1SKVA

Crystal structure of d-63 from sulfolobus spindle virus 1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
64
structure length
64
Chain Sequence
SKEVLEKELFEMLDEDVRELLSLIHEIKIDRITGNMDKQKLGKAYFQVQKIEAELYQLIKVSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical 7.5 kDa protein
publication title Structure of d-63 from sulfolobus spindle-shaped virus 1: surface properties of the dimeric four-helix bundle suggest an adaptor protein function
pubmed doi rcsb
source organism Sulfolobus virus 1
molecule tags Viral protein
total genus 25
structure length 64
sequence length 64
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1skvA00
1X4TA 3CSXA 3SJCC 2CAZC 3SJBC 3THOA 1SKVA 3SJAC 3B2EE 3ICXA 3QF7A 3ZS8C 3QG5A 2JS5A 2P22C 2F66C 1NT2B
chains in the Genus database with same CATH superfamily
4DK1A 5FPOA 4BIUA 2JGDB 4QGPA 3VQYA 2RNBA 2H8PC 2ZM6B 4Z2WA 1NKDA 2BTOA 2NR5A 1LUWA 3O9OA 3VQVA 1WB7A 3HKDB 1YIJV 1S5LZ 1SF9A 3BEHA 4HZ3A 2M6YA 1SRYA 3SPHA 2WLIB 4NXNO 5BR8B 1MSWD 4UXNA 3FFQA 2VQEO 1H2KA 3K0DA 4HAMA 1SA0B 1F7YA 1HP8A 1MOFA 4IIJA 1M9NA 3K58A 4O4IB 1I5XA 3G6BA 2HFEC 3B40A 5A2QN 3ZMVA 2WLNA 1ZAUA 3CRCA 4U7OA 4FIPC 4TUYA 3CS5A 4JI7B 1K7DA 5KMGB 4PA3A 3ZHTA 4ICGA 1FXVA 1SQFA 1SQXH 2AZ2A 1FD9A 4D6TH 4IYIA 2D3OW 3UKMA 1S72V 5EZYA 3HB3B 1CP9A 1W2BU 2PYLA 1X59A 4JI5B 2E5LO 4CC5A 1VQ5V 5B1AB 1EM1A 3HKCA 3CC4V 1BQ0A 3CCLV 2P6JA 5LHHA 3RYCA 3RYHA 3QF7A 2X7RB 2XAJA 4B3SB 2G38A 4FVMA 1K4CC 4WBNA 5JH7B 2ZIOA 3B2EE 1GN2A 2P22C 2F66C 1AI4A 1H2LA 4LF6O 3D36C 2BCCH 4O4JB 2HKOA 1FXKA 2FB5A 2UUBB 4PD4F 3T1YO 1R1BA 4YHHB 4DV3B 1Q6IA 2CE4A 1NR1A 4DRXB 2CDYA 4DYLA 1NTMH 2QEXV 4JYCA 2X0LA 2EX3A 2V1DA 4TV9B 1IBKO 1PP9H 4E4EA 2JK5C 3GB7C 2DQ3A 2XUMA 5LL6Y 4TWKA 4KXRA 1R6KA 2UU9O 1YXBA 1NBMG 2P4KA 5CA1B 3FYIB 3THOA 1YF2A 1P84F 1UJWB 5JVDB 2YIBA 3JD1A 1QLEC 1SZTA 2CTPA 3JARB 5JCOC 2YICA 1I7FA 5LHIA 3K5MA 3FAVB 1JPXA 1RPRA 1AR5A 2XAHA 4F6RA 4JZ2A 4QNHB 3K06A 4E2LA 1JOYA 1CEZA 1XILA 1AI7A 2XNDG 2IU0A 1SQBH 2LFSA 3CYOA 4DR5O 2FKXA 3JALB 3E22A 3CD6V 1B04A 3T4DA 3SPJA 5JQGA 2WLMA 3ZRWA 4X1KB 2JS5A 4YJ2B 3APOA 2JJ1G 4QJFB 2UXCO 3RFRA 1IXMA 3T4ZA 2KSDA 4J41A 5LA6A 4X66O 2JJ2G 2JS3A 3N27A 1YTFD 1SESA 2Y48A 5LXTA 4DV1O 1S3JA 1EFRG 2CGNA 1ORQC 3LSQA 5LP6B 4DR4B 4BR6A 3D3IA 3H1HH 1R3JC 2DQ0A 3ABLC 1IDSA 4DW0A 2GSMB 3CCVV 3JYCA 5IYZA 1N36O 2CTQA 4CS4A 4AI8A 3EVKA 1FXHA 3QO7A 1EN6A 2IJJA 5JWPA 1F51A 3UM7A 3ASOB 1OCRC 1RFYA 4B7KA 5GONA 1RP3B 1M93A 4WFGA 1HNWB 4MVQA 5C8YB 4CC6A 4FLUA 1H2GA 2EILC 1GAXA 4P30A 2ZNJA 2W6JG 2CH7A 3K5NA 2IU3A 1TGOA 4I9QA 2Y69B 2JGDA 4LFAB 4DV7O 4X9QA 4FLXA 4HNAB 3AG4B 5KHIA 4MW3A 1PNLA 4LF5O 4I55B 1N33B 3SR2C 1P7GA 3CCEV 3JD3A 3JAMN 1AJQA 4MVMA 4NXMB 4O2AB 3E35A 2F23A 3KG2A 3OMNB 2WLIA 3K3WA 1O9GA 3WG7C 5L3FA 4CBCA 1NH2B 2FYUH 2R9RB 2Y4UA 1SA0A 3CHXA 4CH4A 2D2CB 4LF4B 4LBEC 1NQTA 2QE7G 3M7MX 4O4IA 1US6A 4DR1O 2P4VA 1ENVA 3S3WA 1N34O 1PNKA 4DUYB 4GX1A 3SYPA 5KMGA 1K4DC 3OGIB 3H1JH 5KLVH 1VIBA 4FM0A 1K92A 2ZINA 4EFBA 3E2EA 2BTQB 2ODMA 2A06H 5IY5C 3SJAC 5KHHA 1RSOB 1U96A 2ZXWB 3JD2A 4K0KO 4MVZA 