5KHJA

Hcn2 cnbd in complex with uridine-3', 5'-cyclic monophosphate (cump)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
199
structure length
199
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cyclic Purine and Pyrimidine Nucleotides Bind to the HCN2 Ion Channel and Variably Promote C-Terminal Domain Interactions and Opening.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 67
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5khjA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5khjA02
2ET7A 1OMIA 4QM8A 2VPVA 1FT9A 2PA7A 3QACA 1O3TA 3BCWA 1X8EA 1ZREA 1ZNPA 5FCCA 4AVAA 1QY4A 4N9IA 4D7TA 5E16A 4Q0PA 1CX4A 1IPKA 1VP6A 5HI0A 2BEOA 3CEWA 1DZTA 5I8TA 1ZVFA 2GC2A 3OCPA 3OGJA 4IEXA 3B02A 2B8MA 3S0MA 1J3QA 4NVPA 1O5LA 1QXJA 2Q30A 3RYRA 3TNPB 1CAVA 4I2OA 2PQQA 3KGZA 4RD7A 4LA3A 2OA2A 1ZRCA 4PIYA 4F8AA 1VR3A 4XFIA 4IEZA 3C3VA 4I02A 3LA7A 2P17A 2KXLA 4QGMA 2FQPA 4E2GA 5F1RA 2BGCA 2GZWA 3CL1A 3I7DA 5FPZA 4Q0SA 2O8QA 3E5XA 4ZU5A 5D1IA 1Y3TA 4P9GA 1CAUA 1JUHA 4IEPA 3H50A 1O3SA 1V70A 5KHJA 5JSPA 4MGZE 4IESA 2PAKA 3IBMA 2VECA 3EJKA 2ZCWA 1YHFA 3EQEA 3D0JA 4DINB 1H1MA 1RTVA 1NE6A 5J48A 3U11A 1O4TA 1PM7A 5EZWA 2PTMA 1QWRA 2PHDA 1O5UA 1CAWB 4KWLA 4QMAA 5BUVA 1RUOA 5JR7B 4AQ2A 3KCCA 1O7FA 4IEYA 5J3UA 1NZCA 2IXCA 4ONUA 4O9EA 3OTFA 1GQGA 2PAMA 4IETA 3S7IA 4IEOA 1DGRA 4KU7A 2EAAA 3E5QA 2WC2A 4XF9A 2GC1A 1PMIA 4F7ZA 3H7YA 3IDCB 2XKOA 4HLTA 2V09A 4D7SA 3M3IA 4PIXA 3EO6A 1G6NA 1NE4A 4KU8A 3SXWA 4IEQA 3FWEA 3NL1A 5T3NA 4JV4A 4I0BA 4MV2A 1U12A 1CAVB 1X8MA 3RDIA 2ETEA 4YRDA 4EV0A 4Q0UA 5BXXA 5LEJA 1SQ4A 4QX5A 4FBFA 3LA2A 2H0VA 4IEVA 1J59A 3DKWA 3ETQA 4MGIE 4XFGA 5KHIA 2MHFA 4Q29A 5LEKA 4KWKA 2UYBA 2OZJA 3SHRA 4E2SA 3E97A 4LEJA 4IEWA 2UY9A 3CLPA 5BPXA 3CF6E 1ZZ8A 4E2QA 1RUNA 3HT1A 2XL9A 4QGLA 5K8SA 1NYWA 2D5FA 4EWAA 1UW8A 4XFBA 2IC1A 2D93A 4O9GA 4I01A 4B29A 4OFGA 1RL3A 4XEZA 1J3RA 4HN1A 5BY5A 2OYZA 3RYPA 3S7EA 4JVAA 1YLLA 5KBFA 2PFWA 2K9ZA 3FJSA 1LB2A 1Y9QA 3I54A 3PNAA 4I09A 4ZU4A 5AVPA 1ZZ9A 1H1IA 4QGNA 3FFQA 1O3QA 2MNGA 2D5HA 3NKTA 4MZUA 1UCXA 3EHKA 3E5UA 4I0AA 1DGWA 2VQAA 4OLLA 2ZKLA 4J1XA 3H8UA 3I59B 1LR5A 3EBRA 2QVSB 1CAXB 3SCGA 3IWZA 1XE8A 4Q0QA 2IXLA 4Z07A 4AVCA 3E6BA 2CAUA 4XF3A 2HKXA 5I8SA 1YWKA 1ZRRA 3LWCA 4BH9A 4MX3A 3ES1A 2C0ZA 1RC6A 1J3PA 5CADA 4BYYA 2ATFA 5FLIA 3LZZA 4XFFA 4IERA 3BU7A 4LUKA 4X6RB 4AXOA 2XLFA 4META 1VJ2A 5JSRA 5FQ0A 4J1WA 5JCTA 2FMYA 3ST7A 4PIZA 2XKPA 4BHPA 3GBFA 2IXJA 1ZZBA 1UIJA 2F4PA 3RZZA 3IIAA 4L11A 2IXHA 2BNMA 2Y0OA 1L3JA 1RGSA 1YFUA 5C8WA 1YUDA 4XF1A 2K0GA 3G7DA 3ROUA 3UKVA 5I0SA 4WZCA 4XFCA 1UIKA 3N4MA 1HW5A 2D40A 4R52A 5KHGA 4IEUA 2IXIA 4A2UA 2Q1ZB 2QNKA 1QXRA 3L2HA 5FLHA 2IXKA 2HJIA 2B9UA 1Q43A 3ELNA 3H1WA 4N9HA 2QJVA 3U10A 3TNQA 3NJZA 4EROA 1J1LA 2H6BA 4FAHA 2BNNA 1YFXA 4XETA 3DL3A 4YARA 1CAXA 2CGPA 3KSCA 4XF0A 5LRSA 3RPQA 2PAEA 4JTOA 3USSA 1I6XA 4HVRA 4LULA 1IPJA 4FT8A 1LRHA 3FZ3A 3H1YA 4YNIA 3HIFA 3H7JA 3PLQA 2XLGA 4UXAA 2CV6A 1EYBA 4MH0E 4HBNA 4XFAA 4HVOA 2WFPA 3MDPA 4HSJA 4ZU7A 2XLAA 5J7MA 4WVZA 4HZFA 4UBHA 3MZHA 4AVBA 3PVBB 2Z69A 4FAGA 2XL7A 3OF1A 1XRUA 1DZRA 4WBBA 2B5HA 2OZ6A 5KHKA 3SMHA 1WGPA 3E6CC 4KWJA 3H3ZA 3GYDA 4KL1A 4MGKE 5JAXA 4GULA 2QDRA 1SEFA 3LA3A 3NVCA 2BYVE 3NW4A 1O3RA 4HVQA 1NXMA 2O1QA 3HT2A 5KHHA 3VHRA 2DCTA 3SCHA 4ORFA 4QXKA 1WLTA 2EVXA 2BNOA 3H3UA 1ZZ6A 3I59A 1YFYA 4LUMA 5I0TA 2N7GA 3FX3A 2OPKA 4L2NA 1OD5A 3KMHA 3CJXA 1OFNA 1X7NA 4LLOA 3QOPA 5FQ0B 3BB6A 4UBGA 3ZDSA 1ZX5A 3RNSA 3WW2A 5E1RA 4HN0A 4YYOA 4YSFA 2Q0AA 1GQHA 4XFHA 4I3PA 1XE7A 3CO2A 3KGLA 5FDBA 3FHIB 2PHLA 3FE5A 2XGXA 3WW4A 2PYTA 1ZZ7A 1UD1A 4MUVA 4PJYA 1Q3EA 5I91A 3IDBB 4LA2A 3DV8A 5CU1A 3RYKA 2CAVA 3LAGA 3SCFA 5BV6A 1UPIA 3M70A 1OI6A 4JTNA 4R8HA 1CGPA 2Q4SA 3LOIA 4HSLA 2GU9A 4BIFA 4H7LA 1I5ZA 1ZZCA 1Q5OA 1FI2A 2GH2A 4TLFA 1ZRDA 3WW3A 5CVRA 2Z2SB 2E9QA 4XF4A 5EFUA 3UKTA 4AQ6A 4LTAA 2UY8A 1EP0A 5C6CA 5I8YA 3UKNA 2GC0A 2GAUA 2MPFA 3NSTA 4Q0VA 2XHKA 1LKNA 4EWDA 5JSOA 4EWEA 2UYAA 2ET1A 3JZVA 3HQXA 1FXZA 1J58A 1YFWA 3ACLA 2EA7A 3ES4A 1X82A 5I0UA 2QCSB 4X6QB 3O14A 4MGYE 3BPZA 3H9AA 3MYXA 5LRRA 3DN7A 5I93A 3D82A 3H1MA 1CAUB 3BALA 3R6SA 5FPXA 2H6CA 5I0RA 3OD0A 1EPZA 1TQ5A 4HMZA 1EY2A 4Z82A 1SFNA 2I45A 1ZRFA 2GC3A 5FLJA 1WA4A 4QM9A 3U0ZA 3E6DA 3MPBA 4K8FA 3WW1A 4CYDA 1CAWA 3D0SA
chains in the Genus database with same CATH superfamily
