3G71V

Co-crystal structure of bruceantin bound to the large ribosomal subunit
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3g71V00
1K73W 4WCEV 4WFBV 3CCSV 1VQKV 1QVFU 3CXCU 3CMEV 3CC7V 2OTLV 1K9MW 1VQ8V 1YJNV 1W2BU 3G6EV 3G4SV 3CMAV 1VQ7V 1VQOV 1VQNV 1JJ2U 3CCRV 4WFAV 1VQPV 1YJ9V 1VQLV 3CCVV 1YJWV 1Q81W 1QVGU 1VQMV 1YI2V 1M1KW 1VQ9V 1VQ5V 1VQ6V 3OW2U 1NJIW 3CCMV 3CPWU 1K8AW 3CC4V 3CCLV 1Q82W 1M90W 3CCQV 2D3OW 1YHQV 2QA4V 3CCJV 3G71V 1KD1W 3I56V 5DM6V 1YIJV 3CCUV 2QEXV 3I55V 1R73A 1YITV 1Q86W 3CC2V 1KC8W 4WF9V 3CCEV 1VQ4V 3CD6V 1S72V 2OTJV 1KQSU 1Q7YW 1N8RW
chains in the Genus database with same CATH superfamily
4BWAA 1IXBA 5IYDO 1CPYA 2ZR2A 3AG2C 4WBNB 1TGOA 5C8YB 5LGTA 3AG4C 1QNMA 2GV9A 1V55C 4PA6A 2AHZA 4GX1A 1J5EB 4GYCB 2OIEA 2EILB 4RWUA 4PDMA 3OM3B 4DYLA 1ORQC 1B06A 5DM6V 5IWAO 3BHPA 1P7GA 1GN6A 3CXHF 4DRXB 2YI8A 1OCCC 4MVUA 3CRAA 4K35A 1YTFB 3B4SA 2XNDG 1KECA 2CGNA 2WLLA 2V7QG 1N36B 5JH7A 4B3MO 2QKSA 1J95A 2QGNA 4JI1B 2CTWA 3K59A 1VQ5V 4EEQA 1XNQB 4DR4B 2E74B 1IX9A 2DOSA 1JVMA 3DXRB 5FPOA 2CK3G 2EINB 1XOUA 1KP2A 2DYRB 4H33A 3JARA 1RPOA 1G1XB 1Y4MA 4JI1O 1FAFA 2WPDG 3IAYA 4JYBA 5IY5B 3CCLV 4X1IA 4Z1VA 4LF4O 1IXMA 4DV1B 3LSQA 2YIBD 1TVKA 2IH3C 5KAIZ 3CE2A 1D5NA 2ZE6A 1B04A 3QO7A 2FTKA 4RUFA 1P4RA 5CBGA 4J80A 3OAAG 4LF4B 1KYOF 3RYFA 4RQFA 5EYPA 1RSOA 4FLUA 2ZIOA 1KD1W 2ADPA 2LGQA 4IT5A 4X65O 3HKBA 2EX3A 3VBBA 3U11A 2XASA 3X2QB 4GKJB 3CMEV 4MVSA 4D7SA 3MAQA 3W7WA 4A5UB 4RO2A 1S0VA 5IJ9A 4RAIA 2AW9A 2Y4TA 2AZ0A 1F4NA 3A8TA 3MHSC 3G71V 4ZI7B 5CA3A 2F4VB 4OXSA 3WB2A 4C7UA 4OPHA 3UT5A 5ITZA 5B3SB 2X6BA 3A0HZ 3OT7A 1K4DC 2ARHA 2YC0A 1M56B 1Y74A 4O4JA 3D36C 5L3EA 2P7TC 2GUZA 2YXHA 1QLNA 1OCCB 1VIBA 1V54C 5GONB 1IVSA 1PV0A 4JV5B 4DR3B 3JD3A 4R7CA 3SYOA 4X89A 1XL6A 3OR6C 4LNUA 1FXVA 4DR1O 4DR2O 2A79B 3HKDA 4DV5O 4UCVA 5LP6B 1MZEA 1B3QA 4I50B 3SPIA 3BCCH 4LF8O 4MVOA 4YHHO 1AI5A 1PNMA 2XTAA 4J7ZA 1VF7A 1KUQA 1OCRC 3G6BA 3HR0A 1NQTA 1YVWA 4UCRA 1N34O 1L8DA 1Y6XA 2B1GA 4EB6B 1R3LC 2Y69C 3AG3B 4U3FH 1N32B 4LFAO 5LHHA 1XDCA 1TUEB 1XMOB 2ZXWB 3LDDA 2ZXWC 4ZOLB 2ETNA 2DJVA 1H2KA 1PNKA 1T5EA 3JARB 5H6RA 1PKXA 1BMFG 4RQEA 2E5LO 1S5JA 4U3JA 1H8HG 5KHIA 3JALA 3JD0A 5KUKA 4TSFG 2Q6AA 3Q4HB 1FFXB 2Q7GA 3K5NA 5K1PA 3JASB 3EVKA 4J10A 1J5EO 4PDRA 3IC9A 1FKAO 3A0BZ 5BR8O 2AZ2A 2Q5ZA 3AK1A 4B3TB 2RCVA 3RYCB 2BTQB 3S3WA 3CWBH 2JDIG 4DV7B 2XAJA 3B8MA 5EK0A 4B3SB 1QVGU 2VWKA 1H2MA 1JOYA 2CH7A 1GK9A 2QEXV 4YJ2A 5BMVA 4WF9V 1AJQA 4R50A 1AI6A 1YSCA 1SF9A 5B1NA 4DV3B 3ZRVA 1K4CC 2EILC 4YJ3B 3EFFK 2UU9B 2PYJA 4I55A 4FLZA 5IDJA 3B09A 1AI7A 3I56V 2BTQA 4IIJA 4JYAO 4AI8A 2GTSA 1MABG 4X64O 4LFCO 2P4VA 4B3RB 4CC5A 1S77D 1VQ7V 3ASNB 4TV8A 5EZYB 1NVPB 2R72A 1M1KW 1XEQA 1NTKH 1QR8A 1N33B 5A9GA 3J7AU 2DN9A 2W0XA 3TCUA 4IGGA 4DRXA 3JAMN 2JJ2G 4NTWA 1EZVH 2OCHA 4JI8O 1IBMO 3AG3C 4L8JA 3ZCCA 2WLMA 4LF7O 4PDLA 4CS4A 2OTLV 1SESA 2DQ0A 2DW4A 1H38A 1FS0G 1PL0A 1OCZB 2RMKB 1N4CA 2JGDB 1Q3EA 3OW2U 4CH6A 1S5HC 2UXBB 5EBWC 4LF6B 4JPRA 2DYRC 1Y66A 1KU9A 2WLIA 3RW0A 1GMGA 4AQYB 1XL4A 2JEUA 4LFBB 3JD4A 3ZMTA 1I94B 2E5LB 2E75B 1UPGA 3KZIZ 3WG7B 1R1BA 1SQPH 3OGIB 2NNUA 1BHAA 3WG7C 3ABKC 4MS2A 1YJ9V 2UXDB 4LBEC 4DUYO 3W7TA 3TJTA 1Q82W 1RM1C 1DK1A 3H1KH 3UO2A 2OCCC 3CRQA 1XREA 5LYJB 2Q69A 2PUSA 4O4HB 4GZRB 5LBQA 1YZBA 1XNRB 3L74H 4U7OA 5FNVB 1K97A 3HKBB 5KHHA 2FB5A 3SDLA 2UUAO 4DV5B 1P84F 5JVDB 2A7WA 1VMGA 1I0HA 4MVZA 1DTOA 2O57A 3AG4B 1Y76B 1S76D 3JSNA 3H9VA 4O2AA 1RPRA 1BS3A 4JI3B 5L3DA 1OCOB 4LC1A 1TUBA 2XT9A 3E22A 2P4KA 3K5MA 3CCMV 1K8AW 4K8ZA 1JX9A 2BTOA 4DV6O 3UO3A 3THOA 4DW0A 4PA3A 1UJWB 4WFHA 1I7FA 1ZLZA 2VS0A 4DK1A 2YDEA 1FD9A 3E35A 1N0JA 4DUZB 1S5LZ 5IY5C 2WLLB 1WB7A 2QTSA 2Q73A 2Y0PA 4P30A 5IYZA 4FIPC 1XI1A 4RUEA 1YDXA 3WFVA 4W4LA 4PI0A 3BFRA 5FLXN 2HFEC 1ZSPA 3E86A 2A9HA 3OTOO 2BCCH 2EULA 4X64B 4BIOA 3CC4V 4ZKIA 2QKAA 3HKCA 4JI4O 2EBOA 1XILA 2WA3A 4DR6O 5EBMC 3UQ8A 4ZIBA 1HDJA 3UKMA 2WA4A 2YIAA 2DQ3A 3J80N 3IGAC 5IJ0A 4ZBMA 2HVKC 3BAAA 4NXMB 2HG5C 3OGCC 2UXNA 3K79A 4JAAA 4B3TO 1KMIZ 2IJIA 2X7RB 2V4DA 4DW1A 5KAFZ 2CH7B 4YXWG 5DN6G 3DGEA 1JFFB 3P30A 4IYIA 3RYHB 1VQ8V 3D8CA 1R3JC 4WFEA 2GDSA 1TVKB 3ETDA 5IT9N 1WPBA 1E1QG 3RYFB 2KSDA 3KCYA 3I5DA 4PD4F 3WB1A 1K5SA 4IYHA 2LW7A 3D3IA 2BE3A 3SJCC 1NH2D 1EN6A 4X20A 4GUNA 4FLXA 5A2QN 1Z5WA 2EINC 3SPHA 5FPRA 3FFQA 1NS1A 2ZE8A 4X1IB 2E3CA 3ZN1A 1EN5A 1Q90D 1JCHA 2ZDIA 1SC5B 2KG7B 3BY6A 5LHGA 1BHBA 3QO5A 2FKXA 4CH5A 3JAWA 4DV2O 2HJDA 5LMUO 1FFTB 2NLJC 3DC5A 1NR1A 4BW5A 5JJJB 4NXNO 2EIMB 3SJBC 1GO3F 2KKWA 1OZ0A 2F43G 5CA1A 4DV0O 2UUCB 3R65A 3LNMB 3ZJZA 1H2LA 3ZIAG 4PA9A 4WFGA 1BQ0A 3SPGA 4WCEV 1FXKA 2ZCEA 5LMNB 1M5IA 4PELA 2HP8A 2IBZH 4X1YA 3F5TA 5EC2C 1GRJA 3RYHA 1VQ9V 4DR3O 1NT2B 3OEEG 4H0LB 4N21A 1H2GA 2QSAA 4WBNA 3TGUH 1HR0B 5DEDA 2UUBB 3ZRSA 2W0FC 4J41A 2A06H 2HR3A 5BXZA 3P3NA 3RT3C 2QWOB 2YXLA 4CS2A 5B1AB 3ZS8C 1CP9A 2WLKA 1I5YA 3SYQA 4MVQA 2Q67A 1LUVA 3RWRD 5E79Z 2WLJA 3GWKC 3ZRWB 3DC6A 3HB3B 2P90A 2RQ6A 4EKWA 4R6ZA 4TQFA 1NVPD 1SKVA 4X1YB 3SJAC 3G6EV 3JD1A 4FMTA 2VQFB 4DUZO 2R9AA 2QJ1A 3L73H 3CCVV 1R3IC 3JSLA 3E8HA 4NXNB 2Q9LA 1X4TA 1YEWA 2JK5C 4FM1A 3BA8A 2HEPA 4Z1MG 5KUMA 4LF5O 4FPPA 4JYYA 1WA8A 1VF6C 3AK3A 1YJNV 4BIZA 1XQ8A 2JJ1G 3VQYA 3JAWB 1F23A 3C90A 2ZKOA 1HNZO 4UUJC 1HNWO 4LFAB 3GB7C 1TAEA 3CJHB 2QE7G 1IBKB 2WLHA 3HKEB 