3G71V

Co-crystal structure of bruceantin bound to the large ribosomal subunit
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3g71V00
1YJNV 3CCEV 3I56V 3CMEV 4WFBV 1YHQV 1QVFU 2OTJV 3CCLV 5DM6V 1W2BU 4WCEV 3G71V 1KD1W 1K73W 4WFAV 1VQ4V 3CCRV 1VQOV 1VQNV 3CC4V 1VQMV 1VQPV 1QVGU 3CCSV 3I55V 2D3OW 2QA4V 2OTLV 1YJWV 2QEXV 1VQ6V 1KQSU 1R73A 1Q86W 1M1KW 1YJ9V 3CC2V 1N8RW 3G4SV 1VQKV 1KC8W 3CC7V 1Q81W 3OW2U 1K8AW 3CMAV 4WF9V 1JJ2U 3CCUV 3CCQV 3CCJV 1VQ7V 1VQ5V 1YI2V 3CD6V 1NJIW 1YIJV 3CCMV 3CXCU 1S72V 3CPWU 1Q82W 1YITV 3G6EV 1VQLV 1K9MW 3CCVV 1VQ9V 1M90W 1VQ8V 1Q7YW
chains in the Genus database with same CATH superfamily
1YJNV 3SDLA 3JARA 4BIOA 5FPOA 1GTOA 1GN6A 4I55A 3SPJA 1NTKH 2ARHA 5BMVA 2HLDG 2CTWA 3M7MX 3CYOA 1VF6C 1Q3EA 1XI1A 1EZJA 2Z3YA 2VQEO 5JH7B 4B3MO 2JS5A 5LMNO 1W59A 2Q73A 3J81N 3CSXA 1Z5WA 5CB4A 4DV0B 1WJZA 4JI2O 5E79Z 4N23A 2ITDC 4I4TA 2LJ2A 5JVDB 1SRYA 2QWPB 3K58A 2ZDIA 2LW1A 3RFRA 3ABMC 3BA9A 1Y76A 2Q67A 4YXWG 5IJ9A 3WFVA 3TXSA 4O2BA 1KKCA 2X6AA 2UU9O 2EIMC 3OGIB 4H33A 3SJBC 4YIOA 2ZKOA 5H2FZ 4JI1O 3RYCB 1YJWV 4E4EA 1VP7A 2E75B 1UFIA 4DW1A 2ILMA 1PNLA 1VQKV 4P9OA 1F51A 2F4VB 5J2UB 4J41A 2DOSA 2P06A 1L0NH 4OX9B 3BY6A 3E22B 2JGDB 4EKWA 3AG2C 1WB8A 2V7QG 1ORQC 1S76D 1Q90D 1XUQA 1WB7A 4D7SA 1SQGA 3FB6C 4JTAB 5JH7A 1SQXH 4WFEA 5B3SB 1Q86W 3OW2U 2OT5A 3ZRSA 4YJ3B 4ZBMA 3JAWB 4PELA 1NR7A 3CPWU 2YSUB 2K1EA 4DUZO 4LFAO 4MS2A 3ETQA 5LGUA 2W0XA 5IDJA 4FFKA 4AHCA 4DR3O 3UCSC 2ZIMA 5EIBC 1JQ0A 4X62O 1GAXA 2JEUA 1THZA 1GH6A 3CC7V 3ZCCA 4PHZA 2P90A 2WLKA 1ZLZA 4LP8A 2DN9A 1RPRA 3RYCA 3N2GB 1Y66A 3B8NA 2QGNA 3BEHA 5IY5B 4HNAB 4DR2O 4JI7O 1PNMA 3LSUA 1GRJA 3A0RA 4CS4A 4F4LA 1YDXA 3HKCB 5J2UA 2UUBO 1CXZB 3SJQC 4UCSA 3E22A 2JGDA 3QVNA 4KHPO 1V54C 4JAUA 4RQEA 4NXNO 2RJZA 2QTOA 2YXLA 1NVPB 5FL7G 1AVMA 2RMKB 2YIBD 4LWSB 2EIMB 1ROPA 4YJ3A 5JJEB 2UUCO 3JAWA 3ABKC 2JRIA 1KMIZ 4BIUA 1TUEB 5C8YB 4LFCB 2DWEC 1HDJA 3RGBA 1N33O 3DC6A 2F93B 2QM8A 1ZSPA 4JYAB 4JAAA 2P4VA 1J5EO 3JD2A 4JF3A 3AG2B 2LP7A 2E76B 1JCHA 2VWJA 3M8AA 4GZRB 2YIDA 5CBFA 2EJ7A 3N2GA 2YEVB 4HNAA 2QSAA 4GKJO 3HKCA 1DK1A 5KHHA 2Q7HA 2HJDA 2CUGA 3JD1A 1H2SB 1MABG 5B5EZ 1TGOA 4CC5A 3OD4A 3AEIA 4ICGA 3U11A 2X6BA 2BOCC 3QO8A 2JEXA 2RN9A 3L70H 3GWOA 1WN7A 1DF5A 2RQ6A 4Z2WA 3EFFK 2LFSA 1R3KC 3TCUA 1SQPH 1PKXA 1N8RW 3VQWA 4LWSA 1XL4A 4DV5O 4PA6A 2MW2B 2N05A 4J9YB 4O4IA 5KHKA 4QIWF 5C8YA 2W0FC 5KX5A 4GX2A 3CCEV 1MNGA 4QE9A 4NB5A 4LF4O 4FVMA 2QJ1A 4FMTA 3CCRV 2Q0AA 3B8MA 3ZN0A 2XNDG 4JI6B 4LH6A 4YY3B 5LMUB 1V54B 3LSQA 4FLXA 2XTAA 3AG4C 1YSCA 1NJIW 1F4NA 3FB8C 1D5AA 3VQYA 1H2KA 1E1RG 4MTXA 3ZJZA 3GVMA 1GK9A 3T1YB 4UCOA 1KBHA 2A79B 1FPOA 3UO2A 5KLVH 4X64O 4LFBO 2BE3A 1CPYA 4FM0A 4YJ2B 2EINC 3CCQV 3CCJV 1JVMA 1EN6A 4DXWA 1MOFA 2XHBA 2QM4A 3ZN1A 5EYPB 1XHXA 2Q7GA 4LF9B 2D3OW 3B2EE 2ZM6B 4BAYA 2DE0X 1IBKO 3CEIA 1ZUQA 3I5DA 3F7YC 3RYFB 5A2QN 3ZRVA 1I7FA 2RDCA 1Q6IA 4Z1VA 3QO5A 1SESA 3TK1A 3T4ZA 2ZNIA 1ZTEA 3SYCA 4J7KA 4PDMA 4DV4O 3ETGA 1JX9A 1YJ9V 5IT9N 4G27B 1K3EA 2RCVA 2A0LA 2ZINA 1XILA 2WWWA 4L8JA 2VQFB 1Q7YW 5EK0A 2ZCEA 4B3SB 1QHTA 4WFBV 2ZE5A 3OTOO 2QE7G 2Q68A 3N27A 2WLHA 3ASNB 4X1IB 3KZIZ 2Z5UA 2LFRA 1I0HA 2F43G 1BGYH 2ZR2A 1P7BA 5LP6C 4LF5O 5B66Z 1MSDA 5EYPA 1LUWA 3ABLC 1IDSA 4KL1A 3AG4B 2VWKA 1QR8A 4E2LA 1NTZH 2NNUA 4FM1A 1JOYA 1VQ8V 1N32B 1K5QA 1B04A 3MD0A 1KD1W 5ITZA 3RYFA 4O4HB 4X8AA 4UVBA 4R6ZA 2LGWA 1H38A 2PZSA 4ASUG 2JJ2G 3JCZA 4TQDA 4X65O 1PL4A 4IL6Z 3W7TA 2EINB 3IC7A 4BR6A 3P3NA 3WB0A 3BHPA 4X89A 1DTOA 4K8XA 1XHZA 2CH7B 2HKOA 1I5YA 1VQ4V 4K0KB 5CA3A 1S5LZ 4X1YB 5FPRA 2WA4A 5LBQA 1M1KW 1G1XB 3UQ8A 2YS8A 1FFXB 2ZE8A 1SF9A 4MTOA 1K4DC 1VQ7V 1OCOB 4X1IA 4X20A 1AP6A 1KECA 3K5MA 2OCHA 3PN1A 2NLJC 4PI0A 2PI5A 3OEEG 3CRMA 3ZX6A 2YIBA 4Q6GA 4EB6B 2FMLA 3ZBHA 5CA0B 5L3EA 2XAHA 1AILA 3FB7C 4DR4B 2ADQB 4WFFA 2QWOB 2IJJA 1RSOB 4GKKB 4O4HA 4MVQA 3J80N 1H2LA 1E1QG 3APQA 1Z2GA 4MSWC 4LNUB 4IIJB 2KSDA 1G8MA 1URFA 3CJHB 1AJNA 3LDDA 4GLXA 1FKAO 1XDCA 1PPJH 2F4VO 1IBMB 3VOUA 2EX3A 3P32A 4OX9O 5LP6B 4WF9V 1OCRC 2GTSA 2R72A 3ABLB 1VF5B 5JQGB 4PD4F 3G80A 4X1YA 3T4DA 1FXKB 5LGNA 1IX9A 1FFXA 4RUEA 4F6EA 2JIZG 1VQMV 3RBZA 2HG5C 1S3JA 3E35A 2UUAO 1JPXA 1Q81W 2X7RB 5H6QA 3UKMA 4JYYA 2A06H 5JWPA 4EB6A 3STZC 2DYSB 4FLTA 5HFMA 5CA0A 1NVPD 4DV2B 1NBMG 4IGGA 2QDOA 1SZXA 4GUNA 4CH6A 2QA4V 1XNRB 4JI5O 1NH2D 3FKSG 3OT7A 1COWG 4FPPA 4UFZA 3JASB 4LNUA 4IIJA 4MVOA 3CJHA 2IH1C 1OCCB 3A0BZ 3HR0A 1WP8A 1XMQB 5DECA 2QWQB 5LP6A 1NTMH 1XMOB 1QLNA 5BZBA 3W7UA 1NQTA 2ZT9B 3SJCC 4R8CA 3JCUZ 3K0DA 1PNKA 5JQGA 2B1GA 3ZS8C 1YF2A 1FXKA 1WPXA 3U0ZA 4LF7B 1OHHG 3ZMZA 5JJJB 1HNXB 3QNEA 1HR0B 1AJPA 4ZIBA 4FM2A 4LFCO 3JAMN 4YIPA 4A5UB 1VQPV 1Y67A 2EILC 3R66A 1K8AW 4JYAO 1NS1A 3OE7G 5EIBD 3CCUV 5L3BA 4X1KB 1OCRB 4LCUC 3UT5B 3TXQA 4QJFB 1M9NA 2XASA 4ZHQB 4NKGB 3K5OA 1EM1A 4WBNB 5F2VO 2WA3A 4IYHA 3ZIAG 1Q5OA 4H0LB 3FFQA 4JTCB 2P22C 1NT2B 3SGIA 2ETNA 4R7CA 4LBEC 2G38A 4DK1A 2LGQA 4DR7B 3L71H 3OR7C 4MW8A 1Y6XA 2HJFC 2R70A 1BQ0A 2Y4UA 4AI8A 4PA3A 1Q43A 4CH3A 1ZWIC 1QBZA 3D36C 1PV0A 4LF6B 1BL8A 2PYJA 5L3GA 4RO2A 1N36B 4TT3G 4JI8B 4BWAA 1OV9A 3L9DA 3BAAA 4P9PA 1WLEA 4TV9B 5B1OA 4JI6O 2IJIA 4X1KA 4U3JB 3O65A 4YY3O 5LMUO 3CP1A 1AR1B 3UT5A 4D7TA 3JAKB 1R6NA 4ZHQA 4WBNA 1KP3A 3NR7A 5KMGB 4BW9A 4HZ3A 2W6IG 4TWKA 3T1YO 4AQYB 1N0NA 4FLZA 2LW7A 4PDRA 