2VRZA 5HCHA 2VPVA 5T50A 4YZ4A 4PI2A 1NTZH 4AVAA 2LGQA 1P7GA 3HQUA 2QTWB 2BEOA 2KM2A 1ULEA 1SQVH 1FXKC 1R092 2VC9A 4BMEA 5J2TA 1SCRA 3I8TA 2J7MA 5LA1A 1WN7A 5TISZ 1PO13 2A70A 3KM5A 4KNCA 1Q81W 1X59A 5FZ4A 2QE3A 3CCEV 1BE3H 4CCMA 1OD3A 4RWUA 3ZVXA 3M7AA 1C8M2 2VOKA 5FZOA 3CU7A 5D1IA 4U3FH 3ILRA 4DW0A 2WWUA 2MEV3 1TZOA 3MW2A 1EN6A 2VECA 3VZLA 3M3QA 1OLQA 4UW4A 4ET7A 4XYXA 1PP9H 2Q9LA 5EZYA 3K5LA 4FOYA 4IEYA 5JWPA 4Q1RA 4Y5TA 5C70A 3STZC 2P3YA 5T5LA 4GA9A 2ZINA 4TOIA 2E7AA 2WN2A 2WC2A 4XF9A 3IDCB 3T1CA 2VO5A 4NE9A 3T09A 1BKZA 1O8PA 1S2BA 1ZTEA 4LR4A 1JU4A 4GCZA 4MV2A 3MLKA 5LP6B 1AR93 1S0FA 2C5DA 4X8NA 5JXGA 4PDMA 4B3SO 1OJHA 4FFHA 4XFGA 4LP8A 3TN92 4L0PA 4BDVB 3ICXA 4K35A 3T4HB 1YIJV 4EEQA 4QHBA 4Y1XA 1HXS2 3MIHA 4I5SA 1V54C 2DQ0A 4Q8KA 4B29A 1W3VA 4NKGB 1BT8A 5FNVA 4E8DA 1UU4A 4FXKB 2PFWA 3PNAA 1O3QA 2D5HA 1E5RA 4WFAV 3MBWA 2VZQA 1I5XA 2VOWA 3SCGA 3V64A 5FKCA 4H55A 4QKDA 2VNVA 4LE3A 4AHZA 4EN8B 5DUVA 2JENA 3IIIA 4PA9A 2Y38A 2YYOA 5IYZA 1W9YA 2QQUA 3WQ1A 5EWSA 3MLLA 1UZYA 3BU7A 3K51A 4MVZA 3VBFA 2YDEA 4JI6O 1ENXA 2BVVA 1OLRA 4C0BA 1DCSA 2IXJA 4Y1UA 5LA9A 4CPBA 2W95A 1HXS3 2VR4A 1VAVA 4OXSA 4GH4B 1ENVA 4GB32 1POQA 2BERA 2E26A 2I07B 4IEUA 3CJIC 2E5LB 1UY1A 1ZYBA 2B9UA 2R72A 3WINE 1G86A 1V6JA 4EROA 4K3UA 1XE0A 4AE2A 1YFXA 5BNNA 1IS4A 3BRCA 4GAZA 3LSEA 2R0FA 4DV2B 2Z5WA 4DV4B 1D2DA 5C8YB 2P67A 2WIIB 1CEZA 1FXHA 4LULA 4A3XA 2R9IA 4IDZA 1QVFU 3VKOA 4FT8A 3F5TA 2XQRA 5FZKA 1EYBA 4MH0E 3J8F3 3A2FA 5FK8A 4QQLA 1PL0A 2A6VA 2PZSA 1K92A 4E4SA 4AF9A 1C8M3 4BISA 3OOXA 1X36A 1XL6A 1SQGA 3Q4HB 2OZ6A 4J25A 4XIKA 3LSQA 2GN3A 5F32A 2GSMB 4FLWA 2VVDA 3LDDA 5LYJA 4TXWA 2JB4A 3NVCA 5FYHA 1N3OA 2XJSA 2JDYA 3BKZA 2EIEA 2ZX1A 2FCUA 2N7GA 3K5OA 2AZ5A 4GWIA 3GF6A 4DZGA 2UXNA 3AP5A 1ZL8A 4H33A 3NNLA 4Q4V2 2XUMA 5K9YA 1GQHA 1UOGA 1PMJX 4I3PA 4RQPC 1YXBA 2YROA 4BW9A 2AW9A 1IQDC 3N2GA 3FLPA 4R9DA 2P3IA 4EJRA 4YW5A 2PN5A 2GMPA 3ENRA 5EP9A 3ZN5A 3FKSG 4J9ZB 1GAXA 5L19A 5FJHA 2EXJA 3HR0A 4WBNA 2XPJA 3W5NA 1EP0A 1ROPA 3OEBA 3WV6A 2RR12 1DLCA 2WO1A 2VWJA 1E57A 2RS53 2P5BA 4AI8A 2Q8VA 2JIZG 2FZ1A 3ABLC 3ORJA 4DV7B 4GJYA 1SLCA 5KX5B 1K73W 4QU1A 3ZFFB 2M6YA 1XEQA 1XILA 4NPMA 3DCQA 4BQ4A 3G80A 3O9OA 3L74H 1M9NA 4KBBA 2R042 2WNEA 4AHCA 2RS13 1SFNA 1ZRFA 4K7JA 2FD8A 4WFEA 1JYXA 4NIHA 5LK5A 1AHSA 1V6NA 2RS31 4AI0A 1URXA 2NLRA 4CDWC 5B1OA 3W20A 5LP6C 2PHUA 1W99A 3T0BA 2B46X 1IG0A 1V9U2 2KD7A 5JMCA 1ZRIA 4YZ3A 1J5EO 2N05A 2RDCA 2XHNA 4IEXA 2B8MA 3UGFA 5A3LA 2VMGA 1QJFA 4IUGA 4JQTA 4LA3A 2V5YA 2ZMLA 1VR3A 3H1HH 2Q8DA 5L3FA 4FOVA 5BMVA 4GUNA 2VZTA 3CL1A 1Q56A 5T5OA 4ZU5A 1OCOC 4AEJA 3IC7A 1NVPD 4IESA 4Q4V1 3PHMA 1S76D 5A3MA 1RTVA 1JA8A 2G9FA 2GNDA 5C3QA 5EXOA 1MS3A 3E8GA 1UZ0A 2JE8A 4TV8B 2A1XA 3AXEA 4ONUA 4W6WA 3B77A 3ZXDA 2PAMA 3S7IA 3H1LH 1K33A 4B3MB 3K3WA 1Z78A 5FBJA 3WEZA 3ZSLA 5IHRA 1HN0A 1FXKB 4D7SA 1CJPA 4PIXA 3ZMNA 3NL1A 4IV3A 2RS51 4NPLA 4M01A 4I0BA 3VBUB 2Q7HA 1KC8W 4DYLA 4O2BA 1MQTB 3DYPA 2ZGRA 2F4LA 2ZJCA 5FZAA 5KWRA 5LEKA 1H2KA 5CA1B 1WWYA 3I55V 3E97A 2W1QA 4AI2A 2B1IA 3QNEA 1IKPA 5EK0A 2CH7B 2D5FA 2HWE3 3NV2A 1VRBA 1LNQA 3WNXA 1C5IA 4NJ4A 1OCCC 2XAQA 2VUDA 3S7EA 4BZ4A 2BPA2 1RUH1 4YPJA 3LB9A 1MEC1 1PVC2 3D5OA 1GMGA 2OWOA 5FL7G 2W6JG 3I59B 4V2WA 3GNEA 3ZKYA 2WDBA 2FZ2A 3NV3A 4OHZA 2CAUA 3H3LA 4GKJO 3JXSA 2C0ZA 3ZRVA 4M4RA 2ATFA 2RJZA 3CPWU 4ES8A 3U78A 2ARBA 4NN0A 1R091 1JODA 3ZIAG 3SGIA 2BJSA 2V4VA 3UT5B 2PHTA 5A6YA 3WCSA 1QLNA 1S77D 3DGEA 4V1PA 4CP0A 3IIAA 2DYRC 4L11A 1XB9A 5CA0B 5A7PA 3G7DA 2QQNA 5ACA3 1K5QA 3T2QA 4B3TB 1UIKA 5LB6A 2D6NA 2R16A 2VGDA 3OMAB 5FP4A 5FLHA 4P5HA 4JAUA 1OA4A 1UZZA 4JI0B 1LOAA 1S0CA 2P6HA 4FFGA 1J1LA 2LJ2A 4I4TB 5HCFA 2DF7A 3D3AA 4Q27A 4Q4W3 2ZNIA 1Q82W 5K1XA 4CDQB 1RUI1 1AP6A 4UXNA 4JGYB 2EILB 1ODMA 4Y1VA 4UXAA 4AAPA 4XQWA 5FAXA 1W8OA 2VMDA 2GHYA 3WUCA 1JYVA 1GWLA 2DTWA 1M56C 4JI4O 1OOPA 3T4ZA 3G4SV 4YG6A 2K1EA 1B06A 3AK3A 3BI3A 3VQXA 3C2UA 1D2QA 1QQP1 1XRUA 1G9FA 1KDMA 2WS93 2E6VA 3TCUA 1JOYA 1RUH2 1NH2B 3D3IA 1SPPB 4MW8A 1ULDA 5F2WA 3SCHA 2OQ7A 4K20A 4QXKA 2B45X 2BBAA 1U5XA 2QQKA 3WB2A 2OPKA 5C3SA 1NLSA 2YXLA 5KAFZ 1NCQC 4ICGA 4L99A 1H8TB 5IW0A 3LSDA 4HONA 3TETA 3DYMA 5IVVA 3ZPOA 2ZM6B 1CESA 2WSUA 1YIPA 1K97A 5C8YA 3WDUA 2RS12 1GH6A 1W6NA 1ZZ7A 5JCOA 2YGMA 1RM1B 1DQ4A 1ZBE1 1FYJA 4PJ0Z 1UMIA 5AC91 1HV0A 3ETEA 1Q6UA 1BVVA 1GNHA 4XBQA 4AI9A 1YIFA 3H1JH 3I2IA 3KV6A 1ZRDA 4Q4X3 5C8CA 1OZ0A 1RPRA 1MACA 1KRIA 4KI5M 4AVTA 1HNZB 4GWNA 1I5PA 2WZ8A 4OI4A 2TUNA 4QQ2A 2YBKA 1SDDB 4PBOA 4LKEA 5GTHZ 4MLOA 4DXWA 5A7WA 1A78A 2Y0IA 2ZCEA 4BAYA 4N53B 3PMEA 4BPZA 5FZLA 3C7HA 4QPIC 2HWC1 1CZVA 2W94A 2I45A 4HL0A 1Q8PA 5EZYB 1UYYA 2GTAA 1QKQA 4PF5A 4QM8A 3MEPA 5A2QN 4N9IA 4D7TA 1BLZA 1WBFA 4I55B 5H6QA 4LO8A 4OHWA 1PNFA 3MI8A 1BBT3 1DBNA 4F83A 1HN1A 1DYOA 1R3IC 1QXJA 3BTZA 4O4JA 4WBNB 3NQHA 4ARYA 1FKAO 2WZR3 2ZNJA 1BGYH 2ZGPA 1EZJA 2A79B 2LP7A 4XABA 2XQXA 3GZEA 4F3JA 2BBVA 2CDOA 4GALA 1UKRA 5JUVA 2Q68A 3I7DA 4N21A 4G27B 1PL4A 4QX2A 4DB5A 4L8QA 4PDWA 1YVWA 2RDSA 1V55B 5JSPA 3LDEA 5LL6Y 3JAWB 3EJKA 2C26A 4XBLA 5FPBA 1LECA 3D36C 3FYIB 3RJRA 2DWEC 2EIKB 1UX7A 5CB4A 2R7EB 4A7ZA 1E1QG 4BLIA 3SDLA 2JK5C 4IEOA 3O0VA 2ZGKA 3WNPA 3DECA 3OGSA 2WO2A 4GWMA 2XVGA 4WFBV 4ZY9A 1U12A 5LXTB 2VY0A 3RJ2X 1WUVA 4K0KO 5LA6B 5FPAA 3RZGA 4O4LA 3CMEV 4PBPA 3B4SA 5C5UA 2JS3A 5BMVB 4MSWC 4AVSA 3POSA 2UY9A 3JASB 4QPIB 3MIDA 2ADPA 2XWBB 4COZA 3DGTA 4UCUA 4FPGA 4QJFB 3VBHC 2W1UA 4FLZA 1VBE1 1KD7A 4FMTA 1K5MA 3B5LB 3JD3A 4PF1A 2XJQA 3FAVA 1HNXB 1X9PA 4UOJA 1W6OA 4FPKA 3IWZA 5LA0A 3DC6A 4URAA 4AYUA 2Q5ZA 1F4AA 1OCZC 4BH9A 1NZIA 2JRIA 1H6YA 4J7KA 4R4XA 1NG0A 3UV9A 5JIUA 1KEXA 1K4DC 1PNLA 3FB5C 4XJZA 1R6NA 3K48A 5D8AA 3X2QC 1YI9A 1MZFA 4PIZA 4UFIA 3T1HO 4FP2A 2X5IC 4URTA 5GW7A 1D5AA 1YJWV 4XDKA 1PZ7A 1SQBH 1NTKH 3W5MA 1EUTA 2EALA 4I50A 4JGSA 4R6ZA 1WW6A 4WZCA 1GM9A 3SH3A 3PVNA 2G4IA 