3BY6A

Crystal structure of a transcriptional regulator from oenococcus oeni
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
119
structure length
119
Chain Sequence
QAMAITQKRPVYLQLVDRIKNEVATDVLSANDQLPSVRETALQEKINPNTVAKAYKELEAQKVIRTIPGKGTFITGNTASVKNSNQNRLLADLSQVIAELIKSGVKGERIKKIVNDILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a transcriptional regulator from Oenococcus oeni.
rcsb
source organism Oenococcus oeni
molecule tags Transcription regulator
molecule keywords Predicted transcriptional regulator
total genus 41
structure length 119
sequence length 119
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3by6A01
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3by6A02
1JE8A 3KEQA 1IN7A 4ZYGA 2OA4A 4ZZDA 4G8XA 2OAZA 1O57A 2CGPA 2G7HA 1XGNA 3GFIA 2NS0A 3R0JA 4M72A 1Z6TA 2LF8A 1BIBA 1WWXA 2P7VB 2XAQA 4L0ZB 2QVOA 2IP2A 3CLOA 1C0WA 3F8NA 3SZTA 3RIRA 4ENKA 3BOQA 1YTYA 4R79A 3BJAA 1BN5A 1DDNA 2R3SA 4BQAA 4LLNA 2XAFA 2Q0OA 4I0AA 1YLFA 3ELKA 1AWCA 4HV5A 3F3XA 4EV0A 4CXFA 4P9FA 3F8MA 1TQMA 2YU3A 2W85A 2ESNA 1MJAA 2FNPA 4EM0B 1ZLJA 3ZMZA 1HXDA 2QQAA 5D5VB 3GO5A 2K4BA 4PCQA 2ZFWA 2ZMEB 4RB3C 1SFEA 4Q47A 1MD0A 1WI9A 2H6BA 1BC8C 3SHFA 5FLXK 4ENNA 2BBYA 2Z5UA 3HHHA 6PAXA 3F22A 2D1HA 1QQIA 3KP4A 3WGHA 1OKRA 3CO7C 1XN7A 3E5XA 3QU3A 2VBXA 3BWGA 1KU3A 3M8EA 4KT5C 3TO7A 1R5HA 1PP8F 1HSTA 3HRSA 4IJAA 1USSA 2GAUA 1E17A 1G3SA 2CSOA 3GLXA 5LGNA 2DAOA 5HS9A 3FMQA 5J8FA 3E6DA 2FBHA 4CO8A 1CF7A 2GA1A 1HW1A 5H20A 1FLIA 1WSUA 5DCMA 4IVNA 3ZN0A 3P9CA 4IXAA 1GXQA 2V79A 2FU4A 1FYMA 5ILSA 3SQNA 2PG4A 1KA8A 4HV6A 5HDKA 1SFUA 3KLOA 3TDUC 1BI1A 4WF2A 2QZ8A 4Y15A 1IF1A 2EFOA 4LB5A 3V7RA 1IUYA 5E1ZB 2HDCA 2FOKA 4G6DA 2JTVA 4OIOF 3HSFA 1IRFA 3ERED 4KIBA 2F5DA 5ED4A 2PQ8A 4RS8A 4AVPA 1SD6A 4XRFA 2XKOA 3ULQB 1KQ8A 4IRHA 4QWQA 5HLIA 3FF5A 4RAZA 5E20A 2A6HF 4MHGA 4EM1A 2RV8A 4MTDA 3DP7A 4R8HA 1U8RA 4I98B 3G73A 1MJBA 3R60A 3J7AO 1XSXA 5L3DA 2EB7A 5JI6A 4MEXF 3T1BA 4EQQA 1FP1D 1IAWA 4M9SA 2WTEA 2WV0A 3I53A 4UVCA 1DPUA 3U1DA 3FM3A 5HDNA 2YPRA 3CUQB 4R1HA 4MQ9F 3OOPA 2CFXA 4BHBA 3I59B 5ICGA 4CGZA 3I59A 1A04A 1HW2A 4P9UA 3GFMA 3DFGA 2VT2A 1I6XA 4YIIA 1DPRA 3D5LA 3KEOA 1OMIA 3ISPA 3EYIA 1YG2A 3HSRA 1TTYA 2L3DA 1MDMA 1IN4A 4H0EA 1EV7A 2FBIA 5FGMA 1K78B 4KN4X 3IWFA 2FA5A 3L09A 2VONA 3SFZA 2Z3YA 4WWCA 2HTSA 1O7FA 5ICCA 4M6YA 4LGWA 4I01A 4CICA 5L3BA 3LQQA 3RTRA 3JAMK 2EA4A 3CDHA 4HF0A 2WC2A 2XRNA 4HBLA 1T98A 5IT9K 3VOEA 1QZYA 2PFBA 4WXCA 4WCGA 2OBPA 3HTSB 1ONVA 4OIQF 2YSRA 1S7OA 1XSDA 3ROUA 1FBUA 2OU2A 4RGXA 2KJCA 2MH9A 2IA2A 4IPAA 2GWRA 3SXYA 4IHSA 5K1YA 4A2UA 4OU0A 3LFKA 4HF1A 2V6CA 4PGGA 2PI0A 4HZFA 3LAJA 4ZYEA 2GXGA 4RAYA 4E70A 5LEKA 1Z1DA 5J8CA 2EFWA 3TOBA 1H9GA 4HA8A 4OIPF 3BPVA 1MGTA 5H6RA 1PDNC 1XCBA 5LLQA 1QBJA 1Z9CA 4L18B 4G94A 4UV9A 2HQNA 4LLGF 4EJOA 2A68F 2CYYA 3O2PE 2M87A 1RUNA 3GZ6A 3QPHA 3RDIA 4G7OF 2NAZA 3FX3A 1D8KA 3VEPA 4GYIA 3ZMSA 1Z91A 3WTTC 3KCCA 3I64A 2ZNYA 2KIUA 1F5TA 2YX7A 1TQIA 2ADUA 3M7GA 3W7TA 2FMYA 3T8RA 2PMHA 1RNLA 1ZARA 4WXHA 5CVVA 3W7SA 4Q5SF 3QP6A 1B4AA 3CUQC 2DQRA 4M9ZA 4EJUA 5EEGA 5DDGA 1X3UA 2F2EA 3KP2A 2P5LC 2IA1A 3MZYA 2AXLA 3IC7A 5LGUA 1JHFA 3IHUA 3BPXA 4GCVA 1OR7A 4I0BA 1ZRFA 5E8GA 1NH2B 3VODA 3L9FA 5J6XA 1P2FA 3WU0A 4UNOA 1Z05A 3V7CA 2QQBA 5ICEA 4HQMA 3TDZC 4KNYA 4EGYA 3QU6A 2IRFG 4U88A 1K78A 3M8FA 5F1RA 4KMFA 3WE3A 2XAJA 5JR3A 5ILVA 5BOXA 1BI2A 2H6CA 2W25A 2CG4A 4M9XA 1ODDA 3LA7A 2HOEA 3BDDA 2DPUA 2VOOA 5TJJA 5E1WA 1JHHA 3OV8A 1OYIA 4G7ZF 4YG2F 3ZP5A 2Y48A 2K02A 5CVIA 1TNSA 2DBBA 2BEOA 3K1NA 2A69F 3I4PA 3NRVA 5DCMB 4ENJA 3ZMDA 5A2QZ 3BJOA 1YTFB 2GQQA 3ZQ7A 4WXDA 5CVRA 2HYFA 2M45A 4CYDA 3GYHX 4HOBA 3KP3A 1F4KA 2QWWA 1LEAA 1IRGA 2VT3A 3RKXA 3RPQA 2Z99A 3BY6A 3TGNA 3E6CC 3Q9SA 1ZG1A 2ZKZA 3DPTA 3M9AA 1ZGJA 3LAPA 4G9YA 1FY7A 1SD7A 4G6QA 1ZG5A 2RC4A 4LK1F 1UB9A 3DKWA 4NHJA 3GVAA 5F64A 1G3TA 2CQKA 3ZPLA 4EJVA 4RB2C 3KP7A 5K5OA 1P4WA 1KQ0A 3TO9A 4HW0A 2PN6A 3GX4X 3LWFA 3HTUA 2BV6A 3FXRA 1XMAA 4WX9A 4AIHA 5H6QA 2VE9A 2L01A 2FRHA 2E1CA 3MWMA 4L5IA 4BNCA 2UXNA 1YYVA 2W24A 4AWXB 2RNJA 4LD5A 5CYVA 1YS7A 2ESHA 1R5GA 1XGMA 3F6OA 3I54A 3HRMA 3WU1B 5HOOA 1XSVA 4L0YB 4S05A 3WTSC 3W6KB 4KDPA 3GEZA 3JSOA 2BYVE 4CDGA 2NNYA 4GYGA 2HS5A 1FC3A 3V8LA 2R7DA 1I1SA 1TLHB 5GW7A 2EK5A 1HKQA 3HOSA 3E5QA 2IVMA 2EJRA 4NB5A 2A07F 1LJ9A 1IZ1A 2RGVA 4DNCA 2E7XA 5CLSA 3LSTA 2F5CA 5D5WB 1FSHA 2ISYA 1O3QA 4HX7A 4HLXA 2DO7A 4L5JA 4BH9A 1JXSA 4A5NA 1HKTA 4RB0A 1FYKA 2COMA 2EFNA 1YO5C 3IKTA 3L7WA 2HKXA 2ZBKA 2ZMEA 1TNTA 3WTWC 2P5VA 3F23A 3FXQA 3R4KA 2DU9A 3AAFA 2XAGA 4ZH4F 4O3MA 3EUHA 2V1XA 4L9VA 5LRSA 4P96A 2O0YA 3GF2A 4L9NA 5HS7A 2ISZA 5CA3A 5FB2A 5JFRA 2RDPA 1T39A 2B0LA 3FMSA 2VE8A 3C1DA 1LQ1A 2GXBA 1B9NA 2EFPA 2KIMA 4A0YA 3WTUC 3KFWX 1U5TA 3KZYA 1O7LA 3K1PA 1W7PA 2DLLA 1L0OC 4D0PA 2KIFA 5D6EA 5E18F 2YX4A 3VB2A 4O6JA 1IXSB 4BAYA 2MLGA 1QGPA 3F21A 3J81K 4EJWA 1QPMA 2V9VA 4CZZA 3KZZA 1ZRDA 2XGXA 1FX7A 1HBXG 1RI7A 2EA2A 4FX0A 3MQ0A 3H92A 2H27A 3U9GA 5E8IA 4KN7X 1R58A 4N0BA 3R0AA 2STWA 2PEXA 1L3LA 3DV8A 5HDGA 5ICFA 2QYOA 4N9IA 1LB2A 1KGSA 2MLKA 2RQPA 4IF4A 4YFXF 2MA3A 3NEUA 1REPC 1FNNA 