1M57C 4LF8B 1UPGA 2N04A 3ZHRA 5JVDA 4JV5B 2WPDG 3G71V 2JGUA 4MVRA 1AR4A 3CRRA 2EILB 1US6A 2DYRC 1XBLA 2NR5A 4CS3A 3ETDA 4J11A 1PM9A 1W0JG 1M56C 2RNBA 1WP7A 4J10A 2B5UA 2ZM6O 5BY1A 2E5LB 3OMAB 5B1NA 5KA6A 3K9AA 2CTRA 2D2CB 5K1PA 2ODMA 3IAYA 4TV9A 4LH7A 4Q20A 4XBFA 2IU3A 4U3JA 2GUZB 1Z5VA 3ABMB 1Q8IA 3JAKA 4DR5B 3ICXA 3EXAA 3VQVA 5KMGA 1NH2B 3ZMVA 1F23A 4RQFA 2E3CA 1KYOF 2HR3A 2AZ0A 2BOBC 4MVZA 5J2TB 2VQFO 4B3SO 2ZR3A 4DK0A 2OIGA 4DYLA 2BTQB 4X88A 1K4CC 1VF6A 1N34B 1E79G 3RW0A 1IBLB 3E8HA 1N32O 4B08A 5E1AC 5EC2C 4K8ZA 2DMXA 5FNVB 1L1FA 1M57B 1EN4A 2XAJA 5EBLC 2GUZA 2F23A 3ZHTA 3E8GA 3L75H 4TV8B 4JI2B 3LNNA 4FLWA 4OXSA 2DYRB 3D36A 4QGPA 1EFRG 3FX7A 4K0KO 1BMFG 4JYBA 1PL0A 4JI3B 5J2TA 3P30A 2BCCH 1I08A 3F5WC 4NTXA 1AP5A 1P84F 4B7KA 3CXHF 4DR1O 3AG1C 3KKYA 2BTOA 4CS2A 3TETA 2YEVA 2YUAA 1FJGB 1W2BU 2IBZH 3AK1A 3RN4A 2EZPA 4UCRA 1OJHA 3ABKB 1J95A 1WAZA 3VBBA 5FNVA 3OFNG 5IYDO 4UV9A 2KKWA 1YI2V 4PDVA 3OR6C 4I0XB 1RPOA 1MA1A 4OGQB 3RT3C 1VQLV 3CCVV 1H2NA 1M90W 3RWRD 5BR8O 3A8TA 3ZHSA 1BE3H 4NXMB 3LNMB 3B77A 3SPCA 2Q9LA 2FTKA 2H94A 3E83A 5KUMA 3ASOC 4C7UA 5CBHA 3L72H 3W7WA 3X2QC 5KHIA 1W0KG 2GV9A 2MK3A 3A2FA 4JI4B 3CXCU 5LYJB 2BSKB 2XUMA 4KXRA 1OCZC 3P3PA 1EN5A 1MZFA 3ABUA 4MVSA 4B3RB 4L87A 3APOA 3GWKC 3H1JH 1FXVA 4LR3A 5B1BC 3SYQA 1XREA 4IT5A 4ZOLB 2GHYA 4J42A 2GDSA 2P67A 3BFRA 2JS3A 4PI2A 1BS3A 2UXDB 2PTMA 4YJ2A 1XNRO 1R3LC 4EFEA 2DW4A 4I0XA 4JI0B 5EC1C 2PUSA 2V4DA 5LHHA 2PYLA 3THOA 3RVYA 2ZNJA 4UVAA 1XMQO 4OPHA 2DWDC 1N33B 2AZ2A 4GX5A 2UXNA 1XMOO 3G6EV 3AG1B 1QQCA 1V9PA 4WFGA 4X66O 1FS0G 5GONB 3CMEV 5L3FA 2EBOA 1B6QA 3IC9A 3L74H 1J5EB 4UV8A 3OMNB 5KUKA 3Q4HB 3OUFA 3T2MA 2BSKA 3SJAC 4LF7O 1HW7A 4YHHB 2EIKC 1GN4A 1HNXO 5KHJA 1U96A 3SPGA 1HR0O 4TOIA 3IJ4A 2ZE6A 4GKJB 4J7JA 2M6YA 3BVOA 2F95B 3T1HB 5B1AC 4FJCC 4ZOLA 2UXCB 1P4RA 1QCEA 3K03A 3T1CA 3ASOB 1X4TA 4B3TB 3ZMSA 3ZHUA 5EBMC 1OZ0A 3X2QB 1GN2A 4DR6B 1YZBA 5IYCO 4DV0O 1VEWA 5H9CA 3RVZA 2YDEA 1OCZB 1S5HC 4HAMA 3R65A 3JD3A 2B9ZA 3A0HZ 2YC0A 3W7SA 4JTDB 4DR7O 1XQ8A 5GONA 5IJ0B 3OAAG 4GCZA 2NN4A 4XDLA 2P4KA 5B1BB 3OUSA 3C90A 1Q82W 4UCVA 2ZDIC 3K08A 4J7ZA 5KAFZ 4R50A 2EIJC 5IE9A 3CCLV 1I94B 4DV1B 3K59A 4LF6O 2LQTA 3FYIB 4MVMA 1N36O 4P30A 5IYBO 3E89A 3F7VC 4W4LA 1A32A 3CMAV 1JJ2U 4JI8O 4G2KA 4G28B 2CH7A 4UB8Z 1R1BA 1YEWA 3D3IA 1M5IA 3CRCA 4DO2A 2IM9A 1K34A 1ENVA 4GT1A 1DGSA 3H1IH 4ZKIA 5LOVB 1VIBA 3HKDB 4UXNA 3RYHB 4AQYO 1SA0B 2Q6AA 4JZGA 4HYOA 2CGNA 3B4SA 2X6CA 1IBKB 4F6RB 4JV5O 4GYCB 3DSQA 5IJ0A 4BIZA 5DEDA 1VF7A 1AI4A 1YHQV 3SYAA 1SZTA 2CDYA 2ZIOA 1JMKC 3ZHVA 1RSOA 3CCSV 4MVUA 3ZMTA 4O4LB 1YTFB 3DXRB 2P6JA 2N74A 4QPJA 3H01A 1PP9H 3CRQA 1TUBB 3VQXA 1AROP 2X0LA 2W6JG 2E5LO 3BA8A 4FLVA 2HP8A 2IW5A 4W4KA 4WFHA 2YI8A 3EHBB 3AK2A 1GM9A 3FB5C 4U7NA 1TA8A 4DV3B 1JJOA 3JALB 4MW3A 3KCYA 2QTSA 2LO1A 4FZ1A 4DR5O 2AGAA 3C3SA 5CN0A 2XT9A 4H44B 5LOVA 4GX1A 1SETA 3EVKA 4I5SA 2QR4A 1BZKA 4IYIA 3RYHA 4DV6B 1SA0A 5HFLA 3J7AU 3MDSA 3QG5A 4O2BB 1O9GA 2Y69C 4F6RA 3BCCH 3SYOA 1LR1A 1KC8W 5LA6B 1GMGA 3KG2A 4NYKA 1XOUA 2L35A 2Q0OC 2JVDA 4KP4A 4QPKA 4O4LA 1ZAUA 3DXRA 1K33A 1N34O 1G6UA 3JASA 1K97A 1SS3A 5KHGA 5D5QA 4Z1MG 1QVGU 1O9HA 3H1KH 5L3DA 1IBLO 1TUBA 4H37A 4CH5A 2HHHB 2ZE7A 3MHSC 3OEHG 4UUJC 1FFTB 3E8FA 4OPAA 5IY5C 3W7XA 3JSLA 5EBWC 2ZQMA 4J80A 1EZVH 3JALA 5JJNB 3JSNA 2EZOA 1XNQB 3H1HH 2KG7B 1KKDA 1KQSU 3OGCC 2Q69A 3UO3A 3K79A 1MMMA 4O4JB 1S72V 1K92A 4JI3O 4DUYB 2M7WA 3H1LH 4FK5C 3B09A 3NXSA 1D5NA 2HVKC 2QKCA 4JZ2A 5LA6A 3ABTA 2UXBB 2WLJA 4IHJB 4NR1A 1HNWB 2A7WA 2R9AA 3B40A 3K3WA 2Z0AA 1KP2A 3SR2C 1FJGO 5FLXN 1MSWD 4N21A 4UCUA 3WG7C 4CBCA 2CE4A 5A9GA 5J9PC 1B06A 3ZMUA 3I55V 5IWAB 3DGEA 4DV7B 2Y69B 1RFYA 3IFXA 4B7EA 1D2DA 2UUAB 3OM3B 1B3QA 4U3FH 1VMGA 4QNHB 4NXMO 2KG7A 2IJKA 4TUYB 3CX5F 4LF9O 5LXTB 4WFAV 1HNZB 4O4JA 4PV1B 4FZ0A 4JI4O 4JGSA 1L8DA 2OIEA 4JI5B 3TGUH 1DF4A 5GW7A 1BHBA 2H3OA 4IHJA 3STLC 5BXZA 4MTGA 4LC1A 4B3RO 2GBOA 5DM6V 2Y0IA 3RYIB 4X9QA 2P5OA 2P7TC 2PY5A 1HP8A 1S5JA 5LL6Y 2FL4A 1S0VA 1U97A 2XAQA 4RAIA 2QWNB 5JCOC 2V1DA 3G67A 2OYQA 1XEQA 3AG7A 4HBNA 1SQVH 4AILC 3JATB 1YITV 3S3XA 2UXDO 4ZI7B 1AJQA 1RM1C 3WB2A 2GTAA 1GKFA 4JI0O 1TVKB 1R3JC 4FLUA 1QVFU 3FD9A 2JDIG 3SYPA 4O4IB 5KX5B 4TUYA 4CC6A 5LHIA 2CAZC 1YCIA 2YXHA 1EBOA 1FXHA 5LXTA 3D3QA 3ZRXA 3E2EA 4UVCA 3U10A 1IXMA 3MAQA 4XDJA 2B1IA 1QLEC 2VQEB 3QTCA 4PJ0Z 1NI8A 4B3MB 1AI7A 5LMNB 5K1XA 3WG7B 1K73W 3GB7C 2QKAA 4I50B 4YHHO 4CH4A 1AB3A 1YVWA 3AG3C 1R3IC 2R9IA 3CS5A 3RYIA 2OCCC 3SPHA 4JAVA 3PJSK 2AW9A 4J9ZB 3T1HO 2CK3G 5KAIZ 1WNSA 2UXCO 1BCCH 2UU9B 1M56B 3HB3B 4ABMA 1K7DA 4B3TO 3JATA 1FYJA 4ZI7A 1AI5A 1R6KA 3ETEA 3CC2V 2IJHA 4JI1B 3CB2A 1TVKA 2QKSA 2PI4A 2BTQA 4DR6O 5EZYB 2WLMA 2WLIB 3OMIB 3UM7A 2WLNA 2XAFA 1IVSA 1YXBA 3K5NA 2Y4TA 3ASNC 4U7OA 1WPBA 4BW5A 3E86A 4DR4O 3HKBB 3G4SV 1Q6UA 2DQ3A 4NVPA 1SQBH 1WA8B 4RWUA 1F7YA 4GKKO 1VQ5V 1X59A 3CWBH 2DQ0A 4UCTA 4FFBB 1I94O 4I50A 4CZZA 4DV1O 1NZ6A 4FIPC 1RM1B 2WLLB 2Q4PA 5LHGA 3O9OA 2FKXA 1SC5B 4TV8A 1KUQA 4DUZB 1IBMO 4LFAB 1JR9A 1ZX3A 2WSSG 2GSMB 3ZHQA 1I5XA 2L6LA 1AR5A 4DR3B 1V55C 4JASA 1K5SA 4X62B 2O57A 4JYCA 2A3QA 5LGTA 1ZL8B 1YTFD 1H8EG 4QE7A 1H8HG 1LNQA 2YICA 3OTFA 3FAVB 5GTHZ 1QLEB 3LDEA 5EZYA 2WLIA 4EFBA 4DR2B 4JI7B 4UB6Z 5D5PA 3K04A 2UUBB 1GM8A 2IU0A 4I9WA 3DC5A 4MTFA 1OCOC 1Y4MA 1SKVA 1QR9A 3CHXA 5ITZB 