1VRH3 2MK3A 4D3WA 2X7RB 4X88A 3H1WA 2J1TA 4N9HA 1R3JC 3ZRXA 3PJQA 3ZKUA 4YVSC 3IPVA 4JQRA 2ZIMA 2RDQA 1UU6A 3RSJA 3USSA 1KP2A 1S3JA 3ASIA 4YG3A 2YXSA 2DFBA 3WCRA 1Q90D 2XLGA 3LPGA 2FMDA 4MHUA 1A32A 1JOBA 1NTMH 4L97A 4I9QA 1VEWA 3OGVA 2B5UA 3IAQA 1XYNA 4J11A 4IE0A 4J80A 2Z69A 1QH6A 1DHKB 1HRV1 1CPNA 4K8XA 4I55A 5FYZA 3VBSB 1OLMA 4R4ZA 4CXWA 1WGPA 3OTOO 1P84F 2JIGA 2E31A 1OQEA 4RS5A 1IG3A 4TWTA 2OW4A 1L8DA 2EVXA 4BJ0A 4BXFA 4PCRA 1RMU3 1XQ8A 2WLIB 4JV5B 4PA4A 1LU1A 3KB5A 2QWQB 3BA9A 1JYIA 2Y60A 4YYOA 4QXHA 2A0LA 4HG6B 4RAIA 5FPRA 3QF7A 4GKJB 2HLDG 3VD5A 3BODA 3P30A 3VDDB 4CZSA 2I2SA 2VTXJ 2E51A 4Y22A 5CU1A 4DV1O 2R063 4UF0B 1CGPA 2Q4SA 1W2NA 4DMIA 2Z79A 1H2SB 5A32B 3OFNG 1W0PA 4LTAA 4LKFA 2HVKC 5IVEA 5LW9A 1DQ1A 4FPPA 3RMXA 2ET1A 1BL8A 4GZ9A 1W9FA 4RR3B 1WW7A 4X6QB 3BN6A 3WSOA 4L9BA 1WB8A 1H8TA 5B3SB 1U96A 1EPZA 3ZYBA 2C2AA 5CFDB 4PA7A 4UFMA 4GH4A 4Y1YA 1PK6B 4XBNA 1GOHA 2AGAA 4DV0B 4FK5C 1VBB3 1VIBA 3A0BZ 1KECA 1GQPA 1FT9A 3J8F2 5JJJB 1R64A 1X8EA 2LGWA 4FPFA 3J26N 2JDKA 1A8DA 4CEYC 5FMOL 3ZN6A 4JZ2A 2WLPA 3T0DA 3C7EA 1TVKB 3OSDA 4B4RA 4BW5A 4A45A 5ANQA 3RYRA 3CX5F 1CAVA 4CRQA 5FREA 2XUEA 4U3JA 1PO21 2DU0A 2XAGA 1B09A 2NMOA 3POFA 1AX2A 5F6LB 3HN3A 5FY1A 4RHV1 2ZGLA 1NA1B 2BOBC 1FFXB 4H3WA 1OFSA 3RFRA 4AL9A 1JUHA 4E27A 4B4QA 4E2LA 4XXPA 3USUB 3ZSEA 1OPOA 5LGNA 2RMU2 5C4WA 3I3MA 3P3PA 5EZWA 3ZCCA 2FB5A 3G6BA 2YEVA 1YI2V 1C1FA 4PT6A 5JR7B 3UGHA 4AQ2A 2ZXWC 5KC6A 1VB4A 1N32O 3OTFA 3RYHB 4DV0O 4YJ2A 3ZHQA 4KU7A 4LCUC 2EAAA 3OBRA 1W3XA 5FPVA 2XKOA 1JVMA 3E8FA 3K08A 4HLTA 3ML0A 1OT5A 4OUMA 2Y6KA 3OE7G 4XMAA 4H37A 2EF6A 4YWAA 1AJNA 5FZ7A 4EV0A 3MFAA 4E4ZA 4DS0A 3HKDB 5FOBB 3UO3A 2H0VA 3I3BA 3K3NA 5KHIA 2ZQMA 3PUSA 4Q29A 1ND3C 4UFJA 3MHHC 1ND2A 2ILMA 4LKDA 4FOWA 1UMZA 3T2TA 2BVBA 1NYWA 1J95A 1SBEA 4LF5B 4QPWA 4XAAA 4MADA 4XEZA 2WO3A 2DFCA 2XAFA 5LOVB 4LH7A 1JFFA 3ZN0A 4MZUA 3OTOB 3SITA 1DGWA 2FCTA 4LF4O 3PTYA 3AMNA 2QVSB 1Y4WA 3VD7A 4Q20A 1XE8A 4Q0QA 3SH5A 1U97A 3THOA 2RM22 3VD9A 4HPKA 1ACCA 1Q8VA 1OUSA 4LXLA 2CUGA 5CN0A 1RUF3 3SYOA 3ZYIB 1QQP2 1Y74B 3TJTA 5K7PA 1NQJA 1XMQO 2VMEA 1WMFA 4CEYA 4Z8BA 1LENA 2J1SA 2ZGSA 1AZDA 4Y22B 3JD4A 3E22A 3OBZA 4DR1O 1RUG1 3K5MA 1HNZO 5CB7A 2BTVC 4GH4C 1O91A 2IJJA 4MVUA 3I2GA 1R3KC 3BA8A 1ND3A 2D40A 5KHGA 2UUCO 2ZPXA 2BGOA 4HT1T 1RPOA 5A3NA 4S2HA 4CP1A 1M5IA 1MVQA 1RUE1 4LBOA 3L9JT 4EN0A 3DL3A 5FBZA 5CISA 5J9PC 1VBA2 4JTOA 1I6XA 2EZPA 3MHSC 4E4HA 3PUQA 3W7UA 1BZKA 3BIWE 1Q8SA 1F23A 5JR2A 2YY1A 5F3IA 4FQ4A 1AYN1 4DUZO 1QQP3 3CKHA 3RZJA 1O6UA 2W47A 4XDLA 4XJUA 4AVBA 5C4WC 4EB6A 1QJX3 4Q8LA 1WA8A 3TGUH 1OOPC 3ZN6B 1DZRA 3T2PA 3WQ0A 4MVSA 1F5JA 1L1FA 1QJU3 3X2QB 2W2IA 2BYVE 3LA3A 2D6MA 3AKQA 5DZGA 2O1QA 1W28A 1YEWA 5JVDA 3STLC 3TK1A 4LUMA 4KMQA 2VQEB 3PTRB 4XCBA 2VUCA 2HWB1 5IYCO 2Y4UA 1RUH3 5EC2C 4ZOLB 5GLTA 5E1RA 4AK3A 1PV0A 3LDBA 3VD3A 5FYUA 2VCBA 4RS5C 1VBA3 3DUIA 1W8WA 2JWPA 2NZ9A 5AC93 4BIUA 1ST8A 1HLCA 5G05L 4ZIBA 1US2A 1JZ3A 2PYJA 2YV8A 5LBEA 3VBHB 4QHZA 4J10A 5I91A 1W03A 5SV5A 4A6OA 4OHVA 2XONA 4DR3O 4YM3A 2Z5UA 2GU9A 1REFA 2EXKA 3MW3A 4I0XA 3T1HB 1R082 5GJ6A 1LGCA 3MO4A 3CIHA 3ABTA 5A80A 5J2UA 2JG9A 2CTWA 1H8TC 1GKBA 4EWDA 2ARXA 2CYFA 3HQXA 1FXZA 1JZ2A 5KMGB 4O4HB 1VBA1 3DTUB 5LRRA 1NY72 3D82A 4ARXA 2WNOA 3DKQA 4NAMA 3BALA 1OBNA 3PJSK 3JCIA 4HANA 3PVEA 3PUHA 4Z1VA 3OJBA 1KFXL 1TMF2 2RM23 5L3BA 2D3RA 3QO8A 2WYSA 2ET7A 2X5IA 2Q1MA 1RHI1 1QF3A 2ZE8A 1O3TA 2MEV1 1V9U1 1JFFB 5E16A 4W65A 4XIOA 1CX4A 2DCZA 2FHRA 2Y6HA 2XDVA 1OCRB 2P4EA 1YJNV 1AYM2 2GMEA 2VXRA 4B3TO 3HEIA 4W8JA 3ZR6A 1IBKO 5D5QA 2EIMC 4MVRA 2HKOA 5FZCA 5A3WA 1JMKC 1DLLA 2D43A 2JG9C 4I02A 5DDJ2 1QJX1 1KKDA 2KXLA 5IAVA 4MTGA 4LHKA 2J1UA 1O59A 3SISA 2QWOB 2RQ6A 4LFAB 2WFF1 5EC1C 2A3WA 3MFCA 1SESA 3AG4C 4NB5A 4AFCA 4IIJA 4UVBA 4OI0A 4JYAB 1W6NB 4MVQA 3HQRA 1KGYA 5L7OB 4TYSA 3KVBA 4AZZA 2N04A 1H0BA 3ZHVA 5J48A 1PM7A 4Z92B 5LBBA 3R0RA 1QWRA 4GZRB 1O7FA 1JS9A 3N9LA 2NYYA 5DABA 1QJEA 4P9LA 4LMFA 4QT6A 3FB7C 2D97A 2DYSC 2Q8OA 5L73A 2QWRB 5H9CA 1GRJA 2LQTA 4BQ3A 3M3IA 4JI7O 2PELA 1QJY2 1VQKV 2JDUA 4LITA 4YVSA 3KS7A 1COV2 2E33A 5F9TA 3G67A 1N4CA 3NV4A 4BWAA 2BSKA 2UU9O 4ATEA 4R9BA 4QX8A 5JPMB 3ETQA 2P6JA 4IYHA 5J1XA 1OA2A 3OGCC 2UYBA 2ZM6O 2OZJA 1K7DA 5E79Z 2X6BA 1XNTA 2IVIB 4X1IB 1TVKA 4EB6B 2ZACA 3OMIB 2IC1A 1Z7S3 2D93A 2WAMA 2XT9A 4GKKO 2YPDA 1RL3A 2DCYA 1EV13 1BEV3 2XR4A 4CH3A 4PDWC 2J1VA 4DW1A 1NUKA 3A8TA 2CGOA 5D8AC 3I97A 4TT3G 1G9DA 1ULPA 4NTXA 1AYN3 4DEQA 2ERFA 2EX3A 5IWFA 2OYQA 1LR5A 4U7NA 3MGUA 3BPSA 1QJY1 2EINB 2W9XA 4CP2A 4MVTA 3ECQA 5B5EZ 2BE3A 3LEIA 4H14A 2NN8A 3S3WA 5AC92 2XG3A 5C5TA 5JSRA 3VBHA 1ZBE2 1JZ6A 1JR9A 2AH2A 2QFEA 2AEYA 1UZVA 1SACA 4LF9O 2G38A 3RVHA 4Y26A 2IBZH 2AXTZ 1ND2B 5LY1A 4B3SB 3O1MA 5J37A 4X20B 1XNQB 2A7AA 2VBPA 1KUQA 2E75B 1YSCA 4G28B 1LGBA 1C4RA 1LU2A 3ZXFA 1EFRG 1XBFA 2LTNA 5B1AB 4XURA 2QQWA 5FPUA 3L2HA 1KDKA 3EYPA 1LUWA 5KLVH 1W0NA 1MZ5A 4W4ZA 1AR73 3WF0A 4FZ1A 2DURA 2DOSA 3WF4A 1IPJA 2YC2A 4YZ5A 4BB3A 2ZAHA 4YNIA 2JGUA 3WU2Z 3ILFA 3CRQA 1TUBA 3CSXA 5GLWA 1WP7A 1C57A 3ZXGA 4L92A 3MDPA 1ULGA 3AK0A 1WPBA 3C3TA 4WVZA 