3BY6A

Crystal structure of a transcriptional regulator from oenococcus oeni
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
119
structure length
119
Chain Sequence
QAMAITQKRPVYLQLVDRIKNEVATDVLSANDQLPSVRETALQEKINPNTVAKAYKELEAQKVIRTIPGKGTFITGNTASVKNSNQNRLLADLSQVIAELIKSGVKGERIKKIVNDILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a transcriptional regulator from Oenococcus oeni.
rcsb
source organism Oenococcus oeni
molecule tags Transcription regulator
molecule keywords Predicted transcriptional regulator
total genus 41
structure length 119
sequence length 119
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3by6A01
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3by6A02
4I2OA 5DUIA 2PI0A 2XAJA 2FOKA 4LG0A 1T38A 5E8IA 1I5ZA 3QU3A 2E7XA 3IRRA 2XUBA 3EETA 3V4GA 2O0YA 3VB2A 3FXQA 4BHCA 4CDGA 2O6GE 1AWCA 1STZA 2H09A 3EYYA 1I6XA 1YTYA 4G7ZF 4RGSA 3TKYA 4KA4A 1BJAA 3H92A 2D1VA 2NNNA 1QZYA 4XLPF 1LEBA 3CJNA 3FX3A 4BXUA 1RI7A 3JSPA 4U0WA 3W6KB 1KYWA 2IA0A 4U0VA 3TQNA 3HTUA 2H6CA 4HX8A 3I58A 1ODDA 2L3DA 3L9FA 4BQAA 2FU4A 3NRVA 3WTVC 2M5WA 3ROUA 3CUQC 4G6DA 4M71A 4KFCA 5E1XA 3PQJA 2XVCA 1Z05A 4HLYA 5LHGA 2HYGD 3GFJA 4RB1A 4G7HF 5FFZA 5CA3A 2IA1A 2RGVA 4HV5A 3K9TA 4I0BA 5D8KB 4CZZA 3M8EA 2P8TA 4LGWA 4KN7X 4I0AA 2RVCA 1UFMA 5CVIA 1FLIA 4UVCA 2ELHA 3DEUA 1OPCA 3RPUA 4R1HA 3GXOA 5D6EA 3M1EA 3ZPLA 2M87A 3EYIA 3F23A 2VBZA 2PFBA 1ONVA 3ECHA 3BDDA 5L3DA 1B59A 3QP6A 2QQBA 3FWEA 1J75A 3K1PA 2LKPA 4HF1A 3CO7C 2FF4A 2EV6A 4KMFA 3FM3A 3LA7A 4EV0A 2DPDA 4ZYHA 3QPTA 1S3JA 1KQ0A 3LFKA 1GVJA 5HLHA 2L54A 1R1UA 5F64A 4I09A 5E8GA 4EQQA 5IT9Z 3CUOA 1TBXA 2ZJ2A 2EA2A 4OMZA 3I64A 4IHTA 4Q48A 1XGNA 1BI3A 4GYIA 1QZZA 3GYHX 2MH9A 3J80K 1XSDA 4YG2F 4TV7A 1LQ1A 2JPBA 4P5OA 3T8RA 4N9HA 4NHJA 3HIFA 2D1HA 1Z9CA 4PGGA 2Z5UA 5LEJA 3C7JA 4KN4X 2FBKA 1G3WA 1ZGAA 5A2QK 2O61A 4O6JA 4GYGA 2YPRA 1I27A 3MZHA 1J7KA 2F5EA 2DQRA 4OIRF 2GWRA 4I02A 3MQ0A 1ZH5A 2QYOA 3M9AA 2HTJA 1PP7U 3COAC 1FP1D 1YFHA 5D5UB 4LK1F 5J8CA 2GXGA 2R7FA 4Y17A 2O3FA 2PMHA 4ZYDA 3T8TA 2CO5A 4CGZA 2HZTA 3HSFA 4R8HA 2L02A 1B1BA 1K78A 2WAMA 3C1DA 1DPRA 2JT1A 2CG4A 2VT3A 2MLKA 1ZRFA 2VE8A 4IJAA 2BV6A 1O57A 2DAOA 2VXZA 2FSWA 4BHPA 2BBYA 2DK8A 3NEUA 3GVAA 3TO7A 4A6EA 3E5XA 1R00A 2IP2A 1YW7A 2D45A 2EFQA 4FHTA 5TRDA 5H20A 5IT9K 1ZAOA 2A68F 2XV4S 1T39A 5CJ9A 3ABTA 3GW2A 4IRIA 1MJAA 2DT5A 2G9WA 3K1NA 2HR3A 2C6YA 2JTVA 2CQKA 3GF2A 5HLIA 3T5XA 1ZG1A 2EV0A 1D5VA 2F5DA 4CYDA 3TO6A 4U7BA 3ZMZA 1S8NA 5LRSA 4N9IA 2KIMA 3IHUA 1GXQA 4IVNA 5L3BA 1KQ8A 4KICA 5HVQC 4Q47A 3WE3A 4EJUA 2A61A 3WE2A 2L4AA 4UVAA 2RC4A 1O3SA 1FYLA 2ZBKA 3HSRA 1B6AA 1SMTA 5A2QZ 2FE3A 3B02A 2FRHA 1S29A 1H9GA 2NS0A 4EVIA 5CYVA 2XKPA 4A0XA 4P9UA 1H0MA 4RGRA 4EJWA 4HA8A 5LLQA 4WCGA 4KDPA 3P9IA 1OKRA 3I5UA 2IRFG 2MBFA 2Z3YA 4ESJA 2DFIA 2H27A 1EH6A 4RAZA 1BI2A 1XGMA 1U5TA 3WTYC 1YO5C 3RYPA 1LB2A 2ETHA 2W25A 4A5NA 1HXDA 3I71A 1K79A 2CW0F 4HF0A 1HW2A 1W7PB 2HOEA 3SQNA 4EGZA 3IL2A 1LNWA 4MTEA 5E17F 2OBPA 4WXCA 4YFXF 4BAYA 2XROA 2EFOA 4AVPA 5CVUA 4NB5A 5K1YA 1JE8A 3L2CA 4L5IA 5LHIA 3F8NA 2RDPA 1LDKB 3DXJF 4EMSA 3ABUA 3RPQA 2CSOA 3SXYA 1OMIA 1WKMA 3IKVA 1K78B 1AOYA 5D4RA 5JVTA 4IXAA 5L3CA 4QWQA 1HKQA 2ISZA 5LEKA 3JTHA 4KYWA 1NHAA 3U2RA 2P7CB 1MGTA 3ECOA 1IN8A 1H9TA 1K7AA 1UHWA 3LSTA 1B4AA 2MC3A 5ICGA 1MJBA 3MCZA 3WGIA 3I0TA 3QP5A 4ETSA 5K5QA 1X3UA 3WTZA 3V8LA 3E6DA 1T98A 5AONA 3REOA 5BQTA 1BM9A 5HS8A 2QBYB 3IWZA 5DUKA 2NAZA 2VN2A 3R0AA 1J0RA 1IN7A 3ZMVA 2BYVE 1FY7A 1T2KA 5FFXA 1YW9A 3JAMZ 5BS6A 2PEXA 3E5QA 4RB0A 2QLZA 3ERED 2FA5A 5FGMA 2V1DA 4HZFA 1ZYRF 4PGHA 4FT8A 4HDVA 3ZN0A 1FZPB 2RQPA 3V7SA 1L3LA 1FYMA 1ZN2A 1U78A 4QLCU 1P6RA 2DBBA 1IZ1A 1YLFA 2RN7A 1R1TA 1YYVA 1MKMA 2XAQA 4GGGA 4P9FA 5ILSA 5ICCA 1KU2A 3CUQA 1TW2A 4WK8F 1BIAA 1O3TA 3HYIA 3F3XA 3WTTC 3W7SA 3BZ6A 5JFRA 2P5VA 3ZMTA 1U5TB 5BPIA 1JHHA 1R23A 3HUGA 1HKTA 5CVRA 3G3ZA 5D6FA 4RGUA 1GXPA 3RKYA 1W7PA 2WV0A 2VC0A 2VODA 1SD7A 2FMYA 1E2XA 1NH2B 2LSOA 1FBSA 4KNYA 3KETA 1GHCA 3LA3A 4ZYEA 3K1MA 2M45A 3LWFA 3HTSB 4ENMA 4WWCA 4XBFA 2IPQX 1R7JA 3BJAA 3KP7A 1KU7A 3TGNA 1UHMA 4HQMA 3VODA 3QPHA 4EJTA 1BN5A 2XGXA 2YU3A 4BH9A 3E6CC 4OINF 4A12A 3EQLF 1HSTA 2OAZA 1F5TA 1YG2A 4KIGA 1SMYF 5ICEA 1F9NA 3MZYA 1BI1A 4HYEA 5DEQA 3ZQ7A 4L9NA 4XRFA 4KIFA 4LFUA 1Z6RA 4PZJA 4M9ZA 3FXRA 4LLGF 2QQAA 2HKXA 2QBYA 3JTGA 2K27A 2P5KA 2QZ8A 3KEOA 1FP2A 3KCCA 2HKOA 1I1SA 1BIBA 5H6QA 4S05A 3U9GA 1LJ9A 4CHUA 3L00A 2DU9A 2NRAC 3KP2A 1V4RA 3FMSA 1E17A 2WC2A 1WI9A 1Z1DA 2VBWA 3F72A 3GWZA 1EH7A 1PDNC 1FC3A 5FD6A 5CLSA 1USTA 1G6NA 4HW0A 2OZ6A 1BOAA 2W85A 4EM0B 4UXNA 4UHTA 3IWFA 3MWMA 2R7DA 1T0FA 1ZGJA 2FNAA 1WRJA 4XSZF 2VBYA 1DPUA 4OIOF 2EWNA 5JI6A 2H94A 2STTA 1XD7A 1ZRDA 3NQOA 4G7OF 1JGSA 2DW4A 4WXDA 3V8KA 2P6TA 5HLGA 1OR7A 4MEXF 4ZYGA 1I1GA 2D2WA 1ON2A 2UXNA 3HOSA 4O3MA 5ICFA 2ZO4A 2X4HA 2Z99A 4IHSA 1F1ZA 4M73A 5DCMA 2QENA 4G6QA 5FLXZ 5K5OA 5BPDA 2KJBA 2Q2EA 1HSJA 5E1ZB 4ENKA 2A07F 3GZ5A 2DQLA 5DD4A 4D0PA 4ENNA 2VT2A 3RI4A 4P55A 4ESFA 3RTRA 1K6OA 2CWEA 2HQNA 4L18B 4O5VA 2V6CA 3R61A 2ACJA 1BC8C 3TDUC 2IJLA 3RDIA 5D4SA 3TOAA 4CO8A 4JBAA 3FM5A 5HDKA 1HW1A 