2FYUH 4PA4A 4KHPB 3AG3B 3HKEB 4NXNB 1KU9A 2OCCB 4DV2O 2YIAA 3HKBA 3N2KB 1WA8A 3L73H 3LDCA 2CGOA 5JCOA 2HFEC 1VQOV 4EEQA 4FFBA 5CA1B 2UUCB 1UJWB 2WLLA 4NTWA 3F5TA 2Q7EA 3CD6V 4FLYA 2ZXWC 2ADPA 2R9RB 3QO7A 5CMUA 3C3TA 3ZEDA 1IZ3A 2AHZA 3LUTB 4DV3O 2YXYA 3K06A 2E74B 4X20B 1ZL8A 5LYJA 1P49A 2QEXV 1H2GA 2CTPA 2Y48A 3ZRWB 3FAVA 1JFFB 1R6TA 2DJVA 5DN6G 3M99B 2H8PC 1KB9F 4KUMA 3CRAA 4DV6O 1BT8A 2HEPA 1FXKC 2KQXA 3WU2Z 3ML0A 4PA7A 4NTYA 1RP3B 2F66C 4PA9A 3BRCA 2Q5ZA 3HKEA 3S3WA 1M93A 2IH3C 1G4YB 2WAMA 5H5NA 1BQZA 1V55B 3N2KA 1NU1H 5KA5A 2DYSC 4DV5B 1VQ9V 5CA1A 3FYEB 3CE2A 2PGGA 3JYCA 4I9QA 4P2ZA 3DTUB 4LF4B 2HHHO 1S77D 2EJRA 2FB5A 2OWOA 1OCCC 2AXTZ 5IYZB 1N4CA 4DR1B 3E8BA 4O2AB 3Q4HA 3ZRWA 5L3CA 1JFFA 1XNQO 1QNMA 2HVJC 1HWYA 3CC4V 4DRXB 3LSSA 5CBGA 2OTLV 2VS0A 4D6TH 2XAGA 3K0GA 5C93A 4DUYO 1VARA 1TAEA 4X64B 4LFBB 1SERA 3K5LA 3CCMV 1H2MA 1CP9A 2ZXWB 2JK5C 2UXBO 3BABA 1M4UA 2K9PA 4KFMA 2AHYA 3IGAC 5GTIZ 1LUVA 1QU7A 1HNWO 1IURA 1Y74B 3WB1A 5BR8B 2A9HA 3BPZA 3QF7A 1JA8A 1NR1A 1BHAA 2EULA 4K3AA 1N0JA 1PD3A 2Q8VA 4LF8O 1GN3A 2EIKB 1AI6A 1K9MW 1T5EA 2PF4E 1DLBA 3I56V 3SPIA 5IWAO 2CTQA 4DV7O 3K57A 4MT8A 1Q6HA 5IYZA 4TQFA 5B1AB 5TISZ 3K9SA 4O2AA 3JARB 1SQQH 4I55B 3H9VA 4PDLA 4DV4B 1IXBA 2QWRB 2C2AA 5BMVB 4DRXA 4GX0A 1XL6A 1HNZO 1FD9A 2OTJV 3KCXA 4XDKA 1VQNV 4H13B 5AG2A 2VRZA 3OTOB 1R73A 1GO3F 1F4MA 1MG1A 3AK3A 2ZD9A 5CB4B 2KB1A 1SQFA 1Y74A 4LF5B 1YIJV 2ATKC 2QM7A 4RUFA 4I4TB 1CEZA 3HKDA 4TSFG 3JD4A 4X66B 3HPLC 4JPRA 2UXXA 4WCEV 3TJTA 1Y76B 3D8CA 3G6BA 5IJ9B 2EIJB 2XOKG 2YI9A 1GM7A 1MZEA 2Y0PA 5B3SC 3MHHC 1VQ6V 2ITCC 1NKDA 1BSMA 5H6RA 4I7ZB 3JD0A 4DW0A 1L0LH 2F1MA 1P7GA 4X65B 2JJ1G 1FAFA 4K35A
chains in the Genus database with same CATH topology
1YJNV 4LC1A 2PI5A 1GTOA 3OEEG 3LNMB 3B77A 3SPCA 5DM6V 2P7TC 3SPJA 2FTKA 2HLDG 2H94A 3E83A 5KUMA 3ASOC 5CBHA 5L3EA 3CYOA 1S0VA 2XAHA 3FB7C 3W7WA 2XAQA 3X2QC 4RAIA 4WFFA 1EZJA 2IJJA 2V1DA 1W0KG 2MK3A 2Z3YA 3CXCU 1YITV 4MVQA 1AJQA 1E1QG 1RM1C 4MSWC 1GKFA 1OCZC 1R3JC 1QVFU 2JDIG 3ABUA 3SYPA 1G8MA 1AJNA 4MVSA 3LDDA 4N23A 2ITDC 3VOUA 3P32A 4L87A 5LHIA 1FXVA 1SRYA 1EBOA 1FXHA 4WF9V 2ZDIA 5B1BC 3SYQA 1OCRC 3ZRXA 3ABMC 3ABLB 2Q67A 4YXWG 3E2EA 4UVCA 3WFVA 2GHYA 2X6AA 1IXMA 2P67A 4XDJA 2B1IA 1QLEC 2EIMC 3T4DA 1FXKB 5LGNA 1AI7A 4H33A 4RUEA 1R3LC 3WG7B 1K73W 2DW4A 2JIZG 1VQMV 5EC1C 3RBZA 3GB7C 2HG5C 1S3JA 5LHHA 3E35A 1YJWV 1PNLA 1JPXA 1VQKV 4P9OA 1Q81W 3RVYA 4UVAA 2X7RB 5H6QA 1F51A 3UKMA 3AG3C 1R3IC 2R9IA 2DWDC 2OCCC 3BY6A 3SPHA 4GX5A 2UXNA 4JAVA 3PJSK 3STZC 3G6EV 2DYSB 3AG1B 4J9ZB 4WFGA 1FS0G 4EKWA 5HFMA 3AG2C 2CK3G 2V7QG 3CMEV 5L3FA 1ORQC 1NVPD 1NBMG 2EBOA 1B6QA 1S76D 1M56B 4UV8A 3FB6C 3HB3B 4JTAB 1K7DA 3OMNB 5KUKA 2QA4V 4WFEA 1AI5A 1R6KA 3ETEA 3FKSG 3OUFA 3T2MA 5B3SB 1NH2D 1Q86W 3CC2V 2IJHA 3OW2U 2OT5A 1COWG 2QKSA 4FPPA 3ZRSA 2PI4A 4ZBMA 2EIKC 4PELA 1NR7A 2WLIB 2WLMA 3OMIB 4MVOA 3UM7A 2IH1C 3SPGA 2WLNA 2XAFA 2YSUB 3CPWU 1OCCB 2K1EA 4MS2A 5LGUA 5IDJA 1QLNA 3ASNC 5BZBA 3W7UA 1NQTA 4U7OA 4R8CA 5B1AC 3K0DA 4FJCC 1JQ0A 1PNKA 1P4RA 2JEUA 1QCEA 2B1GA 3E86A 3K03A 1THZA 4BW5A 3G4SV 3T1CA 2DQ3A 3ASOB 3ZCCA 3CC7V 2P90A 1FXKA 3ZMSA 1WPXA 5EBMC 1OZ0A 1VQ5V 2WLKA 3X2QB 4LP8A 2DQ0A 1RPRA 1OHHG 1Y66A 3ZMZA 3B8NA 4CZZA 5IYCO 3BEHA 3QNEA 5IY5B 4FIPC 5H9CA 1RM1B 2WLLB 5LHGA 3RVZA 1AJPA 1PNMA 3A0RA 1OCZB 1S5HC 4F4LA 4HAMA 3R65A 3SJQC 3JD3A 1VQPV 3W7SA 2WSSG 2GSMB 4JTDB 1I5XA 1V54C 1V55C 2EILC 4JAUA 4JASA 1K8AW 1K5SA 3OAAG 4GCZA 4RQEA 4XDLA 3OE7G 3CCUV 2QTOA 4JYCA 5L3BA 5LGTA 5B1BB 1OCRB 3OUSA 4LCUC 1NVPB 1YTFD 5FL7G 1Q82W 1H8EG 4QE7A 1H8HG 1LNQA 4QJFB 1M9NA 2XASA 2ZDIC 3K08A 1QLEB 4R50A 2EIMB 1ROPA 2EIJC 3CCLV 3LDEA 3ZIAG 3ABKC 2WLIA 4JTCB 4BIUA 1TUEB 3FYIB 4MVMA 2DWEC 3K04A 4R7CA 4P30A 5IYBO 1GM8A 3E89A 3F7VC 4I9WA 4LBEC 4MTFA 2IU0A 1OCOC 3CMAV 1Y4MA 1JJ2U 1QR9A 4G2KA 4G28B 4PA4A 3AG3B 2QM8A 3OR7C 4MW8A 2HJFC 2OCCB 3D3IA 4PA3A 3JD2A 4JF3A 3AG2B 2LP7A 4DO2A 1JCHA 1ZWIC 1QBZA 3LDCA 1K34A 1ENVA 4GT1A 2HFEC 1VQOV 4ZKIA 5CBFA 4UXNA 1BL8A 1UJWB 2YEVB 2WLLA 2Q6AA 5L3GA 4HYOA 4RO2A 3CD6V 2ZXWC 2R9RB 2X6CA 3QO7A 5CMUA 4TT3G 3JD1A 2AHZA 1MABG 3LUTB 4BIZA 3AEIA 4P9PA 1AI4A 1WLEA 2X6BA 3SYAA 2BOCC 3QO8A 1YHQV 1SZTA 2JEXA 3K06A 5B1OA 2IJIA 3CP1A 1AR1B 3GWOA 3CCSV 1DF5A 4MVUA 3EFFK 2LFSA 1H2GA 1R3KC 1R6NA 2Y48A 3ZMTA 2QEXV 3TCUA 3ZRWB 1PKXA 1N8RW 1YTFB 1XL4A 5DN6G 4PA6A 1KP3A 2P6JA 3M99B 2H8PC 4HZ3A 4KUMA 4QPJA 2W6IG 4J9YB 4TWKA 3H01A 1FXKC 4PDRA 4QIWF 2W0FC 1M57C 1AROP 2X0LA 2W6JG 4GX2A 4QE9A 3CCEV 3ML0A 2IW5A 4PA7A 2WPDG 4FMTA 4WFHA 3EHBB 3G71V 4MVRA 4U7NA 1GM9A 3FB5C 4PA9A 3CCRV 3B8MA 2IH3C 1G4YB 2WAMA 3ZN0A 2XNDG 1V54B 1V55B 2EILB 3LSQA 4MW3A 5KA5A 3AG4C 1YSCA 2DYSC 2DYRC 1NJIW 1F4NA 3FB8C 5CN0A 4GX1A 1VQ9V 1SETA 1E1RG 4I5SA 4MTXA 3ZJZA 3FYEB 3ETDA 1GK9A 1W0JG 1M56C 5HFLA 2B5UA 3JYCA 3OMAB 3DTUB 2A79B 4P2ZA 5B1NA 2Y69C 5KA6A 1CPYA 3SYOA 2EJRA 1S77D 3K9AA 1KC8W 2EINC 1GMGA 3CCQV 3CCJV 1JVMA 3KG2A 1OCCC 4Q20A 4DXWA 4XBFA 2IU3A 1MOFA 4KP4A 3ABMB 4QPKA 3E8BA 3ZN1A 3ZRWA 5L3CA 2HVJC 1K33A 1NH2B 3ZMVA 1F23A 1K97A 1HWYA 4RQFA 3CC4V 4Z1MG 1QVGU 3LSSA 5CBGA 2D3OW 2OTLV 2HR3A 5L3DA 2XAGA 2BOBC 3K0GA 5C93A 4MVZA 4BAYA 4H37A 1SERA 3MHSC 3OEHG 3F7YC 4UUJC 3CCMV 1FFTB 3E8FA 3ZRVA 1CP9A 5IY5C 2ZXWB 2JK5C 3W7XA 2ZR3A 5EBWC 2ZQMA 3QO5A 4KFMA 1SESA 2AHYA 3IGAC 4X88A 