3BY6A

Crystal structure of a transcriptional regulator from oenococcus oeni
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
119
structure length
119
Chain Sequence
QAMAITQKRPVYLQLVDRIKNEVATDVLSANDQLPSVRETALQEKINPNTVAKAYKELEAQKVIRTIPGKGTFITGNTASVKNSNQNRLLADLSQVIAELIKSGVKGERIKKIVNDILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a transcriptional regulator from Oenococcus oeni.
rcsb
source organism Oenococcus oeni
molecule tags Transcription regulator
molecule keywords Predicted transcriptional regulator
total genus 41
structure length 119
sequence length 119
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3by6A01
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3by6A02
1YQAA 4R79A 3JW4A 3T8TA 2W85A 2VONA 3COAC 4I0AA 2P8TA 4KYWA 2VC0A 2DI3A 2O03A 1IN5A 3LWFA 2J5PA 3IRRA 4I01A 2RGVA 4Q48A 3MEXA 1UB9A 2PN6A 5EEHA 2FU4A 1UFMA 1MJAA 2NYXA 2HR3A 2ISYA 2MA3A 2ISZA 2BV6A 3ZN0A 3IWZA 3TOAA 4PGGA 4A5MA 5HS8A 2FMLA 1TW3A 1FYLA 1X3UA 2OA4A 1R22A 4RAZA 3SZPA 3WU0A 1YIOA 4K2EA 1YYVA 2KKOA 1B4AA 1TQPA 2HQRA 3KZZA 4B09A 1F5TA 3WTVC 1O3TA 3DV8A 4EJWA 3Q5FA 5LHIA 1BM9A 2R3SA 4ASNA 2F5FA 4PCQA 4L9NA 4RGSA 1U3EM 1S29A 5HDGA 4MTEA 1G6NA 4G6DA 3BY6A 4LFUA 4HV6A 2IA0A 5E20A 3CUOA 1Z7UA 2P90A 1BOAA 1GHCA 1MDMA 5ICEA 4BNCA 2IPQX 1W7PB 1USSA 1OMIA 3K0LA 3ZMVA 4IPAA 5E8GA 5ERIA 2O8XA 4MQVA 1BI0A 1A04A 4U0WA 2A6HF 5FD5A 2FA5A 2W25A 2XKPA 1R36A 1K78A 2DLLA 2JRTA 1XCBA 1ULYA 4G94A 4U0VA 3IHUA 1YTFB 4G9YA 5DUKA 1B1BA 2FBIA 1G3SA 3BOQA 3VFZA 4A2UA 1FT9A 3BJOA 5DV5A 3GW2A 2A61A 3HRSA 3CO6C 2Q2EA 1KGSA 2VE9A 2M45A 1ZG3A 1YFHA 1E17A 3FMSA 2CFXA 4ZZLA 3F23A 3DQVC 4BYYA 5CVIA 3MFKA 3TGNA 1FX7A 1HXDA 3LAJA 2HOEA 4OMZA 3PQKA 2PG4A 2DK5A 2A6EF 3D3IA 1LNWA 1ZREA 4GYIA 5CVRA 3PFIA 4AIKA 1Z9CA 3HOSA 2Y0MA 1D8KA 3FHZA 4XSZF 1EH7A 2HFHA 1HKSA 1XSDA 3P9CA 3F72A 1HW2A 1TNSA 4MNUA 3M8FA 4MHGA 2ESHA 4G6QA 5FD6A 4CYDA 3WTWC 2UXXA 3P7NA 4O5VA 4IVNA 1O3RA 4ENMA 3GFLA 2EK5A 2MH9A 4RB2C 3TO7A 3U2RA 4OOIA 3GZ6A 2DU9A 4JK1X 1IXRC 3BDDA 4ETSA 2GA1A 3HSEA 4EM1A 5F1RA 2ZXJA 2P5KA 2GA2A 3WGIA 3MZHA 2STTA 2EV6A 3I4PA 2P7CB 2H94A 1IUYA 2KJCA 2CWEA 4EM0B 4ESJA 1QZZA 2CSOA 2JPCA 2ACJA 1RUNA 3SZTA 3ZN1A 2PFBA 2KIMA 3K69A 3RIRA 2ZCWA 1K7AA 1XGSA 4HBLA 4ZZDA 5J8FA 1S7OA 4KIFA 1J59A 4UNOA 4GO1A 1SD6A 2KIFA 3LFKA 3MZYA 2O0YA 4AD9A 4EM2A 1YG2A 2DO7A 4Q4ZF 5IT3A 4UVAA 4RB1A 2TDXA 4Z2YA 4UV8A 2Z33A 1HSJA 3Q9VA 3LSTA 3FM3A 3CUQC 3GX4X 5ED4A 5HDKA 3TDZC 3E6DA 3IWFA 1J2XA 1WWXA 3JAMK 4NB5A 4KNYA 1OYWA 1Z05A 4QLCU 2QZ8A 1ZRDA 1TNTA 4AIJA 1TBXA 2M87A 2K02A 1RUOA 1SFUA 3ZMZA 4YFKF 2D45A 5DDGA 1CGPA 1R5GA 5L3CA 4UXNA 1XGNA 4HW0A 5DCMA 3S2WA 3KEQA 4WX9A 2EV5A 4HZFA 2ADUA 6PAXA 1DUXC 1FY7A 2HYFA 5A2QK 1ZGAA 2L3DA 2KRFA 1R00A 3IRQA 4HOBA 2E1CA 3GFMA 5CYVA 3F8MA 4B8XA 4UHTA 3E5XA 3HYIA 4I02A 3RJPA 3IL2A 1O7FA 5E17F 2FBHA 5D4RA 5K5QA 3I59B 2NNYA 1J7KA 2D1VA 2XAJA 3DP7A 1FBUA 3E3VA 1Z91A 2PBIA 2H6BA 1R1VA 2COMA 3C7JA 1ZLKA 5DYMA 1IN6A 2X4HA 3HIFA 1P6RA 4ESFA 1HQCA 4M6YA 3OOPA 2A3SA 4R1HA 3M1EA 1YO5C 1OYYA 2VBXA 1LDJA 1XSXA 2XVCA 3GFJA 5D5UB 1SFEA 2HGCA 3IC7A 3MQ0A 5ICCA 4KA4A 4IHTA 2V6CA 2XAQA 4S05A 1ZH5A 4ESBA 2QENA 3E6CC 3K9TA 3QRFF 2L02A 3R0AA 3P9IA 2RQPA 3SHFA 1HW5A 1NH2B 2QQ9A 2YU3A 3MWMA 4IHSA 2HDCA 1PUEE 5DD4A 4CO8A 5DD8A 3LA2A 4CGZA 2DW4A 1LEAA 1FBQA 5DEQA 1JGSA 3ZMUA 3WTUC 1DPRA 4QWQA 4KICA 1EH8A 2DAOA 1XMAA 1KA8A 1RZ4A 3L7WA 3AAFA 2DBBA 2JSCA 4EVIA 2HWVA 5CLSA 4HV5A 2QYOA 3T5XA 4OIOF 4HF1A 2FSWA 3ISPA 3RTRA 3GZ5A 3KCCA 1D3YA 2W84A 1XMKA 1EH6A 1HBXG 2EFQA 3F3XA 1S8NA 1Z6RA 2FXAA 2YPRA 2D1HA 1T2KA 1XD7A 3C18A 2IRFG 3VB2A 1H0MA 3LA3A 3P9KA 3SXYA 1EV7A 3JAMZ 3BP8A 1TTYA 4YIIA 1TLHB 4Q47A 4CHUA 4RGUA 3GWZA 4P96A 5ILUA 4M9XA 2L01A 2K27A 3QOPA 2L54A 1OKRA 5LBQA 1G3WA 3SQNA 1QPMA 5KVRA 2PJPA 1KU3A 1F9NA 3CLOA 4O3MA 4HX7A 3NEUA 3I59A 1G4DA 2YX4A 4GCVA 4I0BA 5HLIA 1SD4A 2WTEA 1UHWA 3FMRA 1AWCA 3W6KB 1YTYA 2F5EA 1AOYA 3QU3A 1BC7C 3J80Z 2CO5A 4KIGA 2AXLA 4IRGA 5GW7A 2GQQA 4YIFA 2L4MA 4CXFA 4HX8A 3ABTA 3ECHA 4NHJA 3I71A 1BIBA 3JSPA 1I6XA 1V4RA 5HOOA 3GXOA 2GXBA 1BI2A 4EMSA 3V7CA 3ULQB 2FMYA 4A6DA 4A0ZA 2K4JA 4KT5C 2DFIA 4KUMA 3I5UA 1HKQA 3L9FA 1P4XA 2ZNYA 2J5OA 1T0FA 2Z9OA 1LJ9A 2PI0A 2QBYA 1FNNA 3CJNA 4ZYGA 3C1DA 1WRJA 2V79A 5K5OA 2LNBA 1KYZA 3HUGA 5HDNA 4L5JA 3O6BB 2RVCA 4P55A 1ZGJA 5J8CA 1RM1C 3FMQA 3WTSC 2K4BA 2O6GE 1SMYF 2EA2A 1STZA 4R8HA 4LLGF 3KP3A 2F2EA 2IA2A 3Q9SA 3U9GA 3R61A 3I64A 3TO6A 5D4SA 4OIPF 4XLPF 5CVVA 3F8CA 3ERED 2Z3YA 3G3ZA 3KP7A 1IN8A 2P6TA 5F6FA 1FBSA 1QBJA 2QBYB 2MLGA 1USTA 3WTTC 4LLLA 4FX4A 1JE8A 4P5OA 2PMUA 4YG2F 5LEJA 5JR3A 2FNAA 2V1DA 3C3WA 2Z99A 5D6EA 5L3DA 4M73A 2A69F 5LGUA 3R6SA 2LSOA 4EJUA 1YW9A 2X0LA 3RPUA 3L2CA 3MAJA 4AVPA 5TRDA 3KETA 2ELHA 3ECOA 1KYWA 1MKMA 5D8LB 2EWNA 4H0EA 4BAYA 4JQFA 3E97A 2GXGA 2ZNZA 3F8NA 4M9SA 3FXQA 2NAZA 1W7PD 1XCVA 4P9UA 3M8EA 1KU9A 4Y17A 2XHKA 5FFXA 3KP6A 1KQ0A 4ZYDA 3EYIA 4N9HA 1PP7U 5HS7A 1QQIA 2IT0A 1HKTA 3BPXA 1XB4A 3E35A 3W7SA 4BQAA 2OBPA 3I54A 2P4WA 1IRGA 1SD7A 2K7LA 3FXRA 1GVJA 5JVTA 3HRUA 1D5VA 1J5YA 1WKMA 1ONVA 1PDNC 4BHCA 2OQGA 5FO5A 3JSOA 2M8EA 3QP6A 