3BY6A

Crystal structure of a transcriptional regulator from oenococcus oeni
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
119
structure length
119
Chain Sequence
QAMAITQKRPVYLQLVDRIKNEVATDVLSANDQLPSVRETALQEKINPNTVAKAYKELEAQKVIRTIPGKGTFITGNTASVKNSNQNRLLADLSQVIAELIKSGVKGERIKKIVNDILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a transcriptional regulator from Oenococcus oeni.
rcsb
source organism Oenococcus oeni
molecule tags Transcription regulator
molecule keywords Predicted transcriptional regulator
total genus 41
structure length 119
sequence length 119
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3by6A01
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3by6A02
1TW2A 5HLGA 1XCBA 4G6DA 2STTA 4CHUA 3TKYA 2XAFA 2VT3A 3DV8A 3OOPA 2P6SA 3E6CC 1R1TA 2NNYA 2O3FA 2VBYA 3IL2A 2UXNA 2O6GE 3E6MA 5TRDA 5DV5A 2WC2A 2FBIA 1AWCA 2L4AA 4HZFA 2OAZA 5BS6A 4GO1A 3RPQA 2O8XA 3D5LA 5L3GA 2VONA 4HF0A 1BBYA 4RB3C 1W7PA 5E18F 1LVAA 2RNJA 3PFIA 1KGSA 2JZYA 3JSOA 2TDXA 1LDJA 3BP8A 2AS5F 3GZ6A 3IRRA 3E35A 3DEUA 2FE3A 3E6DA 5D5WB 3PQKA 1O7LA 2DI3A 1G6NA 4Y15A 5L3DA 2XIGA 2IT0A 3SHFA 2RDPA 2DLLA 1LQ1A 3WGIA 3F8CA 1U78A 3FM3A 5ILVA 1BN5A 3W7SA 4KFCA 3EUHA 1HKSA 5DUIA 3M1EA 1PP8F 1SMTA 2ZNYA 1D3YA 3WTVC 3HSFA 3ZMTA 2XHKA 2M8EA 2Z9OA 4I2OA 1K7AA 4A6DA 2R7DA 3P9KA 3R60A 5H6QA 2K4BA 2XASA 1IXRC 2EJRA 2QVOA 1W5SA 3LQQA 5E17F 2BEOA 2RC4A 2KIFA 5HLIA 4EVIA 2FOKA 1IN7A 1SD4A 3GFJA 2XVCA 4KMFA 4LD5A 3ZQ7A 3ZP5A 2VOOA 2EV0A 1U6GA 4M71A 4YIFA 3QU3A 4FT8A 2BBYA 2E7WA 3I4PA 4KIFA 1BIAA 1ZG3A 4FX0A 2LNBA 3FXQA 1YW7A 3WU0A 3W6JB 1FBUA 1T0FA 3GW2A 1R1VA 1CF7A 1J59A 1FYKA 4IXAA 2OZ6A 1DDNA 3MZYA 2EV5A 4ZYGA 4BHPA 1HW1A 3KFWX 1C0WA 1P4XA 3JSPA 4LLGF 3J80Z 1U5TA 1YW8A 1IW7F 3GXOA 3L2CA 1SFEA 3U2RA 2VOPA 1IN6A 1T38A 3TO9A 4ZYHA 2BE5F 3IKTA 3K2ZA 3HYIA 1TQIA 3CUOA 1IN8A 4KNYA 1MJ9A 2DQRA 4YFXF 1J0RA 5HDGA 1RI7A 3F3XA 2HR3A 5HS9A 3HRSA 2VBWA 3LWFA 3F8FA 3FMQA 2MH9A 4JBAA 2ZBKA 5IT3A 2JRTA 1B1BA 3RPUA 1FP1D 5LLQA 1FP2A 4HDVA 3NQOA 4HV6A 4IRHA 1TTYA 2XAGA 4PGGA 2A68F 2JPBA 2ZXJA 4BXUA 1DUXC 1D8KA 2IRFG 3HRMA 2PJPA 3HHHA 3RYPA 2AXLA 1ZRCA 3H3UA 4L5JA 2OZUA 5ILUA 5CVUA 2MH2A 1OPCA 4EM1A 4R1HA 2FNPA 2RGVA 3VEPA 4KIGA 2V6CA 1XD7A 1KA8A 2ETHA 3ISPA 4Q5SF 5FO5A 3WGGA 2MD5A 1ONVA 1ZAOA 4RAYA 5ICEA 2K7LA 4PDKA 2A61A 2P5KA 5F1RA 5DD8A 1USTA 1U8RA 1R58A 3V7RA 1QZZA 3C18A 4M6YA 1R1UA 4L18B 4BAYA 4AIHA 1DPRA 3L00A 1QBJA 5DYMA 2HS5A 2OA4A 3N97A 1JHFA 5KVRA 3RTRA 2P7VB 2HQRA 4KDPA 4HLXA 4U0VA 2K02A 2QLZA 4HF1A 4M74A 4N9IA 1FBSA 2KJCA 2W25A 5D4RA 1UCRA 4A0YA 2VBXA 5D8LB 1QO0D 3JTGA 4XLPF 1I5ZA 3GEZA 3JTHA 4LK0F 4O3MA 4RGSA 4UV9A 1MJBA 4ESJA 4BHCA 2M45A 2EFNA 1TNTA 5H20A 3J80K 5FB2A 3VODA 1A04A 1DP7P 3H3ZA 5JVTA 3F6VA 4CXFA 5K5OA 1F1ZA 2QWWA 3GYHX 1HKQA 4UV8A 2K86A 3EYIA 1MDMB 3I58A 4KYWA 3SZTA 1PUEE 1K78B 4FX4A 4M73A 2NAZA 2FF4A 3EETA 2QQ9A 1RUOA 5CYVA 2HZTA 4AIJA 1G3SA 1DPUA 3KP4A 3BWGA 6PAXA 3RYRA 4UHTA 1GVJA 1LDDA 5LGUA 4QWQA 1ZN2A 3DXJF 1F9NA 4WXDA 1E2XA 2VE8A 2R7FA 1S8NA 3FXRA 3ZMUA 3D3IA 3KP7A 2ISYA 1OYWA 2A69F 1WRJA 2EWNA 3IKVA 1HQCA 4WF2A 4G7ZF 1FSEA 1V4RA 2KIUA 3V8JA 3KP3A 4OOIA 2BYVE 1HKTA 1K78A 4PZJA 3DFGA 2W84A 2ELHA 3ERED 3NEUA 1ZYRF 1FBQA 2UXXA 5CVJA 2EFWA 1W4MA 2CW0F 1WQ2A 1MKMA 3M8FA 2KKOA 4G9YA 4ZYDA 5LRRA 3HOTA 2RV8A 3ELKA 4EQQA 4ESBA 2L54A 4L0ZB 3KLNA 4L0YB 4LLLA 3KZYA 1XB4A 4MQ9F 1MGTA 3AAFA 5FLXZ 1T2KA 3Q5FA 4HV5A 3KP2A 3QRFF 3CLOA 4HW0A 3I64A 1KQ8A 2P5VA 3E5UA 2DK5A 4LFUA 1ZHFA 4I01A 3LFKA 2EFQA 4P55A 1K6OA 1B9NA 2Y48A 4EJTA 2Q8KA 2PG4A 3GZ5A 2A6EF 1NVPB 1RNLA 3TOAA 1RZ4A 4U7BA 5BMZA 1FNNA 1ODDA 4MEXF 4L9TA 2V1DA 2EFPA 4PCQA 4LGWA 1Y0UA 1XGOA 1J75A 2A6HF 2WTEA 2HKXA 1HBXG 2OD5A 3ECHA 1JHHA 3CDHA 1MD0A 1RUNA 2QUFA 4HX8A 4UUVA 3I59A 3M7GA 3FF5A 1H9TA 3LA2A 3SXYA 1F5TA 4CO8A 1H9GA 4M72A 2VC0A 2CO5A 4RS8A 4IF4A 4GYIA 2L4MA 4M9XA 1BJAA 3O3KA 5HS8A 3LQRA 1IAWA 3T5XA 2YX7A 3G3ZA 2QBYA 3I59B 2DQLA 2HTSA 5FD5A 3V7SA 3F72A 1XSVA 1H0MA 2PQ8A 1KU2A 5E1XA 2HTJA 2EA4A 2RQPA 2F5FA 4P5OA 1RIOH 2EV6A 2COMA 5BPDA 5EEGA 3FXUA 3CUQA 3W7XA 1IXSB 3U9GA 4MEYF 1WSUA 4UNOA 2YPRA 1FZPB 5D4SA 4N0BA 5L3FA 4H0EA 1U5TC 1SD6A 3SQNA 5LRSA 1STZA 1XGMA 5EEHA 5D5VB 2WWYA 5IT9Z 2QM3A 2D1VA 1IUYA 4NQWA 3T8TA 5ICFA 2M1BA 2ZCWA 4MNUA 1YS6A 2H27A 1BC7C 5DCMB 3WTSC 1FYLA 1R23A 4OIOF 5HS7A 2UZKA 2UWMA 3KZZA 5DEQA 3E97A 1QNTA 4I02A 4E70A 4EGZA 3RI4A 2IA2A 2BV6A 5AIQA 4KA4A 2ZNZA 4KUMA 1REPC 4HAMA 3B02A 1CF7B 4UXNA 4I98B 1HW2A 4CDGA 1EV7A 2KJBA 3MWMA 4BH9A 2CGPA 1O3SA 2G7UA 2CSOA 1G3YA 2FNAA 3GLXA 1KYWA 3KEOA 1I27A 1O57A 2ZO4A 3KP5A 2XRNA 1GXQA 2W57A 1QGPA 5LHGA 2O61A 1OYIA 5F64A 2E7XA 3ZN1A 3R6SA 2P6TA 3TO6A 3WE3A 4AD9A 1FLIA 1ZH5A 4KN4X 2H6CA 4KT5C 1ZLKA 3MFKA 2FMYA 3MZHA 4WWCA 2W24A 5L3CA 2EFOA 1B6AA 2IJLA 1QQIA 2QBYB 1USSA 2Y75A 3FWEA 2PMHA 3HSEA 3FZVA 5AIPA 5D6FA 1B9MA 3F6OA 2GXGA 1QPMA 4IRGA 2X4HA 4MTDA 3BY6A 3QPTA 1J2XA 3BPXA 3I71A 4OINF 2RKHA 3VFZA 5LHHA 4RGRA 1ZREA 1HSJA 2OBPA 1Q1HA 1R7JA 3TDZC 3F8BA 4I0AA 3E5QA 2VT2A 1BI0A 1V3FA 3REOA 3I5UA 3V7CA 2Z99A 4AWXB 4XLNF 4HLYA 3COAC 3WTUC 2HWVA 1ON1A 3MQ0A 5E1ZB 