5KHJA

Hcn2 cnbd in complex with uridine-3', 5'-cyclic monophosphate (cump)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
199
structure length
199
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cyclic Purine and Pyrimidine Nucleotides Bind to the HCN2 Ion Channel and Variably Promote C-Terminal Domain Interactions and Opening.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 67
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5khjA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5khjA02
4JVAA 3RZZA 3WW2A 5EZWA 5FQ0A 2N7GA 4XF3A 3CJXA 4D7TA 3FJSA 1FI2A 5C8WA 1EP0A 2IXJA 4J1WA 3O14A 3CL1A 2MPFA 1VR3A 4HZFA 3E6DA 2MNGA 2XKOA 3R6SA 1XE7A 4E2QA 5D1IA 4WBBA 2GU9A 4QM9A 4R52A 3S7EA 3UKVA 2ZKLA 2OZJA 3KSCA 2Q30A 1NE6A 1QY4A 2IXLA 1SEFA 3VHRA 1FXZA 3H1YA 4K8FA 2QJVA 4MX3A 1ZZ7A 1LKNA 3GYDA 5F1RA 4QX5A 3CLPA 3E5XA 3BU7A 3MYXA 4E2SA 2XGXA 2BNNA 4QM8A 2VPVA 1ZREA 3RYKA 2K0GA 2H0VA 5I93A 3HQXA 3H1MA 3LOIA 1NE4A 4FT8A 1VP6A 3PLQA 3SCHA 2ZCWA 3ACLA 1PMIA 4YARA 5T3NA 2PAKA 2PQQA 3HIFA 4KL1A 1O5UA 1V70A 5KHJA 3EO6A 4XFGA 4I3PA 4O9EA 1YUDA 2WFPA 3NJZA 1J3RA 2PTMA 2IC1A 4UXAA 5KHGA 2O1QA 5E16A 4Q0QA 5EFUA 1ZVFA 1J1LA 3N4MA 2GC3A 3SCFA 3PVBB 1DGRA 1H1MA 1WA4A 1WGPA 1RTVA 3FFQA 5FLIA 3BALA 2PHDA 2PAEA 4A2UA 4MGZE 1RGSA 2K9ZA 3DV8A 3TNPB 1PM7A 5JSRA 3OTFA 4Z82A 3WW3A 5KHIA 2Q0AA 1XRUA 3LA2A 1OMIA 4LA2A 5LRSA 2D5HA 1Y9QA 1RL3A 4MGKE 4DINB 4ZU7A 5I0RA 1O3RA 2OYZA 4YYOA 1ZZ8A 1X8MA 3FHIB 4IEXA 2UYAA 4CYDA 3NSTA 4XFHA 3I59B 3HT1A 2P17A 5FPZA 2IXCA 3HT2A 4JTOA 3SXWA 4N9IA 2HKXA 2DCTA 5LRRA 1YFYA 5BUVA 4Q0VA 4XETA 5JAXA 3G7DA 4NVPA 4UBHA 5J7MA 1RUOA 4BYYA 2CAUA 2I45A 1Q5OA 1UIJA 4XFBA 4Q0PA 3LZZA 5K8SA 5KHHA 3EBRA 4Q0UA 1DZRA 3I54A 3LAGA 3TNQA 3M70A 1DZTA 3KCCA 3MZHA 4PJYA 2GC2A 2BNMA 1H1IA 4KU8A 4XFIA 3NKTA 1U12A 3D82A 3ZDSA 3MDPA 4HLTA 1O7FA 1XE8A 2O8QA 4GULA 2Q4SA 5JSOA 5I0UA 3M3IA 3E5UA 3NW4A 2FMYA 4OFGA 3NL1A 4IEWA 5JCTA 3D0SA 2XLGA 3E97A 4IESA 3ST7A 4UBGA 2VECA 1OI6A 3U11A 2ATFA 2CAVA 4QGNA 2Q1ZB 4HSLA 2GZWA 4MGYE 4QGLA 1DGWA 3KMHA 1O3TA 3IDBB 2VQAA 3ES4A 4ZU5A 3BB6A 1O3SA 1G6NA 2XKPA 2IXKA 4MUVA 1UPIA 2GC0A 2CGPA 5KHKA 3USSA 2F4PA 4I09A 3CF6E 2B9UA 3RYPA 2OZ6A 2XHKA 3L2HA 3KGLA 1QXJA 2GAUA 3IBMA 3OF1A 2PAMA 4KU7A 4YSFA 4IEPA 3EQEA 1TQ5A 4XEZA 5CVRA 5AVPA 5FCCA 4EWDA 4I2OA 1CGPA 3B02A 1YFXA 1X7NA 3E6BA 2HJIA 3SCGA 1CAXA 5I0SA 1UD1A 1ZRRA 2UY8A 2Y0OA 1NXMA 2Z69A 4IEQA 4IERA 3ES1A 2C0ZA 4Z07A 4FAHA 4X6QB 4YNIA 1LR5A 3ELNA 3H50A 4HVOA 4XF9A 3UKNA 1CAXB 1J3PA 4IEOA 4XFFA 4H7LA 4KWJA 4XFCA 4HVRA 1O5LA 2IXIA 3CO2A 2H6CA 3DKWA 1Q43A 3RPQA 2WC2A 4XF1A 4TLFA 1I6XA 4FBFA 1J58A 4META 4BIFA 3U10A 1IPKA 2D40A 2KXLA 4HN1A 3WW4A 2OA2A 4Q0SA 3MPBA 1I5ZA 1X8EA 4LLOA 4J1XA 4YRDA 3BCWA 2UY9A 1L3JA 1YLLA 3QOPA 4KWKA 3JZVA 5FQ0B 4IEZA 2XLAA 4BH9A 3DN7A 3EJKA 4EV0A 3E6CC 4PIYA 1ZNPA 5FDBA 2GH2A 4MGIE 3U0ZA 4LTAA 4PIXA 1RUNA 3C3VA 1CAVB 2QNKA 4ONUA 4E2GA 3I7DA 3LWCA 2PYTA 4I02A 3H3ZA 4JV4A 1CAVA 3QACA 4EROA 3IWZA 1YHFA 4HMZA 4QMAA 1CAUA 4LUMA 3FX3A 1LB2A 3IIAA 1QXRA 5I91A 4WVZA 4I01A 1ZZ6A 2XLFA 1UW8A 1ZZCA 2B5HA 3SMHA 2Z2SB 1YWKA 1EY2A 1ZX5A 2H6BA 2GC1A 4EWEA 4O9GA 1FT9A 4BHPA 2E9QA 4F8AA 5C6CA 1ZRCA 4F7ZA 4KWLA 4IEYA 1O4TA 2PHLA 5J3UA 4B29A 4I0BA 5LEJA 5HI0A 1YFWA 5I8TA 3SHRA 3S0MA 4AQ2A 4JTNA 1CAWB 3H3UA 5BPXA 4HN0A 5I8SA 5FLHA 3H7YA 4MV2A 3D0JA 4WZCA 3H8UA 5BV6A 5CADA 5KBFA 1Y3TA 1EPZA 3S7IA 2BEOA 3I59A 1Q3EA 2EAAA 4LUKA 2IXHA 2BGCA 4N9HA 1ZRFA 3FWEA 4EWAA 1LRHA 3H1WA 1CAWA 1ZZ9A 4L11A 1VJ2A 1SQ4A 4MH0E 5CU1A 1GQHA 3OCPA 1HW5A 4AVCA 4QXKA 4HSJA 4I0AA 3ROUA 3FE5A 3FZ3A 1CAUB 1J3QA 2PA7A 5BXXA 3RDIA 3UKTA 3EHKA 1OFNA 2EA7A 2QVSB 1NYWA 2QDRA 4LEJA 4OLLA 5LEKA 4Q29A 2V09A 3H9AA 1IPJA 1RC6A 2D93A 4QGMA 2BNOA 3RNSA 5JR7B 1EYBA 3KGZA 2XL9A 2OPKA 2BYVE 4IEUA 2QCSB 1O3QA 3LA3A 2CV6A 5E1RA 3E5QA 4XF0A 1SFNA 1YFUA 3RYRA 2B8MA 3PNAA 3CEWA 4ORFA 3BPZA 3NVCA 4AVAA 1QWRA 5FPXA 3IDCB 1CX4A 4AXOA 2D5FA 4XF4A 1J59A 3GBFA 1WLTA 4AVBA 4L2NA 4HVQA 3LA7A 1JUHA 5BY5A 4HBNA 4ZU4A 4P9GA 4IETA 2MHFA 4LA3A 3H7JA 1ZZBA 2PFWA 3WW1A 4MZUA 4FAGA 1NZCA 4D7SA 4PIZA 1X82A 4RD7A 3OGJA 4X6RB 3OD0A 3DL3A 2ETEA 5I0TA 5FLJA 1GQGA 4AQ6A 5I8YA 2FQPA 2ET1A 2EVXA 2UYBA 4XFAA 2XL7A 2ET7A 3ETQA 1OD5A 5J48A 1ZRDA 4IEVA 1UIKA 5JSPA 1UCXA 4R8HA 4LULA
chains in the Genus database with same CATH superfamily