1BJAA 2P90A 4PZJA 3ZMVA 2X4HA 2TDXA 1LNWA 2PMUA 2STTA 2A3SA 3J81Z 1D3YA 4XLPF 1BC7C 1P4XA 4BXUA 2DTRA 2IJLA 2ZCWA 3ABUA 2V1DA 5E17F 3CUQA 3WGGA 3KETA 4TV7A 4ETSA 4I02A 4JK1X 4MNUA 2F5EA 3RPUA 1WRJA 1W5TA 3ZN1A 3JAMZ 2K86A 2A61A 2P5KA 1O3RA 2LF7A 4A0XA 2AS5F 5AIPA 4ZYDA 1PP7U 4S04A 3QOPA 4LFUA 3GFLA 2E7WA 2FXAA 3W7XA 2FQ3A 1Y0UA 2VBZA 3P9IA 1BM9A 4RGUA 3PQJA 4F7ZA 1SFXA 1T2KA 4HF2A 3S2WA 3TO6A 5KVRA 1B6AA 3WG9A 2DPDA 1U5TB 4UVAA 1V3FA 1Z6RA 1RIOH 1S6LA 2DI3A 4GXOA 2P6SA 2FBKA 1S7AA 2XAHA 4LJZF 5DV5A 1H9TA 2FMLA 3WTVC 3BROA 1E2XA 2DT5A 1W7PD 2K7LA 3MEXA 3DQVC 4NQWA 1LDDA 3HHGA 2L02A 3D0SA 3E35A 4ZYHA 4KMUX 3F72A 1SMTA 2DFIA 1RUOA 3JSPA 1I1GA 5FLXZ 5LEJA 3PQKA 3V8JA 1B59A 3T8TA 1R1VA 3RYPA 3IRRA 5HLHA 1ZLKA 1MDMB 5F6FA 5CJ9A 5BPIA 4AIJA 1NVPB 1K7AA 3Q9VA 2IPQX 1D8JA 4IRGA 4EGZA 1SAXA 2H09A 1TW2A 2ETHA 1ZN2A 5TRDA 2FEZA 1R1TA 2WWYA 4A0ZA 4P55A 1BIAA 4EJTA 3D3IA 1J75A 2XVCA 4IHTA 2A6EF 1UFMA 2MD5A 2VC0A 2VN2A 1Z7UA 1GHCA 3RI4A 2P8TA 5IT9Z 3GXOA 4A6EA 1J7KA 4A6DA 2YR2A 3FZVA 1LDKB 4WK8F 3DEUA 2CW0F 2R7FA 1O3SA 2UXXA 3LA2A 5FD5A 1R7JA 3J80K 2GIVA 2LNBA 2HR3A 5DYMA 3EETA 3MFKA 4U7BA 4XBFA 2P7CB 4EM2A 2VOPA 1XGSA 4RGRA 1SD5A 5CVJA 4BHCA 2WAMA 5K5RA 2P4WA 2G9WA 2FNAA 3JTHA 3BJ6A 2XASA 2FE3A 4KYWA 1UCRA 3B73A 1YS6A 1WKMA 2IW5A 2BE5F 4UVBA 1R1UA 3FM5A 3F6VA 2DK5A 4LG0B 1B1BA 3I58A 1IXCA 1P4AA 4G7HF 4MTEA 3TKYA 1EH8A 4FHTA 4A12A 1FOKA 3LQRA 1ULYA 2Q8KA 1LDJA 2PBIA 1UHWA 2L4AA 2UWMA 1VTNC 5EEHA 1RM1C 4ESBA 1J5YA 3MAJA 2QQ9A 1XCVA 2H94A 3JTGA 3R6SA 3HIFA 2JRTA 4M6XA 3E5UA 5HS8A 3W6JB 5LBQA 2VODA 3DPLC 4HDVA 1EH6A 2RKHA 1STZA 2GA2A 1YW9A 1AOYA 2HFHA 1WQ2A 1B9MA 1BBYA 3F8FA 5DCFA 1I27A 1W4MA 1GXPA 4UXNA 1U3EM 4LMYA 3QAHA 2XROA 2M30A 2EFQA 4YFKF 4KIGA 1V4RA 4OIRF 3U2RA 5HLGA 1XDUA 1G4DA 3V8KA 1FP2A 5D4RA 1USTA 1FT9A 2DQLA 4PGHA 3HYIA 4M74A 2HTJA 3HUGA 1OYYA 1KYWA 1U5TC 1EH7A 3FXUA 5DEQA 1ON2A 3EQLF 1XMKA 3T0YA 3MZHA 1MKMA 1Q1HA 1U6GA 3E6BA 4UV8A 1J9IA 3ZMTA 2EWNA 2QBYB 4B09A 4O5VA 4P5OA 3K69A 5DUKA 2JPBA 3KE2A 2HEOA 1YFHA 3QP5A 4KUMA 2QENA 4BYYA 1R00A 2HQRA 4M73A 4I7HA 3N4MA 3IKVA 1R36A 4I09A 1ZHFA 2XKPA 4RB1A 4CHUA 3FMRA 3GZ5A 3KLNA 5FO5A 5HVQC 3P9KA 1FYLA 5BS6A 5FFXA 3WGIA 1F9NA 1DP7P 5BMZA 1W5SA 2VXZA 5E1XA 2D1VA 4AD9A 2ZXJA 2EV6A 1ZYRF 1XDSA 5D5XB 2O6GE 4HAMA 2CO5A 2KRFA 1K79A 3K2ZA 3HRUA 3E3VA 2Y0MA 1LEBA 2Z9OA 1G3WA 2OQRA 4Y17A 4RGSA 3HOTA 4LB6B 1YW7A 2JT1A 4Z2YA 2M8EA 2QM3A 4XSZF 3ABTA 2EV0A 2OZ6A 5L3CA 4UHTA 5L3FA 4JBAA 2K4JA 4HYEA 2EV5A 4K2EA 3C18A 1YW8A 5AONA 1BOAA 5L3GA 3I0TA 2J5PA 1SD4A 3FWEA 2ACJA 5JHUA 2XUBA 4MEYF 2L54A 5ILUA 2Y75A 4OINF 3N97A 2C6YA 3DXJF 2RN7A 1P6RA 3H3ZA 2LKPA 1T38A 1UHMA 3TQNA 2LSOA 2ELHA 3WTZA 1CGPA 1FSEA 2MH2A 4HDUA 5KK1A 2HYGD 3O3KA 4ENMA 2XIGA 3B02A 2HWVA 1IN6A 3M1EA 1TW3A 3W7UA 3WE2A 4U0VA 1ZRCA 2QBYA 1QZZA 2BGCA 3ECOA 2UZKA 1MZBA 2K27A 1HQCA 1RZ4A 3EDPA 2Q2EA 4LK0F 2W84A 1CF7B 2E1NA 4OOIA 2CWEA 4L9TA 3WODF 1QNTA 5LHHA 1T6SA 2XHKA 1U2WA 2FSWA 3WTXC 3JW4A 2ZO4A 4XSXF 2V1UA 4UUVA 4FX4A 3BP8A 4KA4A 2NYXA 3HRTA 3RYRA 4OMYA 1SMYF 2PLYA 3E97A 1XGOA 4AIKA 4A5MA 2J5OA 3R61A 1ZREA 5LRRA 2M5WA 2MC3A 4U0WA 3I5UA 1XB4A 2HKOA 2OD5A 3O6BB 2W57A 4Y13A 2FF4A 3REOA 1KQ9A 3ML6A 4ZZLA 4JQFA 5A2QK 2NNNA 1J59A 2MBFA 4ON0A 4BHPA 4EMSA 3DF8A 2P6TA 3K0LA 5JVTA 5AIQA 4MGRA 1ZH5A 5D8LB 1NHAA 4FT8A 2VBYA 5D6FA 5DUIA 1J2XA 1IW7F 3T5XA 2KKOA 3E6MA 3ZMUA 1HSJA 1FBSA 5BPDA 3IWZA 4KICA 1TBXA 2QUFA 3RKYA 2HZTA 2VBWA 4HLYA 1ON1A 3F8CA 3K9TA 2JSCA 2ZJ2A 1FWZA 1T0FA 4ESFA 3GWZA 3GFJA 1ZG3A 2LDUA 2OZUA 4N9HA 1ZGAA 2RVCA 4HX4A 2GZWA 2DW4A 2M1BA 4LG0A 4HX8A 1YQAA 3P7NA 1FBQA 3CTAA 4ESJA 1G3YA 2F5FA 3W7WA 3C7JA 3CUOA 1BI0A 5DD4A 2O3FA 2ZNZA 1S8NA 1R22A 1QO0D 4L9JA 2PJPA 4U0YA 2DK8A 3BZ6A 1O3TA 1DUXC 1PUEE 1YIOA 1IN8A 1FPQA 4Q48A 1FZPB 3RJPA 3SZPA 1IN5A 3F8BA 3QRFF 1JGSA 2Z33A 3PFIA 4GGGA 2IT0A 1XD7A 3CO6C 3VFZA 2VC1A 1OYWA 2O61A 5ERIA 4MQVA 5LHIA 1ZAOA 4I2OA 5CVUA 3KP5A 1F1ZA 4YFNF 4GO1A 4PDKA 4XLNF 2L4MA 3QPTA 3K1MA 3L2CA 2JPCA 5K5QA 3EYYA 3Q5FA 2D2WA 1D5VA 4EVIA 2QLZA 3GW2A 5D5UB 2HGCA 3IL2A 2A5YB 3FHZA 3CJNA 4OMZA 1KYZA 2O03A 1I5ZA 2IA0A 3KP6A 1TQPA 4HQEA 1LVAA 1J0RA 2KJBA 1KU2A 4IRIA 2JZYA 4Q4ZF 4ASNA 3GUDA 4KFCA 3IRQA 4YIFA 3I71A 5FD6A 5L3EA 1IXRC 5DD8A 1G6NA 5LHGA 5D4SA 5LGTA 1MJ9A 1K6OA 1KU7A 4DQ2A 3ECHA 3C3WA 1KU9A 3L00A 3LA3A 4M71A 4U7DA 1H0MA 4QLCU 1P92A 3WTYC 3NQOA 2G7UA 1S29A 5FFZA 5D8KB 2X0LA 3V4GA 1U78A 1GVJA 1R23A 2NRAC 1BI3A 2OQGA 1W7PB 4LLLA 3V7SA 1HKSA 2O8XA 1HW5A 5IT3A 2XV4S 3MCZA 5BQTA 3RKWA 3HSEA 3COAC 3J80Z 4B8XA 1S3JA 1OPCA 3H3UA 3G3ZA 2D45A 3TOAA 4KIFA
chains in the Genus database with same CATH superfamily
