCCH 3QH6A 3RYHB 5BNNC 1TUBB 1FJGB 1Z7S1 4EN9B 5F3CA 4N53C 1FOD1 5JOYA 4QQOA 5FRAA 3VHOA 1ZLZA 1YJNV 1VQNV 3CMAV 1R093 5GLZA 5JR7B 4OUSA 4DV3O 5DDJ1 4E2LA 2ZTNA 4PDMA 5KXEA 1AZDA 3OPTA 4X9QA 1C8M2 4CCEA 5CADA 1EZVH 4PDWC 2JEMA 1RMU2 5T52A 1GN3A 1MS5A 5FK8A 2CHHA 2AEZA 1R1BA 4AQSA 2PFWA 4Y26A 3CF6E 2BDRA 1RUC3 5JSOA 2ZGLA 2UXNA 1FV3A 2NZ9A 4UCVA 1GZWA 4QX3A 5FP7A 4MOAA 4H33A 4I4TA 3KCCA 4FPLA 3IAYA 2QEXV 4OHWA 1HB4A 3CCQV 3L9JT 4AI3A 5T55A 2QVSB 3H7YA 1FXKC 3CIHA 1D2QA 3ASOB 1HWYA 1JZ4A 3LFMA 4IYIA 4HL0A 1QJU3 3TAYA 4DXSA 1WP7A 1AR71 1Q43A 4OI0A 1HRI3 1O3QA 5BXZA 3KQRA 4AHCA 1AILA 2V4DA 4BQ5A 1V6JA 3WNNA 2W46A 4DR2B 1SFNA 3FE5A 3ZN5A 1S2BA 1WZXA 3KSCA 4Q29A 5CA1A 1L8DA 4DXWA 3U75A 1NXMA 5LB6A 3FFZA 4X62B 3CD6V 1J5EB 3SKVA 1EAH1 3H9VA 3C7FA 2R70A 1YHFA 5GLVA 1JCHA 1GH6A 3WB1A 1W0JG 2VVEA 3PIJA 5F6LB 2DBNA 3T1HO 1UKRA 3D3IA 1JYNA 3S0MA 2I74A 1Q7YW 4N43A 5TSWA 5FZ3A 5BNNA 1R1A1 2ZEZA 1UX6A 3TXQA 2ZGTA 1AHSA 3BAAA 2VUCA 4N53A 4X66O 4B08A 3TNPB 1AR83 5FYYA 3AKPA 3RRDA 4FLXA 4PI0A 2YBSA 4Z92B 2A7WA 1QR9A 5FPVA 4OMCA 3JD0A 4QE9A 1NTKH 1BVVA 3ZYBA 1OCRC 2DWDC 4PDWA 1HP8A 2HVKC 4I30A 3LDEA 1TME2 1XJAA 4QHBA 1VAMA 3K4DA 1UPSA 2IW5A 4Q0QA 3RWRD 1XREA 2VTXA 1YFXA 2CUGA 3KQ4B 1QQP2 2ZX4A 2BWAA 3T4DA 1JH5A 1PK6B 1NCQB 4LF6B 5EC1C 3AX4A 3M2MA 1BEV2 2DUQA 3T3YA 1KKDA 1AL23 1TMF2 3LPGA 1FXKA 1DBNA 2OA2A 5FYUA 2Y4TA 4JQTA 1K5JA 1AXKA 4Q4X2 3N7LA 3ZXKA 4E4DX 1DTOA 1UIJA 4B1MA 2DFBA 2PMWB 1BSMA 4UCSA 4C90A 2QQOA 4PQQA 3T4ZA 1A78A 3X29B 2A3WA 4Q4V3 3D8CA 4L11A 4JF3A 4MVZA 3ON7A 3EO6A 5EWSA 2SLIA 1SG3A 2PQQA 2QZ3A 2RDRA 1F7YA 3HT2A 2WYSA 3GCXA 4M3CF 