2Z3YA 4EV0A 2CYYA 2LKPA 1TNSA 2MA3A 2XAHA 1WKMA 1GXPA 1J9IA 1TBXA 1OKRA 4UVCA 4U88A 1HW5A 1FOKA 2FRHA 3MEXA 3Q9VA 2XUBA 3RDIA 4EM2A 3L09A 3C1DA 4WXCA 5CVIA 5HVQC 5FD6A 1XMAA 2CFXA 1QZYA 3J81K 3HSRA 3R0JA 3WG9A 5A2QK 3E5XA 2DK8A 4M9ZA 4YFKF 1Z05A 5L3EA 4HQMA 4M6XA 3K1PA 4EJVA 3F23A 3ML6A 3GUDA 3CO6C 4U0YA 2Z33A 1BI1A 1T39A 3E3VA 1I1SA 3W7WA 2Z5UA 4RB0A 4MTEA 1L3LA 3MAJA 3L7WA 1U5TB 2VC1A 4ENJA 5JHUA 2YR2A 5CLSA 4EJUA 4LK1F 1BC8C 1S6LA 4GGGA 5CVRA 3FM5A 1ZARA 3QU6A 5DUKA 1D8JA 1KQ0A 1WI9A 2YX4A 4UVAA 3RJPA 1EH7A 4A2UA 2FA5A 4OU0A 3WTZA 3WTYC 1OR7A 5J8CA 1BOAA 2HYFA 1O3TA 1LB2A 3M9AA 3IWFA 4AIKA 2YU3A 3DKWA 4WX9A 1B59A 4KIBA 1ZG5A 1TLHB 2WV0A 2VBZA 3IC7A 1Z7UA 4IRIA 4MHGA 1U3EM 1YO5C 3IHUA 1K79A 3BJ6A 3FMSA 2H6BA 3TO7A 1E17A 3P9CA 3U1DA 2V79A 2HFHA 2HDCA 1SD5A 4UVBA 2V9VA 4G7HF 3W7TA 2Y0MA 3LAJA 4EGYA 3LAPA 2F5EA 3KE2A 2MLKA 1ZLJA 5J6XA 2GA2A 4CYDA 2P7CB 3RKXA 1KU3A 1FWZA 2P4WA 3MCZA 2KIMA 1ZGAA 4OIRF 4I0BA 3FX3A 3C7JA 3HUGA 3E6BA 2GXBA 2HQNA 3R61A 4YFNF 3EDPA 5TJJA 4F7ZA 1XSDA 2IPQX 2XKPA 2E1CA 4A12A 2XKOA 3BDDA 2YSRA 3G73A 4A5MA 3ABUA 1BM9A 3WTTC 2L01A 3ULQB 5JFRA 5BPIA 2K4JA 3B73A 3LA3A 3WU1B 4ETSA 3GFIA 2G9WA 4R79A 3K1NA 3W7UA 2MLGA 2PFBA 2ISZA 3ZPLA 3IRQA 4G94A 2PBIA 2E1NA 2GAUA 3GWZA 2J5OA 1XCVA 2O03A 3QAHA 2RVCA 1RM1C 5CJ9A 2V1UA 4XSXF 4KN7X 3J81Z 4NB5A 3J7AO 4L5IA 2GZWA 2Q0OA 4LLNA 1P4AA 4A5NA 4N9HA 1KYZA 3R4KA 2DTRA 3M8EA 2FMLA 1IRGA 3EQLF 3WGHA 2EB7A 4LB5A 4NHJA 4S05A 4U0WA 2ESNA 1S3JA 2ZFWA 3N4MA 4HX7A 3FHZA 2FBKA 1Z6TA 4HDUA 2OQGA 2IA0A 3V4GA 3HRTA 4LG0B 4G7OF 4MGRA 4Q48A 1ZG1A 3VOEA 2A5YB 4ENKA 1UHWA 1O7FA 1KU9A 1FSHA 3K1MA 2B0LA 2WAMA 4HOBA 5KK1A 4GCVA 2A3SA 2XGXA 3L9FA 4FHTA 4RGUA 2IA1A 3HHGA 2HEOA 2CG4A 4ZZLA 2VE9A 1T98A 1OMIA 5E20A 5HDNA 1R00A 2D1HA 4HBLA 4S04A 4RAZA 3T8RA 2ACJA 1CGPA 3KP6A 3ABTA 3GO5A 4A0XA 5LHIA 1SMYF 3GX4X 1IF1A 2CWEA 1G3TA 4ESFA 2JPCA 4TV7A 4DQ2A 5ICCA 4OIPF 2HKOA 3W6KB 2P90A 1UHMA 4PGHA 3BOQA 4WCGA 1IXCA 1LJ9A 1YTFB 3V8KA 3BJAA 3T1BA 2GQQA 1Z6RA 2HGCA 1L0OC 3H92A 1S29A 3CO7C 5E1WA 2A07F 2M5WA 3QOPA 1IZ1A 5FFXA 1D5VA 4RB2C 5BQTA 1YQAA 3K69A 1G4DA 2ZMEB 3EYYA 3O2PE 1JE8A 3Q9SA 1UFMA 3QPHA 3LSTA 1P6RA 3F21A 1NH2B 2P8TA 2XV4S 2NNNA 4IPAA 2ZKZA 1XDSA 3I0TA 4MQVA 2R3SA 1XGSA 1X3UA 3ZMSA 4O5VA 5F6FA 4IVNA 2F5DA 4BQAA 4P96A 1S7OA 2JTVA 2PMUA 1IN5A 1YIOA 4ON0A 4G8XA 4M9SA 4ASNA 2MC3A 4ZYEA 1OYYA 5L3BA 2LDUA 2IW5A 1R22A 1J7KA 2W85A 4EMSA 3TOBA 3CTAA 3ZMDA 3DF8A 3C3WA 1R5HA 4HQEA 4LB6B 1P4WA 1JXSA 3HIFA 1HXDA 1XN7A 3BJOA 4G6QA 4L9NA 4CICA 1LEBA 1FX7A 2D45A 4GXOA 5CA3A 1S7AA 1YFHA 1MZBA 2VXZA 5D6EA 3DPLC 2L3DA 5E8GA 4KMUX 3P7NA 2ZMEA 1KU7A 3GF2A 3GFLA 4OMZA 2DAOA 2STWA 2LF8A 3VB2A 2V1XA 1FT9A 2FQ3A 4L9VA 1W7PB 4OMYA 3OV8A 1XDUA 5IT9K 4GYGA 1AOYA 2PLYA 1YG2A 2ESHA 2X0LA 4IHSA 4OIQF 1R5GA 1T6SA 5D5UB 3WODF 4RB1A 3S2WA 4Q47A 1F4KA 5H6RA 1LEAA 1HSTA 3RIRA 4B09A 5LGTA 5FFZA 4LJZF 2PEXA 1FC3A 2DPDA 2IVMA 3D0SA 5D5XB 1XMKA 4EM0B 3ECOA 5LGNA 3SFZA 2QQBA 1YTYA 2H94A 1YS7A 1P2FA 3CUQB 1JGSA 5DCFA 2GWRA 2K27A 2F5CA 4L9JA 4HYEA 5DDGA 5HOOA 2XAQA 3T0YA 1B4AA 3TQNA 5JI6A 2VN2A 5J8FA 3JAMZ 2MBFA 2DO7A 4LG0A 1Z9CA 5A2QZ 3P9IA 4IHTA 2RN7A 3ROUA 2L02A 5AONA 3IWZA 3KLOA 4AVPA 1LNWA 2FSWA 3F22A 4EJOA 1Z91A 3DP7A 5HDKA 2XAJA 3PQJA 4XSZF 4ZZDA 3BPVA 3I53A 2PI0A 3K0LA 4RGXA 2HYGD 2GIVA 4CGZA 5K1YA 3WE2A 2J5PA 2CQKA 2IP2A 3RKYA 1IN4A 4O6JA 1MJAA 3WTXC 2DT5A 2QZ8A 2FU4A 3F8NA 3BZ6A 5FGMA 1YW9A 4YG2F 1ZRDA 1BI3A 2C6YA 2QYOA 1ULYA 2GA1A 4ZH4F 3FMRA 3R0AA 2LSOA 2O0YA 2D2WA 3GFMA 1O3QA 4BHBA 3F8MA 2DW4A 3ZMVA 1EH6A 5JR3A 5ED4A 2PN6A 1PP7U 2QENA 2G7HA 2P5LC 4EJWA 2Q2EA 1TQPA 3KEQA 2H09A 4LMYA 4QLCU 1BIBA 1W7PD 3GVAA 3HOSA 3TDUC 3I54A 2FEZA 4WXHA 1KQ9A 4BNCA 5CVVA 4A0ZA 1MDMA 1XSXA 2NS0A 4HF2A 1W5TA 3CJNA 1NHAA 1TW3A 4ENNA 1ZGJA 4JK1X 2VODA 5ILSA 1G3WA 3JW4A 2EK5A 5DCMA 2LF7A 1PDNC 5D8KB 5BOXA 4Z2YA 1LDKB 4JQFA 1YYVA 2F2EA 3RKWA 2M30A 3DPTA 4XRFA 3ZMZA 4B8XA 3HRUA 1FPQA 1Z1DA 4U7DA 3HTSB 2NYXA 5ERIA 1VTNC 4K2EA 1WWXA 2M87A 2FBHA 1FYMA 1J5YA 1R36A 3SZPA 1TQMA 4I7HA 2DFIA 2KRFA 5E8IA 3NRVA 4Y13A 4I09A 4CZZA 2NRAC 2BGCA 5LBQA 4Y17A 5LEJA 2OU2A 4ENMA 4DNCA 5FLXK 3BROA 3LA7A 1SAXA 2JSCA 1FY7A 1BI2A 3K9TA 1I6XA 1GHCA 3ZN0A 1SD7A 2ZJ2A 5HLHA 5K5RA 1SFUA 2HOEA 5LEKA 3JAMK 2DPUA 4KICA 1ZRFA 1I1GA 3QP5A 4P9UA 1EH8A 2EA2A 4R8HA 4HX4A 3TGNA 2XROA 4WK8F 1UB9A 1O3RA 5K5QA 3V8LA 3CUQC 2JT1A 3DQVC 4BYYA 2DU9A 3O6BB 1IRFA 3WTWC 3KCCA 1YLFA 4P9FA 4D0PA 2ADUA 5DD4A 4IJAA 4Q4ZF 4XBFA 1ON2A 2OQRA 2FXAA 5GW7A 2DBBA 4HA8A 1SFXA 3KETA 3HTUA 3QP6A 1P92A 2QQAA 4YIIA 1XGNA 4A6EA 5ICGA 1U2WA
chains in the Genus database with same CATH superfamily