1JE8A 3DSQA 3AL0C 2FUG2 1SQFA 3ICXA 3KEQA 1IN7A 1ZELA 3I55I 1RKWA 5DM6V 5BNGA 4JTAB 4JI7O 1Z2GA 3E83A 3RYCA 4ZYGA 1TWCJ 2EH3A 3FXKA 3M3YJ 4MVQA 2OA4A 4IHYA 3HB9A 5EGOA 5GP9A 3U1KA 4ZZDA 4G8XA 2L7FP 2XOKG 3E8HA 1VIBA 5B1BB 5EGOB 3E7LA 2OAZA 3AG2H 1HCRA 1O57A 3QOEA 3SDGA 2CGPA 1YSCA 4NXMO 1VQ6V 2G7HA 2XPVA 1A6QA 2Q9LA 1XGNA 1VF7A 2X6AA 3CQZJ 3B8MA 3KG2A 1DGRM 2OCCB 3GFIA 2QTOA 3CCRI 4J7KA 4Q20A 2NS0A 1KBHA 3OYEA 1P7JA 3R0JA 4M72A 3OYJA 1LVKA 2DJIA 5LA6A 2WLMA 1Z6TA 1ETOA 2LF8A 2NVTJ 1BIBA 1WWXA 2P7VB 2XAQA 4XK4A 3MKYB 4L0ZB 1X3WB 2BE3A 2QVOA 1NTCA 2IP2A 3CLOA 4HNTA 4E7HA 1C0WA 4FZ0A 4LFBO 1YX5A 4Q6GA 3F8NA 1MSWD 3E89A 2MFZA 4CH3A 3SZTA 4DV2B 4UUSB 2FB5A 3RIRA 4ENKA 3BOQA 3BABA 3OEHG 1RPWA 3IH2A 4A3KJ 3OS1A 1YTYA 4R79A 3BJAA 3OYKA 4OX9B 4NTYA 3R66A 4X88A 1BN5A 2E34A 3RYCB 1DDNA 2R3SA 5GTHZ 3I56I 2A05A 4XL9A 1OCRC 3PL8A 1ORKA 3OYDA 3NXSA 2HI3A 5IPAA 1H89C 4JI2O 4E7LA 4BQAA 3S2DJ 4LLNA 1R6KA 4FFKA 3RVZA 2XAFA 3K10A 5C4JJ 1ZQ3P 1R3JC 2Q0OA 2EIMB 4I0AA 1TT0A 3PNVA 5AG2A 3WB2A 4G6TB 1YLFA 1A31A 1QLEC 3OGIB 2L9RA 2QWNB 3ELKA 2GBYA 4O2AA 2EIKH 1AWCA 2IXSA 4HV5A 3ERMA 3F3XA 4EV0A 1US6A 4CXFA 4P9FA 3F8MA 1SQBH 3W2WA 1TQMA 4IL6Z 2WAQN 4U87A 4JI5B 4ASUG 2YU3A 2QWOB 4X1KA 4PA4A 4JI0B 2GOXB 2HVQA 2XGDA 2W85A 4YIRX 1YTFD 2ESNA 1MJAA 3BG6A 1PP9H 1N8RW 4UUJC 2FNPA 4EM0B 3T1YB 1BR1A 3WG7C 1YZBA 1ZLJA 4PJJA 3OYAA 3ZMZA 1KD1W 4N21A 1YI2V 1NG6A 3IV5A 3E0JB 1HXDA 1P7GA 2NOJB 2QQAA 5D5VB 3CJQB 3GO5A 2K4BA 4PCQA 2ZFWA 2DOEA 3G6BA 2DT6A 2OTLI 4HSTA 2ZMEB 4JP0A 4RB3C 3H9JA 1SFEA 3PO2J 2R70A 4Q47A 3K08A 3DC6A 1MD0A 1WI9A 2WA0A 2H6BA 5GAEJ 4DR6B 1RR8C 2JWTA 1BC8C 5IP6A 4DR2O 3SHFA 1BE3H 4BE2A 5FLXK 1F36A 4ENNA 2DA5A 4DZPA 3CS5A 1K97A 2BBYA 2Z5UA 3HHHA 3SEQA 6PAXA 4GX2A 4QIWF 3F22A 2H8PC 2D1HA 1QQIA 3KP4A 3TP3A 1IUFA 3JR9A 1IJWC 3RPUD 2CTQA 5EJCA 3WGHA 4PDVA 1FFTB 1OKRA 3CO7C 1XN7A 3BG7A 3E5XA 2Q68A 1BCCH 1WPBA 3QU3A 2VBXA 3BWGA 5CQGA 1KU3A 2CU7A 4PDRA 1HLVA 2IBZH 3CC7I 3M8EA 2VRZA 1JKOC 4KT5C 3TO7A 4J7ZA 1R5HA 2CQNA 2CV1A 2X6CA 4KFMA 1PP8F 2GSMB 1HSTA 2VLAA 5EDNA 2LJ2A 3HRSA 1A6IA 1S0VA 1TZLA 3OW2U 4PELA 5KAFC 1VARA 1O4XA 4IJAA 4NR1A 4C7UA 1USSA 2GAUA 3PIPF 1E17A 2UUCB 1HW7A 1OCTC 3LSHA 3K3WA 1KC8W 4LF4O 3JASA 1G3SA 3CF2A 1PKXA 1JFFB 4G28B 2CSOA 3GLXA 3UNGC 5LGNA 1W36C 2ZXWH 2DAOA 3UO3A 5GTIZ 1FFXB 5HS9A 3FMQA 3G1MA 5J8FA 3E6DA 4BEHA 2FBHA 4CO8A 1CF7A 2DCEA 4A3JJ 2GA1A 1JJ2U 4JI7B 1HW1A 4FM0A 5H20A 2DA1A 3NWSA 1U9OA 2R7XA 2CAZC 2XPWA 4PD4F 3LOCA 2QGUA 4LFCB 3RQIA 1FLIA 3QO7A 5GONA 1WSUA 3K9AA 3D5SC 4CCMA 1CQTA 1S72V 3CP2A 1H9TA 5DCMA 1ETQA 5KHJA 4FK5C 3CCVV 1YIJV 2R92J 2CTWA 4IVNA 1YE9A 3ZN0A 5CBHA 2O7OA 3P9CA 4IXAA 1RP3B 1GXQA 2V79A 2FU4A 1FYMA 5ILSA 3SQNA 3TETA 4PA9A 2WB1A 1R4MB 2PG4A 4IOAF 2VQEO 1I94O 2QQ8A 3PIOF 5E79C 1KA8A 1Y8QB 2Z2SB 4HV6A 3OMYA 1FIPA 3S14J 1PL4A 1Y67A 2ECBA 5HDKA 5J1RA 1SFUA 3T1CA 3T4ZA 3CC4V 3KLOA 5KAFZ 1MA1A 2K3PA 3TDUC 3Q0WA 3S3NA 1BI1A 4WF2A 1ZR4A 1GN3A 3SYTA 5H2FZ 2QZ8A 4Y15A 3SYCA 3VPRA 1IF1A 1V55H 2EFOA 3BG5A 1COWG 5IJ0A 4LB5A 3D3QA 3HOUJ 1XDCA 5LYJA 1UMQA 4DV4O 1FTZA 3V7RA 1IUYA 1THZA 2A9HA 5E1ZB 2HDCA 3ZQGA 2FOKA 3JALB 4WFFA 1D1CA 4G6DA 3H01A 3LSRA 2HVKC 1K61A 3CC7V 1QVGU 2JTVA 4OIOF 4MIMA 3HSFA 3UT5B 3ASNC 1VF5B 1SANA 2CUZA 4FLUA 1IRFA 3ERED 3ESWB 1H8HG 4FMTA 4B3MB 4KIBA 2F5DA 2ICWG 3DPUA 5ED4A 3AL0B 2PQ8A 1NTMH 3IGAC 4U7OA 5B5EZ 1Y1VJ 1QZEA 3WG7H 4KP4A 4RS8A 4AVPA 1MMAA 2CRGA 2YS9A 2E1OA 1SD6A 5LP6B 4XRFA 1B6QA 4O4LA 2XRLA 4Y52J 2XKOA 3OYBA 3BR2A 5B1AC 3ULQB 1MMNA 4QPKA 1KQ8A 1F23A 4IRHA 4QWQA 5HLIA 2H1LA 2ZSHB 2W7NA 3FF5A 4JZGA 1D5NA 1XHXA 2LBFB 5M3FJ 3BA8A 3K5NA 4RAZA 2OPTA 1KONA 1GMGA 4QGPA 1RRJA 5ITZA 5E20A 1GH6A 4IL6C 1TWFJ 1MNMC 2A6HF 1VI0A 3WHCA 4D7MA 4MHGA 4EM1A 1SRYA 4G27B 3ETDA 1WN7A 3DEEA 4JI4O 1WJZA 2RV8A 1FJGO 3G1OA 4AIDA 4MTDA 1Y0NA 1S5HC 5KAIC 3DP7A 4R8HA 1U8RA 1ZR2A 4LR3A 1N34B 4I98B 3H0DA 4JV5B 2ODMA 1DF5A 3G73A 4DW0A 4LF6B 2ZD9A 1MJBA 2VQHA 3NARA 3V42A 4II3A 1EZVH 3R60A 3RSNA 1F51A 4H0LB 4UB8C 3STLC 3J7AO 4JX4A 3UM7A 1XSXA 5L3DA 2P81A 1MMDA 2EB7A 1WGXA 5JI6A 4LF5O 1PD3A 3AG3H 2KQXA 1H8AC 1JJOA 1RESA 4A3MJ 1WB8A 1QR8A 5IT9N 1QLNA 1KZHA 5F2VO 2PMZA 4MEXF 3K2AA 5EG0B 4A3GJ 2O57A 2DYSC 3T1BA 3K5LA 4Y3OA 2K9NA 3DGEA 4IIJB 2ZXWC 4EQQA 1QLEB 1XL6A 1AILA 4Z2WA 2ZM6B 4PSWA 3QTCA 1FP1D 3GTQJ 2JVDA 5DTDA 2BY2A 3A2KA 4JI5O 1OV9A 5JHFA 1MMSA 2R7RA 1IAWA 2D5VA 1A32A 4M9SA 2WTEA 2WV0A 3H5RA 1OCOC 1VF6A 3I53A 2YC0A 1HNWB 1SVLA 3QPLA 4UVCA 3U1DA 1DPUA 4MW3A 1VNDA 3FM3A 5HDNA 2YPRA 4ZDOA 1QVFU 2CGNA 3CUQB 3G6EV 4R1HA 4B7KA 1Z67A 1ETWA 4MQ9F 1FD9A 1VP7A 3B6AA 1XEQA 3LNNA 2A06H 3OOPA 1FAFA 3RVYA 2LK2A 2CFXA 2QWPB 4BHBA 3KYCB 3I59B 5ICGA 5C4XJ 2W82A 5FKLA 1BMFG 2QKAA 1HW2A 3I59A 1A04A 4CGZA 2HVJC 3K7AJ 4P9UA 3GFMA 3DFGA 4EB6A 1BZKA 2E2IJ 2VT2A 4W97A 2PUSA 3D36C 1I6XA 4YIIA 3JRHA 1DPRA 3D5LA 4IGGA 4RO2A 3HKZA 5KAIZ 2NR5A 3KEOA 4D7TA 2RAEA 3OL3A 1OMIA 1HNZB 1BS3A 3ISPA 3EYIA 4NBQA 1HC8A 5HFMA 1YG2A 3HSRA 3KYLA 2QKCA 3MDSA 4NTXA 3CMAI 1TTYA 2L3DA 2IGNA 2OF7A 3J7AY 4LP8A 3TW7A 2HZDA 2ECCA 1MDMA 1IN4A 2K9QA 4H0EA 1EV7A 3I4MJ 2FBIA 5FGMA 1K78B 4E7IA 3K70C 4RUFA 3E8BA 4KN4X 2N04A 2VKDA 1GUUA 3C2GA 1AR4A 2YS8A 3GTMJ 2IU3A 2W6JG 2JVGA 3IWFA 2FA5A 3L09A 4TWKA 5B3SH 2YUAA 2VONA 5EZYB 3SFZA 1XILA 4ZDPA 2Z3YA 3ABMC 2YXYA 2IEKA 3A0HZ 1FS0G 3BPZA 1YJ9I 4D6TH 4II2A 4Z1VA 4WWCA 1R9TJ 1U96A 3JCUC 2HJDA 2GXAA 3S1NJ 1WNSA 2HTSA 1O7FA 2IJHA 5KMGA 1X1PA 4IKFA 4J42A 5ICCA 3HKDA 1GAXA 2AHQA 4M6YA 5J2UB 1EN4A 3SJCC 3L9DA 5BMVA 3AK2A 3ZX6A 3J7AU 3S8PA 3LDEA 2L2OA 1MSDA 4LGWA 1EFRG 4I01A 1LNQA 4CICA 5L3BA 1QBZA 