5KHJA

Hcn2 cnbd in complex with uridine-3', 5'-cyclic monophosphate (cump)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
199
structure length
199
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Cyclic Purine and Pyrimidine Nucleotides Bind to the HCN2 Ion Channel and Variably Promote C-Terminal Domain Interactions and Opening.
pubmed doi rcsb
source organism Mus musculus
total genus 67
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5khjA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5khjA02
2OZJA 3IIAA 1LRHA 1SFNA 4XF1A 2Y0OA 4K8FA 4O9GA 1DZRA 4IEUA 1EPZA 3RYPA 3LA7A 3H50A 5JSRA 3U11A 4BYYA 5JR7B 2OZ6A 2XLFA 2XKOA 2IXLA 3DKWA 3GBFA 5EFUA 3RYKA 3EQEA 5LRSA 1X82A 2VPVA 4I2OA 4D7SA 2VQAA 3PNAA 4HVRA 2C0ZA 4N9HA 5BV6A 1CAXA 3PVBB 4RD7A 5I8YA 4EV0A 5BY5A 4IESA 2H6BA 3FE5A 3ST7A 3BALA 2ET1A 3EO6A 4UBHA 4L11A 3LZZA 3FFQA 4WBBA 2UYAA 4F7ZA 5BPXA 1IPJA 3D82A 1YHFA 5FQ0B 1VJ2A 3HQXA 4LA2A 3HT2A 4QMAA 3ELNA 4EWEA 1WA4A 5BXXA 4I01A 1LR5A 4HBNA 4XF9A 2PHDA 4AVBA 3SCGA 4N9IA 4Q0PA 1EY2A 1VP6A 4BHPA 5I0SA 2PAEA 1DZTA 2BEOA 5KHHA 3LOIA 4L2NA 2IXHA 1RUNA 3LA3A 1NE4A 1FI2A 1SQ4A 2QVSB 2CV6A 2BYVE 4F8AA 1EP0A 1ZX5A 3MPBA 4QXKA 3OD0A 1QWRA 3UKNA 3UKTA 3TNPB 1ZRCA 3E5QA 1J3QA 2GU9A 2D5FA 3RDIA 4MGIE 4Z07A 2PAMA 3B02A 4YRDA 1NXMA 4XFAA 4XFBA 4NVPA 1JUHA 4IEYA 5AVPA 5FQ0A 1J59A 1Y3TA 3RZZA 4BH9A 3FWEA 4WZCA 1J1LA 2PAKA 2F4PA 2QNKA 3SCFA 5I0UA 4MGKE 3I59B 2EVXA 3OCPA 4E2QA 2ETEA 4PIYA 5JCTA 5J3UA 3EHKA 4MX3A 2XL7A 1CAWB 1U12A 2ET7A 2VECA 3FHIB 4HSLA 4ZU7A 2EA7A 1NE6A 4R8HA 3CF6E 1FXZA 5CVRA 2OA2A 1OI6A 4IETA 4Q0UA 5FPXA 3IDBB 4HLTA 3D0SA 3KMHA 5LEKA 3ACLA 3H7JA 5FPZA 4IEOA 4MH0E 4EROA 3H8UA 3H7YA 3WW1A 1YFYA 2XL9A 4HN1A 5FLJA 1J58A 3R6SA 2Q0AA 4PIXA 1YFXA 4CYDA 2ZKLA 2O8QA 3FZ3A 2QCSB 3I59A 3S7EA 3E97A 4XFFA 4YNIA 3NSTA 2PTMA 1CGPA 1CAWA 1J3RA 2GC1A 5J7MA 4XETA 4IEXA 1YUDA 5T3NA 4PJYA 2XLGA 3H3UA 5JSOA 3H1MA 3E6DA 3ZDSA 2IXJA 1GQHA 3SHRA 1O3SA 3EBRA 2ATFA 3E5UA 4LUKA 1DGWA 3IWZA 1CX4A 4FBFA 2IXKA 1Y9QA 2GAUA 2PFWA 3OTFA 1RGSA 1CAUB 4O9EA 4IEZA 1RTVA 3GYDA 2H0VA 4WVZA 1PM7A 1HW5A 3BU7A 5I8SA 1ZRFA 3ES1A 3NVCA 1DGRA 3RPQA 3ROUA 3E5XA 3G7DA 2WFPA 5D1IA 3FJSA 5E1RA 4E2SA 3O14A 3M3IA 4QM9A 3UKVA 2Z69A 2OPKA 4I0BA 2K0GA 4XEZA 2HJIA 1VR3A 2CGPA 5CADA 2FQPA 3DL3A 5KHGA 3LWCA 1ZZ7A 1FT9A 4A2UA 2K9ZA 2IXIA 1ZZ6A 2PQQA 3S0MA 3U10A 2BGCA 4TLFA 4X6QB 1OMIA 5EZWA 3CL1A 1LKNA 4Q0SA 1Q3EA 5I8TA 4GULA 3H1WA 2MPFA 4IEQA 4XF0A 1OFNA 1QXRA 1X7NA 4KL1A 4QX5A 4ZU4A 2CAVA 4I02A 4QGNA 3KSCA 1NYWA 2B8MA 1UIKA 3L2HA 1YFUA 5I91A 3C3VA 4HSJA 3IBMA 4I0AA 4MUVA 4OFGA 3KGLA 5FCCA 4AQ2A 1I5ZA 2GC2A 2UY9A 1WLTA 5J48A 1ZZ8A 3MDPA 1YWKA 3WW2A 4OLLA 2XGXA 5CU1A 4ORFA 4H7LA 4PIZA 2GC0A 3EJKA 1WGPA 3IDCB 2O1QA 2N7GA 1YFWA 4FT8A 1ZNPA 4META 1ZRDA 1PMIA 5I0RA 3DV8A 3CO2A 4LUMA 4LTAA 3RYRA 3D0JA 3CJXA 2DCTA 1ZZBA 2FMYA 1UCXA 4QGLA 5E16A 1O3QA 2XLAA 3SCHA 4YSFA 3SXWA 4LLOA 1O5LA 1TQ5A 1RL3A 3PLQA 3H3ZA 4J1XA 4YARA 5K8SA 3KGZA 1GQGA 1RC6A 2V09A 2GC3A 4HZFA 4JVAA 4XFIA 4IEVA 5BUVA 3BB6A 4I09A 3QACA 1O7FA 4HN0A 4KU8A 3SMHA 1O5UA 4B29A 4XFHA 4QM8A 4JV4A 4DINB 2D93A 1X8EA 1OD5A 1Q43A 3I7DA 1QY4A 3BCWA 2Q4SA 2QDRA 4MV2A 2GH2A 1UD1A 2BNNA 1ZZ9A 5I0TA 4XF3A 4JTNA 4AXOA 4AVAA 1RUOA 3BPZA 2IC1A 4R52A 1H1MA 4AQ6A 3FX3A 1G6NA 2WC2A 1CAVB 4LA3A 3S7IA 1EYBA 3H1YA 1UPIA 3N4MA 2B5HA 5LEJA 3CEWA 4ONUA 4YYOA 3MZHA 1ZRRA 4J1WA 2MHFA 3HT1A 1YLLA 2OYZA 2EAAA 3DN7A 2XKPA 5FLIA 2D5HA 3OGJA 4HMZA 1O4TA 5FDBA 2E9QA 2H6CA 4IEWA 3WW3A 2HKXA 2ZCWA 4KWJA 2BNOA 4KWKA 4LEJA 3U0ZA 2IXCA 1XE7A 4MGYE 1QXJA 4IEPA 4XFCA 2I45A 1LB2A 1J3PA 5C6CA 1CAUA 2PHLA 5KBFA 3CLPA 3JZVA 1X8MA 4IERA 1CAVA 3E6BA 4XFGA 3KCCA 2PA7A 1Q5OA 4EWDA 4E2GA 2B9UA 2Q30A 4X6RB 5HI0A 4Z82A 4HVQA 1ZVFA 4FAGA 4Q0VA 1ZZCA 2UYBA 4I3PA 2BNMA 1H1IA 1SEFA 2Z2SB 4KU7A 4Q29A 4UBGA 2QJVA 5JSPA 3LAGA 4LULA 5LRRA 4AVCA 4P9GA 3NL1A 3ETQA 5FLHA 2GZWA 4JTOA 1IPKA 3VHRA 1XE8A 4EWAA 4MZUA 3QOPA 5F1RA 1O3RA 3M70A 3E6CC 5I93A 4HVOA 4D7TA 1O3TA 2XHKA 2P17A 5KHKA 3NJZA 1ZREA 4UXAA 4XF4A 3HIFA 2D40A 4MGZE 5C8WA 3TNQA 3ES4A 3NKTA 2KXLA 4QGMA 4FAHA 2PYTA 4Q0QA 5KHIA 5KHJA 3LA2A 3USSA 3MYXA 4KWLA 1I6XA 1UW8A 2UY8A 5JAXA 1NZCA 2MNGA 1CAXB 3OF1A 1XRUA 3H9AA 3I54A 1V70A 1UIJA 4ZU5A 1L3JA 4BIFA 2CAUA 3NW4A 3RNSA 2Q1ZB 3WW4A
chains in the Genus database with same CATH superfamily