1K4CC 3TK1A 3T4ZA 2EZOA 2A9HA 1NR1A 3SYCA 1BHAA 1KKDA 4PDMA 3ETGA 1KQSU 1JX9A 3OGCC 1YJ9V 2Q69A 1E79G 3K79A 3RW0A 4G27B 1K3EA 1PD3A 2A0LA 3E8HA 1S72V 5E1AC 1K92A 2WWWA 2EIKB 1AI6A 2M7WA 5EC2C 1K9MW 4FK5C 3NXSA 1DLBA 1Q7YW 2HVKC 3I56V 1L1FA 5EK0A 1M57B 3SPIA 2XAJA 4WFBV 2QE7G 2Q68A 3ABTA 2WLHA 2WLJA 3ASNB 2Z5UA 2LFRA 4MT8A 5EBLC 2F43G 2ZR2A 1P7BA 5B1AB 3E8GA 4PDLA 3ABLC 4OXSA 2C2AA 3K3WA 3AG4B 2DYRB 1QR8A 1KP2A 3D36A 4E2LA 4GX0A 2NNUA 1EFRG 1JOYA 1VQ8V 1XL6A 1MSWD 4N21A 1BMFG 4JYBA 1PL0A 1K5QA 3WG7C 2OTJV 3MD0A 4CBCA 1KD1W 4XDKA 5J9PC 1VQNV 3P30A 4X8AA 4UVBA 3ZMUA 4R6ZA 3I55V 1H38A 3F5WC 3DGEA 1R73A 1GO3F 2Y69B 4ASUG 1F4MA 1MG1A 2JJ2G 3IFXA 3JCZA 2ZD9A 3W7TA 2KB1A 3OM3B 2EINB 3IC7A 1YIJV 2ATKC 2QM7A 3AG1C 4RUFA 4QNHB 4X89A 1DTOA 2IJKA 1CEZA 4TSFG 3TETA 3JD4A 3HPLC 2HKOA 4JPRA 2YEVA 2UXXA 4WCEV 1W2BU 4WFAV 1I5YA 1VQ4V 2EZPA 2EIJB 2XOKG 1GM7A 5CA3A 5B3SC 3ABKB 1J95A 3MHHC 1VQ6V 5LBQA 1M1KW 4JGSA 2ITCC 3VBBA 1NKDA 3OFNG 5H6RA 5IYDO 4UV9A 3JD0A 1DF4A 4MTOA 1K4DC 1VQ7V 1YI2V 4PDVA 5GW7A 1OCOB 3OR6C 1BHBA 3STLC 1RPOA 1KECA 1VQLV 2JJ1G 3CCVV 4MTGA 1M90W 2NLJC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJN V;  3CCE V;  3I56 V;  3CME V;  4WFB V;  1YHQ V;  1QVF U;  2OTJ V;  3CCL V;  5DM6 V;  1W2B U;  4WCE V;  3G71 V;  1KD1 W;  1K73 W;  4WFA V;  1VQ4 V;  3CCR V;  1VQO V;  1VQN V;  3CC4 V;  1VQM V;  1VQP V;  1QVG U;  3CCS V;  3I55 V;  2D3O W;  2QA4 V;  2OTL V;  1YJW V;  2QEX V;  1VQ6 V;  1KQS U;  1R73 A;  1Q86 W;  1M1K W;  1YJ9 V;  3CC2 V;  1N8R W;  3G4S V;  1VQK V;  1KC8 W;  3CC7 V;  1Q81 W;  3OW2 U;  1K8A W;  3CMA V;  4WF9 V;  1JJ2 U;  3CCU V;  3CCQ V;  3CCJ V;  1VQ7 V;  1VQ5 V;  1YI2 V;  3CD6 V;  1NJI W;  1YIJ V;  3CCM V;  3CXC U;  1S72 V;  3CPW U;  1Q82 W;  1YIT V;  3G6E V;  1VQL V;  1K9M W;  3CCV V;  1VQ9 V;  1M90 W;  1VQ8 V;  1Q7Y W; 
#chains in the Genus database with same CATH topology
 1YJN V;  3SDL A;  3JAR A;  4BIO A;  5FPO A;  1GTO A;  1GN6 A;  4I55 A;  3SPJ A;  1NTK H;  2ARH A;  5BMV A;  2HLD G;  2CTW A;  3M7M X;  3CYO A;  1VF6 C;  1Q3E A;  1XI1 A;  1EZJ A;  2Z3Y A;  2VQE O;  5JH7 B;  4B3M O;  2JS5 A;  5LMN O;  1W59 A;  2Q73 A;  3J81 N;  3CSX A;  1Z5W A;  5CB4 A;  4DV0 B;  1WJZ A;  4JI2 O;  5E79 Z;  4N23 A;  2ITD C;  4I4T A;  2LJ2 A;  5JVD B;  1SRY A;  2QWP B;  3K58 A;  2ZDI A;  2LW1 A;  3RFR A;  3ABM C;  3BA9 A;  1Y76 A;  2Q67 A;  4YXW G;  5IJ9 A;  3WFV A;  3TXS A;  4O2B A;  1KKC A;  2X6A A;  2UU9 O;  2EIM C;  3OGI B;  4H33 A;  3SJB C;  4YIO A;  2ZKO A;  5H2F Z;  4JI1 O;  3RYC B;  1YJW V;  4E4E A;  1VP7 A;  2E75 B;  1UFI A;  4DW1 A;  2ILM A;  1PNL A;  1VQK V;  4P9O A;  1F51 A;  2F4V B;  5J2U B;  4J41 A;  2DOS A;  2P06 A;  1L0N H;  4OX9 B;  3BY6 A;  3E22 B;  2JGD B;  4EKW A;  3AG2 C;  1WB8 A;  2V7Q G;  1ORQ C;  1S76 D;  1Q90 D;  1XUQ A;  1WB7 A;  4D7S A;  1SQG A;  3FB6 C;  4JTA B;  5JH7 A;  1SQX H;  4WFE A;  5B3S B;  1Q86 W;  3OW2 U;  2OT5 A;  3ZRS A;  4YJ3 B;  4ZBM A;  3JAW B;  4PEL A;  1NR7 A;  3CPW U;  2YSU B;  2K1E A;  4DUZ O;  4LFA O;  4MS2 A;  3ETQ A;  5LGU A;  2W0X A;  5IDJ A;  4FFK A;  4AHC A;  4DR3 O;  3UCS C;  2ZIM A;  5EIB C;  1JQ0 A;  4X62 O;  1GAX A;  2JEU A;  1THZ A;  1GH6 A;  3CC7 V;  3ZCC A;  4PHZ A;  2P90 A;  2WLK A;  1ZLZ A;  4LP8 A;  2DN9 A;  1RPR A;  3RYC A;  3N2G B;  1Y66 A;  3B8N A;  2QGN A;  3BEH A;  5IY5 B;  4HNA B;  4DR2 O;  4JI7 O;  1PNM A;  3LSU A;  1GRJ A;  3A0R A;  4CS4 A;  4F4L A;  1YDX A;  3HKC B;  5J2U A;  2UUB O;  1CXZ B;  3SJQ C;  4UCS A;  3E22 A;  2JGD A;  3QVN A;  4KHP O;  1V54 C;  4JAU A;  4RQE A;  4NXN O;  2RJZ A;  2QTO A;  2YXL A;  1NVP B;  5FL7 G;  1AVM A;  2RMK B;  2YIB D;  4LWS B;  2EIM B;  1ROP A;  4YJ3 A;  5JJE B;  2UUC O;  3JAW A;  3ABK C;  2JRI A;  1KMI Z;  4BIU A;  1TUE B;  5C8Y B;  4LFC B;  2DWE C;  1HDJ A;  3RGB A;  1N33 O;  3DC6 A;  2F93 B;  2QM8 A;  1ZSP A;  4JYA B;  4JAA A;  2P4V A;  1J5E O;  3JD2 A;  4JF3 A;  3AG2 B;  2LP7 A;  2E76 B;  1JCH A;  2VWJ A;  3M8A A;  4GZR B;  2YID A;  5CBF A;  2EJ7 A;  3N2G A;  2YEV B;  4HNA A;  2QSA A;  4GKJ O;  3HKC A;  1DK1 A;  5KHH A;  2Q7H A;  2HJD A;  2CUG A;  3JD1 A;  1H2S B;  1MAB G;  5B5E Z;  1TGO A;  4CC5 A;  3OD4 A;  3AEI A;  4ICG A;  3U11 A;  2X6B A;  2BOC C;  3QO8 A;  2JEX A;  2RN9 A;  3L70 H;  3GWO A;  1WN7 A;  1DF5 A;  2RQ6 A;  4Z2W A;  3EFF K;  2LFS A;  1R3K C;  3TCU A;  1SQP H;  1PKX A;  1N8R W;  3VQW A;  4LWS A;  1XL4 A;  4DV5 O;  4PA6 A;  2MW2 B;  2N05 A;  4J9Y B;  4O4I A;  5KHK A;  4QIW F;  5C8Y A;  2W0F C;  5KX5 A;  4GX2 A;  3CCE V;  1MNG A;  4QE9 A;  4NB5 A;  4LF4 O;  4FVM A;  2QJ1 A;  4FMT A;  3CCR V;  2Q0A A;  3B8M A;  3ZN0 A;  2XND G;  4JI6 B;  4LH6 A;  4YY3 B;  5LMU B;  1V54 B;  3LSQ A;  4FLX A;  2XTA A;  3AG4 C;  1YSC A;  1NJI W;  1F4N A;  3FB8 C;  1D5A A;  3VQY A;  1H2K A;  1E1R G;  4MTX A;  3ZJZ A;  3GVM A;  1GK9 A;  3T1Y B;  4UCO A;  1KBH A;  2A79 B;  1FPO A;  3UO2 A;  5KLV H;  4X64 O;  4LFB O;  2BE3 A;  1CPY A;  4FM0 A;  4YJ2 B;  2EIN C;  3CCQ V;  3CCJ V;  1JVM A;  1EN6 A;  4DXW A;  1MOF A;  2XHB A;  2QM4 A;  3ZN1 A;  5EYP B;  1XHX A;  2Q7G A;  4LF9 B;  2D3O W;  3B2E E;  2ZM6 B;  4BAY A;  2DE0 X;  1IBK O;  3CEI A;  1ZUQ A;  3I5D A;  3F7Y C;  3RYF B;  5A2Q N;  3ZRV A;  1I7F A;  2RDC A;  1Q6I A;  4Z1V A;  3QO5 A;  