3BY6A

Crystal structure of a transcriptional regulator from oenococcus oeni
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
119
structure length
119
Chain Sequence
QAMAITQKRPVYLQLVDRIKNEVATDVLSANDQLPSVRETALQEKINPNTVAKAYKELEAQKVIRTIPGKGTFITGNTASVKNSNQNRLLADLSQVIAELIKSGVKGERIKKIVNDILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Predicted transcriptional regulator
publication title The crystal structure of a transcriptional regulator from Oenococcus oeni.
rcsb
source organism Oenococcus oeni
total genus 41
structure length 119
sequence length 119
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3by6A01
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3by6A02
5E1XA 2YU3A 2ISYA 1TQPA 3DQVC 1LNWA 3HSFA 1TBXA 4FX4A 5ED4A 1RUOA 2Z5UA 4NQWA 1LB2A 3F6VA 3ZMVA 4L18B 3O6BB 4BXUA 2LSOA 1EV7A 4A0XA 3E3VA 1JE8A 3O2PE 4IPAA 4YG2F 2D45A 1GHCA 2UXXA 1S29A 1FSHA 4HF1A 4UHTA 2V1XA 3F3XA 2VBWA 3LQQA 2EV0A 2HFHA 5K5OA 1LJ9A 1KU3A 2F2EA 3ZPLA 1SD4A 2FRHA 1GXQA 5JHUA 1YYVA 2O8XA 2Z3YA 3ZN1A 4ZZDA 2DFIA 3B02A 1WSUA 4G6QA 4M74A 3CDHA 3TDZC 2ISZA 3HIFA 3GLXA 2QENA 1USTA 3KLNA 3WTUC 2EA2A 2DU9A 5J6XA 1KQ9A 1XD7A 5DCMA 2IJLA 3SZTA 2M8EA 4YIIA 5H6QA 1PUEE 2Z9OA 4OOIA 2RC4A 2G7UA 3MEXA 3K1NA 5HLIA 4L5JA 1W7PD 5CVRA 3DPLC 5BPIA 3W7XA 2G7HA 1KQ0A 3RYRA 5L3FA 4HX8A 2DW4A 3Q9VA 1O3QA 2EA4A 4EV0A 4BHCA 3COAC 2CO5A 5F64A 3P9IA 3NQOA 1UFMA 3GVAA 4UXNA 1YQAA 2HR3A 3R0AA 4UV9A 2CFXA 2HKOA 3FX3A 2XRNA 2ZKZA 5JVTA 2GXBA 5CLSA 3D0SA 2DBBA 2VBZA 3D5LA 2KIMA 4L9JA 5HOOA 1FC3A 2HGCA 1YS6A 5D8LB 5DD8A 1HW2A 4YIFA 3BY6A 3FMQA 1SFXA 3H3ZA 3TKYA 3MZHA 1JHHA 1F9NA 3MCZA 1FP1D 3KZYA 1NVPB 5K5QA 4S05A 1FT9A 2BEOA 2QQBA 1W4MA 1NHAA 4L9VA 4ENNA 3FZVA 2VE9A 3BJ6A 1IN8A 1HW1A 2E1NA 4EGZA 2CQKA 2VE8A 3W6KB 2NNNA 3VOEA 4KA4A 4RB0A 3TQNA 1U3EM 3C3WA 5JR3A 1MJBA 3M7GA 1WKMA 1ULYA 5KVRA 4EM0B 4G9YA 2FU4A 2QBYA 3QU6A 4Z2YA 2A69F 1J0RA 1G3TA 2VXZA 3K2ZA 4XSXF 4CO8A 1HXDA 4MEYF 1ZGJA 4M71A 1JXSA 1XGSA 4RGXA 3HRSA 3EYYA 4LD5A 1BI3A 3K0LA 4ESJA 1LEAA 3WGGA 5K1YA 2XHKA 1FYLA 1Q1HA 2EFQA 1K79A 2KJBA 2JTVA 3DF8A 1O3RA 3KP7A 2PBIA 2STTA 5J8CA 3RTRA 3ZP5A 3PQKA 1GXPA 4EJTA 4XSZF 4KN7X 5CVIA 3BDDA 5ICCA 1HQCA 1Z7UA 2QBYB 1IZ1A 3W7SA 3GX4X 3KETA 4HV6A 5HS7A 5DEQA 5H6RA 4ENMA 1QO0D 4UUVA 4Q47A 1FNNA 2GQQA 2IRFG 3BPVA 3LA3A 2GAUA 3FM3A 1P2FA 2EB7A 1REPC 2NAZA 4OIPF 4CXFA 2J5PA 1ZRCA 4D0PA 3FXUA 2DO7A 1P6RA 3V7SA 3P9KA 4IRGA 3I0TA 1IRFA 3CLOA 2ESNA 6PAXA 3WTSC 1G3WA 3ROUA 1ON2A 1DP7P 4P55A 3BJAA 1RNLA 3T1BA 5E1WA 1B9NA 2P5VA 1IXRC 2XAFA 4P9FA 1QBJA 3RKXA 1BIBA 1MJAA 1MKMA 3QRFF 2HZTA 3RYPA 1TW3A 2IW5A 2A3SA 1Z6TA 1XDUA 3E6CC 4M6YA 3DXJF 3TO7A 4GO1A 2R7DA 1U2WA 2TDXA 4F7ZA 4KMFA 1DDNA 1LQ1A 2JPBA 1BN5A 4P96A 1FY7A 1WWXA 1YW8A 3OOPA 5IT9K 2Y48A 1F1ZA 2EFPA 1TNTA 1MD0A 5FD6A 2VOPA 4I98B 3CTAA 4OMZA 4WXHA 4QLCU 2A61A 1FYMA 3FXQA 3G3ZA 1G4DA 1W7PA 3WTYC 2CYYA 2YPRA 2RNJA 3QU3A 5L3CA 3V7RA 1XMAA 4G8XA 4PZJA 2P5LC 3BROA 4G94A 5FLXK 1LEBA 5GW7A 2MD5A 1K78A 3K1MA 3E97A 4OIOF 2E1CA 3M8FA 3DP7A 3LFKA 3W7TA 3WTVC 4WCGA 2XGXA 1E2XA 5FFZA 5IT9Z 4BHBA 3BZ6A 1RUNA 3T0YA 4GYGA 4WXDA 2EV5A 4WK8F 4XRFA 4BAYA 1SD5A 3ECOA 1FWZA 3PFIA 3KFWX 2IA1A 2R7FA 5FLXZ 3HSRA 4HLXA 1ZGAA 4FHTA 2L01A 2HOEA 3F8MA 3RIRA 5BMZA 4KUMA 2F5EA 4Y15A 2WV0A 3U2RA 3FWEA 3HRTA 5FFXA 2OU2A 2QVOA 5LHIA 3WE3A 2DPDA 2MH2A 3Q9SA 3ECHA 4MQ9F 2W24A 3I54A 4RGSA 1Z91A 2IP2A 1IF1A 2IT0A 2F5CA 2CG4A 2L4AA 4I09A 2M30A 1D8JA 4EJUA 1T98A 4IXAA 2HS5A 4LGWA 5L3DA 3MAJA 1QQIA 2PQ8A 4DQ2A 2WTEA 3C1DA 2EV6A 1B1BA 3KEQA 5D6EA 2KIFA 2LNBA 5D4RA 2GA2A 2V6CA 3V8LA 3P7NA 4FX0A 3L7WA 2A5YB 4MEXF 3U1DA 2GWRA 2HQRA 1L3LA 2R3SA 1Z05A 2HWVA 4I0BA 2L3DA 2P4WA 5HVQC 4P9UA 4U88A 4R79A 4ZYEA 2ZXJA 3F23A 2H09A 2D1VA 1XSDA 2PI0A 2BYVE 1QPMA 1GVJA 5CVVA 3ISPA 1YW9A 3U9GA 4N9HA 1J59A 2K4JA 2VC0A 4ZH4F 4UVBA 2FSWA 3H92A 4L0YB 4RAZA 1ZYRF 3DFGA 1Z9CA 2IVMA 1R23A 1R58A 5D5XB 2ACJA 3DPTA 4A0ZA 1RZ4A 1O3SA 1LDJA 2ZNZA 4CYDA 4LFUA 4LG0B 2PMHA 1JHFA 2HTJA 2W84A 3FMSA 2ZJ2A 2HQNA 1IUYA 3HHGA 4FT8A 3KCCA 2PLYA 3R61A 5D6FA 2H27A 5CJ9A 4BQAA 5E18F 2GXGA 2XAGA 4ESBA 1R5HA 2MBFA 2WWYA 2RVCA 3DV8A 1KU7A 1U5TB 2IPQX 2GZWA 2DK5A 1BOAA 3T8RA 3S2WA 2L02A 1SFEA 4B09A 1RI7A 4CZZA 2ZNYA 2KKOA 2MC3A 1I6XA 4L9NA 3JSOA 3BPXA 5JFRA 1BC7C 2QQAA 5DUIA 2ZBKA 4HF0A 1EH7A 2XAHA 3QOPA 2PG4A 1B9MA 2OQGA 3RI4A 4JBAA 3FF5A 3OV8A 2VT3A 1HSJA 4HQEA 4HX7A 2ZFWA 4M72A 4KIGA 1QZZA 2OZUA 5AIQA 2QM3A 3IRRA 2STWA 4Y17A 1ZRDA 4LLLA 2QYOA 2VBXA 2F5FA 1S7AA 2BE5F 1FBQA 2D1HA 2M45A 4CHUA 3R60A 3MZYA 2Q2EA 4L0ZB 3ZMSA 4A6EA 4YFKF 3TOAA 3EQLF 3TGNA 5E8GA 1UHMA 2JSCA 2H6BA 3WTZA 2L4MA 5EEHA 2V79A 3KE2A 1YFHA 1XCVA 5L3EA 1MZBA 3E6DA 2NRAC 1DPRA 4QWQA 1J9IA 2JT1A 1S3JA 1O7LA 1QGPA 3HOSA 2AXLA 1YW7A 4YFNF 4ETSA 3R6SA 3NRVA 1SD7A 1JGSA 4EJVA 4PCQA 3RPUA 2M87A 2FBIA 2FXAA 4UNOA 4N0BA 1ZRFA 3CJNA 1R1TA 4R8HA 4BH9A 3ZMDA 5F6FA 4O3MA 1BI2A 4UV8A 2IA0A 2QWWA 1IN7A 3REOA 5LGTA 3FM5A 5BOXA 1OPCA 2Z33A 1V3FA 3GUDA 4LLGF 3SQNA 2JPCA 2RGVA 1ZH5A 2HEOA 4IJAA 3ZMTA 4RS8A 5LGNA 2FQ3A 1S8NA 4GYIA 2XV4S 1F4KA 1XSVA 4HDVA 2O0YA 5E8IA 1DUXC 2EK5A 1YO5C 