2Y0OA 3UO2A 3DC6A 1XHZA 3SDLA 4CZZA 4DR5B 4UF0A 1DGLA 2PQSA 1JR9A 5LHIA 3CBNA 3V0BA 2R043 3J7AU 1QGLA 4Q4X2 4D7SA 2JEMA 3WDVA 3PVBB 3KT7A 2HWC2 4DR4B 5IUQA 5T5LA 1CQ9A 4N53C 4PQQA 2VVDA 3UGFA 5A1LA 1W0OA 3NJXA 5FZKA 4I01A 1RUD1 3T1LA 1QMJA 4DFSA 3IC9A 3VKNA 3ZFGC 5IJ0A 4F6RB 1F4MA 3WHTA 1HXS1 2A7WA 1JQ0A 3RRDA 2DVGA 4HNAB 1IS6A 1JYWA 1NVPB 4PD4F 2VZVA 4LH6A 3K0GA 3TNPB 1YQ8A 3E5QA 2OW4A 4FI9A 5EK0A 2AGAA 3ZSJA 3ZHTA 4A41A 4AHCA 2VZQA 4JGYC 3M7AA 4OHXA 1D4M2 4AOCA 3FWEA 1V54C 3W21A 1S0IA 4X1IA 4DEVA 2YFUA 5FXXA 1A32A 4PIYA 3EHKA 1D4VB 2XL7A 1W2NA 5K4LA 4RS5B 5FY1A 4F6EA 4HSLA 2RDNA 1YYNA 5A33A 3TEXA 2XJTA 2XJSA 4W6XA 3OMNB 3H8UA 5FZ6A 1J58A 3R6SA 2KG7A 1R3KC 1U0AA 2W9XA 1SBEA 4O4LB 4OXSA 2XB6C 3IKWA 1QJY3 3O1PA 4O65A 5FJHA 2VNOA 1LOBA 1K97A 5T3NA 4AFCA 2XLGA 1S55A 4LIVA 1RJ7A 5E79Z 4CU8A 3SJQC 2HHHO 3T08A 4QQLA 3SYCA 2A5ZA 4BDVB 2B4KA 4Q4Y2 2YC0A 3M8LA 5EBMC 3UJQA 3AYEA 5EWSA 5FOBB 4GJZA 1BYHA 2CY6A 1C8M1 1VMHA 1DGRA 4N23A 1QHTA 1GP6A 3JUUA 5GKAC 5B5EZ 1VIWB 3FJSA 4DV4O 5I0DA 1AYN3 3ACIA 2WSUA 4I0BA 2VCBA 1DZQA 3NAPB 3DL3A 2BOJA 2DCYA 4IV3B 1PM9A 2YU2A 5H6RA 2BGCA 2QTOA 1WB8A 4O2BB 2YIBA 2EXKA 2LGQA 5H9CA 2QTSA 4XOGA 4FPYA 3MI8A 4X1YB 5CAZA 2WR9A 5FCCA 4I50B 1OSGA 4FFHA 3B7MA 5A1FA 2XASA 2WNUB 2WZR1 3H1KH 4JGZA 3ICXA 4L8JA 5DDJ3 3ZSEA 2JG9B 4LF5O 2IM9A 2N7GA 3AG3C 2WNEA 1MNGA 1G6UA 3LCPA 3D0JA 1OV9A 3FYIB 1PGL2 1X4TA 2WUHA 4A5UB 3NQHA 5FWEA 3PJQA 4YARA 4JI5O 2WNVC 4AQYB 3CYOA 3IAQA 4HZFA 2GC3A 2NPIA 1MOFA 2LALA 2G19A 4V1PA 5JH7A 1C3HA 4KHPO 1O5UA 4XDKA 1PO21 2R063 4QM8A 3KT4A 1PD3A 1F5FA 3NR7A 3CMGA 4DINB 4Z2WA 5DUXA 3BCWA 1QNWA 4G4FA 3OE7G 4NPRA 3H1IH 1K5MA 1IHMA 3CNAA 3OEAA 3LSUA 1ND2A 2JGUA 2BWAA 4YFZA 1V0AA 2I2SA 2WLJA 4K21A 1W6OB 1CAVB 1SPPB 3LGRA 1AF9A 3HT1A 1E79G 4NHMA 1C5IA 2BP6A 5L19A 3OW2U 3ZRVA 3PVOA 4K35A 5F5QA 1NKGA 1DQ6A 1WZXA 1ASJ3 4AAPA 1QVFU 4GXLA 1SLLA 3ZHRA 1X50A 2IVJA 1YI9A 1RUC3 1X36A 3MFCA 2AREA 1GZCA 2HLEA 3W5NA 4OUEA 1FFXB 2Y33A 4YY3B 2ETNA 4URAA 4Z82A 3ETGA 2FBEA 4UFZA 3OGSA 4FZ0A 4Q0VA 4KU7A 4X8AA 2A7AA 4MGSA 2YXLA 1NCRA 3ZYIB 4FPCA 1E5HA 2XJPA 1SETA 4JI7B 1W2UA 2B1GA 2WAMA 3MW4A 4AVCA 2ZIOA 3ZN0A 3ZRSA 1HRI1 2QKDA 3KT1A 4IE0A 2GV9A 5F1RA 5K0UB 1VBA3 1YHQV 1OOPB 5LZ6A 3ZN4A 1HNWB 4Y4RA 5GZCA 4H37A 4U3JA 5EYPB 4LF7B 4TSVA 3ZFEB 3NV3A 3GDBA 4GWMA 5LCWL 5C8WA 5B1AC 1KP3A 5L7OC 1ZA7A 1XC6A 3LPFA 3ZYBA 3H9AA 4J9YB 4UW3A 5C3OA 2E32A 5FP9A 3RNSA 3OGVA 4OULA 4TSFG 4XF1A 3NNLA 1DZRA 4D7YA 3H50A 5HV0A 3T1CA 1WUVA 4KI5M 5A1AA 2BERA 2EICA 3GBFA 1R3IC 2PY5A 3EQEA 5EJZB 5D8AB 2EIBA 3STZC 1UZVA 4A3XA 3K4DA 1B06A 5H9SA 3AXDA 1BQZA 4RHV3 3VKLA 4YXWG 5BXXA 1F9KA 1F15A 4N9IA 3W7XA 3FLRA 4BHPA 1Z5VA 2XBO1 3LA3A 2ORXA 4U7OA 1L8DA 4GKKO 3CCEV 2VMGA 1VF6A 4YFWA 1PK6A 1ZRCA 4O2AA 3C7GA 2L9LA 3L9DA 2XAGA 2BVBA 4YRDA 3RJ2X 2W91A 2VUAA 1WJZA 5T5JA 3BABA 4AEDA 1RUJ3 3UQ8A 4AGRA 5DAQA 2LFRA 1WNSA 1UX6A 2FD8A 5BR8B 1K5MC 1KU9A 4E2QA 1RYYA 3PU8A 2ETEA 1JYIA 1GWLA 1SZXA 1FMD3 4R9CA 4LKDA 3PMSA 2P5OA 4Y1YA 3SEEA 1AUYA 4QWNA 4CUAA 2ADQB 5HCHA 2QM4A 4WBNA 1OQDA 1OPMA 1D0GA 1F8VA 1AXZA 4F3JA 4NIGA 3M2MA 2DDUA 4HONA 2B9ZA 2HWB2 1CGPA 3EB7A 2GNTA 4LMFA 1GWKA 1PM4A 2JJ2G 5CA0A 2QQMA 2G9ZA 1IBMB 3W7SA 5FY4A 1GBGA 4FLWA 2R6QA 5LMNB 4BMEA 3VDBA 4WVZA 4ASLA 1FPN1 2ZGUA 4GX5A 4DR7O 1V6KA 3OTOB 1FX5A 4I4TA 1Q86W 3VBHA 3O5SA 5FZ7A 3UKVA 3QH7A 2K0GA 2HJIA 1G8MA 1BLZA 3ZFFC 3MAQA 2XH6A 4A2UA 4BQ1A 2G38A 1ONAA 1S0CA 5FKBA 4JZ2A 4BPZA 3ME2A 3WOGA 4O4HA 4J6GA 5EZWA 3QCWA 4ES9A 2BSKB 3NNGA 2CAVA 4QGNA 4X65O 1UIKA 3ZO0B 4LJHA 3TN92 1YFUA 3KGLA 3HN3A 5GZDA 5FZFA 4HL0A 3T0AA 4K20A 4Z92B 3LKJA 2RS11 1WGPA 1S2EA 1H2GA 4UW5A 5LMUB 1DGWX 2Y6FA 1PZ9A 3CO2A 3SISA 1ST8A 3BCCH 4LBQB 1L7QA 2A9HA 3GM8A 2AW9A 3WQ0A 3V0BB 3KGZA 1OVSA 5FPOA 1COV3 4IXLA 2JDIG 1WLDA 3BB6A 4TOIA 3LQCA 2YGLA 5IAXA 5KMGB 1VF6C 2DU0A 3GCXA 5DUUA 1Q43A 3P32A 2XJRA 1XNQO 2WWWA 4AVAA 4IHJA 5FZOB 4GX0A 2ZEYA 2FB5A 3VBBA 2RS53 2DE0X 3ZXDA 4DRXB 2PI5A 3H1YA 2X05A 3X29B 3MZHA 4QX7A 3UT5B 3T2MA 1W9YA 3ZR5A 2GMMA 3N27A 2UWCA 1SQVH 2EILC 1NX9A 3CMAV 2ZE6A 4XJZA 3OY8A 5LY1A 1YJNV 5C6CA 1CD3G 4X1IB 1KXGA 1ORQC 1HNZO 3CLPA 1C4RA 2NZ9A 4OHZA 3ZYJB 1LHVA 5FZ3A 1NBMG 5H5NA 1ZVFA 2R072 3L70H 1C1LA 4TUYA 2GP3A 4DR6B 4GH4A 2CTQA 4LCUC 3K06A 1SEFA 2BNMA 2IJIA 1UKGA 4JTCB 1RUG3 3KCYA 2HWE3 2HR3A 3DXTA 2YEVB 1O91A 5LRRA 3KHBA 3WG1A 3W20A 1CIYA 2HLDG 4RQEA 3HNMA 4DXZA 1RM1C 5GZEA 1OA2A 1RHI2 2B39A 1HW7A 3NJZA 2UU9B 2GNDA 4S2GA 3AMNA 3PVEA 2RM22 4CEWA 5GONA 1N34O 1V00A 2RMU3 1SC5B 1XSRA 2PYTA 3AKPA 5F9TA 4ZKIA 3PUSA 5GALA 4P30A 4AFBA 1AJQA 3BRCA 4N21A 2Q7HA 1ULEA 1JZ6A 2XHNA 3WW4A 4DV2B 2W2IA 3OYWA 4YZ5A 1EUTA 2X09A 1GMMA 1NXD1 1V9U1 4DRRA 1GNYA 5A7SA 2ZNIA 2ZE5A 4QQOA 1X82A 4I2OA 1VAVA 1PPJH 3MIFA 2BOCC 2C0ZA 5BV6A 4XUQA 1IBKB 3EO6A 4GKJB 5J96B 1NR1A 3FFQA 1UFIA 3S5QA 3D82A 3I2JA 3IAPA 4PJ0Z 5GLTA 2CDPA 1NCQB 2KA3A 1OUSA 5H9RA 2PHDA 2PYLA 1GN2A 1PGW2 2A0LA 1K45A 1MZFA 1FI2A 1RUF1 2FYUH 3FB6C 2WS92 2VNVA 2ODMA 4I0XA 3UKNA 1K7DA 4OQ9A 2D5FA 2WJSA 5IWFA 2W6JG 2WKKA 1BHAA 4QHOA 4FFGA 4WM7B 5EBWC 3KG2A 2AHZA 1STMA 4P9YA 4R9AA 3OBAA 1FV3A 5KXCA 3BTAA 5J36A 2WLLA 1V6IA 2BJSA 5GTIZ 3HKBB 2WT1A 4LLFA 4X1KB 5JH7B 2ZINA 4XXPA 5FPXA 4DUYO 4Q4W2 2F66C 3ACLA 4LBLA 4LK7A 1WP8A 1VRH3 2WT0A 1FNYA 4HAMA 1EN5A 1SACA 4N43A 5DAXA 3EYPA 4QKDA 3OUSA 1Z7S3 3HWJA 5C3RA 4PCRA 2DQ0A 1N33O 1KS4A 2H94A 4PJYA 1GUIA 1YCIA 1XMOO 2R7EB 4JASA 3E5UA 2AR6A 3IWZA 2GH8A 4GH4C 1M56B 2Y6HA 3W5MA 4X20B 3T1MA 4P5HA 2NLRA 3JD71 4AI2A 4QIWF 1VQ5V 4A7YA 1RTVA 1HKDA 1AJNA 3NVCA 1W8ZA 3RPQA 3RYIA 2Q0OC 4YJ2A 2Y0IA 5EBLC 1HWYA 2OCCB 1C28A 1MS4A 4CH3A 1TMF2 1AR93 3WVJA 1NCRB 4CEWC 4D6QA 2DUOA 3O1SA 3T0DA 1YF2A 3THDA 3C8XA 3IN9A 4Q0SA 1BHGA 4GULA 2L35A 5T54A 3WF0A 4MVRA 1QQCA 2Q67A 4JZGA 4UVAA 2LS6A 2AXTZ 3ZXKA 3OPZA 2WZPP 2W46A 5DPNA 1HP8A 3NXSA 2ZX0A 