3G71V

Co-crystal structure of bruceantin bound to the large ribosomal subunit
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3g71V00
1YJNV 1Q82W 2OTLV 1VQ4V 3CMAV 1M1KW 2D3OW 4WF9V 1YITV 1VQPV 3CCJV 1VQMV 1R73A 3I55V 1VQKV 4WCEV 3CCMV 3CCQV 1VQLV 1YJWV 1K8AW 1K9MW 3OW2U 1VQ9V 2QEXV 1N8RW 5DM6V 3CCVV 3CD6V 3CCEV 3CCSV 1YIJV 3G71V 1KQSU 1Q86W 1VQ7V 4WFAV 3G4SV 1KD1W 1YJ9V 1VQ5V 1NJIW 1VQNV 3CMEV 1S72V 3CC2V 3CXCU 3CC7V 1W2BU 1Q7YW 4WFBV 1YI2V 1QVGU 1K73W 1VQ6V 2OTJV 1M90W 2QA4V 1YHQV 3G6EV 1JJ2U 3CCRV 3CPWU 3CCUV 1VQOV 1Q81W 3CC4V 1QVFU 1KC8W 3CCLV 3I56V 1VQ8V
chains in the Genus database with same CATH superfamily
2JGDA 2QDOA 4WF9V 1Y74B 3T2MA 3OGCC 2P6JA 1IXBA 4B3SB 3ZHRA 1Y76A 4F6EA 2WWWA 2YC0A 4XBFA 1Q7YW 5LP6A 1FXHA 4B3TO 1XNQB 4LP8A 5D5PA 4H0LB 1DK1A 1WJZA 2HG5C 1YJWV 3Q4HB 4YIPA 3RYIB 1BQ0A 3TXQA 1GH6A 2QGNA 3PN1A 3CCEV 2XHBA 1WA8A 1VF7A 3SJQC 1K3EA 4DR1O 3D3QA 1JPXA 5LMUO 5LL6Y 2L35A 1Q43A 3O65A 3ABLB 3LSQA 3CC4V 1H38A 1E79G 1VQ8V 3I5DA 1AI7A 3AK2A 5KMGB 1L1FA 4JGSA 2BTQB 2L6LA 1KD1W 1IBLO 3H1IH 3E8FA 1VIBA 3SJBC 4EKWA 5GTHZ 4UXNA 4WFBV 1YHQV 3ABKC 4DRXB 1KKCA 3SPIA 4UFZA 2QSAA 3AG2C 4FLYA 1S76D 3ZS8C 3L72H 1EN5A 4JAUA 1NZ6A 4FPPA 5BXZA 3CP1A 4NB5A 4WBNB 1V54C 4RAIA 1BL8A 3BA9A 2K9PA 3RFRA 1PL4A 1QCEA 1TUBA 2C2AA 3ETDA 4KFMA 4LH7A 1OCRC 1K97A 4JYAB 4QE9A 1HNWB 5C8YA 2ZIMA 4K8ZA 4TQFA 1VQPV 4H33A 5L3EA 2XOKG 1FKAO 2G38A 4FM1A 1URFA 4DK0A 1XMQB 2PF4E 1JOYA 3RN4A 2ZDIA 3EXAA 1RSOA 3C3TA 2UXDB 2B1IA 5IJ9A 4I9WA 3ZN1A 4CS4A 1HNXB 4WFGA 1IBMB 3ZRWB 1G1XB 4ZHQB 3M99B 1CPYA 1VP7A 3JASA 3K0GA 1JR9A 2VQFO 1BZKA 3W7SA 1R73A 4DXWA 1K9MW 2HFEC 3OUFA 1QHTA 5HFMA 4DR5O 4X1IA 3CWBH 1E1QG 3H1LH 5LHHA 4JI1O 3ZHUA 4IGGA 4PDRA 2QTOA 4N21A 3SPCA 2EJ7A 2AGAA 4IHJB 5L3FA 2ZXWC 4PA4A 4PELA 4GKJB 4J7ZA 4FLXA 2BTOA 3BVOA 3WG7C 4XDJA 3W7WA 3AG1C 3AK1A 1D5AA 4PA3A 2JGUA 3BEHA 4G28B 3JCUZ 2CGOA 3CC2V 4JI8O 1NR7A 1LNQA 4DV3B 4L87A 4IT5A 1YVWA 4O2AA 2MW2B 2W0XA 2XASA 1KP2A 4B3TB 1ORQC 4K3AA 3HKBB 3OGIB 1VQMV 1OZ0A 2GTAA 4Q20A 2GDSA 5LHIA 1NT2B 1Z2GA 3AG4C 4JI7B 1GN2A 2QWOB 2WLHA 2P90A 1V9PA 5CB4A 3K58A 3NR7A 4I55A 3RT3C 4O4JA 2Q67A 3WB1A 4KUMA 4JZGA 1YXBA 2Z3YA 1N33O 4DR6B 5E79Z 5CBGA 2LFRA 4BIZA 2OIEA 1JMKC 5LMUB 4Q6GA 4DR2O 5LMNB 4CS2A 1MMMA 5CBFA 4O4LB 5K1XA 4PDMA 2WLJA 4UCOA 2P06A 1M56B 3CEIA 5A9GA 4KHPB 1NTZH 3H01A 2LJ2A 2LQTA 2GHYA 3ABKB 5IE9A 2OCCC 3AG2B 4F6RA 3AG3C 4I50B 2FL4A 3M7MX 3W7UA 3G71V 1V54B 1OCZC 3OE7G 5JJEB 3P30A 3RYHA 4FK5C 1KU9A 3QG5A 1OCRB 1XQ8A 4QNHB 2V7QG 2GUZA 3CXHF 3JD0A 4BW5A 1FFXB 5CA3A 5IYCO 2QEXV 3ZRVA 5B5EZ 4GX5A 1H8HG 1GRJA 2UXNA 1BT8A 4X1KA 5EYPA 4YY3O 3DC6A 2E75B 5DEDA 2X6BA 2EIJC 2QM8A 1AJQA 4JTAB 2XNDG 1SA0B 3IC7A 2NLJC 1HDJA 3HPLC 3OFNG 2VQFB 5BY1A 4Z1MG 1SERA 3K03A 4PV1B 5HFLA 1COWG 2YI9A 3G6EV 3DXRB 3CCUV 1DF5A 4JI1B 3AK3A 2ZXWB 1KC8W 3UO3A 3D36A 5B1NA 3MAQA 4UVAA 1VF6A 3WG7B 2ADPA 5ITZB 5J9PC 3AG1B 4MS2A 2YIAA 1KQSU 2A06H 2Y0PA 2Q7EA 1S3JA 1N4CA 4R50A 2GV9A 4GUNA 4FVMA 5LHGA 4PDLA 5LA6B 2NNUA 2QM4A 1BCCH 1P7BA 2ARHA 3L74H 3T1HO 4GKKO 1Q82W 4JYBA 3U0ZA 1GO3F 2EBOA 4FM0A 3AG4B 1YIJV 4F4LA 3G4SV 2CTRA 5EZYA 1TVKB 2E3CA 1J95A 2PYLA 4DV1B 1SQBH 5KAIZ 2ATKC 4I0XA 4QIWF 1G4YB 3N2KA 3THOA 3BY6A 4BAYA 2Q7GA 1WB8A 5BMVB 1FPOA 4N23A 1PD3A 1N33B 3CCJV 3UO2A 5LYJB 3I55V 5KHKA 3FYIB 3JALA 1N8RW 2R9IA 1Y66A 1PV0A 3E2EA 3QVNA 5IYZA 5JVDB 3ZMUA 4FIPC 4KP4A 1EBOA 3KCXA 2UUAO 4TV8B 2CUGA 3JAMN 2JIZG 2OCCB 3IJ4A 2WLNA 1YSCA 2ETNA 5B1BC 1IXMA 3AG3B 1Q6HA 5EIBD 4X8AA 1SS3A 3PJSK 4LH6A 2AXTZ 1S0VA 3CYOA 4RUFA 4X64O 5L3CA 1XNQO 1UFIA 4DW0A 4J9YB 1AR1B 1OCZB 5LXTB 3SJCC 1K4CC 2P5OA 2Q5ZA 4B7EA 4PI0A 3H1JH 2PY5A 2LGWA 3F5WC 5JH7B 4JZ2A 2ITDC 4DV4O 5KHJA 5LGTA 1XHXA 3IC9A 4UCTA 5F2VO 5KAFZ 4D6TH 4NR1A 1JCHA 2UXXA 3C90A 4DV7B 4LC1A 2H94A 3J7AU 4BR6A 2EIJB 1CXZB 3LDCA 1H2GA 5CN0A 3ABTA 4JAVA 2RQ6A 2UU9B 3E83A 3IGAC 5K1PA 1R3KC 3H1HH 3B2EE 4J7JA 4W4LA 4X65B 4P9OA 4FFKA 3BRCA 3ETGA 1HNZO 1D5NA 1Z5VA 1R3IC 1K92A 4FM2A 1NH2D 2YS8A 4XDLA 4JYYA 4DUZB 4A5UB 4JYAO 5KHIA 4MVMA 4FFBA 1XREA 3MHHC 3RYFB 4TV9A 2Q9LA 1Y67A 3I56V 4GX1A 1XMQO 2Y48A 3FB6C 2PI4A 5KUMA 3T1HB 2UXDO 3SPHA 5TISZ 1HNXO 3WFVA 2IJIA 3E8BA 4LNUB 2N05A 3RVYA 4P2ZA 4PI2A 1F23A 1XNRB 2ZR2A 1FAFA 1AR5A 4GCZA 3K0DA 1OCCB 5L3DA 4IIJA 1M1KW 3LSSA 3CB2A 5FPRA 3HKCA 3VQXA 4X20B 2ITCC 1VQ5V 1WP8A 5LP6C 4QJFB 4NYKA 2WLLA 4EB6B 1EZVH 1S5HC 4O4IB 1KBHA 4GKJO 1DTOA 1W59A 3CCRV 1R6NA 1BHAA 4X1YB 1JA8A 5B1BB 1SF9A 1R1BA 3H1KH 2Q0AA 1WB7A 1VQLV 4KL1A 1GK9A 2IJJA 4JI4B 3SYOA 3ETEA 4OPAA 4DV3O 4NTYA 1EN4A 4TT3G 5IJ0A 4X64B 2HJDA 3E22A 2QA4V 1OJHA 2DOSA 1XEQA 4E4EA 3APOA 2UUAB 1QLNA 3JATB 4JI7O 4G27B 3UM7A 2KSDA 4HBNA 3CJHA 5CA1A 1QLEC 4LF4O 2YI8A 2HJFC 4ZI7B 4UUJC 4DR6O 4X88A 4I7ZB 4DV4B 3ZHTA 4JAAA 1IVSA 3DTUB 4IYIA 1EM1A 5CA0B 1GAXA 4C7UA 5LMNO 4MVZA 1R6TA 3BCCH 3E89A 3UT5A 4O4HA 5JCOA 4ZBMA 4KHPO 2ZNJA 3APQA 4JPRA 5KX5B 4MW8A 5JQGA 2EINC 3BPZA 3CRMA 5H6RA 4MTFA 3TETA 1SQXH 4XDKA 5CBHA 1NVPD 3JYCA 1M56C 3VBBA 3N2GB 3T4ZA 4AHCA 4CC6A 1XBLA 1U96A 1ZWIC 3OR6C 2P4VA 4K35A 1DGSA 3HKDA 2YICA 4NXMO 1XDCA 5KHHA 3A0BZ 1PP9H 2HR3A 2ZDIC 3BA8A 3FB8C 4QGPA 2ZQMA 1YTFD 1HNZB 3OT7A 4HNAB 3HR0A 3TK1A 2A9HA 2Q68A 5J2TA 4ABMA 1R3LC 1W2BU 1FXKA 5B1AC 2CGNA 1N32B 3HKEB 1Q81W 4L8JA 4TSFG 4DV0O 5KA5A 2ADQB 2YIBA 2B9ZA 