4LMYA 3WGIA 1B4AA 4WWCA 4BNCA 4AIKA 2QUFA 2K27A 4R1HA 2BBYA 1Z1DA 4HLYA 3WGHA 3C7JA 2MH9A 3DEUA 2RKHA 4I0AA 1S7OA 2PFBA 5DDGA 1MDMB 1BM9A 1H9GA 3I5UA 1F5TA 2V1UA 3L09A 2FBHA 1I1GA 1IXCA 3TDUC 2FBKA 1T2KA 1I5ZA 2VOOA 4G7OF 3I53A 4EM1A 2HYGD 1HBXG 2HTSA 4E70A 3CUOA 1BI1A 5EEGA 4Q48A 5HDNA 1U78A 1YIOA 3DKWA 3FHZA 1LDKB 3HUGA 2RV8A 3AAFA 1QNTA 3PQJA 4NHJA 1YS7A 3WTTC 5BPDA 1FOKA 1FSEA 3EUHA 4O6JA 4AD9A 1ONVA 2VBYA 3N97A 4H0EA 1TLHB 3M1EA 4OINF 3IRQA 4P5OA 2DK8A 4LK1F 5CVUA 2QQ9A 5HS8A 5FD5A 4NB5A 1VTNC 5HS9A 1FBUA 5LEJA 2DQRA 1EH8A 4KFCA 4RGRA 5FO5A 4GXOA 1R5GA 4OIQF 5DCFA 2WC2A 3HHHA 4IF4A 1HW5A 3JSPA 1D5VA 2FNPA 2RDPA 4PDKA 4UVAA 1U5TC 4EM2A 3I59B 1FPQA 2COMA 2HKXA 1UCRA 1USSA 1KA8A 2XAQA 2DI3A 1ZLJA 4M9ZA 1KQ8A 1HKSA 3B73A 2FE3A 5AONA 1KGSA 5HLGA 2JRTA 4XBFA 1I27A 1IAWA 2FMLA 2LF7A 4KICA 5LGUA 1O3TA 5BS6A 1H0MA 2DPUA 4AIJA 1XDSA 1SAXA 2XASA 3CUQB 2O6GE 3QP5A 3I64A 4KN4X 1D8KA 1A04A 1AWCA 3WE2A 5ERIA 1PP7U 5D4SA 1XSXA 3LA2A 4CICA 4M9SA 3J7AO 5LRRA 4S04A 4RB2C 3L9FA 1SMYF 2H6CA 3F21A 3GFMA 2UZKA 1AOYA 4Q5SF 3HOTA 3GZ5A 4AWXB 3V4GA 4HZFA 2GA1A 3LQRA 1YG2A 1B59A 3LAPA 1OYWA 3V8JA 2PEXA 1MGTA 2XUBA 1CGPA 3WU0A 5LRSA 1U8RA 1BIAA 1G3SA 2HDCA 3HSEA 3ZMUA 4KNYA 2X4HA 3Q5FA 3GO5A 1IN6A 4ZYDA 1OMIA 3F8CA 4Q4ZF 2UWMA 4EJWA 3JW4A 3KLOA 3FXRA 2B0LA 4WXCA 2MA3A 3BP8A 4ENJA 3V8KA 1FLIA 2K7LA 3RKYA 4I7HA 1FP2A 3VFZA 1T0FA 4XLNF 5HDGA 3GWZA 3KP4A 1FYKA 2NYXA 4A2UA 3J80K 3KP5A 1IXSB 1H9TA 2Y0MA 3TOBA 3R4KA 1WI9A 1V4RA 2ELHA 3NEUA 4MGRA 4LG0A 4HDUA 4U7DA 1QZYA 1ZG3A 2LKPA 1STZA 3MFKA 3ZQ7A 4IHTA 3O3KA 3GW2A 1X3UA 3KP6A 1CF7B 3RJPA 4IVNA 3E5QA 3WU1B 3GFIA 4HOBA 2OBPA 3WG9A 1U5TA 2YSRA 5CA3A 3TO6A 1R1UA 3J80Z 4MTEA 1P4XA 1HSTA 2ZMEB 4GCVA 4A12A 2EFWA 1BJAA 3SZPA 3ABTA 2XVCA 1TNSA 4ZYHA 1ON1A 4AIHA 2K4BA 4HW0A 3ZN0A 4LLNA 3W7UA 2ESHA 2IA2A 3R0JA 2UXNA 4A6DA 4I2OA 2FNAA 1G3YA 5DV5A 4IHSA 2KIUA 2F5DA 5LHGA 3GEZA 3VB2A 2CGPA 1XB4A 1OYYA 2EJRA 2RQPA 1O57A 5H20A 1J75A 2XAJA 2QLZA 2DLLA 4OU0A 3V7CA 2FA5A 3CO7C 4A5NA 5L3GA 1T39A 2RN7A 3F6OA 3ABUA 4MQVA 4PGHA 4LB5A 3M8EA 4M6XA 4HV5A 1YLFA 1XGNA 2NS0A 5HDKA 2BGCA 2V1DA 3F8NA 4EJOA 4OIRF 5AIPA 4LK0F 4U0WA 3P9CA 2YX7A 2FMYA 2P6TA 1TW2A 2XKPA 3I71A 3SXYA 2P7VB 5ILSA 4A5MA 4TV7A 4HA8A 1T6SA 1W5TA 3T8TA 1IN5A 5DCMB 2D2WA 1XCBA 5DD4A 2M1BA 2EFNA 1FBSA 2P8TA 3MQ0A 1SFUA 2W85A 4LB6B 3E35A 3K69A 4UVCA 5ILUA 1R36A 1LDDA 3E6MA 2K86A 2MLGA 3KP2A 4MTDA 3L00A 1R1VA 2E7XA 2OQRA 1ODDA 3GFLA 3RDIA 3ML6A 5JI6A 4G7ZF 3I4PA 4PGGA 3HRUA 3LSTA 2EFOA 1KU2A 4HAMA 3CUQC 3EYIA 1TQIA 2EWNA 4JQFA 4EGYA 4ASNA 4HBLA 3T5XA 2H94A 5E1ZB 3W7WA 2ZCWA 3IWZA 4L9TA 2O3FA 3BOQA 2GIVA 3EETA 2CWEA 2O61A 5BQTA 4BHPA 1L0OC 1HKTA 3E5UA 3BWGA 5J8FA 5TRDA 1ZAOA 3HRMA 1YTFB 1MDMA 3K9TA 2L54A 4B8XA 2Q8KA 4I02A 5D5VB 3LWFA 2P6SA 4U7BA 2PJPA 3L2CA 4BYYA 1ZG5A 1TQMA 3HTUA 3ERED 1P4AA 4KIBA 3WTWC 3KZZA 1OR7A 3HTSB 2FEZA 2JZYA 2KRFA 3F72A 2QZ8A 1UHWA 4RAYA 2K02A 2OA4A 2DQLA 3VEPA 1G6NA 1MJ9A 4KMUX 5TJJA 3F8BA 1J2XA 2A07F 3CO6C 1C0WA 1P4WA 4HQMA 5ILVA 1T38A 1ZHFA 4WX9A 4EVIA 5A2QK 1K7AA 3QAHA 1BI0A 1WQ2A 2VONA 4JK1X 5LLQA 1OYIA 4KYWA 4OMYA 3EDPA 2W25A 2CW0F 5E20A 5K5RA 4M9XA 3LA7A 3J81K 2VODA 1EH6A 4L5IA 3LAJA 4U0YA 5CVJA 2G9WA 4RB1A 4N9IA 4HF2A 2Z99A 2A68F 4G7HF 3E6BA 2O03A 3JTGA 4MHGA 1I1SA 1RM1C 4IRIA 1ZLKA 4ESFA 3GYHX 1Z6RA 1ZN2A 3K1PA 3N4MA 3G73A 3HYIA 4ENKA 4KDPA 1KU9A 2ZO4A 3GXOA 5A2QZ 1PDNC 2BV6A 2CSOA 1KYZA 2M5WA 3ZMZA 2KJCA 3JAMK 2ADUA 4MNUA 2PMUA 3J81Z 3I59A 3I58A 2DTRA 3RKWA 2HYFA 4HYEA 2XKOA 4ON0A 1XGOA 2DAOA 1O7FA 3QP6A 2AS5F 3RPQA 1TTYA 3GFJA 2NNYA 5L3BA 1WRJA 4CDGA 2OAZA 3H3UA 2C6YA 3E5XA 4LJZF 3JAMZ 1LVAA 1BC8C 2P90A 1XGMA 3CUQA 2E7WA 4EQQA 4EMSA 5E17F 3QPHA 3IKTA 4O5VA 3D3IA 3TO9A 3W6JB 2J5OA 2A6HF 3F8FA 5D5WB 3JTHA 4DNCA 3WTXC 1PP8F 1D3YA 3IHUA 5FGMA 5D8KB 1K6OA 4YFXF 4KT5C 5LEKA 4RGUA 1IRGA 2X0LA 1ZG1A 2V9VA 1BBYA 1HKQA 3SFZA 3IWFA 1B6AA 3VODA 3GZ6A 3SHFA 4A0YA 2WAMA 5DYMA 1P92A 1NH2B 3MWMA 1FX7A 5FB2A 4HX4A 2VT2A 2P5KA 1R7JA 3FMRA 4IRHA 4GGGA 2FF4A 2YR2A 2W57A 4K2EA 1YTYA 4Y13A 2DT5A 5ICFA 3GF2A 4U0VA 3QPTA 4XLPF 2OZ6A 1DPUA 5LBQA 1SD6A 3IKVA 1E17A 3ULQB 1XMKA 1W7PB 4RB3C 2LDUA 1KYWA 1R22A 2YX4A 5D5UB 1W5SA 4CGZA 2PN6A 1IN4A 4I01A 1K78B 1Y0UA 4ZYGA 5IT3A 2XROA 4AVPA 1J7KA 3IC7A 4ZZLA 1ZARA 2LF8A 2Y75A 5DUKA 5KK1A 5LHHA 1CF7A 1ZREA 5CYVA 5F1RA 1S6LA 3F22A 4KIFA 2VC1A 4M73A 5HLHA 1U6GA 2XIGA 4G6DA 1FZPB 1R00A 2OD5A 3KP3A 1RIOH 1UB9A 1XN7A 2VN2A 4WF2A 3BJOA 3WODF 2ZMEA 1J5YA 1IW7F 2A6EF 2ETHA 3M9AA 5ICEA 2Q0OA 1SMTA 2FOKA 3KEOA 3C18A 2MLKA 5ICGA 3IL2A 2P7CB 1OKRA 3ELKA
chains in the Genus database with same CATH superfamily