1NY71 3SKVA 1LGCA 2ZCEA 5J48A 4KQ7A 3R05A 3J8F3 3NNJA 5LP6B 1LOFC 1NUKA 5CYYA 3HD8B 4QPGC 3CX5F 2J1EA 1YQ6A 3I4IA 1XOYA 4YWAA 2A79B 1H8EG 1OZ0A 2QWNB 4DV0B 4ZIBA 4A4AA 4HFSA 4YSFA 3SNMA 4H2AA 4Z2AA 3PUAA 2WIIB 2VMCA 4TXWA 4QB6A 4CDQA 5A3UA 1O9GA 1JN2P 2QKAA 1EV11 2ZAHA 2PHFA 3FHQA 4DK1A 1ENQA 3VLBB 1WD4A 2V4VA 3OSDA 1S5HC 4JGSA 4V2WA 3VBSA 4LE4A 2YPJA 4YM0A 2XNDG 1PL0A 3ZRWB 3KF5A 4FLVA 2Q8CA 4AQ6A 4AK3A 5CZKA 3WF4A 1FNZA 1UPIA 1NI8A 5F3IA 1YIJV 4ONUA 3BUCA 2WLKA 1SA0B 3JXSA 1UO9A 2R041 2QE3A 3JD1A 4O2AB 4ZHQB 5CEHA 2GSMB 2ZDIA 1SCRA 3UGGA 3WW3A 3AKRA 1S0VA 5FUIA 1SQBH 1QR9A 3HPLC 4ZKTB 1YQ5A 2ZGQA 4YG6A 1W39A 4LHNA 1D5NA 1S76D 2Q1MA 5A9GA 3CC4V 5FZDA 4ITCA 5C93A 1XJAA 3KCCA 4XIOA 1EAH3 2GMEA 5A7WA 5F39A 5EC1C 5J2UA 2YC2A 3SH5A 2VTXA 3CJHA 1IQDC 3JU9A 2HEYF 4YZ3A 3IT8A 3LAGA 2QQJA 4LKSA 5JLVA 5FLHA 4QB1A 2WQZC 1LODA 2JIZG 4E2LA 1R1ZA 4Q4V3 2OPWA 1NT2B 3KD4A 2D6MA 3JALB 3AX4A 4XUPA 2GMPA 4NUBA 5FP8A 4DV7B 1UY1A 1R092 4QDRA 5J9PC 3I56V 2JIGA 4D6TH 5B1BC 4OQ8A 3S57A 2XAQA 4EB6A 1ZL8B 1OCOC 5ITZA 2ZTNA 1VBC3 4FFIA 1VAKA 4CU9A 5T50A 1HQWA 1OVPA 1Y76A 4LO4B 5DZGA 1F35A 2HYKA 3LA7A 4D0QA 1QJY1 2Q8VA 2C24A 4DB5A 3FL7A 3E8HA 4QPKA 2XKOA 2OWOA 1Q90D 2MEV3 4WFFA 1RINA 5M0TA 1AR72 1N36O 3PNAA 5KXEA 2VXJA 3K03A 5KXBA 5IWAO 5DZFA 1OF4A 4XABA 2H6BA 4EKWA 5L3EA 5LGUA 4YM3A 1F5JA 3KV9A 4GB33 1C5HA 1LOEA 4OHYA 1VF5B 3OUIA 4OMDA 3ELNA 4EWEA 3SCGA 1D2SA 5IDJA 2GN3A 1YIFA 1XSQA 2BYVE 3CD6V 1AYN1 3OD0A 4A7ZA 1VEWA 5IYCO 5DM6V 3HNBM 1YJWV 4MGIE 5FZMA 2ZS6B 2CWMA 1PNLA 4NVPA 5F8PA 5FMCA 1AL23 2YUAA 1W8WA 2UXCB 5FYIA 1IVSA 3VBSC 2E74B 4JYAB 4RQPB 3X2QC 1DYKA 2HWF1 5AC91 5HXVA 2VQFB 1SMVA 2NN8A 2VG9A 2ARBA 2WDBA 4FFKA 5EYXA 1MQTA 1KUQA 3CF6E 2ZXWC 5CVRA 2A73B 3I3DA 1CESA 2YXSA 4Q4X3 3IDBB 4HLTA 3JCIA 5GJ6A 3VQWA 4JI6O 3S30A 2HWC3 4X8NA 5DDJ1 2ZDIC 1B35A 3W9AA 5IFTA 1GOFA 2YY1A 1MSDA 5L9RA 2VMHA 1LR1A 1WMDA 3P30A 1G8WA 4OHVA 3S6PA 4BLJA 2AEZA 2TUNA 2D7FA 4GMP1 2DFCA 3I5DA 5BY1A 1YIPA 2V5DA 3T09A 3ZJZA 5HFLA 3DPRC 4J10A 5CNAA 1SRYA 4GLXA 2WA3A 4LNUB 3AZYA 2V7QG 2QWRB 1XB9A 1DTOA 1CPYA 4IIJA 1H6YA 3E89A 4K8XA 3APOA 3ES1A 4XE9A 2JJ1G 5LK5A 4K7JA 1YI2V 2XAHA 2EZPA 3WG2A 3O14A 5JMCA 1HJFA 2R1BA 2F95B 3LWCA 3I2OA 4CS4A 2F4VB 1ASJ1 1AR63 3AP5A 1Q3EA 1RUD2 2J1SA 2WFF3 3OEBA 3ZN5A 2UUAO 4LFBO 3NV1A 1HXS2 4I02A 1RUE2 3L2HA 1S4CA 3GZUC 5GONB 3LSEA 2HWD1 1IXBA 4AW7A 5BNNB 5L9VA 4CTEA 2ZGKA 5FKCA 5BMVA 3G6JB 4XQ4A 4RL7A 1HV1A 4RUEA 1CP9A 1KB9F 1UPGA 3RZMA 3WF1A 1H2KA 2YYOA 4YVWB 5F5IA 4DRVA 4E4SA 1GN3A 4Q4Y3 1MS1A 4HPKB 1Z2GA 4YZ1A 4X62B 5L3FA 2J7MA 2R32A 2BQPA 3LEGA 4LLOA 1TQ5A 2LUWA 1SLIA 1YTFD 1ZRIA 2JDHA 1D0HA 3ZMVA 3SMHA 1JOBA 1F31A 4ZXEA 2X6BA 2V5YA 4TWTA 1JU3A 4LHKA 1URFA 2CL2A 3CMEV 2M6YA 2IH1C 4GKYA 2X5IA 1W8UA 3KS7A 4XCBA 3GALA 3WP6A 4UB8Z 5FYMA 1G6NA 1WW5A 4ZONA 2LGWA 1JZ8A 2YDEA 4HK8A 2W1UA 5LA0A 4M3CE 3U1XA 3DYOA 5FLIA 4Q5OA 3U78A 1UQXA 4RGGA 4DR3B 2E26A 2BNOA 2IXCA 1VQ7V 2LROA 4IYIA 4CXYA 4IEPA 4N53B 2WLPA 1CAUA 1C8M2 4RHV1 4P9XA 4COZA 5C4WC 4PDLA 1FS0G 3KB5A 2Q30A 4JI1B 4C0BA 3RYFB 4PLMA 5JI7A 4LK6A 1YVWA 3PVNA 4UFHA 1FATA 1XQNA 2VCAA 3KWVA 3JBG3 5FO7B 1VBB3 4MW3A 2YI9A 2XVGA 2GTSA 4M0NA 1G4YB 5JSPA 1X59A 2Y64A 4LULA 3HPNA 3ZIAG 2FHRA 4JAAA 4QAWA 5DQ0A 3TB0A 5CBLA 1H8TB 2QTWB 5I93A 1ZREA 3P3PA 2VJXA 4QPYA 1ND3C 3HNYM 5C3PA 5HBAA 4B3SO 1FMD1 2D3RA 3TNQA 2WZR2 4QGMA 4B7KA 1WW4A 1PX4A 1WMEA 2BOIA 1UW8A 4X8PA 5B3SC 4AFMA 1HR0O 1JOPA 5IYYA 2WPDG 4I55A 1S0JA 2CAUA 1N1TA 3AL5A 2Z79A 3CJIC 3OUHA 3RWRD 1LRHA 3LEIA 5B2GB 4K8FA 4KWUA 2AZ5A 4BYYA 2Z5WA 4OI0A 2B5UA 4DR1O 1PO22 2IZWA 4K9SA 3RBZA 3ZLIA 2EZOA 4N9HA 2A3YA 1UY0A 4EV0A 3OMAB 1UMHA 3ABZA 4DEQA 3LZZA 1VRBA 1LU1A 1L1FA 4CDXC 4LFAB 2JDMA 4GAZA 1W03A 5FQ0B 2BRTA 1LR5A 4F4LA 4HBNA 5JR2A 1PL4A 4CDUA 2PAEA 2WLIB 4L2NA 1AJPA 2QVSB 3OUJA 2WO1A 1KITA 3OJBA 4JI7O 1LESA 4MGQA 4CUGA 1OKOA 4FVVA 2B7YA 2BWCA 1MACA 2QEXV 4NXNB 4Z07A 1GP5A 4X66O 4LFCB 1JUHA 5DUWA 2Q7EA 2EXJA 1JYNA 4WZCA 4XDJA 1VQNV 3J7HA 2D6LX 2TNFA 1SFPA 5I0UA 2X5IC 3NNMA 1XBLA 2JX9A 3HKCB 2ATKC 3MLKA 1XNAA 4ZY9A 1WA8A 4UCSA 1PX3A 4R8HA 4QKNA 3AG4C 2P5BA 3SJAC 4DNYA 1GH6A 3CSXA 4NWVA 1W90A 2GUZB 2P6CA 5FPZA 4MH0E 4R7CA 4W50A 1YFYA 2XL9A 1HRI2 3UKMA 1F4HA 3K46A 3AG3B 5FYUA 1TAEA 3AMMA 4CEYA 4BWOA 1VIBA 3M1HA 2ZXQA 4XJAA 3AP7A 2OYQA 3ZS8C 2WNVB 4R9DA 2PYJA 1UKRA 2IUWA 1COV1 3H1MA 2IXJA 2Y6KA 2WAAA 2Y69B 3G6EV 3EBRA 1FFTB 4QB2A 1NKDA 2ATFA 4LUKA 3T2PA 2IJJA 4D6SA 3O0WA 3HN1A 2VZ1A 1SZTA 1M4UA 1U5XA 1BMFG 4XUTA 5T5PA 1OLQA 5HCBA 4TT3G 2P6HA 3H8OA 2OIGA 4IV1A 1DFQA 1NZ6A 3E5XA 2RS51 3U75A 4GA9A 2WINB 3AJZA 2VWKA 4M3CA 4SBVA 1XXNA 3F95A 5C8YA 4YHHB 1GOHA 1ZZ7A 4QX2A 4PBOA 2XJUA 4RO2A 3MO4A 3VHPA 3WUDA 1JI6A 1HNXB 1L0LH 4C8DA 1UOFA 2W1WA 2AACA 5EZYB 1EZVH 4DV3B 5FXWA 1OCCB 1W2TA 1HQLA 2YBPA 2K9PA 4PLNA 4NO4A 2XBO2 1CONA 3U07A 5IJ9A 3AVRA 1KDKA 1EN6A 3NRUA 2V1DA 2HWB3 4YVSC 1G9BA 4I0AA 3IBMA 1FXKC 4W8JA 2UUBB 1MVEA 4XC9A 3RN4A 1JX9A 1DQ0A 3FHAA 1L0NH 5CU1A 1XREA 1RUG1 3K3NA 3N36A 2BBAA 2YFZA 4JQTA 1BT8A 4XBFA 2HWE1 1YFWA 3ETEA 4FT8A 5GM0A 5CFDC 3VBOB 1G7YA 3MIDA 1A8MA 