4JVAA 3KF3A 5A3OA 2M6YA 3VZJA 4CDQC 1D2DA 4JYAB 1GWKA 4UVAA 4XJ8A 5AFBA 1NCQA 2Q7EA 3LSQA 5IATA 4QX1A 4BQ3A 2D6LX 1N34B 1BMV2 2YI9A 4JC1A 4LP8A 2EZPA 1RMU1 3B69A 5A6ZA 2I07B 4MVTA 1S0GA 1W8OA 3POIA 2WZPP 2QQMA 2WSSG 4H37A 1H6YA 1PL0A 2PAKA 4K40A 5FXXA 1AI4A 4QU1A 5FPUA 4O9EA 2V1DA 1VQOV 2RVAA 2JJ6A 2XMLA 2W1UA 1J84A 4W8JA 2CTVA 3JSLA 1DGRA 3CCRV 4AI1A 1KS4A 4AQYO 5DAWA 3C8XA 2AR6A 2W94A 3U4SA 1QJZA 4DY5A 4XW3A 2CAZC 5C4WA 1C8NA 2ZGSA 3I5DA 3ZHRA 3D4KA 1JZ5A 2HH9A 4H2AA 1V6KA 1W6NA 3NSTA 4LLFA 1H30A 4O65A 1PMJX 2D7FA 4CCCA 1W2BU 1QJY3 1PK6A 5ANNA 3B77A 3CB2A 2F23A 3LSUA 3WLUA 3DYMA 1F15A 2J7MA 3FHQA 2G38A 1K5MC 3K2OA 4Q0UA 2A3QA 4JGYB 2XPJA 3ZIXA 4YVWC 4HKWA 1EN5A 1WKYA 3HPNA 4ZOLB 4R9AA 1O7FA 1QDCA 1KUQA 3VDAA 3AZWA 3DYPA 5EIBC 4LFCO 3VN4A 4X66O 3WCRA 2VECA 3IC9A 2SBAA 3A23A 3RN4A 1XNRB 3L9JT 1UU4A 4QPIC 3ZYIB 2F95B 4OVEA 3BB6A 1UPIA 2F4PA 3K46A 3W7XA 3RYCB 4LFBB 2DDUA 3D36A 3B5LB 3CCJV 3TEZA 2E33A 4G4FA 1Z2GA 4HPKA 5LP6B 3OW2U 4IEPA 5HCAA 1ND2C 2YMZA 4MGTA 3ZSJA 5IVVA 1D4VB 2PHFA 1GTOA 1K73W 1K3IA 2CU5A 2VCAA 4FIPC 1X7NA 4QXHA 1DF5A 1BE3H 4JGYA 2C0ZA 3ZN4A 1S5HC 4ZZ8A 1R73A 1GKBA 2E76B 3AK3A 4UFHA 1UQXA 4ZHQA 3M7MX 1OH4A 3SYCA 5GLWA 3HKDB 1WPXA 5H9SA 4FOVA 4BQWA 5A6XA 2D40A 4GWIA 3FLTA 2AENA 1OLME 4GKJO 4PDWC 4Q0SA 1K5QA 4LF5B 3JZVA 2A06H 3MIEA 4BH9A 1XQ8A 3JSNA 1SLTA 3DXUA 4PIYA 1FJGB 5GZCA 1IVSA 2PN5A 3C3VA 3DCQA 3MV11 2QNKA 3UV9A 3M3EA 1HR0B 4MHUA 4FO9A 1F4NA 2LO1A 1Y9MA 3MHHC 1DGLA 2QKDA 5A7OA 5IYCO 1MEC2 1S76D 2C26A 1Q7YW 3Q9OA 1E5IA 2XAJA 2BOJA 2L35A 3ZSKA 2E9QA 3BIWE 4QPYA 2QQJA 1O4TA 2VUJA 4XPVA 2ZJCA 1C3HA 2ZEWA 3JAWB 1K5MB 4FPKA 2OXBA 3I2DA 1NAEA 2HP8A 4EFEA 4GB32 5CADA 3AK2A 3V64A 4CP0A 5D8AB 1VQ5V 1BKZA 4LBMA 1VRBA 4EZHA 3KZIZ 1QH7A 4JAVA 5C8YB 1BZWA 4Q4W2 4UFIA 4LOSA 1IHMA 2VZVA 3FWEA 1CAWA 2ZX3A 1VJ2A 3CRRA 1GQHA 1MR5A 4I55B 2JDHA 3ABLB 3N2GA 4X1KA 1U5YA 5BXXA 1NYWA 1JPXA 4X64O 4Q1PA 4Y1UA 3KGZA 4UF0B 1NX9A 2X10A 2P3IA 1KS5A 3LIHA 2ZEZA 2CV6A 5C9AB 4DO0A 4MVSA 3GJAA 3PNAA 2R041 3IC7A 2IU0A 5FZCA 1HRI1 3N9PA 2ADQB 2DOSA 5KA5A 1DF0A 1JHJA 1X50A 2VTFA 5FKCA 2Q69A 5LA1A 1ZZBA 3ZHTA 1QJY2 2QM8A 1K9MW 1POQA 3I3BA 3DL3A 4FPLA 2ETEA 2BFUL 5I0TA 1VAVA 2Q5TA 3AMHA 1EAH2 4O4IA 2Y26A 1M5IA 4FLTA 4B4QA 4CC6A 4OUEA 3TN92 4LHLA 3CU7A 1G9BA 3WW2A 5IY5B 5K0UA 3K9AA 4XF3A 2RDRA 3W5MA 1EP0A 1O91A 3ZMVA 2QQLA 3C90A 2Y6LA 4BAYA 5JOWA 1SLCA 5C3RA 1ENSA 3WG3A 2IXLA 4LKFA 2UU9B 1AX2A 2RQ6A 1MQTA 1C28A 1DFQA 4QM8A 4NIAA 1Z0HA 1P7GA 1XE0A 1WW4A 3PLQA 4GWNA 5H2FZ 3ACLA 4FFKA 2ARHA 3HIFA 3CZJA 4NRQA 1RUI2 2M7WA 3IFXA 1TVGA 5FBJA 1YTFB 4Y26A 2Y38A 3HR9A 2TUNA 2E7AA 4AOCA 2XJRA 1F5FA 2ZMNA 1X36A 2W08A 3PJYA 3FFQA 1BLZA 2V4VA 5FZKA 3G6JB 4A2UA 2E32A 2K9ZA 2JECA 3LIGA 2R6QA 4J10A 4LF8B 3PIGA 4H13B 1W04A 1MZEA 1HNXO 3ACFA 2OT5A 1SF9A 2VR4A 1X8MA 3V0BB 5LBCA 2Z79A 2PI5A 2P6JA 2CNAA 1AB3A 2V5DA 3AYEA 2I2SA 2D43A 4XUOA 4NKGB 1THZA 2HHHO 2J1RA 5J7MA 5JLVA 1B35A 2LW8A 4X8PA 1QXPA 4CP9A 4AAXA 3BTZA 2ZBJA 1P49A 2XAQA 3TNQA 1R082 3EHBB 1S2BA 4TV9B 2NM1A 3CIHA 2VULA 1V54C 5EHDA 4AHWA 4OXSA 1VB4A 3VDDB 1NVPB 3D0SA 5HFLA 2XLGA 5LK7B 1YDXA 2Y0PA 3P5BA 1W6OA 1BK0A 3A0KA 1AJKA 4A3XA 4WVMB 1AL23 4X65B 5E89A 1HV1A 1W28A 1EAH1 2VMFA 4DR4O 3IPVB 1NT0A 2VBPA 4YZ1A 4GMP1 3F7YC 4JI3B 3IBMA 4LHSA 4YSFA 2J1TA 3EQEA 2DVFA 3ZYHA 2DCYA 1WCDJ 3X2QB 4QIWF 4I7ZB 3BTYA 2QM7A 3PVEA 2Y0IA 4LKDA 5FY5A 2CTWA 5BNPC 4CH5A 5I0SA 2ARXA 2ZIMA 2HWF2 4Q20A 1OVSA 2D3RA 1SA0B 1Y74A 5H6QA 1N32O 3AP5A 3CNAA 5KUMA 3A0RA 4J41A 1CPNA 2LM3A 4KWJA 2LFSA 4OZXA 3HBZA 4YHHO 1ZA4A 4RGAA 3MIDA 2WC2A 1DTOA 4Y1VA 3LB9A 2OQ7A 5L73A 3D3AA 4HAMA 3TJTA 5EPAA 3K0DA 3OYWB 4HN1A 1ASJ2 1AR72 4XMAA 1X8EA 5L3EA 5L3FA 3R05A 5JVDB 2F1MA 2R071 2ZM6B 3OBZA 5EZYB 5J2TA 4CU7A 1KQSU 1BQ0A 5CB7A 2EIKB 4INDA 3U07A 4DR2O 4K20A 4A44A 3JAKA 3SLIA 1VMFA 2L9LA 4FFIA 1MMMA 3ZLIA 1OJHA 5CYYA 3DC5A 3K5OA 3R66A 1QIQA 2Q5ZA 1XMQB 2WUHA 2RNBA 2PHLA 5F7UA 1F7YA 4TLGA 1MQTB 3M7AA 2BOCC 4OHVA 4ARXA 4JTNA 3U37A 3VBHA 1B04A 2A79B 4AQSA 1RIRA 5BV6A 1ZUQA 4NXNB 4JI3O 1V9U1 4Z2AA 4LF6O 2WO7A 4GKXA 1ND3B 3U78A 4N9HA 4UVBA 2ZXWB 1WW6A 3KVAA 3WNMA 2HLDG 2XBO3 1AR62 5LGUA 1J3QA 1WMEA 4YGCA 1SZBA 3EHKA 2EA7A 4FFFA 4XHBA 4B3SB 2ZR2A 4UW4A 3MUZ1 4DRRA 1PVC2 3U1XA 1PIV2 3FAVB 5LBEA 3BPZA 3T4HB 3MW3A 4JF3A 2LUWA 2VZRA 2D5FA 5L9VA 4UUJC 4XF4A 4XDJA 2BTVC 4PBPA 3JATA 4XDLA 4ZI7A 4CCEA 1SRYA 3BA8A 4AHCA 4B1MA 5GZEA 4PA7A 2XOKG 2A1XA 2G19A 4R9CA 1OV9A 1XOUA 2VZ1A 3I2IA 5DDJ1 1BMFG 2YC2A 1RXGA 1UY1A 4K35A 2VMEA 4YY3B 3IN9A 2P3YA 3ZFFC 4TOIA 3ETQA 2Q9LA 2C1FA 2A71A 3VLBB 1NTZH 3JXSA 4R8HA 4JI4O 2XNDG 2GHYA 2ZEXA 3IB3A 2OWOA 1WWYA 3SJCC 2EJRA 1FI2A 3VKNA 5C8WA 1KKCA 1CQ9A 4HZFA 2MNGA 1DQ5A 3G80A 1EFRG 1DCSA 3B8NA 3PVNA 1CONA 1ONAA 4MGSA 1MS8A 1RMU2 1FXKA 3HKCB 2Q30A 4P00B 1OOPC 4YG0A 3OBAA 2D3PA 4NHMA 3DPRC 4X1YA 5GLZA 1WLCA 2YFUA 3LDBA 3EB7A 5LP6A 1BBT2 2EIKC 2IJHA 4LNUA 3QCWA 1SBFA 2DN9A 4X62O 3VKMA 1FMD3 3DGTA 2RDSA 2JDZA 2WFPA 2VZPA 4FFGA 5DDJ3 4GAZA 4AL9A 1AVMA 2WT2A 3EXAA 3E83A 3G67A 2PAEA 2WZ8A 3HQUA 4MGZE 1SMVA 2WAOA 2Y48A 3ZN1A 3MFAA 4SBVA 4RS5B 3AG7A 5H6RA 3OMNB 3ILFA 4ZU7A 4BQ2A 2HG5C 2ETNA 3UNPA 4TT3G 1IBMB 1WAZA 4DR4B 2WLLB 2CTQA 4NJ4A 3SXWA 1FV3A 1TUBA 1EZVH 4OI0A 3G6EV 5AVAA 2DBNA 4CP9B 1MA1A 2I45A 4Y5SA 3OSDA 2HVJC 3PHMA 2GH8A 4M00A 1H2SB 4LT5A 1OFSA 1Q6IA 4QQLA 3ZDSA 4JKLA 5L3BA 1YQ8A 1EUTA 1NTMH 3S3XA 4I4TA 2Y4TA 3IT8A 1V6MA 1MS4A 3VHPA 1C1LA 5DZEA 5IYBO 4UBGA 1M06G 3RYHA 4MVMA 4HSLA 2JDPA 3NJVA 1DGWA 3IDBB 2VQAA 2IJKA 3ZMUA 2GNTA 1UYXA 1I9RA 5CKMA 2ZKNA 5FK8A 3WF0A 5GZFA 1R091 3OUJA 4ASLA 4Q4V3 1QXJA 1NR1A 1SESA 3NKGA 3UJQA 3E8GA 4FXGB 5FYBA 5DAPA 4HONA 3GM8A 3BN6A 2VMIA 4AG4A 3HB3B 1YZBA 4UYBA 3LUTB 3UCSC 1GN2A 5KXBA 2FCTA 2LGQA 3K4AA 2VZ3A 2NNUA 1UAIA 3KT4A 4JDOA 4JI7O 4K0KO 4F83A 4EFBA 4AHZA 3ES1A 4QPKA 3FL7A 4CZZA 4Q4X3 4J80A 