4G27B 1TW2A 1H2KA 5HLGA 4LIVA 4FVMA 1XCBA 4G6DA 1OCPA 2BY0A 2AHYA 1FXVA 3ZHQA 2GIZA 5CB4A 4X62O 3ERMA 2STTA 1TWFJ 1ZR4A 4JI2O 2R5YA 1JCHA 4CHUA 4ZDOA 1ZK8A 3TKYA 1JOYA 2XAFA 3OYJA 3CCEI 3BTCA 2CUGA 3BAAA 1QRYA 2VT3A 1PKXA 1UJWB 3K3WA 4BS9A 3DV8A 2XUMA 5J2TA 3OOPA 1VQ4V 1MIJA 2P6SA 5J2UB 2OPTA 3HXLA 2DMPA 1R1TA 3E6CC 2E2HJ 2NNYA 2O3FA 2VBYA 2YIDA 3PJRA 4A3FJ 3IL2A 2UXNA 2DOFA 3OFNG 4PV1B 4RQEA 2O6GE 3HKDB 3E6MA 4YELA 2R92J 1TWAJ 4XORA 3HKBB 3AG3C 3ABKH 5TRDA 1YOVB 1JKOC 2KB1A 3P3PA 1UFIA 4EKWA 2QA4V 2QQ8A 2OF7A 5DV5A 2KKWA 2WC2A 3BPZA 5EEAA 5EIBC 2FBIA 1AWCA 4CH5A 2L4AA 4HZFA 2OAZA 2ZIOA 2DN0A 3Q0UA 4JTDB 5BS6A 1X2NA 2LO1A 3HZJA 2RCVA 4GO1A 1FIAA 3RPQA 3JYCA 1W0JG 4LNUA 4LFAB 3SZGA 2O8XA 2M4KA 3BG9A 3D5LA 5L3GA 1P7JA 1G8XA 5HFLA 1VQOV 4ZTFA 5BMVB 1N32O 2VONA 1N36B 3G6EI 4HF0A 1BBYA 1ETKA 4RB3C 2L6LA 1W7PA 3GTPJ 5LFAA 4UCRA 4CH3A 5E18F 1LVAA 3ZRWB 2RNJA 3PFIA 4PFOA 1KGSA 3JR9A 2JZYA 3JSOA 1P7GA 4AC0A 4I0XB 4P2ZA 4RWUA 2TDXA 3OR1C 1LDJA 3BP8A 4BXFA 2AS5F 3GZ6A 1FTZA 3IRRA 3EUAA 4DV5B 3E35A 2LD5A 3UM7A 3DEUA 2FE3A 1VF5B 2DA4A 1KONA 3E6DA 4B1RA 5D5WB 3PQKA 3SDBA 4XRSG 1OCZC 3WU2Z 1WPBA 2AHQA 5JH7A 1O7LA 4KJZA 3OYBA 3K4LA 4BBSJ 2OT5A 3B8NA 4J7ZA 2DI3A 2OJED 5EGOB 1G6NA 3B77A 3RYHB 2B5UA 1DP3A 4TWKA 4Y15A 1NH3A 2DJIA 5L3DA 3G6EV 4ZKIA 1VF6A 1R4NB 2XIGA 1OCOC 4TV8A 2IT0A 3SHFA 3CP1A 4CA0A 2CMPA 1MNGA 2WLKA 3AG1C 2RDPA 4H4KC 5HFMA 2DLLA 2ZDIC 3Q4HB 3MHSC 1LQ1A 3WGIA 3F8CA 1U78A 3BEHA 1Y74B 2YEVA 3FM3A 4Z2WA 5ILVA 1BN5A 2KMUA 4XOPA 3KYCB 2JGDB 4KFCA 3W7SA 2Q6AA 3EUHA 3TXQA 4DUYB 3GZNB 1HKSA 3BR5A 2GM4A 2Q69A 2YSUB 3DTKA 4B3TB 5DUIA 3M1EA 1PP8F 5KLVH 1DGRM 1SMTA 2HDWA 3KCXA 5IYBO 2ZNYA 1D3YA 3WTVC 2ZE5A 1K33A 3DU5A 3HSFA 3ZMTA 2XHKA 2M8EA 2BVMA 2Z9OA 3C3SA 4MTFA 2DMXA 3APQA 2W00A 5E79C 4I2OA 3FXLA 1K7AA 1NI8A 4A6DA 2R7DA 2XF7A 3P9KA 1JJ8C 3R60A 2IXSA 5H6QA 3L2RA 2CGOA 1MW7A 2K4BA 2XASA 3A2FA 1IXRC 1SAUA 1BHAA 2EJRA 4HSTA 4B3SO 3CF5F 2QVOA 4GCZA 1W5SA 4F3QA 1RPOA 4DR7O 3RZDJ 1R3KC 3LQQA 1EF4A 3CCQI 1P7BA 5E17F 3CMMA 2BEOA 1AR5A 2RC4A 2KIFA 3DBLB 4NKGB 2OYQA 3SEZA 2DODA 5HLIA 1N36O 5E3LA 2FOKA 4JYKA 4EVIA 1R9TJ 1IN7A 2ADQB 1KC8W 1SD4A 5F04A 3WB0A 3GFJA 2VLAA 1EN5A 2XVCA 4JI6B 4FFBB 2M7AA 4LD5A 2PJRB 4KMFA 3M7MX 3SDGA 2EZPA 5LP6A 2Q7GA 1KUQA 3ZQ7A 3ZP5A 3E89A 1NTCA 3FXJA 2VOOA 2YIBD 1BL8A 2EV0A 4IX7A 1U6GA 3H9JA 1ENHA 4M71A 4A3EJ 4YIFA 4MTXA 2W82A 3QU3A 2V4DA 4QPKA 3A0RA 3S3WA 4DV7O 4FT8A 3CJHA 2BBYA 5EBMC 2RQ6A 3J7YJ 5CBGA 4RDUA 2E7WA 3I4PA 4KIFA 2QGUA 2VB6A 4AIDA 3OSGA 2DMQA 1K4DC 1BIAA 3L74H 1ZG3A 4FX0A 1B04A 4PA9A 4JI1O 3CRRA 1D2DA 2LNBA 3FXQA 1WH5A 1MOFA 2KT0A 3E2EA 1UZCA 1N32B 1M1EB 2X6AA 1YW7A 3WU0A 2NXNB 2HQAA 3W6JB 1TA8A 2XTAA 1PV0A 2ZE7A 1FBUA 1T0FA 3GW2A 4YEJA 1R1VA 1CF7A 1GM8A 1J59A 2E76B 1FYKA 2EZLA 1DF4A 4YJ3A 4IXAA 2LR8A 3PO2J 1X3ZB 2HOTA 1WJEA 4LWSA 2DDBA 2OZ6A 1DDNA 4TV8B 2NVQJ 1NG6A 5IJ9B 3OYIA 3HPHA 4DZPA 3MZYA 4DRXB 2VJ5A 4JASA 3DTIA 3RYHA 2JJ7A 2I5UA 2KZGA 2EV5A 1XQ8A 1K92A 3CMEI 4ZYGA 3TXSA 4BHPA 4XL9A 1HW1A 1WNSA 3KFWX 2E3CA 1C0WA 5AG2A 1XUQA 3HKCA 3T1HB 1P4XA 3BR3A 3JSPA 5IYCJ 3GTLJ 4LLGF 2E36A 3FIWA 1XL4A 2DJNA 3J80Z 1A6IA 2Y0SA 3ETDA 3ABKB 1U5TA 1YW8A 2PTMA 3L73H 3UKGA 3RFRA 3RYFB 3CC7V 4DYCA 1MBFA 1SQBH 1HR0B 1TL8A 2DE0X 1VQLI 1QR8A 3ZRXA 4CS4A 1VQLV 1IW7F 2MSYA 2DFEA 2ID3A 3GXOA 3L2CA 3CCRI 1SEUA 1SFEA 1QA6A 3ASNB 3NR7A 5IOZA 2VQCA 3U2RA 2VOPA 2DYRH 1IN6A 5JLXA 1T38A 1O4XA 2AXTZ 3TO9A 2UU9O 3DC6A 4ZYHA 3ZCCA 3EFFK 4MVMA 2H8RA 2BE5F 4CCMA 3K2ZA 3HYIA 3IKTA 2WLNA 4L87A 3I56I 5H9CA 1TQIA 3CUOA 3ASOB 3BQZA 2WBMA 1IN8A 3W3CA 4UCUA 4LP8A 3QYEA 2CE4A 4KNYA 2F6CA 5EYPB 1KKDA 3SPIA 1OJHA 1YTFD 1MJ9A 1V5FA 1LVKA 2DQRA 5JCOA 2IS4A 4YFXF 4WFGA 1J0RA 1IXBA 2NVXJ 5HDGA 1RI7A 3X2QB 3RYCB 1Y67A 2YS8A 3WB1A 1JJ6C 4HRIA 3CJHB 4MFDA 3F3XA 2HR3A 5HS9A 3HRSA 1LR1A 3K10A 3H1IH 2VBWA 4Q6GA 1BGYH 3LWFA 4UCVA 1N33B 3WG7H 3VWBA 3N05A 5JQGB 1QVTA 3L2VA 3ZQLA 3F8FA 3PNYA 1Z5WA 3FMQA 3IC9A 2MH9A 1LPQA 2KQXA 3RYIB 2PJRA 1I94B 4FFBA 2BZTA 2DFFA 4NTYA 1VQ9V 4RBOA 4JBAA 2ZBKA 4ZDLA 5IT3A 4AHCA 3OGCC 4CUGA 3GCMA 1U0JA 2JRTA 5DM6F 1VQ4I 1B1BA 2Y30A 2LGQA 2YI8A 3RPUA 3FK6A 1FP1D 4AVZA 3VOUA 3PM1A 5LLQA 1J5EO 1FP2A 3VYUB 5CB4B 4GKKB 3NQOA 4HDVA 1JPXA 1SQXH 2ZCEA 5B3SB 5B66C 5GAGJ 2LOOA 4GFBA 1NT2B 3WHBA 2HG5C 4TSFG 3M99B 3GWOA 4HV6A 4IRHA 5IYZA 4BACA 3LSHA 1IC8A 4FPPA 2ILMA 4GX5A 1H2GA 4CC5A 2ZXWH 1TTYA 1Y0NA 3HOWJ 3OTOO 2EZHA 5M5YJ 1UAAA 1OCTC 2XAGA 4PGGA 5LXTA 2LFSA 4TUYB 1WVRA 4K8XA 2A68F 1X1AA 5FKNA 2LG4A 2JPBA 1M1KW 4X1EA 1M57B 4IHWA 2WADA 2LKXA 1UG0A 2JA7J 3ZHUA 1DU6A 1BT8A 5E3OA 2ZXJA 1BL0A 4BXUA 1DUXC 2ZE8A 1D8KA 4FQGA 4AI8A 1VQ9I 5EJCA 2IRFG 1VQMV 4FLTA 1RSOA 5IY5H 3HRMA 4LF4B 5E1AC 2E34A 2PJPA 3A0HZ 3UT5A 2WLMA 2PZSA 3HHHA 4XKVA 4FLYA 3RYPA 1FYJA 4BEHA 2AXLA 1ZRCA 3H3UA 4DYRA 4EEFG 3U0ZA 4L5JA 1MNMC 3BQYA 2OZUA 2IS6A 2E2JJ 2KG7B 4DBRA 4B3SB 5ILUA 3DC5A 1T95A 4C3HJ 4XLHA 4MFEA 4W4KA 1CPYA 1X2MA 5CVUA 2JA6J 2QWRB 2VUMJ 3OIQA 2MH2A 1YI2V 1OPCA 4EM1A 4AQYO 4R1HA 5FKLA 2LH9A 4NXNO 2FNPA 3BVOA 1K5QA 2RGVA 3FB6C 4B3RO 2KLOA 1JT6A 4BQNA 4B08A 1PM9A 4DV4O 1MSDA 4AILC 3H3VK 1K6YA 2ODMA 4JI6O 3VEPA 2DCEA 4KIGA 2JEUA 1HCRA 2ZQMA 2K1EA 3H9QA 2V6CA 1WAZA 4DV4B 1XD7A 1KA8A 2ETHA 4RAFA 3K2AA 3OYFA 3ISPA 4Q5SF 3JCZA 5E79Z 5FO5A 4ZYAA 3WGGA 1JA8A 2MD5A 5EYRA 4CCLA 1P84F 1NR1A 1ONVA 1ZAOA 2A05A 3K4BA 3M1CA 2QSFX 4RAYA 2IH1C 5ICEA 2K7LA 2E2IJ 2VQHA 2D2CB 4XDJA 1V54C 4CCKA 4PDKA 4FLZA 2CUEA 2A61A 2P5KA 2LBFA 4I4TB 1D1CA 1YCIA 3S15J 5F1RA 5DD8A 1D0ZA 1LUWA 3BHPA 1VFCA 1N77A 1USTA 3OMNB 1U8RA 2DWEC 2XGDA 4I55A 4JOMA 1OQYA 