1T39A 2DPDA 1RIOH 2XAFA 3W7UA 2CG4A 3VOEA 1UCRA 5D5WB 3KLNA 2WWYA 2PMHA 2NRAC 4WWCA 2V9VA 5AIQA 4L0ZB 1Z6TA 2Z5UA 3K1PA 3W7WA 2EFOA 1TW2A 2PEXA 4A0XA 5DUIA 3BZ6A 5LGNA 1P92A 3OV8A 4L5IA 3W6JB 3GVAA 2EV0A 5D6FA 5KK1A 1W4MA 1B9MA 4MEYF 2OZ6A 2CGPA 4HDVA 3TDUC 3T0YA 3W7XA 1RNLA 3V8LA 1OPCA 1LB2A 1BI1A 2JTVA 5BPDA 1H9GA 1R7JA 2VE8A 3WE3A 2YX7A 4A12A 5L3GA 4HLYA 3KEOA 3WGHA 5H6QA 5L3BA 2NNNA 2BYVE 2HQNA 5FLXK 4KDPA 4MEXF 2UWMA 2W57A 1XGOA 5H6RA 2DQLA 1U6GA 2PQ8A 1U2WA 1OYIA 2XROA 3IKTA 5LEKA 4MQ9F 5ICGA 1XGMA 5ILSA 3J81Z 2E7WA 3D0SA 1E2XA 2ZFWA 2F5DA 4RGRA 4CICA 2HS5A 5LRSA 2QM3A 1FP2A 1Q1HA 5IT9Z 1BI3A 4CZZA 3FXUA 2YSRA 1O3QA 2R7DA 2WV0A 2NS0A 3GEZA 3ROUA 3F8BA 4IRHA 4HX4A 2ZJ2A 1FOKA 2A5YB 3B02A 3CUQB 4XBFA 3BJAA 1NHAA 4TV7A 3LAPA 1FP1D 4BH9A 1IXCA 2Q8KA 3ABUA 4NQWA 2YR2A 4FHTA 2VN2A 1ZLJA 1IN7A 2EJRA 2CYYA 3H92A 2UZKA 4RB0A 2G7HA 3N97A 3BROA 4M9ZA 2G7UA 2GZWA 3HHGA 3NRVA 4XRFA 2FF4A 2BEOA 1NVPB 2EA4A 3WGGA 2XAGA 4AWXB 4EQQA 4LG0A 4HQMA 3RPQA 2MC3A 5FGMA 2VC1A 3QPTA 3PQJA 2O61A 3K2ZA 4BXUA 1DPUA 4N9IA 2V1UA 3JTHA 4JBAA 3L09A 1O57A 4KFCA 4L9JA 3N4MA 2EFWA 1BN5A 1QO0D 3E5QA 5AIPA 4GGGA 5BPIA 3RKYA 5E18F 4EJVA 1LQ1A 1ZRCA 4ENJA 2HZTA 4D0PA 1V3FA 1FPQA 3GFIA 2DK8A 3WTYC 2P7VB 1BBYA 4HDUA 2VOOA 2AS5F 1T38A 3T1BA 4RAYA 3DPTA 2D2WA 1OR7A 3E6BA 2JPBA 3KE2A 2E7XA 5HS9A 1ZN2A 5HLGA 3FM5A 2IW5A 1IAWA 2KIUA 1J75A 4EGZA 2OU2A 2XIGA 2H27A 1J9IA 1ZG5A 3SFZA 3GLXA 2IA1A 3F21A 2VOPA 4WF2A 5D8KB 4ON0A 1XN7A 2RN7A 2DQRA 4KIBA 3HRMA 5HLHA 4I98B 1LVAA 5A2QZ 3QP5A 5LRRA 3R0JA 1O3SA 4G8XA 4M72A 1LDDA 3HTSB 3TQNA 2W24A 3ZMSA 1IZ1A 3RDIA 4ZH4F 1QZYA 3KFWX 4LK1F 2QLZA 4IJAA 2WC2A 4L9VA 3O2PE 5FFZA 2E1NA 2UXNA 1R23A 3HSFA 4UVBA 4U0YA 2FEZA 2PLYA 2Q0OA 4BHBA 1CF7B 2Y75A 3F6OA 2MLKA 2RNJA 1U5TB 4U7DA 1Y0UA 4IXAA 2JT1A 1F4KA 1PP8F 5E1XA 3EUHA 3CO7C 4WXDA 3FF5A 2EFPA 2JZYA 5EEGA 3F22A 1S7AA 2CQKA 1K6OA 3EDPA 5DCFA 5D5VB 5HVQC 3WTZA 2LDUA 3QPHA 4EV0A 1QNTA 2P6SA 1IW7F 3U1DA 4LJZF 4L0YB 2OZUA 3GF2A 5CVJA 3G73A 5BQTA 4M6XA 1W7PA 3VODA 4LB6B 1MD0A 4UV9A 4G7HF 3I53A 3V4GA 2M5WA 4OMYA 2GWRA 3JTGA 5FB2A 4FT8A 1R1UA 2LF7A 3V8KA 1C0WA 5LHHA 1ODDA 2IVMA 2RV8A 2MH2A 3K1NA 1ON1A 4I7HA 3M7GA 2VT2A 1K79A 4WCGA 4LGWA 4RS8A 2A07F 5JHUA 1WSUA 4N0BA 4OINF 3DEUA 4L9TA 1T6SA 2HYGD 2IP2A 1BC8C 1ZYRF 2MD5A 1TQMA 2VBWA 3V7RA 4WXHA 5JI6A 3HOTA 5L3FA 1K78B 3IKVA 2DTRA 4HA8A 4Q5SF 2QQAA 3KP4A 2IJLA 4S04A 2VXZA 2DPUA 2STWA 4MGRA 3V8JA 2H09A 1MJBA 3E5UA 4ENKA 1MJ9A 1KU7A 4AIHA 1I1SA 1KU2A 2ZMEA 4Y15A 1ZG1A 4LG0B 1KQ8A 4OIRF 3BPVA 1J0RA 1YLFA 5J6XA 1KQ9A 1FLIA 2C6YA 3F8FA 1GXPA 2XUBA 4IRIA 4XLNF 1R1TA 4I2OA 1SAXA 3NQOA 1YW8A 2QQBA 4HF2A 3R4KA 1WQ2A 3H3ZA 3TO9A 5L3EA 2VT3A 4GYGA 4F7ZA 1SMTA 3FZVA 3ZMDA 1D8JA 1FYKA 5CVUA 2LKPA 2R7FA 2GIVA 5JFRA 2FRHA 3GUDA 2EB7A 4U7BA 1YS6A 2HTJA 4HLXA 1S6LA 1G3TA 3LQQA 1QGPA 5CA3A 3QAHA 2F5CA 2ZMEB 4FX0A 3BJ6A 3HSRA 3HHHA 5LGTA 1F1ZA 5E1WA 2FOKA 1G3YA 3DF8A 4PDKA 4LK0F 2CW0F 1ZAOA 4EJTA 2FE3A 2HTSA 4RB3C 3EQLF 3CDHA 2LF8A 3D5LA 5BS6A 4M71A 3F6VA 5CJ9A 2XRNA 2OD5A 1S3JA 3B73A 3TKYA 3KLOA 1FSEA 2HKOA 2ESNA 3ZMTA 2O3FA 4YFNF 1LDKB 4G7ZF 4KN4X 1R5HA 1SD5A 5K1YA 3MCZA 4UVCA 1I5ZA 1DP7P 1I27A 3T8RA 1P4AA 5DCMB 1R58A 2BE5F 1U5TC 1MGTA 4IF4A 1XSVA 5E8IA 2B0LA 1IXSB 1HSTA 4ZYHA 4XSXF 4A6EA 3J7AO 2RDPA 2OQRA 1CF7A 5E1ZB 1JXSA 4KMFA 1IF1A 1U5TA 4O6JA 1L3LA 1JHHA 3H3UA 3WODF 4KN7X 1P4WA 1ZRFA 2RKHA 1LEBA 5BMZA 3ZQ7A 1REPC 2EFNA 3RYPA 3LQRA 2HEOA 5BOXA 5IT9K 3V7SA 2RC4A 3KP2A 1TQIA 2XAHA 2XASA 3BWGA 4ZYEA 4HF0A 4LB5A 2A68F 2VODA 5ILVA 3RI4A 2M30A 1T98A 1Z1DA 5ICFA 2G9WA 3O3KA 2WAMA 4GXOA 4I09A 4CDGA 1YS7A 1GXQA 2XGXA 1MDMB 4LLNA 2DT5A 4OIQF 5F64A 2XV4S 4L18B 3TOBA 1FYMA 5AONA 3CUQA 2QUFA 4WK8F 2MBFA 2BGCA 4E70A 1B59A 2BBYA 3I58A 4KMUX 3ELKA 4LMYA 4HYEA 4LD5A 2VBYA 1FZPB 2M1BA 1WI9A 3DXJF 1XDSA 3WE2A 5LLQA 1O7LA 2VBZA 5LHGA 5TJJA 3RKXA 3DKWA 5H20A 4Y13A 5FLXZ 4ENNA 3KP5A 1H9TA 1UHMA 4EGYA 3R60A 1U78A 1MZBA 4PZJA 4MTDA 2L4AA 2QWWA 2ZBKA 3GYHX 3WU1B 3KZYA 3J80K 2HKXA 4RGXA 3RYRA 3J81K 3I0TA 1RI7A 2K86A 3GO5A 1HW1A 1VTNC 1I1GA 4U88A 1W5SA 3M9AA 4UUVA 2KJBA 1BIAA 3L00A 4BHPA 4DNCA 2P5VA 3VEPA 3RKWA 3WG9A 1SFXA 2V1XA 1DDNA 4PGHA 2FNPA 2GAUA 4G7OF 1P2FA 3W7TA 1W5TA 1JHFA 3REOA 1ZARA 3LA7A 3ML6A 4M74A 4HAMA 1IRFA 2P5LC 5D5XB 1XDUA 3EETA 3E6MA 4YFXF 3FWEA 1BJAA 1YW7A 4DQ2A 4HQEA 3ZPLA 2FQ3A 2Y48A 4WXCA 4P9FA 3ZP5A 1FC3A 4A0YA 3CTAA 3DPLC 3DFGA 3WTXC 1B6AA 3K1MA 4OU0A 3QU6A 1FSHA 2QVOA 2ZO4A 2H6CA 2ETHA 2XKOA 3FX3A 3HRTA 5K5RA 3EYYA 4EJOA 2ZKZA 1FWZA 2OAZA 2FBKA 1IN4A 3HTUA 4A5NA 1L0OC 1ZHFA 1B9NA 1ON2A 1U8RA
chains in the Genus database with same CATH superfamily