3LQQA 5H2FC 1DQUA 3RTRA 1NKDA 2DQ0A 2BY0A 2OWOA 2EZOA 3JAMK 1BA5A 2I10A 2X48A 3CCUI 2EA4A 4BUPA 2IS2A 4JTCB 4ZJZA 2KQRA 3CDHA 4LCUC 4HF0A 3K4NA 4AQYO 2K40A 1J09A 2ITCC 3IP4B 3B2EE 1ENVA 1X19A 4GX5A 3L74H 2CH0A 1BW6A 2DDBA 4XLCA 2DWDC 3K70D 4DV1O 3ZHSA 3C3TA 4MW8A 2WC2A 2XRNA 4CUGA 3CDLA 3F7YC 5CB4B 5KX5A 5JLXA 4HBLA 5DS9A 1VQLI 1T98A 4I6ZA 5IT9K 3VOEA 3HOZJ 1KP2A 1QZYA 1Q6UA 1P49A 2C2AA 3QVNA 4RDUA 3MD0A 1Y56A 4BDYA 4DR7O 1JA8A 2KRCA 3ZHTA 4B3RO 1OCCC 2ZIOA 4K8ZA 2HPMA 2PFBA 5J2UA 1VQ8V 2EBIA 4F4LA 4WFHA 3DLLF 1B3QA 4WXCA 4WBNB 1FXVA 4K0KB 4WCGA 2OBPA 3HTSB 3S17J 5D5QA 1HR0B 3FBIB 3FAVA 1ONVA 2NS8A 4OIQF 2YSRA 1S7OA 4BBRJ 1WB7A 1XSDA 5LMNO 3ROUA 1FBUA 3A02A 2OU2A 1ZSPA 2VWJA 4RGXA 5CA1A 2KJCA 4CCKA 2MH9A 2IA2A 2DJNA 5TGTA 4IPAA 2GWRA 2EZLA 2QCOA 5LMUO 1MBGA 4Y7NJ 3HOVJ 3SXYA 4IHSA 4AC0A 2WLIA 5K1YA 4P30A 2LVSA 4A2UA 4U3JB 1HDDC 2K5CA 2PGGA 4OU0A 2XB0X 2CTPA 5IWAO 3C2HA 2QSFX 3LFKA 3NAUA 4I76A 4HF1A 1VFCA 1VQ6I 3M7MX 2V6CA 3LNQA 4PGGA 3CP1A 2PI0A 3K0DA 4DO2A 4HZFA 1M56B 3LAJA 1N0JA 2JEXA 3E22B 3IH4A 1POGA 4ZYEA 2VXDA 1JUPA 4LFCO 3QF7A 4DYLA 2GXGA 4RAYA 4E70A 4TV9A 2ZE7A 4TT3G 3ZRWA 1K6YA 5LEKA 4FETA 2VJ4A 4CYCB 1SF9A 2BW3B 1T5EA 2OJED 2VQEB 4BS9A 1HF0A 3F7VC 4FM2A 1Z1DA 5J8CA 3ZBHA 2EFWA 3KX2A 4AI8A 5KHIA 3A2FA 2OT5A 3TOBA 2WV1A 1H9GA 3NWTA 4HA8A 3AG2B 1NU1H 4IQJA 4OIPF 3TXQA 5CA0B 3H1LH 1W0TA 2KP6A 1PL0A 3BPVA 1MGTA 5H6RA 1PDNC 4BXXJ 3CCVI 4C2MJ 1YIJI 5EYPB 4EFBA 1VQ4V 3B4SA 1XCBA 3ABKH 5LLQA 2UU9B 9ANTA 1QBJA 3H1KH 3I56V 2GDSA 2FL4A 2YI8A 5EYPA 2LO1A 4XN3A 2MGQA 2R0QC 1Z9CA 4L18B 4U3JA 3ZRWB 3A0BZ 1YJWV 1AJPA 3BCAA 1P7IA 4G94A 5C3EJ 2AGAA 3EHBB 4FQGA 1Z0XA 3ZQHA 2HVSA 4UV9A 1VF6C 3CHXA 1WHUA 2WLLB 2HQNA 4LLGF 3ABMH 4QIWN 2ADQB 1KECA 2CQQA 2RJZA 1QQCA 4EJOA 2A68F 2CYYA 2F4MB 3CD6I 3O2PE 2M87A 1RUNA 3GZ6A 4A3LJ 3BCCH 4XOTA 4YJ3A 2F43G 3JARB 4XDLA 3QPHA 3RDIA 3SDBA 1MNEA 4G7OF 2NAZA 3FB8C 3FX3A 4PJ0Z 1D8KA 3Q0UA 2IJJA 1X4OA 3VEPA 4I0XA 2ZXWB 1U0JA 4GYIA 3ZMSA 1CP9A 3MKWB 2GTAA 1Z91A 1RETA 3WTTC 3LSSA 3RYIA 3KCCA 2EIMH 3I64A 3CRMA 2ZNYA 1A36A 2WLHA 2KIUA 5JVGF 1F5TA 1GM8A 2YX7A 4DR3O 1TQIA 2ADUA 2DMPA 3M7GA 3QQAA 4DBQA 3W7TA 4X6AJ 2FMYA 3T8RA 3CMMA 4B3RB 4BKXA 2PMHA 1W0JG 4DIQA 4DV5O 3W2AA 2E36A 4J11A 4ZI7A 1RNLA 1NK2P 2YSUB 2P06A 1ZARA 4WXHA 2K9SA 4M6VA 1JQ0A 2KKWA 5CVVA 3APOA 3W7SA 4Q5SF 2DJVA 3VQYA 2HOAA 2R7SA 4E7KA 1GLNA 2JA2A 1FKAO 4JX6A 1WCMJ 3QP6A 4LWSB 2FQ4A 5K7HA 1WH7A 2XAUA 1SKVA 1QVTA 3NR7A 1B4AA 2OIEA 2ZE6A 2ZNIA 1B8IB 3CUQC 2DQRA 3WHBA 2LTPA 2WA3A 4AQYB 2FTKA 4M9ZA 2AZ0A 1YI2I 1EA3A 1GRJA 4EJUA 5H5NA 3UKGA 2XF5A 2BOBC 1K9MW 1VQ4I 3FKSG 1GTOA 3OGCC 3IJ4A 5EEGA 4HNAA 3QWLA 5DDGA 1EJ9A 4HRIA 3MHSC 1X3UA 2XF6A 4A93J 2PTMA 4KJZA 2F2EA 2Q7EA 3KP2A 3CC2I 1Q5OA 2CS3A 3CCQI 2P5LC 2E5LB 3J7YJ 2IA1A 3DBRB 3MZYA 2R7TA 2R5YA 3FB6C 2AXLA 3IC7A 1AI6A 4FZ1A 3UO2A 1ETKA 5LGUA 3K04A 1JHFA 1UELB 1WFXA 3IHUA 3AG1C 1VQPV 3BPXA 1AU7A 1SA0A 3QYBA 1NS1A 4GCVA 2R7UA 3SZGA 3X2QB 5A2QN 4LFAB 1OR7A 2OCCH 1Q7YW 4I0BA 1ZRFA 5E8GA 3HZJA 1JVMA 4I50A 4QPJA 1NH2B 1XNQB 4NC6A 3VODA 3ASOB 2DFEA 3HEFA 2OCEA 3L9FA 5J6XA 2DYSB 3BR6A 1P2FA 3WB1A 4YY3O 5EG0A 4XLHA 2V4JC 3K4CA 3WU0A 4UNOA 1Z05A 5BY1A 1DGWY 3LSGA 2DODA 3V7CA 2QQBA 5CKTA 5ICEA 3MKLA 3SYAA 1MBEA 4HQMA 3TDZC 3H1IH 3PJRA 4HNUA 4KNYA 1KKCA 2HVRA 5GAGJ 4PDLA 3B40A 4EGYA 3QU6A 5J40A 2IRFG 2ILMA 4WFEA 4U88A 4AHCA 1JT0A 3ABKC 3L2VA 2VWKA 3JCUZ 1MMMA 4G2KA 1N32O 1K78A 4RM3A 4DW6A 3M8FA 3P3PA 1D5AA 1AB3A 4RAFA 2M3AA 5F1RA 3L2RA 3WE3A 3PUBA 3CCLI 4KMFA 4XRMA 2XAJA 2EQRA 5JR3A 5ILVA 4MFDA 2PJRB 5BOXA 4I99C 3SYOA 1BI2A 2JK3A 1OHHG 2AW9A 1MBHA 3JATA 2B9SA 2H6CA 2W25A 2PMZN 2CG4A 4M9XA 1ODDA 2GOMA 2HOEA 3BDDA 3LA7A 2DPUA 2VOOA 5TJJA 2YXLA 3JATB 1TP4A 2EX3A 4GUNA 3BG9A 5E1WA 1JHHA 2IS6A 3AG4B 4XDKA 2QWRB 4X1YA 3JAMN 1JTXA 4LF9O 3OV8A 3K5MA 2Q2EB 1R6NA 3T1YO 1OYIA 4RAGA 4G7ZF 2KL4A 1LFPA 2BW3A 1NR7A 2IM9A 2F4VO 4YG2F 3ZP5A 2ZJPF 1OCCB 2Y48A 3OTFA 2UXBO 4B47A 4LIVA 2MYSA 1OQYA 2K02A 5CVIA 4CH5A 1JUMA 4BQOA 1TNSA 2DBBA 2TRTA 2BEOA 4GT1A 2EIMC 3K1NA 2A69F 2OTJV 1VQPI 5EBLC 4MTXA 3I4PA 3NRVA 2I5UA 1VQ9V 4MFEA 4C3JJ 4GX1A 4PSXA 1JKQC 4UCSA 4YJ2B 5LL6Y 5DCMB 4X66B 1KQSU 4ENJA 2AZ2A 3ZMDA 1FJGB 1XMXA 3A0RA 3ETGA 5A2QZ 3BJOA 2E1MB 4DR5B 1YTFB 2GQQA 4MT8A 4JOMA 1IDZA 4GKJO 4P9PA 2ZB9A 3ZQ7A 2WY8Q 1Z5WA 4WXDA 3JRDA 4WFBV 3CCSI 1M56C 5CVRA 2HYFA 3BR3A 3OR2C 1WJ5A 3VYRB 3HB3B 3HR0A 3E8GA 3G71V 4V2GA 2M45A 4I5SA 2ZR3A 1P84F 4CYDA 3GYHX 4HOBA 1IC8A 3KP3A 2FKXA 1F4KA 1NK3P 1K73W 2QWWA 1LEAA 4QTRA 1IRGA 2WLKA 3E2EA 3I55V 2VT3A 2X51A 3PM1A 1YDXA 3RKXA 2BXYA 4YRVA 4TV9B 4ANJA 1LE8B 1UAAA 3RPQA 2P4VA 3A8TA 2Z99A 1GV2A 3BY6A 4A3BJ 2EIJH 2QWQB 2ZE8A 3TGNA 3E6CC 5IJ0B 4LF6O 2DA4A 3HL2A 2LQTA 3K06A 3Q9SA 3DBHB 4ZTFA 1ZG1A 1H38A 2E60A 1T0FC 4P1WA 2ZKZA 3DPTA 4OX9O 2X9DA 3M9AA 4DUZB 4DK0A 1MW7A 5JCOC 1ZGJA 5LYJB 5GAHJ 2KISA 1ZLZA 3LAPA 4G9YA 1FY7A 1ZTRA 2E5NA 2YEVB 2PZSA 2X6XA 3CX5F 1SD7A 2NVQJ 1E3PA 3CMEV 2XPUA 4G6QA 4DV7O 1W36D 4CCLA 1ZG5A 4GZRB 5B66C 4RUEA 2B7EA 4BIUA 2RC4A 3UCSC 4LK1F 1UB9A 2M0MA 3DKWA 3GVAA 4A69C 4NHJA 2AXTZ 5F64A 4F92B 1G3TA 2CQKA 3AG1H 