1SKVA

Crystal structure of d-63 from sulfolobus spindle virus 1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
64
structure length
64
Chain Sequence
SKEVLEKELFEMLDEDVRELLSLIHEIKIDRITGNMDKQKLGKAYFQVQKIEAELYQLIKVSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of d-63 from sulfolobus spindle-shaped virus 1: surface properties of the dimeric four-helix bundle suggest an adaptor protein function
pubmed doi rcsb
source organism Sulfolobus virus 1
molecule tags Viral protein
molecule keywords Hypothetical 7.5 kDa protein
total genus 25
structure length 64
sequence length 64
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1skvA00
2CAZC 3CSXA 3QG5A 3THOA 2JS5A 3SJAC 3ZS8C 1NT2B 1SKVA 2F66C 2P22C 3ICXA 1X4TA 3QF7A 3B2EE 3SJCC 3SJBC
chains in the Genus database with same CATH superfamily
3CS5A 5D5QA 4JTAB 1OCCC 4IHJB 1JCHA 4U7OA 3TXSA 2UXBO 4YHHB 1QVGU 2CTQA 4J9ZB 4B3SB 1NVPD 3BVOA 2Z5UA 4X88A 3APQA 3LSUA 4JI2O 4HNAA 4KL1A 3QVNA 4XBFA 1K9MW 1KECA 2WLIA 3F5WC 4DR7O 2OCCC 1US6A 4I50B 3ASNC 3VQYA 1HR0B 2QGNA 2DW4A 3SPHA 4CBCA 2FL4A 4R7CA 3LDEA 4X1KB 4L8JA 2IU3A 1GN2A 2Q8VA 4RQFA 4CH4A 1FAFA 1VF7A 5LGNA 4X66O 1NVPB 4MTOA 4X62O 1GK9A 5JJNB 1KP2A 3T2MA 4MT8A 2FTKA 3AG2C 5EK0A 3OD4A 3K5LA 2P4KA 3ZCCA 2F1MA 1N4CA 2EZPA 3AG7A 2HP8A 4QGPA 3S3XA 4JZGA 3HKDA 3CPWU 5KAFZ 1VQMV 1SQVH 5TISZ 1AJPA 1ZAUA 3N27A 2VQFB 4LF4B 2GTSA 2GHYA 1JX9A 3M99B 2DWDC 3DC6A 2BE3A 2XOKG 1D2DA 5EBWC 5FPRA 1PPJH 1MG1A 3QO7A 2F4VO 2HJDA 2E3CA 2HFEC 3B8MA 5EZYB 4MTGA 1S77D 1VQ6V 2VQEB 2ZR2A 4DR5O 1XMQB 1ZUQA 4YIPA 5L3FA 5B1BB 1HNZB 3VQVA 2GV9A 2XUMA 4B3MB 1WPBA 4FFKA 1YHQV 3P30A 1BZKA 2P22C 3WB2A 2WLJA 4FM2A 2LQTA 3AG3C 5JH7B 1ORQC 3K5OA 2AGAA 2QWNB 2LFRA 1SZXA 1ROPA 1SQXH 4GKJB 4X9QA 2ZE6A 1SQBH 3CCLV 1PNMA 4H44B 5JWPA 4DR7B 1XMOB 1NS1A 3E8BA 1XNQB 3IC7A 1K8AW 3JD1A 3IFXA 3B09A 5FPOA 4FZ1A 2PGGA 2OIEA 5B1OA 2RN9A 4WFHA 2X6CA 5FNVB 4FMTA 3UO2A 5CMUA 1SKVA 4PI0A 2H8PC 1H2NA 3E22A 5KX5A 2JGUA 5BZBA 1FJGB 2FMLA 3SGIA 4FLUA 1OCZB 3B77A 5B3SB 4X8AA 3FB7C 5K1XA 5CA1B 2YI9A 3X2QC 5LHIA 4KHPB 5EYPA 2F66C 4EFBA 4FM1A 3L71H 3G6BA 1NR7A 5IWAO 1B3QA 1I5XA 2QA4V 1ZLZA 3RVZA 3D36A 3CCQV 1TUEB 1XEQA 1N34O 1QR9A 2CTPA 3QO8A 4UVBA 2WLLA 1NH2D 1Q7YW 5KHGA 1Y67A 1ENVA 2ITCC 4F4LA 1S3JA 4DRXB 3AG1B 2YXHA 3K03A 3WG7C 1RP3B 2B9ZA 4Z2WA 1TGOA 4N21A 2IH3C 1QU7A 1N33O 2F93B 4IGGA 2EILB 4GLXA 3UKMA 5KAIZ 3JATA 2ATKC 2RDCA 5BR8B 2EBOA 4GX5A 5LA6B 4BW5A 2ZM6O 4WCEV 4H37A 1PV0A 4PDMA 3UT5A 2LW1A 1FXHA 4X66B 2LGWA 2K1EA 4LF4O 3HKCA 1XUQA 4MW3A 4NXNO 3RYHA 3JD0A 4JYBA 3K0DA 3J80N 4NTWA 1YF2A 1W0JG 4LFBO 3STLC 5LMNO 1M57B 3CC7V 1OCOB 3BABA 4GYCB 4HBNA 4NB5A 3T1YO 1VQ7V 3GWOA 1JJOA 2EINB 5H5NA 2QTSA 3UCSC 2QM4A 1UJWB 1V55B 1PNKA 4O4HB 4DV6O 4DR3O 1DF4A 1FFXA 3HKEA 3W7XA 1H8HG 2IBZH 4JI8O 4EFEA 2X6AA 2YSUB 3J81N 4DUYB 2Y4UA 1AJNA 1OJHA 4DV5B 4AHCA 4FFBA 4UUJC 4ICGA 5IYBO 2AW9A 2KSDA 2Q67A 3I56V 1WJZA 3ZRXA 1T5EA 4MTFA 2P5OA 2UXBB 3T1HB 1U97A 4X65B 1FPOA 3ABKB 1P84F 4X64B 1MABG 3NXSA 4Q20A 1QLNA 3O65A 4MW8A 4XDJA 1FXKA 4LF5B 4YXWG 1LR1A 4R8CA 2YEVA 2Q7GA 4XDLA 2ZNIA 5EC1C 4PA9A 4JI1B 1SRYA 1GN6A 3ASNB 2PI4A 4I55B 4U7NA 5F2VO 4RWUA 4B3RO 2XHBA 4DYLA 1R3IC 3G67A 5LYJB 1R3KC 1NJIW 4FZ0A 3CHXA 1N36B 4R6ZA 3P32A 4J7JA 5EIBD 5IJ0A 2ZE8A 3SJQC 4CH5A 4FJCC 5CN0A 4TV8A 2RQ6A 2R70A 3LSQA 4K0KO 4H33A 1OCCB 4DV5O 3ZMUA 1I94B 1K34A 4QJFB 3E89A 1OV9A 1FXKC 1VQLV 1W59A 4N23A 2P6JA 2XAHA 4PHZA 1E79G 1R6KA 1F23A 4KHPO 1XMQO 4LR3A 1XILA 4X1YA 1Y6XA 3CEIA 5GONB 4AQYO 4I50A 2UUBO 4GX0A 1R3JC 1VP7A 1AI4A 4F6EA 2V1DA 3LDCA 2QTOA 4PJ0Z 3WFVA 5B1AB 4D7TA 3BHPA 2ODMA 3CMAV 1CEZA 4K35A 1QLEB 4JZ2A 4MVSA 3L9DA 1O9GA 1TVKA 2K9PA 1KB9F 1WP7A 1Q43A 2Q7HA 3K0GA 5ITZA 3CD6V 1BMFG 1F7YA 3HKBB 2NNUA 1Q82W 3T4ZA 2WLMA 3UO3A 3K57A 1Z2GA 3ZJZA 3ZRWB 3PJSK 2WLNA 3MHSC 5LOVB 2JGDA 4JYYA 1S5HC 4H13B 3ABTA 5LHHA 3FB8C 3ASOC 1Y66A 2X7RB 1JMKC 2IJIA 1AI5A 1WLEA 4UCOA 3JCZA 4PELA 5KHHA 4LFCO 3JAKA 1NI8A 2ZXWC 5EYPB 4CS4A 3WU2Z 2X6BA 1NQTA 3L73H 4DUYO 1BCCH 3ZRVA 2VQEO 4JPRA 4ZOLA 1HNXB 3DGEA 5H2FZ 1XI1A 1LUVA 4TQDA 1IXMA 5CBFA 2QKAA 5IYCO 4JI2B 3N2KA 2A79B 1MZEA 4O4LB 4I9WA 3OGIB 4B7KA 1WPXA 5BR8O 2OIGA 1Q5OA 5LP6C 2QWOB 2UU9B 1X59A 1COWG 3AEIA 3H1HH 1N32B 3AG4C 5D5PA 1YJNV 3ZBHA 5DECA 2ZE5A 3R66A 5ITZB 4IIJA 1KKDA 1PL4A 2ZXWB 4DO2A 2R9AA 1M56C 4J10A 4DW0A 1B06A 5DM6V 5BMVA 5L3BA 3AK3A 2JS5A 1YEWA 3T1YB 2ZM6B 1HP8A 2Y69C 1HDJA 5C8YA 4DV4O 1A32A 5J2TA 4DV0B 3CCRV 4EKWA 4DV7B 3ZRWA 2R72A 3TETA 4DV1O 1W0KG 4UB8Z 1OCZC 3JD3A 2WSSG 2VQFO 4MVUA 2EIJC 3CXCU 2MK3A 4W4KA 4IYIA 4JI6O 1D5AA 1DGSA 1JR9A 4FM0A 1VQ9V 1F4NA 3SPGA 4IYHA 3ZHSA 5K1PA 5EIBC 2W0XA 4GT1A 4AQYB 2UUBB 2Q7EA 3F7YC 3DTUB 4TUYB 2P67A 1XDCA 4G28B 3SYQA 2D3OW 1S76D 2ARHA 4R50A 1I7FA 