4HBLA 3FMRA 4YIIA 1O7FA 2TDXA 4N0BA 2P6SA 1XN7A 2MA3A 2KRFA 4F7ZA 3JW4A 4HX4A 1XMAA 2IA2A 1IN6A 2YX7A 2J5OA 5HDGA 1ZRCA 1TQMA 3RYRA 5HS7A 2LDUA 3VFZA 1FX7A 2GQQA 5LGUA 2ZKZA 3LAJA 2HEOA 1YQAA 1W7PD 1IN4A 2JSCA 3F8BA 5F1RA 3JAMK 4G94A 1MZBA 1U3EM 4M6YA 2VONA 1XGOA 2MD5A 2ZMEB 3KLOA 3HRMA 5D8LB 3FXUA 5JHUA 3F6OA 3M8FA 2XAFA 3T1BA 3CLOA 2G7HA 1S7AA 3F8CA 1XCVA 3MEXA 4UV8A 3QAHA 2OD5A 2JZYA 2BE5F 3DQVC 4HQEA 3F8FA 2ESNA 1OYIA 5ILUA 3BPXA 3E6MA 4KUMA 2E1CA 1WQ2A 4GO1A 2EK5A 3WGHA 3J7AO 2KIFA 4E70A 5JR3A 1O3RA 3R6SA 1UB9A 1G3YA 4IRHA 5L3GA 2K7LA 3BJ6A 1P4XA 1BC7C 2HDCA 1IN5A 3BOQA 5HOOA 1FWZA 3ML6A 1IXCA 5HS9A 1T6SA 2DLLA 5E20A 2HWVA 4ZZLA 2CYYA 5FB2A 1VTNC 2EB7A 3HRUA 3E3VA 1XDSA 5L3EA 1XCBA 2GZWA 1JHFA 2WTEA 2EFWA 1IXRC 2H6BA 1HKSA 2HS5A 4YIFA 1W5SA 1P4AA 2Q8KA 2P7VB 2E7WA 4EM2A 1R5GA 4Q4ZF 1U2WA 2W24A 2X0LA 2DO7A 4WXHA 4MQ9F 3CTAA 1FPQA 3O6BB 4M72A 4HOBA 3OOPA 3CUQB 3AAFA 4AD9A 4NQWA 4LMYA 3L09A 2EV5A 2GIVA 4MTDA 3IRQA 4EJVA 1G3SA 2ZCWA 3H3UA 4UUVA 1QGPA 1HQCA 5KVRA 3WU1B 3N97A 3GO5A 1XB4A 3V7RA 3KLNA 3E6BA 3J81Z 2Z33A 1JXSA 2OQRA 4LD5A 1PP8F 5E1WA 4PCQA 5FO5A 4BYYA 3H3ZA 2JRTA 3V8JA 2HYFA 2WWYA 1KA8A 2GXBA 3O3KA 1TQIA 2L4MA 1RZ4A 2XAGA 1YS6A 1R5HA 3W7XA 1J59A 5EEGA 5AIPA 4OIPF 3VOEA 3RJPA 2UZKA 4LB5A 4I01A 2PBIA 3FF5A 1FNNA 1KU9A 2OQGA 3KP3A 4R79A 3HRSA 4YFNF 3ZN1A 2UWMA 3J80Z 4Y13A 4YFKF 2Z9OA 4I98B 2IVMA 3TO9A 2ZMEA 2O8XA 2GAUA 1G4DA 3C3WA 3MFKA 1P4WA 4G9YA 3WU0A 5FD5A 3DKWA 3GX4X 3I54A 3W6JB 3O2PE 2AS5F 2YX4A 4A0ZA 5IT3A 3W7TA 3FZVA 3E35A 4Z2YA 3BJOA 1Y0UA 4ASNA 3FMQA 4XSXF 1YTFB 1Z91A 4ZH4F 2O03A 2DPUA 4ZZDA 1IF1A 1TQPA 1D3YA 2A3SA 1MD0A 5ED4A 1Z6TA 2GA2A 1P2FA 3BWGA 4GXOA 2B0LA 1KU3A 2HFHA 2RNJA 2EA4A 1TTYA 1ON1A 2A6HF 1USSA 1XSXA 1TNTA 2XHKA 5GW7A 1HBXG 1ZHFA 2LF8A 3IKTA 4RS8A 4ON0A 2XIGA 6PAXA 1P92A 2CFXA 3J81K 3ISPA 1ULYA 1ZG5A 1F4KA 4LK0F 3SZTA 4FX0A 3SZPA 2VOPA 1RUOA 3KP4A 2Y48A 3DPTA 1TNSA 5DDGA 1J5YA 2EJRA 4M74A 1FT9A 2Y75A 1S6LA 3ZP5A 1U8RA 3DV8A 5E18F 1U6GA 3R4KA 3C18A 2V9VA 3ZMDA 2YSRA 3GLXA 1OYWA 5J8FA 4MGRA 2IW5A 4MNUA 1SD6A 4U88A 4OMYA 2A69F 5J6XA 3KEQA 2Q0OA 3W7UA 3I53A 3E97A 3BPVA 2HTSA 4IRGA 4KIBA 5DCMB 1RIOH 3KZZA 3V7CA 1U5TC 1SFEA 2MH2A 1LVAA 2A6EF 3GUDA 2IT0A 5ERIA 1MDMA 2J5PA 4PDKA 1XSVA 3GZ6A 1KGSA 5CVVA 2L01A 4M9XA 2K02A 1LDDA 2PQ8A 3SHFA 3KFWX 4G8XA 4U0YA 4IF4A 1OYYA 2JPCA 1WSUA 5LGNA 4M6XA 2DTRA 1FSEA 2P5LC 1SFXA 1XGSA 2PG4A 1FYKA 2FMLA 1XDUA 2XASA 1PUEE 2M30A 5EEHA 3QRFF 4AIHA 3WG9A 3EDPA 5LBQA 1Q1HA 2KIUA 2E1NA 4UV9A 4GCVA 3TDZC 2W57A 2STWA 1SD4A 2F5CA 4L0YB 2PMUA 3WODF 1HW5A 3P7NA 3LAPA 4EM1A 1YIOA 1SD5A 1Z7UA 3F22A 2A5YB 1IUYA 3M7GA 1TW3A 2RV8A 3CDHA 3KE2A 5DCFA 2EFNA 3LQQA 4AIKA 1BI0A 5D5VB 1SFUA 3VEPA 1FBQA 5K5RA 5FLXK 1NVPB 3K2ZA 4JQFA 4DQ2A 4ESBA 2V1XA 3Q5FA 2V1UA 4I7HA 4EGYA 3F6VA 1G3TA 3I59A 2BEOA 1IRFA 2YR2A 3R60A 2W84A 2ZXJA 1WWXA 3SFZA 4BHBA 3WTXC 1KQ9A 1QO0D 4B8XA 4MQVA 4P96A 5DYMA 3KZYA 4KT5C 4AIJA 3T0YA 3GFIA 3HHGA 4LB6B 4L5JA 3K0LA 1V3FA 2F2EA 3MAJA 1TLHB 5ILVA 3RKWA 3R0JA 4CICA 1O7LA 4HV6A 4DNCA 3WGGA 4WF2A 2K4BA 4A0YA 4JK1X 2OZUA 2QUFA 4H0EA 4OOIA 2XKOA 1QPMA 4OU0A 1REPC 3E5UA 3KP5A 1D8JA 2PLYA 1XMKA 2FQ3A 2VC1A 3Q9SA 4LLLA 2V79A 1MDMB 4L9JA 2M1BA 2QVOA 2QQ9A 3LQRA 3QOPA 2P90A 2PN6A 3HRTA 5KK1A 2VOOA 5D5XB 4A2UA 2GA1A 5BMZA 4RGXA 3D0SA 2OU2A 3GFLA 3RIRA 4IPAA 3HOTA 4U7DA 1RNLA 1ZARA 2ISYA 2QWWA 1MJ9A 4A5MA 2ZNZA 2FNPA 4AWXB 1DP7P 1IW7F 1LEAA 4Y15A 1CF7B 4L9VA 5LHHA 1DDNA 1R36A 3D3IA 4M9SA 1YW8A 3U1DA 1KYZA 3K69A 1ZG3A 2UXXA 1J9IA 4HX7A 4RB3C 1EV7A 3RKXA 4RB2C 4L0ZB 4LJZF 5D5WB 1R22A 3KP6A 1FBUA 3LA2A 5BOXA 4HDUA 1L0OC 5HDNA 4LG0B 3L7WA 1QBJA 4ENJA 2PJPA 2BGCA 1ZREA 4OIQF 5CVJA 1QQIA 3Q9VA 2ZNYA 3N4MA 4CXFA 4XLNF 4RAYA 2EFPA 1BBYA 1IRGA 3BY6A 4EJOA 4WX9A 3ZMUA 2F5FA 3FHZA 2VBXA 3HHHA 2ADUA 3DF8A 1QNTA 2RKHA 3WTUC 1EH8A 5AIQA 2CGPA 3OV8A 1IXSB 1W5TA 5DD8A 4B09A 2NNYA 4HLXA 3PFIA 3WTSC 4HF2A 3I59B 4K2EA 5L3FA 4Q5SF 2VE9A 2COMA 5LGTA 2KJCA 5LRRA 1ZLKA 1SAXA 3CO6C 2OA4A 3F8MA 3I4PA 1J2XA 2M8EA 2ZFWA 4A6DA 1FSHA 4MHGA 1A04A 3ULQB 3D5LA 3EUHA 2XRNA 2DK5A 2G7UA 3PQKA 2AXLA 1O3QA 3TOBA 1R1VA 4KMUX 2MLGA 1W4MA 2FBIA 3BP8A 3ZMSA 4HAMA 2K4JA 2NYXA 1RUNA 1YS7A 3GEZA 1R58A 5F6FA 2XAHA 1FOKA 4FX4A 3BROA 2QM3A 5TJJA 1B9MA 2ESHA 1C0WA 1ZLJA 1S7OA 3W7WA 3P9CA 1UCRA 1RM1C 1IAWA 5H6RA 2LF7A 2P4WA 3B73A 2LNBA 3P9KA 3F21A 3IC7A 5DV5A 4LLNA 3DP7A 4MEYF 3S2WA 3QU6A 3JSOA 4UNOA 2FXAA 1B9NA 2FBHA 1D8KA 1CF7A 2DI3A 1DUXC 3HSEA 3ELKA 4BNCA 2K86A 1CGPA 2HQRA 2KKOA 3WTWC 2HGCA 3DFGA 4UVBA 4S04A 4L9TA 2R3SA 3GFMA 2FEZA 2Y0MA 3G73A 3DPLC 1LDJA
chains in the Genus database with same CATH superfamily