3JRFA 2F1MA 1SERA 3ZPLA 1K33A 1FOWA 4EJVA 2PYJA 3H1HH 4E7JA 2OCCC 5K7FA 1D1AA 4RB2C 3KP7A 4X20B 5K5OA 4FASD 1P4WA 4A3CJ 4ZDLA 1AROP 1QVUA 4FFBA 1Q86W 3G4SV 4MVUA 5KX5B 5IYCO 1KQ0A 1H2LA 3SPIA 3TO9A 4HW0A 5IYZB 2PN6A 3GX4X 1W2BU 3LWFA 3DU6A 2H1KA 5FPOA 2Q0OC 3CZ6A 3HTUA 1DTOA 3SR2C 2E35A 4C2TA 2DWEC 3CRRA 4QJFB 3K58A 2TCTA 1FOXA 2BV6A 3FXRA 3VDXA 3K4LA 1XMAA 3A0BC 4WX9A 3OE7G 3UKMA 4BL0B 4Y33A 2WAQA 2IGKA 3ASOH 2IH3C 2ZT9B 4RWUA 3HOWJ 4AIHA 2DDAA 4X62B 3ZGKA 5H6QA 3ZQQA 2VE9A 4UCRA 2L01A 1NTKH 2FRHA 1Y74B 1SZTA 3M4OJ 3EPZA 4JYYA 4IHWA 5GPAA 3M99B 4O4JA 1X3ZB 2E1CA 1H2GA 2ZCEA 3MWMA 4L5IA 1BL0A 4BNCA 2UXNA 4O4JB 4NVPA 3JRGA 2LP0A 5F1JA 2E75B 1YYVA 1K7DA 2EILC 2W24A 1PUFB 2R72A 3CSXA 1LFBA 2BTOA 4JI1O 3GMEA 4AWXB 2RNJA 4F52A 2RMKB 3H0GJ 1E1RG 4D5FA 4LD5A 1K8AW 2GV9A 1L8DA 3OUSA 2PYLA 3RT3C 5CYVA 2KPMA 1FTTA 1YS7A 1SA0B 4R6ZA 1XS9A 5J2TA 2ESHA 1JGGA 1G1XB 3ZQFA 1R5GA 1XGMA 2FOWA 3FFQA 4J41A 2E2JJ 1Y39A 3U10A 3F6OA 4NC8A 2Q4PA 3I54A 3PNTA 4U3FH 5C8YA 3ZHRA 2Q69A 5M3MJ 2JUCA 3HRMA 4FIPC 1H88C 1NJIW 3VSLA 3WU1B 1EM1A 2L5QA 1X1BA 1X1AA 5IYBJ 1VQOV 2DFFA 1XSVA 5HOOA 2AHZA 1BHBA 4L0YB 3J7ZI 1O9HA 4S05A 2BY3A 3WTSC 5FKOA 3OYFA 3W6KB 4KDPA 3GEZA 3H5NA 3JSOA 2BYVE 1B06A 3BQZA 3TJTA 3CWBH 3K0GA 4PFOA 1IDSA 5CA0A 2LG4A 2M8GX 4CDGA 2V9KA 2NNYA 3E8FA 1IBLB 3CCJI 5B66Z 4GYGA 3PN1A 2HS5A 3VBBA 3OS2A 1FC3A 2JQ7A 2MW8A 4CH6A 3OY9A 3JD1A 3CCLV 3V8LA 4ZC3A 1F4NA 4JAVA 4GYCB 2ETNA 2LY9A 1NTZH 2Y0IA 1IRZA 1ZL8A 4LBEC 1OFCX 2RQ6A 2R7DA 1I1SA 1PPJH 3HKEA 1XMQB 1TLHB 2M7WA 1D2DA 1MH3A 2YI9A 1OCRB 3CCJV 4X1KB 3HKEB 5GW7A 5KHGA 2EK5A 1HKQA 1T33A 1KMIZ 3HOSA 3E5QA 1IXMA 2IVMA 3DXRA 1QNMA 2EJRA 5KUKA 4NB5A 2A07F 3VOUA 4ZHQB 3SFIA 5LP6C 1U9NA 2QE7G 3KIOA 3TMOA 2LKXA 2F23A 1LJ9A 2DXIA 4EB6B 1IZ1A 2RGVA 1S5LZ 1OCPA 1M1EB 4Y4RA 4YEJA 4DNCA 2ZNJA 3AG1B 4P2ZA 3MAQA 2E7XA 3CB2A 3N2GA 1V54B 2VQFO 2PI4A 1N32B 3ZXSA 5CLSA 4HPQA 2LGQA 3CJHB 1AVMA 5F08A 1L0LH 2WLJA 3LSTA 4X1IB 4BW5A 1X4PA 2WY7Q 4CS2A 1J5EB 5JJJB 1YXBA 1JT6A 2CW7A 3THOA 3OR6C 2MG4A 4IHJA 2F5CA 5D5WB 2UXDO 4XLEA 2EZKA 3G1LA 2ISYA 3OYGA 2O8KA 1FSHA 4JGSA 1F4MA 1O3QA 4HX7A 3K57A 2YIDA 1PVEA 1ZUQA 4HLXA 2DO7A 4L5JA 4BH9A 4E7SA 3L73H 2DMQA 1JXSA 5JVDB 3FK7A 2NVUB 4A5NA 4RB0A 1HKTA 3CCQV 5FLXN 2CUFA 1FYKA 4LF9B 2COMA 2WBMA 3DBLB 2JDIG 2EFNA 1QA6A 1YO5C 3IKTA 2DE0X 3WU2Z 3L7WA 3MKZA 4BWAA 2HKXA 2HXIA 3BVOA 2OV7A 2ZBKA 4DOZA 2ZMEA 5IWAB 2YUSA 2LD5A 1TNTA 2A7WA 4R8CA 3WTWC 3U0ZA 2P5VA 4J00A 2A3QA 3F23A 4X1YB 1UG0A 1JI8A 3AK1A 3FXQA 2JA7J 2MK3A 1Q1VA 3GBGA 4B3MO 3R4KA 2DU9A 3AAFA 1XNQO 2VKEA 2XAGA 4HEA2 4ZH4F 1S72I 4O3MA 5DN6G 3EUHA 4KITB 2V1XA 1KYOF 4K3AA 1VQ8I 2EINC 3BT9A 1D0ZA 4L9VA 1VMGA 4X1IA 4XDJA 3RYHA 5IY5H 4GKJB 2CV2A 1VZ0A 5LRSA 4P96A 3TGUH 2O0YA 3GF2A 1G2HA 1IBKB 4L9NA 2VIXA 2EILH 2P67A 5HS7A 1G4YB 4DR6O 3G4SI 5DM7F 3UT5A 1YITI 1M57C 4H4KC 2ISZA 1NH2D 3FK6A 2BSKB 4LIUA 1I50J 1Z3YA 5CA3A 3MD2A 5FB2A 2EILB 5LD2C 1I7FA 5JFRA 2DT7B 1QHHD 4FM1A 2UUBO 1R4NB 2RDPA 1T39A 5HFLA 2B0LA 3FMSA 4PV1B 4JYKA 3DTUB 1UJ8A 3KCYA 1MMGA 2VE8A 2KDZA 3C1DA 3F9KA 1LQ1A 5IYZA 3S3XA 4FLWA 1K4DC 1AA7A 1NZ6A 2RDCA 2GXBA 4EKWA 4WF9V 1B9NA 2EFPA 2E1MC 2KIMA 4A0YA 4P9OA 1TUEB 4U7NA 4CCNA 3WTUC 2LREA 1J95A 1ETXA 2BY1A 2KMUA 3KFWX 5FKMA 2B1IA 2OTJI 4ZIBA 1GN2A 1Q82W 1U5TA 1J5EO 1IVSA 3KZYA 1I08A 3BC8A 4J10A 1O7LA 1SZXA 3K1PA 1W7PA 2E19A 4KIFA 2DLLA 4H33A 3FYIB 2M6YA 2F4OB 3IAYA 4ZOLA 1L0OC 1SETA 4D0PA 2KIFA 2VKHA 3A01B 2G38A 2JSPA 1D1BA 5D6EA 5E18F 4GKKO 2YX4A 3VB2A 4M3EA 5F04A 2MSYA 3H5AA 4O6JA 1R49A 1R3IC 3QO8A 3CCRV 3EUAA 1IXSB 2LFRA 1E1QG 4BAYA 1Y1WJ 2MLGA 1TWAJ 1QGPA 2A0LA 5FPRA 3T2MA 4X64O 2N05A 3F21A 3J81K 4EJWA 1QPMA 2E71A 2V9VA 5J2TB 4IHXA 2BHYA 2Y9YA 4XNFA 4CZZA 2AQEA 4DR5O 4DR4B 3KZZA 1ZRDA 2XGXA 1FX7A 1HBXG 1BW5A 4X66O 1RI7A 2EA2A 5FNVA 2XGCA 5GTIC 2GBOA 4DRXA 3IH3A 1QPIA 2IS1A 3BTJA 5LOVB 3N05A 2KZVA 4KISA 4FX0A 2HOSA 2W6IG 3MQ0A 3CCYA 3H92A 2H27A 3U9GA 3A1YA 2M9HA 5E8IA 3SJQC 4CC6A 1IV8A 4KN7X 1BSMA 1S9HA 1R6TA 2JGDA 3CCMI 2Z1DA 1Z5VA 1I5XA 1R58A 4N0BA 5B5EC 5HODA 3HC7A 1YRNA 2DYRB 2P22C 5LXTB 3ZIAG 3JYCA 3R0AA 2STWA 2PEXA 1L3LA 3DV8A 4DV6O 3CESA 5HDGA 3AG3C 4K35A 3I5DA 5ICFA 3JD3A 3S3WA 3LUTB 2Y31A 1HP8A 4NKGB 2QYOA 1BR2A 4N9IA 2HXOA 1LB2A 2G0EA 1Q6IA 4JI2B 1KGSA 2MLKA 2RQPA 4IF4A 2PX9A 4YFXF 4BXFA 2MA3A 2JS3A 4IYHA 3NEUA 1REPC 2JIZG 1P7BA 3C2BA 1GO3F 1FNNA 4JASA 3QODA 2IBDA 1BJAA 2P90A 3ZHQA 1OCOB 4PZJA 5C8YB 2IJKA 4YJ3B 2IS4A 4GFBA 4CYCA 4D9JA 3ZMVA 1ERDA 4S0HB 3OOUA 1BOBA 1LUVA 2Q67A 2QKLB 2X4HA 1PM9A 1OCOH 2O5RA 1VQKI 2TDXA 2AHYA 1PV0A 3JAKB 5J1UA 4XMYA 1AR1B 3ZQCA 1LNWA 2XNDG 2W0FC 4XKBA 3QYEA 1FXKA 4IEJA 2OTLV 5LXTA 2QR4A 1TGOA 2BOLA 2PMUA 4LITA 4KT6A 3RCOA 3IC9A 5IY5C 2CJJA 2STTA 3OSGA 2A3SA 1RM1B 3J81Z 5IYDO 1D3YA 2EBOA 5HNFA 4XLPF 1BC7C 1P4XA 2X7RB 3BLYA 4XM3A 4BXUA 1VQ9I 3K79A 3CXHF 4XRSA 2DTRA 2IJLA 2ZCWA 3BCBA 3ABUA 2V1DA 3X2QH 3CUQA 3ZQIA 5GPCA 3ZCOA 5E17F 2Q0AA 3TXSA 5J9PC 2ZE5A 2KG7B 5EZHA 3JSLA 4NC7A 3K4BA 3P5JA 4TQFA 5KLVH 3WGGA 3KETA 1HR0O 4C9YA 3OYLA 4TV7A 4DV3B 4ETSA 3SJMA 1WAZA 1BR4A 1JKRC 1X1DA 2QSAA 4I02A 2B5UA 4BE0A 4OXSA 