2QKCA 5KA6A 1L0NH 4GKKB 2LGQA 2Q5ZA 5EBMC 3CB2A 4UV8A 1YJWV 1QHTA 4IT5A 4QPJA 5CA0A 3A0BZ 5L3CA 4NKGB 3EVKA 3B8NA 3TK1A 1FFTB 4HYOA 1B04A 1P7BA 4ZOLB 5KUKA 2XAGA 5CA3A 3ZRSA 2NLJC 3JAMN 2IJKA 1KMIZ 2CGNA 2UXDO 3SDLA 2VWKA 2CUGA 2OCHA 3QO5A 2HR3A 1NTKH 2XAFA 3RYHB 1NTMH 3SPJA 1SESA 4KFMA 2IH1C 3BCCH 3G71V 1Q86W 1YCIA 5KMGA 4DV0O 1JVMA 4PDRA 2YIDA 4BAYA 3CX5F 3NR7A 2AHYA 4WBNB 5EC2C 4UCVA 4ZBMA 4TV9B 1Z5WA 4LF5O 5C8YB 1EFRG 3JATB 4WFGA 2BOBC 2N05A 2PF4E 2ZINA 1W2BU 3FAVA 4ZHQA 3H9VA 2AZ0A 3R65A 2YICA 3SJBC 1N0JA 1NBMG 2OCCB 2OTLV 2WA4A 3QF7A 1VIBA 2M7WA 4J42A 5EBLC 2Q9LA 3HKBA 1IURA 3CMEV 1DF5A 3SJAC 5L3GA 1YZBA 2DYRB 3CWBH 1Q3EA 3RT3C 5GONA 3MAQA 3LUTB 4PI2A 5JJEB 2YXLA 5JCOA 2NN4A 4JI8B 4ZIBA 1GM7A 3JASA 2Z0AA 1YTFD 2HG5C 4DRXA 4DR2B 4B3MO 3IJ4A 2P7TC 1WA8B 4WFFA 3THOA 2ZDIA 2UXDB 4XDKA 4FLWA 3T1CA 3FB5C 3W7WA 3SYPA 4L87A 3RN4A 1IXBA 4TOIA 2OTJV 3VOUA 2CH7B 1VF6C 3ZHVA 4PA4A 1FD9A 4X89A 4FLZA 4JTCB 2KG7A 1L1FA 1XL6A 2Q4PA 4B3TO 4O4JA 3OAAG 2EJ7A 1JQ0A 3ABLC 1LUWA 3HPLC 4CC5A 3H01A 5DN6G 3FYEB 5KMGB 4F6RA 5JJJB 4LC1A 1IBKB 4FLXA 1Q81W 3U11A 3OUFA 2M6YA 1HNWB 3K9AA 5HFLA 4I7ZB 4PA3A 1Y76A 2IJHA 2GUZA 3FFQA 4DR6B 2EX3A 4IHJA 4A5UB 3CCVV 1RPRA 2GSMB 4HNAB 3RW0A 1XMOO 2JK5C 4FLTA 3U0ZA 3PN1A 3ZEDA 2VRZA 3G80A 3H1IH 4X65O 2ITDC 3SR2C 2O57A 4DR5B 3AG3B 3K04A 3OW2U 1BQZA 2WLKA 1N0NA 3MDSA 4P2ZA 4TV8B 1XOUA 3A0HZ 3OUSA 1MMMA 2OT5A 4J7KA 2N74A 2BSKA 3RYFB 4OPHA 1XL4A 2CK3G 1QCEA 3JD2A 2PYJA 5CB4B 4BR6A 2HHHB 2OYQA 1XNRO 2JRIA 4X64O 4IIJB 1OHHG 1VQNV 4NXMO 4DK0A 4X1IA 5LOVA 4YJ2B 5E79Z 5LA6A 3ICXA 5DEDA 3DSQA 4GZRB 3ML0A 1H2KA 2MW2B 1KUQA 1QVFU 4W4LA 1YSCA 4I4TA 2PUSA 4RAIA 1QR8A 3RYIB 1ZWIC 1K73W 2RNBA 3ZMVA 1RPOA 1S0VA 1CXZB 3KG2A 2F43G 1JPXA 1AROP 4DR2O 2D2CB 2RCVA 4BIZA 3AK2A 3JALB 1BGYH 2BTQA 3OMNB 1AJQA 1Y74B 3DC5A 2GTAA 5L3DA 2UXXA 3OTFA 3RYCB 1BT8A 3H1KH 2WLIB 3TJTA 2QSAA 2UUAO 4JV5B 4FLYA 1BSMA 3QNEA 5KUMA 1DK1A 1GN4A 5LYJA 1P7GA 2Y0IA 4U3FH 5J2TB 1IZ3A 2XAQA 4YY3O 3OEEG 2HLDG 1CP9A 3MD0A 3E8GA 3BRCA 3JD4A 2EIJB 4NTYA 1R73A 1HW7A 1Y76B 2GUZB 1VARA 2XASA 1FYJA 2QWQB 3X2QB 2LFSA 5L3EA 2ZQMA 2YC0A 2DQ3A 3K06A 3HKCB 3Q4HA 4JYAO 5H9CA 2W0FC 1P49A 4LF7B 4X20B 1KQSU 4O4HA 2QE7G 2Q0AA 2EIMC 4RO2A 1XBLA 1IBMO 4Z1VA 1K5SA 1NKDA 2ZIOA 2PY5A 2R9IA 5LGUA 4DR1B 2YUAA 3M8AA 3JALA 2QKSA 1ZTEA 2DN9A 4RUEA 1BHAA 1PKXA 4I0XA 4TQFA 4JYCA 4P30A 5FL7G 2LJ2A 1L0LH 1M1KW 1V9PA 1V55C 4GUNA 3ZN1A 4UFZA 5C93A 3C3SA 4UVCA 3VBBA 1WB7A 2KKWA 3OR6C 4X20A 4DR4O 3N2GA 3E8FA 3W7SA 3W7TA 4UV9A 3RYCA 1J5EB 4ZI7B 4CS3A 3WB0A 2QWRB 3K5NA 2NR5A 5HFMA 3APOA 4DV7O 4BIOA 2LO1A 1GN3A 5LMNB 3EXAA 3IAYA 3FAVB 4ZHQB 3L70H 2DMXA 1N33B 5IWAB 2RMKB 3O9OA 2UU9O 4JAUA 2WWWA 3OGCC 3JAWB 2ZT9B 1S72V 2Y69B 2UUCO 1N32O 2ZR3A 1FS0G 4DR3B 1GH6A 1K7DA 1RM1C 4TUYA 1SQQH 2Y4TA 3OFNG 3E35A 2PZSA 3A2FA 1OCRB 1BE3H 4DV1B 1RSOB 5J9PC 3JCUZ 1K5QA 4QNHB 1H38A 4UXNA 1HNXO 4OXSA 3CSXA 3UT5B 3ZS8C 4QIWF 2PYLA 5LMUB 1NR1A 5KLVH 2E5LO 1O9HA 2QDOA 5KHJA 4NYKA 3ABUA 1HR0O 3JAWA 1YJ9V 2XNDG 5LMUO 4EB6B 1VF6A 3DXRA 3H1JH 3RFRA 2JDIG 4LFAB 4DV3B 4WF9V 4JTDB 1GTOA 4LF9B 1NZ6A 1I94O 1D5NA 3GVMA 1MNGA 1KYOF 4TT3G 3TCUA 5IDJA 1OCOC 4ZI7A 4JAAA 4O4LA 5CB4A 5GW7A 3ABLB 3OEHG 1OZ0A 4K3AA 3KCYA 4FVMA 4JV5O 3E83A 1MOFA 4YJ2A 2R9RB 5JCOC 1NTZH 3ETEA 3CE2A 3CJHB 4NVPA 1P4RA 1VQ5V 4G2KA 4JI7B 1F4MA 4Z1MG 3VQXA 1TUBB 2E74B 1SA0B 1VQ4V 2Q73A 2H94A 3ZIAG 1FXKB 4ABMA 2JS3A 2WLLB 2JEXA 2QM8A 2YEVB 1AI7A 1XQ8A 4ZKIA 2CTRA 2HVJC 2Q69A 1FKAO 3GB7C 3E2EA 5JQGB 3OMAB 3D36C 2JIZG 4UB6Z 2L6LA 3J7AU 3HKEB 4MVQA 1L8DA 2YXYA 4FK5C 1Q90D 4YIOA 2VS0A 2YIBD 4JF3A 1M90W 2QEXV 4MSWC 4DR6O 5JH7A 4KP4A 4AILC 2V7QG 4GKJO 4UCTA 2UXCB 3DXRB 1ZL8A 1EN4A 2F4VB 2EZOA 5CBHA 1H2GA 3AG4B 1YDXA 4CH6A 1KD1W 3LDDA 4FPPA 1DLBA 5CA0B 4OPAA 1KP3A 2N04A 5IY5C 3BA8A 2B1IA 1F51A 3ZMTA 4J9YB 1JOYA 1UPGA 2EIKC 3CC4V 1VF5B 3FYIB 4HZ3A 3JASB 5IYZB 2PI5A 1MA1A 1GKFA 3UQ8A 2YI8A 3RYFA 1IX9A 3ABMC 3S3WA 1AB3A 1R3LC 1UFIA 1B6QA 2IU0A 1K4DC 3GWKC 1GO3F 2P06A 1GMGA 3ZHQA 2CH7A 1EZJA 3TGUH 3ZX6A 4K8XA 4GX2A 4BW9A 1WP8A 3HB3B 3T1HO 2Z3YA 3HKDB 1H8EG 5H6QA 1WN7A 4GKKO 1BQ0A 5GTHZ 2E76B 1N34B 1K4CC 2EILC 1IBLO 1VQ8V 4CS2A 1YITV 1AR4A 3G4SV 5LL6Y 4QPKA 2ZDIC 5IY5B 2DJVA 3P3PA 1X4TA 1SQPH 4K8ZA 2EIKB 4LWSA 1TA8A 3IC9A 5IJ0B 3N2GB 2DOSA 1SC5B 2E5LB 2ADQB 3OMIB 4JYAB 4DV6B 2P90A 2YIBA 4MS2A 5KX5B 2LW7A 4LH6A 4DV2B 4D6TH 4OGQB 2OWOA 2GDSA 4LF6B 2RJZA 4LFCB 1SZTA 3BEHA 1WAZA 4U3JA 5A2QN 3K3WA 1FFXB 3AG1C 3K9SA 5BY1A 3QG5A 3CRAA 4JGSA 2EINC 3FKSG 3RVYA 1R1BA 1AP5A 4O4IA 4NXNB 2HEPA 2QR4A 2C2AA 3LNNA 1SETA 3EHBB 4O4IB 1E1RG 2A06H 2BOCC 5IE9A 4JAVA 2LP7A 2EULA 3A0RA 4X1KA 1SA0A 3FD9A 5B3SC 1IBLB 4BWAA 4PA7A 4MVZA 1V54B 3H1LH 4PDVA 1VEWA 1VQOV 3KCXA 5J2UB 2EIMB 1Q6UA 1K3EA 2ZNJA 