5ITZA 1V55H 2X85A 3HKCB 4I2OA 1WN7A 4FJCC 2XB5A 5DUIA 4FASD 1KP3A 2PI0A 2XAJA 1EN6A 2R72A 4LF7B 2DMXA 4PDRA 2FOKA 4LG0A 2DCEA 3DKXA 5E8IA 1T38A 5GADJ 1I5ZA 3HOXJ 1FIAA 5EF6A 3QU3A 2E7XA 3IRRA 1K5QA 4PI2A 3RQ4A 4O4JB 2XUBA 3EETA 3V4GA 1V54H 4IQJA 4DV4B 1F4NA 2CH7A 1POGA 2ZJQF 3E7LA 1YJNV 4DR7B 2O0YA 4FFBA 3TCUA 5LFAA 3VB2A 3FXQA 4BHCA 4CDGA 1AWCA 2O6GE 1Y8QB 2WBMA 5M5XJ 3JATB 3OL4A 3OEHG 2R7TA 1STZA 3M07A 1N0NA 2JGUA 5LOVB 5LMNB 4AM3A 2QEXV 1NR1A 2HFEC 3ETEA 3OIOA 2H09A 3EYYA 3ZHUA 2DFEA 1ETKA 2KLOA 1I6XA 3IV5A 2DT6A 2LREA 5J1YA 2IEKA 3HOUJ 1YTYA 4G7ZF 2Q7GA 4RGSA 3TKYA 5DM6F 4KA4A 1BJAA 3CB2A 4BDZA 3M7MX 3G71V 1VZ0A 3H92A 2D1VA 2KPMA 2NNNA 1QZYA 3LSKA 2A6TA 5TGTA 1K7DA 2WLNA 4XLPF 3K57A 1LEBA 4DZJA 3CJNA 2DDBA 2TCTA 1OCRH 3FX3A 3CCQI 3F5WC 2Q9LA 4PELA 4DBRA 4BXUA 1WJDA 4JZGA 1TP4A 1GTOA 4YJ2B 5A9GA 3ASOC 1RM1B 2HHHO 2OF7A 2A06H 2F4OB 1RI7A 3JSPA 1UHSA 2N05A 4U0WA 3W6KB 3A2FA 1FIPA 3LSHA 1KYWA 2IA0A 4U0VA 3TQNA 3HTUA 2Q69A 2XB0X 4O4IA 2H6CA 3CDLA 1SQPH 4HX8A 3I58A 1ODDA 3ZRWA 4LOCA 5IP9J 2L3DA 3L9FA 3KCYA 4XQFA 4BQAA 2FU4A 1S5LC 4UUTA 1W1WE 3NRVA 1I5YA 3A03A 3WTVC 1R73A 3S3XA 3LDEA 2EIKH 1S76D 4E7SA 2M5WA 1E3HA 4JX4A 1I6HJ 2LG4A 1T56A 4WF9V 2EZKA 1OISA 3O9OA 2ICWG 4N4NB 4A3GJ 1X4TA 1MH3A 3OMNB 3ROUA 4DZPA 2HVKC 3CUQC 2EINH 3HPLC 4G6DA 4GX5A 1MMMA 1PJRA 2JUCA 4UB6C 5KUKA 4M71A 2W00A 2KZGA 4KFCA 1JJ6C 4TOIA 4CSWA 3K4JA 2H1KA 5E1XA 3W3CA 3ZHRA 1OQYA 4RQEA 3PQJA 4UB8C 3P30A 4A3CJ 1R6NA 1JGGA 2HDDA 2XVCA 2ZJRF 2ZKOA 3ZHVA 2P0WA 4I50A 1AROP 2NR5A 3CDIA 1Z05A 3H1CA 3L2RA 4HLYA 5LHGA 3DSQA 4PJLA 5KHKA 2HYGD 1I3AA 1JJ2U 3GFJA 4RB1A 4NC7A 2UUCB 3ZCCA 4G7HF 1EZJA 5FFZA 4DV3B 5IPAA 5CA3A 3K5LA 2IA1A 2LJ2A 1SESA 4E2LA 2RGVA 3AG3H 4EEQA 4HV5A 3VYRB 3K9TA 4I0BA 5D8KB 1XTAA 1EN4A 2UXDB 1WFXA 4CZZA 2O8KA 1QU3A 2R9IA 3ZR8X 1GUUA 3QO8A 4J00A 3M8EA 3N2GB 2P8TA 2V7FA 2KKWA 3G4SV 4W4LA 4LGWA 4KN7X 2DJVA 4I0AA 1HR0B 1KKCA 2OCHA 2EIMB 3ZRSA 2RVCA 1KB9F 1UFMA 5CVIA 3K08A 5GAEJ 2QQ8A 1FLIA 1D1BA 3VQVA 1H8HG 1VQOI 4UVCA 3RQIA 2IXSA 4JYKA 1RC9A 2ELHA 3KYDB 3DEUA 2PTMA 3K59A 4JI2O 2N8GA 2UV1A 1OPCA 1YF2A 3RPUA 2NLJC 3H1IH 3LSMA 3BTLA 4R1HA 4DV6O 2LFRA 3OYGA 3GXOA 5D6EA 2QEXI 3M1EA 2PJRA 1SA0A 4Z1VA 5DTDA 2NOJB 1V54C 3ZPLA 2M87A 1DQUA 2E5ZA 2VBZA 3K4NA 4DYRA 3F23A 3EYIA 2QKSA 3EFFK 3ETQA 2PFBA 1ONVA 1QRYA 2BW3A 1AKHA 3ECHA 3B77A 2CQNA 2MABA 3BDDA 5L3DA 5FKOA 2R7ZJ 3CRCA 1BQ0A 4CH5A 1B59A 3QP6A 2QQBA 1U8BA 5IYZA 3OYBA 3FWEA 1J75A 2R5ZA 4TUYB 2L9SA 1XX5A 3K1PA 3PM1A 4O4LA 4X1KA 3K0DA 3DC5A 3S8PA 4L5EA 3OYEA 2LKPA 1HDDC 3PJSK 4HF1A 3FXKA 2XTAA 3JRHA 1XUQA 4MVUA 4U3JA 3CO7C 2ZCEA 1ZELA 2FF4A 1GN2A 2EIMH 3L2WA 4QE9A 2EV6A 4KMFA 1JKQC 3K4KA 2WLJA 3FM3A 3Q4HB 2XOKG 4UB8Z 3LA7A 1JQ0A 2AZ2A 2ARHA 4EV0A 1PL0A 3QYFA 2DPDA 2DWEC 3FKJA 4UCOA 4DV2O 4ZYHA 1PYVA 3HR0A 2GM4A 5JVGF 5J9PC 3QPTA 3CCEV 4JI3B 1S3JA 1VQPI 2IJIA 1YJWI 1KQ0A 4BXXJ 3E2EA 1TWHJ 4BEHB 2VQGA 3DC6A 4K35A 1ETOA 3LFKA 1GVJA 1BOBA 5HLHA 2F5VA 2L54A 1T8IA 1VQLI 1QA6A 5TISC 4DV0O 1R1UA 1VF9A 2IBDA 3IAS2 4I09A 4XOTA 5E8GA 5F64A 4B44A 4EQQA 5IT9Z 3HXLA 3CUOA 1TBXA 1GLNA 2ZJ2A 3FB7C 3VQYA 2EA2A 1E79G 2ZE6A 3GWOA 4OMZA 5DECA 4DUZB 5EZGA 3I64A 4D5CA 3RZDJ 4IHTA 4YY3B 2QSGX 4Q48A 4XKBA 5LP6A 1AP6A 1M57C 1XGNA 2CTPA 2FD5A 1VQ6V 5EK0A 1BI3A 5EG0B 4UY8I 4GYIA 1QZZA 2UXCB 3GYHX 2X1DA 3M3YJ 1CEZA 4B47A 4FLZA 2F48A 2WB1A 2WA3A 3HKCA 2VQFB 1PP9H 3MD2A 3CCUI 2MH9A 4GRIA 3J80K 1XSDA 2KP6A 1B04A 2GBOA 2ZINA 4DR3B 1IBLO 4YG2F 4GKJB 1TAEA 1Q43A 4TV7A 5B1AC 1LQ1A 4DUYO 2JPBA 1SFKA 4P5OA 1DGWY 2GLOA 4O4JA 3T8RA 4N9HA 4NHJA 4DRXA 1W0UA 3HIFA 3GTLJ 2BZTA 2D1HA 4MW8A 2CGOA 3HEFA 3P32A 1VI0A 3QYBA 1Z9CA 2LFBA 1R5ID 4PGGA 2Z5UA 3CCYA 5LEJA 3CJHA 1NT2B 3C7JA 2IS6A 2R7XA 2LLKA 2LY1A 3OYAA 1N36B 4E7HA 2O7OA 4KN4X 4XN3A 2FBKA 4IZZA 5KMGA 3S1MJ 4B3RO 4EFBA 1G3WA 3LUTB 3BVOA 1ZGAA 4PK4A 1MIJA 5A2QK 2O61A 1JJOA 2QTOA 4H13B 5EZYA 4O6JA 1WZ2A 4GYGA 4RQFA 2YPRA 1I27A 2A7WA 3MZHA 1J7KA 2M0MA 2W6IG 3N05A 3FHNA 1QLEC 5J2UA 4I9QA 4V2FA 2F5EA 1O9HA 2QA4V 1BQZA 2DQRA 4OIRF 2GWRA 5J1RA 5IJ0B 3PSFA 4DR6B 1IRZA 4E7KA 1D2DA 4I02A 3MQ0A 1XMXA 1KMIZ 1ZH5A 3SPHA 2QE7G 3ZHQA 1VQ7V 2FL4A 2UXBO 2QYOA 1OCCC 3M9AA 2HTJA 1JTXA 1PP7U 3COAC 1FP1D 2LVSA 5D5UB 1YFHA 1AJQA 1TVKA 4LK1F 5J8CA 3H1KH 1M57B 2BY2A 4JI6B 1XNRO 1N4CA 2GXGA 2R7FA 3FXMA 4Y17A 2O3FA 2PMHA 2QM4A 3ZS8C 3CCSV 4TV8B 4ZYDA 3T8TA 2CO5A 3A02A 2QR4A 1RESA 1BE3H 4CGZA 2HZTA 3HSFA 4R8HA 2L02A 1VQPV 1B1BA 1K78A 3RKQA 2WAMA 3C1DA 3CQZJ 4PJNA 1DPRA 1FOWA 2JT1A 2CG4A 2BTOA 4Q20A 2VT3A 2MLKA 1DF5A 1ZRFA 1Q1VA 3H1HH 1ETWA 3TGUH 2VE8A 2JRMA 4IJAA 3EUKL 4CCOA 2BV6A 5K7ZA 1O57A 2DAOA 2VXZA 3CCVV 2FSWA 2VJ5A 4BHPA 2CQ7A 9ANTA 4U7NA 1IDSA 3F7VC 2BBYA 2DK8A 3I56V 3NEUA 4B3AA 2M2EA 3GVAA 1F23A 3ZQQA 3TO7A 1BJZA 1DU0A 3T2MA 4O2AA 4A6EA 1NK2P 4CS2A 1WPKA 3AG2H 3E5XA 1MOFA 2Q0OC 1R00A 3TXSA 2IP2A 1YW7A 1AP5A 3JAWA 3JSLA 3VYSB 1A6QA 1QVFU 4A3EJ 3SR2C 1VQOV 5EBMC 3OEEG 3BAAA 2D45A 2QTSA 2EFQA 1XL4A 2NVXJ 2OCCH 4FHTA 5TRDA 3NWSA 5H20A 3H5AA 4PHZA 1IBMO 2HU9A 4BQQA 4NC8A 5IT9K 1ZAOA 2A68F 4X1EA 1FPOA 2XV4S 5CQGA 2MSYA 3DEWA 1T39A 3BR5A 5CJ9A 3ABTA 1V54B 2QWNB 3LDDA 5EBWC 3ZX6A 1D5AA 3GW2A 1D5YA 1MJAA 2DT5A 2G9WA 4IRIA 3JCUZ 3ZJZA 3K1NA 2HR3A 2C6YA 4GX0A 4FLTA 2JTVA 2CQKA 4N23A 1Z7LA 1HNXB 3GCMA 3I55I 3GF2A 5HLIA 3T5XA 3KX2A 1BMFG 1ZG1A 2DMNA 1XHXA 4MT8A 3HG9A 1JI8A 2EV0A 1YJNI 1D5VA 1XS9A 2EBIA 1QR9A 2F5DA 3EHBB 3CCRV 4CYDA 1G59A 5IYBO 3TO6A 4U7BA 3OWTA 3ZMZA 4ZOLA 1S8NA 2WAFA 5LRSA 4N9IA 3HKZN 2Q8VA 2KIMA 3DBRB 1GXQA 3IHUA 2WADA 5GONB 4IVNA 4XLAA 5FKNA 5L3BA 1KQ8A 3QO5A 4KICA 5HVQC 