4IEOA 1TAEA 4H7LA 3IAQA 3UT5B 5A9GA 3RPQA 4P9YA 1NY71 1HRI2 3CX5F 5LOVA 3POYA 3RZGA 2VRZA 4PHZA 4DR1B 3LDKA 3U10A 1R3LC 1N8RW 3EFFK 3VZNA 2OA2A 1TUEB 1F2NA 2WSVA 4MO3M 1OQ1A 1AXYA 4TN7A 1H0BA 5JUVA 1QBZA 5JQGB 4QPJA 1ZNPA 2GH2A 5EC1C 5JH7B 4O4IB 4LMFA 1O59A 2BOBC 3K9SA 4N43C 4QB6A 2RR13 2XWJB 1NZIA 4P30A 1BEV2 5A7QA 5GZDA 2ZX0A 2D2CB 1W99A 4WM7A 3SJQC 5LK5A 4O9GA 1WLDA 3ZXLA 3N9OA 1HB3A 1POV3 2KA3A 4IYHA 1O4ZA 3JASA 2QBXA 5JCOA 4L99A 3A0BZ 2DWDC 3ALQA 1W8UA 5KAIZ 3W5NA 5JXGA 1CP9A 2DF7A 5C8YA 3D0JA 2E63A 4DUXA 2XAHA 1EPZA 3S7IA 3T1HB 1PVXA 5DUWA 1GZ9A 3ZRWB 2EIJB 2WL1A 1N3OA 1YI9A 3ABUA 5K9YA 3T3YA 4JI5O 5DPNA 1J5EO 4AVCA 4QXKA 2YPJA 4I0AA 3FE5A 1UKRA 1QVFU 4NPMA 3ZYRA 4J42A 3T1MA 4AF9A 2P7TC 3WDXA 5CA1A 1UX7A 2ZHLA 1ZRIA 1S0VA 3VD3A 2OW4A 1F5JA 5L7OC 3DECA 2X6CA 4YZ5A 4YM0A 5FNVB 2JGDB 3M99B 1CX4A 1ODMA 3LPGA 4DRXB 1KU9A 3WUDA 4AEKA 1NZ6A 3VBUC 4R8CA 2RR12 1OXCA 1AI5A 2XBO1 3POEA 1PL4A 5FZAA 2Z3YA 3DYOA 3ABLC 1UF2C 4Y22A 1M56C 1SC5B 4RD7A 2H94A 2QQVA 3RFRA 4QWNA 1EV11 2VVEA 3AG1C 1HQWA 4DR6B 3FAVA 4NOTA 2EILC 3CMEV 2GTSA 2WLNA 5J48A 4IEVA 3K3WA 1WCSA 2QWNB 3KWVA 1HNWB 1BZKA 1OLQA 4DV4B 2IXJA 5FZ6A 3C7FA 1N47A 1YVWA 3C3SA 2GU9A 1LNSA 3S7EA 3UKVA 1KP3A 4CUCA 1GN3A 4H33A 3RS6A 1NE6A 1H2MA 1SEFA 1IBLO 1N0JA 1O9HA 2LQTA 4F6RA 1ZZ7A 5EIBD 5LXTA 4ZY9A 2IJJA 2OIEA 4XOGA 4UOJA 3LOIA 1ZSPA 2F6BA 3ZFFB 3HWJA 1VP6A 2P3KA 4YM3A 1RUD1 4AHXA 2Q1MA 3KV4A 3VDDA 4YARA 3CQOA 4FPFA 5JIUA 2GNDA 2A9HA 3M3OA 3ZXDA 2IC1A 3K5MA 5EBLC 1BT8A 4Q0QA 4AFAA 2FHRA 4GWJA 2Q8EA 3VUOA 2W6IG 5ABJA 1B35B 2VOWA 1T6BX 4M0HA 1WD4A 5JXHA 1Y74B 4HK8A 2EIJC 3SPHA 5EYYA 4DINB 2FCUA 5FPAA 4DUWA 4LF4B 1U5ZA 4JI8B 1GZWB 2RMU2 5JJEB 2WAMA 1E5SA 5F3GA 1DQ2A 3W7TA 3VDDC 3LD8A 3WB0A 4CEWB 5FZIA 2R1DA 1F4AA 1D2SA 3ZN6A 3M3QA 5FYHA 4B4PA 2OIGA 1OCOB 4FLVA 1AP6A 3P6BA 4Q0PA 1NJIW 4PD4F 5EJ1B 1QJU2 3J26N 2CWMA 3RJRA 3ZRVA 5FXWA 4GX0A 1UZVA 5ABJB 4I4TB 1JCHA 3E5UA 3NW4A 1M56B 4A4AA 1WCUA 4YHHB 3ST7A 4O4JB 4CEYA 2AEYA 2ATFA 5LGNA 1N33O 3T2TA 3FYEB 4J11A 4AFDA 4E8CA 4FSJA 1UNBA 5A32B 1EV12 1AZDA 5KHKA 2YG0A 4EN9B 2QZ2A 2B9UA 1S5LZ 3SJAC 3KGLA 4UFZA 4O4LA 3V0AB 3OF1A 2PAMA 3ACHA 2Q67A 3O65A 1KGYA 2G9FA 3ZOIA 1VBB1 5IVEA 3P3PA 5GLUA 1E5RA 2PHWA 5A6QA 1RM1C 1YFXA 1VBD2 3J7LA 3NJXA 3D36C 1XJAA 3P32A 3RWRD 4M3CA 2H8PC 4AILC 4QPIA 3N9LA 4X6QB 4YNIA 1N3PA 5DAQA 1G9AA 2WA3A 4BQ1A 2UXXA 4BMEA 1V55C 2FBEA 4FBFA 2R072 3CDZB 2CYFA 4Y1YA 4QX7A 4DXWA 3ZMNA 4YVWA 1MSWD 4CDQB 1QHTA 2BTQB 1FKAO 1QJEA 3APOA 3FLRA 4AVSA 5FZOA 5DXDA 1OCZB 5LY1A 1XB9A 4Q5OA 5KC6A 3E6CC 2IH3C 2NR5A 4Q4Y2 4NXMB 2GMPA 2MEV3 4P9WA 2EXHA 3C7EA 2AGAA 4WF9V 1PZ8A 5F9TA 5FXVA 1MVQA 5DZFA 1CAVA 3WY6A 4EJRA 4FFBB 4X1KB 3FX3A 2BOIA 1W2UA 1ZX3A 3R0RA 4OGQB 5T5PA 3AG3C 4J25A 2BBVA 4XDQA 2ZXQA 1W3VA 2R1BA 2YIBD 4JI8O 1YJ9V 1YFWA 4TUYB 1H4HA 3MPPG 4GD4A 3K5NA 3K04A 3CBNA 2CL2A 4PA6A 4HN0A 5FLHA 2TNFA 4WZCA 2KD7A 1RVF3 1JOBA 5FMDA 2QGNA 1SERA 1W8HA 2W46A 5F6LB 1YQ2A 2V4AA 1G4YB 3OUFA 3VZKA 1JU4A 4PLMA 2Q1FA 1ZRFA 3HKCA 2AZ0A 1Q8PA 4BOWA 3BU0A 2CH7A 2FDGA 2EIMC 5C7GA 4YW2A 2VNRA 3H8XA 3QO7A 3TRSB 3H9AA 2XOMA 3UGGA 2BNOA 2CDYA 3RNSA 2HWD3 1EYBA 2OPKA 2MEV1 5A3NA 5IK5A 5GM0A 4XF0A 1XYOA 4DXRA 1M90W 4QB1A 2B8MA 3WG4A 3AG4B 3JAWA 3NAPA 4LOTA 1FXHA 4FCAA 4K8ZA 4IIJB 2W91A 1BQPA 4QX3A 2RMU3 2DURA 4D6QA 1A8DA 4HVQA 1JOPA 4CZSA 3WP4A 5BZBA 1PGL1 4ZU4A 2HYXA 3I2OA 4Q8LA 4LA3A 3OEAA 3H7JA 3VBSB 1GFF2 4CBCA 1X82A 4UAPA 5C8CC 4KWUA 4LHKA 4X6RB 3ZFEC 5BNNA 2YV8A 4AQ6A 5G04L 3WQBA 2HWE2 2VZTA 5FZ9A 3O1UA 1ZRDA 3THPA 2VOKA 1UIKA 4A3ZA 1K45A 1EZJA 2BP6A 2UXBB 2NLRA 1FOD3 1JYNA 4MVOA 4ZPIA 3H8OA 2LP7A 2JG9B 4PDWB 1PO21 2P22C 4H55A 4IW3A 4EYUA 3WCSA 1A3KA 4K3AA 1K8AW 3ZMOA 2DTYA 3KV6A 3S6PA 5HCHA 1WCQA 2BJSA 3OEHG 2PGGA 2WLPA 3BU7A 4E2SA 1W2OA 5L7OA 1W90A 2JKBA 3AJZA 3ZHQA 2ZGNA 3B7MA 4ES8A 2O14A 1AL0G 4CEYB 2VU9A 1SPPA 5EYPB 4UXNA 2UXDB 1K92A 1SCRA 5C3SA 3MF9A 4XZUG 3R4UA 3FB8C 1RGSA 4GB33 3TNPB 2X6AA 4CDXA 2Q0AA 1RP3B 3OYWA 1JA8A 2BERA 3EMRA 4NR1A 4LF7O 1WZXA 4PELA 3JD1A 3ZHVA 1XNQO 4CCJA 1S5JA 4PDLA 1IXMA 4H44B 1ROPA 1U96A 2WPDG 1WBLA 1ULPA 3ZN6B 2B5UA 1VBC1 4DW0A 1RPRA 2JG8C 2XTAA 3HT2A 4IGPA 3ZX7A 1RJ7A 1V9U3 3DXRA 2A3XA 2WLHA 1DQ4A 4P5YA 3OGRA 5JI9A 5KMGA 4TV8A 2MK3A 4JTAB 5LMUO 1YRZA 2BV4A 2WSUA 4Z1VA 4YGEA 5IJ9A 4C1WA 1JYWA 4IV1B 5LMNB 1OOPA 2UXBO 4B3TB 5E88A 3OMAB 4NIGA 3Q4HB 4QGPA 1PD3A 4RYDA 4AI9A 5KLVH 2DYRB 4KU8A 2ZEYA 4M3CE 3CCSV 4E4DX 1ZM1A 2ORZA 2PHXA 4XTPA 4UCUA 1LULA 4AEDC 3NL1A 5FFOC 1LOEA 2Y4UA 1R092 4YW5A 4EN7B 5JH7A 2AH2A 3SYPA 4X89A 2GZWA 2HEVF 2QTWB 3KMHA 1JI6A 3E1F1 4JKMA 5AG2A 3USSA 3VBRA 3D6EA 3L2HA 1KQRA 3AP7A 3IMMA 4LBOA 4RQPA 2GAUA 3ZDVA 1VRH1 2WLKA 3AZYA 1RUH2 1NCQB 4CVUA 2ZX1A 2VL4A 1QNWA 1CESA 3OOXA 2ZDIA 4N53A 4B3SO 4NXMO 4I2OA 4WBNA 2P34A 3UT5A 2QR4A 2VUDA 3W7WA 1ZRRA 1R081 3VBSC 2B7YA 2P67A 1TZOA 2HEPA 4MXWA 3VKFC 2WZR1 5CFDA 1XNRO 2Q8VA 3CJIC 1UMIA 1WMDA 1YSCA 2DMXA 1G9CA 4DR1O 1VAMA 3SPJA 1CZSA 2XONA 1VBB3 4OI4A 2DVDA 3K79A 3TWIA 3INAA 3JBG3 1NH2D 2GBOA 4LH7A 3URFA 2DCKA 4NMIA 4YIPA 2Q7GA 2JE7A 2V4DA 1G1XB 3QD6A 2HBUA 