1QNMA 2BTQB 2HHHO 1YIJV 5LXTB 1YVWA 4H0LB 1HNZO 3E22B 3ETDA 1FJGO 4UCUA 3C90A 3SYAA 4DR1O 5FNVA 5JVDA 1KU9A 4LF6O 2DQ0A 1AILA 2B1GA 3JSNA 1VQPV 4DW1A 1JFFA 5B66Z 1TAEA 4WBNA 3T4DA 1NU1H 1XNRB 2XAJA 2A9HA 1SQGA 2JJ2G 3ZMZA 1V54C 3JAKB 4B7EA 4TSFG 5CBGA 2A0LA 4LH7A 2YS8A 2Q6AA 4DV4B 4LBEC 4O4JB 5LGTA 2UXCO 1EN6A 4HAMA 4PDLA 4O2AA 4JI5B 4YJ3A 3ABKC 3K5MA 3CCJV 3K08A 1YTFB 1G1XB 2AHZA 3M7MX 4LNUB 1J95A 1GM9A 3N2KB 5JQGA 3L74H 3B2EE 1LNQA 1K92A 2B5UA 2ILMA 2CDYA 4NR1A 1YI2V 1M57C 1WB8A 1K33A 3K58A 5H6RA 3CP1A 3OT7A 3RYIA 4B3SO 1SS3A 2V4DA 1PNLA 3RBZA 5B1AC 1TVKB 2L35A 2AXTZ 1G8MA 3BY6A 5BXZA 3CCSV 5KHIA 3OTOO 2Q68A 1PD3A 4LWSB 2FKXA 1WNSA 4PD4F 3BAAA 2IJJA 4I9QA 4OX9B 4E4EA 1IBKO 3STZC 3BA9A 3FB6C 3VQWA 2WAMA 4I4TB 3K79A 4EB6A 1H2LA 2G38A 2FB5A 4B3TB 2IM9A 4J7ZA 1PP9H 5B5EZ 4MVRA 4C7UA 4LP8A 4X1IB 3L75H 1N36O 2UUCB 1H2MA 5A9GA 1RM1B 4U3JB 4P9OA 2FYUH 5B1NA 1BS3A 1DTOA 1IDSA 4UCRA 4LNUA 3KKYA 3BPZA 3CCEV 4JI7O 2IW5A 3ZHUA 1NH2B 3BFRA 1QLEC 4LF8O 1MSWD 1Z5VA 1JFFB 4JI6B 2ZD9A 1H2SB 5IJ9B 3ZHTA 1G6UA 4CH3A 3E86A 5IT9N 3ETGA 4E2LA 1RSOA 1RFYA 4TWKA 2JEUA 3K59A 4KUMA 5LBQA 3CCMV 3CRMA 4JI0O 2KG7B 1XREA 2CAZC 2ETNA 5B1BC 3AG2B 3QTCA 3E8HA 1XHZA 5EZYA 4DV3O 3ASOB 4RQEA 2JVDA 5AG2A 4YHHO 4LF9O 1G4YB 1EBOA 1M56B 4LCUC 2JJ1G 4FFBB 4UCSA 5GTIZ 4JI3B 3RGBA 4X62B 4Q6GA 4KXRA 1E1QG 1FXVA 4DUZO 1Y4MA 1JA8A 3OR7C 1M9NA 2CGOA 2HKOA 1EZVH 3UM7A 3CXHF 2Y48A 1Y74A 3WG7B 3LNMB 2ZE7A 4TV9A 1R6NA 5IYDO 4DV2O 3D3IA 3OE7G 2UXNA 3ZN0A 4FLVA 2QJ1A 5LP6B 2F23A 2BTOA 4B3RB 4LF8B 2QWPB 2HJFC 4RUFA 2KB1A 3OM3B 4QE7A 2BSKB 5IYZA 1M5IA 3WB1A 3CC2V 2W6IG 3B40A 3ZMSA 2ADPA 3ABMB 1M93A 2PTMA 3CCUV 2WA3A 1R6TA 1SERA 3I5DA 1VMGA 2EJRA 3ZHRA 1J5EO 2BCCH 3JARB 5KHKA 3JSLA 1IBMB 3CRCA 4D7SA 1K97A 3JARA 3SYOA 4MVMA 4K0KB 3CYOA 4DR4B 4WFBV 2A7WA 1I0HA 3F7VC 2CTWA 3AK1A 2DE0X 2F95B 4CC6A 2XTAA 1GRJA 1KKCA 3P3NA 4EEQA 2ZKOA 4J80A 2XT9A 3JYCA 2CE4A 3SJCC 1SQFA 2KQXA 1MSDA 1IVSA 4JI4B 4DXWA 1BL8A 2QM7A 4JI1O 4BIUA 3IGAC 4YJ3B 1VQKV 1U96A 1S5JA 1BHBA 1KBHA 4OX9O 1KC8W 4YY3B 1ZX3A 2DYSC 3KZIZ 3TXQA 3A8TA 3D3QA 4LF7O 4QE9A 2WLHA 5LP6A 4J41A 2DWEC 1CPYA 1AP6A 1SF9A 2GBOA 3I55V 1I08A 2UUAB 1Q8IA 3C3TA 4PV1B 1HNWO 1AI6A 4JI5O 3HR0A 1N8RW 3D8CA 1ZSPA 1TUBA 2VWJA 4IL6Z 1I5YA 1AR1B 2H3OA 5FLXN 5J2UA 4B08A 2W6JG 2DYRC 2P4VA 1GM8A 3SYCA 1ZL8B 2HVKC 4GCZA 2X0LA 1Q6HA 2Q0OC 4JI3O 2WPDG 3CJHA 5LXTA 3ETQA 1XNQO 1EN5A 3F5TA 5CA1A 2DYSB 1QBZA 1JJ2U 1EM1A 3Q4HB 4AI8A 4LFBB 4G27B 3MHHC 1S5LZ 1GAXA 3RWRD 4MVOA 4DUZB 4NXMB 4I0XB 5E1AC 4NTXA 5JVDB 4O2BB 4FIPC 1XHXA 4JASA 1URFA 2YIAA 4DK1A 3W7UA 2E75B 2Y0PA 1HWYA 4ASUG 3B4SA 4GX1A 1AVMA 4CZZA 4WFAV 3G6EV 4JI4O 1PL0A 4LFAO 3CRRA 4I5SA 1WA8A 1Q6IA 1YXBA 3L72H 1MZFA 3OTOB 2YDEA 1QQCA 4O2AB 5BMVB 1PM9A 3SPIA 2A3QA 5LHGA 2ZCEA 1OCRC 5IJ9A 3SPCA 2ZIMA 4WFEA 4PA6A 3EFFK 4MTXA 3LSSA 4UVAA 3U10A 4F6RB 4JI0B 1NT2B 4I55A 3FX7A 4X1YB 2JGDB 5KA5A 1THZA 4P9PA 4J11A 3CRQA 1M4UA 1AR5A 4O2BA 2AZ2A
chains in the Genus database with same CATH topology
5D5QA 5J2TB 3HKBB 4IHJB 3E22B 3K57A 4UCUA 4YHHB 3BRCA 4B3SB 5FNVA 5JVDA 1KU9A 5LOVB 1HW7A 3JSNA 1JFFA 1TAEA 4WBNA 4HNAA 3HKCB 4KL1A 1XNRB 1SQGA 3JAKB 1JMKC 4I50B 1P49A 3VQYA 4LF7B 4X20B 4UCOA 1HR0B 4O4HA 5KHHA 4LH7A 3JAKA 5EYPB 4CS4A 4DV4B 4O4JB 2Q0AA 4O2AA 4X1KB 4L8JA 4JI5B 4YJ3A 4ZOLA 1HNXB 2ZIOA 3K5MA 2PY5A 4CH4A 1VF7A 3M7MX 4LNUB 4DR1B 1XI1A 3N2KB 3JALA 5JQGA 4TQDA 4TQFA 5JJNB 3B2EE 4JI2B 3N2KA 4O4LB 3K5LA 1V9PA 2F1MA 4UFZA 1Q5OA 5LP6C 2UU9B 3K58A 3HKDA 1N32B 3RYIA 5D5PA 2V4DA 2KKWA 4X20A 3N2GA 1TVKB 5ITZB 4IIJA 5KHIA 1ZAUA 3RYCA 1J5EB 2VQFB 4LF4B 2R9AA 4ZI7B 4CS3A 3WB0A 5BMVA 3K5NA 1WNSA 3BAAA 5FPRA 4I9QA 2JS5A 5LMNB 1YEWA 4OX9B 3T1YB 2ZM6B 2E3CA 3IAYA 5EZYB 4ZHQB 3BA9A 5C8YA 5J2TA 2VQEB 3VQWA 5IWAB 4DV0B 1N33B 1XMQB 3JAWB 4DV7B 2R72A 1HNZB 3VQVA 2GV9A 4DR3B 4I4TB 4EB6A 4B3MB 1WPBA 4B3TB 2IM9A 4TUYA 2PZSA 4X1IB 3A2FA 2P22C 3WB2A 2UUCB 4FM2A 5JH7B 4U3JB 1D5AA 1DGSA 3K5OA 4FM0A 4DV1B 4UCRA 4LNUA 3BPZA 5K1PA 5EIBC 4GKJB 4AQYB 2UUBB 1Z5VA 1JFFB 2Q7EA 4JI6B 1H2SB 3CSXA 4TUYB 3UT5B 5IJ9B 3ZS8C 2PYLA 5LMUB 1G6UA 4DR7B 1I7FA 1XMOB 4CH3A 1O9HA 1XNQB 5KHJA 4GKKB 3CB2A 3JAWA 1RSOA 1QHTA 5FPOA 4EB6B 2PGGA 3K59A 5CA0A 3RFRA 5FNVB 4LFAB 4DV3B 4LF9B 1SKVA 1B04A 4PI0A 4ZOLB 2CAZC 3E22A 5KX5A 2JGUA 3QTCA 1KMIZ 1XHZA 5EZYA 1FJGB 4ZI7A 3SGIA 4FLUA 4O4LA 2JVDA 2VWKA 5K1XA 5CA1B 5CB4A 2YI9A 4KHPB 4FVMA 3RYHB 5EYPA 4FFBB 4YJ2A 5JCOC 2F66C 4UCSA 4EFBA 4FM1A 4NVPA 4JI3B 3RGBA 4X62B 4Q6GA 5KMGA 4JI7B 4WBNB 4UCVA 4TV9B 1Z5WA 3VQXA 1TUBB 1SA0B 5C8YB 3JATB 5KHGA 4TV9A 4DRXB 4FLVA 2QJ1A 2ZINA 5LP6B 1TGOA 2BTOA 4ZHQA 4B3RB 1XQ8A 3SJBC 4LF8B 2F93B 3QF7A 4GLXA 3JATA 3HKBA 3SJAC 5JQGB 5BR8B 5IYZA 1Q3EA 5GONA 5LA6B 3HKEB 3MAQA 1M5IA 3WB1A 4PI2A 5JJEB 1L8DA 