4U3JA 2VD7A 1ULOA 1W0NA 1CAXA 1SCRA 3NKTA 2A71A 5JXGA 3SPIA 4XJ8A 4XJAA 5EYXA 1HJGA 2D5HA 3ETDA 4YGEA 3LDRA 4ABMA 4RD7A 1Y74A 3K46A 3VBSC 3TGUH 1QLNA 1QJX3 4IEUA 5HCAA 2WO1A 5FO7B 2WQZC 4M00A 1E79G 2KXLA 2D3RA 3RYIA 1EV12 4GJYA 1O91A 3N7KA 4LXLA 2VQTA 1TAEA 2Q8CA 2FQPA 4GD4A 4FSJA 4R52A 1ZZ7A 4M0NA 2BJSA 1WMEA 4KNCA 1FYJA 4P9GA 4E8DA 3CKHA 5EIBC 4EB6B 2WZEA 5DUVA 1FI2A 4WFAV 3PU8A 5IYBO 2GU9A 2UWCA 5FP3A 4PA3A 3TN91 3KG2A 1SDDB 4LPLA 5CU1A 3THOA 2YFUA 4NAOA 1F2NA 1CJDA 5DAQA 1DGLA 3K3NA 1QJY1 4JI2B 4LBJA 4OVEA 1RUG1 2R1BA 1I1EA 1S1AA 3LGRA 3NWKA 1JX9A 3IM0A 4XF4A 1GK9A 3CRCA 5A7NA 4HXCA 1K97A 1QLEC 2DCJA 2YXLA 3VBUC 4O61A 3OM3B 4X62O 3RJRA 1J5EO 2HYKA 5H9PA 4AHYA 2ZGQA 4KGGA 4BMBA 3OGJA 2EULA 3C8XA 4MT8A 2ZEYA 1F5FA 1ZX3A 3TCUA 2MW2B 4AI2A 2QQJA 5FKBA 5I8SA 3MV01 1KXGA 4LF4B 4UW4A 2WN3A 1S2KA 3GBGA 3THDA 3MZHA 1RM1B 1NZCA 4TZDA 2DDUA 5JJEB 2DVDA 2ID4A 3LUTB 3I2IA 3O1UA 1N36O 2IM9A 4LBQD 4EE2A 5EBLC 1JW6A 4EZHA 4CBCA 1D0GA 4CP1A 2IH1C 1Y67A 1AR81 5FO9B 4HT1T 3WEZA 3ZYIB 4FVVA 5LOVB 4C1XA 3OBTA 3P6BA 5BMVA 5HV0A 1I7FA 4K8RB 3FHIB 2Z5WA 4B4RA 3VBSA 3FUQA 3MIFA 4QPGC 4L8QA 1JZ7A 1RB8G 2RJ2A 2JIJA 1K33A 4Q26A 1XNKA 5DMYA 4XC9A 3BKZA 2Y0OA 2HG5C 3E5XA 3NNFA 1AX0A 2ZPXA 2VZTA 1DG6A 3NJVA 4MTFA 1A8MA 2VZQA 3PTYA 3SNMA 3QCWA 4ZKIA 2EINB 4AAXA 5ITZA 3AP5A 4LWSB 2V09A 5FPBA 4AYUA 3H1KH 4IV3C 3C2UA 2VH9A 3CDZB 2A1XA 5K1PA 1Z78A 5EQUA 1UU6A 1AL21 2YMZA 4I50A 4DK0A 5I0UA 5DQ0A 1XOUA 4RR3C 3TXSA 1X36A 5A6XA 2Q1FA 4P9IA 3ZR6A 4J10A 1NQDA 3CNAA 5DN2A 1XQNA 1LHUA 4MTXA 5IFTA 1ZL8A 4GQ7A 5JWPA 3UGFA 3VBUA 4MVQA 1BCCH 3O0WA 3AJYA 3CE2A 2W87A 3WCRA 