3RYRA 1DQ1A 1GAXA 4XUNA 1YO8A 4FOWA 3ORJA 2R9RB 1IBMO 2JB4A 3VBFC 3OBZA 5KAFZ 1C57A 4UUJC 1GMGA 4FP2A 4AQTA 4KU8A 1A34A 5L7OB 2D6PA 4CU6A 4WF9V 3TYJA 2DYSC 4FLYA 1O8PA 1K73W 3EFFK 3A8TA 2JVDA 4LF6B 4OCTA 4JI8B 1M9NA 3H1JH 2BGOA 5C8CC 3VZMA 2QJ1A 2YICA 4DV5O 3T4HB 2NR5A 4GIQA 4DR2O 3O65A 2EAAA 2PHXA 4ZI7A 2YC4A 3AFGA 1UMIA 3UCSC 3K3OA 4LEJA 4KWKA 2UWBA 3SLIA 3B94A 3ZYFA 1FPN2 1EBOA 5KBFA 2FTKA 1MSWD 4S2DA 4TQDA 5D5PA 3JARB 4EWDA 2I74A 4FPEA 5IY5C 4BK5A 3I2DA 1MQTB 3O1TA 3WR0A 3DSQA 3A4UA 4JHTA 4ZOLA 4N7IA 3ZHUA 2CHHA 4W4ZA 4M0HA 3HKEA 5CFCA 2UYBA 2Z2SB 3HQUA 3WNPA 3DKQA 2XHBA 1Y4WA 2E5LO 1PVXA 4P9GA 3CRQA 4QDSA 2QQPA 4DXWA 2ZGLA 2GZWA 1TUBA 5KC5A 4DMIA 3RI8A 1UNBA 2ZM6O 3QO8A 1QNYA 4X89A 4UXAA 1N32B 5IVCA 4DY3A 4MGZE 5SV5A 3MLLA 3NKTA 2KXLA 1OA4A 5LW9A 1US2A 2RS12 5KHIA 3WCSA 5K7PA 3CP1A 4MSVA 4Z8BA 3BTZA 1BZWA 1B6QA 2HBTA 1CZSA 3JD4A 1F4NA 2Y48A 5LYJA 4P9WA 3IIAA 3WDXA 1G1XB 5A7NA 1B09A 4B3TB 5FPBA 3WG7C 5JR7B 3ZVXA 2P22C 1Z7S1 2ARCA 4DIQA 3VKOA 2QA4V 3A2FA 5IYZA 2SLIA 2VQTA 4LQRA 4XQWA 4EE2A 4DUZO 1P8JA 4RD7A 1W8TA 4RSUA 4CDWC 1JZ4A 3ABMB 4LF4B 2UYAA 5BPXA 3RMXA 3HBKA 1YHFA 4NHYA 3JAKB 2QQLA 1AJKA 1A6CA 4XF9A 5HV4A 1VQKV 1QJU3 4NB5A 3T1HB 2A70A 1J84A 4B4PA 2OUHA 1R083 3PTYA 4O7XA 1ZX5A 1GYKA 1W6QB 1JYXA 1RVF1 3RDIA 2RM23 4IGOA 3B02A 1ZSPA 3GF6A 3ZFFB 2CNAA 2E33A 1IX9A 1W6PB 4JYBA 2BZDA 2GN7A 1DF5A 2BUKA 4F6RA 3LFIA 1WKYA 2QWQB 4HNAA 4AEMA 4MX3A 3VHOA 4CH6A 1JOJA 4BXSV 4AI3A 4BR6A 4WFHA 1NE6A 2E6VA 3I3MA 4LC1A 4FLUA 3SITA 1MZ6A 4QXHA 1UU4A 3D0SA 5DG1A 4UT5A 5BNPA 4KUMA 4I0WB 1I7FA 5KX5B 1I08A 4J7JA 4X64B 3B9CA 4DQAA 5GZGA 4YIPA 3RVYA 3DUIA 1K4CC 3TRSB 4G9SB 4A7KA 2ZKLA 1TEIA 3WD5A 4FFBB 3E97A 4XFFA 2A06H 1K3IA 1SKVA 3J81N 4K1ZA 3IDAA 4AAXA 2C6SA 4RS5A 2QFEA 1GANA 2VW2A 1YUDA 4XTPA 3R4UA 1XE0A 2QE7G 3RQ0A 4QQPA 4QE7A 1LJ7A 4LOSA 1GP4A 3FKSG 1W04A 4FBFA 3JATB 5CFCC 4EN8B 4TN7A 3BEHA 4O4LA 2A6ZA 5AFEA 1CAUB 3H42B 1VB4A 2WQ8A 1QKQA 3T4VA 4L99A 1XNBA 1V9U2 5ABJB 4C90A 3M3IA 4AI8A 1TE1B 4QT6A 1DLBA 4YW3A 1VR3A 3ZCCA 5KXDA 3G4SV 5FO8B 2FQPA 5CA1A 4XDPA 1I5XA 1UX7A 1RIRA 2F43G 4JI4O 2ES3A 2X7RB 5JPMB 3POWA 4Q4W3 4FZ1A 1Q6UA 4RFRB 2XT9A 1KBHA 4KL1A 1PVC1 1N1YA 5GLVA 3KSCA 1T5EA 1ZBA3 3RJRA 1RUF2 3CWBH 4DXRA 1EAH1 2NMNA 2DQ3A 3NAPA 1O9HA 4LHSA 4IV3A 4MOAA 4YW2A 1RITA 2EJ7A 3VGIA 4O2BA 4YW5A 4LF8O 1ZNPA 4META 1MMMA 5I0RA 1MZEA 4Z1MG 1NQDA 3WNNA 2FMYA 4NHKA 2XXZA 5LXTB 4Q4V1 5FZLA 4X1YA 2QKSA 1OQEA 3SCHA 1T6GC 4QU2A 1RM1B 4HK9A 1O5LA 5JVVA 4EFBA 1NOVA 1IKPA 2V09A 2WNUA 5FMDA 5JOZA 4IE7A 3GZAA 1CX1A 3H01A 4UFMA 1JZ5A 2JG9A 4EYUA 4JAVA 5KUMA 4RA0A 1Q81W 1QY4A 4CH4A 5LA6B 1AI4A 3CCUV 2JD4A 3B69A 3FN9A 4JTAB 4CXWA 1NA1B 1QXPA 3K5NA 3KZ4C 3HMYA 3S7IA 1Y7BA 2W6IG 2CH7B 4YYOA 2UURA 4J1WA 3VV1A 4LE3A 1JH5A 2MEV1 2OX0A 1LGNA 3K04A 1UMZA 2ZGMA 4YW6A 3IB3A 5FK8A 5ISLA 2VE1A 5FYSA 4KWJA 1RUH3 3BVOA 1RXFA 3AG1B 2QQUA 3UM7A 1XMQB 4WM8A 4GB31 3JASB 1W6OA 1CAVA 5FY7A 3LEMA 2PA7A 1VQ4V 5FMOL 5F2WA 2ADPA 1ENSA 2CDYA 3NMBA 1V6LA 2YGMA 1XNKA 3O1MA 1H1IA 1HN1A 3K58A 4LO7A 3LD8A 3KM5A 1WPBA 4DV0O 1POV1 5FLXN 4L97A 1AL21 5ANQA 1WCKA 2EX3A 2IU3A 3CRMA 3RS6A 3ILFA 3QOPA 1FFXA 2VBDA 5KHKA 1NY72 3WU2Z 2ORZA 5DN6G 2Y0PA 1DQ2A 1GM7A 3WFVA 1OLME 1Y4MA 2VMDA 4TV9A 1S2KA 4K6BA 5EIYB 2WLQA 4LBKA 4J7KA 4LF9B 4WCEV 2HWC1 2VQEO 5IYBO 5K0UA 1OOPA 5L3GA 4AHYA 5EYPA 3U11A 3J4UH 3ZFEA 4BM8A 2OZ6A 4B3RO 2IXLA 3DKWA 1EV12 2HG5C 2Q7GA 2WN3A 4M01A 4M3CB 5H9PA 4ZS2A 3RYCB 2J1TA 1H8HG 5B4NA 2FMLA 5I8YA 5BY5A 1H0BA 5IYDO 4RAIA 2PZSA 1REEA 4IV3C 1KMIZ 1FJGO 3FBYA 5LHHA 4DO2A 1VJ2A 4MW8A 2VL4A 3RFRA 3CCRV 4Q0PA 4K8ZA 1AVBA 1KRIA 1E1RG 1CEZA 3E2EA 4GX1A 3M4FA 3LOIA 1I1EA 4JF3A 1SQ4A 2R042 5D8AA 4C0HA 2YV8A 2BE3A 2DCZA 2P67A 1UWWA 3O1OA 3RWNA 3UV9A 1NXMA 1CZTA 3DXRB 5LBQA 2Y6JA 1AR61 1S0DA 2JG9C 4XURA 2WFF1 5IVBA 2QNKA 1SQXH 5LBCA 4CP9B 1ODNA 3VB9A 1WCUA 1H2LA 5JUVA 1Y67A 2WWUA 5LY2A 4IUGA 1IQAA 4OMCA 4K40A 4AI1A 4MXWB 3ETPA 4LWSB 2L6LA 2A6XA 2WZ8A 3T4ZA 4QPGB 2YIBD 3LPGA 3KKYA 2ZZQA 4G28B 1SQPH 3B9IA 4XVHA 4Q4Y1 3J9SA 3B8NA 2DUQA 1N8RW 5J7MA 3W7UA 3T2QA 3SYAA 4XETA 2F17A 2VM9A 1LEDA 2R0HA 1UJWB 3B00A 2VMIA 4COVA 2RS31 1W3VA 3HQRA 1G86A 2WNOA 4JTDB 2BGPA 1F4AA 1W0NA 5FZ1A 4TYSA 3OEEG 4AL9A 1IURA 1QJY2 1BS3A 2HHHB 3AJYA 4KNCA 1SF9A 4Y1ZA 5D1IA 2OT5A 3ZBHA 4ZOLB 4UFKA 4QPIB 5B4XA 2Y8KA 2K9ZA 1ZZ6A 3LUTB 3K5LA 4OX9O 4DV4B 4X6QB 1PMHX 4AFDA 2R49A 3CL1A 4L8QA 1CXZB 5JDBA 4AI0A 5FPVA 5FBJA 1WW6A 1XNTA 1QLNA 1XEQA 5HPOA 3RZKA 2CU5A 5K0UC 1OOPC 1AYN2 2JE9A 2A3QA 3O1RA 2UY9A 4YG3A 2VY0A 1OQ1A 4CZSA 1YWKA 2CK3G 4OLLA 1K34A 3JBG1 1VBB1 2OXBA 3MUY1 1AX0A 3JD0A 5E89A 2AZ2A 1SHWB 3RMYA 1QJZA 2YHJA 3K75B 2DVBA 4BW5A 2BSKA 2HWF2 4CU7A 3A21A 3WB0A 3AB0A 5FZAA 5AC92 3OBTA 4FQZA 1YEWA 4LO8A 2AH2A 5K8SA 4YG0A 2DJVA 1W6MB 5KA6A 5LBEA 1TNFA 3BAAA 1IZ3A 2YIDA 3N9MA 2JGDB 1OLMA 5A6XA 1P49A 1K8AW 4H3WA 3H8RA 5JZGC 5DDJ2 1X8EA 1OD5A 4E9KA 4JI5B 4I9WA 1OC1A 2EAKA 5JXGA 1RUI1 1YJ9V 1OCOB 2RV9A 5LWBA 4LBQA 4C1WA 3KV4A 2LO1A 1RUD3 4NHLA 1NLRA 1HXS3 1RUE3 1GO3F 3R4DB 5KMGA 2XKPA 3AKTA 4LBMA 2QQIA 3VDDB 4AVTA 4IL6Z 1W9WA 5F3GA 