2YXLA 5JCOA 3UT5A 2YIBD 4JI8B 1M93A 2PTMA 4X66B 4ZIBA 5JH7A 3JASA 3HKCA 4AILC 4DRXA 4DR2B 3RYHA 3JARB 5KHKA 4UCTA 2UXCB 3JSLA 3THOA 1IBMB 2UXDB 4D7SA 3JARA 4FLWA 2F4VB 4K0KB 4DR4B 3BABA 4GYCB 4TOIA 4HBNA 4CH6A 5CA0B 2F95B 1JJOA 4CC6A 2QM4A 4EEQA 4FLZA 4O4HB 1FFXA 3HKEA 3SJCC 1SQFA 3BA8A 4JI4B 4O4JA 4EFEA 4DUYB 3JASB 4YJ3B 4CC5A 4DV5B 5IYZB 4AHCA 4FFBA 1S5JA 3UQ8A 5KMGB 4F6RA 4YY3B 2YI8A 5JJJB 3RYFA 1IBKB 4FLXA 1T5EA 5LP6A 2P5OA 2UXBB 3T1HB 3U11A 1HNWB 4X65B 3FFQA 4DR6B 4X64B 2EX3A 4IHJA 4K8XA 2UUAB 1Q8IA 4BW9A 4HNAB 3HKDB 4FLTA 3U0ZA 4LF5B 1WN7A 3PN1A 3ZEDA 1N34B 3SR2C 1TUBA 4DR5B 2VWJA 2Q7GA 2ZNIA 4CS2A 5J2UA 4B08A 4JI1B 1X4TA 4K8ZA 4I55B 4TV8B 1TA8A 2XHBA 3RYFB 5LXTA 5LYJB 3ETQA 5IJ0B 3N2GB 3CHXA 2E5LB 2PYJA 5CA1A 5CB4B 1N36B 2HHHB 2OYQA 4JYAB 4DV6B 5EIBD 5IJ0A 4IIJB 2YIBA 5KX5B 4LH6A 4DV2B 4CH5A 4DK0A 4X1IA 5LOVA 4TV8A 4YJ2B 2OWOA 5LA6A 4LFBB 2RQ6A 2R70A 3ICXA 3DSQA 4LF6B 2RJZA 3RWRD 4LFCB 1I94B 4U3JA 4DUZB 4I4TA 2PUSA 4NXMB 1FFXB 3QG5A 5JVDB 3RYIB 4O2BB 1XHXA 4DK1A 2YIAA 4PHZA 4O4IA 4NXNB 2HEPA 3LNNA 4O4IB 3JALB 4LR3A 3OTOB 2BTQA 4X1YA 1QQCA 5GONB 4O2AB 4I50A 4X1KA 5BMVB 1SA0A 2ZCEA 1IBLB 5IJ9A 4BWAA 2ZIMA 3OTFA 3RYCB 4D7TA 3BHPA 5J2UB 3U10A 4F6RB 4JI0B 2ZNJA 1NT2B 4JV5B 4I55A 2BTQB 1O9GA 4X1YB 4FLYA 1TVKA 1Q43A 2Q7HA 1M4UA 5LYJA 5LXTB 5ITZA 4O2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CAZ C;  3CSX A;  3QG5 A;  3THO A;  2JS5 A;  3SJA C;  3ZS8 C;  1NT2 B;  1SKV A;  2F66 C;  2P22 C;  3ICX A;  1X4T A;  3QF7 A;  3B2E E;  3SJC C;  3SJB C; 
#chains in the Genus database with same CATH topology
 3CS5 A;  5D5Q A;  4JTA B;  1OCC C;  4IHJ B;  1JCH A;  4U7O A;  3TXS A;  2UXB O;  4YHH B;  1QVG U;  2CTQ A;  4J9Z B;  4B3S B;  1NVP D;  3BVO A;  2Z5U A;  4X88 A;  3APQ A;  3LSU A;  4JI2 O;  4HNA A;  4KL1 A;  3QVN A;  4XBF A;  1K9M W;  1KEC A;  2WLI A;  3F5W C;  4DR7 O;  2OCC C;  1US6 A;  4I50 B;  3ASN C;  3VQY A;  1HR0 B;  2QGN A;  2DW4 A;  3SPH A;  4CBC A;  2FL4 A;  4R7C A;  3LDE A;  4X1K B;  4L8J A;  2IU3 A;  1GN2 A;  2Q8V A;  4RQF A;  4CH4 A;  1FAF A;  1VF7 A;  5LGN A;  4X66 O;  1NVP B;  4MTO A;  4X62 O;  1GK9 A;  5JJN B;  1KP2 A;  3T2M A;  4MT8 A;  2FTK A;  3AG2 C;  5EK0 A;  3OD4 A;  3K5L A;  2P4K A;  3ZCC A;  2F1M A;  1N4C A;  2EZP A;  3AG7 A;  2HP8 A;  4QGP A;  3S3X A;  4JZG A;  3HKD A;  3CPW U;  5KAF Z;  1VQM V;  1SQV H;  5TIS Z;  1AJP A;  1ZAU A;  3N27 A;  2VQF B;  4LF4 B;  2GTS A;  2GHY A;  1JX9 A;  3M99 B;  2DWD C;  3DC6 A;  2BE3 A;  2XOK G;  1D2D A;  5EBW C;  5FPR A;  1PPJ H;  1MG1 A;  3QO7 A;  2F4V O;  2HJD A;  2E3C A;  2HFE C;  3B8M A;  5EZY B;  4MTG A;  1S77 D;  1VQ6 V;  2VQE B;  2ZR2 A;  4DR5 O;  1XMQ B;  1ZUQ A;  4YIP A;  5L3F A;  5B1B B;  1HNZ B;  3VQV A;  2GV9 A;  2XUM A;  4B3M B;  1WPB A;  4FFK A;  1YHQ V;  3P30 A;  1BZK A;  2P22 C;  3WB2 A;  2WLJ A;  4FM2 A;  2LQT A;  3AG3 C;  5JH7 B;  1ORQ C;  3K5O A;  2AGA A;  2QWN B;  2LFR A;  1SZX A;  1ROP A;  1SQX H;  4GKJ B;  4X9Q A;  2ZE6 A;  1SQB H;  3CCL V;  1PNM A;  4H44 B;  5JWP A;  4DR7 B;  1XMO B;  1NS1 A;  3E8B A;  1XNQ B;  3IC7 A;  1K8A W;  3JD1 A;  3IFX A;  3B09 A;  5FPO A;  4FZ1 A;  2PGG A;  2OIE A;  5B1O A;  2RN9 A;  4WFH A;  2X6C A;  5FNV B;  4FMT A;  3UO2 A;  5CMU A;  1SKV A;  4PI0 A;  2H8P C;  1H2N A;  3E22 A;  5KX5 A;  2JGU A;  5BZB A;  1FJG B;  2FML A;  3SGI A;  4FLU A;  1OCZ B;  3B77 A;  5B3S B;  4X8A A;  3FB7 C;  5K1X A;  5CA1 B;  2YI9 A;  3X2Q C;  5LHI A;  4KHP B;  5EYP A;  2F66 C;  4EFB A;  4FM1 A;  3L71 H;  3G6B A;  1NR7 A;  5IWA O;  1B3Q A;  1I5X A;  2QA4 V;  1ZLZ A;  3RVZ A;  3D36 A;  3CCQ V;  1TUE B;  1XEQ A;  1N34 O;  1QR9 A;  2CTP A;  3QO8 A;  4UVB A;  2WLL A;  1NH2 D;  1Q7Y W;  5KHG A;  1Y67 A;  1ENV A;  2ITC C;  4F4L A;  1S3J A;  4DRX B;  3AG1 B;  2YXH A;  3K03 A;  3WG7 C;  1RP3 B;  2B9Z A;  4Z2W A;  1TGO A;  4N21 A;  2IH3 C;  1QU7 A;  1N33 O;  2F93 B;  4IGG A;  2EIL B;  4GLX A;  3UKM A;  5KAI Z;  3JAT A;  2ATK C;  2RDC A;  5BR8 B;  2EBO A;  4GX5 A;  5LA6 B;  4BW5 A;  2ZM6 O;  4WCE V;  4H37 A;  1PV0 A;  4PDM A;  3UT5 A;  2LW1 A;  1FXH A;  4X66 B;  2LGW A;  2K1E A;  4LF4 O;  3HKC A;  1XUQ A;  4MW3 A;  4NXN O;  3RYH A;  3JD0 A;  4JYB A;  3K0D A;  3J80 N;  4NTW A;  1YF2 A;  1W0J G;  4LFB O;  3STL C;  5LMN O;  1M57 B;  3CC7 V;  1OCO B;  3BAB A;  4GYC B;  4HBN A;  4NB5 A;  3T1Y O;  1VQ7 V;  3GWO A;  1JJO A;  2EIN B;  5H5N A;  2QTS A;  3UCS C;  2QM4 A;  1UJW B;  1V55 B;  1PNK A;  4O4H B;  4DV6 O;  4DR3 O;  1DF4 A;  1FFX A;  3HKE A;  3W7X A;  1H8H G;  2IBZ H;  4JI8 O;  4EFE A;  2X6A A;  2YSU B;  3J81 N;  4DUY B;  2Y4U A;  1AJN A;  1OJH A;  4DV5 B;  4AHC A;  4FFB A;  4UUJ C;  4ICG A;  5IYB O;  2AW9 A;  2KSD A;  2Q67 A;  3I56 V;  1WJZ A;  3ZRX A;  1T5E