5E1XA 2YSUB 3K4NA 2B7EA 1OCCC 2B9ZA 3CSXA 1MMDA 2F4OB 3TBIA 5M3MJ 2YDEA 5J2UB 3OD4A 5BY1A 2EZLA 1IBKB 3HR0A 2YU3A 2ISYA 1K3EA 4NBQA 1FTTA 1Y66A 2PMZN 1E1QG 4J11A 3DTEA 1TQPA 3DQVC 2F4VB 3GB7C 1OCZB 1LNWA 4KHPO 4Q20A 2HHHB 5CA1A 3HSFA 1TBXA 3K03A 3CCJV 4FX4A 2HDWA 3FB8C 2QSHX 5ED4A 5CBFA 5EIBD 3B8MA 1RUOA 4MTGA 3BZCA 2Z5UA 4NQWA 1LB2A 4V2FA 4BL0B 3FKIJ 1IRXA 3KX2A 1D5YA 3F6VA 1VQ4V 4B3TO 3N2KB 3IUOA 2F66C 3TW7A 2XB0X 4O4LA 2ITCC 3N2GA 4X9QA 2R7OA 1IVSA 5J3LA 5IPAA 3ZMVA 1H38A 1A32A 3JAWA 4L18B 3O6BB 4BXUA 2LSOA 1PV0A 1R4NB 2AW9A 2MYSA 3NWTA 1MOFA 1EV7A 5FKMA 1RFYA 4A0XA 4F93B 3E3VA 1JE8A 2Y69C 3O2PE 4IPAA 5J1UA 2HXOA 3DLLF 4YG2F 4FFKA 2D45A 4DV3B 3CP1A 4LF7O 2CGNA 1GHCA 2UXXA 4WFBV 1S29A 3C90A 2CFOA 1FSHA 1BW6A 4HF1A 1WA8B 3D5RC 4B3SB 4UHTA 2R5YA 3CCLI 2UUBO 2ID6A 2V1XA 4BQOA 5M5WJ 5EJCA 2WAFA 4RM2A 3F3XA 4RQFA 2UXCB 1Y6IA 2VBWA 2MW8A 1B04A 1UFIA 2FL4A 2JJ1G 4AHCA 3K5OA 3LQQA 3KZIZ 4CH3A 3QO8A 2EV0A 3WG7B 2EH3A 2HFHA 2CV2A 5K5OA 1TA8A 2Q8VA 3LNNA 4ASUG 3ETEA 1XNQO 1LJ9A 1KU3A 2AQFA 2F2EA 3G67A 1OCOH 4E7ZA 3ZPLA 1SD4A 1F36A 2FRHA 1GXQA 4CC6A 1ORKA 1QQCA 4X64O 5JHUA 1YYVA 2ZR3A 1D1BA 3IH2A 4P2ZA 3CC4V 3WB0A 1M1KW 2O8XA 2DOEA 2Z3YA 3K4JA 3ZN1A 1KECA 2ZINA 4DV1B 2DYRH 4RLFA 4TQDA 4ZZDA 2DFIA 3B02A 2QJ1A 3RFRA 1WSUA 3CWBH 5FKNA 1W1WE 2CJJA 1FXVA 1FJGB 2LOOA 5GPCA 3M3YJ 4G6QA 1B72A 2WLLA 4O4IB 2O8KA 2W4SA 1G8XA 4NXMB 1F43A 4M74A 4PDVA 3CDHA 2ADPA 3TDZC 2Z2SB 5E3LA 2ISZA 3HIFA 2UU9B 3CDIA 3GLXA 1HP8A 2YXLA 1NH2D 4CH5A 1BZKA 3GTOJ 2WLHA 2HOTA 2QENA 1USTA 3KLNA 3AG1C 3WTUC 3CMEI 2MFZA 1XL6A 4JYBA 2EIJH 4J19A 2EA2A 1GM7A 5B1AH 4MVUA 2DU9A 5J6XA 4BE2A 2HOAA 3ABKH 1N0NA 2A5WA 3CP2A 1THZA 1KQ9A 1XD7A 4OPHA 5DCMA 4EB6A 1R49A 3CD6V 4W4LA 3IFXA 2IJLA 3RT3C 1Z2GA 1M9NA 3SZTA 5TISZ 1Q7YW 2M8EA 2ARHA 4YIIA 5H6QA 4X65B 1PUEE 1TUBA 3JD2A 1FOWA 2Z9OA 4JAUA 1R3LC 3CCJI 3CC7I 2LMDA 2RC4A 4OOIA 1PYVA 3QTCA 5ITZB 1P9QC 2G7UA 2DJVA 4A3FJ 3OYMA 2RAEA 3ZQIA 3K4CA 1VQ4I 3MEXA 3K1NA 2QKSA 5HLIA 4F3QA 3B6AA 4L5JA 4I0XA 1W7PD 4UUTA 2K9MA 5CVRA 5K7ZA 2X6WA 3DPLC 5BPIA 3W7XA 2G7HA 3JALB 2VJJA 1OCOC 4JTAB 1KQ0A 3RYRA 1XMXA 5LYJB 4LCUC 3RZOJ 5L3FA 4HX8A 4QIWF 2WY8Q 2EULA 5EIBC 1FJGO 3TEDA 2DW4A 3Q9VA 1AI6A 5IY5H 2GTSA 2E1MB 2XPVA 1O3QA 2EA4A 2OCCH 4BGDA 2DYRC 2L7ZA 4II3A 4EV0A 1X1AA 4R6ZA 4BHCA 3IH4A 3COAC 3JAMN 5JQGB 2NXNB 1N34B 3HPGA 1HR0B 2CO5A 4BR6A 5F64A 1YRNA 4UCRA 5GAGJ 3P9IA 3NQOA 3OMNB 3KYCB 1UFMA 5IJ0B 3GVAA 4UXNA 1YQAA 1WJDA 4GUNA 4DR2O 2HR3A 3R0AA 2VRZA 5KLVH 4UV9A 1QU3A 1TWFJ 3BA9A 4DUZB 2CFXA 2HKOA 3FX3A 4B43A 2XRNA 3FXKA 4X1YB 2ZKZA 3FK7A 5JVTA 1ZL8B 2XT9A 4LOCA 3BG3A 4KITB 2GXBA 1BJZA 3L71H 1P7JA 4HSTA 2UXBB 3LSKA 1OV9A 1ZTRA 5B1AC 4J7JA 4X65O 2L5QA 2H3OA 3ABKC 5CLSA 3TJTA 3D0SA 3CC4I 2DBBA 2M0MA 2XF7A 1VIBA 2VBZA 1AR5A 3D5LA 2KIMA 3CCEV 1P7IA 4Y3OA 2LY1A 3H5AA 3MAQA 4L9JA 1DGWY 5HOOA 2DQ0A 1FC3A 3FB6C 2HGCA 4LIVA 3W3CA 3SPGA 1YS6A 1FFTB 5J1YA 5HFLA 3SPCA 5JVDA 5D8LB 3T4ZA 4GX1A 4OXSA 1BSMA 4DR1O 2VJ4A 5DD8A 2DCEA 4AQYO 1HW2A 2VQHA 1ZWIC 4YIFA 1MABG 2E3CA 3BY6A 3FMQA 2QWNB 4GCZA 1SFXA 4DRXB 1IURA 3H3ZA 3TKYA 1H2KA 1GUUA 1YI2V 4QSHA 2QTOA 3MZHA 1JJ6C 3HPLC 4JI6O 1JHHA 3BR0A 1Q90D 3AG2B 3FYEB 1FFXB 2XSDC 4YRVA 2HQAA 2ZIMA 1F9NA 3MCZA 1FP1D 3E22B 5EEAA 3KZYA 3CD6I 5BMVB 5IY5C 1NVPB 3LSJA 2OCCC 5K5QA 4GRIA 5IYDJ 4S05A 1FT9A 4MW8A 2BEOA 2BZTA 2QEXV 3VYTB 3SDLA 2QQBA 2VKHA 2FYUH 1W4MA 1NHAA 4II2A 4L9VA 1VFCA 4FFBB 4JI0O 2JVDA 3PO2J 4ENNA 3FZVA 2VE9A 3BJ6A 4NC7A 1MNGA 3CLQA 3D1NI 1IN8A 1BMFG 1Q6IA 1XUQA 2LP7A 1VQ7V 3HOYJ 2QA4I 2WLKA 2UXBO 3DTUB 1HW1A 2EZOA 2E1NA 1XX5A 4WFAV 2E35A 4EGZA 3TK1A 3CCUV 4O2BA 2CQKA 4KISA 2VPLA 1GAXA 3DBHB 5LOVA 2VE8A 4E7LA 1KD1W 3W6KB 1RKWA 1YEWA 4FLVA 1Q81W 5JJEB 2NNNA 3VOEA 4KA4A 3EHBB 4DR4B 1RR8C 5F2VO 3N05A 4I99C 2WBMA 4ITVA 3UR3C 4RB0A 3MKYB 5TGTA 5FLXN 1YHQV 3L1PA 1N32O 3UO2A 1I5XA 4ANJA 2Q0AA 2QKCA 1N8RW 3TQNA 3HB3B 1HNWB 1IDSA 3I9V2 4FLWA 1U3EM 2Q2EB 2XTAA 3C2BA 3C3WA 5JR3A 1MJBA 2QWQB 3BC8A 3ZJZA 1LUVA 2BXZA 3R66A 2XNDG 3GLLA 3L73H 3M7GA 4LF5O 1WKMA 2DYSB 5KHIA 4RUFA 1G1XB 4YJ2A 4JPRA 4UB8C 1FPOA 4JI5O 1ULYA 5KVRA 4EM0B 4G9YA 2Q68A 2Y4UA 4DW1A 3JSLA 4UCTA 2FU4A 2QBYA 2B5UA 4F92B 3QU6A 1EF4A 1VQMV 3HJEA 4Z2YA 1MMAA 2A69F 4K0KO 2VJIA 2K1EA 2DN0A 4H33A 1K83J 4FLZA 3OGCC 1J0RA 5CPRB 2QF7A 1G3TA 3BTCA 2WLNA 4DUYB 1O9GA 3OMIB 3HKBA 2VXZA 2CTWA 3K2ZA 4XSXF 4CO8A 4JOMA 2K5CA 4XLEA 1HXDA 4CYCA 1OCZH 4MEYF 4I50B 1ZGJA 1WGXA 1R6TA 4M71A 1JXSA 3JCUZ 1KKDA 1XGSA 4RGXA 1JTYA 3FAVB 3HRSA 3EYYA 1ZQ3P 4LD5A 1BI3A 3K0LA 4ESJA 4G2KA 2QDOA 2MSYA 1LEAA 3WGGA 5K1YA 2XHKA 2CGOA 1FYLA 1Q1HA 4NTXA 2EFQA 1K79A 3SPJA 1XTAA 4RAFA 3JARB 3CCVV 2KJBA 3HG9A 1YI2I 1QA6A 2JTVA 3DF8A 1HNWO 1DF5A 1O3RA 3KP7A 2P81A 2Y69B 2BY2A 3CRAA 2JA5J 2PBIA 2Q69A 2N8GA 2STTA 1K34A 4IHXA 5LMUB 2QGUA 5IDJA 5J8CA 4LF4O 3RTRA 1YX5A 5IJ9A 1W2BU 1S5LC 1GKFA 2NVXJ 3ZP5A 1X3WB 3PQKA 1GXPA 4NDLA 4EJTA 5JLXA 3RWRD 2HJDA 1OZ0A 2QSAA 4XSZF 4B08A 2LFSA 4KN7X 3QO7A 4HZ3A 1KONA 2LR8A 3UKGA 2NOGA 3BDDA 5CVIA 1VQ7I 1Q3EA 5ICCA 1HQCA 1Z7UA 2WV1A 1TGOA 2QBYB 1IZ1A 3W7SA 3JRGA 2UXDB 3CCUI 3GX4X 1JFFB 3KETA 3VQXA 4HV6A 1K5QA 2GUZA 5HS7A 2P4KA 5DEQA 5H6RA 3DXRB 2B63J 2ZD9A 4ENMA 4Q6GA 4DUYO 3WG7H 3ERMA 2V4JC 3QPSA 2X1CA 1DK1A 2ZJRF 4A3KJ 1QO0D 2LG4A 3G1MA 1P84F 2X51A 1WAZA 5IOZA 5HFMA 4UUVA 2Q7HA 4Q47A 3JAKB 1XNRB 1EN4A 4X1IB 1FNNA 2GQQA 2IRFG 4J41A 2R5ZB 4JYCA 2PI5A 3BPVA 3LA3A 4Y33A 2GAUA 1L0LH 1P4RA 1VF9A 3FM3A 3T1HB 1UJWB 1P2FA 1Q86W 4CS3A 3OIQA 4LFAO 2EB7A 3OUSA 4XRSG 5B5EZ 2R0QC 1OCZC 1REPC 3BR2A 1YITV 2ZXIA 4FE7A 2VUMJ 1GMGA 1KZHA 4I76A 2IJIA 2NAZA 4OIPF 