4Q4V1 3ZCCA 2X05A 2EALA 1W39A 2BNNA 3RYRA 1HRV2 1I5YA 1CPMA 4FTEA 3HN3A 2IXKA 2FD8A 3OUIA 5JCOA 1UYYA 4KFMA 4AQYB 3EFFK 4AI0A 3LWCA 1C28A 3HQUA 1YDXA 1AJPA 3H42B 4GT1A 4O65A 5TISZ 1WCKA 4MS2A 1WNSA 4XUQA 4ISQA 1XB9A 2XAFA 2ZGUA 4KH9A 1MVEA 5K0UC 3POYA 3N9OA 1W9FA 3ITQA 4QDSA 4YW2A 3NAPB 4Q4Y2 4IEYA 2PUSA 2XVKA 2RMU2 3AXDA 3U37A 4W50A 1QJX1 1SLAA 2JIZG 3FUOA 3K03A 4L0PA 1F9KA 1OOPC 1BKZA 5FZOB 4I0XB 4ZS2A 4XMAA 2R041 1H8TB 4I3GA 4BR6A 5CIRA 3GF6A 2G9ZA 3MUZ1 1LGNA 3DPRC 3K79A 2ADDA 2LGWA 4Y5SA 2C4XA 2QQWA 4MVSA 4QPGA 2ZMKA 3NV4A 3LA2A 4QD2A 5C7GA 2V7QG 3Q8FA 3H1HH 3J8F1 3CMEV 5HXMA 3N36A 2FMDA 3AK0A 3SISA 1S76D 4NXNO 5DN6G 1CIWA 1EUTA 3S3XA 3H9AA 1BMFG 3JAKA 3T1YB 4EROA 1B35A 4IV3A 2WWUA 4HPKA 1CAUB 5JZGC 3KV4A 1GZTA 5IVCA 2VZUA 4G3YC 3HNBM 1WA8B 4RR3A 1AJOA 2XUMA 4YW6A 1FS0G 5JOWA 4QKFA 2JDIG 3ZSMA 2BERA 3ZX7A 4QGLA 4JI1O 4MGTA 1UWWA 2E32A 4Y20A 2QQIA 4YVSC 1U97A 1LODA 1GP5A 2ZGKA 4ZBMA 1YXBA 2E74B 5FPLA 2GMPA 3WG7C 3DGEA 1V9U3 4DV4O 3SEEA 4DR3B 1JHJA 3NV3A 2ZCWA 2FTKA 2A6VA 3CLPA 2B7YA 4XABA 2Z42A 1ENRA 4JGZB 3IPVA 3OGCC 1GP4A 5T50A 2C9AA 2ZHLA 3BVCA 5EPAA 1F4HA 2FHRA 4YM1A 4AQ6A 4MVRA 4O4HB 1MMMA 3A0NA 1J3PA 1BMV2 2B8MA 3WZ1A 2Q67A 2PHDA 4TTGA 4Y3OA 2RS53 5K0UA 1K5MB 1W8UA 4DS0A 3O1MA 2E31A 2VNVA 1DGSA 1RUE3 4FPYA 2B1IA 2A73B 3GGLA 1OOPA 3CCVV 5K1XA 3VD4A 4QKDA 2ZKNA 1KU9A 1XHXA 1TEIA 3USUB 3WP5A 1XL6A 3A22A 5LHHA 1UY1A 3MLLA 3DPRA 3MBWA 2ZHMA 3VBHB 3OTFA 1OQDA 2WT2A 3FLRA 4XACA 1QHDA 5C3OA 2DYSB 3B01A 1V54B 2B4KA 1ASJ2 2PTMA 4FOVA 2OIIA 2UXCB 1R3IC 1PM4A 4LOTA 1IXBA 3IMNA 4FAHA 4IIJA 1FAFA 2N04A 2D40A 2PHRA 1F35A 1RXGA 