5KHJA

Hcn2 cnbd in complex with uridine-3', 5'-cyclic monophosphate (cump)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
199
structure length
199
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Cyclic Purine and Pyrimidine Nucleotides Bind to the HCN2 Ion Channel and Variably Promote C-Terminal Domain Interactions and Opening.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 67
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5khjA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5khjA02
2PA7A 3SXWA 3H1YA 4QGNA 5I93A 4TLFA 3CF6E 3KMHA 1O5LA 3KCCA 4J1WA 5C8WA 2I45A 4Q0SA 1LR5A 4AQ2A 2PAMA 3I59A 1YFUA 1ZVFA 3IDCB 4I01A 4HSLA 5BXXA 3U0ZA 4BIFA 2D93A 5HI0A 5J3UA 2H6BA 3ES1A 5JCTA 4XF9A 3MPBA 1RTVA 1UCXA 3LA7A 1Q5OA 1OI6A 5FCCA 1SFNA 3IWZA 3LA2A 5CVRA 2ET1A 5I0UA 1J1LA 2Q30A 1YFYA 4AVCA 1UIJA 3UKVA 3EJKA 3H3UA 2GZWA 5I0RA 3OD0A 1HW5A 2PAKA 4H7LA 2FQPA 1WA4A 3FX3A 2UY8A 4IEOA 4EWEA 1YWKA 4D7TA 2XKOA 2XLAA 3FFQA 3NJZA 4XFAA 4I0BA 4I0AA 4JTOA 1YFXA 2Z69A 4HLTA 5CU1A 2EA7A 2ETEA 5D1IA 5BV6A 4QMAA 4MGKE 1VJ2A 3E97A 2Z2SB 2ZKLA 2KXLA 3ES4A 3D0JA 2H6CA 4HMZA 3ZDSA 1EYBA 4HVOA 3U10A 5I91A 1WLTA 1X8EA 2WFPA 3PLQA 4HN1A 4BHPA 3JZVA 3KGLA 5C6CA 1ZREA 4PIXA 1U12A 5EZWA 3M3IA 2XKPA 3MZHA 1DGRA 4F8AA 3RNSA 2EVXA 4IEUA 4L11A 1ZRDA 4YNIA 1J58A 1QXJA 1X7NA 5FLJA 5CADA 3BU7A 4I09A 1CAUA 3EHKA 4Z07A 5I8YA 1OMIA 3KGZA 5J7MA 5FQ0B 3WW2A 2D5HA 1RL3A 1DZTA 2WC2A 3M70A 2B8MA 2F4PA 4E2GA 3DL3A 3S7EA 4R52A 1UPIA 2PFWA 4F7ZA 4XF3A 4HVRA 3SCFA 2OPKA 2IXJA 3NVCA 1X8MA 1UW8A 1YLLA 4QM9A 1XE8A 2QDRA 1NE4A 3SHRA 4LEJA 5I8SA 4UXAA 5AVPA 3U11A 4JVAA 1OFNA 4ZU5A 4UBHA 1CAWB 4MUVA 3CL1A 3VHRA 3D82A 3FJSA 3KSCA 4PIYA 2IXCA 1Q3EA 4MV2A 4AQ6A 3E6DA 3ELNA 3H7JA 3NL1A 4AVAA 4PJYA 3H1WA 1ZX5A 4Q29A 4X6QB 3TNQA 1SQ4A 4IEYA 2PHLA 4GULA 3MDPA 3ROUA 2ATFA 3DN7A 2K9ZA 2IXLA 1LB2A 5FLHA 3TNPB 4L2NA 3NW4A 4ORFA 2XLGA 4B29A 2VPVA 2PTMA 4WBBA 2Q0AA 1OD5A 1WGPA 1UD1A 1QWRA 4EWAA 1O3QA 3WW3A 2CAVA 5E16A 1RC6A 3LA3A 3C3VA 3H50A 1VR3A 3HQXA 1FI2A 2Q1ZB 2Y0OA 2XGXA 2XHKA 1UIKA 3QOPA 1I5ZA 3FE5A 5JSOA 3GYDA 2O1QA 4CYDA 1RGSA 3E6CC 5JAXA 4XF1A 1O5UA 4KU7A 1Y9QA 2IC1A 4XFHA 2H0VA 4DINB 2VECA 4MZUA 1PMIA 4OLLA 4PIZA 4LLOA 3H3ZA 3UKNA 1CAVB 3EQEA 4KL1A 2BGCA 1V70A 5KHKA 1J3PA 3OCPA 4XFFA 1YFWA 3SCGA 1G6NA 4XFCA 1DZRA 4X6RB 3RPQA 3OTFA 4IESA 4ZU4A 1XRUA 1ZRRA 5FQ0A 4XF0A 3ST7A 4IEQA 4HBNA 1GQGA 5K8SA 2IXHA 4I02A 1ZZ8A 5KHJA 2PQQA 5EFUA 2BEOA 2OYZA 2OZ6A 4QM8A 3SCHA 2BYVE 4O9EA 1CAXB 1J3RA 1ZZCA 4AVBA 1NE6A 5JR7B 2UYAA 3LOIA 3L2HA 4FBFA 3I54A 4Q0UA 2Q4SA 5JSPA 4WVZA 5I0TA 1I6XA 2B9UA 1J3QA 1ZZ6A 2K0GA 1O4TA 3USSA 4IEWA 4BYYA 1CAWA 1FXZA 4HVQA 3S0MA 4KWKA 1LRHA 4YSFA 1ZZBA 2GU9A 1J59A 4Q0PA 2OZJA 4LULA 3RZZA 3FZ3A 3HT1A 3N4MA 4META 3UKTA 4BH9A 1ZZ7A 1Q43A 5BPXA 3ETQA 3H1MA 4IEXA 3PVBB 1PM7A 3WW1A 2ET7A 2XL9A 3GBFA 4FAHA 4LTAA 1DGWA 1L3JA 1VP6A 2OA2A 3DKWA 1CX4A 4XETA 3I7DA 5KHGA 1X82A 1H1MA 4I3PA 4N9IA 2D40A 3BPZA 1YHFA 5LRSA 4XF4A 1ZNPA 3FHIB 4J1XA 4IEZA 5FLIA 4KU8A 1NXMA 2QNKA 2N7GA 2HJIA 4FAGA 4P9GA 4EV0A 4RD7A 2MPFA 4ONUA 5I8TA 1ZRCA 1JUHA 3H8UA 4MGYE 3HT2A 5KHHA 4YARA 4LA3A 3MYXA 4EWDA 2UY9A 5F1RA 4IEVA 3OF1A 3RYRA 4A2UA 1IPKA 4Z82A 4O9GA 4E2SA 1RUOA 5KBFA 4AXOA 3EBRA 3E6BA 2P17A 4XFGA 1IPJA 4XFBA 4MH0E 1XE7A 1CAVA 5FPZA 1CGPA 4NVPA 3WW4A 2CGPA 3BB6A 2CV6A 2IXIA 3BALA 5BUVA 4UBGA 4K8FA 4XEZA 3B02A 5T3NA 3RDIA 2E9QA 3BCWA 3RYKA 1NZCA 2CAUA 2C0ZA 4MGIE 2ZCWA 3S7IA 1CAXA 1O3RA 3I59B 1H1IA 5KHIA 2GC2A 2D5FA 2GAUA 3H9AA 4LUMA 4OFGA 2DCTA 3CLPA 2UYBA 4HSJA 4WZCA 5J48A 2EAAA 5LEKA 3CJXA 5FDBA 4MX3A 1GQHA 4E2QA 2MNGA 1SEFA 4I2OA 2XLFA 3SMHA 3FWEA 4QX5A 2IXKA 2PHDA 4HN0A 2XL7A 1YUDA 3QACA 1EY2A 5LRRA 2QCSB 4LUKA 4HZFA 4JTNA 1RUNA 3RYPA 4QGMA 3E5QA 4YRDA 4ZU7A 3IIAA 3LAGA 4IETA 2MHFA 1EP0A 2PAEA 1O3SA 3R6SA 2V09A 4KWLA 4N9HA 5E1RA 3G7DA 1FT9A 2GC0A 4YYOA 3NKTA 5JSRA 1ZRFA 3HIFA 1QXRA 2GC3A 1TQ5A 2BNNA 3D0SA 4MGZE 1LKNA 4Q0VA 5BY5A 1EPZA 4LA2A 1Y3TA 2B5HA 2QJVA 4QGLA 2VQAA 5FPXA 2BNOA 2QVSB 4JV4A 3DV8A 2O8QA 2GH2A 4R8HA 3CEWA 2PYTA 3OGJA 1ZZ9A 3ACLA 3PNAA 3O14A 3IDBB 3LZZA 4D7SA 1CAUB 5I0SA 4FT8A 2GC1A 1NYWA 3CO2A 1O3TA 2FMYA 4IEPA 4KWJA 4EROA 3NSTA 2BNMA 4XFIA 4QXKA 3EO6A 3E5XA 3H7YA 3E5UA 4IERA 3LWCA 4Q0QA 2HKXA 5LEJA 3IBMA 1QY4A 1O7FA
chains in the Genus database with same CATH superfamily