1SES A;  3TK1 A;  3T4Z A;  2ZNI A;  1ZTE A;  3SYC A;  4J7K A;  4PDM A;  4DV4 O;  3ETG A;  1JX9 A;  1YJ9 V;  5IT9 N;  4G27 B;  1K3E A;  2RCV A;  2A0L A;  2ZIN A;  1XIL A;  2WWW A;  4L8J A;  2VQF B;  1Q7Y W;  5EK0 A;  2ZCE A;  4B3S B;  1QHT A;  4WFB V;  2ZE5 A;  3OTO O;  2QE7 G;  2Q68 A;  3N27 A;  2WLH A;  3ASN B;  4X1I B;  3KZI Z;  2Z5U A;  2LFR A;  1I0H A;  2F43 G;  1BGY H;  2ZR2 A;  1P7B A;  5LP6 C;  4LF5 O;  5B66 Z;  1MSD A;  5EYP A;  1LUW A;  3ABL C;  1IDS A;  4KL1 A;  3AG4 B;  2VWK A;  1QR8 A;  4E2L A;  1NTZ H;  2NNU A;  4FM1 A;  1JOY A;  1VQ8 V;  1N32 B;  1K5Q A;  1B04 A;  3MD0 A;  1KD1 W;  5ITZ A;  3RYF A;  4O4H B;  4X8A A;  4UVB A;  4R6Z A;  2LGW A;  1H38 A;  2PZS A;  4ASU G;  2JJ2 G;  3JCZ A;  4TQD A;  4X65 O;  1PL4 A;  4IL6 Z;  3W7T A;  2EIN B;  3IC7 A;  4BR6 A;  3P3N A;  3WB0 A;  3BHP A;  4X89 A;  1DTO A;  4K8X A;  1XHZ A;  2CH7 B;  2HKO A;  1I5Y A;  1VQ4 V;  4K0K B;  5CA3 A;  1S5L Z;  4X1Y B;  5FPR A;  2WA4 A;  5LBQ A;  1M1K W;  1G1X B;  3UQ8 A;  2YS8 A;  1FFX B;  2ZE8 A;  1SF9 A;  4MTO A;  1K4D C;  1VQ7 V;  1OCO B;  4X1I A;  4X20 A;  1AP6 A;  1KEC A;  3K5M A;  2OCH A;  3PN1 A;  2NLJ C;  4PI0 A;  2PI5 A;  3OEE G;  3CRM A;  3ZX6 A;  2YIB A;  4Q6G A;  4EB6 B;  2FML A;  3ZBH A;  5CA0 B;  5L3E A;  2XAH A;  1AIL A;  3FB7 C;  4DR4 B;  2ADQ B;  4WFF A;  2QWO B;  2IJJ A;  1RSO B;  4GKK B;  4O4H A;  4MVQ A;  3J80 N;  1H2L A;  1E1Q G;  3APQ A;  1Z2G A;  4MSW C;  4LNU B;  4IIJ B;  2KSD A;  1G8M A;  1URF A;  3CJH B;  1AJN A;  3LDD A;  4GLX A;  1FKA O;  1XDC A;  1PPJ H;  2F4V O;  1IBM B;  3VOU A;  2EX3 A;  3P32 A;  4OX9 O;  5LP6 B;  4WF9 V;  1OCR C;  2GTS A;  2R72 A;  3ABL B;  1VF5 B;  5JQG B;  4PD4 F;  3G80 A;  4X1Y A;  3T4D A;  1FXK B;  5LGN A;  1IX9 A;  1FFX A;  4RUE A;  4F6E A;  2JIZ G;  1VQM V;  3RBZ A;  2HG5 C;  1S3J A;  3E35 A;  2UUA O;  1JPX A;  1Q81 W;  2X7R B;  5H6Q A;  3UKM A;  4JYY A;  2A06 H;  5JWP A;  4EB6 A;  3STZ C;  2DYS B;  4FLT A;  5HFM A;  5CA0 A;  1NVP D;  4DV2 B;  1NBM G;  4IGG A;  2QDO A;  1SZX A;  4GUN A;  4CH6 A;  2QA4 V;  1XNR B;  4JI5 O;  1NH2 D;  3FKS G;  3OT7 A;  1COW G;  4FPP A;  4UFZ A;  3JAS B;  4LNU A;  4IIJ A;  4MVO A;  3CJH A;  2IH1 C;  1OCC B;  3A0B Z;  3HR0 A;  1WP8 A;  1XMQ B;  5DEC A;  2QWQ B;  5LP6 A;  1NTM H;  1XMO B;  1QLN A;  5BZB A;  3W7U A;  1NQT A;  2ZT9 B;  3SJC C;  4R8C A;  3JCU Z;  3K0D A;  1PNK A;  5JQG A;  2B1G A;  3ZS8 C;  1YF2 A;  1FXK A;  1WPX A;  3U0Z A;  4LF7 B;  1OHH G;  3ZMZ A;  5JJJ B;  1HNX B;  3QNE A;  1HR0 B;  1AJP A;  4ZIB A;  4FM2 A;  4LFC O;  3JAM N;  4YIP A;  4A5U B;  1VQP V;  1Y67 A;  2EIL C;  3R66 A;  1K8A W;  4JYA O;  1NS1 A;  3OE7 G;  5EIB D;  3CCU V;  5L3B A;  4X1K B;  1OCR B;  4LCU C;  3UT5 B;  3TXQ A;  4QJF B;  1M9N A;  2XAS A;  4ZHQ B;  4NKG B;  3K5O A;  1EM1 A;  4WBN B;  5F2V O;  2WA3 A;  4IYH A;  3ZIA G;  1Q5O A;  4H0L B;  3FFQ A;  4JTC B;  2P22 C;  1NT2 B;  3SGI A;  2ETN A;  4R7C A;  4LBE C;  2G38 A;  4DK1 A;  2LGQ A;  4DR7 B;  3L71 H;  3OR7 C;  4MW8 A;  1Y6X A;  2HJF C;  2R70 A;  1BQ0 A;  2Y4U A;  4AI8 A;  4PA3 A;  1Q43 A;  4CH3 A;  1ZWI C;  1QBZ A;  3D36 C;  1PV0 A;  4LF6 B;  1BL8 A;  2PYJ A;  5L3G A;  4RO2 A;  1N36 B;  4TT3 G;  4JI8 B;  4BWA A;  1OV9 A;  3L9D A;  3BAA A;  4P9P A;  1WLE A;  4TV9 B;  5B1O A;  4JI6 O;  2IJI A;  4X1K A;  4U3J B;  3O65 A;  4YY3 O;  5LMU O;  3CP1 A;  1AR1 B;  3UT5 A;  4D7T A;  3JAK B;  1R6N A;  4ZHQ A;  4WBN A;  1KP3 A;  3NR7 A;  5KMG B;  4BW9 A;  4HZ3 A;  2W6I G;  4TWK A;  3T1Y O;  4AQY B;  1N0N A;  4FLZ A;  2LW7 A;  4PDR A;  1M57 C;  4LF8 B;  1UPG A;  2N04 A;  3ZHR A;  5JVD A;  4JV5 B;  2WPD G;  3G71 V;  2JGU A;  4MVR A;  1AR4 A;  3CRR A;  2EIL B;  1US6 A;  2DYR C;  1XBL A;  2NR5 A;  4CS3 A;  3ETD A;  4J11 A;  1PM9 A;  1W0J G;  1M56 C;  2RNB A;  1WP7 A;  4J10 A;  2B5U A;  2ZM6 O;  5BY1 A;  2E5L B;  3OMA B;  5B1N A;  5KA6 A;  3K9A A;  2CTR A;  2D2C B;  5K1P A;  2ODM A;  3IAY A;  4TV9 A;  4LH7 A;  4Q20 A;  4XBF A;  2IU3 A;  4U3J A;  2GUZ B;  1Z5V A;  3ABM B;  1Q8I A;  3JAK A;  4DR5 B;  3ICX A;  3EXA A;  3VQV A;  5KMG A;  1NH2 B;  3ZMV A;  1F23 A;  4RQF A;  2E3C A;  1KYO F;  2HR3 A;  2AZ0 A;  2BOB C;  4MVZ A;  5J2T B;  2VQF O;  4B3S O;  2ZR3 A;  4DK0 A;  2OIG A;  4DYL A;  2BTQ B;  4X88 A;  1K4C C;  1VF6 A;  1N34 B;  1E79 G;  3RW0 A;  1IBL B;  3E8H A;  1N32 O;  4B08 A;  5E1A C;  5EC2 C;  4K8Z A;  2DMX A;  5FNV B;  1L1F A;  1M57 B;  1EN4 A;  2XAJ A;  5EBL C;  2GUZ A;  2F23 A;  3ZHT A;  3E8G A;  3L75 H;  4TV8 B;  4JI2 B;  3LNN A;  4FLW A;  4OXS A;  2DYR B;  3D36 A;  4QGP A;  1EFR G;  3FX7 A;  4K0K O;  1BMF G;  4JYB A;  1PL0 A;  4JI3 B;  5J2T A;  3P30 A;  2BCC H;  1I08 A;  3F5W C;  4NTX A;  1AP5 A;  1P84 F;  4B7K A;  3CXH F;  4DR1 O;  3AG1 C;  3KKY A;  2BTO A;  4CS2 A;  3TET A;  2YEV A;  2YUA A;  1FJG B;  1W2B U;  2IBZ H;  3AK1 A;  3RN4 A;  2EZP A;  4UCR A;  1OJH A;  3ABK B;  1J95 A;  1WAZ A;  3VBB A;  5FNV A;  3OFN G;  5IYD O;  4UV9 A;  2KKW A;  1YI2 V;  4PDV A;  3OR6 C;  4I0X B;  1RPO A;  1MA1 A;  4OGQ B;  3RT3 C;  1VQL V;  3CCV V;  1H2N A;  1M90 W;  3RWR D;  5BR8 O;  3A8T A;  3ZHS A;  1BE3 H;  4NXM B;  3LNM B;  3B77 A;  3SPC A;  2Q9L A;  2FTK A;  2H94 A;  3E83 A;  5KUM A;  3ASO C;  4C7U A;  5CBH A;  3L72 H;  3W7W A;  3X2Q C;  5KHI