1XC5A 3G2BA 2IM9A 1WCMJ 4LFAO 1R58A 3QYBA 2E71A 4J9ZB 1FJGB 4DR1O 4DBQA 1VQKV 1I94O 4FETA 3ZEDA 2MG4A 4CCJA 3V7RA 4DZJA 1OFCX 1SANA 1QZZA 4FLVA 3C18A 4P1WA 3RQ4A 5H2FC 4M6YA 4PJ0Z 4XLCA 2P81A 4LFCO 5M3FJ 1IV6A 1R1UA 4L18B 2JVHA 4BAYA 1B8IA 3FFQA 4D5FA 4GX2A 4AIHA 2ZNIA 3OEHG 1R73A 2BW3A 3WG7B 4E4EA 1QLEB 3EVKA 3ASNH 3DWLE 3HOXJ 4MTGA 2L0KA 2Y2ZA 3BA8A 4KHPB 2VKDA 2R5YB 4DR5O 1DPRA 4AU7A 1QVUA 2K40A 2R4GA 1D5NA 4N23A 3K4NA 3BLYA 3CC7I 1BZKA 1OV9A 3OYLA 4I6ZA 4ZOLB 3L00A 1YXBA 1QBJA 5DYMA 5EG0B 1FXKA 2HS5A 2WPDG 3DEEA 3NXSA 2OA4A 1GKFA 4PI2A 3RYIA 4UCOA 3N97A 4MLOA 1KZHA 1JHFA 5KHIA 1AKHB 2X9DA 2ZMEC 5KVRA 2P67A 2VASA 2DT7B 3RTRA 1FMWA 5H2FZ 2P7VB 5K7HA 2VL8A 5F08A 5IOYA 2HQRA 9ANTA 1NTKH 2ZXWC 4KDPA 3ABMB 4HLXA 4U0VA 4XKCA 2K02A 1KKCA 2ZXWB 3A8TA 2QLZA 4HF1A 2NOJB 4M74A 4N9IA 2UUBB 4K0KB 1FBSA 2KJCA 2W25A 3LSRA 4XOTA 2YIBA 4U3FH 3RYCA 2A3QA 5D4RA 1AR4A 1B06A 4CH4A 1UCRA 3DEWA 4A0YA 4C3IJ 1H2NA 2K3FA 3GTMJ 2VBXA 5D8LB 2CH0A 4RLQA 1MMDA 4ZIBA 1QO0D 3Q0WA 3JTGA 3AL0C 2LP7A 3LNQA 4XLPF 1I5ZA 3GEZA 3JTHA 4LK0F 3LSPA 5DTDA 4O3MA 2R7OA 2EPFA 4XLFA 1FMVA 4RGSA 4UV9A 5KCMA 1QQCA 2G38A 3LSQA 2QJ1A 3QVNA 1PNLA 2FJ1A 3UR3C 1FAFA 1MJBA 3WHCA 4BHCA 4ESJA 3CCQV 2M45A 2EFNA 2N74A 3JD3A 1XS9A 3UO2A 3T2MA 4Y52J 3O8HA 5JVDB 4TQFA 2JVGA 1TNTA 2PX9A 4JX5A 5H20A 5J4VA 3J80K 5FB2A 3VODA 1A04A 1DP7P 3H3ZA 5JVTA 4IHXA 3BC8A 3H9VA 3CE2A 3TBIA 1VQPI 1EZVH 3F6VA 4CXFA 5K5OA 2BOBC 2JS5A 1F1ZA 5J1UA 4HNVA 3OYDA 2K3PA 2QWWA 1K61A 3GYHX 3HOZJ 3LNNA 4OX9O 1XTAA 4EB6B 3CQZJ 1LE8A 3OTOB 2FOWA 3HOYJ 1R6KA 1ROPA 1HKQA 3UNGC 4UV8A 2F4OB 2K86A 3JRHA 3EYIA 1MDMB 4LF7O 3H36A 3I58A 3KX2A 3SZTA 4KYWA 4YJ3B 4C7UA 1PUEE 3I3LA 3NWTA 1JTYA 3NARA 1K78B 2CUZA 3LFUA 4F92B 3MD2A 1V55C 2NS7A 2V1NA 5IYBJ 4FX4A 2ZM6O 2ZSHB 2P7TC 1WJAA 4M73A 4RO2A 4A93J 2NAZA 5KHDA 1K34A 2G0EA 4DW1A 2CW7A 1KECA 2FF4A 1JFFA 5KAFZ 3QODA 4PI0A 4FZ1A 3EETA 3N2KB 3BCBA 2QQ9A 1SQPH 2Y0SN 2UXBB 4JI3O 1RUOA 4X1YB 3BG7A 1URFA 3OYHA 4ZHQA 2M9HA 1HP8A 5CYVA 2WA3A 4RUFA 2QEXV 3H01A 2HZTA 4IL6C 4AIJA 3VSKA 1RR8C 2YXHA 1XOUA 2B9SA 5B5EZ 1Q86W 3QO8A 1F51A 1G3SA 1YIJI 1DPUA 4TV9A 3KP4A 3T4DA 3BWGA 1Y1WJ 2ZR3A 6PAXA 1SESA 2WLHA 4O4IB 5KA5A 3RYRA 4O2BB 4UHTA 4BKXA 3CS5A 1GVJA 2E5NA 1SZXA 5FKMA 4J42A 1UJ8A 3RVYA 1LDDA 5LGUA 3ABLC 5D5QA 2V9PA 2PMZN 4QWQA 3T1HO 5CA0A 1ZN2A 2F4IA 3DXJF 1F9NA 3LSJA 4WXDA 1E2XA 3BTLA 2VE8A 2R7FA 2Y9ZA 1S8NA 2K5CA 3FXRA 1OCRC 1W0UA 4O2BA 2Q9LA 3JRBA 1N0JA 2F93B 3C3TA 3CRAA 1I50J 5FLMJ 3ZMUA 3D3IA 3VQXA 4BU2A 3KP7A 5CKTA 1JUMA 4V2FA 2F95B 4XDLA 1HA8A 1ZTRA 1QLNA 4IIJB 4A3IJ 2ISYA 1OYWA 2R93J 1W0TA 2A69F 4HBNA 4PA6A 4XKBA 5JJEB 1WRJA 2EWNA 3IKVA 1HQCA 4HSRA 4WF2A 4XKWA 1E1QG 3K58A 5A9GA 3AG2B 1Y76A 4G7ZF 1FSEA 4K3AA 1ORKA 1R6NA 1R49A 3K03A 5B1OA 2GLOA 3P30A 3PSFA 3JRIA 3PUBA 1V4RA 2ZINA 2KIUA 2E19A 3V8JA 4FK5C 4DK1A 3KP3A 2LFBA 2Q73A 1VQOI 4LFBO 3NWSA 4JX4A 4A3MJ 2IH3C 2PF4E 4X1KB 4E7KA 1MG1A 3RW0A 4OOIA 2BYVE 3CJTB 2KSDA 1HKTA 1K78A 4D7SA 4UB8Z 4PZJA 4B7KA 1FFXB 3DFGA 2W84A 2ELHA 3ERED 1N34O 3NEUA 2ZXIA 4PDMA 1ZYRF 3KEYA 3CCEV 1FBQA 2UXXA 3JRGA 3MKLA 5CVJA 2EFWA 1TVKA 3AG4H 1PJRA 1W4MA 2LREA 4EB6A 2CW0F 4A3GJ 1WQ2A 2V6EA 5TISC 4ZJZA 2R72A 2RDCA 1MKMA 2DA3A 3M8FA 2WA4A 2W48A 4KHPO 2KKOA 1IUFA 4GX0A 5EZHA 5K7FA 4DR5B 1W1WE 2EBIA 2EIKH 2KZVA 4G9YA 1EKEA 5FROA 4ZYDA 2EZIA 3CCJI 1FXKC 1RKWA 2QTOA 2Y0IA 1A31A 3IH3A 2K9MA 5LRRA 3HOTA 2RV8A 2HJDA 4I0XA 3ELKA 4EQQA 4ESBA 2L54A 1BOBA 2XB5A 4L0ZB 3ZJZA 2A9HA 1MNDA 3KLNA 4L0YB 4LLLA 3KZYA 3K5LA 5F27A 1XB4A 4MQ9F 2HVSA 3S1NJ 1MGTA 2QWOB 1US6A 1X4PA 3FISA 5K1PA 1XI1A 4HEA2 1HC8A 3AAFA 1WHUA 1HF0A 2EZKA 3CD6V 5FLXZ 3CLQA 2YI9A 3OT7A 4NBQA 1OR7C 1T2KA 3ZXSA 3Q5FA 3AK3A 4HV5A 3EXAA 4PDRA 2JWTA 3KP2A 3QRFF 2Y4UA 3CLOA 4HW0A 4NQWB 4FZ0A 3K4JA 3BTIA 4LOCA 3I64A 1KQ8A 1ETWA 2P5VA 4YIOA 3E5UA 2DK5A 1ERDA 4X64B 1S72V 4B3MO 3H0GJ 4XDKA 4UUSB 3L1PA 2EX3A 3SJBC 5CBHA 3HBLA 2NN4A 4DR6O 1UELB 4HNUA 3CCMV 4LFUA 3CXHF 2KIQA 3ZHVA 5IJ0B 2ZB9A 2IJIA 3BG3A 2RN9A 3R65A 2ZSIB 4UUJC 1ZHFA 3P5JA 2M34A 3OYCA 1Z0XA 2L7KA 4I01A 3R66A 4F91B 3LFKA 1BSMA 2DJVA 4CCOA 5J2UA 1WJCA 2EFQA 4P55A 1K6OA 2X1CA 2HU9A 4IOCF 1B9NA 2Y48A 4EJTA 4AUXA 3FDYA 3H1CA 1PPJH 5C8YA 2Q8KA 2PG4A 3MVPA 3CCRV 3DLAA 3GZ5A 2A6EF 2DOAA 4QE7A 1XNQB 1NVPB 4JAAA 4B43A 3KG2A 2ID6A 2L7FP 2HVRA 5C8YB 2BXZA 1RNLA 1JMKC 3TOAA 3FYIB 1Y39A 1GK9A 4OX9B 4C30A 1RZ4A 4U7BA 5BMZA 4BE1A 2AGAA 3CESA 1AU7A 1L0NH 4K35A 3OYAA 4FM2A 1QVGU 5FRNA 4RA2A 1FNNA 1VQ7V 2IBDA 4X89A 1ODDA 2RQQA 3G4SV 4DV6O 2CFOA 4PA3A 1R6RA 4MEXF 4L9TA 2JQ7A 2V1DA 4LCUC 2EFPA 4B44A 4PCQA 2BTQB 4LGWA 1Y0UA 4A69C 4PJJA 3CRCA 1XGOA 2AZ0A 3PO3J 4B3XA 3SYPA 3FB8C 1J75A 2AHZA 3OD4A 2L9VA 4BDZA 3GTGJ 3CCUI 2A6HF 3ASOH 4DR4O 3TK1A 4E7IA 1JKPC 2WTEA 2HKXA 1HBXG 2JS3A 4BIZA 2OD5A 4FTHA 2YDEA 3CC2V 3ECHA 4NTWA 5B1BC 1BJZA 1JHHA 4YIRX 4M3BA 1FOWA 1Y6IA 3CDHA 5CQGA 1MD0A 1JQ0A 3SPHA 5GTIZ 4AYBA 1RUNA 4FLUA 3VYTB 2M0MA 2QUFA 4HX8A 2RAEA 4MVSA 2RNBA 4UUVA 1G59A 3I59A 3M7GA 1B72B 3FF5A 3JATB 3B6CA 1H9TA 1GM7A 3LA2A 3SXYA 3FYEB 1F5TA 4CO8A 1H9GA 3QO5A 4M72A 2R5ZB 1IDZA 2LP0A 1AROP 1S72I 2Q0OC 3H5AA 