A;  4MTF A;  2P5O A;  2UXB B;  3T1H B;  1U97 A;  4X65 B;  1FPO A;  3ABK B;  1P84 F;  4X64 B;  1MAB G;  3NXS A;  4Q20 A;  1QLN A;  3O65 A;  4MW8 A;  4XDJ A;  1FXK A;  4LF5 B;  4YXW G;  1LR1 A;  4R8C A;  2YEV A;  2Q7G A;  4XDL A;  2ZNI A;  5EC1 C;  4PA9 A;  4JI1 B;  1SRY A;  1GN6 A;  3ASN B;  2PI4 A;  4I55 B;  4U7N A;  5F2V O;  4RWU A;  4B3R O;  2XHB A;  4DYL A;  1R3I C;  3G67 A;  5LYJ B;  1R3K C;  1NJI W;  4FZ0 A;  3CHX A;  1N36 B;  4R6Z A;  3P32 A;  4J7J A;  5EIB D;  5IJ0 A;  2ZE8 A;  3SJQ C;  4CH5 A;  4FJC C;  5CN0 A;  4TV8 A;  2RQ6 A;  2R70 A;  3LSQ A;  4K0K O;  4H33 A;  1OCC B;  4DV5 O;  3ZMU A;  1I94 B;  1K34 A;  4QJF B;  3E89 A;  1OV9 A;  1FXK C;  1VQL V;  1W59 A;  4N23 A;  2P6J A;  2XAH A;  4PHZ A;  1E79 G;  1R6K A;  1F23 A;  4KHP O;  1XMQ O;  4LR3 A;  1XIL A;  4X1Y A;  1Y6X A;  3CEI A;  5GON B;  4AQY O;  4I50 A;  2UUB O;  4GX0 A;  1R3J C;  1VP7 A;  1AI4 A;  4F6E A;  2V1D A;  3LDC A;  2QTO A;  4PJ0 Z;  3WFV A;  5B1A B;  4D7T A;  3BHP A;  2ODM A;  3CMA V;  1CEZ A;  4K35 A;  1QLE B;  4JZ2 A;  4MVS A;  3L9D A;  1O9G A;  1TVK A;  2K9P A;  1KB9 F;  1WP7 A;  1Q43 A;  2Q7H A;  3K0G A;  5ITZ A;  3CD6 V;  1BMF G;  1F7Y A;  3HKB B;  2NNU A;  1Q82 W;  3T4Z A;  2WLM A;  3UO3 A;  3K57 A;  1Z2G A;  3ZJZ A;  3ZRW B;  3PJS K;  2WLN A;  3MHS C;  5LOV B;  2JGD A;  4JYY A;  1S5H C;  4H13 B;  3ABT A;  5LHH A;  3FB8 C;  3ASO C;  1Y66 A;  2X7R B;  1JMK C;  2IJI A;  1AI5 A;  1WLE A;  4UCO A;  3JCZ A;  4PEL A;  5KHH A;  4LFC O;  3JAK A;  1NI8 A;  2ZXW C;  5EYP B;  4CS4 A;  3WU2 Z;  2X6B A;  1NQT A;  3L73 H;  4DUY O;  1BCC H;  3ZRV A;  2VQE O;  4JPR A;  4ZOL A;  1HNX B;  3DGE A;  5H2F Z;  1XI1 A;  1LUV A;  4TQD A;  1IXM A;  5CBF A;  2QKA A;  5IYC O;  4JI2 B;  3N2K A;  2A79 B;  1MZE A;  4O4L B;  4I9W A;  3OGI B;  4B7K A;  1WPX A;  5BR8 O;  2OIG A;  1Q5O A;  5LP6 C;  2QWO B;  2UU9 B;  1X59 A;  1COW G;  3AEI A;  3H1H H;  1N32 B;  3AG4 C;  5D5P A;  1YJN V;  3ZBH A;  5DEC A;  2ZE5 A;  3R66 A;  5ITZ B;  4IIJ A;  1KKD A;  1PL4 A;  2ZXW B;  4DO2 A;  2R9A A;  1M56 C;  4J10 A;  4DW0 A;  1B06 A;  5DM6 V;  5BMV A;  5L3B A;  3AK3 A;  2JS5 A;  1YEW A;  3T1Y B;  2ZM6 B;  1HP8 A;  2Y69 C;  1HDJ A;  5C8Y A;  4DV4 O;  1A32 A;  5J2T A;  4DV0 B;  3CCR V;  4EKW A;  4DV7 B;  3ZRW A;  2R72 A;  3TET A;  4DV1 O;  1W0K G;  4UB8 Z;  1OCZ C;  3JD3 A;  2WSS G;  2VQF O;  4MVU A;  2EIJ C;  3CXC U;  2MK3 A;  4W4K A;  4IYI A;  4JI6 O;  1D5A A;  1DGS A;  1JR9 A;  4FM0 A;  1VQ9 V;  1F4N A;  3SPG A;  4IYH A;  3ZHS A;  5K1P A;  5EIB C;  2W0X A;  4GT1 A;  4AQY B;  2UUB B;  2Q7E A;  3F7Y C;  3DTU B;  4TUY B;  2P67 A;  1XDC A;  4G28 B;  3SYQ A;  2D3O W;  1S76 D;  2ARH A;  4R50 A;  1I7F A;  2QKC A;  5KA6 A;  1L0N H;  4GKK B;  2LGQ A;  2Q5Z A;  5EBM C;  3CB2 A;  4UV8 A;  1YJW V;  1QHT A;  4IT5 A;  4QPJ A;  5CA0 A;  3A0B Z;  5L3C A;  4NKG B;  3EVK A;  3B8N A;  3TK1 A;  1FFT B;  4HYO A;  1B04 A;  1P7B A;  4ZOL B;  5KUK A;  2XAG A;  5CA3 A;  3ZRS A;  2NLJ C;  3JAM N;  2IJK A;  1KMI Z;  2CGN A;  2UXD O;  3SDL A;  2VWK A;  2CUG A;  2OCH A;  3QO5 A;  2HR3 A;  1NTK H;  2XAF A;  3RYH B;  1NTM H;  3SPJ A;  1SES A;  4KFM A;  2IH1 C;  3BCC H;  3G71 V;  1Q86 W;  1YCI A;  5KMG A;  4DV0 O;  1JVM A;  4PDR A;  2YID A;  4BAY A;  3CX5 F;  3NR7 A;  2AHY A;  4WBN B;  5EC2 C;  4UCV A;  4ZBM A;  4TV9 B;  1Z5W A;  4LF5 O;  5C8Y B;  1EFR G;  3JAT B;  4WFG A;  2BOB C;  2N05 A;  2PF4 E;  2ZIN A;  1W2B U;  3FAV A;  4ZHQ A;  3H9V A;  2AZ0 A;  3R65 A;  2YIC A;  3SJB C;  1N0J A;  1NBM G;  2OCC B;  2OTL V;  2WA4 A;  3QF7 A;  1VIB A;  2M7W A;  4J42 A;  5EBL C;  2Q9L A;  3HKB A;  1IUR A;  3CME V;  1DF5 A;  3SJA C;  5L3G A;  1YZB A;  2DYR B;  3CWB H;  1Q3E A;  3RT3 C;  5GON A;  3MAQ A;  3LUT B;  4PI2 A;  5JJE B;  2YXL A;  5JCO A;  2NN4 A;  4JI8 B;  4ZIB A;  1GM7 A;  3JAS A;  2Z0A A;  1YTF D;  2HG5 C;  4DRX A;  4DR2 B;  4B3M O;  3IJ4 A;  2P7T C;  1WA8 B;  4WFF A;  3THO A;  2ZDI A;  2UXD B;  4XDK A;  4FLW A;  3T1C A;  3FB5 C;  3W7W A;  3SYP A;  4L87 A;  3RN4 A;  1IXB A;  4TOI A;  2OTJ V;  3VOU A;  2CH7 B;  1VF6 C;  3ZHV A;  4PA4 A;  1FD9 A;  4X89 A;  4FLZ A;  4JTC B;  2KG7 A;  1L1F A;  1XL6 A;  2Q4P A;  4B3T O;  4O4J A;  3OAA G;  2EJ7 A;  1JQ0 A;  3ABL C;  1LUW A;  3HPL C;  4CC5 A;  3H01 A;  5DN6 G;  3FYE B;  5KMG B;  4F6R A;  5JJJ B;  4LC1 A;  1IBK B;  4FLX A;  1Q81 W;  3U11 A;  3OUF A;  2M6Y A;  1HNW B;  3K9A A;  5HFL A;  4I7Z B;  4PA3 A;  1Y76 A;  2IJH A;  2GUZ A;  3FFQ A;  4DR6 B;  2EX3 A;  4IHJ A;  4A5U B;  3CCV V;  1RPR A;  2GSM B;  4HNA B;  3RW0 A;  1XMO O;  2JK5 C;  4FLT A;  3U0Z A;  3PN1 A;  3ZED A;  2VRZ A;  3G80 A;  3H1I H;  4X65 O;  2ITD C;  3SR2 C;  2O57 A;  4DR5 B;  3AG3 B;  3K04 A;  3OW2 U;  1BQZ A;  2WLK A;  