5KHJA

Hcn2 cnbd in complex with uridine-3', 5'-cyclic monophosphate (cump)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
199
structure length
199
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Cyclic Purine and Pyrimidine Nucleotides Bind to the HCN2 Ion Channel and Variably Promote C-Terminal Domain Interactions and Opening.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 67
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5khjA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5khjA02
1YHFA 2MPFA 1GQGA 4JTNA 2H6CA 3NW4A 4HLTA 5F1RA 1UPIA 2QDRA 3RNSA 3H3UA 2XLFA 3BALA 2VPVA 2IC1A 3KGZA 4WZCA 4BHPA 5FPZA 3MPBA 3H50A 1ZZ8A 4HBNA 3E5QA 3FZ3A 3UKTA 2GAUA 3E5XA 4H7LA 2OYZA 4X6QB 4NVPA 5KHHA 4KU7A 1RGSA 5BV6A 1NE4A 1DZTA 5FLHA 2CAUA 3BPZA 4XFCA 4LLOA 5I93A 4Q0QA 1UD1A 3CO2A 5KHJA 2XL7A 2WFPA 4AVCA 3SMHA 2MNGA 2GC3A 3LA3A 2UY9A 4FT8A 1CAWB 3S7IA 4N9IA 3KMHA 3FX3A 2O1QA 4IEUA 4O9GA 3EO6A 2PAKA 2PAEA 4ZU5A 3R6SA 4PIXA 1OD5A 2DCTA 1XRUA 3H3ZA 1O3QA 3OD0A 5KHIA 3LA2A 3EHKA 1ZNPA 5I0RA 4GULA 5I8YA 2PAMA 3M3IA 2CGPA 1V70A 2HKXA 4E2QA 5FLIA 3HQXA 3FE5A 3SCFA 4X6RB 3B02A 4R52A 4CYDA 3PLQA 3NL1A 3WW4A 2Q0AA 3O14A 3DL3A 2PQQA 1VJ2A 3MYXA 3RDIA 1I5ZA 5LRSA 1ZZ6A 3EBRA 4DINB 3SHRA 2IXIA 4MH0E 4IEVA 3CF6E 2IXHA 5J3UA 4FBFA 2GC1A 3DV8A 1SFNA 4XEZA 4QGNA 1U12A 1Q3EA 1YWKA 3DN7A 2OA2A 3ES1A 2D93A 5C6CA 4ONUA 1YFUA 4F8AA 1O4TA 4ZU4A 1EP0A 2IXCA 2BNOA 1JUHA 4IEXA 3IDCB 3U11A 4I0BA 3E5UA 1XE7A 4IESA 4PJYA 4EWDA 4LA3A 1ZZCA 3EQEA 3H1YA 4HN1A 4JV4A 3RYRA 1ZRDA 2IXLA 2IXJA 4PIZA 2B8MA 2XGXA 2PTMA 3CJXA 5J7MA 5C8WA 3WW1A 4EWEA 1RTVA 4XF4A 1CAUA 4XF1A 5J48A 4A2UA 2BYVE 5KHKA 1X82A 4XF3A 3FFQA 4Z07A 1ZZ9A 1DZRA 2Q1ZB 2D5HA 2K9ZA 3CEWA 3MZHA 4MGYE 3H7YA 5FPXA 3SCGA 2Z69A 4B29A 5K8SA 2O8QA 2Q30A 4E2SA 1QY4A 4HSLA 4YYOA 5FDBA 1LKNA 3LAGA 1L3JA 4HSJA 5JSPA 2H0VA 2GZWA 3KSCA 5EZWA 2ATFA 5CADA 2KXLA 3LOIA 5I0SA 1O5UA 3BCWA 3SXWA 2QNKA 2XKOA 3I7DA 4WVZA 3PVBB 1NZCA 5FCCA 2ZKLA 1GQHA 2BNNA 5I8TA 5BUVA 4MZUA 4J1XA 3E6DA 4KWKA 4RD7A 3I59A 1ZRRA 1VR3A 3NVCA 1PM7A 4IETA 5JCTA 3H1WA 4YRDA 2GC2A 3RPQA 4LA2A 1VP6A 4ZU7A 4LUKA 4D7SA 4META 1Y3TA 1J1LA 4QM9A 4E2GA 1CX4A 2CAVA 4N9HA 4IEZA 1Q43A 3ROUA 2EAAA 3C3VA 3WW3A 3H9AA 4MV2A 3LA7A 3PNAA 4Q0VA 4AQ2A 5CVRA 1HW5A 2GH2A 2OZ6A 4F7ZA 3E6CC 1G6NA 4I09A 2GU9A 3RYKA 4IEWA 1CAUB 1UIJA 5LEKA 4EWAA 1EY2A 2FQPA 2MHFA 5JR7B 4AQ6A 3IIAA 1YLLA 2XHKA 2ET7A 2PHLA 1ZREA 3NJZA 1DGWA 2ZCWA 3GBFA 4LUMA 1X7NA 4KL1A 4HZFA 4XFAA 3S0MA 4XFFA 3ETQA 5KHGA 5HI0A 5FQ0B 4HN0A 4Q0UA 1OFNA 2Q4SA 5I0TA 4QX5A 1UW8A 1X8EA 1WA4A 1YFXA 5CU1A 4KWJA 4I3PA 1DGRA 4MGZE 1J3PA 2UY8A 5BXXA 5E16A 4HVOA 3IBMA 3ACLA 5AVPA 4I02A 2VECA 3EJKA 3H7JA 3I59B 4UBGA 3G7DA 3ST7A 5JSRA 5JAXA 3FJSA 5E1RA 1Q5OA 4D7TA 3D82A 4K8FA 1CAXB 3ES4A 1FXZA 1H1MA 2B5HA 1NE6A 3OF1A 3VHRA 5KBFA 3NSTA 1EYBA 1YFYA 3WW2A 4HVQA 1J58A 2XLGA 4ORFA 4KU8A 4JVAA 4XFGA 2F4PA 1LRHA 4LULA 4LEJA 4LTAA 3TNQA 3H1MA 3UKVA 4OFGA 1I6XA 4UXAA 4XF9A 2PA7A 1J59A 3FHIB 2OZJA 1EPZA 1IPJA 5FQ0A 1RUOA 3KCCA 2IXKA 3IDBB 2N7GA 2BGCA 2EVXA 2OPKA 3E97A 1ZRFA 1FI2A 1ZZBA 3LWCA 4YARA 2PYTA 3L2HA 4JTOA 2C0ZA 5I91A 4O9EA 2XL9A 2GC0A 5BPXA 2HJIA 2K0GA 3BB6A 3DKWA 2ET1A 2PHDA 4I01A 3USSA 4I2OA 4XFHA 2WC2A 1H1IA 4QXKA 4L2NA 2B9UA 3NKTA 4P9GA 3M70A 4XETA 1CAXA 1O3SA 1OI6A 2QJVA 5I8SA 4FAGA 2VQAA 2QCSB 4OLLA 1NXMA 1UIKA 5I0UA 5T3NA 1O7FA 4KWLA 4MUVA 2ETEA 1XE8A 1O5LA 3BU7A 2D40A 3D0SA 4IEOA 4XFBA 1QWRA 3HT1A 5D1IA 3FWEA 3IWZA 4R8HA 1IPKA 3HIFA 1FT9A 1O3RA 4UBHA 3TNPB 1O3TA 2XLAA 3D0JA 1CAVA 2D5FA 3KGLA 1WLTA 4HVRA 1YFWA 1SEFA 1Y9QA 2CV6A 2EA7A 2Y0OA 3HT2A 4IEQA 2PFWA 3OCPA 2Z2SB 1CGPA 1WGPA 5JSOA 4WBBA 3U0ZA 4QMAA 1TQ5A 4I0AA 1J3RA 3LZZA 1NYWA 1RL3A 1QXJA 2QVSB 5FLJA 4TLFA 5LEJA 4Q0SA 4L11A 2V09A 4MX3A 1J3QA 2XKPA 5LRRA 4BYYA 4YSFA 2H6BA 1RUNA 1X8MA 1LB2A 1QXRA 2BNMA 2UYBA 4Q29A 4AXOA 4QGMA 3SCHA 5EFUA 1YUDA 3CL1A 3I54A 2P17A 1LR5A 4PIYA 4AVBA 1ZRCA 4IEPA 3N4MA 3GYDA 4EV0A 4Q0PA 1OMIA 3QOPA 1ZVFA 3QACA 1ZX5A 4BH9A 4IEYA 3ZDSA 4QGLA 4AVAA 4FAHA 1CAWA 3H8UA 2BEOA 3OGJA 4XFIA 1SQ4A 4MGKE 1RC6A 3JZVA 4IERA 4Z82A 3CLPA 3E6BA 4J1WA 2E9QA 2I45A 3ELNA 5BY5A 3OTFA 3UKNA 1PMIA 4QM8A 4XF0A 1UCXA 3RZZA 3MDPA 1CAVB 2FMYA 1ZZ7A 3S7EA 3RYPA 4BIFA 4HMZA 4YNIA 4EROA 2UYAA 3U10A 4MGIE
chains in the Genus database with same CATH superfamily