5FZOA 1J3PA 4HT1T 2ZE7A 3WG3A 3VOUA 2RDQA 4DRXA 4O4IB 3ENRA 2IBZH 2ZGNA 2B9UA 1VBE1 4YW7A 3UT5A 2WABA 4B1MA 2XR4A 2ARXA 4FAGA 1UYPA 2RJLA 1S2BA 1OD3A 2Y6GA 2PI4A 4OUSA 1ASJ2 5BNPB 4BK4A 3ZM8A 3PJSK 4CC6A 2QJVA 4X62O 4R4ZA 3ACFA 3HBZA 5FMOS 4YJ3B 5F3EA 2XVKA 4M4PA 5JOXA 1BSMA 4HG6B 4DW1A 2ZEZA 4DW0A 4D7TA 4FXGB 4LIUA 2HWD2 3ZN6A 2TBVA 4JI0O 3HIFA 4KH9A 2IW5A 2WO3A 5C7GA 2J1AA 1CAXB 2YEVA 1CWPA 2C1FA 4BB3A 4XACA 1OF3A 2O14A 3N9PA 4Q6GA 1L3JA 3VUOA 3V0AB 1WCDJ 4ZPIA 4NIHA 1HJGA 1BL8A 2GP5A 2PELA 3DCQA 4EEQA 4G2KA 4DXSA 5A3PA 3O1UA 4IYHA 4DR3O 2B42B 3SH3A 2P4VA 3RSJA 3ABKC 5CA1B 3DPRB 4AVSA 1O59A 1TGOA 2J1VA 3D36A 3LSQA 3VDAA 3JAWB 2BBVA 4NJ4A 3URFA 1IS3A 1XL4A 4JI1O 4YIOA 3BOPA 4B1LA 4PF1A 2VGDA 5LASA 2X0LA 4BQYA 2WWJA 3B2EE 1ULOA 3DYMA 4GJYA 3BIEA 3VD9A 2HEPA 1JFFB 3POJA 3B4SA 2Z5UA 1J3QA 4DYLA 5CG8A 3DGEA 1ZTEA 2JD9A 2WZR3 1Q6IA 4KG8A 4XFAA 3FLTA 3S3XA 1W06A 4GKKB 1NCQA 4RHV2 3RZZA 1ALYA 3TK1A 3GVMA 4C1XA 3SQOA 1SBDA 1RPRA 3AK3A 1YC61 2LW8A 3CC7V 5JCTA 1ZBE1 4LPLA 2CTWA 4ATFA 5JJNB 1KECA 2NMOA 4RWUA 2UUCB 4YPJA 1AI5A 2OA2A 2WSVA 2YROA 3KZIZ 2P1BA 3KMHA 3AG2B 4WM7A 3UJOA 4CUBA 3KQ4B 4G3YC 3H1LH 3WB1A 1GWMA 1RJ8A 2EULA 3ZMUA 3CXCU 3WZ1A 1FOD3 1W0PA 2EIDA 1JW6A 1DDLA 3N7MA 4B08A 4MVQA 3HKBA 2XWJB 4X1KA 1FMD2 5JSOA 1NQTA 3PN1A 4XILA 3QD6A 3LDDA 3ALQA 4WFEA 4YW4A 5JQGB 2R1DA 3LNMB 4WM8B 4C7UA 4IEZA 2JICA 3JCZA 1DK1A 4Y1UA 2H8PC 5AG2A 4N8MA 3ROUA 2R0FA 4K0KO 2Z69A 1QOSA 3L73H 1U5ZA 3J7MA 2OT7A 5KHGA 4PA3A 4MYEA 1R1A1 1LAJA 2PHWA 2JG8B 4X20A 4LR4A 2RNBA 4QX3A 2F23A 1VLNA 2RJ2A 1M90W 2P3IA 2ARAA 1LKNA 3WDTA 2MPFA 5JCOA 5LBBA 1HRI3 5C4WB 4ZU4A 3DXUA 4NTWA 5A7OA 1SLBA 2FDIA 4C91A 3WDYA 3WQBA 4RR3B 4TV9B 5HCFA 5FP3A 4BIZA 4NN0A 4KG0A 4LKFA 4ISRA 2X53S 1Q8OA 3WP4A 2O1QA 3D36C 3OB8A 3VL8A 3IM0A 3STLC 2IJKA 4GYCB 1GRJA 1Z78A 4PT6A 1UCXA 3M8AA 2H0BA 3WY6A 3H3ZA 3ZKUA 5JOWA 1J83A 4DV6B 4JVAA 2QZ3A 1ND3B 3U14A 2VOTA 4AFAA 1O7FA 5LP6A 3QLQA 3KVAA 4PQ9A 4IQPA 5CISA 3TEZA 1GM9A 5B3SB 3AKQA 4FXKB 3CS5A 4RFT0 2X29A 1G9AA 1RUOA 3CJIB 1WD3A 1H1MA 3BVCA 3ZYGA 5J98B 4F83A 2WRAA 4PHZA 1GNZA 1EN4A 1COV2 1XNQB 3CEWA 3BHPA 2OYZA 4UV9A 1JJ2U 5A3OA 5FYZA 5FDBA 1JHNA 2ZCWA 2DF7A 4JGZC 3VDCA 3J7LA 3ZRWA 1IG3A 1YXWA 4WM7C 4CDXB 4GALA 2PN5A 3BODA 2W39A 2YPDA 2PHLA 5FWJA 2YBSA 2UUBO 2RS52 1LGBA 3OPWA 1QJU1 1MEC3 1SA0A 4HVQA 4OI1A 1R081 4ZHQA 1QU7A 4XDLA 5FZIA 2ZT9B 2KQXA 2RG4A 3EVKA 2RM21 3HR0A 1OHFA 2VCCA 2ZEXA 3VHRA 1O3RA 3M70A 1ND2C 1AI7A 3BTXA 5K1XA 2YUEA 2YSUB 1I94O 5EJ1B 1AP6A 1AILA 2QKCA 4K1YA 1UPSA 2QDOA 4UV8A 2VXRA 3N3HA 1V55B 4Q0QA 4J11A 2NN4A 5KHJA 5CBFA 1RUG2 4OGQB 4E4DX 4CA9A 1SG3A 2DYRC 5DEDA 3GB7C 3OF1A 4J80A 2RCVA 2RJZA 1V70A 3AMHA 4ZU5A 3NV2A 4BIFA 1XBFA 1N34B 3JALA 1OURA 1PZ7A 5FL7G 5JCOC 3EHBB 1PIV3 4OPAA 2VOKA 4QJFB 5ACA1 5EFUA 1PP9H 2VPVA 2OCCC 1PGW1 2FZ2A 2W94A 1HX6A 3BA9A 3U4XA 4PDRA 1I3HA 4BIOA 1N3PA 1ZL8A 1XNRO 4JV5B 1NCRC 2ET1A 4UBHA 2Q8DA 2P7TC 2QQNA 5EXOA 4ZS3A 4HOOA 1J5EO 3C2UA 3N9NA 3NV4A 3UGHA 4ASMB 4AVBA 4JKKA 2LTNA 4RGKA 1DZTA 2ZKNA 2JECA 1JU4A 1EP0A 1OCRB 2Z3YA 3HOBA 4XBLA 4P9LA 1MS9A 3IPVB 2VNGA 4WVWA 1LUWA 5IHRA 3H8XA 1J59A 3MD0A 4J41A 4KP4A 3ZR6A 1WP7A 1UOJA 1I5PA 4OI2A 1O4ZA 3I59B 2EVXA 3L74H 3FLPA 3HKDB 3VQVA 1ULPA 1H2SB 1ZBA1 3MHZA 4YVSB 4NRMA 2DURA 2OTJV 5LB6A 3RZJA 3P5BA 1OI6A 2OUJA 4GMP0 3W59A 1CPNA 5CKQA 5CIRA 3MV11 3MGUA 2GDSA 1UZ0A 5CFDB 4RQPA 3VD4A 2PTMA 1ZX3A 2VUDA 3POFA 4DUYB 2UXBO 2EALA 5F6LB 3V65A 3I8TA 1U97A 4PDWB 3VBFB 3M3QA 5FNVB 4LF4O 3E6DA 1PK6C 3SHRA 4J42A 4UAPA 1KJLA 1N33B 1SBFA 3VBUB 2Q68A 2DMXA 2ZE8A 4J7ZA 4AEDC 3Q9OA 5I8SA 1KC8W 1Z7S2 2E3CA 5C8CB 2PF4E 3H0OA 5K1PA 2E76B 1GSLA 3WHUA 5FO9B 3AP9A 4XUOA 1AZDA 4LNUA 3L9JT 4E4EA 4GZ9A 1VQ9V 4BOWA 1RUH1 1C1FA 1WMXA 2HYXA 2Q4PA 2LQTA 4NPLA 3T3YA 1VMJA 3ASOC 3I55V 2EIJB 4AYUA 2QZ2A 4NPMA 3CCVV 3N9QA 4LOTA 5FZBA 4CS2A 3ZN6B 3MW3A 4AQ2A 1RVF2 4B3MB 3THPA 2A3WA 3FAVB 4ASUG 4X9QA 3WW2A 2JENA 3QO7A 5FOJB 2IFRA 3MIBA 4JKMA 3UYJA 3WV6A 2DCTA 4QKBA 3JSLA 3CEIA 2XLAA 4ZZ5A 4BAYA 2WSSG 1Q7YW 1RC6A 1V9U3 4TLGA 5BNNA 3SGIA 3VBHC 4UYBA 4P14A 4I09A 2A1XA 3G80A 4Y5TA 5FYVA 2EINB 4O4JB 5A3WA 3ZXLA 1JJOA 4B29A 3WP5A 3IZOA 1Q6HA 1IOAA 2D93A 3OUFA 5LA2A 4CE8A 1X33A 2D44A 4YVWA 1UD1A 1XQ8A 4HPKA 4JTNA 1AR81 3B93A 2D98A 2ID4A 3WG7B 1JMKC 1W9SA 3N4MA 2OCHA 4I5SA 2B45X 3ASNB 3QO5A 3HJRA 1KFUL 2AENA 1Y66A 1YTFB 2ZA9A 1W8FA 2HKOA 3CRAA 2D5HA 5FPAA 1VMGA 3OGRA 5LA1A 4CDWB 2HKXA 2JXAA 1RXGA 3FB7C 2K1EA 5BNOB 4CCLA 1BVP1 1DYPA 2JDNA 2VVEA 1NJIW 3BFRA 3M3CA 5C9AB 1UZWA 2XOKG 1HRV1 1QQP2 3LE0A 3WEZA 3K9SA 3JZVA 1A78A 3K5MA 4IERA 3ZYPA 3JD2A 4URTA 3K08A 3ILRA 4RQPC 5E8AA 3SC7X 4Y3OA 1TME3 4U2AA 1BEV3 4PLOA 2C9AA 5AFBA 1JBCA 5HCAA 1M57C 1EM1A 2A6YA 2HVJC 1NH2D 4SLIA 4AG4A 1IBLO 3K77A 4ASKA 4Y1VA 3UESA 2JJ6A 4N53A 4MVUA 1POQA 2FCTA 4G27B 3D3QA 1D2DA 3INAA 4QDQA 4P2ZA 1I9RA 4JTOA 5FZ8A 1PVC2 3RI9A 4TQFA 2WLNA 3RYFA 3WB2A 3AYDA 1W05A 2XHKA 1GZWB 3LEKA 4V2VA 2UWAA 2D40A 2G9GA 1LU2A 1SZBA 1YQ2A 4QX8A 3M99B 1LTEA 4Q8KA 1PNMA 1R64A 5FZCA 4L87A 1M5IA 1WB7A 1T6BX 4LBNA 4XDQA 3I2GA 1BGYH 1H8TA 5HFMA 4Q4V2 4I3GA 