4W4LA 4X1EA 5JLWA 3A2FA 1BR4A 1YQAA 2Y9ZA 4R79A 2WPDG 3JW4A 2VKVA 3T8TA 4YHHB 1SAUA 3CMYA 4AYBN 2MABA 2PTMA 4P9OA 2W85A 3J7AU 2VONA 2OTLV 3COAC 3D3QA 1KP3A 1AP5A 3FXLA 1N32B 4I0AA 5E1AC 2P8TA 4D7TA 4KYWA 2VC0A 2DI3A 3FXJA 4JI8O 4YIPA 4FIPC 4JV5O 3PO2J 1PM9A 2O03A 4G27B 5JHFA 4HSTA 2OF7A 1IN5A 3LWFA 2E1MC 3AEIA 5B1AB 4JI8B 3G1MA 5GPCA 2P81A 2J5PA 3HG9A 1SC5B 3J81N 3ZOBA 3IRRA 4I01A 3SGIA 4CS2A 2RGVA 5KHJA 4Q48A 2QSHX 2YEVB 4S0HB 2W0XA 1Z7LA 3MEXA 2L35A 4RM2A 1UB9A 2PN6A 5EEHA 1R6TA 2DODA 2FU4A 2C2AA 3J80N 1UFMA 1MZEA 5M5YJ 1MJAA 4X89A 1HNZB 1P7BA 5K7ZA 2NYXA 2HR3A 2ISYA 3JRIA 5KLVH 2B9SA 2E5NA 2R9AA 3LSQA 5IYDJ 3RGBA 1WJAA 3QODA 3PUFA 2IS6A 2M7BA 3HR0A 2MA3A 4O2BA 1H8AC 1MMMA 2VUMJ 1FAFA 3SYCA 2ISZA 2F1MA 2BV6A 3ZN0A 4A5UB 3IWZA 2YUSA 3A8TA 3TETA 3BCBA 4J41A 3ZX6A 3TOAA 4PGGA 4A5MA 4X6AJ 3WB1A 5HS8A 1QNMA 2FMLA 1TW3A 2OC6A 5FKKA 1FYLA 1JFFA 2ZE8A 4XN3A 2ID3A 1X3UA 2BZTA 4DV7O 2R92J 3MAQA 3NR7A 1Y67A 2OA4A 2ZQMA 1R22A 3RSNA 3S1RJ 4RAZA 3SZPA 4TSFG 2XAUA 4ZDPA 2MYSA 3WU0A 1YIOA 3PM1A 4K2EA 3VSLA 3WU2C 1TA8A 3OS0A 1N77A 4F52A 1VQ5I 2P4VA 2MC4A 1YYVA 4LF5B 2KKOA 1B4AA 4BIOA 2L9NA 4UUSB 4LH6A 3NWSA 2JVDA 4YELA 3K59A 1TQPA 2HQRA 2BW3B 4TQFA 3KZZA 4B09A 1IBKB 4DK1A 1F5TA 2DE0X 1ZAUA 1HW7A 2IJHA 4RMNA 3WTVC 3QYFA 3OIOA 1T8IA 1O3TA 3B8MA 3DV8A 1FXVA 2WY7Q 4EJWA 1T08B 3Q5FA 1I08A 3E22A 3T1YB 2DMPA 5LHIA 1BM9A 1MBFA 2R3SA 2E2IJ 1Q86W 4BIZA 3RFRA 2R7ZJ 4X65O 4ASNA 2F5FA 5EZYA 1LVKA 4PCQA 1K4SA 2JA5J 2OTLI 4HRIA 4L9NA 4RGSA 1U3EM 1S29A 5HDGA 2CH0A 4MTEA 4UCOA 1G6NA 4G6DA 5BR8O 5E3MA 4AM3A 4H44B 3I56I 4MVZA 2UV1A 3BY6A 2R7OA 1XI1A 1LFUP 1POGA 4HV6A 4LFUA 2IA0A 3OGIB 5E20A 4E7KA 3CUOA 2K40A 2DMQA 4NBQA 4X20B 1GMGA 3CC4I 4LFBB 2JJ2G 4XK4A 3OYGA 1Z7UA 5EZGA 2BOBC 4BKXA 1P4RA 5JVDA 3SFIA 3CRRA 1AHDP 3U21A 2P90A 1YRNB 3MD0A 4R7CA 4DW0A 1BOAA 1GHCA 1MDMA 5ICEA 1P84F 5B66C 3FFQA 4BNCA 1IBLB 4LR3A 3QVNA 1M1KW 4GRIA 4U87A 3VDXA 1Z67A 2VIXA 3OMAB 2IPQX 1W7PB 4WFGA 1USSA 1OMIA 5JJJB 3SJBC 3K0LA 2ZSIB 3ZMVA 4IPAA 5E8GA 3L2WA 1TP4A 3IP4B 5ERIA 4B3SB 1FJGO 2O8XA 3QPLA 5B1BB 4ZTJA 4MQVA 1BE3H 1H2GA 1PV0A 4EFEA 3OMNB 5F0HA 2PMZA 3RYHA 1BI0A 1A04A 3G1LA 4U0WA 4MVQA 3G71V 2A6HF 2WAQN 4IL6Z 1HF0A 5FD5A 2FA5A 1AI6A 2W25A 2XKPA 5FKNA 2K9QA 3QO7A 4H0LB 4NXNB 4QNHB 1L1FA 3BG3A 2ZD9A 3ZHVA 3SJQC 1VQKV 4Y4RA 3DSQA 1B8IA 1R36A 3H9VA 2LOOA 1K78A 4JOMA 2K9PA 2DLLA 3JRDA 2GLOA 4G2KA 2MW2B 2JRTA 3K5OA 3M1CA 1XCBA 1QVUA 4V2GA 1QU7A 1TGOA 2JDIG 5KAFZ 3T1HO 1ULYA 1YI2V 3KYCB 4G94A 1P9QC 4U0VA 3S32A 4D6TH 1DTOA 1LE8B 3SDGA 4JI1B 4DR7B 3IHUA 3ZCCA 4DRXB 1YTFB 1FFXA 2ARHA 3M8JA 4G9YA 5DUKA 1BHAA 1SQFA 1EN6A 1UJ8A 1WH7A 1B1BA 2FBIA 2YS9A 4DYCA 2QGNA 5JWPA 3WG7C 3N05A 5J1YA 4CCNA 3JAMN 1G3SA 3G6BA 2WBMA 1MNEA 3BOQA 3HUGB 3VFZA 4A2UA 1FT9A 4RLQA 4F91B 3BJOA 1MZFA 4K0KO 1BS3A 2YXYA 2VLAA 4DV7B 5DV5A 3GW2A 1PJRA 4XKVA 2B7EA 2JWTA 2A61A 3HRSA 3NWTA 4BJ5C 4CSWA 5DM7F 2Q2EA 4RA2A 3CO6C 1QLEC 1ETQA 1KGSA 2VE9A 5EC1C 1YX5A 1RM1B 2M45A 1ZG3A 1YFHA 4LF6B 3HEFA 1E17A 3K5NA 2GIZA 3BR5A 3FMSA 2CW7A 2BY1A 3QWLA 1QZEA 2CFXA 4BEHB 4ZZLA 5HLTA 1MNGA 2CTRA 4MT8A 4CC5A 4CCJA 3F23A 2VWKA 3I56V 5FJ8J 4IGGA 4X66B 5DS9A 3DQVC 3CMAV 4B3TB 4BYYA 3DBRB 3K4NA 1XMQB 4F92B 2CUGA 3JATB 5CA0A 2IU0A 3OYHA 5CVIA 3UM7A 2AZ2A 3MFKA 4Z1MG 3TGNA 1FX7A 2FL4A 3G6EI 1HXDA 3LAJA 3MHHC 4EATA 3GTKJ 1I50J 2NOJB 1AP6A 2HOEA 4OMZA 4X1IA 2CU7A 3PQKA 2KP6A 4DW6A 4O4HB 2X9DA 2YI8A 2PG4A 2DK5A 2A6EF 2IBDA 1YHQI 3D3IA 1LNWA 2L9VA 1ZREA 2DYSB 2TCTA 3WHBA 4GYIA 5CVRA 1WA8B 3FXMA 3PFIA 4AIKA 1Z9CA 4C3HJ 3HOSA 1JVMA 2Y0MA 2JUGA 4FFBB 2XT9A 1D8KA 2ATKC 1I5XA 5J4VA 4XSZF 2WA0A 3FHZA 2V4DA 3G1OA 1EH7A 4DGWB 1IX9A 3DEWA 2IM9A 2BW3A 3X2QB 2HFHA 3AG1H 1HKSA 1AI5A 4B3XA 1XSDA 2OPTA 4K35A 2MG4A 1MBHA 3P9CA 4PJNA 1E0EA 3U1KA 3ABKB 1Z3XA 2OUMA 1I3AA 3JASA 1I6HJ 3F72A 1HW2A 1G8XA 1OCOH 1X4TA 1TNSA 4GLXA 1DGSA 4MNUA 3M8FA 1KC8W 4MHGA 2ZSHB 1X4PA 5EYPB 4Y52J 1CP9A 1D5AA 2ESHA 4B7EA 2D3OW 4XORA 4G6QA 4TV9B 3AG7A 5FD6A 1QHHD 4CYDA 2YEVA 3WTWC 3CB2A 2LW1A 4DV2O 3OUSA 3F9KA 2UXXA 2KB1A 3P7NA 1N8RW 4O5VA 2VJ4A 1I39A 4UB8C 3S3OA 1S72I 4IVNA 1VQOI 3E8HA 4QPKA 4I0XA 4I99C 1O3RA 4B47A 4ENMA 3GFLA 4B3SO 2EK5A 2F4VO 4I4TB 3FB8C 2MH9A 3CCQI 4RB2C 3LL7A 1Y8RB 1YJ9I 3TO7A 5FKOA 3U2RA 4GT1A 5IJ9A 5LOVB 4OOIA 4LFAO 3GZ6A 3ABMH 3S3XA 3LDCA 1AJNA 1YEWA 2DU9A 5M5WJ 4WBNB 4DYQA 4JK1X 4BDZA 3BABA 1IXRC 3BDDA 3IH2A 4ETSA 4I5SA 3ZR8X 1QPIA 1JJ2U 2GA1A 3HSEA 1E3OC 3PNVA 4CH3A 4PJMA 4IQ4A 1I0HA 1HCRA 4M3GA 1SF9A 2IAIA 3BQYA 3P30A 4EM1A 4BXFA 5F1RA 2O8KA 3O8GA 2ZXJA 1IC8A 4J01A 2P5KA 2JS3A 2DYSC 3L75H 3QO5A 3MD2A 4IYIA 2GA2A 3WGIA 3M3YJ 2QCOA 3MZHA 2STTA 5CQGA 4OPAA 3BT9A 2EV6A 1DGRM 3I4PA 4DV5B 2P7CB 4U7OA 3A01A 3FBNB 2H94A 4X1KA 4ZKIA 3HPLC 1XC5A 1MSDA 2F95B 1WHUA 1IUYA 1K5SA 4ZI7B 5C4XJ 2KJCA 3BLYA 3H01A 2CWEA 5F08A 4EM0B 4ESJA 1NVPD 1BJZA 3BTLA 4CH6A 4YY3B 3OEEG 3OL4A 1QZZA 2CSOA 2JPCA 2B1IA 2ACJA 1RUNA 4LWSA 3SZTA 3BA9A 3ZN1A 4IQJA 3TK1A 2PFBA 3UCSC 2EILH 2KIMA 3K69A 5J1UA 3RIRA 2WWWA 3BPZA 3MN2A 1LE8A 4AU7A 1V54H 1SQQH 3L70H 2ZCWA 3RBZA 3GTPJ 4DYLA 2BOCC 2TRTA 1K7AA 1IBMO 3RQ4A 2M0CA 2PGGA 1EKEA 1Z2GA 1XGSA 2DMNA 4HBLA 4ZZDA 5J8FA 2VPLA 1P7JA 1S7OA 4KIFA 1J59A 2QKAA 4UNOA 4GCZA 4GO1A 1FIAA 2EINH 1SD6A 5EIBC 2IJIA 3CP2A 2KIFA 1M56B 5F2VO 1SANA 1PP9H 3DU5A 1YJWI 3BZKA 3LFKA 1X19A 2GTSA 3MZYA 1VQMI 1B72B 1SETA 3QF7A 4X66O 1VQ8V 3I4NJ 2O0YA 4AD9A 1FEXA 4JAAA 4MTOA 4O2AB 4B08A 3AL0B 1AILA 1T56A 2FX0A 2VQEO 3HOYJ 4EM2A 5JVGF 4PSWA 4IHJA 3STLC 3BG9A 1YG2A 3G80A 2DO7A 4Q4ZF 5IT3A 3JREA 3M4OJ 2IS4A 4HNAA 1HNXB 4JI4B 5J2UA 3DTEA 2P06A 