1ETVA 2VC0A 2CO5A 5F0HA 1SQVH 4Y4RA 2XC7A 4B3TO 4RS8A 2X1DA 4IF4A 3SPCA 2VJIA 5E3MA 4X62B 1XDCA 4GYIA 1ZSPA 2L4MA 2XGCA 4M9XA 1Q5OA 4FM1A 1BJAA 3O3KA 5KHJA 4UY8I 4M3GA 4HNAB 4UCTA 5EZYB 4XNFA 5HS8A 1N78A 3LQRA 2YUAA 5B3SH 1IAWA 3BA9A 3RBZA 5A2QN 2EIKB 3AG2H 3ABMC 1Y56A 3T5XA 2YX7A 1GN6A 1W0KG 1H8HG 4BW5A 3G3ZA 2QBYA 3I59B 2DQLA 2HTSA 5EC1C 3TETA 5FD5A 2EH3A 1FXHA 3UT5B 1WJZA 1ZL8B 2WAQA 3K5NA 4RMNA 1RSOB 2EZOA 4BE2A 3V7SA 1GTOA 5B1AB 1EJ9A 3F72A 3JRAA 1WJFA 1XSVA 2WY7Q 4E7JA 2IS1A 1T33A 1H0MA 3K04A 1WP7A 2PQ8A 3W2VA 1KU2A 4YHHB 2Q8VA 2F66C 5E1XA 1ACIA 3VQYA 1SS3A 2HTJA 1GV2A 2EA4A 4E7SA 2EINB 2RQPA 2F5FA 4P5OA 1RIOH 4LF8B 5EF6A 4XRMA 2EV6A 3QWLA 2COMA 2O8KA 2Q0AA 3G1LA 5BPDA 2VKHA 4MS2A 3M07A 4V19K 5EEGA 2E60A 4X66O 3FXUA 4DV7B 3CUQA 4QNHB 3W7XA 1IXSB 1X4OA 3VSLA 4IIJA 2XHBA 3U9GA 2WLIB 4G6TB 2Y69C 3KCYA 1G6UA 1IURA 4MEYF 1WSUA 3E22A 3S8PA 5BY1A 3D5RC 3TEDA 4KFMA 5LYJB 1FJGO 5IP7J 4UNOA 2YPRA 1NR7A 1FZPB 1SKVA 5D4SA 2B1GA 5KHKA 2CAZC 2HPIA 2XF5A 2GDSA 2KL4A 2ICWG 4N0BA 4YXWG 2B9ZA 5L3FA 1AB3A 1MH3A 3SYTA 5KA6A 4DR2B 3OEEG 2YC0A 4H0EA 3TCUA 2R7ZJ 1QU3A 2PGGA 1U5TC 5GPAA 1SD6A 3SQNA 5DEDA 5LRSA 5H5NA 1STZA 1XGMA 5EEHA 1VARA 3ZIAG 3FK7A 5D5VB 1Y8QB 2WWYA 5IT9Z 2KPMA 2TCTA 3CMAI 1D0XA 5IT9N 4B47A 2VRZA 4LF9O 3ZRGA 1JKRC 4ZDPA 5J1RA 1VQNI 2OIGA 2Y0PA 3I4NJ 5IYDJ 3KKYA 4RQFA 3QG5A 2QM3A 1MABG 2D1VA 1IUYA 2YIAA 2XF6A 4DR4B 2XDVA 4NQWA 2KRCA 5C4JJ 1YE9A 3T8TA 2XSDC 5ICFA 1CXZB 2QF7A 2X6CA 3ASOC 2M1BA 2ZCWA 5M5WJ 3SYOA 2X1EA 5LA6A 3IAYA 5F1JA 2HDDA 1VP7A 1YIJV 4DR6B 1PYVA 3SFIA 4MNUA 1YS6A 2EIJC 4EFBA 2DA1A 4YJ2A 1S5LC 2H27A 1GO3F 2YICA 4O4HB 1BC7C 1L1FA 1Y1VJ 3CC4V 4UCSA 1Q90D 5DCMB 2X7RB 2XOKG 3WTSC 2GBYA 2OWOA 3J7AU 3IP4B 1FYLA 4IHVA 1R23A 4OIOF 3O8GA 5HS7A 2LJ2A 2UZKA 2UWMA 3KZZA 2LYCA 4JI5B 4ABZA 5DEQA 3E97A 1RRJA 2VWJA 1QNTA 3S3NA 2FL4A 1XNQO 2ZJRF 2KFDA 3HUGB 3H1KH 1IJWC 1KP3A 1OCZB 4I02A 5KUKA 3N2GB 4E70A 3HKCB 4X20B 2X48A 3HB9A 3NAUA 4EGZA 4JI5O 1HW7A 2DA7A 3I56V 3BG5A 1NK2P 5C4XJ 5JVDA 3RI4A 3BG6A 2FB5A 2EULA 2IA2A 3VDXA 2BV6A 2QA4I 1RESA 3AG1H 1I08A 5AIQA 1H38A 1TVKB 1OHHG 2QM4A 4KA4A 2ZNZA 4O4HA 4X65O 4KUMA 4KISA 1GN4A 4LITA 1REPC 4XN3A 4HAMA 3B02A 1CF7B 1OISA 2DMTA 2JVDA 3PN1A 2P4KA 2DYSB 1IRZA 4NR1A 4UXNA 4I98B 4LF5B 1HW2A 4ICGA 3K59A 2BOLA 2VKEA 3OAAG 2ZKOA 4O2AB 3QYFA 1U96A 4JI1B 4CDGA 1SQGA 3CC4I 4LF5O 3GB7C 3E7LA 4LF7B 5B1AH 1Y76B 2V7QG 2O9LA 4MTOA 5M3MJ 4HZ3A 4JF3A 2W0FC 1EV7A 1D1BA 2KJBA 3MWMA 3DTUB 2HHHO 4BH9A 4JV5B 2UXBO 1GT0C 2CGPA 2JA5J 2AQFA 1QCEA 1R4MB 1O3SA 1VQ6V 3K5MA 3FX7A 1AKHA 2G7UA 5JWPA 2CSOA 5LP6B 3OR2C 1MZEA 1G3YA 5IYDO 2F4MB 2FNAA 3GLXA 4JI4O 2I8DA 1KYWA 4BW9A 3KEOA 4JZGA 2CV1A 1J09A 1I27A 1BCCH 1XMOO 3F0CA 1NG7A 1O57A 2ZO4A 3KP5A 2XRNA 3CX5F 4F6EA 3ASNC 1GXQA 2L5QA 4QIWF 2W57A 1HNZO 2LY1A 4LC1A 1QHHD 2CUFA 3H1LH 1QGPA 2KISA 1IXMA 3CJQB 5CMUA 3IUOA 4TV9B 5LHGA 2O61A 1TAEA 1OYIA 5F64A 2CUJA 3VQVA 2E7XA 1JGGA 3ZN1A 1W59A 3HR0A 1ZR2A 5C3EJ 3R6SA 3U11A 5BR8B 2P6TA 3TO6A 3WE3A 1FFTB 3G71I 1QBZA 3ZHSA 1V5GA 4AD9A 4GT1A 1FLIA 3OM3B 1ZH5A 1NTZH 4KN4X 3W2WA 2H6CA 3LDDA 2D3OW 4KT5C 3AK1A 1ZLKA 3N2KA 1PL4A 4DK0A 1NH2D 3SJQC 2YU9J 3MFKA 2OCHA 2FMYA 2PUSA 1XG1A 3MZHA 2E1MB 1TT5B 3JAWA 4WWCA 4X66B 2W24A 5L3CA 5J1YA 2EFOA 5FJ8J 4P9PA 5FNVA 4C9YA 1B6AA 2IJLA 3BR1A 3M8AA 1QQIA 2QGNA 2R7XA 2QBYB 3OGIB 1USSA 4DV0O 1DK1A 1JTXA 2EIJH 2GOMA 2Y75A 1K8AW 3FWEA 2PMHA 3RN4A 3HSEA 3FZVA 1R6TA 3L71H 5AIPA 2HEPA 4BE0A 4DW0A 5D6FA 1M56B 3ETGA 4DYLA 4GKJO 1B9MA 1FD9A 4DR7B 3F6OA 2GXGA 1QPMA 3OYGA 3TL4X 3E8HA 5CQEA 3D3QA 1FPOA 5J9PC 4JAUA 3HKZA 1VQ6I 1POGA 3UCSC 4D1QA 4IRGA 1OCZH 2X4HA 4MTDA 2WLJA 1U9OA 2BE3A 3BY6A 3QPTA 2ITDC 3S1QJ 1RFYA 1J2XA 2JUCA 1HDDC 2DYRB 3ZRWA 3BPXA 1RM1B 3HM5A 3I71A 4OINF 2JMWA 3A0BC 2RKHA 3VFZA 1KB9F 2IJKA 5LHHA 1H8AC 4RGRA 1ZREA 2IU0A 4D7TA 2B7EA 4LBEC 5BMVA 1HSJA 2OBPA 1A35A 3AG1B 1Q1HA 1R7JA 3GBGA 3TDZC 4BQOA 3DXRB 3F8BA 2JGUA 3STZC 4I0AA 4DV3B 3E5QA 2VT2A 1BI0A 3CC2I 1V3FA 4G2KA 2LY2A 3JAKB 3DKYA 1TT0A 2KHMA 3I5UA 3REOA 3V7CA 2QSAA 4LNUB 2Z99A 4QPQA 4XLNF 3C2BA 4AWXB 3COAC 4PK4A 1ETYA 3WTUC 4HLYA 1VQKI 2HWVA 4A3DJ 2GHYA 5FPRA 5TISZ 3X2QH 1YJNV 2WB1N 3A4CA 3Q3SA 1X59A 4FLWA 1ON1A 5HLTA 2OTLV 3K4CA 3JRDA 2FX0A 2CK3G 3MQ0A 5E1ZB 4CZCA 3MKYB 4A3KJ 1WB7A 2Z3YA 4BJ6C 4EV0A 2CYYA 3B40A 4I50B 2LKPA 1TNSA 2MA3A 2BTQA 3GVMA 4OWRB 3S16J 2CQNA 3T1CA 4OXSA 2XAHA 2LKSA 1CP9A 1WKMA 1GXPA 1J9IA 1YEWA 3GLLA 2NLJC 4IYHA 3LDEA 5CPRB 1TBXA 4IT5A 3LSKA 1OKRA 3FKJA 3HC7A 4U88A 4UVCA 3L2QA 1XHXA 1HW5A 1CQTA 2FRHA 1FOKA 4BXXJ 3CCUV 3MEXA 3Q9VA 1L8DA 2XUBA 5KAFC 3RDIA 2EILB 3UQ8A 3THOA 2ELJA 3VYRB 2Z0AA 2X51A 1ETQA 4EM2A 2R7WA 4CSWA 1FTTA 3CEIA 3L09A 1Q43A 5FPOA 2KRHA 1AJPA 3MHHC 3PUFA 4XMYA 3FKIJ 2DN9A 2QKAA 1JJOA 2N8GA 3C1DA 4WXCA 5CVIA 2KQRA 1B8IB 1BS3A 1W2BU 4MO7A 4OAZA 1EM1A 5HVQC 3UO3A 5FD6A 4L5EA 2E5LO 1XX5A 3I5DA 5KNLA 1XMAA 2CFXA 2BHZA 4WFFA 1QZYA 3J81K 3HSRA 3R0JA 3JCUZ 3WG9A 5A2QK 2OTJV 3HKZN 2NVUB 3FBIB 4E2LA 2L9SA 1PUFB 5IJ0A 1YHQI 3E5XA 4I50A 3B8MA 3L72H 1GAXA 2DK8A 2QKMB 3HL2A 3ZGKA 1JVMA 2OCEA 4A3LJ 4M9ZA 4YFKF 1KQSU 1X1DA 1Z05A 1GM9A 