1GP6A 4NOTA 5FZDA 3LUTB 5K1XA 3VZOA 1DBNA 1XE0A 4X88A 5HI0A 2VZUA 3M3OA 3VBUC 5GZCA 4CTEA 3T0DA 2P4EA 4MHRA 4JF3A 1RUC3 3LA2A 3NXSA 2XTAA 1HV1A 2VR4A 4OUEA 1K5MB 3MHZA 5DZFA 4OHXA 5FY9A 1YFXA 3K3OA 5LATA 3OUIA 2EA7A 1V6LA 3PTYA 1Q8QA 4A3ZA 4IT5A 2H6CA 5KC6A 4FCAA 1ENXA 5IY5C 2DW4A 4GWMA 1ODMA 3FX7A 2BE3A 1VEWA 3OYWB 1YTFB 2ATKC 4XJAA 4YVSB 4FPEA 2EVXA 3E1F1 2X5IA 5EJZB 4TV8A 5E1AC 1AHSA 4I09A 4Z07A 1MS9A 3WD5A 5FFOC 3K4AA 3WQBA 4UCRA 2RS31 3QBQA 2OQ7A 2OXBA 2VM9A 4HVRA 3SCFA 2OPKA 4A45A 1SC5B 1YLLA 4IW3A 5A6YA 5FXZA 4MLOA 2H8PC 1R1BA 1KKCA 5DN2A 5CEHA 4R9CA 1OCCB 1XL4A 3K51A 1S0CA 1W6OA 2PY5A 1MVEA 1TZOA 2W6IG 3ELNA 2WNUC 3SH3A 1GNYA 2DVBA 1IBLB 1NI8A 4K3AA 3STLC 2CNAA 4RR3B 1HQNA 5J09A 2Y6LA 1TME3 3AMNA 2P4KA 1NA1C 3JB4C 4Z2WA 5IAXA 2EIDA 3N2KB 3AZWA 4JC1A 2NLJC 1HR0B 2VQEO 4XHXA 2IJKA 1NZ6A 4LF9B 5C4WC 1R091 1W8NA 3X29B 3ASNC 4JZRA 3JASB 3FE5A 4FP2A 1VAKA 3K3NA 3PIGA 5JAXA 1DQ4A 2R7EB 4YHHO 1YJNV 3WP3A 1UXXX 2LFSA 1K4DC 4BISA 1UMHA 2PXJA 5ANNA 1PVC1 4TWKA 2IZWA 3EQEA 4OX9B 2H94A 3JXSA 4AEDA 4UB8Z 5KXDA 3JAKA 5EIBD 1LHUA 1FYUA 1I0HA 4DXWA 1NOVA 1JYCA 4G3YC 5EFUA 1W8HA 2BEOA 3MUY1 3QO8A 2BYVE 2HFEC 1FMD2 3HJRA 2G9ZA 4YW5A 1NCRA 3MLJA 1CP9A 4FLZA 5L9BA 1ZZ6A 4OI4A 3ZIWA 1PNFA 4IEWA 5FZ8A 3V0AB 2IJJA 1ZLZA 2EXKA 3ETGA 3RZZA 3AX4A 1QNYA 4QD2A 1R083 2O8OA 1WCSA 1Y67A 2YC4A 1SCSA 4A7KA 1R6NA 5C3PA 2QM8A 1JOYA 1YJ9V 2XHBA 3FHIB 1UY2A 1M56B 1GAXA 2EX3A 3R65A 1YNAA 4ITCA 3ZO0B 4FAGA 2EIJC 3ASOB 2CE4A 2X6CA 4TUYB 2ZGTA 2QKCA 3JARA 4IEVA 5EBMC 5FYCA 1VBE1 3BAAA 4N43A 2R49A 2XJRA 5D8AB 1OA2A 4D6RA 1SG3A 1OUXA 2RE9A 3J8F1 2GN7A 3BALA 3ZIXA 2FB5A 1ZBA2 5L3GA 2IJIA 3KT4A 3K5MA 2Z3YA 2ZX4A 4DEVA 3D3AA 5B2GB 5FPLA 5K7PA 2I74A 1U5YA 2G1MA 1SERA 1D2QA 3NNJA 4DO2A 1OD3A 4UWDA 1ASJ3 2XJSA 1BJQA 1YSCA 1AYM2 3H1KH 2XJPA 5JIUA 4I2OA 3MV01 4YW4A 4DV1B 2ZGQA 4JI3O 3NV2A 1VIBA 4JI8B 4B3RB 2JG8B 2RJKA 1DGSA 1BLZA 2QQVA 3CJHB 4DUZB 4FI9A 5LL6Y 3GB7C 4YW6A 1K3IA 4AEJA 1R73A 1AR72 1VF7A 1WB8A 3T1YO 4LA2A 2QJVA 2R0FA 1MZ6A 4BK5A 3NJXA 1XOUA 4F6RB 3LSUA 2P06A 1OHFA 4FXKB 4F83A 4GMP0 3G80A 1PNKA 1QQCA 2E5LB 3HNMA 1RUC1 1UWWA 2HEVF 3VBFA 2XBO3 2BNMA 3K0GA 3SYAA 1MS4A 1H8TA 3S6PA 5LEJA 1QY4A 3K4DA 4NRPA 1IQDC 4QGNA 5JUVA 4NR1A 3V0BB 2I45A 4BE3A 3X2QB 3MGUA 3RBZA 1VBB2 2E74B 3OEEG 3ES1A 1CD3G 4XF9A 4MXWB 2EF6A 4AEDC 4Z8BA 1RUD3 4X1IA 2GNBA 2CY6A 2E76B 2BOBC 1YFYA 5KLVH 4NWVA 4XZPA 3KF5A 5E89A 4I30A 1YO8A 4URAA 5FZKA 1SESA 1M57B 5H6RA 3TRSB 4JI7O 1NCRC 3D3QA 3GALA 4NHYA 5IJ9B 5FWJA 3F2ZA 5L9VA 5IK8A 2HWE2 3AYDA 4B7KA 5HCFA 3BUCA 2DCKA 3KHBA 2JG9B 2ZE7A 3KGLA 2GUZA 1M1KW 2ZMLA 2EBOA 3PN1A 5FZ0A 1H9WA 2GDSA 5FO7B 3E86A 2UU9B 4UFMA 2VD7A 1X59A 5FREA 4E8DA 2BERA 2P6CA 2YFUA 5C8CA 2ZR3A 3KHCA 4GYCB 3VD7A 2WWSA 4I3GA 2DVGA 2KG7A 4ASMB 1UQXA 3F95A 3WFVA 3MV11 5LMNO 4E2GA 3DPRA 4R52A 1NH2B 4QHBA 1TME1 2ZGLA 2IXJA 4W4LA 4HG6B 1YZBA 5FZEA 3N7LA 4TV9A 3VBHA 1ONAA 5LXTB 1NE4A 1ULEA 1KECA 5F8PA 1E5IA 1JCHA 1JZ3A 4N43C 1RIRA 1JHNA 2WR9A 5DUUA 3F5WC 3LPFA 4ZXKA 3TEXA 1IURA 3ROUA 5ACA2 3W20A 4CC5A 2K9ZA 1SBEA 2QTSA 1AP5A 2ARHA 4WFFA 2RR12 4WBBA 5LGNA 5CA3A 2A71A 2GSYA 5JH7A 1EM1A 2JDHA 3HMYA 4B4RA 2VY0A 2F43G 1V9U3 2W9XA 3IAYA 1RUH3 1XU1A 4KU7A 1JZ8A 3CKHA 3AXDA 3O5SA 2WN3A 3LPGA 2QEXV 5IK4A 2BGCA 1X9TA 1G6NA 4A7YA 3BABA 4Z1MG 5A80A 4XHBA 4IEQA 1R081 4UYBA 4UUJC 1B3QA 2P90A 2DN9A 2PQQA 1D5NA 4CDWB 3SPCA 1N36O 5LYJB 4ZIBA 1VP7A 3ZX6A 3CWBH 1R3IC 1LUWA 1VALA 4V1PA 5JSPA 2F93B 1I6XA 2NMOA 3WCRA 3CRAA 2B45X 4MW3A 1FXZA 4XUQA 2IVIB 4P08A 3DTUB 3K0DA 4MTFA 4YJ2B 5EPAA 1Z7S3 5DABA 4XDQA 3UKTA 3A0NA 3ZMNA 4GXLA 3WV6A 2ZE8A 5FPAA 3RZGA 3ZIAG 3M99B 3GBFA 2UUAO 1H8TC 1S76D 1DGWA 2WLHA 1CX4A 1TNRA 4DRXB 5FNVA 2GV9A 1NTKH 1N33O 2F6BA 3IPVA 4PD4F 2AUYA 1BE3H 3E2EA 1ZNPA 4A6OA 5LOVA 3VD4A 5IUQA 3B8NA 4P9GA 3T1MA 1HXS3 2YBKA 3OE7G 3VQYA 4X64O 4ES8A 2VQ0A 4NHXA 1ASJ1 2ZT9B 3ME2A 3MYXA 5F1RA 4CU9A 4H7MA 4DV7O 3ABKB 1K97A 1KFUL 4ISQA 2J7MA 1S2EA 2IBZH 1O8SA 3WB2A 4JGYA 1QH7A 4LF7O 4J7KA 3THTA 3L71H 3VDDA 1VMJA 2G9FA 1H2NA 1F35A 4CDQB 5F32A 3QO5A 2CV6A 2O57A 3GHNA 3M3CA 4K8FA 3AZYA 3B02A 4DRVA 4EB6A 1NZIA 1TE1B 3HB3B 1JU4A 3CBNA 2ZCWA 3EVKA 2YEVA 2ZNIA 3DEMA 4CDXB 2D5FA 2Y48A 3THPA 1YXWA 2CL2A 5C8CC 2JE7A 2EAAA 5FMDA 2ZPXA 2XLFA 1LGNA 3A0HZ 3KQ4B 1HIXA 3OFNG 3WSOA 4OVEA 3DPRC 4LUKA 1K4CC 2Q0OC 4JI6B 5C7GA 2Q5ZA 1GZ9A 3LAGA 3VBHC 3ZMVA 4CSWA 1C57A 1V55C 1YYNA 5FPBA 2XBO1 2RS52 1JYXA 4BCUA 3ZMSA 2XT9A 4FOYA 2WLLB 3RYHB 5C8YB 3PURA 1NR1A 1RXFA 2VQAA 4ES9A 1OLMA 3ZS8C 2X6AA 4UFHA 4QX2A 4FXGB 2QQPA 1DK1A 2Q8DA 1UY0A 4Q26A 3WCSA 1KC8W 1PGL2 1QJY3 1ACCA 1NYWA 3CO2A 2DYRC 1IHMA 4JDMA 2FMYA 1RUD1 3RSJA 1GRJA 3IMNA 1ZWIC 3J7MA 4LLFA 3EO6A 2XAGA 2QQLA 5SV5A 2GU9A 1WPXA 2CK3G 3JALA 3JD3A 4Y1YA 2ZACA 2FDFA 1QVGU 1BBT3 4AQ2A 3IJ4A 3SGIA 2OIIA 4S2HA 3NR7A 2NZ9A 4X66B 3ZFEB 1SLBA 4JGZA 2PI4A 5EYYA 1I94B 2ET1A 4XMIA 3OGGA 5IFPA 4Q4Y3 2DYSC 1UO9A 4LE3A 1HJFA 4AEMA 4MGSA 4DV0B 4NIDA 3EB7A 4N7IA 4AVTA 4BPZA 2Z69A 4U3JB 5JVDA 4HNAB 3AMPA 3ASIA 1X8EA 2OCHA 2KSDA 3AK2A 1S4CA 3B7MA 5C6CA 4NXNB 3CMGA 3MZHA 5E6HA 1SZTA 2XOKG 4CCNA 1PX3A 2XQXA 1RXGA 1GP5A 1RUF2 1QGLA 3MIBA 1Y6XA 5FQ0B 3AG7A 2ZR2A 3OGIB 1S3JA 1SQXH 5CFCA 2BSKA 2OCCB 4KXRA 4YVWB 5A3OA 1UW8A 3WEZA 3K58A 1XE8A 3QTCA 2OVUA 2C1FA 1JS9A 2N05A 4JVAA 4ZU5A 4R6ZA 3J7HA 5JOXA 3NAPC 4JGYC 3U75A 2IXCA 3WHTA 3E6DA 1V9U1 1RUH1 4PJYA 5B3SB 1SRYA 2EJ7A 5LA6A 2RQ6A 4LF4B 1EV13 4ORFA 4B29A 4WM7A 4XUTA 4LO8A 1EAH2 2HWB2 4QPKA 3VKLA 2IH1C 5DAXA 4AI3A 5B5EZ 4LNUB 4MSVA 5A32A 4JAUA 5HPOA 2ZHMA 4HONA 1UYZA 2XGXA 1UIKA 5BNPB 5CB4B 1Y9MA 4TQFA 5BNNA 1Y66A 1SZBA 2LS6A 1K12A 3UKMA 2YV8A 5K1PA 4TSVA 1XMQO 2WZEA 1HWYA 4AQSA 2VRZA 3O7OA 4N8MA 5GLVA 4OI1A 1W90A 2WLIB 5KHKA 1NTZH 3SCGA 1Z7S1 1PK6B 1IG3A 4M01A 1MQTA 3POGA 4GQ7A 4CUGA 3ZFGC 5DUVA 3OUFA 1E1QG 2VMDA 1QCEA 3ZXJA 5IWAB 4FZ1A 