3W2AA 1Y39A 4XICA 1R6KA 2X1DA 3APOA 4UVAA 3A0HZ 3W2VA 4LIVA 4RB1A 4XR6A 1K4DC 2TDXA 4Z2YA 2BSKB 2MW8A 4MLOA 1OCZB 4UV8A 4GUNA 3VBBA 2Z33A 1HSJA 3Q9VA 2VASA 2A0LA 3LSTA 2R7VA 3FM3A 2DMXA 2PJRB 1R6NA 1GM7A 3CUQC 4LBEC 3GX4X 3G2BA 2W82A 1YITV 4YIOA 5ED4A 2VQLA 1X1DA 5HDKA 3IFXA 3JSNA 5GTHC 2QWPB 2DT7B 2QE7G 4CH5A 2I5UA 4MW8A 3JCUC 4PK4A 3TDZC 3FYIB 3E6DA 1VQ4V 3IWFA 1J2XA 1WWXA 2UUAB 3JAMK 4NB5A 4KNYA 4FLZA 1OYWA 2BY2A 1TC3C 1Z05A 4BU2A 3JASB 4QLCU 1XNRO 1WP7A 3FK7A 4DR6B 2QZ8A 1ZRDA 2BVMA 3QG5A 1TNTA 4AIJA 4JI7O 1TBXA 1DQUA 3FAVA 2M87A 1XMOO 2EINC 2K02A 1VZ0A 3AG3H 2RQQA 1RUOA 3E8GA 4DV0B 1SFUA 3WG7B 4FLVA 3OR1C 3ZMZA 4DXWA 1H8HG 1WFXA 4YFKF 2R72A 1HP8A 1N33B 2D45A 5HFLA 5DDGA 4PJ0C 1CGPA 4JX6A 2KDZA 5GTHZ 4B3RB 5HNFA 1QRYA 1R5GA 5L3CA 5M5XJ 2BVLA 2H1KA 2YSUB 4CYCB 1RKTA 4UXNA 1XGNA 2ZINA 3OGCC 2E60A 4HW0A 4NXMB 1IRXA 2JVGA 2WLLB 1JT0A 4BJ6C 2EILC 4I9WA 4TUYB 1MMNA 2XGDA 2E5LO 2XSJC 5DCMA 3S2WA 3CS5A 4IX7A 2V7FA 3KEQA 2EV5A 4WX9A 4HZFA 4IHYA 1HNWO 2LQTA 4B7KA 4XN0A 2ADUA 4JYCA 3CESA 1PKXA 2XOKG 4IEJA 2XF7A 6PAXA 1F43A 4MFDA 4A3LJ 2B9ZA 4A3FJ 1DUXC 1OCRC 3ETQA 5B5EZ 2YI9A 1FY7A 1DU6A 2QWNB 4MVMA 1VQOV 1V5GA 4IHXA 1D1BA 2HYFA 3B8NA 5A2QK 1OHHG 1ZGAA 2L3DA 2Q9LA 2KRFA 2K1EA 3E8FA 4AIDA 3IAM2 1R00A 3IRQA 1ZGWA 2K9SA 3D8CA 4PA7A 3I4MJ 1DLBA 3UT5B 4HOBA 2E1CA 2HDDA 1JTXA 2LFSA 3K2AA 3GFMA 1X1CA 5CYVA 4RO2A 1VQ6V 5LP6B 2QEXV 3F8MA 4ZBMA 3K9SA 4B8XA 3CF2A 1WPBA 4XMYA 2JK5C 4A3JJ 1IBLO 4UHTA 2YS8A 1AJPA 2QM8A 2LBFB 3E5XA 2JGUA 3AK1A 3HYIA 2M34A 5KMGA 4I02A 4XKWA 3RJPA 2RNGA 1O7FA 3IL2A 5E79C 5E17F 4MVRA 4YXWG 3OYKA 1ZUQA 2FBHA 5K5QA 5D4RA 1WVRA 2RQ6A 3I59B 1GV5A 2NNYA 1J7KA 2D1VA 2EQRA 2XAJA 1FBUA 3DP7A 2HLDG 4IHJB 3BR1A 3E3VA 1FTZA 3CJRB 2V6EA 2RMKB 1Z91A 2PBIA 1JFFB 2H6BA 1R1VA 1FJGB 2COMA 4TV9A 3C7JA 4XDJA 3CJTB 3K7AJ 1DF5A 3J7ZI 1WCMJ 4NTWA 1ZLKA 4DV6B 3F5WC 4I50A 1H2LA 1VP7A 1LNQA 5DYMA 5E3LA 4JTDB 4K8ZA 3E0JB 1ENVA 1IN6A 2X4HA 3HIFA 1OJLA 1P6RA 3K10A 1RRJA 2Q68A 3OTFA 3RYHB 3ZGKA 4ESFA 3BCCH 1HQCA 4JI3B 1XNQO 4M6YA 1OCOC 5LMUB 3OOPA 3BR3A 4TUYA 4DK0A 1J5EB 2A3SA 4R1HA 5LP6C 1I94O 1BR1A 3M1EA 3B77A 4XRMA 5EBLC 5FPOA 1YO5C 1B06A 3H1JH 2PYLA 1OYYA 3CCUI 4QE9A 1W5CC 1X1AA 1LDJA 1XSXA 2VBXA 2XVCA 1FXKC 3RYIB 3CQZJ 1KB9F 3GFJA 4ZDLA 5B5EC 5D5UB 4FLTA 1SFEA 3JD1A 3TGUH 2KZVA 1VQNI 1B04A 4M6VA 3O65A 3CC7V 2HGCA 3PN1A 1IV6A 2Y30A 3IC7A 1Q3EA 1MMAA 2QM4A 3AG4B 4Q6GA 4UCTA 3MQ0A 3FAVB 3SYAA 1NU1H 5ICCA 2F5VA 4KA4A 1K33A 4IHTA 2AW9A 2P4KA 2V6CA 5IWAB 2XAQA 2E75B 3E8BA 4S05A 1ZH5A 4LF6O 1T33A 3HZJA 4ESBA 3DEEA 4YEJA 2QENA 4BUPA 3E6CC 3K9TA 4UCUA 3QRFF 2L02A 5IYDO 3R0AA 3QOEA 3I55I 3P9IA 1ACIA 2RQPA 2ZKOA 3SHFA 1APLC 1HW5A 1PYVA 2YIBD 2LMDA 2NS7A 2ITCC 2HNHA 5EIBD 3SYOA 2LG4A 1NH2B 2MFZA 2QQ9A 1OCZH 2L7MP 2HQAA 1V55H 3TCUA 2YU3A 3MWMA 2JJ7A 4IHSA 5EF6A 2HDCA 4XQFA 1PUEE 1WH5A 5DD4A 3JRAA 2VRZA 2ETNA 1MH3A 4KITB 3HKBB 4CO8A 4XDLA 3LFUA 2VKHA 5DD8A 3G71I 2ECBA 3LA2A 1XUQA 1I7FA 4CGZA 3OR6C 2DW4A 1W36D 1B3QA 1LEAA 1E1RG 4FJCC 1TWAJ 4NR1A 1GRJA 1FBQA 1W59A 3FYEB 3GBGA 1JGSA 5DEQA 1N75A 1F4NA 3ABLC 4CYCA 2GOMA 3SPJA 5FKMA 4RDUA 3QTCA 2DN0A 5C8YA 3ZMUA 1NTMH 3WTUC 1YE9A 2DYRB 4ZYAA 2EIMB 4O4IA 4BXXJ 1DPRA 3FKSG 3ASOB 3QQAA 4QWQA 3THOA 4KICA 2RAEA 1EH8A 1OQYA 3H9JA 2DMTA 2DAOA 3HB3B 1VF6A 2R7XA 1M57B 1XMAA 5JQGA 1Z5WA 1BOBA 1X1PA 1KA8A 1RZ4A 4EEQA 4CCMA 1B8IB 3L7WA 2AHZA 1YJNI 3AAFA 2DBBA 2JSCA 4EVIA 4DR3O 4BQNA 2EILB 2VJJA 1KBHA 1BR2A 2HVKC 4HSRA 3ASNB 2EZOA 2HWVA 5CLSA 1IBMB 4HV5A 3DWLE 3HKEB 3K58A 2P67A 5B66Z 2QYOA 3T5XA 4HF1A 4OIOF 2FSWA 4AC0A 2M7WA 3ISPA 1PNKA 2DN9A 4ZHQA 1QVTA 3RTRA 1FJLA 3GZ5A 2CS3A 2PI5A 4JI2O 2XRLA 5FNVA 1Q5OA 2Z2SB 3KCCA 3TXQA 1S5LZ 5J2TB 1SA0A 4XLEA 1D3YA 2DJNA 3AG4C 4P30A 4K8XA 3OYLA 4DR2B 2DA7A 1Y76B 1Q81W 2E36A 2W84A 4YJ2A 5LD2C 4JTAB 1XMKA 3OYDA 1EH6A 2ZE5A 1ETYA 2WV1A 3KX2A 1HBXG 1MNDA 2DQ0A 2EFQA 3F3XA 1YRNA 1S8NA 2X6OA 3UR3C 1OCCB 1VF5B 2IH3C 5BR8B 2QEXI 2DA3A 2GXAA 2P22C 1Z6RA 2FXAA 2XPWA 3BG6A 2EIJH 3R65A 3P3NA 5IYCO 3CCLI 3RYFA 2YPRA 3CZ6A 2Y0SN 1FXKA 2D1HA 1T2KA 1BZKA 3JATA 1XD7A 5IPAA 3C18A 5K7HA 3QYEA 2DWEC 3FD9A 2Y9YA 4CCKA 3OUFA 1TT5B 2OCEA 2IRFG 4MIMA 4G12A 4V2FA 1V5FA 4YIRX 2LJ2A 4TV8A 1S5LC 1PUFA 1VQKI 3VB2A 4X1IB 5CBGA 1JUMA 1YJNV 4J9YB 1H0MA 5GPAA 3LA3A 3LNQA 4YHHO 4LF4B 3P9KA 4X64B 3SXYA 1EV7A 3JAMZ 4RWUA 2LY2A 1MBJA 1XG1A 2BTQA 3BP8A 2HP8A 1X4OA 3HOUJ 4MW3A 1IV8A 2E1OA 3IH3A 2ZB9A 4XRSG 4DV3O 3A02A 3HB9A 1W0UA 4J11A 1TTYA 4YIIA 2CAZC 3BR6A 3AG3C 4I7ZB 2LR8A 4X8AA 3BTIA 2ZM6B 5A9GA 1TLHB 2BTOA 4Q47A 4CHUA 3JRGA 2R9IA 2LY9A 4RGUA 4XLCA 2KG7B 5B3SC 2LH9A 3GWZA 4IT5A 4P96A 5ILUA 1BL0A 4A3KJ 4M9XA 2L01A 1AI4A 1GLNA 5EYPA 2CTPA 3CCQV 3DTIA 2ZIOA 2EJ7A 2K27A 3QOPA 1FIPA 1IVSA 5IP6A 1GAXA 4BACA 1NR1A 2L54A 3DKXA 1OKRA 5LBQA 1WB8A 2CV2A 1G3WA 4GKKO 5FLXN 2Y0SA 1QPMA 3SQNA 5KVRA 4E2LA 2PJPA 2OCCC 1KU3A 5E79Z 2E2JJ 1QHGA 1JCHA 1FD9A 2AHYA 1F9NA 5E3NA 3O9OA 3PNYA 3CLOA 1PVEA 4O3MA 4HX7A 1OZ0A 2QA4V 1IXMA 3CD6V 1G1XB 3DTUB 4PFOA 3NEUA 2R7TA 5EGOB 2F6CA 5JQGB 3I59A 1Y0NA 2YX4A 4GCVA 4I0BA 5CKTA 4IO9F 1G4DA 5HLIA 1EN4A 4WF9V 2UXBO 3BTCA 2HPMA 