4KITB 2ZR2A 5L3EA 2JN6A 4HQMA 4CYCB 5LD2C 4M6XA 2LW7A 3FB5C 4Z6YA 3CP8A 3K1PA 4EJVA 3F23A 3ML6A 1EBOA 3A1YA 3N27A 1QHTA 5IE9A 2OUMA 4O4LA 3GUDA 1YJWV 3CO6C 4U0YA 3TMOA 4CH7A 2Z33A 1YTFB 3OL4A 4FCYA 1B3QA 5JJNB 1BI1A 1T39A 3E3VA 1I1SA 1XNRB 3W7WA 2UUCB 1X1PA 2HZDA 2Z5UA 3K6GA 4RB0A 2IJJA 4MTEA 1L3LA 1THZA 3F5WC 3MAJA 3CDIA 2K9QA 3L7WA 4DUZB 2X85A 1U5TB 1M4UA 1X1BA 2H8PC 4X88A 2VC1A 3RYFA 4ENJA 5JHUA 2NS8A 3T4ZA 2JK5C 2YR2A 5CLSA 4EJUA 2F43G 2VJJA 2WAFA 1XMXA 3K70C 4LK1F 4U3JB 1BC8C 5EZGA 2DA5A 2L7ZA 3OY9A 1O9GA 2DA6A 4I99C 2EIKC 1S6LA 1YDXA 3CHXA 4GGGA 2KG7A 5CVRA 1HDPA 3FM5A 3OL3A 1ZARA 2CGNA 1AJQA 3CCLI 2R7SA 4IGGA 1E3HA 4M3EA 3QU6A 3SEQA 1NU1H 5DUKA 4AQYB 2DQ0A 1JJ2U 1D8JA 3DU6A 1OCRB 1KQ0A 1WI9A 2YX4A 4UVAA 3RJPA 4I9WA 1DTOA 5IWAB 1EH7A 4A2UA 3JSNA 2DMNA 1RPWA 1V54B 2FA5A 4OU0A 3WTZA 3WTYC 1S5JA 3BCCH 2LVSA 1I0HA 3HPLC 1OR7A 5J8CA 2IJHA 3W2AA 1XEQA 2MW2B 1HNWO 1WI3A 2JA8J 1BOAA 1Z7LA 2Q1ZB 4GDFA 2HYFA 2UU9B 1O3TA 2RMKB 5LL6Y 1A6QA 1LB2A 4LH6A 4N4OB 3D1NI 4JI3B 2TRTA 2DWDC 3BR0A 3M9AA 2Q67A 2W6IG 4NXMO 3IWFA 4AIKA 1YHQV 2DOEA 2BHYA 4FIPC 2YU3A 4JI8O 1M9NA 4U87A 2P4VA 3DKWA 5LXTB 3CCJV 4WX9A 1B59A 4KIBA 1ZG5A 2ZJQF 1TLHB 2WV0A 2VBZA 3IC7A 3W6VA 1N8RW 1Z7UA 3GTQJ 4IRIA 4MHGA 3CMYA 4LF8O 1U3EM 2JA2A 2Z16A 1WH7A 1YO5C 2VQEO 1AI7A 3IHUA 1K79A 3OTFA 1S0VA 4MVOA 3BJ6A 3FMSA 1WPXA 3LDCA 2HYJA 4FE4A 2H6BA 3TO7A 3U21A 1E17A 4DV2B 4DV1B 3P9CA 2UXDB 3U1DA 3L9DA 3OE7G 4X6AJ 2V79A 2HFHA 3M8JA 2HDCA 3QNEA 2VQFB 2P06A 2VQGA 2P0WA 2BCCH 1SD5A 1U97A 2L9NA 1XILA 3D8CA 4ZBMA 2F4VB 3RWRD 4UVBA 4H33A 4O4IA 3FXKA 2Q7HA 2VI6A 2VPLA 2ITCC 2JIZG 2NR5A 3L2WA 3FAVB 4PJNA 2DXIA 3ABKC 5JQGA 4NNJA 3FD9A 1BW5A 1FJLA 2K9PA 4E4HA 1R5ID 1T5EA 3CP2A 3CMEV 4W1UA 2DOSA 3KIOA 2V9VA 1I39A 4G7HF 3W7TA 2Y0MA 3CCSI 3RSNA 2R7RA 1IRXA 3I55V 1HNZB 3LAJA 4EGYA 3HEFA 3LAPA 2F5EA 3FXMA 3O65A 4NC8A 3KE2A 3GTOJ 2MLKA 1ZLJA 2UUAB 4IKFA 2VS0A 2LQTA 4O2AA 5J6XA 2GA2A 4CYDA 2P7CB 3RKXA 3OOUA 2YEVB 1HNXO 1KU3A 5EYPA 4FM0A 1FWZA 2P4WA 2BY2A 2EINH 3MCZA 1VMGA 4EATA 4UFZA 2L35A 1HNXB 1ZWIC 4KXRA 2EILH 4M3DA 1GRJA 4DV5O 1HLVA 2HOAA 3ZOBA 4JV5O 2FQ4A 1EZJA 1NJIW 1VF6C 4HPQA 5GTHZ 3LSMA 1U8BA 2KIMA 3TW7A 4BUPA 2EIMH 1NVPD 2ELKA 3D36A 1ZGAA 3DBRB 3PNVA 4I0BA 4OIRF 4XICA 3ETEA 4X64O 3FX3A 3CWBH 3N2GA 3K08A 3TW6A 1MBEA 3C7JA 3HUGA 3E6BA 2GXBA 3F5TA 5ITZA 2HQNA 4BIOA 5J4YA 2ME0A 3R61A 4JYAO 2P22C 4YFNF 2Q4PA 2HJFC 3IJ4A 3EDPA 4JAVA 4B3AA 3DLLF 1S5HC 5TJJA 4F7ZA 2Q7EA 3HG9A 1XSDA 3KPHA 1MBGA 2IPQX 4XM3A 2H3OA 1AI4A 4U7NA 4JP0A 4X1IB 3TP3A 2XKPA 3S3OA 1AI6A 3OR7C 4YJ2B 2E1CA 4A12A 2K85A 2XKOA 1HNWB 2RNGA 3OIOA 5J40A 3BDDA 2YSRA 1E0EA 1APLC 2FTKA 4DR3B 3G73A 4A5MA 3ZQQA 3ABUA 2E1MC 1WA8B 3CB2A 3OMIB 1BM9A 1X1CA 3WTTC 5JVGF 2CV0A 4R50A 3K4KA 4D9JA 4DOZA 1H2MA 3CCSV 1Q7YW 2L01A 3ULQB 2R9RB 5JFRA 5BPIA 2K4JA 3B73A 1Z77A 3LA3A 3ZCOA 1M57C 3OYMA 1Y4MA 1M93A 2NOGA 3WU1B 4MT8A 2COBA 2E75B 1IBMB 3CF2A 4ETSA 1Z67A 5DN6G 2ZM6B 2VQEB 4I76A 3GFIA 2G9WA 1U9NA 1WZ2A 2H1LA 1LFUP 3A0BZ 4H13B 4R79A 5LP6C 3AKZA 3K1NA 3W7UA 2MLGA 4NC6A 3ZS8C 2QWNB 2PFBA 1VQ8I 2ISZA 4GUNA 4KP4A 2X6YA 3ZPLA 2HHHB 3IRQA 1PNMA 2Y69H 4R7CA 4G94A 5KAIZ 4B4CA 1RKTA 4FISA 3ZR8X 1ZKGA 2PBIA 2E1NA 2GAUA 3LOCA 1ZGWA 1IV8A 3GWZA 1R71A 2J5OA 1XCVA 2JUGA 1I7FA 1JR9A 1Z2GA 3QO7A 1EA3A 1OCRH 1D5AA 1A5JA 3U10A 2O03A 3QAHA 2RVCA 1RM1C 5CJ9A 1GMGA 2V1UA 4XSXF 4KN7X 3GTJJ 2CQXA 3J81Z 4NB5A 3J7AO 1H2LA 3PIOF 5LMUO 1J95A 4L5IA 3OR6C 1WJ5A 2GZWA 2JRMA 4D7MA 3B4SA 3OMAB 2Q0OA 4MVZA 5LMUB 1Q82W 4LLNA 2QSHX 4XQFA 2CH7B 2IGMA 1P4AA 4DGWB 2H8WA 2FUG2 1GN3A 3SPGA 3EUHC 4J11A 3AG3H 2L2OA 4N9HA 4A5NA 1KYZA 2DYSH 2QSGX 1SA0A 3R4KA 2CDYA 5GAEJ 1GN2A 2GTAA 2DTRA 3M8EA 3ICXA 2FMLA 3GMEA 1IRGA 3EQLF 4I4TA 4MVQA 1TC3C 3WGHA 4R8CA 3I9V2 3JAKA 1ORQC 2E1OA 2EB7A 1KP2A 4DRXA 4LB5A 4NHJA 3TP0A 3DXRA 3Q4HA 4S05A 1ZUQA 1SC7A 2UUBO 4U0WA 2ESNA 3AL0B 1MNEA 1S3JA 4DR3O 2DQ3A 3S3MA 2V7FA 2CJJA 2ZFWA 2EINC 4MSWC 3N4MA 2JSPA 3AG4B 4HX7A 4PJMA 2WA0A 3LSIA 1HDJA 3FHZA 2QM8A 2NNUA 2XNDG 2FBKA 2AQEA 2UUZA 1EN6A 4A3JJ 4EEQA 2E5ZA 5CA1A 2BY3A 1G2HA 5FKKA 4Z1MG 1Z6TA 4HDUA 2EIMC 1YI2I 4IOAF 2FYUH 4H0LB 2OQGA 1AP6A 2EIMB 4RAIA 1OZ0A 3SYQA 2IA0A 1F43A 3V4GA 1N0NA 2GUZA 4IL6Z 4PDLA 1ZLZA 3HRTA 2DYRC 2YXLA 4LG0B 4XLAA 4LG3A 3FHNA 4G7OF 5GAHJ 4YY3O 1SQFA 5EBLC 1WJBA 4BEHB 3AG7A 4MGRA 4Q48A 4IO9F 3VPRA 3H5RA 3CYOA 1JI8A 3OYEA 1ZG1A 4PD4F 1VI0A 3VOEA 2A5YB 1PVEA 4ENKA 1FOXA 2JEXA 4ZI7A 1UHWA 4GRIA 2QWPB 4BIUA 1O7FA 1KU9A 2LY9A 3HGGA 1FSHA 3K1MA 4W4LA 4CC6A 2B0LA 4ITVA 2P5OA 2WAMA 3QOEA 4HOBA 4J41A 1V55H 3M3YJ 1BR2A 2Q68A 4JYCA 1MBJA 1K3EA 4UB6Z 2UUAO 2Z2SB 2V4JC 5KK1A 4ASUG 4J10A 4GCVA 2EBOA 1GV5A 5IPAA 2A3SA 2XGXA 3SJMA 4E7LA 1IX9A 1R3IC 2CH7A 1JUSA 3L9FA 4FHTA 4RGUA 3ZQHA 1IDSA 3EUKL 2OTJI 2IA1A 3BR6A 2XGEA 3HKBA 3EPZA 4GYCB 4TUYA 4GLXA 2BVLA 4DUYO 4X9QA 1BR1A 5E3NA 4CBCA 3HHGA 1AJNA 2HEOA 2CG4A 4JI7B 1BW6A 4JZ2A 5IYZB 2XB0X 3RCOA 4BJTA 1LUJB 4ZZLA 2VE9A 1T98A 1OMIA 5E20A 5HDNA 4JI0O 3RT3C 5GADJ 2N04A 4N4NB 1R00A 4Y3OA 2D1HA 1EN4A 2R0QC 2MABA 2QWQB 4HBLA 1Q6HA 3ABLH 2O5RA 4PSWA 1Q6UA 4S04A 4RAZA 3K9SA 2OCCH 3T8RA 2ACJA 