3G71V

Co-crystal structure of bruceantin bound to the large ribosomal subunit
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
molecule tags Ribosome
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3g71V00
2OTJV 3CCLV 1Q82W 4WFBV 1VQ9V 3CCQV 1KC8W 1VQ4V 1VQ6V 1YI2V 1S72V 1N8RW 1VQ7V 3G71V 1YHQV 2OTLV 3I55V 1YJNV 3CCRV 3G4SV 1YITV 1YJWV 1R73A 1VQ8V 3CC7V 3CMAV 3CMEV 1YIJV 1VQNV 1M90W 2QA4V 1KQSU 2QEXV 3CXCU 1VQPV 3OW2U 3CC2V 5DM6V 1Q7YW 1VQ5V 1QVFU 2D3OW 1VQMV 1YJ9V 3CCVV 1W2BU 3G6EV 4WF9V 3CCSV 1KD1W 1M1KW 1VQKV 1Q81W 3CCUV 1NJIW 4WFAV 3I56V 1Q86W 1K73W 1K8AW 3CC4V 3CD6V 3CCEV 1VQLV 4WCEV 3CPWU 1QVGU 3CCJV 1K9MW 3CCMV 1VQOV 1JJ2U
chains in the Genus database with same CATH superfamily
4FM2A 5BMVB 2CH7B 2PY5A 3AEIA 3FYEB 4TUYB 4DO2A 2F93B 4BW5A 1NTZH 2LO1A 2X0LA 4NTXA 2Q5ZA 4GZRB 1M5IA 4LFBB 4ICGA 2D2CB 4ZHQA 4JYYA 4TUYA 1R6TA 4MVOA 4FLYA 4IHJB 2YDEA 2PYLA 1JX9A 1Q86W 1I5YA 2JGDB 1Q6HA 1M93A 5J2TB 2LW7A 4JI2O 2XT9A 4KP4A 1MMMA 1R73A 2HG5C 5JVDB 1XHXA 3VQVA 4PA9A 4DR6O 3OEHG 1B04A 1J95A 1H38A 1Q3EA 3K5OA 3T1YO 2DOSA 1Q81W 5AG2A 2GHYA 2EIMC 4L8JA 1FAFA 1XL4A 2LGQA 3CWBH 5EIBD 2DMXA 4UCVA 3KCXA 3AG7A 4G27B 3IC7A 3WB2A 2YXYA 4UB6Z 3IJ4A 4JZ2A 1YIJV 5KUKA 4JI4O 1IXBA 3SJBC 2D3OW 3H1KH 1EN5A 1NKDA 1AJNA 3FB7C 5KAIZ 2UXBO 2HVJC 4NVPA 2JJ2G 3EXAA 3W7XA 3B8MA 1KC8W 1W0JG 2V1DA 3ABLC 1NH2D 2OIGA 3BA8A 2QDOA 1FXKA 3U11A 2PF4E 1OV9A 4JI4B 3K57A 4MT8A 2CH7A 2UXNA 5IYCO 3JD0A 1NTMH 1KD1W 1HNWB 4QIWF 5J2UA 1M1KW 1G8MA 3E8HA 4CH6A 4HAMA 4X1KB 3LNMB 3LUTB 1YI2V 1HDJA 4FFBA 3WG7C 3CCRV 4NKGB 1I08A 2BOCC 3OGCC 4EEQA 2KKWA 3SJAC 1JR9A 1S5LZ 3CXCU 1F4MA 1YXBA 4KFMA 1D5NA 3BAAA 1QHTA 4P9PA 5JVDA 1AI7A 4DV2B 2DYRC 1N34O 3TJTA 3KG2A 3L73H 4MVRA 1M56B 1N33B 3B2EE 3K79A 1SQPH 3CX5F 3JD4A 2WLKA 1KKCA 4J80A 4B7EA 3G6BA 4LNUA 4MVSA 3BVOA 4UCOA 2CGOA 3JSLA 1S5JA 1OZ0A 4HNAA 3ABMB 2EIJB 4J10A 3X2QC 1HNXB 1GN3A 2YUAA 5B5EZ 1L0LH 4IL6Z 1MOFA 2R9AA 3RVZA 4RWUA 1IBKB 5FLXN 2EINC 4X1IA 5CBGA 3OMAB 3ZRXA 1N0JA 1SA0B 2YXHA 2NLJC 3ABKB 2EJRA 2P06A 2AHYA 1XILA 2WLIB 3JALA 5HFLA 4EB6A 2WLLA 5LGUA 1N36B 1HNWO 1AB3A 2UUCO 1VF6A 1WJZA 1L1FA 4DV3B 4FIPC 3WU2Z 2RQ6A 2Z3YA 3CMAV 3NR7A 2QEXV 1SRYA 3ZHSA 2FYUH 4KL1A 3CSXA 1UPGA 4A5UB 2R70A 3TK1A 2XHBA 4WCEV 1QVGU 3UT5B 5EZYB 4AQYO 4B3MB 5HFMA 4G28B 4DR5B 1AI6A 2ZDIA 3LDEA 1MNGA 4DR5O 2EULA 4MTGA 2EZPA 5B1AC 1WPBA 1JA8A 5DM6V 4BIZA 2E75B 4NYKA 5EC1C 1RSOB 4ZBMA 3T1YB 1XL6A 4JV5B 1G4YB 1HR0O 4I4TB 4GKJB 3F5WC 5IY5B 2E74B 1M4UA 1AR5A 4BAYA 3PJSK 4ASUG 4YY3B 3CRQA 3O65A 4CH5A 4RO2A 2CGNA 4JI1O 3A8TA 5LA6B 3OR6C 2VWJA 3CHXA 1AR1B 5JH7A 5KA5A 5LMNB 3SPCA 3OT7A 5JCOA 3WB1A 5LA6A 5CB4A 1LUWA 3ZRWA 3B40A 3F7YC 1PPJH 1Z5VA 5KUMA 1XMQB 3CRCA 4C7UA 4FM0A 4JI8B 5IE9A 1K7DA 3ZRWB 1XNRO 2QJ1A 4U7OA 3SPJA 2HEPA 4TV8B 1SQXH 2OT5A 3FD9A 1OCZB 3K08A 4FFBB 4JI7B 1IZ3A 1N34B 4CS3A 2PI4A 1OHHG 2PI5A 4I0XA 1S5HC 4IGGA 2B1IA 3ASNB 3QTCA 2Q8VA 1VQ9V 1RFYA 1R1BA 5EIBC 5LYJB 2GTSA 1AILA 3FB5C 4JI8O 4JASA 4DV4B 1Y67A 3MDSA 3OMNB 4JPRA 3IGAC 3RT3C 2EJ7A 2NN4A 1AR4A 4HNAB 4I5SA 3U10A 2Q4PA 4U3FH 5KX5B 5IT9N 5D5QA 5LXTB 3JCUZ 1YITV 3C90A 3WG7B 4N23A 3SYPA 2WPDG 1F23A 5H5NA 5F2VO 1SA0A 5EBLC 1PM9A 4GYCB 2DQ3A 3UCSC 5CA1A 5IJ0B 4JV5O 2X6AA 4LR3A 1DF4A 3H1HH 2ZCEA 2G38A 3VOUA 2P4VA 3P30A 1F51A 2W6JG 1N4CA 2QWNB 1PNLA 1TUEB 1I94B 4L87A 2E76B 4PDLA 2QKCA 3H01A 4X62O 3SYCA 1IBMO 5JJNB 3BFRA 1THZA 2KB1A 4UXNA 2CTPA 1I7FA 2IJJA 4TV8A 3TXQA 2EILB 5J9PC 3T1HB 2YIAA 3J7AU 4DV0O 1XDCA 1YHQV 5LL6Y 1MABG 1Q6IA 2F66C 3K9AA 2M7WA 2P90A 1WNSA 3N2GA 1BS3A 2VQEO 4D6TH 1VF6C 5BY1A 1SETA 3E22B 4DV2O 1WN7A 1DF5A 1HW7A 4X66B 2FMLA 1KP2A 1PL0A 4JI6O 2XAHA 4PA4A 3FAVB 4J7KA 1NBMG 3C3SA 1IBMB 1K97A 3DC6A 3K0DA 2RMKB 4MW8A 3AK2A 2MW2B 4K35A 3CRAA 4JI6B 5EYPB 1YTFB 1D2DA 1Y66A 3AG2C 5CA1B 4F4LA 4E4EA 5IWAB 4UCSA 1RM1B 3WB0A 4MS2A 2ZR3A 4BIOA 1AROP 1GRJA 2QWOB 1BMFG 2XTAA 1X4TA 2HJDA 3JARA 3CC4V 4FFKA 4PELA 4GX1A 2DWEC 3AG3B 4OGQB 1GTOA 1O9GA 4O2AA 3P3PA 1N0NA 1VARA 2KSDA 2FKXA 1SC5B 4DXWA 3OAAG 1PNKA 2VRZA 2EIMB 1W2BU 4ZOLA 5CA0B 4GCZA 3SDLA 1NZ6A 5ITZB 5B1NA 3RYCA 3DC5A 5L3BA 4LWSB 3RYIA 3JCZA 1Y4MA 2X6BA 3TGUH 3MHSC 3APOA 2Q0OC 1V54C 4H33A 3CC7V 5CBFA 4LF6B 1XNRB 4MTOA 4DR4B 5IWAO 3ICXA 4WBNA 5A2QN 2UXCB 2OCHA 4F6RB 5FPRA 1XBLA 1HP8A 4EKWA 4WBNB 2LQTA 2UUAB 4B7KA 2GDSA 1JVMA 3CS5A 3ZN1A 1BGYH 3JATA 4H44B 4WFFA 1D5AA 3AG4B 2DN9A 3FX7A 2JVDA 5FL7G 4DR3B 1S3JA 4JYAO 1QCEA 1VEWA 4DK0A 5KHHA 2OYQA 4AILC 2IJKA 4D7SA 1MSDA 3QG5A 3FB8C 2BE3A 3H1JH 5GONB 3CE2A 5LHHA 4O2BB 2WSSG 3ZIAG 1MA1A 4B3TB 3E8FA 4QJFB 1OCRB 1SKVA 2NNUA 3E8BA 5CMUA 4AHCA 2Q69A 3ETGA 3HKBB 2OCCB 3CPWU 4PA3A 1K4DC 3SYAA 2DYRB 3J80N 4HYOA 2FB5A 1NTKH 2ZE8A 4Z1VA 2UXDB 2W6IG 4FJCC 5EC2C 3SGIA 5LXTA 4NTWA 4UCUA 2AGAA 2YIDA 4MVQA 1B06A 1ROPA 3L74H 2EINB 2WA4A 3MHHC 3THOA 1H2LA 2N74A 2Q9LA 1EM1A 1LR1A 2MK3A 3OW2U 2V4DA 4R8CA 3HKCB 4JYCA 1NU1H 1OJHA 4DRXB 3ZHVA 2DYSB 4EFBA 2JRIA 3JATB 4JYBA 4DV1O 1BSMA 2F23A 4DRXA 3E83A 1K5SA 1R3JC 4I9WA 4LF7O 1TVKA 3JARB 3ZHUA 2QR4A 4AI8A 3S3XA 2E5LO 1AJPA 3C3TA 3W7TA 4P9OA 4P30A 3A0RA 3LNNA 1K4CC 5L3DA 2W0XA 2EIJC 4FLTA 3L9DA 5FNVA 1N33O 1Z5WA 1AP6A 3OR7C 2IBZH 5L3GA 4WFGA 1FXVA 1H8HG 1PL4A 2K9PA 2BTOA 3RBZA 2BSKB 4ZKIA 2F4VO 1US6A 2DQ0A 3OTOO 3DTUB 1LNQA 5LOVB 4I9QA 1AP5A 3JD3A 4DR2O 1K73W 1R3IC 