4B3AA 3DBLB 4CXFA 4CUGA 1Q5OA 2J5PA 1ZRCA 1MZEA 4D0PA 4R7CA 2XUMA 3FXUA 1I6HJ 2DO7A 3AG1B 1T08B 1R1BA 1P6RA 3V7SA 3EXAA 3HKDB 2M0CA 5JLWA 1S5HC 2KMUA 3OSGA 4LWSA 3P9KA 4IRGA 5GTIC 2WA3A 1Z67A 1PUFB 3G71V 3I0TA 2V4DA 1UG0A 1IRFA 2LYCA 1YJ9I 1Y74A 3CLOA 2ESNA 1YX3A 3UM7A 6PAXA 3WTSC 1G3WA 3S15J 1S5JA 3ROUA 5IP6A 2BTQA 2PGGA 3H36A 4PA3A 5J2TB 1ON2A 1DP7P 4P55A 2IJHA 3BJAA 1XPXA 1RNLA 3T1BA 4ZHQA 1N25A 5E1WA 1B9NA 2P5VA 3U11A 1IXRC 1MBFA 2XAFA 3Q3SA 4P9FA 5KHDA 3S1QJ 1IZ3A 4ZHQB 2ELJA 1XMOB 1SVOA 3BAAA 1Y67A 1ACIA 4H37A 1QBJA 2QKAA 3OR1C 3ABLB 3RKXA 1BIBA 1MJAA 1LFBA 1MKMA 1U97A 2CW8A 3CCVI 1H2LA 3QRFF 1FKAO 5B66Z 1MW7A 3WG7C 2FD5A 2A06H 2LVSA 3A0RA 5IYZA 4TV9B 5KMGA 5C4XJ 2NR5A 3SPHA 4IEJA 1JTXA 2HZTA 3RYPA 2FB5A 2WB1N 2XPUA 1IX9A 5FNVB 2L2OA 1TW3A 2IW5A 1K61A 3BG5A 1Y76A 2A3SA 1F4MA 1Z6TA 5FRNA 4MS2A 1URFA 1XDUA 4G6TB 1X4TA 3EVKA 3E6CC 2UUCB 4GKJO 4M6YA 5A9GA 2LC2A 3DXJF 1HDDC 5GTHZ 4CBCA 2QWPB 3TO7A 1QNMA 3E83A 4U3JA 4GO1A 2R7DA 1IBMO 1SVMA 3ZQHA 3L70H 2LREA 1OCRH 1U2WA 1WJAA 1T56A 2TDXA 4M3GA 4F7ZA 4KMFA 2GOXB 1DDNA 1NVPD 1LQ1A 2JPBA 4JTDB 1BN5A 5FRMA 4P96A 1FY7A 1WWXA 1YW8A 1NQTA 1KBHA 3OOPA 3OYCA 5GAHJ 5IT9K 2BW3A 2LKSA 2Y48A 1VQ5I 1F1ZA 1TNTA 2EFPA 1MD0A 3F9KA 5FD6A 2VOPA 3ZRWB 1EM1A 1V9PA 4I98B 3AL0B 1I94O 3HUGB 3CTAA 2OIEA 2DDAA 3ETDA 4OMZA 4WXHA 4QLCU 2BSKB 2XOKG 4FJCC 5DEDA 2A61A 1G59A 1JUSA 1M56C 2ZNJA 5DM6V 3K57A 4GFBA 4AYBA 2LRDA 3FXQA 1FYMA 1AKHB 3G3ZA 3TGUH 1G4DA 2X7RB 1W7PA 3LSPA 1OISA 2CYYA 3SZGA 4C9YA 3WTYC 1YITI 2YPRA 2RNJA 3AFHA 2VQFB 3QU3A 4C7UA 5KX5A 5L3CA 3V7RA 1XMAA 5E79C 2IEKA 3CMYA 4LF9B 4G8XA 4PZJA 2P5LC 3BROA 4G94A 5FLXK 1LEBA 4CCOA 1X4PA 1DGSA 5GW7A 1R6RA 1JA8A 3RYHB 1HA8A 3RYCB 2MD5A 1K78A 1XG1A 3K1MA 3E97A 4OIOF 2X6XA 2E1CA 2GBYA 3G71I 2HVJC 3ONQA 3CRMA 4PHZA 3EUAA 3DP7A 3M8FA 3LFKA 4QTRA 3W7TA 3A0BZ 3AG2H 3WTVC 3OY9A 4WCGA 1M93A 4DR5B 4TV8B 2H8WA 4AIDA 2IBZH 3HOZJ 2E1MC 5LA6A 2CUJA 2XGXA 1BS3A 1H89C 1PL0A 1E2XA 2QQ8A 5FFZA 4HBNA 2VQGA 5IT9Z 4BHBA 4H13B 5H2FZ 3E8GA 2DMQA 2EIKB 3BQYA 4JI2O 4XRMA 2DWDC 3BZ6A 3HGYA 1RUNA 3KPHA 2ZCEA 3RBZA 5F27A 3T0YA 3IAS2 4GYGA 5EG0B 4YIPA 4WXDA 2EV5A 4PJNA 3V42A 4WK8F 1FOXA 1QR8A 1X4OA 5LP6B 4XRFA 2WAQA 4BAYA 4MVZA 1SD5A 2LY9A 4D5CA 4LR3A 5TISC 2KQRA 3ECOA 3HKZN 3A0HC 3K4MA 1L0NH 4MFEA 1FWZA 2EINC 3PFIA 1IXMA 3KFWX 2IA1A 4CH7A 1MSFC 2KZVA 2RDCA 5FPOA 3K5NA 2R7FA 2JS3A 3OS2A 5FLXZ 3HSRA 1SEUA 2ICWG 4HLXA 1K7DA 4GYCB 4DJAA 4DYRA 4JAAA 3HOVJ 1ZGAA 1ZKGA 2R72A 4NVPA 1JKQC 4LFCB 4B7KA 4FHTA 2L01A 2RREA 2YEVA 4CH6A 2HOEA 3F8MA 3RPUD 3RIRA 2V26A 3QODA 1NTMH 2OF7A 1X1DA 5BMZA 4HNTA 4KUMA 2F5EA 4JI7B 5IWAO 4Y15A 2WV0A 5F0HA 2JMWA 2IS2A 1I08A 4QE9A 3U2RA 4G27B 3FWEA 1VZ0A 1K4SA 4JX4A 2DYSH 4DR5O 1SKVA 3HRTA 5FFXA 3A8TA 2OU2A 2QVOA 5LHIA 3ZRVA 2IU3A 2R93J 3WE3A 3OYAA 4BDZA 3D36C 3FFQA 2NOJB 2DPDA 3QNEA 4WF9V 2E5LB 2MH2A 5LD2C 2CTRA 3L74H 3BT9A 3LSMA 3B6CA 1IDZA 4DV5O 5FL7G 3Q9SA 4F6RB 2DMUA 1EN5A 3AG2C 1FAFA 3ECHA 3H5RA 3GTLJ 4FLXA 3ZXSA 3RN4A 4MQ9F 2GHYA 2W24A 4M3EA 3I54A 3M99B 3S93A 4RGSA 1BHBA 2DWEC 4XN0A 2XGEA 3AG3B 4AUXA 2MD0A 1Z91A 1CEZA 1FS0G 2IP2A 1IF1A 2R7TA 3OTFA 2XGCA 1KKCA 3CCLV 1TT0A 4E7SA 2OIGA 3B4SA 2IT0A 1QVUA 2M6YA 4GX2A 2BVLA 4PA4A 5FROA 1W0JG 3ZIAG 2HFEC 2W82A 2F5CA 2CG4A 3KCXA 2L4AA 4I09A 5K7FA 2M30A 1D8JA 4KHPB 1ITYA 2YIBD 5KA5A 3DC6A 3B2EE 4EJUA 4RWUA 2F1MA 2CUEA 1A35A 1T98A 1W59A 4IXAA 1VNDA 4W97A 4ZJZA 2PJRB 5EGOA 2HS5A 2K3PA 3JREA 4LGWA 1JPXA 3N2KA 1I0HA 1SZTA 1QVGU 5L3DA 3OYKA 1VQKI 3MAJA 4B3TB 1QQIA 2PQ8A 3TMOA 4DQ2A 3I55I 5KAIZ 2Y69H 5DN6G 1WZ2A 2JRMA 2NS7A 3ZQQA 4E6KG 3P3NA 3ZS8C 4N23A 2WTEA 4EEQA 3C1DA 4KXRA 2EV6A 3ZR8X 1B1BA 4DK0A 3KEQA 5BNGA 3OYLA 5D6EA 3SJMA 4JI1B 2KIFA 4HG2A 2LNBA 5D4RA 4FM2A 4X66B 2GA2A 1MNDA 3E1SA 1MNMC 5E3OA 1GO3F 5EBMC 5CBHA 3W2VA 3D3QA 5F04A 3H1HH 3G1OA 2V6CA 4BBSJ 1WA8A 3V8LA 1VF5B 3P7NA 4DYCA 4FX0A 3L7WA 2A5YB 4BUPA 4MEXF 2JK3A 2O57A 3U1DA 3HPHA 2LP0A 2DYSC 2YIDA 2LJ2A 4IZZA 4FZ0A 2GWRA 2QWRB 1Y39A 3T4DA 2HQRA 1L3LA 1G4YB 5E3NA 2UUBB 3X2QB 2TCTA 4E7JA 2M7WA 2R3SA 1WCMJ 3CMEV 4J9ZB 1Z05A 2XB5A 5GPAA 2P06A 2VL8A 2HWVA 3BR3A 4I0BA 4AVZA 2L3DA 2OCEA 2P4WA 5HVQC 4P9UA 4E7HA 1XNQB 4U88A 4R79A 4ZYEA 4M3BA 1EJ9A 4PD4F 2ZXJA 3F23A 2ZE7A 4R8CA 4U7NA 2H09A 2D1VA 1XSDA 2PI0A 2XC7A 2HVKC 2BYVE 4X64B 1QPMA 4XONA 1GVJA 4C2TA 5CVVA 3CC7V 4Y4RA 4QGPA 2H1KA 4P9OA 5M5XJ 2AXTZ 3CB2A 3ISPA 1YW9A 3U9GA 3F0CA 1MA1A 4N9HA 1J59A 3CE2A 2K4JA 2VC0A 2DMTA 5EGOB 3S1RJ 5F0CA 4ZH4F 4O4IA 2L9VA 3S3OA 4WFFA 3GTKJ 3FKJA 4UVBA 4X62O 1N0JA 3O9OA 2ATKC 3S17J 2JGDB 2RJZA 3G6EV 4EATA 2KQXA 3AG1H 4JI3O 2FSWA 1MG1A 2JS5A 3H92A 4L0YB 2AHZA 4JI1O 3JR9A 3HEFA 1ERDA 3E8HA 3M07A 4RAZA 1XS9A 4PELA 1ZYRF 2CTQA 3DFGA 3DKYA 1KUQA 4V2GA 1Z9CA 4AILC 2IVMA 3O8GA 2ODMA 2CMPA 4UY8I 3GZNB 1Y8QB 1R23A 1R58A 1ENHA 2F48A 5D5XB 1PNLA 3K70D 3LOCA 2ACJA 3DPTA 4J9YB 1N36O 4D7TA 1H8HG 4RAIA 4A0ZA 2RMKB 1RZ4A 1BQZA 2ZQMA 2EQRA 2L7MP 4XK4A 1O3SA 1GTOA 2QCOA 4E7IA 3KCYA 1LDJA 1M57B 2L9NA 1I39A 2G0EA 3FD9A 3OYEA 5ITZA 2JRIA 3ABLH 2ZNZA 4CYDA 4LFUA 2XRLA 4LG0B 9ANTA 4IL6C 2CUFA 2PMHA 3K6GA 2A0LA 3P5JA 2LW7A 