1SKVA

Crystal structure of d-63 from sulfolobus spindle virus 1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
64
structure length
64
Chain Sequence
SKEVLEKELFEMLDEDVRELLSLIHEIKIDRITGNMDKQKLGKAYFQVQKIEAELYQLIKVSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Hypothetical 7.5 kDa protein
publication title Structure of d-63 from sulfolobus spindle-shaped virus 1: surface properties of the dimeric four-helix bundle suggest an adaptor protein function
pubmed doi rcsb
source organism Sulfolobus virus 1
total genus 25
structure length 64
sequence length 64
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1skvA00
2CAZC 1X4TA 2JS5A 3SJAC 3CSXA 1SKVA 1NT2B 2P22C 3QG5A 3SJBC 3SJCC 3THOA 3ZS8C 2F66C 3B2EE 3QF7A 3ICXA
chains in the Genus database with same CATH superfamily
4F6EA 1LR1A 4MVOA 4DR7B 2BOCC 5LOVB 3L70H 4JI8B 5JVDA 1K4DC 1BQZA 1YEWA 2RN9A 4IYHA 1US6A 4Q20A 4RUFA 3U10A 2Q68A 4DV7O 5LBQA 4DV2O 3LSUA 1KMIZ 2IH1C 4P9OA 4BIUA 4GKJO 3WU2Z 3K5LA 4LWSA 5KHJA 4JZ2A 2VQFO 3VBBA 3IC7A 2XTAA 4FFBB 4BIZA 1N34B 1KP3A 2DW4A 2WLKA 3X2QB 5FPRA 2NLJC 2IJJA 1GK9A 4AI8A 4JGSA 2LGWA 1IBMO 2XOKG 3L9DA 4OXSA 4DR4B 1JFFA 2P4VA 2IU0A 4MW8A 2JJ1G 1U96A 2X6CA 4G27B 4O2BA 2QWOB 5AG2A 3C3TA 2ZE6A 2JS3A 5HFMA 3QG5A 3QO7A 5EK0A 2HHHO 2PI4A 3W7TA 1YIJV 4B7EA 3ZRWA 3U11A 1FFXA 2QJ1A 2ADPA 4LF5O 3FAVB 5BXZA 5JJJB 2M7WA 1TAEA 1XILA 2ZIMA 2IJIA 4JPRA 3BEHA 4LC1A 1R3LC 2ZXWC 3OFNG 1K97A 2OIEA 2GV9A 2UXXA 3ZMZA 1R3KC 3APOA 3ZRXA 4WF9V 5LMNB 1PNMA 2JEXA 1I5XA 5IYCO 4LNUB 4GKKB 3OR7C 2ARHA 4UCTA 3BHPA 4ICGA 3UCSC 5IWAB 1EN4A 2ZIOA 3K04A 3RYIA 4UFZA 2ITCC 3JD2A 3BA8A 1S5HC 1XREA 1JJ2U 3UKMA 4CS4A 4YY3O 1S5LZ 1BL8A 2HJFC 3HKEA 5ITZA 5LHIA 4B3SO 1ROPA 3D8CA 1FS0G 3HKDB 1KQSU 4J7KA 3CWBH 1L1FA 1PNLA 1VF5B 1DLBA 3ICXA 4YJ2A 1Q82W 4MVUA 1Y76A 2EIMC 2ZXWB 1R73A 1YZBA 4LF7O 2N05A 2W0FC 3AG2C 4LF8O 4DV4O 2PTMA 4WFFA 4B3MO 2Y69C 1MABG 3CRRA 5IYZB 4FLZA 3STZC 2QR4A 4H0LB 3FFQA 4DRXB 4TUYB 5FPOA 4Z1MG 2ZD9A 4E2LA 4ZBMA 4D6TH 3ZMTA 1AI5A 4PV1B 2JEUA 2QA4V 3CS5A 1GMGA 3N2KB 4U7OA 1BCCH 2EILC 4FPPA 4BW5A 1Z5WA 4OX9O 1X59A 3GWOA 5EZYA 1K5QA 4DUZO 1G8MA 4XDLA 3OT7A 4DRXA 5LHGA 3AG1B 3AG2B 4FVMA 1N33B 2B9ZA 1Q81W 2Y69B 1N32B 3CX5F 4LF6O 3K08A 3OTFA 2Q69A 1Y6XA 1Q6UA 5EC1C 1JVMA 1SQFA 4DUYB 1MA1A 5LA6A 2O57A 1WB7A 2DYSC 1EBOA 1H38A 4LF4B 3SPJA 3B8MA 5A9GA 2UUAB 4I9QA 1N4CA 3ETQA 5B1OA 3B09A 3CRCA 2EILB 3VQXA 3WB1A 4DK1A 1S3JA 3UT5A 3JAKB 2HFEC 2EZPA 4X1KB 1YDXA 4PA7A 1ZTEA 3CRMA 3E8FA 2LO1A 5E79Z 2E76B 5CBHA 1KC8W 4NXNB 1L8DA 3JAWA 3SDLA 4X88A 1H2NA 1G1XB 4I0XB 3BRCA 2JRIA 1SETA 1FYJA 3CCVV 3CRAA 1Q7YW 4JI5B 4GX1A 3K03A 4KHPB 2QKCA 3A2FA 3IGAC 2EULA 4NTYA 4P9PA 4QJFB 5D5PA 1KUQA 3LUTB 3OR6C 4XDJA 2DYSB 1CPYA 1IURA 4DV1O 4AQYO 1I5YA 3UM7A 4TQFA 2DJVA 5KHKA 1AI7A 4DV3B 3QO8A 3L72H 1MNGA 1GTOA 2PYLA 5IYBO 1QR8A 4U3JB 2RQ6A 2A9HA 4I50A 2AW9A 1VF7A 4UV9A 1AJNA 2XAGA 2YIBA 2RJZA 1FJGO 4CH6A 5BR8O 2WLJA 2QSAA 3JYCA 4K0KO 3CCSV 3THOA 2PGGA 5LMUB 2D3OW 1BMFG 4JI3B 4MS2A 4N21A 2Q5ZA 1LUVA 5H6QA 4WBNB 3J80N 3HPLC 1KECA 5KHIA 3ZHVA 3RGBA 2YC0A 2OIGA 3CCRV 5J2UB 5LP6C 5DEDA 4JI6O 1AR5A 3AG3C 3Q4HB 3P3NA 2WLIA 1J5EB 2AXTZ 3EXAA 5FLXN 2OYQA 4IHJB 2GUZA 3G4SV 4WFEA 2PY5A 2EIKC 4TWKA 2Z0AA 3CC2V 2ZE7A 2UXDO 2IBZH 1GM8A 1DGSA 1MMMA 1ZSPA 5IE9A 3OTOB 5KMGB 2IM9A 3OEHG 3FB7C 4IIJA 2HP8A 3JCUZ 3SPHA 4YIPA 4JYAB 2P7TC 2CGNA 4GX0A 2A0LA 1HR0O 3SJAC 2Q7GA 2ZNJA 5CB4A 1QHTA 1VQ4V 3OAAG 4JYYA 1F4NA 1FXKB 1AJQA 2Y4UA 2Y0IA 1NKDA 2UXNA 2W0XA 1GRJA 2MK3A 4MVQA 4O2AA 3LNMB 2P4KA 4YHHO 5L3DA 5KA6A 4DR6O 3G71V 5LP6B 3KG2A 4JAUA 4B3TO 3AG3B 1WPXA 2VRZA 5IT9N 5B1NA 1IBKO 2E5LO 1N36B 1I94B 5FL7G 3IC9A 1RP3B 5JH7B 2WSSG 1GH6A 1WNSA 2YIBD 4Q6GA 2EIKB 4K8XA 1FFTB 4UXNA 4JI4O 4WFGA 3DTUB 3HKBB 3T4DA 2JIZG 5KAFZ 1PP9H 3MD0A 4MTGA 5CMUA 2IH3C 3JARA 3TCUA 5L3CA 1M4UA 1NH2D 1M1KW 1BS3A 3H1LH 1I0HA 3ZHQA 3GVMA 3T1YB 5F2VO 3ZN0A 3HR0A 1EZJA 1IBLO 4GYCB 1L0NH 3BVOA 4JAAA 5CA0A 4LH7A 4MW3A 4PDVA 1SZTA 1Y4MA 1EM1A 1UFIA 2KSDA 4HBNA 1GN2A 3P32A 1XNQO 2AZ0A 2PI5A 5CA1B 1QVGU 4XBFA 1BE3H 4X1IB 3ASNB 3ABLC 4R6ZA 4J9ZB 2E75B 3TXSA 5JCOA 5IJ9A 3H1IH 1F23A 1XL6A 4UCRA 4QPJA 4L8JA 1F4MA 1VIBA 3RW0A 3AEIA 2CAZC 1YJ9V 3EFFK 1FPOA 1M90W 2UUCB 3CCMV 3S3XA 1VQOV 3ML0A 3SYCA 4HNAB 2BE3A 4GX5A 2WLLA 4JI7O 4QIWF 4DV2B 4X64B 1VQ7V 4TQDA 1WAZA 3VOUA 2EJ7A 4LFBO 1T5EA 2LW7A 5IJ0B 5LXTA 2V7QG 4QGPA 4PJ0Z 4DXWA 4FLTA 3ABLB 4R7CA 2Y48A 4FK5C 4CZZA 5KAIZ 4X1YA 2QWQB 1IBMB 3QNEA 4EFBA 1AR4A 4I9WA 1YCIA 1XDCA 3CCLV 3X2QC 2AZ2A 2HJDA 4UVCA 1Y66A 2ZCEA 5E1AC 2P67A 2VQEO 3E35A 2WLHA 4AHCA 2QM7A 2XASA 5KX5B 2DE0X 3ABUA 3SPIA 3H1HH 4I4TB 1E1QG 3W7WA 4EEQA 4JI0B 1I7FA 3JASB 1J95A 1FXHA 1IDSA 1V9PA 3TETA 2PF4E 4ZHQA 4X66B 3HKCB 1THZA 4JTDB 4H37A 4FMTA 