1N0N A;  3MDS A;  4P2Z A;  4TV8 B;  1XOU A;  3A0H Z;  3OUS A;  1MMM A;  2OT5 A;  4J7K A;  2N74 A;  2BSK A;  3RYF B;  4OPH A;  1XL4 A;  2CK3 G;  1QCE A;  3JD2 A;  2PYJ A;  5CB4 B;  4BR6 A;  2HHH B;  2OYQ A;  1XNR O;  2JRI A;  4X64 O;  4IIJ B;  1OHH G;  1VQN V;  4NXM O;  4DK0 A;  4X1I A;  5LOV A;  4YJ2 B;  5E79 Z;  5LA6 A;  3ICX A;  5DED A;  3DSQ A;  4GZR B;  3ML0 A;  1H2K A;  2MW2 B;  1KUQ A;  1QVF U;  4W4L A;  1YSC A;  4I4T A;  2PUS A;  4RAI A;  1QR8 A;  3RYI B;  1ZWI C;  1K73 W;  2RNB A;  3ZMV A;  1RPO A;  1S0V A;  1CXZ B;  3KG2 A;  2F43 G;  1JPX A;  1ARO P;  4DR2 O;  2D2C B;  2RCV A;  4BIZ A;  3AK2 A;  3JAL B;  1BGY H;  2BTQ A;  3OMN B;  1AJQ A;  1Y74 B;  3DC5 A;  2GTA A;  5L3D A;  2UXX A;  3OTF A;  3RYC B;  1BT8 A;  3H1K H;  2WLI B;  3TJT A;  2QSA A;  2UUA O;  4JV5 B;  4FLY A;  1BSM A;  3QNE A;  5KUM A;  1DK1 A;  1GN4 A;  5LYJ A;  1P7G A;  2Y0I A;  4U3F H;  5J2T B;  1IZ3 A;  2XAQ A;  4YY3 O;  3OEE G;  2HLD G;  1CP9 A;  3MD0 A;  3E8G A;  3BRC A;  3JD4 A;  2EIJ B;  4NTY A;  1R73 A;  1HW7 A;  1Y76 B;  2GUZ B;  1VAR A;  2XAS A;  1FYJ A;  2QWQ B;  3X2Q B;  2LFS A;  5L3E A;  2ZQM A;  2YC0 A;  2DQ3 A;  3K06 A;  3HKC B;  3Q4H A;  4JYA O;  5H9C A;  2W0F C;  1P49 A;  4LF7 B;  4X20 B;  1KQS U;  4O4H A;  2QE7 G;  2Q0A A;  2EIM C;  4RO2 A;  1XBL A;  1IBM O;  4Z1V A;  1K5S A;  1NKD A;  2ZIO A;  2PY5 A;  2R9I A;  5LGU A;  4DR1 B;  2YUA A;  3M8A A;  3JAL A;  2QKS A;  1ZTE A;  2DN9 A;  4RUE A;  1BHA A;  1PKX A;  4I0X A;  4TQF A;  4JYC A;  4P30 A;  5FL7 G;  2LJ2 A;  1L0L H;  1M1K W;  1V9P A;  1V55 C;  4GUN A;  3ZN1 A;  4UFZ A;  5C93 A;  3C3S A;  4UVC A;  3VBB A;  1WB7 A;  2KKW A;  3OR6 C;  4X20 A;  4DR4 O;  3N2G A;  3E8F A;  3W7S A;  3W7T A;  4UV9 A;  3RYC A;  1J5E B;  4ZI7 B;  4CS3 A;  3WB0 A;  2QWR B;  3K5N A;  2NR5 A;  5HFM A;  3APO A;  4DV7 O;  4BIO A;  2LO1 A;  1GN3 A;  5LMN B;  3EXA A;  3IAY A;  3FAV B;  4ZHQ B;  3L70 H;  2DMX A;  1N33 B;  5IWA B;  2RMK B;  3O9O A;  2UU9 O;  4JAU A;  2WWW A;  3OGC C;  3JAW B;  2ZT9 B;  1S72 V;  2Y69 B;  2UUC O;  1N32 O;  2ZR3 A;  1FS0 G;  4DR3 B;  1GH6 A;  1K7D A;  1RM1 C;  4TUY A;  1SQQ H;  2Y4T A;  3OFN G;  3E35 A;  2PZS A;  3A2F A;  1OCR B;  1BE3 H;  4DV1 B;  1RSO B;  5J9P C;  3JCU Z;  1K5Q A;  4QNH B;  1H38 A;  4UXN A;  1HNX O;  4OXS A;  3CSX A;  3UT5 B;  3ZS8 C;  4QIW F;  2PYL A;  5LMU B;  1NR1 A;  5KLV H;  2E5L O;  1O9H A;  2QDO A;  5KHJ A;  4NYK A;  3ABU A;  1HR0 O;  3JAW A;  1YJ9 V;  2XND G;  5LMU O;  4EB6 B;  1VF6 A;  3DXR A;  3H1J H;  3RFR A;  2JDI G;  4LFA B;  4DV3 B;  4WF9 V;  4JTD B;  1GTO A;  4LF9 B;  1NZ6 A;  1I94 O;  1D5N A;  3GVM A;  1MNG A;  1KYO F;  4TT3 G;  3TCU A;  5IDJ A;  1OCO C;  4ZI7 A;  4JAA A;  4O4L A;  5CB4 A;  5GW7 A;  3ABL B;  3OEH G;  1OZ0 A;  4K3A A;  3KCY A;  4FVM A;  4JV5 O;  3E83 A;  1MOF A;  4YJ2 A;  2R9R B;  5JCO C;  1NTZ H;  3ETE A;  3CE2 A;  3CJH B;  4NVP A;  1P4R A;  1VQ5 V;  4G2K A;  4JI7 B;  1F4M A;  4Z1M G;  3VQX A;  1TUB B;  2E74 B;  1SA0 B;  1VQ4 V;  2Q73 A;  2H94 A;  3ZIA G;  1FXK B;  4ABM A;  2JS3 A;  2WLL B;  2JEX A;  2QM8 A;  2YEV B;  1AI7 A;  1XQ8 A;  4ZKI A;  2CTR A;  2HVJ C;  2Q69 A;  1FKA O;  3GB7 C;  3E2E A;  5JQG B;  3OMA B;  3D36 C;  2JIZ G;  4UB6 Z;  2L6L A;  3J7A U;  3HKE B;  4MVQ A;  1L8D A;  2YXY A;  4FK5 C;  1Q90 D;  4YIO A;  2VS0 A;  2YIB D;  4JF3 A;  1M90 W;  2QEX V;  4MSW C;  4DR6 O;  5JH7 A;  4KP4 A;  4AIL C;  2V7Q G;  4GKJ O;  4UCT A;  2UXC B;  3DXR B;  1ZL8 A;  1EN4 A;  2F4V B;  2EZO A;  5CBH A;  1H2G A;  3AG4 B;  1YDX A;  4CH6 A;  1KD1 W;  3LDD A;  4FPP A;  1DLB A;  5CA0 B;  4OPA A;  1KP3 A;  2N04 A;  5IY5 C;  3BA8 A;  2B1I A;  1F51 A;  3ZMT A;  4J9Y B;  1JOY A;  1UPG A;  2EIK C;  3CC4 V;  1VF5 B;  3FYI B;  4HZ3 A;  3JAS B;  5IYZ B;  2PI5 A;  1MA1 A;  1GKF A;  3UQ8 A;  2YI8 A;  3RYF A;  1IX9 A;  3ABM C;  3S3W A;  1AB3 A;  1R3L C;  1UFI A;  1B6Q A;  2IU0 A;  1K4D C;  3GWK C;  1GO3 F;  2P06 A;  1GMG A;  3ZHQ A;  2CH7 A;  1EZJ A;  3TGU H;  3ZX6 A;  4K8X A;  4GX2 A;  4BW9 A;  1WP8 A;  3HB3 B;  3T1H O;  2Z3Y A;  3HKD B;  1H8E G;  5H6Q A;  1WN7 A;  4GKK O;  1BQ0 A;  5GTH Z;  2E76 B;  1N34 B;  1K4C C;  2EIL C;  1IBL O;  1VQ8 V;  4CS2 A;  1YIT V;  1AR4 A;  3G4S V;  5LL6 Y;  4QPK A;  2ZDI C;  5IY5 B;  2DJV A;  3P3P A;  1X4T A;  1SQP H;  4K8Z A;  2EIK B;  4LWS A;  1TA8 A;  3IC9 A;  5IJ0 B;  3N2G B;  2DOS A;  1SC5 B;  2E5L B;  2ADQ B;  3OMI B;  4JYA B;  4DV6 B;  2P90 A;  2YIB A;  4MS2 A;  5KX5 B;  2LW7 A;  4LH6 A;  4DV2 B;  4D6T H;  4OGQ B;  2OWO A;  2GDS A;  4LF6 B;  2RJZ A;  4LFC B;  1SZT A;  3BEH A;  1WAZ A;  4U3J A;  5A2Q N;  3K3W A;  1FFX B;  3AG1 C;  3K9S A;  5BY1 A;  3QG5 A;  3CRA A;  4JGS A;  2EIN C;  3FKS G;  3RVY A;  1R1B A;  1AP5 A;  4O4I