4JK1X 1TVKA 3F5TA 4MNUA 5IJ9A 3JAKA 2F5EA 3RPUA 5JJEB 1YJ9V 4IIJA 1VQNI 1JUSA 1OLTA 1WRJA 4XKVA 3ZS8C 2P5OA 1W5TA 1NR1A 3ZN1A 1VQ5V 3JAMZ 2K86A 4DK1A 3AG7A 2A61A 2P5KA 5FLVA 2Q7GA 5KHHA 1O3RA 4IQ4A 1Y74A 1NT2B 4BGDA 1ZK8A 4ZI7B 5CBGA 2LF7A 4A0XA 2AS5F 1Q3EA 1OCZB 1T08B 1W5CC 3AKZA 5AIPA 4ZYDA 2CUGA 2QTSA 2HYJA 1PP7U 3T1HB 4S04A 3ZCCA 1ZL8B 3QOPA 4ITVA 2HPIA 4XKWA 1BL8A 4LFUA 4MTGA 4B3TB 1H8EG 3GFLA 3ONQA 1EN6A 2E7WA 2FXAA 3AFHA 2CDYA 5K1XA 3W7XA 2FQ3A 1Y0UA 3OIPA 4BJTA 2VBZA 4QE9A 3AG4H 4PJ0C 3P9IA 4AUXA 1BM9A 3JAWB 4RGUA 4YHHO 3PQJA 2M34A 2BVLA 2B1GA 4F7ZA 1ENHA 1SFXA 5J1YA 1T2KA 2ADPA 4WFAV 1JX9A 2ME0A 3I4NJ 4HF2A 3S2WA 3S32A 3KCXA 4MVRA 4FPPA 2IGMA 1XX5A 3BR5A 3TO6A 5KVRA 4MVMA 3U11A 1XNRB 2R9AA 2HDDA 3BTCA 2NOGA 1B6AA 2VUMJ 2WWWA 3WG9A 4F3QA 2DPDA 2VI6A 2VKVA 2CV0A 4MS2A 1T8IA 2EINB 1VQMV 5M5WJ 1U5TB 2R9RB 4TQDA 4YELA 3L70H 2M7AA 3HJEA 4UVAA 3JD4A 3P30A 4W4KA 2Q73A 1V3FA 3M8JA 1P9QC 1Z6RA 4HBNA 4I9WA 2L7KA 2XSDC 1S6LA 1RIOH 2DI3A 4GXOA 3FYEB 3TCUA 2P6SA 5GTHC 2FBKA 5LMNB 3QYFA 3OUFA 1S7AA 2XAHA 4LJZF 5DV5A 2DA2A 3LMMA 5FKNA 1JTYA 2FMLA 3BROA 5HNHA 3WTVC 4BDZA 1GT0C 3N2KA 4RQFA 1E2XA 5EF6A 1FYJA 4IZZA 3BTIA 2DT5A 2XC7A 1W7PD 3N2KB 2K7LA 3MEXA 2ID6A 2WAFA 1S5LC 3DQVC 4NQWA 2BSKA 4JAAA 4ZBMA 2PJRA 1CEZA 2JK5C 2ID3A 1VQ5I 5KA5A 4DV0O 1LDDA 3HHGA 1TUBA 2JRIA 4LF4B 3UR3C 3ASNB 3LSMA 3L2QA 2L02A 2QJ1A 1ORQC 1VQNV 2M2EA 3D0SA 2V1NA 3H9QA 4PFPA 1GDTA 4JF3A 3E35A 5JH7B 5J4YA 3RZOJ 3CCSV 5KMGB 2EPFA 4ZYHA 4KMUX 3F72A 1SQGA 1SMTA 2DFIA 4M3GA 3JSPA 1RUOA 1SQXH 4I55B 2NXNB 4TOIA 2JMWA 1HNXB 2QA4I 1GN4A 1I1GA 5FLXZ 1XG1A 2GHYA 1IO2A 5LEJA 3PQKA 4WBNA 4LF7O 3V8JA 1B59A 5CPRB 5JLWA 1I6HJ 4E4HA 1EN5A 1PJRA 3T8TA 1RPOA 1R1VA 4YJ2A 3RYPA 3LSPA 2N8GA 4X64B 3M07A 1SAUA 4O2BB 3IRRA 5HLHA 1ZLKA 1MDMB 2Y69C 4Z6YA 3LDCA 4NXMB 2CFOA 5F6FA 5CJ9A 3K6GA 2DMXA 5BPIA 4AIJA 2CGOA 1NVPB 3CMYA 3FXLA 1ACIA 1K7AA 3Q9VA 3APQA 3GVMA 2UU9O 2IPQX 5M5XJ 3TP0A 5H9CA 1D8JA 1AI4A 2ZMEC 1V5GA 3FX7A 4IRGA 1VQKV 4EGZA 4LH6A 4B1RA 2NS7A 1AI5A 1R6RA 3VSKA 2JEUA 2ZR2A 4JI6B 1SAXA 3SYQA 2H09A 4BE1A 1TW2A 4BIZA 4X65B 2JN6A 3VYSB 2Z0AA 2LC2A 4NXNO 1OJLA 2ETHA 1PNKA 1ZN2A 5TRDA 3S1RJ 4F6RA 2FEZA 1R1TA 2WWYA 2W4SA 1MSFC 2BHZA 3S3MA 1TA8A 3SJBC 4PUSA 2VASA 3DKYA 5B1BH 4A0ZA 1JFFA 4D5CA 4P55A 1BIAA 4EJTA 2QM4A 3D3IA 1J75A 4O4IA 2XVCA 4IHTA 4X8AA 2A6EF 1FFXA 1UFMA 1X4TA 2MD5A 2VC0A 4CC5A 1D0YA 3OMIB 4I0XB 3STZC 1UJWB 4HG2A 2CH7B 4BJ5C 1P4RA 3JALA 4OPHA 1YJWI 3BZKA 2OIGA 1Z3XA 2VN2A 4B44A 3RYIB 4WFGA 5CA1B 4UUTA 3QNEA 1Z7UA 4H37A 1GHCA 5GONB 3ABLH 3RI4A 3OMNB 2P8TA 2QF7A 1FOYA 4MLOA 5IT9Z 4UFZA 3SPCA 2F4IA 3GXOA 4A6EA 2JA5J 1JMKC 3GCMA 1M90W 1IBLO 2WLIB 1J7KA 1K4SA 5FRNA 2L0KA 2RNGA 3OT7A 4DR3B 4A6DA 2YR2A 1EKEA 1TWGJ 3H3VK 3FZVA 2BTQA 3RGBA 5LP6A 4LFBB 1ETYA 5DEDA 3JRCA 4FFBB 4GKKB 1LDKB 4GRIA 4F93B 4WK8F 3CCUV 2HHHB 4X0GA 1KP3A 3DEUA 1SVOA 1YITV 2EZPA 2CW0F 2PF4E 5FNVB 5B1OA 2R7FA 1IG7A 1AP5A 1VEWA 1O3SA 5KUMA 1NBMG 2UXXA 3PO3J 3LA2A 4TUYA 5FD5A 1R7JA 4RAIA 2A6TA 4UB6Z 3ZHUA 3J80K 4XOPA 1MZFA 2GIVA 2LNBA 3CE2A 1JJ6C 1BHAA 2HR3A 2YIAA 2LLKA 4JPRA 1K4CC 2JA6J 3I9V2 3EETA 5DYMA 2R4GA 3MFKA 1YRNB 3GTOJ 3QG5A 1K83J 2CE4A 2K1EA 3K03A 1AR5A 4U7BA 1BGYH 2F95B 2CMPA 4KHPO 1DP3A 4BIOA 2BZTA 5EC2C 4XBFA 2KHMA 5IY5B 4W1UA 1T95A 2L9VA 1V55B 1S7EA 4F91B 2P7CB 1MZEA 3BHPA 1ETVA 1MIJA 2YIBD 4JTDB 4EM2A 1AI7A 2L35A 3D1NI 3L2WA 4FE4A 3T4DA 2UXBB 2WPDG 3CMAV 2VOPA 4MVOA 1H2NA 2ZSIB 1XGSA 5IYCJ 5LFAA 4RGRA 1SD5A 1WJFA 4YIPA 4B08A 4JYAO 2VJJA 3SPJA 1IGNA 3JAWA 4HZ3A 5CVJA 4R7CA 4PJNA 4F55A 3DXRB 4BHCA 2WAMA 4DXWA 3LSJA 5K5RA 2P4WA 1VQ7I 4B4CA 3HPLC 5A9GA 1L1FA 5CQEA 2G9WA 3OTOB 2FNAA 4GLXA 3JTHA 1YOVB 3BJ6A 2JUGA 5IE9A 2XASA 1XI1A 3BZCA 2FE3A 3K5OA 4KYWA 1G8MA 1UCRA 4NNJA 4ZKIA 3CLQA 2BOCC 3B73A 1GM9A 2FYUH 2KDOA 3OWTA 1YS6A 2W0XA 1WKMA 4MSWC 4TSFG 5DM6F 2IW5A 3W3CA 4IT5A 4JZ2A 2CTRA 4ZYAA 2BE5F 4UVBA 1GVDA 4A3IJ 1R1UA 1K4TA 2JJ1G 2HNHA 3CRAA 3FM5A 4MTOA 3F6VA 4QE7A 2EIJB 3H36A 1YF2A 4DV4B 1YX3A 4PA3A 3KZIC 4DYCA 1L0NH 3LDDA 3K59A 4B3SO 2IAIA 1Y6IA 2DK5A 2Y0SA 3IAS2 4LG0B 4JYCA 4UUSA 3LNMB 1B1BA 4JI3B 3I58A 1IXCA 2X85A 4B3XA 1P4AA 2F4VB 4G7HF 5F0HA 4MTEA 1IBKO 5F27A 3TKYA 1MBFA 1EH8A 4FHTA 4A12A 4L8JA 3ZR8X 1FOKA 2KLOA 3LQRA 2VJIA 2L9SA 4QPOA 1ULYA 3BR1A 4DR1B 3ZRSA 2LFBA 2Q8KA 4LOCA 1RR7A 4UCTA 1O9GA 2VQFB 3WG7B 3IUOA 1N77A 1LDJA 4J80A 2PBIA 1Q8IA 5B1BC 3J80N 1IDYA 2Y0SN 4DV3O 1UHWA 2L4AA 4FISA 5F0FA 3L2UA 1VTNC 5EEHA 2UWMA 1M9NA 3L1PA 1DGSA 4OWRB 3CXCU 2X6OA 1RM1C 4ESBA 1J5YA 3MAJA 1QR9A 2YIBA 2QQ9A 3OYIA 2LY1A 1N4CA 1XCVA 3FB7C 3LSQA 4GCZA 2H94A 4ABZA 4YIOA 2IGOA 3A03A 3JTGA 2R9IA 3R6SA 3CF5F 2P0WA 1F7YA 3OD4A 5KHDA 5J4VA 2X1CA 4DR7B 2N74A 3HIFA 2JRTA 1TWHJ 4M6XA 3SDLA 4JYAB 3E5UA 5HS8A 1Y66A 3W6JB 5LBQA 1BQ0A 2ZM6O 2XDVA 4FCYA 3DKXA 4I4TB 1IXBA 4KXRA 2VODA 1G6UA 3DPLC 3RZDJ 2HFEC 2ZINA 3DU5A 4HDVA 1EH6A 1GK9A 2RKHA 3GB7C 4O4HB 1UG2A 4DUZO 4KHPB 1STZA 2L7ZA 2GA2A 3M1CA 1U97A 3OTOO 3HUGB 3KKYA 1X2NA 4O4HA 3O8HA 5E3OA 2HQAA 3PSIA 4AYBA 2DMUA 3JRBA 1YW9A 3TL4X 3Q4HB 1AOYA 2HFHA 1RFYA 3CRCA 2QEXV 1WQ2A 2JRMA 1DF4A 1B9MA 1BBYA 3FIWA 