1SD4A 2HI3A 4FK5C 4WBNA 2WTEA 1SS3A 1UHWA 2GM4A 2EIJB 3SPCA 2CE4A 3N2KA 3FMRA 1VQ4I 1AWCA 1D2DA 4PHZA 3BC8A 4HPQA 1K5QA 3W6KB 1MMGA 4PA9A 2UXDB 1YTYA 2F5EA 3OMYA 1UG2A 2RREA 4PDVA 1AOYA 4FFKA 3CHXA 4PA3A 1XMQO 4JAUA 3QU3A 3CX5F 3SDLA 1BC7C 3J80Z 3OMIB 4FFBA 3ASNH 2CO5A 4KIGA 1THZA 2AXLA 4IRGA 3JRFA 5D5QA 1WJDA 4OAZA 2H3OA 5GW7A 1LFBA 2GQQA 4YIFA 4B3MO 2L4MA 2M4GA 4CXFA 4HX8A 3N2GB 3ABTA 3ECHA 4B3TO 4NHJA 1FTTA 5BNGA 5IY5H 2ZDIA 3I71A 1BIBA 1GH6A 2K9NA 3OYJA 3JSPA 1VQ9I 4J7KA 1I6XA 4CS3A 1I94B 4LF9B 2VQCA 3Q3SA 3CCJV 1V4RA 4XLFA 3A1YA 1J5EO 1WN7A 5IYBJ 2VPRA 2P7TC 5HOOA 4RM3A 3CCRI 3IJ4A 1K6YA 2FD5A 2B1GA 3EPZA 1Z3YA 3GXOA 2GXBA 2JEUA 3HKDA 1BI2A 1B6QA 2LD5A 4EMSA 1H2MA 2AXTZ 2DJVA 3V7CA 5KHDA 1VQ8I 3ULQB 1PD3A 3KKYA 2FMYA 4OWRB 5GAEJ 2E74B 4FPPA 3HXLA 2IU3A 2F66C 3HKCA 4ZOLB 1SA0B 1N36O 5DTDA 3FB6C 4H4KC 4A6DA 2ZDIC 4A3CJ 4A0ZA 1EM1A 4JZ2A 2K4JA 5IOZA 3CE2A 3WB0A 4KT5C 1MA1A 1ZKGA 1W0KG 4DR7O 2DFIA 4KUMA 1MG1A 2JGDB 5B1BH 4A3MJ 4O2AA 4XL9A 5IJ0A 4O4JB 3RPUD 3I5UA 1NG7A 2IGOA 3JD2A 1HKQA 1A31A 2AGAA 4QJFB 3L9FA 4B3AA 2KQXA 4G6TB 5C4JJ 3AL0C 2A5WA 1P4XA 2ZNYA 5KX5B 1TUBB 2LRDA 4CCLA 2KPMA 2J5OA 2AXTC 1T0FA 2Z9OA 1LJ9A 4JYKA 2PI0A 2KG7A 2QBYA 1FNNA 1YCIA 4FQGA 5B1NA 4OXSA 4QGPA 1RPWA 1RESA 3CJNA 3S15J 5EJCA 4ZYGA 3C1DA 3K4JA 3IUOA 3ASNC 1WRJA 4XKBA 2V79A 4E7SA 4GX5A 2M8GX 1WJZA 4NNJA 5K5OA 5CA1A 1URFA 1R5ID 2LNBA 3EHBB 1KYZA 3SDBA 3HUGA 3RWRD 4BBRJ 5HDNA 3HOXJ 2BTQB 4X1KB 1JX9A 1XEQA 3UO3A 1M57C 2LGWA 4L5JA 4PA4A 3CXCU 3L1PA 2WA4A 1WI3A 3O6BB 5M3MJ 4CH4A 4ZI7A 4X62O 2RVCA 3ZQCA 3CLQA 2GTAA 2KRCA 3EUHC 4P55A 1ZGJA 5J8CA 5KMGB 4MVUA 4D7NA 3ZQLA 4XONA 3GMEA 1RM1C 3FMQA 2XPUA 2K4BA 3WTSC 2HG5C 5B1BC 3K6GA 2O6GE 3I3LA 2LO1A 1BMFG 2HXOA 1SMYF 2JN6A 3CCSV 2EA2A 4P1WA 4HZ3A 2OCCH 1STZA 5JCOA 2V1NA 2DTZA 1JPXA 3JD4A 1SQXH 4R8HA 3J7YJ 1D5YA 2F43G 3A0BZ 3OIPA 3DU6A 2CH7B 5J4YA 2A6TA 4LLGF 5LMUO 3KP3A 2BXYA 2FKXA 2F2EA 2Q73A 2IA2A 2O7OA 3Q9SA 3U9GA 3R61A 3M07A 3I64A 3PSIA 3TO6A 2CMPA 2R7WA 2WLLA 5HFMA 5D4SA 1YOVB 4OIPF 5FROA 4XLPF 5CVVA 3VYRB 2BE3A 5JH7B 4QTRA 2NVQJ 2UU9O 3CP8A 4Q20A 4JYAB 3F8CA 4ZDOA 3ERED 4H33A 3SEZA 2Z3YA 3G3ZA 3OYFA 3KP7A 4A93J 1IN8A 1S77D 2P6TA 4BGDA 4M3FA 5F6FA 1FBSA 1QBJA 4I55A 1XMXA 1SVOA 4NVPA 3K08A 5DECA 4D1QA 2QBYB 5CBHA 2Y0PA 1ZL8B 3OR2C 2WB1A 4ABMA 2MLGA 1USTA 3ZQFA 4LLLA 3WTTC 3D1NI 2A9HA 1HR0O 4FX4A 2LK2A 1AJQA 2NOGA 1JR9A 2DDAA 5HODA 1JE8A 2PYJA 1GT0C 1AKHB 4P5OA 4H13B 2PMUA 4YG2F 3K9AA 3T4DA 5LEJA 2DA5A 3AG2B 3K79A 5JR3A 2FNAA 3TXSA 3VQXA 2KT0A 1Q82W 3G6EV 2M6YA 3H5RA 2JA8J 4JASA 3LOCA 4PSXA 1HNXO 2JIZG 2V1DA 3BR0A 3C3WA 3AK2A 2WY8Q 1ZLZA 2Z99A 5D6EA 3LSIA 5FKLA 5L3DA 4QPQA 1GKFA 5GONA 4M73A 2A69F 2E34A 4QSHA 3BEHA 5K7FA 5H5NA 3CCVV 5LGUA 5LMNB 4DV3B 3R6SA 1JT6A 2DA4A 4E7JA 4LFCB 3M99B 3C2HA 2LSOA 4M3BA 4EJUA 1YW9A 2X0LA 5FLVA 5BZBA 5CA0B 3RPUA 3L2CA 3MAJA 2VI6A 4AVPA 3KETA 5TRDA 4FLYA 1M1EB 3HC7A 2VS0A 4J00A 1GN6A 1ROPA 1R4NB 1YZBA 2RJZA 2ELHA 3ECOA 2V7QG 4DV0O 1VQ9V 1KYWA 1MKMA 3PNTA 4DIQA 2X51A 1R49A 3CRQA 5D8LB 4JI7B 3AG3B 1QLNA 2EWNA 3E2EA 4K0KB 1CQTA 3T1YO 4H0EA 4BAYA 2PI4A 1M9NA 4DR6O 2VWJA 4ABZA 1N32O 4JQFA 2MK3A 3MKZA 3E97A 4DV6O 3VQWA 4I0XB 4GDFA 2YIAA 2WADA 4XLHA 2GXGA 2NVTJ 1Q6UA 4JV5B 1WZ2A 2ZNZA 3F8NA 3OYMA 4M9SA 3A4CA 4W1UA 3FXQA 4IOAF 2NAZA 1W7PD 5AG2A 5KUMA 4DUZB 1XCVA 3FISA 4X1YB 4P9UA 3TP3A 3M8EA 4X65B 3P5JA 1KU9A 4Y17A 2ZNJA 1Y6XA 3JSLA 2DCEA 2XUMA 2XHKA 2ME6A 2X6AA 5KAFC 1AVMA 1PNMA 4CS4A 5FFXA 1ZL8A 2HHHB 3KP6A 2DA6A 3TW6A 3H9QA 4NXNO 4GKKB 1KQ0A 4ZYDA 3EYIA 4D5FA 1W0TA 2JK3A 4BW9A 4N9HA 3TBIA 3S8PA 5HS7A 1PP7U 5J1RA 3JARB 1QQIA 2IT0A 4LP8A 1HKTA 3BPXA 1XB4A 3E35A 3C90A 4JPRA 5CBFA 3SJAC 4DV4O 3W7SA 3PFYA 4PDMA 2ID6A 4R8CA 2HOTA 5FRNA 4LG3A 4BQAA 1V55C 2Q4PA 2KDOA 1OCZC 3K4LA 2OBPA 3TJTA 4LFAB 2R7RA 4FASD 2CGNA 2WLNA 3ERMA 3MHSC 3I54A 3CYOA 4LWSB 2P4WA 4A3IJ 2HQ5A 3MKWB 4C2TA 5CMUA 5LYJA 2F4VB 1IRGA 2QWOB 1YJWV 1SD7A 4AUXA 2QKMB 1KYOF 2K7LA 2ZIMA 3FXRA 3L2UA 2Q7HA 1MABG 2WLKA 1D1CA 4D9JA 1H2SB 4BWAA 5A2QN 2OTJI 1GVJA 5JVTA 1ERDA 3HRUA 2NXNB 2ZT9B 4AQYO 4P9PA 2NR5A 4C30A 1D5VA 2FB5A 3ZQGA 1J5YA 3BG5A 1M5IA 4FLWA 2PY5A 4II3A 1WKMA 2Y31A 2Q2EB 1ONVA 2F4MB 3FB7C 2DT6A 2XHBA 2GHYA 4I76A 1PDNC 4BHCA 2OQGA 5FO5A 3JSOA 2M8EA 2R0QC 3QP6A 1PL4A 2QDOA 1NJIW 1T39A 1ETKA 2OCCB 2DPDA 1RIOH 3D36C 2XAFA 1VF6C 3W7UA 1QLEB 2CG4A 3VOEA 4C2MJ 1UCRA 2CJJA 5D5WB 1TWCJ 3KLNA 2WWYA 5GONB 2F4IA 3ML0A 2BHYA 1BGYH 2PMHA 2NRAC 4WWCA 2QKCA 2V9VA 5AIQA 4L0ZB 4XLAA 1D1AA 1Z6TA 2HVJC 3LSGA 2LP0A 2Z5UA 3K1PA 1H2NA 1X2NA 3ABLH 5EG0A 2YU9J 2Z0AA 3W7WA 5C3EJ 2Y4TA 2EFOA 5H2FC 1TW2A 2PEXA 3MDSA 4A0XA 1ETVA 5DUIA 3BZ6A 3OS1A 3EFFK 2DOEA 1NQTA 1QR9A 2Q6AA 2QKLB 3C2GA 4J7ZA 1H8EG 5LGNA 1P92A 2PUSA 3PJSK 3OV8A 1RPOA 3TW7A 4YJ2B 1N0JA 4JI6B 1VQPI 2YUAA 4L5IA 3W6JB 3GVAA 4FISA 2OTJV 1W1WE 1WAZA 5LMNO 2EV0A 5D6FA 2G0EA 1W4MA 1B9MA 5KK1A 4MEYF 2OZ6A 3ZRXA 4DR3B 4AQYB 5E3OA 4U3FH 2K9LA 1YITI 1IDSA 4H37A 2CGPA 1N0NA 2RN9A 5GTIZ 1Y8QB 4HDVA 1V9PA 4IIJA 3E7LA 3HDDA 3TDUC 4PA6A 1LKXA 2R9RB 4QIWF 1UPGA 2MGQA 3ZRGA 3ZHTA 5KAIC 5LYJB 4LF8B 3BZCA 3T0YA 4UCVA 3W7XA 