1IS5A 3JQXA 5FAXA 4DO0A 2LM3A 2QWPB 1JXNA 1VBD2 3UO3A 3B77A 4ARYA 3KLSA 4D6RA 4IL7A 2PXJA 5CA3A 1K5JA 3PL0A 2XMLA 3N9LA 1WPXA 1ULFA 3E22B 3RGBA 2VH9A 3USUB 4JRLA 3TEWA 3OR6C 2YS8A 1N36B 4QMAA 3WF3A 5IWAB 2ZMKA 5CB4B 4XYXA 1EY2A 5I0SA 3WNMA 2HJDA 3CQOA 2MEV2 1W99A 1PNFA 1ZA4A 3VBRB 4F8AA 2X6AA 5BNNC 1M4WA 4D69A 2PAMA 3V56A 3PUIA 1RSOB 1QJX3 4XFBA 3LDEA 2X6CA 5FQ0A 4GB32 3HR9A 3LDCA 2RMKB 3E8FA 4UFIA 4KGQA 2WLIA 3K4AA 2E7QA 5FK7A 2RR11 3TGUH 1Q56A 3DYPA 3WNOA 1DGRN 5E88A 1CAWB 2ET7A 1QDCA 5FZ4A 1MS5A 3M7MX 4LBEC 1SDWA 4Q0UA 2ADDA 1MA1A 5C70A 2P06A 3H7JA 2LP7A 4H13B 4BIUA 1AL22 3CZUA 1V6MA 3RZLA 4P08A 3Q8EA 4CYDA 3CCQV 3O0XA 4YNIA 2RN9A 3ZIXA 2VRZA 4QKFA 1FD9A 2B46X 4JI6B 1J3RA 4LT5A 3HKCA 5K9YA 1JZ2A 3N2GA 5A32B 4HYOA 3OPTA 4XBQA 1JYTA 4OZOA 1H6XA 1E5IA 4DV1B 1GQHA 5F2SA 2GUZA 4CCMA 1DGWA 4BQ3A 3B3QE 1N3QA 5DABA 3ZYHA 3C3SA 3K3WA 2BU9A 3QH6A 1DIWA 3Q4HB 5FZ0A 2AHYA 2DWEC 1DQ5A 4Y20B 2DVAA 2WNVA 5L9BA 1DCSA 2WFPA 1C8NA 2FMDA 3BKZA 4IGQA 5E1RA 3ETDA 3K0DA 2VW0A 5JXJA 5L36A 1PNGA 4BCUA 1RUE1 4LNVA 5DAWA 1OCZC 1FXVA 2EIKC 5EPAA 5JIAA 1RMU3 3TCUA 4DUWA 2E63A 4CPBA 4LH7A 4DUXA 5IVJA 5G05L 2Q6AA 5I8TA 2FDFA 1VARA 3HB3B 3A22A 4N43C 1X7NA 2HFEC 1YQCA 4QX5A 4XTMA 5L73A 1VE0A 4W4KA 4AHWA 1H8TC 2ZHLA 1MR5A 4MVTA 4JI2O 3C3VA 3RW0A 2C9KA 5LBFA 4OFGA 2JDAA 2FZ1A 1AYM3 2UUAB 4LFBB 2WLHA 1YNAA 1PO13 2ZHKA 4CP2A 5KAIZ 2XGXA 3A0HZ 3KV6A 2GC0A 1AR62 5EZYA 1M1KW 3B40A 1Q8QA 2N74A 1A8DA 4BISA 2WFF2 4GX2A 1WA6X 4XJUA 5E16A 3I2KA 3A0KA 4S2HA 1ZUQA 5JI9A 1DGSA 5FP4A 4FTBA 2K46A 3IMNA 4J1XA 2IJHA 3AK0A 4XFIA 3H9VA 2OIIA 2EIEA 2VR4A 3VBOA 1W3XA 1CZVA 4BLIA 2GH2A 2W87A 1LOAA 1N0NA 2BNNA 5IJRA 1YJKA 4Z1VA 3BPZA 2PLV3 4AWDA 4R52A 4FPOB 3RYHA 2YMZA 2B5HA 5LEJA 5A70A 1GKFA 2YG0A 4AHZA 3PURA 3ZOIA 4UFLA 1YLLA 2RS32 3GWOA 5L7OA 3VQXA 2ZGOA 4B3NA 4LHLA 4IEWA 1P84F 3I2IA 1XE7A 3D5OA 4JDNA 2DCKA 4CC5A 4HKLA 1ZWIC 2WLMA 5A3NA 1AVMA 3U4SA 1BBT3 2VC9A 2DWDC 2HWF3 2VZUA 1JTZX 5AC93 4NRQA 1IKQA 4CDQC 3LNNA 3NJYA 1AR5A 1ZZCA 1QVGU 5LK7B 4UBGA 1PHMA 1FAFA 4P9PA 3CPWU 4FM2A 3KVBA 1UOBA 2VMEA 4MHRA 1QBZA 2P3JA 1SESA 3WQ7A 5IFPA 3FMGA 3JARA 4MTOA 4HVOA 3LFMA 3GZTB 4PI0A 4GMP3 1HDJA 2DTWA 4UOJA 2JEXA 4XF4A 4OZXA 4AHXA 1F7YA 3JBG2 4W6WA 1VBB2 3GXUA 2E53A 2Y69C 2UY8A 1H8VA 4DR5O 1VQ6V 4UCUA 4KMQA 3VN4A 4JI3B 1QLEC 1CN1A 4DOUA 1JCHA 4B3SB 2VAUA 2I07B 1QH6A 1N3OA 2CWSA 1FOD1 4IEUA 1TVGA 2VS0A 4DR4O 1HR0B 1VQLV 4CP1A 1NTZH 3C90A 2XTAA 5BYNA 4NROA 2RHPA 1LNSA 2R061 1KKDA 1KJRA 1AXKA 3P1IA 2OVUA 3FE5A 1J95A 4L11A 1RUI2 1US6A 4DR1B 1D4M3 4LA2A 1OCCC 1XU2A 1REFA 2KM2A 2DTYA 1IPSA 1KYOF 4IE6A 2ITDC 3VZNA 2IXHA 1ODMA 1RUNA 5FY5A 5IVVA 3UT0A 2CV6A 1Y74B 5J2TB 1S0EA 4NKGB 2ZQMA 4FPJA 4K3UA 2HWD3 2QQVA 4MTXA 1E5SA 2XDVA 3RZGA 1DF4A 2JWPA 4JRAA 2AEYA 4LO5B 2PHRA 1KEXA 5AVPA 1BK0A 1RUC1 3AL6A 1GLHA 4QPJA 3JAKA 4BQXA 4WVMB 3VBOC 5EJ3A 4QXBA 2A71A 4MGKE 3OCPA 1VBE2 4X66B 4E8CA 2F6BA 2VTFA 1W6QA 1ZYBA 4WVVA 4GQ7A 4NTXA 1FXZA 1LULA 3ZFFA 4IETA 3SPJA 4AVVA 4FQ4A 2J42A 1TVKB 4N90A 2V4AA 1W6PA 1AROP 5EIBC 1GNHA 2QM7A 2PHUA 2O8OA 3S7EA 1VBA1 3WNKA 2VUJA 3LOBA 1KS5A 1YRZA 1N4CA 3POIA 3GCWA 3ZDSA 2R30A 4XHBA 1WMFA 3WSOA 5KX5A 3VZKA 1S1AA 2IXKA 5JZGB 2VQUA 2DV9A 2GAUA 2PFWA 1RGSA 3ZSMA 4FFBA 2MW2B 5FYYA 3O9OA 1PM7A 3E35A 4M3CF 2WA4A 2X10A 1AX2A 2P6JA 2W3JA 5A6YA 1W2OA 2JDUA 3N9OA 3D3AA 1XYPA 2OPKA 1MQTC 5FUPA 4BMBA 3FUQA 2Q9LA 2Q73A 1UN1A 3JATA 2Y38A 3TXQA 4A42A 2IXIA 3MPPG 1ZM1A 5H2FZ 4NAMA 1OMIA 2BTVC 1B35C 2ZBJA 5FRAA 3ZFGB 3FFZA 1QXRA 5ABJA 2UUCO 3THCA 2ZNJA 5FYBA 2OQ7A 5IW0A 4HSJA 4YGCA 1MEC1 2HP8A 1M06G 1I5ZA 5FZHA 2YXHA 1ENVA 4BQ4A 2EXIA 5J1XA 4PIZA 4W65A 4JGYB 2B9VA 2VMFA 4AQYO 4R50A 1V54B 1JHJA 3NJVA 1RUJ1 5DMYA 5JOYA 1OH4A 1ULGA 3N2KA 1WN7A 1ZBE2 4FCAA 2BTQB 5CN0A 1GQGA 4NR1A 1LEMA 4IEVA 3QACA 4Y22A 1MS8A 1AXYA 3ZXFA 3DF0A 3A0NA 1P7BA 5LOVA 4LKEA 4PA7A 5FR3A 4YGDA 5T52A 2QDRA 1JPXA 2LW1A 3OFNG 1OUXA 3ABMC 3AYAA 1PZ8A 1HB4A 5C5TA 5CBHA 3S3WA 3C7EA 1U5YA 3ECQA 2YI8A 5LXTA 2QDNA 2IC1A 5GLZA 5FZ9A 4A6SA 1VMFA 1S0BA 2BCCH 3FC0A 5DN2A 1B04A 1EYBA 2GSYA 3PU3A 3AC0A 4UW4A 1PIV1 3EXAA 4DK0A 1YJLA 3ABKB 1KQRA 2BFUL 5DG2A 4HMZA 3JB4C 5D2AA 3H1HH 5LA6A 1R3LC 4DV5B 4YY3O 4DR2B 4FOYA 1LB2A 2E75B 1NA1A 4KFMA 2A6WA 1A3KA 4QHBA 4XQDA 1POV0 4BQWA 2CH7A 4E2GA 3B01A 4WV8A 3CCSV 4RUFA 3TWIA 1MVQA 5FZEA 1HLCA 2JS5A 2VBPA 1S3JA 1R1A2 4YZ2A 1REDA 3T0BA 4K3AA 1XILA 2ILMA 3TXSA 1HNWO 1CIWA 1JYVA 3VD3A 1YZBA 4LF7O 2N04A 1BQ0A 2W08A 3JASA 4LR3A 2VNRA 3ETQA 4DV6O 5F7UA 4INDA 4MZUA 1KD1W 3ABTA 4Y5SA 4MS2A 2XONA 4ES8A 3N2GB 1W0JG 2E5LB 4UF0B 4B8EA 3NKGA 1SERA 1O4YA 5ERLA 5L3BA 2GBOA 1R3JC 1QOOA 1GV9A 3THOA 3ZMSA 1I6XA 4M4RA 3R0RA 5JXIA 1JYCA 2ZM6B 3NO8A 2W92A 4PDVA 3T1YB 3NW4A 1K3EA 3I2FA 1SFNA 1DU3D 5A7QA 5B1NA 1JS9A 3AYCA 3BOWA 2UXDB 4MG2A 1NVPD 2XQRA 3K79A 2XLFA 5IJ0B 1W2AX 5ABJC 4UVBA 1Q8VA 1XOUA 2JKXA 4LO6B 4FIPC 1KKCA 3ZMZA 4HVRA 3QBQA 1SQGA 4FLTA 2XAJA 4XAEA 1AI6A 1IPJA 1G9DA 3MIEA 4DUZB 1GOGA 1FKAO 3F2ZA 4KGGA 3WQ1A 2ZMLA 1WLEA 2CTVA 1R1BA 1H30A 5EYYA 1AR1B 3RYCA 3MICA 3PUQA 5KA5A 2DFBA 5KC6A 3CDZB 5BR8O 5A33B 1AR4A 