5KHJA 2VQEO 3JALB 4FM2A 1KP3A 5KA5A 1PM9A 3W7UA 1QQCA 4KHPB 3N27A 4NVPA 3K0GA 1XMQB 2JGDA 4GX0A 4HNAB 5LA6B 4AQYO 3TETA 1YITV 5B5EZ 3KKYA 3FB8C 2B1IA 4GX5A 5B1OA 1US6A 4OX9O 4JI4B 4GX2A 3K9AA 2JEXA 4J42A 1VQPV 5JJNB 3CB2A 1MG1A 5CB4B 4IIJB 2KQXA 2DYSC 4O4IA 1SZXA 1AI4A 1OCOC 2CGOA 4O4HA 4CH3A 1SQFA 4JAVA 3CD6V 4UVBA 5B1BC 2YS8A 2R9IA 4CBCA 1K9MW 1SQXH 3LDCA 1MOFA 1NZ6A 1YTFD 1VQMV 4DV4O 4H37A 1LNQA 4I55B 2P5OA 5KMGA 2WWWA 3APOA 3CCJV 5KHGA 1IBMB 4J11A 2EZPA 2C2AA 2OIGA 2N04A 5IYBO 3ZHVA 3K03A 4MT8A 2OT5A 1THZA 1VQLV 5EIBC 4D7TA 4J7KA 4UVAA 1W0KG 2WLNA 5C93A 4LF9B 3OEHG 1JFFA 4B08A 1EBOA 1VQ4V 1VQKV 5LA6A 3QO8A 1BT8A 2DWDC 3OMAB 1YXBA 4DV3O 3E8FA 4DR6B 2Z0AA 1JA8A 3ZMSA 2QTOA 4OX9B 3CRMA 2LJ2A 3JASA 4NTYA 3VQVA 4I7ZB 4DV0B 1Q7YW 5H9CA 2Q4PA 1URFA 5BR8B 1FPOA 2H8PC 2UUCO 4U3JB 3AG2B 1Q6UA 1OCRB 1NH2B 2PY5A 1Q6IA 4DV2B 4K3AA 4DR4O 1IBLB 1AROP 5FL7G 3ASNC 3T2MA 2ZQMA 3E22B 3RFRA 1R73A 2ATKC 3OFNG 3CP1A 3OE7G 4UB8Z 3B8NA 2XAQA 1IBKO 4LF6O 3UCSC 1PP9H 2IU3A 3G67A 2Q7EA 3STZC 1Q81W 2F1MA 3IC7A 1BQZA 1HW7A 2QM8A 3FAVB 1N34B 2P22C 3FD9A 3JATA 3R66A 1NI8A 5LOVB 2ADQB 1M9NA 3H1HH 3ASOC 2UXXA 2JRIA 5J9PC 1QHTA 2FMLA 1XMOO 1L0LH 2JS3A 2Z5UA 2YEVA 3F7VC 3VQXA 3K0DA 1ZL8A 2LP7A 2R70A 2EZOA 1AVMA 3K9SA 1FFXA 2G38A 5IE9A 3KCXA 3ZRXA 3GWOA 3UM7A 4KP4A 4DR7B 1QR9A 2Q0OC 2UUAB 2JS5A 4JV5O 1JQ0A 4DK0A 3T1HO 3GVMA 1GH6A 1MA1A 4PI2A 1K92A 2QWQB 4UCSA 1EZJA 2IU0A 4H13B 3BEHA 1K34A 4FM0A 4OGQB 4LCUC 2QWNB 3IJ4A 1G8MA 5D5QA 4J9ZB 3D36A 3AG7A 5IJ9B 4FFKA 2N05A 2ZT9B 5LMNO 4JYAB 1AP5A 2LO1A 3LSSA 2CTRA 4JF3A 4XBFA 4WFFA 2ZNJA 3ZHQA 1VQNV 4ABMA 4FZ0A 1WN7A 1U97A 1NJIW 2BSKB 3B77A 3FYIB 4NTXA 5CBHA 1IURA 4QGPA 3MDSA 1K7DA 1YIJV 2IJKA 1GAXA 2CTQA 3CCEV 5LMUB 1FXHA 4PHZA 4QNHB 4MVRA 1DF4A 1FXKB 3N2GA 3DSQA 4CZZA 3RVYA 4ZOLA 2EIKC 4O4LB 4GCZA 5KHKA 3H1JH 3FB5C 4GKJO 4D6TH 4MSWC 3N2KB 2VWJA 1R6NA 5F2VO 1V54B 4X65B 3ML0A 1EN4A 1NU1H 3H1LH 3T1YO 1LUWA 3CHXA 4FLVA 3U10A 2DWEC 4ICGA 4Q20A 1JJ2U 1XUQA 3SPJA 1AR4A 1JPXA 1NTZH 3O9OA 4NYKA 3N2KA 1ROPA 5KX5A 1SRYA 4JI3O 4PV1B 3J81N 1EFRG 4O2AB 4TV8B 5EZYA 1GTOA 1R3KC 1Z2GA 3OMNB 2X0LA 2PI4A 1Q43A 1OV9A 3RYCA 1HNXO 1GM9A 3E8GA 3ABMC 2VRZA 1IBLO 2A3QA 5LGUA 1N32O 2QWPB 2M7WA 4X9QA 3CX5F 5CBFA 3L75H 2XUMA 1HNXB 1GM8A 4U7NA 5KMGB 1QLEC 4B7EA 3BPZA 5ITZB 1Z5VA 1DGSA 2P6JA 4TT3G 1XHXA 2ODMA 2NN4A 1XNQO 1SZTA 2W6IG 5GTIZ 1GN2A 2QKCA 4KXRA 4TV9B 1SQGA 4H44B 2L6LA 5K1XA 4CC6A 1AR5A 3ZHRA 3FB7C 2GBOA 4MTXA 3SJQC 2EIJC 3EHBB 5GW7A 3SGIA 4YIOA 2Y4UA 4I4TA 2BSKA 3ZHUA 3KG2A 3E2EA 2AGAA 2PI5A 1E79G 2MK3A 4HZ3A 4TQDA 2RNBA 3BVOA 5AG2A 2ILMA 4UV9A 2F23A 4FVMA 2BOCC 2Q8VA 1RM1B 2LQTA 3W7SA 1PL4A 3LUTB 3JD2A 3OTFA 1Q86W 4IL6Z 1N33O 4YY3B 1AJNA 4DXWA 4X66O 1QVFU 3MHHC 1VF5B 5J2UB 3RYIA 5GONA 1QU7A 2V1DA 4JZ2A 3CSXA 1RFYA 1O9HA 1VARA 4CS3A 3OMIB 4I4TB 4P9OA 3CJHA 5KLVH 1V55B 5LXTA 4B7KA 4JTCB 2ZM6O 2WSSG 5HFLA 5BY1A 4FLTA 3ABUA 2YEVB 1F4MA 5KA6A 1QCEA 3E8BA 4X1KA 3WU2Z 4E2LA 2QM4A 5JVDA 4DR5B 3FYEB 2PYLA 4I9QA 3L72H 2JGUA 5JCOC 5DECA 3STLC 1Y76A 4GLXA 2YIBA 4O2BA 5L3BA 2OTJV 4PDVA 1ZAUA 4E4EA 2GHYA 4DV7O 1AP6A 3F5WC 4B3SO 2F4VO 5HFMA 1VP7A 3CPWU 3P3PA 2JVDA 5EYPB 2QWRB 1P7BA 1MSDA 2GSMB 3JCUZ 4AHCA 3ZX6A 1L1FA 1KB9F 4BW9A 5CA1B 4LFBO 3L70H 2UXCO 1FJGO 2Z3YA 3G4SV 2XHBA 4DUYB 1HWYA 2HHHO 4K0KB 1M90W 4TV9A 2CDYA 1AILA 3ABMB 3ABTA 2PZSA 1FYJA 4UVCA 2XAHA 2RDCA 4LF7B 3SPCA 4JAUA 3ABLB 5LXTB 2HLDG 4JI2B 1Y67A 2UXCB 5CA0A 1JR9A 3OUFA 2VQFO 4OPAA 1MZFA 2ZR3A 4I0XB 3T4DA 1N0NA 3ASOB 1SS3A 4YHHB 4KHPO 5B3SC 2H3OA 2VQEB 3CC7V 1XMQO 4I5SA 4YIPA 4DR2B 4EFBA 4JI6O 2RN9A 3QTCA 5L3GA 3UT5B 3ZEDA 3VQWA 1H2SB 1BCCH 2UU9O 1PD3A 2P06A 5E1AC 2A0LA 2P67A 2IJHA 1F51A 3X2QC 1Q5OA 5BMVB 3AG1C 1G6UA 3HKEA 5CA0B 4Z2WA 1VQOV 3C3SA 1I5XA 4PA4A 2EIJB 4O4LA 2ZIMA 1NTMH 3M99B 4F6RA 1X59A 2PTMA 1Q6HA 2AHYA 3HKCB 2DMXA 1KQSU 2HHHB 4FLYA 2XOKG 3H1IH 4LH7A 3C3TA 3TXSA 1G4YB 1L0NH 4O2BB 4BR6A 5LYJA 3AEIA 2IW5A 3PJSK 3W7XA 3QG5A 2OWOA 5LOVA 2BOBC 4JYCA 4DV6B 2GTAA 3ETEA 2R9RB 4BAYA 3JATB 1OJHA 1MSWD 4ZHQB 3FAVA 1S72V 3A0RA 5D5PA 4QPKA 1M93A 2QDOA 4P2ZA 4MTOA 1ZX3A 2LGWA 4TOIA 5EBLC 4WFAV 3ZMZA 3Q4HA 1B6QA 3DXRA 5JJEB 4UB6Z 2D3OW 3ABLC 1CEZA 3ZN0A 5CN0A 3I55V 2Y48A 4HAMA 4NKGB 4XDKA 1YCIA 2F93B 3MD0A 4KUMA 4MW8A 5LHIA 3NR7A 1DF5A 3M8AA 1HP8A 3K58A 1IDSA 1K3EA 1P49A 4G27B 3OTOB 1OHHG 2X6AA 1FXKC 4DR7O 3AK2A 2YXYA 2WAMA 1PNLA 4MW3A 5H6QA 1ZUQA 2YSUB 4JI7B 3LDEA 5IYCO 1N8RW 3CXCU 3WB0A 1H8EG 4JI5O 3CCRV 1M57B 3FKSG 2LFRA 2ZE5A 4JGSA 1SERA 3CCQV 1K33A 3ZHSA 1R6TA 2ZDIC 4JI2O 5B1AC 3RBZA 3K5LA 5JCOA 5JQGA 2CE4A 1MNGA 3T4ZA 1AR1B 3CCSV 2KG7A 2FYUH 3TK1A 3L9DA 4BIUA 5L3CA 1NKDA 1WP8A 4TUYB 4JZGA 5C8YA 1NR7A 1LR1A 1SETA 2L35A 3S3XA 2K1EA 2RJZA 2JIZG 2GUZB 1BSMA 1SQQH 4JI8B 5H2FZ 3APQA 2ZNIA 1M56C 4UFZA 1SQVH 4LP8A 5B66Z 1DLBA 1GKFA 4GKKO 2ITDC 5JWPA 4MVMA 2PF4E 3ETQA 4UCTA 4P9PA 4IHJB 4JI0O 3ZMUA 1GN3A 2AXTZ 4JASA 4QPJA 1YF2A 1GM7A 1XNRO 4NR1A 4DR1B 3ETGA 4JTDB 3D3QA 4R8CA 2EIMC 2IM9A 4ZHQA 1WP7A 3B40A 3P32A 1XHZA 4DV1O 3OD4A 4FLWA 3CRRA 2H94A 1COWG 3O65A 2F95B 4MTGA 1ENVA 2DYSB 4N23A 3K5OA 2N74A 2ZINA 3CYOA 3SYAA 3OUSA 4LF5B 2Y69B 1KC8W 2EJ7A 5B1BB 2YI9A 5GTHZ 3K08A 3K06A 4FFBB 1W2BU 3CMAV 4X20B 3VOUA 3FB6C 4MTFA 1YJWV 2X6CA 4JTAB 3T1HB 4UCUA 2EJRA 1F7YA 2FL4A 1WNSA 3LNNA 3K57A 5JH7B 1D5AA 