5K0UA 2LGQA 5LP6B 1S2BA 4QM8A 4F6EA 2BDRA 3SPGA 1CONA 1W6NB 2D43A 1C4RA 5FZ6A 2CTWA 2HYXA 3WG7B 1XNRO 2ZJCA 4DR5B 2QM4A 2W39A 1W3VA 1K5SA 3K9SA 3GGLA 1HXS1 4NAMA 1GU3A 5FMOS 4LO7A 3MO4A 1X4TA 1OH4A 1SS3A 1SA0B 4P9YA 4WZFA 1WP8A 5FYVA 4KHPO 2JDZA 1H2LA 2XL9A 2BQPA 3POIA 4LXLA 5GJ6A 1MS0A 1JH5A 1ND3C 1E5SA 5AC92 3BPZA 3FN9A 4SBVA 2ZE5A 3N9OA 2PGGA 1D0HA 4JGZC 1Y43B 1JYTA 1VRH1 3HOBA 3VOUA 2RN9A 3MIFA 4B3TB 2P34A 2Q8OA 3H3LA 3SYQA 1IPKA 2HH9A 3SKVA 2EIKC 4E2LA 3RZLA 2OW4A 4PDWB 3T2TA 2W52A 2B42B 2ZXQA 1PV0A 4NVPA 1U5IA 1H0BA 5A1LA 2EAKA 2BVBA 4QPIA 1C5IA 1JUIA 3RS6A 2UUCB 4X20B 2GP5A 5FZBA 1NZCA 1ULFA 1JYWA 1H1IA 4UF0B 5LK7B 2DV9A 2JKXA 5LBQA 1WKYA 4HSJA 4TQDA 3ABTA 1NLRA 1QDOA 1UF2C 5LCWL 1O4ZA 1FPN2 4LQRA 5J9PC 1LGBA 5FYUA 1PGW1 3FWEA 1FNZA 4OMDA 3KS7A 2OIEA 2AC1A 3ZXEA 5CFCC 1QJY1 1HRI3 3B01A 4Y5Z0 5HCAA 2V09A 5E1RA 2ZEXA 1WUVA 3A8TA 1QXRA 3VDCA 4Q0VA 4MGZE 2B5HA 1WPBA 5FZAA 3A2FA 3ITQA 5CN0A 1FXKC 5DQ0A 2A9HA 3NMBA 1BBT1 3HBKA 2GN3A 4DUXA 1G8WA 1OUSA 2PYTA 3OGJA 3ZMUA 1W6QB 4MT8A 3LZZA 4A7ZA 2P5BA 1AI4A 2UXCB 5JOZA 5T52A 2ZXWB 2WAOA 1BHAA 4PBOA 3NSTA 4XFIA 4Q4Y1 1JI6A 2NN8A 5FYHA 5C70A 1NUKA 3H1YA 5BNNC 1XNQO 2PUSA 1O5LA 2JIZG 3IDCB 1JYNA 4BIFA 1RUI2 5J3UA 1UN1A 2EALA 2ZIMA 1UAIA 1ZBE3 5FZIA 3WNPA 4Y24A 1MQTC 5C9AA 2ITCC 3I8TA 3ZHSA 2JDPA 1ZYBA 1US2A 2PAKA 1LGCA 4GJZA 1YWKA 4TLGA 2XLAA 1GR3A 1PPJH 4I0BA 4NIIA 4XIOA 5CU1A 4GWJA 2XASA 4ZI7A 4GMP3 3USUA 3JQXA 3GZAA 4B08A 1WBFA 3NV1A 5F9TA 1F4NA 4DXRA 4ASKA 2CWSA 1WW6A 3R4SA 3VHNA 4OHYA 3HKEB 5KMGB 4JKKA 1CQ9A 3IFXA 4LBNA 3RNSA 1J58A 1QXJA 4XW3A 3THOA 4LNVA 3AG4C 4FTBA 3I3MA 3KT7A 4X1KA 3WW2A 5FY0A 1YC61 1SDDB 1EV11 2P3KA 4C7UA 4XF3A 2RS13 4LP8A 1W9FA 3IN9A 4QM9A 2ZINA 2D97A 1PX4A 4DS0A 4X8NA 1OCOC 4LFAB 4RUEA 3H8XA 2GHYA 3TB0A 1KDKA 4FJCC 1OHHG 3WVJA 3WINE 4JYAB 2VMCA 3PUSA 4X6QB 1SQ4A 3TGUH 1N1YA 1UMIA 4R4XA 2ATFA 2FCVA 3DN7A 3DF0A 4HETA 3O0VA 4QPIC 1UOJA 4INDA 1KEXA 3FFZA 4ATFA 1DYOA 3AG1C 2PYJA 3ZBHA 3WB1A 2WQ8A 1KRIA 1WCQA 4AHWA 4LKDA 1WZXA 2C24A 5CFDA 2N04A 4YIPA 3MIDA 2A70A 2IC1A 1RSOB 4CP0A 3W5NA 5FYMA 3D3IA 1AR63 2DUOA 3DECA 4ZOLA 3HEIA 1UYYA 4KL1A 3KV9A 2VWJA 4ASUG 4Q4X3 2WPDG 1RUE3 1GOGA 4FZ0A 1ZZ8A 2X29A 1AR5A 1NA1B 2ZD9A 3PU3A 2PLV2 3AYEA 3N2GB 1QEXA 1WA8A 1LODA 2Q1MA 3ORJA 3ZN4A 1CXZB 2VNOA 4LBJA 2WJSA 3ZFFC 4M00A 3O0WA 3ZX7A 1NX9A 3RYCA 4C91A 1QHDA 4YJ3A 3UO3A 3TEYA 2JDYA 1UZWA 2WQZC 5BR8O 3N9QA 3ZHTA 4FK5C 3UO2A 1NKDA 5IJ0B 4M4PA 1VQ4V 2ZHKA 1I5PA 4MTGA 2HJDA 2QJ1A 3DGTA 4W50A 2VW1A 3PL0A 2G19A 1RB8G 5LBFA 4PLMA 1YHFA 4M3CA 4K8ZA 1KMIZ 2DCJA 3OEHG 4DY5A 2VQFO 3HN3A 4CUAA 3BA8A 1NT2B 3MDSA 1S0VA 1VMFA 2R062 4BZ4A 1MABG 3Q8CA 4A2UA 2W0XA 4JV5O 2ERFA 2HWD3 4H3WA 1K3EA 2Q7HA 3I2IA 2QM7A 5ISLA 1XSRA 3ABUA 4FOWA 1CGPA 1H9PA 5GLUA 3UETA 3QVNA 2X6BA 4YVSC 2ENRA 4FPHA 3A7QA 3K5LA 2BZDA 2XDVA 5JQGA 1HRI1 3JU9A 4MGIE 4CP9A 2ORXA 4ZS2A 2V7QG 3CRQA 2EIJB 2ZEZA 1N1TA 4FFBA 4UVAA 5F5CA 3LF7A 2GTSA 1BCCH 3VZKA 1VQ7V 1DCSA 4QX5A 1OCCC 2PHDA 1J83A 2XL7A 2QCSB 3L9JT 4IHJA 4A6SA 3H1HH 4X9QA 2ZMKA 4IGQA 2IU3A 3G67A 5JOYA 4G27B 3KV4A 4JZ2A 4P2ZA 1POV0 2EXIA 2BNNA 3IT8A 3OPTA 3IDEA 4JKLA 1C3HA 3OPZA 2HLDG 2VZTA 3M7AA 4XMAA 4WVWA 4GWNA 2K2SA 4WCEV 2X5IB 3DYMA 5BY1A 1QVFU 4TV8B 3HKDA 1XC6A 1S0DA 1ZBE1 2B4KA 1W8UA 2YPJA 2OTLV 2BTOA 4IEPA 2B7YA 1ZM1A 5H2FZ 2YXLA 1PIV2 3WNXA 3TJTA 4IGGA 2DTYA 4TWTA 4AFCA 4LHLA 3LWCA 2YIBA 1XBLA 3PTRB 1R64A 4FPFA 4GMP1 1W59A 5C8WA 3I59A 2ZBJA 5CA6A 1W6OB 4GH4A 5JWPA 2VNGA 3GM8A 2QQNA 2FDIA 4B3NA 3O1MA 3IC7A 4J42A 1OI6A 2GMMA 2AGAA 5HFMA 2LFRA 1HR0O 4RHV2 3FX3A 1OURA 3RYFA 3FC0A 1QR9A 4LF9O 5JJNB 2I07B 5B1OA 4J11A 4PQQA 4KWUA 5IT6A 1AI5A 2E33A 2B9ZA 2HVJC 5J98B 2RM22 3CB2A 2RS11 5I91A 4BHPA 1W6MA 3OUHA 4FLVA 5F3IA 2XXZA 1M56C 4OX9O 3HAGA 1MSWD 4BLJA 3PUIA 3BY6A 2BJSA 5FPUA 5CADA 4TN7A 1UY4A 4AEDB 5LXTA 3KGZA 3WP5A 2WL1A 3JAKB 3M70A 1IS6A 3OTOB 1V6IA 4Y1VA 1WMXA 5JPNB 2W5FA 4Y5TA 3L74H 1NCRB 4ZONA 4PI0A 4UBHA 1A6CA 1FKAO 3MF9A 1DF0A 1VBC2 3K57A 3KSCA 1Q3EA 1GO3F 4AVAA 5H9PA 2PHLA 2ZGOA 4LOTA 1AR61 1SLLA 4CZZA 2R30A 1GANA 2PF4E 4DR2B 4OHZA 2QWPB 1OD5A 2ZZQA 4MS2A 4Q4X1 2GDFA 4TYSA 4FQ4A 4UW3A 3RWNA 1RUE1 2JB4A 1RC6A 4JI2B 1HNWB 5JVVA 5KX5A 2F66C 5EJ1B 4LFCB 1UU5A 1WCKA 4LK7A 2EIGA 2GMPA 3JARB 1RJ7A 1UZZA 1UMZA 4N43B 1HNXB 5EXOA 2P22C 2QQUA 4P9JA 3UKNA 2A6WA 4EFBA 3POBA 1AUYA 1YITV 3OM3B 3OCPA 4JRLA 1Q8PA 4HYOA 1VQNV 1XMOB 5K8SA 4I02A 2NN4A 1QKQA 1DU3D 5GZEA 1W0JG 4EZHA 5FYSA 1NE6A 3IZOA 1BEV2 4Q4W2 3RYIA 4JQTA 4DV1O 2ARBA 1TGOA 5IJRA 3FBYA 3LEKA 1MZEA 2K0GA 4BYYA 2CSGA 4LJHA 5JXJA 4JI8O 1MZFA 5HV0A 4FPYA 4Z92B 4B3RO 5IYBO 2NR5A 2B46X 1A32A 4WFAV 2HWD1 2VMHA 1JU3A 2D44A 1TEIA 5H9CA 3DKWA 3GWKC 1X36A 2W94A 2VBDA 5JZGA 4K9SA 4JPRA 4J1XA 4GH4C 5FYZA 2QNKA 4YFZA 4RAIA 4EN0A 4AI2A 2ES3A 3ZYGA 5I8TA 5A7SA 1GNZA 2W68A 5BNOA 4JKMA 2VO5A 5L3EA 1R6KA 4UXNA 2E5LO 5IATA 3JBG3 2FL4A 3WR0A 4RQPA 3E8HA 2A6VA 3LGRA 2AZ0A 5KBFA 3WQ1A 2JG9C 5J37A 3T1CA 3PUHA 1EZJA 1VRBA 3VBFB 2WT0A 1FMD3 5A1FA 2HWC2 1SF9A 4JHTA 3WT3A 1UKRA 4QHZA 1LOFC 2ZGRA 1H8TB 4EKWA 5HXVA 2P6HA 3M8LA 1JHJA 2ZM6O 