3G71V 2H3OA 2NM1A 2W52A 4H33A 1LENA 2VO5A 4BH9A 1K92A 3AVSA 2KG7B 2JKBA 3FD9A 5KUKA 1HIXA 2F4PA 5EQUA 1QJU2 2VZOA 3GBWA 5BXZA 5F6KA 1R082 1U12A 1EUUA 3L71H 4ZU7A 4A6OA 4CCCA 2J22A 4PV1B 1FYJA 5A80A 3DXRA 4IEOA 2Q8EA 5IT9N 2ZZJA 3NNFA 2NP0A 3IFXA 1D7PM 2ZGTA 4UCTA 4XMAA 2FDKA 2CTPA 4YGBA 4RN5A 4CP9A 1NA1C 3RYHB 4CDUC 2AYHA 2EIMC 3ABLC 1VQ8V 2WAOA 4CH5A 5B1AB 5LMNO 3EMRA 4JV5O 2RMU1 3RWKX 4EZ4A 4MXWA 1K4DC 1LOFA 4FOQA 4LWSA 4EZHA 1SLCA 4FM0A 1SDDB 2W0FC 2BV4A 2C26A 4QPGA 3OTOO 1BJQA 3OTFA 4O9EA 3QG5A 3AG1C 3GHNA 1OA3A 2H0VA 3T2TA 5GTHZ 5GLUA 5FPLA 5JPNB 1RPOA 5ACA2 4HKOA 5A6ZA 4UI9L 3TN93 4HXCA 1ENXA 2E31A 4FOVA 1KFXL 2PMWB 1IG0A 5FYHA 1MS3A 5A3MA 3LB9A 1T2XA 4JGZB 1S5JA 4MVSA 4I30A 2N05A 1W0KG 4MVZA 3MFAA 4UVCA 4IEQA 4CEYC 5CKNA 3GJBA 3A0BZ 4DPNA 2B8MA 4JI4B 4GWJA 5I91A 5T55A 3HVDA 4WZFA 5LMUO 1TME1 4QPIA 3WG4A 3IJ4A 1BEV1 2Q5TA 5LGNA 2GNMA 1EZJA 1UZYA 1I5YA 4Q20A 2CUGA 1QEXA 3SYQA 4PA9A 4CUCA 2WT2A 1PMIA 3DV8A 3TBDA 2R16A 4OHWA 1K5MB 2D6OX 2XWBB 3O7OA 2DVDA 3VL9A 4IV1C 2R70A 4EJRA 1ZBA2 4BXFA 1ND2B 1DYOA 4W4LA 4LF8B 2KB1A 5BUVA 1GN6A 2CTRA 1D2QA 3BPSA 5E1AC 1S72V 1HV0A 5H9QA 1KQSU 3Q8FA 2DYRB 3I7DA 3ZKYA 2Q4SA 1VRH1 2VOVA 5CMUA 3BY6A 1DHKB 1UF2C 3FYEB 4BW9A 3LSSA 3I49A 1OJHA 2LJ2A 2CGNA 1W6MA 4I9QA 2ZX1A 4NXMB 3J7NA 4ZBMA 2R073 2JGDA 3MF6A 2IFWA 3DN7A 1JA8A 5CKMA 4PI2A 4JHZA 1RVF3 5ANNA 3JB8A 4D3WA 4MGYE 4NOTA 2KD7A 1H1AA 4E4HA 4XFCA 3JYCA 4B4RA 2XPJA 4DR6O 4FPKA 3CC2V 3FX7A 1X8MA 3C7FA 5FP7A 4B3MO 4QU1A 4XFGA 4QNHB 2BFUS 2E7AA 1RHI3 3BTYA 4U3JB 1AR91 1SQFA 1NAEA 2DW4A 3AXEA 3VDDA 3FB8C 3OEHG 4Q29A 4Q27A 3POBA 1RUH2 3R4SA 4DXTA 2Q69A 2UU9O 1QJX1 2ZAAA 4Q26A 4FMTA 1QH7A 3NL1A 4O4IA 2DYCA 1XE8A 1O6UA 3E6CC 3A7QA 3MHSC 2P17A 4AGVA 3ZXJA 1DLLA 1Y43B 3VZLA 4HKWA 1SLTA 1VP7A 3J8F1 4DV2O 1UL9A 4AZZA 3LA2A 1UU5A 2WBKA 1XYOA 3I54A 2LW7A 1UIJA 4YJ3A 2ZKOA 5F3CA 1RB8G 2A75A 3MBWA 4UW6A 1QQP3 1IBKO 4GKJO 2D3SA 2HH9A 2WS93 3RYKA 1SS3A 5LRSA 3ASIA 2ITCC 3GBGA 2VQEB 2JIJA 5F5CA 2P34A 3HAGA 1CAXA 1PK6B 4QPIC 2ZGSA 2ZMNA 3ST7A 3BALA 3AFKA 1K42A 4B3RB 2D43A 3V0AA 4WBBA 3C7HA 4YGEA 2BDRA 2QR4A 1AR82 4I7ZB 1UY3A 2GALA 3HQXA 3GJAA 3HT2A 5FMBA 4QHZA 1UU6A 3RG0A 4AEDB 4GZRB 2C5DA 1PVC3 3P3NA 3SYPA 1FJGB 3A0RA 2XOMA 2QQKA 4H7MA 1XPWA 3MPBA 2D2CB 4QXKA 3DPRA 4JDMA 2DVFA 4AGGA 2Q1FA 2EILB 3E86A 3OGIB 3JAWA 5FPUA 3OOXA 1PKXA 4PA6A 1RMU1 2QSAA 1OT5A 4WBNB 1HRV2 3PHMA 3N2KB 3ASOB 2YB7A 3N7JA 2QQOA 1NLQA 3SCFA 3DECA 3ZYRA 1JFFA 2AGSA 5J3UA 1FYUA 3O1VA 5F37A 4AQSA 3SKJE 4Y22B 2NLJC 1VBD3 1Y6XA 5KLVH 1UY2A 1AYM1 5CA0B 4N7UA 3E8GA 1PO11 3UL2A 5LOVB 2TEPA 5FFOC 1U96A 2R72A 2Z42A 4PIXA 1YFXA 3FZ3A 1VQPV 1E57A 2UXNA 1BQPA 2P4EA 5A2QN 4FJCC 1BMV1 3GWKC 4IEXA 1URXA 2XG3A 2Y26A 4I4TB 3VBHB 1TMF3 3LSDA 4XHXA 3C7OA 5IVFA 3WDUA 3Q8CA 1G9CA 1CX4A 1VBC1 3VDDC 3L75H 1OPOA 2FCVA 4O4HB 4FFFA 1S0FA 2PLV1 2QUOA 1KD7A 4XZPA 1KP2A 3CHXA 4A44A 3I3BA 3ZHVA 2XUMA 5IK7A 4XEZA 3BYWA 3WNLA 3ZPYA 1WW7A 5CADA 3L2YA 3JAMN 1OXCA 3JD72 1OFSA 5JQGA 1FV2A 2GDFA 2PQQA 5BNPC 1POV3 2ENRA 4LBQD 3OGGA 4HANA 5B66Z 2EF6A 1QU0A 4YZ4A 3LDKA 5B1OA 1PGSA 3LIGA 1OFNA 5FIXA 3CZJA 1BBT1 1GK9A 1XU1A 4OX9B 2OTLV 4RS5C 1YXBA 4LORA 2GC2A 2QBXA 2JG8A 1M57B 3O12A 4CCDA 1W9FA 4YW1A 3EJKA 1JUIA 2P3YA 4KBBA 3SR2C 4FPPA 1J1TA 3POEA 4LBJA 4E8DA 4LUMA 5C4WA 1ZZBA 1LNQA 4QGLA 1UAIA 4IHJB 2RR12 5D21A 1WCSA 2R9IA 4DV1O 1YITV 3PLQA 2ZJCA 1VALA 1IGOA 4RR3A 4DY5A 1NU1H 1WLWA 4S2FA 3J26N 4Q4X1 3SEPA 4XFHA 1UXZA 1QJEA 2G1MA 2O0OA 1BHBA 2RQ6A 2EXHA 1GTOA 1WBFA 1OH3A 2WZEA 1HB2A 3OY8B 5A3TA 3OD4A 2RDRA 3IC7A 1ND3A 3AKSA 5DAVA 1ZRRA 3I3EA 3NAPC 3PIJA 1VAMA 2JDPA 4TUYB 2W95A 2V73A 1P7GA 3OGJA 3OT7A 4GH4B 5LGTA 5SV8A 3P6BA 2QQWA 4FVMA 4JCKA 2P2KA 2I45A 1OBNA 3CJIA 2HVKC 3IGAC 4IE4A 3ABUA 4YM2A 3AZXA 5GW7A 1D4M1 4EN0A 2SBAA 3B8MA 4QD2A 4CVUA 5AVAA 1W6NA 1LHOA 3WUCA 5JWPA 1S77D 1R093 2WNUC 4Y24A 1Q8PA 2WWSA 4CEWB 2VD7A 5BNQA 1PMJX 3OAAG 1PNKA 1JZ3A 2ZHNA 3AG2C 4CDXA 5JXHA 4DV7O 4XAAA 4WFAV 1FPOA 4IDZA 1IPKA 2P90A 1QR8A 2VTXJ 1HN0A 2QWOB 3OYWB 1YSCA 3OMIB 2LFSA 5A6QA 2W68A 4GT1A 3V64A 5LHGA 1AR73 4QX1A 4FAHA 2RS33 3USSA 2AZ0A 2RVAA 2DWRA 1TNRA 1W8HA 4JI0B 1Y9GA 4LITA 2ZOEB 4WM8C 5D5QA 2IWGB 4Y5Z0 4NIDA 1UYXA 1EPZA 4TWKA 4L0PA 5JSRA 2WQ4A 2ZACA 3OBRA 2K2SA 1MS0A 3N7KA 4XPVA 3KCXA 2X8KA 2VQAA 4WFBV 2ZR3A 3WXPA 2Y4UA 3VQYA 4A45A 1VB2A 3TAYA 4I0XB 2WYFA 1GM8A 4P9OA 4Y26A 4IESA 5FY0A 3VHNA 2JG8C 4F7ZA 1COWG 4AF9A 2JEUA 2Z4FA 1MPXA 4HETA 4FP3A 4NHXA 1VP6A 1H4GA 5JIUA 4NMIA 5KHHA 1K9MW 1NE4A 2WLLB 5JMOA 3ZHSA 2UXCO 4UCRA 3AZWA 2XAFA 4JYAO 4JC1A 4U7NA 1K33A 2GU9A 4RR3C 4OI4A 1OCZB 1AL0G 2CAZC 3ZX6A 2VQFO 1HDKA 4XZUG 2EIKB 4GD4A 1LHUA 3D3IA 1WBLA 4XIKA 3SPGA 3MDSA 3F7VC 4N43B 5CA6A 3ACHA 4NWWA 4XBNA 1PGL1 2VW1A 3ZFEC 3Q8AA 2UXXA 1DG6A 3FHIB 2EA7A 2GNBA 2ZPXA 1F51A 4JI3O 1F2NA 4CCEA 5IK5A 1NLSA 1IXMA 3IPVA 4MLOA 1QNMA 2FDHA 4P9JA 3VD7A 1XL6A 3DC5A 1W28A 2Q8OA 4BA6A 5J09A 1RUI3 3I59A 3S5AA 3HKDA 4EFEA 4LF5B 4Q8LA 2NQYA 4YVSA 4JZRA 1FXKA 4YJ2B 3RYIB 3W7WA 4AEJA 3APBA 2ZX3A 5D8AC 4JQRA 2W47A 2J1UA 1QHDA 5B1BB 4R4XA 5CG9A 1O3SA 1O8SA 5JJJB 3MF9A 2EBOA 