3JALA 2COBA 1JHFA 2E1OA 2HTJA 5LYJA 2W84A 1M90W 2JJ2G 4UUJC 3JCUC 1MMSA 1G6UA 4A3IJ 1GK9A 3FMSA 2CK3G 3J7YJ 3M8AA 2M8GX 2IS1A 2ZJ2A 2HQNA 1TWHJ 3KIOA 2E60A 2E34A 1IUYA 5GONB 3VPRA 4MVSA 3HHGA 5IOYA 4FT8A 3ZQCA 3KCCA 4IHJB 4MW3A 2VKVA 5IJ0A 1UJ8A 3IP4B 2H8RA 2PLYA 3R61A 5D6FA 4YY3B 2H27A 2O9LA 5CJ9A 3A01B 5E18F 4BQAA 3HKEB 3FKSG 3S2DJ 4DR2B 1Y4MA 4JAVA 2DMPA 2GXGA 2XAGA 1B3QA 4B4CA 4ESBA 1BR1A 1QBZA 5EBLC 4X1YA 4F4LA 1R5HA 4Z1VA 2ME6A 1ZL8A 2MBFA 3H5NA 2A79B 1HNXO 2WWYA 2RVCA 4BDYA 3DGEA 1M56B 4MFDA 4PA7A 2Y31A 3DEEA 4C2MJ 3VOUA 1K97A 1XI1A 3OYFA 3DV8A 1KU7A 3Q0VA 5JCOC 1U5TB 2IPQX 2BHYA 2DK5A 2GZWA 1BOAA 3E8FA 4KFMA 3K5MA 4IQ4A 3T8RA 3GWKC 4FLTA 4J10A 3S2WA 2ZC2A 3S3NA 3BR1A 2L02A 3I4MJ 1SFEA 4B09A 1RI7A 4D7MA 4CZZA 1VEWA 5KUMA 3W6VA 4FLYA 2ZNYA 4FISA 3CHXA 2QA4V 2IBDA 2KKOA 3HZJA 2MC3A 1I6XA 4L9NA 3JSOA 3ZOBA 3RZDJ 1N78A 1AI7A 1K73W 3BPXA 5JFRA 1BC7C 4A5UB 2QQAA 2O7OA 1KYOF 3ABLC 3G6EI 1US6A 3ABMB 2JQ7A 4DYLA 3G2BA 4J01A 2GLOA 2KRHA 1YF2A 4DR1B 2CU7A 5DUIA 2JVGA 2ZBKA 3UQ8A 3OW2U 5CQGA 4AQYB 3CRQA 1LUJB 4HF0A 3D36A 4DK1A 4DRXA 3K5LA 1EH7A 3RW0A 4J80A 3OYBA 4DV2O 2UU9O 2XAHA 3QOPA 2PG4A 4P9PA 1Z3YA 1B9MA 2OQGA 1FFXA 5EK0A 3SDBA 4JI6B 3RI4A 2R7XA 3E22A 4JBAA 3FF5A 3OV8A 2Y4TA 3LSSA 5BMVA 4YY3O 2CDYA 4ZC3A 2VT3A 2Z1DA 1HSJA 4XOPA 4HQEA 4HX7A 3ESWB 3VSKA 4A3JJ 2DFHA 4XICA 3CS5A 2ZFWA 1YOVB 4FFBA 1XC5A 2XDVA 2EIKH 2XHBA 3IC9A 2IS6A 3CX5F 1TVKA 4JI0B 1AB3A 2KP6A 4M72A 5HNHA 4KIGA 3DEWA 1WNSA 4LC1A 2E76B 1WLEA 2LO1A 1QZZA 3K70C 2LH9A 2OZUA 5AIQA 1SC7A 5FPRA 2EINB 3UKMA 3SJCC 1K92A 2W6JG 2EILB 1J95A 3BHPA 1UAAA 1QLEB 1R5ID 3DWLE 3AL0C 5H5NA 2QM3A 2HVQA 1GLNA 3IRRA 2STWA 3LSGA 4Y17A 1ZRDA 4LLLA 2QYOA 4RBOA 2LW1A 2VBXA 1I7FA 3F5WC 5C93A 2F5FA 1S7AA 2VWKA 3ZRXA 2BE5F 3EUHC 1FBQA 4DBRA 2D1HA 4KL1A 1DQUA 2ITDC 2M45A 4BWAA 4DR3O 3MD2A 1ZTEA 3A02A 4C3JJ 1N32B 2X48A 1V5EA 4CHUA 3R60A 3MZYA 2Q2EA 4XKWA 4F55A 4L0ZB 1YSCA 5BR8B 3CCQI 1GM9A 4X6AJ 3ZMSA 3OGIB 4A6EA 1CQTA 4IYHA 1XMQO 4YFKF 3TOAA 5JH7B 3EQLF 3TGNA 4GT1A 1EZJA 3MDSA 2DJIA 5E8GA 2ILMA 1UHMA 3LSQA 4BY1J 3QQAA 1LE8B 2R70A 2JSCA 1ETVA 1SQBH 3E89A 4LF5B 2WPDG 2B9SA 1SVLA 1B6QA 2H6BA 3K59A 3WTZA 4JI5B 2L4MA 5C8YB 1T95A 5EEHA 2HJFC 2ZSHB 2V79A 3KE2A 3ZGKA 1XCVA 1YFHA 1HCRA 1NU1H 1WPBA 4IYIA 5L3EA 2FX0A 1MZBA 2R7RA 3E6DA 4A3CJ 1JUMA 2NRAC 3DSQA 1DPRA 1X58A 4QWQA 1WN7A 2QM8A 2VQEO 1J9IA 5IT9N 5FKKA 4K0KB 2JT1A 1BOBA 1TVKB 1S3JA 4X1KB 2DA3A 3DBRB 1O7LA 1K9MW 2VXDA 3AG3H 2YICA 1QGPA 3HOSA 2AXLA 1YW7A 1SA0B 2EIKC 1SQVH 4YFNF 1G2HA 4ETSA 1LPQA 4I50A 3WU2Z 2KB1A 1HDJA 3SJQC 4DV4O 3R6SA 3H9GA 3NRVA 1SD7A 1I5YA 2E2IJ 2N04A 3FAVA 1JGSA 1ZX3A 3CCRV 1SC5B 4ZDOA 3FBIB 4EJVA 2PI4A 5LP6C 2GM4A 1K4CC 2AZ2A 4PCQA 2BOCC 2ZXWB 1X3ZB 4LF9O 3RPUA 2K40A 3JARA 1DU6A 5IYCO 4FK5C 3JCZA 5BR8O 2CRGA 2M87A 3L9DA 2FKXA 2FBIA 3NXSA 4XOTA 4LFBB 4K3AA 1U8BA 2FXAA 4GX5A 3BCAA 4O4HB 4I5SA 2QR4A 3BZKA 4UNOA 1M5IA 4N0BA 1ZRFA 2PTMA 1QVTA 3CJNA 1A36A 1TWGJ 1R1TA 2GSMB 4ABZA 2AGAA 3PN1A 4X88A 1RRJA 4LF4B 1TWAJ 1NG6A 4R8HA 4BH9A 4BIZA 3ZMDA 3WHCA 5F6FA 4D1QA 4O3MA 1M4UA 2DMNA 1VF7A 3A0BC 1BI2A 4UV8A 4A3MJ 2DDBA 2Q9LA 2IA0A 2QWWA 2BY0A 4NC8A 1IN7A 3REOA 2VWJA 5LGTA 3FM5A 1JFFA 1YJ9V 3X2QH 3DXRA 2NVYJ 5BOXA 3BFRA 3PJRA 2Q7GA 1OPCA 3CQZJ 3MD0A 4I9QA 2Z33A 1V3FA 3GUDA 4LLGF 3SQNA 5H2FC 3J7AY 2JPCA 4U3FH 1PPJH 2IXSA 3E7LA 4LNUA 5FLMJ 2RGVA 1ZH5A 2R92J 2HEOA 2WLIB 1FYJA 4IJAA 2QE7G 3OIPA 3K04A 2YIBA 3JAKA 2DA7A 3DKXA 3ZMTA 3BR5A 3OWTA 3CMAI 2QM7A 4X1IA 1A31A 1S72I 4RS8A 5F1JA 1X2NA 2R5ZA 1MH3A 5LGNA 3AG3C 1Q43A 4X66O 3D5SC 2FQ3A 1S8NA 3PM1A 4GYIA 3OYHA 5JVGF 1R6KA 5D5PA 2XV4S 2CUZA 4GDFA 3JASB 2M2EA 4PFPA 4CCMA 1F4KA 1XSVA 1RR7A 4HDVA 4XLFA 3U0ZA 4LFAB 2O0YA 1D0XA 3RYFB 1QU7A 4LFBO 5JWPA 2KFDA 2YI8A 3HOXJ 3G80A 3LDCA 5E8IA 1DUXC 3OM3B 4JI4O 3PO3J 3AK3A 2XPWA 1NBMG 2EK5A 1YO5C 3FIWA 3HKDA 3AG7A 1BR2A 2KDOA 4LMYA 4JI8B 4BEHA 1U9OA 1OHHG 1PUFA 3WGIA 4DW0A 1B8IB 2HVSA 3HOUJ 2JEUA 1E1RG 1B4AA 5IYBO 4WWCA 2MC4A 4PJMA 4FASD 2PY5A 5JCOA 2JWTA 1U0JA 1ETWA 2O5RA 4D5FA 1RPOA 1HOMA 4BNCA 5B1BB 4AIKA 5B3SB 5J2TA 2QUFA 5K7HA 1KMIZ 2K27A 1WB7A 4MVMA 1X1PA 4R1HA 2BBYA 3QPLA 2BCCH 3RVZA 1Z1DA 3TP0A 2KDZA 2CQ7A 3WGHA 3OL4A 4HLYA 2Y9YA 2DOFA 2Y9ZA 3C7JA 2Q73A 4FVMA 4JZ2A 3CCRI 1PVEA 2MH9A 2KLOA 3DEUA 4M3FA 3AK1A 2RKHA 4I0AA 4J7KA 3ZHQA 3DU5A 4NXNB 3MKWB 5EZYB 5LXTB 1X1CA 3A2KA 4LNUB 2G38A 3X2QC 1VQ5V 1S7OA 3GBGA 2PFBA 5DDGA 1OJHA 3CXHF 4HSRA 2UUCO 1MDMB 2L7KA 1JR9A 4IT5A 4GLXA 1BM9A 1H9GA 2OV7A 5J1RA 3I5UA 3LSRA 1JVMA 1F5TA 2V1UA 4TV9A 3VQVA 1B06A 1GH6A 1MSWD 3L09A 2FBHA 2NVQJ 1I1GA 2X6YA 5FNVA 3VWBA 1IXCA 2AO9A 3TDUC 3WHBA 2R7VA 1CP9A 1MZFA 2FBKA 1T2KA 1I5ZA 2VOOA 4YELA 4ZDLA 3ZCOA 4G7OF 4QE7A 2PYJA 1D1CA 3FX7A 1AVMA 4XQFA 3I53A 3S14J 4CH4A 2D2CB 4EM1A 3BCCH 2HYGD 1HBXG 3RYIB 2HTSA 3G6BA 3JD0A 3A03A 1NKDA 3K08A 4FM1A 2DA1A 4GKJB 4JI8O 4E70A 3CUOA 4HRIA 1BI1A 5EEGA 3S1NJ 3E8BA 5KAIC 4Q48A 1YVWA 4TT3G 4E2LA 2WAEA 4BEHB 1SZXA 4DR7O 4C2UA 3FXJA 2LBFB 5IP7J 5HDNA 1IBMB 2IU0A 1GN4A 5KAFZ 2D3OW 1WJFA 1ETKA 3GVMA 3BLYA 2XSJC 1U78A 1YIOA 3DKWA 3FHZA 3LSIA 4TSFG 3ZRWA 2E75B 3EUKL 2IJKA 