2K9PA 4B3MB 3CCUV 4EB6A 3CC2V 1WJZA 4FFBA 4X66B 3HKDB 4G2KA 4YY3O 4LNUB 4W4KA 4X88A 4O4IB 3QF7A 2PGGA 4DV4B 1BGYH 4UXNA 3DTUB 3N2GB 1QBZA 2OCCB 3F7YC 4AILC 3M7MX 2LFSA 4K8XA 4QE7A 3G80A 4GKKB 4LR3A 2ZD9A 2CAZC 1U96A 3SR2C 4I0XA 4KL1A 2QR4A 3RN4A 5J2UA 1WB8A 3TXQA 1JMKC 4HNAA 2UXBO 1D2DA 3E83A 2NR5A 4FZ1A 2HJFC 1YI2V 3ZBHA 5IYZB 4ZI7A 2KB1A 4UCOA 1WPXA 4IHJA 1TUBB 4QIWF 2QA4V 1VEWA 4O4JB 5BZBA 4DO2A 3ZRWA 3QVNA 4L87A 1OCZC 1BE3H 2Q68A 4TUYA 1AJPA 3CS5A 3RGBA 1KBHA 4QE9A 2HKOA 4JI6B 3BABA 4X1KB 5IJ0B 3JCZA 2MW2B 4J7JA 1HNWB 1RP3B 3BA9A 2XAFA 4LFCB 2EIKB 4LF8B 1I08A 4QJFB 5LL6Y 4X62O 1Q8IA 3BRCA 5J2TA 3LSUA 4DR5O 1K73W 4LWSA 1EM1A 3JAKB 4LH6A 5LP6A 1E1RG 3U0ZA 2ZM6B 3RYIB 1QLEB 4XDLA 3ZHTA 1GN4A 1W0JG 1PPJH 2CUGA 1UFIA 2YUAA 1M4UA 1HNZB 1FJGB 2HVJC 3ICXA 3H01A 5LP6C 3AG1B 1CXZB 1M57C 1R6KA 2Y0IA 3T1YB 2IH1C 2WLIB 4K0KO 3HPLC 1SQBH 1Y74B 5LGNA 4FJCC 1VF6A 3SYCA 1MMMA 1S3JA 5EC1C 4G28B 2YIDA 1K5QA 5EIBD 5KX5B 1YHQV 2Q0AA 4EFEA 2M6YA 3T1CA 4GT1A 3CRCA 4UV8A 4JI5B 3ABKB 2UUBO 4ASUG 4FK5C 3JYCA 3CEIA 3PN1A 3SYPA 4JI7O 1WA8B 5FNVA 4NXMO 3NXSA 4I50A 1H2NA 2F66C 1VQ6V 2YICA 1KKCA 4X8AA 4HBNA 3E89A 1WLEA 3L71H 2CTPA 4B3RO 2QM7A 1HR0O 4I9WA 1BZKA 5H5NA 5TISZ 1RSOB 2B9ZA 1AB3A 2XAGA 4Q6GA 4X62B 2LW1A 2B5UA 3B2EE 1W59A 2E76B 3JAKA 2IJJA 3OR7C 5CMUA 1KKDA 4XDJA 4LWSB 4CH4A 4KFMA 4F6EA 3K3WA 2DE0X 3ZMVA 1JJOA 4LF9O 3K04A 3FX7A 1XBLA 1NBMG 4NB5A 4WFBV 2W6JG 1IZ3A 4YJ2B 4JI0B 1ZTEA 1SA0B 1O9GA 4HYOA 3EXAA 5J2TB 1N36O 4F6RB 1WAZA 1BL8A 5JQGB 2ZE7A 1V9PA 4PA7A 3A2FA 4PJ0Z 1I94O 4J9YB 1ZL8B 2OYQA 4TWKA 1A32A 1ZWIC 2ITCC 3QNEA 4YJ3A 3RVZA 1TA8A 5IWAB 5CB4A 5L3FA 3IFXA 2D2CB 1SA0A 2Q7HA 4F4LA 2UXDO
chains in the Genus database with same CATH topology
5IYDO 2XOKG 1CPYA 2ZR2A 3AG2C 5LGTA 3AG4C 3E35A 2IU3A 1V55C 4PA6A 2AHZA 4GX1A 1G4YB 3STZC 5IY5C 1Q81W 2WLLB 3IC7A 2EILB 2QM8A 4P30A 4PDMA 3OM3B 4FIPC 3AEIA 2IW5A 3PJSK 4RUEA 3W7XA 1ORQC 3WFVA 2BOBC 4JYCA 5DM6V 3ETEA 2R9RB 4BAYA 1M9NA 1MSWD 3ASOC 1S72V 1OCCC 2UXXA 4MVUA 5J9PC 2HFEC 3A0RA 1YTFB 4QPKA 2XNDG 2Z5UA 1KECA 2YEVA 3E86A 2WLLA 2V7QG 4MTOA 3F7VC 4P2ZA 3K0DA 2A9HA 2LP7A 2QKSA 5EBLC 4WFAV 3ZMZA 2EZOA 1J95A 3ZRXA 1VQ5V 3GWOA 3UM7A 3CC4V 1B6QA 4KP4A 4ZKIA 1QR9A 2D3OW 2EBOA 1JVMA 5EBMC 3ABLC 1CEZA 3ZN0A 2CK3G 5CN0A 3I55V 2Y48A 4HAMA 1JQ0A 4XDKA 3UKMA 2EINB 3MD0A 4KUMA 1KP2A 1K92A 4MW8A 2DQ3A 5LHIA 1EZJA 2DYRB 1DF5A 4H33A 3IGAC 2IU0A 1RPOA 4ZBMA 1Y4MA 3BEHA 1K34A 2WPDG 2HVKC 4LCUC 1K3EA 4G27B 1OHHG 1G8MA 2X6AA 1FXKC 2HG5C 3OGCC 4JYBA 5IY5B 3CCLV 2UXNA 3K79A 1IXMA 3D36A 1PNLA 2WAMA 4J9ZB 4MW3A 2IJIA 2X7RB 5H6QA 2YSUB 3LSQA 3LDEA 4YXWG 5IYCO 3LSSA 5DN6G 1N8RW 2IH3C 3DGEA 4JF3A 3CXCU 3QO7A 2FTKA 4RUFA 3P30A 1P4RA 4XBFA 5CBGA 3OAAG 1VQ8V 4WFFA 1R3JC 1H8EG 1VQNV 3CCRV 4WFEA 1M57B 3FKSG 3ETDA 2LFRA 4JGSA 1NJIW 1E1QG 3B77A 3FYIB 4RQFA 5CBHA 3CCQV 1SERA 1K33A 1K5SA 1KD1W 2ZDIC 1K7DA 1YIJV 5B1AC 3RBZA 3D3IA 2IJKA 3CCEV 1FXHA 4QNHB 3T4ZA 4MVRA 3VBBA 2XASA 1AR1B 3X2QB 3CCSV 1DF4A 1FXKB 3CMEV 1NH2D 3TK1A 4CZZA 3RVYA 4MVSA 2EIKC 4BIUA 5L3CA 1NKDA 2EINC 3W7WA 3SPHA 4RO2A 1S0VA 4GCZA 4RAIA 3FB5C 1NR7A 1SETA 3ZN1A 4MSWC 1F4NA 3MHSC 2K1EA 2JIZG 1R6NA 3G71V 1JCHA 1V54B 2ZDIA 3ML0A 5CA3A 1BHBA 1M56C 3BY6A 5LHGA 4OXSA 3QO5A 4LP8A 5B3SB 1DLBA 1GKFA 2X6BA 1FFTB 2ITDC 2NLJC 1NR1A 4BW5A 2DWEC 2EIMB 1K4DC 4Q20A 1JJ2U 3SPJA 1M56B 1JPXA 4MVMA 1GO3F 5L3EA 2P7TC 1OZ0A 4P9PA 1ROPA 2F43G 1QLNA 1SRYA 3R65A 1OCCB 3LNMB 1EFRG 3ZMUA 3ZJZA 4JASA 1GTOA 1R3KC 4QPJA 1GM7A 1V54C 3ZIAG 3OMNB 4PA9A 3ETGA 2X0LA 4JTDB 4WFGA 2PI4A 3SPGA 3JD3A 4R8CA 4R7CA 4WCEV 1FXKA 1GM9A 2EIMC 3SYOA 3E8GA 4X89A 3ABMC 1XL6A 3OR6C 4PELA 1FXVA 3P32A 5LGUA 2A79B 5EC2C 2H94A 1COWG 1VQ9V 2M7WA 3SPIA 4MTGA 5CBFA 1ENVA 2DYSB 4N23A 1GM8A 4MVOA 3CYOA 3SYAA 1AI5A 1PNMA 3OEEG 3OUSA 4N21A 4U7NA 1H2GA 2Y69B 1QLEC 1KC8W 1OCRC 5B1BB 1NQTA 2P6JA 3K08A 4TT3G 3K06A 2B1GA 1W2BU 1SZTA 2W6IG 3CMAV 3VOUA 3ZRSA 1R3LC 2Y69C 2W0FC 3AG3B 2HR3A 3FB6C 4MTFA 1YJWV 5LHHA 2X6CA 4JTAB 1CP9A 2WLKA 5B1AB 2EJRA 1I5YA 1TUEB 2ZXWB 3LDDA 3SYQA 3FB7C 4MVQA 2Q67A 2ZXWC 4MTXA 2EIJC 3SJQC 2WLJA 3EHBB 5GW7A 3ZRWB 3CCUV 1PNKA 3HB3B 2P90A 5H6RA 3CC2V 4EKWA 1PKXA 1BMFG 4RQEA 4R6ZA 1H8HG 4G2KA 1NVPD 3KG2A 3JD0A 5KUKA 4TSFG 2Q6AA 3E2EA 3G6EV 2PI5A 1E79G 2MK3A 3JD1A 4HZ3A 4X88A 4FMTA 3CCVV 4UXNA 4UV9A 1R3IC 3DTUB 4PDRA 1QBZA 2BOCC 2OCCB 3F7YC 2LFSA 3E8HA 4QE7A 1RM1B 3W7SA 2ZD9A 2JK5C 3LUTB 3JD2A 4Z1MG 1Q86W 5KUMA 4FPPA 1AJNA 4DXWA 1QVFU 3MHHC 1YJNV 2JDIG 3E83A 4BIZA 3B8MA 2JJ1G 2V1DA 2XAJA 5EK0A 2HJFC 1QVGU 1YI2V 1F23A 4UUJC 2KB1A 3GB7C 1WPXA 2QE7G 4QIWF 1JOYA 3OMIB 2QA4V 2WLHA 4P9OA 5BZBA 4DO2A 3ZRWA 1GK9A 2QEXV 1V55B 4L87A 1OCZC 1AJQA 4WF9V 2Q68A 4R50A 1AI6A 1YSCA 4JTCB 1AJPA 4QE9A 5B1NA 2HKOA 1KP3A 2WSSG 5HFLA 5KA5A 3W7UA 3ABUA 2YEVB 3ZRVA 1F4MA 5KA6A 1QCEA 3E8BA 4E2LA 1K4CC 2EILC 3FYEB 3JCZA 3EFFK 3K0GA 2XAFA 5IDJA 2EIKB 1AI7A 3STLC 3I56V 4GX0A 4QJFB 3TETA 1YITV 5L3BA 2OTJV 1MABG 4PDVA 3FB8C 1K73W 2B1IA 4GX5A 2GHYA 5B1OA 1S77D 1E1RG 3F5WC 4GX2A 3ASNB 3K9AA 1VQ7V 2JEXA 1NVPB 1QLEB 1VQPV 4XDLA 1M1KW 1W0JG 1MG1A 5HFMA 1QR8A 3CPWU 2DYSC 2HVJC 3TCUA 1AI4A 1P7BA 2JJ2G 3H01A 1OCOC 2GSMB 3AG1B 1L1FA 1M57C 1R6KA 4JAVA 3AG3C 4UVBA 5B1BC 3ZCCA 3CD6V 2WLMA 2R9IA 4PDLA 2IH1C 2WLIB 2OTLV 4CBCA 1SESA 2DQ0A 2DW4A 2Z3YA 1K9MW 