2ZR3A 4Q47A 3WE3A 3UT5B 2DYRC 3FXLA 4JYYA 3CPWU 4EJUA 2A61A 3B6CA 1U96A 1XDCA 3WE2A 5IDJA 4FM0A 1K73W 2ZNIA 2R5ZB 2L4AA 4TUYA 3IGAC 4Z6YA 4NYKA 3I55V 4XIDA 2KSDA 4DR4O 5FLXN 4F93B 4HNTA 3GTOJ 1CQTA 4LIVA 4LIUA 4UVAA 2BHZA 2QKLB 3APOA 2RC4A 3S3OA 4GFBA 2HVJC 3KYCB 1O3SA 1NI8A 3N2KB 1B8IA 1FYLA 2ZBKA 3OOUA 3HSRA 4GKKB 4IKFA 4B4CA 1GN4A 3FD9A 1B6AA 1X1DA 1SMTA 1QHHD 2ME0A 5A2QZ 4U7OA 1JJ8C 3T1HO 3IH4A 1Z5WA 2FE3A 3PNYA 4Q6GA 3B02A 3DXRA 5GPAA 1ZKGA 2FRHA 2EINC 1W36C 2NVTJ 4CA0A 3H0GJ 1S29A 3APQA 1R71A 4HEA2 2UUBO 1H9GA 2NS0A 4EVIA 3RN4A 3G1MA 5CYVA 1R49A 2XKPA 4A0XA 1ORQC 2GV9A 3ZQIA 4P9UA 3ABMC 3D36C 2MW8A 3VDXA 4O4HB 4XORA 1H0MA 4RGRA 4EJWA 3FK7A 3LSQA 3E8GA 5JH7B 4HA8A 2DOSA 1HLVA 1NG7A 5LLQA 4WCGA 1OCPA 1P7GA 1R3IC 4B3MO 3MDSA 1U9OA 3I3LA 4KDPA 1FXHA 2JRIA 5GAGJ 1LE8B 4YRVA 2LC2A 1HNXO 3P9IA 4TQDA 1OKRA 1QQCA 1SZTA 1WB7A 3I5UA 2WLIA 4R50A 3DTKA 1PNMA 2MBFA 2Z3YA 4ESJA 2IRFG 2DFIA 3J80N 2H27A 2Y0PA 2OPTA 3QPSA 4B08A 5JCOC 3CMAI 4TQFA 4DUZO 2PMZN 3BG5A 1EH6A 4RAZA 4DR5O 1BI2A 1XGMA 1U5TA 3RYPA 5E3LA 3WTYC 1YO5C 2ETHA 1LB2A 2W25A 4A5NA 3ASNC 4JYAB 3HB3B 2YXYA 4OAYA 1N32O 2DOAA 2XHBA 1HXDA 3LNQA 1IBMB 3I71A 1K79A 2CW0F 5IYDJ 3K5NA 4HF0A 5EZHA 4MLOA 1HW2A 2LMDA 3JRDA 2QM8A 2E1MC 5EIBD 3D3QA 4DR1B 2X1EA 1M4UA 3JARA 3AG2B 1W7PB 3DU6A 5EIBC 3SYOA 4CH6A 2HOEA 3KPHA 4RAIA 4ZHQB 3SQNA 5EDNA 2P4KA 2LBFA 3VOUA 4EGZA 1F36A 3IL2A 3RYHA 2DA3A 1QVUA 2IGMA 1LNWA 3T4DA 1QNMA 1D0XA 1CP9A 4PA3A 1WLEA 4MTEA 2A0LA 2Q68A 3IJ4A 5E17F 2OBPA 2HQ5A 2ZIMA 3OS2A 3TXQA 2K9MA 3RSNA 2RQ6A 2ZT9B 5EZYB 4WXCA 4YFXF 1HW7A 4FIPC 1PUFB 5GP9A 3S14J 1G6UA 4BAYA 2XROA 1IXBA 1GAXA 4IT5A 3LSUA 5C4XJ 2EFOA 1WJZA 5LP6C 2MW2B 3UKGA 2JK3A 4AVPA 2F1MA 2QKCA 3AK3A 5CVUA 3QQAA 1IV6A 4W97A 3EPZA 4NB5A 3RPUD 5K1YA 1JE8A 3L2CA 4HG2A 2X6BA 3JALA 5KNLA 3QTCA 4L5IA 3K4BA 2A05A 5LHIA 3F8NA 2DT7B 2E60A 2RDPA 3OE7G 1LDKB 1TVKB 4GUNA 3K4LA 3GTMJ 5CBHA 4OX9O 3DXJF 2E35A 4KITB 2YUSA 2FX0A 4EMSA 2KL4A 1AHDP 3ABUA 3S17J 1O4XA 3JREA 4KJZA 1FTTA 3OM3B 4DV7B 1NG6A 5F27A 3RPQA 1S5JA 1SQXH 5FLVA 1BHAA 2CSOA 4AIDA 4IHJB 3SXYA 4WFAV 3UNGC 2DYRH 2IM9A 1OMIA 1WKMA 2QSFX 3IKVA 1K78B 5D4RA 1AOYA 5HLTA 4IOCF 5JVTA 1NJIW 4IXAA 3E22B 4BUPA 1M1EB 2CUFA 2W48A 5L3CA 4QWQA 2BE3A 1HKQA 2QM7A 2ISZA 4II3A 3H01A 5LEKA 5GTHC 3JTHA 4FCYA 3SJAC 5BR8B 1IRXA 2IS2A 4KYWA 1D0YA 1NHAA 3U2RA 1BA5A 4BIOA 3BTJA 3PO2J 1I39A 1YEWA 4QSHA 2YI9A 4LFAO 1M56B 2P7CB 1MGTA 3ECOA 1IN8A 4KHPB 3UO3A 1H9TA 3S3MA 1K7AA 2DYRB 1UHWA 1IGNA 3IUOA 4DV2B 3CHXA 3LSTA 1B4AA 2MC3A 1OCOH 3JAWB 5ICGA 1MJBA 3MCZA 4CZCA 3WGIA 3I0TA 3CC2I 3QP5A 1IXMA 4PJ0Z 1JUSA 1T33A 1IDYA 5F08A 4ETSA 4CUGA 1EM1A 5IY5H 4WFFA 5K5QA 1X3UA 2H1LA 3M1CA 4U87A 3WTZA 1TZLA 2LKXA 4IOAF 4LCUC 1KBHA 3I5DA 3V8LA 4OPAA 3E6DA 3C90A 2GUZB 4I99C 5HNFA 1T98A 3W6VA 3ZRXA 5AONA 5E3MA 3OS0A 3OAAG 1ITYA 4IHXA 4UUSB 4V2GA 3CYOA 5EC1C 3REOA 5BQTA 2M4GA 3AG4C 1LKXA 5B3SH 3CS5A 5CBFA 1BM9A 2JUGA 4LG3A 5HS8A 2QBYB 3IWZA 3LSGA 2FOWA 2HEPA 4FISA 5DUKA 2NAZA 4NNJA 1J09A 2VN2A 4B3XA 1Y1WJ 2NVQJ 4DR2O 4FLYA 4JYAO 2IGOA 1VFCA 1WCMJ 3R0AA 3CSXA 1J0RA 4R8CA 1IN7A 3ZMVA 4YJ2A 1YE9A 5CB4A 2BYVE 2YS8A 1FY7A 4RLFA 1RR7A 5IYCO 3PL8A 1T2KA 1X3WB 5FFXA 1YW9A 3TMOA 2A3QA 4I0XB 1I3QJ 3SDGA 3ZOBA 3JAMZ 4BE2A 2Y31A 5BS6A 4IGGA 2XDVA 1MNMC 4O4IB 3L72H 2PEXA 5GONA 2UUZA 3O8HA 4LF7O 3E5QA 3AL0C 4TT3G 2H8PC 5J4YA 3JD0A 3OGIB 5E79C 4RB0A 1QCEA 3ABLC 2QLZA 2ID3A 3BRCA 4FZ0A 4A3BJ 3ERED 4FLUA 2VQHA 2FA5A 1T95A 4XLEA 5FGMA 2V1DA 4C3HJ 4H37A 4FTHA 4HZFA 1ZYRF 1WJCA 4PGHA 4FT8A 2UXDO 4HDVA 3LMMA 1JKRC 5GTHZ 2BOLA 1KONA 3S3NA 1PPJH 3ZN0A 1THZA 4RBOA 1FZPB 2ZDIC 1SF9A 2RQPA 1JT6A 3V7SA 3N2KA 2OCCC 2XF6A 1L3LA 1FYMA 5HNHA 2OT5A 2YIDA 3K7AJ 1PNKA 5KX5A 4RWUA 2CJJA 2RNGA 2ZDIA 1ZN2A 1U78A 4Z1MG 1US6A 1BR1A 5FKLA 3CJRB 4QLCU 4X20B 4DW1A 2P5OA 4B3SO 2DOEA 3DXRB 3ZEDA 1ERDA 2AZ0A 2Y69H 4I50B 4X8AA 1P6RA 1Y66A 3UKMA 3DBHB 3FBIB 3SYCA 4ZKIA 2B9SA 3J7AY 5JHFA 3BFRA 2DBBA 5CQEA 4F3QA 4ZTJA 1ZWIC 4DR7O 1X4OA 1IZ1A 1YLFA 4C2MJ 1AJNA 3OGCC 4O4HA 3BEHA 2O5RA 2RN7A 1A35A 1WPXA 1R1TA 2ILMA 4QIWN 3JAMN 3BCCH 1YYVA 3K03A 3BZCA 1MKMA 2XAQA 4GGGA 4P9FA 1ETYA 2HPMA 4A3IJ 2H8RA 5ILSA 4X1YA 5K1XA 1HNZB 3A0BC 1RSOB 2RCVA 5ICCA 4BJ5C 1KU2A 3CUQA 1YIJV 4BQNA 1TW2A 4WK8F 2KQXA 1BIAA 1LE8A 1T0FC 4NTXA 1O3TA 5HFMA 3HYIA 4P9OA 4X65O 2W6JG 2Q67A 4FFKA 2WLIB 1JX9A 4YIPA 5C8YA 3MZ8A 3E8FA 4DW0A 3F3XA 3I56I 2JVHA 3WTTC 4CCNA 3W7SA 1N36O 1HNWB 1F7YA 4D7NA 3BZ6A 3FBNB 5JFRA 4WBNB 1IO2A 2P5VA 3LNMB 3ZMTA 1E1RG 1U5TB 5BPIA 2QSHX 1JHHA 1OCRC 1D0ZA 1R23A 1U0JA 2DTZA 3HUGA 3VYUB 5HODA 2R92J 5CVRA 3G3ZA 1HKTA 5D6FA 3CWBH 5JJJB 3PUFA 2PJRB 1SA0B 4RGUA 1FYJA 1GXPA 3MAQA 4BJ6C 3RKYA 1UMQA 2X6WA 4MS2A 4WCEV 5J2TA 1W7PA 2WV0A 4F92B 2VWJA 2VC0A 2VODA 1SD7A 3B2EE 2B1GA 5IYZB 4XN0A 1FXKC 3OYJA 2FMYA 1E2XA 4X9QA 5B1BB 1NH2B 2XGCA 2K1EA 1S5HC 2LSOA 3F9KA 1FBSA 2WAEA 4KNYA 3H9VA 1UELB 2ELJA 4JZ2A 5LYJA 1J5EB 3KETA 1GHCA 1FKAO 3LA3A 4ZYEA 4XICA 3K1MA 1VQ5I 2M45A 3LWFA 3HTSB 3BR3A 2ODMA 1G8MA 1Z77A 3TEDA 4ENMA 1L8DA 3A0HZ 4NDLA 4WWCA 4J80A 4MVZA 3F0CA 1N32B 1SVOA 4D5FA 2VJ4A 3K4CA 2CGNA 4HNUA 3GVMA 