2HP8A 3QNEA 3LDBA 1O3RA 4Y4RA 4CE8A 1SPPA 1AJOA 1XDCA 5FMOL 4GKJO 3TBDA 1IQAA 2UYBA 3ETPA 2JECA 2B9VA 4AYUA 5BZBA 4X1IB 3C7OA 2ZGSA 4WM8A 2NMNA 3KVAA 3J7LA 2VU9A 3FYIB 4ABMA 1UPSA 3SH4A 3SYCA 2AENA 4DIQA 3IIAA 3O1VA 2YFZA 4BQ5A 3OBRA 2W3JA 3VZJA 1WCUA 2I2SA 2R9RB 5CMUA 2GC0A 4YYOA 4KG8A 2YC0A 3ZYIB 2QZ3A 3OEBA 2NP0A 4I7ZB 5DEDA 5FMCA 1Y76A 3JD73 2PMWB 3WZ1A 2A06H 2GUZB 2FCTA 5GLZA 4R8CA 5SV8A 4DEQA 5C8CB 2V4DA 5CA0A 3J8F2 4URTA 2W1QA 2KG7B 4ZZ8A 1JR9A 4AHZA 4WVVA 2E53A 3DPRB 4IUGA 2DVAA 1AYM3 1XPWA 4QX7A 5FZCA 3A0BZ 4TV9B 3VBHB 2VL4A 5ERLA 4JTCB 1V55B 2PA7A 3SXWA 3ZR5A 2P3YA 2FDJA 4ICGA 3AG2B 3CRCA 2F4LA 2VZ1A 1GYKA 1XI1A 2ZGUA 3U0ZA 5FWEA 2P3JA 1DQ6A 3TAYA 3TXQA 1G9FA 4FTEA 5LGTA 4BQ2A 3AB0A 1UCXA 3LA7A 5CZKA 5CKQA 1PO13 5C3RA 5ANQA 1BSMA 2DDUA 1W2UA 3H3UA 4YW2A 2QKSA 1S0GA 2UY8A 1VQMV 3AC0A 4CCKA 1EN5A 3LD8A 3NJZA 4LBLA 4W8JA 1Z78A 1ENSA 5JH7B 4Y1XA 1CESA 3ZKUA 4FM2A 1VJ2A 2Z2SB 5FZOA 3D0JA 3CEIA 4OMCA 1MS1A 2AHYA 3ZYHA 3P1IA 1ZL8A 3PLQA 1OV9A 1JMKC 4CP1A 4PIXA 2QFEA 5APAA 2EJRA 1JFFA 2DQ0A 2YMZA 5C71A 1RUC2 4OCTA 5CBHA 5J7MA 1PNLA 3ABKC 1HN0A 4DV6B 2JGUA 1S1AA 1URFA 1VBB3 2KA3A 3N3HA 2DYSB 3AP4A 1P49A 1DFQA 5A3PA 1ZAUA 5BNOC 3KVBA 4MADA 3SPHA 5I8SA 3U1XA 4CDQC 3RZMA 1Z0HA 2UXXA 4QXCA 1PL0A 1L7LA 1QIQA 3IC9A 3B00A 1UYPA 5CKNA 1SLCA 3A21A 4QKBA 4CDXC 5CBGA 1UU6A 2O0OA 1FAYA 3BA9A 2JB8A 1LB2A 2HWE3 2HLEA 4HK9A 2QQWA 1OC1A 1UX7A 2PTMA 4NUBA 5FNVB 1G7YA 1IXBA 2WFF3 3IPVB 2XUEA 2H0BA 1O3QA 3MBWA 5LOVB 4BJ0A 5E16A 3LNNA 3POWA 1SQQH 5C5UA 3JD0A 1T6GC 2W08A 3EHBB 1WJZA 1FI2A 1N3QA 3HKBA 5A3WA 3D5OA 4AE2A 1XNAA 1XNCA 1GQPA 1RGSA 1F4HA 2ARAA 4WM8C 1NY72 2OTJV 1V6OA 3I4IA 2WNVA 4JGYB 5B66Z 1W2AX 4JTAB 3VDDB 5LY2A 1V70A 3FLTA 1EUTA 1TME2 2ZNJA 5CA1A 2D6OX 3CXCU 1GP4A 4IESA 4ZU4A 3ST7A 5FK7A 3K46A 1L0LH 3VBOA 2BP6A 3A23A 1VBD2 5FUIA 1BK1A 1ENRA 1PMHX 4EB6B 2HHHB 3ZXFA 4I50A 2YEVB 4AVBA 5JR7B 2E26A 2Y6JA 2AACA 1UU4A 4HL0A 4BB3A 5ACA3 3MIGA 4PQ9A 1TUBA 3MAQA 4LOSA 2X0LA 3CP1A 3IAQA 3WUCA 2HJFC 5KR7A 1M93A 2R70A 4CH3A 1LRHA 1XNTA 1XNDA 5FBJA 1MR5A 2YXYA 3JBG1 4UFKA 4QX8A 3G6EV 1C1LA 3S30A 1B06A 3ZFEC 5LMUB 3ZEDA 3CJIA 1B09A 1FMD1 2WRAA 2LW8A 4I3PA 2PHFA 1HB1A 2Y69C 5KA6A 5A2QN 1HNZO 2J1AA 1GSLA 2DUQA 4IEZA 3ZR6A 4R50A 5C33A 3CYOA 1THZA 4XBFA 1Q8VA 1ZRCA 3H8UA 4CU8A 1F31A 3HT2A 5JMOA 4YARA 3F7YC 3APBA 1DLCA 1OQEA 4DV2B 3CCEV 5FIXA 3SEEA 4AHYA 2XJUA 5FP7A 4BQWA 4P9WA 2FBEA 2VAUA 5FPVA 3UYJA 4ZY9A 2WT2A 3AP5A 4EN9B 1ULGA 1E57A 3EFFK 1RVF2 1U96A 4LC1A 1J1TA 4PDVA 3AKQA 3VD9A 3JALB 4O2AA 2EULA 2QDOA 3WP6A 2E9QA 2QQOA 1MZ5A 2Y6KA 2CAUA 1CAXA 3IKWA 4RA0A 1B35A 2W1SA 3K48A 3SPJA 1I94O 4YVWC 3JD71 4AQYB 1LOBA 4JGZB 4DV0O 5FKCA 4PHZA 1WNSA 1QXPA 5IAVA 1RMU3 4JI1O 5GONA 4AGVA 1Y9GA 2EIKB 3RYPA 3E5QA 4UCVA 4UFLA 5B3SC 1AR93 2WWJA 5ABJA 3CSXA 5JVDB 5JJJB 1AYM1 2WZ8A 4AVVA 1IBKB 2PI5A 4NXNO 3HIFA 3LEGA 2PHWA 1ASJ2 4L8JA 3ALQA 1VF6A 1YQ2A 2X8KA 2A7WA 2X10A 1RHI2 3OW2U 3A22A 3AMMA 2VC9A 4D7SA 5BNPC 3S5AA 4CZSA 1DQ5A 4CCMA 4DXTA 4KWJA 2VQEB 1PO11 1PZ8A 2DU1A 3ILFA 4O4LA 5CFCB 4P9LA 2BSKB 5DXDA 3MIHA 1CX1A 1QMJA 1JOPA 2FYUH 3ZRXA 2GP3A 3FHQA 2ILMA 1BVVA 3KCCA 4YHHB 3ZN1A 1VAMA 5D2AA 2RMU2 3EYPA 1HQWA 1AXZA 5LP6C 2CTQA 1SQFA 2J1VA 2X09A 4EZ4A 2LGWA 3VL8A 3JAWA 1POV3 3I3DA 1W06A 2RS53 1J5EO 5LA6B 3WF2A 2IUWA 2IH3C 4CS2A 4E27A 2HYKA 5L19A 4QQHA 5LZ6A 1GNHA 3VLBB 3VBOC 2XBO2 3LFMA 4P9IA 1KQSU 4WM7B 1XYNA 4I0AA 1IXMA 2GBOA 5LBCA 3WG1A 4MYEA 2LO1A 1VBB1 5A32B 2Q4PA 4A4AA 3SR2C 4IGPA 2D6MA 1IBMB 5BNNB 2IJHA 2XNDG 1OCZC 4HN1A 2XPJA 4ATEA 1U12A 2ARXA 4DNYA 4DV3B 4GALA 2QQJA 2QDNA 1RUD2 4LFBB 2XAQA 2D2CB 3WQ7A 4QXBA 3FB8C 5IWAO 5A3TA 1OMIA 3M2MA 1MQTB 4OQ8A 2JEUA 1PGSA 4E4HA 3ZHVA 1QLNA 1LEMA 4B4PA 3POEA 4O4HA 2ITDC 2HWE1 3S7EA 2VW2A 3FL7A 2QE3A 4NWWA 4EN6B 5K0UB 4QPGA 3OG2A 4PDWC 3K4ZA 4RYDA 2BPA2 3BFRA 2WFF1 1PD3A 3SNMA 4I4TA 4EN7B 2QDRA 4KBZA 1AJQA 5L7OA 2YY1A 4JHZA 1WD3A 5AVPA 3O1SA 3ZN6A 1SQGA 5A7PA 4ZS3A 5IVBA 3JUUA 2V5DA 1J84A 4GD4A 2DWRA 3VHRA 1DGLA 2FZ1A 4AQ6A 5JXHA 1E5RA 4JYYA 3I2DA 3QF7A 4DV5B 1WBLA 2XVLA 4BW5A 1Q7YW 4L2NA 4MW8A 1YJLA 1Q8SA 4YPJA 2UUBB 1BQPA 3BTYA 3VDAA 3LEIA 1D0GA 5LK5A 4FPKA 1XREA 5T50A 4IE7A 1LULA 4GWIA 4YY3B 3O65A 1W6PA 4B3TO 4DR3B 3BGAA 2Q1ZB 2AREA 1RUF3 4XDPA 2A0LA 1WB7A 4BMBA 3ZHQA 1FAFA 4JI3B 5ACA1 1AX2A 4NPMA 4K8RB 2JJ2G 2R0HA 1W39A 4N7UA 2VECA 4COYA 1SFYA 2A7AA 4XTMA 5A1AA 4U36A 2FMDA 5DMYA 2CTPA 2QSAA 2YHJA 4LR4A 1XILA 4TT3G 2UUCO 1BVP1 4NO4A 4D0QA 4QPIB 4QDRA 4D3WA 3E83A 3VKFC 2EICA 2VMIA 1VF6C 3KD4A 4TOIA 4IYHA 3EXUA 2BVVA 3IMMA 4DMIA 3AG1B 4BQXA 1VBA2 3Q8BA 5IVVA 1V9U2 4QE9A 4GKYA 3DKQA 3UV9A 2WLQA 4NIGA 3RGBA 1QJZA 2JX9A 3OR7C 4HK8A 3HT1A 2HWB3 1ZZ7A 2XAHA 3ETQA 2TBVA 2EILC 1I9RA 1SDWA 1ST8A 5A3LA 3I2HA 3WW1A 5FO8B 1LR1A 1AR82 3H01A 1I5XA 2QBXA 4LTAA 5FMBA 2WS93 4HT1T 5KHGA 4RFRB 4B3MB 4XF4A 1DGRN 4K7JA 3VBSA 2UU8A 3NNGA 2ZKOA 3ZM8A 1VQPV 1ULPA 2XAFA 3QCWA 3GNEA 2JRIA 1OOPA 5KHHA 1UYXA 3AK0A 4PLNA 5H9QA 1Z7S2 4O9GA 4W6WA 4Y1ZA 4Z2AA 2L35A 2P17A 1NVPB 1RMU1 2Z42A 3C8XA 4ZZ5A 1XHZA 4LBMA 3VQVA 2JK5C 3ZSEA 1AR4A 3B3QE 1BHGA 1FOD2 4XEZA 