A;  4NXN B;  2HEP A;  2QR4 A;  2C2A A;  3LNN A;  1SET A;  3EHB B;  4O4I B;  1E1R G;  2A06 H;  2BOC C;  5IE9 A;  4JAV A;  2LP7 A;  2EUL A;  3A0R A;  4X1K A;  1SA0 A;  3FD9 A;  5B3S C;  1IBL B;  4BWA A;  4PA7 A;  4MVZ A;  1V54 B;  3H1L H;  4PDV A;  1VEW A;  1VQO V;  3KCX A;  5J2U B;  2EIM B;  1Q6U A;  1K3E A;  2ZNJ A;  1QNM A;  2BTQ B;  2HHH O;  1YIJ V;  5LXT B;  1YVW A;  4H0L B;  1HNZ O;  3E22 B;  3ETD A;  1FJG O;  4UCU A;  3C90 A;  3SYA A;  4DR1 O;  5FNV A;  5JVD A;  1KU9 A;  4LF6 O;  2DQ0 A;  1AIL A;  2B1G A;  3JSN A;  1VQP V;  4DW1 A;  1JFF A;  5B66 Z;  1TAE A;  4WBN A;  3T4D A;  1NU1 H;  1XNR B;  2XAJ A;  2A9H A;  1SQG A;  2JJ2 G;  3ZMZ A;  1V54 C;  3JAK B;  4B7E A;  4TSF G;  5CBG A;  2A0L A;  4LH7 A;  2YS8 A;  2Q6A A;  4DV4 B;  4LBE C;  4O4J B;  5LGT A;  2UXC O;  1EN6 A;  4HAM A;  4PDL A;  4O2A A;  4JI5 B;  4YJ3 A;  3ABK C;  3K5M A;  3CCJ V;  3K08 A;  1YTF B;  1G1X B;  2AHZ A;  3M7M X;  4LNU B;  1J95 A;  1GM9 A;  3N2K B;  5JQG A;  3L74 H;  3B2E E;  1LNQ A;  1K92 A;  2B5U A;  2ILM A;  2CDY A;  4NR1 A;  1YI2 V;  1M57 C;  1WB8 A;  1K33 A;  3K58 A;  5H6R A;  3CP1 A;  3OT7 A;  3RYI A;  4B3S O;  1SS3 A;  2V4D A;  1PNL A;  3RBZ A;  5B1A C;  1TVK B;  2L35 A;  2AXT Z;  1G8M A;  3BY6 A;  5BXZ A;  3CCS V;  5KHI A;  3OTO O;  2Q68 A;  1PD3 A;  4LWS B;  2FKX A;  1WNS A;  4PD4 F;  3BAA A;  2IJJ A;  4I9Q A;  4OX9 B;  4E4E A;  1IBK O;  3STZ C;  3BA9 A;  3FB6 C;  3VQW A;  2WAM A;  4I4T B;  3K79 A;  4EB6 A;  1H2L A;  2G38 A;  2FB5 A;  4B3T B;  2IM9 A;  4J7Z A;  1PP9 H;  5B5E Z;  4MVR A;  4C7U A;  4LP8 A;  4X1I B;  3L75 H;  1N36 O;  2UUC B;  1H2M A;  5A9G A;  1RM1 B;  4U3J B;  4P9O A;  2FYU H;  5B1N A;  1BS3 A;  1DTO A;  1IDS A;  4UCR A;  4LNU A;  3KKY A;  3BPZ A;  3CCE V;  4JI7 O;  2IW5 A;  3ZHU A;  1NH2 B;  3BFR A;  1QLE C;  4LF8 O;  1MSW D;  1Z5V A;  1JFF B;  4JI6 B;  2ZD9 A;  1H2S B;  5IJ9 B;  3ZHT A;  1G6U A;  4CH3 A;  3E86 A;  5IT9 N;  3ETG A;  4E2L A;  1RSO A;  1RFY A;  4TWK A;  2JEU A;  3K59 A;  4KUM A;  5LBQ A;  3CCM V;  3CRM A;  4JI0 O;  2KG7 B;  1XRE A;  2CAZ C;  2ETN A;  5B1B C;  3AG2 B;  3QTC A;  3E8H A;  1XHZ A;  5EZY A;  4DV3 O;  3ASO B;  4RQE A;  2JVD A;  5AG2 A;  4YHH O;  4LF9 O;  1G4Y B;  1EBO A;  1M56 B;  4LCU C;  2JJ1 G;  4FFB B;  4UCS A;  5GTI Z;  4JI3 B;  3RGB A;  4X62 B;  4Q6G A;  4KXR A;  1E1Q G;  1FXV A;  4DUZ O;  1Y4M A;  1JA8 A;  3OR7 C;  1M9N A;  2CGO A;  2HKO A;  1EZV H;  3UM7 A;  3CXH F;  2Y48 A;  1Y74 A;  3WG7 B;  3LNM B;  2ZE7 A;  4TV9 A;  1R6N A;  5IYD O;  4DV2 O;  3D3I A;  3OE7 G;  2UXN A;  3ZN0 A;  4FLV A;  2QJ1 A;  5LP6 B;  2F23 A;  2BTO A;  4B3R B;  4LF8 B;  2QWP B;  2HJF C;  4RUF A;  2KB1 A;  3OM3 B;  4QE7 A;  2BSK B;  5IYZ A;  1M5I A;  3WB1 A;  3CC2 V;  2W6I G;  3B40 A;  3ZMS A;  2ADP A;  3ABM B;  1M93 A;  2PTM A;  3CCU V;  2WA3 A;  1R6T A;  1SER A;  3I5D A;  1VMG A;  2EJR A;  3ZHR A;  1J5E O;  2BCC H;  3JAR B;  5KHK A;  3JSL A;  1IBM B;  3CRC A;  4D7S A;  1K97 A;  3JAR A;  3SYO A;  4MVM A;  4K0K B;  3CYO A;  4DR4 B;  4WFB V;  2A7W A;  1I0H A;  3F7V C;  2CTW A;  3AK1 A;  2DE0 X;  2F95 B;  4CC6 A;  2XTA A;  1GRJ A;  1KKC A;  3P3N A;  4EEQ A;  2ZKO A;  4J80 A;  2XT9 A;  3JYC A;  2CE4 A;  3SJC C;  1SQF A;  2KQX A;  1MSD A;  1IVS A;  4JI4 B;  4DXW A;  1BL8 A;  2QM7 A;  4JI1 O;  4BIU A;  3IGA C;  4YJ3 B;  1VQK V;  1U96 A;  1S5J A;  1BHB A;  1KBH A;  4OX9 O;  1KC8 W;  4YY3 B;  1ZX3 A;  2DYS C;  3KZI Z;  3TXQ A;  3A8T A;  3D3Q A;  4LF7 O;  4QE9 A;  2WLH A;  5LP6 A;  4J41 A;  2DWE C;  1CPY A;  1AP6 A;  1SF9 A;  2GBO A;  3I55 V;  1I08 A;  2UUA B;  1Q8I A;  3C3T A;  4PV1 B;  1HNW O;  1AI6 A;  4JI5 O;  3HR0 A;  1N8R W;  3D8C A;  1ZSP A;  1TUB A;  2VWJ A;  4IL6 Z;  1I5Y A;  1AR1 B;  2H3O A;  5FLX N;  5J2U A;  4B08 A;  2W6J G;  2DYR C;  2P4V A;  1GM8 A;  3SYC A;  1ZL8 B;  2HVK C;  4GCZ A;  2X0L A;  1Q6H A;  2Q0O C;  4JI3 O;  2WPD G;  3CJH A;  5LXT A;  3ETQ A;  1XNQ O;  1EN5 A;  3F5T A;  5CA1 A;  2DYS B;  1QBZ A;  1JJ2 U;  1EM1 A;  3Q4H B;  4AI8 A;  4LFB B;  4G27 B;  3MHH C;  1S5L Z;  1GAX A;  3RWR D;  4MVO A;  4DUZ B;  4NXM B;  4I0X B;  5E1A C;  4NTX A;  5JVD B;  4O2B B;  4FIP C;  1XHX A;  4JAS A;  1URF A;  2YIA A;  4DK1 A;  3W7U A;  2E75 B;  2Y0P A;  1HWY A;  4ASU G;  3B4S A;  4GX1 A;  1AVM A;  4CZZ A;  4WFA V;  3G6E V;  4JI4 O;  1PL0 A;  4LFA O;  3CRR A;  4I5S A;  1WA8 A;  1Q6I A;  1YXB A;  3L72 H;  1MZF A;  3OTO B;  2YDE A;  1QQC A;  4O2A B;  5BMV B;  1PM9 A;  3SPI A;  2A3Q A;  5LHG A;  2ZCE A;  1OCR C;  5IJ9 A;  3SPC A;  2ZIM A;  4WFE A;  4PA6 A;  3EFF K;  4MTX A;  3LSS A;  4UVA A;  3U10 A;  4F6R B;  4JI0 B;  1NT2 B;  4I55 A;  3FX7 A;  4X1Y B;  2JGD B;  5KA5 A;  1THZ A;  4P9P A;  4J11 A;  3CRQ A;  1M4U A;  1AR5 A;  4O2B A;  2AZ2 A; 