2H8PC 5DG1A 1Q7YW 4HFSA 1COV3 3D36A 4JI2B 4Q26A 1RUG2 1OH4A 3OGRA 4LWSA 2PLV2 1ND2C 4GMP3 3QH7A 1B3QA 2A7WA 3JD0A 1RUE2 4XDJA 1J5EB 5EV7A 2I74A 4ORFA 3WG3A 4QXBA 1DQ0A 1JBCA 3B3QE 1NCQA 4JI1B 1CQ9A 1Q6HA 4CP9B 1VF5B 3KMHA 4U2AA 3QOPA 5FQ0B 1Z5WA 4MW3A 4UCSA 2V7QG 1S4CA 2YPJA 3CJIA 3CC2V 4BQ5A 3WP4A 3A23A 2BDRA 2XASA 2PHLA 4UW6A 1MSDA 3AMQA 1SLLA 1OF3A 2X29A 5LXTA 1QMJA 1M57C 2DYSB 4LA2A 3DV8A 2CAVA 5A33A 4PHZA 3HKCA 1M4WA 1NQDA 2SBAA 1HV1A 4DRRA 1AR81 1J83A 3JASA 4QPIA 4UCTA 1GZTA 4M0HA 4TV8A 3ZMTA 3SPIA 4W6YA 1J58A 1KQRA 5KXBA 4WFFA 3ES4A 3VBOB 3O7OA 3FX7A 1IOAA 1SG3A 2ETNA 3R4SA 3O14A 2Y33A 3MYXA 3DN7A 2GNBA 3SYQA 4AQYB 4QNHB 4S2FA 1HP8A 4LIUA 3SLIA 5C8CC 3EHBB 2JKBA 2EIMB 4DK0A 3LUTB 3KZ4C 1A8MA 1GN4A 3OY8A 4DXRA 1BHGA 2QQPA 3O12A 4LLFA 2PA7A 1H2NA 4CCJA 4DXZA 1VBB1 1POV0 4Q0PA 2Q1FA 1DZTA 1ZVFA 4EE2A 3GM8A 1UY4A 1AXZA 1RHI3 3B01A 1TA8A 4HKWA 1QNWA 4NVPA 5IVYA 3AG1B 2VUAA 4OX9O 1PX3A 1L7LA 4I2OA 5DAWA 4EZHA 5EJ3A 3AJYA 3W21A 3JSNA 3CYOA 1RSOB 3SJQC 2FQPA 1CZSA 2BGPA 1CIWA 5FPZA 1URFA 2Y64A 2ZEYA 1D4VB 3CCUV 3AG4B 4I0XB 5B1NA 3H50A 4NPRA 3DSQA 1UKGA 2XNDG 4JKLA 5E88A 2ZCWA 5LA2A 3JU9A 1NE6A 3VZKA 4HYOA 5FUNA 1FFTB 1BEV2 3KCCA 4RGGA 3WOGA 1NZCA 1H4HA 3AFKA 1PO22 1DGRA 4Y4YA 5J09A 3E5QA 1S72V 1RP3B 2GC1A 1PMIA 3PL0A 3H7YA 4RFT0 2RS11 2QE7G 4JI3B 2ZS6B 1JZ7A 3EVKA 1XNDA 1S0IA 2VH9A 1AILA 4COVA 4PLNA 4EN7B 1HNWO 1RXGA 3OUSA 3O0XA 1NJIW 4FBFA 1V9PA 4FP3A 3NRUA 4QPGB 4D7YA 1VF7A 2D3SA 2ZABA 1TUBB 4CCKA 5F2SA 3ASNC 3CF6E 1ALYA 4RYDA 4YZ2A 1HQWA 2AR6A 4M3CE 2W6IG 1KB9F 1RUF2 4O9GA 4I01A 1Y9GA 1QHTA 4AILC 3NAPB 1J3RA 1AI6A 1L7RA 3E8BA 1H4GA 1EZVH 3NNJA 4XJWA 3TWIA 1UMHA 4I0AA 3EHKA 2VQAA 2ZKLA 2GP3A 3T2MA 2AGSA 3EBRA 4OZOA 5FY0A 1UYXA 2JVDA 3E6BA 1ZM1A 2WSSG 1ZRRA 2UURA 1IX9A 1E79G 4MS2A 4GLXA 5EHDA 3KWVA 3BHPA 4LUKA 3ASNB 2HWE2 1VJ2A 1FFXA 2V72A 5FZ9A 2DVBA 1Y43B 3RYIB 2CU5A 5JXJA 1GV9A 1C1LA 2R6QA 4P9IA 4YW7A 3RZZA 2QSAA 2GDFA 4QD2A 2ZHLA 4GQ7A 4YFZA 3SJAC 5C8WA 4XUTA 1YUDA 3ACGA 1X33A 2XWJB 4UAPA 3OYWB 2JD4A 2W39A 4LHLA 4LBQB 4R52A 5FYYA 2Q1ZB 1IBKB 4BQYA 4AVVA 3T1YB 3ABKC 5AG2A 1VQNV 2VM9A 4ZOLA 5CKQA 3USUA 5ISLA 1TMF3 2QQJA 5LRSA 2PAEA 4CCDA 4PA3A 1HB3A 1Y6XA 4Z2AA 2YFZA 1K5MC 3CXHF 2HVJC 1BJQA 2ARCA 4XFAA 4BQ1A 3RS6A 4HSJA 3T0AA 1C3HA 4E8CA 1RUD3 1FOD1 4WZFA 5FYIA 2BFUL 4DRXB 3WR0A 2K46A 1YHQV 4GX1A 4GT1A 2VOXA 3E6CC 2NM1A 3A7QA 5EPAA 4RQPA 5FJKA 4GULA 1R6KA 3BYWA 3NWKA 2GBOA 2ZX4A 4J7JA 4WCEV 3CRCA 2VW1A 2ZOEB 5CYYA 1YFYA 4YW2A 1WMXA 3H1IH 4P9YA 3SEEA 3PN1A 3QCWA 3SYPA 4ZXEA 1HRI3 3NO8A 4UFZA 5FFOC 2Q0AA 1PIV1 3KGLA 4C1XA 2YFUA 1SZBA 4JF3A 2XGXA 1NBMG 1VQLV 3HNMA 5LP6A 1IS5A 3VKFC 1V00A 4LBLA 3LGRA 1BK0A 4CDWA 4M3CF 4JTNA 1GP4A 5CBHA 2LUWA 1JXNA 1S2KA 1MQTC 2QBXA 4XPVA 2Q73A 2JX9A 3RWKX 3UKNA 2GC0A 3W9AA 4Q0VA 1E5SA 5C93A 2HWF3 2WNUB 1YFWA 4XOGA 1Y76A 1S5JA 4LF4B 3B40A 2O57A 3WLUA 1FAFA 1WD4A 2D6OX 3RN4A 1E5IA 3I2FA 1RXFA 3MIEA 2CNAA 4DO0A 2W0FC 5F6KA 2ZT9B 3H1MA 1M57B 3HNYM 4XVHA 4DUXA 1W8UA 1UPSA 4LWSB 1GBGA 2NQYA 4FPHA 2CTRA 4QB1A 4LO6B 2WT2A 3GVMA 5LBCA 1CAWA 1V6OA 1XNBA 1IS3A 3AC0A 1XNAA 4OMDA 3VBFC 2DUQA 3POJA 3FB8C 1UAIA 1Y7BA 1T2XA 1DLBA 1RVF2 4D8MA 2HP8A 3HKBA 3RZKA 3IM0A 3TB0A 2DVAA 2PQQA 2GTSA 2Y0PA 2UUCB 4QHOA 2VVFA 1N1YA 4F8AA 1QVGU 3O1RA 1W2AX 1VBB2 5IK5A 3PUIA 2BGCA 3RZHA 2P4VA 1GSLA 4KGQA 4Q0SA 2DMXA 1DF5A 4JI2O 3POIA 4QPYA 3MIGA 1RINA 2YI9A 2Z42A 2HBUA 1O4TA 4LNVA 3KLSA 4NTWA 5JCOC 1DYKA 2EIDA 5FXXA 4S2GA 3TRSB 1PNMA 4IQPA 4CCEA 1LHUA 1OPMA 2OIGA 4JI1O 5LZ6A 1VF6C 4JDMA 1U5ZA 3BY6A 5FXZA 4FO9A 3LDCA 1YRZA 4DPNA 5FZGA 4B3RO 4KU8A 3K0GA 1PGL1 2Q7EA 3GB7C 4JV4A 5BNNC 2UUAO 1YQCA 2OCHA 5BNOA 2RS52 3OUJA 1SQ4A 3ZIXA 4AFAA 3HNBM 1YDXA 3ABMC 4Z1MG 1ONAA 1GKFA 2DQ3A 3SHRA 4BK4A 1ZZ8A 2OS2A 3DPRB 1CWPA 2YHJA 4E2QA 2R49A 2R30A 2XL9A 1XJAA 2AACA 2HWC2 5IJ0B 3Q8BA 4OI2A 3KT1A 4UCOA 2RCVA 3JBG3 2ZA9A 3NKGA 2OYZA 1JUIA 2WLLB 1REEA 4A3ZA 2CSGA 5B1BB 4QAWA 3JD2A 1LR1A 1KD1W 1P7BA 3P32A 2HYXA 3UNPA 4FVMA 4LBMA 1DTOA 3F2ZA 1I5YA 4QDRA 4XF3A 2NLJC 1GNYA 4QDSA 1YWKA 2QTSA 1N34B 3ES1A 2EIJB 5E1AC 2WN3A 4D6TH 2WLIA 4META 5DZFA 2JDIG 4MXWB 3O1TA 4BCUA 5DMYA 4CC5A 2IW5A 4I7ZB 5CA3A 3CCMV 1GN2A 1ENRA 3PMSA 1W6PB 3WF1A 2BNMA 1OCRC 1CPMA 3U07A 3V56A 4LQRA 3O0WA 2Q69A 3LEMA 2RDNA 1OHFA 3K2OA 5C3OA 3RWNA 4BM8A 4A7KA 3CXCU 4LF6B 2JGDA 1BCCH 3OEHG 1FMD1 5SV8A 5FP3A 5IVFA 4IIJB 2YC4A 5A32A 1VARA 2R043 1AR1B 1WAZA 4LFBB 2QWNB 2YGLA 3UJOA 4MYEA 4OYUA 2CV6A 3OUHA 4HBNA 1O4YA 3FLRA 4HVOA 2WFPA 2WWJA 1FYUA 1YQ2A 4J41A 3VDCA 1DGWX 4X1IA 1N0JA 2KG7B 3FBMA 4UVAA 5CBLA 3LNNA 4UI9L 4UCVA 4WBBA 5KHKA 1W0JG 3EXUA 1BQ0A 1SBFA 1SCSA 3JUUA 2HG5C 4OMCA 1GK9A 2H94A 5LBQA 3GGLA 3AVRA 3ETDA 3QG5A 4WFHA 1N32B 1S5LZ 4YY3O 3PU8A 3ABZA 1O8SA 4OHYA 4IV3C 4OZXA 2JDPA 4FZ0A 2VZ3A 1LUVA 2R073 3E86A 2WLJA 5BNPC 3M99B 2VMFA 1S0JA 3LNMB 3WG4A 5IVJA 4XFHA 5FDBA 3CMAV 4Q4Y1 2ZMKA 3H8RA 1W6QB 1FPN3 2R0HA 3UETA 4XAEA 3CMGA 4E4EA 5BV6A 4BQ2A 3KF5A 4O2BB 2HJDA 5FYMA 4GYCB 1ZZCA 1PO11 4TQFA 4YFWA 1JJOA 4LF5O 1I0HA 5KC5A 3LIGA 3THPA 3UKTA 5F8PA 3CNAA 5CG8A 5DN2A 5ITZB 1HNWB 3JATA 1XNRO 