2FCUA 2PHXA 2H6CA 5F1RA 3H42B 1VQ7V 4QWNA 1UKGA 4RUFA 2MEV3 3DKQA 1K45A 2VQUA 3VD9A 2ZXQA 3FZ3A 1KUQA 2QEXV 4H7LA 1AYM3 1YXWA 1HB2A 4I30A 2NP0A 4MGTA 4Y5SA 1DZTA 4XFCA 3G80A 3FB5C 1X9TA 1G6UA 5T5PA 3B00A 2HLDG 2RR12 1GZTA 1MS0A 2P3JA 1C1FA 2VRZA 3AFKA 1UY0A 4JAAA 3OE7G 5L3GA 1XRUA 1JU3A 2HHHO 3OD0A 4XDOA 4A6SA 1GNHA 1UX6A 4WBNB 4JI8B 1WA6X 4GULA 3JD71 5FLIA 2ZGMA 1TME2 5A80A 4RHV2 3DC5A 3POGA 4INDA 5H6QA 1OOPC 1LUVA 4LF7B 1C8M1 3AG3B 2Q0AA 2UUAB 3JD2A 2F6BA 1UZZA 3JD1A 2IU3A 3ZIWA 1RUJ3 4JAUA 4A45A 3AC0A 3GM8A 1TNRA 4XJ9A 2G9ZA 3TRSB 3CDZB 4ZBMA 3ACHA 3OJBA 4OULA 3C2UA 4FFBB 2UWAA 1QKQA 4XDLA 2O0OA 1F31A 1QJY2 5BR8B 4DO2A 1BEV3 2FDIA 3L73H 1H8EG 3NNJA 3CXHF 4CEYA 1ZBA3 2R073 3ZMUA 2Q8OA 3SLIA 4UCUA 4JGYB 3IFXA 1K8AW 3ZYIB 3GWKC 1L7LA 1V6OA 1N3QA 5D5PA 3USUB 4XDQA 1Q6HA 3CHXA 1NG0A 3L72H 5BNNB 3BCWA 2IBZH 3E22A 4MW8A 2R72A 4WVZA 1XHZA 3HWJA 4FFGA 5EYXA 1UYPA 3ZXFA 2YXHA 4MZUA 2GMPA 4KWKA 5FZ0A 1SERA 4OHVA 4OZXA 2EX3A 4Y22B 3DC6A 3VBFA 3LFMA 4PF5A 1OPOA 5CFCC 5L3FA 4D7SA 5HPOA 4QM9A 1F51A 2ZE5A 4QE9A 2A7WA 4F3JA 2JDZA 4FFFA 3LA7A 4WVMB 2B9ZA 4LWSB 5BY1A 1GH6A 3BI3A 3GXUA 1Q86W 1NBMG 2J1AA 2QQOA 4ZHQB 4CH5A 4DR1B 4RL7A 2W9XA 2BCCH 1REDA 3P1IA 4I9WA 1XB9A 4DR6B 4IE7A 4RUEA 4JI6O 1ORQC 2WNUC 4XUQA 5CU1A 1Z5VA 1UY4A 5J2UA 5L7OC 4M01A 4XDJA 2YU1A 3WDYA 1W8FA 1GYKA 3BA9A 3KF3A 3CS5A 4DV3O 2GP3A 1K4DC 3ES4A 3VUOA 1NE6A 4JGSA 1HNWB 4IV1B 2VGDA 1GU3A 1UFIA 3NAPA 4XJ8A 2Z4FA 3E89A 2VCMA 3POYA 2P34A 2Q5ZA 3KQRA 1GANA 2Q1MA 1B35B 1SPPA 3V64A 5CBFA 3CCRV 5FZ3A 4OQ8A 4FM2A 3L2HA 4O9EA 3T2TA 3K79A 4W6XA 4G3YC 1QDCA 4CCCA 4CRQA 2OWOA 5FPRA 4QXKA 4LR3A 2HWB1 1RP3B 4RO2A 2C26A 2HYKA 1C4RA 1AJKA 1CPNA 5LBQA 5CG9A 1NT0A 1EAH1 2YXLA 2VE1A 4QX1A 5D1IA 1GZWB 2CWSA 4FIPC 3CJHB 5C5TA 2P37A 3FC0A 2E6VA 4UWDA 3GJBA 4GWIA 1KDKA 1LEDA 5F3IA 5DUWA 2Z2SB 2AUYA 5A6XA 3V0BA 1G4YB 4DMIA 2QR4A 2AREA 2WLIA 1AI5A 1X8MA 3AM2A 2FDJA 2P3IA 1RM1B 5CBLA 3BA8A 4EZHA 2QWPB 2H3OA 5GZDA 5L3DA 5B1BC 1ULGA 5SV5A 2B5UA 5T50A 4AVAA 3FYIB 1LHUA 3JCIA 5AVAA 1AL21 1HV1A 4MGQA 4FM1A 1CD3G 5IVEA 3N7MA 2DVFA 5C8YA 2X05A 3UKNA 2HP8A 2ZA9A 4CCKA 2AGSA 4M3CE 4LF4O 4CXXA 5FYCA 4JDMA 5M0TA 5FZ6A 1PZ9A 3POBA 3CMEV 5ABJC 1JZ8A 4O4IA 3KHBA 1KD1W 1UPIA 2A6WA 4LMFA 2EALA 3POFA 1CR7A 3K08A 2YBPA 4BW5A 5F32A 4YVWA 1ZZ8A 4BK5A 4H3WA 1H9WA 5FP9A 2P06A 1ASJ1 1ENXA 4ASUG 4NO4A 4IE0A 4Q4X1 2J1UA 3L70H 3G6EV 1RINA 2WNOA 2JG8C 1K7DA 3KMHA 3P6BA 1VIWB 4NTYA 1A8DA 1WN7A 2K46A 5JUVA 2I74A 1JHNA 2P4KA 4H7MA 2ZZQA 1W8TA 5FKCA 1ULEA 2VOKA 2X29A 3MV11 4BW9A 1T2XA 2GV9A 4A3XA 3OYWB 5C8CA 3KV6A 2F4VB 3VKMA 3ME2A 4FZ1A 3H1IH 1I5ZA 1Q8VA 4UCRA 1WCQA 3BKZA 2UXCO 4JYAB 1MEC1 2ITCC 3F2ZA 3PL0A 4QPGC 2HWB2 2P1BA 3L2YA 1SFNA 4JI6B 3E22B 1IZ3A 1K97A 2D93A 2XG3A 4NXNO 1XOUA 4FPFA 3SJBC 4QB6A 5KAIZ 4XQDA 3NO8A 4PJYA 3JALB 2P6CA 5J9PC 4RQFA 3FYEB 3TXQA 3EXAA 1F7YA 5DZGA 1YQ8A 2JG9C 4QKBA 3W7SA 1XYPA 4XF1A 4Q4Y1 5KC6A 3VHNA 3ZFFA 2EBOA 5A7WB 1DZRA 2RJLA 2DV9A 4IGGA 1QJEA 4IDZA 5FKBA 5JSPA 3UETA 4X66B 2UXDO 4JI2O 3RWRD 3I7DA 2XVKA 5GLTA 2BNNA 1RVF1 4FPCA 3I59A 3POSA 1AR1B 3T1MA 4A7YA 1AL22 2W87A 4PBPA 3IKWA 1NQJA 4ZS3A 1V00A 1AP6A 2GU9A 3N27A 2YU2A 1ENQA 2H94A 4LBMA 2R9RB 5CZKA 3W7XA 3NAPB 4XE9A 3PU3A 1K33A 1VBC1 2XHKA 1CEZA 5A3WA 2ZCWA 4W6WA 2ZNJA 4XFFA 2VNOA 1SPPB 2W1UA 4FPJA 1IBMB 1MSDA 3B5LB 5BNOA 2E7AA 3LEKA 4LFAB 4MGZE 4TTGA 3AYDA 3OR7C 3IBMA 4HVOA 5FPLA 2VECA 3G7DA 4Q4X2 2A3YA 3VBRA 1BQ0A 3V56A 1WUVA 5C9AA 3BFRA 3VHRA 4IGPA 5KBFA 2G9GA 4AHXA 5FYIA 4K8ZA 5HCAA 2D6MA 3AJYA 4ORFA 4C90A 1KP3A 3SYCA 2GHYA 1DZQA 3T2QA 4AEJA 1BE3H 1YIJV 3STZC 1YDXA 1S5HC 1XMOO 1IPJA 1TG7A 5FQ0A 2HKOA 3V0BB 2QQVA 1HRV2 3O65A 3ZX6A 4WF9V 4IV3A 1MEC2 3SNMA 1WP7A 3IAYA 4I2OA 5E89A 1G9FA 4CXWA 1H1AA 1OI6A 1MZFA 4BPZA 2OT7A 3UCSC 1S1AA 4X8NA 2NYYA 3NMBA 1JFFA 1F4NA 5B3SC 1P8JA 1QWRA 1UXZA 3ZFEA 4A5UB 2XUMA 1IX9A 1HRI2 4AVTA 1OF4A 2ZT9B 3HKBA 1GN6A 4Q4Y2 3QBQA 4IEQA 3I2DA 4LP8A 5C8YB 1NYWA 1US2A 4TLFA 2Q7HA 2EULA 4DR7B 5FZIA 2B42B 4O2BA 3RZHA 4GB33 2GN7A 4O4IB 1VQ5V 1Q8OA 3K3WA 2FBEA 4XPVA 1ZBE1 1KP2A 2LGQA 3UT5B 4LKEA 1V6LA 3ZO0B 2QWNB 4NPRA 3UESA 1RVF2 4W6YA 2EZOA 1GZCA 1Z7S2 4LORA 1Q8PA 1JA8A 2WFF1 5CA1B 4DUVA 3BIWE 4P9LA 5LMNO 2WAAA 3OGSA 1RXFA 4BM8A 3C7FA 4J1WA 3MF9A 4AFDA 2XJUA 2E9QA 1MS5A 4DW0A 4O2AA 2NQYA 5JVVA 5F3CA 4H44B 3B93A 4UV9A 4N43C 2PZSA 5C3RA 4HMZA 4Z2AA 2VCAA 5CA6A 4YZ1A 5J2TB 1DLCA 1MVEA 2VZOA 4HL0A 3B09A 3AG4B 4I0XB 4B3SB 3KT4A 1S55A 4TXWA 2ADQB 1GN4A 3MLKA 1NXD1 5D21A 2AYHA 1K34A 4AEDC 4Q4V3 1H2MA 1POQA 1UOJA 4QDSA 3IZOA 4J9ZB 5FL7G 2VZ1A 1MS3A 1TVKA 2IZWA 4D6TH 1RMU3 4MSVA 3H1KH 3QF7A 1U96A 3R4UA 2VR4A 4A6OA 2X5IA 3PTYA 5KWRA 3SYPA 2WFPA 2WRAA 3ZMOA 2R9IA 1UPGA 1BHBA 2QTWB 4EN8B 1K92A 3KZIZ 4AF9A 3CRRA 1Q8QA 3LA2A 3Q8EA 3WG4A 4CP2A 5DM6V 5DDJ1 3QTCA 1HN1A 4YGEA 1GUIA 5JQGA 1W8ZA 3CJIB 4FVVA 3VQWA 3R65A 3WNPA 1XC6A 3F7VC 3TCUA 3ZN1A 5LA1A 3WNLA 2ETNA 5KXCA 5LRSA 4Q4W1 3S3XA 5FTTC 5LBBA 3HAGA 3CF6E 1GWMA 4AVVA 4QX8A 2QWOB 4DY3A 1O4TA 1RUD3 1RFYA 1HDKA 2IUWA 1CXZB 5IAXA 3GB7C 4IQPA 4I0BA 1JYWA 4UOJA 1ZZCA 4CZZA 4CPBD 2TUNA 4IL6Z 4C0HA 4CDWC 2KG7A 2XGXA 4OUMA 3EVKA 3WW1A 2EILC 3IN9A 4B3RO 2TBVA 3WD5A 1N3PA 1V6MA 1M06G 2BV4A 4CDUA 1H38A 1D4M1 5A3OA 2ZEYA 4YG0A 2RG4A 4XAEA 3OT7A 4M3CF 2YXSA 4FP3A 2YEVB 1IPSA 4ZI7B 5FPXA 4QXHA 5JOZA 3C8XA 1XMOB 1L3JA 2E53A 1SMVA 2QDNA 2RR13 1ZBE2 3VZLA 3VDDC 1PGL1 1HR0O 4BISA 2XTAA 3UGHA 1AI4A 4XJWA 3QH6A 1LOBA 2GSMB 3HNMA 4JGZA 4QHBA 2FB5A 1MS1A 1BT8A 3K5LA 2NN8A 3NQHA 1RUE2 5F9TA 2WFF2 1SESA 2JDAA 1YQ2A 1XNAA 4RHV3 2OT5A 3S5AA 5EIBD 2CAVA 3O1UA 4EN9B 3OPZA 5IYBO 1RXGA 3VBOA 1FYUA 4DV2B 1NLSA 3O7OA 2QTOA 4B3TO 4MLOA 2W6IG 2UUBB 1G9CA 4G27B 1YLLA 1L0NH 3C3SA 2HEVF 4U3FH 2VC9A 3GBFA 5L9BA 1LHWA 3JBG2 5FPUA 4JYBA 5KHGA 3HN1A 2R062 2VXJA 3OEEG 3T0DA 4J41A 5FQ0B 1PNMA 4XUNA 2Q4SA 3S5QA 2RS11 5APAA 