1H38A 3HPLC 3G4SV 3LDCA 5LGNA 1FS0G 1PL0A 1OCZB 4FJCC 1MOFA 3SYCA 1S3JA 1YTFD 1HWYA 5EC1C 4G28B 1VQMV 3OW2U 4H37A 1LNQA 1K5QA 1S5HC 1M90W 2WWWA 5EBWC 1YHQV 3CCJV 4JPRA 2DYRC 3T1CA 4GT1A 3ABMB 1Y66A 3ABTA 3RW0A 2WLIA 4UV8A 3ABKB 1GMGA 1XL4A 4UVCA 2XAHA 2EZPA 2C2AA 2JEUA 5IYBO 3JD4A 3ZMTA 4ASUG 4FK5C 3JYCA 3SPCA 4JAUA 3ABLB 3SYPA 2HLDG 3WG7B 1BHAA 2NNUA 3K03A 4MT8A 2OT5A 3ABKC 4MS2A 1THZA 3NXSA 3WG7C 1VQLV 3OUFA 1YJ9V 4LBEC 4UVAA 1VQ6V 1W0KG 3W7TA 2WLNA 1Q82W 2ZR3A 4X8AA 1RM1C 3T4DA 3ASOB 5C93A 3E89A 1WLEA 2OCCC 3OEHG 2QM7A 2Q69A 4I9WA 5LBQA 1EBOA 5B3SC 1VQ4V 4U7OA 1VQKV 3CC7V 2XAGA 3QO8A 1K97A 4I5SA 2DWDC 3OMAB 2B5UA 3E8FA 5L3GA 2IJJA 3OR7C 5CMUA 3ZMSA 1KKDA 4XDJA 2QTOA 4KFMA 4MVZA 3K3WA 1PD3A 5E1AC 3ZMVA 2A0LA 1DTOA 2P67A 2IJHA 3AG4B 1F51A 1S76D 3K04A 3X2QC 1RPRA 1Q7YW 1NBMG 5H9CA 4WFBV 2H8PC 2W6JG 3AG1C 5L3DA 1OCOB 3AG2B 4HYOA 4LC1A 1VQOV 1OCRB 1NH2B 1BL8A 3CCMV 1K8AW 1I5XA 1JX9A 4PA4A 4PA7A 2EIJB 1AROP 4J9YB 4TWKA 5FL7G 2ITCC 1ZWIC 3ASNC 3M99B 3QNEA 3RVZA 3T2MA 2ZQMA 4PA3A 1UJWB 1R73A 2ATKC 3OFNG 5L3FA 3IFXA 2AHYA 3CP1A 3OE7G 4WFHA 3B8NA 4F4LA 1KQSU 2XAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K73 W;  4WCE V;  4WFB V;  3CCS V;  1VQK V;  1QVF U;  3CXC U;  3CME V;  3CC7 V;  2OTL V;  1K9M W;  1VQ8 V;  1YJN V;  1W2B U;  3G6E V;  3G4S V;  3CMA V;  1VQ7 V;  1VQO V;  1VQN V;  1JJ2 U;  3CCR V;  4WFA V;  1VQP V;  1YJ9 V;  1VQL V;  3CCV V;  1YJW V;  1Q81 W;  1QVG U;  1VQM V;  1YI2 V;  1M1K W;  1VQ9 V;  1VQ5 V;  1VQ6 V;  3OW2 U;  1NJI W;  3CCM V;  3CPW U;  1K8A W;  3CC4 V;  3CCL V;  1Q82 W;  1M90 W;  3CCQ V;  2D3O W;  1YHQ V;  2QA4 V;  3CCJ V;  3G71 V;  1KD1 W;  3I56 V;  5DM6 V;  1YIJ V;  3CCU V;  2QEX V;  3I55 V;  1R73 A;  1YIT V;  1Q86 W;  3CC2 V;  1KC8 W;  4WF9 V;  3CCE V;  1VQ4 V;  3CD6 V;  1S72 V;  2OTJ V;  1KQS U;  1Q7Y W;  1N8R W; 
#chains in the Genus database with same CATH topology
 4BWA A;  1IXB A;  5IYD O;  1CPY A;  2ZR2 A;  3AG2 C;  4WBN B;  1TGO A;  5C8Y B;  5LGT A;  3AG4 C;  1QNM A;  2GV9 A;  1V55 C;  4PA6 A;  2AHZ A;  4GX1 A;  1J5E B;  4GYC B;  2OIE A;  2EIL B;  4RWU A;  4PDM A;  3OM3 B;  4DYL A;  1ORQ C;  1B06 A;  5DM6 V;  5IWA O;  3BHP A;  1P7G A;  1GN6 A;  3CXH F;  4DRX B;  2YI8 A;  1OCC C;  4MVU A;  3CRA A;  4K35 A;  1YTF B;  3B4S A;  2XND G;  1KEC A;  2CGN A;  2WLL A;  2V7Q G;  1N36 B;  5JH7 A;  4B3M O;  2QKS A;  1J95 A;  2QGN A;  4JI1 B;  2CTW A;  3K59 A;  1VQ5 V;  4EEQ A;  1XNQ B;  4DR4 B;  2E74 B;  1IX9 A;  2DOS A;  1JVM A;  3DXR B;  5FPO A;  2CK3 G;  2EIN B;  1XOU A;  1KP2 A;  2DYR B;  4H33 A;  3JAR A;  1RPO A;  1G1X B;  1Y4M A;  4JI1 O;  1FAF A;  2WPD G;  3IAY A;  4JYB A;  5IY5 B;  3CCL V;  4X1I A;  4Z1V A;  4LF4 O;  1IXM A;  4DV1 B;  3LSQ A;  2YIB D;  1TVK A;  2IH3 C;  5KAI Z;  3CE2 A;  1D5N A;  2ZE6 A;  1B04 A;  3QO7 A;  2FTK A;  4RUF A;  1P4R A;  5CBG A;  4J80 A;  3OAA G;  4LF4 B;  1KYO F;  3RYF A;  4RQF A;  5EYP A;  1RSO A;  4FLU A;  2ZIO A;  1KD1 W;  2ADP A;  2LGQ A;  4IT5 A;  4X65 O;  3HKB A;  2EX3 A;  3VBB A;  3U11 A;  2XAS A;  3X2Q B;  4GKJ B;  3CME V;  4MVS A;  4D7S A;  3MAQ A;  3W7W A;  4A5U B;  4RO2 A;  1S0V A;  5IJ9 A;  4RAI A;  2AW9 A;  2Y4T A;  2AZ0 A;  1F4N A;  3A8T A;  3MHS C;  3G71 V;  4ZI7 B;  5CA3 A;  2F4V B;  4OXS A;  3WB2 A;  4C7U A;  4OPH A;  3UT5 A;  5ITZ A;  5B3S B;  2X6B A;  3A0H Z;  3OT7 A;  1K4D C;  2ARH A;  2YC0 A;  1M56 B;  1Y74 A;  4O4J A;  3D36 C;  5L3E A;  2P7T C;  2GUZ A;  2YXH A;  1QLN A;  1OCC B;  1VIB A;  1V54 C;  5GON B;  1IVS A;  1PV0 A;  4JV5 B;  4DR3 B;  3JD3 A;  4R7C A;  3SYO A;  4X89 A;  1XL6 A;  3OR6 C;  4LNU A;  1FXV A;  4DR1 O;  4DR2 O;  2A79 B;  3HKD A;  4DV5 O;  4UCV A;  5LP6 B;  1MZE A;  1B3Q A;  4I50 B;  3SPI A;  3BCC H;  4LF8 O;  4MVO A;  4YHH O;  1AI5 A;  1PNM A;  2XTA A;  4J7Z A;  1VF7 A;  1KUQ A;  1OCR C;  3G6B A;  3HR0 A;  1NQT A;  1YVW A;  4UCR A;  1N34 O;  1L8D A;  1Y6X A;  2B1G A;  4EB6 B;  1R3L C;  2Y69 C;  3AG3 B;  4U3F H;  1N32 B;  4LFA O;  5LHH A;  1XDC A;  1TUE B;  1XMO B;  2ZXW B;  3LDD A;  2ZXW C;  4ZOL B;  2ETN A;  2DJV A;  1H2K A;  1PNK A;  1T5E A;  3JAR B;  5H6R A;  1PKX A;  1BMF G;  4RQE A;  2E5L O;  1S5J A;  4U3J A;  1H8H G;  5KHI A;  3JAL A;  3JD0 A;  5KUK A;  4TSF G;  2Q6A A;  3Q4H B;  1FFX B;  2Q7G A;  3K5N A;  5K1P A;  3JAS B;  3EVK A;  4J10 A;  1J5E O;  4PDR A;  3IC9 A;  1FKA O;  3A0B Z;  5BR8 O;  2AZ2 A;  2Q5Z A;  3AK1 A;  4B3T B;  2RCV A;  3RYC B;  2BTQ B;  3S3W A;  3CWB H;  2JDI G;  4DV7 B;  2XAJ A;  3B8M A;  5EK0 A;  4B3S B;  1QVG U;  2VWK A;  1H2M A;  1JOY A;  2CH7 A;  1GK9 A;  2QEX V;  4YJ2 A;  5BMV A;  4WF9 V;  1AJQ A;  4R50 A;  1AI6 A;  1YSC A;  1SF9 A;  5B1N A;  4DV3 B;  3ZRV A;  1K4C C;  2EIL C;  4YJ3 B;  3EFF K;  2UU9 B;  2PYJ A;  4I55 A;  4FLZ A;  5IDJ A;  3B09 A;  1AI7 A;  3I56 V;  2BTQ A;  4IIJ A;  4JYA O;  4AI8 A;  2GTS A;  1MAB G;  4X64 O;  4LFC O;  2P4V A;  4B3R B;  4CC5 A;  1S77 D;  1VQ7 V;  3ASN B;  4TV8 A;  5EZY B;  1NVP B;  2R72 A;  1M1K W;  1XEQ A;  1NTK H;  1QR8 A;  1N33 B;  5A9G A;  3J7A U;  2DN9 A;  2W0X A;  3TCU A;  4IGG A;  4DRX A;  3JAM N;  2JJ2 G;  4NTW A;  1EZV H;  2OCH A;  4JI8 O;  1IBM O;  3AG3 C;  4L8J A;  3ZCC A;  2WLM A;  4LF7 O;  4PDL A;  4CS4 A;  2OTL V;  1SES A;  2DQ0 A;  2DW4 A;  1H38 A;  1FS0 G;  