A;  1W0K G;  2GV9 A;  2MK3 A;  3A2F A;  4JI4 B;  3CXC U;  5LYJ B;  2BSK B;  2XUM A;  4KXR A;  1OCZ C;  3P3P A;  1EN5 A;  1MZF A;  3ABU A;  4MVS A;  4B3R B;  4L87 A;  3APO A;  3GWK C;  3H1J H;  1FXV A;  4LR3 A;  5B1B C;  3SYQ A;  1XRE A;  4IT5 A;  4ZOL B;  2GHY A;  4J42 A;  2GDS A;  2P67 A;  3BFR A;  2JS3 A;  4PI2 A;  1BS3 A;  2UXD B;  2PTM A;  4YJ2 A;  1XNR O;  1R3L C;  4EFE A;  2DW4 A;  4I0X A;  4JI0 B;  5EC1 C;  2PUS A;  2V4D A;  5LHH A;  2PYL A;  3THO A;  3RVY A;  2ZNJ A;  4UVA A;  1XMQ O;  4OPH A;  2DWD C;  1N33 B;  2AZ2 A;  4GX5 A;  2UXN A;  1XMO O;  3G6E V;  3AG1 B;  1QQC A;  1V9P A;  4WFG A;  4X66 O;  1FS0 G;  5GON B;  3CME V;  5L3F A;  2EBO A;  1B6Q A;  3IC9 A;  3L74 H;  1J5E B;  4UV8 A;  3OMN B;  5KUK A;  3Q4H B;  3OUF A;  3T2M A;  2BSK A;  3SJA C;  4LF7 O;  1HW7 A;  4YHH B;  2EIK C;  1GN4 A;  1HNX O;  5KHJ A;  1U96 A;  3SPG A;  1HR0 O;  4TOI A;  3IJ4 A;  2ZE6 A;  4GKJ B;  4J7J A;  2M6Y A;  3BVO A;  2F95 B;  3T1H B;  5B1A C;  4FJC C;  4ZOL A;  2UXC B;  1P4R A;  1QCE A;  3K03 A;  3T1C A;  3ASO B;  1X4T A;  4B3T B;  3ZMS A;  3ZHU A;  5EBM C;  1OZ0 A;  3X2Q B;  1GN2 A;  4DR6 B;  1YZB A;  5IYC O;  4DV0 O;  1VEW A;  5H9C A;  3RVZ A;  2YDE A;  1OCZ B;  1S5H C;  4HAM A;  3R65 A;  3JD3 A;  2B9Z A;  3A0H Z;  2YC0 A;  3W7S A;  4JTD B;  4DR7 O;  1XQ8 A;  5GON A;  5IJ0 B;  3OAA G;  4GCZ A;  2NN4 A;  4XDL A;  2P4K A;  5B1B B;  3OUS A;  3C90 A;  1Q82 W;  4UCV A;  2ZDI C;  3K08 A;  4J7Z A;  5KAF Z;  4R50 A;  2EIJ C;  5IE9 A;  3CCL V;  1I94 B;  4DV1 B;  3K59 A;  4LF6 O;  2LQT A;  3FYI B;  4MVM A;  1N36 O;  4P30 A;  5IYB O;  3E89 A;  3F7V C;  4W4L A;  1A32 A;  3CMA V;  1JJ2 U;  4JI8 O;  4G2K A;  4G28 B;  2CH7 A;  4UB8 Z;  1R1B A;  1YEW A;  3D3I A;  1M5I A;  3CRC A;  4DO2 A;  2IM9 A;  1K34 A;  1ENV A;  4GT1 A;  1DGS A;  3H1I H;  4ZKI A;  5LOV B;  1VIB A;  3HKD B;  4UXN A;  3RYH B;  4AQY O;  1SA0 B;  2Q6A A;  4JZG A;  4HYO A;  2CGN A;  3B4S A;  2X6C A;  1IBK B;  4F6R B;  4JV5 O;  4GYC B;  3DSQ A;  5IJ0 A;  4BIZ A;  5DED A;  1VF7 A;  1AI4 A;  1YHQ V;  3SYA A;  1SZT A;  2CDY A;  2ZIO A;  1JMK C;  3ZHV A;  1RSO A;  3CCS V;  4MVU A;  3ZMT A;  4O4L B;  1YTF B;  3DXR B;  2P6J A;  2N74 A;  4QPJ A;  3H01 A;  1PP9 H;  3CRQ A;  1TUB B;  3VQX A;  1ARO P;  2X0L A;  2W6J G;  2E5L O;  3BA8 A;  4FLV A;  2HP8 A;  2IW5 A;  4W4K A;  4WFH A;  2YI8 A;  3EHB B;  3AK2 A;  1GM9 A;  3FB5 C;  4U7N A;  1TA8 A;  4DV3 B;  1JJO A;  3JAL B;  4MW3 A;  3KCY A;  2QTS A;  2LO1 A;  4FZ1 A;  4DR5 O;  2AGA A;  3C3S A;  5CN0 A;  2XT9 A;  4H44 B;  5LOV A;  4GX1 A;  1SET A;  3EVK A;  4I5S A;  2QR4 A;  1BZK A;  4IYI A;  3RYH A;  4DV6 B;  1SA0 A;  5HFL A;  3J7A U;  3MDS A;  3QG5 A;  4O2B B;  1O9G A;  2Y69 C;  4F6R A;  3BCC H;  3SYO A;  1LR1 A;  1KC8 W;  5LA6 B;  1GMG A;  3KG2 A;  4NYK A;  1XOU A;  2L35 A;  2Q0O C;  2JVD A;  4KP4 A;  4QPK A;  4O4L A;  1ZAU A;  3DXR A;  1K33 A;  1N34 O;  1G6U A;  3JAS A;  1K97 A;  1SS3 A;  5KHG A;  5D5Q A;  4Z1M G;  1QVG U;  1O9H A;  3H1K H;  5L3D A;  1IBL O;  1TUB A;  4H37 A;  4CH5 A;  2HHH B;  2ZE7 A;  3MHS C;  3OEH G;  4UUJ C;  1FFT B;  3E8F A;  4OPA A;  5IY5 C;  3W7X A;  3JSL A;  5EBW C;  2ZQM A;  4J80 A;  1EZV H;  3JAL A;  5JJN B;  3JSN A;  2EZO A;  1XNQ B;  3H1H H;  2KG7 B;  1KKD A;  1KQS U;  3OGC C;  2Q69 A;  3UO3 A;  3K79 A;  1MMM A;  4O4J B;  1S72 V;  1K92 A;  4JI3 O;  4DUY B;  2M7W A;  3H1L H;  4FK5 C;  3B09 A;  3NXS A;  1D5N A;  2HVK C;  2QKC A;  4JZ2 A;  5LA6 A;  3ABT A;  2UXB B;  2WLJ A;  4IHJ B;  4NR1 A;  1HNW B;  2A7W A;  2R9A A;  3B40 A;  3K3W A;  2Z0A A;  1KP2 A;  3SR2 C;  1FJG O;  5FLX N;  1MSW D;  4N21 A;  4UCU A;  3WG7 C;  4CBC A;  2CE4 A;  5A9G A;  5J9P C;  1B06 A;  3ZMU A;  3I55 V;  5IWA B;  3DGE A;  4DV7 B;  2Y69 B;  1RFY A;  3IFX A;  4B7E A;  1D2D A;  2UUA B;  3OM3 B;  1B3Q A;  4U3F H;  1VMG A;  4QNH B;  4NXM O;  2KG7 A;  2IJK A;  4TUY B;  3CX5 F;  4LF9 O;  5LXT B;  4WFA V;  1HNZ B;  4O4J A;  4PV1 B;  4FZ0 A;  4JI4 O;  4JGS A;  1L8D A;  2OIE A;  4JI5 B;  3TGU H;  1DF4 A;  5GW7 A;  1BHB A;  2H3O A;  4IHJ A;  3STL C;  5BXZ A;  4MTG A;  4LC1 A;  4B3R O;  2GBO A;  5DM6 V;  2Y0I A;  3RYI B;  4X9Q A;  2P5O A;  2P7T C;  2PY5 A;  1HP8 A;  1S5J A;  5LL6 Y;  2FL4 A;  1S0V A;  1U97 A;  2XAQ A;  4RAI A;  2QWN B;  5JCO C;  2V1D A;  3G67 A;  2OYQ A;  1XEQ A;  3AG7 A;  4HBN A;  1SQV H;  4AIL C;  3JAT B;  1YIT V;  3S3X A;  2UXD O;  4ZI7 B;  1AJQ A;  1RM1 C;  3WB2 A;  2GTA A;  1GKF A;  4JI0 O;  1TVK B;  1R3J C;  4FLU A;  1QVF U;  3FD9 A;  2JDI G;  3SYP A;  4O4I B;  5KX5 B;  4TUY A;  4CC6 A;  5LHI A;  2CAZ C;  1YCI A;  2YXH A;  1EBO A;  1FXH A;  5LXT A;  3D3Q A;  3ZRX A;  3E2E A;  4UVC A;  3U10 A;  1IXM A;  3MAQ A;  4XDJ A;  2B1I A;  1QLE C;  2VQE B;  3QTC A;  4PJ0 Z;  1NI8 A;  4B3M B;  1AI7 A;  5LMN B;  5K1X A;  3WG7 B;  1K73 W;  3GB7 C;  2QKA A;  4I50 B;  4YHH O;  4CH4 A;  1AB3 A;  1YVW A;  3AG3 C;  1R3I C;  2R9I A;  3CS5 A;  3RYI A;  2OCC C;  3SPH A;  4JAV A;  3PJS K;  2AW9 A;  4J9Z B;  3T1H O;  2CK3 G;  5KAI Z;  1WNS A;  2UXC O;  1BCC H;  2UU9 B;  1M56 B;  3HB3 B;  4ABM A;  1K7D A;  4B3T O;  3JAT A;  1FYJ A;  4ZI7 A;  1AI5 A;  1R6K A;  3ETE A;  3CC2 V;  2IJH A;  4JI1 B;  3CB2 A;  1TVK A;  2QKS A;  2PI4 A;  2BTQ A;  4DR6 O;  5EZY B;  2WLM A;  