3QVNA 3PO3J 4XBFA 1B3QA 4DV4O 3FYIB 2IPQX 1R7JA 3BJAA 3KP7A 4FLVA 4KP4A 4PA9A 1O9GA 2W4SA 1KU7A 1KD1W 3J7AU 2Q2EB 1HDJA 3TGNA 1UHMA 2P6JA 3OR1C 1PD3A 2P67A 1AR4A 2QSAA 4CC5A 4HQMA 3ZQHA 4HNVA 1JUMA 2DQ3A 3M4OJ 3VODA 1TWFJ 1YHQV 4IIJB 2R93J 3QPHA 2ZB9A 1K4TA 2JS3A 4LFCO 4EJTA 2EIKB 2DE0X 4BBRJ 1H2KA 2HHHB 4QPOA 1BN5A 1M5IA 2XGXA 4MFEA 1X1BA 4DYLA 1ENHA 2Z16A 2YU3A 3SYPA 1E1QG 3MN2A 3STLC 1XREA 2EJ7A 1Q5OA 4BH9A 4DYQA 1H89C 2Q7HA 3E22A 2XF5A 3E6CC 2ZE5A 3E0JB 4D7MA 3WHBA 2HI3A 4JI4O 4OINF 4JX5A 4A12A 1FJGO 3EQLF 1R4NB 3CESA 2ADPA 1HSTA 4GT1A 2OAZA 2CFOA 1F5TA 1YG2A 3HC7A 3ABMB 4KIGA 4PV1B 2ITDC 1DP3A 1LUJB 1GM9A 3U0ZA 3ZRVA 2UUAB 4EKWA 2CS3A 4G2KA 2OIEA 1MBEA 1I0HA 3OTOB 2R7SA 2F4VB 1SMYF 5ICEA 2L7KA 4J9YB 3BCBA 4TV9A 5LA6B 1YHQI 1F9NA 4GX2A 2LOOA 3H5RA 3H9QA 4DRXB 4AI8A 3MZYA 1BI1A 1ZR2A 2FKXA 3ZBHA 1BL0A 4HYEA 5DEQA 1SQBH 1YJ9I 3A0HC 3ASNH 4L9NA 3ZQ7A 3OYDA 3QWLA 3SFIA 2XC7A 1XQ8A 4MTFA 4XRFA 4B3RB 4KIFA 3S1RJ 1G2HA 4JV5O 2DOFA 4LFUA 4GYCB 2AQFA 2ZXWH 5KMGB 3E83A 4DYCA 4JV5B 2OWOA 2K5CA 3VPRA 1K4DC 1Z6RA 4PZJA 4UUSA 4M9ZA 3B8MA 4C9YA 2V4DA 3CC4V 3OSGA 1NH2D 3FXRA 5J2UB 4LLGF 2QQAA 2HKXA 1MBHA 2VLAA 1XHZA 2DODA 3IC9A 1JOYA 2QBYA 4BIZA 5IJ0A 1K92A 3JTGA 2K27A 2UU9O 2P5KA 2KB1A 3B40A 4HNAB 1NR7A 4BY1J 1JCHA 5E79Z 4A69C 2QZ8A 2DA7A 2NN4A 3BR6A 3JRGA 3KG2A 1ZLZA 2LGQA 4OGQB 3JCZA 1FJLA 2XSJC 4IHWA 3KEOA 1UJWB 5B5EZ 1HDPA 3WB1A 1FP2A 2A9HA 3KCCA 2HKOA 2LGWA 3GB7C 2ZM6B 1I1SA 3X2QH 1OCZH 2JJ7A 2K9PA 1MSEC 3FXJA 3AL0B 5B5EC 1HNWO 3AG3C 5JCOA 1BIBA 5H6QA 4S05A 4A3DJ 2LW1A 2OYQA 4Y4RA 4TWKA 2IH1C 1MNGA 1S72V 3U9GA 1LJ9A 1Q82W 2R5YA 5CA1B 2DA5A 2AGAA 3ABKH 3KZIC 1OCOC 1EJ9A 2YIBA 4CHUA 2D3OW 3L00A 3S93A 1VNDA 3O65A 2W82A 2DU9A 2R7UA 2NRAC 3KP2A 1LR1A 3DU5A 2BY3A 4CCMA 2E34A 5H2FC 1KYOF 5KX5B 1V4RA 3FMSA 4X65B 1VQLV 2Y4UA 5J3LA 4O2AB 4JI1O 2LY2A 3TW7A 1Y39A 1OCZB 2YICA 3PN1A 4X20A 1LFPA 3K5MA 3T1CA 2MYSA 3GTKJ 4JI8B 1WJFA 4NKGB 2L9NA 1E17A 2CQQA 2QDOA 2IU3A 1TUEB 2E5LB 2WC2A 3GZNB 3AG4H 1Q6UA 1WI9A 1Z1DA 2DJNA 4PUSA 2VBWA 2M7BA 3F72A 3GWZA 4X0GA 1BL8A 1MABG 3F7YC 5KAIZ 1EH7A 5J4VA 1V55C 2DMTA 1PDNC 1OLTA 1FC3A 2OUMA 5FD6A 3ML0A 5KHHA 3P5JA 1VQ4I 4KISA 1CXZB 4MIMA 1BCCH 5CLSA 4XDJA 1JT0A 2L7ZA 5JQGB 1USTA 1RSOA 4MSWC 1AA7A 1G6NA 4HW0A 1AILA 2OZ6A 2X6XA 4F55A 1IC8A 1BOAA 1Y76A 4ZBMA 4X62B 4K0KB 2W85A 4EM0B 1P4RA 3CMMA 3NR7A 1WVRA 1S9HA 4UXNA 5JJNB 4JOMA 4UHTA 2OJED 4XONA 3GTGJ 5C8YB 3IWFA 3MWMA 3CCMI 2A5WA 1M56C 4UCRA 3CLQA 4A3JJ 2R7DA 1N25A 1T0FA 1ZGJA 2FNAA 1WRJA 1VMGA 2BTQB 1XNQB 2CUJA 4XSZF 5IE9A 4FM2A 4YY3O 2VBYA 2FQ4A 5B66C 4D9JA 1RR8C 1DPUA 1K83J 4OIOF 1Q8IA 2EWNA 5JI6A 2H94A 1NTCA 3HUGB 3ZQCA 2STTA 2GHYA 1WAZA 1Z2GA 2DYSC 1JUPA 3WU2Z 2BVMA 4FLWA 2VKVA 1XD7A 1ZRDA 3NQOA 4G7OF 3JRFA 1JGSA 1FXVA 2DW4A 3M99B 2LR8A 1K8AW 3H3VK 3TETA 2L6LA 5J2TB 1MBJA 3G67A 4CCLA 4WXDA 3V8KA 3RVYA 3P3NA 5CPRB 2BXYA 2P6TA 2WLKA 5GTIC 5HLGA 1OR7A 4YELA 1MMGA 4ZYGA 1LPQA 4MEXF 2CV2A 3S1QJ 4II2A 1I1GA 4J11A 5KUMA 3SJBC 5HFLA 1FAFA 4KL1A 2D2WA 3G2BA 3G71I 1IZ3A 1ON2A 5F0HA 5LYJB 2UXNA 2ZXWC 1SQVH 2ZFUA 3HOSA 2UUCO 2XGDA 4O3MA 3SDLA 5ICFA 2ZO4A 1V5GA 3SPCA 4YIRX 3HOYJ 1F51A 2KQRA 3L2UA 1A6IA 2X4HA 5FROA 1B8IB 2Z99A 1SEUA 2JVDA 3K79A 4IHSA 2LQTA 1F1ZA 2Y2ZA 4GKJO 3EUAA 2OIGA 4BACA 4M73A 3CRMA 3CXHF 5DCMA 3HOZJ 3CRRA 2VJIA 2QENA 4G6QA 4CC6A 5FLXZ 1PKXA 3G6EI 5K5OA 2N74A 3VSKA 1X3ZB 5BPDA 1Z3YA 2O9LA 1J5EO 2KJBA 2Q2EA 1HSJA 3ABMH 5E1ZB 5J1UA 1TA8A 3CF2A 4A3KJ 1H2GA 4ENKA 2A07F 3CC7V 3GZ5A 2DQLA 2R7RA 3ASNB 2CMPA 5DD4A 3H0DA 4D0PA 1W2BU 4JAUA 1SQFA 1B72A 4ENNA 2VT2A 2AW9A 1TWGJ 3ETGA 2K9QA 3ERMA 3RI4A 5KA6A 1Q6IA 4MVOA 3HZJA 1VQ6I 1XPXA 3A0RA 3CF5F 4PDVA 4P55A 4ESFA 2LO1A 4NUBA 3MD0A 4NTWA 4DV6B 2JQ7A 1KQSU 2V6EA 3V42A 3L2QA 3RTRA 5C3EJ 1K6OA 4C3IJ 4NQWB 3BC8A 3L2VA 2CWEA 2VUMJ 2HQNA 3MKLA 4L18B 2ZMEC 4O5VA 2V6CA 2AHYA 4LFAB 3R61A 4AYBN 3UO2A 2Q4PA 2ACJA 4J19A 5E1AC 1BC8C 3TDUC 1YITI 2IJLA 3L73H 1WH5A 3RDIA 2VQEB 1GO3F 5D4SA 2IS1A 1ETVA 3TOAA 4CO8A 2Y9ZA 1NZ6A 2WAQN 4JPRA 4E4EA 1MBFA 1OR7C 4JBAA 3KKYA 3OYHA 2WLLA 1AJPA 3FM5A 5HDKA 1HW1A 4HBLA 2HP8A 2YXHA 3FMRA 3D5SC 4YIIA 1O7FA 2B63J 1R1BA 1HNZO 2NOGA 4CH7A 1N77A 3T1YB 3E86A 2TDXA 4MFDA 4N0BA 1RRJA 3S3WA 2P6SA 1XN7A 3JARB 2MA3A 4LF6O 3Q3SA 2HVQA 3JR9A 4ZHQA 3J81N 2I8DA 2KRFA 2LBFB 3OUSA 1I7FA 5KHJA 3RYHB 1WH7A 4F7ZA 2CTRA 5B66Z 2DMUA 3H1LH 5KA5A 4DBQA 3JW4A 4HX4A 1NKDA 2XGEA 4Z2WA 1MBGA 2E2JJ 5D5PA 1XMAA 2IA2A 4XM3A 1IN6A 3A1YA 4BBSJ 1MMNA 2YX7A 5IYBJ 3CD6I 1PUFA 2DN0A 2EPFA 2J5OA 5HDGA 1ETQA 3RVZA 3EUHC 2EULA 1ZRCA 1TQMA 3RYRA 5HS7A 2LDUA 3ZCOA 1G1XB 2R0QC 2VI6A 1RKWA 3VFZA 3QPLA 2GTSA 3JALB 2E5LO 4HNAA 1FX7A 2GQQA 5LGUA 2VRZA 4ZTFA 2CTQA 3E89A 2Q73A 2ZKZA 1K61A 3H9GA 3JD3A 4G12A 2DA6A 3S16J 3LAJA 2E76B 4JI7O 4YIOA 2HEOA 1YQAA 3JRBA 4J7ZA 4UFZA 5BR8O 3PUBA 2WA4A 2X6AA 2GXAA 4I7ZB 1W7PD 2K3FA 1IN4A 4IO9F 2JSCA 3F8BA 1YI2I 2XUMA 2I10A 1YRNA 1FOYA 5F1RA 4H44B 3OT7A 3JAMK 3UCSC 3WU2C 4G94A 4FE7A 4RLQA 1SANA 3OYMA 2ZNJA 2AHQA 3A8TA 3ZQLA 1QHTA 1MZBA 1U3EM 3BG3A 4M6YA 2VONA 1ACIA 1XGOA 1COWG 2MD5A 4GZRB 2VKEA 1YX3A 2ZMEB 5EGOB 3KLOA 2BVLA 1F43A 