3K58A 1XMQB 4X62B 1AVMA 4MTXA 5EC2C 3I55V 2AGAA 2IJHA 3D3IA 1S5JA 5A2QN 3BPZA 4O4JB 4TT3G 2BTQB 4B3RB 3OGCC 3BA9A 2CH7A 1SF9A 3SPGA 2IJKA 3ETDA 3G6BA 1PPJH 1GN6A 5LOVA 3MHSC 3BABA 3RWRD 3JALB 2ZQMA 2ATKC 3GWKC 1K3EA 3W7SA 3OUSA 3MDSA 2WAMA 4YJ3B 1M9NA 5LGNA 1NR1A 4CS3A 4DW0A 4EB6B 4ABMA 4R8CA 3O65A 4J9YB 2EJRA 4FFBA 2PUSA 2VWJA 3CJHB 3A0RA 3N2GB 1Y74B 2NR5A 1HNWO 1PM9A 2WA4A 2HVJC 4H13B 4W4LA 1SERA 1AR1B 4TSFG 3TK1A 3DGEA 1RPRA 4F6RB 4C7UA 2R9RB 4DK0A 5L3GA 1WP7A 4UUJC 4EB6A 2P90A 4DW1A 1VF6C 4DR1O 4LF9O 3O9OA 3FAVA 2QM8A 4GZRB 1W2BU 4DR7O 3F5TA 4LFAB 2L6LA 4DO2A 4JI8O 2MW2B 2P06A 1WN7A 3B2EE 2YXHA 2LGQA 3P3PA 2ZKOA 1SQBH 3B77A 1G4YB 2XAFA 4LNUA 1QCEA 4PDLA 2W6JG 4FLUA 3D3QA 1N34O 4X8AA 4PDRA 3ZHUA 1Z5VA 2RMKB 5BY1A 2G38A 3H01A 4JI1B 3RBZA 3AG1C 2DQ0A 3AG4C 4FZ0A 4O4HB 1SQXH 4H44B 4FM0A 4DV6B 4PHZA 4DR4O 3E8GA 4DR3B 1RPOA 3T1HB 3SJQC 4MSWC 2EBOA 1P4RA 4NXMB 2FMLA 3W7UA 1JR9A 2IW5A 3HKDA 2GTSA 3JAMN 1UJWB 3K5NA 1MSDA 3AG7A 1XI1A 5EBLC 4J7JA 4J80A 1RSOB 3UO2A 2ZE5A 1ORQC 5LL6Y 1K34A 2Q8VA 3T4ZA 4JTCB 4P30A 4JYCA 1O9HA 2F1MA 4EKWA 5LMNO 1PKXA 2F4VB 5IYZA 2X6BA 1ZL8B 4GKKO 1P84F 2ZM6B 1CEZA 1K92A 2LFRA 4TUYA 3AG4B 2JDIG 3FD9A 5LYJB 3ZX6A 1JCHA 2CTPA 4HYOA 3OW2U 3RYHB 3CHXA 2XHBA 3CXHF 1VEWA 2Q7EA 4NKGB 4TOIA 5JQGB 3N2KA 4RAIA 4FLYA 2WA3A 1ZLZA 2A7WA 4BR6A 4RO2A 4U3FH 2KG7B 4JV5B 1KKDA 2AHYA 3CCUV 2CDYA 1Q86W 1KD1W 4DR2B 4OPAA 4DR5B 1M5IA 4CBCA 4W4KA 2FKXA 1NVPB 3OE7G 4DV5B 3BFRA 3GB7C 1FJGB 1GN3A 3CRQA 1TUBB 1PL4A 4JASA 3BCCH 3C90A 3ZIAG 3RYFB 3JATB 4FLVA 1SKVA 2ZNIA 4DV0B 2YI9A 3KCXA 1H8HG 5BMVB 3BY6A 1OCZC 2WLNA 4K8ZA 3B4SA 3AK2A 1OV9A 4ZI7B 1YTFB 3QTCA 2NNUA 4MVSA 5KA5A 4O4LB 1TUBA 2DN9A 5C93A 4I7ZB 1MOFA 1IVSA 2Q4PA 2HEPA 3VQYA 3JAKA 1SQQH 5H2FZ 4PI0A 4GT1A 4FIPC 4MVZA 4JI2B 1JA8A 1QLEC 4X1KA 3B8NA 3WG7B 2RDCA 1R3JC 1XMOB 2YI8A 3DXRB 3CE2A 1YJNV 4RUEA 4JZGA 1W59A 1TA8A 5KUKA 1U97A 4I0XA 3KKYA 3CD6V 4J10A 1N33O 1H2LA 1TUEB 1FXKC 3H9VA 1M57C 1OCZB 1N32O 1BHBA 3CP1A 1XQ8A 2LFSA 1NTKH 1WLEA 5LGUA 1HNZB 4G28B 2DOSA 1K9MW 3RYCB 2OCCC 1VQ8V 4DUYO 4YXWG 2GBOA 2B1GA 4LF4O 1SA0B 4LFCO 1X4TA 3R66A 2UUAO 1S77D 5IYDO 2H8PC 2YXLA 4KP4A 4U3JA 1YITV 1SZXA 3K5MA 1HNXB 1QLEB 3PJSK 2YIDA 3E8HA 2P6JA 5GTIZ 1N0NA 2N04A 2IU3A 2HR3A 4GX2A 3ZRVA 1QBZA 2Z3YA 1H2GA 1SQGA 1GAXA 3CC7V 3A0BZ 1EFRG 3VQVA 4WBNA 1NVPD 1VP7A 4LP8A 4NXNO 3E2EA 4OGQB 2F93B 5FNVB 2UXCB 5J2UA 1M57B 4F4LA 3RVZA 3Q4HA 3JD1A 5J2TB 4KHPO 4IHJA 5LGTA 3CXCU 2OCCB 2XT9A 4WFAV 1OJHA 4UCUA 1D2DA 4E4EA 3ABMB 4BAYA 1LUWA 5EYPB 5KMGA 1E1RG 4LR3A 1Q6HA 1AI6A 3LDEA 1YTFD 1K33A 1OCRC 3SYOA 2YS8A 3M7MX 1FXKA 2K1EA 3E86A 1IXBA 3CPWU 3ASNC 3E83A 2BCCH 5LMUO 2UUBB 4JI3O 3CMAV 1Q3EA 4RQEA 1HP8A 4O4IB 3H1JH 4N23A 5LP6A 5KUMA 1BT8A 2KQXA 1B04A 1NJIW 3SR2C 2GHYA 5JH7A 2HKOA 4WCEV 2ZDIC 4KXRA 2CTQA 2EIJB 5L3BA 2H94A 2Q6AA 3HKBA 1GKFA 1IXMA 5C8YB 1OCRB 2KKWA 2QEXV 1ZX3A 1XNRO 3JD4A 1OCOC 3RT3C 5H9CA 4JYAO 1BQ0A 4BW9A 1SQVH 1B3QA 2QDOA 1P7BA 4R50A 3JSNA 1K7DA 2UU9B 2QKSA 4UV8A 2XAQA 3DC6A 3ZMSA 3ZS8C 1OCCC 1S76D 1VMGA 2UXBB 2YXYA 3JD0A 3OM3B 1XEQA 2XAHA 3EVKA 2JVDA 2YSUB 2QE7G 4L87A 5GONB 3J7AU 2HG5C 3LDCA 2D2CB 2A3QA 4X65B 1R6TA 3A8TA 2Q0OC 1N36O 2GSMB 1I94O 5CA1A 4CH5A 4TV8B 2JGDB 2ETNA 4UCVA 1M56C 5GTHZ 2QGNA 4X1IA 1TVKB 1EN5A 1WA8B 4DV7B 2DYRC 4I55B 4D7TA 1QR9A 1XL4A 3ABTA 4GKJB 2CTRA 2ILMA 3WB2A 1OCOB 5K1XA 2VQFB 4PD4F 3F7YC 5HFLA 1N8RW 3SJBC 3W7XA 2GDSA 1MZEA 2ITDC 2OT5A 3BAAA 5L3EA 3LNNA 1OCCB 1Q90D 4NR1A 2LW1A 3T1YO 4TV8A 2JGDA 4HNAA 1NTMH 2A79B 3U0ZA 2DWEC 4PA3A 4ZOLB 1S0VA 3VQWA 2QM4A 3RVYA 4KL1A 1VQ9V 2AHZA 1VQ6V 1B06A 1KKCA 3CMEV 2HHHB 1V54C 5EIBC 5IJ0A 2BSKB 2QTOA 1BSMA 3RN4A 4LF5B 2YIAA 1XHZA 2QKAA 1M56B 3CB2A 2DQ3A 3A0HZ 2DYRB 4J11A 5JVDB 3CSXA 3T2MA 5TISZ 4JF3A 3ZMVA 3CCQV 4LWSB 3B40A 1L0LH 2GTAA 3M8AA 1SS3A 3EHBB 1GM7A 4Z1VA 1F7YA 5H6RA 5JJEB 4MTFA 1FAFA 5KX5A 2UUCO 5B66Z 3DSQA 5CBGA 3JSLA 1H8EG 4I4TA 4FJCC 4YY3B 1JFFB 3CEIA 2OWOA 2R9IA 3JASA 4X64O 4O2BB 2EX3A 1V54B 4MTOA 4B3SB 1LNQA 2CE4A 2ZR2A 3UO3A 2XUMA 1YJWV 3L74H 3ABKC 1NU1H 4X20B 1JX9A 1GO3F 3HKCA 3LSSA 3NR7A 3ZRWB 3AK3A 1FFXB 1RFYA 1YSCA 1I08A 3L71H 1NZ6A 2W6IG 4LF7B 3MHHC 3CCEV 1KB9F 4O4JA 1NTZH 2BTQA 3KZIZ 4QNHB 1RM1C 4LF8B 4DV4B 4J7ZA 1IX9A 3ZN1A 1YHQV 3OMAB 4K3AA 4B3MB 5KHHA 3LSQA 3JALA 4X20A 4PDMA 3STLC 4YJ3A 3K06A 4NTWA 3RYIB 2L35A 1P49A 5DM6V 5DECA 2E74B 1VQNV 4G2KA 3CJHA 3N2GA 1VARA 3ETEA 4QPKA 1Y74A 4JI0O 2CUGA 3HKEB 5ITZB 3ABKB 5H5NA 4OX9B 2B5UA 4DYLA 4X66O 4DUZB 4F6RA 3F5WC 1YXBA 1ZUQA 2LQTA 4YJ2B 3QO5A 3I5DA 5IDJA 1WPBA 1Y76B 3QVNA 1XMQO 4X62O 1ZAUA 3TXQA 3DC5A 4UB6Z 1BZKA 1H2KA 1RM1B 5J9PC 5B1BC 2QTSA 1MG1A 3T1CA 2EINC 1XBLA 4IL6Z 4B3RO 1PNKA 3K0DA 4AILC 4LF6B 5L3FA 4HAMA 4NYKA 1SESA 3K5OA 1R3IC 1QLNA 4RQFA 4B7KA 3G6EV 