2WLI B;  3OMI B;  3UM7 A;  2WLN A;  2XAF A;  1IVS A;  1YXB A;  3K5N A;  2Y4T A;  3ASN C;  4U7O A;  1WPB A;  4BW5 A;  3E86 A;  4DR4 O;  3HKB B;  3G4S V;  1Q6U A;  2DQ3 A;  4NVP A;  1SQB H;  1WA8 B;  4RWU A;  1F7Y A;  4GKK O;  1VQ5 V;  1X59 A;  3CWB H;  2DQ0 A;  4UCT A;  4FFB B;  1I94 O;  4I50 A;  4CZZ A;  4DV1 O;  1NZ6 A;  4FIP C;  1RM1 B;  2WLL B;  2Q4P A;  5LHG A;  3O9O A;  2FKX A;  1SC5 B;  4TV8 A;  1KUQ A;  4DUZ B;  1IBM O;  4LFA B;  1JR9 A;  1ZX3 A;  2WSS G;  2GSM B;  3ZHQ A;  1I5X A;  2L6L A;  1AR5 A;  4DR3 B;  1V55 C;  4JAS A;  1K5S A;  4X62 B;  2O57 A;  4JYC A;  2A3Q A;  5LGT A;  1ZL8 B;  1YTF D;  1H8E G;  4QE7 A;  1H8H G;  1LNQ A;  2YIC A;  3OTF A;  3FAV B;  5GTH Z;  1QLE B;  3LDE A;  5EZY A;  2WLI A;  4EFB A;  4DR2 B;  4JI7 B;  4UB6 Z;  5D5P A;  3K04 A;  2UUB B;  1GM8 A;  2IU0 A;  4I9W A;  3DC5 A;  4MTF A;  1OCO C;  1Y4M A;  1SKV A;  1QR9 A;  3CHX A;  5ITZ B;  2FYU H;  4PA4 A;  4KHP B;  3AG3 B;  3HKE B;  4NXN B;  1KU9 A;  2OCC B;  4DV2 O;  2YIA A;  3HKB A;  3N2K B;  1WA8 A;  3L73 H;  3LDC A;  2CGO A;  5JCO A;  2HFE C;  1VQO V;  4EEQ A;  4FFB A;  5CA1 B;  2UUC B;  1UJW B;  2WLL A;  4NTW A;  3F5T A;  2Q7E A;  3CD6 V;  4FLY A;  2ZXW C;  2ADP A;  2R9R B;  3QO7 A;  5CMU A;  3C3T A;  3ZED A;  1IZ3 A;  2AHZ A;  3LUT B;  4DV3 O;  2YXY A;  3K06 A;  2E74 B;  4X20 B;  1ZL8 A;  5LYJ A;  1P49 A;  2QEX V;  1H2G A;  2CTP A;  2Y48 A;  3ZRW B;  3FAV A;  1JFF B;  1R6T A;  2DJV A;  5DN6 G;  3M99 B;  2H8P C;  1KB9 F;  4KUM A;  3CRA A;  4DV6 O;  1BT8 A;  2HEP A;  1FXK C;  2KQX A;  3WU2 Z;  3ML0 A;  4PA7 A;  4NTY A;  1RP3 B;  2F66 C;  4PA9 A;  3BRC A;  2Q5Z A;  3HKE A;  3S3W A;  1M93 A;  2IH3 C;  1G4Y B;  2WAM A;  5H5N A;  1BQZ A;  1V55 B;  3N2K A;  1NU1 H;  5KA5 A;  2DYS C;  4DV5 B;  1VQ9 V;  5CA1 A;  3FYE B;  3CE2 A;  2PGG A;  3JYC A;  4I9Q A;  4P2Z A;  3DTU B;  4LF4 B;  2HHH O;  1S77 D;  2EJR A;  2FB5 A;  2OWO A;  1OCC C;  2AXT Z;  5IYZ B;  1N4C A;  4DR1 B;  3E8B A;  4O2A B;  3Q4H A;  3ZRW A;  5L3C A;  1JFF A;  1XNQ O;  1QNM A;  2HVJ C;  1HWY A;  3CC4 V;  4DRX B;  3LSS A;  5CBG A;  2OTL V;  2VS0 A;  4D6T H;  2XAG A;  3K0G A;  5C93 A;  4DUY O;  1VAR A;  1TAE A;  4X64 B;  4LFB B;  1SER A;  3K5L A;  3CCM V;  1H2M A;  1CP9 A;  2ZXW B;  2JK5 C;  2UXB O;  3BAB A;  1M4U A;  2K9P A;  4KFM A;  2AHY A;  3IGA C;  5GTI Z;  1LUV A;  1QU7 A;  1HNW O;  1IUR A;  1Y74 B;  3WB1 A;  5BR8 B;  2A9H A;  3BPZ A;  3QF7 A;  1JA8 A;  1NR1 A;  1BHA A;  2EUL A;  4K3A A;  1N0J A;  1PD3 A;  2Q8V A;  4LF8 O;  1GN3 A;  2EIK B;  1AI6 A;  1K9M W;  1T5E A;  2PF4 E;  1DLB A;  3I56 V;  3SPI A;  5IWA O;  2CTQ A;  4DV7 O;  3K57 A;  4MT8 A;  1Q6H A;  5IYZ A;  4TQF A;  5B1A B;  5TIS Z;  3K9S A;  4O2A A;  3JAR B;  1SQQ H;  4I55 B;  3H9V A;  4PDL A;  4DV4 B;  1IXB A;  2QWR B;  2C2A A;  5BMV B;  4DRX A;  4GX0 A;  1XL6 A;  1HNZ O;  1FD9 A;  2OTJ V;  3KCX A;  4XDK A;  1VQN V;  4H13 B;  5AG2 A;  2VRZ A;  3OTO B;  1R73 A;  1GO3 F;  1F4M A;  1MG1 A;  3AK3 A;  2ZD9 A;  5CB4 B;  2KB1 A;  1SQF A;  1Y74 A;  4LF5 B;  1YIJ V;  2ATK C;  2QM7 A;  4RUF A;  4I4T B;  1CEZ A;  3HKD A;  4TSF G;  3JD4 A;  4X66 B;  3HPL C;  4JPR A;  2UXX A;  4WCE V;  3TJT A;  1Y76 B;  3D8C A;  3G6B A;  5IJ9 B;  2EIJ B;  2XOK G;  2YI9 A;  1GM7 A;  1MZE A;  2Y0P A;  5B3S C;  3MHH C;  1VQ6 V;  2ITC C;  1NKD A;  1BSM A;  5H6R A;  4I7Z B;  3JD0 A;  4DW0 A;  1L0L H;  2F1M A;  1P7G A;  4X65 B;  2JJ1 G;  1FAF A;  4K35 A; 
#chains in the Genus database with same CATH homology
 1YJN V;  4LC1 A;  2PI5 A;  1GTO A;  3OEE G;  3LNM B;  3B77 A;  3SPC A;  5DM6 V;  2P7T C;  3SPJ A;  2FTK A;  2HLD G;  2H94 A;  3E83 A;  5KUM A;  3ASO C;  5CBH A;  5L3E A;  3CYO A;  1S0V A;  2XAH A;  3FB7 C;  3W7W A;  2XAQ A;  3X2Q C;  4RAI A;  4WFF A;  1EZJ A;  2IJJ A;  2V1D A;  1W0K G;  2MK3 A;  2Z3Y A;  3CXC U;  1YIT V;  4MVQ A;  1AJQ A;  1E1Q G;  1RM1 C;  4MSW C;  1GKF A;  1OCZ C;  1R3J C;  1QVF U;  2JDI G;  3ABU A;  3SYP A;  1G8M A;  1AJN A;  4MVS A;  3LDD A;  4N23 A;  2ITD C;  3VOU A;  3P32 A;  4L87 A;  5LHI A;  1FXV A;  1SRY A;  1EBO A;  1FXH A;  4WF9 V;  2ZDI A;  5B1B C;  3SYQ A;  1OCR C;  3ZRX A;  3ABM C;  3ABL B;  2Q67 A;  4YXW G;  3E2E A;  4UVC A;  3WFV A;  2GHY A;  2X6A A;  1IXM A;  2P67 A;  4XDJ A;  2B1I A;  1QLE C;  2EIM C;  3T4D A;  1FXK B;  5LGN A;  1AI7 A;  4H33 A;  4RUE A;  1R3L C;  3WG7 B;  1K73 W;  2DW4 A;  2JIZ G;  1VQM V;  5EC1 C;  3RBZ A;  3GB7 C;  2HG5 C;  1S3J A;  5LHH A;  3E35 A;  1YJW V;  1PNL A;  1JPX A;  1VQK V;  4P9O A;  1Q81 W;  3RVY A;  4UVA A;  2X7R B;  5H6Q A;  1F51 A;  3UKM A;  3AG3 C;  1R3I C;  2R9I A;  2DWD C;  2OCC C;  3BY6 A;  3SPH A;  4GX5 A;  2UXN A;  4JAV A;  3PJS K;  3STZ C;  3G6E V;  2DYS B;  3AG1 B;  4J9Z B;  4WFG A;  1FS0 G;  4EKW A;  5HFM A;  3AG2 C;  2CK3 G;  2V7Q G;  3CME V;  5L3F A;  1ORQ C;  1NVP D;  1NBM G;  2EBO A;  1B6Q A;  1S76 D;  1M56 B;  4UV8 A;  3FB6 C;  3HB3 B;  4JTA B;  1K7D A;  3OMN B;  5KUK A;  2QA4 V;  4WFE A;  1AI5 A;  1R6K A;  3ETE A;  3FKS G;  3OUF A;  3T2M A;  5B3S B;  1NH2 D;  1Q86 W;  3CC2 V;  2IJH A;  3OW2 U;  2OT5 A;  1COW G;  2QKS A;  4FPP A;  3ZRS A;  2PI4 A;  4ZBM A;  2EIK C;  4PEL A;  1NR7 A;  2WLI B;  2WLM A;  3OMI B;  4MVO A;  3UM7 A;  2IH1 C;  3SPG A;  2WLN A;  2XAF A;  2YSU B;  