1CR7A 3T1HB 4XXAA 4UI9L 2J42A 2VTFA 1AR91 3LDCA 2Q67A 3S7IA 3ECQA 1HXS2 4BW9A 1H4HA 2NPIA 4AW7A 3B4SA 2Y38A 4S2FA 4X65B 1TVKA 5CNAA 4I0XA 4XILA 4B7EA 1EZVH 4E4DX 2XVKA 5C9AB 5AC93 4RGGA 1REEA 3GBGA 3JSNA 2VW0A 4DPNA 1ZUQA 2C2AA 1QHTA 3RFRA 3VBBA 2LRPA 4IV1A 4RGKA 5GM0A 4ZI7B 3E22A 1EP0A 1AB3A 5GTHZ 4JASA 3USUB 5L7OC 3ZKYA 3R6SA 1CN1A 1DLLA 3P6BA 1FFXA 3D0SA 1LKNA 5FL7G 3P3NA 1PL4A 1RPOA 3C3SA 2V5YA 1VQ5V 4BDVB 1T5EA 4X1KB 1POV1 2ID4A 2RS51 4LO4B 5FZ4A 3PIJA 4PI2A 1AJNA 4A3XA 3L9DA 2V73A 2ZZJA 3MF6A 1FPN3 4DR6B 5G05L 2D3SA 4LF5O 3QH6A 5A7NA 2WAAA 5L3CA 1CPNA 4S2DA 5LWBA 2GTAA 2JE8A 4CCDA 3M8AA 3BPSA 5B4XA 1QJY2 2RJZA 3K5NA 4X1YA 1UIJA 1TMF2 1N36B 4KG0A 3DC6A 4XFAA 3BHPA 1WA6X 1EUUA 1EPWA 3FMGA 4CEYA 4MVZA 1HV0A 1T6BX 5JJEB 2VOTA 3VKNA 3RJ2X 3ZPOA 4ARXA 2Y34A 5CFDB 3L75H 3VHPA 1ZTEA 3BRCA 2XKPA 5CKMA 1ZSPA 2IFRA 1I7FA 1BCXA 4Q2FA 2UXDB 1YJKA 2UUAB 4ZOLB 2CUGA 2C9KA 3VBRA 2WUHA 4Q4Y2 4GX0A 2WWWA 2YBSA 1G9CA 2Q73A 4C0HA 4AFBA 5FOJB 2QGNA 4A41A 3E89A 1UPIA 4Y3OA 5LA0A 4LR3A 1GN2A 2W2IA 4QPWA 2ZGKA 1WA8B 2R9IA 4X64B 2F95B 4UXAA 1IS5A 4DV7B 3RYCB 2HR3A 4YJ3B 1RUF1 3UK9A 2E7TA 5CG8A 4QX3A 3WDWA 4LF7B 2QWRB 1N34O 4LF6O 1ENQA 1R1A3 3TNPB 4DRRA 1L8DA 3K03A 2XLGA 2VPVA 4CXXA 2Q0AA 3ABZA 4BWOA 1QNWA 3PU8A 4LT5A 3CHXA 2BRTA 4M3CB 1SMVA 4AI0A 4FTSA 4Q8LA 2CAVA 5FPOA 4QKNA 1YTFD 1K8AW 3TN93 3OPWA 4QQLA 2VGDA 4XBLA 2F23A 4J41A 3SJCC 2VZRA 1HB3A 3RZKA 3HN1A 1W8OA 4IV1C 5JI9A 4B4QA 2RDRA 2ZTNA 4C90A 4A42A 2HWB1 2UWAA 4RN5A 1NT0A 3RPQA 4IL7A 2X5IC 2JWPA 4NAOA 4XF0A 5EIYB 3PMEA 4IGOA 3WY6A 5JQGB 1H6XA 5DAQA 3TYJA 2W1WA 2WS91 5F2VO 3O0XA 2QTWB 4X8AA 3E8BA 4CP9B 5JDBA 4UCTA 4FOVA 5LHIA 5FZ3A 5JLVA 3GZUC 1XL6A 2B9UA 2JENA 3KWVA 1OVSA 2YGLA 4FFBB 4KWKA 1ZZBA 1UZ0A 2P1BA 2OZJA 4LULA 4CCJA 4AFAA 5LW9A 1WW4A 2E32A 1Q43A 3H1MA 2Q7GA 4K0KO 4IHJB 1VE0A 4QDQA 1J95A 3K59A 2ZAAA 2QZ2A 1X82A 1V00A 4G28B 3WDYA 2Q7EA 2YBPA 1PZ7A 5LRSA 3I2KA 1SLIA 3KCYA 4LE4A 2WAMA 5T54A 1HW7A 1CJPA 2AW9A 5CISA 1W9WA 3NO8A 1YQ6A 5FTTC 3HKDB 3N7KA 3RYRA 1C8M3 1JVMA 1XBFA 1AF9A 2PLV3 5AC91 3I2FA 3QG5A 1XUQA 3T4DA 4CEYC 5LA9A 3WW4A 3Q8AA 5D5PA 3AMQA 4XVHA 4XAEA 4FPCA 4UBGA 4FPPA 2DUPA 4CS3A 2BV4A 1RINA 4YZ1A 1BKZA 3I59B 3OUJA 4GH4B 4XBQA 4DUWA 4P9OA 3OR6C 2X7RB 2Q8EA 4J25A 4DQAA 5GW7A 4WF9V 3UNPA 4K6BA 4F4LA 4K1ZA 1W2BU 1F8VA 1YUDA 3QACA 5FUNA 2DMXA 3RYFB 4CDUA 3LSQA 2VQTA 2HWF2 4ZU7A 2VQUA 4D6QA 5IVJA 5FJHA 4OUMA 3WOGA 1E1RG 4GJYA 4E9KA 1R1ZA 3NKTA 3I3QA 4X62B 2GC3A 4HPKA 4D69A 3PJSK 1LTEA 1BHBA 1W6MB 1FPN1 2R073 4DK1A 4BXSV 1GTOA 1TVGA 3CCUV 3P5BA 2VZPA 4EJRA 1Q90D 4NRQA 4E8CA 1VQ8V 4NHLA 2WABA 4FT8A 2A6ZA 3ACGA 1AL0G 4FMTA 1K9MW 1GKFA 2Q6AA 4YG3A 4JI5O 1NQDA 1LOEA 4IERA 1F4MA 2ADPA 4PV1B 4Q4V2 1WMEA 2ADEA 3D8CA 3MHHC 1N32O 4R9BA 3T09A 1LR5A 2PAMA 2HVKC 1S72V 3LFIA 2TUNA 1BMV1 1WMFA 5EV7A 2NNUA 2RMKB 2JKBA 4YGBA 2M6YA 2LJ2A 2K9PA 3DGEA 2GZWA 1XYOA 2Y4UA 1HLCA 2ZHLA 2Y33A 5BYNA 4QU2A 4JI2O 2XKOA 5F5QA 1PVXA 4LFCO 4P30A 3O1TA 1QJFA 1W2TA 3PJQA 3K79A 2LW1A 4L87A 2CDOA 2Z5WA 5KX5B 2FMLA 3W7WA 1WLCA 2P5OA 2JDAA 4J10A 2A3QA 1YXBA 3O1PA 1HNXO 1IS3A 4B3SB 5EZWA 4XACA 1ZBE2 4F8AA 2QQKA 4QX0A 1P8JA 1BZWA 3R0RA 5FLJA 1XMOO 4COUA 3G71V 1VQ6V 3AK3A 1AYN2 5DG1A 5JIAA 2ORZA 4NTXA 4UOJA 3ZLIA 1JZ4A 4CS4A 3WNOA 3B77A 1R1A1 2VUJA 4O4IA 4XYXA 4CPBD 2LUWA 5E88A 3VBFC 4DOUA 4M3CE 3RYIB 2LALA 4PDLA 5IE9A 3CU7A 3UJQA 4RHV3 5ITZA 3TN91 1S55A 5KA5A 1A78A 2TEPA 3CL1A 4BQ1A 2ZE6A 2E3CA 1K34A 4Y1UA 3OAAG 3S5QA 1QNMA 2Y6GA 2JD9A 1W04A 4QIWF 3MDPA 2RM23 4XDOA 5GZGA 4QDSA 4Q5OA 4BM8A 3D4KA 5JZGB 3I2OA 1WGPA 4GUNA 4BMEA 2OQ6A 1C5HA 2UWBA 3WG3A 4N21A 3GJBA 5BNOB 3FKSG 5DUWA 1OT5A 2ZA9A 2O1QA 5TSWA 1R3LC 4RQPB 1O5UA 2MW2B 4XFHA 1HRV2 2Y6FA 4CDUC 3BOPA 4DR7B 4LMFA 4AILC 1NH2D 1VRH3 2R72A 2AEZA 5K4LA 1QJX2 1RITA 4XDKA 1DZRA 1H8EG 4AHXA 1GQGA 4KFMA 1CIWA 2GNDA 2VUCA 3CC7V 1VBC3 2R6QA 2WBKA 2W91A 2FTKA 1SPPB 1KUQA 3RW0A 3ZYRA 5I0TA 2ZX1A 4AQTA 1GZTA 3USSA 2WN2A 3J9SA 3S0MA 3RZJA 1CPYA 4PLOA 5HCHA 3AG2C 4O2BA 1W2NA 1AR62 2WLNA 2A1XA 4WM8B 3AXEA 5BPXA 1FATA 1C8M1 4KNCA 3O1UA 4L9BA 4KI5M 3HWJA 2ZX2A 2PLV1 4JYBA 5EK0A 4XETA 1H1MA 4G4FA 1ULDA 2XWBB 2E31A 2JEMA 5F7UA 1AXKA 5BMVA 5DAWA 1CZTA 3AL5A 1Y76B 3ABLB 1AL22 2RV9A 5JOWA 4FLWA 1Q8OA 2CTVA 4XUPA 1JPXA 4MGYE 3PVNA 2LP7A 3ZYFA 2DTWA 2Z4FA 5CA0B 1JYIA 2E51A 3AZVA 4RFT0 3VL9A 1S0FA 1SKVA 3DUIA 1S5LZ 3OBZA 4XFGA 1BEV3 2VVDA 4GT1A 4Q4W3 1F5FA 2PHTA 2WSUA 2YS8A 3WNMA 1HDJA 3ACIA 2Z5UA 5EZYA 2VCAA 3J4UH 2Y69B 3VBUA 3LQCA 3W5MA 1N8RW 1Y74A 5LY1A 1OFSA 1IS4A 1CPMA 2GMEA 2QKAA 3J81N 3PVOA 2K1EA 3MICA 2R071 2IWGB 4MX3A 2HWD2 2H3OA 2FCUA 1EBOA 2QA4V 1X33A 1F2NA 4TXWA 3ZMOA 5FY5A 3T2MA 1RUNA 4QWNA 2X53S 1VB4A 2Y0PA 3ZCCA 5A6ZA 1S2KA 2XVGA 1D4M2 1QU0A 1DQ1A 4N9HA 2XWJB 5FZOB 4XOGA 4N53A 1TQ5A 2YU1A 1ZL8B 4O7XA 5FP3A 4KUMA 1RFYA 5IWFA 4PT6A 1ORQC 3PUQA 2HWC3 5FPXA 1RP3B 1JFFB 4IIJA 1K7DA 3CQOA 1LOGA 1COWG 1ZZ9A 4XTPA 4DV6O 4LK6A 1DG6A 1PKXA 1CZSA 1JZ5A 1QJEA 4BWAA 5T5PA 1CEZA 4QXKA 5FZ1A 3ZN0A 3WDXA 4NPRA 1QOOA 3IBMA 3VDDC 2ODMA 2AHZA 2P3IA 3ZSJA 2WNUA 4YZ5A 2VNRA 4ISRA 3ZSKA 5IHRA 1D2DA 4HKLA 