3O1VA 3OPTA 3ATGA 3U75A 4DV4O 1VRH3 3ZJZA 2JKXA 3HQRA 2YXLA 3WEZA 1W6MB 1DYOA 4ZZ5A 2HWF1 3ABKC 1QXRA 1ZZ6A 2N74A 3CEIA 5CA1B 5BR8B 2Q8OA 2XH6A 3F2ZA 3ZXAC 1EY2A 4LBNA 1UYYA 3OGSA 2EULA 4I30A 1FT9A 4F8AA 3SDLA 1DGSA 1G8WA 4GKJB 4JYCA 4FLUA 5HI0A 1UMHA 2ZPXA 5I8SA 4MTFA 2QQUA 3WNLA 4QX0A 2DYRC 1QOTA 3VV1A 2R9AA 5CG9A 1S72V 4GA9A 1H2LA 2UUBB 1SA0A 1I5PA 5FY0A 3ZMZA 2CWSA 5LMNO 1YC61 1HW5A 2YICA 5A7WB 3USUB 3NJYA 3AG3B 2JICA 1AL21 5LHIA 2AREA 4RUFA 4JI1O 2PLV1 4Q29A 4WZFA 4XE9A 4S2HA 2WNUA 1KYOF 4QGMA 2JG8B 1AR1B 3L72H 2DFCA 3E5QA 4NHLA 3RZKA 1GZTA 1MG1A 1RVF1 3OAAG 2WNOA 1P84F 4AXOA 3CC7V 4UVCA 1MPXA 1VRH2 3UGHA 5CB4B 2IU3A 3ECQA 1JOYA 4LF6B 3MLJA 3RVZA 3LE0A 2R9RB 1ASJ3 3LDRA 1YJWV 1PGW1 1QOOA 2JIZG 3HMYA 4TYSA 2E51A 1ZBA2 4N53C 3GXUA 5FP3A 2ZDIC 4Q4V1 3HAGA 3MBWA 2JK5C 2QWQB 5BNOC 5HPOA 5FP7A 2XAFA 1MS1A 2QWPB 3O1TA 4YZ2A 2WWUA 3Q4HA 1FXKB 5TSWA 3VBRC 3RWKX 4UF0A 1OKQA 3CCQV 3AG4C 1NG0A 1W9SA 3AJYA 2HLEA 1ZA7A 1MZFA 5A1FA 1HB1A 2IUWA 3RI9A 3BEHA 4A45A 1VR3A 3ILRA 3R6SA 2XUMA 2YXHA 1PIV1 4C0HA 2EAKA 1WLEA 2G9GA 4XIKA 4WFHA 1HW7A 4YG3A 1QY4A 1FFTB 4Q4X2 1B35C 1VMHA 4W50A 3SISA 1IDSA 2BQPA 5BNPB 3GYDA 1KXGA 2ZHNA 3I2KA 2BCCH 4Y22B 2Q7HA 1IXBA 5I93A 2ZE6A 4M4PA 1FFXA 1TVKA 3AMQA 2ZMKA 4X64B 2X5IB 4R4ZA 2NP0A 3RRDA 2VNOA 1YUDA 4EZ4A 4P5HA 2PTMA 1XMOB 2YIBA 4V2WA 4UXAA 4MTOA 5GTHZ 1N34O 2ZGKA 1ZVFA 1J1LA 5F2SA 2CGNA 1OCOC 1ZL8A 1PVC3 2X6BA 5KR7A 1XQNA 1M9NA 4FLYA 1D2QA 3PVOA 5IDJA 3H42B 4CDXC 1ULCA 4K7JA 1EAH3 3SKVA 3LDEA 4IL6Z 1RL3A 4BW5A 4MGKE 3GGLA 1M4UA 1GP5A 2DCJA 5E6HA 2YB7A 4CP2A 4XTMA 4X8AA 1RSOA 1IS5A 2NN8A 1Y66A 3TETA 1DG6A 1QQP2 3ML0A 2MW2B 4ZIBA 1QMJA 1MQTC 1TMF2 3VZMA 1ALYA 3LZZA 1NCRB 2XVKA 4X1IB 4HXCA 1XREA 1JZ4A 4O4JA 4Q27A 5KAFZ 4PLNA 1DIWA 2VQEB 1W3XA 4N53B 3WV6A 1STMA 1N1VA 4WM8B 2CUGA 5A3MA 1RUG2 4R9BA 5J09A 5T5OA 1G8MA 1UJWB 1XSRA 4FOQA 1F4MA 1HXS2 1VBD1 3ZYFA 1V55B 4J7JA 1C57A 4W6WA 5AVPA 5BNPA 3T0BA 4DOUA 1CGPA 3FKSG 1CZTA 5FTTC 3CYOA 3E6BA 4EN0A 1I94O 4D7YA 4QT6A 1H8VA 2PMWB 2VQ0A 4X1YB 1QCEA 1J3PA 4Y33A 4RR3B 4I3GA 2BSKA 2FMLA 1W6NB 3OMIB 5FO8B 2H6CA 4EKWA 3FX7A 3O1RA 4BIFA 5JJJB 3RYIB 2RCVA 5TISZ 2JB4A 5L3CA 5ANQA 4Q4W1 2LW7A 2BPA2 4NIHA 3VHOA 3ETGA 3WDWA 4D6RA 2WZR3 2R0FA 4CU6A 1N36B 4DK1A 4Z1MG 2A0LA 2UUCB 1YXBA 2B42B 3Q8FA 4YIOA 3C7GA 3AKTA 3GWKC 4ZXKA 3ZS8C 4DXZA 5F5IA 4QKFA 4DR3B 1PO22 1GNYA 2GDSA 1PX3A 1N4CA 2VZQA 4P14A 4ASMB 3T1CA 2WJSA 5I8TA 1CZVA 4A41A 1UXXX 1K7DA 5FNVA 3THCA 3NV2A 4XJZA 1MS9A 1GM7A 5LASA 4YW3A 1W0NA 1H9PA 1JJ2U 2EAAA 2JJ2G 4PDWA 3AP6A 2NMNA 1UZWA 4PA3A 4KH9A 1YNAA 3MO4A 4EWAA 4N7UA 2WWJA 2BZDA 4ICGA 2R7EB 4HSJA 3ROUA 3PU8A 4IQPA 4KQ7A 2DWRA 1D5AA 5FMCA 2XQXA 1MSDA 2QSAA 4C0BA 4BDVB 3NAPB 2BYVE 1QQP3 4W6YA 3EYPA 1BYHA 4UT5A 1NKDA 1O4YA 3OEEG 4DFSA 1P8JA 2J22A 3JALB 2YI8A 4QE9A 5AC93 5IVJA 3L73H 2XQRA 3UO3A 3X2QC 5CB4A 4E4HA 2FMDA 1SBDA 3T1HO 1JUHA 5A6YA 4LKSA 2P4VA 4IETA 1ND2A 4TSVA 1DYKA 1R3IC 2EIMB 4AI8A 3STZC 1XBLA 4OMCA 2GMEA 1DF4A 2ZGLA 1LOBA 1LTEA 4ZOLA 5FOBB 3LQCA 1UOGA 2JVDA 3OGGA 1GSLA 2W39A 5E8AA 4TXWA 1GBGA 1PP9H 4C8DA 3ZPYA 1ENVA 2C24A 2XWBB 1R083 4YJ2A 1RUJ1 3I2GA 4LULA 1HRI3 5HCFA 1YQ5A 4XIOA 2BTOA 1LNQA 1GOFA 5JWPA 3O9OA 4YW4A 2Q0OC 3DXRB 4H3WA 2W6JG 5EWSA 2NLJC 3GJBA 4QM9A 4CEYC 1Q90D 3HKBA 1XU1A 2D6KA 5CG8A 1AYM3 2NMOA 5SV5A 4AWDA 5L3GA 4B08A 1XU2A 4MX3A 1LKNA 3SPGA 5AFEA 2RR11 3BODA 2AHZA 2E6VA 1AYN2 1F23A 5AC91 1DQ1A 4OMDA 3TXQA 5B3SC 2JIJA 1LOFC 2ILMA 2R0HA 4N23A 2NQYA 3I8TA 5HV4A 5FMOS 4FPEA 1N36O 5B1AB 1RUH1 1REEA 4X8NA 1SPPB 1OBNA 1VP7A 1TG7A 1KRIA 2A6YA 3CS5A 4N7IA 2HWF3 2Q6AA 2R062 4BE3A 3VL8A 4IV1C 1REDA 2UXCB 5JSRA 1I1EA 1Z7S2 2PY5A 4YVWB 5T54A 1XNCA 4C90A 2YZ4A 2QKSA 3ABTA 1ODNA 2WFF2 1ZZ8A 5ABJC 5JOYA 2N04A 3TK1A 1U0AA 3K4DA 3MIHA 2BTQA 4XUPA 5KMGB 3VD5A 1WA8A 3ZYBA 2F93B 2X5IC 3APBA 5LA0A 4V1PA 2A70A 3MIBA 1PKXA 3HBKA 2FKXA 5CFDB 4I50A 5C3QA 3AMMA 2N05A 4LORA 2XHBA 1VQPV 3O12A 3CRCA 1OHFA 3DF0A 1WP8A 2KG7A 1NA1A 5KHHA 3EBRA 1GNHA 3I4IA 1VBA3 2JS5A 3G4SV 3MGUA 5FO7B 1W8TA 1NCQC 4XFIA 3ASOC 1XE8A 2O8QA 5CMUA 2HWD1 3M3IA 5BNQA 1EUUA 4FPHA 1H6XA 4QQOA 3SEPA 3IMNA 4MYEA 4C7UA 2BWAA 1R1A3 2WKKA 2RMU1 5FLXN 2VCCA 2ZD9A 1KKDA 4YW7A 2GP3A 1NCRC 1W05A 1RUJ2 4IDZA 3AP9A 3MV01 1GOHA 3W20A 5BYNA 4Y5Z0 1C1FA 2A6XA 4D6TH 5CA6A 4IT5A 3JB8A 4CU8A 4A7YA 4FOWA 1VLNA 2DWEC 1JZ2A 1DLLA 2HJIA 3BA9A 3LNMB 5FZ3A 2PLV2 3JARB 4IERA 4GKKO 1LR5A 4TSFG 1PIV3 4XF9A 4A6OA 2HVKC 2EBOA 2OCCC 1BHAA 4QPWA 4YVSA 2RMKB 1C8M1 4XFFA 1OCCB 4XDKA 1LHNA 1YI7A 1H2NA 4U7NA 5DUXA 2WT0A 1QR9A 1QU0A 2IH1C 4XF1A 3HKBB 2HHHB 4JI5B 3TEXA 3QBQA 3ETPA 5FY7A 3HR0A 3WW4A 1HRV3 4J1XA 3SITA 3M3CA 2C6SA 1VE0A 2B4KA 5A3WA 1DQ0A 1ENXA 2OCHA 2ZOEB 3TBDA 1K12A 3WVJA 5LHGA 4D0QA 1ZLZA 3NXSA 4LHNA 3CRMA 4LTAA 1XNAA 4J9ZB 4ONUA 3WP6A 4JCKA 4MVZA 2W92A 4QB2A 1QEXA 2WNVC 3ZFGB 4COVA 5D2AA 5L19A 3IWZA 4OHXA 2VM9A 4NTYA 3CC2V 3C7OA 4BIZA 1NLRA 1PVC1 5B3SB 1N1YA 3UO2A 4DK0A 4J7ZA 1UW8A 5JMOA 2JEUA 2B9VA 3WG1A 5FYMA 4YGDA 4WM7C 4B29A 2WLJA 1N0NA 3LF7A 2IJIA 4XILA 3SHRA 5J1XA 1N1TA 1CN1A 4X9QA 3T2QA 2JRIA 1MS5A 2J1UA 5HXMA 4MV2A 