3CPW U;  1OCC B;  2K1E A;  4MS2 A;  5LGU A;  5IDJ A;  1QLN A;  3ASN C;  5BZB A;  3W7U A;  1NQT A;  4U7O A;  4R8C A;  5B1A C;  3K0D A;  4FJC C;  1JQ0 A;  1PNK A;  1P4R A;  2JEU A;  1QCE A;  2B1G A;  3E86 A;  3K03 A;  1THZ A;  4BW5 A;  3G4S V;  3T1C A;  2DQ3 A;  3ASO B;  3ZCC A;  3CC7 V;  2P90 A;  1FXK A;  3ZMS A;  1WPX A;  5EBM C;  1OZ0 A;  1VQ5 V;  2WLK A;  3X2Q B;  4LP8 A;  2DQ0 A;  1RPR A;  1OHH G;  1Y66 A;  3ZMZ A;  3B8N A;  4CZZ A;  5IYC O;  3BEH A;  3QNE A;  5IY5 B;  4FIP C;  5H9C A;  1RM1 B;  2WLL B;  5LHG A;  3RVZ A;  1AJP A;  1PNM A;  3A0R A;  1OCZ B;  1S5H C;  4F4L A;  4HAM A;  3R65 A;  3SJQ C;  3JD3 A;  1VQP V;  3W7S A;  2WSS G;  2GSM B;  4JTD B;  1I5X A;  1V54 C;  1V55 C;  2EIL C;  4JAU A;  4JAS A;  1K8A W;  1K5S A;  3OAA G;  4GCZ A;  4RQE A;  4XDL A;  3OE7 G;  3CCU V;  2QTO A;  4JYC A;  5L3B A;  5LGT A;  5B1B B;  1OCR B;  3OUS A;  4LCU C;  1NVP B;  1YTF D;  5FL7 G;  1Q82 W;  1H8E G;  4QE7 A;  1H8H G;  1LNQ A;  4QJF B;  1M9N A;  2XAS A;  2ZDI C;  3K08 A;  1QLE B;  4R50 A;  2EIM B;  1ROP A;  2EIJ C;  3CCL V;  3LDE A;  3ZIA G;  3ABK C;  2WLI A;  4JTC B;  4BIU A;  1TUE B;  3FYI B;  4MVM A;  2DWE C;  3K04 A;  4R7C A;  4P30 A;  5IYB O;  1GM8 A;  3E89 A;  3F7V C;  4I9W A;  4LBE C;  4MTF A;  2IU0 A;  1OCO C;  3CMA V;  1Y4M A;  1JJ2 U;  1QR9 A;  4G2K A;  4G28 B;  4PA4 A;  3AG3 B;  2QM8 A;  3OR7 C;  4MW8 A;  2HJF C;  2OCC B;  3D3I A;  4PA3 A;  3JD2 A;  4JF3 A;  3AG2 B;  2LP7 A;  4DO2 A;  1JCH A;  1ZWI C;  1QBZ A;  3LDC A;  1K34 A;  1ENV A;  4GT1 A;  2HFE C;  1VQO V;  4ZKI A;  5CBF A;  4UXN A;  1BL8 A;  1UJW B;  2YEV B;  2WLL A;  2Q6A A;  5L3G A;  4HYO A;  4RO2 A;  3CD6 V;  2ZXW C;  2R9R B;  2X6C A;  3QO7 A;  5CMU A;  4TT3 G;  3JD1 A;  2AHZ A;  1MAB G;  3LUT B;  4BIZ A;  3AEI A;  4P9P A;  1AI4 A;  1WLE A;  2X6B A;  3SYA A;  2BOC C;  3QO8 A;  1YHQ V;  1SZT A;  2JEX A;  3K06 A;  5B1O A;  2IJI A;  3CP1 A;  1AR1 B;  3GWO A;  3CCS V;  1DF5 A;  4MVU A;  3EFF K;  2LFS A;  1H2G A;  1R3K C;  1R6N A;  2Y48 A;  3ZMT A;  2QEX V;  3TCU A;  3ZRW B;  1PKX A;  1N8R W;  1YTF B;  1XL4 A;  5DN6 G;  4PA6 A;  1KP3 A;  2P6J A;  3M99 B;  2H8P C;  4HZ3 A;  4KUM A;  4QPJ A;  2W6I G;  4J9Y B;  4TWK A;  3H01 A;  1FXK C;  4PDR A;  4QIW F;  2W0F C;  1M57 C;  1ARO P;  2X0L A;  2W6J G;  4GX2 A;  4QE9 A;  3CCE V;  3ML0 A;  2IW5 A;  4PA7 A;  2WPD G;  4FMT A;  4WFH A;  3EHB B;  3G71 V;  4MVR A;  4U7N A;  1GM9 A;  3FB5 C;  4PA9 A;  3CCR V;  3B8M A;  2IH3 C;  1G4Y B;  2WAM A;  3ZN0 A;  2XND G;  1V54 B;  1V55 B;  2EIL B;  3LSQ A;  4MW3 A;  5KA5 A;  3AG4 C;  1YSC A;  2DYS C;  2DYR C;  1NJI W;  1F4N A;  3FB8 C;  5CN0 A;  4GX1 A;  1VQ9 V;  1SET A;  1E1R G;  4I5S A;  4MTX A;  3ZJZ A;  3FYE B;  3ETD A;  1GK9 A;  1W0J G;  1M56 C;  5HFL A;  2B5U A;  3JYC A;  3OMA B;  3DTU B;  2A79 B;  4P2Z A;  5B1N A;  2Y69 C;  5KA6 A;  1CPY A;  3SYO A;  2EJR A;  1S77 D;  3K9A A;  1KC8 W;  2EIN C;  1GMG A;  3CCQ V;  3CCJ V;  1JVM A;  3KG2 A;  1OCC C;  4Q20 A;  4DXW A;  4XBF A;  2IU3 A;  1MOF A;  4KP4 A;  3ABM B;  4QPK A;  3E8B A;  3ZN1 A;  3ZRW A;  5L3C A;  2HVJ C;  1K33 A;  1NH2 B;  3ZMV A;  1F23 A;  1K97 A;  1HWY A;  4RQF A;  3CC4 V;  4Z1M G;  1QVG U;  3LSS A;  5CBG A;  2D3O W;  2OTL V;  2HR3 A;  5L3D A;  2XAG A;  2BOB C;  3K0G A;  5C93 A;  4MVZ A;  4BAY A;  4H37 A;  1SER A;  3MHS C;  3OEH G;  3F7Y C;  4UUJ C;  3CCM V;  1FFT B;  3E8F A;  3ZRV A;  1CP9 A;  5IY5 C;  2ZXW B;  2JK5 C;  3W7X A;  2ZR3 A;  5EBW C;  2ZQM A;  3QO5 A;  4KFM A;  1SES A;  2AHY A;  3IGA C;  4X88 A;  1K4C C;  3TK1 A;  3T4Z A;  2EZO A;  2A9H A;  1NR1 A;  3SYC A;  1BHA A;  1KKD A;  4PDM A;  3ETG A;  1KQS U;  1JX9 A;  3OGC C;  1YJ9 V;  2Q69 A;  1E79 G;  3K79 A;  3RW0 A;  4G27 B;  1K3E A;  1PD3 A;  2A0L A;  3E8H A;  1S72 V;  5E1A C;  1K92 A;  2WWW A;  2EIK B;  1AI6 A;  2M7W A;  5EC2 C;  1K9M W;  4FK5 C;  3NXS A;  1DLB A;  1Q7Y W;  2HVK C;  3I56 V;  1L1F A;  5EK0 A;  1M57 B;  3SPI A;  2XAJ A;  4WFB V;  2QE7 G;  2Q68 A;  3ABT A;  2WLH A;  2WLJ A;  3ASN B;  2Z5U A;  2LFR A;  4MT8 A;  5EBL C;  2F43 G;  2ZR2 A;  1P7B A;  5B1A B;  3E8G A;  4PDL A;  3ABL C;  4OXS A;  2C2A A;  3K3W A;  3AG4 B;  2DYR B;  1QR8 A;  1KP2 A;  3D36 A;  4E2L A;  4GX0 A;  2NNU A;  1EFR G;  1JOY A;  1VQ8 V;  1XL6 A;  1MSW D;  4N21 A;  1BMF G;  4JYB A;  1PL0 A;  1K5Q A;  3WG7 C;  2OTJ V;  3MD0 A;  4CBC A;  1KD1 W;  4XDK A;  5J9P C;  1VQN V;  3P30 A;  4X8A A;  4UVB A;  3ZMU A;  4R6Z A;  3I55 V;  1H38 A;  3F5W C;  3DGE A;  1R73 A;  1GO3 F;  2Y69 B;  4ASU G;  1F4M A;  1MG1 A;  2JJ2 G;  3IFX A;  3JCZ A;  2ZD9 A;  3W7T A;  2KB1 A;  3OM3 B;  2EIN B;  3IC7 A;  1YIJ V;  2ATK C;  2QM7 A;  3AG1 C;  4RUF A;  4QNH B;  4X89 A;  1DTO A;  2IJK A;  1CEZ A;  4TSF G;  3TET A;  3JD4 A;  3HPL C;  2HKO A;  4JPR A;  2YEV A;  2UXX A;  4WCE V;  1W2B U;  4WFA V;  1I5Y A;  1VQ4 V;  2EZP A;  2EIJ B;  2XOK G;  1GM7 A;  5CA3 A;  5B3S C;  3ABK B;  1J95 A;  3MHH C;  1VQ6 V;  5LBQ A;  1M1K W;  4JGS A;  2ITC C;  3VBB A;  1NKD A;  3OFN G;  5H6R A;  5IYD O;  4UV9 A;  3JD0 A;  1DF4 A;  4MTO A;  1K4D C;  1VQ7 V;  1YI2 V;  4PDV A;  5GW7 A;  1OCO B;  3OR6 C;  1BHB A;  3STL C;  1RPO A;  1KEC A;  1VQL V;  2JJ1 G;  3CCV V;  4MTG A;  1M90 W;  2NLJ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...