3H8RA 4PD4F 5K0UC 2ZGQA 4HZ3A 3U14A 4I02A 3GCWA 4UBGA 4DIQA 3WG2A 3K5MA 3O9OA 5EWSA 3ST7A 4BZ4A 3FJSA 1XNKA 3ON7A 4ZPIA 1W9YA 4H13B 1H1MA 4FM0A 4DV5B 4A7ZA 1YFYA 4LO4B 4HVQA 2F66C 3MFAA 1NVPD 5EBMC 4LTAA 2GMEA 4YHHO 3HKBB 3KWVA 2VMEA 5CFDA 4EQVA 1CONA 3ZYHA 2VZVA 2JICA 5CB4A 2OPKA 5JJNB 2QWRB 1R091 2K0GA 2G1MA 5JI9A 1U97A 2BUKA 3V0AA 3VBUC 5IVFA 2CGOA 1XYOA 3WSOA 3DGEA 1J95A 2VQAA 1JBCA 2Y6LA 1WBFA 4AW7A 3SGIA 3IWZA 4BIOA 3R4DB 2D6NA 2WWWA 4DYLA 3ZXGA 1KITA 2VZ3A 1WW6A 4MXWB 1SEFA 1Y9QA 2BOCC 1CPYA 2PELA 1D4M2 5JSOA 1N34O 1LOAA 1OURA 2E26A 4O2AB 3OMAB 3HMYA 2V09A 1S0CA 3LCPA 3ZYBA 2JD4A 3VHPA 2P4EA 2I2SA 3OR6C 1VAKA 1PGL2 1S76D 1POV0 2P17A 3L9DA 2QBXA 4QKDA 3THPA 4YW1A 4DUYO 4LF5B 2XMLA 1XQNA 3AG3C 4DV4O 4GYCB 4X1YA 5C93A 2Q7EA 1D2QA 3IDAA 2VOVA 3ATGA 3OTOB 5FZ7A 1RC6A 5TISZ 1MQTA 3E6BA 3VL9A 3IMNA 2RJZA 3MHSC 2W1WA 2X5IB 2EIMB 5IVYA 1WWYA 3ELNA 3UYJA 2P22C 2HWE1 1CAVB 3ZMSA 2UWBA 4D6RA 2DYSC 4YNIA 2JB8A 3WU2Z 1EZVH 1IXMA 4FO9A 4KG8A 2WINB 2ORZA 4CCDA 3AZXA 2QA4V 1PVXA 1XNDA 5JXHA 5JQGB 3H3UA 4X20B 3AMHA 4WZCA 1PL4A 4COZA 1RUG2 3E5QA 4MVTA 3EMRA 3AXEA 1F8VA 1LHOA 3I2GA 1D4VB 5FMBA 2JE9A 5LGUA 1FOD2 1E5IA 3EFFK 4Q0QA 4GWMA 4D0QA 5J1XA 1HKDA 4AVCA 4AEKA 2WBKA 4J11A 5FWEA 1GN3A 1QJU2 3ASIA 5IT9N 1S4CA 1KGYA 3LE0A 4LO7A 1P84F 4JHZA 2CGPA 1F15A 1W2TA 4FVMA 2HWF1 1VBB1 2JE8A 3BTXA 4N23A 4X6RB 1N32O 1S77D 4YFWA 4YJ2B 2HJDA 5JVDB 1YITV 3RRDA 1R092 1SBDA 2NLRA 2HWC1 2CE4A 1JYCA 1G8WA 1LEMA 4DB5A 5F7UA 5FBZA 2KKWA 1YJNV 4CCJA 1EZJA 3TBDA 3CD6V 2Y38A 3MV01 4IGQA 3QNEA 4DR2B 3T1HO 1W59A 3KV4A 3POIA 5B1AC 4LNUB 1LU1A 1VF6C 1TMF1 4JI0B 3ZYGA 4DXTA 1HNXO 3IDCB 4LITA 2QKAA 1D2SA 4XUPA 5IJ0A 2IXLA 2IXJA 3M7MX 3MDSA 3AKRA 3PVEA 4RGGA 4M3CA 1NJIW 3AK3A 4BQ4A 1TA8A 5IYZB 1SKVA 4L0PA 3U4SA 2ZBJA 2BFUL 3VBOB 3MZHA 3K3NA 4LBQB 4LKSA 4IIJB 2Q30A 2Z0AA 4B08A 1O5UA 5CA0A 1XU2A 3EYPA 1XNCA 1UMZA 2XNDG 4PDWC 4J1XA 4QQPA 1GBGA 1WMDA 3OBZA 1H2SB 4BCUA 2XH6A 1G8MA 1VP6A 2JGDB 3Q4HB 2LGWA 1T6GC 2EAAA 4YFZA 3WCSA 4BMBA 5GLWA 2HWE2 5A3MA 5FZ1A 1TUBA 2YGMA 1XNQO 5AG2A 1BBT1 3PVNA 5FY5A 1KB9F 2DWRA 4AR2A 5L3EA 3K5NA 3L9JT 3CXCU 4D8MA 4NPLA 3T09A 3LPFA 1YXBA 5FUIA 2Q68A 3CRQA 5FP3A 1JMUB 5I0TA 4QX5A 4YZ4A 4JASA 1H0BA 5L19A 4ZKIA 2RDQA 1BCXA 3NJYA 2JEXA 1DP0A 3BAAA 1JH5A 4I3GA 4DK0A 2CSGA 3EJKA 3D82A 3B94A 2E7TA 4K8RB 2XWJB 2WA4A 4N53A 2BSKB 2L6LA 2YGLA 4TSFG 1LNSA 1UX7A 1NLQA 1VQKV 2XLGA 2FCVA 4XCBA 3CCMV 2HWF2 1VBB2 1KQRA 2UU9O 1CN1A 3IDBB 1DGWX 3SC7X 2RMU2 3AG2B 3WNNA 3LIGA 1AL23 4GMP1 4RFRB 5CBHA 2C0ZA 2ZGRA 4H55A 2GC0A 2M7WA 2ADDA 3DKWA 3NV3A 4E4HA 2VMCA 1FD9A 1FNYA 1O59A 4MT8A 3M70A 1GZ9A 1IBLB 3I2JA 2QQWA 3LFIA 1BMFG 2RV9A 2W92A 1UIKA 1ND3A 3DXUA 5LY2A 1BQZA 5T3NA 1H8VA 4BU2A 2FDHA 1W99A 5A9GA 4TYSA 3E8HA 2ZMNA 1VARA 4R8HA 4X1YB 2AZ2A 3WG3A 1HXS2 4K40A 3ZSEA 3AG7A 2VVFA 3KGLA 4HVRA 3AP9A 1PIV1 3D3AA 2RS33 4I0AA 3ZFGB 4LT5A 4HONA 4OHXA 4DPNA 4OHWA 5A32A 4Q4X3 1UZ0A 3MW4A 5B2GB 3FN9A 3DYPA 5C3PA 4HKLA 1V55C 3VQXA 3Q8AA 4NIIA 2A73B 3G71V 5A70A 4CEYC 1QJX1 4AVBA 2NZ9A 4AHWA 2NR5A 1E5SA 3D8CA 3VZMA 3ASNC 2X6AA 4ASMB 3OEHG 2BOIA 1SQ4A 2ATKC 3JZVA 3T0AA 4LF9B 2ZGLA 4S2DA 2WO1A 1XEQA 1H2NA 1HRV3 1VBE1 1C5HA 3JAMN 5C4WA 3VQYA 4R9AA 1JYIA 3A4UA 1BHAA 3RVYA 1BBT2 1QR9A 1K12A 3QCWA 5FXZA 2P3KA 5CKMA 1YHFA 3JASA 1XILA 1GQGA 3ABMB 3SH4A 1UAIA 2ZXWC 3ZRXA 3PIGA 4HKWA 3VBFC 1QHTA 5LL6Y 3RNSA 2G9FA 3NNFA 1Y4MA 4QPKA 4GA9A 2ILMA 1D0GA 3BALA 4CP9B 3KGZA 4HBNA 1HRI3 3ABTA 1MNGA 4Q4Y3 1QLEB 1VQPV 1P4RA 3POJA 4LLOA 3H1HH 3PUIA 2YIDA 1Q6IA 3WX5A 4Y5TA 3AG1C 2LQTA 2UY9A 1JVMA 2Y48A 4DUXA 4N9IA 2VOWA 4FFKA 2VBPA 3EO6A 3R6SA 1N1TA 4YJ3B 4AAXA 4CUAA 4NRMA 3TYJA 5I8YA 1RVF3 1CIWA 3N2KB 3HNBM 1G1XB 5L9RA 1H6XA 2ZX2A 4M3CB 1UNBA 1HDJA 1E5HA 1Z7S3 2OIGA 3ZN6B 1QJZA 3MYXA 2XJVA 3ABLC 4CUCA 1H4HA 4IEVA 1AR63 3WNMA 4W4LA 1RUF2 3NAPC 3CBNA 2HFEC 1OCRB 3FUQA 5ITZB 2QQUA 5CBGA 1Y67A 5CA0B 3DN7A 4COYA 2VW2A 3HKEB 3MLJA 2V1DA 1DQ0A 3E5UA 2DUQA 4GH4B 1QVGU 4QX2A 4JV4A 5AFEA 5FXVA 3I5DA 5C8WA 4EWEA 1RTVA 1PIV2 2QM8A 4QXBA 3PDQA 1X82A 4KGQA 3KT1A 3ENRA 1KC8W 2JS5A 1XYNA 2Z79A 5K8SA 4DUZB 5CKNA 4CUBA 3HD8B 3HKCB 2BERA 2FZ2A 2QE3A 5I0SA 3TEWA 3IAQA 4I55A 1OKOA 1BMV1 3KCXA 1HLCA 2J1RA 1W6NA 2WNVA 3H8XA 1JOJA 5BMVB 1VBA1 5BUVA 4P02B 2P6HA 3ZR6A 4MTFA 1I0HA 4K6BA 2ADEA 1IQDC 1ZRRA 2ZX1A 5JCTA 3WG7B 3BABA 4YRDA 2XASA 2PLV1 5EZYA 2LALA 1QR8A 4ZU7A 2A9HA 2ZQMA 3E8FA 1N3OA 4NAMA 3T1YO 1VBE2 3C3VA 4LOTA 3GGLA 4LF6B 2LTNA 5CVRA 2GTSA 1FAFA 3AVSA 4R7CA 2EIBA 2R0FA 4A4AA 1CX1A 5IWAO 3CNAA 4P14A 1PK6A 3OGCC 1WD3A 4ZOLA 3D3QA 1V54B 2X6CA 1XE0A 1E1RG 2L9LA 3ACFA 1AF9A 3S30A 1JZ7A 1ZREA 3H3LA 1AJNA 1X7NA 3I3BA 1O9HA 5KXEA 4FLWA 3S0MA 4QE7A 3KZ4C 1WMXA 2V7QG 1Y76A 2DBIA 1H2GA 2ZE6A 1VQ6V 2VZUA 1YQ6A 4XUTA 3ZSMA 1YC61 2VOTA 4KWJA 1K5MA 3KF5A 4L97A 3M7AA 1GLHA 1ZUQA 5LK7B 3OBAA 1XHXA 4YVSB 1I08A 1OF3A 1NKGA 4YZ2A 4YGCA 4IHJA 2ZX0A 3K4AA 3NSTA 4MXVA 1IG0A 1Q81W 4YVWC 1N1VA 4JI5B 1HW7A 4J7KA 3OPTA 4WFBV 5E79Z 4OCTA 1O8SA 1TAEA 1RUE3 2WFF3 4HNAB 1W8UA 4BLJA 3JUUA 4YARA 4LPLA 1KXGA 2ZD9A 3JYCA 2WUHA 2ET1A 2PHDA 2CTVA 4XFHA 