2XAGA 1GTOA 2IJKA 2EIKC 2A0LA 1PKXA 3B40A 3P32A 1NS1A 2BSKB 2HVJC 1AI5A 2ODMA 1M90W 1D2DA 2WLIB 2JGDB 1BS3A 2B5UA 3CS5A 4U7NA 1QU7A 2CTWA 2VWJA 5DM6V 4QPKA 3J81N 3G67A 4PA7A 1AP6A 1A32A 2F4VO 5LP6B 2IJHA 4CH4A 1GN6A 1HR0B 2DJVA 2V1DA 2ZNIA 1G8MA 3IAYA 4LFBB 3BABA 1YJNV 1YF2A 3RWRD 2IH3C 4W4KA 1X4TA 1WA8B 4HAMA 2JDIG 1Y4MA 3GWKC 4DV6O 1YEWA 2KG7A 1VQNV 3ZMTA 4RQFA 4WFEA 3SYQA 4BIOA 1K33A 4LWSB 2QWNB 1SQPH 3CRAA 3JSNA 1K5SA 1U97A 1N0NA 1M93A 1UJWB 4UCSA 3CMAV 2HHHB 2UUBO 3RVZA 4UCUA 2V4DA 3P3NA 1GKFA 4DV1O 1LR1A 1EFRG 4UVBA 3UKMA 1NH2B 2W6JG 1QLEB 3TGUH 2ZM6B 4MVOA 1PNLA 3RGBA 4LF4B 1WPXA 2RDCA 1SETA 2IU0A 2WLKA 3ZMVA 2EILC 5J2UA 1JX9A 2DE0X 1TUEB 2HP8A 2JRIA 2KQXA 2DWDC 2DW4A 4TUYA 3ABUA 1XL6A 2EINB 2FB5A 1TUBB 1B04A 3OMAB 4P30A 1O9HA 1RFYA 3R65A 1CEZA 2JK5C 1I94B 4GT1A 4J41A 4PD4F 5LA6A 5C8YB 2AHZA 1P49A 5B1OA 2YIDA 4LF8O 2VS0A 1RSOB 4U3FH 3CCSV 2CDYA 5IJ9B 1Q86W 2UXBO 4U3JA 4NXMB 4JTDB 3JCZA 3JAKA 3A0HZ 2OIGA 2WAMA 3K5MA 5EC2C 4JV5O 5B1AB 1K73W 1SKVA 3B4SA 3SJAC 3JASB 2PZSA 2PGGA 4UCRA 5E1AC 2QM7A 1ZUQA 1RPRA 4Z1VA 4QPJA 4X1IB 3ML0A 4OPHA 1ZAUA 4H37A 3TJTA 5LYJA 4DV0B 2EIKB 3KKYA 1XUQA 3OD4A 4DV7O 4MSWC 1OCOC 3ZMZA 1THZA 2DYSC 1VEWA 1XMOO 4JI2O 2OTJV 2Z0AA 2X6CA 1VF6C 2WSSG 4GZRB 2UU9O 4X66B 1SQVH 2A3QA 2Q7HA 1AP5A 5IYBO 5FNVB 1W0KG 3K5NA 1AB3A 3STLC 2EX3A 4X65O 3K08A 3L70H 4O2AB 2QR4A 5LXTA 2F4VB 3JARA 2QJ1A 2RMKB 4CZZA 5C93A 3R66A 4ICGA 4I4TA 4DV5O 3FKSG 3MDSA 2AZ2A 4DUZO 2OYQA 3OEHG 2EZOA 5CB4B 4I55B 4WFAV 4YXWG 3K04A 4O4JB 1KB9F 1GM8A 5KA6A 1MZFA 4YJ2A 5B3SC 4AQYB 1AROP 2JS3A 4DV6B 4NVPA 1ZX3A 3ZN0A 4PHZA 2QTSA 3MD0A 2RCVA 2QKSA 3ICXA 4FZ0A 4JI3O 2YSUB 4J10A 2BOCC 1JJOA 2X6AA 3JAWA 3SPGA 3VQVA 4FZ1A 2UUBB 1XNRO 1H2NA 1F4MA 2ZE5A 3ZX6A 2XT9A 2JJ2G 1JFFA 4F6RB 3QNEA 3RYCA 2EILB 2GTSA 1OCCC 4H13B 1XHZA 3LNNA 4CH3A 1I7FA 3B09A 3RYHB 3OR7C 2JVDA 5EBMC 3K57A 1XILA 4OGQB 4R7CA 1SC5B 3K9SA 3ZJZA 4GX2A 2ZIOA 1BQZA 2DWEC 3B8MA 3CRQA 4QE7A 2GUZB 5D5QA 3OM3B 4JI4O 2QWPB 1ROPA 2HEPA 4IYHA 3LSUA 4X1KB 1AI6A 4LF7B 2EULA 4OX9O 1H2MA 1MG1A 2N74A 4EEQA 1XL4A 5EYPB 4LF9O 4LF8B 2GBOA 3CRRA 3UQ8A 2CTPA 3U10A 2UXBB 2Y4UA 3F7VC 4UV9A 1NKDA 1AILA 4JV5B 3RW0A 3CCQV 2WPDG 1K4DC 2UXCO 3AEIA 2YEVA 4IL6Z 3ZIAG 5A2QN 2Q73A 4AILC 1OCOB 1ZL8A 2JJ1G 3FB5C 2DYSB 3LDEA 1M5IA 4UVCA 2W6IG 3K9AA 3X2QC 4MTOA 3BAAA 4O2BA 3ABMC 2LO1A 3CPWU 3B8NA 4O4IA 5EBWC 4GYCB 4JI0B 3SYPA 1XMOB 4PJ0Z 2XAHA 3CCLV 1SRYA 4TQDA 4JI2B 2CH7A 3KZIZ 1YITV 2Z5UA 1N0JA 3DSQA 5GW7A 1Y74A 4DUYO 3L71H 3ETQA 3AG7A 2DQ3A 1GM9A 1LUVA 1Q90D 2Y0IA 1VMGA 3QO7A 4LFAO 4ZOLB 3FAVB 1QVFU 1TA8A 4UCVA 1QR9A 1Y6XA 4X89A 1DF4A 2BCCH 1LUWA 4JTCB 5EZYB 1SQGA 3MHSC 3SPJA 3CD6V 3SYCA 2QWQB 3Q4HA 1NI8A 3KCYA 3RYIA 1N32O 1WN7A 3N2KB 4DV5B 4B3MO 2XUMA 1P84F 4GX0A 1IBKO 5LGUA 3JD2A 5B3SB 1F7YA 1KMIZ 1SESA 1MA1A 1SZXA 3K06A 2E5LB 3B77A 2F66C 3ZHVA 3JALB 3WB2A 1SQQH 2DYRC 5EIBC 4DO2A 4I9QA 5IYZB 1P4RA 2F43G 3K59A 4JI3B 5LOVB 2UUCB 5KMGA 2BTQA 5KX5A 1KP3A 1ZSPA 1N36B 5FLXN 2YIBD 1FYJA 3ASOC 4WFFA 5B66Z 1CP9A 4J11A 4RWUA 4DRXA 2PI5A 2D3OW 3DGEA 3W7XA 2X7RB 1RM1C 2VQEB 1XI1A 4FMTA 1UPGA 1HR0O 2QWRB 2ILMA 3GWOA 1YJ9V 1N34B 4WBNA 5H5NA 1H2KA 3A8TA 1H2SB 1PNKA 1WLEA 4UB6Z 1AJPA 4LFBO 1YI2V 2H3OA 2R70A 2HVKC 1KYOF 4LFCO 1AJNA 2WA4A 3OTOO 3CHXA 1Q6IA 3FD9A 4MT8A 5CMUA 1VQKV 1PL0A 2B1GA 3C3SA 3JD1A 1MABG 2Q0OC 1AI4A 4OX9B 1QNMA 4NTXA 3G6BA 2IBZH 3RBZA 2HHHO 4LF9B 1M4UA 3ZRWA 3EFFK 3OUSA 4JASA 2WLIA 4ZHQA 1FJGB 5JCOC 3T1CA 4WCEV 4EFBA 4DV2B 3KG2A 2ZM6O 4RQEA 3U11A 1J5EB 2UXCB 3FFQA 3OEEG 3CXCU 4U7OA 4NKGB 1QVGU 3X2QB 4ZKIA 4MVSA 1KKDA 3ABMB 1V55C 1VQOV 4IHJA 2XAFA 3H9VA 2ZCEA 2ZE7A 5EBLC 1ZTEA 1VQ7V 1I94O 2NN4A 3BHPA 1FXKC 4FFBB 4BW9A 4DR3O 1PPJH 4TV9B 4BIUA 4DUYB 2LW1A 1L0NH 3ZRXA 4LWSA 4MW3A 2LP7A 4JI5B 4MVQA 2M7WA 4MVUA 2Y69B 2Q8VA 3WU2Z 4LFAB 3F7YC 3HKBA 3UCSC 1VARA 2P22C 2LFSA 2AHYA 2IU3A 1I5YA 4IIJB 1M57C 4B3MB 4FLVA 1IBKB 3STZC 3HKCB 2JEXA 1RPOA 1VQ9V 2DYRB 1SQFA 5GONB 3LUTB 2WLLB 4I5SA 4D7SA 2RJZA 1YZBA 4YJ3B 4JI6O 4O4LA 5IYDO 3SR2C 4YHHB 2P67A 4J80A 3ASOB 4X66O 3QF7A 2M6YA 2CE4A 4ASUG 1Q8IA 4LF5O 1RM1B 3T4DA 1Y76B 4MVRA 2PUSA 1O9GA 4I50A 5H9CA 3CSXA 1QQCA 2IH1C 5IJ0B 3E22B 1R3JC 3FB7C 5FPOA 3ASNC 1JJ2U 1FXVA 2HLDG 3CJHB 5CA1B 3M8AA 4LFCB 3CCVV 1K34A 4AQYO 2KB1A 4G2KA 1FFXA 3OTOB 2HKOA 1QR8A 1BHBA 1GMGA 1NJIW 2PTMA 4PA6A 2O57A 2QKAA 2EIMB 1IURA 4NXNO 3P3PA 1EN6A 2YXHA 1I08A 2OCHA 3UT5B 5FL7G 4O4HB 2ZD9A 1BGYH 3F5TA 3ZBHA 1PNMA 1B3QA 5JQGB 1SA0A 2K1EA 5FNVA 2DN9A 5L3GA 5H2FZ 4DR4O 3D3IA 1TAEA 3HKDB 1V55B 1MSWD 5KHGA 1GM7A 3DXRA 3ZMSA 1VQ4V 1K5QA 3K3WA 1B06A 4PA9A 1IX9A 1PM9A 3OW2U 3NXSA 5J2TB 5ITZA 1KUQA 1AVMA 1FXKB 3L75H 4LCUC 2IM9A 2ZE8A 1S72V 4FLWA 3JD4A 4DR1B 4DR3B 4GLXA 2ZR3A 1I5XA 4LF7O 4DR7O 4J7KA 4RO2A 1WNSA 3W7TA 3BFRA 5AG2A 1IDSA 1T5EA 2ZE6A 1NBMG 1TVKA 1Z5WA 1S77D 5BR8O 1IBLB 1G6UA 2ZINA 4EFEA 1M57B 1MZEA 3EVKA 2W0FC 2GSMB 3ZRSA 5BMVA 2E76B 4Z2WA 4ZIBA 3A0RA 5EC1C 3TXSA 5JJJB 3CMEV 4JI0O 4E2LA 1YCIA 5IWAO 3SDLA 1L0LH 2VRZA 3CE2A 4X62O 2MK3A 5JVDA 3D36C 3FYEB 4JF3A 4TV8A 2XTAA 4DYLA 1FD9A 4JI6B 2YXLA 5KUKA 1NU1H 3D8CA 1BSMA 3IFXA 1FFTB 4K8XA 2CK3G 2KG7B 3L9DA 4LF5B 1Q5OA 2LGQA 2EZPA 3JSLA 3ASNB 2DMXA 4B7KA 3K79A 3VQWA 5LGNA 2WA3A 4PDVA 5IY5C 4UV8A 2Q69A 2QKCA 4FLZA 2XAQA 5JH7A 3EHBB 2P7TC 2F95B 1OHHG 4HYOA 2E5LO 