5CBGA 2P5OA 2BVBA 5KBFA 2JDKA 2IFRA 2JDUA 2WNUB 2HWB1 4DV3O 2IXHA 4P9OA 3HD8B 2GP5A 1KFUL 1Q8VA 3ZPOA 1JTZX 1HRV1 2W0FC 1UWWA 1JZ3A 1CAUB 2C5DA 1U97A 1S3JA 3OG2A 2V09A 1OUXA 4XAEA 2PQSA 3JCIA 3AKSA 3RBZA 1UN1A 3WQ1A 5A33A 1C4RA 4LBQA 1DGRN 1ZBA1 4NTXA 4GH4C 2X5IA 2H3OA 3EVKA 1BBT1 1OF3A 4IIJA 3OUSA 2QQWA 3K75B 3W59A 1SQQH 1V6JA 2VNVA 4WFGA 2JS3A 2VW1A 2XJVA 4UCOA 1OCRB 4DUYO 2YGMA 2ZGOA 5FZLA 3OGJA 2ADPA 3AKQA 1XYNA 2CDOA 1QQP1 2W1QA 3GF6A 3F5WC 5I8YA 2FQPA 2ET1A 4ZS2A 5F6KA 1AXKA 2RS31 3VGIA 2UYBA 5FRAA 2LTNA 1SS3A 4QDQA 1C8M2 4N8MA 1W59A 2HWC1 5EZWA 1F31A 4DV0O 2HKOA 2XVGA 2LGWA 5A3TA 2P90A 5HBAA 3OFNG 1NUKA 5DUVA 4PV1B 5FUNA 2W95A 4LIUA 2ENRA 2QDNA 4W4ZA 1VQ9V 4QX5A 3K3OA 3MD0A 5FO9B 3PJQA 2WNVB 1XUQA 4HPKB 1VBE2 3K4ZA 1BGYH 1DU3D 1BBT3 3U4XA 2W9XA 4XJAA 3V65A 4HETA 3EO6A 5A3LA 2WNEA 4XCAA 2UXDO 5LYJB 3WP5A 1EBOA 2RM22 1HNXB 5IJRA 4TV9A 2YBSA 3AVSA 3BAAA 2Q73A 3FB6C 4JX0A 2QJ1A 1VF5B 1WNSA 1WA4A 1OOPB 5EXOA 3KF5A 3RYCA 2Y34A 2ZHKA 4BA6A 2YY1A 5A3UA 1C5HA 2WO1A 4EE2A 5EZYA 4WVMA 2JJ1G 3D3QA 4GKYA 4BK4A 2Q4PA 3B3QE 3SH3A 4N43B 4JYYA 2WYFA 1Q56A 2OS2A 2W2IA 3BUCA 4BK5A 5DEDA 4CYDA 2AXTZ 2WN3A 3E22A 4AHYA 1VQ8V 1YFYA 1SHWB 3KD4A 4XQWA 2E3CA 2YSUB 1CX1A 1NCRA 4GZRB 2YYOA 4ASUG 1RUC1 5K8SA 2K9PA 2VUAA 4YFWA 5BR8O 1GP4A 5LP6C 5FXZA 1A6CA 1NLQA 1SDWA 2PLV3 3JU9A 5LA2A 5JSOA 4JQTA 2JD9A 2FMYA 4OFGA 4XUNA 1YCIA 2Y6GA 1H8EG 1TGOA 3ILNA 3OM3B 1NY72 1JOJA 4BR6A 3N7LA 1ZTEA 1GP6A 3ASIA 3AG1B 1HLCA 3I2HA 1VALA 4FI9A 2KG7B 4OHYA 4GJZA 4JI0B 2NYYA 2WZEA 1Y76A 4AYUA 3ZFFA 1RUF3 4OULA 3HNBM 3W7UA 4DV3B 2WLQA 5L7OB 2HWC2 2CE4A 3BCCH 4UFKA 1RUI1 1ULEA 4E4SA 1Z5VA 4BXFA 1WMFA 3WNXA 2JDIG 3S57A 4URTA 1CPYA 3VBOB 4JGZA 3ZVXA 1CAXA 1UD1A 3THTA 3ACIA 5J2UB 1RMU3 1NXMA 1R1A1 1HKDA 2QQKA 2ERFA 2YU2A 4WM8C 5A1LA 4FQ4A 4LC1A 2OUHA 4CP1A 3ICXA 4X20B 1O5LA 2YGLA 4U3JA 3R4SA 4JAAA 4R4XA 4R9DA 5DG2A 1CIWA 1F9KA 4H7MA 1W6QA 2LS6A 3LGRA 3E8FA 1IGOA 5A7SA 4RS5A 1HWYA 3AL6A 4YG6A 1PM4A 1I5ZA 4K0KB 3QOPA 4LO8A 3HNMA 1BMV1 5B1BC 4FZ1A 5IUQA 3RZMA 3BOPA 1DBNA 1BXHA 5FDBA 1VF6A 3OGIB 1R3JC 4QKBA 1P4RA 1AR71 3JYCA 4LBQB 1SLIA 4BMBA 1NKGA 1PMHX 4I9QA 3QACA 4QMAA 1GNZA 5C70A 4K6BA 5J36A 1S0JA 2WZR2 5IYZA 2ADEA 2RS52 4DR7O 3AVRA 3B00A 4BJ0A 5LA9A 2YDEA 2D98A 4I0BA 5LEJA 3J7HA 1IZ3A 4Q26A 4U3FH 3ZYPA 4M3CF 2XXZA 2ITCC 3SYAA 3HNYM 3FUOA 4NAOA 1AR5A 2DCZA 1HR0O 1GO3F 4JTDB 5GW7A 3GVMA 4LUKA 4XBQA 1DYPA 1KITA 3H1WA 2ZGPA 1MABG 3P30A 1SQ4A 3AZVA 3OPZA 3J8F3 3A21A 3N2KA 4FM2A 4E4ZA 1VBA1 1S2KA 1W6MA 3UESA 4CRQA 5KX5A 1BCXA 1K97A 3I55V 2GDFA 1D4M1 4HKLA 3RG0A 1Y4WA 1TNFA 4YJ2B 2QCSB 4DV1O 1SFNA 1U5IA 3MHZA 2P4EA 2JGUA 1WW7A 2WBKA 1VQMV 2P2KA 1Z7S1 4JI2O 3IM0A 2VVDA 5GJ6A 2HWB3 3RMYA 3WF2A 1J59A 2ZGUA 5BMVA 4L2NA 2ZKOA 2Y69B 2E74B 1W6OB 2KSDA 4DO2A 5CNAA 1RUG3 4R6ZA 3ZMTA 3O5SA 2B9ZA 3DPRB 5KXEA 1GMMA 2VMDA 3MIGA 2EVXA 1VF6C 3DKQA 3AXEA 3AYAA 2XL7A 2JB8A 1OD5A 1AR83 4DXTA 4A6SA 4LF7B 1S0FA 3H8RA 4RA0A 3I3QA 4PA4A 3S5AA 1X9TA 4CUBA 4NROA 4RQFA 4MG2A 3VHRA 1D7PM 1L8DA 5BNNB 1KBHA 1EV13 2IFWA 3NRUA 4NRPA 5FPRA 2VPVA 4XJWA 4WVWA 4O4LB 4GALA 2HWC3 2JXAA 4ISQA 1WMXA 3TB0A 3MW2A 3Q8CA 5KHJA 1ORQC 4I3PA 4CDWA 1XMQO 2K46A 4NRMA 4IYIA 3JUUA 3JAKB 1W9FA 4ASKA 3ZHSA 1IBLB 2WABA 4C1XA 2WIIB 3N4MA 1T5EA 1H4GA 2VJXA 1QOSA 5KA6A 5IWAB 2UXCO 5FLIA 3GZUC 4IUGA 5B1BB 1AX0A 4CCKA 3VKOA 4Q2FA 4Z82A 4NHKA 1VMGA 1K4CC 4ZXEA 4UV9A 4DMIA 5IFTA 3LCPA 4AZZA 1QVGU 5FZGA 1F4HA 5FZ0A 1SETA 1MEC1 1AR82 2AW9A 2RDQA 3WNNA 3DSQA 4B3MB 3RGBA 1VBA2 1OZ0A 2IXCA 2ZE7A 3E22B 4Q1RA 4FP2A 2RS53 4JTOA 3VBBA 1R1BA 5LRRA 3ZMSA 5B5EZ 1AJPA 4XETA 5IHRA 1RUOA 3IPVA 2CAUA 2DV9A 2R72A 1JR9A 1JYIA 1BHBA 4NWWA 4D3WA 3F95A 3ACGA 4DV2B 3NNLA 1O8SA 1UKGA 4RFRB 2Y69C 1YEWA 4FVMA 2L6LA 2VZSA 3WDVA 1CWPA 2C4XA 4S2GA 2DVGA 2ZR3A 3KV5A 3RVYA 5JCTA 2WRAA 4TWTA 3SGIA 1ZBA3 5EIYB 5F5AA 4YFZA 3P1IA 3U11A 3UK9A 4EN6B 3JBG1 1HB2A 3WQ0A 1O3TA 1WUVA 2RS13 1XHXA 1OLMA 1AX1A 3J9SA 4P08A 3BOWA 3BGAA 3ZXJA 1YXWA 4KU7A 2HWB2 1A78A 4FPJA 2JDNA 1F35A 2FDIA 5B2GB 3M8LA 4DV5O 2CHHA 4BZ4A 1BS3A 4Y4RA 1XNKA 5FBZA 4MT8A 3SCGA 4GKKB 5F8PA 4LF9O 3D8CA 4YZ3A 4I0WB 3FLPA 2LALA 3H50A 4C91A 1IBMO 1XNQB 1JFFB 4DXSA 3TN91 4MVUA 5K4LA 4B4RA 4YWAA 1RYYA 2IXIA 5A7PA 2UUAB 4IHJB 3ZSEA 3FHAA 3NV3A 4I0XA 4FTSA 2VQFO 1Y4MA 3WXPA 3RZJA 3CJIA 4KWKA 4EV0A 1NI8A 2ZE5A 5F3IA 1DLCA 4O2BB 1S4CA 4MSVA 3ASNB 4E2GA 3CCMV 4I02A 4NIDA 3ZXGA 3U14A 3FC0A 2ZXWC 4CCMA 2Y6JA 4LIVA 2KM2A 3S5QA 1FS0G 4QPGB 5EV7A 1C5IA 2OT7A 2Q8CA 4BHPA 4GH4A 4MHRA 5BMVB 1H9WA 2B39A 1OCZC 3KT7A 4XUTA 5T5LA 1K4DC 3DUIA 4IHJA 1UPSA 2OTLV 1TUBB 2UURA 4MLOA 4ARYA 1U5XA 1AR73 4FM0A 1Y3TA 4M4RA 2BEOA 1UX6A 3I59A 2X29A 3LNNA 2HR3A 2YC0A 3LOBA 1LRHA 4NIIA 4KP4A 1Q82W 5A7NA 4DV6O 4L11A 4OI2A 5T50A 5CU1A 2B1GA 5CA0A 4LO5B 3N2KB 2PA7A 4BLIA 4FLZA 3QO8A 4NPRA 2WWWA 3JD2A 4PDRA 3GBWA 5FWJA 1X33A 5JR7B 1I08A 2XL9A 1O3QA 2BU9A 3K06A 4GMP3 4RUEA 1JODA 4Y20A 1AVBA 3AKPA 5IYYA 5GLTA 3EXUA 5FPXA 1SQXH 3HVDA 1W8FA 3AZZA 3KB5A 1GWMA 3GBFA 4JGYC 4A7ZA 1URFA 1APNA 4IGQA 1SQGA 4Y5TA 2RS32 3CCLV 1IBKB 4NO4A 4Z92B 1PPJH 1HIXA 2WNVA 4Q6GA 