4ZI7B 4NB5A 1F23A 4JGSA 4GKKO 1Q5OA 4NTYA 4W4KA 4JZGA 4J7JA 3LDCA 4TQDA 4DV4B 1AJNA 5JH7A 4FLWA 1V54C 2A79B 4KP4A 3ETEA 1YI2V 3JD4A 4O4JA 4I7ZB 1GRJA 1THZA 4X62B 1K3EA 5B1NA 2VS0A 4K8XA 1N32B 2P5OA 4DRXA 5B3SC 1Y67A 3TCUA 5L3CA 3QNEA 3CCMV 3ABKC 4TV9A 1K34A 2E3CA 1OCCB 4FK5C 4JV5B 2HG5C 2QR4A 2ZM6O 4NKGB 2QWOB 2LFRA 4UUJC 3C3TA 3ZS8C 1QBZA 4DV2B 3UT5A 5CA1A 3W7TA 3JSLA 5LGUA 5JVDA 5GW7A 4P9PA 2QM7A 3BFRA 4BAYA 3TK1A 5BR8O 3ZCCA 2AW9A 2Y0PA 4J11A 1AROP 3FAVA 1J5EB 3VQXA 2IH3C 1N4CA 3BHPA 5J2TB 4Z1VA 3T1CA 5B1BB 1CXZB 1K73W 1EZJA 4JI4B 3SPIA 3JALA 1K33A 3ZMTA 5KHJA 1ZL8B 4X1KA 1SERA 1B06A 4UFZA 4YJ2A 1L8DA 5IT9N 3JCUZ 3S3XA 3FD9A 2E74B 3G80A 1GKFA 3ZJZA 3IAYA 3F7YC 1LR1A 1R6TA 3ZMSA 5LP6A 2JEXA 1SS3A 4ZBMA 2EIKC 4MTXA 2QDOA 3H1KH 4JI5O 3NXSA 5FPRA 1WPBA 1EZVH 1VQNV 2E76B 1NU1H 4BWAA 3EHBB 4I4TB 3SYOA 4B3MO 1P49A 3T1HB 1XEQA 3ZEDA 2ITDC 4LC1A 3E8HA 4R50A 2ZD9A 2QSAA 1VQPV 4ZOLB 3K5LA 1AVMA 2UUBO 4O4HB 3K9AA 3JATA 5B66Z 1QR9A 1RM1C 1KKCA 4YHHO 2DMXA 4BIZA 2YXLA 4DV3O 3CCJV 3WB0A 2OCCC 3HKEB 1OJHA 3CCRV 3ABMB 1WN7A 2F1MA 4HNAA 4DK0A 4I55A 3U11A 2X6BA 3CXCU 1GMGA 1P4RA 1M56B 4O2AA 3SJBC 5KUKA 3SYQA 5L3GA 4YJ3B 1TVKB 3OT7A 4K35A 4R6ZA 2F95B 2HLDG 1F4NA 1XL4A 5K1PA 2YS8A 1SQPH 5D5QA 4J9YB 4JI1B 4FJCC 1M5IA 1ZSPA 2C2AA 3JAWB 4U3JA 3JSNA 4QIWF 2LGQA 2A0LA 5CBFA 4JAAA 4EEQA 1M57B 4LWSB 1K5QA 2R9AA 2PUSA 4NVPA 1AI5A 1NT2B 3A8TA 1X4TA 4DR4O 2CTWA 2MK3A 2BTQA 1WJZA 1RSOA 1Q86W 3MD0A 2M7WA 4KFMA 3OEEG 5EC2C 4JI2B 4X65O 2UXDB 2LO1A 4J7KA 2CK3G 5IYDO 1XMQB 1VP7A 2PYJA 1M4UA 4H44B 1N0NA 3CEIA 1LNQA 1YVWA 1VQ8V 1VEWA 5GONB 3ABUA 4UCUA 1GO3F 1YITV 1NZ6A 4B3RO 4KUMA 4JAVA 4JAUA 1TA8A 1HNWO 4DR7B 4YY3B 1VF6C 3AG7A 2DYRC 5KHGA 4O2BB 2Q7EA 3LUTB 2RQ6A 1FFXB 4PA9A 5IE9A 4GX5A 1QCEA 1RPOA 4LFAO 3E83A 1HDJA 4JTCB 4LFBO 2WA4A 3BY6A 3MDSA 4GCZA 1KBHA 4U7NA 1N33O 4OPAA 2B5UA 3OMIB 4UB6Z 1V55C 5E1AC 1R3IC 1GH6A 4NXMO 1WA8B 1FS0G 5GTHZ 5CN0A 2KKWA 4LFCB 1IVSA 1IBMO 1H2MA 1D2DA 2Q69A 5LGTA 3CRQA 5J2TA 5B5EZ 4LF4O 1IX9A 5LOVB 4LP8A 1XQ8A 3CCQV 2EJRA 4R7CA 4F6EA 3STZC 1ZL8A 5LGNA 1YJ9V 4DR3B 5L3DA 2DOSA 4UCTA 4DW1A 5KAFZ 2QJ1A 5CBHA 2B1IA 1AB3A 3ZHVA 5EBWC 4MVRA 3ZN1A 3APQA 3CCSV 4LH6A 1VF5B 1ROPA 4FFKA 2LW7A 1FFTB 4H33A 2WWWA 4X89A 1OV9A 4I4TA 4TOIA 5BZBA 4LF7O 3AEIA 3JCZA 3G4SV 4DV4O 4I5SA 5GTIZ 3IFXA 2BOBC 4K8ZA 4UV9A 4ZOLA 4PDMA 3E8BA 3SYAA 2IW5A 2CTRA 2GBOA 4O4HA 3CJHB 4X62O 1XBLA 2ZDIA 5B1OA 2B1GA 1XHXA 3VOUA 2NNUA 2YXYA 3HKEA 4PDRA 1XNRO 5F2VO 1K9MW 3ABLB 2UUCB 2QWNB 3UT5B 4J7ZA 4JASA 5JJEB 5H9CA 4G27B 4QE7A 1YEWA 1F4MA 1TAEA 3RT3C 4OX9B 2X6AA 5J2UB 3RWRD 2Q0AA 1JA8A 1QVGU 4JI6O 4UV8A 4DV2O 2EINC 3F5TA 1V9PA 2AHZA 1IXBA 1W59A 1FJGO 5CA0A 2OTLV 2ZR3A 2FL4A 4YJ3A 4DV5B 1TVKA 5JJNB 1OCRB 1S0VA 5LMUB 1J5EO 1WP7A 2ZKOA 2EILB 4MVSA 4LF9B 2NLJC 1FAFA 4F4LA 4JI4O 3JAWA 5HFMA 1KUQA 2PZSA 2YI8A 5ITZB 2QM4A 5C93A 1SC5B 3DXRB 4LWSA 3KCYA 1M1KW 2HP8A 3W7WA 2WLJA 2UXNA 3JAKB 3K03A 1I5YA 2UXBB 3KZIZ 2YIAA 1G8MA 4CH3A 3CMAV 1KP3A 5LBQA 1WNSA 1B3QA 1DLBA 1GM7A 1T5EA 3WG7B 3OTOB 2QKSA 2H94A 3ZHQA 3T1HO 2E75B 5BMVB 3JATB 2BSKB 