4AZZA 3OGRA 2WC2A 5JZGA 4NVPA 1UF2C 5HPOA 3THCA 3DXRB 3JAWA 5CA0B 2D6MA 1C4RA 3RZKA 1M56C 1XNBA 1B6QA 4CDWB 5BNOC 5LGTA 2EAAA 4XILA 4AFMA 4AQYO 1LULA 5HFMA 5BXXA 4Q2FA 2FMLA 3STZC 3CZUA 5D1IA 4YVSA 1GUIA 1UX7A 1G1XB 4BK5A 3CEIA 5EZYB 1VALA 2XJUA 4BU2A 3C90A 5LBFA 1ZBA2 3M3EA 5JDBA 1E5RA 3I3DA 4LO5B 1NCRB 3JSNA 1W06A 1WWYA 4WVMA 2KA3A 4CDQC 4LO7A 1OCOC 3RQ0A 3CRAA 2WPDG 5M0TA 5FPXA 5FZLA 4AVTA 3BODA 1PVC1 2WFF3 3CRMA 1V55C 2X0LA 4FZ0A 5T5PA 3ZPYA 4CZZA 1GO3F 5FZMA 2P90A 4AVBA 1IBMB 1JOBA 2FCTA 4QMAA 4CRQA 1D5AA 2Q30A 5B3SC 2X5IC 3JCZA 4YG6A 5H2FZ 1RUJ1 4R8CA 4AQTA 2DVFA 4HMZA 1RXFA 1UKGA 4MYEA 4NYKA 3NSTA 5D5QA 1UPIA 4PJ0Z 2F95B 4HSJA 3NO8A 2LROA 2BNMA 1UMIA 2HEWF 4TUYB 3D4KA 3GWKC 1JZ6A 1UN1A 3ASIA 2UXXA 3JARB 5AC93 4EFBA 4YZ1A 2B5UA 2AUYA 1MQTC 1VBE2 3KV6A 2ZAHA 3VD3A 4GKXA 3BABA 1U96A 2YPDA 4MHUA 4ZKTB 3O9OA 4AEDC 4BA6A 2ZA9A 4M3CA 3UETA 3SYAA 3LZZA 2F66C 4OX9B 5IAXA 4JI3B 4ZHQA 3EMRA 3VZMA 1PO12 4GX2A 4X6QB 5EHDA 5JMCA 4CH3A 1IQAA 3IDBB 1OV9A 1ZA4A 4DR3O 3OEAA 1VAVA 4CDXB 4ZU5A 3GWOA 3P3PA 3CU7A 5BNOA 1C8M3 1Q6HA 3HKDB 1V9U1 4QM8A 4ATFA 1SFPA 4X89A 3RT3C 4JTAB 1ZRFA 3AP7A 3GM8A 4DR1B 2JJ1G 2W0XA 1HKDA 2OS2A 5DABA 4OLLA 2JDAA 4JGSA 3MI8A 4JAVA 1F4AA 2E26A 3O7OA 3NW4A 1QJZA 1UU4A 1N32B 2VOTA 1O7FA 4WBNB 3K51A 3LIGA 1AX1A 2XXZA 4QDRA 3E8BA 3PUAA 3FFQA 3WNPA 1QNWA 4CDQA 2WLNA 3ABMC 4ARYA 5JIUA 3LIHA 1US2A 2R1DA 2JD4A 5A33B 2CWMA 2QM7A 3NVCA 4TT3G 3TK1A 2Q0AA 3CCSV 2IXLA 1EN5A 5FDBA 3POEA 3HBKA 2QNKA 2Y64A 2XAJA 1OC1A 5HCFA 1HNXB 1KDKA 3KHCA 2X5IA 3VHPA 5IWAB 2UXCO 3SMHA 3LEMA 2Y38A 1Y9MA 3AL5A 4Q4W2 5JI9A 1Q8OA 3ZRVA 4WZFA 4RSUA 