3C3SA 1DF5A 3D36C 1H2SB 1WP8A 3KCYA 4FZ1A 1S72V 1PV0A 1COWG 1IZ3A 5LHHA 3K0GA 2RCVA 5DN6G 4LCUC 3G80A 5D5QA 1MZFA 5EIBD 3ZBHA 3FB5C 3OGIB 1NI8A 2E3CA 3E22B 2FL4A 2RNBA 1W0KG 4O4HA 5EZYB 1VQLV 1PD3A 4EFEA 2WLMA 3ZHTA 3IJ4A 5B1BB 4JAVA 1VF6A 4WFHA 3OUFA 2EINB 3SGIA 2QWNB 5IWAO 5CN0A 1F51A 3AK1A 5JWPA 5BZBA 3RFRA 3N27A 3SJCC 4GLXA 1RSOA 4LFAO 1FXVA 5CA3A 2YICA 1QU7A 3E22A 4DV1B 4AQYB 4NVPA 5LA6B 3ZMUA 3K3WA 2Q9LA 2EIMB 2Q0AA 3F7VC 4ZKIA 1HWYA 3M99B 1Y67A 4TV9B 1H2MA 3ASOC 1EZVH 2X7RB 1DK1A 4B08A 1D5NA 2JK5C 3OD4A 2CTWA 1R6KA 2R70A 5IY5C 3TJTA 3JD3A 1ZL8A 4H33A 3WG7C 4I5SA 3UT5B 5JJNB 5BR8B 5LYJA 4K0KB 1AP5A 5KLVH 4JI1O 3RYHA 2BOBC 1PL0A 3D36A 4PI2A 5JQGA 4DV6O 1K5SA 3UQ8A 2P5OA 1KYOF 4DR3O 3T1HO 1VQ5V 4TV9A 3JAWB 4LFCB 2C2AA 1A32A 2ZINA 4FLXA 2KG7A 4NXMO 4JI6B 4JTAB 1MSWD 4GUNA 4NB5A 3CCJV 2Q7HA 3K79A 4PELA 1SRYA 3SYQA 1VQMV 1Q8IA 2UXDB 1AI4A 3RYFA 2QWPB 1GM9A 3ASOB 3FKSG 3JATA 1HR0B 5IY5B 2A06H 2ODMA 4UVAA 5BMVA 1NBMG 2F4VO 5EBMC 1KBHA 4I50B 1YVWA 3ZHSA 2ZM6O 2H3OA 1V55C 1M93A 4MVRA 4ZI7A 2ZE8A 2JGUA 1ZWIC 4P2ZA 3I56V 2Q73A 4O4LA 4YHHB 2R72A 2KB1A 3K59A 1DTOA 2QWRB 2ZR3A 2M6YA 1YI2V 4DR6B 4KFMA 4B3TB 2VWKA 2XAJA 3K9AA 1IBKB 2E5LB 1NH2B 1YF2A 4JV5O 2CK3G 4PA6A 4DR2O 4DR5O 2WLIB 2HVKC 3ABMC 4FM1A 3ZHRA 1OHHG 3DXRA 2FB5A 4DV5O 4MVMA 2GUZB 4JI4B 2VS0A 1D5AA 3MAQA 4CH4A 1B6QA 3ZJZA 1N0JA 4IIJB 2JJ2G 1SQPH 4Z2WA 3E89A 4WFBV 2OTJV 2WWWA 4DV0O 4CS2A 5CB4B 2R9AA 4KUMA 4A5UB 3L73H 3RYCA 1V55B 2OCHA 4XDKA 4BWAA 1IBLB 1CP9A 3PN1A 3S3WA 4O2AB 1SC5B 1SA0A 1G6UA 2LJ2A 1UPGA 2OTLV 1K4CC 4JI5O 1JQ0A 2YDEA 3ZEDA 3APQA 2LP7A 1KU9A 1XNRB 1XNQB 1XUQA 4JI2O 5B3SC 1WB8A 4NTXA 2EIJC 2PYJA 4CC6A 2F43G 1AROP 5KHGA 2FTKA 1KP2A 2P22C 1XMOO 4PA9A 5GW7A 2F23A 4DV3O 5FNVA 2PZSA 3OMIB 1Q43A 2X0LA 4IGGA 1JOYA 3HB3B 1Z2GA 3NXSA 5JCOC 5J2TA 4FLWA 2HLDG 2JS5A 3JARB 1HNZO 1AJPA 1AP6A 2YEVB 4CC5A 5EYPA 4U7NA 4JI7B 3OMNB 1FKAO 1NR7A 5CA0B 4IYIA 1R1BA 1QQCA 4RWUA 5CBFA 4ZIBA 1QVFU 1J5EO 3TGUH 4LFBB 4FM2A 4J41A 4OPHA 5B3SB 1HNXO 2F66C 3IFXA 1P7GA 3R65A 2V4DA 1DF4A 5B1AC 3OTOO 1WJZA 2YEVA 3IAYA 3FB8C 4O4IA 3J81N 4YIOA 2YUAA 3CYOA 4X89A 1OZ0A 2V1DA 1XHXA 5IJ9B 2UXCO 2FYUH 3ETGA 2Y4TA 4IT5A 1JMKC 2EZOA 3FYEB 1URFA 5B5EZ 4UCSA 3SYPA 2ZT9B 3WB0A 4LBEC 2CGOA 2VQEB 3G67A 3WFVA 4MT8A 1JPXA 2Y0PA 3QF7A 5EBWC 5C8YA 1AILA 4QE9A 4J42A 3K57A 1O9GA 2WLLB 2Z5UA 4UCOA 1GN4A 1HW7A 1HDJA 1K8AW 4QE7A 2BTOA 2XNDG 4HZ3A 4LH6A 1K73W 5LXTB 1W0JG 4X9QA 5B1AB 1E79G 3FX7A 3LDDA 3ZCCA 2F95B 2DMXA 1TGOA 2UUBO 4JYBA 5GONA 1FD9A 1NS1A 1ENVA 1Q6IA 4X1YB 4D7SA 3E8BA 1JJOA 1AB3A 1VQPV 2K9PA 3OEEG 2ZDIA 3CC4V 2ADQB 1TVKA 1VQKV 1R6NA 1WA8A 3L75H 4I55A 2N74A 3SYAA 4K35A 5K1PA 3H1KH 1XOUA 1BGYH 4UVBA 2WPDG 1HNWB 2X6AA 1NQTA 2UU9O 3FB6C 2Q67A 1BHAA 4CH3A 4ZHQB 1Q5OA 3ZRSA 4ZOLA 4ASUG 2UXBO 3K9SA 1QNMA 1EN6A 4UB8Z 4FFKA 1NT2B 2DWDC 3JCZA 4BIOA 4DR1B 4GCZA 2B1IA 2BSKA 3P30A 1CXZB 3FYIB 2CH7B 4PA4A 3SPCA 4X65O 2NN4A 4LF9B
chains in the Genus database with same CATH topology
4DR7B 1TA8A 5LOVB 4JI8B 5D5QA 4GYCB 5EIBD 5JVDA 1YEWA 5CA0A 4LH7A 3U10A 2E3CA 3E22B 1KMIZ 1XQ8A 4O4HA 5EZYB 3K5LA 1HNZB 4EFEA 5KHJA 4HBNA 3RYCB 4FFBB 5CA1B 1N34B 3SGIA 1SA0B 1X4TA 5FPRA 4X1IB 2YXLA 4U3JA 3RFRA 3K5MA 3SJCC 5JCOA 1HNXB 5IJ9A 4GLXA 4DR4B 1JFFA 1RSOA 3E22A 4DV1B 4AQYB 4UCRA 4NVPA 4L8JA 4O2BA 5LA6B 2Q0AA 2CAZC 3QG5A 4TV9B 1SQGA 3VQVA 4WBNA 2UUCB 4B08A 3U11A 1FFXA 2QJ1A 2R70A 2F93B 4HNAB 5JJJB 5FNVB 2UXCB 1TAEA 5J2UA 3UT5B 2ZIMA 4DV2B 5JJNB 5BR8B 4X64B 5LYJA 4K0KB 5J2TB 4IHJA 4TQDA 2GV9A 3RYHA 4UCUA 1T5EA 5IJ0B 4PI2A 5JQGA 5LXTA 5LMNB 3UQ8A 2P5OA 5EYPB 5KMGA 4TV9A 4LR3A 4LNUB 4GKKB 3JAWB 4LFCB 4FLXA 2ZINA 4UCTA 4FLTA 3BHPA 5IWAB 4JI6B 2ZIOA 3RYIA 4X1YA 4UFZA 1IBMB 3M7MX 3BA8A 4EFBA 2Q7HA 4CS4A 1Q8IA 2UXDB 3HKEA 5ITZA 3RYFA 2ZCEA 3JATA 2UUBB 1HR0B 3HKDB 1Q3EA 4AHCA 5KX5B 4O4IB 5BMVA 5LP6A 3ICXA 4YJ2A 4I50B 1B04A 4I4TB 4EEQA 4JI0B 1M93A 3SR2C 4ZI7A 1I7FA 2JGUA 3JASB 5JH7A 4O4LA 4YHHB 2R72A 3K59A 1V9PA 4ZHQA 4X66B 3HKBA 2PTMA 4DR6B 3HKCB 4B3TB 5C8YB 2VWKA 5IYZB 2KKWA 3K58A 4FLZA 1XMQB 4X62B 2E5LB 1IBKB 3FFQA 4DRXB 1S5JA 3BPZA 4TUYB 5FPOA 4BW9A 4O4JB 2BTQB 3JSNA 4B3RB 3BA9A 4FM1A 2UU9B 4JI4B 3ZS8C 1D5AA 3N2KB 3MAQA 5LOVA 4CH4A 2UXBB 3BABA 3RWRD 4IIJB 3JALB 1Z5WA 4YJ3B 5EZYA 2JVDA 4CS3A 5GONB 4CS2A 5CB4B 4EB6B 2R9AA 4DRXA 3RYCA 4X65B 4FFBA 2PUSA 4BWAA 2VWJA 3N2GB 4FVMA 5CA1A 1IBLB 3PN1A 4CH5A 4O2AB 1SA0A 4TV8B 4UCVA 1N33B 1G6UA 4X1IA 1TVKB 4DV7B 4I55B 4D7TA 1N32B 4GKJB 3ZEDA 4F6RB 3OTFA 1KU9A 3WB2A 5K1XA 1XNRB 1XNQB 2VQFB 1SQFA 4DK0A 4DUYB 5LA6A 3SJBC 2PYJA 4CC6A 4EB6A 3BAAA 4LF4B 5KHGA 3LNNA 2UUAB 4I9QA 2P22C 3ETQA 3VQXA 4TV8A 4HNAA 3WB1A 3U0ZA 5FNVA 4DK1A 2PZSA 1Q43A 4ZOLB 3UT5A 4LFAB 3JAKB 3VQWA 5JCOC 2QM4A 5J2TA 1WN7A 4X1KB 3B2EE 