3EXAA 1ZLZA 4I9WA 1S5JA 2W0FC 4RUEA 3TJTA 4CS2A 1PL4A 5IDJA 3BCCH 1BHBA 3WB1A 5KUMA 4FZ1A 4IYHA 2ZE5A 4O2BA 1U97A 1MSDA 3PJSK 1FFXA 3I5DA 3OMAB 5BY1A 2YSUB 2Z0AA 4FLTA 2YIDA 1KYOF 4FLYA 5IY5B 4JYAO 1PNMA 2ZNIA 4XDLA 5D5PA 2DW4A 2R70A 2A7WA 1MZFA 1GTOA 3BABA 1XNQB 5LP6C 2Q73A 3B09A 5LYJB 1WA8A 5KHKA 1KP2A 2QTOA 4NXNB 3L72H 3D36A 1H38A 2F43G 2VQEB 4DR2B 2PY5A 4B7EA 4U3JB 3VBBA 5LOVA 1AP6A 1XL6A 2VQFO 1COWG 1FPOA 3ETQA 4RO2A 2XAFA 4JI1O 2PI4A 3B8NA 3FB5C 2JEUA 1H8EG 2Y0IA 3J80N 3E86A 1BGYH 2RDCA 1NH2D 4WFAV 1H8HG 4O4LB 4PI2A 3ZRSA 3B77A 2ZCEA 1PPJH 2FTKA 4AILC 4LF8B 1HNZB 1WAZA 2P06A 1KQSU 1K8AW 4PI0A 1XMOB 4JI2O 1L1FA 5JCOA 1R3KC 5CB4B 4FFBB 4H0LB 3IC7A 2EIMC 1GN3A 3RYIA 1KD1W 1OHHG 3K57A 3RN4A 2Q67A 1HNXB 2DYSC 2WAMA 4GX2A 3WU2Z 3AK1A 2ZR2A 2ZE7A 4JYYA 4TT3G 4LF6B 4X8AA 4DR7O 3GVMA 4XDKA 4YY3O 1Y66A 3CJHA 3GWKC 4JTDB 3OW2U 1QU7A 2A3QA 1ZUQA 4FLVA 3ASNB 1WPXA 4MVUA 2CGOA 3AG2B 2F4VB 2RMKB 3DC6A 3ETGA 4B3TB 3JASB 4JI3B 4PJ0Z 1KB9F 2EIKB 4IGGA 4LR3A 1L0LH 3LDEA 4NYKA 5J2UA 3R65A 2WLHA 5EBMC 2UU9B 4MTFA 3OFNG 1B6QA 3AG3C 4UCVA 1MA1A 3RVYA 1SQQH 1N8RW 3W7SA 4UCSA 4UVAA 2XT9A 3I55V 4X1YA 5LMNB 5IYBO 3QO8A 3N2KB 3RYFB 1XHZA 1RM1B 4JI7O 4TV8B 1NVPB 4IHJB 1KECA 1JJOA 4JI8B 1JMKC 1GN6A 5ITZA 4J10A 3HR0A 2UXCB 3DXRA 4RWUA 3M8AA 1L0NH 2DWDC 3T2MA 3VQWA 1NJIW 3JAKA 2RN9A 2R72A 3TETA 2AGAA 1QNMA 2QM8A 1JQ0A 3W7UA 4DR6B 2PTMA 1AP5A 1XREA 4U3FH 2AXTZ 2JGUA 4B3SO 4PA7A 4I0XB 4JYBA 1XUQA 1LUVA 3HPLC 2EIJC 2QTSA 3A0BZ 3N2GB 5BMVA 4GUNA 3MHSC 3H1LH 1P7BA 2BSKA 4X1IB 1EN5A 1GM8A 4X64B 2VRZA 4NR1A 2KQXA 1QHTA 1IBLB 3H9VA 3E8GA 2YUAA 1R6NA 4ASUG 1G6UA 3SYCA 3K59A 2FMLA 3U0ZA 3SJQC 1VQLV 3TGUH 1YHQV 4JI0B 4EFEA 2UUCO 4OX9O 1JX9A 2IJIA 1XI1A 1DGSA 2QWRB 2Q68A 5CA0B 5IYCO 4GZRB 3OGCC 2ZE8A 1HR0B 4N23A 3IC9A 2R9IA 5LYJA 3U10A 2ADQB 2K9PA 4ABMA 1BE3H 5CA3A 2EULA 4DV5O 3SDLA 2P7TC 2YIBD 2DYRB 1G1XB 1FXKC 4LF9O 3L74H 4G28B 2OT5A 4P2ZA 1AI6A 2LW1A 1Y76B 2GUZB 1K5SA 1IZ3A 4YIPA 1N34B 4DO2A 2AHYA 2ZT9B 1BT8A 2OYQA 5IWAB 2RJZA 3EFFK 2GDSA 2WLKA 3G6EV 3X2QC 4MVOA 4IL6Z 4O4LA 1JR9A 1PM9A 1TUEB 4I50A 4FZ0A 2EBOA 2GHYA 2WLLB 3JD0A 5EYPB 1E1QG 3SJCC 4DXWA 5CB4A 4FFBA 1Z2GA 3M99B 3OTOO 3WB2A 1OCZC 4DUZB 3I56V 3ZBHA 3LDDA 1DF4A 2IJKA 4OXSA 1J95A 3A2FA 1WB8A 2DJVA 3ABTA 2RCVA 2YEVB 3AG1C 3D3QA 1R3LC 3ML0A 2DWEC 2L35A 1SQVH 4GKJB 2JVDA 2H3OA 4YXWG 4ZIBA 3CC7V 3FKSG 1GN4A 2WSSG 3DGEA 3JASA 5KAIZ 4YIOA 4DV0B 3CC2V 4KHPB 1BHAA 1M57C 3K5OA 1SKVA 3F5WC 2GTAA 3BA9A 3LSSA 4XDJA 2XOKG 4B08A 2A9HA 3K9SA 2YXHA 4H37A 4PV1B 1XOUA 1XNQO 3RVZA 2MW2B 3CMEV 1FYJA 2VWKA 2GTSA 5IJ0B 1XDCA 1EBOA 2P67A 5TISZ 1VQ7V 4BW9A 4DR2O 2V4DA 3N2KA 3RYFA 1E1RG 4AQYB 2KG7B 1Q7YW 1OCOC 1D5NA 3DSQA 4TV8A 4DUYO 4IHJA 2JDIG 4AHCA 4QPKA 3ZHSA 2OIGA 2OIEA 2OCHA 2HEPA 2X6CA 2Q7HA 3NR7A 2OTJV 3ZIAG 4CH5A 3LNMB 3ZHRA 1I0HA 1VQOV 3OD4A 1QLEB 4RQEA 3KKYA 2EINB 4LF8O 1A32A 3IGAC 3CCUV 1PL0A 3ETDA 1HNZO 3RYIB 1XMOO 4UVCA 2Q0OC 1Q8IA 1VQ6V 3E8FA 4WF9V 1JCHA 4I0XA 4Z1MG 2ETNA 4B3MB 2ZIMA 3N2GA 3ICXA 1HNXO 4X20B 1HWYA 4X88A 4X1IA 5H6QA 2Z5UA 1GK9A 1SETA 3CE2A 1N32O 1PV0A 3CRAA 