3KG2A 4XCBA 4GYCB 1R6KA 1D4M3 3WDYA 2B1IA 3OD0A 3UGFA 2R30A 2VOXA 2XUEA 2XBO2 1AR63 4YXWG 4YGBA 1YHQV 5J2UA 4AGGA 4B1LA 4DV2O 2BGPA 1S0BA 2N7GA 1VB2A 4XDOA 4J1WA 1OA4A 3CL1A 5FZ1A 3E6DA 5IVBA 4Q4W3 2Q68A 4IV3B 2EIDA 1VMJA 3RI8A 4K21A 4CXXA 5ISLA 1W2TA 3V0AA 2GSYA 5IVCA 1OCRC 4FM1A 2ADDA 1FXZA 3WQ7A 4YVSC 1MZ6A 5F1RA 5JZGC 3VB9A 3H3LA 3RQ0A 4QQHA 2BNNA 1XXNA 5LHHA 2H0VA 3GHMA 3JQXA 1K5MA 1NE4A 3K48A 1LCLA 1FOD1 4NHYA 4CPBD 4DZGA 2X8KA 1G6UA 3I56V 4JI1B 3ZRXA 1PK6C 1YO8A 4FXKB 1V70A 1L0LH 2EX3A 4MS2A 3ZBHA 1QKQA 2D97A 5L9BA 4NXNO 1RUD2 2VBDA 4R7CA 2GC3A 2J42A 3FMGA 4DUZO 1WGPA 5FPOA 1LGCA 5DMYA 5EK0A 3ZXKA 1FFXB 2BW8A 1M57C 3AM2A 5FPBA 1Y9QA 4YYOA 1VBD3 3K0GA 2EF6A 3PDQA 3IJ4A 5FIXA 4O4HA 4RGGA 4AGVA 4CS2A 3NAPC 3RVHA 2YBPA 2FDFA 3RWNA 5JAXA 1REFA 4CS3A 2FTKA 4DEVA 3ENRA 1OPMA 4XQDA 2EINC 3MF6A 3K57A 5GTIZ 1W9TA 1E57A 4JI6B 1M4WA 4PJYA 3KVBA 2E26A 1VF7A 4M3CB 4P9LA 3D82A 2VY0A 4LF9B 3MDPA 1QQCA 4O2AA 2BE3A 5FJKA 4RQEA 2VZOA 1Z7S3 2ODMA 3SYQA 4JRAA 2RS51 3HN1A 3I2FA 1Y43B 5FR3A 4DR6O 4IV1A 1G6NA 3W21A 3JD0A 1Y76B 1VPHA 5IAXA 4I09A 3CF6E 1IX9A 1SLLA 1NTKH 2A75A 4UCTA 2IVIB 4BLJA 3LEGA 3NV4A 3GHNA 2OPWA 1TQ5A 4KBZA 2R16A 3NWKA 2JG8A 1W6PB 2PHUA 5FCCA 2JE8A 5EBMC 1N33B 3A0HZ 4PI2A 4AEDB 1GZWA 1LOFA 4MTGA 1Y67A 3M8AA 1KJRA 3IAYA 3L71H 1GN6A 2Y0OA 4Y1ZA 3WX5A 4AE2A 2DYSB 4Q8KA 4PT6A 3UKNA 3WP3A 3J7NA 1OA3A 3F5TA 1K42A 1H8TC 4HVRA 2FDJA 3CO2A 1PK6B 2P3JA 3O1MA 3K3NA 2UWBA 4JKKA 3NQHA 3CHXA 1HNZB 3PU3A 4B3TO 1NQTA 2RE9A 5FWEA 1US2A 3EJKA 1GLHA 1M57B 4K8XA 3DEMA 3U0ZA 5JPNB 5IJ0B 3BPSA 1L7RA 3CCVV 2GN3A 3LSSA 4JV4A 3PURA 1SBEA 4B8EA 1CAUA 1FNYA 4WVZA 4I01A 1L7LA 1ZZCA 4Q4Y3 5G05L 5A80A 2Z2SB 4P9PA 2ZMLA 1EN6A 4OPHA 1YQ6A 2OX0A 3ABZA 4I55A 2J1EA 3O1OA 4AQ2A 1CAWB 1UXZA 1TME1 3H8UA 2WAAA 3KT1A 1J95A 3POJA 2GUZA 1PGW2 3CMGA 1N3QA 3SKJE 1UU5A 1GV9A 1UFIA 1GQPA 5GALA 4UWDA 3KQ4B 2DBIA 3NNFA 4MXVA 1D4M2 3UL2A 3I2JA 3K51A 3OCPA 1W8NA 2ORXA 1SKVA 2B45X 4OZOA 1AR4A 3H1HH 1D5NA 2VW2A 3UKTA 3T4ZA 4PQ9A 5LEKA 4DS0A 3KZ4C 1Z78A 4DUZB 4G3YC 3MLKA 1W9WA 2HEYF 3SPIA 4GIQA 5C5UA 1NT2B 2CSGA 1NA1C 5D8AC 1Q8OA 2RS11 4D94A 2JWPA 2MEV2 3LA7A 4DRVA 3GCWA 5A1AA 5F2WA 1FV2A 2PFWA 1RUH3 1AP5A 4XQ4A 1A34A 4MZUA 4FAGA 4X66B 2NN4A 3R65A 4RR3A 5FOJB 1C8M3 3N27A 3D3IA 4B3NA 2VH9A 4RR3C 4LBJA 1T6GC 3NV1A 1PNLA 1SCSA 3GDBA 4DR3O 3B2EE 3WB2A 3CJXA 1I7FA 4CH4A 2IWGB 3SR2C 4TV8B 3R4DB 3OR6C 4KHPO 5K0UB 3MICA 4E2QA 5H9CA 5GONB 3FUQA 5D8AA 1LENA 5L9RA 4R52A 1ASJ1 3ZSMA 1R6NA 4WBNB 3QF7A 3CJHB 3JBG2 3O0VA 4PBOA 4K8FA 1HQNA 3E5XA 4UFLA 2XGXA 4JYAO 2H0BA 2HJDA 3FYIB 5IK4A 1HP8A 2W47A 4YJ3A 1CVNA 2A5ZA 3ON7A 2JEXA 4DNYA 1POV1 3PL0A 3DTUB 4LFBO 2WO3A 4QHZA 4KNCA 3LDDA 5KHGA 3K08A 3IDAA 4ES9A 3SCFA 4L9BA 3AEIA 3LDCA 4W4KA 1RTVA 4ATEA 2V7QG 4N21A 3BFRA 1PM7A 1JW6A 4S2FA 1LHOA 4E9KA 4W6XA 5KHIA 4JHTA 3B8MA 2A3WA 1FPN3 2F43G 1V9U2 3N2GB 5JI7A 3MAQA 2DE0X 1PX4A 5H9RA 1XPWA 1E1RG 4PF5A 2DQ0A 3ZFGC 3AL5A 1BEV1 3FHIB 2DUPA 2UYAA 3LKJA 3T08A 5JXIA 4XFHA 3AZXA 3VBFB 2DCTA 5CN0A 4QPIB 2VUCA 4Q0VA 3STLC 2Y6FA 3ZR6A 1BHGA 3WSOA 4FP3A 2AHYA 2IZWA 4BYYA 4XFBA 1NU1H 5A32A 3LFMA 1XNBA 1GUIA 2JEMA 4OI1A 4BPZA 3OGVA 1DZRA 3FBYA 3M70A 1H2KA 1PNFA 2RS12 1IKQA 3NKTA 3BTXA 1AJOA 3POSA 3J7AU 5FZEA 4GULA 4J7KA 3KHBA 2W3JA 3WB1A 4IEWA 1WA8B 2ZS6B 3E97A 4MTXA 5DQ0A 3L70H 3E35A 4QKDA 5F5QA 1FJGO 4G2KA 5DDJ2 3VZOA 1RINA 4RSUA 2BRTA 2CGPA 3KHCA 5D5QA 2VQFB 2VZUA 5DAVA 3RYPA 5E1AC 3LSEA 3O0WA 3CPWU 2F4LA 3A2FA 3B01A 2WLIA 1IPSA 4IE6A 2Z0AA 2YC4A 5DABA 2WN2A 1GICA 3FB7C 4KFMA 5FREA 1DLBA 1ULGA 5GLVA 1QLEB 2OUJA 4N43A 4CUAA 1K5SA 2VMHA 3UYJA 2EJ7A 2WR9A 4QJFB 1SLBA 4K1ZA 4QE7A 1QJX2 5DECA 3IAPA 4P2ZA 4BB3A 1VQLV 3B09A 3OBRA 5HFMA 4QQPA 1J58A 4XACA 1ND2B 4UCRA 4JZGA 5APAA 1GKFA 3QH6A 5C33A 4LLOA 2RHPA 4UCSA 2A73B 4IEZA 1NQJA 4YJ3B 4XDPA 1AI7A 3G71V 4NUBA 1FAFA 2UU8A 1AUYA 4ZBMA 3MUY1 3UKMA 1RUNA 1CAVB 1GYKA 4JHZA 2G4IA 3W58A 1M1KW 3UQ8A 3CJHA 4RHV2 3ZO0B 4P9JA 5FY8A 4B3RO 4EROA 5K7PA 4ATFA 4HNAB 1HDKA 1VQNV 4LPLA 5FY1A 3VBFC 5FZFA 5LGTA 5C6CA 4CCLA 4CXYA 1VARA 5FZDA 4BM8A 4Y3OA 5J3UA 4JV5O 1AYM2 2ZACA 3WUCA 1UZYA 2I74A 2VW0A 5LBBA 1RSOB 3TCUA 1M93A 2V72A 1PV0A 3H1KH 3T0AA 3AKRA 4JI6O 1JN2P 1Q86W 3N9NA 5CAZA 5J9PC 2YBKA 4CTEA 3WG7C 3E89A 1S2EA 2D93A 1VQ7V 3MEPA 3O1PA 5BNOB 4D8MA 5JZGA 1XYPA 3H1JH 3LA3A 3WU2Z 2Z5WA 3CEWA 4ORFA 5B4XA 2FL4A 1QJU1 1RUI3 1VIWB 3J80N 5EJ3A 1A32A 3AP4A 3H1IH 5JDBA 1LHUA 4HOOA 1ND3C 2JG9C 4NAMA 5JIAA 4IGGA 3G6BA 4AQTA 1RVF2 1WN7A 2JGDA 2VVFA 2A6ZA 5EQUA 3WW1A 1L0NH 2ITDC 2WQ4A 3KV9A 4DV0B 2FYUH 3PUAA 4NB5A 5FY9A 3AYCA 3SYOA 4COYA 3AG2B 5CA3A 4WFBV 4XFAA 3CCUV 4X20A 5CIRA 4DV1B 4D69A 4D7TA 2R061 5JCOC 4X88A 1RUE1 5FYSA 4DV7B 2XKOA 1XE7A 2GTAA 4OPAA 2WA4A 3DXTA 2WS92 1P7BA 1LGNA 4TZDA 3I97A 4PJ0Z 1US6A 1GRJA 2WFF1 1LAJA 5ACA2 4GX5A 3ZRWA 3VKLA 2Z5UA 3GALA 3H0OA 3H1YA 4DUVA 1QLEC 4ZHQB 1W06A 3CLPA 2QTOA 3DPRA 1QJU3 3FD9A 3MYXA 4ET7A 2YIAA 3HQXA 3H1MA 3THOA 2BFUS 1FXKC 5FMBA 2ZCWA 1PMIA 2PQQA 1BK1A 3JD3A 3RW0A 1BVVA 1I0HA 5CFCA 4LJHA 3NJZA 1J3RA 3CE2A 1G9DA 2O1QA 4X1IA 5LYJA 4LF5O 4QDRA 1CIYA 