4QKNA 4R8HA 5JR2A 3RZGA 1SQGA 1Q5OA 5C8YB 4RL7A 3OUFA 3MPBA 3KWVA 1S0DA 4UI9L 3EJKA 3UKTA 4HFSA 3RZLA 1MQTA 1QCEA 5JXIA 4DRXA 3I3QA 1R081 5GKAC 3TRSB 1BZWA 3UT5A 1N34B 5I0RA 3AZVA 4AEDA 4JI0B 1FFTB 5F5CA 2WFPA 1CIYA 5JH7B 4WVVA 2HWE2 4UUJC 5FZGA 3L2YA 5KUKA 3OPZA 1ZZBA 1UY2A 3RJ2X 3NJZA 2DW4A 4GYCB 3LKJA 5LBCA 2WS92 1F4NA 2WUHA 2QUOA 5I91A 1J3RA 4R9CA 5FQ0A 1TME3 1KMIZ 2N7GA 2ORZA 2XKOA 3OY8B 2WR9A 3T2MA 2WSSG 1GNHA 3IJ4A 2G1MA 2YY1A 5LA1A 5D5PA 1JPXA 1RUF2 5GZEA 2XONA 2PAMA 3WNOA 3OMIB 3BOWA 3WDYA 4X64B 1VQKV 1QQP3 2RM22 4UCRA 4AE2A 3CS5A 2E63A 1PM9A 5LY1A 2Y6HA 3LEIA 2KQXA 2W08A 5FTTC 5FNVA 1H2LA 5IY5B 3N4MA 1O5UA 3SPHA 3ETEA 1BEV3 2VECA 5A3PA 4K3AA 4BWAA 1K4DC 4J7JA 1TMF3 1KD7A 5B1OA 5J48A 1RC6A 2XGXA 3E97A 5IT6A 2PLV3 2A70A 3I2DA 1X59A 1YI2V 3V0BA 2L6LA 4OQ9A 5J2UA 3T30A 1RJ8A 3JSLA 1YNAA 2Y4UA 4E27A 1Z5VA 4I5SA 3B2EE 5FY8A 1JZ5A 5LMUB 2CAZC 3Q9OA 5L9VA 1XE0A 4JI3O 4A4AA 1UPGA 5HFLA 3KHBA 3K5LA 1IPKA 3THPA 4UFLA 4U2AA 2ET7A 3INAA 2K9PA 3FD9A 2J1VA 5KX5A 4PJYA 3VHNA 3AVRA 3FYEB 3MPPG 1S0IA 3GHNA 4GMP3 4DV6B 3NL1A 1D2SA 4NHKA 2XAGA 5A80A 1W9WA 4RGKA 4FFIA 1PPJH 4DR1O 1C8M1 1IS6A 4QAWA 1W3VA 1EV13 1RMU1 4BJ0A 3V0AA 5DEDA 4UB8Z 1UU5A 3WUDA 4WM7C 1DZQA 3TEWA 3AMPA 1OA2A 1N32O 1FMD2 4LEJA 2JGDB 4XYXA 2VBDA 3LOIA 3RWKX 2ENRA 1ULDA 5CYYA 4C1WA 1WCDJ 5KA6A 1N1TA 3ZMZA 4LT5A 4AILC 4LE4A 2LFSA 3MIBA 1WKYA 3S6PA 5FFOC 5DUWA 4HOOA 1JYCA 4BXFA 4X8AA 1G9CA 5F3EA 1ENXA 2W92A 3N9LA 5CB4B 3B00A 2Y0PA 4DV0B 5IWAO 4W6WA 2ZT9B 5A3WA 1DU3D 3CC7V 3E89A 1OCCC 1DDLA 5KAIZ 3HVDA 2NPIA 2OPWA 3H8UA 2D7FA 3EYPA 1S0EA 1O3TA 4NPMA 1S2EA 2Y60A 2X6CA 2VM9A 