1EBOA 1GO3F 4K3AA 2Q7GA 3QVNA 5JQGA 1PP9H 1NR7A 5H2FZ 5BR8B 1SZXA 4OXSA 4BWAA 4DW0A 2QM7A 2QA4V 1S77D 2VQEB 1VQ5V 4LC1A 1R3KC 5B1BB 3CJHA 4BW9A 3AG1B 1ZAUA 1P7BA 3CCUV 2C2AA 4WFAV 3JAMN 4D7TA 2PGGA 1H2SB 2HKOA 3K58A 1AI4A 4MVMA 3RYHA 4FLWA 2JDIG 5J2UB 2BOBC 2ZIOA 2P6JA 2IU0A 4X8AA 1Y74B 2QGNA 2HP8A 4O4LA 3K5MA 1OCCC 1VQKV 2IJIA 1H2NA 3N2KB 3OTOB 3ZHRA 5KMGA 1P4RA 3CCMV 1KBHA 1PKXA 1HWYA 3B8NA 4TOIA 2Z0AA 1ZSPA 1HNZB 3ZMSA 5BZBA 2E5LB 3N2KA 4X1YA 1MZFA 2WAMA 1XOUA 4PA6A 3D36C 2JS5A 4W4LA 3ABUA 1XHZA 2GSMB 5KHGA 4IT5A 2W0FC 3ASOB 1FXHA 3OE7G 2IW5A 4PDMA 1NJIW 1FS0G 1FKAO 2AW9A 2H8PC 1ZL8A 1M57B 5KHIA 5LBQA 1IBKO 4UVAA 3K3WA 2LW1A 2KG7B 4FVMA 4F6EA 4DYLA 1Q5OA 1ZL8B 4LCUC 4X1IB 4DR6B 3RGBA 4J7JA 4U3JA 4J41A 1VMGA 1KMIZ 5BMVA 3IC9A 4RUEA 3RW0A 2WLIA 4LF5B 3CCQV 3CJHB 4K0KB 1F7YA 3JASB 1YJNV 2XUMA 3I5DA 4JAVA 4JTCB 5LP6C 1EN6A 4MVUA 3ABMC 1VQPV 4DV6B 2B9ZA 3J81N 2JGDA 4DV7O 4X1KA 1EZJA 3QO7A 1FXKC 2WLJA 1QNMA 3WFVA 3CRMA 4DR7B 1FD9A 5C8YA 1OCCB 1L0NH 5KMGB 4JGSA 1NQTA 1Q6UA 2ZNJA 4GT1A 2VQFO 1V55B 4TT3G 3E35A 1QR9A 4XDKA 4X66O 4MTXA 3Q4HB 3IFXA 2YI9A 2IJHA 3T4ZA 3ZMTA 3L72H 3Q4HA 3ABLB 1HNXO 3SPIA 3M8AA 1EZVH 1GN4A 2ZE7A 4UUJC 4HZ3A 5BXZA 4TV9B 4JYAB 3AG1C 3CCSV 4LF4B 4CH4A 1YF2A 2DW4A 4FK5C 5H6RA 3JAKA 2EIKC 2OTJV 4G2KA 4QE9A 4TV9A 2Q73A 4TSFG 1GAXA 2WLLB 1EFRG 3B09A 2HFEC 5E1AC 3OUSA 4ZI7B 4J42A 3ZMZA 4H13B 4TQFA 4LF8B 4FLXA 3G6EV 1FFXA 3A0HZ 1FPOA 1PV0A 3JSNA 3BY6A 5LMUB 4FLZA 2UUBO 1Y74A 3BHPA 3TCUA 4IHJA 4MVZA 4OPAA 2OTLV 4PDRA 5CBHA 5FNVB 1H2KA 4JI5O 4O4JB 2JIZG 2EX3A 3N27A 4ABMA 4H37A 5DECA 4B08A 3L75H 1AI5A 5KA6A 1N32O 4FPPA 1GMGA 1TA8A 3CCLV 1XMOO 4YXWG 1AJQA 4B3RO 1YSCA 4X9QA 2DYSC 1RSOA 2Y0PA 4LFBO 5JJJB 4CS2A 3ZMVA 5JQGB 5KHKA 5KX5A 2CDYA 5B3SB 2LFSA 4GKKO 1WB7A 3ABKC 1CEZA 3DXRB 3K06A 3ZEDA 2IU3A 4JTAB 2ADPA 4U3JB 4CH3A 2QE7G 3UO3A 4RQEA 3AK1A 1NS1A 3QO5A 3T4DA 1PNMA 1FJGB 4YHHB 2P4KA 2LGWA 4Z1MG 1FXKB 2K1EA 4KHPB 4BIUA 5TISZ 1XMOB 3LDCA 3ML0A 3VQXA 4YJ3A 2A7WA 2ZXWC 1LUVA 4RAIA 3ZRVA 5K1XA 2JS3A 2CE4A 4J11A 2YI8A 4I0XB 1WLEA 3UKMA 4JI3B 4BR6A 5FPOA 2HVKC 3OEEG 1HR0B 4WFEA 3S3WA 4DR4O 2UUBB 4DW1A 3QNEA 3P3NA 3APQA 1QBZA 1K92A 2Y0IA 3K5NA 2RNBA 2WLMA 1MSWD 3STZC 1VF7A 3T2MA 5IY5C 1COWG 3E89A 1XREA 3W7UA 1K5QA 3ETEA 3ZX6A 4E2LA 2KG7A 4OPHA 1Z2GA 2AZ0A 1JJOA 3K04A 1B3QA 2EZOA 2CUGA 3EHBB 2F1MA 3ETDA 1VQOV 1JJ2U 2H3OA 1N8RW 4IIJB 2ZD9A 2CAZC 4X89A 3DXRA 3R66A 1IURA 2HR3A 2GV9A 2XAGA 3SYOA 1VF5B 3JASA 3EVKA 2HHHO 1SQFA 2X6CA 1M9NA 2VS0A 5IDJA 3JD1A 4JAUA 4QPJA 2ARHA 4DR7O 4RQFA 2ZINA 3H1IH 1WP8A 4DR2B 3ASNC 3ZRSA 5KLVH 3ABTA 4GX0A 3HKEB 3R65A 2JEUA 1JPXA 2A3QA 1ZTEA 1ZX3A 2CTQA 4YY3O 1P49A 3L71H 1TUBB 1FJGO 4R6ZA 3CXHF 1GM8A 2E3CA 3HKEA 2B5UA 3JD2A 2UU9O 4NXMO 1JCHA 2BTQA 2QTOA 2ATKC 3KKYA 1YTFD 4MSWC 4O4JA 2UXXA 4IYIA 4X65O 1NT2B 4LF5O 2Q6AA 3L70H 3N2GB 2GUZA 4DV4O 3G71V 3D36A 2CTWA 5IYDO 4CBCA 2P5OA 5JWPA 4FLVA 4I7ZB 1NVPD 3E2EA 1KB9F 3OD4A 4UB8Z 4WF9V 1IVSA 3HKDB 1R6KA 2YIBA 1XEQA 2WLHA 4JI7O 2ITDC 4PD4F 2HHHB 3ZCCA 4OX9O 1SQBH 1SS3A 3STLC 4EFEA 1IX9A 4DK1A 1V55C 5IJ0A 3M99B 2ZE5A 4CC5A 3A2FA 4I50A 2F95B 5LMNO 2A79B 2XAQA 1BL8A 3P32A 4UCRA 3FKSG 1N36O 4GUNA 4R7CA 3CCJV 4K0KO 3D3IA 4ZHQB 3RYFB 5LP6A 3OTFA 5D5PA 4YJ3B 4LBEC 2AHZA 3CP1A 2QSAA 1IBLO 4DR1O 2AZ2A 3AG4C 3ZHTA 4N21A 1P84F 5GONA 1F4NA 4DV1B 2QM8A 4CS4A 1DTOA 4Z2WA 1K33A 1E1RG 2NR5A 5ITZA 3QF7A 5EZYA 1SERA 1NH2B 1YJ9V 2UUCB 5EBWC 2IH1C 4QGPA 4YJ2A 4PJ0Z 1WA8A 3ZBHA 3ZJZA 3SYQA 2ZIMA 2Z5UA 2Y48A 1OCOC 5IYZB 4JI2B 2ZM6B 3KZIZ 1GH6A 3B4SA 2ZXWB 1XNQO 1I0HA 1MG1A 3HB3B 2B1GA 5H9CA 5IYZA 2JGUA 3F5TA 4KHPO 3BABA 4WFHA 4DV7B 3D8CA 4I50B 1S0VA 1VQ6V 2Y69B 3SPHA 1WP7A 3AG3C 5JH7B 1VIBA 4NXNO 2WLNA 1GM7A 1XMQO 2PZSA 5CB4B 4UCTA 2X7RB 2O57A 2OIEA 4DR3O 4B3TO 1Q90D 4LFAO 2F4VB 3BA9A 1SESA 4DV6O 1A32A 4FMTA 5LP6B 1KECA 2A0LA 2EBOA 1SQVH 4R50A 3U0ZA 4NR1A 1TVKB 5B3SC 3OMIB 2UU9B 2ILMA 5IJ9B 4NXMB 3JAWB 1U97A 4PDVA 5E79Z 2BTQB 4PHZA 2QTSA 3I55V 4JI5B 3LSSA 4B3RB 3BEHA 4YIPA 3AG2B 4B3MO 3ASOC 3HKBA 4ZIBA 3UT5A 3DGEA 3CC2V 2GUZB 1BHAA 1Y6XA 5GW7A 3RWRD 2F43G 3CCEV 4LF8O 2BSKA 2P7TC 4UVBA 1BQ0A 1VQ7V 4I4TA 1YDXA 1DK1A 3OFNG 1HNZO 5EBMC 4AQYB 3CYOA 1WA8B 2V7QG 3FAVA 2HLDG 1R3LC 1ENVA 3F7VC 4GLXA 3ZS8C 3G80A 5DEDA 2QWRB 1Q43A 4LF4O 3SJQC 5H6QA 2QKSA 4WFBV 1XI1A 2JJ1G 1VQ8V 2KQXA 2P22C 4X88A 1VQNV 2Y69C 2LJ2A 5LHIA 1JQ0A 4XBFA 4MTFA 2IH3C 3CD6V 4NTYA 4FLUA 1E79G 1CPYA 1TUBA 2XAJA 2PYJA 2ZR2A 4FZ0A 1U96A 2YEVA 3MD0A 4PA7A 1K34A 3LDDA 5LHGA 1J5EO 4Q6GA 2IM9A 3JAWA 1M90W 4P2ZA 4JZGA 5A9GA 1YVWA 2FTKA 4FZ1A 4O2AB 1SF9A 1DLBA 5L3EA 5EK0A 3MAQA 1XQ8A 1XUQA 3ZN0A 3HKDA 1FFTB 3CRRA 3DSQA 3RYCB 2QWQB 2YICA 2GBOA 1NVPB 2DJVA 1TAEA 4PI0A 5B66Z 3I56V 4GKKB 2ITCC 3BRCA 4HBNA 1BZKA 1TGOA 3K03A 3T1HO 5B1AB 1Q8IA 3JYCA 4XDJA 4JF3A 4X20A 4GKJO 3SPGA 4Q20A 3HKCA 1Y76A 3TXSA 4B3SO 1S76D 3SR2C 2Q68A 5EYPA 3RYFA 1J5EB 1Y76B 1GKFA 2Y4UA 3BPZA 1H2GA 1BT8A 1URFA 1WAZA 3VQWA 3D3QA 5GTIZ 4LF7B 2UUAO 1EN4A 4PV1B 2R72A 4I55B 1MZEA 2Q67A 2R9RB 5GTHZ 2Q7EA 5CN0A 3W7WA 2YEVB 5LYJA 1WPXA 4LFAB 3CCVV 4QE7A 4I55A 4LF6O 4J7ZA 3VBBA 1ZLZA 1H2MA 2RJZA 1PD3A 2XAFA 4X1YB 1R6NA 4U7NA 1YCIA 4QPKA 3GWKC 2N05A 2Y4TA 1UJWB 2QM4A 1QLEC 3FFQA 2L6LA 3GVMA 3CEIA 4LWSA 3RYIB 4YJ2B 5LOVA 3X2QB 1RPRA 4JAAA 3O9OA 1XNQB 1VQMV 3RFRA 2VQFB 1BQZA 1QU7A 