2RJKA 1LOBA 2DVFA 2YUAA 1FV3A 3ASOB 4XC9A 4EWEA 5F2VO 5FY5A 2J1AA 4LK6A 1DQ5A 3SKVA 4NO4A 4MGYE 3H9AA 5FZIA 1QCEA 4F6EA 4JPRA 1H38A 1LNSA 2IFRA 2CDYA 5F3CA 3RI9A 3OPWA 1JQ0A 2VXJA 2CWMA 5IDJA 3TEXA 1DF4A 3OPTA 1Z7S2 4K8FA 5JH7A 1RIRA 3H42B 5KXDA 3MHZA 4ASMB 1SDWA 4I9WA 1ZREA 1GO3F 1ZNPA 4JZGA 3ZHTA 3JALA 1DZQA 1AYN2 3F7VC 4NMIA 2GC2A 3DC5A 2A6YA 4DY5A 5C3RA 1ASJ3 2QQOA 4XZUG 1NH2D 5T55A 1MZ6A 2VU9A 3VDAA 4JTAB 3TNPB 2D6KA 4RD7A 1HWYA 1QOTA 2OA2A 4NRMA 4XFIA 4TUYA 4AGVA 3WF2A 2P17A 5A9GA 4LF9B 1WA6X 4GKYA 1W0KG 2XHBA 4LF7O 4IEPA 4YGDA 1V70A 2WT0A 3AZWA 4L8JA 2ZTNA 2ZBJA 2UWCA 3TEWA 5FNVB 5D21A 1VAMA 3JQWA 5CA0A 4CCOA 4IE4A 2E5LO 1QNYA 4KWLA 4JTCB 4EN6B 1UO9A 4K1ZA 3ETPA 1AJQA 3HKEB 4H13B 5CKNA 5LGTA 3H01A 5IE9A 3ZYHA 5GONB 1US3A 3I5DA 3TN91 2WQ8A 5A3TA 1JX9A 1FNYA 2LS6A 1LTEA 4QX3A 4Y33A 3P5BA 4G9SB 4DRVA 2PQSA 4B4PA 3LEKA 3ZXJA 4ZHNA 2WLHA 5BXXA 1PO23 4JKKA 3BTYA 3E89A 2A3XA 4MGIE 3GCXA 2MHFA 5IAXA 4ZHQA 1NT0A 1XNKA 5IWAB 4KUMA 4AQYO 3JQXA 4LE4A 4XZPA 3WDYA 1FD9A 1UW8A 1AI5A 4I3GA 3UYJA 1FNZA 2YS8A 4QWNA 3RYPA 4JVAA 2HWD3 2K9ZA 1VP7A 3C8XA 3I54A 1RITA 3O1VA 3ZEDA 5DZEA 2P2KA 4WVWA 1UOFA 3THTA 1HRI2 1SMVA 2PXJA 1WA8B 3QO5A 1W39A 4AVCA 4CS4A 3K04A 4X8PA 1N47A 5DPNA 5ANNA 5EIBD 4NR1A 3T2OA 5JVDB 5T54A 3JD73 3CCSV 2QKAA 1RM1C 3GBWA 2Q67A 5IVCA 4YM0A 4O65A 5JCTA 5KUMA 4N7UA 4LJHA 3WP5A 1S55A 1GP6A 2XKPA 2JE9A 1WW4A 1JHJA 4NWVA 1UIJA 2FBEA 1LJ7A 2A9HA 3V0AB 5B1AC 4GX0A 1HR0B 1YFUA 3I2KA 1GLHA 1G9BA 5CG9A 1Q86W 4AEMA 1R1A1 4K8RB 2ZGMA 4CCNA 2P22C 1HW5A 1B04A 1EAH2 3WNOA 2ZR2A 5FY9A 3M7MX 3AB0A 1RJ7A 2HR3A 4ZBMA 2B42B 1W2OA 1Q8QA 1AJPA 5EIYB 3KD4A 4OULA 3KSCA 1PVXA 4XE9A 3LDRA 3ZMUA 1ORQC 1MR5A 4FPEA 3N35A 4MGTA 5L9BA 1HB4A 3JD72 5AFEA 4AGGA 1NS1A 3PURA 1R3LC 2WINB 1BQPA 3GHNA 1NVPB 4EZ4A 2F4VO 2X10A 1WCQA 2GMMA 1XHZA 3A0KA 3JALB 5LGUA 1JOJA 5LHGA 2B5HA 3LKJA 3CCQV 4MGKE 2A75A 1SQXH 4CVUA 1ULFA 4AR2A 5LA6A 3HN1A 5CZKA 3OG2A 3VHRA 2GP5A 3KQRA 5IT9N 3TOJA 3B09A 4UFLA 1UY0A 5LY2A 1QGLA 1O9HA 4XDQA 1AR91 4LLOA 1IBLO 1ZX5A 4KP4A 2DYRB 3I3QA 2IUWA 1GOGA 2D7FA 2E32A 1IXBA 4KHPO 2A5ZA 1QJX2 1XYPA 3PDQA 4MUVA 2JD9A 4G4FA 1Q3EA 1H9WA 4LOSA 1LEMA 1W6OB 3U37A 3TBDA 5H9QA 1TMF1 4ASLA 1XMOO 1ZUQA 1AYM1 1NLRA 5FMOS 2ES3A 5FZ0A 3OGIB 5CVRA 2YG0A 4NOTA 1DYPA 5C6CA 5I8YA 4XHBA 1NZ6A 4X1KB 2JG8C 1TGOA 3LE0A 3INAA 4I0WB 4DR6O 4MT8A 1UOJA 5JQGB 4CA9A 1FXKA 5FPXA 2H6CA 3W7WA 2KG7A 3LEGA 2J1EA 3K59A 4Z82A 2ZR3A 4M00A 3MIBA 3SNMA 2ID4A 4K21A 3ABKB 1PIV3 2Q8CA 1DK1A 1KS5A 2XOMA 2ATKC 4JI3O 5CA1A 3CHXA 2UXCO 1RUD2 1K5JA 4AFBA 5HV0A 3ZHRA 2OX0A 2UU9B 3E2EA 4LO4B 2W1WA 5BNOB 2JJ1G 1SLIA 2QWPB 2YSUB 1H8VA 3RZLA 4YW1A 5JVVA 2EJ7A 4UWDA 1NKDA 3C3VA 4E2GA 1M93A 2Y26A 3V0BB 5L7OC 2VTXA 3JAKA 4FXGB 3E5XA 3IT8A 1OCZB 3T1LA 3IPVB 4X89A 1HW7A 5FZBA 2J22A 1H1AA 3THCA 1MZEA 1VBC3 2PHDA 1AI7A 1LHOA 5EBWC 1RUOA 4LFCO 1ZLZA 2IXCA 3GZUC 2CGNA 1MMMA 3C3SA 3MIFA 4TLGA 3K46A 3KT7A 3NAPC 1VBD1 1B35B 3ZN1A 1MNGA 4GIQA 1WP8A 3B9CA 2GN7A 4F7ZA 5H2FZ 1RUD1 4K8ZA 4DXTA 3EO6A 5IUQA 3SXWA 3FWEA 3WG7C 1QQCA 5HCBA 3B2EE 3DXRA 4HNAA 5A7SA 3EB7A 4Q0UA 5JH7B 4B1LA 1CIYA 4Y4RA 3DXUA 3JCUZ 4LF8O 2VCCA 3IFXA 2XJTA 3J7NA 4DV6B 2F6BA 4IEVA 5BNQA 5FMCA 3IDEA 3ZYFA 2FYUH 2CY6A 4NTYA 3ZMOA 1N1SA 5ACA1 4DR7O 4DR3B 2P7TC 2VE1A 1WZXA 2A3QA 4PDWB 5LHHA 2V4AA 3L70H 3HT1A 1NR7A 4QGLA 2D6LX 1Y76B 5BXZA 5BY5A 2VMHA 1YLLA 5C71A 4RS5B 1VQ6V 5F7UA 5FYSA 2A6WA 1WNSA 5FY4A 4RUEA 5CFCA 4JGZA 3H8UA 4XCAA 4XTMA 1K9MW 3WG7B 3RZMA 1PK6A 3H9VA 2NNUA 1CZTA 2DW4A 4H0LB 2HKXA 3AG7A 5I8SA 2IU0A 4GX2A 1XREA 1TME2 2RJLA 1G9CA 5ABJC 1DG6A 3POGA 5FLIA 1DF0A 2XB6C 4FI9A 1WB7A 1AUYA 4X6RB 4CP9A 1CN1A 1KP3A 5FQ0A 2WQZC 3HKEA 3ZHUA 3PJYA 3TN93 2XJRA 4CH4A 4ZI7B 3CEIA 3RYFB 3TYJA 1QEXA 1FATA 3A0HZ 1ZA7A 5I0SA 5GKAC 1XU2A 1AJOA 4XW3A 5GLVA 5LWBA 3OEEG 2DDUA 2QNKA 2PLV3 3A4UA 3WB0A 4FFKA 1YO8A 4CTEA 5C9AC 1Q43A 2CTPA 2H6BA 2PF4E 1ZBA3 5E8AA 2WZR1 2AREA 1TE1B 2ENRA 2ZE5A 2VQFO 4TZDA 2XBO1 2DWRA 4LR3A 1BQZA 2SLIA 3WUDA 5EYPB 3VBOA 1N1TA 2Q7GA 3ZO0B 2XLAA 4FM1A 5J7MA 4NHYA 3VKNA 2DE0X 4J6GA 2YC0A 1PHMA 4FAGA 1F4HA 3VKMA 2XL7A 4DV3O 3P1IA 4EYUA 3CB2A 1RUC3 2CK3G 4KL1A 3OY8B 1F2NA 1G8WA 1N0NA 3VHOA 1ZSPA 2DTYA 5C9AB 5ERLA 5KHHA 3GBGA 4R50A 2DCKA 3WT3A 3VBRC 4QIWF 4NXNO 3I59A 1CR7A 5A7OA 2JG8B 2UU8A 2XBO3 2ZAAA 1NI8A 2WLKA 1VALA 2VZRA 2YI8A 1Z2GA 4IE6A 5JMOA 2F1MA 1GNZA 3APOA 5K0UB 1FV2A 2JE7A 5APAA 4WVMA 4B3RB 4UB6Z 2Y6LA 3JAKB 5FZ6A 2JDZA 1K8AW 3L73H 4PI0A 4X20A 4H44B 1JOPA 5IJ9A 3ME2A 2RV9A 4WFGA 2XOKG 1DGRN 4SLIA 5I0DA 2Z3YA 3GJBA 1OI6A 3NJXA 4FPJA 3OR6C 3V65A 2JECA 2CTVA 1YYNA 3AK1A 1EM1A 1QLEB 2ZGOA 3VBSA 4NIDA 2JIJA 2XJUA 1HR0O 3PIJA 2GAUA 3CZJA 1JYNA 4K0KB 1T5EA 2XHKA 5IYDO 4B8EA 2QKCA 4OQ8A 1VRH2 3JB8A 1GM8A 1LHVA 1GUIA 2QCSB 5L9VA 4CEWC 2QZ2A 3UT0A 2WFF2 1BBT1 1RUF1 4CDQA 5FYCA 4KWUA 3HVDA 1EY2A 2PI5A 3URFA 3Q8EA 4CDXA 2RDRA 5DUWA 4R7CA 2Y34A 3JBG1 1OUXA 1JZ8A 3W7SA 4JCKA 3FMGA 2YBSA 3I2HA 3RG0A 3JAMN 4BR6A 1QR9A 1NX9A 1VP6A 1CONA 2OQ6A 3LOBA 4JYYA 4DR5B 1SETA 2E7TA 3R4UA 5DAQA 3TXSA 3VV1A 4P9JA 4IV1B 4IGGA 4KH9A 2V73A 4WF9V 1H2GA 5IK7A 