1KDMA 4JZGA 2JDZA 3VKFC 4LKEA 2GN7A 1N34O 2CAUA 4XCAA 1R6TA 3BIWE 4JI0O 4YNIA 3ACIA 5J37A 5FBZA 3RMYA 2ES3A 3PUQA 1P84F 1RITA 3LFIA 1NE4A 4K35A 3WP6A 1HNZB 1VB2A 2RS13 2XMLA 3ZX6A 4GMP0 1GZCA 1XU2A 1YQCA 1PL4A 1JU4A 4GCZA 4IEPA 4XJWA 2JS3A 1KITA 4KHPB 1IX9A 3JYCA 3PUHA 1GQPA 3UQ8A 4YJ3B 4IL7A 2F23A 4FBFA 1ZTEA 1VBB2 3CYOA 4K40A 3VBFC 1AX2A 1TME1 4SLIA 3KV9A 4UFZA 3ZM8A 3HKCA 2P4EA 1UW8A 4WM7A 1MZ6A 2ZIMA 4WVZA 4P2ZA 1EM1A 1HQWA 4PV1B 5EV7A 2HVJC 1QQP1 3MICA 1P8JA 2OXBA 2ZIOA 4CXYA 1TE1B 1KS4A 5FK7A 4CP2A 3K0GA 3ZN0A 1DK1A 2Q69A 1A8DA 4LE3A 1NCQC 4QHZA 1GAXA 2CL2A 3RNSA 5B1AC 4L92A 4IE6A 4YW1A 1TMF1 3WX5A 3BEHA 4YW5A 1IKQA 4YSFA 2RJZA 1M06G 2XBO2 2Y6LA 4P08A 5CG9A 4LF9B 4Q4X1 1CPNA 4QU1A 1NT0A 1BHAA 2ARCA 3IDEA 2KD7A 3GZAA 4BQ1A 1YJWV 4KWKA 5LMUO 5IJRA 3BTXA 2JDNA 1ODNA 2VAUA 4YG3A 4YYOA 1XL4A 1R3JC 2V73A 5IWFA 5FOBB 2R6QA 1HRV3 1RGSA 3FAVA 2ZZQA 2GSMB 2PHUA 4LFCB 3RYCA 4FPJA 1FD9A 4CE8A 1VBC2 3B9CA 4I3PA 5FMCA 1R6NA 3CJIC 3FHAA 2HR3A 5A7WB 4WFFA 3N9QA 3CJHB 2WNVB 2EILC 1QXRA 3AK1A 2CGNA 4DUYB 2RJLA 1NZIA 2R0FA 3VB9A 3H3UA 3OMAB 4K7JA 3RW0A 1W2UA 4Q4Y3 5CAZA 2RMU3 1GBGA 4UV8A 2VOKA 3NNJA 3G7DA 1V00A 4QXKA 1L7RA 3GZEA 2XVLA 4MVOA 4RWUA 2YU2A 4A6SA 2JWPA 1MEC3 2GAUA 1QVFU 4MZUA 4DR4O 1I5PA 5LHGA 5KMGA 4BIOA 4QKBA 4Q0UA 1OLME 4X65O 3VBFA 4GB31 4LKFA 1YF2A 3ABLC 1WD3A 3WP4A 3BA8A 1NR7A 4XXAA 5DAWA 4GKJO 1YEWA 3H1MA 5GZGA 2PN5A 4QU2A 4O4IB 1SPPB 5CBHA 2CH7B 4UW5A 3BB6A 5C4WB 2X6BA 1NCQA 4GA9A 1I9RA 5LBBA 5T5OA 4CP0A 3W5NA 4UVCA 2FDIA 1JOJA 4F6RA 4DR5B 2D93A 3WDXA 4XFIA 1Q6IA 4X1YB 1ULFA 4S2GA 2XASA 3CCJV 2C2AA 5AG2A 1NE6A 4CPBA 