3AG3B 4FJCC 5C93A 3F8FA 2EZIA 3H1CA 2ME6A 1AKHB 5DCFA 1I27A 1W4MA 1WP7A 4XICA 2R7VA 3LSUA 1GXPA 4UXNA 2E5LO 2E2HJ 2DMTA 2B9ZA 5BMVB 1U3EM 3LFUA 5K1PA 4AU7A 4LMYA 4C2UA 3S93A 1RSOB 2EJ7A 1X2MA 3FAVB 3QAHA 3G6EI 2KT0A 2XROA 2Y69B 4IHJB 2M30A 1RSOA 3D8CA 2EFQA 4YFKF 1I39A 4E2LA 3EUKL 2DMNA 1DLBA 3GTKJ 4KIGA 4RBOA 3A01A 1XMOO 2UUBB 1V4RA 1R5ID 2ZJQF 4OIRF 2HP8A 3U2RA 3CC2V 5HLGA 1XDUA 1IX9A 2Q7HA 1G4DA 3V8KA 2F5VA 2LY2A 1FP2A 4JX5A 5D4RA 3CYOA 1USTA 4A3FJ 1FT9A 2DQLA 4B3AA 4PGHA 2KRHA 3VYTB 1Z7LA 3RWRD 3HYIA 3O8GA 4M74A 1TT5B 2HTJA 3S1MJ 3HUGA 1OYYA 2MD0A 3DTIA 4EFEA 3OS0A 1N0NA 3OR7C 3OMAB 2QKMB 1KYWA 1UPGA 2V9PA 2GM4A 2VQLA 1U5TC 2R7WA 4UCVA 2ZXHA 4Z1MG 2XTAA 1EH7A 1R71A 3FXUA 1MBKA 1FIAA 5DEQA 1ON2A 4YXWG 4LNUB 3EQLF 1XMKA 4MO7A 1ITYA 5KCMA 3T0YA 4N4OB 4G12A 4I7ZB 3EUHC 4BBSJ 3MZHA 2Y2ZA 4IYIA 1MKMA 1Q1HA 1RKTA 2P7TC 1V5EA 4XLFA 1R3LC 2HEPA 4LF7B 2DYRH 1U6GA 3E6BA 3G2BA 2FJ1A 4UV8A 2LW7A 2LRDA 1ZX3A 1XUQA 1LR1A 1J9IA 4OGQB 4UB8Z 1LKXA 2X6WA 3ZMTA 4FTHA 1V9PA 1BT8A 1N34O 4CZCA 2DOFA 2EWNA 1WVRA 4B09A 4J19A 4IX7A 2QBYB 5LMUB 4O5VA 3ASOC 1VQ7V 5GADJ 4JI4B 2QM7A 4RQEA 4P5OA 3K69A 5DUKA 4M3FA 2VQGA 2UV1A 5K7ZA 3OYCA 1LFUP 2KSDA 2JPBA 4DBRA 4XQFA 3KE2A 2HEOA 2R7QA 1YFHA 4CS3A 3J81N 3SGIA 1K34A 4I55A 3QP5A 1WPKA 2BXZA 2Y30A 2ZFUA 5JQGA 4FLXA 4X65O 4KUMA 1M1KW 2QENA 3GTLJ 4DV5B 4DZJA 4BYYA 3WFVA 1R00A 2DQ3A 2HQRA 4M73A 1ZKGA 4I7HA 2LFSA 3N4MA 1K92A 3PJSK 3EVKA 3IKVA 2XB5A 2H8RA 2K85A 3W6VA 3RFRA 3BRCA 3B8NA 1R36A 3GZNB 4I09A 3SJAC 1ZHFA 3HXLA 2XKPA 4RB1A 4CHUA 1FMVA 3FMRA 3L75H 1N36O 4D7SA 2VL8A 1N33O 2W48A 3GZ5A 1V55C 2XSJC 3KLNA 5FO5A 5HVQC 3P9KA 1QHGA 1EZJA 4K0KO 5BS6A 1FYLA 1Q90D 4J7JA 1RPRA 1WJEA 1S77D 1ZGWA 4X20A 2I8DA 1QU7A 5FFXA 3WGIA 3CEIA 4NYKA 1Y4MA 1F9NA 1MABG 1DP7P 3ASNH 2W00A 2DOSA 4ZHQA 5BMZA 3OR1C 3CJRB 3OYHA 1XPXA 3VWBA 1LE8A 1QRYA 3S2HJ 1I94B 1W5SA 1PNLA 1N25A 2LYCA 2Y9ZA 3FISA 4O4IB 2AO9A 4DUYB 3G71I 2UUAB 4FLYA 1I3AA 2R5ZB 2HLDG 2VXZA 5E1XA 2D1VA 5FKKA 3EFFK 1X58A 5B1AH 1LUWA 2NVXJ 4AD9A 2ZXJA 5C44J 2E76B 2EV6A 2R93J 2WADA 1URFA 4LFAO 1V54C 1YHQI 2OCHA 2ZXIA 4UCUA 2CQ7A 1KB9F 1ZYRF 3CJHA 1XDSA 5IOYA 1S5JA 2YEVA 3FXMA 3PFYA 5D5XB 3RKQA 1SQQH 4OPAA 4DYRA 2O6GE 2K9PA 3DLAA 2CO5A 4HAMA 5KNLA 3S1QJ 2KRFA 1K79A 3CP8A 2ZIMA 5FLMJ 5LA6B 3F5WC 1XQ8A 3WB0A 3K2ZA 3HRUA 2IH1C 3E3VA 3ZRXA 2ZKOA 4ZTJA 3K4MA 2Y0MA 1LEBA 4CA0A 4CCJA 2Z9OA 4DR1O 3IAM2 4NUBA 3ETQA 1G3WA 2OQRA 4Y17A 3FBNB 1OCZC 4X89A 5IDJA 3JD2A 4J9YB 2CUEA 4RGSA 3HOTA 4TV8A 1MBJA 4LB6B 1TAEA 2QGNA 4LWSA 1YW7A 4M3BA 1E3OC 4DGWB 2JT1A 4Z2YA 2QEXI 1IBMO 2IU0A 1F43A 2V7QG 4FE7A 4DYQA 3BR0A 2M8EA 1XMOB 4JI1B 4FLTA 2QM3A 1QU3A 4XSZF 4H13B 3GLLA 3ABTA 2EV0A 3CJTB 2JJ2G 2OZ6A 1FMWA 2OC6A 1AKHA 5L3CA 2ELKA 4UHTA 4AYBN 1VQOI 4NDLA 3Q3SA 5L3FA 4JBAA 2K4JA 2YICA 4HYEA 2F6CA 3HGYA 1Y76A 4XLAA 2QSHX 2HU9A 2EV5A 2VPRA 4J9ZB 4K2EA 1Q6HA 3C18A 2DYSH 1SESA 1YCIA 3FHNA 1YW8A 2VJ5A 5AONA 2O9LA 1BOAA 1CXZB 1Y76B 2D2CB 2DYRC 3ETEA 4R50A 2W1OA 5L3GA 2D3OW 3I0TA 2J5PA 2WA4A 1SD4A 2CK3G 1IZ3A 3FWEA 5JWPA 1AHDP 1SQPH 3FKJA 5TISC 2K9MA 1TC3C 3OFNG 2ACJA 3BQYA 2ZJRF 4MVZA 4PI0A 1E0EA 3ZRGA 5JHUA 2XUBA 2QDOA 4MEYF 2L54A 3JRIA 4WCEV 5ILUA 3JD0A 2Y75A 4JI3O 5E1AC 4OINF 3N97A 1TUBB 4UY8I 1H2MA 4DUYO 2C6YA 3DXJF 2RN7A 1WH5A 3ML0A 3HG9A 2EINH 4A5UB 4PK4A 1P6RA 3H3ZA 2LKPA 2R7ZJ 4MTFA 2MABA 2COBA 1T38A 4EEQA 4JV5O 1UHMA 4PI2A 1B72A 3KEYA 3TQNA 1FXKC 2XT9A 5EIBD 2VB6A 3JASB 2LSOA 2ELHA 3WTZA 1CGPA 1GN6A 3HPHA 1FSEA 5FRMA 2MH2A 4HDUA 1NVPD 2LMDA 2MC4A 5KK1A 4UCOA 1KKDA 4O2AB 2HYGD 1OZ0A 4JI6O 5IP9J 3O3KA 3RW0A 4XIDA 4A3DJ 2M4KA 1Y8RB 3DTKA 4ENMA 2XIGA 4D1QA 2YDEA 2QM8A 4AM3A 4AVZA 1SQVH 3HKCB 3RQ4A 4LC1A 3B02A 2HWVA 4DV0B 4QPQA 3FDYA 4DJAA 4CBCA 3FB5C 1IN6A 3VQVA 1MOFA 3M1EA 1TW3A 5IYBO 5B1AB 3W7UA 3WE2A 1WA8A 4I50B 4U0VA 1ZRCA 2QBYA 1QZZA 2BGCA 1WJBA 3ECOA 3K4KA 2UZKA 1Q43A 1NG7A 2LGWA 3E22A 5EBMC 4BACA 2Q5ZA 2UXDB 2DN0A 1YVWA 4DV6B 1MZBA 2ZDIC 3IFXA 1N78A 1XHZA 2H8WA 2M7BA 2K27A 1X59A 2HJFC 3HKDB 2KB1A 1HQCA 1RZ4A 3EDPA 1SC7A 4F6RB 3RN4A 3HGGA 5JQGB 1HDPA 2Q2EA 1SFOJ 5B3SC 3G80A 4LK0F 2W84A 1FJLA 3AK3A 5EEAA 5EZGA 2JGDB 1CF7B 4OAZA 4CCOA 4LNUA 1V54H 2E1NA 5KHKA 4OOIA 1NQTA 4CSWA 3CRQA 2CWEA 2LH9A 4L9TA 3WODF 1QNTA 5LHHA 2HOTA 1T6SA 4V2FA 2XHKA 4BU2A 1U2WA 1JKPC 3GWKC 2Z16A 1WP8A 3TEDA 2RN9A 1UZCA 2FSWA 3WTXC 3JW4A 3OL4A 2JA8J 1M93A 2IJIA 3JCZA 3OAAG 1IURA 2BVMA 4CH4A 2CW8A 3PUFA 5J47A 1FEXA 3RYFA 3JSNA 1OCZH 2ZO4A 1WA8B 1DU6A 2L9NA 4XSXF 3CPWU 2V1UA 3A0HC 3HKZN 1Q81W 1JJ8C 1FPOA 3HPGA 2JVHA 1K3EA 2F66C 3ABMB 1A35A 2K3FA 4FX4A 4UUVA 3D5RC 2K9LA 1JR9A 3SPGA 3CD6V 3BP8A 4KA4A 2NYXA 1OISA 4IO9F 5B1NA 3ZRVA 2YU9J 4ABMA 2P4KA 3HRTA 3RYRA 4DR2B 1OJHA 2H3OA 4BW9A 4OMYA 1SMYF 2PLYA 2LBFA 3CDIA 1W1WE 4J01A 3JARA 1GKFA 3K9SA 2A5WA 3E97A 5FJ8J 4PDMA 1XGOA 2EZHA 4CS4A 4XONA 2CH7A 4C3IJ 4AIKA 3ZEDA 4E4EA 4A5MA 2J5OA 2V4DA 3S3OA 1XC5A 1MH4A 2V26A 3R61A 4YHHB 5E3NA 1ZREA 5LRRA 4LH7A 2M5WA 2MC3A 2RREA 3F0CA 2CQXA 3H35A 4U0WA 1OCCH 3HDDA 2Q8VA 1I3QJ 3I5UA 3TW6A 4O2BA 5BXZA 1JOYA 1XB4A 2HKOA 4V19K 2QSGX 3TK1A 2OD5A 3O6BB 2W57A 4Y13A 3RYFB 1GM7A 