4KL1A 4FLWA 2JS5A 3JARB 2HHHB 5EIBC 5IJ0A 4CC5A 4NXNB 1L8DA 4LF5B 5EYPA 2YIAA 1XHZA 4LNUA 3JAWA 4FLUA 3CB2A 4JI7B 3BRCA 1Z5VA 5JVDB 4JI5B 3CSXA 5CA0B 4KHPB 1QQCA 3A2FA 4JI1B 4ZIBA 4O4HB 4LFBB 4FM2A 5D5PA 4FM0A 4DV6B 4PHZA 2F66C 4DR3B 3T1HB 4TQFA 2V4DA 4NXMB 5KHKA 5JJEB 3IAYA 3HKDA 4DV3B 5KX5A 4O4IA 2PYLA 3DSQA 3K5NA 4U3JB 2RQ6A 1XI1A 4I50A 3JSLA 4I4TA 1VF7A 1XHXA 5IJ9B 4YY3B 1JFFB 2OWOA 2YIBA 1JMKC 2RJZA 4CH6A 3JASA 4O2BB 2EX3A 4B3SB 4UCSA 3THOA 3WB0A 2PGGA 5LMUB 2VQEB 4JI3B 4WBNB 4X20B 1O9HA 2F1MA 3HKCA 3QF7A 5C8YA 5KHIA 2F4VB 1FFXB 3RGBA 5IYZA 3K57A 2ZM6B 5J2UB 1O9GA 5LP6C 4UCOA 4LF7B 4TUYA 1HW7A 5LYJB 1J5EB 4O4JA 2BTQA 2OYQA 4IHJB 4LF8B 2BTOA 3RYHB 4DV4B 3CHXA 4LH6A 2XHBA 2Q7EA 2PY5A 4TOIA 5JQGB 5LXTB 3N2KA 4B3MB 1DGSA 5KHHA 3OTOB 4FLYA 5KMGB 2IM9A 4IIJA 3JALA 4JV5B 2F95B 1TGOA 4X20A 4JYAB 4YJ3A 4DR2B 4DR5B 3SJAC 5GONA 1M5IA 2Q7GA 2ZNJA 3RYIB 1P49A 1QHTA 4X1YB 5CB4A 4D7SA 1JJOA 4DV5B 1FJGB 3N2GA 1TUBB 4O2AA 3HKEB 5ITZB 3RYFB 1TVKA 3JATB 4FLVA 1SKVA 4OX9B 2ZNIA 4I55A 4DV0B 2YI9A 4DUZB 4F6RA 5BMVB 5LP6B 4YJ2B 5K1PA 4K8ZA 1WPBA 1ZAUA 1N36B 1I94B 1HNWB 4ZI7B 5JH7B 2YIBD 1WNSA 4Q6GA 3QTCA 4K8XA 4O4LB 1TUBA 4AILC 4LF6B 4CH3A 4ZHQB 1Q5OA 2HEPA 3HKBB 4ZOLA 3K5OA 3VQYA 3JAKA 4PI0A 4JI2B 4X1KA 1NT2B 3JARA 1M4UA 1H2SB 4DR1B 1XMOB 2YI8A 3T1YB 4LF9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CAZ C;  1X4T A;  2JS5 A;  3SJA C;  3CSX A;  1SKV A;  1NT2 B;  2P22 C;  3QG5 A;  3SJB C;  3SJC C;  3THO A;  3ZS8 C;  2F66 C;  3B2E E;  3QF7 A;  3ICX A; 
#chains in the Genus database with same CATH topology
 4F6E A;  1LR1 A;  4MVO A;  4DR7 B;  2BOC C;  5LOV B;  3L70 H;  4JI8 B;  5JVD A;  1K4D C;  1BQZ A;  1YEW A;  2RN9 A;  4IYH A;  1US6 A;  4Q20 A;  4RUF A;  3U10 A;  2Q68 A;  4DV7 O;  5LBQ A;  4DV2 O;  3LSU A;  1KMI Z;  2IH1 C;  4P9O A;  4BIU A;  4GKJ O;  3WU2 Z;  3K5L A;  4LWS A;  5KHJ A;  4JZ2 A;  2VQF O;  3VBB A;  3IC7 A;  2XTA A;  4FFB B;  4BIZ A;  1N34 B;  1KP3 A;  2DW4 A;  2WLK A;  3X2Q B;  5FPR A;  2NLJ C;  2IJJ A;  1GK9 A;  4AI8 A;  4JGS A;  2LGW A;  1IBM O;  2XOK G;  3L9D A;  4OXS A;  4DR4 B;  1JFF A;  2P4V A;  2IU0 A;  4MW8 A;  2JJ1 G;  1U96 A;  2X6C A;  4G27 B;  4O2B A;  2QWO B;  5AG2 A;  3C3T A;  2ZE6 A;  2JS3 A;  5HFM A;  3QG5 A;  3QO7 A;  5EK0 A;  2HHH O;  2PI4 A;  3W7T A;  1YIJ V;  4B7E A;  3ZRW A;  3U11 A;  1FFX A;  2QJ1 A;  2ADP A;  4LF5 O;  3FAV B;  5BXZ A;  5JJJ B;  2M7W A;  1TAE A;  1XIL A;  2ZIM A;  2IJI A;  4JPR A;  3BEH A;  4LC1 A;  1R3L C;  2ZXW C;  3OFN G;  1K97 A;  2OIE A;  2GV9 A;  2UXX A;  3ZMZ A;  1R3K C;  3APO A;  3ZRX A;  4WF9 V;  5LMN B;  1PNM A;  2JEX A;  1I5X A;  5IYC O;  4LNU B;  4GKK B;  3OR7 C;  2ARH A;  4UCT A;  3BHP A;  4ICG A;  3UCS C;  5IWA B;  1EN4 A;  2ZIO A;  3K04 A;  3RYI A;  4UFZ A;  2ITC C;  3JD2 A;  3BA8 A;  1S5H C;  1XRE A;  1JJ2 U;  3UKM A;  4CS4 A;  4YY3 O;  1S5L Z;  1BL8 A;  2HJF C;  3HKE A;  5ITZ A;  5LHI A;  4B3S O;  1ROP A;  3D8C A;  1FS0 G;  3HKD B;  1KQS U;  4J7K A;  3CWB H;  1L1F A;  1PNL A;  1VF5 B;  1DLB A;  3ICX A;  4YJ2 A;  1Q82 W;  4MVU A;  1Y76 A;  2EIM C;  2ZXW B;  1R73 A;  1YZB A;  4LF7 O;  2N05 A;  2W0F C;  3AG2 C;  4LF8 O;  4DV4 O;  2PTM A;  4WFF A;  4B3M O;  2Y69 C;  1MAB G;  3CRR A;  5IYZ B;  4FLZ A;  3STZ C;  2QR4 A;  4H0L B;  3FFQ A;  4DRX B;  4TUY B;  5FPO A;  4Z1M G;  2ZD9 A;  4E2L A;  4ZBM A;  4D6T H;  3ZMT A;  1AI5 A;  4PV1 B;  2JEU A;  2QA4 V;  3CS5 A;  1GMG A;  3N2K B;  4U7O A;  1BCC H;  2EIL C;  4FPP A;  4BW5 A;  1Z5W A;  4OX9 O;  1X59 A;  3GWO A;  5EZY A;  1K5Q A;  4DUZ O;  1G8M A;  4XDL A;  3OT7 A;  4DRX A;  5LHG A;  3AG1 B;  3AG2 B;  4FVM A;  1N33 B;  2B9Z A;  1Q81 W;  2Y69 B;  1N32 B;  3CX5 F;  4LF6 O;  3K08 A;  3OTF A;  2Q69 A;  1Y6X A;  1Q6U A;  5EC1 C;  1JVM A;  1SQF A;  4DUY B;  1MA1 A;  5LA6 A;  2O57 A;  1WB7 A;  2DYS C;  1EBO A;  1H38 A;  4LF4 B;  3SPJ A;  3B8M A;  5A9G A;  2UUA B;  4I9Q A;  1N4C A;  3ETQ A;  5B1O A;  3B09 A;  3CRC A;  2EIL B;  3VQX A;  3WB1 A;  4DK1 A;  1S3J A;  3UT5 A;  3JAK B;  2HFE C;  2EZP A;  4X1K B;  1YDX A;  4PA7 A;  1ZTE A;  3CRM A;  3E8F A;  2LO1 A;  5E79 Z;  2E76 B;  5CBH A;  1KC8 W;  4NXN B;  1L8D A;  3JAW A;  3SDL A;  4X88 A;  1H2N A;  1G1X B;  4I0X B;  3BRC A;  2JRI A;  1SET A;  1FYJ A;  3CCV V;  3CRA A;  1Q7Y W;  4JI5 B;  4GX1 A;  3K03 A;  4KHP B;  2QKC A;  3A2F A;  3IGA C;  2EUL A;  4NTY A;  4P9P A;  4QJF B;  5D5P A;  1KUQ A;  3LUT B;  3OR6 C;  4XDJ A;  2DYS B;  1CPY A;  1IUR A;  4DV1 O;  4AQY O;  1I5Y A;  3UM7 A;  4TQF A;  2DJV A;  5KHK A;  1AI7 A;  4DV3 B;  3QO8 A;  3L72 H;  1MNG A;  1GTO A;  2PYL A;  5IYB O;  1QR8 A;  4U3J B;  2RQ6 A;  2A9H A;  4I50 A;  2AW9 A;  1VF7 A;  4UV9 A;  1AJN A;  2XAG A;  2YIB A;  2RJZ A;  1FJG