2W6IG 3BVOA 4J80A 3UO2A 1I94B 4JV5O 2HJFC 3P32A 3SPCA 2O57A 2F4VO 4B3TO 3E89A 4EB6B 4JI3O 2EJ7A 4PELA 3SGIA 5KX5B 4KL1A 3P3PA 5L3EA 5B1AC 3G71V 4H13B 3H1IH 5H6RA 4X1YB 3TXSA 1BZKA 4A5UB 1NI8A 2HHHB 1JJ2U 4HBNA 1BMFG 2Q7GA 4QE9A 3HKBB 1YTFB 3H01A 4RUFA 5LMNO 1VF6A 1Q6UA 3L9DA 3ZRVA 2P90A 5H2FZ 1VF7A 2XASA 1UPGA 3FX7A 4WFBV 4QPJA 5H5NA 1Y76A 2GUZA 3CWBH 3R66A 2PF4E 4JI8O 1VQ4V 4TQFA 2QGNA 3OUFA 1VMGA 1YZBA 5FNVB 3ZRXA 2VWJA 3LNNA 4G2KA 1Y6XA 3J7AU 1SQGA 1YCIA 4LNUB 3MAQA 1MNGA 4LH7A 4BIOA 4P9OA 4CZZA 4DR6O 2WLLA 1H2NA 5EYPA 4DV6B 4X65B 1BSMA 2HVKC 2LP7A 2XAGA 2IBZH 3FB6C 4B3RB 1MABG 5J9PC 2K1EA 4JTAB 4X64O 2KB1A 1YSCA 2UUAB 1PD3A 2YEVA 3P3NA 3IJ4A 5HFLA 3BAAA 1IBLO 1E79G 3ZMZA 1HW7A 3RGBA 1Y74A 2Z3YA 3C3SA 2ARHA 3ZX6A 4JI0O 4PA4A 4PDVA 4LFBB 3OUSA 3BRCA 1S77D 3UO3A 2PI5A 3CRMA 5IJ9B 2LGWA 3K79A 2XAQA 1M90W 3ZN0A 4C7UA 2EIMB 1QR8A 2W0XA 1V54B 4W4LA 1HR0O 4NTWA 3ZMUA 3A0HZ 1VQKV 3HKDA 2DYSB 3QO5A 4PDLA 4JPRA 1N0JA 3UCSC 4UCRA 1WP8A 3SPGA 5IJ0A 1UFIA 1IBMB 3ASOC 1Q6HA 5B3SB 1Q90D 4FM2A 2KG7A 2YDEA 2JIZG 3ABKB 4K3AA 4MTOA 1IURA 5CBGA 3QTCA 5L3BA 3AK3A 1ZTEA 1YDXA 1D5AA 3L73H 4ZHQB 5IWAO 4I50B 2HJDA 2Y69C 5FL7G 1CPYA 3AG4C 4GYCB 3WFVA 5EC1C 3Q4HB 2E5LB 5DN6G 1VARA 1BQZA 1AR4A 1GM9A 2CAZC 2Q5ZA 3STLC 2UXDO 1OZ0A 3AG3B 5LHGA 1XMQO 2Q6AA 1ZX3A 2ITCC 1Q3EA 4J9ZB 3OM3B 1KC8W 3O65A 1O9HA 4UVBA 4DUZO 4Q20A 2IM9A 2WPDG 4N21A 5A9GA 4LF7B 1Z5VA 4X20A 3OR6C 3T1YB 1JFFB 2QWPB 2LJ2A 4GX0A 2YC0A 1H2SB 4CH6A 5DECA 1TUBB 2QKCA 3QVNA 3W7XA 1VQMV 1KMIZ 4GKJO 4BW5A 1IBKB 1NTZH 4D7TA 2IJHA 2N04A 4MW8A 4L87A 1BCCH 1XNRB 4EB6A 4DV0O 2LQTA 4KHPO 5K1XA 1WLEA 3FYEB 5KX5A 4MT8A 5KA5A 1Q82W 1MZEA 3G67A 3J81N 4JF3A 2ZXWC 4GT1A 4JI6B 2N74A 1K97A 2EIJB 1AILA 4HYOA 4LFCO 1URFA 1S5HC 1W0KG 3DTUB 4UB8Z 2AZ0A 4FLZA 1FJGB 3CB2A 3JARA 4IIJB 4L8JA 3ZHUA 3HKBA 4UCOA 3MHHC 4RAIA 2NN4A 2OCCB 4Q6GA 4DR5B 2WA3A 2BOCC 4TUYB 3L71H 4AQYO 3LSUA 2EZPA 2UXXA 1Y4MA 4DR3O 2JRIA 1NTKH 3CP1A 1JVMA 5E79Z 2ADPA 4X66B 3CXHF 5FNVA 5DEDA 4DV1B 3L75H 2V7QG 1MMMA 4LNUA 3ASNC 5EZYB 1OCCC 4EKWA 3K0GA 2OWOA 1NVPD 3AG2C 3DC5A 2HVJC 4OPHA 3A0RA 3HKCB 3P30A 4WFFA 1I08A 1QLNA 4R8CA 3FB8C 1N36B 3GWOA 1YJNV 3RYCB 3RYHB 3BA8A 3PN1A 1DTOA 4WBNB 3L70H 1FKAO 1Q43A 1FXKB 3OEHG 4PA6A 4WFHA 2F93B 5B1BC 4FM1A 2HR3A 3OE7G 5C8YA 1AR1B 5EIBD 5EK0A 2QKAA 3F7VC 2CUGA 4MSWC 1QQCA 3X2QB 5FLXN 3UQ8A 4DV7B 1I94O 5EBLC 3D8CA 4J42A 2Q8VA 5AG2A 4LF5B 2ZQMA 3C90A 4GLXA 1Z5WA 4LCUC 4JYAB 1KKDA 5DM6V 3CRRA 3K04A 4IT5A 2Q4PA 2YI9A 5IJ9A 4CS3A 3AK2A 1W0JG 2GV9A 1S76D 4TSFG 2N05A 1OCZB 4MS2A 2ZE6A 3OTFA 2HHHO 5LMUO 5CMUA 4PHZA 1NS1A 4F6RB 1BL8A 5EIBC 4DR1B 2ATKC 3B4SA 3AG1B 2XHBA 4WCEV 3E22B 5JQGB 4NTXA 3ZRWB 1AJPA 2VQFB 2ZDIC 5LA6B 1YJWV 2XTAA 1VQ9V 1BS3A 2Q9LA 4ZHQA 2ILMA 5LXTB 1SZXA 1V55B 2UXBO 3ABMC 2EZOA 1MG1A 1QVFU 1NR7A 5BXZA 2Y4TA 3KCXA 3Q4HA 4ZKIA 3B8MA 3RBZA 3TXQA 1DK1A 4FPPA 4K0KB 2DN9A 1DF5A 5IYZB 1M56C 3RW0A 4DV6O 4GKKB 4MTGA 4OGQB 5JJJB 3OAAG 1PKXA 2QWQB 4ZI7A 4XBFA 4D7SA 3FB7C 3OR7C 4RQFA 3CSXA 3K08A 2B9ZA 3CPWU 3CX5F 2PGGA 3QG5A 1EN4A 4FMTA 2DE0X 1OCOB 5KA6A 1R73A 1JFFA 3BPZA 1Q81W 2L6LA 1Y74B 2UUAO 2QA4V 2IH1C 2CH7B 1G4YB 1KU9A 1ZWIC 4WFEA 1TUBA 2BE3A