4DR5B 2F93B 3S3WA 2E74B 1NVPB 4LF6O 1US6A 5J2UB 4NXNB 2F23A 3E35A 2F1MA 4TUYB 4AI8A 2UUCO 1NTMH 1M9NA 1H8EG 2Q4PA 4LR3A 4UB8Z 2R9AA 1YTFB 4JYCA 1N36O 3A2FA 4HZ3A 1KECA 2Q6AA 4YIOA 2VQEO 1QBZA 2XAJA 2CTQA 4JI8B 4DR4B 2OWOA 4ZOLA 3FAVA 3T1YO 1N34O 4U3JB 3CCMV 1K8AW 5EK0A 2FMLA 3JAKB 5H6QA 4CH6A 2BE3A 3CRCA 3GVMA 2JS5A 1DLBA 4R6ZA 4WFHA 2D2CB 1WAZA 1Q3EA 2A79B 4B3RO 1GN4A 3ZCCA 3RYFA 2AZ0A 4MTXA 1K7DA 4K0KO 3OTFA 4DR7B 4P9PA 3ZHSA 1BE3H 1BMFG 2Y4TA 4DR2B 5LOVA 4LNUA 2R72A 1GN3A 1VQ6V 4BWAA 1FJGO 3WB0A 3ZHQA 3OMNB 3N27A 4DV2O 4B3SO 5DN6G 3LDDA 1HP8A 1FS0G 5BR8B 1WPBA 1S5LZ 1MSDA 4X9QA 2P4KA 2FKXA 3LNMB 4FJCC 1J5EO 2BOBC 1NR1A 2VWKA 2PYJA 4X20A 3JARB 1ZLZA 1NQTA 5DECA 1F4NA 3TCUA 4H44B 4I4TB 4EB6A 1R6KA 5IWAB 4X62B 3FX7A 3K5OA 3QO5A 1B6QA 2CAZC 2DQ0A 4X1YA 5JWPA 2LW7A 1X59A 4YJ2B 2A7WA 2N04A 2WLMA 1YDXA 4CH5A 5IT9N 5KLVH 1AR4A 2YUAA 4JI5O 1TGOA 2OT5A 3SYAA 3ABLC 1HWYA 4YY3B 5GTIZ 1Q6UA 5IY5B 3DC5A 1S5JA 3E8GA 3JAWB 4DW1A 1RP3B 5L3BA 1JQ0A 2Y69C 1MNGA 2JEUA 3OAAG 3JATA 1F51A 4J42A 3ZEDA 2X0LA 4I0XB 1H2LA 1JFFB 3O9OA 2QE7G 4B08A 4NTWA 3RYCB 4ZI7A 3CC7V 3QTCA 1EZJA 1W0JG 4OXSA 4TOIA 1ENVA 5IDJA 1WP7A 2AW9A 1OV9A 4LF6B 1IZ3A 5CA0A 3S3XA 4KXRA 5LBQA 3VOUA 1I0HA 2KKWA 4YHHO 1P7GA 2YXYA 3VQYA 1JVMA 1L8DA 1HW7A 1XOUA 1HNWO 3E86A 3G80A 2R9RB 3N2GA 3JD3A 4D7TA 4CBCA 2ZT9B 4CS3A 2IW5A 2EJRA 2H8PC 2RN9A 5JJNB 4GKKB 1IBMO 1MOFA 3L73H 3T1YB 2YDEA 2ZKOA 3E8HA 1SZTA 4HNAA 2FYUH 3HB3B 3HKEA 3SGIA 2NR5A 4FLUA 2OTLV 4FLTA 2YEVB 3J80N 1VF5B 3GB7C 4R8CA 1E1RG 3CX5F 1ZL8B 3K5LA 4B3RB 5BZBA 5GONA 3QO8A 2FTKA 2RNBA 3OMIB 4O2BB 4K0KB 2EIMC 4LBEC 2BSKA 1NTKH 4YJ3A 4J9ZB 4CC5A 2CH7B 4MTGA 4RUEA 4DK1A 4TWKA
chains in the Genus database with same CATH topology
2WSSG 4WF9V 3T2MA 3OGCC 2P6JA 3CCVV 1K34A 2ITDC 2KB1A 4G2KA 5IYBO 5LGTA 2HKOA 1QR8A 1BHBA 1W0KG 1GMGA 3STLC 1NJIW 4PA6A 2WWWA 2EIMB 3K08A 1JCHA 2UXXA 4XBFA 1Q7YW 1FXHA 4LP8A 4LC1A 2H94A 2EIJB 4CZZA 3LDCA 1H2GA 5CN0A 5C93A 5FL7G 2ZD9A 2HG5C 3FKSG 1YJWV 3ABTA 4JAVA 1PNMA 3OEHG 2EZOA 3CCEV 4WFAV 4YXWG 3K04A 3E83A 3SJQC 3IGAC 1R3KC 1GM8A 5KA6A 1K3EA 2K1EA 5B3SC 5L3GA 1AROP 1JPXA 3D3IA 3ZN0A 3ABLB 1V55B 3MD0A 3LSQA 4P9OA 3CC4V 1MSWD 1H38A 1E79G 3ETGA 1VQ8V 2QKSA 1GM7A 3ZMSA 1VQ4V 1K5QA 2YSUB 3K3WA 1AI7A 1R3IC 1K92A 1NH2D 4PA9A 2BOCC 3OW2U 4XDLA 3NXSA 2X6AA 1L1FA 4JGSA 3SPGA 1KD1W 1FXKB 3E8FA 1F4MA 4LCUC 4EKWA 1S72V 2JJ2G 4UXNA 4WFBV 4MVMA 3MHHC 3JD4A 3QNEA 1YHQV 3ABKC 3SPIA 3AG2C 1S76D 2ZR3A 1I5XA 3I56V 4GX1A 2EILB 2Y48A 3FB6C 4JAUA 1OCCC 2PI4A 4RO2A 5KUMA 4FPPA 3W7TA 3CP1A 3SPHA 3WFVA 2IJIA 3E8BA 3OR7C 1NBMG 1V54C 5EBMC 4RAIA 1BL8A 3RVYA 4P2ZA 4R7CA 1F23A 1QCEA 1S77D 2C2AA 3ETDA 4KFMA 2ZR2A 3ZJZA 4GX2A 1M57B 2DWEC 1OCRC 3B8MA 4QE7A 1K97A 2W0FC 2GSMB 4GCZA 3K0DA 4QE9A 1OCCB 3OM3B 5L3DA 3ZRSA 1M1KW 3LSSA 1VQPV 1ROPA 4H33A 5L3EA 2XOKG 1AI6A 1MG1A 2ITCC 1XL4A 1JOYA 3A0RA 2ZDIA 1VQ5V 4QJFB 5EC1C 2B1IA 4I9WA 3CMEV 3ZN1A 2WLLA 4E2LA 4WFGA 3ZRWB 1S5HC 2MK3A 3F7VC 4UV9A 1NKDA 1DTOA 3M99B 3CCRV 1CPYA 1R6NA 3FYEB 1BHAA 4JF3A 5B1BB 3K0GA 3RW0A 5KUKA 3W7SA 1R73A 3IFXA 4DXWA 3CCQV 2HFEC 1K4DC 2WPDG 1VQLV 1K9MW 1FFTB 1GK9A 2CK3G 3OUFA 2IJJA 2YEVA 3AEIA 5HFMA 3SYOA 3ETEA 1E1QG 3ZIAG 5LHHA 1OCOB 2JJ1G 3FB5C 2DYSB 4TT3G 3LDEA 2EZPA 4PDRA 2QTOA 4N21A 4UVCA 3SPCA 2W6IG 3ASNB 3K9AA 4MTOA 3X2QC 2QA4V 3ABMC 3CPWU 3B8NA 3K79A 5EBWC 5L3FA 3SYPA 2ZXWC 5LGNA 2XAHA 4PDVA 3CCLV 1SRYA 4PA4A 5IY5C 1QLNA 4PELA 4UV8A 2Q69A 1YITV 4G27B 3WG7C 4XDJA 3W7WA 2Z5UA 3AG1C 2XAQA 3UM7A 4PA3A 5GW7A 3EHBB 2P7TC 1QLEC 2HJFC 3BEHA 4G28B 4UUJC 1OHHG 4HYOA 3CC2V 4X88A 2DQ3A 1NR7A 1LNQA 1GM9A 4L87A 1NVPB 3QO7A 3DTUB 1QVFU 2XASA 1KP2A 1ORQC 1QR9A 4MVZA 3E35A 1VQMV 1OZ0A 4Q20A 3E89A 4X89A 5LHIA 1DF4A 4JTCB 3SPJA 1M9NA 1H8EG 3MHSC 3CD6V 3AG4C 4ZBMA 3SYCA 4JPRA 2WLHA 4MW8A 2P90A 1YTFB 4JYCA 2EINC 4GX0A 5H6RA 4MTFA 3TETA 5LGUA 3JD2A 5B3SB 4XDKA 5CBHA 2Q67A 1NVPD 1SESA 1M56C 1KECA 3JYCA 4HZ3A 2Z3YA 4KUMA 2Q6AA 3T4ZA 3VBBA 3K06A 1ZWIC 3OR6C 3B77A 5CBGA 2LFRA 4BIZA 1QBZA 2XAJA 3CCMV 1K8AW 2DYRC 5EK0A 2ZDIC 2HR3A 4DO2A 3FB8C 1P4RA 2ZQMA 1YTFD 2F43G 5H6QA 5CBFA 4PDMA 2WLJA 3TK1A 2A9HA 2Q68A 1M56B 1KP3A 1R3LC 1W2BU 1DLBA 1FXKA 5B1AC 3H01A 4R6ZA 4WFHA 2GHYA 3ABKB 2OCCC 3ASOC 1Q81W 3AG2B 4TSFG 4WFFA 2A79B 3ZCCA 2PI5A 1CP9A 3AG3C 5KA5A 2D3OW 3DGEA 4MTXA 2XAGA 3W7XA 2X7RB 1GTOA 1RM1C 1K7DA 2IJKA 3W7UA 4FMTA 2EIKC 2A0LA 4P9PA 3G71V 1PKXA 3P32A 3GWOA 1YJ9V 1V54B 1PNKA 1BMFG 2HVJC 1OCZC 1WLEA 3OE7G 1AI5A 3P30A 1AJPA 4FK5C 1YI2V 1VQ6V 1M90W 2HVKC 2WLIB 1OCRB 3OMNB 2B5UA 4QNHB 1AJNA 5DN6G 3LDDA 2V7QG 4MT8A 1FS0G 3JD0A 4BW5A 5CMUA 5CA3A 4U7NA 5IYCO 1PL0A 2B1GA 1VQKV 2QEXV 3LNMB 4FJCC 3ZRVA 4GX5A 2BOBC 5DM6V 4QPKA 1H8HG 1NR1A 3JD1A 2UXNA 1MABG 4PA7A 2IJHA 1AI4A 1NQTA 1F4NA 3TCUA 3RBZA 2X6BA 2V1DA 1G8MA 3ZRWA 3EFFK 3OUSA 2EIJC 2QM8A 4JASA 1R6KA 2WLIA 1YJNV 3QO5A 1B6QA 1AJQA 2IH3C 2DQ0A 3T1CA 4JTAB 2XNDG 4HAMA 4WCEV 2JDIG 1Y4MA 3KG2A 3IC7A 2NLJC 4RQEA 3HPLC 3OFNG 2WLMA 4Z1MG 1SERA 3K03A 1VQNV 3ZMTA 3OEEG 4RQFA 3CXCU 4U7OA 5HFLA 4WFEA 1QVGU 3SYQA 3X2QB 4ZKIA 4MVSA 1KKDA 2OT5A 1COWG 1K33A 3SYAA 3ABMB 3ABLC 3G6EV 1V55C 3CCUV 1DF5A 1HWYA 1VQOV 1K5SA 2ZXWB 1KC8W 3D36A 5B1NA 5IY5B 1UJWB 3CMAV 3E8GA 2XAFA 3RVZA 5L3BA 1JQ0A 2Y69C 1GKFA 4UVAA 3WG7B 5J9PC 2JEUA 3AG1B 1EFRG 3OAAG 4UVBA 3UKMA 