O;  4CH6 A;  5BR8 O;  2WLJ A;  2QSA A;  3JYC A;  4K0K O;  3CCS V;  3THO A;  2PGG A;  5LMU B;  2D3O W;  1BMF G;  4JI3 B;  4MS2 A;  4N21 A;  2Q5Z A;  1LUV A;  5H6Q A;  4WBN B;  3J80 N;  3HPL C;  1KEC A;  5KHI A;  3ZHV A;  3RGB A;  2YC0 A;  2OIG A;  3CCR V;  5J2U B;  5LP6 C;  5DED A;  4JI6 O;  1AR5 A;  3AG3 C;  3Q4H B;  3P3N A;  2WLI A;  1J5E B;  2AXT Z;  3EXA A;  5FLX N;  2OYQ A;  4IHJ B;  2GUZ A;  3G4S V;  4WFE A;  2PY5 A;  2EIK C;  4TWK A;  2Z0A A;  3CC2 V;  2ZE7 A;  2UXD O;  2IBZ H;  1GM8 A;  1DGS A;  1MMM A;  1ZSP A;  5IE9 A;  3OTO B;  5KMG B;  2IM9 A;  3OEH G;  3FB7 C;  4IIJ A;  2HP8 A;  3JCU Z;  3SPH A;  4YIP A;  4JYA B;  2P7T C;  2CGN A;  4GX0 A;  2A0L A;  1HR0 O;  3SJA C;  2Q7G A;  2ZNJ A;  5CB4 A;  1QHT A;  1VQ4 V;  3OAA G;  4JYY A;  1F4N A;  1FXK B;  1AJQ A;  2Y4U A;  2Y0I A;  1NKD A;  2UXN A;  2W0X A;  1GRJ A;  2MK3 A;  4MVQ A;  4O2A A;  3LNM B;  2P4K A;  4YHH O;  5L3D A;  5KA6 A;  4DR6 O;  3G71 V;  5LP6 B;  3KG2 A;  4JAU A;  4B3T O;  3AG3 B;  1WPX A;  2VRZ A;  5IT9 N;  5B1N A;  1IBK O;  2E5L O;  1N36 B;  1I94 B;  5FL7 G;  3IC9 A;  1RP3 B;  5JH7 B;  2WSS G;  1GH6 A;  1WNS A;  2YIB D;  4Q6G A;  2EIK B;  4K8X A;  1FFT B;  4UXN A;  4JI4 O;  4WFG A;  3DTU B;  3HKB B;  3T4D A;  2JIZ G;  5KAF Z;  1PP9 H;  3MD0 A;  4MTG A;  5CMU A;  2IH3 C;  3JAR A;  3TCU A;  5L3C A;  1M4U A;  1NH2 D;  1M1K W;  1BS3 A;  3H1L H;  1I0H A;  3ZHQ A;  3GVM A;  3T1Y B;  5F2V O;  3ZN0 A;  3HR0 A;  1EZJ A;  1IBL O;  4GYC B;  1L0N H;  3BVO A;  4JAA A;  5CA0 A;  4LH7 A;  4MW3 A;  4PDV A;  1SZT A;  1Y4M A;  1EM1 A;  1UFI A;  2KSD A;  4HBN A;  1GN2 A;  3P32 A;  1XNQ O;  2AZ0 A;  2PI5 A;  5CA1 B;  1QVG U;  4XBF A;  1BE3 H;  4X1I B;  3ASN B;  3ABL C;  4R6Z A;  4J9Z B;  2E75 B;  3TXS A;  5JCO A;  5IJ9 A;  3H1I H;  1F23 A;  1XL6 A;  4UCR A;  4QPJ A;  4L8J A;  1F4M A;  1VIB A;  3RW0 A;  3AEI A;  2CAZ C;  1YJ9 V;  3EFF K;  1FPO A;  1M90 W;  2UUC B;  3CCM V;  3S3X A;  1VQO V;  3ML0 A;  3SYC A;  4HNA B;  2BE3 A;  4GX5 A;  2WLL A;  4JI7 O;  4QIW F;  4DV2 B;  4X64 B;  1VQ7 V;  4TQD A;  1WAZ A;  3VOU A;  2EJ7 A;  4LFB O;  1T5E A;  2LW7 A;  5IJ0 B;  5LXT A;  2V7Q G;  4QGP A;  4PJ0 Z;  4DXW A;  4FLT A;  3ABL B;  4R7C A;  2Y48 A;  4FK5 C;  4CZZ A;  5KAI Z;  4X1Y A;  2QWQ B;  1IBM B;  3QNE A;  4EFB A;  1AR4 A;  4I9W A;  1YCI A;  1XDC A;  3CCL V;  3X2Q C;  2AZ2 A;  2HJD A;  4UVC A;  1Y66 A;  2ZCE A;  5E1A C;  2P67 A;  2VQE O;  3E35 A;  2WLH A;  4AHC A;  2QM7 A;  2XAS A;  5KX5 B;  2DE0 X;  3ABU A;  3SPI A;  3H1H H;  4I4T B;  1E1Q G;  3W7W A;  4EEQ A;  4JI0 B;  1I7F A;  3JAS B;  1J95 A;  1FXH A;  1IDS A;  1V9P A;  3TET A;  2PF4 E;  4ZHQ A;  4X66 B;  3HKC B;  1THZ A;  4JTD B;  4H37 A;  4FMT A;  3K58 A;  1XMQ B;  4X62 B;  1AVM A;  4MTX A;  5EC2 C;  3I55 V;  2AGA A;  2IJH A;  3D3I A;  1S5J A;  5A2Q N;  3BPZ A;  4O4J B;  4TT3 G;  2BTQ B;  4B3R B;  3OGC C;  3BA9 A;  2CH7 A;  1SF9 A;  3SPG A;  2IJK A;  3ETD A;  3G6B A;  1PPJ H;  1GN6 A;  5LOV A;  3MHS C;  3BAB A;  3RWR D;  3JAL B;  2ZQM A;  2ATK C;  3GWK C;  1K3E A;  3W7S A;  3OUS A;  3MDS A;  2WAM A;  4YJ3 B;  1M9N A;  5LGN A;  1NR1 A;  4CS3 A;  4DW0 A;  4EB6 B;  4ABM A;  4R8C A;  3O65 A;  4J9Y B;  2EJR A;  4FFB A;  2PUS A;  2VWJ A;  3CJH B;  3A0R A;  3N2G B;  1Y74 B;  2NR5 A;  1HNW O;  1PM9 A;  2WA4 A;  2HVJ C;  4H13 B;  4W4L A;  1SER A;  1AR1 B;  4TSF G;  3TK1 A;  3DGE A;  1RPR A;  4F6R B;  4C7U A;  2R9R B;  4DK0 A;  5L3G A;  1WP7 A;  4UUJ C;  4EB6 A;  2P90 A;  4DW1 A;  1VF6 C;  4DR1 O;  4LF9 O;  3O9O A;  3FAV A;  2QM8 A;  4GZR B;  1W2B U;  4DR7 O;  3F5T A;  4LFA B;  2L6L A;  4DO2 A;  4JI8 O;  2MW2 B;  2P06 A;  1WN7 A;  3B2E E;  2YXH A;  2LGQ A;  3P3P A;  2ZKO A;  1SQB H;  3B77 A;  1G4Y B;  2XAF A;  4LNU A;  1QCE A;  4PDL A;  2W6J G;  4FLU A;  3D3Q A;  1N34 O;  4X8A A;  4PDR A;  3ZHU A;  1Z5V A;  2RMK B;  5BY1 A;  2G38 A;  3H01 A;  4JI1 B;  3RBZ A;  3AG1 C;  2DQ0 A;  3AG4 C;  4FZ0 A;  4O4H B;  1SQX H;  4H44 B;  4FM0 A;  4DV6 B;  4PHZ A;  4DR4 O;  3E8G A;  4DR3 B;  1RPO A;  3T1H B;  3SJQ C;  4MSW C;  2EBO A;  1P4R A;  4NXM B;  2FML A;  3W7U A;  1JR9 A;  2IW5 A;  3HKD A;  2GTS A;  3JAM N;  1UJW B;  3K5N A;  1MSD A;  3AG7 A;  1XI1 A;  5EBL C;  4J7J A;  4J80 A;  1RSO B;  3UO2 A;  2ZE5 A;  1ORQ C;  5LL6 Y;  1K34 A;  2Q8V A;  3T4Z A;  4JTC B;  4P30 A;  4JYC A;  1O9H A;  2F1M A;  4EKW A;  5LMN O;  1PKX A;  2F4V B;  5IYZ A;  2X6B A;  1ZL8 B;  4GKK O;  1P84 F;  2ZM6 B;  1CEZ A;  1K92 A;  2LFR A;  4TUY A;  3AG4 B;  2JDI G;  3FD9 A;  5LYJ B;  3ZX6 A;  1JCH A;  2CTP A;  4HYO A;  3OW2 U;  3RYH B;  3CHX A;  2XHB A;  3CXH F;  1VEW A;  2Q7E A;  4NKG B;  4TOI A;  5JQG B;  3N2K A;  4RAI A;  4FLY A;  2WA3 A;  1ZLZ A;  2A7W A;  4BR6 A;  4RO2 A;  