1PL0 A;  1OCZ B;  2RMK B;  1N4C A;  2JGD B;  1Q3E A;  3OW2 U;  4CH6 A;  1S5H C;  2UXB B;  5EBW C;  4LF6 B;  4JPR A;  2DYR C;  1Y66 A;  1KU9 A;  2WLI A;  3RW0 A;  1GMG A;  4AQY B;  1XL4 A;  2JEU A;  4LFB B;  3JD4 A;  3ZMT A;  1I94 B;  2E5L B;  2E75 B;  1UPG A;  3KZI Z;  3WG7 B;  1R1B A;  1SQP H;  3OGI B;  2NNU A;  1BHA A;  3WG7 C;  3ABK C;  4MS2 A;  1YJ9 V;  2UXD B;  4LBE C;  4DUY O;  3W7T A;  3TJT A;  1Q82 W;  1RM1 C;  1DK1 A;  3H1K H;  3UO2 A;  2OCC C;  3CRQ A;  1XRE A;  5LYJ B;  2Q69 A;  2PUS A;  4O4H B;  4GZR B;  5LBQ A;  1YZB A;  1XNR B;  3L74 H;  4U7O A;  5FNV B;  1K97 A;  3HKB B;  5KHH A;  2FB5 A;  3SDL A;  2UUA O;  4DV5 B;  1P84 F;  5JVD B;  2A7W A;  1VMG A;  1I0H A;  4MVZ A;  1DTO A;  2O57 A;  3AG4 B;  1Y76 B;  1S76 D;  3JSN A;  3H9V A;  4O2A A;  1RPR A;  1BS3 A;  4JI3 B;  5L3D A;  1OCO B;  4LC1 A;  1TUB A;  2XT9 A;  3E22 A;  2P4K A;  3K5M A;  3CCM V;  1K8A W;  4K8Z A;  1JX9 A;  2BTO A;  4DV6 O;  3UO3 A;  3THO A;  4DW0 A;  4PA3 A;  1UJW B;  4WFH A;  1I7F A;  1ZLZ A;  2VS0 A;  4DK1 A;  2YDE A;  1FD9 A;  3E35 A;  1N0J A;  4DUZ B;  1S5L Z;  5IY5 C;  2WLL B;  1WB7 A;  2QTS A;  2Q73 A;  2Y0P A;  4P30 A;  5IYZ A;  4FIP C;  1XI1 A;  4RUE A;  1YDX A;  3WFV A;  4W4L A;  4PI0 A;  3BFR A;  5FLX N;  2HFE C;  1ZSP A;  3E86 A;  2A9H A;  3OTO O;  2BCC H;  2EUL A;  4X64 B;  4BIO A;  3CC4 V;  4ZKI A;  2QKA A;  3HKC A;  4JI4 O;  2EBO A;  1XIL A;  2WA3 A;  4DR6 O;  5EBM C;  3UQ8 A;  4ZIB A;  1HDJ A;  3UKM A;  2WA4 A;  2YIA A;  2DQ3 A;  3J80 N;  3IGA C;  5IJ0 A;  4ZBM A;  2HVK C;  3BAA A;  4NXM B;  2HG5 C;  3OGC C;  2UXN A;  3K79 A;  4JAA A;  4B3T O;  1KMI Z;  2IJI A;  2X7R B;  2V4D A;  4DW1 A;  5KAF Z;  2CH7 B;  4YXW G;  5DN6 G;  3DGE A;  1JFF B;  3P30 A;  4IYI A;  3RYH B;  1VQ8 V;  3D8C A;  1R3J C;  4WFE A;  2GDS A;  1TVK B;  3ETD A;  5IT9 N;  1WPB A;  1E1Q G;  3RYF B;  2KSD A;  3KCY A;  3I5D A;  4PD4 F;  3WB1 A;  1K5S A;  4IYH A;  2LW7 A;  3D3I A;  2BE3 A;  3SJC C;  1NH2 D;  1EN6 A;  4X20 A;  4GUN A;  4FLX A;  5A2Q N;  1Z5W A;  2EIN C;  3SPH A;  5FPR A;  3FFQ A;  1NS1 A;  2ZE8 A;  4X1I B;  2E3C A;  3ZN1 A;  1EN5 A;  1Q90 D;  1JCH A;  2ZDI A;  1SC5 B;  2KG7 B;  3BY6 A;  5LHG A;  1BHB A;  3QO5 A;  2FKX A;  4CH5 A;  3JAW A;  4DV2 O;  2HJD A;  5LMU O;  1FFT B;  2NLJ C;  3DC5 A;  1NR1 A;  4BW5 A;  5JJJ B;  4NXN O;  2EIM B;  3SJB C;  1GO3 F;  2KKW A;  1OZ0 A;  2F43 G;  5CA1 A;  4DV0 O;  2UUC B;  3R65 A;  3LNM B;  3ZJZ A;  1H2L A;  3ZIA G;  4PA9 A;  4WFG A;  1BQ0 A;  3SPG A;  4WCE V;  1FXK A;  2ZCE A;  5LMN B;  1M5I A;  4PEL A;  2HP8 A;  2IBZ H;  4X1Y A;  3F5T A;  5EC2 C;  1GRJ A;  3RYH A;  1VQ9 V;  4DR3 O;  1NT2 B;  3OEE G;  4H0L B;  4N21 A;  1H2G A;  2QSA A;  4WBN A;  3TGU H;  1HR0 B;  5DED A;  2UUB B;  3ZRS A;  2W0F C;  4J41 A;  2A06 H;  2HR3 A;  5BXZ A;  3P3N A;  3RT3 C;  2QWO B;  2YXL A;  4CS2 A;  5B1A B;  3ZS8 C;  1CP9 A;  2WLK A;  1I5Y A;  3SYQ A;  4MVQ A;  2Q67 A;  1LUV A;  3RWR D;  5E79 Z;  2WLJ A;  3GWK C;  3ZRW B;  3DC6 A;  3HB3 B;  2P90 A;  2RQ6 A;  4EKW A;  4R6Z A;  4TQF A;  1NVP D;  1SKV A;  4X1Y B;  3SJA C;  3G6E V;  3JD1 A;  4FMT A;  2VQF B;  4DUZ O;  2R9A A;  2QJ1 A;  3L73 H;  3CCV V;  1R3I C;  3JSL A;  3E8H A;  4NXN B;  2Q9L A;  1X4T A;  1YEW A;  2JK5 C;  4FM1 A;  3BA8 A;  2HEP A;  4Z1M G;  5KUM A;  4LF5 O;  4FPP A;  4JYY A;  1WA8 A;  1VF6 C;  3AK3 A;  1YJN V;  4BIZ A;  1XQ8 A;  2JJ1 G;  3VQY A;  3JAW B;  1F23 A;  3C90 A;  2ZKO A;  1HNZ O;  4UUJ C;  1HNW O;  4LFA B;  3GB7 C;  1TAE A;  3CJH B;  2QE7 G;  1IBK B;  2WLH A;  3HKE B;  5KHJ A;  2VQE O;  3JAL B;  4FM2 A;  1KP3 A;  5KA5 A;  1PM9 A;  3W7U A;  1QQC A;  4KHP B;  3N27 A;  4NVP A;  3K0G A;  1XMQ B;  2JGD A;  4GX0 A;  4HNA B;  5LA6 B;  4AQY O;  3TET A;  1YIT V;  5B5E Z;  3KKY A;  3FB8 C;  2B1I A;  4GX5 A;  5B1O A;  1US6 A;  4OX9 O;  4JI4 B;  4GX2 A;  3K9A A;  2JEX A;  4J42 A;  1VQP V;  5JJN B;  3CB2 A;  1MG1 A;  5CB4 B;  4IIJ B;  2KQX A;  2DYS C;  4O4I A;  1SZX A;  1AI4 A;  1OCO C;  2CGO A;  4O4H A;  4CH3 A;  1SQF A;  4JAV A;  3CD6 V;  4UVB A;  5B1B C;  2YS8 A;  2R9I A;  4CBC A;  1K9M W;  1SQX H;  3LDC A;  1MOF A;  1NZ6 A;  1YTF D;  1VQM V;  4DV4 O;  4H37 A;  1LNQ A;  4I55 B;  2P5O A;  5KMG A;  2WWW A;  3APO A;  3CCJ V;  5KHG A;  1IBM B;  4J11 A;  2EZP A;  2C2A A;  2OIG A;  2N04 A;  5IYB O;  3ZHV A;  3K03 A;  4MT8 A;  2OT5 A;  1THZ A;  1VQL V;  5EIB C;  4D7T A;  4J7K A;  4UVA A;  1W0K G;  2WLN A;  5C93 A;  4LF9 B;  3OEH G;  1JFF A;  4B08 A;  1EBO A;  1VQ4 V;  1VQK V;  5LA6 A;  3QO8 A;  1BT8 A;  2DWD C;  3OMA B;  1YXB A;  4DV3 O;  3E8F A;  4DR6 B;  2Z0A A;  1JA8 A;  3ZMS A;  2QTO A;  4OX9 B;  3CRM A;  2LJ2 A;  3JAS A;  4NTY A;  3VQV A;  4I7Z B;  4DV0 B;  1Q7Y W;  5H9C A;  2Q4P A;  1URF A;  5BR8 B;  1FPO A;  2H8P C;  2UUC O;  4U3J B;  3AG2 B;  1Q6U A;  1OCR B;  1NH2 B;  2PY5 A;  1Q6I A;  4DV2 B;  4K3A A;  4DR4 O;  1IBL B;  1ARO P;  5FL7 G;  3ASN C;  3T2M A;  2ZQM A;  3E22 B;  3RFR A;  1R73 A;  2ATK C;  3OFN G;  3CP1 A;  3OE7 G;  4UB8 Z;  3B8N A;  2XAQ A;  1IBK O;  4LF6 O;  3UCS C;  1PP9 H;  2IU3 A;  3G67 A;  2Q7E A;  3STZ C;  1Q81 W;  2F1M A;  3IC7 A;  1BQZ A;  1HW7 A;  2QM8 A;  3FAV B;  1N34 B;  2P22 C;  3FD9 A;  3JAT A;  3R66 A;  1NI8 A;  5LOV B;  2ADQ B;  1M9N A;  3H1H H;  3ASO