#chains in the Genus database with same CATH homology
 5D5Q A;  5J2T B;  3HKB B;  4IHJ B;  3E22 B;  3K57 A;  4UCU A;  4YHH B;  3BRC A;  4B3S B;  5FNV A;  5JVD A;  1KU9 A;  5LOV B;  1HW7 A;  3JSN A;  1JFF A;  1TAE A;  4WBN A;  4HNA A;  3HKC B;  4KL1 A;  1XNR B;  1SQG A;  3JAK B;  1JMK C;  4I50 B;  1P49 A;  3VQY A;  4LF7 B;  4X20 B;  4UCO A;  1HR0 B;  4O4H A;  5KHH A;  4LH7 A;  3JAK A;  5EYP B;  4CS4 A;  4DV4 B;  4O4J B;  2Q0A A;  4O2A A;  4X1K B;  4L8J A;  4JI5 B;  4YJ3 A;  4ZOL A;  1HNX B;  2ZIO A;  3K5M A;  2PY5 A;  4CH4 A;  1VF7 A;  3M7M X;  4LNU B;  4DR1 B;  1XI1 A;  3N2K B;  3JAL A;  5JQG A;  4TQD A;  4TQF A;  5JJN B;  3B2E E;  4JI2 B;  3N2K A;  4O4L B;  3K5L A;  1V9P A;  2F1M A;  4UFZ A;  1Q5O A;  5LP6 C;  2UU9 B;  3K58 A;  3HKD A;  1N32 B;  3RYI A;  5D5P A;  2V4D A;  2KKW A;  4X20 A;  3N2G A;  1TVK B;  5ITZ B;  4IIJ A;  5KHI A;  1ZAU A;  3RYC A;  1J5E B;  2VQF B;  4LF4 B;  2R9A A;  4ZI7 B;  4CS3 A;  3WB0 A;  5BMV A;  3K5N A;  1WNS A;  3BAA A;  5FPR A;  4I9Q A;  2JS5 A;  5LMN B;  1YEW A;  4OX9 B;  3T1Y B;  2ZM6 B;  2E3C A;  3IAY A;  5EZY B;  4ZHQ B;  3BA9 A;  5C8Y A;  5J2T A;  2VQE B;  3VQW A;  5IWA B;  4DV0 B;  1N33 B;  1XMQ B;  3JAW B;  4DV7 B;  2R72 A;  1HNZ B;  3VQV A;  2GV9 A;  4DR3 B;  4I4T B;  4EB6 A;  4B3M B;  1WPB A;  4B3T B;  2IM9 A;  4TUY A;  2PZS A;  4X1I B;  3A2F A;  2P22 C;  3WB2 A;  2UUC B;  4FM2 A;  5JH7 B;  4U3J B;  1D5A A;  1DGS A;  3K5O A;  4FM0 A;  4DV1 B;  4UCR A;  4LNU A;  3BPZ A;  5K1P A;  5EIB C;  4GKJ B;  4AQY B;  2UUB B;  1Z5V A;  1JFF B;  2Q7E A;  4JI6 B;  1H2S B;  3CSX A;  4TUY B;  3UT5 B;  5IJ9 B;  3ZS8 C;  2PYL A;  5LMU B;  1G6U A;  4DR7 B;  1I7F A;  1XMO B;  4CH3 A;  1O9H A;  1XNQ B;  5KHJ A;  4GKK B;  3CB2 A;  3JAW A;  1RSO A;  1QHT A;  5FPO A;  4EB6 B;  2PGG A;  3K59 A;  5CA0 A;  3RFR A;  5FNV B;  4LFA B;  4DV3 B;  4LF9 B;  1SKV A;  1B04 A;  4PI0 A;  4ZOL B;  2CAZ C;  3E22 A;  5KX5 A;  2JGU A;  3QTC A;  1KMI Z;  1XHZ A;  5EZY A;  1FJG B;  4ZI7 A;  3SGI A;  4FLU A;  4O4L A;  2JVD A;  2VWK A;  5K1X A;  5CA1 B;  5CB4 A;  2YI9 A;  4KHP B;  4FVM A;  3RYH B;  5EYP A;  4FFB B;  4YJ2 A;  5JCO C;  2F66 C;  4UCS A;  4EFB A;  4FM1 A;  4NVP A;  4JI3 B;  3RGB A;  4X62 B;  4Q6G A;  5KMG A;  4JI7 B;  4WBN B;  4UCV A;  4TV9 B;  1Z5W A;  3VQX A;  1TUB B;  1SA0 B;  5C8Y B;  3JAT B;  5KHG A;  4TV9 A;  4DRX B;  4FLV A;  2QJ1 A;  2ZIN A;  5LP6 B;  1TGO A;  2BTO A;  4ZHQ A;  4B3R B;  1XQ8 A;  3SJB C;  4LF8 B;  2F93 B;  3QF7 A;  4GLX A;  3JAT A;  3HKB A;  3SJA C;  5JQG B;  5BR8 B;  5IYZ A;  1Q3E A;  5GON A;  5LA6 B;  3HKE B;  3MAQ A;  1M5I A;  3WB1 A;  4PI2 A;  5JJE B;  1L8D A;  2YXL A;  5JCO A;  3UT5 A;  2YIB D;  4JI8 B;  1M93 A;  2PTM A;  4X66 B;  4ZIB A;  5JH7 A;  3JAS A;  3HKC A;  4AIL C;  4DRX A;  4DR2 B;  3RYH A;  3JAR B;  5KHK A;  4UCT A;  2UXC B;  3JSL A;  3THO A;  1IBM B;  2UXD B;  4D7S A;  3JAR A;  4FLW A;  2F4V B;  4K0K B;  4DR4 B;  3BAB A;  4GYC B;  4TOI A;  4HBN A;  4CH6 A;  5CA0 B;  2F95 B;  1JJO A;  4CC6 A;  2QM4 A;  4EEQ A;  4FLZ A;  4O4H B;  1FFX A;  3HKE A;  3SJC C;  1SQF A;  3BA8 A;  4JI4 B;  4O4J A;  4EFE A;  4DUY B;  3JAS B;  4YJ3 B;  4CC5 A;  4DV5 B;  5IYZ B;  4AHC A;  4FFB A;  1S5J A;  3UQ8 A;  5KMG B;  4F6R A;  4YY3 B;  2YI8 A;  5JJJ B;  3RYF A;  1IBK B;  4FLX A;  1T5E A;  5LP6 A;  2P5O A;  2UXB B;  3T1H B;  3U11 A;  1HNW B;  4X65 B;  3FFQ A;  4DR6 B;  4X64 B;  2EX3 A;  4IHJ A;  4K8X A;  2UUA B;  1Q8I A;  4BW9 A;  4HNA B;  3HKD B;  4FLT A;  3U0Z A;  4LF5 B;  1WN7 A;  3PN1 A;  3ZED A;  1N34 B;  3SR2 C;  1TUB A;  4DR5 B;  2VWJ A;  2Q7G A;  2ZNI A;  4CS2 A;  5J2U A;  4B08 A;  4JI1 B;  1X4T A;  4K8Z A;  4I55 B;  4TV8 B;  1TA8 A;  2XHB A;  3RYF B;  5LXT A;  5LYJ B;  3ETQ A;  5IJ0 B;  3N2G B;  3CHX A;  2E5L B;  2PYJ A;  5CA1 A;  5CB4 B;  1N36 B;  2HHH B;  2OYQ A;  4JYA B;  4DV6 B;  5EIB D;  5IJ0 A;  4IIJ B;  2YIB A;  5KX5 B;  4LH6 A;  4DV2 B;  4CH5 A;  4DK0 A;  4X1I A;  5LOV A;  4TV8 A;  4YJ2 B;  2OWO A;  5LA6 A;  4LFB B;  2RQ6 A;  2R70 A;  3ICX A;  3DSQ A;  4LF6 B;  2RJZ A;  3RWR D;  4LFC B;  1I94 B;  4U3J A;  4DUZ B;  4I4T A;  2PUS A;  4NXM B;  1FFX B;  3QG5 A;  5JVD B;  3RYI B;  4O2B B;  1XHX A;  4DK1 A;  2YIA A;  4PHZ A;  4O4I A;  4NXN B;  2HEP A;  3LNN A;  4O4I B;  3JAL B;  4LR3 A;  3OTO B;  2BTQ A;  4X1Y A;  1QQC A;  5GON B;  4O2A B;  4I50 A;  4X1K A;  5BMV B;  1SA0 A;  2ZCE A;  1IBL B;  5IJ9 A;  4BWA A;  2ZIM A;  3OTF A;  3RYC B;  4D7T A;  3BHP A;  5J2U B;  3U10 A;  4F6R B;  4JI0 B;  2ZNJ A;  1NT2 B;  4JV5 B;  4I55 A;  2BTQ B;  1O9G A;  4X1Y B;  4FLY A;  1TVK A;  1Q43 A;  2Q7H A;  1M4U A;  5LYJ A;  5LXT B;  5ITZ A;  4O2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...