1RNLA 3V8LA 1OPCA 3FB5C 4FTHA 2LP7A 2L7ZA 2Q8VA 1OFCX 2KZGA 3CCEV 5LA6B 2IXSA 1LB2A 1FXHA 1K34A 1BI1A 2CGOA 4TV8B 2JTVA 2AQFA 5BPDA 1JGGA 4JAVA 1H9GA 2VQHA 3CDLA 5IDJA 1K83J 1R7JA 2VE8A 4N23A 3WE3A 2YX7A 3KCYA 1HC8A 2LTPA 4C3JJ 4A12A 1OCTC 1AR5A 1OCOB 5L3GA 4HLYA 2DWDC 3JARA 4RUEA 3KEOA 1IUFA 5JJEB 2HHHO 4PDLA 2B63J 3OYBA 3ZRWA 3CXHF 3CP1A 3ABKH 1OCRH 5H6QA 3WGHA 5L3BA 2NNNA 2BYVE 2HQNA 3L2RA 3HOZJ 4X64O 5FLXK 3DTKA 1HDDC 4MEXF 4KDPA 3E83A 5IP9J 2UWMA 5KUKA 3K4CA 2W57A 4E7ZA 1JKRC 2A06H 3ZRSA 1WA8A 4R6ZA 1XGOA 5H6RA 3UQ8A 2DQLA 1U6GA 1E79G 2K5CA 2PQ8A 3KG2A 4IOCF 1U2WA 1H38A 1X2MA 3H0DA 1HLVA 4C7UA 1OYIA 1R4MB 5F04A 5GAGJ 2XROA 3HGYA 3IKTA 1BHBA 3FHNA 5LEKA 4MQ9F 5ICGA 4WFHA 4CUGA 1XGMA 5ILSA 2OCHA 1H89C 1PNLA 2XDVA 3C2BA 3J81Z 1S0VA 1MSEC 2E7WA 2AZ0A 1TAEA 1L0NH 1G8MA 2EPFA 3D0SA 4QPOA 2B5UA 2P6JA 2WLJA 2HJDA 3CC7I 1VQNV 1E2XA 1MBGA 2F5DA 2ZFWA 1P49A 5J40A 5KCMA 3VSKA 4P2ZA 4IHVA 2CRGA 1R3JC 1YX3A 2BXZA 4RGRA 1S7EA 4CICA 1AROP 2DFEA 1YSCA 2GUZB 2HS5A 4QE7A 4BR6A 4F4LA 5LRSA 2WAFA 3OYAA 2QM3A 1FP2A 1Q1HA 1ZELA 5IT9Z 1H88C 4E4EA 1BI3A 2Y2ZA 2X1EA 4CZZA 1JMKC 5KHHA 2IGNA 3FXUA 4LFBO 2H8WA 2IJJA 2F93B 1LUJB 1RFYA 2YSRA 1IJWC 3K0DA 2K3PA 1O3QA 2E5LB 2R7DA 2WV0A 4MFEA 3OD4A 3K70C 2NS0A 1FOXA 1SZTA 3SPGA 3S1QJ 3GEZA 3ROUA 4XOPA 1NBMG 2XB5A 1VF7A 2HOAA 5BXZA 1K9MW 3F8BA 3CSXA 1Y6IA 3ZQHA 3GLLA 4IRHA 1D5NA 2EIKH 4HX4A 4A3EJ 2ZJ2A 1FOKA 1WP8A 1ZWIC 2A5YB 4GX0A 4K3AA 3B02A 3CCUV 4DR4O 3OSGA 1G6UA 4EEFG 4UCSA 3CPWU 2L7FP 2CFOA 2JUCA 3CUQB 4XBFA 3BJAA 1NHAA 4GX2A 1XBLA 4TV7A 2M2EA 3LAPA 1EF4A 1XILA 1FP1D 4BH9A 1IXCA 4F55A 2Q8KA 5ITZA 3ABUA 1SQVH 2UUBB 1F7YA 4NQWA 1QCEA 4GKJO 3HJEA 4IKFA 3ZS8C 5IYZA 2YR2A 1YXBA 4IHWA 4FHTA 2VN2A 1Z0XA 4WFFA 1ZLJA 2ELJA 3SJMA 2UUAO 1N34B 3AFHA 1IN7A 1J09A 1ORQC 1JKPC 1XDCA 4AILC 2BY0A 2EJRA 4NC7A 4LNUB 1IDYA 1ENHA 2CUEA 2CYYA 3H92A 2ZJQF 4HNTA 1Y4MA 5KA6A 2UZKA 1Y56A 5BMVB 4RB0A 2PMZN 4DJAA 2G7HA 3N97A 2QKSA 4DRXA 3K5MA 1ZR2A 5C93A 3BROA 5IY5C 1GN4A 4M9ZA 3S2DJ 2D2CB 2G7UA 1VMGA 3IGAC 1ITYA 5LL6Y 1W2BU 3NXSA 2GZWA 3HHGA 3NRVA 4XRFA 1R9TJ 2FF4A 2EIKC 1Y1VJ 1RETA 2BEOA 4RLFA 1NVPB 3PUBA 3GTLJ 3TMOA 3RT3C 2R5YA 3CCJI 2EA4A 3K5LA 3WGGA 4NUBA 2XAGA 4AWXB 4XRSA 1BW5A 3GB7C 4EQQA 3CCEI 2K9MA 4LG0A 1D0ZA 4HQMA 3RPQA 2MC3A 4I4TA 3MVPA 5FGMA 2VC1A 4F3QA 3OYCA 1VQLV 4TWKA 1O9HA 5EYRA 4LF9O 3QPTA 1Z77A 3PQJA 5CPRB 2O61A 1GM9A 3IAYA 3K2ZA 1SEUA 5EC2C 3WB2A 4BEHA 4BXUA 1DPUA 3S16J 2KIQA 4N9IA 1R73A 1YHQV 1I3QJ 3FK6A 1HNWB 2V1UA 3OT7A 5J47A 2BOLA 2DA2A 5LXTB 1X3WB 4DV1B 3JTHA 4JBAA 3SJCC 4UUJC 3L09A 5B3SB 1O57A 4X88A 2UXCO 5GADJ 1OISA 4KFCA 4JI3O 4L9JA 1XNQB 2F48A 4NC6A 2KFDA 1VIBA 1U8BA 4C2UA 3M7MX 4CA0A 3CMAI 1U0JA 4XNFA 2H8RA 3GZNB 4O4HA 3TP0A 3N4MA 1W0JG 5CB4B 2EFWA 4BJTA 1F4MA 2DDBA 1BN5A 5DN6G 1QO0D 3MKYB 3CCLV 4B1RA 3E5QA 5AIPA 5C8YB 4ZJZA 2UXDO 4GGGA 5BPIA 3H5AA 1OJHA 2WB1N 3RKYA 2YDEA 2CUZA 2WAEA 5E18F 1F51A 3OFNG 1MBKA 1XS9A 3UKMA 4F6RA 4EJVA 1LQ1A 1ZRCA 4ENJA 2HZTA 3UO2A 1XNRB 1KP2A 4D0PA 1JA8A 1V3FA 1FPQA 1SRYA 2IH1C 3C3SA 1SQPH 3GFIA 1Y74A 2DK8A 2VQEB 2LVSA 3WTYC 3ASOH 2EX3A 1XMOB 4N4NB 1K3EA 2P7VB 1M90W 3KZIZ 4J42A 1BBYA 1JJOA 2JRIA 3RVYA 4HDUA 1MSFC 1Q6IA 3BA8A 2VOOA 2AS5F 2QF7A 2RCVA 3T1BA 1T38A 4RAYA 1OCRB 1CXZB 4ZHQB 2CK3G 2LC2A 3L73H 2LREA 2ME0A 3DPTA 3FBIB 3STZC 4J10A 3B6CA 2D2WA 2LGQA 5B1OA 1OR7A 3E6BA 2JPBA 1DP3A 3KE2A 4PV1B 2E7XA 1SQBH 5EK0A 2FOWA 5HS9A 1ZN2A 1AI7A 4DW1A 5HLGA 3FM5A 4D7MA 2ICWG 2IW5A 1IAWA 2EIKB 2KL4A 2KIUA 2X1CA 5IE9A 1J75A 2R4GA 4EGZA 2OU2A 1R3KC 4O4LA 2XIGA 1X3ZB 2H27A 1J9IA 1S9HA 1NT2B 1ZG5A 1GN2A 2VJIA 1UFIA 2Q7GA 2P0WA 3SFZA 1NTZH 2V9KA 3GLXA 2IA1A 3J7AY 4YJ3A 1AB3A 2IGKA 2LYCA 3OM3B 4BL0B 3ABKC 3MKLA 4KT6A 4QIWN 3F21A 1Y1WJ 2VOPA 3LSKA 4PJJA 4WF2A 1V55B 4GX1A 2VXDA 2ZXIA 5D8KB 4ON0A 1QU3A 4JTCB 3K4KA 5IOYA 3CJHA 4C3IJ 1M56C 1U9NA 1XN7A 2RN7A 3AG4H 5J3LA 1K61A 1EJ9A 1NI8A 2HEPA 2UUCB 2E2HJ 2DQRA 3B6AA 3MZ8A 4KIBA 1HDPA 2QSAA 3HRMA 1LR1A 3S14J 3L72H 3F5TA 2NS8A 5HLHA 1Y76A 2K3FA 4I98B 2MSYA 1G59A 1LVAA 2ADPA 2QWRB 4DR5B 3CMEV 3OIQA 3DBLB 5IYZB 5A2QZ 4DZPA 1E3HA 3ABLB 3QP5A 5LRRA 3BVOA 5DM6V 3LNNA 4O2BB 3R0JA 3RYIA 4DV5O 1N33O 1O3SA 2L9RA 2ODMA 1A6IA 4G8XA 4M72A 2JS5A 2UUCO 3D5SC 4X0GA 1MMDA 3RYCA 2E19A 1W36C 2HDWA 1WLEA 1DU0A 3K57A 1TWHJ 1LDDA 1WJ5A 3HTSB 3TQNA 4BE2A 1ZQ3P 1I5YA 3JD3A 5D5PA 2AHQA 2W24A 1BT8A 3ZMSA 4PI0A 4JGSA 1IZ1A 3RDIA 2FQ4A 3K4BA 1XQ8A 3A0HC 5J9PC 2VB6A 2M3AA 4ZH4F 5CQEA 3S93A 3OYNA 2NLJC 1IZ3A 4LITA 3GTQJ 1QZYA 2AO9A 4NYKA 4AYBA 3KFWX 1ETWA 4LK1F 4MTGA 2QLZA 3WG7H 2Q0OC 4IJAA 3FXKA 3JAKB 4NKGB 1KKCA 3N27A 2WC2A 4L9VA 3H36A 3O2PE 1L0LH 2M4KA 4KJZA 3OYIA 5FFZA 2E1NA 2UXNA 4LFCO 1R23A 3HSFA 3CCSI 4UVBA 4U0YA 5JH7A 2VQFB 3JRCA 3JRBA 2GBOA 2CTWA 2L9SA 4ZIBA 4KXRA 2FEZA 2GSMB 3LSUA 4AI8A 2V26A 2OWOA 1BSMA 2W6JG 3AG1C 3ZRWB 2ECCA 4WCEV 5DM6F 1FOWA 3W3CA 2L0KA 4LF4O 2HOSA 2PLYA 3E22B 4JI5B 2Q0OA 1S72V 1PPJH 1Q8IA 3RW0A 4BHBA 1KMIZ 4DZJA 2LFBA 3JRHA 2JJ1G 2A7WA 3SEQA 4JI4O 2QJ1A 3ZBHA 1CF7B 2Y75A 1X58A 2Z1DA 3F6OA 2VJ5A 4RAGA 3OW2U 4MTFA 2DYRC 2ELKA 2EIMC 2MLKA 2MD0A 4BDYA 2QSFX 4DBQA 1KZHA 4XIDA 