3T30A 4YIOA 2YZ4A 4L92A 4UVCA 1UZVA 1FJGB 1NR7A 4YM0A 3E8FA 1OF4A 4D94A 4GKKB 1J1LA 2VTXA 1VMHA 3C7EA 4H7LA 2FQPA 4J6GA 1POQA 4D7TA 5A33A 5C4WA 5F3CA 2FDGA 3Q8EA 4XJZA 4DR1O 3QO7A 3MW3A 3MD0A 3NRUA 5A7WA 2BW8A 2WZPP 1GUIA 3HKBB 4P02B 4IE4A 5IVCA 5F3GA 5L36A 3K9AA 1BYHA 4WV8A 1O91A 4UW6A 4LBKA 4L97A 4RHV1 2B1GA 5FP4A 2WNVB 3WG4A 4IEUA 4L11A 1OJHA 1X7NA 4NROA 1BZKA 1Y4MA 4LKSA 4XCBA 2AXTZ 5CA1B 5C3SA 4K20A 2HHHO 1RL3A 2RM21 1DZTA 3CCQV 5FKBA 3VBOB 4PA9A 1RJ8A 1YRZA 2VQFB 4I50B 3MUZ1 3JQWA 1KD7A 2LW7A 2QR4A 3SHRA 2IVJA 5DDJ3 5KAIZ 4DV4B 1TUBB 3CS5A 1OFNA 1P4RA 1WD4A 3ZHRA 4JV5B 2E7AA 1OCZB 4PIYA 4L99A 4E4ZA 2VS0A 4NE9A 5LMUO 1KKDA 4O61A 1OZ0A 4UAPA 1IZ3A 2Q1FA 2IXLA 3CJIB 1OKOA 4PELA 4XC9A 1MG1A 2YXHA 3OY8A 3ZOIA 3ZDVA 3WW3A 1MNGA 2DCYA 4H33A 3NJVA 1VBC1 1Q56A 2PN5A 4DV2O 1GM8A 2OYQA 1VR3A 3PUAA 2BWCA 2UXBB 2VOXA 3R4UA 4DUYO 2IM9A 3UT5A 4Q6GA 5FV3A 5F6LB 5DN6G 2Q8CA 5LBBA 2OUJA 4EQVA 4ASLA 4GB33 2JDMA 3NNLA 3KZ4C 4HKWA 2DF7A 4LF8O 1B04A 3OMNB 1YCIA 4DR4B 3NNFA 3RWRD 4XFCA 1DF5A 4X6RB 3OTFA 5AG2A 5KXBA 1YF2A 2VUAA 4N53C 2QUOA 4O2AB 1G86A 4DW1A 3AYAA 4AAPA 3SCHA 2NLRA 1CAXB 4AQYO 1B35B 5EP9A 2ZABA 3N7JA 1CWPA 4FBFA 4AOCA 2OIGA 2YUAA 3BVCA 3CE2A 1CAWA 3MEPA 4FLTA 3FB6C 1QQP2 2ZMNA 5HCBA 5LASA 3GCXA 3DSQA 4BU2A 2CU5A 5GONB 5AFBA 2JDIG 4LH7A 2R042 4NHMA 1G9AA 3VD5A 5FR3A 5B1AC 1IBKO 4FFFA 1BEV1 2OWOA 3I7DA 2JIGA 1W0PA 2W46A 4Q4W1 5ABJB 5KAFZ 4FFKA 1G1XB 1WCDJ 1Q81W 1O59A 2AEYA 3I56V 4WM7C 1YI9A 4J9ZB 2MPFA 1NBMG 2A5ZA 3DYOA 4ONUA 1REDA 3JD4A 1FNYA 2YICA 3IB3A 4AFDA 3LSSA 4YZ4A 3RI9A 3AMHA 3B8MA 1F5JA 4EWDA 5IYDO 2FZ2A 1YQCA 1VBD3 2OKXA 3WF1A 4KGGA 3MFAA 1OCRC 4XFBA 4U7OA 3OGCC 2UWCA 4O4LB 2CGPA 2EILB 4ARYA 2J1SA 2XR4A 2WDBA 3UT0A 2V4VA 1P84F 4XQWA 3WF4A 1EFRG 2EXJA 4J80A 2QWNB 4NRMA 3GHMA 2PQSA 4JGSA 1AVBA 1N3PA 5K0UC 4QAWA 5GLWA 1GV9A 2GAUA 1YIJV 3H9AA 4LUMA 3SYOA 3JBG2 1FS0G 2CDYA 5J48A 3JAWB 3GBWA 4UFIA 1W8WA 4E2QA 1SEFA 2HWC1 3N35A 4GAZA 3M4FA 1REFA 4ZPIA 2MEV2 1S0IA 1EY2A 4FM1A 3CCLV 4RSUA 4E4SA 4YRDA 1F7YA 1U5ZA 2PAEA 5LGUA 1IBMO 1V9PA 2W6JG 5HFLA 1FT9A 1ZRFA 1TUEB 2A3XA 2BBVA 5BY5A 4DV3O 2YGMA 2QWQB 5E8AA 4YW3A 3PHMA 4LFBO 1SCRA 4DO0A 4XUNA 4BXFA 3CIHA 1RVF3 4R8HA 5LB6A 4OPHA 3AP6A 1QJU3 5I0SA 1SHWB 1HP8A 1H1AA 2RNBA 3HQUA 3K3WA 4O4HB 4QPGB 4KMQA 3N36A 4FPOB 1HB4A 3E5XA 4LWSA 4Q0QA 2HKXA 1JMUB 4I4TB 1HX6A 5L7OB 5L3BA 2P7TC 1FV2A 3ZN6B 3JD72 2EZOA 4Q0SA 1YI7A 5BXXA 4DV5O 5AFEA 1TA8A 1K42A 3WG2A 2CGOA 1L7QA 2ZOEB 5FLXN 5T55A 2UUBO 3INAA 3ZXKA 2HEWF 5FBZA 2OT7A 3RMXA 4EWEA 2NQYA 4IE6A 4YY3O 1HKDA 2CH7A 4DR3O 3OBAA 1RHI3 5BV6A 1U0AA 1W9TA 2CYFA 1W6PB 1F9KA 2R32A 4HVOA 2RCVA 3BI3A 1QOTA 5FPRA 5CAZA 1DTOA 1RUG3 2HBUA 5DDJ1 1GLHA 3M3IA 4CEWA 2JS5A 1WLDA 1ZA4A 5T5LA 4YNIA 1ULCA 3C7HA 1PO12 1KQRA 4V2WA 4I55A 3BU0A 1NCQA 2LTNA 2JXAA 4Q27A 1U97A 4MGQA 5DUXA 4HFSA 2RMU3 3ENRA 2PFWA 4F7ZA 5FZLA 2R9AA 1OA3A 5CYYA 3PMSA 4JRAA 3SJAC 3LSEA 5A9GA 3ZRSA 3D82A 4LHSA 5FY8A 2J1UA 4CCOA 4GX5A 3H1WA 4CBCA 3Q8FA 5D5QA 4GULA 2B39A 1KP3A 4GB31 4B3MO 3AEIA 5EC2C 5HV4A 1X9PA 3DXRA 1V6KA 3LNMB 3FUQA 3C90A 2ZM6B 5C9AC 1R3KC 3OGRA 4ZHQA 2WNOA 1V54B 1MEC2 2ZGPA 4NMIA 1UJWB 1UD1A 1AI7A 1QWRA 4EWAA 1FPOA 3VBSB 3PJYA 4JDNA 4GKJB 5B1NA 3S57A 3BEHA 1V6MA 2Q8VA 1OOPB 4UT5A 1QLEB 1I5ZA 5A70A 3RZHA 4K21A 1DHKB 2XH6A 3OSDA 4QPJA 4DINB 1AZDA 4QPYA 1KJLA 1GN3A 4G9SB 3SPIA 4P14A 4AR2A 4G2KA 3T1HO 4AEKA 1ZRRA 2WFF2 3ON7A 4CU6A 2JDNA 4TSFG 2JS3A 1W28A 4QB2A 4XIKA 2AGSA 1WLEA 5K9YA 3O1OA 1BXHA 2VBPA 4U2AA 4YGDA 2UYAA 1JZ2A 4X65O 2W95A 1NY71 1GK9A 3ZYBA 1TVKB 2VMFA 4I0XB 3SKJE 3UCSC 1NS1A 4Q0PA 3VV1A 1K73W 3N27A 4CCCA 3NJYA 1VBD1 4IV3A 4IV1B 3E22B 3KT1A 1OH3A 2JIJA 3TOJA 3STZC 2JD4A 4RGAA 4C1XA 1FFXB 4N90A 3DXTA 3ZRWA 1M4UA 1AX1A 3RVYA 2ZDIA 4MTXA 4LIUA 2X05A 1IG0A 1JJ2U 4JI0B 1N3OA 5DG2A 1P7BA 2DWDC 1Z2GA 2NM1A 1H38A 3OMAB 5T5JA 3B93A 3OF1A 3N9LA 1IPSA 4K1YA 5CFDC 1W3XA 2WZR2 4CUBA 4AXOA 4LBQA 4RS5A 1PO23 4D7YA 4MH0E 4Y20A 1CAVA 1JN2P 1VBA3 3CRRA 5FZMA 4JZGA 1IBLO 5IW0A 5DAPA 4W4ZA 4DR6O 4I5SA 1WN7A 1KS4A 3RG0A 2ZIOA 3JYCA 2EINC 2BOCC 5KHIA 1RUJ2 4CEWC 3FHAA 5FRAA 2GC2A 2JE9A 1BGYH 2JJ1G 5FK8A 1AR83 4JI4B 2DCTA 4WZCA 2EIBA 3WXPA 2MNGA 1NCQC 3RQ0A 2J1EA 4U3FH 3SMHA 1BQZA 3CDZB 4X1YB 3POSA 3BODA 1RVF1 1GN6A 1X50A 3D6EA 1QJU1 4KP4A 1COV2 5IYYA 4MG2A 1S0EA 1YI2V 4QGMA 4FPLA 1WMDA 4CEYB 2OT5A 1O3SA 2Y60A 1RYYA 3H42B 4KWLA 4AVSA 2YG0A 5JSRA 1L1FA 3CPWU 1OPMA 4YXWG 1Y3TA 5EYPA 3SJBC 4NB5A 2UXDO 1O6UA 3HKCA 1ALYA 5L73A 2Q5TA 2QVSB 4JV4A 5GZFA 1FOD3 4NTWA 3A0RA 5DM6V 1RMU2 3VBRB 1NKGA 2ZS6B 4UFZA 3GZEA 1K5JA 1GOHA 4BIZA 4CUCA 4W6YA 3V65A 2ZX3A 2VCBA 5LA2A 3B94A 1AR92 4LHNA 5CB7A 2PZSA 4HXCA 4EEQA 4TLFA 3CF6E 1RHI1 3HD8B 3NAPA 3K5OA 4FQZA 5FYIA 2YDEA 4WFHA 4BIUA 3T1LA 3WF3A 1UY3A 1YFUA 2H6BA 1DIWA 5JCTA 2JGDA 2Y0IA 1K45A 1RUG1 1Q5OA 3T4VA 1GOFA 4JAAA 5I0RA 3AFGA 2RJLA 3LCPA 1UX6A 4QGPA 3TCUA 4XBNA 3WDTA 5KUMA 3BN6A 4HLTA 3GJAA 3B9IA 1LENA 2RMU1 5D1IA 1R3JC 1WAZA 4QMAA 4P9XA 1CJDA 1XQ8A 1Q6IA 2RS32 2WA4A 2M7WA 2BWAA 2A3WA 1E79G 4WVMA 3JZVA 2FDKA 1XB9A 4CH4A 2QQMA 3APQA 3CMAV 3PVEA 1M90W 