1AYM1 4MW8A 2X7RB 2C9AA 4YVSB 3QNEA 1XC6A 1KMIZ 1JU3A 2PELA 4HT1T 2YROA 3I3DA 3LA2A 3HJRA 3AMNA 2D3SA 2A7AA 1X59A 4AEDA 4AVTA 5CFCC 1N32B 1BQZA 2E5LB 1HQLA 3T1LA 1B09A 4FVVA 4GJYA 3GZAA 3ZM8A 4QDSA 2WFF3 5DAXA 4CEWA 5EP9A 5BUVA 4CA9A 2IW5A 1YIJV 2GNBA 4HG6B 4TQDA 1UIJA 3PUIA 3ZYJB 1MS3A 1QU7A 2R70A 1IG3A 3LSDA 1LECA 3ITQA 3MZHA 2YEVA 4AI2A 2J1VA 2GC2A 1JYCA 3OGCC 5JXJA 1H1IA 1U12A 1GAXA 2WNUC 3JD72 3ZN5A 4XMIA 3B94A 3E86A 3C3TA 2P06A 2X05A 3HKEB 4Y1XA 5H9QA 1R3KC 2YUEA 5IFPA 3NNMA 2CDPA 3B40A 2ES3A 1GMGA 3OEBA 2Y60A 4W4LA 2PHTA 3JATB 1W8WA 1AR81 4SLIA 2GC0A 3E2EA 1OSGA 4DV6B 1IURA 2XHKA 1QNMA 2FCVA 4QX8A 4YW1A 4F4LA 3WHUA 1PO23 4S2DA 4UB6Z 4NN0A 5FPLA 1OC1A 5FY4A 1PGL2 1RUE2 2TBVA 4EWDA 2DUOA 1AF9A 1AR61 1RJ8A 3FB5C 3JAMN 2WS91 3RJ2X 3KCYA 4GLXA 1F51A 1H1AA 4OHWA 2W0XA 2A6VA 3GCXA 4FK5C 2ZNJA 5F2VO 1YQCA 4CH3A 2VOTA 1OQDA 2YFZA 5FZHA 3WZ1A 1EM1A 1V6LA 1JYTA 3VD9A 2V5YA 1Q43A 3K5LA 4IE0A 1ACCA 2W5FA 2PHRA 1EPWA 3MIFA 3ABKB 1QJX3 5T55A 4K3UA 2OTJV 4QHBA 3BIEA 1HX6A 3CZUA 3J8F1 3ZXFA 2YHJA 2YUAA 4YRDA 5L3DA 2UY9A 1S0EA 1HN0A 5FYUA 1TMF1 2W1SA 4WCEV 2BBAA 4PIXA 5BNNC 5F3EA 5BXZA 3LWCA 1Y7BA 3ETEA 4E2LA 1AILA 1ZL8B 1OUSA 4BQ4A 5E79Z 4YM2A 1W9YA 1DQ6A 2ZZQA 4LUMA 3VBSA 3CRQA 3ZSLA 1LEDA 3NR7A 1DP0A 4LQRA 1RUD3 1FPN1 1FAYA 2GC1A 4EWEA 1X9PA 1G7YA 4F7ZA 3UJOA 1XNTA 5C5TA 1PHMA 3J81N 4AFMA 1ZAUA 1S0CA 1RUG1 1W0KG 4LBEC 1JYXA 4DR2B 3IDEA 2RJLA 5EJZB 4CS4A 5BPXA 3QLQA 1JYVA 1OA2A 4RQPC 2G9ZA 2E31A 2A7WA 1HXS1 5FYVA 4UB8Z 2ZAAA 2WQ8A 5DN6G 1UOBA 5JOZA 3LPFA 3TXSA 1R1ZA 5A7WA 3USUA 2JDYA 1VBC2 4JAUA 4BIOA 2DVBA 4XYXA 1SQVH 4GUNA 2J1SA 2JDMA 4WM7B 4JZ2A 4CCNA 2EIBA 5IK7A 1SLAA 5E1RA 3N9MA 3H9VA 2VCMA 1POV0 2VO5A 1QWRA 5FZMA 5FZOB 3NO8A 1WLTA 2DFBA 5IK8A 1GN4A 5FYTA 2ZTNA 3TYJA 1K33A 4FFBA 4Y24A 4U3JB 4BWAA 1WB7A 5JZGB 4F6RB 2UU9O 1W6QB 2GUZB 2O57A 2UWCA 5LOVB 1LODA 2XJSA 4V2VA 3HN3A 2RJKA 4O2BA 4A42A 5JSPA 1UCXA 4AR2A 3FJSA 2JE9A 1LOAA 3O14A 2MPFA 2JENA 1BL8A 5IVYA 1AYN3 1KB9F 5D1IA 3POGA 4LFAB 5CA0B 3BVCA 3J8F2 3J7MA 2AGSA 2P5BA 2D6MA 3MLLA 1ND3A 4OX9O 1B06A 3ASNC 5C71A 1CJPA 2RS33 2WLIB 4FPOB 2Y33A 2WINB 1RUF2 3VQWA 4LITA 5JVDA 4RL7A 3V56A 2E53A 1GM9A 2EALA 2R063 2VNGA 5T3NA 1RUE3 4DY3A 4KL1A 3CC4V 4XBFA 3ZFGA 3BI3A 5FP8A 3SQOA 3ZN0A 1XILA 1AHSA 5IWFA 1QGLA 2FDKA 4QD2A 4BIUA 4GZ9A 5H9PA 4CUGA 3UETA 2K1EA 2PI4A 4FQZA 1R6TA 3B93A 1OF4A 3OTOO 1FPOA 3M1HA 5FL7G 2TEPA 1QHDA 5IT9N 2C9KA 4F3JA 4ZKIA 3NNJA 3VBFA 5ITZA 2P17A 5FPZA 2ATKC 4LF8O 3WDTA 2G1MA 4BQ5A 4QHOA 3T4DA 2X0LA 1Q5OA 2BDRA 2W1WA 1PZ7A 4QAWA 1XBFA 1YIPA 5IYZB 3RYFA 3T2OA 5K1XA 3CP1A 1ZBE1 4CXWA 5F37A 4JI0O 5FKBA 2YXSA 1COV2 2WO2A 3N9QA 5EYXA 2J1AA 2FZ2A 1AL22 1BCCH 1SACA 1AJNA 2CAVA 1KP2A 3A8TA 1UOFA 2Q1ZB 5T52A 1QR8A 5FV3A 2YS8A 5B1OA 1IQDC 4KMQA 3O0XA 4WM8A 5LCWL 4ZI7B 3ES4A 1GOGA 2IXKA 3VBRB 4NTWA 3S30A 4RO2A 5IY5C 3POFA 1J1TA 1TEIA 3C7HA 4XEZA 1AJQA 5ERLA 3PUSA 2LJ2A 4LKEA 3ZRSA 1AR91 1G9FA 1W2AX 5HV0A 1QNYA 2Y8KA 3B02A 4LR3A 4DR7B 5FK7A 4Q4V2 4OQ8A 4PDVA 1J5EB 5CKNA 1S0DA 5A3PA 3ZIWA 3JCUZ 3ZFEB 2ZAHA 5LXTB 3L9DA 4E27A 3HPLC 1RUF1 1LU2A 4XFCA 4CCOA 2O8OA 4LCUC 1WA6X 2YIDA 1HNWO 2BVVA 4JYBA 1CJDA 1QDOA 5B1NA 1CR7A 1HN1A 1HJFA 2KXLA 3CSXA 1NLSA 3PUHA 1RM1B 1YLLA 1COV3 2XLAA 1RXFA 4KGQA 3UT0A 2RV9A 3WDUA 4HANA 1JMKC 3CWBH 1KFXL 1JH5A 5J98B 4DRXA 2WQZC 2F4VO 3IGAC 3TEYA 2PYTA 1Q8QA 4BU2A 5GKAC 4LBLA 1B6QA 4XBNA 5SV8A 4HMZA 2JX9A 2AZ5A 2HWD2 4UFMA 5I91A 3VBUA 4COZA 3SMHA 1YWKA 2H6BA 4FPYA 2XAGA 2AC1A 1D0GA 1MOFA 1ZRCA 4LNUB 2PF4E 4IEYA 1OURA 3GZEA 1OH3A 3S0MA 2RN9A 3TGUH 3THDA 1SQFA 4XBLA 4CCDA 4URAA 4P9XA 2WLLA 4RN5A 2LROA 4I9WA 3IKWA 2BGCA 4A7KA 5B66Z 1MNGA 2CH7B 2EXJA 2HWE3 1GANA 1Y9GA 3JASB 1COV1 4U2AA 2XT9A 5CBFA 1L7QA 4AFCA 4LEJA 5LA6B 2ZT9B 1ST8A 2QE7G 1IPJA 3C2UA 2Q8DA 1G86A 1LR1A 4IL7A 3K77A 1KC8W 3OY8B 3AG2C 3WF4A 3TAYA 1HXS3 2R49A 3NVCA 1SG3A 1UY0A 2WWSA 4JZRA 5KC5A 1V9PA 4ZONA 1LOGA 3ME2A 4YM1A 5J2TB 4YPJA 2QWOB 4OCTA 2ZCEA 4DB5A 5D5PA 1GM8A 2PYJA 1O6UA 2MHFA 3BKZA 2W68A 3S3WA 2ZGMA 5FMOL 5F3CA 1NZCA 5C4WC 3RMXA 3B4SA 4UW5A 5M0TA 2VQEO 1DHKB 4P9IA 2QM4A 1HJGA 5CBHA 3RYFB 5JR2A 2WS93 2Y64A 4KHPB 3Q8BA 2VC9A 1T2XA 3MFCA 4FJCC 4WBBA 4AQYB 4YY3O 4JASA 4ZKTB 2ZKLA 3SJBC 2OZJA 3ZCCA 1V6NA 1ENQA 4KG8A 4JI7B 2QJVA 1ULOA 1WP7A 3KCXA 3RT3C 3QTCA 3X29B 2XVLA 3RYKA 2K0GA 2GSMB 4XJ9A 3AFKA 1GH6A 3RSJA 3VD7A 2XJPA 4CDQA 1HRV2 3HKEA 2R9IA 1O5UA 2VXJA 5FUPA 3BHPA 1JBCA 5E16A 4L8JA 5EFUA 4KBBA 1H1MA 4PF1A 3ZYGA 5IAVA 1LUVA 2WDBA 3BALA 4H14A 2RJ2A 2DYCA 5T5JA 5FZ4A 4IGOA 3WW3A 4CC5A 4JI4B 5F32A 3H01A 3ETDA 1OMIA 4LA2A 5A70A 5LRSA 3IZOA 4G27B 1AROP 2E5LO 2AACA 1OVPA 4U36A 3VOUA 4L97A 1FX5A 1W2NA 2GALA 5LZ6A 1JX9A 1ZWIC 1YF2A 1I3HA 1I94B 4OUMA 4N9IA 3AFGA 5F39A 1UYPA 1LUWA 2FB5A 1IS4A 4UBHA 3AX4A 3JD71 1NA1B 4XZPA 1KECA 2DU0A 4PA9A 2QQNA 1RHI2 3I54A 1YJNV 3KCCA 2ZM6O 5FJHA 2VS0A 2B46X 5KWRA 1X4TA 1V6OA 1JHNA 2QQPA 4XUQA 2LW1A 5LATA 1FPN2 3QO5A 1OI6A 1CD3G 1UYZA 3ZKYA 4QGNA 5JPMB 2OYQA 2QEXV 3UM7A 3ZHUA 2ZGRA 3DGEA 1IS6A 4BISA 1O3SA 1RUJ3 4MUVA 1H8TA 5JVVA 3N35A 2OZ6A 5F5CA 1VBE1 3PMEA 3HEIA 1YYNA 