C;  2UXX A;  2JRI A;  5J9P C;  1QHT A;  2FML A;  1XMO O;  1L0L H;  2JS3 A;  2Z5U A;  2YEV A;  3F7V C;  3VQX A;  3K0D A;  1ZL8 A;  2LP7 A;  2R70 A;  2EZO A;  1AVM A;  3K9S A;  1FFX A;  2G38 A;  5IE9 A;  3KCX A;  3ZRX A;  3GWO A;  3UM7 A;  4KP4 A;  4DR7 B;  1QR9 A;  2Q0O C;  2UUA B;  2JS5 A;  4JV5 O;  1JQ0 A;  4DK0 A;  3T1H O;  3GVM A;  1GH6 A;  1MA1 A;  4PI2 A;  1K92 A;  2QWQ B;  4UCS A;  1EZJ A;  2IU0 A;  4H13 B;  3BEH A;  1K34 A;  4FM0 A;  4OGQ B;  4LCU C;  2QWN B;  3IJ4 A;  1G8M A;  5D5Q A;  4J9Z B;  3D36 A;  3AG7 A;  5IJ9 B;  4FFK A;  2N05 A;  2ZT9 B;  5LMN O;  4JYA B;  1AP5 A;  2LO1 A;  3LSS A;  2CTR A;  4JF3 A;  4XBF A;  4WFF A;  2ZNJ A;  3ZHQ A;  1VQN V;  4ABM A;  4FZ0 A;  1WN7 A;  1U97 A;  1NJI W;  2BSK B;  3B77 A;  3FYI B;  4NTX A;  5CBH A;  1IUR A;  4QGP A;  3MDS A;  1K7D A;  1YIJ V;  2IJK A;  1GAX A;  2CTQ A;  3CCE V;  5LMU B;  1FXH A;  4PHZ A;  4QNH B;  4MVR A;  1DF4 A;  1FXK B;  3N2G A;  3DSQ A;  4CZZ A;  3RVY A;  4ZOL A;  2EIK C;  4O4L B;  4GCZ A;  5KHK A;  3H1J H;  3FB5 C;  4GKJ O;  4D6T H;  4MSW C;  3N2K B;  2VWJ A;  1R6N A;  5F2V O;  1V54 B;  4X65 B;  3ML0 A;  1EN4 A;  1NU1 H;  3H1L H;  3T1Y O;  1LUW A;  3CHX A;  4FLV A;  3U10 A;  2DWE C;  4ICG A;  4Q20 A;  1JJ2 U;  1XUQ A;  3SPJ A;  1AR4 A;  1JPX A;  1NTZ H;  3O9O A;  4NYK A;  3N2K A;  1ROP A;  5KX5 A;  1SRY A;  4JI3 O;  4PV1 B;  3J81 N;  1EFR G;  4O2A B;  4TV8 B;  5EZY A;  1GTO A;  1R3K C;  1Z2G A;  3OMN B;  2X0L A;  2PI4 A;  1Q43 A;  1OV9 A;  3RYC A;  1HNX O;  1GM9 A;  3E8G A;  3ABM C;  2VRZ A;  1IBL O;  2A3Q A;  5LGU A;  1N32 O;  2QWP B;  2M7W A;  4X9Q A;  3CX5 F;  5CBF A;  3L75 H;  2XUM A;  1HNX B;  1GM8 A;  4U7N A;  5KMG B;  1QLE C;  4B7E A;  3BPZ A;  5ITZ B;  1Z5V A;  1DGS A;  2P6J A;  4TT3 G;  1XHX A;  2ODM A;  2NN4 A;  1XNQ O;  1SZT A;  2W6I G;  5GTI Z;  1GN2 A;  2QKC A;  4KXR A;  4TV9 B;  1SQG A;  4H44 B;  2L6L A;  5K1X A;  4CC6 A;  1AR5 A;  3ZHR A;  3FB7 C;  2GBO A;  4MTX A;  3SJQ C;  2EIJ C;  3EHB B;  5GW7 A;  3SGI A;  4YIO A;  2Y4U A;  4I4T A;  2BSK A;  3ZHU A;  3KG2 A;  3E2E A;  2AGA A;  2PI5 A;  1E79 G;  2MK3 A;  4HZ3 A;  4TQD A;  2RNB A;  3BVO A;  5AG2 A;  2ILM A;  4UV9 A;  2F23 A;  4FVM A;  2BOC C;  2Q8V A;  1RM1 B;  2LQT A;  3W7S A;  1PL4 A;  3LUT B;  3JD2 A;  3OTF A;  1Q86 W;  4IL6 Z;  1N33 O;  4YY3 B;  1AJN A;  4DXW A;  4X66 O;  1QVF U;  3MHH C;  1VF5 B;  5J2U B;  3RYI A;  5GON A;  1QU7 A;  2V1D A;  4JZ2 A;  3CSX A;  1RFY A;  1O9H A;  1VAR A;  4CS3 A;  3OMI B;  4I4T B;  4P9O A;  3CJH A;  5KLV H;  1V55 B;  5LXT A;  4B7K A;  4JTC B;  2ZM6 O;  2WSS G;  5HFL A;  5BY1 A;  4FLT A;  3ABU A;  2YEV B;  1F4M A;  5KA6 A;  1QCE A;  3E8B A;  4X1K A;  3WU2 Z;  4E2L A;  2QM4 A;  5JVD A;  4DR5 B;  3FYE B;  2PYL A;  4I9Q A;  3L72 H;  2JGU A;  5JCO C;  5DEC A;  3STL C;  1Y76 A;  4GLX A;  2YIB A;  4O2B A;  5L3B A;  2OTJ V;  4PDV A;  1ZAU A;  4E4E A;  2GHY A;  4DV7 O;  1AP6 A;  3F5W C;  4B3S O;  2F4V O;  5HFM A;  1VP7 A;  3CPW U;  3P3P A;  2JVD A;  5EYP B;  2QWR B;  1P7B A;  1MSD A;  2GSM B;  3JCU Z;  4AHC A;  3ZX6 A;  1L1F A;  1KB9 F;  4BW9 A;  5CA1 B;  4LFB O;  3L70 H;  2UXC O;  1FJG O;  2Z3Y A;  3G4S V;  2XHB A;  4DUY B;  1HWY A;  2HHH O;  4K0K B;  1M90 W;  4TV9 A;  2CDY A;  1AIL A;  3ABM B;  3ABT A;  2PZS A;  1FYJ A;  4UVC A;  2XAH A;  2RDC A;  4LF7 B;  3SPC A;  4JAU A;  3ABL B;  5LXT B;  2HLD G;  4JI2 B;  1Y67 A;  2UXC B;  5CA0 A;  1JR9 A;  3OUF A;  2VQF O;  4OPA A;  1MZF A;  2ZR3 A;  4I0X B;  3T4D A;  1N0N A;  3ASO B;  1SS3 A;  4YHH B;  4KHP O;  5B3S C;  2H3O A;  2VQE B;  3CC7 V;  1XMQ O;  4I5S A;  4YIP A;  4DR2 B;  4EFB A;  4JI6 O;  2RN9 A;  3QTC A;  5L3G A;  3UT5 B;  3ZED A;  3VQW A;  1H2S B;  1BCC H;  2UU9 O;  1PD3 A;  2P06 A;  5E1A C;  2A0L A;  2P67 A;  2IJH A;  1F51 A;  3X2Q C;  1Q5O A;  5BMV B;  3AG1 C;  1G6U A;  3HKE A;  5CA0 B;  4Z2W A;  1VQO V;  3C3S A;  1I5X A;  4PA4 A;  2EIJ B;  4O4L A;  2ZIM A;  1NTM H;  3M99 B;  4F6R A;  1X59 A;  2PTM A;  1Q6H A;  2AHY A;  3HKC B;  2DMX A;  1KQS U;  2HHH B;  4FLY A;  2XOK G;  3H1I H;  4LH7 A;  3C3T A;  3TXS A;  1G4Y B;  1L0N H;  4O2B B;  4BR6 A;  5LYJ A;  3AEI A;  2IW5 A;  3PJS K;  3W7X A;  3QG5 A;  2OWO A;  5LOV A;  2BOB C;  4JYC A;  4DV6 B;  2GTA A;  3ETE A;  2R9R B;  4BAY A;  3JAT B;  1OJH A;  1MSW D;  4ZHQ B;  3FAV A;  1S72 V;  3A0R A;  5D5P A;  4QPK A;  1M93 A;  2QDO A;  4P2Z A;  4MTO A;  1ZX3 A;  2LGW A;  4TOI A;  5EBL C;  4WFA V;  3ZMZ A;  3Q4H A;  1B6Q A;  3DXR A;  5JJE B;  4UB6 Z;  2D3O W;  3ABL C;  1CEZ A;  3ZN0 A;  5CN0 A;  3I55 V;  2Y48 A;  4HAM A;  4NKG B;  4XDK A;  1YCI A;  2F93 B;  3MD0 A;  4KUM A;  4MW8 A;  5LHI A;  3NR7 A;  1DF5 A;  3M8A A;  1HP8 A;  3K58 A;  1IDS A;  1K3E A;  1P49 A;  4G27 B;  3OTO B;  1OHH G;  2X6A A;  1FXK C;  4DR7 O;  3AK2 A;  2YXY A;  2WAM A;  1PNL A;  4MW3 A;  5H6Q A;  1ZUQ A;  2YSU B;  4JI7 B;  3LDE A;  5IYC O;  1N8R W;  3CXC U;  3WB0 A;  1H8E G;  4JI5 O;  3CCR V;  1M57 B;  3FKS G;  2LFR A;  2ZE5 A;  4JGS A;  1SER A;  3CCQ V;  1K33 A;  3ZHS A;  1R6T A;  2ZDI C;  4JI2 O;  5B1A C;  3RBZ A;  3K5L A;  5JCO A;  5JQG A;  2CE4 A;  1MNG A;  3T4Z A;  1AR1 B;  3CCS V;  2KG7 A;  2FYU H;  3TK1 A;  3L9D A;  4BIU A;  5L3C A;  1NKD A;  1WP8 A;  4TUY B;  4JZG A;  5C8Y A;  1NR7 A;  1LR1 