4MHUA 1WLWA 4IV3C 4FO9A 4H0LB 2Y6HA 2F4VB 4YLZA 3ZFGA 1E5HA 3OGSA 3G6JB 1CAUA 3HVDA 3C3TA 5I8YA 1SZXA 1XOYA 2D5HA 2C26A 1HNZB 4QQOA 4DB5A 1D2SA 2RHPA 1AJPA 5C93A 2ZDIC 1S0BA 5JMCA 1PMJX 4DUZO 3H9VA 2RDNA 4LEJA 3LB9A 3U11A 3KCXA 1AP6A 4U7NA 1OA4A 4MUVA 1L0NH 3FLPA 1A34A 1TMF3 3M1HA 1WP7A 4RS5C 2E75B 1R092 1N0NA 4UW4A 3H7JA 4O4JA 3NL1A 1UY1A 2ADDA 3TNQA 2KD7A 3R4DB 2J22A 3UL2A 1ENVA 1ND3A 2VZSA 4NXMB 1WW7A 3FB5C 5C5TA 2VZVA 4QB1A 2DQ3A 2C6SA 1PVC2 1A8MA 2WINB 2VVEA 4AK3A 3SEPA 3THCA 2XJVA 2YC2A 2E63A 3AZXA 3ABMB 4H14A 1IOAA 3H50A 4XXPA 2DURA 2ADQB 2ZHNA 1Q86W 1OKQA 4D8MA 3Q4HA 1VQ9V 4XDLA 3BVOA 4UB6Z 3SLIA 5HBAA 4PJ0Z 3TEWA 3AVSA 2ZX0A 4JI1B 3CCSV 3MI8A 2PHXA 5J2UA 3Q9OA 1C28A 4OI2A 3VB9A 3VDBA 4COZA 1J3PA 1QBZA 2D3RA 3QD6A 2KM2A 3T08A 2GSMB 3ILRA 2W92A 4B1MA 4DUVA 3UM7A 2WNEA 4QT6A 2OZ6A 4JX0A 4UFJA 1R6TA 1Y7BA 5GLTA 5J2TA 3U4XA 2YPDA 4I9WA 1J3QA 4D6SA 3BKZA 3CRMA 1S5HC 4YSFA 2A79B 3VD3A 1XYPA 4QHOA 3KB5A 2RVAA 2UU9O 2ZAHA 4CDUB 5B1BB 4Y33A 2JEXA 2C5DA 3PVBB 1VBE2 1PO21 4QQPA 4X62O 4QU1A 4FAHA 1XNBA 2BTQA 3HR9A 4DZGA 3WNLA 1VBA1 1ZBA3 5FAXA 1FXKA 3T3YA 4HPKB 2RG4A 4P9PA 2CAZC 4Y22A 1JUHA 1MPXA 4MOAA 3FLRA 1M9NA 1LESA 1J5EB 2DVDA 4YG6A 1JTZX 4LA3A 4QNHB 1O8PA 1AR81 3VUOA 4OUSA 4AWDA 3EBRA 3E6BA 3O1RA 3KKYA 1GICA 3T0AA 4CVUA 5A3NA 2VXJA 2D6LX 3JATA 2WS92 3BB6A 4XJUA 3IDAA 1MSDA 4GA9A 3RT3C 3V64A 3FAVA 4YGEA 3RDIA 3W58A 1AR73 3RYKA 1VF5B 1GFF2 1AXYA 3BOWA 1N47A 2YI9A 3GDBA 4FP3A 3TK1A 4YG0A 4B8EA 1SFPA 2KKWA 3UESA 1H2SB 3QLQA 1FOD1 4WBNA 2G38A 4HZFA 1FFTB 3LOBA 4PA4A 3K77A 1UOGA 1IX9A 3POJA 4L8QA 2AH2A 3DC5A 3G7DA 2VMEA 4LBOA 4B3SO 4AHCA 4MGTA 1URXA 3ZSLA 2VE1A 1EPZA 4N23A 3I55V 5JXGA 5JZGC 5DAVA 1G9BA 3L2YA 5DZGA 4YW1A 3URFA 5FZGA 4FIPC 1ODNA 1JA8A 2Z79A 1VPHA 1DYKA 4HAMA 2WO1A 4FLXA 3O14A 2UXNA 2YIDA 2GC1A 1GZWA 4XE9A 3LSDA 3OD4A 1SQVH 4RQPC 4HOOA 3HPNA 2DFCA 4EROA 2P4VA 5L3FA 4O4IB 1AX0A 3H1JH 3H7YA 3MPPG 4RQFA 3ZXLA 3AG3C 3OGVA 1QU7A 2XJTA 3MLLA 5I93A 3ZVXA 4E4EA 3WUDA 5ITZB 1RM1B 5E79Z 2C9AA 2HWF3 3MPBA 2PHRA 2VCMA 1KFXL 2DBNA 1ND2A 3N9MA 5FO9B 1KXGA 1V6NA 2QE7G 4S2GA 1KBHA 1YQ8A 5FCCA 4M3CF 1SFNA 3ZXAC 2KB1A 5KXEA 3H0OA 4AVCA 5IYZA 3UKVA 3EJKA 2K46A 2VULA 3BTAA 4FSJA 3FFQA 3S3WA 2V1DA 2F17A 3WDUA 5LA1A 4JYCA 2KXLA 1G4YB 4HMZA 1EYBA 3U10A 2WFPA 1JZ6A 5JI7A 2P6JA 4DR7O 2Y4TA 2CWMA 1K92A 1D5AA 3F5TA 1GM9A 3P32A 3ABLC 4UCUA 1TMF1 3A0KA 4Q4V3 2DJVA 1PM9A 1MS8A 4GIQA 4PA7A 1TAEA 3VKOA 4YZ2A 2RR13 1KDMA 4D6TH 5F5IA 3AFKA 2BCCH 4JI6O 3NVCA 1X8MA 2CHHA 5J1XA 4CH6A 3ZFFA 4BLIA 2QKDA 1AROP 1UPGA 3KZIZ 4GX1A 1BMV2 5GZDA 2G9GA 1HJGA 3UQ8A 1JXNA 4YFWA 4O2BB 5FJKA 4CC6A 1XXNA 1MS3A 1UL9A 1ZX5A 3WB0A 1UOFA 1W9YA 2WQ4A 2ZEWA 2EIMC 3RMYA 3CD6V 2BBAA 4AF9A 1LAJA 1K5MA 4F3JA 2E6VA 5BMVB 4FFGA 5FP9A 1OQ1A 3CC4V 4CRQA 3C3VA 1R082 1JOJA 2EXHA 2LROA 1AYN3 3ZXGA 4A5UB 5CBLA 4QKFA 2DOSA 3OYWA 3I3BA 3U37A 4OLLA 1VMGA 4PIZA 4YVSA 4RWUA 4FFIA 2WLKA 4X66O 1NJIW 1R1A2 1ZA7A 1GWMA 3OOXA 2GALA 5JCOA 3SQOA 3KM5A 5IDJA 5EZYB 1YIPA 2AZ2A 1B6QA 1UFIA 2OPWA 3LIGA 1SBDA 3VBUB 2CTRA 4O9EA 2D6KA 4XQDA 5GALA 3TN92 1Y74B 3IGAC 4Q8KA 1ZBA1 3TWIA 2BUKA 3U07A 3UGFA 3I54A 3NKGA 4Q0UA 3T2OA 4QXHA 3E8GA 3LDRA 1O4TA 4YM1A 3FYEB 2BFUS 1BL8A 3K75B 4IE0A 3N4MA 1VLNA 2DE0X 5FY7A 1LHOA 4CCLA 3AJYA 1PM7A 4XJ9A 2OUHA 2OA2A 1VP6A 4RR3A 4H55A 4QKDA 2ZCEA 4ZHNA 5IY5B 4UCSA 3N2KA 3ZMTA 5H9RA 4LF5B 1M5IA 4N53B 1OBNA 4AL9A 1HRV3 1VAVA 1P7GA 2N7GA 4LORA 1TG7A 3ZXDA 3POYA 2IU0A 2W47A 4H2AA 1O9HA 1AR71 1ND2C 1C1FA 1QJX3 1DDLA 4IIJB 1UKGA 3RVZA 3JASA 3KLSA 4HANA 3VN4A 1XEQA 3BTXA 4OPAA 1RUOA 4AI9A 5H9SA 1WW5A 2WNVC 2AZ5A 1Q82W 5F2WA 3CZJA 5B1AB 1QR8A 3BIWE 4LF4O 5T3NA 4MVMA 1LNQA 3BCWA 3VZNA 2WNUB 5IK5A 4XUOA 1FJGO 4Y26A 3POFA 4MVTA 4GKKO 1F51A 3V0AA 1GQHA 1C8M2 2R16A 3AM2A 3GVMA 5EIBC 3W7SA 4LPLA 5DECA 3RWKX 1KS5A 1W05A 3SYPA 3UJOA 1F4AA 4UVBA 1OCRB 1AL23 2XHNA 5F6KA 5A33B 1GWKA 4WFBV 5C4WB 4LKFA 3ASNB 3EXAA 5A7WB 3CX5F 3CJIC 2ZGMA 3N7MA 4OI0A 1U5XA 1GWLA 4DXZA 3ICXA 1FD9A 1XSQA 2BNOA 2VZQA 3J7NA 1HN1A 1N34B 4TUYA 2TNFA 4LCUC 2WT1A 4AI1A 3ZRVA 2O8QA 3WHUA 2WIIB 4LF6B 4DR5O 2HWF1 1Q6HA 3CZUA 2XUMA 5J96B 1QF3A 3R66A 2VJXA 1K5MC 2Q68A 1O3TA 4W65A 3S3XA 5D8AA 3J80N 4COVA 4MTOA 3H1LH 5FXXA 5EBLC 2G4IA 4JDOA 4DV4O 3SITA 1CZVA 1W8ZA 1YHQV 1LOAA 1JZ7A 1PZ9A 3KMHA 3H8OA 4MXVA 1NG0A 2R072 1ZVFA 5J36A 1M4WA 2D93A 1N1SA 1N0JA 1VQLV 2V4AA 1LCLA 1RTVA 1B35C 1MVQA 3W7XA 1D4M3 2Q9LA 5JCOC 1KP2A 1QH6A 4R9AA 2FKXA 1XU2A 3OD0A 4Q4V1 1JYVA 2JG8A 1QDCA 2J1TA 3OY8B 2ZKNA 1A3KA 1T2XA 5FP8A 2VZOA 3MFCA 2UXBO 3CJHA 2GNTA 2D6NA 2RR11 2E7QA 3L73H 2ZKLA 4ZBMA 4O65A 2YROA 1FYJA 3GZTB 1OXCA 1WLTA 2VBBA 5ABJC 3UT5B 2XJQA 3HQRA 1ZREA 3AKTA 4DR4O 3T1YB 4CP2A 4F6RA 3D36A 1H4GA 3IM0A 4K0KB 1NXD1 5AVAA 4KBBA 2EZPA 1O9GA 5FYBA 4RR3C 1UOBA 2WLPA 3EHKA 4KH9A 1DGWX 1BK0A 1PHMA 3ZPYA 3VHOA 1RUH2 4BOWA 1OLME 1LHNA 1H6YA 2D7FA 1LEDA 1JOBA 1EAH3 5CG9A 2CGNA 4RQEA 3W59A 2JVDA 3N9NA 1SBFA 3V0BA 5EJ3A 1CAWB 4CPBA 4WFEA 2BOIA 3VQWA 2VCCA 1AYN1 4PBPA 1ZRIA 5F39A 4MXWA 4OHWA 4J7ZA 3HNYM 4M0HA 3HR0A 1QOSA 5LBEA 3BTZA 1KD1W 2JDUA 3NW4A 2UXCO 1AVMA 