2UXBB 2XASA 4OX9B 4UFZA 4LH7A 1KP3A 1GN6A 2YC0A 2YXLA 2JEXA 2ZE6A 2OCCC 4F6RA 2L35A 1KKDA 4K8XA 1YJWV 4X64B 1YZBA 4MW3A 2EILC 2ZM6O 3JAKB 4UVCA 1KYOF 4YIOA 3ZMUA 3RYHB 3K0GA 3CB2A 4CC6A 1OCOB 3T1CA 3K5LA 1QLEB 4UV8A 1JFFB 1H8EG 3LSUA 4LF9O 4X64O 4TQDA 3W7SA 1KUQA 4DUZB 1KU9A 5IJ9A 3CMEV 1X59A 3GB7C 2ZQMA 1UFIA 4DR1B 5L3CA 2PTMA 4J9YB 1BHBA 2R9IA 2RDCA 1BCCH 4DUYO 4NB5A 2BCCH 1ZWIC 3E22A 1Q82W 1NR1A 3BCCH 1GK9A 3UM7A 1KQSU 4LFCO 2A9HA 3K9SA 1I94O 4K8ZA 4LP8A 3GWOA 2FL4A 2CTRA 1W59A 5CA3A 3A0BZ 1SQGA 1B6QA 2RN9A 3ETQA 4O4HB 3B77A 5LGTA 4JI0B 2XNDG 2P67A 3RVYA 4LF9B 4X20B 5JJEB 4O4HA 4JI3O 4O4IB 4DUYB 5IYBO 1GM9A 1WB8A 3SJCC 4KXRA 1I5XA 2AXTZ 2EIKB 2YIBD 3M7MX 4JI0O 4LFCB 2CK3G 1FFXB 1JOYA 1JFFA 5KHJA 4KUMA 3G67A 1IBLB 3VQYA 3TETA 3UQ8A 3H1LH 1QVFU 4J9ZB 5J2TA 4O2BA 2WWWA 5C8YB 1CXZB 1OCZC 1M57C 4PI2A 4NXNB 2Q7HA 1K3EA 4W4KA 4O4LB 1S72V 5KAFZ 4ZOLB 5CA0A 3HR0A 1ZUQA 2DWDC 3NXSA 4DUZO 4YHHO 2HJFC 4XDLA 5L3FA 2A06H 1QR8A 1O9HA 2PUSA 1GN2A 2XOKG 2ZT9B 3IAYA 3E8GA 1K8AW 1JMKC 5LMUO 3FYIB 1G1XB 4X65B 2QWPB 2ETNA 3RN4A 4FM1A 4CZZA 2ZDIC 5BR8O 1L8DA 4DV0B 2DE0X 1M56C 2QKAA 4JI1B 1SZTA 1IDSA 3OGIB 1QLNA 2ZNIA 3UO2A 4IIJA 4UV9A 3QO8A 1W0KG 1G6UA 4O4IA 2ODMA 5B1BC 1K9MW 2Q0AA 3JALB 4ZI7A 2OWOA 1N32B 2M6YA 2N04A 1T5EA 2VWKA 3KCYA 4EB6B 3G4SV 1FYJA 1YEWA 2RCVA 4X62B 1Q7YW 2ZKOA 2GTAA 2WA3A 4DV5B 1RM1C 2H94A 4JTDB 3EFFK 5C93A 1V54B 1AVMA 2UXCO 1E1QG 5JCOC 2JK5C 1RP3B 3HPLC 3ZHQA 2YSUB 2YS8A 3K59A 2UXDO 3FB6C 5B1OA 3OM3B 1IXMA 4GX2A 4DV5O 4H0LB 4LH6A 2LP7A 3LSQA 1DGSA 2LFRA 3H9VA 4RUFA 1P7GA 4LNUB 1VQLV 1QQCA 4DV3O 4GX5A 4IYHA 1VQ4V 5DN6G 4TWKA 3PN1A 4B3SB 2ADQB 1OCRC 4QNHB 1VP7A 1ORQC 1RPOA 5LGNA 1CP9A 1NI8A 1V9PA 5K1PA 3OUFA 3AK3A 3E86A 1SQQH 1BE3H
chains in the Genus database with same CATH topology
1YTFB 2QKSA 4G2KA 4QE9A 4WFBV 2OTJV 1Y66A 4TSFG 3AG2C 4F4LA 2JJ1G 2WLLB 3AEIA 3FYEB 4DO2A 4BW5A 1EFRG 1VQ8V 2HFEC 4X88A 1VQNV 2Y69C 2X0LA 3OUSA 5E1AC 1RM1B 4MS2A 2ZR3A 1AROP 5LHIA 1JQ0A 1BMFG 3ZMZA 4MVOA 3G6EV 4XBFA 4MTFA 1JX9A 3CC4V 3BY6A 2IH3C 1Q86W 1I5YA 3CD6V 4PELA 4GX1A 1E79G 2DWEC 3AG3B 1CPYA 2XAJA 1GTOA 3TCUA 2ZR2A 2YEVA 4PA7A 3MD0A 4MVZA 2OTLV 1K34A 4PDRA 5CBHA 4KP4A 1R73A 3LDDA 2HG5C 5LHGA 1M90W 4P2ZA 2JIZG 4DXWA 4PA9A 4H37A 3OAAG 1PNKA 2FTKA 3OEHG 1J95A 2EIMB 1H38A 1W2BU 1DLBA 5L3EA 1Q81W 2GHYA 2EIMC 4GCZA 5EK0A 1XL4A 1AI5A 5B1NA 5KA6A 5L3BA 4FPPA 1GMGA 3JCZA 1Y4MA 3CCLV 4G27B 2X6BA 3ZN0A 3IC7A 3MHSC 4YXWG 1AJQA 1FFTB 1YSCA 2DYSC 1V54C 4H33A 3CC7V 1YIJV 5KUKA 5CBFA 3ZMVA 4MTOA 2D3OW 1NVPB 1NKDA 1AJNA 3FB7C 5B3SB 2LFSA 3ABKC 2HVJC 3I56V 1CEZA 3K06A 2ITCC 2JJ2G 3W7XA 3B8MA 3K03A 4EKWA 2IU3A 4JTAB 5B1AB 3JYCA 4XDJA 4JF3A 1KC8W 1W0JG 3SPGA 4Q20A 2V1DA 3ABLC 2QE7G 1NH2D 4RQEA 1JVMA 1S76D 1FXKA 3QO5A 3ZN1A 3T4DA 2Q68A 1PNMA 4WFFA 3AG4B 4MT8A 4Z1MG 2UXNA 5FL7G 1GKFA 5IYCO 3JD0A 1S3JA 1FXKB 1KD1W 2K1EA 1H2GA 4QIWF 4BIUA 1M1KW 1G8MA 1QCEA 2IJKA 3LDCA 3ML0A 3E8HA 4HAMA 2ZXWC 3FB8C 3LNMB 3LUTB 1YI2V 4RAIA 3ZRVA 3WG7C 3CCRV 5LHHA 2WSSG 3ZIAG 2BOCC 2Q67A 2R9RB 3OGCC 5CN0A 3W7WA 3CXCU 1WLEA 1F4MA 3UKMA 2YEVB 1WPXA 4KFMA 2HVKC 3E8FA 4QE7A 4QJFB 3CCVV 3OEEG 3VBBA 1OCRB 4P9PA 2NNUA 3E8BA 5CMUA 2Q69A 3ETGA 4WFEA 1AI7A 2OCCB 2XAFA 1PD3A 3CPWU 2DYRC 1R6NA 3KG2A 3QNEA 4MVRA 4PA3A 1M56B 4U7NA 3K79A 4QPKA 1K4DC 3SYAA 3JD4A 2WLKA 2DYRB 1UJWB 1QBZA 1QLEC 4HYOA 1K92A 4MVSA 2W6IG 4FJCC 2WLMA 3X2QB 1RPRA 1MSWD 3STZC 1OZ0A 5EC2C 3ABMB 2EIJB 3T2MA 5IY5C 1COWG 3E89A 3X2QC 1VQMV 3W7UA 1K5QA 3ETEA 4E2LA 1MOFA 2XASA 3RVZA 3K04A 1KP3A 2EINC 2EZOA 5CBGA 3EHBB 3ETDA 2JEXA 3OMAB 1VQOV 3ZRXA 1JJ2U 4MVQA 1ROPA 1N8RW 2OCCC 2EINB 2ZD9A 2NLJC 3ABKB 1KKDA 2EJRA 3MHHC 4X89A 1YJWV 2AHYA 2HR3A 2WLIB 4MW3A 5HFLA 2XAGA 2MK3A 3SYOA 4R8CA 3OW2U 2EILC 4JYCA 4UVCA 2WLLA 3ZMUA 5LGUA 2DYSB 2X6CA 1M9NA 3K0GA 1OCOB 3T1CA 5IDJA 3JD1A 1QLEB 4JAUA 4JYBA 4QPJA 4UV8A 4RQFA 1L1FA 1H8EG 4FIPC 3E83A 1K5SA 1R3JC 3ASNC 4I9WA 3ZRSA 3ABTA 4GX0A 3W7SA 3R65A 2JEUA 2Z3YA 1JPXA 3CMAV 3CMEV 1AJPA 2QEXV 3GB7C 1SRYA 2ZQMA 3W7TA 4P9OA 5L3CA 4P30A 4R6ZA 1GM8A 3A0RA 3JD2A 2B5UA 4J9YB 1BHBA 1JCHA 2QTOA 2ATKC 1YTFD 2R9IA 4MSWC 1K4CC 5L3DA 3TK1A 2EIJC 4WCEV 1QVGU 2UXXA 1ZWIC 2Q6AA 1NR1A 1Q82W 3OR7C 5L3GA 4WFGA 4G28B 5HFMA 1FXVA 1AI6A 2ZDIA 3D36A 4CBCA 5IYDO 3G71V 1GK9A 1H8HG 3LDEA 4MTGA 3RBZA 2EZPA 5B1AC 3UM7A 1KQSU 1NVPD 4ZKIA 2A9HA 2DQ0A 5DM6V 4BIZA 3E2EA 4LP8A 3DTUB 5EC1C 3GWOA 4ZBMA 4WF9V 1LNQA 1XL6A 1G4YB 1R6KA 3JD3A 5CA3A 1K73W 2WLHA 1R3IC 3F5WC 2ITDC 1EBOA 1B6QA 1GO3F 3ZCCA 5IY5B 4BAYA 3PJSK 4ASUG 1NR7A 3B77A 3STLC 5LGTA 4RO2A 2XNDG 2P67A 4OXSA 1V55C 3RVYA 3M99B 2QM7A 2QA4V 1S77D 1VQ5V 4LC1A 1R3KC 5B1BB 3OR6C 5IYBO 1AR1B 1GM9A 2A79B 2XAQA 1BL8A 3AG1B 3P32A 5KA5A 1I5XA 1P7BA 3CCUV 2C2AA 3FKSG 3SPCA 4WFAV 4R7CA 3CCJV 3D3IA 3ZRWA 3F7YC 2EIKB 2HKOA 1AI4A 4MVMA 2CK3G 5KUMA 1JOYA 2JDIG 4KUMA 2BOBC 1K7DA 4LBEC 3ZRWB 2AHZA 3CP1A 4U7OA 3SPJA 2P6JA 2IU0A 4X8AA 3TETA 3AG4C 1QVFU 2OT5A 3K08A 1OCZB 4J9ZB 4N21A 2WWWA 2PI4A 1OCCC 1VQKV 1OHHG 2PI5A 1OCZC 1M57C 1F4NA 2IJIA 1S5HC 2B1IA 3ASNB 1P4RA 3CCMV 1K3EA 1PKXA 1HWYA 1VQ9V 3B8NA 2QM8A 1S72V 1DTOA 3ZMSA 5BZBA 3FB5C 1K33A 2WAMA 2DWDC 3NXSA 4JASA 4PA6A 1E1RG 2HJFC 4XDLA 3ABUA 5L3FA 2GSMB 1SERA 1NH2B 1QR8A 3OMNB 1YJ9V 2W0FC 3ASOB 4JPRA 3IGAC 2XOKG 1FXHA 3OE7G 2IW5A 4PDMA 1NJIW 1FS0G 3E8GA 5EBWC 