1DFQA 5IYBO 5FOJB 3J7LA 1TAEA 2W52A 3LA7A 3MD0A 5BY1A 1K34A 4JV5O 4BK5A 5A33B 4MG2A 2O8QA 4FTSA 2RMU1 2GALA 3IAYA 3T3YA 4P9GA 3SKJE 2YU2A 2R9RB 3P3NA 3GALA 1CXZB 1W2BU 2NPIA 3ZFGC 3IBMA 2FMLA 1QU7A 3EQEA 5B4NA 5GLZA 4G2KA 4MTOA 4TN7A 5BUVA 4RHV2 3CS5A 4CUBA 4Q4W2 5GALA 4XHXA 5HFMA 1EN4A 2LW7A 5CIRA 2BTQB 4ABMA 3LFIA 4DNYA 4XILA 1RFYA 3JATB 3L75H 1RMU1 2EXIA 2JICA 3J80N 4E4DX 3KV4A 4JC1A 3RDIA 1X8MA 2ETEA 4YRDA 5DAVA 4OCTA 3H8OA 3T4VA 4QX5A 4LBEC 2CWSA 3W59A 2VZVA 1AL0G 4ZZ8A 3VBUC 4KWKA 2L6LA 4FCAA 3ZOIA 4Z2WA 1YTFD 5B3SC 1F5FA 1SZTA 2BWAA 4B1MA 4ISRA 3C90A 3E1F1 3VOUA 2ZGUA 2QDNA 2IJKA 3DPRC 4I09A 3CD6V 1R6TA 1UCXA 5FLXN 1PNKA 3WG2A 5D2AA 4QB6A 3JD71 4D69A 4P08A 2IXLA 4PDVA 1GZWA 3I49A 3FB6C 3UGGA 1G4YB 3AJZA 2HH9A 4ZZ5A 3N36A 3K58A 1AL23 3J7HA 3S30A 3ZMVA 2JG9B 4IERA 2CDPA 2P6CA 4AXOA 4RL7A 1RB8G 1XOYA 1YF2A 3VD4A 4J1WA 1QXPA 3AZYA 4ISQA 1YI7A 2TEPA 3JAWA 1VMFA 2YU1A 2O14A 1OKOA 1LOFA 1A34A 1R1A2 4IE7A 3ROUA 5A3UA 3E35A 3U14A 2WAAA 2HEPA 4XFCA 3IGAC 3N9PA 2G9ZA 4YM2A 1HB2A 2IXIA 1V6IA 4IGQA 2QM7A 3LCPA 1FPOA 2QJVA 4XQDA 3U10A 3NJZA 5FO8B 5CFCB 2XBO2 5CKMA 1A6CA 2X8KA 4X1YA 4YVWC 5JOWA 3KZIZ 1K3IA 2JJ6A 4PLOA 4A5UB 1D7PM 4X65B 1LRHA 1AR71 1JYWA 3HIFA 4UV8A 4YM1A 2DWDC 3M8LA 2ZDIA 3ZSJA 3F95A 4XDOA 1OVPA 3AFGA 3BFRA 1GMMA 3WD5A 3VBFB 3RW0A 2WLNA 2Y6FA 3CC4V 3N7MA 4N7IA 3B7MA 1LOEA 4LHNA 5DXDA 3KG2A 3WNLA 2R062 3E22B 3AL6A 4XACA 2GNTA 1ZX3A 2YIBA 4CUGA 1VQPV 1XI1A 4GXLA 2Q6AA 1WW5A 3K79A 1U5IA 2W92A 3FHAA 4IT5A 3CDZB 1F51A 3VQWA 5HXMA 3SPCA 2ZEXA 4DUYB 1X7NA 5H6RA 2PI4A 1W9SA 4UBGA 3RNSA 4DO2A 1LOGA 4I30A 5J96B 3EMRA 3DF0A 3RYFA 4RUFA 3CO2A 5FWEA 2YUEA 2ZMNA 2RVAA 4YJ3A 4MXVA 4XMIA 5FXVA 1OSGA 1LCLA 4O4IA 1SQPH 1ZWIC 1W8HA 4HSLA 3BIEA 3IJ4A 2IJIA 1YQ5A 1Q5OA 4SBVA 1CVNA 2A71A 5LMNO 1UXXX 3N9MA 2O8OA 3ZFEC 1GP5A 5GZGA 1AR5A 1YJKA 2ARAA 2YEVB 1LKNA 2UXDO 4IV3B 2AHYA 5EYPA 4ZKTB 4HETA 4HZ3A 1TNRA 2XMLA 4FM2A 1VQ9V 1NOVA 4JRAA 1NY71 2LW8A 2DU1A 4XJ8A 3WXPA 3BUCA 1TQ5A 3Q8AA 1TEIA 3U0ZA 1VBD2 2JDHA 4RQPB 2YICA 5JZGC 2CE4A 2VCAA 1VLNA 3J9SA 1OMIA 2ODMA 4R8CA 4DV5B 4CSWA 3WDWA 2PHWA 2ITDC 2ZE6A 1XDCA 3A0RA 3CEWA 5F5QA 2DVGA 3WHUA 2QKDA 3H0OA 1QDCA 1Z0HA 3AMMA 3VBRB 4DK1A 4AI1A 2N74A 3ZDVA 2P06A 2W1SA 3ZPYA 2WNVC 4X65O 4PIYA 3K4AA 3N2GB 2AEZA 3NV1A 5H9RA 4D6QA 1G9AA 4UV9A 2G9GA 4CDUA 5FO9B 1AL22 3RVYA 3LIHA 4Y20A 1BBT2 2BP6A 4N53C 1UQXA 4WM8C 3ZFFA 4HPKB 5FYTA 5L3CA 4MGZE 2NR5A 2VOVA 2VQTA 3VDBA 3SQOA 3KCXA 1OURA 1K12A 3M1HA 1WCKA 3ZYRA 5FRAA 1R1A3 4DUWA 4QQPA 4UB8Z 4P30A 2P34A 5JOYA 2WNUA 2DCJA 3TAYA 1GQGA 4NYKA 4JI8B 4ATFA 1HX6A 1KJLA 2VZSA 3TXQA 3NJYA 1M06G 2BW8A 1KFUL 4COYA 2PHFA 1MG1A 4LIVA 4FVVA 3OBAA 1BMV1 4I4TA 1UOBA 4WM7C 4X1KA 4X1YB 2NP0A 2GV9A 2ZE7A 2HEWF 1ND3B 4DFSA 2DUPA 1XL4A 1H6XA 5JZGB 3K06A 3OT7A 1N3PA 3GWOA 3AP9A 4CU6A 2OIEA 1XPWA 4FPLA 1JYCA 1W0OA 1UL9A 2VVEA 1SZXA 4JTDB 1RUC2 2A73B 5FZ8A 3ILNA 1N8RW 5K8SA 2WA3A 4EWAA 2VNOA 5A3OA 1B35C 5FR3A 3MF9A 2QQLA 1JU3A 2WUHA 4CU7A 4JYBA 3BU0A 3AMPA 5DUUA 3I4IA 3SJCC 1ZAUA 1Y9QA 4ZU4A 3FN9A 1LEDA 2MNGA 5JQGA 1XC6A 3F7YC 4QE7A 4UVCA 1CAXB 4M3CB 1U5YA 2HBTA 3UESA 4Y5SA 3ZX6A 3CC7V 4U3JB 2ZGTA 2EILC 1GM7A 1WLWA 1NA1C 4KXRA 1MEC2 4PDLA 4XFFA 5M0TA 2BWCA 2VQ0A 5HPOA 1VB2A 3N2KB 3FHQA 3C7GA 2ORXA 4AAXA 2D98A 2FMYA 2WZR2 2VOTA 5FP8A 2QA4V 4R9AA 4NIAA 4BHPA 4B3NA 5FPOA 4INDA 1SLBA 5C4WB 5L3DA 5L9RA 1BHAA 2W68A 4JDNA 4ES9A 4Q4X1 3VHPA 2VUJA 4OQ9A 1BSMA 3BEHA 5H9SA 4IGPA 4XQ4A 1AX1A 2H0BA 1P8JA 1E5HA 3JB4C 3ELNA 3MUY1 1ZL8B 3FL7A 3TNQA 1WCDJ 4AHYA 5K0UA 1AX0A 3J81N 5JIAA 1JHNA 4XF0A 1KQSU 4LT5A 1N1VA 3SH4A 3ZR5A 2QQMA 3N9NA 2EBOA 3JCZA 2KSDA 2GNMA 4AHXA 2RNBA 5FY7A 2E74B 1VBD3 1L7QA 2QJ1A 2LROA 3RQ0A 1RMU2 2FCVA 5EJZB 4EFEA 4HZFA 3UT5A 2VG9A 5E89A 1JZ5A 1YZBA 5A1AA 4JYAO 5JPNB 4XJAA 1VBC1 2GUZA 3OF1A 1FPN1 4M4PA 3X29B 5B1BC 4DV5O 1K5SA 5BYNA 4Q4W1 4FFFA 1VBE2 4CUCA 2ZX0A 1EV11 3H3ZA 4Y3OA 1EPWA 1O3RA 5L3EA 4Q4Y3 1NXMA 1BVP1 4ASUG 4NIIA 4RR3C 4FPOB 2VBDA 2WABA 3ZXAC 3CCJV 4YW6A 4FLYA 1JW6A 4L2NA 1JH5A 3MAQA 1GFF2 4TWKA 3BAAA 2HYKA 1SA0B 5FZHA 4BXSV 2PLV1 2K2SA 3ZSMA 5D5PA 1I08A 5EBMC 4DIQA 3ZS8C 1YJLA 3IMNA 2OUJA 2HWF2 2DJVA 3AG2B 2IU3A 3ZIWA 3SPGA 1UPGA 3ZMSA 4AHWA 4B7EA 4NIGA 1S1AA 1UX6A 1UY3A 1MS9A 3IAPA 5JJEB 1UD1A 2EZOA 4B3MO 1VMGA 1AXYA 2GSYA 4DR7B 3VLBB 4H2AA 4D94A 3VDDC 3LOIA 3CZUA 4Y1ZA 1N33O 2WPDG 1HRV3 4G3YC 1IZ3A 3ZBHA 2QZ3A 2RM21 1NR1A 1QNMA 3POWA 4NAOA 1JZ4A 3ZFGB 1LHWA 4LF7B 2OKXA 1V9U3 2RS32 4YIPA 4X62O 5GZFA 4KFMA 1VQ4V 5GONA 2ARHA 2RE9A 4N43C 4AFDA 2R071 4QPGA 4NWWA 5KAIZ 2WJSA 4QKBA 3CJHA 1UN1A 1UU5A 3UKMA 1V0AA 2OT7A 3WW1A 5FYBA 4KBZA 4FFIA 2C24A 2ZXWB 4AEDA 1QR8A 5FZDA 1NCRA 1F15A 3CRRA 5FCCA 4XUNA 1HJGA 5GZDA 5EQUA 1G8MA 3R66A 5A7NA 2OIIA 3AG3B 3OGJA 1JMUB 2XVLA 3OUIA 1Y4MA 1COWG 4C8DA 1SF9A 4NROA 1YXWA 4YVWB 5CEHA 5F1RA 4DRXA 3RWRD 1W8FA 2DN9A 2VNRA 2D2CB 3L72H 5IY5B 4QU2A 4FTEA 2VTFA 4F4LA 4K40A 1XNQO 2PAKA 4IL7A 1KXGA 2ZKNA 4ZS2A 3B8NA 1ZBE3 3MDSA 4FLUA 3U11A 3BCCH 1SLAA 2PTMA 1SRYA 1R081 2X05A 1O5UA 3OYWA 1AJKA 3ZFFC 4IV1C 4YY3B 1MS0A 1Z7S1 4ZXKA 2FDFA 2C4XA 1IBMO 