4AQYO 4IE5A 3VBSA 4LO8A 3AXDA 1WW4A 4UCOA 3QH7A 4BQ2A 2DMXA 3IDEA 3RS6A 5L73A 4OLLA 1AJPA 4CBCA 4I4TA 1W8NA 4KWLA 5C8CC 2JJ2G 3NR7A 1XE8A 2P5BA 4G2KA 4QU1A 4CEWA 1IPKA 3ETPA 1V9U1 2OYQA 3JBG3 3ACGA 4YGBA 2R063 4IYIA 4KBBA 1GOHA 3SDLA 4HKOA 4XJUA 2ITDC 3U0ZA 2HJFC 2VW1A 1WD4A 3M8AA 2VH9A 4L11A 3JAKA 4A42A 1RUNA 2H6BA 1GWKA 4Q29A 3JASB 1OVPA 4XBNA 3FLPA 1R3LC 4CSWA 3K06A 2RS52 1VBA2 4EV0A 2A6YA 3ZFFC 1A6CA 4P9XA 3U75A 4NAOA 3LSSA 1AR91 3CCJV 4KI5M 3RVHA 1CAWA 4NIAA 2UUCO 2IVJA 1UY2A 4LFCO 3WHTA 1PHMA 3LD8A 1MS8A 1VMHA 2M6YA 2UXBO 3L71H 1D5NA 1PMIA 1XDCA 4XF0A 1VF5B 3ABKC 1JYNA 4UVBA 4DY5A 2D6LX 3G6BA 5FY4A 4RS5A 2FL4A 2YDEA 2H0BA 5FAXA 1H8TB 5DAWA 2Y64A 4B4RA 2MPFA 1UMHA 3MBWA 1JI6A 4LBEC 3O1TA 3LDBA 1UF2C 3ZRWA 5KMGA 1F5JA 1NCRA 1A34A 3B8MA 2ARBA 5FPZA 2DCKA 4X1IA 1AR81 1RGSA 2VQFB 1D4M3 1SF9A 1OBNA 5FLHA 2IH3C 3WY6A 1WW5A 2OS2A 4N90A 2EXIA 4O4HA 1QVFU 2BRTA 3K59A 1MA1A 3S7IA 4TV8A 3FLTA 2R043 2VZTA 5EYPA 2PGGA 4K21A 1W6MB 4V1PA 5G05L 2A79B 3ILNA 4LHSA 1R6KA 4OX9B 5BNOC 1XSRA 1OUSA 4Y33A 2CU5A 2EF6A 1RIRA 3RWKX 5JXIA 2QQPA 3ZN0A 4LH7A 1SCRA 5JZGA 3SCFA 3U07A 3WCRA 4CDQB 4C91A 2PI4A 3VBRC 4MVOA 3CCLV 5JOYA 2VJXA 4UCTA 3I49A 5C9AC 5A7PA 2CDYA 2YIBD 3OBTA 2BBAA 3AMMA 2EXHA 1ENRA 1W06A 2HBUA 2BOBC 1YJLA 4GX2A 5C6CA 1W6NB 4F8AA 2JKBA 4UF0B 1UO9A 3I2HA 1KRIA 2A3XA 4HN1A 3OW2U 1W0OA 2AR6A 5H9PA 5A6YA 1ST8A 2JD9A 4IV3C 1N0JA 4LOSA 3CJXA 3ZXDA 5JJEB 1VLNA 2ZIMA 1PM4A 1SACA 2Q4PA 1RUG3 5FYTA 2B39A 1D7PM 1CIYA 2GNBA 5H5NA 1SZXA 4PV1B 4TZDA 3CEWA 1FOD3 1VQOV 3GBWA 2X53S 2DTYA 3FB8C 1AYN1 2RDCA 3A8TA 2O57A 1QJU3 3ZFEC 4X62B 2R6QA 1M5IA 4I5SA 3E1F1 1I94O 1HB4A 3WNOA 1OXCA 2B4KA 1PGW1 5A7NA 5BZBA 2W1SA 3SPCA 4FFHA 4OHYA 4IETA 1AR92 4NMIA 1IS5A 3OG2A 4U7OA 2ZEXA 3IAPA 2QM7A 1NS1A 4N9HA 2JEMA 5JLVA 1VBD1 2Y4TA 3RBZA 3ROUA 1BZWA 3WW3A 3ASOC 2RN9A 2VY0A 2R9AA 4XTMA 1LOFA 3K04A 1G6NA 4RQEA 4O4LA 4JI1O 2JIZG 4RQPA 3DTUB 5IVCA 3JARB 4GKKB 2DDUA 2F95B 4U3JA 4AQ6A 2LROA 3BCCH 4AAPA 3ZMZA 2N74A 1P49A 3DXTA 3B4SA 2VD7A 3W7WA 4D94A 4FPKA 1AR82 2HWD1 5B66Z 1IBKO 5EC2C 2JDPA 3LKJA 3H7JA 4ISQA 3MF6A 2R30A 5D8AB 1KD7A 3PN1A 2W39A 5GONB 4K1YA 2MK3A 3SJQC 2JJ1G 4I4TB 3CSXA 1K73W 4MO3M 4SBVA 4JI3B 2Y6GA 4CEWB 2UXNA 3LSEA 1FXKC 4O7XA 4FK5C 1Y4WA 5A7SA 1RUI1 4WM7B 3WDUA 5KX5B 5GZCA 4BB3A 1HQNA 2RJKA 4XIOA 1GWLA 2RNBA 1DCSA 3LWCA 4B4PA 2XL9A 1YI2V 1TUEB 2DUOA 1AVBA 3BB6A 5DN2A 3JQXA 3ETEA 2WT1A 5LP6A 2D43A 4HYOA 3H1LH 2PI5A 2XXZA 2QKCA 1HB1A 2ZHMA 4CH3A 5DXDA 4ASKA 2YV8A 4PA3A 4AL9A 4YW6A 2EINB 4XMIA 3IPVB 1S0DA 5D5QA 1VMFA 4K7JA 2IJKA 4CDXB 2XVLA 1RUH2 4V2WA 2JENA 3PHMA 3TNPB 3VZJA 1NCQB 4Q20A 1OV9A 3H8OA 3HKDA 1UKRA 2VQ0A 3RI8A 5FZ8A 3MFCA 3CIHA 3RYCB 3ITQA 3MAQA 4RS5B 4NWWA 4NIGA 4NN0A 4JF3A 3CL1A 3KQ4B 1DQ6A 4DV6O 5KMGB 4X64B 5FK7A 5AC91 1ZRCA 1YI9A 3ZXJA 3S57A 4URAA 3VD4A 1PGW2 4CDUC 3AP4A 4Q0PA 3HR9A 3THOA 2HWF3 2ZX4A 4X1IB 1VBB3 3BN6A 1J5EO 4JAVA 4DV0B 3PVOA 4IERA 1VBD2 5LGTA 2DFBA 2RMU3 5LOVA 3AKTA 3MLLA 1GO3F 2EJ7A 3VBHB 2ERFA 4GIQA 2OTLV 3UJQA 2EIJC 2DJVA 4YPJA 4WBNA 5LMUO 3GHNA 4TV8B 1IS6A 1S0GA 4AQSA 1FJGO 4PHZA 2ZEZA 4Y4YA 1IURA 4JGZC 2VUJA 1FATA 2DOSA 4RSUA 2WZR2 4KXRA 3TETA 4K20A 1GICA 1OFSA 4BOWA 2QDRA 2WLNA 5GM0A 5DAVA 5JZGB 2IC1A 1HXS3 4FPOB 3T30A 3N7JA 1KQSU 1YNAA 2XVGA 3HPNA 3LGRA 3WR0A 2HWD2 1ODNA 3WUDA 1W8OA 2OYZA 4KU7A 3DECA 1ENSA 3RGBA 1UY3A 1XI1A 2XJSA 2VMFA 4IGOA 2GP5A 4GKJB 1AX1A 3SYOA 1YCIA 3NV1A 4ES9A 3ZKYA 3ABZA 4BK4A 3UO3A 4JGYA 4DXSA 1MSWD 1OD5A 3S3WA 5IYDO 1Y74A 4GZ9A 3ZCCA 5FYZA 4CS4A 1OHHG 5DG1A 1YVWA 3PLQA 3WW4A 4XQWA 3DL3A 5BNNA 2ZDIA 1ZYBA 3ZDVA 4W4KA 4MH0E 3BY6A 4DUWA 2H8PC 4UB6Z 4XEZA 3J4UH 4Y22A 3K75B 3X2QC 1S0BA 4LLFA 5CFDC 2VTXJ 2IXCA 1NAEA 3A2FA 1S72V 3H1YA 1EV13 1DGLA 4WVMA 5GZGA 4HFSA 5CISA 2HEWF 5IVBA 4OXSA 1SDDB 4LWSA 1NVPB 4K3AA 3CRMA 5L7OA 1VRH1 3OGGA 4FXKB 1FPOA 2KR2A 3HOBA 3CZUA 4YY3B 2BTOA 1OA3A 3RQ0A 4Z07A 5CG8A 2W1QA 4Q26A 5DECA 3N9QA 4MGSA 1Z0HA 4P5HA 4B29A 3VKFC 3K4ZA 3FHQA 4HSLA 2LO1A 4G9SB 3SXWA 3K77A 5AC92 1S0FA 3WF1A 4K0KO 5ANNA 4RD7A 4HANA 3SITA 3KKYA 4LUKA 4IV1A 1AI6A 3SQOA 2ARHA 3EXUA 4ISRA 3VBBA 5JDBA 2QFEA 4YWAA 4NTWA 2GALA 1NA1B 3PJQA 5FP4A 1GRJA 1DLLA 1AI7A 4XABA 1CAUB 1UIJA 1RUF3 3OM3B 1B35A 4UW5A 1N1YA 1JYVA 4GZRB 3NJZA 1HNZO 4HZFA 1MQTC 5KAFZ 4XFAA 4W50A 1WCUA 3JSNA 4TT3G 1QCEA 2WWJA 2XAGA 4GMP0 1OFNA 1PIV3 3ZKUA 4O4JB 4BE3A 4QPYA 2O14A 4P9PA 1NR1A 3MHZA 5E1RA 3CZJA 1KJLA 1GZWA 4O61A 4LO5B 5LATA 1W3VA 4BLIA 3CJHA 3O5SA 1W0NA 3IT8A 5T5JA 1AYM1 3M1HA 4YG3A 4HK9A 3WP3A 1SQVH 1H2KA 3FMGA 1L7RA 2CYFA 3AYAA 4XBFA 3TNQA 2VMGA 1OA4A 3H1MA 4UXAA 2XJRA 3FHIB 1YQ5A 1Q7YW 1EPZA 1S2KA 3HKDB 4UCVA 4BAYA 1ENVA 1BQPA 1DDLA 2IJHA 3A0BZ 4F4LA 5IYCO 2ZGKA 1UOFA 2WQZC 4AZZA 1YIPA 1SQQH 2AACA 1E79G 1POV1 2K1EA 1LGCA 4GQ7A 3TEXA 2KM2A 1NH2D 4QHOA 5ACA2 5I8SA 3LB9A 3B8NA 4XHBA 4AE2A 4U7NA 1KFUL 1YQCA 2F4LA 1O7FA 5T5LA 1RUJ1 3IGAC 4X65B 5DZFA 1OOPB 1S0IA 2GSYA 2VZSA 2E31A 3GBGA 3HIFA 2OCCC 1EM1A 4WVWA 5L3BA 1V0AA 1VRH2 2CV6A 4AI8A 5LOVB 5FMOL 1JOPA 4WBBA 2ZM6O 4QPIC 3LZZA 3FL7A 1RJ7A 2QVSB 1RJ8A 1BEV1 4OI1A 2IM9A 1BYHA 2A71A 