4MS2A 1NH2B 1F51A 2W6JG 5EBLC 1KQSU 1VQ7V 1QLEB 2X0LA 1S3JA 1FXKC 4R50A 2QE7G 4MVOA 5LHGA 3CC7V 4PDLA 1PNLA 4BIUA 2NNUA 1WPXA 1EZJA 1P7BA 1SETA 1W0JG 2IU0A 3ZRXA 2WLKA 4OXSA 1ENVA 4MW3A 2LP7A 5IDJA 1Q82W 4MVQA 4JYBA 2EILC 3ZMVA 2M7WA 4MVUA 1JX9A 2Y69B 1GO3F 2EBOA 1TUEB 3F7YC 2DWDC 2DW4A 3AG4B 5LBQA 4F4LA 1YIJV 3VOUA 3G4SV 3ABUA 1XL6A 1J95A 2EINB 3OMAB 4P30A 1JVMA 2ATKC 3R65A 1CEZA 4QIWF 1G4YB 2JK5C 2LFSA 3BY6A 3E86A 4GT1A 2AHYA 4BAYA 2IU3A 1I5YA 2R9RB 1M57C 3STZC 2AHZA 3JD3A 4N23A 4CBCA 5B1OA 1PD3A 2JEXA 2IW5A 2EJRA 1RPOA 3CCJV 3I55V 1VQ9V 2DYRB 2H8PC 3FYIB 1N8RW 1MOFA 2R9IA 3CCSV 1Y66A 1Q86W 3LUTB 3E2EA 2WLLB 4I5SA 4JTDB 3JCZA 2WAMA 4FIPC 3ZMUA 3E8HA 1SZTA 5EC2C 5B1AB 1K73W 4KP4A 1EBOA 5IYDO 2JIZG 2OCCB 2P67A 2WLNA 3ASOB 1YSCA 3HB3B 5B1BC 5E1AC 1IXMA 2QM7A 2OTLV 3AG3B 1RPRA 2YEVB 4ASUG 4QPJA 4X8AA 3ML0A 3GB7C 4R8CA 1RM1B 3PJSK 3T4DA 4H37A 4MVRA 1E1RG 1S0VA 5H9CA 3CYOA 2EIKB 4RUFA 5L3CA 5BZBA 2IH1C 3QO8A 2FTKA 4MSWC 1OCOC 1R3JC 3OMIB 1THZA 4J9YB 1OCZB 2DYSC 3ZMZA 3FB7C 1AR1B 1K4CC 2EIMC 4LBEC 2OTJV 3ASNC 4J9ZB 1JJ2U 2X6CA 4MTGA 1FXVA 4RUEA 3F5WC 2HLDG 4TWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJN V;  1Q82 W;  2OTL V;  1VQ4 V;  3CMA V;  1M1K W;  2D3O W;  4WF9 V;  1YIT V;  1VQP V;  3CCJ V;  1VQM V;  1R73 A;  3I55 V;  1VQK V;  4WCE V;  3CCM V;  3CCQ V;  1VQL V;  1YJW V;  1K8A W;  1K9M W;  3OW2 U;  1VQ9 V;  2QEX V;  1N8R W;  5DM6 V;  3CCV V;  3CD6 V;  3CCE V;  3CCS V;  1YIJ V;  3G71 V;  1KQS U;  1Q86 W;  1VQ7 V;  4WFA V;  3G4S V;  1KD1 W;  1YJ9 V;  1VQ5 V;  1NJI W;  1VQN V;  3CME V;  1S72 V;  3CC2 V;  3CXC U;  3CC7 V;  1W2B U;  1Q7Y W;  4WFB V;  1YI2 V;  1QVG U;  1K73 W;  1VQ6 V;  2OTJ V;  1M90 W;  2QA4 V;  1YHQ V;  3G6E V;  1JJ2 U;  3CCR V;  3CPW U;  3CCU V;  1VQO V;  1Q81 W;  3CC4 V;  1QVF U;  1KC8 W;  3CCL V;  3I56 V;  1VQ8 V; 
#chains in the Genus database with same CATH topology
 2JGD A;  2QDO A;  4WF9 V;  1Y74 B;  3T2M A;  3OGC C;  2P6J A;  1IXB A;  4B3S B;  3ZHR A;  1Y76 A;  4F6E A;  2WWW A;  2YC0 A;  4XBF A;  1Q7Y W;  5LP6 A;  1FXH A;  4B3T O;  1XNQ B;  4LP8 A;  5D5P A;  4H0L B;  1DK1 A;  1WJZ A;  2HG5 C;  1YJW V;  3Q4H B;  4YIP A;  3RYI B;  1BQ0 A;  3TXQ A;  1GH6 A;  2QGN A;  3PN1 A;  3CCE V;  2XHB A;  1WA8 A;  1VF7 A;  3SJQ C;  1K3E A;  4DR1 O;  3D3Q A;  1JPX A;  5LMU O;  5LL6 Y;  2L35 A;  1Q43 A;  3O65 A;  3ABL B;  3LSQ A;  3CC4 V;  1H38 A;  1E79 G;  1VQ8 V;  3I5D A;  1AI7 A;  3AK2 A;  5KMG B;  1L1F A;  4JGS A;  2BTQ B;  2L6L A;  1KD1 W;  1IBL O;  3H1I H;  3E8F A;  1VIB A;  3SJB C;  4EKW A;  5GTH Z;  4UXN A;  4WFB V;  1YHQ V;  3ABK C;  4DRX B;  1KKC A;  3SPI A;  4UFZ A;  2QSA A;  3AG2 C;  4FLY A;  1S76 D;  3ZS8 C;  3L72 H;  1EN5 A;  4JAU A;  1NZ6 A;  4FPP A;  5BXZ A;  3CP1 A;  4NB5 A;  4WBN B;  1V54 C;  4RAI A;  1BL8 A;  3BA9 A;  2K9P A;  3RFR A;  1PL4 A;  1QCE A;  1TUB A;  2C2A A;  3ETD A;  4KFM A;  4LH7 A;  1OCR C;  1K97 A;  4JYA B;  4QE9 A;  1HNW B;  5C8Y A;  2ZIM A;  4K8Z A;  4TQF A;  1VQP V;  4H33 A;  5L3E A;  2XOK G;  1FKA O;  2G38 A;  4FM1 A;  1URF A;  4DK0 A;  1XMQ B;  2PF4 E;  1JOY A;  3RN4 A;  2ZDI A;  3EXA A;  1RSO A;  3C3T A;  2UXD B;  2B1I A;  5IJ9 A;  4I9W A;  3ZN1 A;  4CS4 A;  1HNX B;  4WFG A;  1IBM B;  3ZRW B;  1G1X B;  4ZHQ B;  3M99 B;  1CPY A;  1VP7 A;  3JAS A;  3K0G A;  1JR9 A;  2VQF O;  1BZK A;  3W7S A;  1R73 A;  4DXW A;  1K9M W;  2HFE C;  3OUF A;  1QHT A;  5HFM A;  4DR5 O;  4X1I A;  3CWB H;  1E1Q G;  3H1L H;  5LHH A;  4JI1 O;  3ZHU A;  4IGG A;  4PDR A;  2QTO A;  4N21 A;  3SPC A;  2EJ7 A;  2AGA A;  4IHJ B;  5L3F A;  2ZXW C;  4PA4 A;  4PEL A;  4GKJ B;  4J7Z A;  4FLX A;  2BTO A;  3BVO A;  3WG7 C;  4XDJ A;  3W7W A;  3AG1 C;  3AK1 A;  1D5A A;  4PA3 A;  2JGU A;  3BEH A;  4G28 B;  3JCU Z;  2CGO A;  3CC2 V;  4JI8 O;  1NR7 A;  1LNQ A;  4DV3 B;  4L87 A;  4IT5 A;  1YVW A;  4O2A A;  2MW2 B;  2W0X A;  2XAS A;  1KP2 A;  4B3T B;  1ORQ C;  4K3A A;  3HKB B;  3OGI B;  1VQM V;  1OZ0 A;  2GTA A;  4Q20 A;  2GDS A;  5LHI A;  1NT2 B;  1Z2G A;  3AG4 C;  4JI7 B;  1GN2 A;  2QWO B;  2WLH A;  2P90 A;  1V9P A;  5CB4 A;  3K58 A;  3NR7 A;  4I55 A;  3RT3 C;  4O4J A;  2Q67 A;  3WB1 A;  4KUM A;  4JZG A;  1YXB A;  2Z3Y A;  1N33 O;  4DR6 B;  5E79 Z;  5CBG A;  2LFR A;  4BIZ A;  2OIE A;  1JMK C;  5LMU B;  4Q6G A;  4DR2 O;  5LMN B;  4CS2 A;  1MMM A;  5CBF A;  4O4L B;  5K1X A;  4PDM A;  2WLJ A;  4UCO A;  2P06 A;  1M56 B;  3CEI A;  5A9G A;  4KHP B;  1NTZ H;  3H01 A;  2LJ2 A;  2LQT A;  2GHY A;  3ABK B;  5IE9 A;  2OCC C;  3AG2 B;  4F6R A;  3AG3 C;  4I50 B;  2FL4 A;  3M7M X;  3W7U A;  3G71 V;  1V54 B;  1OCZ C;  3OE7 G;  5JJE B;  3P30 A;  3RYH A;  4FK5 C;  1KU9 A;  3QG5 A;  1OCR B;  1XQ8 A;  4QNH B;  2V7Q G;  2GUZ A;  3CXH F;  3JD0 A;  4BW5 A;  1FFX B;  5CA3 A;  5IYC O;  2QEX V;  3ZRV A;  5B5E Z;  4GX5 A;  1H8H G;  1GRJ A;  2UXN A;  1BT8 A;  4X1K A;  5EYP A;  4YY3 O;  3DC6 A;  2E75 B;  5DED A;  2X6B A;  2EIJ C;  2QM8 A;  1AJQ A;  4JTA B;  2XND G;  1SA0 B;  3IC7 A;  2NLJ C;  1HDJ A;  3HPL C;  3OFN G;  2VQF B;  5BY1 A;  4Z1M G;  1SER A;  3K03 A;  4PV1 B;  5HFL A;  1COW G;  2YI9 A;  3G6E V;  3DXR B;  3CCU V;  1DF5 A;  4JI1 B;  3AK3 A;  2ZXW B;  1KC8 W;  3UO3 A;  3D36 A;  5B1N A;  3MAQ A;  4UVA A;  1VF6 A;  3WG7 B;  2ADP A;  5ITZ B;  5J9P C;  