A;  1SET A;  2L35 A;  3S3X A;  2K1E A;  2RJZ A;  2JIZ G;  2GUZ B;  1BSM A;  1SQQ H;  4JI8 B;  5H2F Z;  3APQ A;  2ZNI A;  1M56 C;  4UFZ A;  1SQV H;  4LP8 A;  5B66 Z;  1DLB A;  1GKF A;  4GKK O;  2ITD C;  5JWP A;  4MVM A;  2PF4 E;  3ETQ A;  4UCT A;  4P9P A;  4IHJ B;  4JI0 O;  3ZMU A;  1GN3 A;  2AXT Z;  4JAS A;  4QPJ A;  1YF2 A;  1GM7 A;  1XNR O;  4NR1 A;  4DR1 B;  3ETG A;  4JTD B;  3D3Q A;  4R8C A;  2EIM C;  2IM9 A;  4ZHQ A;  1WP7 A;  3B40 A;  3P32 A;  1XHZ A;  4DV1 O;  3OD4 A;  4FLW A;  3CRR A;  2H94 A;  1COW G;  3O65 A;  2F95 B;  4MTG A;  1ENV A;  2DYS B;  4N23 A;  3K5O A;  2N74 A;  2ZIN A;  3CYO A;  3SYA A;  3OUS A;  4LF5 B;  2Y69 B;  1KC8 W;  2EJ7 A;  5B1B B;  2YI9 A;  5GTH Z;  3K08 A;  3K06 A;  4FFB B;  1W2B U;  3CMA V;  4X20 B;  3VOU A;  3FB6 C;  4MTF A;  1YJW V;  2X6C A;  4JTA B;  3T1H B;  4UCU A;  2EJR A;  1F7Y A;  2FL4 A;  1WNS A;  3LNN A;  3K57 A;  5JH7 B;  1D5A A;  2K9P A;  4B3M B;  3CCU V;  4EB6 A;  3CC2 V;  1WJZ A;  4FFB A;  4X66 B;  3HKD B;  4G2K A;  4YY3 O;  4LNU B;  4W4K A;  4X88 A;  4O4I B;  3QF7 A;  2PGG A;  4DV4 B;  1BGY H;  4UXN A;  3DTU B;  3N2G B;  1QBZ A;  2OCC B;  3F7Y C;  4AIL C;  3M7M X;  2LFS A;  4K8X A;  4QE7 A;  3G80 A;  4GKK B;  4LR3 A;  2ZD9 A;  2CAZ C;  1U96 A;  3SR2 C;  4I0X A;  4KL1 A;  2QR4 A;  3RN4 A;  5J2U A;  1WB8 A;  3TXQ A;  1JMK C;  4HNA A;  2UXB O;  1D2D A;  3E83 A;  2NR5 A;  4FZ1 A;  2HJF C;  1YI2 V;  3ZBH A;  5IYZ B;  4ZI7 A;  2KB1 A;  4UCO A;  1WPX A;  4IHJ A;  1TUB B;  4QIW F;  2QA4 V;  1VEW A;  4O4J B;  5BZB A;  4DO2 A;  3ZRW A;  3QVN A;  4L87 A;  1OCZ C;  1BE3 H;  2Q68 A;  4TUY A;  1AJP A;  3CS5 A;  3RGB A;  1KBH A;  4QE9 A;  2HKO A;  4JI6 B;  3BAB A;  4X1K B;  5IJ0 B;  3JCZ A;  2MW2 B;  4J7J A;  1HNW B;  1RP3 B;  3BA9 A;  2XAF A;  4LFC B;  2EIK B;  4LF8 B;  1I08 A;  4QJF B;  5LL6 Y;  4X62 O;  1Q8I A;  3BRC A;  5J2T A;  3LSU A;  4DR5 O;  1K73 W;  4LWS A;  1EM1 A;  3JAK B;  4LH6 A;  5LP6 A;  1E1R G;  3U0Z A;  2ZM6 B;  3RYI B;  1QLE B;  4XDL A;  3ZHT A;  1GN4 A;  1W0J G;  1PPJ H;  2CUG A;  1UFI A;  2YUA A;  1M4U A;  1HNZ B;  1FJG B;  2HVJ C;  3ICX A;  3H01 A;  5LP6 C;  3AG1 B;  1CXZ B;  1M57 C;  1R6K A;  2Y0I A;  3T1Y B;  2IH1 C;  2WLI B;  4K0K O;  3HPL C;  1SQB H;  1Y74 B;  5LGN A;  4FJC C;  1VF6 A;  3SYC A;  1MMM A;  1S3J A;  5EC1 C;  4G28 B;  2YID A;  1K5Q A;  5EIB D;  5KX5 B;  1YHQ V;  2Q0A A;  4EFE A;  2M6Y A;  3T1C A;  4GT1 A;  3CRC A;  4UV8 A;  4JI5 B;  3ABK B;  2UUB O;  4ASU G;  4FK5 C;  3JYC A;  3CEI A;  3PN1 A;  3SYP A;  4JI7 O;  1WA8 B;  5FNV A;  4NXM O;  3NXS A;  4I50 A;  1H2N A;  2F66 C;  1VQ6 V;  2YIC A;  1KKC A;  4X8A A;  4HBN A;  3E89 A;  1WLE A;  3L71 H;  2CTP A;  4B3R O;  2QM7 A;  1HR0 O;  4I9W A;  1BZK A;  5H5N A;  5TIS Z;  1RSO B;  2B9Z A;  1AB3 A;  2XAG A;  4Q6G A;  4X62 B;  2LW1 A;  2B5U A;  3B2E E;  1W59 A;  2E76 B;  3JAK A;  2IJJ A;  3OR7 C;  5CMU A;  1KKD A;  4XDJ A;  4LWS B;  4CH4 A;  4KFM A;  4F6E A;  3K3W A;  2DE0 X;  3ZMV A;  1JJO A;  4LF9 O;  3K04 A;  3FX7 A;  1XBL A;  1NBM G;  4NB5 A;  4WFB V;  2W6J G;  1IZ3 A;  4YJ2 B;  4JI0 B;  1ZTE A;  1SA0 B;  1O9G A;  4HYO A;  3EXA A;  5J2T B;  1N36 O;  4F6R B;  1WAZ A;  1BL8 A;  5JQG B;  2ZE7 A;  1V9P A;  4PA7 A;  3A2F A;  4PJ0 Z;  1I94 O;  4J9Y B;  1ZL8 B;  2OYQ A;  4TWK A;  1A32 A;  1ZWI C;  2ITC C;  3QNE A;  4YJ3 A;  3RVZ A;  1TA8 A;  5IWA B;  5CB4 A;  5L3F A;  3IFX A;  2D2C B;  1SA0 A;  2Q7H A;  4F4L A;  2UXD O; 
#chains in the Genus database with same CATH homology
 5IYD O;  2XOK G;  1CPY A;  2ZR2 A;  3AG2 C;  5LGT A;  3AG4 C;  3E35 A;  2IU3 A;  1V55 C;  4PA6 A;  2AHZ A;  4GX1 A;  1G4Y B;  3STZ C;  5IY5 C;  1Q81 W;  2WLL B;  3IC7 A;  2EIL B;  2QM8 A;  4P30 A;  4PDM A;  3OM3 B;  4FIP C;  3AEI A;  2IW5 A;  3PJS K;  4RUE A;  3W7X A;  1ORQ C;  3WFV A;  2BOB C;  4JYC A;  5DM6 V;  3ETE A;  2R9R B;  4BAY A;  1M9N A;  1MSW D;  3ASO C;  1S72 V;  1OCC C;  2UXX A;  4MVU A;  5J9P C;  2HFE C;  3A0R A;  1YTF B;  4QPK A;  2XND G;  2Z5U A;  1KEC A;  2YEV A;  3E86 A;  2WLL A;  2V7Q G;  4MTO A;  3F7V C;  4P2Z A;  3K0D A;  2A9H A;  2LP7 A;  2QKS A;  5EBL C;  4WFA V;  3ZMZ A;  2EZO A;  1J95 A;  3ZRX A;  1VQ5 V;  3GWO A;  3UM7 A;  3CC4 V;  1B6Q A;  4KP4 A;  4ZKI A;  1QR9 A;  2D3O W;  2EBO A;  1JVM A;  5EBM C;  3ABL C;  1CEZ A;  3ZN0 A;  2CK3 G;  5CN0 A;  3I55 V;  2Y48 A;  4HAM A;  1JQ0 A;  4XDK A;  3UKM A;  2EIN B;  3MD0 A;  4KUM A;  1KP2 A;  1K92 A;  4MW8 A;  2DQ3 A;  5LHI A;  1EZJ A;  2DYR B;  1DF5 A;  4H33 A;  3IGA C;  2IU0 A;  1RPO A;  4ZBM A;  1Y4M A;  3BEH A;  1K34 A;  2WPD G;  2HVK C;  4LCU C;  1K3E A;  4G27 B;  1OHH G;  1G8M A;  2X6A A;  1FXK C;  2HG5 C;  3OGC C;  4JYB A;  5IY5 B;  3CCL V;  2UXN A;  3K79 A;  1IXM A;  3D36 A;  1PNL A;  2WAM A;  4J9Z B;  4MW3 A;  2IJI A;  2X7R B;  5H6Q A;  2YSU B;  3LSQ A;  3LDE A;  4YXW G;  5IYC O;  3LSS A;  5DN6 G;  1N8R W;  2IH3 C;  3DGE A;  4JF3 A;  3CXC U;  3QO7 A;  2FTK A;  4RUF A;  3P30 A;  1P4R A;  4XBF A;  5CBG A;  3OAA G;  1VQ8 V;  4WFF A;  1R3J C;  1H8E G;  1VQN V;  3CCR V;  4WFE A;  1M57 B;  3FKS G;  3ETD A;  2LFR A;  4JGS A;  1NJI W;  1E1Q G;  3B77 A;  3FYI B;  4RQF A;  5CBH A;  3CCQ V;  1SER A;  1K33 A;  1K5S A;  1KD1 W;  2ZDI C;  1K7D A;  1YIJ V;  5B1A C;  3RBZ A;  3D3I A;  2IJK A;  