2RNJA 1U5TB 4U7DA 1Y0UA 4IXAA 1NKDA 2JT1A 3RZDJ 4DR5O 4GYCB 2CQ7A 1F4KA 1PP8F 3U11A 4CZCA 5E1XA 2YICA 3SPIA 3EUHA 3P3PA 4MSWC 3CO7C 2R93J 4WXDA 2FTKA 2IBZH 2JGDA 3OAAG 3FDYA 1IURA 2BY3A 4JP0A 1TVKB 2V9PA 3GCMA 5EGOA 3FF5A 4RAIA 1UHSA 5K1XA 4YY3O 4FLXA 1KQSU 3FXOA 2EFPA 5JLXA 2JZYA 3LSPA 3HOVJ 5CN0A 5EEGA 3F22A 1MMSA 4FETA 4BIUA 3HKDB 1WJFA 1S7AA 4JI0B 2JRMA 2CQKA 1K6OA 2A05A 3EDPA 5DCFA 4OGQB 2R70A 2CUFA 2EULA 5D5VB 1PL0A 2E3CA 1JJ8C 2EZPA 4GZRB 3ZHRA 2JMWA 4DOZA 3CWBH 3JCUZ 2OIEA 5HVQC 4D7SA 5CA1B 3WTZA 4KHPB 2LDUA 4MO7A 3QPHA 3WHCA 2Z16A 4EV0A 4Z6YA 1QNTA 2IGMA 2PX9A 2IJKA 3RZOJ 1UAAA 3HOWJ 4O4JA 2ZXWC 3Q0VA 3LSRA 2P6SA 2OJED 4A3DJ 3RKQA 4L87A 5EBWC 5K1PA 4NC8A 2UXCB 1IW7F 3D36A 3U1DA 4MVSA 3A2KA 3G4SI 1Q43A 4LJZF 2OZUA 4L0YB 3GF2A 5CVJA 3G73A 3OE7G 5BQTA 1GDTA 4M6XA 1W7PA 3VODA 4E7LA 2CUJA 3RYCB 1VQPV 4PJ0Z 4LB6B 1MD0A 4HG2A 2N74A 4UV9A 2E35A 3H1LH 1SVLA 4G7HF 3I53A 3VYUB 3V4GA 2M5WA 2L5QA 4MS2A 4KFMA 4OMYA 2XPVA 1MSWD 2GWRA 3JTGA 4PUSA 4DUYO 1T0FC 3OTOB 1WGXA 3RQIA 3MMYB 3HKCB 3OSFA 5FB2A 1VFCA 2CH7A 4ZOLA 3VYSB 5M3FJ 4DV2B 4FT8A 1R1UA 3OEHG 2LF7A 1YI2I 3S17J 3V8KA 1KUQA 1C0WA 5LHHA 3KYDB 1ODDA 2Q67A 3K70D 2IVMA 1VF9A 1A6QA 1F23A 4I9QA 3DC6A 2RV8A 2MH2A 3K1NA 1ON1A 1IG7A 4I7HA 2X6BA 5IJ9B 4LH7A 2Y4UA 1K73W 3M7GA 2BCCH 1MNMC 2VT2A 1JI8A 1A32A 3IAS2 1YF2A 1VQ5V 3SYPA 2PF4E 5EZYB 4PELA 4DV4B 1FFXB 1K79A 2UUBO 1A35A 2IS2A 1QVGU 4WCGA 4LGWA 1N25A 1JTYA 4RS8A 2A07F 2Y0IA 5LA6A 1EN5A 5JHUA 1WSUA 1MBEA 4N0BA 4OINF 2O57A 2CW8A 3U0ZA 3DEUA 4AVZA 1L8DA 3JAKA 1FKAO 5EBMC 4L9TA 4OX9B 3CMMA 3WFVA 1T6SA 3KPHA 2Q69A 4WFAV 3HM5A 3ETEA 2HYGD 1AKHA 1O9GA 5F27A 2IP2A 2RNBA 3T4ZA 1BC8C 4EB6B 1ZYRF 4JI2B 3G67A 2MD5A 1TQMA 2VBWA 4B44A 3VQVA 4J19A 3BCAA 3V7RA 4WXHA 4HNVA 5JI6A 2X6WA 3H9GA 3HOTA 3DPUA 5L3FA 1K78B 1R1BA 3E86A 1Q6HA 2EZKA 1WJBA 3DCFA 4E4HA 3IKVA 4U7NA 2DTRA 1WPKA 3RVZA 1TVKA 2ZMEC 4HA8A 2KSDA 3D5RC 1NG6A 2ILMA 5GTIC 1HNZO 1VQ6I 4BQQA 3I9V2 4ICGA 4Q5SF 4BBSJ 1VNDA 2N05A 3BRCA 2HYJA 3B4SA 4N21A 5EG0B 2QQAA 4LOCA 3HPHA 3KIOA 1Q90D 3KP4A 2FYUH 1H2KA 2IJLA 4S04A 4DYRA 3L2QA 3PO3J 3JYCA 3SYQA 2VXZA 3CCVI 2KISA 1SC7A 2DPUA 4BQOA 2STWA 1RC9A 4MGRA 3PSFA 2IEKA 3V8JA 1FOYA 2H09A 2W48A 2DXIA 1RP3B 1BQZA 1BW6A 1X59A 1MJBA 3E5UA 3DLAA 1MJ9A 4ENKA 1KU7A 1EBOA 2A79B 4AIHA 2QTSA 5H9CA 3WU2Z 1I1SA 1ZK8A 2JA6J 1D0XA 1KU2A 2ZMEA 4Y15A 1ZG1A 5F1JA 3BFRA 4LG0B 1KQ8A 2X6YA 4OIRF 3LDDA 3BPVA 1J0RA 1YLFA 5J6XA 1KQ9A 1FLIA 2DOSA 2GOXB 2KRHA 4D5CA 1GVDA 1NR7A 4PJLA 3T1HB 2VQGA 1JJ6C 1SKVA 2C6YA 1G2HA 1GUUA 4ASUG 3F8FA 4UUTA 1GXPA 2XUBA 4IRIA 3RN4A 4Z2WA 3RYFB 4XLNF 1R1TA 3SYTA 4DBRA 3A0BC 4I2OA 1SAXA 1EZVH 1FXKB 3HKBA 5H2FZ 3NQOA 4II2A 9ANTA 1YW8A 3C3TA 2W0FC 2W1OA 2KKWA 4UFZA 4B3RO 2QQBA 1U96A 4HF2A 3R4KA 2DA1A 1RSOB 3IV5A 5F0FA 1WNSA 1F36A 1WQ2A 1NTCA 3H3ZA 3TO9A 4C9YA 5L3EA 2ITDC 4XDKA 5EDNA 2VT3A 4GYGA 2K85A 5EZHA 3DBHB 3JR9A 3K06A 4F7ZA 4FM2A 1SMTA 3FZVA 1Z21A 3DXRB 1NZ6A 4JYBA 2ZJRF 1QQCA 5BY1A 1MOFA 5KHIA 1RR8C 3H3VK 4NQWB 3K04A 3ZQQA 4UUSA 5KHKA 3U10A 5ITZB 2YC0A 3ZMDA 2CV0A 4DUYB 1D8JA 2XF5A 1FYKA 1V54C 1TWGJ 4Y33A 5CVUA 2E71A 2LKPA 1WPXA 2QSGX 2R7FA 1RPRA 1Y74B 2GIVA 5JFRA 2HZDA 2VQFO 1RKWA 2FRHA 1GO3F 3GUDA 4I55B 5FL7G 5BMVA 2Y69H 3HBLA 3EXAA 3CC2I 5FRMA 4JI6O 2EB7A 4U7BA 1YS6A 1EA3A 2HTJA 3EUAA 4KP4A 4LCUC 4HLXA 5IY5B 4ANJA 4HEA2 3UNGC 1S6LA 2KMUA 2X6CA 1G3TA 3AG1B 3LQQA 3QYBA 3OY9A 3LSHA 1Q7YW 3GTGJ 5GP9A 1JKOC 1QGPA 2R5YB 3CRAA 5CA3A 3K0GA 3R66A 2DYSH 2ZXHA 2E76B 3QAHA 4EB6A 3Q4HB 4TQDA 4JYYA 3K03A 2F5CA 2ZMEB 3L2VA 2CTQA 3H5NA 3QPSA 4FX0A 3BJ6A 1YDXA 1FMVA 2BHZA 5B3SH 1RR7A 3HSRA 3HHHA 5LGTA 3B09A 5B1AC 3LSMA 5JVDB 4JI0O 4BY1J 1F1ZA 5E1WA 2RDCA 2FOKA 1AR4A 1G3YA 1V5EA 3Q0UA 4IZZA 3LNMB 4HNAB 4X1YA 5LXTA 1FFTB 1UG0A 1VEWA 3ABMC 3NAUA 3AKZA 1A36A 2VKEA 3ABMB 3CD6I 1UZCA 3BHPA 3N2KB 3AG2C 3DF8A 3CMEI 4L5EA 4PDKA 3H1CA 1QR8A 1XX5A 2HXIA 1T95A 4NTYA 4LK0F 2X85A 2JEXA 4LF5O 1PUFB 1SFKA 2CW0F 4CBCA 1ZAOA 4EJTA 1BCCH 2V4JC 2PJRA 2FE3A 2HTSA 4RB3C 3TEDA 2CQNA 3EQLF 3OTOO 2DQ3A 1XPXA 2OYQA 2Y69B 4FE7A 3CDHA 4PDRA 2LF8A 3D5LA 4M71A 5BS6A 4U3JA 5KHGA 3F6VA 5CJ9A 1B72A 3H35A 2XRNA 4BE1A 1MIJA 2OD5A 3CEIA 3N2GA 1S3JA 2XSDC 3B73A 2IS1A 3F7VC 4F6RB 5LOVA 3F0CA 4UB6Z 2OT5A 3TKYA 3DKYA 3KLOA 5FLMJ 3ESWB 2CDYA 2QM7A 1FSEA 3PIPF 2HKOA 1K92A 3VQYA 3ZJZA 2N04A 3TL4X 4OAYA 2ESNA 3ZMTA 2YXLA 2ZNIA 1LFPA 2O3FA 1AA7A 2R5ZA 4YFNF 1LDKB 4G7ZF 2HVSA 4PFPA 1N78A 4KN4X 2ZM6O 4E7HA 3S2HJ 2JQ7A 1TT0A 2ADQB 3JD0A 1VQMV 2I10A 3T1CA 3X2QH 4JX5A 3S1MJ 4B43A 4KHPO 2A3QA 2R7SA 5J2TA 1S5HC 1R5HA 1SD5A 4YRVA 1LUVA 2JA7J 5JJNB 1SZXA 5K1YA 4UB6C 3S3MA 3MCZA 1OR7C 4UVCA 1I5ZA 1DP7P 1I27A 2W00A 3DGEA 2QGUA 3T8RA 4I6ZA 1GK9A 1P4AA 1OCCH 2HVRA 3BTJA 5DCMB 3DLLF 5IJ0B 3NARA 2H1LA 5F0CA 3A0RA 3V42A 1FMWA 1R58A 2BE5F 2F4OB 1U5TC 1COWG 1MGTA 2DFFA 4MTXA 2Q7EA 1VARA 4IF4A 2ZXWB 4DUZO 4YJ3B 1OV9A 2LFRA 1XSVA 3FKJA 5E8IA 3JALB 2B0LA 5GAHJ 2Q1ZB 3E89A 4W4KA 3FKIJ 1IXSB 4N4OB 2ZXWH 1HSTA 1S76D 4ZYHA 2HFEC 3SZGA 3PJRA 3ZCOA 3CCMI 1IDZA 1UMQA 5IYCJ 2F23A 4XSXF 4A69C 4E7IA 1QHTA 3KZIC 2ZJPF 3BAAA 4FMTA 4A6EA 3J7AO 4FVMA 4PD4F 