1CGPA 4TT3G 4U7OA 2MYSA 4D6TH 3KP6A 2KDZA 3BRCA 3ABTA 1IVSA 3DBHB 4L8JA 1SFOJ 3GO5A 2VXDA 3V42A 4A0XA 5LHIA 1VF7A 1SMYF 3MN2A 4B48A 3GX4X 2QTSA 1ZELA 2CTQA 2VQLA 4CCNA 1IF1A 2PYJA 4GKJB 1AI5A 4O4JB 4KT6A 1TZLA 1HOMA 1V55B 2CWEA 2WY8Q 4DR1B 2EQRA 1QPIA 5LOVA 1G3TA 3CZ6A 3JRCA 4UUSA 2GXAA 4ESFA 2JPCA 2X6WA 4TV7A 4DQ2A 5ICCA 3IAS2 4OIPF 1OCOB 1P4RA 2HKOA 4RM2A 3W6KB 2GOXB 2V26A 2DMUA 2DYSC 2P90A 5KMGA 1UHMA 4QPJA 2Y69B 1TWGJ 5LMNB 4PGHA 2M3AA 3BOQA 4WCGA 1VQ7I 2M6YA 3SPJA 1IBMO 1IXCA 1LJ9A 4XRSA 3PIPF 3RZOJ 2QKSA 3JRFA 3V8KA 3APOA 3BJAA 5GPCA 4RLFA 1Q6IA 3T1BA 3S14J 2MK3A 4WFEA 2GQQA 4DW6A 3OW2U 4I7ZB 1Z6RA 3I55I 1X4TA 4IHJA 2HGCA 3IV5A 2XT9A 2QE7G 1L0OC 3H92A 2ZT9B 1S29A 2V9KA 2XPVA 3CO7C 1IZ3A 2GBOA 2ZIMA 3KZIZ 5LMNO 3MD0A 5E1WA 2VIXA 1JX9A 4FFKA 2HLDG 2WSSG 2A07F 2M5WA 3QOPA 1IZ1A 5FFXA 1D5VA 4X20A 5FLXN 4RB2C 2OC6A 4II2A 5BQTA 3QTCA 1YQAA 2ME6A 3K69A 1MMAA 1IBKB 4K0KO 3I4MJ 1G4DA 2KDOA 1MBKA 2ZMEB 3EYYA 2ZD9A 3O2PE 2MD0A 1JE8A 3SJCC 3Q9SA 4WFBV 4ZTJA 3LSGA 4NC7A 3F9KA 2LW1A 2F4VO 1XL6A 3K57A 2XRLA 4J7JA 1UFMA 3QPHA 3MDSA 4EFEA 3LSTA 3IGAC 1DGWY 1T8IA 2R7UA 2O7OA 4FMTA 2MFZA 1P6RA 1FFXA 3F21A 5KHGA 1CEZA 2RREA 2P8TA 2XV4S 2NNNA 2F1MA 1NH2B 3CCVI 4IPAA 4BGDA 3A01B 1TUBA 1NKDA 2ZKZA 1XDSA 2W4SA 4IQJA 2AW9A 5B1NA 4X1KA 1IDYA 3I0TA 4MQVA 4P30A 2R3SA 3ESWB 1XGSA 4QGPA 1M90W 3M4OJ 4MW8A 4HYOA 1X3UA 2DDAA 3ZMSA 1RETA 3G71V 4O5VA 3S2DJ 3RGBA 1PNKA 3WFVA 2WAQN 2PY5A 3X2QC 2LTPA 5F6FA 2LC2A 1H8EG 3LSUA 4DYQA 3G6BA 5BZBA 1MZFA 1F23A 3JD1A 3SDLA 1I3AA 4IVNA 2F5DA 2W1OA 5D5PA 4QTRA 3OUSA 4BQAA 2DTZA 1I6HJ 2L7MP 5EIBD 3RKQA 3BZKA 1S7OA 4P96A 1VQMI 2JTVA 2PMUA 5BXZA 1IN5A 1YIOA 3WG7C 4NXMB 1WFXA 4ON0A 4G8XA 2Z1DA 4M9SA 1R1BA 1YX3A 3KYDB 2HQ5A 4ASNA 2MC3A 4HNTA 1UHSA 1OYYA 4ZYEA 5L3BA 5DM7F 3ZQCA 4Y7NJ 1IGNA 2LDUA 2JRIA 3AK2A 5CA0B 3CCLV 2IW5A 1NZ6A 4JI2B 3C90A 1R22A 3PL8A 1AHDP 1DQUA 3S93A 1J7KA 1D0YA 1VEWA 2BY1A 2IGOA 2W85A 4EMSA 5FLVA 2VJ4A 1MA1A 4JGSA 5J3LA 5B5EC 3TOBA 4GZRB 2OCCC 3B2EE 3MMYB 3CTAA 1LUVA 4DV1O 1ZAUA 2UXDO 2QR4A 3ZMDA 2OCCB 3DF8A 3C3WA 2MGQA 4B7EA 1WJDA 5KAIC 1R5HA 3H0DA 4WBNA 4QIWN 1P49A 3ZRSA 4BJ5C 3OIPA 4G12A 2ATKC 4JYYA 1FOYA 2DFHA 5F0CA 1VNDA 1P4WA 4LB6B 4HQEA 1PD3A 3CPWU 3MKZA 1JXSA 1N25A 3ML0A 3HIFA 1WN7A 1HXDA 3C2HA 4LF9B 2R7QA 1XN7A 3BJOA 4G6QA 4L9NA 3CCYA 3A01A 1TUBB 3WU2C 2F5VA 2HNHA 4CICA 1LEBA 1NBMG 1ZL8A 1FX7A 2D45A 2WWWA 5IY5B 1YSCA 5IWAO 1K4CC 4GXOA 5CA3A 4PSXA 1S7AA 5IP6A 1X19A 5IY5C 3K5OA 4PUSA 1YFHA 2IU3A 4MW3A 1MZBA 1BQ0A 2VXZA 4F6RB 3JD0A 5D6EA 3JARB 5KX5B 3K0DA 3J7AY 3DPLC 2L3DA 5EDNA 5EGOA 3OS1A 5E8GA 4J7KA 4AM3A 1AR1B 1DLBA 2HPMA 4KMUX 4BBRJ 5EBWC 1VQ5I 3TJTA 3P7NA 2ZMEA 1ENVA 4HNAA 3CSXA 1SC5B 3CDLA 3S3XA 3FKSG 1KU7A 4U3JA 3SJAC 3LSSA 2PYLA 4X65B 3GF2A 3GFLA 4OMZA 4A3BJ 1AP5A 3ETQA 4XR6A 2DAOA 2VKVA 4ZC3A 1S77D 2STWA 3CCVV 2LF8A 2CQ7A 3VB2A 3T1YB 2V1XA 2K9LA 3QQAA 1FT9A 4UB8C 1QU7A 1I5YA 3ZQGA 1OCOH 2FQ3A 2QCOA 3JAMN 3K0GA 4CS2A 4L9VA 1B72A 1W7PB 2CV2A 1FS0G 5GTIC 3MZ8A 4OMYA 1JKQC 2MC4A 3OV8A 3Q0VA 3J81N 1XDUA 3QF7A 5IT9K 1DGSA 1XREA 2X6BA 3BFRA 3PJSK 3STLC 4A5UB 5BR8O 4GYGA 2CU7A 1MSFC 1AOYA 2EJ7A 3BABA 3AEIA 1VQ5V 4ABMA 2PLYA 1KYOF 5B66Z 2IEKA 3KZIC 1YG2A 3G4SI 3E83A 3J80N 4CYCA 2ESHA 2X0LA 3A02A 4IHSA 1TUEB 4WCEV 4OIQF 1QVFU 3VYSB 1R5GA 3UKMA 4DV6B 2OTLI 2WB1A 2M2EA 4LF4O 1T6SA 3KYLA 3K06A 5DM6V 5D5UB 1WGXA 3WODF 4RB1A 1XMQO 3PFYA 3HKDA 1K4TA 4O4LB 5B1BB 3LUTB 2HVKC 4YIPA 1XMOB 3S2WA 1H2SB 1F36A 4YHHO 4BY7J 4Q47A 1TWCJ 1N75A 3K79A 4AYBN 1F4KA 1YRNA 1E1RG 3SYCA 5H6RA 5EG0A 1FXKB 5JHFA 1LEAA 1HSTA 3RIRA 1LKXA 4B09A 4YRVA 3H9GA 5F0FA 4ZOLA 1SF9A 5J2TB 5LGTA 4PJLA 5FFZA 1A32A 3FB7C 3P3NA 2IGKA 2A0LA 4LJZF 2X6XA 1MMSA 1AILA 1WB8A 2PEXA 1FC3A 1BE3H 1QHGA 4MIMA 3S32A 2DPDA 4V2GA 1YITI 1L0LH 2O57A 2HP8A 4QJFB 2IVMA 3D0SA 2ETNA 3FXOA 1OCCH 1YJ9I 2FKXA 1Y66A 5D5XB 1JT0A 1XNRO 4J80A 2UUCO 5LYJA 4B3MB 1MBHA 1E3OC 1I3QJ 3E22B 3HKEB 1XMKA 4EM0B 3ECOA 3IAM2 5LGNA 1VZ0A 2VPRA 3SFZA 4DR2O 2LK2A 2QQBA 2H94A 4F93B 1YTYA 5IYCO 5TGTA 3ZX6A 2HI3A 3BCAA 3BR2A 1YS7A 1P2FA 3CUQB 4TQDA 1ZQ3P 2ZJPF 1JGSA 1S7EA 2LMDA 1NTMH 4MVUA 2NVTJ 1Q1VA 1NK3P 2R7VA 3CCMI 2K9SA 5DCFA 2GWRA 2Q5ZA 5IDJA 1BHBA 2K27A 1SETA 3K4MA 2F5CA 4RAGA 4L9JA 1P7IA 5HNHA 4HYEA 5DDGA 5HOOA 1E79G 1VQ8V 1TGOA 2XAQA 3LNMB 2M0CA 1UG2A 3S1RJ 5CBFA 3T0YA 3L70H 5IJ9A 4ZI7B 4LH7A 1B4AA 3TQNA 1G8MA 5JI6A 3AG4C 2VN2A 5J8FA 4QSHA 1XPXA 1IO2A 4NTXA 3JAMZ 5LOVB 2MBFA 2GSMB 4MVRA 2JJ2G 2EIJB 4IZZA 2DO7A 3OS2A 2IGNA 1I5XA 2EILC 3OYNA 1SVLA 2DA2A 4LG0A 1K4SA 1Z9CA 1KMIZ 1SFKA 5A2QZ 3F7VC 3P9IA 1VQPV 4IHTA 4UB6C 3CXCU 2RN7A 3QPLA 4X0GA 1HWYA 1MSEC 5EZYA 3ROUA 2GUZB 2PI4A 5J47A 2WV1A 2A7WA 2L02A 5AONA 3IWZA 3KLOA 2QKLB 2W7NA 2BSKB 4AVPA 3MAQA 1LNWA 1X3WB 2FSWA 1K83J 4EJOA 3F22A 1Z91A 4LIUA 2FD5A 5JCOC 5DS9A 1QLEC 3RVZA 2JK3A 3HOVJ 5JLWA 3E8GA 4Y33A 1YITV 2HVJC 4PJ0C 3JREA 3HDDA 2ZE6A 3G67A 4WF9V 3DP7A 5HDKA 2XAJA 3JARA 1F4MA 3PQJA 4XSZF 4ZZDA 5KX5A 3BPVA 3J7ZI 3A2KA 3I53A 2MW8A 1BR4A 2PI0A 3JASA 3A0HC 4NVPA 1GVDA 3K0LA 4RGXA 2HOSA 5FNVB 2HVQA 2HYGD 4XIDA 4F4LA 1S5LZ 4I9QA 3BZCA 2GIVA 3S17J 4CGZA 