1K8AW 2IH1C 2H8PC 4I5SA 3FYIB 3ZJZA 3SYQA 2Z5UA 2Y48A 1M57B 5LBQA 1OCOC 4UVAA 3K3WA 4CZZA 2ZDIC 1YITV 3WG7B 4N23A 3SYPA 2WPDG 1F23A 1M56C 5EBLC 4LCUC 2ZXWB 1MG1A 1SZTA 3HB3B 2B1GA 2DQ3A 5H9CA 1QLNA 4UV9A 4WFHA 3QO8A 4RUEA 2X6AA 1W0KG 1DF4A 3RW0A 1S0VA 1VQ6V 5B1BC 1K9MW 2WLIA 2Y69B 3SPHA 3VOUA 3CCQV 3AG3C 2WLNA 1GM7A 3P30A 1YJNV 3G4SV 1F51A 2W6JG 1PNLA 1TUEB 4JAVA 2X7RB 4JTCB 4MVUA 4L87A 3ABMC 1VQPV 1SESA 3H01A 4PDLA 1Q7YW 3SYCA 4FMTA 1KECA 1RM1C 2A0LA 1THZA 2EBOA 2H94A 2KB1A 1EZJA 3EFFK 3QO7A 4JTDB 1FXKC 4R50A 4UXNA 5C93A 1V54B 5B3SC 2WLJA 1E1QG 3OMIB 3WFVA 2IJJA 2EILB 5J9PC 4PDVA 2JK5C 3HPLC 2YSUB 1YHQV 1OCCB 3FB6C 5B1OA 3OM3B 1MABG 3I55V 3LSSA 3K9AA 3BEHA 1IXMA 4GX2A 3AG2B 2M7WA 2P90A 3ASOC 4JGSA 3DGEA 3CC2V 1NQTA 1BHAA 1SETA 2LP7A 3LSQA 1DF5A 4GT1A 1V55B 5GW7A 4TT3G 2LFRA 3E35A 1QR9A 4XDKA 4RUFA 1KP2A 1PL0A 4MTXA 3IFXA 2F43G 3CCEV 1VQLV 2IJHA 3T4ZA 3ZMTA 4GX5A 2P7TC 2XAHA 4UVBA 4PA4A 1VQ4V 1VQ7V 5DN6G 1NBMG 4TWKA 3OFNG 5EBMC 3ABLB 3CYOA 1OCRC 1K97A 4QNHB 3SPIA 3K0DA 2V7QG 2HLDG 4UUJC 1ORQC 1RPOA 1R3LC 4HZ3A 1ENVA 3F7VC 1CP9A 5LGNA 3OUFA 4MW8A 3AG1C 3CCSV 3E86A 2DW4A 4FK5C 3SJQC 5H6RA 5H6QA 2EIKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTJ V;  3CCL V;  1Q82 W;  4WFB V;  1VQ9 V;  3CCQ V;  1KC8 W;  1VQ4 V;  1VQ6 V;  1YI2 V;  1S72 V;  1N8R W;  1VQ7 V;  3G71 V;  1YHQ V;  2OTL V;  3I55 V;  1YJN V;  3CCR V;  3G4S V;  1YIT V;  1YJW V;  1R73 A;  1VQ8 V;  3CC7 V;  3CMA V;  3CME V;  1YIJ V;  1VQN V;  1M90 W;  2QA4 V;  1KQS U;  2QEX V;  3CXC U;  1VQP V;  3OW2 U;  3CC2 V;  5DM6 V;  1Q7Y W;  1VQ5 V;  1QVF U;  2D3O W;  1VQM V;  1YJ9 V;  3CCV V;  1W2B U;  3G6E V;  4WF9 V;  3CCS V;  1KD1 W;  1M1K W;  1VQK V;  1Q81 W;  3CCU V;  1NJI W;  4WFA V;  3I56 V;  1Q86 W;  1K73 W;  1K8A W;  3CC4 V;  3CD6 V;  3CCE V;  1VQL V;  4WCE V;  3CPW U;  1QVG U;  3CCJ V;  1K9M W;  3CCM V;  1VQO V;  1JJ2 U; 
#chains in the Genus database with same CATH topology
 4FM2 A;  5BMV B;  2CH7 B;  2PY5 A;  3AEI A;  3FYE B;  4TUY B;  4DO2 A;  2F93 B;  4BW5 A;  1NTZ H;  2LO1 A;  2X0L A;  4NTX A;  2Q5Z A;  4GZR B;  1M5I A;  4LFB B;  4ICG A;  2D2C B;  4ZHQ A;  4JYY A;  4TUY A;  1R6T A;  4MVO A;  4FLY A;  4IHJ B;  2YDE A;  2PYL A;  1JX9 A;  1Q86 W;  1I5Y A;  2JGD B;  1Q6H A;  1M93 A;  5J2T B;  2LW7 A;  4JI2 O;  2XT9 A;  4KP4 A;  1MMM A;  1R73 A;  2HG5 C;  5JVD B;  1XHX A;  3VQV A;  4PA9 A;  4DR6 O;  3OEH G;  1B04 A;  1J95 A;  1H38 A;  1Q3E A;  3K5O A;  3T1Y O;  2DOS A;  1Q81 W;  5AG2 A;  2GHY A;  2EIM C;  4L8J A;  1FAF A;  1XL4 A;  2LGQ A;  3CWB H;  5EIB D;  2DMX A;  4UCV A;  3KCX A;  3AG7 A;  4G27 B;  3IC7 A;  3WB2 A;  2YXY A;  4UB6 Z;  3IJ4 A;  4JZ2 A;  1YIJ V;  5KUK A;  4JI4 O;  1IXB A;  3SJB C;  2D3O W;  3H1K H;  1EN5 A;  1NKD A;  1AJN A;  3FB7 C;  5KAI Z;  2UXB O;  2HVJ C;  4NVP A;  2JJ2 G;  3EXA A;  3W7X A;  3B8M A;  1KC8 W;  1W0J G;  2V1D A;  3ABL C;  1NH2 D;  2OIG A;  3BA8 A;  2QDO A;  1FXK A;  3U11 A;  2PF4 E;  1OV9 A;  4JI4 B;  3K57 A;  4MT8 A;  2CH7 A;  2UXN A;  5IYC O;  3JD0 A;  1NTM H;  1KD1 W;  1HNW B;  4QIW F;  5J2U A;  1M1K W;  1G8M A;  3E8H A;  4CH6 A;  4HAM A;  4X1K B;  3LNM B;  3LUT B;  1YI2 V;  1HDJ A;  4FFB A;  3WG7 C;  3CCR V;  4NKG B;  1I08 A;  2BOC C;  3OGC C;  4EEQ A;  2KKW A;  3SJA C;  1JR9 A;  1S5L Z;  3CXC U;  1F4M A;  1YXB A;  4KFM A;  1D5N A;  3BAA A;  1QHT A;  4P9P A;  5JVD A;  1AI7 A;  4DV2 B;  2DYR C;  1N34 O;  3TJT A;  3KG2 A;  3L73 H;  4MVR A;  1M56 B;  1N33 B;  3B2E E;  3K79 A;  1SQP H;  3CX5 F;  3JD4 A;  2WLK A;  1KKC A;  4J80 A;  4B7E A;  3G6B A;  4LNU A;  4MVS A;  3BVO A;  4UCO A;  2CGO A;  3JSL A;  1S5J A;  1OZ0 A;  4HNA A;  3ABM B;  2EIJ B;  4J10 A;  3X2Q C;  1HNX B;  1GN3 A;  2YUA A;  5B5E Z;  1L0L H;  4IL6 Z;  1MOF A;  2R9A A;  3RVZ A;  4RWU A;  1IBK B;  5FLX N;  2EIN C;  4X1I A;  5CBG A;  3OMA B;  3ZRX A;  1N0J A;  1SA0 B;  2YXH A;  2NLJ C;  3ABK B;  2EJR A;  2P06 A;  2AHY A;  1XIL A;  2WLI B;  3JAL A;  5HFL A;  4EB6 A;  2WLL A;  5LGU A;  1N36 B;  1HNW O;  1AB3 A;  2UUC O;  1VF6 A;  1WJZ A;  1L1F A;  4DV3 B;  4FIP C;  3WU2 Z;  2RQ6 A;  2Z3Y A;  3CMA V;  3NR7 A;  2QEX V;  1SRY A;  3ZHS A;  2FYU H;  4KL1 A;  3CSX A;  1UPG A;  4A5U B;  2R70 A;  3TK1 A;  2XHB A;  4WCE V;  1QVG U;  3UT5 B;  5EZY B;  4AQY O;  4B3M B;  5HFM A;  4G28 B;  4DR5 B;  1AI6 A;  2ZDI A;  3LDE A;  1MNG A;  4DR5 O;  2EUL A;  4MTG A;  2EZP A;  5B1A C;  1WPB A;  1JA8 A;  5DM6 V;  4BIZ A;  2E75 B;  4NYK A;  5EC1 C;  1RSO B;  4ZBM A;  3T1Y B;  1XL6 A;  4JV5 B;  1G4Y B;  1HR0 O;  4I4T B;  4GKJ B;  3F5W C;  5IY5 B;  2E74 B;  1M4U A;  1AR5 A;  4BAY A;  3PJS K;  4ASU G;  4YY3 B;  3CRQ A;  3O65 A;  4CH5 A;  4RO2 A;  2CGN A;  4JI1 O;  3A8T A;  5LA6 B;  3OR6 C;  2VWJ A;  3CHX A;  1AR1 B;  5JH7 A;  5KA5 A;  5LMN B;  3SPC A;  3OT7 A;  5JCO A;  3WB1 A;  5LA6 A;  5CB4 A;  1LUW A;  3ZRW A;  3B40 A;  3F7Y C;  1PPJ H;  1Z5V A;  5KUM A;  1XMQ B;  3CRC A;  4C7U A;  4FM0 A;  4JI8 B;  5IE9 A;  1K7D A;  3ZRW B;  1XNR O;  2QJ1 A;  4U7O A;  3SPJ A;  2HEP A;  4TV8 B;  1SQX H;  2OT5 A;  3FD9 A;  1OCZ B;  3K08 A;  4FFB B;  4JI7 B;  1IZ3 A;  1N34 B;  4CS3 A;  2PI4 A;  1OHH G;  2PI5 A;  4I0X A;  1S5H C;  4IGG A;  2B1I A;  3ASN B;  3QTC A;  2Q8V A;  1VQ9 V;  1RFY A;  1R1B A;  5EIB C;  5LYJ B;  2GTS