3AG1 B;  4MS2 A;  2YIA A;  1KQS U;  2A06 H;  2Y0P A;  2Q7E A;  1S3J A;  1N4C A;  4R50 A;  2GV9 A;  4GUN A;  4FVM A;  5LHG A;  4PDL A;  5LA6 B;  2NNU A;  2QM4 A;  1BCC H;  1P7B A;  2ARH A;  3L74 H;  3T1H O;  4GKK O;  1Q82 W;  4JYB A;  3U0Z A;  1GO3 F;  2EBO A;  4FM0 A;  3AG4 B;  1YIJ V;  4F4L A;  3G4S V;  2CTR A;  5EZY A;  1TVK B;  2E3C A;  1J95 A;  2PYL A;  4DV1 B;  1SQB H;  5KAI Z;  2ATK C;  4I0X A;  4QIW F;  1G4Y B;  3N2K A;  3THO A;  3BY6 A;  4BAY A;  2Q7G A;  1WB8 A;  5BMV B;  1FPO A;  4N23 A;  1PD3 A;  1N33 B;  3CCJ V;  3UO2 A;  5LYJ B;  3I55 V;  5KHK A;  3FYI B;  3JAL A;  1N8R W;  2R9I A;  1Y66 A;  1PV0 A;  3E2E A;  3QVN A;  5IYZ A;  5JVD B;  3ZMU A;  4FIP C;  4KP4 A;  1EBO A;  3KCX A;  2UUA O;  4TV8 B;  2CUG A;  3JAM N;  2JIZ G;  2OCC B;  3IJ4 A;  2WLN A;  1YSC A;  2ETN A;  5B1B C;  1IXM A;  3AG3 B;  1Q6H A;  5EIB D;  4X8A A;  1SS3 A;  3PJS K;  4LH6 A;  2AXT Z;  1S0V A;  3CYO A;  4RUF A;  4X64 O;  5L3C A;  1XNQ O;  1UFI A;  4DW0 A;  4J9Y B;  1AR1 B;  1OCZ B;  5LXT B;  3SJC C;  1K4C C;  2P5O A;  2Q5Z A;  4B7E A;  4PI0 A;  3H1J H;  2PY5 A;  2LGW A;  3F5W C;  5JH7 B;  4JZ2 A;  2ITD C;  4DV4 O;  5KHJ A;  5LGT A;  1XHX A;  3IC9 A;  4UCT A;  5F2V O;  5KAF Z;  4D6T H;  4NR1 A;  1JCH A;  2UXX A;  3C90 A;  4DV7 B;  4LC1 A;  2H94 A;  3J7A U;  4BR6 A;  2EIJ B;  1CXZ B;  3LDC A;  1H2G A;  5CN0 A;  3ABT A;  4JAV A;  2RQ6 A;  2UU9 B;  3E83 A;  3IGA C;  5K1P A;  1R3K C;  3H1H H;  3B2E E;  4J7J A;  4W4L A;  4X65 B;  4P9O A;  4FFK A;  3BRC A;  3ETG A;  1HNZ O;  1D5N A;  1Z5V A;  1R3I C;  1K92 A;  4FM2 A;  1NH2 D;  2YS8 A;  4XDL A;  4JYY A;  4DUZ B;  4A5U B;  4JYA O;  5KHI A;  4MVM A;  4FFB A;  1XRE A;  3MHH C;  3RYF B;  4TV9 A;  2Q9L A;  1Y67 A;  3I56 V;  4GX1 A;  1XMQ O;  2Y48 A;  3FB6 C;  2PI4 A;  5KUM A;  3T1H B;  2UXD O;  3SPH A;  5TIS Z;  1HNX O;  3WFV A;  2IJI A;  3E8B A;  4LNU B;  2N05 A;  3RVY A;  4P2Z A;  4PI2 A;  1F23 A;  1XNR B;  2ZR2 A;  1FAF A;  1AR5 A;  4GCZ A;  3K0D A;  1OCC B;  5L3D A;  4IIJ A;  1M1K W;  3LSS A;  3CB2 A;  5FPR A;  3HKC A;  3VQX A;  4X20 B;  2ITC C;  1VQ5 V;  1WP8 A;  5LP6 C;  4QJF B;  4NYK A;  2WLL A;  4EB6 B;  1EZV H;  1S5H C;  4O4I B;  1KBH A;  4GKJ O;  1DTO A;  1W59 A;  3CCR V;  1R6N A;  1BHA A;  4X1Y B;  1JA8 A;  5B1B B;  1SF9 A;  1R1B A;  3H1K H;  2Q0A A;  1WB7 A;  1VQL V;  4KL1 A;  1GK9 A;  2IJJ A;  4JI4 B;  3SYO A;  3ETE A;  4OPA A;  4DV3 O;  4NTY A;  1EN4 A;  4TT3 G;  5IJ0 A;  4X64 B;  2HJD A;  3E22 A;  2QA4 V;  1OJH A;  2DOS A;  1XEQ A;  4E4E A;  3APO A;  2UUA B;  1QLN A;  3JAT B;  4JI7 O;  4G27 B;  3UM7 A;  2KSD A;  4HBN A;  3CJH A;  5CA1 A;  1QLE C;  4LF4 O;  2YI8 A;  2HJF C;  4ZI7 B;  4UUJ C;  4DR6 O;  4X88 A;  4I7Z B;  4DV4 B;  3ZHT A;  4JAA A;  1IVS A;  3DTU B;  4IYI A;  1EM1 A;  5CA0 B;  1GAX A;  4C7U A;  5LMN O;  4MVZ A;  1R6T A;  3BCC H;  3E89 A;  3UT5 A;  4O4H A;  5JCO A;  4ZBM A;  4KHP O;  2ZNJ A;  3APQ A;  4JPR A;  5KX5 B;  4MW8 A;  5JQG A;  2EIN C;  3BPZ A;  3CRM A;  5H6R A;  4MTF A;  3TET A;  1SQX H;  4XDK A;  5CBH A;  1NVP D;  3JYC A;  1M56 C;  3VBB A;  3N2G B;  3T4Z A;  4AHC A;  4CC6 A;  1XBL A;  1U96 A;  1ZWI C;  3OR6 C;  2P4V A;  4K35 A;  1DGS A;  3HKD A;  2YIC A;  4NXM O;  1XDC A;  5KHH A;  3A0B Z;  1PP9 H;  2HR3 A;  2ZDI C;  3BA8 A;  3FB8 C;  4QGP A;  2ZQM A;  1YTF D;  1HNZ B;  3OT7 A;  4HNA B;  3HR0 A;  3TK1 A;  2A9H A;  2Q68 A;  5J2T A;  4ABM A;  1R3L C;  1W2B U;  1FXK A;  5B1A C;  2CGN A;  1N32 B;  3HKE B;  1Q81 W;  4L8J A;  4TSF G;  4DV0 O;  5KA5 A;  2ADQ B;  2YIB A;  2B9Z A;  2XAG A;  1GTO A;  2IJK A;  2EIK C;  2A0L A;  1PKX A;  3B40 A;  3P32 A;  1NS1 A;  2BSK B;  2HVJ C;  1AI5 A;  2ODM A;  1M90 W;  1D2D A;  2WLI B;  2JGD B;  1BS3 A;  2B5U A;  3CS5 A;  4U7N A;  1QU7 A;  2CTW A;  2VWJ A;  5DM6 V;  4QPK A;  3J81 N;  3G67 A;  4PA7 A;  1AP6 A;  1A32 A;  2F4V O;  5LP6 B;  2IJH A;  4CH4 A;  1GN6 A;  1HR0 B;  2DJV A;  2V1D A;  2ZNI A;  1G8M A;  3IAY A;  4LFB B;  3BAB A;  1YJN V;  1YF2 A;  3RWR D;  2IH3 C;  4W4K A;  1X4T A;  1WA8 B;  4HAM A;  2JDI G;  1Y4M A;  3GWK C;  4DV6 O;  1YEW A;  2KG7 A;  1VQN V;  3ZMT A;  4RQF A;  4WFE A;  3SYQ A;  4BIO A;  1K33 A;  4LWS B;  2QWN B;  1SQP H;  3CRA A;  3JSN A;  1K5S A;  1U97 A;  1N0N A;  1M93 A;  1UJW B;  4UCS A;  3CMA V;  2HHH B;  2UUB O;  3RVZ A;  4UCU A;  2V4D A;  3P3N A;  1GKF A;  4DV1 O;  1LR1 A;  1EFR G;  4UVB A;  3UKM A;  1NH2 B;  2W6J G;  1QLE B;  3TGU H;  2ZM6 B;  4MVO A;  1PNL A;  3RGB A;  4LF4 B;  1WPX A;  2RDC A;  1SET A;  2IU0 A;  2WLK A;  3ZMV A;  2EIL C;  5J2U A;  1JX9 A;  2DE0 X;  1TUE B;  2HP8 A;  2JRI A;  2KQX A;  2DWD C;  2DW4 A;  4TUY A;  3ABU A;  1XL6 A;  2EIN B;  2FB5 A;  1TUB B;  1B04 A;  3OMA B;  4P30 A;  1O9H A;  1RFY A;  3R65 A;  1CEZ A;  2JK5 C;  1I94 B;  4GT1 A;  4J41 A;  4PD4 F;  5LA6 A;  5C8Y B;  2AHZ A;  1P49 A;  5B1O A;  2YID A;  4LF8 O;  2VS0 A;  1RSO B;  4U3F H;  3CCS V;  2CDY A;  5IJ9 B;  1Q86 W;  2UXB O;  4U3J A;  4NXM B;  4JTD B;  3JCZ A;  3JAK A;  3A0H Z;  2OIG A;  2WAM A;  3K5M A;  5EC2 C;  4JV5 O;  5B1A B;  1K73 W;  1SKV A;  3B4S A;  3SJA C;  3JAS B;  2PZS A;  2PGG A;  4UCR A;  5E1A C;  2QM7 A;  1ZUQ A;  1RPR A;  4Z1V A;  4QPJ A;  4X1I B;  3ML0 A;  4OPH A;  1ZAU A;  4H37 A;  3TJT A;  5LYJ A;  4DV0 B;  2EIK