4U3F H;  2KG7 B;  4JV5 B;  1KKD A;  2AHY A;  3CCU V;  2CDY A;  1Q86 W;  1KD1 W;  4DR2 B;  4OPA A;  4DR5 B;  1M5I A;  4CBC A;  4W4K A;  2FKX A;  1NVP B;  3OE7 G;  4DV5 B;  3BFR A;  3GB7 C;  1FJG B;  1GN3 A;  3CRQ A;  1TUB B;  1PL4 A;  4JAS A;  3BCC H;  3C90 A;  3ZIA G;  3RYF B;  3JAT B;  4FLV A;  1SKV A;  2ZNI A;  4DV0 B;  2YI9 A;  3KCX A;  1H8H G;  5BMV B;  3BY6 A;  1OCZ C;  2WLN A;  4K8Z A;  3B4S A;  3AK2 A;  1OV9 A;  4ZI7 B;  1YTF B;  3QTC A;  2NNU A;  4MVS A;  5KA5 A;  4O4L B;  1TUB A;  2DN9 A;  5C93 A;  4I7Z B;  1MOF A;  1IVS A;  2Q4P A;  2HEP A;  3VQY A;  3JAK A;  1SQQ H;  5H2F Z;  4PI0 A;  4GT1 A;  4FIP C;  4MVZ A;  4JI2 B;  1JA8 A;  1QLE C;  4X1K A;  3B8N A;  3WG7 B;  2RDC A;  1R3J C;  1XMO B;  2YI8 A;  3DXR B;  3CE2 A;  1YJN V;  4RUE A;  4JZG A;  1W59 A;  1TA8 A;  5KUK A;  1U97 A;  4I0X A;  3KKY A;  3CD6 V;  4J10 A;  1N33 O;  1H2L A;  1TUE B;  1FXK C;  3H9V A;  1M57 C;  1OCZ B;  1N32 O;  1BHB A;  3CP1 A;  1XQ8 A;  2LFS A;  1NTK H;  1WLE A;  5LGU A;  1HNZ B;  4G28 B;  2DOS A;  1K9M W;  3RYC B;  2OCC C;  1VQ8 V;  4DUY O;  4YXW G;  2GBO A;  2B1G A;  4LF4 O;  1SA0 B;  4LFC O;  1X4T A;  3R66 A;  2UUA O;  1S77 D;  5IYD O;  2H8P C;  2YXL A;  4KP4 A;  4U3J A;  1YIT V;  1SZX A;  3K5M A;  1HNX B;  1QLE B;  3PJS K;  2YID A;  3E8H A;  2P6J A;  5GTI Z;  1N0N A;  2N04 A;  2IU3 A;  2HR3 A;  4GX2 A;  3ZRV A;  1QBZ A;  2Z3Y A;  1H2G A;  1SQG A;  1GAX A;  3CC7 V;  3A0B Z;  1EFR G;  3VQV A;  4WBN A;  1NVP D;  1VP7 A;  4LP8 A;  4NXN O;  3E2E A;  4OGQ B;  2F93 B;  5FNV B;  2UXC B;  5J2U A;  1M57 B;  4F4L A;  3RVZ A;  3Q4H A;  3JD1 A;  5J2T B;  4KHP O;  4IHJ A;  5LGT A;  3CXC U;  2OCC B;  2XT9 A;  4WFA V;  1OJH A;  4UCU A;  1D2D A;  4E4E A;  3ABM B;  4BAY A;  1LUW A;  5EYP B;  5KMG A;  1E1R G;  4LR3 A;  1Q6H A;  1AI6 A;  3LDE A;  1YTF D;  1K33 A;  1OCR C;  3SYO A;  2YS8 A;  3M7M X;  1FXK A;  2K1E A;  3E86 A;  1IXB A;  3CPW U;  3ASN C;  3E83 A;  2BCC H;  5LMU O;  2UUB B;  4JI3 O;  3CMA V;  1Q3E A;  4RQE A;  1HP8 A;  4O4I B;  3H1J H;  4N23 A;  5LP6 A;  5KUM A;  1BT8 A;  2KQX A;  1B04 A;  1NJI W;  3SR2 C;  2GHY A;  5JH7 A;  2HKO A;  4WCE V;  2ZDI C;  4KXR A;  2CTQ A;  2EIJ B;  5L3B A;  2H94 A;  2Q6A A;  3HKB A;  1GKF A;  1IXM A;  5C8Y B;  1OCR B;  2KKW A;  2QEX V;  1ZX3 A;  1XNR O;  3JD4 A;  1OCO C;  3RT3 C;  5H9C A;  4JYA O;  1BQ0 A;  4BW9 A;  1SQV H;  1B3Q A;  2QDO A;  1P7B A;  4R50 A;  3JSN A;  1K7D A;  2UU9 B;  2QKS A;  4UV8 A;  2XAQ A;  3DC6 A;  3ZMS A;  3ZS8 C;  1OCC C;  1S76 D;  1VMG A;  2UXB B;  2YXY A;  3JD0 A;  3OM3 B;  1XEQ A;  2XAH A;  3EVK A;  2JVD A;  2YSU B;  2QE7 G;  4L87 A;  5GON B;  3J7A U;  2HG5 C;  3LDC A;  2D2C B;  2A3Q A;  4X65 B;  1R6T A;  3A8T A;  2Q0O C;  1N36 O;  2GSM B;  1I94 O;  5CA1 A;  4CH5 A;  4TV8 B;  2JGD B;  2ETN A;  4UCV A;  1M56 C;  5GTH Z;  2QGN A;  4X1I A;  1TVK B;  1EN5 A;  1WA8 B;  4DV7 B;  2DYR C;  4I55 B;  4D7T A;  1QR9 A;  1XL4 A;  3ABT A;  4GKJ B;  2CTR A;  2ILM A;  3WB2 A;  1OCO B;  5K1X A;  2VQF B;  4PD4 F;  3F7Y C;  5HFL A;  1N8R W;  3SJB C;  3W7X A;  2GDS A;  1MZE A;  2ITD C;  2OT5 A;  3BAA A;  5L3E A;  3LNN A;  1OCC B;  1Q90 D;  4NR1 A;  2LW1 A;  3T1Y O;  4TV8 A;  2JGD A;  4HNA A;  1NTM H;  2A79 B;  3U0Z A;  2DWE C;  4PA3 A;  4ZOL B;  1S0V A;  3VQW A;  2QM4 A;  3RVY A;  4KL1 A;  1VQ9 V;  2AHZ A;  1VQ6 V;  1B06 A;  1KKC A;  3CME V;  2HHH B;  1V54 C;  5EIB C;  5IJ0 A;  2BSK B;  2QTO A;  1BSM A;  3RN4 A;  4LF5 B;  2YIA A;  1XHZ A;  2QKA A;  1M56 B;  3CB2 A;  2DQ3 A;  3A0H Z;  2DYR B;  4J11 A;  5JVD B;  3CSX A;  3T2M A;  5TIS Z;  4JF3 A;  3ZMV A;  3CCQ V;  4LWS B;  3B40 A;  1L0L H;  2GTA A;  3M8A A;  1SS3 A;  3EHB B;  1GM7 A;  4Z1V A;  1F7Y A;  5H6R A;  5JJE B;  4MTF A;  1FAF A;  5KX5 A;  2UUC O;  5B66 Z;  3DSQ A;  5CBG A;  3JSL A;  1H8E G;  4I4T A;  4FJC C;  4YY3 B;  1JFF B;  3CEI A;  2OWO A;  2R9I A;  3JAS A;  4X64 O;  4O2B B;  2EX3 A;  1V54 B;  4MTO A;  4B3S B;  1LNQ A;  2CE4 A;  2ZR2 A;  3UO3 A;  2XUM A;  1YJW V;  3L74 H;  3ABK C;  1NU1 H;  4X20 B;  1JX9 A;  1GO3 F;  3HKC A;  3LSS A;  3NR7 A;  3ZRW B;  3AK3 A;  1FFX B;  1RFY A;  1YSC A;  1I08 A;  3L71 H;  1NZ6 A;  2W6I G;  4LF7 B;  3MHH C;  3CCE V;  1KB9 F;  4O4J A;  1NTZ H;  2BTQ A;  3KZI Z;  4QNH B;  1RM1 C;  4LF8 B;  4DV4 B;  4J7Z A;  1IX9 A;  3ZN1 A;  1YHQ V;  3OMA B;  4K3A A;  4B3M B;  5KHH A;  3LSQ A;  3JAL A;  4X20 A;  4PDM A;  3STL C;  4YJ3 A;  3K06 A;  4NTW A;  3RYI B;  2L35 A;  1P49 A;  5DM6 V;  5DEC A;  2E74 B;  1VQN V;  4G2K A;  3CJH A;  3N2G A;  1VAR A;  3ETE A;  4QPK A;  1Y74 A;  4JI0 O;  2CUG A;  3HKE B;  5ITZ B;  3ABK B;  5H5N A;  4OX9 B;  2B5U A;  4DYL A;  4X66 O;  4DUZ B;  4F6R A;  3F5W C;  1YXB A;  1ZUQ A;  2LQT A;  4YJ2 B;  