chains in the Genus database with same CATH topology
4DK1A 2HHHB 5FPOA 4HBNA 2Q7GA 3VQYA 4O4LB 3HKBB 4PI2A 2ZM6B 2BTOA 2ZCEA 4ZOLB 3K5LA 4AILC 4LF8B 4O4HB 1VF7A 3JATA 1HNZB 3VQVA 4PI0A 1XMOB 2YXLA 3HKDB 5JCOA 5CB4B 4FFBB 3WB0A 3HKEB 3RYIA 4TQFA 5BR8B 3K57A 5FNVB 3FFQA 2VWJA 3LNNA 1WN7A 1SQGA 2F1MA 1HNXB 1SA0B 4HNAA 4LNUB 4DK0A 4IIJA 3MAQA 3K58A 4I55A 4LH7A 4O4IB 3U11A 4LF6B 1ZAUA 4TUYA 4JI7B 5EYPA 4DV6B 5KMGB 4FLVA 4O2AA 4X65B 1SQFA 3SJBC 4YJ3B 2F4VB 1TVKB 4B3TB 3JASB 4JI3B 2F95B 4LR3A 5EZYA 4B3RB 5K1PA 2PYLA 4JI5B 5J2UA 4CC5A 5D5QA 3HKCA 4JI1B 1M5IA 2UUAB 2UU9B 3JAWB 4U3JA 3JSNA 3BAAA 4UCVA 1HW7A 4EEQA 3RYCA 3RGBA 3RYHA 3QF7A 4UCSA 4B3SB 4FVMA 4WBNA 2R9AA 5JH7B 2ZIOA 3B2EE 2PUSA 4X1YA 2P22C 2F66C 4NVPA 5LMNB 1NT2B 1X4TA 4O4JB 2BTQA 3N2KB 3RYFB 2UUBB 1XHZA 1RSOA 4LFBB 3BRCA 4TV8B 4YHHB 4JI2B 4IHJB 5IJ9B 4DV3B 2UXDB 1JJOA 4DRXB 4JI8B 1JMKC 1XMQB 2PYJA 1M4UA 5ITZA 3HKDA 2UXCB 5GONB 2EX3A 4TV9B 4UCUA 3VQWA 4UCRA 5IJ0A 1TA8A 1IBMB 3JAKA 4DR7B 2R72A 4YY3B 4FM2A 4DR6B 2PTMA 5CA1B 3THOA 5JVDB 5KHGA 2YIBA 2JGUA 4O2BB 2Q7EA 2RQ6A 3QTCA 1FFXB 3JARB 5JCOC 1I7FA 1D5AA 4ZHQB 3K5MA 4I50B 3N2GB 5BMVA 4F6RA 4GYCB 4X1IB 2E5LB 4X64B 2CAZC 3JALB 3E22A 1B04A 5JQGA 1Q3EA 1IBLB 1QHTA 4X1KB 2JS5A 4YJ2B 3T1HB 1G6UA 3RFRA 2KKWA 3K59A 5LA6A 3U0ZA 1O9HA 4LFCB 2IM9A 5LXTA 4LF7B 4DR4B 4JI0B 5LP6B 1Z5VA 4EFEA 4X20A 5J2TA 5LOVB 3T1YB 1XQ8A 1JFFB 1XI1A 1DGSA 1H2SB 4CH6A 5CA0B 5IYZA 1HR0B 4CS4A 1TUBB 3U10A 5LYJA 1KMIZ 4DR3B 1IBKB 4D7TA 4UCTA 2QJ1A 1XNRB 4EB6A 2YIBD 5GONA 1HNWB 1M93A 5K1XA 4LH6A 5C8YB 4CC6A 5KX5A 4FLUA 2ZNJA 4JI6B 3K5NA 1N34B 1TGOA 4I9QA 4I4TA 4TOIA 2OYQA 5IWAB 2RJZA 4LFAB 4FLZA 4FLXA 4HNAB 1FJGB 5KHIA 3CB2A 3JARA 4IIJB 4L8JA 4O4LA 3HKBA 4I55B 4UCOA 4K8ZA 4ZOLA 4I50A 1N33B 3SR2C 4Q6GA 4O4HA 4DR5B 4TUYB 5EYPB 3SJCC 4NXMB 4O2AB 1XHXA 4FFBA 5CB4A 3HKEA 4X66B 1O9GA 3WB2A 4DUZB 5FNVA 4DV1B 1SA0A 3CHXA 2UUCB 3UT5B 4LNUA 4CH4A 5JJEB 4LF4B 5EZYB 1YEWA 1TAEA 3M7MX 3A2FA 4O4IA 2OWOA 4OX9B 5J2UB 3HKCB 2Q0AA 3RWRD 4DUYB 5KMGA 1N36B 3RYCB 3RYHB 3BA8A 3PN1A 1V9PA 4GKJB 2JVDA 4WBNB 4FM0A 5CA0A 4DV5B 4YJ3A 4ZIBA 1TVKA 5JJNB 2ZINA 3JASA 4DV0B 4EFBA 5LMUB 4KHPB 1Q43A 2BTQB 3K5OA 1SKVA 3SJAC 5KHHA 4LF9B 3BA9A 2F93B 4B08A 4FM1A 4ZI7B 3JAWA 5C8YA 2PZSA 5EIBD 2YI8A 5ITZB 1Q5OA 2QM4A 1QQCA 4DV7B 3UQ8A 4TQDA 4DV4B 4FLWA 5JH7A 2VWKA 4LF5B 5IJ0B 4O4JA 3JAKB 4BW9A 2V4DA 3N2KA 3RYFA 4GLXA 1Z5WA 4JYAB 2UXBB 2YIAA 4X62B 4AQYB 4CH3A 3DSQA 4TV8A 4K8XA 2YI9A 1WNSA 4IHJA 5IJ9A 4CS3A 4AHCA 1N32B 2P5OA 4DRXA 2GV9A 1T5EA 3OTOB 2HEPA 3OTFA 2Q7HA 4CH5A 4TV9A 2E3CA 5BMVB 4PHZA 4JV5B 4F6RB 3JATB 1S5JA 5EIBC 4DR1B 3ZS8C 2XHBA 4DV2B 3UT5A 3E22B 4CS2A 5JQGB 3RYIB 5CA1A 3WB1A 3JSLA 2VQFB 5JVDA 1Q8IA 4O2BA 1FFXA 5LA6B 4FLTA 4ZHQA 4B3MB 2ZIMA 4FLYA 5LXTB 3N2GA 1J5EB 3ICXA 3VQXA 4X20B 2ZNIA 3BHPA 5J2TB 5D5PA 4X1IA 2R70A 4JI4B 4K0KB 3BABA 3JALA 1XNQB 5LP6C 5KHJA 5IYZB 4X1KA 4UFZA 4GKKB 4YJ2A 1L8DA 5JJJB 5LYJB 1I94B 5KHKA 4ZI7A 4D7SA 4NXNB 3CSXA 3IAYA 2PGGA 3QG5A 4EB6B 2VQEB 5LP6A 4DR2B 2PY5A 3SGIA 4U3JB 5KX5B 5LOVA 4KL1A 1JFFA 3BPZA 5FPRA 1WPBA 3ETQA 4BWAA 1KU9A 4I4TB 4X1YB 1TUBA 1P49A 3ZEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X4T A;  3CSX A;  3SJC C;  2CAZ C;  3SJB C;  3THO A;  1SKV A;  3SJA C;  3B2E E;  3ICX A;  3QF7 A;  3ZS8 C;  3QG5 A;  2JS5 A;  2P22 C;  2F66 C;  1NT2 B; 