B;  3KKY A;  1XUQ A;  3OD4 A;  4DV7 O;  4MSW C;  1OCO C;  3ZMZ A;  1THZ A;  2DYS C;  1VEW A;  1XMO O;  4JI2 O;  2OTJ V;  2Z0A A;  2X6C A;  1VF6 C;  2WSS G;  4GZR B;  2UU9 O;  4X66 B;  1SQV H;  2A3Q A;  2Q7H A;  1AP5 A;  5IYB O;  5FNV B;  1W0K G;  3K5N A;  1AB3 A;  3STL C;  2EX3 A;  4X65 O;  3K08 A;  3L70 H;  4O2A B;  2QR4 A;  5LXT A;  2F4V B;  3JAR A;  2QJ1 A;  2RMK B;  4CZZ A;  5C93 A;  3R66 A;  4ICG A;  4I4T A;  4DV5 O;  3FKS G;  3MDS A;  2AZ2 A;  4DUZ O;  2OYQ A;  3OEH G;  2EZO A;  5CB4 B;  4I55 B;  4WFA V;  4YXW G;  3K04 A;  4O4J B;  1KB9 F;  1GM8 A;  5KA6 A;  1MZF A;  4YJ2 A;  5B3S C;  4AQY B;  1ARO P;  2JS3 A;  4DV6 B;  4NVP A;  1ZX3 A;  3ZN0 A;  4PHZ A;  2QTS A;  3MD0 A;  2RCV A;  2QKS A;  3ICX A;  4FZ0 A;  4JI3 O;  2YSU B;  4J10 A;  2BOC C;  1JJO A;  2X6A A;  3JAW A;  3SPG A;  3VQV A;  4FZ1 A;  2UUB B;  1XNR O;  1H2N A;  1F4M A;  2ZE5 A;  3ZX6 A;  2XT9 A;  2JJ2 G;  1JFF A;  4F6R B;  3QNE A;  3RYC A;  2EIL B;  2GTS A;  1OCC C;  4H13 B;  1XHZ A;  3LNN A;  4CH3 A;  1I7F A;  3B09 A;  3RYH B;  3OR7 C;  2JVD A;  5EBM C;  3K57 A;  1XIL A;  4OGQ B;  4R7C A;  1SC5 B;  3K9S A;  3ZJZ A;  4GX2 A;  2ZIO A;  1BQZ A;  2DWE C;  3B8M A;  3CRQ A;  4QE7 A;  2GUZ B;  5D5Q A;  3OM3 B;  4JI4 O;  2QWP B;  1ROP A;  2HEP A;  4IYH A;  3LSU A;  4X1K B;  1AI6 A;  4LF7 B;  2EUL A;  4OX9 O;  1H2M A;  1MG1 A;  2N74 A;  4EEQ A;  1XL4 A;  5EYP B;  4LF9 O;  4LF8 B;  2GBO A;  3CRR A;  3UQ8 A;  2CTP A;  3U10 A;  2UXB B;  2Y4U A;  3F7V C;  4UV9 A;  1NKD A;  1AIL A;  4JV5 B;  3RW0 A;  3CCQ V;  2WPD G;  1K4D C;  2UXC O;  3AEI A;  2YEV A;  4IL6 Z;  3ZIA G;  5A2Q N;  2Q73 A;  4AIL C;  1OCO B;  1ZL8 A;  2JJ1 G;  3FB5 C;  2DYS B;  3LDE A;  1M5I A;  4UVC A;  2W6I G;  3K9A A;  3X2Q C;  4MTO A;  3BAA A;  4O2B A;  3ABM C;  2LO1 A;  3CPW U;  3B8N A;  4O4I A;  5EBW C;  4GYC B;  4JI0 B;  3SYP A;  1XMO B;  4PJ0 Z;  2XAH A;  3CCL V;  1SRY A;  4TQD A;  4JI2 B;  2CH7 A;  3KZI Z;  1YIT V;  2Z5U A;  1N0J A;  3DSQ A;  5GW7 A;  1Y74 A;  4DUY O;  3L71 H;  3ETQ A;  3AG7 A;  2DQ3 A;  1GM9 A;  1LUV A;  1Q90 D;  2Y0I A;  1VMG A;  3QO7 A;  4LFA O;  4ZOL B;  3FAV B;  1QVF U;  1TA8 A;  4UCV A;  1QR9 A;  1Y6X A;  4X89 A;  1DF4 A;  2BCC H;  1LUW A;  4JTC B;  5EZY B;  1SQG A;  3MHS C;  3SPJ A;  3CD6 V;  3SYC A;  2QWQ B;  3Q4H A;  1NI8 A;  3KCY A;  3RYI A;  1N32 O;  1WN7 A;  3N2K B;  4DV5 B;  4B3M O;  2XUM A;  1P84 F;  4GX0 A;  1IBK O;  5LGU A;  3JD2 A;  5B3S B;  1F7Y A;  1KMI Z;  1SES A;  1MA1 A;  1SZX A;  3K06 A;  2E5L B;  3B77 A;  2F66 C;  3ZHV A;  3JAL B;  3WB2 A;  1SQQ H;  2DYR C;  5EIB C;  4DO2 A;  4I9Q A;  5IYZ B;  1P4R A;  2F43 G;  3K59 A;  4JI3 B;  5LOV B;  2UUC B;  5KMG A;  2BTQ A;  5KX5 A;  1KP3 A;  1ZSP A;  1N36 B;  5FLX N;  2YIB D;  1FYJ A;  3ASO C;  4WFF A;  5B66 Z;  1CP9 A;  4J11 A;  4RWU A;  4DRX A;  2PI5 A;  2D3O W;  3DGE A;  3W7X A;  2X7R B;  1RM1 C;  2VQE B;  1XI1 A;  4FMT A;  1UPG A;  1HR0 O;  2QWR B;  2ILM A;  3GWO A;  1YJ9 V;  1N34 B;  4WBN A;  5H5N A;  1H2K A;  3A8T A;  1H2S B;  1PNK A;  1WLE A;  4UB6 Z;  1AJP A;  4LFB O;  1YI2 V;  2H3O A;  2R70 A;  2HVK C;  1KYO F;  4LFC O;  1AJN A;  2WA4 A;  3OTO O;  3CHX A;  1Q6I A;  3FD9 A;  4MT8 A;  5CMU A;  1VQK V;  1PL0 A;  2B1G A;  3C3S A;  3JD1 A;  1MAB G;  2Q0O C;  1AI4 A;  4OX9 B;  1QNM A;  4NTX A;  3G6B A;  2IBZ H;  3RBZ A;  2HHH O;  4LF9 B;  1M4U A;  3ZRW A;  3EFF K;  3OUS A;  4JAS A;  2WLI A;  4ZHQ A;  1FJG B;  5JCO C;  3T1C A;  4WCE V;  4EFB A;  4DV2 B;  3KG2 A;  2ZM6 O;  4RQE A;  3U11 A;  1J5E B;  2UXC B;  3FFQ A;  3OEE G;  3CXC U;  4U7O A;  4NKG B;  1QVG U;  3X2Q B;  4ZKI A;  4MVS A;  1KKD A;  3ABM B;  1V55 C;  1VQO V;  4IHJ A;  2XAF A;  3H9V A;  2ZCE A;  2ZE7 A;  5EBL C;  1ZTE A;  1VQ7 V;  1I94 O;  2NN4 A;  3BHP A;  1FXK C;  4FFB B;  4BW9 A;  4DR3 O;  1PPJ H;  4TV9 B;  4BIU A;  4DUY B;  2LW1 A;  1L0N H;  3ZRX A;  4LWS A;  4MW3 A;  2LP7 A;  4JI5 B;  4MVQ A;  2M7W A;  4MVU A;  2Y69 B;  2Q8V A;  3WU2 Z;  4LFA B;  3F7Y C;  3HKB A;  3UCS C;  1VAR A;  2P22 C;  2LFS A;  2AHY A;  2IU3 A;  1I5Y A;  4IIJ B;  1M57 C;  4B3M B;  4FLV A;  1IBK B;  3STZ C;  3HKC B;  2JEX A;  1RPO A;  1VQ9 V;  2DYR B;  1SQF A;  5GON B;  3LUT B;  2WLL B;  4I5S A;  4D7S A;  2RJZ A;  1YZB A;  4YJ3 B;  4JI6 O;  4O4L A;  5IYD O;  3SR2 C;  4YHH B;  2P67 A;  4J80 A;  3ASO B;  4X66 O;  3QF7 A;  2M6Y A;  2CE4 A;  4ASU G;  1Q8I A;  4LF5 O;  1RM1 B;  3T4D A;  1Y76 B;  4MVR A;  2PUS A;  1O9G A;  4I50 A;  5H9C A;  3CSX A;  1QQC A;  2IH1 C;  5IJ0 B;  3E22 B;  1R3J C;  3FB7 C;  5FPO A;  3ASN C;  1JJ2 U;  1FXV A;  2HLD G;  3CJH B;  5CA1 B;  3M8A A;  4LFC B;  3CCV V;  1K34 A;  4AQY O;  2KB1 A;  4G2K A;  1FFX A;  3OTO B;  2HKO A;  1QR8 A;  1BHB A;  1GMG A;  1NJI W;  2PTM A;  4PA6 A;  2O57 A;  2QKA A;  2EIM B;  1IUR A;  4NXN O;  3P3P A;  1EN6 A;  2YXH A;  1I08 A;  2OCH A;  3UT5 B;  5FL7 G;  4O4H B;  2ZD9 A;  1BGY H;  3F5T A;  3ZBH A;  1PNM A;  1B3Q A;  5JQG B;  1SA0 A;  2K1E A;  5FNV A;  2DN9 A;  5L3G A;  5H2F Z;  4DR4 O;  3D3I A;  1TAE A;  3HKD B;  1V55 B;  1MSW D;  5KHG A;  1GM7 A;  3DXR A;  3ZMS A;  1VQ4 V;  1K5Q A;  3K3W A;  1B06 A;  4PA9 A;  1IX9 A;  1PM9 A;  3OW2 U;  3NXS A;  5J2T B;  5ITZ A;  1KUQ A;  1AVM A;  1FXK B;  3L75 H;  4LCU C;  2IM9 A;  2ZE8 A;  1S72 V;  