A;  1AIL A;  3FB5 C;  4JI8 O;  4JAS A;  4DV4 B;  1Y67 A;  3MDS A;  3OMN B;  4JPR A;  3IGA C;  3RT3 C;  2EJ7 A;  2NN4 A;  1AR4 A;  4HNA B;  4I5S A;  3U10 A;  2Q4P A;  4U3F H;  5KX5 B;  5IT9 N;  5D5Q A;  5LXT B;  3JCU Z;  1YIT V;  3C90 A;  3WG7 B;  4N23 A;  3SYP A;  2WPD G;  1F23 A;  5H5N A;  5F2V O;  1SA0 A;  5EBL C;  1PM9 A;  4GYC B;  2DQ3 A;  3UCS C;  5CA1 A;  5IJ0 B;  4JV5 O;  2X6A A;  4LR3 A;  1DF4 A;  3H1H H;  2ZCE A;  2G38 A;  3VOU A;  2P4V A;  3P30 A;  1F51 A;  2W6J G;  1N4C A;  2QWN B;  1PNL A;  1TUE B;  1I94 B;  4L87 A;  2E76 B;  4PDL A;  2QKC A;  3H01 A;  4X62 O;  3SYC A;  1IBM O;  5JJN B;  3BFR A;  1THZ A;  2KB1 A;  4UXN A;  2CTP A;  1I7F A;  2IJJ A;  4TV8 A;  3TXQ A;  2EIL B;  5J9P C;  3T1H B;  2YIA A;  3J7A U;  4DV0 O;  1XDC A;  1YHQ V;  5LL6 Y;  1MAB G;  1Q6I A;  2F66 C;  3K9A A;  2M7W A;  2P90 A;  1WNS A;  3N2G A;  1BS3 A;  2VQE O;  4D6T H;  1VF6 C;  5BY1 A;  1SET A;  3E22 B;  4DV2 O;  1WN7 A;  1DF5 A;  1HW7 A;  4X66 B;  2FML A;  1KP2 A;  1PL0 A;  4JI6 O;  2XAH A;  4PA4 A;  3FAV B;  4J7K A;  1NBM G;  3C3S A;  1IBM B;  1K97 A;  3DC6 A;  3K0D A;  2RMK B;  4MW8 A;  3AK2 A;  2MW2 B;  4K35 A;  3CRA A;  4JI6 B;  5EYP B;  1YTF B;  1D2D A;  1Y66 A;  3AG2 C;  5CA1 B;  4F4L A;  4E4E A;  5IWA B;  4UCS A;  1RM1 B;  3WB0 A;  4MS2 A;  2ZR3 A;  4BIO A;  1ARO P;  1GRJ A;  2QWO B;  1BMF G;  2XTA A;  1X4T A;  2HJD A;  3JAR A;  3CC4 V;  4FFK A;  4PEL A;  4GX1 A;  2DWE C;  3AG3 B;  4OGQ B;  1GTO A;  1O9G A;  4O2A A;  3P3P A;  1N0N A;  1VAR A;  2KSD A;  2FKX A;  1SC5 B;  4DXW A;  3OAA G;  1PNK A;  2VRZ A;  2EIM B;  1W2B U;  4ZOL A;  5CA0 B;  4GCZ A;  3SDL A;  1NZ6 A;  5ITZ B;  5B1N A;  3RYC A;  3DC5 A;  5L3B A;  4LWS B;  3RYI A;  3JCZ A;  1Y4M A;  2X6B A;  3TGU H;  3MHS C;  3APO A;  2Q0O C;  1V54 C;  4H33 A;  3CC7 V;  5CBF A;  4LF6 B;  1XNR B;  4MTO A;  4DR4 B;  5IWA O;  3ICX A;  4WBN A;  5A2Q N;  2UXC B;  2OCH A;  4F6R B;  5FPR A;  1XBL A;  1HP8 A;  4EKW A;  4WBN B;  2LQT A;  2UUA B;  4B7K A;  2GDS A;  1JVM A;  3CS5 A;  3ZN1 A;  1BGY H;  3JAT A;  4H44 B;  4WFF A;  1D5A A;  3AG4 B;  2DN9 A;  3FX7 A;  2JVD A;  5FL7 G;  4DR3 B;  1S3J A;  4JYA O;  1QCE A;  1VEW A;  4DK0 A;  5KHH A;  2OYQ A;  4AIL C;  2IJK A;  4D7S A;  1MSD A;  3QG5 A;  3FB8 C;  2BE3 A;  3H1J H;  5GON B;  3CE2 A;  5LHH A;  4O2B B;  2WSS G;  3ZIA G;  1MA1 A;  4B3T B;  3E8F A;  4QJF B;  1OCR B;  1SKV A;  2NNU A;  3E8B A;  5CMU A;  4AHC A;  2Q69 A;  3ETG A;  3HKB B;  2OCC B;  3CPW U;  4PA3 A;  1K4D C;  3SYA A;  2DYR B;  3J80 N;  4HYO A;  2FB5 A;  1NTK H;  2ZE8 A;  4Z1V A;  2UXD B;  2W6I G;  4FJC C;  5EC2 C;  3SGI A;  5LXT A;  4NTW A;  4UCU A;  2AGA A;  2YID A;  4MVQ A;  1B06 A;  1ROP A;  3L74 H;  2EIN B;  2WA4 A;  3MHH C;  3THO A;  1H2L A;  2N74 A;  2Q9L A;  1EM1 A;  1LR1 A;  2MK3 A;  3OW2 U;  2V4D A;  4R8C A;  3HKC B;  4JYC A;  1NU1 H;  1OJH A;  4DRX B;  3ZHV A;  2DYS B;  4EFB A;  2JRI A;  3JAT B;  4JYB A;  4DV1 O;  1BSM A;  2F23 A;  4DRX A;  3E83 A;  1K5S A;  1R3J C;  4I9W A;  4LF7 O;  1TVK A;  3JAR B;  3ZHU A;  2QR4 A;  4AI8 A;  3S3X A;  2E5L O;  1AJP A;  3C3T A;  3W7T A;  4P9O A;  4P30 A;  3A0R A;  3LNN A;  1K4C C;  5L3D A;  2W0X A;  2EIJ C;  4FLT A;  3L9D A;  5FNV A;  1N33 O;  1Z5W A;  1AP6 A;  3OR7 C;  2IBZ H;  5L3G A;  4WFG A;  1FXV A;  1H8H G;  1PL4 A;  2K9P A;  2BTO A;  3RBZ A;  2BSK B;  4ZKI A;  2F4V O;  1US6 A;  2DQ0 A;  3OTO O;  3DTU B;  1LNQ A;  5LOV B;  4I9Q A;  1AP5 A;  3JD3 A;  4DR2 O;  1K73 W;  1R3I C;  1EBO A;  1GO3 F;  4K3A A;  2Q7G A;  3QVN A;  5JQG A;  1PP9 H;  1NR7 A;  5H2F Z;  5BR8 B;  1SZX A;  4OXS A;  4BWA A;  4DW0 A;  2QM7 A;  2QA4 V;  1S77 D;  2VQE B;  1VQ5 V;  4LC1 A;  1R3K C;  5B1B B;  3CJH A;  4BW9 A;  3AG1 B;  1ZAU A;  1P7B A;  3CCU V;  2C2A A;  4WFA V;  3JAM N;  4D7T A;  2PGG A;  1H2S B;  2HKO A;  3K58 A;  1AI4 A;  4MVM A;  3RYH A;  4FLW A;  2JDI G;  5J2U B;  2BOB C;  2ZIO A;  2P6J A;  2IU0 A;  4X8A A;  1Y74 B;  2QGN A;  2HP8 A;  4O4L A;  3K5M A;  1OCC C;  1VQK V;  2IJI A;  1H2N A;  3N2K B;  3OTO B;  3ZHR A;  5KMG A;  1P4R A;  3CCM V;  1KBH A;  1PKX A;  1HWY A;  3B8N A;  4TOI A;  2Z0A A;  1ZSP A;  1HNZ B;  3ZMS A;  5BZB A;  2E5L B;  3N2K A;  4X1Y A;  1MZF A;  2WAM A;  1XOU A;  4PA6 A;  3D36 C;  2JS5 A;  4W4L A;  3ABU A;  1XHZ A;  2GSM B;  5KHG A;  4IT5 A;  2W0F C;  3ASO B;  1FXH A;  3OE7 G;  2IW5 A;  4PDM A;  1NJI W;  1FS0 G;  1FKA O;  2AW9 A;  2H8P C;  1ZL8 A;  1M57 B;  5KHI A;  5LBQ A;  1IBK O;  4UVA A;  3K3W A;  2LW1 A;  2KG7 B;  4FVM A;  4F6E A;  4DYL A;  1Q5O A;  1ZL8 B;  4LCU C;  4X1I B;  4DR6 B;  3RGB A;  4J7J A;  4U3J A;  4J41 A;  1VMG A;  1KMI Z;  5BMV A;  3IC9 A;  4RUE A;  3RW0 A;  2WLI A;  4LF5 B;  3CCQ V;  3CJH B;  4K0K B;  1F7Y A;  3JAS B;  1YJN V;  2XUM A;  3I5D A;  4JAV A;  4JTC B;  5LP6 C;  1EN6 A;  4MVU A;  3ABM C;  1VQP V;  4DV6 B;  2B9Z A;  3J81 N;  2JGD A;  4DV7 O;  4X1K A;  1EZJ A;  3QO7 A;  1FXK C;  2WLJ A;  1QNM A;  3WFV A;  3CRM A;  4DR7 B;  1FD9 A;  5C8Y A;  1OCC B;  1L0N H;  5KMG B;  4JGS A;  1NQT A;  1Q6U A;  2ZNJ A;  4GT1 A;  2VQF O;  1V55 B;  4TT3 G;  3E35 A;  1QR9 A;  4XDK A;  4X66 O;  4MTX A;  3Q4H B;  3IFX A;  2YI9 A;  2IJH A;  3T4Z A;  3ZMT A;  3L72 H;  3Q4H A;  3ABL B;  1HNX O;  3SPI A;  3M8A A;  1EZV H;  1GN4 A;  2ZE7 A;  