2R4GA 4DV3O 3HRMA 5D8LB 3FXUA 3OD4A 2XNDG 5JHUA 2OC6A 3F6OA 2E2IJ 3M8FA 1XC5A 2XAFA 4QTRA 3T1BA 3CLOA 3W2WA 5IYDO 2G7HA 1S7AA 3F8CA 1XCVA 3DWLE 4B7EA 4ZDLA 3SJMA 1TWAJ 1AR1B 2LYCA 3MEXA 4UV8A 1VQ9I 1VQKI 2R9AA 4LNUA 3QAHA 1AVMA 2OD5A 4QPKA 2JZYA 2JIZG 2YSUB 2F6CA 2LK2A 2VPRA 3CJQB 2BE5F 3DQVC 3A01A 2EZPA 4HQEA 3CRAA 5BY1A 3F8FA 3TBIA 2ESNA 1OYIA 3CCLI 3K9SA 3H1JH 4CS3A 5ILUA 1LUVA 2UUBB 1CPYA 3BPXA 3E6MA 2XAUA 2GUZA 2LRDA 4KUMA 2ZIOA 3KYLA 4M3DA 2E1CA 2WA0A 3HPHA 1GDTA 1WQ2A 3LSIA 4GO1A 2EK5A 4MVQA 3WGHA 3TK1A 3CCJI 3J7AO 2FYUH 1UPGA 2K9SA 4DK0A 2KIFA 4X88A 3HOVJ 4J7JA 2K9NA 1Y76B 3T1HB 3GBGA 1UG0A 4AILC 2WY8Q 1SC7A 4E70A 3O8GA 3QYEA 1ORKA 2ELKA 5JR3A 2BSKA 1O3RA 2BXZA 1YCIA 2ECBA 3R6SA 4IHVA 3J7YJ 1RP3B 1UB9A 3FFQA 5JVDA 1G3YA 4IRHA 5L3GA 2CV1A 1GM7A 1XOUA 2CDYA 2Y69C 2K7LA 2Z0AA 2AXTC 1V5EA 3BJ6A 1EA3A 2BTQA 1N34O 5CB4B 1BZKA 3P3PA 1P4XA 1BC7C 2HDCA 2OCEA 1ZL8B 4BE0A 1IN5A 1AI4A 3BOQA 4I0XA 5HOOA 1FWZA 5IWAB 3ML6A 2M8GX 4JP0A 4BXFA 3K70D 2IJJA 4FVMA 1IXCA 4XLCA 5HS9A 1VF6C 3IAM2 2Y0IA 3K70C 3ABLH 1VQ4V 1T6SA 4HPQA 1N33B 5TISZ 4MO7A 4TSFG 4K8XA 2DLLA 2QWOB 5E20A 3BHPA 4NXNO 2K3PA 4KT6A 5IYCJ 2HWVA 4ZZLA 5KHGA 2CYYA 5FB2A 2VKDA 1VTNC 3M8AA 3QG5A 2EB7A 2G38A 3HRUA 1P49A 2KFDA 4A5UB 3E3VA 4UB6Z 1XDSA 5L3EA 1XCBA 2GZWA 1JHFA 1Q7YW 2WTEA 2V9PA 2EFWA 2NVYJ 1IXRC 1VQ7I 1EBOA 2H6BA 4YHHB 2GTAA 3SYQA 5B1BC 1HKSA 4E7JA 4RM3A 3FYEB 2JWTA 3ETDA 2JEXA 3S32A 1GN6A 2PGGA 1YI2V 3CZ6A 3CRQA 2P4VA 2HS5A 4YIFA 2NNUA 4MTGA 1W5SA 1P4AA 5C93A 1MA1A 2Q8KA 4GCZA 1PNLA 1YIJI 1R4MB 1B6QA 4GKKO 2P7VB 2E7WA 1QBZA 4EM2A 1R5GA 4JI1B 4BIUA 3K6GA 2P06A 3U21A 2Y4TA 4Q4ZF 1U2WA 2W24A 2X0LA 3WG7B 2DO7A 4WXHA 2RDCA 4MVRA 4W4KA 3HB9A 2MD0A 3CX5F 4MQ9F 3CTAA 1H2NA 3OR7C 4LFBB 2VJJA 1B72B 5CKTA 2Z1DA 1FPQA 1QR8A 3O6BB 1VQ8V 4CS4A 4M72A 4XKVA 3K10A 1VEWA 2WAQA 3OMYA 4HOBA 4WFHA 4X1YB 4WFEA 3OOPA 2KIQA 3CUQB 1W0KG 5FPOA 3QF7A 4L87A 2KMUA 3AG2C 3RW0A 3FIWA 3AAFA 4AD9A 4NQWA 1VQMV 4LMYA 2ZM6O 5F0FA 3L09A 2EV5A 3H5NA 1KP2A 4JI4B 1FJGB 3ASOH 2CU7A 3WG7H 3RWRD 4BL0B 2GIVA 4MTDA 2WLMA 3CCUV 1RETA 3IRQA 4E6KG 1E3OC 3B09A 2QF7A 3BG7A 4EJVA 1G3SA 2ZCWA 4W1UA 4WBNA 3H3UA 1Y8RB 4UUVA 4DV1O 2P22C 1QGPA 3C2GA 4XRSG 1JKPC 2PYJA 3JASB 2WLLB 1HQCA 1BR2A 1Z67A 5KVRA 3WU1B 3N97A 3JD2A 3GO5A 1XB4A 3V7RA 3KLNA 1YSCA 4LFCB 1R6KA 4LF4O 3E6BA 3J81Z 5K7HA 1FXKB 2QGUA 2GBYA 2Z33A 4V19K 1JXSA 2OQRA 4LD5A 1PP8F 3ZRGA 5E1WA 3A2KA 1ROPA 5EC2C 4CH3A 2E71A 4PCQA 4YXWG 5FO5A 4BYYA 2P7TC 3H3ZA 4XRMA 1DK1A 3BR1A 2JRTA 3C2BA 5EBLC 5KHIA 1OCCB 3V8JA 1K4SA 3LSRA 1HOMA 4K8ZA 1MSWD 1XNRB 2F4MB 4I6ZA 2HYFA 2WWYA 3CCEI 3C3SA 3NWTA 1KA8A 2GXBA 3UR3C 3O3KA 5GPCA 2KDZA 1TQIA 2L4MA 1RZ4A 3E8BA 2ETNA 2XAGA 1SETA 2ZJPF 1YS6A 2F95B 1XILA 5LD2C 2DJIA 3GLLA 4HSTA 1R5HA 3BG9A 5GTIZ 1BHBA 1P7JA 3W7XA 4RDUA 1J59A 3FB5C 5EEGA 5AIPA 4OIPF 4XMYA 3VOEA 2CH0A 3RJPA 2UZKA 4LB5A 4I01A 1M93A 2M7WA 4G28B 5EYPA 4EFEA 4DJAA 1OCRB 2PBIA 1X59A 3FAVB 3FF5A 2E2HJ 3HKDA 1FNNA 2EIJB 3AG1C 4WFGA 1KU9A 2OQGA 3KP3A 1S5LZ 5IP7J 5M3FJ 1TGOA 2EILC 4F6RB 4R79A 2UUAO 2Y0SA 3HRSA 2F23A 3RYCB 4YFNF 3ZN1A 1MSDA 4OWRB 2UWMA 1GRJA 1YDXA 4IIJA 2DQ0A 2F43G 3J80Z 2NVUB 3OSFA 2EX3A 5B1AB 2R7OA 2QWRB 4Y13A 4YFKF 3JYCA 2Z9OA 5IY5C 1MH4A 2M7AA 4I98B 3A4CA 1X2MA 2IVMA 1MG1A 1NTZH 4I9WA 5B1OA 3TO9A 3L1PA 3PNTA 2ZMEA 2O8XA 5EGOA 1X1CA 2GAUA 1P7IA 1Z21A 1FD9A 1G4DA 3FK6A 2HLDG 1N75A 3KEYA 5DM6V 3C3WA 5JLWA 3MFKA 1P4WA 3OYCA 2ZSHB 4I5SA 2M34A 4G9YA 3WU0A 1LUWA 3CCJV 3UT5A 3S1NJ 4A3FJ 4M3EA 5EEAA 5FD5A 3DKWA 4UCSA 5EJCA 3L71H 5B3SB 3GX4X 3OYKA 1EZVH 4TV9B 4CCJA 3BQYA 1H2MA 3I54A 3W6JB 2JGDB 3QO7A 2E36A 4PSWA 5LA6A 2P81A 1VIBA 3O2PE 2AS5F 3OUFA 2YEVA 1WJ5A 3A01B 1OCZC 1YOVB 2YX4A 3CP2A 4A0ZA 1UFIA 2CTWA 4D7SA 5IT3A 3W7TA 4DW6A 3FZVA 3E35A 4IYIA 1JA8A 4DR2B 3PJRA 1ZUQA 1ENVA 4Z2YA 3BJOA 4B3SB 1E3PA 2M3AA 3LSPA 3ABKC 2W1OA 1Y0UA 4ASNA 1URFA 1MMSA 1OCOB 3FMQA 5CA0B 1Y6XA 1K9MW 3HGYA 3HKEB 4XSXF 1YTFB 4PA7A 2M4KA 2Z2SB 1Z91A 2KG7A 2W0XA 4ZH4F 2VKHA 2HQAA 2O03A 3VWBA 3D36A 2DPUA 4PI0A 4ZZDA 1IF1A 4JI0O 1TQPA 4F6EA 5CBGA 3BT9A 2BY1A 1N78A 1D3YA 2A3SA 1MD0A 2QCOA 2V9KA 1AI6A 2JDIG 5ED4A 2IAIA 5JWPA 5CN0A 1Z6TA 2GA2A 3B6AA 3WG7C 2H3OA 3CMEV 1W5CC 2AHZA 3SPIA 1JKOC 2QWPB 3G1OA 1W36D 1OV9A 3AK2A 3UM7A 2YIBD 1P2FA 5CMUA 3ONQA 3BWGA 2A79B 1IBKB 1MMDA 1WJBA 2L7FP 1ZL8A 4GXOA 3ABKB 2B0LA 5LXTB 5IJ9B 1KU3A 2KRHA 2HFHA 2DXIA 1Y74B 2RNJA 1TT5B 2MFZA 1TTYA 2EA4A 1ON1A 2A6HF 5B1BH 1VF6A 3X2QC 1USSA 1XSXA 2ZSIB 4QNHB 1TNTA 4NVPA 2XHKA 3I4NJ 1YVWA 5GW7A 5IT9N 3K5OA 2VQCA 1HBXG 1ZHFA 4XKCA 2DFHA 4NR1A 4YJ3A 4H0LB 1WJAA 2EQRA 5BMVB 2LF8A 2EBOA 2WSSG 1IURA 1GM8A 2R5YB 5CA1A 3IKTA 3F5TA 4ZJZA 4RS8A 2B1IA 2XPVA 4ON0A 4M3GA 1NH3A 4BDYA 1GK9A 2NS8A 2XIGA 1WPBA 5H5NA 1XMQO 4PFPA 2XPWA 4J9ZB 4ABMA 6PAXA 2ZE7A 2R7QA 1P92A 3IP4B 4RAGA 4E7LA 1WNSA 3SZGA 2CFXA 4MW3A 2X1CA 2HOSA 3J81K 3ISPA 1LFBA 1BW5A 1RPRA 4UCTA 1HR0O 2X6YA 3VQWA 2RN9A 5IJ9A 2COBA 3OR6C 4X62O 1ULYA 1ZK8A 1ZG5A 1F4KA 2B7EA 2HXIA 4LK0F 1EFRG 4LWSB 3SZTA 4F4LA 2Y30A 5DS9A 3BLYA 4FX0A 3SZPA 1H88C 1VF7A 1WP8A 2RMKB 2DA1A 4RA2A 4B43A 2VOPA 1RUOA 4NXMB 1JFFB 1XMOB 