5D5PA 3KYDB 4RMNA 2FF4A 2WAEA 3REOA 3HOXJ 1IRXA 1H2SB 4RA2A 4QNHB 1DK1A 1KQ9A 3OSFA 2RNBA 3ML6A 2ZQMA 1BQZA 1NI8A 1TL8A 3H1JH 3CC4I 1X1CA 1N75A 3DCFA 3TBIA 4ZZLA 4BR6A 1W0KG 4XORA 2YXHA 4JQFA 4LG3A 1OR7C 2QKSA 3FD9A 2VPLA 2AQFA 5A2QK 1ZTEA 2NNNA 3QPSA 4XRSG 1J59A 2MBFA 4ON0A 4BHPA 4EMSA 4B3SB 2KFDA 2E74B 3DF8A 1VQMI 2E3CA 1B8IA 5EBWC 4EATA 5JJNB 4W4LA 2P6TA 3HBLA 4B7EA 1VQLV 2DA3A 3K0LA 5JVTA 1D5YA 2RCVA 3GTJJ 5AIQA 4MGRA 2ARHA 3X2QC 2EULA 1FXKB 1ZH5A 4HSRA 4E6KG 3P3NA 5D8LB 1NHAA 3OM3B 4LF8B 2WB1N 1R1BA 1WLEA 4HYOA 4FT8A 3H9VA 5FROA 3DEWA 2Q1ZB 1CPYA 2VBYA 5D6FA 5DUIA 1LUJB 5KA6A 1J2XA 4C30A 1R73A 2P6JA 5CMUA 1IW7F 4EEFG 1XNRO 4C3HJ 1WJCA 3BEHA 3T5XA 2KKOA 4MVSA 4K8XA 2X1DA 5CBFA 3E6MA 3DC5A 2GLOA 2RQQA 3ZMUA 1HSJA 1FBSA 1EBOA 3CCEI 1SS3A 2WLLA 3PSFA 4B3TO 1N33B 4O4LB 1VF9A 5BPDA 1WJDA 3IWZA 4KICA 1K5QA 1TBXA 3BG3A 3N27A 2QA4V 1KUQA 2QUFA 3FXOA 3RKYA 2HZTA 2VBWA 4RLQA 1SFKA 1W59A 1B04A 4JI8O 1GV5A 4HLYA 1K5SA 1JPXA 4DRXB 1ON1A 1MNDA 4TUYB 3F8CA 3MHHC 4N4NB 1SC5B 3C3SA 2X1EA 2VS0A 3K9TA 1UHSA 2FX0A 2KIQA 4BQQA 2Q6AA 2JSCA 5JCOA 5IJ9B 5ITZB 5BR8B 1QHTA 2ZJ2A 2ITDC 1B72B 1LPQA 4XKCA 1FWZA 3SPHA 4HNVA 1T0FA 4ESFA 3K4JA 3GWZA 1XBLA 1JCHA 4AILC 3GFJA 4KL1A 4PA6A 1Z77A 1ZG3A 2LDUA 3DTEA 4RM2A 2V6EA 2OZUA 4DV1B 4N9HA 1ZGAA 2RVCA 3OYMA 2PY5A 3HOYJ 4HNAB 1PYVA 4HX4A 2GZWA 2DW4A 2WLNA 2M1BA 3AG4C 1D0XA 2NNUA 3L71H 1XMQO 1HDJA 3O9OA 4LG0A 1HWYA 4HX8A 1V5FA 1YQAA 3Q0VA 1PUFA 3P7NA 1FBQA 3A4CA 3CTAA 4ESJA 2HDWA 2ZC2A 1E79G 3MMYB 1G3YA 4X1EA 2F5FA 1YJNI 1WJAA 3W7WA 1W0UA 1A5JA 4TV8B 4X62O 2B63J 4FVMA 5JVDA 2UXCB 3C7JA 3KZIZ 2OYQA 4I4TA 3CUOA 4BY1J 1BI0A 2FD5A 5DD4A 2O3FA 2LW1A 3ZHVA 5IOZA 2ZNZA 1S8NA 4QSHA 1AJQA 1TVKB 2VQCA 4DV2O 3JREA 1R22A 1QO0D 1NH3A 4L9JA 2PJPA 1HOMA 3MN2A 5HLTA 5EK0A 1QCEA 5BR8O 4IHVA 3VQWA 1WI3A 3WU2C 2DK8A 3BZ6A 4U0YA 1O3TA 1DUXC 3OYNA 1PUEE 1XOUA 3N2GB 2DN9A 1R3KC 1YIOA 3B6CA 3B77A 3O65A 1IN8A 1FPQA 4Q48A 3S16J 3VQXA 3BA9A 1FZPB 1SVMA 3RJPA 3SZPA 1IN5A 4GX0A 5CN0A 4PA7A 4A3EJ 3CCEV 3F8BA 3T1HO 2HG5C 3QRFF 1JGSA 2JS5A 3D36A 2LR8A 2V7FA 2Z33A 3PFIA 2R5YB 1PNMA 1WPXA 4GGGA 2IT0A 3VYUB 1XD7A 3CO6C 4F6EA 3ZJZA 3VFZA 2VC1A 1WZ2A 2UUZA 1OYWA 2LKSA 4N23A 2O61A 3JRAA 3BAAA 2KG7A 2GUZA 5ERIA 1ZAUA 4MQVA 1MNGA 5LHIA 2AXTC 3EXAA 2XUMA 4XN0A 5EZYA 1ZAOA 3GWOA 4I2OA 5CVUA 5EIBC 3KP5A 5M5YJ 1F1ZA 4B48A 1HA8A 2UUCO 4YFNF 2L6LA 4LF8O 4OAYA 3S15J 1HNWO 2DFHA 4JAUA 5DECA 4IOCF 5FL7G 4BQNA 4GO1A 4PJMA 3LSKA 4PDKA 5E3LA 5EC1C 4XLNF 5JH7A 3PNYA 2F48A 2L4MA 5J3LA 3QPTA 1ROPA 2GTSA 3E86A 3Q4HA 2PI5A 3K1MA 4PHZA 2MW2B 3AG2C 2Y69H 4M3DA 2A79B 3L2CA 2JPCA 3RYHB 1XL4A 5K5QA 2HHHO 4RLFA 3OEEG 1YJNV 1ZWIC 1E3HA 3EYYA 3Q5FA 2D2WA 3R65A 2M4GA 5EYRA 1MSEC 4EVIA 2QLZA 1D5VA 4NTWA 4BEHB 4L87A 2HQ5A 3QO5A 1AP6A 3GW2A 4PJLA 1UFIA 3HKCA 2DA6A 5D5UB 3BFRA 2HGCA 3IL2A 3DWLE 3B09A 2UXCO 1BJZA 1H2KA 2A5YB 3MVPA 3FHZA 3CJNA 3C90A 4OMZA 2GUZB 3RBZA 5B3SB 5IP7J 1KYZA 1M5IA 5E79Z 2O03A 4GDFA 5BZBA 1I5ZA 2IA0A 1IBMB 4DV7B 3KP6A 1TQPA 4HQEA 1LVAA 4JYBA 4L5EA 3E1SA 1J0RA 2KJBA 4YY3B 2GIZA 1KU2A 5TISZ 2NVYJ 4D7NA 4E7ZA 1G59A 4IRIA 2DTZA 4BJ6C 1G8XA 2JZYA 2NLJC 4Q4ZF 4DW1A 5IYDJ 1OCRH 5CB4A 1MG1A 4ASNA 1YHQV 1HNZO 3GUDA 4KFCA 2EIKB 3SEZA 3IRQA 1I0HA 4YIFA 5LOVA 2CUJA 1N36B 3I71A 3ABLC 5FD6A 2DOAA 1IXRC 5L3EA 5DD8A 2JGUA 1G6NA 2E5ZA 2XGEA 4B43A 5LHGA 2WSSG 2L7MP 3ZOBA 5D4SA 5E3MA 3W2VA 5LGTA 1DU0A 1MJ9A 1K6OA 1KU7A 2Y0PA 1SEUA 4DQ2A 2EIKC 3ECHA 3C3WA 1KU9A 1M4UA 2M0CA 4XR6A 3ABLB 2DA7A 1RC9A 3AEIA 3L00A 4ZOLB 4FLVA 5F0CA 3LA3A 3P32A 4M71A 4X9QA 3HKBB 4U7DA 4DR4O 2JJ7A 3HM5A 1I5YA 2ATKC 2R7OA 3CMEI 2UUAO 1H0MA 4QLCU 1APLC 1P92A 4NQWB 2Y4UA 2X6BA 2ZDIA 1YEWA 2BTQB 3WTYC 1FXHA 4FLZA 3NQOA 2G7UA 2XF7A 3OIOA 1S29A 5FFZA 3ZQLA 5D8KB 2LP7A 2X0LA 3OIQA 3CCMV 1HNXO 3U21A 3I3LA 3V4GA 1U78A 4H44B 3KPHA 1GVJA 3FXJA 1R23A 2NRAC 1XTAA 4I9QA 1BI3A 3G67A 3MZ8A 1U8BA 3GTPJ 2XHBA 4JI0O 3UQ8A 2OUMA 2R5ZA 2OQGA 1W7PB 2LOOA 4LLLA 1IV6A 3GTGJ 1EF4A 3V7SA 1HKSA 2O8XA 1HW5A 3LSIA 1M57B 2ELJA 5IT3A 3FKIJ 3M8AA 2XV4S 4NXNB 4LF5B 3L72H 4ICGA 4BY7J 1AJNA 2Y4TA 2KZGA 3LL7A 4CH7A 2EIJC 3MCZA 5BQTA 1XREA 2BCCH 3RKWA 3HKBA 1S76D 3HSEA 3COAC 3J80Z 1S3JA 3BTLA 1OPCA 3H3UA 4B8XA 2NN4A 3G3ZA 2D45A 4JI8B 4UB6C 1Y6XA 1Z21A 3TOAA 2F93B 3ABKB 3H9GA 2X6YA 1T56A 3SYPA
chains in the Genus database with same CATH topology
1JE8A 3KEQA 1IN7A 5DM6V 4JTAB 3E83A 4ZYGA 4MVQA 2OA4A 4ZZDA 2XOKG 4G8XA 3E8HA 5B1BB 1YSCA 2OAZA 1VQ6V 1O57A 2CGPA 2G7HA 1XGNA 2X6AA 3B8MA 3KG2A 2OCCB 2QTOA 3GFIA 4Q20A 2NS0A 3R0JA 4M72A 2WLMA 1Z6TA 2LF8A 1BIBA 1WWXA 2P7VB 2XAQA 4L0ZB 2QVOA 2IP2A 3CLOA 1MSWD 1C0WA 3F8NA 3E89A 3SZTA 3RIRA 4ENKA 3BOQA 3OEHG 1YTYA 4R79A 3BJAA 4X88A 1BN5A 1DDNA 2R3SA 1OCRC 3NXSA 4BQAA 4LLNA 1R6KA 3RVZA 2XAFA 2EIMB 1R3JC 2Q0OA 4I0AA 1YLFA 1QLEC 3ELKA 1AWCA 4HV5A 3F3XA 4EV0A 4CXFA 4P9FA 3F8MA 1TQMA 4ASUG 2YU3A 4PA4A 2W85A 2ESNA 1MJAA 1N8RW 4UUJC 2FNPA 4EM0B 3WG7C 1ZLJA 3ZMZA 1KD1W 4N21A 1YI2V 1HXDA 2QQAA 5D5VB 3GO5A 2K4BA 4PCQA 2ZFWA 2ZMEB 4RB3C 1SFEA 4Q47A 3K08A 1MD0A 1WI9A 2H6BA 1BC8C 3SHFA 5FLXK 4ENNA 1K97A 2BBYA 2Z5UA 3HHHA 4GX2A 6PAXA