3QO5 A;  3I5D A;  5IDJ A;  1WPB A;  1Y76 B;  3QVN A;  1XMQ O;  4X62 O;  1ZAU A;  3TXQ A;  3DC5 A;  4UB6 Z;  1BZK A;  1H2K A;  1RM1 B;  5J9P C;  5B1B C;  2QTS A;  1MG1 A;  3T1C A;  2EIN C;  1XBL A;  4IL6 Z;  4B3R O;  1PNK A;  3K0D A;  4AIL C;  4LF6 B;  5L3F A;  4HAM A;  4NYK A;  1SES A;  3K5O A;  1R3I C;  1QLN A;  4RQF A;  4B7K A;  3G6E V;  3C3S A;  1DF5 A;  3D36 C;  1H2S B;  1WP8 A;  3KCY A;  4FZ1 A;  1S72 V;  1PV0 A;  1COW G;  1IZ3 A;  5LHH A;  3K0G A;  2RCV A;  5DN6 G;  4LCU C;  3G80 A;  5D5Q A;  1MZF A;  5EIB D;  3ZBH A;  3FB5 C;  3OGI B;  1NI8 A;  2E3C A;  3E22 B;  2FL4 A;  2RNB A;  1W0K G;  4O4H A;  5EZY B;  1VQL V;  1PD3 A;  4EFE A;  2WLM A;  3ZHT A;  3IJ4 A;  5B1B B;  4JAV A;  1VF6 A;  4WFH A;  3OUF A;  2EIN B;  3SGI A;  2QWN B;  5IWA O;  5CN0 A;  1F51 A;  3AK1 A;  5JWP A;  5BZB A;  3RFR A;  3N27 A;  3SJC C;  4GLX A;  1RSO A;  4LFA O;  1FXV A;  5CA3 A;  2YIC A;  1QU7 A;  3E22 A;  4DV1 B;  4AQY B;  4NVP A;  5LA6 B;  3ZMU A;  3K3W A;  2Q9L A;  2EIM B;  2Q0A A;  3F7V C;  4ZKI A;  1HWY A;  3M99 B;  1Y67 A;  4TV9 B;  1H2M A;  3ASO C;  1EZV H;  2X7R B;  1DK1 A;  4B08 A;  1D5N A;  2JK5 C;  3OD4 A;  2CTW A;  1R6K A;  2R70 A;  5IY5 C;  3TJT A;  3JD3 A;  1ZL8 A;  4H33 A;  3WG7 C;  4I5S A;  3UT5 B;  5JJN B;  5BR8 B;  5LYJ A;  4K0K B;  1AP5 A;  5KLV H;  4JI1 O;  3RYH A;  2BOB C;  1PL0 A;  3D36 A;  4PI2 A;  5JQG A;  4DV6 O;  1K5S A;  3UQ8 A;  2P5O A;  1KYO F;  4DR3 O;  3T1H O;  1VQ5 V;  4TV9 A;  3JAW B;  4LFC B;  2C2A A;  1A32 A;  2ZIN A;  4FLX A;  2KG7 A;  4NXM O;  4JI6 B;  4JTA B;  1MSW D;  4GUN A;  4NB5 A;  3CCJ V;  2Q7H A;  3K79 A;  4PEL A;  1SRY A;  3SYQ A;  1VQM V;  1Q8I A;  2UXD B;  1AI4 A;  3RYF A;  2QWP B;  1GM9 A;  3ASO B;  3FKS G;  3JAT A;  1HR0 B;  5IY5 B;  2A06 H;  2ODM A;  4UVA A;  5BMV A;  1NBM G;  2F4V O;  5EBM C;  1KBH A;  4I50 B;  1YVW A;  3ZHS A;  2ZM6 O;  2H3O A;  1V55 C;  1M93 A;  4MVR A;  4ZI7 A;  2ZE8 A;  2JGU A;  1ZWI C;  4P2Z A;  3I56 V;  2Q73 A;  4O4L A;  4YHH B;  2R72 A;  2KB1 A;  3K59 A;  1DTO A;  2QWR B;  2ZR3 A;  2M6Y A;  1YI2 V;  4DR6 B;  4KFM A;  4B3T B;  2VWK A;  2XAJ A;  3K9A A;  1IBK B;  2E5L B;  1NH2 B;  1YF2 A;  4JV5 O;  2CK3 G;  4PA6 A;  4DR2 O;  4DR5 O;  2WLI B;  2HVK C;  3ABM C;  4FM1 A;  3ZHR A;  1OHH G;  3DXR A;  2FB5 A;  4DV5 O;  4MVM A;  2GUZ B;  4JI4 B;  2VS0 A;  1D5A A;  3MAQ A;  4CH4 A;  1B6Q A;  3ZJZ A;  1N0J A;  4IIJ B;  2JJ2 G;  1SQP H;  4Z2W A;  3E89 A;  4WFB V;  2OTJ V;  2WWW A;  4DV0 O;  4CS2 A;  5CB4 B;  2R9A A;  4KUM A;  4A5U B;  3L73 H;  3RYC A;  1V55 B;  2OCH A;  4XDK A;  4BWA A;  1IBL B;  1CP9 A;  3PN1 A;  3S3W A;  4O2A B;  1SC5 B;  1SA0 A;  1G6U A;  2LJ2 A;  1UPG A;  2OTL V;  1K4C C;  4JI5 O;  1JQ0 A;  2YDE A;  3ZED A;  3APQ A;  2LP7 A;  1KU9 A;  1XNR B;  1XNQ B;  1XUQ A;  4JI2 O;  5B3S C;  1WB8 A;  4NTX A;  2EIJ C;  2PYJ A;  4CC6 A;  2F43 G;  1ARO P;  5KHG A;  2FTK A;  1KP2 A;  2P22 C;  1XMO O;  4PA9 A;  5GW7 A;  2F23 A;  4DV3 O;  5FNV A;  2PZS A;  3OMI B;  1Q43 A;  2X0L A;  4IGG A;  1JOY A;  3HB3 B;  1Z2G A;  3NXS A;  5JCO C;  5J2T A;  4FLW A;  2HLD G;  2JS5 A;  3JAR B;  1HNZ O;  1AJP A;  1AP6 A;  2YEV B;  4CC5 A;  5EYP A;  4U7N A;  4JI7 B;  3OMN B;  1FKA O;  1NR7 A;  5CA0 B;  4IYI A;  1R1B A;  1QQC A;  4RWU A;  5CBF A;  4ZIB A;  1QVF U;  1J5E O;  3TGU H;  4LFB B;  4FM2 A;  4J41 A;  4OPH A;  5B3S B;  1HNX O;  2F66 C;  3IFX A;  1P7G A;  3R65 A;  2V4D A;  1DF4 A;  5B1A C;  3OTO O;  1WJZ A;  2YEV A;  3IAY A;  3FB8 C;  4O4I A;  3J81 N;  4YIO A;  2YUA A;  3CYO A;  4X89 A;  1OZ0 A;  2V1D A;  1XHX A;  5IJ9 B;  2UXC O;  2FYU H;  3ETG A;  2Y4T A;  4IT5 A;  1JMK C;  2EZO A;  3FYE B;  1URF A;  5B5E Z;  4UCS A;  3SYP A;  2ZT9 B;  3WB0 A;  4LBE C;  2CGO A;  2VQE B;  3G67 A;  3WFV A;  4MT8 A;  1JPX A;  2Y0P A;  3QF7 A;  5EBW C;  5C8Y A;  1AIL A;  4QE9 A;  4J42 A;  3K57 A;  1O9G A;  2WLL B;  2Z5U A;  4UCO A;  1GN4 A;  1HW7 A;  1HDJ A;  1K8A W;  4QE7 A;  2BTO A;  2XND G;  4HZ3 A;  4LH6 A;  1K73 W;  5LXT B;  1W0J G;  4X9Q A;  5B1A B;  1E79 G;  3FX7 A;  3LDD A;  3ZCC A;  2F95 B;  2DMX A;  1TGO A;  2UUB O;  4JYB A;  5GON A;  1FD9 A;  1NS1 A;  1ENV A;  1Q6I A;  4X1Y B;  4D7S A;  3E8B A;  1JJO A;  1AB3 A;  1VQP V;  2K9P A;  3OEE G;  2ZDI A;  3CC4 V;  2ADQ B;  1TVK A;  1VQK V;  1R6N A;  1WA8 A;  3L75 H;  4I55 A;  2N74 A;  3SYA A;  4K35 A;  5K1P A;  3H1K H;  1XOU A;  1BGY H;  4UVB A;  2WPD G;  1HNW B;  2X6A A;  1NQT A;  2UU9 O;  3FB6 C;  2Q67 A;  1BHA A;  4CH3 A;  4ZHQ B;  1Q5O A;  3ZRS A;  4ZOL A;  4ASU G;  2UXB O;  3K9S A;  1QNM A;  1EN6 A;  4UB8 Z;  4FFK A;  1NT2 B;  2DWD C;  3JCZ A;  4BIO A;  4DR1 B;  4GCZ A;  2B1I A;  2BSK A;  3P30 A;  1CXZ B;  3FYI B;  2CH7 B;  4PA4 A;  3SPC A;  4X65 O;  2NN4 A;  4LF9 B; 