2RDPA 3ZHQA 3H1KH 1RSOA 2ZE6A 3CJHB 2EZLA 2OQRA 1CF7A 5E1ZB 1JXSA 2ZC2A 5IWAO 1Z5VA 4KMFA 2P5OA 1R71A 4F6EA 3VWBA 1IF1A 3K4MA 1U5TA 1E1QG 4JZGA 1VQ7V 3OS2A 4DV1O 2D5VA 4KISA 2WLHA 4O6JA 3L9DA 1ZSPA 2EH3A 1GN3A 1L3LA 4HYOA 2JSPA 1LUWA 4AHCA 1JHHA 3H3UA 3WODF 3ZXSA 2LBFA 2EIJC 4J9ZB 4KN7X 3S1NJ 4DR1O 1DGWY 2G38A 5IP7J 4BY7J 1D0YA 2HPIA 4DO2A 1P4WA 1ZRFA 5KA5A 1BA5A 2RKHA 1CEZA 2E1MB 2WLIB 4CH7A 2WSSG 4UY8I 1FS0G 1HWYA 2X6XA 1LEBA 2KLOA 2BSKA 1Y66A 4RQFA 5BMZA 4MVOA 4JF3A 3QO8A 2O5RA 1U97A 3VPRA 1WJCA 2E5ZA 3ZQ7A 1REPC 1XHXA 2EFNA 4JX4A 4FCYA 3RYPA 2LKSA 4NTXA 3LQRA 2HEOA 5BOXA 5IT9K 3V7SA 3H1HH 5IYBO 2RC4A 3GWOA 3KP2A 4QPJA 1TQIA 2XAHA 1LPQA 2XASA 3BWGA 5TGTA 1WB7A 4ZYEA 5CB4A 4HF0A 1NK2P 4LB5A 2A68F 2DYRH 2EIMH 5ILVA 3OYEA 2VODA 5TISZ 3RCOA 3RI4A 1GM8A 4TOIA 3BR2A 1FPOA 1N4CA 1YVWA 3CCMV 2M30A 1T98A 1Z1DA 5ICFA 1XHZA 2NVUB 2UU9B 4JYAO 1M4UA 1NS1A 1FYJA 2O9LA 2G9WA 4F93B 1P7GA 2ZR2A 3Q4HA 3ETDA 1XL6A 3O3KA 1MW7A 2DMUA 4GXOA 4HNUA 2WAMA 4I09A 4M3DA 4CDGA 1ZX3A 3I5DA 1YS7A 4IIJB 1HR0B 1GXQA 2XGXA 4Y7NJ 1MDMB 4WFBV 4LF7O 4LLNA 1BL8A 1SQGA 1EFRG 5KX5A 3FIWA 1KONA 3L71H 2X7RB 1XREA 2DT5A 4OIQF 1T5EA 2GBYA 1NTKH 2WLMA 2ZR3A 1K4CC 3OR7C 5F64A 2XV4S 3GTJJ 5TISC 4L18B 2EBIA 3TOBA 1ZTEA 4UB8Z 4DR2O 1NH2D 1K8AW 2NVYJ 2CQQA 1R3IC 3GTOJ 1FYMA 3DXRA 1CPYA 2Q0AA 4FZ1A 1ORKA 3BQZA 3CUQA 2QUFA 5AONA 4WK8F 1K97A 4U3JB 2AQEA 2MBFA 1J95A 5DEDA 2BGCA 2I8DA 4E70A 1B59A 2BBYA 4Z1VA 3OL3A 3I58A 1XL4A 3CC2V 3CCRV 3OOUA 4G28B 2XB0X 4KMUX 3ELKA 2DOFA 4HYEA 4LMYA 5LFAA 2GUZA 4LD5A 3A03A 2WA3A 3M8AA 3SPHA 3SR2C 2LLKA 1NH3A 2VBYA 1JUSA 2M1BA 1FZPB 3DXJF 1WI9A 1XDSA 2DJIA 4BE0A 4XKCA 2NVXJ 2JVHA 1IXBA 1VQ7I 1XOUA 2W6IG 3ASOC 3FX7A 3ZHUA 3WE2A 5LLQA 1O4XA 1ETOA 1O7LA 3GTMJ 1ETXA 2VBZA 3VYTB 1QBZA 2CQXA 1X1BA 2YXHA 3S3NA 1VQLI 5LHGA 4PI2A 2DFHA 1YJ9V 3JAWB 3HL2A 1OCPA 5TJJA 3RKXA 4XM3A 3DKWA 1DF4A 5KAIZ 5H20A 3PL8A 1K7DA 1DK1A 4Y13A 3LSJA 1S5JA 3X2QC 5LP6A 4EFBA 5FLXZ 5EEAA 4ENNA 2M7AA 3KP5A 1WJEA 2VKDA 2KHMA 1H9TA 1QVFU 3ONQA 2L6LA 1UHMA 4R50A 4EGYA 3R60A 1U78A 2NN4A 1MZBA 2N8GA 3L74H 2XGEA 4PZJA 2LW7A 4CC6A 4MTDA 3E1SA 2L4AA 2QWWA 2ZBKA 4GKJB 3OWTA 4FE4A 3CRCA 3GYHX 3WU1B 3KZYA 4FLUA 1TUEB 1IGNA 3J80K 2HKXA 4RGXA 3EVKA 3JCZA 1TUBA 3RYRA 3K3WA 3JALA 3J81K 5JCOC 1N36B 4A3BJ 3ZIAG 4LNUA 4WFEA 4GFBA 3VOUA 3CJQB 4HBNA 1GV2A 1RI7A 3I0TA 2K86A 3F7YC 4LIUA 4CCOA 4J7JA 3GO5A 1TL8A 3I55V 1HW1A 2UUZA 3HKEA 3H0GJ 1HA8A 3LSSA 1VTNC 4L8JA 1N34O 4IYHA 4IL6C 4I50B 1GTOA 1I1GA 1SVMA 1EZJA 4LF8O 3G4SV 4U88A 1W5SA 3M9AA 3BG7A 4UUVA 5FNVB 3HKZA 4LC1A 2KJBA 1BIAA 2ZFUA 1YTFD 4X9QA 3KCXA 4JI5O 3A01B 3L00A 4BHPA 4DNCA 2COBA 3LDEA 4J80A 3H1IH 2ZE7A 2YIDA 2GDSA 3DC5A 1P7IA 2P5VA 3VEPA 1TZLA 3T2MA 3W6VA 1ZTRA 3RKWA 3WG9A 1IRZA 3ICXA 3GWKC 1SFXA 1VI0A 4B48A 5B1AH 4XOTA 2V1XA 1OCCC 2QTOA 4O4LB 3CCYA 1SFOJ 2YIBA 2XF6A 1K4TA 1DDNA 3Q0WA 4PGHA 2R7UA 2WLIA 2FNPA 2GAUA 3GVMA 4G7OF 2R5ZB 1P2FA 1TWFJ 4ITVA 4X62B 3HGGA 1W5TA 3LUTB 3ZEDA 3W7TA 4B3MB 3UKGA 2XGCA 1JHFA 3REOA 1JKQC 2X48A 1ZARA 3LA7A 3ML6A 2JA2A 5KNLA 2LKXA 3S3WA 1AU7A 2HVQA 4FM1A 2DOAA 3APQA 2HU9A 1UELB 4M74A 2XC7A 3W2WA 4OX9O 3QNEA 4HAMA 1IRFA 4RAFA 2P5LC 3AK3A 3ZRVA 2ZCEA 4TT3G 4A3GJ 3CF5F 2QR4A 3ZHSA 5C44J 4Y3OA 2Y69C 3LMMA 5D5XB 1XDUA 1R6RA 3EETA 2CV1A 4EKWA 3CDIA 1R3LC 4W97A 4JI1O 1SESA 1U9OA 2UXBB 3HKZN 3E6MA 3KEYA 5IT9N 4UCRA 1JOYA 5J2UB 4YFXF 3FWEA 5FPRA 1OLTA 2WAQA 2Q5ZA 1BJAA 1NK3P 4FZ0A 1YW7A 4DQ2A 2XTAA 4HQEA 3ZPLA 1QA6A 4ZC3A 3EUKL 2PZSA 1BQ0A 2FUG2 2M9HA 2FQ3A 2Y48A 2NNUA 1US6A 2QWQB 3CRMA 4LF7B 2EBOA 2VL8A 1JQ0A 1KECA 1AR1B 4WXCA 3B2EE 1KD1W 2QQ8A 4OPHA 1IBKO 1HOMA 3UT5A 4KL1A 4P9FA 3ZP5A 2EZIA 1FC3A 3AG2H 4A0YA 1G4YB 2LY1A 3CTAA 3ZQIA 4O4IB 3DPLC 3DFGA 2HJFC 4DR4B 4E6KG 2R7QA 1B6AA 3WTXC 3PIOF 3K1MA 4X20A 2W4SA 1MH4A 4OU0A 4B4CA 1YIJI 3QU6A 1JUPA 3KYLA 3P32A 2XNDG 1SERA 1Q1VA 1FSHA 2QVOA 2GV9A 2ZO4A 2H6CA 2ETHA 4ZTFA 2XKOA 1E3PA 3FX3A 3HRTA 5K5RA 1UJWB 4RQEA 1HDJA 3ETGA 1A5JA 3EYYA 4BW5A 4EJOA 2H8PC 4DR1B 5HNHA 2L2OA 2ZKZA 1FWZA 2FJ1A 4V19K 4NDLA 1M93A 3IC9A 3JAWA 2OAZA 2OV7A 4RUFA 1IO2A 1YIJV 1KKDA 2FBKA 2KQRA 3HPGA 1IN4A 3HTUA 2EZHA 4A5NA 2QA4I 3CC4V 3O8HA 4NXMO 4BS9A 1ZR4A 4FM0A 2OIGA 1V54B 1XTAA 1L0OC 1ZHFA 1B9NA 1ON2A 2M0MA 3IH4A 4M3EA 1U8RA 3B40A 2W7NA 2EINB 2L7KA 4RBOA
chains in the Genus database with same CATH topology
1YQAA 2WPDG 4R79A 3JW4A 3T8TA 4P9OA 2W85A 2VONA 2OTLV 3COAC 1KP3A 4I0AA 5E1AC 2P8TA 4KYWA 2VC0A 2DI3A 4FIPC 4G27B 2O03A 1IN5A 3LWFA 3AEIA 5B1AB 2J5PA 3IRRA 4I01A 2RGVA 4Q48A 2YEVB 3MEXA 1UB9A 2PN6A 5EEHA 2FU4A 2C2AA 1UFMA 1MJAA 1P7BA 2NYXA 2HR3A 2ISYA 3LSQA 2MA3A 3SYCA 2ISZA 2BV6A 3ZN0A 3IWZA 3TETA 3TOAA 4PGGA 4A5MA 5HS8A 2FMLA 1TW3A 1FYLA 1X3UA 2OA4A 2ZQMA 1R22A 4RAZA 3SZPA 3WU0A 1YIOA 4K2EA 1YYVA 2KKOA 1B4AA 1TQPA 2HQRA 3KZZA 4B09A 1F5TA 2IJHA 3WTVC 3B8MA 1O3TA 3DV8A 1FXVA 4EJWA 3Q5FA 5LHIA 1BM9A 2R3SA 1Q86W 4BIZA 4ASNA 2F5FA 4PCQA 4L9NA 4RGSA 1U3EM 1S29A 5HDGA 4MTEA 1G6NA 4G6DA 4MVZA 3BY6A 4LFUA 4HV6A 2IA0A 5E20A 3CUOA 1GMGA 2JJ2G 2BOBC 1Z7UA 1P4RA 2P90A 3MD0A 4R7CA 1BOAA 1GHCA 1MDMA 5ICEA 4BNCA 1M1KW 3OMAB 2IPQX