3CCE V;  1FXH A;  4QNH B;  3T4Z A;  4MVR A;  3VBB A;  2XAS A;  1AR1 B;  3X2Q B;  3CCS V;  1DF4 A;  1FXK B;  3CME V;  1NH2 D;  3TK1 A;  4CZZ A;  3RVY A;  4MVS A;  2EIK C;  4BIU A;  5L3C A;  1NKD A;  2EIN C;  3W7W A;  3SPH A;  4RO2 A;  1S0V A;  4GCZ A;  4RAI A;  3FB5 C;  1NR7 A;  1SET A;  3ZN1 A;  4MSW C;  1F4N A;  3MHS C;  2K1E A;  2JIZ G;  1R6N A;  3G71 V;  1JCH A;  1V54 B;  2ZDI A;  3ML0 A;  5CA3 A;  1BHB A;  1M56 C;  3BY6 A;  5LHG A;  4OXS A;  3QO5 A;  4LP8 A;  5B3S B;  1DLB A;  1GKF A;  2X6B A;  1FFT B;  2ITD C;  2NLJ C;  1NR1 A;  4BW5 A;  2DWE C;  2EIM B;  1K4D C;  4Q20 A;  1JJ2 U;  3SPJ A;  1M56 B;  1JPX A;  4MVM A;  1GO3 F;  5L3E A;  2P7T C;  1OZ0 A;  4P9P A;  1ROP A;  2F43 G;  1QLN A;  1SRY A;  3R65 A;  1OCC B;  3LNM B;  1EFR G;  3ZMU A;  3ZJZ A;  4JAS A;  1GTO A;  1R3K C;  4QPJ A;  1GM7 A;  1V54 C;  3ZIA G;  3OMN B;  4PA9 A;  3ETG A;  2X0L A;  4JTD B;  4WFG A;  2PI4 A;  3SPG A;  3JD3 A;  4R8C A;  4R7C A;  4WCE V;  1FXK A;  1GM9 A;  2EIM C;  3SYO A;  3E8G A;  4X89 A;  3ABM C;  1XL6 A;  3OR6 C;  4PEL A;  1FXV A;  3P32 A;  5LGU A;  2A79 B;  5EC2 C;  2H94 A;  1COW G;  1VQ9 V;  2M7W A;  3SPI A;  4MTG A;  5CBF A;  1ENV A;  2DYS B;  4N23 A;  1GM8 A;  4MVO A;  3CYO A;  3SYA A;  1AI5 A;  1PNM A;  3OEE G;  3OUS A;  4N21 A;  4U7N A;  1H2G A;  2Y69 B;  1QLE C;  1KC8 W;  1OCR C;  5B1B B;  1NQT A;  2P6J A;  3K08 A;  4TT3 G;  3K06 A;  2B1G A;  1W2B U;  1SZT A;  2W6I G;  3CMA V;  3VOU A;  3ZRS A;  1R3L C;  2Y69 C;  2W0F C;  3AG3 B;  2HR3 A;  3FB6 C;  4MTF A;  1YJW V;  5LHH A;  2X6C A;  4JTA B;  1CP9 A;  2WLK A;  5B1A B;  2EJR A;  1I5Y A;  1TUE B;  2ZXW B;  3LDD A;  3SYQ A;  3FB7 C;  4MVQ A;  2Q67 A;  2ZXW C;  4MTX A;  2EIJ C;  3SJQ C;  2WLJ A;  3EHB B;  5GW7 A;  3ZRW B;  3CCU V;  1PNK A;  3HB3 B;  2P90 A;  5H6R A;  3CC2 V;  4EKW A;  1PKX A;  1BMF G;  4RQE A;  4R6Z A;  1H8H G;  4G2K A;  1NVP D;  3KG2 A;  3JD0 A;  5KUK A;  4TSF G;  2Q6A A;  3E2E A;  3G6E V;  2PI5 A;  1E79 G;  2MK3 A;  3JD1 A;  4HZ3 A;  4X88 A;  4FMT A;  3CCV V;  4UXN A;  4UV9 A;  1R3I C;  3DTU B;  4PDR A;  1QBZ A;  2BOC C;  2OCC B;  3F7Y C;  2LFS A;  3E8H A;  4QE7 A;  1RM1 B;  3W7S A;  2ZD9 A;  2JK5 C;  3LUT B;  3JD2 A;  4Z1M G;  1Q86 W;  5KUM A;  4FPP A;  1AJN A;  4DXW A;  1QVF U;  3MHH C;  1YJN V;  2JDI G;  3E83 A;  4BIZ A;  3B8M A;  2JJ1 G;  2V1D A;  2XAJ A;  5EK0 A;  2HJF C;  1QVG U;  1YI2 V;  1F23 A;  4UUJ C;  2KB1 A;  3GB7 C;  1WPX A;  2QE7 G;  4QIW F;  1JOY A;  3OMI B;  2QA4 V;  2WLH A;  4P9O A;  5BZB A;  4DO2 A;  3ZRW A;  1GK9 A;  2QEX V;  1V55 B;  4L87 A;  1OCZ C;  1AJQ A;  4WF9 V;  2Q68 A;  4R50 A;  1AI6 A;  1YSC A;  4JTC B;  1AJP A;  4QE9 A;  5B1N A;  2HKO A;  1KP3 A;  2WSS G;  5HFL A;  5KA5 A;  3W7U A;  3ABU A;  2YEV B;  3ZRV A;  1F4M A;  5KA6 A;  1QCE A;  3E8B A;  4E2L A;  1K4C C;  2EIL C;  3FYE B;  3JCZ A;  3EFF K;  3K0G A;  2XAF A;  5IDJ A;  2EIK B;  1AI7 A;  3STL C;  3I56 V;  4GX0 A;  4QJF B;  3TET A;  1YIT V;  5L3B A;  2OTJ V;  1MAB G;  4PDV A;  3FB8 C;  1K73 W;  2B1I A;  4GX5 A;  2GHY A;  5B1O A;  1S77 D;  1E1R G;  3F5W C;  4GX2 A;  3ASN B;  3K9A A;  1VQ7 V;  2JEX A;  1NVP B;  1QLE B;  1VQP V;  4XDL A;  1M1K W;  1W0J G;  1MG1 A;  5HFM A;  1QR8 A;  3CPW U;  2DYS C;  2HVJ C;  3TCU A;  1AI4 A;  1P7B A;  2JJ2 G;  3H01 A;  1OCO C;  2GSM B;  3AG1 B;  1L1F A;  1M57 C;  1R6K A;  4JAV A;  3AG3 C;  4UVB A;  5B1B C;  3ZCC A;  3CD6 V;  2WLM A;  2R9I A;  4PDL A;  2IH1 C;  2WLI B;  2OTL V;  4CBC A;  1SES A;  2DQ0 A;  2DW4 A;  2Z3Y A;  1K9M W;  1H38 A;  3HPL C;  3G4S V;  3LDC A;  5LGN A;  1FS0 G;  1PL0 A;  1OCZ B;  4FJC C;  1MOF A;  3SYC A;  1S3J A;  1YTF D;  1HWY A;  5EC1 C;  4G28 B;  1VQM V;  3OW2 U;  4H37 A;  1LNQ A;  1K5Q A;  1S5H C;  1M90 W;  2WWW A;  5EBW C;  1YHQ V;  3CCJ V;  4JPR A;  2DYR C;  3T1C A;  4GT1 A;  3ABM B;  1Y66 A;  3ABT A;  3RW0 A;  2WLI A;  4UV8 A;  3ABK B;  1GMG A;  1XL4 A;  4UVC A;  2XAH A;  2EZP A;  2C2A A;  2JEU A;  5IYB O;  3JD4 A;  3ZMT A;  4ASU G;  4FK5 C;  3JYC A;  3SPC A;  4JAU A;  3ABL B;  3SYP A;  2HLD G;  3WG7 B;  1BHA A;  2NNU A;  3K03 A;  4MT8 A;  2OT5 A;  3ABK C;  4MS2 A;  1THZ A;  3NXS A;  3WG7 C;  1VQL V;  3OUF A;  1YJ9 V;  4LBE C;  4UVA A;  1VQ6 V;  1W0K G;  3W7T A;  2WLN A;  1Q82 W;  2ZR3 A;  4X8A A;  1RM1 C;  3T4D A;  3ASO B;  5C93 A;  3E89 A;  1WLE A;  2OCC C;  3OEH G;  2QM7 A;  2Q69 A;  4I9W A;  5LBQ A;  1EBO A;  5B3S C;  1VQ4 V;  4U7O A;  1VQK V;  3CC7 V;  2XAG A;  3QO8 A;  1K97 A;  4I5S A;  2DWD C;  3OMA B;  2B5U A;  3E8F A;  5L3G A;  2IJJ A;  3OR7 C;  5CMU A;  3ZMS A;  1KKD A;  4XDJ A;  2QTO A;  4KFM A;  4MVZ A;  3K3W A;  1PD3 A;  5E1A C;  3ZMV A;  2A0L A;  1DTO A;  2P67 A;  2IJH A;  3AG4 B;  1F51 A;  1S76 D;  3K04 A;  3X2Q C;  1RPR A;  1Q7Y W;  1NBM G;  5H9C A;  4WFB V;  2H8P C;  2W6J G;  3AG1 C;  5L3D A;  1OCO B;  3AG2 B;  4HYO A;  4LC1 A;  1VQO V;  1OCR B;  1NH2 B;  1BL8 A;  3CCM V;  1K8A W;  1I5X A;  1JX9 A;  4PA4 A;  4PA7 A;  2EIJ B;  1ARO P;  4J9Y B;  4TWK A;  5FL7 G;  2ITC C;  1ZWI C;  3ASN C;  3M99 B;  3QNE A;  3RVZ A;  3T2M A;  2ZQM A;  4PA3 A;  1UJW B;  1R73 A;  2ATK C;  3OFN G;  5L3F A;  3IFX A;  2AHY A;  3CP1 A;  3OE7 G;  4WFH A;  3B8N A;  4F4L A;  1KQS U;  2XAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...