4X6AJ 1RKTA 1LFUP 4NXMO 3KP4A 2Y48A 1EN5A 1DTOA 1MMAA 3DPTA 4I55B 1KC8W 1XG1A 1TNSA 5DDGA 2CE4A 1XMOO 4QPQA 2EIJC 1J5YA 3DEEA 1WB8A 2WB1N 5JQGA 1EKEA 2EJRA 3RYFB 4M74A 3CCSI 1FT9A 1WA8B 2B9ZA 2BCCH 2Y75A 1HC8A 3C2HA 1S6LA 3ZP5A 1U8RA 2QJ1A 4RUFA 4DK1A 4RM2A 2XF7A 3DV8A 3CC7I 5E18F 1U6GA 4ZYAA 3R4KA 2D5VA 4BS9A 4GLXA 1KKDA 2OTJI 3C18A 4LR3A 2M6YA 1XMQB 5K1PA 2ZQMA 2DYSH 4AC0A 1GV2A 4D1QA 4MVSA 4UUJC 2V9VA 4XOPA 3JASA 2HNHA 3DTEA 1M90W 3CP1A 1ZTRA 1SQGA 2DA2A 4AQYO 4IL6Z 3DLAA 3RBZA 3MVPA 1FXKA 1TT0A 4B3TB 3SDBA 4G6TB 3ZMDA 5IOZA 2YSRA 3GLXA 1OYWA 4OX9B 5J8FA 2JJ1G 4LF9B 2VPLA 4MGRA 2IW5A 5FPRA 3AG3B 2F4IA 4MNUA 3ZHSA 4BR6A 2X6OA 2EZHA 1SD6A 4U88A 3GMEA 4OMYA 1SERA 1H8EG 1IBKO 2A69F 5FNVA 5J6XA 2IBZH 3J7ZI 3KEQA 1BT8A 2Q0OA 2CRGA 4M3FA 4A3MJ 3L75H 4K3AA 3W7UA 2R9RB 1XEQA 3HKBA 2XPUA 4FQGA 4ZC3A 2M0CA 5E3OA 1L0NH 3I53A 3SPJA 3E97A 3D1NI 2AO9A 2DMPA 3K58A 3BPVA 2HTSA 5LL6Y 4DV1B 4IRGA 4KIBA 5DCMB 4GDFA 4Y33A 4NC6A 1L0LH 3OYLA 5EYPB 3RCOA 5GAHJ 4KXRA 3AFHA 5ITZB 4KHPO 2DWDC 1RIOH 3G80A 3KZZA 3KCXA 5D5QA 3V7CA 1MZFA 1NBMG 3DBLB 2VIXA 3HKZA 4MTOA 1U5TC 4XK4A 1SFEA 3K04A 2WPDG 1QHGA 4AU7A 2MH2A 2FB5A 1LVAA 3ZQFA 2A6EF 5B1NA 4ZIBA 3GUDA 3ZXSA 1Q81W 1MW7A 4G27B 2IT0A 3H9JA 3OMAB 5ERIA 1MDMA 1RPWA 2J5PA 3HBLA 1EF4A 3FX7A 4PDKA 4X89A 3SYAA 4CBCA 1M9NA 4EEFG 1XSVA 1VF5B 1UAAA 2CH7B 3I4MJ 2E5NA 2GOXB 5IP6A 4LF8O 3GZ6A 1KGSA 5CVVA 2L01A 3FKSG 3ICXA 4QJFB 2R70A 2VS0A 1D1CA 5IOYA 4QE7A 4M9XA 1P9QC 4AVZA 5J47A 4F52A 2X7RB 1YTFD 2K02A 4JI2B 1LDDA 3JATA 3OTOO 5LOVA 2DYSB 3MHSC 2PQ8A 4OAZA 3JD1A 4PDMA 4CCKA 3SHFA 3KFWX 4G8XA 4U0YA 4B3MB 4A93J 3MHHC 3ESWB 4IF4A 2PZSA 1OYYA 1AI7A 2JPCA 3BPZA 1WSUA 3GWKC 5LGNA 1DLBA 4PA6A 4M6XA 3JCUC 2DTRA 4C2TA 5KLVH 1FSEA 1OCTC 2KZVA 2Y9YA 2QKMB 2VL8A 3K2AA 1TWCJ 2P5LC 3HOWJ 3THOA 1SFXA 3TL4X 3EVKA 1HA8A 4RAFA 2EILB 2ATKC 4D7TA 2XSDC 1XGSA 2PG4A 2K9LA 4FE4A 1FYKA 1RPOA 2XT9A 2HZDA 4ABZA 2OTJV 1BS3A 2FMLA 1XDUA 2F93B 4WFBV 4PJJA 2XASA 1UJ8A 1U9NA 1OFCX 3BQZA 2Y0SN 1A31A 1PUEE 1H2SB 4LH7A 3G6EV 4NXNB 1SS3A 2M30A 5EEHA 3QRFF 2RJZA 1K4CC 5FLMJ 2RAEA 4AIHA 3WG9A 2ID6A 3EDPA 5LBQA 4BW9A 2V26A 1Q1HA 3PNVA 2RNBA 3TJTA 5CA0A 1YJWV 2KIUA 5BXZA 3BZKA 1WGXA 4BJTA 2E1NA 1JTYA 2KG7B 4DO2A 2IGKA 4LF8B 2BOBC 3L9DA 2EILH 4UV9A 4GCVA 3TDZC 1YXBA 4RUEA 3AEIA 3ZRWB 2W57A 3OFNG 1NK3P 3H36A 1S72I 2STWA 5H2FZ 2QA4I 1SD4A 2CUZA 5C4JJ 4ASUG 4DR1O 3OL3A 1XNQO 3PFYA 4LC1A 2OCCB 3CP8A 4YEJA 4FPPA 4DXWA 2PI5A 3ZQGA 2ADQB 4JGSA 2E1MB 1FMWA 1V55B 4OXSA 2F5CA 2RREA 4L0YB 5LXTA 4NBQA 2PMUA 3WODF 4BQOA 4JF3A 2CQXA 1Y74A 1HW5A 2Y69B 3STZC 2W0FC 1OCCH 3FISA 1FFTB 4JI5O 2LY9A 4JASA 1YRNB 1HCRA 2V4JC 1P7BA 3P7NA 3LAPA 3Q0VA 1VQNV 4UCUA 1DU6A 4EM1A 1YIOA 3B8NA 1SD5A 2L5QA 1Z7UA 3AG1H 2YC0A 4HSRA 4M3BA 3CXCU 3RT3C 2VB6A 2EH3A 2K40A 4X66B 3F22A 4XDKA 1HWYA 4LF4B 2A5YB 2LKSA 1IUYA 3FDYA 1ZX3A 1T5EA 4X66O 1XBLA 3M7GA 1TW3A 2RV8A 1RFYA 1K97A 1Y4MA 1FEXA 2LFSA 3MKWB 2GIZA 3CDHA 3KE2A 5DCFA 4UCVA 2PI4A 2EFNA 3LQQA 2HJFC 4AIKA 1BI0A 1IJWC 1QU7A 5D5VB 1KECA 1SAUA 1VP7A 2VXDA 2YU9J 1SFUA 1V5FA 4JI6O 4E7ZA 3VEPA 4LNUB 1FBQA 3K4MA 5K5RA 3CMEI 5FLXK 1NVPB 1S0VA 3K2ZA 4FMTA 4R6ZA 1N33O 3LL7A 3ZHTA 5KAIC 2KDOA 4LWSA 3W2VA 4JQFA 2EINB 5LMNO 1D1AA 4B48A 4DQ2A 4ESBA 2V1XA 3Q5FA 1H8AC 4GX1A 4LF5B 4C7UA 3LSSA 3SJCC 5JJEB 2JA8J 2V1UA 3CCMV 4I7HA 1SKVA 4EGYA 1SQQH 4C3JJ 1I08A 5KAFC 2DN9A 1AB3A 2CW7A 3U11A 3RYFA 2Q7EA 3F6VA 5LMUB 1G3TA 3I59A 2BEOA 1IRFA 1AU7A 1PM9A 3NAUA 1BW6A 2YR2A 2BSKB 3R60A 4KFMA 2G0EA 2W84A 5FRMA 3KZIZ 2ZXJA 4FM1A 2AQEA 3FXOA 3R65A 4O2BB 3DTIA 1WWXA 2ZXIA 3SFZA 4C2UA 2YDEA 2YS9A 3IH2A 5JVDB 1NQTA 1QVTA 1BGYH 3RYIA 4BHBA 3WTXC 4E7IA 1KQ9A 1SRYA 1QO0D 4B8XA 3TP3A 4MQVA 1LNQA 4P96A 5DYMA 3OY9A 3KZYA 1Q86W 4DUYB 4KT5C 1Q3EA 3X2QB 4AIJA 4JYBA 1IV8A 2H8WA 2HPIA 1R6RA 4Y3OA 4DR3O 2F4VO 1S7EA 4ZDOA 4CYCA 1PV0A 1A5JA 2VQFO 1IUFA 3T0YA 3GFIA 4IHYA 3HHGA 4LB6B 3VQXA 2X48A 4L5JA 1DGSA 2O57A 3BCAA 1D5NA 3W2AA 2E19A 1GT0C 1FTZA 1K33A 1PL4A 1QLEB 4B7KA 3BA8A 3FKIJ 2I5UA 1V3FA 2F2EA 3K0LA 3D5RC 3MAJA 4PA4A 2UXCO 1TLHB 5ILVA 2UXBB 3CC2V 4LF9O 3CD6V 1I94O 3RKWA 2Q1ZB 3HL2A 1DF4A 3R0JA 4CICA 1O7LA 4HV6A 4DNCA 3WGGA 4P9PA 1B06A 4FLXA 4RMNA 1BR4A 4WF2A 3WHCA 2K4BA 1ZR4A 4B3TO 1PVEA 3GTQJ 1Z0XA 4A0YA 2JEUA 4QGPA 1VQ8I 1NS1A 2Q6AA 2EZIA 2KISA 4JK1X 2IGNA 2OZUA 2ME6A 1TUBA 3GTPJ 4X1IA 3JSNA 5LP6B 2QUFA 4H0EA 3NARA 1ZGWA 2BOCC 2W7NA 3JRCA 2KRCA 1Z3XA 2XKOA 4OOIA 4JI3O 1QPMA 4DV0B 5EG0A 4OU0A 1FS0G 1REPC 1YZBA 1Y0NA 1I5XA 4PSXA 2QGNA 1YITV 2LP0A 2LW7A 5FKMA 3PIPF 3E5UA 4DR6O 3KP5A 2NS7A 4ZDPA 4BKXA 2R7WA 1HF0A 2PLYA 2JA7J 1XMKA 1D8JA 2FQ3A 3QODA 2ZD9A 4JI7B 2XRLA 4ZI7A 2VC1A 3Q9SA 4DOZA 3Q0UA 2VQLA 1X4PA 4LLLA 2V79A 4J01A 1MDMB 4L9JA 3VYTB 1IBLB 1AI5A 2M1BA 2QVOA 4EB6A 1IVSA 1X2NA 2C2AA 2QQ9A 2DA4A 5B1AH 1K5SA 1J95A 2MGQA 3LQRA 5M3MJ 3QOPA 1TL8A 3RGBA 3E1SA 4LBEC 2P90A 1R6TA 4ANJA 1R3KC 1R3LC 2PN6A 3HRTA 3CMAV 1ZQ3P 1X19A 2JJ2G 5KK1A 1W59A 3CJHB 2VOOA 2EIJH 2EZLA 4A2UA 5D5XB 1OZ0A 2GA1A 5BMZA 4PJ0C 4RGXA 3D0SA 2OU2A 1X1PA 2HJDA 3GFLA 1T08B 2L2OA 1GV5A 3RIRA 4IPAA 3HOTA 2JK5C 2KT0A 4U7DA 1RNLA 1ZARA 4I4TA 