1P4RA 2IBZH 4CEWC 2GP5A 4Y5TA 4WF9V 2QQNA 1SZTA 3WF0A 3MIGA 2YC2A 3AXEA 1Q56A 5G05L 2ZXQA 3J7NA 2VU9A 1DQ5A 1K3EA 4LUKA 4QT6A 2HWC2 3E5QA 5FXWA 3HWJA 2QQKA 2VCAA 2OQ7A 1DF4A 1OA3A 2UURA 2GDSA 1Y66A 3CJIA 4INDA 3QH7A 3R4SA 3OT7A 1YUDA 3EHBB 3QO8A 3MLJA 5JI7A 3K08A 4D8MA 4MG2A 4A6OA 2G38A 1HB1A 4PBOA 2VUAA 3GALA 4LLFA 2HEYF 1XILA 1R092 4KP4A 4OULA 2I07B 4YM0A 4JAUA 4MXWB 1SQVH 2JICA 3BHPA 3WHTA 3E6BA 4O9GA 3JB8A 3ES1A 3L70H 1ZBE2 1DLBA 3D82A 3D6EA 1LNQA 1KKCA 5F3GA 1FPN1 3GHMA 3G6JB 4O2BA 5KHJA 3SCGA 1ASJ3 4QPYA 4SBVA 4IE0A 1IBKO 2OTLV 5F9TA 4LF9O 2AZ5A 2OZ6A 3UK9A 5H6RA 4R6ZA 1RJ7A 2B46X 1RHI1 2YEVB 3ZRWA 2P3IA 4QB2A 3I49A 2XUEA 2GMEA 3PVEA 4IXLA 5CBFA 1V6OA 4GXLA 2EIJB 4CS4A 2CTVA 4B3RO 4MSWC 5C5UA 1H8EG 1W0OA 1HRI2 1PNFA 2WNUB 2WLIB 4H37A 4LFCO 3OMNB 4RAIA 4CEWA 4Y1ZA 3E83A 2PY5A 5KAFZ 1BBT2 4LNUA 3ZDSA 5J09A 3WW1A 4DW0A 1ZBA3 2XPJA 1UOGA 2P2KA 5CVRA 3M70A 4IV1C 2YHJA 2F4VB 3U0ZA 4LHSA 2BTOA 3A0KA 4Q4Y1 3AG3B 1MZEA 3UO3A 3NR7A 3LA3A 1LR1A 3B09A 2D44A 3PVOA 2FB5A 3ZSKA 3I2OA 3PMSA 3L74H 1R3KC 2W52A 4OHZA 1AVMA 1JYWA 4HLTA 4OXSA 2IUWA 1AR93 4K20A 4LQRA 2W0FC 1MABG 1PM7A 3VV1A 1FT9A 4IDZA 2OCCC 4DV7B 3R0RA 4DXZA 1YI7A 1DP0A 1N8RW 4NTYA 5DZEA 4FPPA 4EN6B 1NY72 3AC0A 5JOXA 4BZ4A 3KT7A 2QWQB 2GV9A 4CCCA 3K59A 4HN1A 1K42A 4YHHB 4E9KA 5FYIA 4O2AB 2E6VA 3HIFA 1XMOB 4IGPA 3F2ZA 5HV4A 4FPHA 1SESA 4OPAA 4PDLA 3E22A 3TEZA 1ND2B 4DR5O 2PAEA 3FYIB 3OF1A 5BNQA 4DFSA 2ZGNA 4OHYA 1E5HA 5BYNA 3SR2C 2W5FA 4W4KA 4XTMA 4TLGA 4PDVA 1G86A 4MX3A 4OUMA 5GONA 1WCQA 2X29A 3F5WC 4NR1A 4AOCA 1PO13 3I2JA 4L97A 1W2TA 3X2QB 1W6PA 1I5ZA 4FVMA 3W9AA 1VF5B 2Q1ZB <