2EIKC 1ZBA1 1FFTB 1QXRA 4BXFA 1L1FA 4AXOA 5EP9A 4XIKA 5B1NA 3LF7A 5JIAA 4XBLA 5LZ6A 1O91A 4FTSA 1XMQB 3N3HA 4TSVA 3QACA 4R9DA 1S2BA 1TEIA 5LHHA 1VQ8V 2VUDA 4AGVA 1FV3A 3OGJA 4OMCA 2LW7A 1HN0A 4PF1A 4P2ZA 3QLQA 1GP4A 4Q1RA 3GVMA 3JB4C 4QM8A 4PBOA 3FLRA 3IM0A 2DCYA 3OEAA 3RZZA 4EB6A 5FPVA 4FI9A 4BIFA 3OYWA 2GDSA 3M4FA 2A1XA 3WDVA 4MGIE 1XNRB 5I0DA 5B4XA 4KMQA 4FPGA 1Y74B 3Q9OA 2QKDA 2R7EB 1PNLA 3ZSLA 5CFCB 4FPEA 1WMEA 2YC0A 3B40A 1K4CC 2D44A 3QO5A 3JCZA 1QQP1 2OQ6A 4R50A 4JYYA 4JRLA 4YXWG 4YM1A 5JXGA 2WDBA 2HEYF 4L9BA 1NE4A 1U5IA 3CCUV 3CCSV 2CAUA 5FZ9A 1UD1A 4YLZA 3DCQA 4EN0A 5FZ4A 3JALA 1OA2A 2GC3A 3TB0A 1A32A 4KBZA 4D6SA 3WP6A 3M3CA 3E2EA 5F39A 3QO8A 4M4PA 1J83A 2XHNA 5KHIA 5HCBA 5AFBA 3UK9A 1SLBA 1W2UA 5A7WA 2WNUB 2RS53 3MICA 3RYHB 2CDPA 5L7OB 2E33A 4PA9A 1JZ3A 3NL1A 4I7ZB 2D98A 3WQ7A 4JV5O 2CDOA 4FQZA 3AP5A 5A1LA 4N53C 4B1LA 3UGFA 1VMGA 3HBKA 4FPPA 4XW3A 4DINB 5FJHA 3ZXLA 1J1TA 3AKPA 4AG4A 5GZEA 4FBFA 1JX9A 4GD4A 2JVDA 1SQGA 2YHJA 3B9IA 2WS93 1W8HA 3MEPA 1FMD1 4B8EA 1AP5A 4J80A 5TSWA 3OMNB 2R16A 4P5YA 4M00A 1NX9A 1ZRDA 1PNGA 4DR5O 1JOBA 4FLZA 2B8MA 2ZCEA 1URXA 2WAMA 1NUKA 1QH6A 4OPAA 3ZHSA 4PT6A 2Y26A 1GKBA 1BEV2 2WO2A 1JR9A 3WEZA 4RFT0 3JD72 2Q1ZB 1ND3C 1ZBA2 3JXSA 3IJ4A 4YYOA 4BWAA 1F5FA 1C8M2 4UVAA 4JI7O 2PHWA 4IL7A 3T4HB 5A3LA 1UPSA 1DU3D 3TAYA 2JIJA 1W6QB 1ZL8B 1IQAA 1TNFA 4LH6A 1NZCA 1JTZX 2XJPA 1YSCA 4NWVA 1U5XA 2LW1A 1XXNA 4Q5OA 1BCCH 3CQOA 3P3PA 2GC2A 3JD4A 5LHIA 2BGOA 3F7YC 4XDKA 1R3KC 4BMEA 2C1FA 2E5LO 4DR3O 1FPN3 4AQ2A 1XPWA 2GNDA 2OZ6A 4K1ZA 2P2KA 2F1MA 3AK2A 1QEXA 5A33B 5B1BB 2WN2A 3THDA 4TV9A 2FQPA 2YFUA 3CE2A 2HHHB 5F37A 3B9CA 5IY5C 3K48A 1OCCB 3M99B 4GT1A 2YS8A 4SLIA 3ETQA 4ZHNA 5HI0A 4K35A 4F83A 1QQP2 1NLRA 5C4WC 3OD4A 2JEUA 2CAZC 4WFHA 4AI2A 1JS9A 2DQ0A 5FP7A 5DAPA 4CCLA 4LF8O 3O1MA 4P9WA 5ABJB 4D7TA 4CC6A 2OIIA 4Z1VA 2WSSG 4XAAA 5DAQA 1JW6A 3O0XA 5FO8B 3R0RA 4ZONA 5FZLA 2QWQB 1IXBA 4MHUA 1UZYA 1R1A1 4AI9A 4PA7A 1EN6A 4X89A 1AXZA 5C7GA 3MD0A 1VQMV 3J81N 2JXAA 1H8HG 2C5DA 4FQ4A 1AR93 1AJQA 5GTHZ 4FOVA 2RDNA 4EKWA 3KD4A 2YYOA 3UT5A 3ETDA 1W2BU 3K0DA 2JG8B 3K46A 1M56C 5LXTB 2ZGSA 4L2NA 4P9GA 3OOXA 4XETA 5JMOA 1IS3A 4PLMA 5CA1A 1FMD2 4PCRA 1NXMA 3VD5A 5I0UA 1C57A 2EXJA 5HFLA 5KR7A 4J7JA 2YZ4A 2L35A 4AEDA 1Z5WA 3ZLIA 4DR4O 2UU8A 3VL8A 4OPHA 1PNKA 4CP0A 2PYLA 1VRBA 4EFBA 1D5AA 1AR83 2CK3G 3M8LA 4QPGB 5J2TA 2DVBA 4LBJA 3FD9A 5LEJA 4EEQA 2AHYA 4I0XA 3TEYA 5FY9A 4EB6B 1WKYA 2Y6KA 5LA6A 2YBSA 5FMCA 4MTOA 4HPKA 2Y33A 5IJ9B 2ENRA 3J9SA 2Z3YA 3BRCA 2RJ2A 1SZTA 1GMMA 1NTMH 3KVBA 4B4QA 3I2FA 4UFIA 4LFBO 4JX0A 4XVHA 4XCAA 3LQCA 1URFA 5E1AC 3RSJA 2OKXA 1N33O 2ZNIA 3TJTA 2ZGNA 3H01A 1MZ6A 3W59A 3LEGA 4MGKE 4Y1YA 4LNVA 4ZKTB 1XBFA 1EAH2 3B2EE 1DF4A 1W0KG 5GW7A 1DYPA 5BY5A 3I2OA 4DV3B 1U5ZA 4JDOA 4UB8Z 2WNVC 4B3MO 2ZX3A 3CJIA 2CWMA 4P08A 3R4SA 2E74B 3N9LA 2WLLA 4UUJC 3SJCC 4JTNA 4LIVA 3NW4A 4C1WA 4CDWA 4JI4O 1UU6A 4NKGB 5FZCA 2D6KA 3LDDA 4CS3A 1RUH3 1N4CA 4TQFA 2ZS6B 3UKTA 2GAUA 5FZKA 4NVPA 2XBO1 5F5IA 2DBNA 1PK6C 1QMJA 3WVJA 1E57A 1S5LZ 1YIFA 4AYUA 5KUMA 3LA3A 5LK5A 4FT8A 3D3IA 1R6NA 3ECQA 3FX3A 1WCDJ 2DTWA 3NXSA 1PO11 3SPJA 4LHKA 1VE0A 3LOBA 2GNMA 4FPHA 4GX0A 4AFMA 5IHRA 5FOBB 1R1A2 4DR3B 4UFMA 1GP5A 2D3RA 2YEVA 5HV4A 1K5MC 4ZI7A 3KHCA 3HQXA 5H9SA 2LM3A 3BUCA 2CL2A 2RHPA 1M90W 3O14A 1UWWA 1VBD3 2BWCA 5FNVB 3W20A 4RA0A 2ID4A 2YC2A 3SHRA 5CB7A 4CS2A 3BTAA 4DV7O 1LUWA 3DV8A 1M57C 4X8AA 1GR3A 1QDOA 1ASJ2 5BNPC 2WLQA 4NXMO 5JR2A 1YJ9V 3UKMA 2WZR3 4UFLA 3WF2A 2XDVA 4LA3A 1OD3A 4NOTA 1OCZC 3WOGA 3A0RA 2CTQA 1BK0A 3BTZA 3OY8A 3VBSC 2QQNA 3F95A 3H1JH 2BYVE 2HWD3 4LR4A 5FZOB 5FY8A 2B1IA 2Y69C 5CIRA 1AR5A 3I3EA 4QPWA 4LF4B 2O8QA 3SISA 4H2AA 1K3IA 2RQ6A 4TV9B 5B3SB 1BS3A 1YJKA 2ZHKA 1SS3A 2AH2A 3STLC 5FYUA 2YB7A 5FREA 4GB31 2RVAA 2YI9A 4BIZA 4QXCA 4BQ5A 4CC5A 5EJ3A 3Q8BA 2VMIA 4GWNA 1IVSA 3CX5F 4Q0VA 2C4XA 2YICA 3PUAA 2A06H 4QX3A 2PHTA 3EB7A 4WFAV 4AK3A 5C5UA 4E4SA 1MS4A 4JZRA 5JXJA 1PO21 4KL1A 3T3YA 2NPIA 4JKLA 4M4RA 5DUVA 1OQDA 3BIEA 1CWPA 1WA8B 2HEPA 4K3UA 3INAA 3ZVXA 2XBO2 1I9RA 1LOGA 2VL4A 4J25A 1CJDA 3JB8A 4N43B 2UY8A 2UXCB 4KHPO 4LKFA 2G38A 3KT7A 4XBQA 4PQQA 4G28B 1TE1B 2XWBB 3W5MA 3ABUA 2VQEO 1GQPA 2JRIA 4I0WB 1NCRC 4JKKA 1PO12 3WQ1A 2VNVA 3JAWB 4NXNB 4MXWA 5FZEA 4FMTA 1N36O 4AEDB 3WINE 3SEEA 4KU8A 4NTXA 3D36A 5AC93 2LUWA 5J96B 4QNHB 2KQXA 3WUCA 1MG1A 2XOKG 1W9SA 1JCHA 1Y43B 2CGNA 2OZJA 1D0HA 2W52A 3JATB 1VBC2 2VTXA 3ZSKA 3CPWU 2IW5A 2QE7G 2A7AA 5T55A 5LA6B 4HPKB 5DUUA 4GAZA 1JZ5A 3K58A 2UXDB 4JI2B 2JKXA 4MUVA 2ADPA 5LASA 4J42A 3FWEA 3RZJA 4JI8O 3ZS8C 5KC5A 1QNMA 2JX9A 1CAVA 2DUPA 5FJKA 2A70A 3HT2A 4LF7O 1RUD1 3ZMNA 2UUAO 2D3SA 4IXLA 1DF5A 2ZR2A 1RL3A 3POWA 1VAMA 1O9GA 3BOWA 3POEA 1B3QA 3PURA 1UQXA 4BYYA 3SPHA 4X20A 1I5PA 2WLLB 3AFGA 4CDWB 2CY6A 4NRPA 4Y5Z0 3HNYM 5KXBA 3C7OA 2EILB 4OHZA 2W0XA 5BR8O 1OT5A 4MG2A 2Q0OC 5FYHA 2OIEA 4GB32 5FPBA 3T1CA 3J26N 3C7GA 2VVDA 4JC1A 2W5FA 2DYRC 2BEOA 5FYSA 4UW3A 4Z2WA 5IK4A 5BXZA 2Z42A 2WZ8A 1XL6A 4RYDA 5FK8A 3VDDB 1VMJA 5A1FA 3CCQV 3VOUA 2BFUS 2ZEWA 2JDMA 2ZHLA 4LKDA 3WDTA 1L0LH 1VQLV 4EROA 5ACA3 