#chains in the Genus database with same CATH homology
 4DR7 B;  1TA8 A;  5LOV B;  4JI8 B;  5D5Q A;  4GYC B;  5EIB D;  5JVD A;  1YEW A;  5CA0 A;  4LH7 A;  3U10 A;  2E3C A;  3E22 B;  1KMI Z;  1XQ8 A;  4O4H A;  5EZY B;  3K5L A;  1HNZ B;  4EFE A;  5KHJ A;  4HBN A;  3RYC B;  4FFB B;  5CA1 B;  1N34 B;  3SGI A;  1SA0 B;  1X4T A;  5FPR A;  4X1I B;  2YXL A;  4U3J A;  3RFR A;  3K5M A;  3SJC C;  5JCO A;  1HNX B;  5IJ9 A;  4GLX A;  4DR4 B;  1JFF A;  1RSO A;  3E22 A;  4DV1 B;  4AQY B;  4UCR A;  4NVP A;  4L8J A;  4O2B A;  5LA6 B;  2Q0A A;  2CAZ C;  3QG5 A;  4TV9 B;  1SQG A;  3VQV A;  4WBN A;  2UUC B;  4B08 A;  3U11 A;  1FFX A;  2QJ1 A;  2R70 A;  2F93 B;  4HNA B;  5JJJ B;  5FNV B;  2UXC B;  1TAE A;  5J2U A;  3UT5 B;  2ZIM A;  4DV2 B;  5JJN B;  5BR8 B;  4X64 B;  5LYJ A;  4K0K B;  5J2T B;  4IHJ A;  4TQD A;  2GV9 A;  3RYH A;  4UCU A;  1T5E A;  5IJ0 B;  4PI2 A;  5JQG A;  5LXT A;  5LMN B;  3UQ8 A;  2P5O A;  5EYP B;  5KMG A;  4TV9 A;  4LR3 A;  4LNU B;  4GKK B;  3JAW B;  4LFC B;  4FLX A;  2ZIN A;  4UCT A;  4FLT A;  3BHP A;  5IWA B;  4JI6 B;  2ZIO A;  3RYI A;  4X1Y A;  4UFZ A;  1IBM B;  3M7M X;  3BA8 A;  4EFB A;  2Q7H A;  4CS4 A;  1Q8I A;  2UXD B;  3HKE A;  5ITZ A;  3RYF A;  2ZCE A;  3JAT A;  2UUB B;  1HR0 B;  3HKD B;  1Q3E A;  4AHC A;  5KX5 B;  4O4I B;  5BMV A;  5LP6 A;  3ICX A;  4YJ2 A;  4I50 B;  1B04 A;  4I4T B;  4EEQ A;  4JI0 B;  1M93 A;  3SR2 C;  4ZI7 A;  1I7F A;  2JGU A;  3JAS B;  5JH7 A;  4O4L A;  4YHH B;  2R72 A;  3K59 A;  1V9P A;  4ZHQ A;  4X66 B;  3HKB A;  2PTM A;  4DR6 B;  3HKC B;  4B3T B;  5C8Y B;  2VWK A;  5IYZ B;  2KKW A;  3K58 A;  4FLZ A;  1XMQ B;  4X62 B;  2E5L B;  1IBK B;  3FFQ A;  4DRX B;  1S5J A;  3BPZ A;  4TUY B;  5FPO A;  4BW9 A;  4O4J B;  2BTQ B;  3JSN A;  4B3R B;  3BA9 A;  4FM1 A;  2UU9 B;  4JI4 B;  3ZS8 C;  1D5A A;  3N2K B;  3MAQ A;  5LOV A;  4CH4 A;  2UXB B;  3BAB A;  3RWR D;  4IIJ B;  3JAL B;  1Z5W A;  4YJ3 B;  5EZY A;  2JVD A;  4CS3 A;  5GON B;  4CS2 A;  5CB4 B;  4EB6 B;  2R9A A;  4DRX A;  3RYC A;  4X65 B;  4FFB A;  2PUS A;  4BWA A;  2VWJ A;  3N2G B;  4FVM A;  5CA1 A;  1IBL B;  3PN1 A;  4CH5 A;  4O2A B;  1SA0 A;  4TV8 B;  4UCV A;  1N33 B;  1G6U A;  4X1I A;  1TVK B;  4DV7 B;  4I55 B;  4D7T A;  1N32 B;  4GKJ B;  3ZED A;  4F6R B;  3OTF A;  1KU9 A;  3WB2 A;  5K1X A;  1XNR B;  1XNQ B;  2VQF B;  1SQF A;  4DK0 A;  4DUY B;  5LA6 A;  3SJB C;  2PYJ A;  4CC6 A;  4EB6 A;  3BAA A;  4LF4 B;  5KHG A;  3LNN A;  2UUA B;  4I9Q A;  2P22 C;  3ETQ A;  3VQX A;  4TV8 A;  4HNA A;  3WB1 A;  3U0Z A;  5FNV A;  4DK1 A;  2PZS A;  1Q43 A;  4ZOL B;  3UT5 A;  4LFA B;  3JAK B;  3VQW A;  5JCO C;  2QM4 A;  5J2T A;  1WN7 A;  4X1K B;  3B2E E;  4KL1 A;  4FLW A;  2JS5 A;  3JAR B;  2HHH B;  5EIB C;  5IJ0 A;  4CC5 A;  4NXN B;  1L8D A;  4LF5 B;  5EYP A;  2YIA A;  1XHZ A;  4LNU A;  3JAW A;  4FLU A;  3CB2 A;  4JI7 B;  3BRC A;  1Z5V A;  5JVD B;  4JI5 B;  3CSX A;  5CA0 B;  4KHP B;  1QQC A;  3A2F A;  4JI1 B;  4ZIB A;  4O4H B;  4LFB B;  4FM2 A;  5D5P A;  4FM0 A;  4DV6 B;  4PHZ A;  2F66 C;  4DR3 B;  3T1H B;  4TQF A;  2V4D A;  4NXM B;  5KHK A;  5JJE B;  3IAY A;  3HKD A;  4DV3 B;  5KX5 A;  4O4I A;  2PYL A;  3DSQ A;  3K5N A;  4U3J B;  2RQ6 A;  1XI1 A;  4I50 A;  3JSL A;  4I4T A;  1VF7 A;  1XHX A;  5IJ9 B;  4YY3 B;  1JFF B;  2OWO A;  2YIB A;  1JMK C;  2RJZ A;  4CH6 A;  3JAS A;  4O2B B;  2EX3 A;  4B3S B;  4UCS A;  3THO A;  3WB0 A;  2PGG A;  5LMU B;  2VQE B;  4JI3 B;  4WBN B;  4X20 B;  1O9H A;  2F1M A;  3HKC A;  3QF7 A;  5C8Y A;  5KHI A;  2F4V B;  1FFX B;  3RGB A;  5IYZ A;  3K57 A;  2ZM6 B;  5J2U B;  1O9G A;  5LP6 C;  4UCO A;  4LF7 B;  4TUY A;  1HW7 A;  5LYJ B;  1J5E B;  4O4J A;  2BTQ A;  2OYQ A;  4IHJ B;  4LF8 B;  2BTO A;  3RYH B;  4DV4 B;  3CHX A;  4LH6 A;  2XHB A;  2Q7E A;  2PY5 A;  4TOI A;  5JQG B;  5LXT B;  3N2K A;  4B3M B;  1DGS A;  5KHH A;  3OTO B;  4FLY A;  5KMG B;  2IM9 A;  4IIJ A;  3JAL A;  4JV5 B;  2F95 B;  1TGO A;  4X20 A;  4JYA B;  4YJ3 A;  4DR2 B;  4DR5 B;  3SJA C;  5GON A;  1M5I A;  2Q7G A;  2ZNJ A;  3RYI B;  1P49 A;  1QHT A;  4X1Y B;  5CB4 A;  4D7S A;  1JJO A;  4DV5 B;  1FJG B;  3N2G A;  1TUB B;  4O2A A;  3HKE B;  5ITZ B;  3RYF B;  1TVK A;  3JAT B;  4FLV A;  1SKV A;  4OX9 B;  2ZNI A;  4I55 A;  4DV0 B;  2YI9 A;  4DUZ B;  4F6R A;  5BMV B;  5LP6 B;  4YJ2 B;  5K1P A;  4K8Z A;  1WPB A;  1ZAU A;  1N36 B;  1I94 B;  1HNW B;  4ZI7 B;  5JH7 B;  2YIB D;  1WNS A;  4Q6G A;  3QTC A;  4K8X A;  4O4L B;  1TUB A;  4AIL C;  4LF6 B;  4CH3 A;  4ZHQ B;  1Q5O A;  2HEP A;  3HKB B;  4ZOL A;  3K5O A;  3VQY A;  3JAK A;  4PI0 A;  4JI2 B;  4X1K A;  1NT2 B;  3JAR A;  1M4U A;  1H2S B;  4DR1 B;  1XMO B;  2YI8 A;  3T1Y B;  4LF9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...