1LDKB 1V5FA 2UV1A 3H01A 2OYQA 1UELB 3HUGA 2RV8A 3AAFA 4HYOA 4I4TB 2IGNA 1T33A 3L75H 3AKZA 1VARA 1QNTA 2BSKA 1T0FC 3PQJA 4NHJA 2M4KA 3Q4HB 1YS7A 3WTTC 5BPDA 1FOKA 1FSEA 4HNVA 3J80N 4NXNO 2XF6A 3EUHA 1AKHA 1HWYA 4O6JA 4AD9A 1IBLO 1ONVA 2VBYA 3S3WA 2FJ1A 3N97A 2YUAA 2X1DA 2PUSA 4GZRB 3M8JA 1RETA 1BL0A 4H0EA 3W2AA 3CJHB 1YJWV 1M57C 3K7AJ 3VBBA 4WFEA 4YHHO 2XGDA 1TLHB 4D9JA 3M1EA 1TUEB 3RSNA 1RSOB 2LQTA 3ABMH 3RYHA 3RYCA 2YI9A 1SQPH 2M3AA 4OINF 2EPFA 3IRQA 4P5OA 3O65A 1Z21A 2DK8A 4LK1F 3G1LA 2RNGA 4IGGA 4XNFA 1AI4A 5CVUA 4O2AB 3WFVA 2ID3A 3U10A 2QQ9A 4D7SA 3L72H 3B77A 5HS8A 5DECA 2BHZA 4AC0A 5FD5A 3PIPF 1V55B 4TV8A 4NB5A 4MT8A 1ZGWA 4IIJB 1MMGA 4UFZA 1VTNC 2XF5A 1FBUA 5HS9A 2A9HA 2OT5A 3SEQA 2RN9A 3HGGA 5LEJA 4MLOA 4BXFA 3QYFA 3KYLA 2DQRA 2ZE5A 1EH8A 4KFCA 1XOUA 3K10A 4RGRA 3IJ4A 4O4JB 5FO5A 2X6AA 3HOWJ 3P32A 4GXOA 1R5GA 4OIQF 4JI2B 2HZDA 1R71A 3UCSC 1D0ZA 1H2GA 3DPUA 5DCFA 2LK2A 5EG0A 3T1YO 2GIZA 2WC2A 3HHHA 3PL8A 2EZPA 4LP8A 4IF4A 3QOEA 2EINH 3AG4B 3SYCA 5LP6A 4EEFG 4PI0A 4NTYA 3GTMJ 1HW5A 1COWG 1FTZA 3F5TA 3QYEA 3JSPA 2EILH 2JUCA 4YXWG 2CV1A 1FXKB 2WWWA 1D5VA 2V7QG 3K2AA 2FNPA 2RDPA 4E4HA 2UUAO 4JYAO 4PDKA 4UVAA 1LNQA 1IUFA 2HYJA 1U5TC 3KZIC 1WI3A 3BABA 4EM2A 3A1YA 3I59B 1FPQA 2AHYA 2COMA 5AG2A 3TXQA 2HKXA 1X1BA 1RKTA 1XBLA 3MHHC 3M1CA 4PDLA 2R7QA 5EYRA 3PJSK 2YIAA 1UCRA 1USSA 3FYIB 4N4NB 1MH4A 4LF8O 4BJ6C 4QPKA 2F6CA 1KA8A 2LD5A 2C2AA 2XAQA 4JV5O 4E7KA 4RQEA 4JGSA 2GTAA 2DI3A 1E79G 2F23A 4JYYA 3K9AA 3ABMC 1ZLJA 5IWAB 5BZBA 4M9ZA 4BXXJ 2YS9A 1KQ8A 1VQKV 1HKSA 3B73A 4XN3A 3U1KA 3LSHA 1QR9A 3I55V 4PA6A 4ZOLB 2FE3A 3H1JH 4RA2A 5AONA 5DM7F 4F6RA 4GKKO 4JTCB 1KGSA 3ZBHA 5K1XA 3ZHSA 3K4LA 4DV5B 1XREA 4ICGA 5HLGA 2JRTA 4XRSA 4IQJA 4B44A 3JRHA 1DP3A 1EFRG 1SQXH 2ETNA 2P22C 4H0LB 1V54B 4XBFA 1I27A 3D8CA 1QRYA 1NT2B 3FXOA 3CJRB 1QPIA 3F7VC 1IAWA 2FMLA 1R73A 2K3FA 2LF7A 3GMEA 4KICA 5LGUA 3H9JA 1O3TA 2EX3A 5C3EJ 3FISA 2P67A 5BS6A 1YJWI 1H0MA 2DPUA 1XDCA 2KG7B 3UO3A 4AIJA 3GWOA 1XDSA 1FOYA 1QZEA 1V5GA 1WVRA 1SAXA 2NVTJ 4FQGA 2HDDA 3I56V 2XASA 4OAZA 3CUQB 1FXHA 2O6GE 2HG5C 3QP5A 4MSWC 1IRZA 4UUSA 3I64A 3KKYA 3SGIA 4KN4X 1D8KA 2ZXWH 1A04A 5GP9A 3DCFA 4W4KA 1KB9F 5CA0A 2PJRA 5HLTA 1AWCA 3WE2A 5ERIA 2EILC 2VB6A 3RCOA 1QLEC 2HQ5A 3BEHA 3JATB 1O9HA 1AHDP 2IS4A 1PP7U 1ETQA 3K4BA 1K6YA 3IAM2 5D4SA 1XSXA 3LA2A 4CICA 1AP6A 3I5DA 4M9SA 3RQIA 5LRRA 1TP4A 4LITA 3J7AO 3PSFA 1JJOA 2CUGA 2Q6AA 5K1PA 4S04A 4RB2C 2XAUA 3L9FA 1SMYF 2H6CA 4M3DA 3F21A 3GFMA 5KNLA 2UZKA 1AOYA 2E5NA 2H1LA 3N27A 2V1NA 3ZX6A 5IYBJ 4Q5SF 3CYOA 3ASOB 3HOTA 4WBNB 3GZ5A 3ASNB 4TQFA 4MVQA 4AWXB 1M1EB 3V4GA 5KHGA 1FJLA 4K8XA 4HZFA 2GA1A 2D5VA 1NK3P 3LQRA 2A3QA 1LKXA 2KT0A 1YG2A 3A4CA 4L87A 1B59A 4HEA2 1OYWA 3LAPA 1GM8A 1FIPA 2GOMA 3V8JA 4LF6O 2PEXA 1Z5VA 2WLJA 3AEIA 1MGTA 2XUBA 2CV0A 2YC0A 1PNKA 3H1LH 1CGPA 2MW2B 3WU0A 3CCYA 3K06A 3H1CA 2IGMA 5BXZA 3OSFA 2ZIOA 1GVDA 5LRSA 4X20B 5DM6F 1JT0A 3QF7A 3UT5B 1YE9A 2EBIA 1U8RA 1BIAA 1G3SA 4DV7B 1P49A 3BCBA 3QYBA 3TXSA 2HDCA 1TWCJ 3K58A 1Y56A 2VKEA 1D5AA 5JJNB 3HSEA 3ZMUA 5HODA 4KNYA 2EBOA 2X4HA 3Q5FA 1NR7A 2DFEA 3GO5A 1SFKA 1IJWC 1IN6A 4ZYDA 1OMIA 4UUSB 4B7EA 4TUYB 2Z0AA 3F8CA 2R7WA 4Q4ZF 2UWMA 3SYQA 2P6JA 2V9KA 4PI2A 4EJWA 4YJ3A 4C3IJ 3JW4A 4NNJA 1I50J 5EC1C 3OR7C 5IY5B 5EBWC 2IGOA 1SQFA 3B8NA 3KLOA 3FXRA 1A6IA 2JGDA 2ZXWC 2B0LA 4WXCA 2MA3A 3BP8A 1FIAA 4X62B 3H3VK 4ENJA 4EFBA 3V8KA 1LFPA 2AZ0A 3I3LA 4X0GA 4FCYA 3SDGA 3JRAA 4JI3B 1FLIA 3O8HA 3PUFA 1WPXA 2X85A 1Z0XA 2K7LA 1Q8IA 3RKYA 2RCVA 3APQA 3BR6A 4I7HA 1FP2A 3VFZA 3S1MJ 4UCVA 4XMYA 3BG7A 1A5JA 4DZJA 1T0FA 5B3SH 2L35A 4X89A 2Y0PA 2CQNA 5B1BH 1MSDA 4XLNF 4JZGA 1CXZB 5IP9J 5HDGA 4ZI7B 4NC6A 5CBGA 4RMNA 1VQNV 3GWZA 3KP4A 1N36B 3BTLA 4FTHA 4PDMA 2CH7B 3M4OJ 4K35A 2Z16A 1FYKA 1POGA 2NYXA 2DOAA 3I56I 1GN2A 4PJ0Z 5LMNO 4KP4A 1YJNV 1HNZO 4U87A 1BHAA 4A2UA 2AHQA 4PK4A 4B1RA 3NR7A 4HNAB 4BJ5C 3J80K 1MBKA 2ZJQF 3KP5A 2Q7EA 1IXSB 1H9TA 2Y0MA 3L2WA 2LKXA 1YIJI 3TOBA 3R4KA 1WI9A 1V4RA 2ELHA 1F4NA 3EPZA 1JT6A 3NEUA 4MGRA 4LG0A 5EDNA 4HDUA 4DV7O 4U7DA 2BOLA 5HNFA 3QO5A 3MVPA 1NZ6A 2LFRA 3WU2C 1H8EG 4DO2A 2A6TA 1R4MB 1QZYA 1ZG3A 3ZCCA 3VQWA 2LKPA 1ZR2A 5J4YA 2LY2A 1STZA 1RM1B 3MFKA 3ZQ7A 5KCMA 4IHTA 5GONA 2HVRA 4L8JA 3O3KA 1RESA 2LLKA 4RO2A 4A3EJ 4A3DJ 3C3SA 3GW2A 1K4DC 3EFFK 4IHJA 1X3UA 3U21A 1VQOV 1FMVA 4I55A 1TZLA 3KP6A 1CF7B 2H8PC 1ZK8A 2X9DA 3RJPA 3A01A 3FB7C 3HKEA 3B09A 3H35A 2QKMB 4IVNA 1LFUP 4ZTFA 1IGNA 1P7BA 4ZKIA 2ZM6B 2K9LA 1UZCA 1QVFU 1K8AW 3OR6C 3E5QA 2OTLI 4G12A 3WU1B 3JYCA 3JD1A 3SYOA 3GFIA 2JJ7A 2QSFX 4HOBA 2OBPA 1BGYH 4FM0A 2VI6A 1CPYA 4H4KC 1HNXB 4L5EA 3CF5F 3LMMA 3WG9A 1U5TA 3CC2I 2YSRA 2EIMB 2KSDA 3TO6A 5CA3A 1R1UA 3J80Z 5B3SC 1W36D 1Q82W 4MTEA 1E0EA 5B1BC 3T2MA 3OEEG 1P4XA 4OGQB 1AJPA 1HSTA 2AQEA 2ZMEB 4GCVA 4A12A 1MBJA 3BG6A 1SAUA 2TRTA 1X19A 1MSEC 4FMTA 1D1AA 2EFWA 3VSLA 3NAUA 2ZE6A 4CCLA 1VQ6I 3SYAA 2DT7B 5M3FJ 2WB1A 1BJAA 4IOAF 3SZPA 1GN6A 3ABTA 5EYPB 3SR2C 4N4OB 1SS3A 2XVCA 2QWOB 1TNSA 3OFNG 4ZYHA 1ON1A 4EKWA 1X59A 3JRFA 4AU7A 4M6VA 4BIUA 2IGKA 3GCMA 1JJ2U 4AIHA 2K4BA 1Q6HA 4HW0A 3UNGC 3ZN0A 4LLNA 3W7UA 4XL9A 