4FLW A;  3JD4 A;  4DR1 B;  4DR3 B;  4GLX A;  2ZR3 A;  1I5X A;  4LF7 O;  4DR7 O;  4J7K A;  4RO2 A;  1WNS A;  3W7T A;  3BFR A;  5AG2 A;  1IDS A;  1T5E A;  2ZE6 A;  1NBM G;  1TVK A;  1Z5W A;  1S77 D;  5BR8 O;  1IBL B;  1G6U A;  2ZIN A;  4EFE A;  1M57 B;  1MZE A;  3EVK A;  2W0F C;  2GSM B;  3ZRS A;  5BMV A;  2E76 B;  4Z2W A;  4ZIB A;  3A0R A;  5EC1 C;  3TXS A;  5JJJ B;  3CME V;  4JI0 O;  4E2L A;  1YCI A;  5IWA O;  3SDL A;  1L0L H;  2VRZ A;  3CE2 A;  4X62 O;  2MK3 A;  5JVD A;  3D36 C;  3FYE B;  4JF3 A;  4TV8 A;  2XTA A;  4DYL A;  1FD9 A;  4JI6 B;  2YXL A;  5KUK A;  1NU1 H;  3D8C A;  1BSM A;  3IFX A;  1FFT B;  4K8X A;  2CK3 G;  2KG7 B;  3L9D A;  4LF5 B;  1Q5O A;  2LGQ A;  2EZP A;  3JSL A;  3ASN B;  2DMX A;  4B7K A;  3K79 A;  3VQW A;  5LGN A;  2WA3 A;  4PDV A;  5IY5 C;  4UV8 A;  2Q69 A;  2QKC A;  4FLZ A;  2XAQ A;  5JH7 A;  3EHB B;  2P7T C;  2F95 B;  1OHH G;  4HYO A;  2E5L O;  4DR5 B;  2F93 B;  3S3W A;  2E74 B;  1NVP B;  4LF6 O;  1US6 A;  5J2U B;  4NXN B;  2F23 A;  3E35 A;  2F1M A;  4TUY B;  4AI8 A;  2UUC O;  1NTM H;  1M9N A;  1H8E G;  2Q4P A;  4LR3 A;  4UB8 Z;  2R9A A;  1YTF B;  4JYC A;  1N36 O;  3A2F A;  4HZ3 A;  1KEC A;  2Q6A A;  4YIO A;  2VQE O;  1QBZ A;  2XAJ A;  2CTQ A;  4JI8 B;  4DR4 B;  2OWO A;  4ZOL A;  3FAV A;  3T1Y O;  1N34 O;  4U3J B;  3CCM V;  1K8A W;  5EK0 A;  2FML A;  3JAK B;  5H6Q A;  4CH6 A;  2BE3 A;  3CRC A;  3GVM A;  2JS5 A;  1DLB A;  4R6Z A;  4WFH A;  2D2C B;  1WAZ A;  1Q3E A;  2A79 B;  4B3R O;  1GN4 A;  3ZCC A;  3RYF A;  2AZ0 A;  4MTX A;  1K7D A;  4K0K O;  3OTF A;  4DR7 B;  4P9P A;  3ZHS A;  1BE3 H;  1BMF G;  2Y4T A;  4DR2 B;  5LOV A;  4LNU A;  2R72 A;  1GN3 A;  1VQ6 V;  4BWA A;  1FJG O;  3WB0 A;  3ZHQ A;  3OMN B;  3N27 A;  4DV2 O;  4B3S O;  5DN6 G;  3LDD A;  1HP8 A;  1FS0 G;  5BR8 B;  1WPB A;  1S5L Z;  1MSD A;  4X9Q A;  2P4K A;  2FKX A;  3LNM B;  4FJC C;  1J5E O;  2BOB C;  1NR1 A;  2VWK A;  2PYJ A;  4X20 A;  3JAR B;  1ZLZ A;  1NQT A;  5DEC A;  1F4N A;  3TCU A;  4H44 B;  4I4T B;  4EB6 A;  1R6K A;  5IWA B;  4X62 B;  3FX7 A;  3K5O A;  3QO5 A;  1B6Q A;  2CAZ C;  2DQ0 A;  4X1Y A;  5JWP A;  2LW7 A;  1X59 A;  4YJ2 B;  2A7W A;  2N04 A;  2WLM A;  1YDX A;  4CH5 A;  5IT9 N;  5KLV H;  1AR4 A;  2YUA A;  4JI5 O;  1TGO A;  2OT5 A;  3SYA A;  3ABL C;  1HWY A;  4YY3 B;  5GTI Z;  1Q6U A;  5IY5 B;  3DC5 A;  1S5J A;  3E8G A;  3JAW B;  4DW1 A;  1RP3 B;  5L3B A;  1JQ0 A;  2Y69 C;  1MNG A;  2JEU A;  3OAA G;  3JAT A;  1F51 A;  4J42 A;  3ZED A;  2X0L A;  4I0X B;  1H2L A;  1JFF B;  3O9O A;  2QE7 G;  4B08 A;  4NTW A;  3RYC B;  4ZI7 A;  3CC7 V;  3QTC A;  1EZJ A;  1W0J G;  4OXS A;  4TOI A;  1ENV A;  5IDJ A;  1WP7 A;  2AW9 A;  1OV9 A;  4LF6 B;  1IZ3 A;  5CA0 A;  3S3X A;  4KXR A;  5LBQ A;  3VOU A;  1I0H A;  2KKW A;  4YHH O;  1P7G A;  2YXY A;  3VQY A;  1JVM A;  1L8D A;  1HW7 A;  1XOU A;  1HNW O;  3E86 A;  3G80 A;  2R9R B;  3N2G A;  3JD3 A;  4D7T A;  4CBC A;  2ZT9 B;  4CS3 A;  2IW5 A;  2EJR A;  2H8P C;  2RN9 A;  5JJN B;  4GKK B;  1IBM O;  1MOF A;  3L73 H;  3T1Y B;  2YDE A;  2ZKO A;  3E8H A;  1SZT A;  4HNA A;  2FYU H;  3HB3 B;  3HKE A;  3SGI A;  2NR5 A;  4FLU A;  2OTL V;  4FLT A;  2YEV B;  3J80 N;  1VF5 B;  3GB7 C;  4R8C A;  1E1R G;  3CX5 F;  1ZL8 B;  3K5L A;  4B3R B;  5BZB A;  5GON A;  3QO8 A;  2FTK A;  2RNB A;  3OMI B;  4O2B B;  4K0K B;  2EIM C;  4LBE C;  2BSK A;  1NTK H;  4YJ3 A;  4J9Z B;  4CC5 A;  2CH7 B;  4MTG A;  4RUE A;  4DK1 A;  4TWK A; 
#chains in the Genus database with same CATH homology
 2WSS G;  4WF9 V;  3T2M A;  3OGC C;  2P6J A;  3CCV V;  1K34 A;  2ITD C;  2KB1 A;  4G2K A;  5IYB O;  5LGT A;  2HKO A;  1QR8 A;  1BHB A;  1W0K G;  1GMG A;  3STL C;  1NJI W;  4PA6 A;  2WWW A;  2EIM B;  3K08 A;  1JCH A;  2UXX A;  4XBF A;  1Q7Y W;  1FXH A;  4LP8 A;  4LC1 A;  2H94 A;  2EIJ B;  4CZZ A;  3LDC A;  1H2G A;  5CN0 A;  5C93 A;  5FL7 G;  2ZD9 A;  2HG5 C;  3FKS G;  1YJW V;  3ABT A;  4JAV A;  1PNM A;  3OEH G;  2EZO A;  3CCE V;  4WFA V;  4YXW G;  3K04 A;  3E83 A;  3SJQ C;  3IGA C;  1R3K C;  1GM8 A;  5KA6 A;  1K3E A;  2K1E A;  5B3S C;  5L3G A;  1ARO P;  1JPX A;  3D3I A;  3ZN0 A;  3ABL B;  1V55 B;  3MD0 A;  3LSQ A;  4P9O A;  3CC4 V;  1MSW D;  1H38 A;  1E79 G;  3ETG A;  1VQ8 V;  2QKS A;  1GM7 A;  3ZMS A;  1VQ4 V;  1K5Q A;  2YSU B;  3K3W A;  1AI7 A;  1R3I C;  1K92 A;  1NH2 D;  4PA9 A;  2BOC C;  3OW2 U;  4XDL A;  3NXS A;  2X6A A;  1L1F A;  4JGS A;  3SPG A;  1KD1 W;  1FXK B;  3E8F A;  1F4M A;  4LCU C;  4EKW A;  1S72 V;  2JJ2 G;  4UXN A;  4WFB V;  4MVM A;  3MHH C;  3JD4 A;  3QNE A;  1YHQ V;  3ABK C;  3SPI A;  3AG2 C;  1S76 D;  2ZR3 A;  1I5X A;  3I56 V;  4GX1 A;  2EIL B;  2Y48 A;  3FB6 C;  4JAU A;  1OCC C;  2PI4 A;  4RO2 A;  5KUM A;  4FPP A;  3W7T A;  3CP1 A;  3SPH A;  3WFV A;  2IJI A;  3E8B A;  3OR7 C;  1NBM G;  1V54 C;  5EBM C;  4RAI A;  1BL8 A;  3RVY A;  4P2Z A;  4R7C A;  1F23 A;  1QCE A;  1S77 D;  2C2A A;  3ETD A;  4KFM A;  2ZR2 A;  3ZJZ A;  4GX2 A;  1M57 B;  2DWE C;  1OCR C;  3B8M A;  4QE7 A;  1K97 A;  2W0F C;  2GSM B;  4GCZ A;  3K0D A;  4QE9 A;  1OCC B;  3OM3 B;  5L3D A;  3ZRS A;  1M1K W;  3LSS A;  1VQP V;  1ROP A;  4H33 A;  5L3E A;  2XOK G;  1AI6 A;  1MG1 A;  2ITC C;  1XL4 A;  1JOY A;  3A0R A;  2ZDI A;  1VQ5 V;  4QJF B;  5EC1 C;  2B1I A;  4I9W A;  3CME V;  