2FCTA 1FXVA 3B77A 1S5JA 4R9CA 4YJ2A 5JVDA 1BVVA 4TLGA 1V6NA 4HLTA 1NTZH 1PO22 3O0VA 4AILC 2Q7GA 4D3WA 2LS6A 4BHPA 4FLYA 5E88A 3E8GA 3U1XA 1PL0A 4RR3C 3E5XA 1LOFC 4X6QB 5G04L 1VRH3 1NKDA 2P67A 4RQPC 2A6ZA 2AEYA 4LNUA 3AP7A 4OI2A 1SLAA 2R0HA 2XQRA 2CTRA 3B01A 2VTFA 4ZXKA 3WDWA 3SMHA 1HX6A 2X0LA 1EFRG 4AGRA 3AYEA 1TME3 4QQOA 2A0LA 1QIQA 3I8TA 1QU0A 1X4TA 1PNFA 5IYZA 1WNSA 1GTOA 1V70A 3FHAA 5K0UB 3VQVA 4DR1O 5IE9A 4LBQA 3M2MA 3OY8B 1REEA 4IIJA 1BZKA 3BPSA 1JODA 1HQLA 4DR6O 4N21A 1E5RA 4LIUA 4Z1MG 3OGIB 1QJY3 4XQ4A 2Y34A 1RHI1 5IVVA 4FLTA 3WF0A 3G6JB 4P9IA 4ABMA 2JGDA 5A3UA 3Q4HA 3A22A 1R3JC 1W6PB 3K5OA 1K3EA 5J7MA 1R64A 5EHDA 2XAQA 4XF4A 5LP6C 5LMNB 3BVCA 3VBUB 5KHKA 3N36A 1BJQA 5DDJ2 4TUYB 2K9ZA 3G4SV 3O1RA 2ZABA 1CZTA 2KA3A 4YG6A 3GZUC 5LA9A 4P9YA 2W46A 2V5DA 3JD0A 4HK8A 2QNKA 1I1EA 3FUOA 2XKOA 4Q4W2 2ZKLA 3ZHUA 1LR1A 2EICA 2ZTNA 1B06A 1QLNA 2Y6HA 5JOXA 1GOGA 1O4ZA 4DXRA 1JU4A 4YW5A 4YW3A 3PJSK 4P00B 1ULFA 4QKFA 3DXRB 2BSKA 1J1LA 1R1BA 3VHOA 1NI8A 4QX0A 1FKAO 4C8DA 2ZE8A 1J84A 1POV3 1HW5A 2GH2A 3LDKA 4QHZA 4MHRA 5LA2A 2IU0A 4IE6A 1WLCA 1EY2A 3AL5A 4E27A 1DQ4A 2DVAA 3HR0A 4LUMA 3FAVB 5FIXA 5KUKA 2IJJA 4ZIBA 2AGAA 3BU0A 3I56V 5LHGA 1NQTA 4A7KA 3HQRA 4PDRA 2AZ5A 1YFXA 4JTCB 1QXPA 4AGGA 2DYSB 5E16A 5AVPA 4EE2A 1BGYH 2BGPA 1PVC1 5JH7A 3JD73 1N8RW 2XPJA 4NJ4A 5EQUA 3B3QE 4PA4A 4PA6A 4Y24A 1C8M3 1SQFA 3ZM8A 2WYSA 4B7KA 2R1BA 4AOCA 1H2LA 2WQ4A 5F5AA 3ZFGA 1RUC1 3K0GA 4L8JA 2XAFA 4FOWA 4R9BA 3RI9A 2IVIB 1W2NA 5IDJA 5KA5A 1WB7A 2DW4A 4B3RB 1PP9H 1K42A 3RWNA 1RUOA 2A6XA 2IXKA 5HV0A 2AENA 4AFCA 4BIUA 4CU9A 4PJ0Z 3MGUA 1ZZBA 4LBNA 3J7AU 2FZ1A 1V9PA 5J37A 4JGYC 4JZ2A 4RN5A 1I5YA 2LJ2A 4Q1PA 1ZTEA 1RHI2 3CCEV 2P6JA 2RS12 1HR0B 3LDRA 4FAGA 1DQ5A 2J22A 3P30A 3CKHA 2WIIB 3D0SA 2GUZB 5BNNC 2ZDIC 4U2AA 4QJFB 1FT9A 3Q8CA 2BTQB 2Y0OA 4LBLA 1W6OB 1QQP3 2F4VO 3N9PA 3N2GB 3U4XA 1F4MA 2DF7A 5F3EA 4LHNA 3NNGA 2VNRA 2PUSA 4JYAO 5B1AB 2PXJA 5IWFA 3RYIA 1UU5A 4CP9A 4B3TB 1FFXA 4C0BA 3ETGA 1VALA 4QGMA 5FZHA 5EFUA 1JYXA 2A3WA 3QD6A 4XUOA 1ULDA 4N7IA 2VCBA 4XDPA 1YI7A 1SETA 2D3OW 1PV0A 4MW3A 4J10A 3RMXA 2ZKNA 1YO8A 1GMGA 4UXNA 4IEYA 5FR3A 1WPBA 1UYXA 4W4ZA 3J8F1 2D6PA 1HIXA 1PZ7A 2N05A 5DMYA 4YJ3A 2WLPA 4MVQA 2HLEA 4CTEA 3N2KA 1UOGA 1LECA 1M1KW 4PDWB 1QGLA 5JCOA 1EN5A 1UU4A 1OH4A 2V72A 5F2VO 4X66O 1W03A 2DQ3A 3ZN6A 3VDBA 1FMD3 3I4IA 1VQ4V 5C70A 4IV1C 4YHHB 4FZ0A 4JQTA 4QB1A 4YW4A 1REFA 3VDAA 3GDBA 2WA3A 2BBVA 5ITZA 2YPJA 4FTBA 1HQWA 1BL8A 4S2HA 2VOXA 3NKGA 5JJJB 3HKEA 1B35C 1Y66A 3OBRA 1PVC2 2FD8A 4BQYA 1IG3A 3MIFA 1RSOA 4GH4A 2OQ7A 2FKXA 3CC7V 2J7MA 1QH7A 3ZYFA 2WT0A 2PAKA 5GLZA 1ULCA 4JRAA 1XJAA 1S0EA 2LW8A 1RUC2 1JQ0A 2FMDA 1UN1A 2YXYA 3M3IA 2HKXA 4PDVA 3AL6A 3VZOA 5F5QA 1W9TA 1GKFA 2P90A 3DUIA 2HWB3 1IBMO 3PMEA 3HKCA 1N34B 5CYYA 1OHFA 2VVEA 4LFAO 1YEWA 5DG2A 4X88A 3FFZA 4NHKA 1EAH3 1JJOA 1ZZ6A 2R70A 1F23A 5BMVA 1F4HA 2WZPP 4D69A 4EFEA 3ZOIA 4DOUA 4XYXA 1YWKA 1OCCC 1W05A 2W95A 2IFRA 2BNOA 3NV2A 4L99A 1JUHA 3U11A 4DUYB 1DK1A 1RM1C 1N47A 3W7UA 1MABG 4DV4B 3RYRA 4PIZA 2LFRA 3ZMVA 3LSUA 3K03A 1ALYA 1MZEA 1GAXA 4RGAA 4PDMA 1SQPH 3ZPYA 3FX7A 4BDVB 1MOFA 1CJPA 4QQLA 1OJHA 4E8DA 4CCEA 1GSLA 3KB5A 5CADA 2GMMA 3MIBA 4NB5A 1W8WA 2RS31 2EZPA 4U36A 2HWC2 5A7QA 1NH2B 5FCCA 1GQHA 1HB3A 3UT0A 5EJ1B 3E6DA 1R1A3 4YVSA 4COVA 1DGSA 3J8F2 2AXTZ 3CU7A 2YY1A 4DS0A 1TMF2 1CX4A 4E2GA 1Q43A 2J1VA 1OCOB 1ACCA 2C9KA 5JH7B 2SBAA 4JPRA 3H9AA 1V55B 5T52A 5EK0A 1LHVA 4CEYB 4F7ZA 2BVVA 4DR7O 4FCAA 4IEWA 3VKOA 1NU1H 4PDLA 4EWAA 5LEKA 1FXHA 4GJYA 3WP4A 4HNAA 2XOMA 1NZ6A 1ASJ3 2JDKA 1HRV1 2PHLA 3ASNB 1MACA 2BJSA 3ILFA 5IAVA 2FDGA 4GWJA 2RM21 3VB9A 3APBA 2LFSA 1SLLA 3ACIA 1N32B 3WT3A 2YG0A 5J36A 3MW3A 1LCLA 1WA4A 4GKYA 5IK8A 3AZYA 4I3PA 3RZKA 1LAJA 1DGRA 1D2DA 1KKCA 3RJRA 4HXCA 2D97A 4P30A 4OGQB 4CZSA 3WB2A 2VUAA 4NE9A 4DEVA 2ZXWB 1FXZA 5CN0A 3VBFB 3OF1A 3T1HB 1HRI1 4AHZA 4ARXA 1R1ZA 2AW9A 1EYBA 4YGDA 4DNYA 1XNBA 1KS5A 1HNXB 1GM7A 4NHMA 4B3SO 4LCUC 1MEC3 3LDCA 2W47A 4ZZ5A 4JZGA 4XF9A 3J7MA 1J59A 3KCCA 3FBMA 1NR7A 3AG1B 1Y9GA 2HJIA 4OI0A 4FJCC 3WLUA 3WF4A 3RYIB 2Q73A 2OW4A 1FFXB 1R73A 3NKTA 4NR1A 1Z7S1 5JWPA 1CAXA 4BA6A 1O3SA 4DO0A 4CCMA 5JPNB 5J2UB 1AUYA 3RZLA 3OUIA 3KG2A 4XFBA 3MUY1 3VV1A 1SCSA 4E8CA 4AVSA 1AR61 1DGRN 1O3TA 3ABLB 3SKVA 2EA7A 2XBO3 1TQ5A 3BVOA 1H8TA 1J3RA 1H30A 3AZWA 4DW1A 2WN3A 3DPRA 4IW3A 1XNQB 4QKNA 4LK7A 3CRCA 3URFA 1TGOA 2R1DA 3LDEA 5DUXA 3SCHA 3KV9A 2RS32 1PO13 2ZGPA 1UY1A 3K3OA 3VN4A 4EYUA 1O6UA 4ARYA 3T4DA 5DZEA 3N4MA 3ICXA 3APQA 1ND2A 4GJZA 4QQ2A 3ZXKA 2ORXA 3U37A 4DRRA 4FLVA 4Z82A 2E7QA 3O0WA 1W6MA 5IVJA 5FOJB 1VBC3 1T6BX 3VGIA 4Q27A 1RSOB 1W39A 5FXWA 2I45A 5DQ0A 2C9AA 1EN4A 4QDRA 3NJVA 1AR71 3S7EA 2OCHA 1UL9A 4CDQA 3VLBB 1R6TA 1WBLA 1JUIA 2HR3A 2WLIB 2RM22 1JN2P 4TWTA 2D7FA 4LO6B 2UU9B 4CU7A 3ZIAG 4OQ9A 1QJX2 1LOEA 1ZA7A 3QG5A 4Q6GA 2ZZJA 4UF0A 4J9YB 3WQ0A 3CO2A 5KHJA 2YSUB 1AX0A 2RE9A 2MNGA 5KXDA 4DV2O 4GLXA 2F23A 3ZYJB 4YIPA 4O9GA 2MW2B 2PAEA 4ZU5A 4CA9A 2ZHNA 2EIEA 2UUBO 5LBFA 2ZAAA 3D5OA 3W5NA 1HP8A 3FE5A 5IFPA 2W2IA 5GKAC 4FOYA 5B5EZ 1H4GA 4QD2A 3RDIA 3ALQA 4UW4A 