#chains in the Genus database with same CATH topology
 4DK1 A;  5FPO A;  4BIU A;  2JGD B;  4QGP A;  3VQY A;  2RNB A;  2H8P C;  2ZM6 B;  4Z2W A;  1NKD A;  2BTO A;  2NR5 A;  1LUW A;  3O9O A;  3VQV A;  1WB7 A;  3HKD B;  1YIJ V;  1S5L Z;  1SF9 A;  3BEH A;  4HZ3 A;  2M6Y A;  1SRY A;  3SPH A;  2WLI B;  4NXN O;  5BR8 B;  1MSW D;  4UXN A;  3FFQ A;  2VQE O;  1H2K A;  3K0D A;  4HAM A;  1SA0 B;  1F7Y A;  1HP8 A;  1MOF A;  4IIJ A;  1M9N A;  3K58 A;  4O4I B;  1I5X A;  3G6B A;  2HFE C;  3B40 A;  5A2Q N;  3ZMV A;  2WLN A;  1ZAU A;  3CRC A;  4U7O A;  4FIP C;  4TUY A;  3CS5 A;  4JI7 B;  1K7D A;  5KMG B;  4PA3 A;  3ZHT A;  4ICG A;  1FXV A;  1SQF A;  1SQX H;  2AZ2 A;  1FD9 A;  4D6T H;  4IYI A;  2D3O W;  3UKM A;  1S72 V;  5EZY A;  3HB3 B;  1CP9 A;  1W2B U;  2PYL A;  1X59 A;  4JI5 B;  2E5L O;  4CC5 A;  1VQ5 V;  5B1A B;  1EM1 A;  3HKC A;  3CC4 V;  1BQ0 A;  3CCL V;  2P6J A;  5LHH A;  3RYC A;  3RYH A;  3QF7 A;  2X7R B;  2XAJ A;  4B3S B;  2G38 A;  4FVM A;  1K4C C;  4WBN A;  5JH7 B;  2ZIO A;  3B2E E;  1GN2 A;  2P22 C;  2F66 C;  1AI4 A;  1H2L A;  4LF6 O;  3D36 C;  2BCC H;  4O4J B;  2HKO A;  1FXK A;  2FB5 A;  2UUB B;  4PD4 F;  3T1Y O;  1R1B A;  4YHH B;  4DV3 B;  1Q6I A;  2CE4 A;  1NR1 A;  4DRX B;  2CDY A;  4DYL A;  1NTM H;  2QEX V;  4JYC A;  2X0L A;  2EX3 A;  2V1D A;  4TV9 B;  1IBK O;  1PP9 H;  4E4E A;  2JK5 C;  3GB7 C;  2DQ3 A;  2XUM A;  5LL6 Y;  4TWK A;  4KXR A;  1R6K A;  2UU9 O;  1YXB A;  1NBM G;  2P4K A;  5CA1 B;  3FYI B;  3THO A;  1YF2 A;  1P84 F;  1UJW B;  5JVD B;  2YIB A;  3JD1 A;  1QLE C;  1SZT A;  2CTP A;  3JAR B;  5JCO C;  2YIC A;  1I7F A;  5LHI A;  3K5M A;  3FAV B;  1JPX A;  1RPR A;  1AR5 A;  2XAH A;  4F6R A;  4JZ2 A;  4QNH B;  3K06 A;  4E2L A;  1JOY A;  1CEZ A;  1XIL A;  1AI7 A;  2XND G;  2IU0 A;  1SQB H;  2LFS A;  3CYO A;  4DR5 O;  2FKX A;  3JAL B;  3E22 A;  3CD6 V;  1B04 A;  3T4D A;  3SPJ A;  5JQG A;  2WLM A;  3ZRW A;  4X1K B;  2JS5 A;  4YJ2 B;  3APO A;  2JJ1 G;  4QJF B;  2UXC O;  3RFR A;  1IXM A;  3T4Z A;  2KSD A;  4J41 A;  5LA6 A;  4X66 O;  2JJ2 G;  2JS3 A;  3N27 A;  1YTF D;  1SES A;  2Y48 A;  5LXT A;  4DV1 O;  1S3J A;  1EFR G;  2CGN A;  1ORQ C;  3LSQ A;  5LP6 B;  4DR4 B;  4BR6 A;  3D3I A;  3H1H H;  1R3J C;  2DQ0 A;  3ABL C;  1IDS A;  4DW0 A;  2GSM B;  3CCV V;  3JYC A;  5IYZ A;  1N36 O;  2CTQ A;  4CS4 A;  4AI8 A;  3EVK A;  1FXH A;  3QO7 A;  1EN6 A;  2IJJ A;  5JWP A;  1F51 A;  3UM7 A;  3ASO B;  1OCR C;  1RFY A;  4B7K A;  5GON A;  1RP3 B;  1M93 A;  4WFG A;  1HNW B;  4MVQ A;  5C8Y B;  4CC6 A;  4FLU A;  1H2G A;  2EIL C;  1GAX A;  4P30 A;  2ZNJ A;  2W6J G;  2CH7 A;  3K5N A;  2IU3 A;  1TGO A;  4I9Q A;  2Y69 B;  2JGD A;  4LFA B;  4DV7 O;  4X9Q A;  4FLX A;  4HNA B;  3AG4 B;  