3ZN1 A;  2WLL A;  4E2L A;  4WFG A;  3ZRW B;  1S5H C;  2MK3 A;  3F7V C;  4UV9 A;  1NKD A;  1DTO A;  3M99 B;  3CCR V;  1CPY A;  1R6N A;  3FYE B;  1BHA A;  4JF3 A;  5B1B B;  3K0G A;  3RW0 A;  5KUK A;  3W7S A;  1R73 A;  3IFX A;  4DXW A;  3CCQ V;  2HFE C;  1K4D C;  2WPD G;  1VQL V;  1K9M W;  1FFT B;  1GK9 A;  2CK3 G;  3OUF A;  2IJJ A;  2YEV A;  3AEI A;  5HFM A;  3SYO A;  3ETE A;  1E1Q G;  3ZIA G;  5LHH A;  1OCO B;  2JJ1 G;  3FB5 C;  2DYS B;  4TT3 G;  3LDE A;  2EZP A;  4PDR A;  2QTO A;  4N21 A;  4UVC A;  3SPC A;  2W6I G;  3ASN B;  3K9A A;  4MTO A;  3X2Q C;  2QA4 V;  3ABM C;  3CPW U;  3B8N A;  3K79 A;  5EBW C;  5L3F A;  3SYP A;  2ZXW C;  5LGN A;  2XAH A;  4PDV A;  3CCL V;  1SRY A;  4PA4 A;  5IY5 C;  1QLN A;  4PEL A;  4UV8 A;  2Q69 A;  1YIT V;  4G27 B;  3WG7 C;  4XDJ A;  3W7W A;  2Z5U A;  3AG1 C;  2XAQ A;  3UM7 A;  4PA3 A;  5GW7 A;  3EHB B;  2P7T C;  1QLE C;  2HJF C;  3BEH A;  4G28 B;  4UUJ C;  1OHH G;  4HYO A;  3CC2 V;  4X88 A;  2DQ3 A;  1NR7 A;  1LNQ A;  1GM9 A;  4L87 A;  1NVP B;  3QO7 A;  3DTU B;  1QVF U;  2XAS A;  1KP2 A;  1ORQ C;  1QR9 A;  4MVZ A;  3E35 A;  1VQM V;  1OZ0 A;  4Q20 A;  3E89 A;  4X89 A;  5LHI A;  1DF4 A;  4JTC B;  3SPJ A;  1M9N A;  1H8E G;  3MHS C;  3CD6 V;  3AG4 C;  4ZBM A;  3SYC A;  4JPR A;  2WLH A;  4MW8 A;  2P90 A;  1YTF B;  4JYC A;  2EIN C;  4GX0 A;  5H6R A;  4MTF A;  3TET A;  5LGU A;  3JD2 A;  5B3S B;  4XDK A;  5CBH A;  2Q67 A;  1NVP D;  1SES A;  1M56 C;  1KEC A;  3JYC A;  4HZ3 A;  2Z3Y A;  4KUM A;  2Q6A A;  3T4Z A;  3VBB A;  3K06 A;  1ZWI C;  3OR6 C;  3B77 A;  5CBG A;  2LFR A;  4BIZ A;  1QBZ A;  2XAJ A;  3CCM V;  1K8A W;  2DYR C;  5EK0 A;  2ZDI C;  2HR3 A;  4DO2 A;  3FB8 C;  1P4R A;  2ZQM A;  1YTF D;  2F43 G;  5H6Q A;  5CBF A;  4PDM A;  2WLJ A;  3TK1 A;  2A9H A;  2Q68 A;  1M56 B;  1KP3 A;  1R3L C;  1W2B U;  1DLB A;  1FXK A;  5B1A C;  3H01 A;  4R6Z A;  4WFH A;  2GHY A;  3ABK B;  2OCC C;  3ASO C;  1Q81 W;  3AG2 B;  4TSF G;  4WFF A;  2A79 B;  3ZCC A;  2PI5 A;  1CP9 A;  3AG3 C;  5KA5 A;  2D3O W;  3DGE A;  4MTX A;  2XAG A;  3W7X A;  2X7R B;  1GTO A;  1RM1 C;  1K7D A;  2IJK A;  3W7U A;  4FMT A;  2EIK C;  2A0L A;  4P9P A;  3G71 V;  1PKX A;  3P32 A;  3GWO A;  1YJ9 V;  1V54 B;  1PNK A;  1BMF G;  2HVJ C;  1OCZ C;  1WLE A;  3OE7 G;  1AI5 A;  3P30 A;  1AJP A;  4FK5 C;  1YI2 V;  1VQ6 V;  1M90 W;  2HVK C;  2WLI B;  1OCR B;  3OMN B;  2B5U A;  4QNH B;  1AJN A;  5DN6 G;  3LDD A;  2V7Q G;  4MT8 A;  1FS0 G;  3JD0 A;  4BW5 A;  5CMU A;  5CA3 A;  4U7N A;  5IYC O;  1PL0 A;  2B1G A;  1VQK V;  2QEX V;  3LNM B;  4FJC C;  3ZRV A;  4GX5 A;  2BOB C;  5DM6 V;  4QPK A;  1H8H G;  1NR1 A;  3JD1 A;  2UXN A;  1MAB G;  4PA7 A;  2IJH A;  1AI4 A;  1NQT A;  1F4N A;  3TCU A;  3RBZ A;  2X6B A;  2V1D A;  1G8M A;  3ZRW A;  3EFF K;  3OUS A;  2EIJ C;  2QM8 A;  4JAS A;  1R6K A;  2WLI A;  1YJN V;  3QO5 A;  1B6Q A;  1AJQ A;  2IH3 C;  2DQ0 A;  3T1C A;  4JTA B;  2XND G;  4HAM A;  4WCE V;  2JDI G;  1Y4M A;  3KG2 A;  3IC7 A;  2NLJ C;  4RQE A;  3HPL C;  3OFN G;  2WLM A;  4Z1M G;  1SER A;  3K03 A;  1VQN V;  3ZMT A;  3OEE G;  4RQF A;  3CXC U;  4U7O A;  5HFL A;  4WFE A;  1QVG U;  3SYQ A;  3X2Q B;  4ZKI A;  4MVS A;  1KKD A;  2OT5 A;  1COW G;  1K33 A;  3SYA A;  3ABM B;  3ABL C;  3G6E V;  1V55 C;  3CCU V;  1DF5 A;  1HWY A;  1VQO V;  1K5S A;  2ZXW B;  1KC8 W;  3D36 A;  5B1N A;  5IY5 B;  1UJW B;  3CMA V;  3E8G A;  2XAF A;  3RVZ A;  5L3B A;  1JQ0 A;  2Y69 C;  1GKF A;  4UVA A;  3WG7 B;  5J9P C;  2JEU A;  3AG1 B;  1EFR G;  3OAA G;  4UVB A;  3UKM A;  4MS2 A;  1NH2 B;  1F51 A;  2W6J G;  5EBL C;  1KQS U;  1VQ7 V;  1QLE B;  2X0L A;  1S3J A;  1FXK C;  4R50 A;  2QE7 G;  4MVO A;  5LHG A;  3CC7 V;  4PDL A;  1PNL A;  4BIU A;  2NNU A;  1WPX A;  1EZJ A;  1P7B A;  1SET A;  1W0J G;  2IU0 A;  3ZRX A;  2WLK A;  4OXS A;  1ENV A;  4MW3 A;  2LP7 A;  5IDJ A;  1Q82 W;  4MVQ A;  4JYB A;  2EIL C;  3ZMV A;  2M7W A;  4MVU A;  1JX9 A;  2Y69 B;  1GO3 F;  2EBO A;  1TUE B;  3F7Y C;  2DWD C;  2DW4 A;  3AG4 B;  5LBQ A;  4F4L A;  1YIJ V;  3VOU A;  3G4S V;  3ABU A;  1XL6 A;  1J95 A;  2EIN B;  3OMA B;  4P30 A;  1JVM A;  2ATK C;  3R65 A;  1CEZ A;  4QIW F;  1G4Y B;  2JK5 C;  2LFS A;  3BY6 A;  3E86 A;  4GT1 A;  2AHY A;  4BAY A;  2IU3 A;  1I5Y A;  2R9R B;  1M57 C;  3STZ C;  2AHZ A;  3JD3 A;  4N23 A;  4CBC A;  5B1O A;  1PD3 A;  2JEX A;  2IW5 A;  2EJR A;  1RPO A;  3CCJ V;  3I55 V;  1VQ9 V;  2DYR B;  2H8P C;  3FYI B;  1N8R W;  1MOF A;  2R9I A;  3CCS V;  1Y66 A;  1Q86 W;  3LUT B;  3E2E A;  2WLL B;  4I5S A;  4JTD B;  3JCZ A;  2WAM A;  4FIP C;  3ZMU A;  3E8H A;  1SZT A;  5EC2 C;  5B1A B;  1K73 W;  4KP4 A;  1EBO A;  5IYD O;  2JIZ G;  2OCC B;  2P67 A;  2WLN A;  3ASO B;  1YSC A;  3HB3 B;  5B1B C;  5E1A C;  1IXM A;  2QM7 A;  2OTL V;  3AG3 B;  1RPR A;  2YEV B;  4ASU G;  4QPJ A;  4X8A A;  3ML0 A;  3GB7 C;  4R8C A;  1RM1 B;  3PJS K;  3T4D A;  4H37 A;  4MVR A;  1E1R G;  1S0V A;  5H9C A;  3CYO A;  2EIK B;  4RUF A;  5L3C A;  5BZB A;  2IH1 C;  3QO8 A;  2FTK A;  4MSW C;  1OCO C;  1R3J C;  3OMI B;  1THZ A;  4J9Y B;  1OCZ B;  2DYS C;  3ZMZ A;  3FB7 C;  1AR1 B;  1K4C C;  2EIM C;  4LBE C;  2OTJ V;  3ASN C;  4J9Z B;  1JJ2 U;  2X6C A;  4MTG A;  1FXV A;  4RUE A;  3F5W C;  2HLD G;  4TWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...