4UUJ C;  4HZ3 A;  5BXZ A;  4TV9 B;  4JYA B;  3AG1 C;  3CCS V;  4LF4 B;  4CH4 A;  1YF2 A;  2DW4 A;  4FK5 C;  5H6R A;  3JAK A;  2EIK C;  2OTJ V;  4G2K A;  4QE9 A;  4TV9 A;  2Q73 A;  4TSF G;  1GAX A;  2WLL B;  1EFR G;  3B09 A;  2HFE C;  5E1A C;  3OUS A;  4ZI7 B;  4J42 A;  3ZMZ A;  4H13 B;  4TQF A;  4LF8 B;  4FLX A;  3G6E V;  1FFX A;  3A0H Z;  1FPO A;  1PV0 A;  3JSN A;  3BY6 A;  5LMU B;  4FLZ A;  2UUB O;  1Y74 A;  3BHP A;  3TCU A;  4IHJ A;  4MVZ A;  4OPA A;  2OTL V;  4PDR A;  5CBH A;  5FNV B;  1H2K A;  4JI5 O;  4O4J B;  2JIZ G;  2EX3 A;  3N27 A;  4ABM A;  4H37 A;  5DEC A;  4B08 A;  3L75 H;  1AI5 A;  5KA6 A;  1N32 O;  4FPP A;  1GMG A;  1TA8 A;  3CCL V;  1XMO O;  4YXW G;  1AJQ A;  4B3R O;  1YSC A;  4X9Q A;  2DYS C;  1RSO A;  2Y0P A;  4LFB O;  5JJJ B;  4CS2 A;  3ZMV A;  5JQG B;  5KHK A;  5KX5 A;  2CDY A;  5B3S B;  2LFS A;  4GKK O;  1WB7 A;  3ABK C;  1CEZ A;  3DXR B;  3K06 A;  3ZED A;  2IU3 A;  4JTA B;  2ADP A;  4U3J B;  4CH3 A;  2QE7 G;  3UO3 A;  4RQE A;  3AK1 A;  1NS1 A;  3QO5 A;  3T4D A;  1PNM A;  1FJG B;  4YHH B;  2P4K A;  2LGW A;  4Z1M G;  1FXK B;  2K1E A;  4KHP B;  4BIU A;  5TIS Z;  1XMO B;  3LDC A;  3ML0 A;  3VQX A;  4YJ3 A;  2A7W A;  2ZXW C;  1LUV A;  4RAI A;  3ZRV A;  5K1X A;  2JS3 A;  2CE4 A;  4J11 A;  2YI8 A;  4I0X B;  1WLE A;  3UKM A;  4JI3 B;  4BR6 A;  5FPO A;  2HVK C;  3OEE G;  1HR0 B;  4WFE A;  3S3W A;  4DR4 O;  2UUB B;  4DW1 A;  3QNE A;  3P3N A;  3APQ A;  1QBZ A;  1K92 A;  2Y0I A;  3K5N A;  2RNB A;  2WLM A;  1MSW D;  3STZ C;  1VF7 A;  3T2M A;  5IY5 C;  1COW G;  3E89 A;  1XRE A;  3W7U A;  1K5Q A;  3ETE A;  3ZX6 A;  4E2L A;  2KG7 A;  4OPH A;  1Z2G A;  2AZ0 A;  1JJO A;  3K04 A;  1B3Q A;  2EZO A;  2CUG A;  3EHB B;  2F1M A;  3ETD A;  1VQO V;  1JJ2 U;  2H3O A;  1N8R W;  4IIJ B;  2ZD9 A;  2CAZ C;  4X89 A;  3DXR A;  3R66 A;  1IUR A;  2HR3 A;  2GV9 A;  2XAG A;  3SYO A;  1VF5 B;  3JAS A;  3EVK A;  2HHH O;  1SQF A;  2X6C A;  1M9N A;  2VS0 A;  5IDJ A;  3JD1 A;  4JAU A;  4QPJ A;  2ARH A;  4DR7 O;  4RQF A;  2ZIN A;  3H1I H;  1WP8 A;  4DR2 B;  3ASN C;  3ZRS A;  5KLV H;  3ABT A;  4GX0 A;  3HKE B;  3R65 A;  2JEU A;  1JPX A;  2A3Q A;  1ZTE A;  1ZX3 A;  2CTQ A;  4YY3 O;  1P49 A;  3L71 H;  1TUB B;  1FJG O;  4R6Z A;  3CXH F;  1GM8 A;  2E3C A;  3HKE A;  2B5U A;  3JD2 A;  2UU9 O;  4NXM O;  1JCH A;  2BTQ A;  2QTO A;  2ATK C;  3KKY A;  1YTF D;  4MSW C;  4O4J A;  2UXX A;  4IYI A;  4X65 O;  1NT2 B;  4LF5 O;  2Q6A A;  3L70 H;  3N2G B;  2GUZ A;  4DV4 O;  3G71 V;  3D36 A;  2CTW A;  5IYD O;  4CBC A;  2P5O A;  5JWP A;  4FLV A;  4I7Z B;  1NVP D;  3E2E A;  1KB9 F;  3OD4 A;  4UB8 Z;  4WF9 V;  1IVS A;  3HKD B;  1R6K A;  2YIB A;  1XEQ A;  2WLH A;  4JI7 O;  2ITD C;  4PD4 F;  2HHH B;  3ZCC A;  4OX9 O;  1SQB H;  1SS3 A;  3STL C;  4EFE A;  1IX9 A;  4DK1 A;  1V55 C;  5IJ0 A;  3M99 B;  2ZE5 A;  4CC5 A;  3A2F A;  4I50 A;  2F95 B;  5LMN O;  2A79 B;  2XAQ A;  1BL8 A;  3P32 A;  4UCR A;  3FKS G;  1N36 O;  4GUN A;  4R7C A;  3CCJ V;  4K0K O;  3D3I A;  4ZHQ B;  3RYF B;  5LP6 A;  3OTF A;  5D5P A;  4YJ3 B;  4LBE C;  2AHZ A;  3CP1 A;  2QSA A;  1IBL O;  4DR1 O;  2AZ2 A;  3AG4 C;  3ZHT A;  4N21 A;  1P84 F;  5GON A;  1F4N A;  4DV1 B;  2QM8 A;  4CS4 A;  1DTO A;  4Z2W A;  1K33 A;  1E1R G;  2NR5 A;  5ITZ A;  3QF7 A;  5EZY A;  1SER A;  1NH2 B;  1YJ9 V;  2UUC B;  5EBW C;  2IH1 C;  4QGP A;  4YJ2 A;  4PJ0 Z;  1WA8 A;  3ZBH A;  3ZJZ A;  3SYQ A;  2ZIM A;  2Z5U A;  2Y48 A;  1OCO C;  5IYZ B;  4JI2 B;  2ZM6 B;  3KZI Z;  1GH6 A;  3B4S A;  2ZXW B;  1XNQ O;  1I0H A;  1MG1 A;  3HB3 B;  2B1G A;  5H9C A;  5IYZ A;  2JGU A;  3F5T A;  4KHP O;  3BAB A;  4WFH A;  4DV7 B;  3D8C A;  4I50 B;  1S0V A;  1VQ6 V;  2Y69 B;  3SPH A;  1WP7 A;  3AG3 C;  5JH7 B;  1VIB A;  4NXN O;  2WLN A;  1GM7 A;  1XMQ O;  2PZS A;  5CB4 B;  4UCT A;  2X7R B;  2O57 A;  2OIE A;  4DR3 O;  4B3T O;  1Q90 D;  4LFA O;  2F4V B;  3BA9 A;  1SES A;  4DV6 O;  1A32 A;  4FMT A;  5LP6 B;  1KEC A;  2A0L A;  2EBO A;  1SQV H;  4R50 A;  3U0Z A;  4NR1 A;  1TVK B;  5B3S C;  3OMI B;  2UU9 B;  2ILM A;  5IJ9 B;  4NXM B;  3JAW B;  1U97 A;  4PDV A;  5E79 Z;  2BTQ B;  4PHZ A;  2QTS A;  3I55 V;  4JI5 B;  3LSS A;  4B3R B;  3BEH A;  4YIP A;  3AG2 B;  4B3M O;  3ASO C;  3HKB A;  4ZIB A;  3UT5 A;  3DGE A;  3CC2 V;  2GUZ B;  1BHA A;  1Y6X A;  5GW7 A;  3RWR D;  2F43 G;  3CCE V;  4LF8 O;  2BSK A;  2P7T C;  4UVB A;  1BQ0 A;  1VQ7 V;  4I4T A;  1YDX A;  1DK1 A;  3OFN G;  1HNZ O;  5EBM C;  4AQY B;  3CYO A;  1WA8 B;  2V7Q G;  3FAV A;  2HLD G;  1R3L C;  1ENV A;  3F7V C;  4GLX A;  3ZS8 C;  3G80 A;  5DED A;  2QWR B;  1Q43 A;  4LF4 O;  3SJQ C;  5H6Q A;  2QKS A;  4WFB V;  1XI1 A;  2JJ1 G;  1VQ8 V;  2KQX A;  2P22 C;  4X88 A;  1VQN V;  2Y69 C;  2LJ2 A;  5LHI A;  1JQ0 A;  4XBF A;  4MTF A;  2IH3 C;  3CD6 V;  4NTY A;  4FLU A;  1E79 G;  1CPY A;  1TUB A;  2XAJ A;  2PYJ A;  2ZR2 A;  4FZ0 A;  1U96 A;  2YEV A;  3MD0 A;  4PA7 A;  1K34 A;  3LDD A;  5LHG A;  1J5E O;  4Q6G A;  2IM9 A;  3JAW A;  1M90 W;  4P2Z A;  4JZG A;  5A9G A;  1YVW A;  2FTK A;  4FZ1 A;  4O2A B;  1SF9 A;  1DLB A;  5L3E A;  5EK0 A;  3MAQ A;  1XQ8 A;  1XUQ A;  3ZN0 A;  3HKD A;  1FFT B;  3CRR A;  3DSQ A;  3RYC B;  2QWQ B;  2YIC A;  2GBO A;  1NVP B;  2DJV A;  1TAE A;  4PI0 A;  5B66 Z;  3I56 V;  4GKK B;  2ITC C;  3BRC A;  4HBN A;  1BZK