3U1KA 5K1YA 1Z21A 3WE2A 3JALB 3JAWB 2J5PA 2CQKA 3ONQA 2IP2A 1TP4A 4YY3B 4NUBA 3S1MJ 4UUTA 3AG3B 1WP8A 2XPUA 1W36C 2ZC2A 3RKYA 4QE9A 5GONA 1RP3B 1SA0B 1IN4A 1XMQB 3SGIA 1Q8IA 4JTAB 4O6JA 1MJAA 3WTXC 4DV3O 2DT5A 2QZ8A 2FU4A 3F8NA 2AXTC 3BZ6A 5FGMA 4WBNB 4DO2A 1YW9A 4YG2F 1ZRDA 1VQNV 1BI3A 5GP9A 2BXYA 1YVWA 2C2AA 3JCUC 3CRMA 4PELA 2C6YA 2QYOA 2QM7A 1V9PA 3HB3B 1ULYA 4KL1A 1IBLB 3OYKA 2GA1A 4ZH4F 2Y9YA 2QDOA 3FMRA 2E5LB 2YUSA 1M5IA 3R0AA 1TWHJ 2LSOA 2O0YA 4TOIA 2DT6A 1X58A 2D2WA 2QEXI 1FIPA 2M8GX 3GFMA 2IAIA 1LNQA 2UXCO 3JD2A 2M7BA 4BHBA 3F8MA 3ZMVA 2DW4A 4J00A 1O3QA 1EH6A 1N4CA 2YXYA 1KD1W 1NQTA 3E8FA 5JR3A 2I10A 5ED4A 1FEXA 4Q20A 4JI4B 4JI7O 2PN6A 4A3CJ 3T1YO 2E74B 4C2MJ 1PP7U 2AZ2A 1YRNB 5EK0A 4WFAV 4OAYA 4XN0A 3CMAV 5C44J 4XONA 2QENA 1VF9A 2G7HA 1OCCC 2W0XA 4C2TA 4LFBB 2P5LC 3D36C 1F7YA 1OCCB 4EJWA 1WLEA 4LR3A 4ZHQB 4JI8B 2Q2EA 1IG7A 3L75H 1TQPA 3KEQA 2H09A 4X1YA 3C2GA 1D1AA 4BQQA 2B63J 5FRMA 2CTWA 1MMNA 4JYAB 3S2HJ 4LMYA 5B1BH 3CRQA 1GDTA 2ZXHA 4LFCB 4E7HA 2ARHA 4QLCU 4OPAA 1T0FC 1JFFB 2P6JA 4JPRA 1BA5A 1ETOA 1BIBA 1W7PD 3GVAA 1Z3YA 2A5WA 2CQQA 3ZQIA 3TDUC 3I54A 2A6TA 3HOSA 1WA8A 3VQWA 2FEZA 1G4YB 4WXHA 4BL0B 1KQ9A 1J5EB 3E0JB 1S76D 4BNCA 1YJ9V 4XLEA 1W36D 5CVVA 3D5SC 4A0ZA 5KHHA 4J9YB 2L9RA 1MDMA 1XSXA 2NS0A 3DTEA 4C3JJ 2WAEA 1A36A 1W5TA 4HF2A 4X1IA 5FKOA 3CJNA 4C2UA 2F48A 1NHAA 2WLLB 5C93A 1ZTEA 1MSWD 1TW3A 4ENNA 2A79B 1YJWI 1ZGJA 3LL7A 4JK1X 4JX6A 4IHYA 2VODA 3ZHRA 5ILSA 5ITZB 2M7WA 3G80A 1XBLA 4DJAA 5KUMA 4DV0B 1G3WA 4BY1J 1SZTA 3P32A 1K97A 1DU0A 2IS2A 1T08B 3OSFA 3JW4A 5F2VO 1QNMA 2BTOA 1EFRG 3IFXA 4BDYA 4X8AA 1BQZA 2EK5A 2WLLA 3ABLB 3TGUH 5K1XA 4M3FA 2JDIG 4PA7A 2LLKA 5DCMA 1K73W 2LF7A 4S0HB 4F6RA 1G1XB 4H44B 1AA7A 4IHJB 2CTPA 4IEJA 1B6QA 3RPUD 4DIQA 1PDNC 5D8KB 4LWSB 2R9AA 4I5SA 4PDVA 4JI0B 3EHBB 3H1HH 1V54H 5BOXA 1LFBA 4Z2YA 1LDKB 2NVYJ 3GWKC 5LA6B 1H89C 4JQFA 4E6KG 4Z1VA 2ECCA 5GTHC 1YYVA 1H88C 4F52A 4CS3A 2F2EA 3RKWA 3OS0A 1E3PA 2M30A 4P9OA 4II3A 1PL0A 1Z5VA 3DPTA 1XHZA 4XRFA 2IBZH 2D5VA 3K9AA 3ZMZA 4B8XA 4PA4A 2XPWA 1FPQA 1Z1DA 3HRUA 4W97A 4U7DA 3HTSB 1K7DA 1SQQH 2BOCC 3ZRVA 2NYXA 2ECBA 5ERIA 1VTNC 2Q2EB 4O4JA 4K2EA 1FKAO 1UPGA 3E86A 4B3RB 1WWXA 2M87A 4CH6A 2FBHA 1MH4A 4DV2O 4XK4A 3OMYA 1FYMA 2K9NA 3FAVA 4LF6O 2ZDIA 1J5YA 1IBLO 1R36A 3SZPA 2Y31A 1D5YA 1TQMA 1NS1A 4I7HA 3LMMA 1WPKA 2DFIA 1W5CC 5DECA 3H5NA 4GKKO 1RR7A 2KRFA 4IQ4A 2OV7A 4J01A 3HOUJ 1JUPA 2CS3A 4IYIA 1N33O 5E8IA 2KP6A 1IBKO 1Z3XA 3B6AA 3NRVA 4Y13A 1SVOA 2N05A 4I09A 4CZZA 4ANJA 2NRAC 1YF2A 2BGCA 2XAUA 5LBQA 1QZEA 1M56C 2BW3B 1LFPA 1GLNA 4Y17A 4NYKA 4R6ZA 3SR2C 2R7TA 5LEJA 2F23A 1HR0O 4DXWA 2OU2A 4ENMA 4DNCA 2B1IA 2QKCA 1R3LC 3K70D 2HXOA 1MMMA 3ZHTA 3QPSA 1COWG 2GV9A 5FLXK 2W6JG 3BROA 3VBBA 3LA7A 1SAXA 2JSCA 2WLIA 1O9HA 1FY7A 5BNGA 3ZBHA 1BI2A 3K9TA 2ZNJA 1SERA 2VQFO 3E1SA 4PHZA 3DKXA 4HG2A 4I55B 1I6XA 3G1MA 2X6OA 1YJNI 1AVMA 1DF5A 4J19A 1GHCA 2RJZA 5CN0A 3ZN0A 3HPGA 2HFEC 1SD7A 2HXIA 2R70A 5GONB 1YZBA 2LGWA 2JGDA 2ZJ2A 2OIEA 5HLHA 1SVMA 2LBFB 5IP9J 5K5RA 1RPRA 2CTRA 3JSLA 3WB2A 1BMFG 4D7NA 1SFUA 1Y74A 3JALA 2HOEA 5LEKA 2A06H 1YX5A 2M4GA 2YS9A 3HJEA 3JAMK 1PP9H 2DPUA 4BR6A 5HNFA 4M6VA 4K8ZA 2ADPA 4JYBA 2VWKA 3PSIA 4OGQB 1UMQA 3JASB 1U2WA 3L2UA 3BTJA 4JTCB 1T56A 4NXNB 1S9HA 4FJCC 4RM3A 3JD4A 4KICA 4N21A 1ZRFA 1LE8B 3OUFA 2AO9A 2UV1A 1I1GA 5JH7B 4BWAA 5HODA 1GH6A 2E35A 3F7YC 2CRGA 1V5EA 3HGYA 3A03A 3QP5A 1EH8A 2EA2A 4P9UA 1Q3EA 3DCFA 2BSKA 4R8HA 2UXCB 2GTSA 2PMZA 5M5XJ 4HX4A 3TGNA 5JJJB 2XROA 5CA1B 1ZX3A 2XSJC 4WK8F 1RC9A 4DUZO 1UB9A 2R5ZA 4FLXA 3K7AJ 4NDLA 3V8LA 3CUQC 5K5QA 2JT1A 5K7ZA 1OJLA 1O3RA 1R3JC 3DQVC 1SRYA 3DGEA 3E8BA 4BYYA 5B3SC 2CW8A 3IH4A 4FASD 2DU9A 3ABMH 3AG2C 3JATA 3SYAA 4F55A 3B09A 3H1JH 3CJRB 3DSQA 4OPHA 3O6BB 4FE7A 1IRFA 3WTWC 3KCCA 1F4NA 1N34B 4GX1A 1KBHA 2LRDA 1YLFA 4P9FA 4D0PA 3CD6I 1VIBA 2Y4TA 2ZFUA 5KMGB 4D5CA 3FBNB 2ADUA 3G1OA 5EC2C 5B1AC 4WFHA 4H37A 1P9QC 5DD4A 4G28B 1K9MW 1QR9A 3DPUA 1GUUA 4IJAA 4Q4ZF 4XBFA 3GTKJ 1ON2A 2OQRA 3IH2A 3ZQFA 1Q81W 3OWTA 2FXAA 5GW7A 2DBBA 1Y6XA 4HA8A 2LFRA 3O9OA 4E7ZA 5FL7G 3MKWB 4LF6B 1SFXA 3KETA 1Y8RB 3H35A 1PUFA 4QPOA 3PNTA 2PI5A 2H1KA 3HTUA 3QP6A 1P92A 2QQAA 1ITYA 1K5SA 1OLTA 2JJ1G 4PFPA 4YIIA 1XGNA 3RQIA 3BT9A 4RUEA 4A6EA 5ICGA 2R9IA 3HKEA 1MMGA 1ETXA 3AFHA
chains in the Genus database with same CATH topology
4G27B 1TW2A 5HLGA 1XCBA 4G6DA 2AHYA 1FXVA 2STTA 1JCHA 4CHUA 3TKYA 1JOYA 2XAFA 1UJWB 2VT3A 1PKXA 3K3WA 3DV8A 1VQ4V 3OOPA 2P6SA 3E6CC 1R1TA 2NNYA 2O3FA 2VBYA 4RQEA 3IL2A 2UXNA 3OFNG 2O6GE 3E6MA 3AG3C 5TRDA 2KB1A 4EKWA 2QA4V 5DV5A 2WC2A 2FBIA 1AWCA 2L4AA 4HZFA 2OAZA 4JTDB 5BS6A 4GO1A 3JYCA 3RPQA 1W0JG 2O8XA 3D5LA 5L3GA 5HFLA 1VQOV 2VONA 4HF0A 1BBYA 4RB3C 1W7PA 5E18F 1LVAA 3ZRWB 2RNJA 3PFIA 1KGSA 2JZYA 3JSOA 4P2ZA 2TDXA 1LDJA 3BP8A 2AS5F 3GZ6A 3IRRA 3E35A 3DEUA 2FE3A 3E6DA 5D5WB 3PQKA 1OCZC 1O7LA 2OT5A 3B8NA 2DI3A 3B77A 1G6NA 2B5UA 4TWKA 4Y15A 5L3DA 3G6EV 4ZKIA 2XIGA 1OCOC 2IT0A 3SHFA 3CP1A 3AG1C 2WLKA 2RDPA 5HFMA 2DLLA 2ZDIC 3MHSC 1LQ1A 3WGIA 3F8CA 1U78A 3BEHA 2YEVA 3FM3A 5ILVA 1BN5A 3W7SA 4KFCA 2Q6AA 3EUHA 2Q69A 1HKSA