5KHI A;  4MW3 A;  1PNL A;  4LF5 O;  4I55 B;  1N33 B;  3SR2 C;  1P7G A;  3CCE V;  3JD3 A;  3JAM N;  1AJQ A;  4MVM A;  4NXM B;  4O2A B;  3E35 A;  2F23 A;  3KG2 A;  3OMN B;  2WLI A;  3K3W A;  1O9G A;  3WG7 C;  5L3F A;  4CBC A;  1NH2 B;  2FYU H;  2R9R B;  2Y4U A;  1SA0 A;  3CHX A;  4CH4 A;  2D2C B;  4LF4 B;  4LBE C;  1NQT A;  2QE7 G;  3M7M X;  4O4I A;  1US6 A;  4DR1 O;  2P4V A;  1ENV A;  3S3W A;  1N34 O;  1PNK A;  4DUY B;  4GX1 A;  3SYP A;  5KMG A;  1K4D C;  3OGI B;  3H1J H;  5KLV H;  1VIB A;  4FM0 A;  1K92 A;  2ZIN A;  4EFB A;  3E2E A;  2BTQ B;  2ODM A;  2A06 H;  5IY5 C;  3SJA C;  5KHH A;  1RSO B;  1U96 A;  2ZXW B;  3JD2 A;  4K0K O;  4MVZ A;  4ZI7 B;  4NB5 A;  1F23 A;  4JGS A;  4GKK O;  1Q5O A;  4NTY A;  4W4K A;  4JZG A;  4J7J A;  3LDC A;  4TQD A;  4DV4 B;  1AJN A;  5JH7 A;  4FLW A;  1V54 C;  2A79 B;  4KP4 A;  3ETE A;  1YI2 V;  3JD4 A;  4O4J A;  4I7Z B;  1GRJ A;  1THZ A;  4X62 B;  1K3E A;  5B1N A;  2VS0 A;  4K8X A;  1N32 B;  2P5O A;  4DRX A;  5B3S C;  1Y67 A;  3TCU A;  5L3C A;  3QNE A;  3CCM V;  3ABK C;  4TV9 A;  1K34 A;  2E3C A;  1OCC B;  4FK5 C;  4JV5 B;  2HG5 C;  2QR4 A;  2ZM6 O;  4NKG B;  2QWO B;  2LFR A;  4UUJ C;  3C3T A;  3ZS8 C;  1QBZ A;  4DV2 B;  3UT5 A;  5CA1 A;  3W7T A;  3JSL A;  5LGU A;  5JVD A;  5GW7 A;  4P9P A;  2QM7 A;  3BFR A;  4BAY A;  3TK1 A;  5BR8 O;  3ZCC A;  2AW9 A;  2Y0P A;  4J11 A;  1ARO P;  3FAV A;  1J5E B;  3VQX A;  2IH3 C;  1N4C A;  3BHP A;  5J2T B;  4Z1V A;  3T1C A;  5B1B B;  1CXZ B;  1K73 W;  1EZJ A;  4JI4 B;  3SPI A;  3JAL A;  1K33 A;  3ZMT A;  5KHJ A;  1ZL8 B;  4X1K A;  1SER A;  1B06 A;  4UFZ A;  4YJ2 A;  1L8D A;  5IT9 N;  3JCU Z;  3S3X A;  3FD9 A;  2E74 B;  3G80 A;  1GKF A;  3ZJZ A;  3IAY A;  3F7Y C;  1LR1 A;  1R6T A;  3ZMS A;  5LP6 A;  2JEX A;  1SS3 A;  4ZBM A;  2EIK C;  4MTX A;  2QDO A;  3H1K H;  4JI5 O;  3NXS A;  5FPR A;  1WPB A;  1EZV H;  1VQN V;  2E76 B;  1NU1 H;  4BWA A;  3EHB B;  4I4T B;  3SYO A;  4B3M O;  1P49 A;  3T1H B;  1XEQ A;  3ZED A;  2ITD C;  4LC1 A;  3E8H A;  4R50 A;  2ZD9 A;  2QSA A;  1VQP V;  4ZOL B;  3K5L A;  1AVM A;  2UUB O;  4O4H B;  3K9A A;  3JAT A;  5B66 Z;  1QR9 A;  1RM1 C;  1KKC A;  4YHH O;  2DMX A;  4BIZ A;  2YXL A;  4DV3 O;  3CCJ V;  3WB0 A;  2OCC C;  3HKE B;  1OJH A;  3CCR V;  3ABM B;  1WN7 A;  2F1M A;  4HNA A;  4DK0 A;  4I55 A;  3U11 A;  2X6B A;  3CXC U;  1GMG A;  1P4R A;  1M56 B;  4O2A A;  3SJB C;  5KUK A;  3SYQ A;  5L3G A;  4YJ3 B;  1TVK B;  3OT7 A;  4K35 A;  4R6Z A;  2F95 B;  2HLD G;  1F4N A;  1XL4 A;  5K1P A;  2YS8 A;  1SQP H;  5D5Q A;  4J9Y B;  4JI1 B;  4FJC C;  1M5I A;  1ZSP A;  2C2A A;  3JAW B;  4U3J A;  3JSN A;  4QIW F;  2LGQ A;  2A0L A;  5CBF A;  4JAA A;  4EEQ A;  1M57 B;  4LWS B;  1K5Q A;  2R9A A;  2PUS A;  4NVP A;  1AI5 A;  1NT2 B;  3A8T A;  1X4T A;  4DR4 O;  2CTW A;  2MK3 A;  2BTQ A;  1WJZ A;  1RSO A;  1Q86 W;  3MD0 A;  2M7W A;  4KFM A;  3OEE G;  5EC2 C;  4JI2 B;  4X65 O;  2UXD B;  2LO1 A;  4J7K A;  2CK3 G;  5IYD O;  1XMQ B;  1VP7 A;  2PYJ A;  1M4U A;  4H44 B;  1N0N A;  3CEI A;  1LNQ A;  1YVW A;  1VQ8 V;  1VEW A;  