A;  1TGO A;  3K03 A;  3T1H O;  5B1A B;  1Q8I A;  3JYC A;  4XDJ A;  4JF3 A;  4X20 A;  4GKJ O;  3SPG A;  4Q20 A;  3HKC A;  1Y76 A;  3TXS A;  4B3S O;  1S76 D;  3SR2 C;  2Q68 A;  5EYP A;  3RYF A;  1J5E B;  1Y76 B;  1GKF A;  2Y4U A;  3BPZ A;  1H2G A;  1BT8 A;  1URF A;  1WAZ A;  3VQW A;  3D3Q A;  5GTI Z;  4LF7 B;  2UUA O;  1EN4 A;  4PV1 B;  2R72 A;  4I55 B;  1MZE A;  2Q67 A;  2R9R B;  5GTH Z;  2Q7E A;  5CN0 A;  3W7W A;  2YEV B;  5LYJ A;  1WPX A;  4LFA B;  3CCV V;  4QE7 A;  4I55 A;  4LF6 O;  4J7Z A;  3VBB A;  1ZLZ A;  1H2M A;  2RJZ A;  1PD3 A;  2XAF A;  4X1Y B;  1R6N A;  4U7N A;  1YCI A;  4QPK A;  3GWK C;  2N05 A;  2Y4T A;  1UJW B;  2QM4 A;  1QLE C;  3FFQ A;  2L6L A;  3GVM A;  3CEI A;  4LWS A;  3RYI B;  4YJ2 B;  5LOV A;  3X2Q B;  1RPR A;  4JAA A;  3O9O A;  1XNQ B;  1VQM V;  3RFR A;  2VQF B;  1BQZ A;  1QU7 A;  2UXB B;  2XAS A;  4OX9 B;  4UFZ A;  4LH7 A;  1KP3 A;  1GN6 A;  2YC0 A;  2YXL A;  2JEX A;  2ZE6 A;  2OCC C;  4F6R A;  2L35 A;  1KKD A;  4K8X A;  1YJW V;  4X64 B;  1YZB A;  4MW3 A;  2EIL C;  2ZM6 O;  3JAK B;  4UVC A;  1KYO F;  4YIO A;  3ZMU A;  3RYH B;  3K0G A;  3CB2 A;  4CC6 A;  1OCO B;  3T1C A;  3K5L A;  1QLE B;  4UV8 A;  1JFF B;  1H8E G;  3LSU A;  4LF9 O;  4X64 O;  4TQD A;  3W7S A;  1KUQ A;  4DUZ B;  1KU9 A;  5IJ9 A;  3CME V;  1X59 A;  3GB7 C;  2ZQM A;  1UFI A;  4DR1 B;  5L3C A;  2PTM A;  4J9Y B;  1BHB A;  2R9I A;  2RDC A;  1BCC H;  4DUY O;  4NB5 A;  2BCC H;  1ZWI C;  3E22 A;  1Q82 W;  1NR1 A;  3BCC H;  1GK9 A;  3UM7 A;  1KQS U;  4LFC O;  2A9H A;  3K9S A;  1I94 O;  4K8Z A;  4LP8 A;  3GWO A;  2FL4 A;  2CTR A;  1W59 A;  5CA3 A;  3A0B Z;  1SQG A;  1B6Q A;  2RN9 A;  3ETQ A;  4O4H B;  3B77 A;  5LGT A;  4JI0 B;  2XND G;  2P67 A;  3RVY A;  4LF9 B;  4X20 B;  5JJE B;  4O4H A;  4JI3 O;  4O4I B;  4DUY B;  5IYB O;  1GM9 A;  1WB8 A;  3SJC C;  4KXR A;  1I5X A;  2AXT Z;  2EIK B;  2YIB D;  3M7M X;  4JI0 O;  4LFC B;  2CK3 G;  1FFX B;  1JOY A;  1JFF A;  5KHJ A;  4KUM A;  3G67 A;  1IBL B;  3VQY A;  3TET A;  3UQ8 A;  3H1L H;  1QVF U;  4J9Z B;  5J2T A;  4O2B A;  2WWW A;  5C8Y B;  1CXZ B;  1OCZ C;  1M57 C;  4PI2 A;  4NXN B;  2Q7H A;  1K3E A;  4W4K A;  4O4L B;  1S72 V;  5KAF Z;  4ZOL B;  5CA0 A;  3HR0 A;  1ZUQ A;  2DWD C;  3NXS A;  4DUZ O;  4YHH O;  2HJF C;  4XDL A;  5L3F A;  2A06 H;  1QR8 A;  1O9H A;  2PUS A;  1GN2 A;  2XOK G;  2ZT9 B;  3IAY A;  3E8G A;  1K8A W;  1JMK C;  5LMU O;  3FYI B;  1G1X B;  4X65 B;  2QWP B;  2ETN A;  3RN4 A;  4FM1 A;  4CZZ A;  2ZDI C;  5BR8 O;  1L8D A;  4DV0 B;  2DE0 X;  1M56 C;  2QKA A;  4JI1 B;  1SZT A;  1IDS A;  3OGI B;  1QLN A;  2ZNI A;  3UO2 A;  4IIJ A;  4UV9 A;  3QO8 A;  1W0K G;  1G6U A;  4O4I A;  2ODM A;  5B1B C;  1K9M W;  2Q0A A;  3JAL B;  4ZI7 A;  2OWO A;  1N32 B;  2M6Y A;  2N04 A;  1T5E A;  2VWK A;  3KCY A;  4EB6 B;  3G4S V;  1FYJ A;  1YEW A;  2RCV A;  4X62 B;  1Q7Y W;  2ZKO A;  2GTA A;  2WA3 A;  4DV5 B;  1RM1 C;  2H94 A;  4JTD B;  3EFF K;  5C93 A;  1V54 B;  1AVM A;  2UXC O;  1E1Q G;  5JCO C;  2JK5 C;  1RP3 B;  3HPL C;  3ZHQ A;  2YSU B;  2YS8 A;  3K59 A;  2UXD O;  3FB6 C;  5B1O A;  3OM3 B;  1IXM A;  4GX2 A;  4DV5 O;  4H0L B;  4LH6 A;  2LP7 A;  3LSQ A;  1DGS A;  2LFR A;  3H9V A;  4RUF A;  1P7G A;  4LNU B;  1VQL V;  1QQC A;  4DV3 O;  4GX5 A;  4IYH A;  1VQ4 V;  5DN6 G;  4TWK A;  3PN1 A;  4B3S B;  2ADQ B;  1OCR C;  4QNH B;  1VP7 A;  1ORQ C;  1RPO A;  5LGN A;  1CP9 A;  1NI8 A;  1V9P A;  5K1P A;  3OUF A;  3AK3 A;  3E86 A;  1SQQ H;  1BE3 H; 
#chains in the Genus database with same CATH homology
 1YTF B;  2QKS A;  4G2K A;  4QE9 A;  4WFB V;  2OTJ V;  1Y66 A;  4TSF G;  3AG2 C;  4F4L A;  2JJ1 G;  2WLL B;  3AEI A;  3FYE B;  4DO2 A;  4BW5 A;  1EFR G;  1VQ8 V;  2HFE C;  4X88 A;  1VQN V;  2Y69 C;  2X0L A;  3OUS A;  5E1A C;  1RM1 B;  4MS2 A;  2ZR3 A;  1ARO P;  5LHI A;  1JQ0 A;  1BMF G;  3ZMZ A;  4MVO A;  3G6E V;  4XBF A;  4MTF A;  1JX9 A;  3CC4 V;  3BY6 A;  2IH3 C;  1Q86 W;  1I5Y A;  3CD6 V;  4PEL A;  4GX1 A;  1E79 G;  2DWE C;  3AG3 B;  1CPY A;  2XAJ A;  1GTO A;  3TCU A;  2ZR2 A;  2YEV A;  4PA7 A;  3MD0 A;  4MVZ A;  2OTL V;  1K34 A;  4PDR A;  5CBH A;  4KP4 A;  1R73 A;  3LDD A;  2HG5 C;  5LHG A;  1M90 W;  4P2Z A;  2JIZ G;  4DXW A;  4PA9 A;  4H37 A;  3OAA G;  1PNK A;  2FTK A;  3OEH G;  1J95 A;  2EIM B;  1H38 A;  1W2B U;  1DLB A;  5L3E A;  1Q81 W;  2GHY A;  2EIM C;  4GCZ A;  5EK0 A;  1XL4 A;  1AI5 A;  5B1N A;  5KA6 A;  5L3B A;  4FPP A;  1GMG A;  3JCZ A;  1Y4M A;  3CCL V;  4G27 B;  2X6B A;  3ZN0 A;  3IC7 A;  3MHS C;  4YXW G;  1AJQ A;  1FFT B;  1YSC A;  2DYS C;  1V54 C;  4H33 A;  3CC7 V;  1YIJ V;  5KUK A;  5CBF A;  3ZMV A;  4MTO A;  2D3O W;  1NVP B;  1NKD A;  1AJN A;  3FB7 C;  5B3S B;  2LFS A;  3ABK C;  2HVJ C;  3I56 V;  1CEZ A;  3K06 A;  2ITC C;  2JJ2 G;  3W7X A;  3B8M A;  3K03 A;  4EKW A;  2IU3 A;  4JTA B;  5B1A B;  3JYC A;  4XDJ A;  4JF3 A;  1KC8 W;  1W0J G;  3SPG A;  4Q20 A;  2V1D A;  3ABL C;  2QE7 G;  1NH2 D;  4RQE A;  1JVM A;  1S76 D;  1FXK A;  3QO5 A;  3ZN1 A;  3T4D A;  2Q68 A;  1PNM A;  4WFF A;  3AG4 B;  4MT8 A;  4Z1M G;  2UXN A;  5FL7 G;  1GKF A;  5IYC O;  3JD0 A;  1S3J A;  1FXK B;  1KD1 W;  2K1E A;  1H2G A;  4QIW F;  4BIU A;  1M1K W;  1G8M A;  1QCE A;  2IJK A;  3LDC A;  3ML0 A;  3E8H A;  4HAM A;  2ZXW C;  3FB8 C;  3LNM B;  3LUT B;  1YI2 V;  