1APLC 2ISYA 4P2ZA 2QWWA 3PIOF 4AQYB 3FB6C 1IDZA 5A2QN 1MJ9A 4A5MA 4LF6B 2ZNZA 2FNPA 2IS4A 4AWXB 5DM7F 1DP7P 4HRIA 1IW7F 1LEAA 4Y15A 1CF7B 1FFXA 4L9VA 2TRTA 5KCMA 4E4HA 5K7FA 5LHHA 3ZGKA 1DDNA 2E75B 1GKFA 2KHMA 2HYJA 4HYOA 2E1OA 4BE1A 1R36A 4ICGA 4J7KA 4JYCA 5IY5B 3JAKA 1IG7A 3D3IA 2L35A 3SJQC 4TV8A 4M9SA 1YW8A 1U97A 4M6VA 3U1DA 1KYZA 4PDLA 3K69A 4AUXA 2E74B 1Q90D 5C44J 3L74H 4XR6A 1ZG3A 2UXXA 2PYLA 4FK5C 1J9IA 4RO2A 4HX7A 3RZOJ 4RB3C 1IX9A 2VWKA 1EV7A 1WI3A 3LOCA 4C30A 3RKXA 2CV0A 4RB2C 5F1JA 3AKZA 3U10A 2ECCA 4IEJA 4L0ZB 1G8XA 1MZEA 4H33A 3WB2A 4LJZF 5D5WB 3QOEA 1R22A 2WV1A 3KP6A 3S15J 3FAVA 4FETA 1FMVA 2EZOA 3C3TA 3HKDB 3LDCA 1AR5A 5JLXA 5FL7G 2AXTZ 1N8RW 5BZBA 4XLFA 1FBUA 2OTLI 4LH6A 1NTKH 2V7QG 3LA2A 2FTKA 3SGIA 5BOXA 4HDUA 5KAFZ 3RYCA 1L0OC 5HDNA 3WFVA 2BHYA 4LG0B 1OJLA 2EIKC 3L7WA 4LF5O 3LSJA 2ZXHA 4LP8A 1QBJA 4ENJA 2CUGA 4PD4F 2PJPA 3OYIA 4JTCB 1S77D 3HGGA 3HM5A 3T1YO 2BGCA 1GN3A 3ABLB 2DMQA 2GOMA 2X51A 4BU2A 2YUAA 2L0KA 1ZREA 3DGEA 4FFBB 2LTPA 4OIQF 4OPHA 5KHDA 5CVJA 1QQIA 3Q9VA 1QZEA 3AK1A 3UQ8A 1QVGU 2V1NA 2ZNYA 3N4MA 4IX7A 4DGWB 4J41A 2VQEO 4D6TH 4CXFA 4XLNF 1QLNA 4RAYA 2EFPA 3E8HA 4U3FH 1G4YB 3R66A 1GH6A 2HVSA 1BSMA 3A0BZ 1BBYA 3BA9A 3U1KA 1Y6IA 3BY6A 1IRGA 2PX9A 4JTAB 1SVLA 5F2VO 5E3NA 2JGDA 4EJOA 1JMKC 4WX9A 4A3LJ 5FKKA 3ZMUA 2F5FA 3FHZA 2CK3G 4J42A 2VBXA 3BR0A 1TC3C 1SZXA 3HHHA 2ITCC 2YEVB 2ADUA 3DF8A 1A32A 4B1RA 4CH4A 1QNTA 2RKHA 2R7VA 3WTUC 4FZ1A 1Y1VJ 2DFFA 1EH8A 1Z5VA 4JX6A 5AIQA 1Q6HA 4I76A 3BG6A 3M8JA 2CGPA 3OV8A 1IXSB 1Y67A 1MBKA 1W5TA 2GDSA 4ZOLB 3IAYA 5DD8A 4B09A 2YI8A 2Q5ZA 4HBNA 5AG2A 2PF4E 1KZHA 2NNYA 3HKEA 3SPGA 4HLXA 4JI0B 2L9VA 1H2LA 1X58A 3PFIA 3SEQA 2JA6J 2WWWA 2YXLA 3N27A 3S2DJ 2NXNB 3MMYB 3WTSC 1ETXA 3HPGA 4HF2A 1K34A 3I59B 2B5UA 5DEDA 5F0CA 4K2EA 2HOAA 5L3FA 4Q5SF 3CJTB 2ZXWB 2VE9A 3CEIA 4K0KO 2COMA 1VQNI 2VASA 1UG2A 5LGTA 3G6BA 3TW6A 4O2BA 2KJCA 4LITA 4P1WA 5LRRA 3CMYA 2PUSA 1R9TJ 4XNFA 2UU9B 1W0TA 1HP8A 5B3SC 4P30A 3RYIB 1L1FA 1ZTEA 3BABA 4JTDB 1ZLKA 2FJ1A 1SAXA 2DDAA 3ASOB 2IU0A 3CO6C 2JSPA 4DR4B 3G4SI 4IYHA 1WJEA 2OA4A 3TP0A 4XL9A 3BTIA 3JD4A 3F8MA 3I4PA 3OYFA 2PMZA 1J2XA 2M8EA 3KIOA 2LH9A 2D2CB 3IFXA 4CYCB 3CCQV 1KUQA 2ZFWA 3Q0WA 4A6DA 1FSHA 1YX5A 3DPUA 3JRAA 1NVPD 4MHGA 4JAVA 2HDWA 1A04A 2HXOA 3PSIA 3ULQB 2WLHA 3D5LA 1UZCA 3EUHA 1K6YA 2MC4A 2IJHA 4YJ3B 3VBBA 1XI1A 1ZSPA 3K06A 2XRNA 3OTFA 5BMVA 2DK5A 2G7UA 3D8CA 3OS1A 2EIMC 2ZR2A 2IH3C 4R7CA 3HJEA 2JMWA 3LFUA 5DN6G 1YJ9V 4AHCA 1VQKV 3PQKA 1VQ9V 2ZC2A 3ZIAG 2AXLA 3NXSA 2L9RA 3H35A 5JH7A 3CCVI 1O3QA 1NTMH 2X9DA 4N21A 2LP7A 1WHUA 2F66C 4DV7O 2L7MP 3TOBA 5F04A 4PJMA 1R1VA 4DIQA 1N0JA 2QKAA 1I50J 3FB8C 1TUBB 3N2GA 4X1IB 1W0JG 2JA5J 1A36A 2HOTA 2WY7Q 2MLGA 2RQQA 3BTCA 4KMUX 1F4MA 1W4MA 2FBIA 1R3JC 3BP8A 3ZMSA 2IJKA 1M1KW 2CUEA 4HAMA 3JRIA 4IL6C 1K3EA 2K4JA 4N4OB 2JN6A 3I9V2 3MKZA 1VQMI 3BR2A 4BW5A 2NYXA 3B4SA 1RUNA 1YS7A 1N34B 1JFFA 2LD5A 2M9HA 3GEZA 3DCFA 1OHHG 2GSMB 3T4ZA 4ZI7B 1R58A 4EATA 2X6CA 5F6FA 4I55A 1JPXA 2XAHA 1FOKA 3OMIB 2CAZC 1V9PA 3AG4B 4FX4A 4AYBA 3CCRI 2HVRA 4J10A 3BROA 2QM3A 5TJJA 3SYTA 1B9MA 2JS5A 2ESHA 1P84F 4EB6B 4LFBO 1WA8A 4JI8O 4F91B 2MG4A 2MK3A 3QNEA 2BW3B 1AKHB 1C0WA 1Y56A 1ZLJA 1S7OA 3W7WA 4X64O 3P9CA 4JI5B 5LMUO 1LVKA 1UCRA 5H9CA 4BWAA 2FUG2 4XRSA 1RM1C 3IH3A 2E3CA 4X64B 4MTXA 3L70H 4HZ3A 1IAWA 2K85A 5H6RA 4BGDA 4O4LB 2LF7A 3GTJJ 2P4WA 3B73A 2LNBA 5J40A 3SEZA 1H38A 4XDLA 2JA2A 1E0EA 1ZAUA 3P9KA 4Y7NJ 3CE2A 3DLLF 3IC7A 5DV5A 3F21A 1WP7A 2PY5A 4MEYF 3DP7A 4LLNA 3AG1B 3AG7A 4U3JB 3S2WA 1JR9A 3QU6A 1JVMA 4QPJA 4ITVA 3OIPA 4I4TB 3JSOA 1DGRM 5EYRA 4UNOA 3Q4HA 5FRNA 2QWQB 4JAAA 3MKYB 3WB0A 3S2HJ 2FXAA 3DKYA 4DR5B 5FJ8J 1NU1H 4PFOA 1MNDA 3K9AA 1B9NA 1MNEA 1D8KA 2FBHA 3OR2C 3OYNA 1CF7A 2CW8A 4H4KC 1FFXB 3DTUB 4DV5B 1GMGA 5M5YJ 1XL6A 3EXAA 1OJHA 2DI3A 1VQ5V 1DUXC 1I94B 2OTLV 3HSEA 4DV5O 3ELKA 5BNGA 4BEHA 3HDDA 3LNNA 4X1KB 4BNCA 2K86A 1CGPA 2BY0A 4F6RA 3OW2U 1SFOJ 2N04A 1SVMA 4NTYA 1SC5B 4XKWA 3CC4I 2HQRA 3JAKB 1GVDA 5FNVB 2KKOA 3CCLV 2Q0AA 2JVGA 1QPIA 3G1LA 3WTWC 3OIQA 4L8JA 2YIAA 4YHHO 4S0HB 2HGCA 3DFGA 4UVBA 4S04A 1FOXA 4Y52J 3HKBB 4BY7J 4IHJA 3RFRA 5IWAO 4L9TA 1MSFC 3VSLA 2HG5C 5M5WJ 1VARA 2OV7A 3K3WA 4QIWF 4IQ4A 2R3SA 3K0GA 3GFMA 2FEZA 2Y0MA 2ZE8A 4XLHA 3G73A 1X1AA 3DPLC 4MVMA 1LDJA
chains in the Genus database with same CATH topology
4I2OA 5DUIA 1KP3A 2PI0A 2XAJA 4PDRA 2FOKA 4LG0A 1T38A 5E8IA 1I5ZA 1K5QA 3QU3A 2E7XA 3IRRA 2XUBA 3EETA 3V4GA 1F4NA 1YJNV 2O0YA 3TCUA 3VB2A 3FXQA 4BHCA 4CDGA 2O6GE 1AWCA 3OEHG 1STZA 2QEXV 1NR1A 2HFEC 3ETEA 2H09A 3EYYA 1I6XA 1YTYA 4G7ZF 4RGSA 3TKYA 4KA4A 1BJAA 3G71V 3H92A 2D1VA 2NNNA 1QZYA 1K7DA 2WLNA 4XLPF 1LEBA 3CJNA 3FX3A 3F5WC 4PELA 4BXUA 1GTOA 3ASOC 1RM1B 1RI7A 3JSPA 4U0WA 3W6KB 1KYWA 2IA0A 4U0VA 3TQNA 3HTUA 2Q69A 2H6CA 4HX8A 3I58A 1ODDA 3ZRWA 2L3DA 3L9FA 4BQAA 2FU4A 3NRVA 1I5YA 3WTVC 1R73A 3LDEA 1S76D 2M5WA 4WF9V 3OMNB 3ROUA 2HVKC 3CUQC 3HPLC 4G6DA 4GX5A 5KUKA 4M71A 4KFCA 5E1XA 4RQEA 3PQJA 3P30A 1R6NA 2XVCA 1AROP 1Z05A 4HLYA 5LHGA 2HYGD 1JJ2U 3GFJA 4RB1A 3ZCCA 4G7HF 1EZJA 5FFZA 5CA3A 2IA1A 1SESA 4E2LA 2RGVA 4HV5A