4DW1A 4JRLA 3BY6A 4IV3C 3QVNA 1PZ9A 1SFYA 2ZX4A 5LA6A 1NVPD 2RM21 3CKHA 1VQ4V 2VAUA 1KEXA 2GMMA 1O9GA 1NBMG 2Z69A 2ZNIA 3BABA 5LWBA 3CCEV 2AYHA 4LE3A 4HVOA 5IJ9B 1SQPH 1H38A 1HNZO 3O1SA 1GU3A 1TME3 2WYSA 3SH4A 2ZGTA 2P4KA 1MACA 2YPDA 1D0HA 1R1A2 3AYDA 1I6XA 1W0JG 1RITA 2C2AA 1AR93 3L2YA 1PNGA 5DM6V 1UZ0A 1VQKV 2RG4A 1W0PA 1XHZA 1QF3A 5FQ0B 1US3A 3A4UA 3K59A 3WF3A 1Q8IA 3LEMA 2KR2A 4CDXB 1IG0A 5AC92 2BWCA 1Q6UA 4DV7O 1XNDA 1BEV3 5FPVA 1OLRA 3H3ZA 3T1YB 3H1LH 5D21A 4AK3A 2VBBA 2B5HA 2XDVA 3RZHA 4GMP0 3T09A 2ZABA 3E8BA 3CRAA 1LESA 3KKYA 1IS3A 2P6HA 4GX1A 3T2PA 3CD6V 4LFCB 1PM9A 3PN1A 1I5YA 4XAAA 1QJY1 2DW4A 4P02B 3KLSA 5IW0A 4MXWB 1MZ5A 4LNVA 4MH0E 2DU1A 3OB8A 2VTXJ 2NPIA 4B3RB 4QPGC 3PTRB 3FZ3A 3BTAA 4HNAA 1WCKA 3RDIA 5C8CB 2D3OW 2QVSB 2QDRA 2R073 1SZXA 4UFJA 4G28B 5C93A 2ZE8A 2CTPA 1WPBA 2D6NA 2QFEA 4LBQD 2FD8A 3VBHC 2F66C 3B9CA 1XL4A 4RQPB 2DJVA 3I49A 1FMD2 3IDCB 2CTRA 4OX9B 3K03A 3W9AA 2EINB 1S77D 1Q81W 3PUQA 3CXCU 4LK6A 3PIJA 3D5OA 1WW5A 4ZS3A 1FYJA 4P9GA 1ULDA 2HWE1 5FZBA 2ZA9A 1FD9A 4QQ2A 4UW3A 3O7OA 4LK7A 1V54B 1FOD2 4PIZA 2DYSC 1OT5A 4EB6B 4ITCA 1E1QG 5FYZA 4EN8B 4XABA 1UY3A 4QXCA 5C9AC 3ABMC 3OD4A 3T1YO 1LOCA 4MSWC 5FQ0A 1GR3A 4TTGA 2UUAO 1ZBE2 2F17A 3N7KA 4XXAA 1I5XA 4HZ3A 1OPOA 4CDUC 5EC2C 1IBKO 5EBWC 5CEHA 1ENRA 1VQ6V 5FP4A 3KSCA 4L92A 5H5NA 1UU6A 3WFVA 4LWSA 2PUSA 3POWA 1TE1B 4ABMA 1JJOA 1ZREA 4AVVA 1MS0A 4XJUA 4FT8A 1XEQA 2XB6C 4YZ4A 4TUYA 1YTFD 2P1BA 1H8TB 4XFGA 1O8PA 4CEWC 1KD7A 4J9YB 2VXRA 3JALA 4QKNA 3MW4A 2ZX2A 2FDHA 4Z8BA 3PVBB 1S0IA 3KQRA 4HFSA 3LEIA 1SZTA 4M01A 3DV8A 2EICA 1FYUA 2V73A 2QQIA 1XRUA 4I0XB 2ZINA 1KDKA 2R32A 2A3YA 2D5HA 4DYLA 4COWA 2KB1A 5ACA1 3L74H 4DQAA 1JMUB 4YLZA 3VBOA 4JDMA 3WG2A 4IEXA 2ZIOA 2DQ3A 4WFEA 5FYIA 2VWKA 1XI1A 2HKXA 2ARBA 3ZIAG 4AGRA 2P37A 3VBHB 4JQRA 4NVPA 4XC9A 3KM5A 2A6WA 3MI8A 1QLNA 2RDNA 4GH4B 1WLWA 1FMD1 3LAGA 4E4EA 2ARCA 1GWLA 3VBUB 4PLOA 2BNMA 2HFEC 3Q8AA 3TEWA 2Q4SA 4O4HB 3JQWA 4JGZB 5I0UA 2W87A 4UI9L 4IESA 5J37A 1CXZB 4DUYB 3GBGA 4WVVA 5JJNB 2QKAA 3GB7C 3AC0A 1UL9A 4CDWB 1VEWA 4MGYE 4OYUA 2OIIA 4XXPA 1NQDA 1PNKA 3OPWA 2XKPA 3PMSA 5C3PA 1RB8G 1AR92 4CU9A 3HOBA 4K9SA 5LL6Y 1IOAA 4ISRA 2BUKA 1JQ0A 3T4VA 4LF4O 5HXVA 3GWOA 4WFAV 1Q6HA 1PO11 2F4VB 1FXVA 1JS9A 2YEVB 2Y6HA 1UZZA 4UCVA 4XURA 2E7TA 4EQVA 3BVOA 5KX5B 4QU2A 2JG9A 3A7QA 5K1PA 4OUSA 3ELNA 3GZTB 1E5HA 2W52A 1AYN1 4KUMA 1VBE3 4FPCA 4LWSB 1YJLA 4N90A 2EILB 5B1AC 4I50B 1XOYA 1TME2 4RGKA 3WD5A 1IPKA 1UO9A 3QH7A 2VOVA 4BWOA 4FMTA 3CMAV 3IIIA 2LFRA 1JXNA 5GZGA 5K0UC 3PJSK 3MPBA 2VQTA 3AB0A 1L3JA 4X65O 1YJKA 3AK1A 3DN7A 1H8HG 5LB6A 2GV9A 1VBB2 1RPOA 4WV8A 1R093 2K2SA 5LY2A 2EXIA 4ZHNA 2QE3A 1UPGA 3FFZA 4MOAA 2HJFC 3N7JA 1YHFA 1JUIA 4RAIA 1MVEA 1NXD1 3IIAA 5GONA 4KGGA 4F6EA 1DK1A 2ID4A 5A2QN 2ZHMA 3N7MA 5B4NA 5IT6A 4HK9A 4FOYA 5DN2A 3I3EA 4Q4X1 2VCBA 5I0DA 3H3UA 2PYLA 4Y20B 2UXNA 1GZCA 4FTEA 5KUKA 5CKQA 1ULFA 4EB6A 3ASOB 4E8DA 1VAKA 3JD4A 3ORJA 3JD73 3VD4A 4RS5C 4W65A 1S55A 4XHXA 1RHI3 3JARA 2VQUA 1ZZ9A 4DIQA 3ZX6A 3VQVA 3QG5A 4Q4Y1 2DUQA 3OE7G 1WJZA 3E8HA 5IE9A 3WNKA 4CDWC 1NR7A 1OFNA 4LFAO 3BRCA 2E7QA 1RC6A 1TNRA 3GNEA 4IXLA 3TOJA 4JV5B 4IEUA 4BQYA 3APQA 4M0NA 2VG9A 4GX2A 2XJUA 1RUC2 2OVUA 1YFUA 2IVJA 4O61A 3RYRA 1V00A 1OHHG 4B7KA 4AAPA 3N36A 4IE5A 2YXYA 2PXJA 3OJBA 2LRPA 1JVMA 4DPNA 1NS1A 3SNMA 3VBOC 4DV5B 1R64A 5IYDO 2HEWF 4HBNA 2YU1A 5FZ7A 1PO12 2R042 4GQ7A 3HKDA 1AI6A 4LXLA 3WOGA 5A33B 2Z4FA 3JB4C 1W03A 1TA8A 2BSKB 3ZXEA 3N3HA 5JMCA 1EN4A 1F8VA 5BNOA 2SLIA 3NNGA 5FLJA 3L75H 1GQGA 1URXA 4MGQA 2Z42A 1OCCC 5FYYA 1K34A 4JI2B 2QDOA 3LFIA 3VQXA 3RZLA 5FAXA 3I3MA 2CY6A 4O7XA 1RHI1 3RZZA 1LHVA 4TQFA 1IKPA 3OTOB 4BQXA 3NMBA 3T0DA 3DC6A 5LMUB 3Q8EA 3RYIA 2X09A 4D6SA 1TMF3 3VDCA 1XMOO 1KDMA 4DEQA 5CISA 3VDBA 1BJQA 3WHTA 4BXSV 1YI2V 2EIEA 2XJQA 4LR4A 1JFFA 4GB31 1FNZA 4AEJA 4UW6A 3OUIA 2QQOA 1W8ZA 3ABMB 2DVAA 3WINE 4PCRA 3M4FA 3K58A 3A0NA 2OKXA 3SCHA 1A8MA 1W39A 2X53S 2XHNA 4KXRA 2JD4A 3ZKUA 1COWG 2VD7A 1HDJA 2AEZA 1VBC3 4YW6A 2ZGQA 4HKOA 3PTYA 4LH6A 4QNHB 3J4UH 4CE8A 2XG3A 5C9AA 2Y6KA 4LO7A 2PHDA 4FFHA 3AXDA 4L87A 1V6IA 4GXLA 3OTFA 5IJ0A 3CXHF 5C3OA 2WT1A 1IQAA 4QX2A 3VL9A 4UV8A 4NHXA 1E79G 2UUCO 3WNPA 5I0RA 1OD3A 4Y4YA 1O3RA 2OYZA 1H2GA 5ITZB 4RWUA 4NPLA 4I5SA 3I59B 4PI0A 3HT1A 5IVFA 3WR0A 3T30A 1CPMA 3G7DA 4FTBA 4AW7A 4IE4A 5DUUA 4FPGA 4X62B 4RFT0 3BYWA 2JIGA 4R50A 1DZTA 2ZZJA 5KXDA 4Z2WA 1B3QA 1DZQA 4QPGA 2UUBO 1WBFA 2WLMA 4KI5M 2IM9A 4HLTA 2QZ3A 2RDCA 5FP9A 4BW9A 3VQYA 1QJX1 2EXKA 3MHSC 4IE7A 4WFFA 4FLWA 1ZYBA 2E75B 1J83A 1W6PA 1KJLA 3OR7C 1PGSA 5J96B 4A5UB 4HYOA 2FZ1A 1LJ7A 5CBLA 1Z5WA 1KD1W 4QGLA 5CFDC 1SFPA 1K5JA 3WF1A 4ZU5A 4CSWA 4OHZA 4QXBA 3CJIB 2HYKA 2P6CA 4FPPA 2XJTA 2AZ2A 2QWRB 3FN9A 1FATA 5CVRA 3RYHB 1BSMA 2BGOA 3POBA 4JGZC 1NH2B 3JCZA 4RHV1 3WNOA 5LBFA 2HBTA 2CK3G 1LU1A 3SEEA 1NOVA 2UY8A 1UMZA 4IEQA 3WT3A 2ARAA 4Z07A 4FAHA 4NWVA 2D44A 2O0OA 3F7VC 1CAXB 5FYCA 2DTWA 1BVP1 1UOJA 1V0AA 3AK0A 4DR5B 4GWMA 3W7SA 4G9SB 5DG1A 1YIFA 2QUOA 3DKWA 1XDCA 2QKCA 1JZ7A 4NE9A 2QA4V 4TLFA 3ZR5A 2GNMA 4META 5LBQA 4JTCB 1PO13 4CH6A 4BCUA 1Y6XA