4H13B 4LO6B 2Y64A 4XQ4A 1PM4A 3H1IH 1Q8IA 3G4SV 4DW0A 5IJ9A 2HEYF 4Q1RA 4I9QA 4GCZA 1K5QA 3ML0A 4JI7B 4YZ3A 3LDDA 2Y0OA 2XHKA 3QOPA 3R05A 4V2VA 2JG9A 3O12A 1H30A 1DP0A 4J7JA 2L6LA 1Y9QA 2H0VA 3ZHUA 2Z0AA 2YYOA 1PMIA 4LLOA 2DYCA 1LOFA 4X8PA 3K08A 1Q6UA 4AG4A 1DLBA 2A3YA 4FPGA 4JTDB 4HBNA 1JJOA 2QQIA 1DZQA 4AI8A 4ZKIA 2VWKA 3ASOC 1ZZCA 5LMNB 3J26N 4COWA 4HKOA 4QPGC 4MSWC 2Q4SA 2BGOA 1HRV1 1NQJA 2OX0A 3ACFA 2WWUA 3P30A 4MVQA 4HVQA 3RRDA 1QJX1 4P5HA 4DYLA 3B40A 5H6QA 5D8AC 4M4RA 3CXHF 2WA3A 4BH9A 1VRH2 3V56A 4JI5B 4NIAA 4NHKA 3JSLA 4CXYA 4XABA 4UCOA 4CCEA 1HQLA 3JCUZ 2LM3A 3GF6A 1N32B 1YIFA 3OEAA 5IVEA 3KF3A 5FOBB 2HJIA 4AGGA 4RD7A 2YIAA 1UNBA 2SLIA 3PDQA 2N74A 3UGHA 3T2PA 4LFAO 3C7GA 2D6PA 1VB2A 2GH8A 4JAVA 4Z82A 4RUFA 2JG8C 5F37A 4LHKA 4JYAO 4XJWA 3VZLA 2LQTA 5EC1C 1OF3A 2WSSG 1PGL1 2B5UA 3FUOA 4LWSB 1PGW2 3ZN5A 2IXIA 4FPJA 1W0NA 1AL21 5G04L 1H2GA 3AKSA 1QQP3 2P67A 5CBFA 4CDWA 2FD8A 5LYJA 1DF4A 1AR1B 5A7OA 2C0ZA 4CA9A 2VMGA 4R7CA 2R043 5C3OA 1AI6A 3W21A 1JBCA 3D36C 2PELA 4OZXA 2DBIA 4XZUG 3CCRV 1W0OA 4JQRA 3CLPA 1GMGA 2NYYA 1GH6A 2RJ2A 2RDCA 3WF0A 2VZ3A 4GZRB 2WSVA 4YJ2A 1BBT2 2J1RA 5EQUA 2WLJA 3F7VC 2DWEC 1VQOV 2CH7B 4GZ9A 4PDRA 4IETA 2AYHA 2R1DA 3FD9A 2JJ6A 4Q20A 4AGRA 1US3A 4DRXA 3C7FA 3VGIA 1BQ0A 5FXWA 4BK4A 3X2QC 1CVNA 3EMRA 2B1IA 1SQBH 4QX1A 4QGLA 1SLTA 1V54C 1N33B 4K8XA 2EINB 5EBWC 1G8MA 4CEWB 3VBSC 1DYPA 1RUI3 3ATGA 1NVPD 1VARA 4K40A 5T5OA 3ACLA 4FVVA 3IDBB 4I55B 1IGOA 4XURA 1NCQB 1OOPC 1QLEC 2MK3A 4B1LA 5FZ7A 3OT7A 1D4M1 1M57C 4DY3A 4GLXA 1VQKV 2Y8KA 4CDQA 4I0WB 1VIWB 2XG3A 1STMA 3M3QA 4QJFB 4PA6A 4NJ4A 3CMEV 1KITA 4J1WA 2MEV3 4I01A 5IVFA 2BGPA 4CDXA 3OUSA 2BTVC 1M06G 1LECA 4XJ8A 4AZZA 1O4YA 5M0TA 1OSGA 1KYOF 5CVRA 3LIHA 4QB6A 5I0UA 2Q30A 3DXRB 1UZYA 2O14A 1D7PM 1HW5A 1WA4A 4ZHQB 1I3HA 4JTOA 2ETEA 2WO3A 1LJ7A 5D21A 3P3PA 1XQNA 3SDLA 3WDVA 4MGKE 5IVYA 3WNKA 3ES4A 2WO7A 4K3UA 4NPLA 3ZDSA 3ZSMA 2WLLA 3VZMA 3RYHA 1EAH1 1EV12 5C8YA 3E35A 2YUEA 2DCZA 1US6A 1W0KG 1DGRA 5L9RA 1KGYA 2DVFA 2VUDA 5IK7A 1ZRDA 3RI8A 2C4XA 2FDHA 3BU7A 5DPNA 1KJRA 5FZHA 2W87A 1W9SA 1HB2A 2A6XA 2L9LA 1CIYA 1ZX3A 4QQ2A 4C8DA 1V0AA 4NIHA 2DFBA 4W4KA 2HG5C 2ARCA 3NV4A 4AFMA 3I2JA 4KGQA 4LO5B 4MV2A 1S77D 3BYWA 3ZFEA 4CXWA 3LKJA 3M3EA 2WYSA 2XMLA 4IV3B 5FXVA 1SETA 1Z5VA 1C8NA 2XOMA 3WX5A 3JCIA 3JD1A 1MACA 4CDWC 3ZMZA 3AYCA 1PNGA 3ZRWB 4JI0O 4U3JA 5KWRA 5DDJ2 5GKAC 1XHXA 3ILNA 4EE2A 4HNAA 1APNA 5F3EA 1YEWA 2DYRB 3L72H 1JQ0A 3E6CC 3A4UA 1S0JA 5EYXA 2QTOA 5BNQA 1Z5WA 4LBQB 4RS5B 4MZUA 2IW5A 3H3ZA 1OPOA 4P00B 4Y20B 1CAVB 1FXVA 3H8RA 2AR6A 5FQ0A 2W1UA 4IE5A 2IXHA 3VBRC 2P37A 2GNMA 2F1MA 3FB7C 4PA3A 1G6UA 3C2UA 4JI4O 1J3RA 4YVWA 3MHSC 2YI8A 3LOIA 3L2HA 2JDKA 4BQYA 4BQ4A 2XAJA 1LNSA 2IFWA 2WLMA 3TETA 4GB32 2KR2A 2R063 3CCMV 1NLSA 1MEC3 1NLQA 4J9YB 5FY1A 5F5AA 4META 4P5YA 4IEXA 3B5LB 4OZOA 4R9DA 4TZDA 1XJAA 3T4HB 4MVSA 1L3JA 1MS5A 5EHDA 3GXUA 3BIEA 3AL6A 5A6XA 1ULOA 1LUVA 3CC2V 2A6YA 5EYPB 3OTOO 1NXMA 1QQP1 3NWKA 2XB6C 4LNUA 4EV0A 1K33A 3HKCB 1HRI2 4TTGA 3JAMN 2R041 5BNPA 5CB4A 3NQHA 1NTMH 3I3EA 1OVPA 2UY9A 4IQPA 3SC7X 4XCAA 3AP9A 3VQXA 2XONA 4XPVA 3W7UA 3CCJV 1AILA 2WLIA 4DR1B 1XMQB 1PK6A 4MO3M 3G6BA 1PNMA 3SH5A 5BUVA 2D3OW 4H37A 3U14A 3I49A 3AJZA 4H44B 1EN6A 4DR2O 1DQ0A 3NAPB 2VVFA 5LP6A 2D3PA 3TEZA 2VOWA 2DU0A 1W6NA 1HNWO 2JGDB 2BFUL 2WKKA 3HNBM 5LEKA 5DZEA 3B09A 1XNRB 1RUI1 1SACA 1EN4A 3MLKA 1SA0A 2PHUA 4IYIA 4YM2A 3UGGA 4Z1VA 3T0BA 3SJQC 1PIV3 2MHFA 5A6QA 4KHPB 3MW4A 4IDZA 3WP4A 4X89A 5KUKA 2KQXA 2WZR3 2YXSA 1A8DA 4SLIA 4WVMB 5A7QA 2OS2A 3OBTA 5I0DA 2F4VO 1FX5A 4BIOA 3NNMA 4ZKTB 4FFHA 3ABMC 2MEV1 4LITA 3JB8A 2VOKA 1OLQA 3DV8A 4MVOA 2GH2A 1KU9A 5EWSA 3PNAA 3ZFGB 1H2KA 4XDJA 3MIEA 1CAUB 4GKXA 3LDEA 3ACHA 5B4NA 2YIBD 1XNKA 3APOA 1LU1A 1IDSA 4PDWA 4LBQD 4RO2A 1RUJ3 3B2EE 3BCCH 3ZYJB 4WFGA 1F15A 4NTYA 1MMMA 4BA6A 5KC5A 5HXMA 4XAAA 4DUYB 4X20A 4W6XA 4LH6A 2ZQMA 1S5JA 2R1BA 3DCQA 4HSLA 4DFSA 1COV3 4UF0A 4LF8B 5FYYA 3IIIA 2ZEYA 4O4JB 2RS12 1H8VA 4NXMO 1QJU2 3NV3A 3IWZA 1ND3B 2V72A 5IYCO 1DQ2A 3O9OA 3AVRA 4IEOA 4NYKA 3AKPA 2OCCC 3L70H 3OMIB 2WYFA 4FLUA 5B1BC 3ETEA 1BMFG 3E97A 1BS3A 3KV5A 1W03A 1FV3A 2W0FC 4K35A 3AG3B 3Q4HB 2A75A 3LDKA 3TXSA 4PDMA 1GM7A 2VNVA 1IVSA 4AAXA 5J2UB 2HBTA 3RVHA 4FLYA 3LEMA 2XQRA 3WLUA 1N4CA 3KQRA 1W6QA 4IXLA 3W7TA 5CIRA 3T4ZA 1MA1A 1W8TA 2WC2A 2B8MA 2F4PA 2RDSA 1N1VA 3DL3A 3ETDA 4R4ZA 1H2MA 5JXIA 4JCKA 5J2TB 1I08A 4Q4X2 3HBZA 2BU9A 3N9PA 4EFEA 3M7MX 1RUG2 1RUE2 4BR6A 1XNQB 3GCWA 5FZFA 1GKBA 3FJSA 4BAYA 3OJBA 4Q29A 2HEPA 4IEYA 1PK6C 2RS33 1GMMA 3K2OA 1W8FA 5FLHA 2BTQB 1W99A 2Q69A 1FXKB 1HDKA 2VH9A 5FYTA 3LA3A 4UV8A 1I5YA 3WG7C 3ZJZA 2VXRA 3HQXA 4Y22B 1NU1H 5JR2A 1G9DA 5JSOA 3WQ0A 3GYDA 4CYDA 4UW5A 1OLRA 3J7AU 4XF1A 5KXCA 4OXSA 4CU7A 1FXHA 3I2GA 1KB9F 3HKEA 5KMGA 1BT8A 4DK0A 1GN4A 1LHWA 2R061 1AJKA 1MEC1 4CH5A 4OHVA 3JATB 1IKQA 4XFFA 3IAPA 1YFWA 1MOFA 5LHHA 3JCZA 5L3DA 3B9CA 1XRUA 2ETNA 4PF5A 2EIMB 5FY4A 4FOQA 4KQ7A 5KHJA 3FAVB 1R093 4C1WA 3K06A 2OYZA 1D4VB 3KG2A 5FZ9A 5C3QA 2QWOB 2HKOA 4WVZA 3DXUA 1RPRA 4ZXEA 1L7RA 4FM0A 3AP7A 3I97A 5LHGA 3WU2Z 1PVC3