3ZSKA 4TTGA 1WAZA 1VQMV 1NR7A 3ON7A 1OLRA 5CFDA 4R8CA 4KHPB 5APAA 1FOD2 2G9FA 5C71A 1B3QA 2QGNA 3B5LB 5F5AA 1LECA 5FYTA 4PDWA 3VBFA 2F4VO 5FNVA 4QM9A 4FM1A 1VBE3 2R062 3SYOA 4UWDA 3TEYA 1CPMA 2RE9A 3PDQA 4OYUA 1GKBA 3VBUA 1AP5A 4K0KB 3U10A 4GWNA 3MV01 2W0XA 2D3OW 2FDJA 4FPLA 4QQHA 3ZSLA 4XF0A 5C8CA 4KBZA 3VD5A 1V9PA 2ZGPA 3Q8BA 4AI9A 5L3DA 1P4RA 5C3SA 1DBNA 4QXCA 4ZHNA 2CE4A 3AM2A 4CDQB 2OIEA 1H2NA 1ZZ8A 2VCMA 4ZXKA 2M7WA 4ORFA 4H7LA 3ZPOA 1V55C 2VWJA 3SPCA 1RUC2 3D8CA 2RDSA 3DEMA 4FTEA 1XI1A 4GWIA 3VBSB 1TUEB 2WYSA 3WF2A 3OM3B 5JVDA 4LTAA 4COUA 3X2QB 2ZX4A 2CYFA 3IIIA 5J37A 3W7TA 3R66A 3SXWA 4JYYA 1W59A 3ZRXA 1RL3A 1GICA 5CB7A 3SJBC 4CCJA 1US3A 2ZXWB 4GKXA 4FTSA 4RGAA 3FAVA 4QPWA 1LOCA 4Y33A 1JZ7A 4B7EA 1OHHG 4TV8A 5C33A 1LOGA 5IT6A 3SPIA 4MV2A 1QLEB 2F4LA 5I0TA 1VBA2 2E51A 4XF3A 4WFGA 2Y6LA 1C8M3 1NS1A 3OR7C 3QVNA 4GUNA 3FX3A 1G9FA 4XW3A 4IGGA 3M3EA 1ULCA 3SJCC 3UNPA 4AILC 4IE5A 5A7WB 1ZLZA 4O4JA 2R9AA 2D6NA 3CKHA 5J2UB 2AC1A 1OCRC 3QF7A 1XYNA 1O4TA 1GZ9A 3CJHB 3I2HA 4M00A 2YU1A 1U5IA 4E4ZA 5IE9A 4EN7B 2Y60A 3DGTA 4NTYA 3E6BA 1E1QG 3ITQA 2ZR2A 4UCOA 4PDMA 4BZ4A 5IVEA 2OS2A 1ZBE3 5IAVA 4I3PA 4CDWA 4H55A 4ISQA 3PMEA 1Q8IA 4MVOA 5BNOA 1V6JA 3K5OA 4H0LB 2NYYA 1ROPA 5C9AA 5G04L 4EB6B 5ITZB 4P5YA 4XCAA 4EWAA 1NTMH 3GHMA 2PGGA 1Y76B 4MADA 2HWB1 5FBZA 1MEC2 1UOGA 3NWKA 4FK5C 3UK9A 2DN9A 2RDCA 4L9BA 4PDWC 1PO23 3OGCC 1L7RA 2DBIA 5EV7A 4FPHA 5JAXA 2MNGA 4JAUA 3QTCA 1XRUA 1NH2B 1I94B 1RUJ2 3F5TA 4YLZA 3VBUC 3FB5C 2Q1ZB 1ACCA 2BW8A 4KXRA 3F5WC 4FPFA 4QX0A 4JDOA 2ZABA 3BN6A 3AZVA 3ZX7A 3RYPA 1GZWA 4NRPA 5F2VO 3K57A 1CJPA 4J9ZB 3IMMA 5E6HA 4LFAO 2JDZA 4QQ2A 3WDWA 2YIAA 4ARXA 1V6OA 1WWYA 4UCVA 3ZN1A 1R1A3 3POGA 3CIHA 2NNUA 2YXYA 5FPRA 5FTTC 3RZHA 2EIJC 1AHSA 1CJDA 4NXNO 1XNRB 2RJKA 1D5AA 1PIV2 4LFCO 1FAYA 5IVYA 3TN91 1J5EB 2V72A 3G67A 4DR7B 1QWRA 3L72H 3E22A 1QCEA 3USUA 4FO9A 3KV5A 2XQXA 1M93A 4IEYA 4QGPA 4L92A 4TZDA 4LBOA 3BI3A 5CB4A 1B35B 2PAKA 1X9PA 4MT8A 4MSWC 5EHDA 1WCQA 2JE8A 2FL4A 1FXHA 4QE9A 3WCRA 3POYA 3VBRA 1N0JA 3FUOA 1Q8SA 3N35A 2VZPA 5FY8A 1R73A 3E83A 4X65B 4BU2A 5F32A 3T1YO 1RSOA 1WLCA 2EINC 5LL6Y 3K59A 3VKFC 4D8MA 1JODA 3CCLV 3H7YA 3WW1A 5FLJA 4HN1A 2UXDO 2O8QA 3AMQA 5IATA 3NSTA 4MHUA 4IIJB 3BGAA 1CAWA 1Z5WA 4XDOA 1IDSA 1DP0A 3H3UA 3TJTA 3ASNC 3E8BA 5C5UA 2XUEA 2UXBB 3PIGA 1QJFA 2WO2A 1Y9QA 3VZJA 1N1VA 5BNOC 3MEPA 1NCQC 1HW5A 4YHHO 3BU7A 1ZRFA 5C9AC 1XHXA 2XBO3 5KR7A 3ZDVA 1W6NB 5A32A 1H9WA 1QF3A 1GN4A 1HNXO 5TISZ 4CRQA 4E2SA 3KQRA 1R6KA 3I97A 2C2AA 4DV3O 2R071 2CGPA 2WO7A 4XJ9A 1QOTA 1FT9A 5BMVB 1E5RA 4TLFA 2VOXA 1HB1A 1EPWA 3OG2A 3Q4HA 4AEKA 4J25A 3MW2A 3H1WA 4Y20A 1OKQA 3PTRB 5GLWA 3EXUA 2DU1A 1SQQH 4OUMA 4CCKA 4CS3A 3CRRA 2W5FA 1DLCA 2VULA 3QNEA 1HNZB 1RHI1 2Z0AA 1WLTA 4U36A 3MDPA 4NAOA 1BE3H 1VPHA 2D6KA 3O0VA 4CCOA 4RQFA 1K5SA 3HEIA 2ADEA 2VQ0A 5EP9A 1ZRDA 3TOJA 3ML0A 2X5IB 4A3ZA 4H14A 1BZKA 4UFJA 2G4IA 4P02B 2A6VA 3ACGA 1MZ5A 2E7TA 3AK2A 2YBKA 3VKMA 4GCZA 2OKXA 1BCCH 2XJVA 5FXVA 4IT5A 3AG4B 5ACA3 4LF6O 2FCUA 4JYCA 4CXXA 4HN0A 2HWE2 4JI8O 4EN6B 1M56C 5A3LA 3F7YC 3WP3A 2ZGRA 2W1SA 1KDMA 5FJKA 1ZZ9A 3CU7A 1YDXA 3AK1A 4AXOA 4BQ5A 1FPN3 2Q5ZA 1HB3A 2ZHMA 1Y9MA 3RT3C 2ERFA 2WC2A 4LA3A 3JCUZ 2RMU2 1QQP1 1H4HA 1SFYA 1H2MA 2MHFA 2VUCA 5LATA 3VBRC 2WS91 2A3XA 4BJ0A 5GZFA 3ZMTA 3AG7A 1YI7A 3N7LA 1HQNA 3JSNA 2E9QA 1LUVA 3U0ZA 3APQA 3RVHA 2FDGA 1AJOA 4PA4A 4CCNA 4P9IA 2GTAA 2J1RA 4AR2A 3M3OA 3MIGA 3BU0A 4IW3A 3THTA 1RP3B 3AMPA 1Q5OA 4ZZ8A 2GHYA 2LRPA 4X6RB 5HI0A 5LA9A 2BVVA 3MHHC 1DF0A 1LCLA 1RFYA 1CVNA 5LP6C 2KKWA 2RS13 1R6NA 2JB8A 4Q4W1 3FBMA 3ZEDA 1N32O 4X88A 2JDYA 4XJ8A 3VZOA 4EN9B 4I55B 2HJFC 2WL1A 1IBLB 3J80N 4BE3A 2V4DA 4FSJA 3ZHQA 1FXKB 1O3TA 1TME2 1NT0A 1BEV2 3UETA 4FLXA 4Q1PA 1EFRG 4COWA 4I50A 5DXDA 3MUZ1 1QDOA 3ES4A 4MVMA 3B09A 1VBD1 2IVIB 3C3TA 3MYXA 4KWLA 4B3TO 1NZCA 1VF7A 1F23A 3CB2A 4BWAA 2HEWF 4NXMO 3GNEA 3GGLA 4Q2FA 1CR7A 2OZJA 4O61A 4O9GA 2VZTA 2JK5C 2JE7A 4LXLA 3BIWE 5HXMA 4CDUB 2D97A 2EIMB 1BKZA 3ABLB 3AP4A 1W2BU 4OPHA 3I3QA 5JJEB 1TMF1 1TZOA 2XJQA 2DYSB 2ZEWA 1VRH2 4AE2A 4JKLA 3T1HO 3AZZA 1NTKH 1DQ4A 2CGOA 1XMOB 1JOYA 2DCJA 2HBUA 4OVEA 3MLJA 4PELA 3CCJV 1WA4A 2VOWA 2C4XA 4NIIA 1JMUB 2PHTA 4ABMA 2BEOA 4B4QA 1SPPA 2IH3C 2DUPA 2BOBC 2FKXA 3UKTA 5FV3A 5DECA 1WA8B 1NG0A 3DTUB 1SLAA 1TG7A 2VZSA 4NYKA 2HEVF 1Y3TA 3WNXA 5TSWA 2XVLA 5JVDB 1J1LA 3MIHA 5IY5B 4CEYB 4U3FH 4MTGA 2D3PA 4MTFA 1AR92 1Y74A 5J2TA 4X64O 1K5QA 2VECA 2DBNA 1BXHA 2EJRA 2JRIA 2MK3A 4FPGA 5C3QA 1GU3A 4TV8B 3K51A 4NE9A 3D4KA 5FXZA 1PV0A 4BQ2A 5LEKA 1AB3A 3K48A 1QJX2 1LHWA 1W8NA 4CPBD 2KSDA 5DAPA 4EROA 1BCXA 2VZ3A 2CSGA 4WVMA 1UXXX 5DZEA 2VZRA 2IU0A 4MXVA 1GZTA 4CSWA 2Q0AA 2Y34A 2QCSB 1AR83 2GC1A 4IV1B 2AUYA 1L7LA 3J8F2 2BPA2 2JS3A 2VU9A 5EC2C 4R6ZA 2EIGA 3WT3A 5H6QA 1TVKA 5C8YB 4K8RB 4H44B 4MGTA 3U37A 4JPRA 1ZAUA 5FZGA 1XNCA 4W6YA 4XMIA 3RVZA 3GYDA 1UYYA 1HRV3 3ZMOA 4JX0A 4D94A 3G7DA 3ZXAC 2WN2A 1RUF3 1NQJA 5IJ9B 4R9BA 1UYZA 1H38A 2P37A 3PUHA 5IK4A 2B1IA 3LDBA 3D6EA 4Y1XA 5FUNA 4IGPA 5JZGA 1BK1A 1TA8A 1XNDA 1UZZA 3S0MA 4Y4YA 5DUVA 4FLZA 1THZA 2ZD9A 2UU8A 4LP8A