1OHHG 3UJQA 5CFDC 2QDOA 3ZRWB 3E8HA 4U7OA 5IK8A 1M1KW 2V09A 4JZRA 4IHJA 2ZHKA 1MA1A 1GTOA 4N23A 1VBE3 2GDSA 1QDOA 1AI4A 1PVC3 1SQFA 1WBLA 5JDBA 3ZXEA 3J7MA 3O65A 4RFRB 1K3EA 2OVUA 4QGPA 4DEVA 5KXEA 2Y69B 2AC1A 1Z5VA 4IEWA 2WFF3 3UM7A 3I3EA 1DU3D 4PLMA 3CBNA 1XYOA 2HLEA 3M3EA 4GMP1 2FKXA 4XFBA 5LHIA 4DR2B 3JYCA 5F3GA 4LBJA 2ZGQA 4CH6A 3FJSA 2TBVA 4DV2O 2EJRA 2FDKA 1AR82 2W46A 1RYYA 4Y20B 2RR11 2EXHA 3AL5A 1ULOA 5A6XA 5DECA 2O0OA 4YXWG 1BMFG 3UL2A 3D8CA 4JKMA 2VWKA 4MX3A 5IYYA 1YTFB 4LFAO 1PPJH 4V2VA 2JDMA 3DYOA 5FIXA 4HKLA 3NNMA 3ST7A 1OLME 1H2MA 2RS33 2VZ1A 2UWBA 1XQNA 3BGAA 1ZZBA 4NRQA 4AEDC 4DOUA 3FD9A 1Y66A 3VL8A 3LD8A 5LASA 1WKYA 4C7UA 1SC5B 3UKVA 4O61A 4L87A 1IBMB 1IBLB 1E1RG 4N43A 2L35A 4HK9A 2HJIA 2HEVF 5A7QA 1W2UA 5LMUB 1AR61 2RMKB 3QTCA 1AXKA 5ACA2 1D0GA 1CAXA 2RG4A 3HMYA 4OX9B 2YIAA 2VZPA 3KCYA 1O4ZA 4HVRA 3VB9A 1GYKA 3HKBB 5A6ZA 5CFDA 1PKXA 3H1YA 3H7JA 1SFYA 4IV1A 4AWDA 3CQOA 1SERA 1VQOV 1V6MA 2ITCC 1W06A 4QX1A 2OTLV 2VNGA 1EN5A 3NR7A 3LQCA 2GH8A 2V4DA 5FMDA 4X64O 3Q8FA 3B9IA 4LPLA 3ZFEB 2AENA 1JPXA 2P3JA 4COUA 3RMYA 4MGQA 2E63A 3GYDA 3FUOA 2XTAA 2X0LA 2ZDIC 1JYTA 3HT2A 1MS4A 3AM2A 1ZZ6A 5I0TA 2DUOA 1FXVA 4CEWB 1UFIA 2PYLA 4C91A 3BB6A 1GN6A 4QQHA 4YSFA 2A06H 1AR83 2E53A 2W08A 3R65A 3T30A 5LMUO 2WLLA 2HJFC 1C8M1 2UUBB 3SYCA 3I3DA 1BS3A 3G6JB 4QE9A 3HPLC 3FE5A 4CXXA 2AUYA 1V54B 4PJYA 4AW7A 4F6RB 1OVSA 2KQXA 1SS3A 3I56V 3LAGA 4R8HA 4U36A 1KKCA 3ZJZA 1WCUA 4O7XA 3RYHA 1C28A 1NLQA 3RT3C 3LPFA 1WLDA 2B39A 4QPGC 3NSTA 4A42A 3LDKA 5DDJ3 3ACLA 2EA7A 3J4UH 2CTQA 4XUPA 3HKDA 1W6PA 4EN9B 4JGYC 2ADDA 1AROP 4LO7A 2LFSA 1AR62 3AP6A 3AZXA 1U0AA 1HXS1 2BOIA 4Q1PA 2WRAA 5CBFA 2GC3A 3DPRA 3GJAA 3K9SA 4X64B 4X8AA 3WQBA 4XXAA 4LORA 5IJ0A 4LKSA 2RMU3 3POBA 3AXDA 2VS0A 5IK4A 1HDKA 1XHXA 5EYYA 5HI0A 1FJGO 1SA0A 3J8F1 2VMIA 3ACHA 1J3QA 1BHBA 4YGEA 4N8MA 4JGYA 2EIGA 4LBQD 4DV1B 1MS5A 1XMOB 1OF4A 2VZOA 2ZD9A 5IATA 3THDA 1ZRCA 1NU1H 4NHKA 4J9YB 2EULA 1JTZX 2F43G 2ZXQA 2WNVB 4RR3A 3T1MA 2EIJC 4OGQB 1Q6IA 4K3AA 4JHZA 1Y3TA 1AR63 5HBAA 1AR92 5A6QA 1XMQB 2JXAA 5KHJA 4YJ3B 2K9PA 4D0QA 2X6CA 5IYZB 1QJZA 5BR8B 3D0JA 4DINB 1H1MA 4TSFG 3AVSA 1AL21 1CAWB 1PM4A 2VBBA 3ZFGA 4JI4B 4QMAA 4OPHA 4KG8A 5EIBC 1NCRB 4O9EA 2JGDB 1CP9A 4ZONA 3AKRA 3KHBA 4XDPA 2KA3A 2D44A 5FZFA 1H8HG 4JASA 4DR6B 3CRAA 1YITV 2HWF1 1HJFA 4S2DA 1CAVB 3ATGA 1VQ8V 3BVCA 2WA4A 5T5PA 2UXDB 1APNA 1J59A 3KF3A 4IYIA 4FLXA 1DDLA 4WV8A 1J84A 2RN9A 3KKYA 5JOZA 2IM9A 5ITZA 5IFTA 2OCCC 1WD3A 3RI8A 4IL6Z 3VZMA 5A7WB 1M4UA 4CDXC 4N53A 4OVEA 5AVPA 4QGNA 4NRPA 3FFQA 4B08A 5IFPA 3NKTA 4CDUC 4QPJA 4DR4O 1H9PA 1KS4A 4JAVA 4FOQA 1NA1A 4A4AA 4X62B 1RJ8A 4KQ7A 1W04A 4GB33 4CEWA 3Q4HA 4OHXA 1JCHA 1VIWB 5F5CA 4COWA 1OKQA 1J3PA 3ACIA 1Y9MA 5CADA 3OD4A 1SBDA 3NXSA 3LZZA 2HWE1 1RUJ2 1YCIA 2IFWA 5FZMA 2IJHA 3VBSC 1F4NA 3IN9A 3AP7A 4KHPB 4CXYA 4YJ2B 1ZA4A 1T6BX 1YQ6A 2F4PA 1B35A 5FZEA 2OUHA 2QM8A 4Q4X2 2B9ZA 1XNRB 3R05A 4EKWA 4BOWA 3CE2A 2ADEA 4R9CA 2A3YA 1US6A 3WFVA 3H1KH 4YGBA 4CDWB 2IXKA 4JI7B 5K4LA 2VULA 3VZNA 3B94A 3U4XA 4A44A 2ZZJA 4J42A 4CBCA 2VQUA 2BUKA 5LBFA 3AX4A 3POYA 3MUZ1 2WO7A 4WM7A 4QB2A 2YIBD 4RGAA 4BQXA 3KV9A 1AF9A 2YXYA 3QH6A 3PLQA 4LHSA 2BRTA 4YHHO 2F23A 4OI1A 4Q4V3 1OH3A 1X50A 2R70A 1Y74A 1RUJ3 2WNUC 4ZU7A 2AYHA 4CEYB 3N7LA 4A6SA 5FUIA 4CDUB 4YW3A 4MVMA 5AVAA 4ASKA 2FTKA 2HHHO 1L0LH 3HWJA 2BU9A 1H30A 1SEFA 2G19A 4FPCA 4QX0A 4DR2O 2DCTA 3PIGA 2BNOA 1VQ5V 3FX3A 2PMWB 2OTJV 4N43B 4LF8B 1OD5A 3ZSKA 4MVOA 3R4DB 1R1ZA 1HRV2 3ZDSA 1N36B 3M2MA 2WNVA 1FMD3 4UW3A 4HN0A 1PGSA 3HPNA 4O2AA 2UUAB 4JI6B 1LULA 1XE7A 2G1MA 2WLMA 1S0VA 3PUAA 4FQZA 1I3HA 3S3XA 2OXBA 5HV4A 1WMDA 1O9GA 2JKXA 3WW4A 3U4SA 4D6SA 4P5YA 5CAZA 3NNFA 2VL4A 2ZX3A 3SPJA 3VGIA 2VQFB 3FAVB 5KUKA 2NMNA 2QKSA 3SCFA 2CL2A 4PELA 1UPIA 3IDAA 3M70A 4TV9A 3A22A 2ZEWA 2W0XA 4XUQA 3IC9A 4MHRA 3IMMA 4TQDA 1QJU2 4W50A 5IT6A 4OUSA 3TEYA 1X9TA 1S0DA 2VZUA 3MW4A 3WNNA 3WHTA 3FFZA 2FL4A 4YG0A 2Z2SB 2E9QA 2UWAA 4XF4A 5KA5A 4BIZA 4LBQA 2AHZA 2W91A 1JJ2U 1VRH1 5K1PA 5D8AB 5JSOA 2UYAA 4YVWA 2HHHB 5F5IA 4P2ZA 5I0UA 2P90A 1BXHA 4IXLA 2OCCB 4P00B 3CWBH 3B00A 5I93A 2E7QA 2XJVA 5FP9A 3OGGA 4C90A 1VPHA 1XNCA 4NUBA 5C3PA 4ZHQB 1D4M2 3WDVA 2R1BA 3VBBA 1EUUA 2P3KA 1PGW2 4FFBA 3SEPA 1LOFC 1NCRC 2XXZA 2WYFA 4PQ9A 4DV3B 1BEV1 2ZEZA 2HFEC 3BCWA 3HB3B 4DUZB 2ORZA 2MEV2 2GUZB 1GR3A 2PY5A 4CCLA 1GU3A 5I8TA 3ZRWA 3AZZA 3B02A 1UXZA 3APBA 2J1RA 4IHJB 2XVKA 1O5LA 2Q30A 3V0AA 5GM0A 4IGOA 5FTTC 3FLTA 4MO3M 1QJY3 2IH3C 3F5WC 1V6LA 1R1BA 1ENQA 4Q4Y2 4HK8A 3ZYPA 3BTAA 2D6PA 2HWB3 2DYCA 1I1EA 5LK7B 4QGMA 2GZWA 2B1GA 4XUOA 5ABJB 1GZWB 1PX4A 1F8VA 4C0HA 1SHWB 1COV1 3H8XA 3VDDA 1GANA 2C9AA 2VW2A 3M3OA 1OQDA 4MXWA 3M8AA 1GWMA 2X5IB 5J3UA 1AB3A 3HAGA 4IETA 1XBLA 2VQEO 3OM3B 5FP7A 1WPXA 2R9AA 1R73A 1DGLA 3HBKA 3PVOA 5T52A 2JDAA 4JHTA 4GKXA 4IEQA 4LC1A 4LBKA 5T3NA 1IHMA 3ZM8A 1XOUA 5LEJA 3LA2A 5J98B 5BNPB 2F66C 2J42A 2M7WA 3CJHB 4FJCC 5BPXA 1BYHA 2CHHA 1FMD2 1W9WA 5EYXA 1S0EA 1RUG3 2Y69C 4JI5B 3DXTA 3K77A 3RBZA 2LM3A 2QM4A 1TUEB 4UUJC 4CU8A 2PHXA 3J7AU 3WP6A 4BWOA 2A6XA 4DQAA 4TSVA 1ZBA1 2XH6A 2Y6JA 