1FD9A 5D5QA 2RNBA 4IHYA 1Y6XA 2ESHA 2CW7A 1JI8A 2IA2A 1IBKO 2NVUB 1VF6C 1V55H 3R0JA 2UXNA 3GTJJ 4A6DA 5KHJA 4DV2B 3BQZA 3E0JB 4I2OA 3B40A 4JASA 5EC2C 1ETXA 4F6EA 5KA6A 2X6CA 2FNAA 5E79Z 3CCQV 2F4VO 3CP8A 4I55B 1ZAUA 1OR7C 3STZC 1G3YA 3TP3A 4JX5A 2HHHO 4V19K 1VQNI 3K0DA 2IAIA 3MMYB 2M34A 5EZGA 4YIRX 3CCSV 2ZM6O 5DV5A 1QCEA 5CA1B 2JN6A 1YJNI 1VI0A 2PF4E 2VQCA 4IHSA 2KIUA 4B3MO 3MZ8A 4UCOA 2F5DA 5LHGA 4NQWB 3GEZA 4LIUA 3DLAA 2LFBA 3P30A 5CQEA 3AG4H 5A2QN 3VB2A 2CGPA 4EFEA 1XB4A 1WJBA 3LNQA 3E2EA 1OYYA 4BY7J 4O4LB 3N2GB 3G4SI 1JKOC 2ZNIA 3JAWB 2EJRA 3OOUA 2RQPA 1JQ0A 4LBEC 4XIDA 1O57A 1OQYA 2ECBA 1OLTA 5H20A 1VQLI 1XL4A 3L2RA 1PNMA 5B1OA 4CCNA 1NTKH 1J75A 4DV3O 2XAJA 1F23A 2F43G 2QLZA 3OYDA 2DLLA 3J81N 4OU0A 5KUKA 3V7CA 3SYTA 4B3SO 2FA5A 3CO7C 4A5NA 5L3GA 4BE1A 1T39A 1OCTC 3H1IH 1WPKA 2DA5A 2RN7A 4BBRJ 3Q0UA 4DR3B 1VQOI 2X6BA 5H9CA 1MBGA 3F6OA 3ABUA 2HI3A 2Y30A 2WADA 2R5YB 1OCPA 4MQVA 2HPMA 2DE0X 2UXCO 3HB9A 1WFXA 1DU0A 4CC5A 5JH7A 1ETOA 2W00A 3FXMA 5F0FA 3A0HZ 1NTCA 1G8MA 3QG5A 1XMQB 5B5EC 4PGHA 3FB5C 4K8ZA 4DYQA 1LE8A 3TCUA 4CSWA 2F4MB 3ZQLA 4LB5A 2GV9A 2B1IA 4PSXA 3M8EA 1AJQA 3CZ6A 4M6XA 4HV5A 1YLFA 1OFCX 5C8YA 1Q6UA 1XGNA 4XR6A 2NS0A 5HDKA 1V55C 2E36A 2BGCA 1EZVH 2KKWA 3ZEDA 1D5NA 4DV1O 1WHUA 2V1DA 4MTFA 3F8NA 5KAFC 1V54H 2VQEB 4EJOA 4A3GJ 2CS3A 2HPIA 4OIRF 1MNEA 2L6LA 3ETGA 4X1KA 5AIPA 4LK0F 4U0WA 4ZTJA 3P9CA 5JJJB 3HKZA 4X1EA 4WCEV 2YX7A 2FMYA 1SA0A 1PJRA 5CA0B 4NXMO 2ZDIC 2P6TA 4Z2WA 1B72B 3S8PA 1TW2A 2WLLB 1YDXA 2NNUA 1SERA 2XKPA 3TL4X 3I71A 3SXYA 1W36C 3HC7A 4J42A 3C3TA 3WB2A 4DV0B 1XQ8A 2KZGA 3DC5A 1WJEA 2P7VB 5ILSA 2DQ3A 4DV4B 3AG4C 2BY1A 4A5MA 3AK2A 5M5YJ 2P4VA 2JSPA 3E86A 1OCRB 3CJTB 4TV7A 5GAEJ 4HA8A 3DTIA 1T6SA 1E3HA 1FXKC 4P30A 1W5TA 3T8TA 1BA5A 1IN5A 1I3QJ 3VYSB 4PA9A 4UB6Z 3CMAV 4YJ3B 3STLC 3VYUB 1S72V 1ETYA 5B66C 4O4HA 4EB6B 5DCMB 3RGBA 2D2WA 1XCBA 5DD4A 2DN9A 2M1BA 2EFNA 2EIJC 1BCCH 1FBSA 2P8TA 3MQ0A 4ZBMA 4R50A 4ABMA 4PJJA 3CCSI 4D6TH 1U9NA 1IDYA 1MIJA 5LFAA 1PM9A 1TUBB 4OX9B 4AI8A 3MHSC 2E5ZA 1SFUA 3ZHRA 3ASOH 5E3MA 3ASNH 3KYDB 1R3KC 3IH3A 4UB8Z 1E3PA 2W85A 1QHTA 4LB6B 1K33A 4BW5A 3BA8A 4F52A 5GTHC 3E35A 3K69A 4UVCA 3CRCA 4AYBN 5ILUA 1R36A 4B48A 2FTKA 2R9IA 3K3WA 4I0XB 3T1CA 1LDDA 3HM5A 3E6MA 1H2MA 1WH7A 3JRBA 2ZFUA 3TETA 2K86A 2MLGA 3CMMA 3PIOF 3OTOB 1BW5A 3KP2A 4MTDA 1S9HA 3L00A 2WLIA 1R1VA 1IV6A 2E7XA 1PKXA 4CZCA 1W0KG 2ADQB 2OQRA 3JRCA 1V54C 4OPAA 1ODDA 3GFLA 4DV0O 3RDIA 3ML6A 5JI6A 2UUZA 1N34O 1MBEA 4G7ZF 1R3JC 1HR0O 3PFYA 3OS1A 3I4PA 4PGGA 1YZBA 3HRUA 1YRNB 1S77D 3JASA 2JUGA 4OWRB 1K5SA 1JKRC 2I8DA 3LSTA 4XKVA 1P7GA 4DUZO 2EFOA 4BU2A 4MVRA 2ELKA 1KU2A 4HAMA 2MABA 4F91B 2KHMA 2BOBC 3CUQC 2BTOA 3BPZA 3BVOA 3RYFA 3EYIA 3BTJA 1RPWA 1TQIA 3GTQJ 4FLUA 2Y0SA 3P3PA 2I5UA 2ZR2A 2EWNA 3BTIA 2CTPA 3QWLA 4JQFA 1O4XA 4EGYA 1GT0C 4ASNA 4HBLA 4IO9F 4JI4B 4WFHA 3T5XA 3LDDA 1HF0A 2H94A 5E1ZB 5J47A 3W7WA 2ZCWA 1B8IA 3IWZA 4L9TA 1Z3XA 2IM9A 2WSSG 4OX9O 2OWOA 1HDPA 4IOCF 4IHVA 2X6OA 1E3OC 2O3FA 1EBOA 3K9SA 3BOQA 5CN0A 2GIVA 3EETA 1JCHA 2CWEA 1LVKA 4RLQA 2QSGX 2O61A 2WAQN 5BQTA 4BHPA 4XKBA 1J5EO 3J7AU 1MMNA 4BE0A 2WA4A 1L0OC 2CE4A 3ASOC 1HKTA 5JVDB 3ASNC 4DXWA 3ETQA 3MKLA 3E5UA 2JA7J 3VYRB 1EA3A 5J40A 3BWGA 2R7SA 1HC8A 5J8FA 4TWKA 3OTOO 2PMZA 2VKDA 2E2HJ 2HU9A 4CCJA 2JVHA 5TRDA 1EN6A 1T5EA 1QHGA 1ZAOA 2M9HA 3HRMA 5EZYA 2EJ7A 1ZLZA 5LXTA 1QLNA 2DFFA 4XLCA 4DW6A 1YTFB 1R6NA 3DU6A 2GXAA 1W0TA 2MGQA 1MDMA 3K9TA 2L54A 3OYGA 4B8XA 5CKTA 2Q8KA 3ZHVA 1Y8RB 3S16J 2F4IA 4I02A 3JRDA 1GN3A 5D5VB 3LWFA 3LL7A 2ZXHA 4LH7A 4UCSA 2P6SA 4U7BA 4DIQA 3L2CA 2PJPA 2Y2ZA 4BYYA 1OCCB 3LDEA 3LUTB 2VQLA 3OMYA 3VDXA 1ZG5A 1TQMA 3OL3A 1NK2P 3HTUA 3ERED 1VF6A 3H1KH 1P4AA 4KIBA 4CA0A 2YU9J 3WTWC 2A05A 1XHZA 1JMKC 4Z1MG 3KZZA 1OR7A 2LTPA 1IG7A 3HTSB 2OPTA 2BXYA 2FEZA 3Q0WA 2JZYA 2KRFA 3F72A 4QPQA 3L2VA 3CCEI 1NR1A 3RYIA 2QZ8A 2W0XA 5GADJ 2KPMA 4NTWA 4DBQA 1UHWA 4P1WA 5J9PC 4RAYA 1EKEA 1AA7A 4DZPA 2HLDG 3CRRA 4IL6Z 2K02A 2OA4A 1SQGA 3FXLA 1XILA 2DTZA 2DQLA 2LBFA 3VEPA 4O2BB 3NARA 1G6NA 1MJ9A 4KMUX 2ZB9A 3OEHG 1NJIW 4DR7B 5TJJA 5LOVB 3F8BA 1R3IC 2QM4A 1N33B 3S2HJ 4RUEA 1J2XA 3OYJA 4DR4O 4QNHB 2A07F 1WJZA 3FK6A 2K85A 4MTOA 3CO6C 1C0WA 1ZUQA 1P4WA 4HQMA 5ILVA 4XLHA 2VS0A 1T38A 3IGAC 1ZHFA 4ZDPA 4WX9A 1K4TA 4I4TA 3PNTA 2EIMH 2MG4A 5C44J 3OIOA 4EVIA 3Q4HA 4I7ZB 2W48A 4XDLA 5EF6A 5A2QK 1K7AA 3QAHA 1BI0A 2B1GA 1WQ2A 2CH0A 4XKCA 3ZRGA 1TAEA 2VONA 4JK1X 3JRIA 2HOSA 1I3AA 3H9QA 3OT7A 5LLQA 1AR1B 1KC8W 2PX9A 1OYIA 4KYWA 1PL4A 4OMYA 2QEXI 2GDSA 3C2GA 3OUFA 1IBLB 3CJHA 2DA2A 3EDPA 1UG2A 2W25A 2A7WA 3SEZA 3LSUA 4J00A 2Q5ZA 4MIMA 3IAYA 2CW0F 5E20A 4BJTA 4M9XA 3LA7A 5K5RA 3J81K 3HL2A 2VODA 4H44B 4YJ2B 1EH6A 2FQ4A 4L5IA 2K9QA 1RSOA 2BE3A 1BR4A 2VIXA 4U0YA 5CVJA 3LAJA 2G9WA 4RB1A 1Y1WJ 4YHHB 4XDJA 2OUMA 1FEXA 2BY3A 1AILA 1Y0NA 4N9IA 1BT8A 4HF2A 1ROPA 3A2FA 3OAAG 3R65A 5J4VA 3CESA 4CS2A 4IX7A 3K4KA 4O2AA 2Z99A 2A68F 4G7HF 2R7UA 3E6BA 2O03A 4YIOA 4MO7A 3JTGA 1SF9A 4MHGA 1I1SA 1N4CA 2ZE8A 1ZELA 3J7ZI 4E4EA 5CB4A 2HP8A 2QGNA 4IRIA 1RM1C 4MVOA 4JX6A 4IIJA 3HKBB 3OMAB 2X1EA 1YHQI 2F5VA 4ESFA 3GYHX 1ZLKA 