3OUHA 1P7BA 4KP4A 1G9DA 4YVWB 5LCWL 1SFYA 3PUHA 2GC1A 1RUE1 3KLSA 2ZR3A 1H9PA 1R3IC 3MW2A 4DV5O 3WZ1A 2Y60A 1NT2B 1DF0A 5FY7A 4ONUA 1DTOA 1SFPA 1PZ8A 3LUTB 1QOTA 2Q9LA 2CNAA 1AR62 1PO23 3LSDA 1SHWB 2YBKA 1IKQA 5F2SA 2LRPA 1ZBE3 3JARA 3IMMA 3ZR5A 1N0NA 1JOYA 5FMDA 4GX1A 1ZZ9A 2OX0A 4HG6B 3H9VA 3AMQA 4ITCA 2Z69A 3JBG1 2NMNA 5C8CB 2R061 2QTSA 1Q8SA 4HSJA 4XTPA 5EZWA 2ATFA 3NJXA 4NIHA 3LOIA 1FXKA 2FMLA 4AHYA 2A6VA 5EPAA 3HVDA 3BGAA 5FXXA 3ORJA 1COWG 2IH1C 5FYVA 2BW8A 1VPHA 1YYNA 5HFMA 5D8AA 3AG4C 3RPQA 1MPXA 3JD3A 5IT6A 2E32A 5GONA 4META 2WABA 4YZ3A 5A6QA 3E35A 1OSGA 3OGRA 3PNAA 1OPMA 5F3GA 1W2OA 4YM3A 4BQWA 4DV1O 3K4DA 1AR72 3RYKA 2QDOA 3UV9A 2OUJA 4QB2A 4WM7A 3ZFFB 5KX5A 2BOJA 3IIAA 4X1KA 2DYCA 2X6BA 4CCOA 1SA0A 4BQ1A 4LF5O 5EJZB 5H9QA 2VZPA 2V4AA 1VAVA 3MIGA 2ZGUA 1BMV2 5FPAA 3OTOO 3CEIA 3ABKB 2ZOEB 5IJRA 2UWCA 3HJRA 3CJIC 1Q6UA 1S3JA 4H33A 1A8MA 2JK5C 4QT6A 5BXXA 2KD7A 3IPVA 3ACLA 3I59B 2JWPA 5DDJ3 1CAXB 4CDXA 2B5HA 2PLV2 3K57A 2X09A 1NCQA 3SJAC 5HXMA 2KSDA 2VZRA 2OPWA 4R6ZA 4LQRA 4W65A 1OH3A 1DG6A 4QPJA 3SEPA 4HT1T 2F4PA 4Q4W3 2VXRA 3LPGA 4HOOA 4EZ4A 3RYCA 1ULOA 1PMJX 2WSUA 4Y1UA 1C1LA 2R041 5DN6G 2N7GA 3ZHQA 1I5XA 3DPRB 2PYTA 5A1AA 4XHXA 3GNEA 3USSA 1S0VA 4NHXA 1H1IA 4F6RA 1LESA 1XBLA 1COV1 2B9UA 3I3QA 5BNOB 2QJVA 4BQ3A 2Z5UA 1GNYA 4NROA 2JGUA 2QCSB 4RAIA 2YC4A 4CPBA 5FLXN 4XACA 3FB7C 5CKQA 1O5LA 1WLDA 2D40A 1WLEA 3VBRB 3HT1A 1ND2B 3VBHA 5C9AB 3RW0A 2V4VA 5LBEA 4K9SA 1TZOA 3SH5A 1AXYA 3D0JA 3SPIA 5BYNA 5FY1A 1CGPA 1WGPA 3T1YB 3ML0A 5ISLA 1DIWA 3RN4A 1FYJA 1DYKA 4Q8KA 4R8CA 2QQJA 1QXJA 3A0NA 2QQMA 2ZMKA 4Q0SA 4AEMA 2XQXA 5IWAB 1WP8A 2PMWB 3WF3A 4JYCA 1XNTA 1Q8IA 4XXAA 4DR2O 1RUG1 1WMFA 4IV3B 1LR5A 3KCYA 2E75B 4JI0O 4IEPA 1FOD1 5FRAA 4GALA 2WZEA 3BHPA 1OMIA 1DQ2A 4AI3A 1AX2A 1OLME 1OVSA 3F5TA 3ZSJA 3ZDSA 3I2IA 4QGLA 1AR4A 1QJU1 4XFIA 4XXPA 4ES8A 2GTAA 1JFFB 2HVKC 1CESA 3ZFEB 3FBYA 1V9U2 1H6YA 1W28A 2BE3A 4WM8A 3E83A 3MDPA 3GZTB 1F2NA 4GXLA 1RHI3 5GLUA 2RS13 5FY0A 1GNZA 1GV9A 2JIGA 1VIBA 2PHRA 3T0BA 4ZZ8A 5FUPA 3ILRA 4O2BB 3ZIXA 4BQXA 2VPVA 2NN4A 3MPBA 1DQ1A 2HH9A 3ASOB 3GZAA 4FLUA 5KHHA 1APNA 2PN5A 4J7ZA 4LC1A 4F6EA 4CU6A 4AQYB 3TN91 3VD7A 2BWAA 5CAZA 4FPLA 4BWOA 1K5QA 2CTPA 1XSQA 3MO4A 5ERLA 2ZAHA 4P9JA 2R32A 4QDQA 4PIXA 5IK7A 2OUHA 1O3QA 1L8DA 2WQ8A 4OYUA 1R093 2D3PA 5EIYB 2PAMA 1AB3A 1NZIA 4DV1B 2CUGA 2QGNA 2R042 4FXGB 4AQTA 4A3ZA 4A44A 3APOA 5FO7B 2PQQA 2W94A 2E76B 5IATA 1COV2 5J3UA 5HCHA 1CQ9A 3D36C 5F6KA 1DBNA 4XC9A 4XURA 1FXKB 4Q2FA 1L7QA 2JDNA 2NNUA 3AEIA 4MTXA 2VAUA 3TOJA 1TVKB 1YFUA 1EP0A 5HCFA 4EWDA 3I2KA 1VQ9V 4KG0A 2X8KA 1BLZA 4I9QA 2QSAA 3T08A 1NA1A 3O12A 2UUCB 3GCXA 2YROA 3WFVA 3RMYA 2A3QA 1CAUA 3C90A 4LFCB 3RG0A 2I07B 5DAXA 2UXBB 2Q8VA 2D5HA 1PGSA 1KECA 3SCGA 5L36A 1PVC3 2F43G 1UYZA 1QY4A 4O65A 2X5IC 2EIMC 3KSCA 2GZWA 4X1KB 1FAYA 1RYYA 1IBLO 1A78A 1QNYA 2VW0A 1SA0B 3AB0A 4O4JA 2C6SA 3E8BA 1RUC3 2HWE3 5FBJA 1PM7A 3JQWA 1KMIZ 4UFJA 3AX4A 2LP7A 3SYQA 4OMDA 3N9MA 3H1WA 3WQBA 4LA2A 2JJ6A 2WYFA 3OGVA 4IEZA 1LTEA 3OPWA 5FMOS 5C3QA 5K4LA 4GUNA 4URTA 4KQ7A 5DEDA 2KG7B 5EV7A 4I09A 5IK5A 4YW7A 5FYBA 4FTEA 4CDUB 2MHFA 5JR7B 2RMU1 3WB0A 5K7PA 1DGWA 2ZGTA 2AZ0A 4UW6A 5HBAA 4DXWA 3C3TA 1AYN2 2ZMLA 3A23A 2QQIA 4P9OA 3LIHA 4QPIA 3EHBB 3AP6A 2EIJB 1X8EA 4FOQA 2WWUA 1PM9A 2WAOA 1QQCA 1KKDA 4LF9O 3WXPA 1S2EA 4JGZB 4F6RB 2DWDC 3TN92 1OOPA 1HXS1 5HXVA 3C7EA 1XQ8A 3OEBA 2WWSA 2DE0X 2HBTA 3TWIA 3B7MA 1YTFB 2GH8A 4BJ0A 3ZXAC 3UJOA 2P5OA 1KU9A 4JVAA 3CP1A 2HWC3 3RZMA 4LULA 3AKQA 5F6LB 3ZN4A 5K1XA 3UKVA 3WNKA 2FDKA 4CUGA 4CCNA 3J8F3 2OXBA 4H37A 4CVUA 1AJOA 2B7YA 1AZDA 3RZGA 1TMF3 3FB6C 5FP8A 1WPXA 4I01A 2P3YA 4MVSA 1UXXX 2XAHA 3R66A 2ODMA 4W8JA 2YIAA 4E2LA 2QQKA 2RDRA 3VBOC 4NIDA 4N8MA 3HN3A 1I94B 3PU8A 2Y0PA 5C3OA 3BU7A 2O8OA 4NHYA 4MVMA 3PIJA 1R081 2WL1A 4UBHA 2WLKA 3GALA 2D5FA 1YFWA 1DYOA 3HQUA 2FDFA 4H0LB 5H6RA 2WNEA 2E51A 1EUUA 2ZGOA 4WM8B 3X2QB 1MZ5A 5CFDB 1M9NA 1EV11 5CFCA 4JI1B 1J3QA 1JHJA 1RUI2 1LB2A 4KUMA 2BNMA 5B4NA 5CB4B 3ZMTA 4QQHA 4Y20A 2ZPXA 3MIHA 3I54A 1ZRIA 1Q82W 4NPMA 4WZFA 3V0AB 1F35A 1F9KA 1VB4A 5FUNA 3QOPA 1ZVFA 1JYTA 1PX3A 1G7YA 3E86A 2XUEA 1BBT3 1IBKB 3THTA 1ZX3A 2VCCA 3U78A 1W04A 2WO3A 3V65A 2WNUA 1FV2A 3RYHA 1XU1A 2FMYA 3RT3C 4DUZO 3RFRA 3A0KA 2Y4UA 1UJWB 3PMSA 2XR4A 4D7YA 1SG3A 5DPNA 1HV0A 4KNCA 1PPJH 2J1EA 4JTAB 3SPGA 1PKXA 1OZ0A 3HB3B 1RUF1 2FHRA 3ZPOA 5CMUA 4ZXEA 4Y1ZA 3OUSA 3QVNA 4C1XA 4MYEA 5FZMA 3LEMA 4LF6O 3AG2C 1IOAA 3MHHC 3CMGA 5GLVA 2O1QA 5D2AA 1MQTB 1GM8A 2VZQA 2ARXA 4GMP3 4UAPA 1M4UA 2IWGB 2W0FC 3EHKA 2QZ2A 1LENA 4OVEA 3MPPG 2NMOA 5IUQA 3TK1A 1OCOC 4UFKA 4R52A 4IYHA 1VJ2A 2Z5WA 3GJAA 1GN2A 1W6QA 1ZL8A 4OUSA 1NY71 4KFMA 4LHLA 3EBRA 4C7UA 2IJIA 2E63A 1K5JA 3NNLA 3FKSG 3A7QA 1WJZA 4JCKA 3N7KA 1W9WA 3ZFGC 1U12A 4LK6A 3T2MA 3ES1A 4DV6B 1QNWA 1X33A 1XE7A 3EQEA 1GP6A 1R082 3RJ2X 1BXHA 2MEV1 2ZJCA 4JI5O 1N1SA 3K9AA 2RM23 1E1QG 1J5EB 2QKSA 3IC7A 3WHUA 5J48A 3UL2A 5A33A 2BU9A 4A2UA 1PD3A 5A3TA 3Q8FA 1QJX3 3THCA 5FWJA 1EBOA 5LMUB 1ONAA 1EV12 4DRXA 3ZX7A 2BVBA 1FJGB 4XILA 4DQAA 3K51A 4B7EA 1LKNA 4AI0A 2W68A 2KXLA 2F93B 