1LESA 1YC61 5K0UC 1RUI3 2WBKA 1RC6A 1G1XB 1Q8OA 4P9WA 1LODA 1MOFA 3MV11 4P9XA 3AYAA 3O5SA 2ZIOA 2EIKC 1EV12 3AG1C 1TG7A 5G04L 1EBOA 2IXHA 3RYCA 1FPN2 1L3JA 2FDGA 4DR5O 4XF1A 2K0GA 3AKTA 1KBHA 2ZHNA 4JI8O 2ZKOA 1IQAA 3CRMA 1KYOF 5BR8O 1LAJA 2WZPP 3GCWA 2LO1A 3WDTA 3BVOA 2YZ4A 2JJ2G 4LFCB 1W6MB 1HIXA 1QOSA 4XETA 4YARA 3P6BA 4A7YA 1JN2P 2QTOA 3JARB 5H5NA 2Y48A 4Y24A 2V1DA 3GZAA 5J2TB 3LSUA 3FYEB 1N3QA 3SR2C 3N9OA 4NHXA 3ALQA 2UXCB 1OA3A 4N90A 1IGOA 4UBHA 3MZHA 1PZ8A 5EJ1B 4DUVA 1PVC1 4RGKA 3ACFA 3VL9A 4UFHA 3KHCA 1W9TA 4W4LA 5L3GA 4JX0A 4HNAB 3RVZA 4KWJA 4CE8A 2QDRA 1CPYA 2CAZC 1QIQA 3ZXLA 5KMGA 1WJZA 3G6EV 3PU3A 4HOOA 2QQIA 3OUFA 3HJRA 3ZXKA 4Q6GA 3CJXA 3KVAA 1THZA 4HXCA 1SKVA 3K3OA 2HWB2 5L36A 3VBRA 1RSOA 3WW2A 2EIBA 2KKWA 5CBGA 1D2SA 2XAHA 3N27A 4B7KA 2Q8EA 1BK1A 4GMP0 2H3OA 3SJBC 4CS3A 3FHIB 5F3EA 4W4KA 4GKKB 4JI5O 3AZVA 3AYEA 1BCXA 1POV3 1LGNA 1OQ1A 4DV4O 3AKSA 3UO2A 1WLEA 4BIOA 2A6ZA 2P1BA 4QQOA 3ZYGA 4DXSA 3VBOC 4WM8A 1TME1 3ABMB 1FI2A 1P49A 4GJZA 1KU9A 5FPLA 3B93A 4Q2FA 5EFUA 1FS0G 2MPFA 1AR72 4TUYB 2F93B 4DV6O 3JZVA 2X53S 3DXRB 2PGGA 4BLJA 4M0NA 2E76B 3K4ZA 4W6XA 4A41A 1B6QA 3C7OA 5B4XA 1QH7A 4WVVA 1CAUB 2JEMA 3OEAA 5I0RA 3OD0A 1Q8IA 5DN6G 1BMV2 1F4MA 5GTIZ 1NT2B 3LF7A 4O2AB 5DEDA 1QBZA 3JD1A 1S5HC 1UNBA 4QM9A 4XJ9A 3D4KA 3B69A 2QUOA 1SPPA 3D0SA 4O4LB 5J36A 1GN3A 1HQLA 5JZGA 3QACA 4QDQA 1WLCA 1PM9A 1IDSA 4LH6A 3GHMA 1NCQB 3T1YO 1IPKA 1LOCA 4K1YA 1YJ9V 4YGCA 3OCPA 3CCVV 3I2DA 5HFLA 3ZYJB 3OPZA 4PDRA 5A1LA 4RHV3 2DBNA 2BOJA 3NJVA 1I9RA 3KGZA 4BMBA 2R041 3MPPG 1PK6C 2JB8A 5DDJ1 5A70A 5AFBA 1XXNA 3N9QA 4AQTA 2PHRA 1PIV2 5IJRA 2IH1C 1PMHX 3ZFEA 4AGRA 4LNUB 4RQFA 3WY6A 3AG3C 4FLTA 1TVGA 5LYJB 4EQVA 2P37A 4AEKA 5KA6A 3OB8A 4DV7O 2VMCA 3S5AA 4CH5A 4F6RA 1HNXO 2JEXA 3N2KA 3D6EA 2Q0OC 1PO12 1IXMA 4NHLA 5JLVA 2W87A 1RHI2 3BTXA 1X4TA 5EBLC 3W58A 2QEXV 1MSWD 3NMBA 3ABLB 2WZEA 3N7KA 5FMBA 2WSVA 3QD6A 3L71H 1QU0A 4FIPC 3ZN4A 3S5QA 1G6NA 4BU2A 4RO2A 2UXBO 4JI0O 2AZ0A 1YNAA 1VMHA 3BOPA 1SFPA 2D3OW 5CNAA 2NN4A 2HWD1 1EAH1 3E83A 4E9KA 3T08A 1V6KA 1CJDA 3DKWA 3A0NA 3FBYA 1F35A 4E2SA 2BZDA 4CS2A 3GWKC 1D0HA 4IW3A 3CLPA 3T4DA 1W2TA 4Y5Z0 4ZPIA 1W8TA 4P9OA 2YB7A 3C7FA 2FDIA 2EINC 4OFGA 2FDHA 4O4HA 1RUC1 4HN1A 4X66O 1LB2A 3Q8CA 4P9PA 4CPBD 1ZZ9A 1H1IA 5KX5A 5IJ9B 4LFBO 5HCAA 4GD4A 3AG2C 4UW5A 5ABJA 1VE0A 1EAH3 3OR7C 3ZRSA 4WM7B 2WWSA 2C6SA 1OC1A 1STMA 1BZWA 3LWCA 5A1FA 1AYM3 3WNKA 4YW4A 2ZX2A 1PGW1 3OW2U 4JGZC 5HXVA 1VQMV 1VAKA 1MPXA 1K45A 3VUOA 3UK9A 1H2LA 3GBFA 1GZ9A 5E6HA 2RJ2A 1V55C 2P4KA 4OUEA 4CCCA 3APQA 1ZBA2 1GWKA 3QO7A 3N7JA 3WP3A 2AZ2A 5JI7A 1P4RA 2Y8KA 2B7YA 1WCSA 4LOTA 4A2UA 3VQVA 1GOFA 4PQQA 3WDXA 3HOBA 2PUSA 5BNPA 3AYCA 1POV1 1HB1A 4FAHA 3WNMA 4X66B 1PNGA 2BNNA 3RRDA 3GXUA 1D4M3 5A3PA 2CGPA 3OBTA 5F5AA 4BQWA 2TNFA 3IB3A 3WZ1A 4JYCA 4YVSB 4NXMO 5F37A 1RVF1 2WKKA 2EICA 2YBPA 3AEIA 3FZ3A 2BSKB 1VQ7V 3NAPA 4AG4A 2VAUA 3EXAA 1G6UA 5KR7A 3ASOC 1UWWA 5JI9A 1ASJ2 1FJGB 2LALA 1K5MB 2UXXA 3VZOA 2BFUS 2FDJA 4OPAA 2C1FA 1RUJ1 2KR2A 4MGSA 3K4DA 3SMHA 5KXCA 3VBUA 4ZS3A 5JAXA 5GZCA 3Q9OA 3NW4A 4K9SA 4HVQA 5FV3A 5CA6A 1W05A 2UXBB 5L7OA 1YQ8A 1WLTA 4PA6A 3SYAA 4JDOA 1R093 1H8EG 2WR9A 2ZGNA 4AQSA 3DEMA 2DV9A 4RQEA 1VBC2 3RYIA 2E3CA 4XBFA 1RUE3 3L9DA 5JXIA 4P14A 1J1TA 1VMJA 3RYCB 2IVJA 1W59A 4FTBA 3ON7A 2HWD2 5FZ3A 3ZX7A 4QX7A 1QLEC 2PYTA 3MF6A 1MABG 4AOCA 3FUQA 4FPYA 1IPSA 3IDBB 2JDNA 4NXMB 3KQ4B 3VN4A 2VJXA 5LCWL 2VD7A 1XUQA 1D4M1 2F95B 4KG0A 4TLFA 5CMUA 5DAPA 4LF6O 3WW3A 5DQ0A 4AI3A 3W7XA 4AQ6A 1W8ZA 1IURA 1DQ6A 4BE3A 5DAXA 1HRI1 3OMNB 4GB31 3LSSA 3IZOA 1C8NA 4FSJA 1X82A 3K9AA 3V0BA 3U1XA 2JG8A 4CU9A 2JS5A 5FZOB 1M90W 4TTGA 1DQ2A 2Z0AA 2W5FA 3AMHA 1QJU1 3B8MA 4HMZA 2R061 3CCLV 3BABA 1WA4A 3JSLA 4C1WA 3MPBA 2WWWA 2CH7A 4CYDA 1K4CC 1ENSA 3ZLIA 2ZZQA 4DR4B 4JRLA 3VKLA 3UCSC 4QXCA 2IWGB 2QR4A 1QHDA 1QY4A 3BOWA 1S2EA 1FAYA 2YIDA 2HEYF 4CDQC 4WM8B 3QVNA 3S0MA 3M3CA 2QGNA 2BV4A 5LOVA 1UYZA 5BNOC 1MS1A 1UZWA 4QKFA 3OAAG 1UF2C 1OOPB 1T6GC 3GZTB 4IEZA 3G71V 3VZJA 2LRPA 2Y6GA 1S0BA 3HD8B 1GZCA 4D6RA 1VF6A 4UF0A 1TME3 3S6PA 4FM0A 1CAUA 1O3SA 3ETGA 2VCMA 1IKQA 1L0NH 5LATA 1AVMA 4YHHB 1WMEA 2WT1A 1YHFA 4RA0A 4GWJA 1N33B 1HDJA 1I7FA 3O1OA 2L9LA 4DY3A 4DR1B 2KB1A 1W90A 1SQQH 1G7YA 2WAOA 1D5NA 3CJIB 4CC6A 2OT5A 3KT4A 5FY8A 3MICA 1ASJ1 3AP4A 1NE4A 5LMNB 4EFBA 4UT5A 2EAKA 2IZWA 3U75A 1PD3A 3K0DA 2RR13 5FK7A 5JOXA 4AEDB 4K6BA 5FWJA 2RHPA 2W3JA 1AVBA 3N3HA 3IKWA 3HKCB 2DBIA 3LFMA 3MLJA 1OCCB 4BA6A 4LEJA 5C8CB 4ZI7A 2R072 4FFBB 3UQ8A 1RUNA 1DIWA 3A21A 3TEZA 1QOOA 3WVJA 1A3KA 1DP0A 4H7MA 4YLZA 5F39A 1RVF3 5KBFA 3HR9A 2YXHA 3POEA 1UYPA 4DUYO 3S57A 3W7TA 1AR4A 4YIOA 4IE5A 1AP5A 1W6MA 3E5UA 1FOD2 3K5NA 2C9KA 3K75B 4OLLA 4J1XA 1N36O 1XSRA 3QLQA 1I94B 5BNNB 1ULCA 1XU1A 4TV9B 2BTQA 4Z07A 4LNUA 3JARA 5IY5C 5C9AA 3L2YA 4BYYA 3WQ7A 1S0GA 2B4KA 3I2OA 4GX5A 2V5DA 2XLFA 1GICA 5GZEA 2XJPA 1MQTA 1W6QA 2UUBO 3FC0A 4X9QA 2Q4PA 4WVMB 5FYVA 4O4IB 2R1DA 5TSWA 4NXNB 2Y0OA 2Q5TA 1RGSA 2OPWA 1K42A 2DVDA 2VW0A 5T5JA 5IWAO 5FXWA 3VQYA 4MTFA 3D3QA 1REDA 3N4MA 2XAJA 4HKOA 1QXRA 1F9KA 1PGL2 4LK7A 1OXCA