1Z6RA 1ZN2A 3K1PA 2DA4A 4CYCB 3N4MA 1T8IA 1N33O 3ML0A 4O4JA 3G73A 5LL6Y 2JDIG 2W1OA 3SPIA 5B1NA 4JYKA 2ZDIA 3I4NJ 1BL8A 1NTZH 3HYIA 4PFOA 4B47A 4ENKA 2M7BA 1WP7A 4KDPA 1KU9A 2ZO4A 3GXOA 1R9TJ 5A2QZ 2DOSA 5DS9A 1PDNC 2BV6A 1AR4A 2CSOA 1KYZA 2VLAA 2M5WA 2YS8A 3T1YB 1WJCA 1DGRM 2NLJC 2YXHA 4BS9A 4TOIA 1JJ8C 2N05A 3ZMZA 1FXKA 4DR6B 2KJCA 4FETA 2W7NA 1UPGA 3SJAC 3ICXA 3JAMK 5LMUO 2ADUA 3PNVA 1TC3C 4MNUA 1NS1A 2PMUA 4PJ0C 2EIMC 4JYAB 3J81Z 2UUAB 3BG9A 1IV8A 3I59A 1VQMI 5IJ9B 2Q4PA 3I58A 2DTRA 2W0FC 2ZMEC 2JIZG 3KG2A 1GV5A 2DMXA 2W6IG 1S76D 3RKWA 2DT6A 2HYFA 3APOA 4HYEA 2ME0A 2XKOA 2LGWA 4LF8B 2UXDO 3L2QA 4ON0A 2R7ZJ 3CCMV 3OYNA 2Q0OC 4NR1A 4JV5B 2L9SA 1XGOA 4LH6A 2DAOA 1O7FA 2GUZB 2ZSIB 2HEPA 5C4JJ 2KRCA 2AXTC 3FBNB 3QP6A 1TL8A 1SQQH 1YXBA 2AS5F 3RPQA 1TTYA 2WY7Q 5CMUA 1D2DA 3GFJA 2NNYA 4ZOLA 2EZKA 5CB4B 4HPQA 2E74B 4FZ1A 4UCUA 1OCOB 2OCHA 4BW9A 5L3BA 1XNRO 1WRJA 4XLAA 4CDGA 1L8DA 2OTJV 1WP8A 3S3MA 1GV2A 2L9RA 3T1HO 2OAZA 4GKKB 1AU7A 2NN4A 4RM3A 4U7OA 3H3UA 2RQQA 1KP3A 2C6YA 4ZIBA 1KQSU 2PYLA 1U96A 2DYRB 3H9VA 2R9AA 1UHSA 4KT6A 1VMGA 3DTKA 4JP0A 3E5XA 3PSIA 4LJZF 4W1UA 1H88C 1JKPC 3JAMZ 2EZIA 1AP5A 2KG7A 1LVAA 4KJZA 1ZSPA 4FPPA 4PV1B 1BC8C 1AJNA 2F95B 1VQ9V 4DR6O 2P90A 4FIPC 4Z6YA 1XGMA 1HLVA 3CUQA 1XHXA 2E7WA 4ZYAA 2VASA 4BQNA 1VQ8V 1JOYA 4LWSB 4QPOA 4EQQA 1FMWA 3OR2C 4EMSA 4A3BJ 2YUSA 5E17F 1Y74B 3QPHA 4LG3A 3IKTA 3HDDA 3JATA 1J09A 4O5VA 2EIJB 2ECCA 5IYCJ 1DLBA 3ZQGA 5B1AB 3D3IA 4IHWA 2KIQA 3TO9A 3ABKB 1MBHA 1WJ5A 3W6JB 2BTQB 2J5OA 3MKZA 2A6HF 4QJFB 3F8FA 1W0UA 2R9RB 2V9PA 5D5WB 3JTHA 1XMOO 4DNCA 4Y52J 1YCIA 1OJLA 3WTXC 3HKCA 3GTPJ 1PP8F 2EZHA 2VPRA 2YXYA 1D3YA 3IHUA 5FGMA 4PSWA 5D8KB 1IC8A 4FE4A 1K6OA 2IH3C 4X8AA 4B3RB 4YFXF 4WBNA 2IJJA 2FOWA 2CQXA 1NH3A 5EZHA 2N74A 4GX0A 3HBLA 4DOZA 5DTDA 2RQ6A 3ZHUA 1SANA 4KT5C 4RGUA 5LEKA 1IRGA 2X0LA 4BACA 2K9SA 2V6EA 5IYZB 4HNUA 5KMGB 1VP7A 4C30A 1ZG1A 2V9VA 4XM3A 1F51A 2P5OA 4LF6B 4I6ZA 1X2MA 1BBYA 1HKQA 3SFZA 4NUBA 4IKFA 3FDYA 2DXIA 3PNYA 1TT5B 3IWFA 1ZR4A 1B6AA 1Y76B 3VODA 4I9WA 3GZ6A 3CPWU 3SHFA 4X20A 2E19A 4A0YA 2WAMA 3NWSA 5DYMA 1P92A 1PD3A 2E71A 3W2WA 2OCCB 2P7TC 2BVMA 3OE7G 3UT5A 3MWMA 4BKXA 1FX7A 5FB2A 1NH2B 4HX4A 4B3XA 4QIWN 2VT2A 1YTFD 3FHNA 2P5KA 2K9PA 1R7JA 1RC9A 4U3JB 3FMRA 5KHHA 3WB1A 1RP3B 5JQGA 4DGWB 3CCMI 3HXLA 2GBOA 4IRHA 4TUYA 4GGGA 3CEIA 2FF4A 2YR2A 3CF2A 1VQPV 1YIJV 1J5EB 4G28B 2FUG2 2W57A 4K2EA 1YTYA 4Y13A 3GTGJ 2Q67A 1GDTA 2DT5A 5ICFA 1OCRC 4A93J 2P0WA 3RVYA 3CXCU 2BW3B 3VQYA 4PUSA 1N77A 3GF2A 1DTOA 3M7MX 1Z7LA 2OTJI 4U0VA 4Y7NJ 3QPTA 1PP9H 2F93B 5KHKA 3ZQFA 2M4GA 4XLPF 2OZ6A 1UMQA 3HKCB 3OYIA 4DV6B 4B3RO 1RPRA 1DPUA 5LBQA 1SD6A 4D7NA 1MMMA 3F7YC 1D0YA 4QPJA 2VJ5A 1H2SB 2KL4A 3IKVA 1LR1A 1DF4A 2ZT9B 1E17A 3JD3A 3ULQB 2VQFO 4XDKA 1XMKA 1XEQA 3S3XA 1W7PB 4YEJA 4S0HB 4RB3C 2LDUA 1SFOJ 1KYWA 1R22A 4CCKA 4A3LJ 1SRYA 4XORA 4ZI7A 5KX5B 2DJNA 2YX4A 5D5UB 1VQ9I 5FLVA 2KISA 4OAYA 3TW6A 2K9NA 1W5SA 2CH7A 4CGZA 3BRCA 2PN6A 2ZKOA 4CS4A 1IN4A 4I01A 3SYPA 1JUPA 2QKLB 4B3MB 1K78B 1VQ8I 1Y0UA 4HNAA 5LMNB 1JGGA 1HNZB 2OTLV 2PZSA 4MTXA 1A6QA 1S5LZ 1Z5WA 2I10A 2JEXA 1ORQC 1S0VA 4NYKA 3LNMB 3CC2V 2R4GA 1I94B 2HXIA 2QTSA 2L7FP 4ZYGA 5IT3A 2XROA 4AVPA 2ZJPF 2Y0IA 1GRJA 1SETA 1APLC 1LUWA 1OCCH 1Y1VJ 2CQQA 2DA6A 3QVNA 5LA6B 1J7KA 3C2HA 1IO2A 3IC7A 1L1FA 4ZZLA 1VQ6V 5E1AC 1H2NA 2LGQA 3MN2A 1ZARA 2JGUA 1NG7A 1BQ0A 2MK3A 3H0DA 1BE3H 2LF8A 5J2UA 4UB6C 2Y75A 2WLMA 3H0GJ 1QHHD 3PUBA 1JX9A 3S32A 3LFUA 4BIOA 1H8AC 4PJLA 5DUKA 1SESA 2E2JJ 4JF3A 1Q1VA 5KK1A 5LHHA 2WA0A 2M7AA 2NS8A 1CF7A 1ZREA 4DV6O 5CYVA 5F1RA 1S6LA 2L0KA 3F22A 5F08A 4KIFA 4C3HJ 2JA6J 2VC1A 4AM3A 3K0GA 4J7ZA 3OS0A 2DODA 3JD4A 3RKQA 4M73A 3SJBC 1WH5A 3L2UA 3JSNA 5HLHA 1U6GA 2OJED 5IE9A 3ZHTA 2XIGA 4G6DA 1FZPB 1ENVA 5JHFA 1R00A 3K79A 4WFGA 2OD5A 3KP3A 4LFCO 1RIOH 3ZRSA 1UB9A 1XN7A 4RAGA 4BQQA 2VN2A 4RDUA 4WF2A 3BJOA 2JA8J 2YEVB 1F7YA 2JA2A 4N21A 3THOA 3SFIA 4A69C 3WODF 1N75A 5GTIZ 4JI7O 2ZMEA 5FJ8J 1J5YA 1IW7F 1AI5A 3RQ4A 2CAZC 2JK5C 2A6EF 2ETHA 3KEYA 3M9AA 1VQPI 1AROP 2Y0SN 1HW7A 5ICEA 5EYPA 4LF7B 2OC6A 1Z77A 2Q0OA 1NI8A 4NKGB 2E5LO 2HNHA 3G4SV 1W5CC 1KP2A 1SMTA 2FOKA 2IH1C 3KEOA 5IYDO 1WB8A 2V7FA 3C18A 2MLKA 5FKOA 1S7EA 5ICGA 3IL2A 1IXBA 2Q1ZB 1VQLV 3IV5A 5FKLA 4PDRA 2P7CB 3CJQB 1OKRA 3ELKA 3CDLA
chains in the Genus database with same CATH topology
5E1XA 2YSUB 1OCCC 2YU3A 2ISYA 1K3EA 1Y66A 1E1QG 1TQPA 3DQVC 3GB7C 1OCZB 1LNWA 4Q20A 3HSFA 1TBXA 3K03A 3CCJV 4FX4A 3FB8C 5ED4A 5CBFA 3B8MA 1RUOA 4MTGA 2Z5UA 4NQWA 1LB2A 3F6VA 1VQ4V 2ITCC 1H38A 3ZMVA 4L18B 3O6BB 4BXUA 2LSOA 1MOFA 1EV7A 4A0XA 3E3VA 1JE8A 2Y69C 3O2PE 4IPAA 4YG2F 2D45A 3CP1A 1GHCA 2UXXA 4WFBV 1S29A 1FSHA 4HF1A 4UHTA 2V1XA 3F3XA 4RQFA 2VBWA 2JJ1G 3LQQA 3QO8A 2EV0A 3WG7B 2HFHA 5K5OA 4ASUG 3ETEA 1LJ9A 1KU3A 2F2EA 3ZPLA 1SD4A 2FRHA 1GXQA 5JHUA 1YYVA 2ZR3A 4P2ZA 3CC4V 1M1KW 2O8XA 2Z3YA 1KECA 3ZN1A 4ZZDA 2DFIA 3B02A 1WSUA 1FXVA 4G6QA 2WLLA 4M74A 4PDVA 3CDHA 3TDZC 2ISZA 3HIFA 3GLXA 1NH2D 2WLHA 2QENA 1USTA 3KLNA 3AG1C 3WTUC 1XL6A 4JYBA 4MVUA 2EA2A 1GM7A 2DU9A 5J6XA 1THZA 1KQ9A 1XD7A 5DCMA 3CD6V 3IFXA 2IJLA 1M9NA