2OCCB 2VBDA 1VBE3 1WLWA 4KH9A 1OUXA 1VR3A 3NVCA 5ABJA 4QPIB 2Q67A 1OQEA 3MI8A 1CPMA 3ABMC 2NLJC 2TEPA 1ROPA 3QO7A 1HJFA 2B45X 2Y6JA 1Y3TA 2EIKB 4MS2A 4JTDB 2CH7A 4UVCA 4MV2A 5GALA 5IJ0B 1X36A 3IIIA 5JI7A 1QLEC 2BP6A 4A41A 1MMMA 3JCUZ 3T4ZA 4M0HA 5EXOA 3JU9A 2JG8A 4ICGA 5A3NA 3O1PA 5LXTA 2R071 4RGKA 4DEQA 2PF4E 3A0HZ 4Q0UA 2YUEA 5FPOA 1IGOA 2DCJA 2QQLA 1UW8A 1K5SA 2B46X 1AXKA 3GWOA 1J3PA 4ATFA 3T2OA 1OLRA 5JCOC 2WLJA 5DABA 2BZDA 1SC5B 1SLIA 1W2AX 5JSRA 2JE7A 1M93A 4K8FA 1KDMA 2J1TA 4FP2A 1US6A 3W58A 3LNNA 4B1MA 1QOSA 2K9PA 4LE3A 3JSLA 3N9OA 4PELA 1OCRC 4QPGA 4ZS2A 1TUBB 1PX4A 4LEJA 1SRYA 2PHFA 3IB3A 5C33A 1UZVA 2PA7A 4XMAA 1LU2A 4R4XA 5IJ9A 4GH4C 3E97A 3BEHA 4JTOA 1LGNA 1NY72 3I3DA 2VQFO 1ZM1A 1S0JA 2RS51 4COWA 2JG9A 4TQDA 1KYOF 1QU7A 5C3SA 3HPLC 2VUCA 1OC1A 3W7TA 3BTYA 5B1OA 2Y6FA 3AZZA 4Y20B 2PYJA 1AR73 1JJ2U 4UT5A 4I50A 4K0KB 3AMPA 1I7FA 4IEOA 2MEV2 4OX9O 4DRVA 3AYCA 3LNMB 5K1PA 1O3RA 5CA3A 4N53B 4ASLA 1AYM2 2WS91 2FYUH 2A5ZA 3OCPA 3CRAA 4AI1A 3I97A 3WG7C 4FSJA 4TN7A 1VBA3 5LRRA 1YRZA 3O1OA 4NUBA 1GK9A 2UXXA 2PLV3 1JZ6A 4MADA 1SLCA 2XT9A 4EN7B 5GZFA 1XREA 2JDUA 5SV8A 4DXZA 1JZ2A 4PIYA 1HNZB 5LA0A 3GYDA 1VEWA 3VDCA 3CWBH 3DYOA 1V54C 4Z92B 2B9VA 2QJ1A 2YFZA 4CXYA 3P3NA 4WFFA 4FAHA 4E4EA 1ND3B 2EAKA 1G86A 3CC4V 1RUJ2 2VS0A 1WB8A 3ZHTA 2ARAA 4QAWA 1K9MW 4YW2A 3OTFA 3NNMA 1UCXA 1NQDA 5BNPA 2UURA 4L87A 2JDIG 4X62O 3DYMA 1KEXA 4YVSC 5FZAA 1FPN1 1IS4A 1JMKC 5A32B 5FNVA 2R072 2XLFA 5LW9A 1JXNA 5LBCA 1Q56A 1LOCA 1XL4A 4QU2A 1M4WA 2DVGA 1EUTA 3MIEA 1AVMA 1YZBA 5BV6A 5LGNA 1F4AA 3D6EA 4L8QA 5I93A 3VZNA 4ATEA 4WCEV 2XJQA 4CH6A 1SBEA 5IY5B 5L3CA 2XAJA 4ZY9A 1RPOA 4IEUA 4GKKO 2DCTA 1Q90D 5FZOA 5C4WB 1ZNPA 4PI2A 5FV3A 5I0RA 1I3HA 1AILA 3NV4A 3PUQA 4E2QA 3M3QA 2HG5C 3TEZA 3B02A 4CYDA 2ZM6B 1MR5A 4DRXB 4L92A 1X9PA 2IXIA 4E4ZA 1LNQA 1V9U3 5T5OA 4QIWF 3RVZA 3UO2A 3KM5A 4QGNA 1Q3EA 2NM1A 3TGUH 5A3PA 4UFHA 1OLMA 1STMA 2FTKA 2ZIOA 4IEXA 2VO5A 4JI3O 5LYJA 2RDSA 3OB8A 4LBKA 4XOGA 5K9YA 2Y0IA 2WS92 1M56B 1CZSA 4D6QA 4XJZA 2CH7B 1X50A 3ZRVA 1KJRA 4XF3A 1KBHA 2W91A 2B1GA 3CMAV 3X29B 1SZBA 2QZ3A 1RITA 1B04A 3AZVA 2VNGA 4E2SA 5F2WA 3N35A 5FDBA 3LAGA 3DEMA 3J7NA 2H0VA 1WA8A 1T5EA 1QHDA 3WNXA 3J7HA 2HVJC 1XOYA 3GZEA 3WG1A 4N43A 3P32A 1GM9A 1XUQA 1AROP 1H8TC 3J7LA 5E6HA 1BKZA 3DPRC 1AHSA 2SLIA 1W0JG 1X59A 4EJRA 2BPA2 3JAWA 2WO7A 4DFSA 4PQ9A 2BQPA 4IUGA 5IYYA 2W08A 1CZVA 3O1VA 3E6CC 1YHQV 1FS0G 4H14A 2VM9A 3NWKA 1COV3 1WW7A 4UYBA 4AFBA 1G9AA 1THZA 3ZJZA 3OFNG 1ND2C 2P4VA 3WV6A 2Q1FA 3JATA 1FPN2 4X64O 3WP5A 3T4VA 3AKSA 4AWDA 3F5WC 2ARCA 1TVGA 4QGPA 2XB6C 4HN0A 2V4DA 3S6PA 2JDHA 4I55B 2Y8KA 4UCSA 4JV5B 4Y26A 3AVRA 4DV0O 4WFGA 3I3MA 2WNVB 4R4ZA 4JDNA 2JG9B 4DK1A 5JPMB 4CDQC 2VWKA 3UGGA 5JAXA 2EJRA 3BOPA 1C8NA 3PTRB 4OZOA 1RUH1 5EZYB 5C71A 1BHGA 1MS9A 3ZYPA 3PUSA 4YM0A 1ZAUA 4I50B 3WW2A 3N9NA 1JZ4A 4KWUA 2WLHA 5EBWC 4J6GA 2PY5A 1LJ7A 1SQXH 4DR5B 3W21A 4OFGA 2XJTA 1PK6B 4YZ5A 4ZOLB 4PLNA 2YIBA 1V6JA 3K2OA 1ZSPA 3OUFA 1FNZA 1ZRFA 1FI2A 4EN6B 5BPXA 3OSDA 2V73A 3TXSA 3T2PA 2VU9A 1Y76B 3VZKA 4JI7B 2YI8A 4GKXA 1GOFA 1VF7A 4GKJO 5A6ZA 2DFCA 3DSQA 1OLQA 2WKKA 1K5MB 3VKNA 3OMIB 1QF3A 5FZBA 2ETEA 3BYWA 1QBZA 3ZN5A 2RMKB 4RR3A 3L74H 1V6KA 5JMCA 4IHJB 3VDDA 2XLAA 2BTVC 1ZLZA 1AYN3 5FFOC 2YMZA 2A75A 4S2FA 2PFWA 4Y1XA 5LB6A 2YPDA 2EIDA 4QMAA 2E5LB 2WZR1 1M57B 4HETA 5FLJA 5EBLC 5CEHA 4MX3A 1UZWA 3TN93 3RYFA 4YSFA 5BNPB 2WR9A 3AK1A 3I55V 2P7TC 1UMIA 1OCZB 3PJYA 2DVDA 2OVUA 2DU0A 5FZGA 3VBSB 3MIDA 4NHLA 4MSWC 3AMNA 5KA6A 3LSQA 1ZX5A 1Y9MA 3UM7A 2W6JG 2Y69B 1NOVA 3H8UA 2QUOA 5H2FZ 2Q6AA 1CP9A 3L75H 1W3XA 2R49A 2VG9A 1LODA 3CYOA 4LF8B 4YY3O 1SQBH 1G9BA 5T54A 3KV5A 2VWJA 2HYXA 1GFF2 5K0UA 3GF6A 2RCVA 4HAMA 4WVVA 5D8AC 3ZEDA 4MOAA 3ZYRA 4Z8BA 3G67A 3JAKB 3J80N 2G4IA 2WPDG 4TWKA 2ZINA 4ET7A 2BDRA 1ZA4A 3H50A 4X9QA 4CEWC 4TOIA 1KFXL 2XONA 4Y4RA 2YUAA 2G19A 4LBOA 3BPZA 3K9SA 4WM7C 4S2GA 1YJWV 2XL7A 2GN3A 2F17A 1W6PA 1CAWB 2VBBA 5FYYA 3CCVV 3N7LA 1QJFA 1RUI3 5ANQA 5GJ6A 5LYJB 2Q8EA 5GTIZ 4COUA 3H3ZA 4YM2A 3VBUA 4K8XA 3BODA 1Y6XA 4CP1A 5E8AA 5EC1C 5FO9B 5LWBA 4DR4B 1A3KA 1DHKB 3VKLA 4TUYA 1RB8G 2EINC 1IDSA 1FX5A 4M0NA 1UYYA 2Q69A 4CDXC 1BVP1 3AK0A 2CTWA 1Y7BA 2QM4A 3IC9A 1C5IA 3ZRWB 1NCRB 2ZACA 4NRQA 1NCQC 4WV8A 1SDWA 3OAAG 1WCKA 1ODMA 4GX5A 2IXHA 1O8PA 5CNAA 1V6IA 2OA2A 3D4KA 4Y1VA 3R05A 1W0PA 3GHMA 1BSMA 1RPRA 4RS5C 4ZU4A 4LFBB 3DXRA 4IESA 4O4HB 2D6OX 2N04A 3O1SA 2Q8DA 1N33B 4Q4V1 3KS7A 4JHTA 2PTMA 1YF2A 3C7HA 4JQRA 5EYPB 5BNQA 2JS3A 4OI4A 4XJAA 1RMU1 1WZXA 1C3HA 3FFQA 4YIOA 4MGYE 3H7YA 3VD3A 3FAVA 1IHMA 4IT5A 4B3MB 3SYAA 5EYYA 4MVZA 3VBHC 1PMHX 4V2VA 1VB2A 3UNPA 1CVNA 4FFBA 1LGBA 1QOOA 4JI4B 4PLOA 3PVBB 1UOBA 4BXSV 5I8TA 4X65O 2Q5TA 1MVQA 4E4DX 3B69A 5FZFA 2CHHA 5H9CA 2AHZA 4XZUG 1SLTA 1LULA 5JZGC 3CC2V 1W9FA 3SKJE 5F5CA 4RWUA 2DCZA 4IE4A 4N7UA 4LE4A 4AFAA 5A7OA 2W3JA 2Q8CA 3USUA 4CE8A 1KS4A 3W9AA 5EIBC 2VMDA 2JDYA 3MUZ1 2ET7A 2XHBA 4KGGA 2DYRB 1XMQO 2K2SA 4FLXA 3SH3A 2AC1A 4DZGA 1R083 2EIGA 3HBZA 2J42A 1WCSA 2ZKOA 4WM8C 5ACA1 1NTKH 5KLVH 3ZBHA 4B3NA 1HJGA 2JB4A 2GNTA 1VQNV 3ZHRA 2VMHA 3ZXEA