4RAI A;  3ZRV A;  3WG7 C;  3CCR V;  5LHH A;  2WSS G;  3ZIA G;  2BOC C;  2Q67 A;  2R9R B;  3OGC C;  5CN0 A;  3W7W A;  3CXC U;  1WLE A;  1F4M A;  3UKM A;  2YEV B;  1WPX A;  4KFM A;  2HVK C;  3E8F A;  4QE7 A;  4QJF B;  3CCV V;  3OEE G;  3VBB A;  1OCR B;  4P9P A;  2NNU A;  3E8B A;  5CMU A;  2Q69 A;  3ETG A;  4WFE A;  1AI7 A;  2OCC B;  2XAF A;  1PD3 A;  3CPW U;  2DYR C;  1R6N A;  3KG2 A;  3QNE A;  4MVR A;  4PA3 A;  1M56 B;  4U7N A;  3K79 A;  4QPK A;  1K4D C;  3SYA A;  3JD4 A;  2WLK A;  2DYR B;  1UJW B;  1QBZ A;  1QLE C;  4HYO A;  1K92 A;  4MVS A;  2W6I G;  4FJC C;  2WLM A;  3X2Q B;  1RPR A;  1MSW D;  3STZ C;  1OZ0 A;  5EC2 C;  3ABM B;  2EIJ B;  3T2M A;  5IY5 C;  1COW G;  3E89 A;  3X2Q C;  1VQM V;  3W7U A;  1K5Q A;  3ETE A;  4E2L A;  1MOF A;  2XAS A;  3RVZ A;  3K04 A;  1KP3 A;  2EIN C;  2EZO A;  5CBG A;  3EHB B;  3ETD A;  2JEX A;  3OMA B;  1VQO V;  3ZRX A;  1JJ2 U;  4MVQ A;  1ROP A;  1N8R W;  2OCC C;  2EIN B;  2ZD9 A;  2NLJ C;  3ABK B;  1KKD A;  2EJR A;  3MHH C;  4X89 A;  1YJW V;  2AHY A;  2HR3 A;  2WLI B;  4MW3 A;  5HFL A;  2XAG A;  2MK3 A;  3SYO A;  4R8C A;  3OW2 U;  2EIL C;  4JYC A;  4UVC A;  2WLL A;  3ZMU A;  5LGU A;  2DYS B;  2X6C A;  1M9N A;  3K0G A;  1OCO B;  3T1C A;  5IDJ A;  3JD1 A;  1QLE B;  4JAU A;  4JYB A;  4QPJ A;  4UV8 A;  4RQF A;  1L1F A;  1H8E G;  4FIP C;  3E83 A;  1K5S A;  1R3J C;  3ASN C;  4I9W A;  3ZRS A;  3ABT A;  4GX0 A;  3W7S A;  3R65 A;  2JEU A;  2Z3Y A;  1JPX A;  3CMA V;  3CME V;  1AJP A;  2QEX V;  3GB7 C;  1SRY A;  2ZQM A;  3W7T A;  4P9O A;  5L3C A;  4P30 A;  4R6Z A;  1GM8 A;  3A0R A;  3JD2 A;  2B5U A;  4J9Y B;  1BHB A;  1JCH A;  2QTO A;  2ATK C;  1YTF D;  2R9I A;  4MSW C;  1K4C C;  5L3D A;  3TK1 A;  2EIJ C;  4WCE V;  1QVG U;  2UXX A;  1ZWI C;  2Q6A A;  1NR1 A;  1Q82 W;  3OR7 C;  5L3G A;  4WFG A;  4G28 B;  5HFM A;  1FXV A;  1AI6 A;  2ZDI A;  3D36 A;  4CBC A;  5IYD O;  3G71 V;  1GK9 A;  1H8H G;  3LDE A;  4MTG A;  3RBZ A;  2EZP A;  5B1A C;  3UM7 A;  1KQS U;  1NVP D;  4ZKI A;  2A9H A;  2DQ0 A;  5DM6 V;  4BIZ A;  3E2E A;  4LP8 A;  3DTU B;  5EC1 C;  3GWO A;  4ZBM A;  4WF9 V;  1LNQ A;  1XL6 A;  1G4Y B;  1R6K A;  3JD3 A;  5CA3 A;  1K73 W;  2WLH A;  1R3I C;  3F5W C;  2ITD C;  1EBO A;  1B6Q A;  1GO3 F;  3ZCC A;  5IY5 B;  4BAY A;  3PJS K;  4ASU G;  1NR7 A;  3B77 A;  3STL C;  5LGT A;  4RO2 A;  2XND G;  2P67 A;  4OXS A;  1V55 C;  3RVY A;  3M99 B;  2QM7 A;  2QA4 V;  1S77 D;  1VQ5 V;  4LC1 A;  1R3K C;  5B1B B;  3OR6 C;  5IYB O;  1AR1 B;  1GM9 A;  2A79 B;  2XAQ A;  1BL8 A;  3AG1 B;  3P32 A;  5KA5 A;  1I5X A;  1P7B A;  3CCU V;  2C2A A;  3FKS G;  3SPC A;  4WFA V;  4R7C A;  3CCJ V;  3D3I A;  3ZRW A;  3F7Y C;  2EIK B;  2HKO A;  1AI4 A;  4MVM A;  2CK3 G;  5KUM A;  1JOY A;  2JDI G;  4KUM A;  2BOB C;  1K7D A;  4LBE C;  3ZRW B;  2AHZ A;  3CP1 A;  4U7O A;  3SPJ A;  2P6J A;  2IU0 A;  4X8A A;  3TET A;  3AG4 C;  1QVF U;  2OT5 A;  3K08 A;  1OCZ B;  4J9Z B;  4N21 A;  2WWW A;  2PI4 A;  1OCC C;  1VQK V;  1OHH G;  2PI5 A;  1OCZ C;  1M57 C;  1F4N A;  2IJI A;  1S5H C;  2B1I A;  3ASN B;  1P4R A;  3CCM V;  1K3E A;  1PKX A;  1HWY A;  1VQ9 V;  3B8N A;  2QM8 A;  1S72 V;  1DTO A;  3ZMS A;  5BZB A;  3FB5 C;  1K33 A;  2WAM A;  2DWD C;  3NXS A;  4JAS A;  4PA6 A;  1E1R G;  2HJF C;  4XDL A;  3ABU A;  5L3F A;  2GSM B;  1SER A;  1NH2 B;  1QR8 A;  3OMN B;  1YJ9 V;  2W0F C;  3ASO B;  4JPR A;  3IGA C;  2XOK G;  1FXH A;  3OE7 G;  2IW5 A;  4PDM A;  1NJI W;  1FS0 G;  3E8G A;  5EBW C;  1K8A W;  2IH1 C;  2H8P C;  4I5S A;  3FYI B;  3ZJZ A;  3SYQ A;  2Z5U A;  2Y48 A;  1M57 B;  5LBQ A;  1OCO C;  4UVA A;  3K3W A;  4CZZ A;  2ZDI C;  1YIT V;  3WG7 B;  4N23 A;  3SYP A;  2WPD G;  1F23 A;  1M56 C;  5EBL C;  4LCU C;  2ZXW B;  1MG1 A;  1SZT A;  3HB3 B;  2B1G A;  2DQ3 A;  5H9C A;  1QLN A;  4UV9 A;  4WFH A;  3QO8 A;  4RUE A;  2X6A A;  1W0K G;  1DF4 A;  3RW0 A;  1S0V A;  1VQ6 V;  5B1B C;  1K9M W;  2WLI A;  2Y69 B;  3SPH A;  3VOU A;  3CCQ V;  3AG3 C;  2WLN A;  1GM7 A;  3P30 A;  1YJN V;  3G4S V;  1F51 A;  2W6J G;  1PNL A;  1TUE B;  4JAV A;  2X7R B;  4JTC B;  4MVU A;  4L87 A;  3ABM C;  1VQP V;  1SES A;  3H01 A;  4PDL A;  1Q7Y W;  3SYC A;  4FMT A;  1KEC A;  1RM1 C;  2A0L A;  1THZ A;  2EBO A;  2H94 A;  2KB1 A;  1EZJ A;  3EFF K;  3QO7 A;  4JTD B;  1FXK C;  4R50 A;  4UXN A;  5C93 A;  1V54 B;  5B3S C;  2WLJ A;  1E1Q G;  3OMI B;  3WFV A;  2IJJ A;  2EIL B;  5J9P C;  4PDV A;  2JK5 C;  3HPL C;  2YSU B;  1YHQ V;  1OCC B;  3FB6 C;  5B1O A;  3OM3 B;  1MAB G;  3I55 V;  3LSS A;  3K9A A;  3BEH A;  1IXM A;  4GX2 A;  3AG2 B;  2M7W A;  2P90 A;  3ASO C;  4JGS A;  3DGE A;  3CC2 V;  1NQT A;  1BHA A;  1SET A;  2LP7 A;  3LSQ A;  1DF5 A;  4GT1 A;  1V55 B;  5GW7 A;  4TT3 G;  2LFR A;  3E35 A;  1QR9 A;  4XDK A;  4RUF A;  1KP2 A;  1PL0 A;  4MTX A;  3IFX A;  2F43 G;  3CCE V;  1VQL V;  2IJH A;  3T4Z A;  3ZMT A;  4GX5 A;  2P7T C;  2XAH A;  4UVB A;  4PA4 A;  1VQ4 V;  1VQ7 V;  5DN6 G;  1NBM G;  4TWK A;  3OFN G;  5EBM C;  3ABL B;  3CYO A;  1OCR C;  1K97 A;  4QNH B;  3SPI A;  3K0D A;  2V7Q G;  2HLD G;  4UUJ C;  1ORQ C;  1RPO A;  1R3L C;  4HZ3 A;  1ENV A;  3F7V C;  1CP9 A;  5LGN A;  3OUF A;  4MW8 A;  3AG1 C;  3CCS V;  3E86 A;  2DW4 A;  4FK5 C;  3SJQ C;  5H6R A;  5H6Q A;  2EIK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...