5GON B;  3ABU A;  4UCU A;  1GO3 F;  1YIT V;  1NZ6 A;  4B3R O;  4KUM A;  4JAV A;  4JAU A;  1TA8 A;  1HNW O;  4DR7 B;  4YY3 B;  1VF6 C;  3AG7 A;  2DYR C;  5KHG A;  4O2B B;  2Q7E A;  3LUT B;  2RQ6 A;  1FFX B;  4PA9 A;  5IE9 A;  4GX5 A;  1QCE A;  1RPO A;  4LFA O;  3E83 A;  1HDJ A;  4JTC B;  4LFB O;  2WA4 A;  3BY6 A;  3MDS A;  4GCZ A;  1KBH A;  4U7N A;  1N33 O;  4OPA A;  2B5U A;  3OMI B;  4UB6 Z;  1V55 C;  5E1A C;  1R3I C;  1GH6 A;  4NXM O;  1WA8 B;  1FS0 G;  5GTH Z;  5CN0 A;  2KKW A;  4LFC B;  1IVS A;  1IBM O;  1H2M A;  1D2D A;  2Q69 A;  5LGT A;  3CRQ A;  5J2T A;  5B5E Z;  4LF4 O;  1IX9 A;  5LOV B;  4LP8 A;  1XQ8 A;  3CCQ V;  2EJR A;  4R7C A;  4F6E A;  3STZ C;  1ZL8 A;  5LGN A;  1YJ9 V;  4DR3 B;  5L3D A;  2DOS A;  4UCT A;  4DW1 A;  5KAF Z;  2QJ1 A;  5CBH A;  2B1I A;  1AB3 A;  3ZHV A;  5EBW C;  4MVR A;  3ZN1 A;  3APQ A;  3CCS V;  4LH6 A;  1VF5 B;  1ROP A;  4FFK A;  2LW7 A;  1FFT B;  4H33 A;  2WWW A;  4X89 A;  1OV9 A;  4I4T A;  4TOI A;  5BZB A;  4LF7 O;  3AEI A;  3JCZ A;  3G4S V;  4DV4 O;  4I5S A;  5GTI Z;  3IFX A;  2BOB C;  4K8Z A;  4UV9 A;  4ZOL A;  4PDM A;  3E8B A;  3SYA A;  2IW5 A;  2CTR A;  2GBO A;  4O4H A;  3CJH B;  4X62 O;  1XBL A;  2ZDI A;  5B1O A;  2B1G A;  1XHX A;  3VOU A;  2NNU A;  2YXY A;  3HKE A;  4PDR A;  1XNR O;  5F2V O;  1K9M W;  3ABL B;  2UUC B;  2QWN B;  3UT5 B;  4J7Z A;  4JAS A;  5JJE B;  5H9C A;  4G27 B;  4QE7 A;  1YEW A;  1F4M A;  1TAE A;  3RT3 C;  4OX9 B;  2X6A A;  5J2U B;  3RWR D;  2Q0A A;  1JA8 A;  1QVG U;  4JI6 O;  4UV8 A;  4DV2 O;  2EIN C;  3F5T A;  1V9P A;  2AHZ A;  1IXB A;  1W59 A;  1FJG O;  5CA0 A;  2OTL V;  2ZR3 A;  2FL4 A;  4YJ3 A;  4DV5 B;  1TVK A;  5JJN B;  1OCR B;  1S0V A;  5LMU B;  1J5E O;  1WP7 A;  2ZKO A;  2EIL B;  4MVS A;  4LF9 B;  2NLJ C;  1FAF A;  4F4L A;  4JI4 O;  3JAW A;  5HFM A;  1KUQ A;  2PZS A;  2YI8 A;  5ITZ B;  2QM4 A;  5C93 A;  1SC5 B;  3DXR B;  4LWS A;  3KCY A;  1M1K W;  2HP8 A;  3W7W A;  2WLJ A;  2UXN A;  3JAK B;  3K03 A;  1I5Y A;  2UXB B;  3KZI Z;  2YIA A;  1G8M A;  4CH3 A;  3CMA V;  1KP3 A;  5LBQ A;  1WNS A;  1B3Q A;  1DLB A;  1GM7 A;  1T5E A;  3WG7 B;  3OTO B;  2QKS A;  2H94 A;  3ZHQ A;  3T1H O;  2E75 B;  5BMV B;  3JAT B;  2BSK B;  3EXA A;  1ZLZ A;  4I9W A;  1S5J A;  2W0F C;  4RUE A;  3TJT A;  4CS2 A;  1PL4 A;  5IDJ A;  3BCC H;  1BHB A;  3WB1 A;  5KUM A;  4FZ1 A;  4IYH A;  2ZE5 A;  4O2B A;  1U97 A;  1MSD A;  3PJS K;  1FFX A;  3I5D A;  3OMA B;  5BY1 A;  2YSU B;  2Z0A A;  4FLT A;  2YID A;  1KYO F;  4FLY A;  5IY5 B;  4JYA O;  1PNM A;  2ZNI A;  4XDL A;  5D5P A;  2DW4 A;  2R70 A;  2A7W A;  1MZF A;  1GTO A;  3BAB A;  1XNQ B;  5LP6 C;  2Q73 A;  3B09 A;  5LYJ B;  1WA8 A;  5KHK A;  1KP2 A;  2QTO A;  4NXN B;  3L72 H;  3D36 A;  1H38 A;  2F43 G;  2VQE B;  4DR2 B;  2PY5 A;  4B7E A;  4U3J B;  3VBB A;  5LOV A;  1AP6 A;  1XL6 A;  2VQF O;  1COW G;  1FPO A;  3ETQ A;  4RO2 A;  2XAF A;  4JI1 O;  2PI4 A;  3B8N A;  3FB5 C;  2JEU A;  1H8E G;  2Y0I A;  3J80 N;  3E86 A;  1BGY H;  2RDC A;  1NH2 D;  4WFA V;  1H8H G;  4O4L B;  4PI2 A;  3ZRS A;  3B77 A;  2ZCE A;  1PPJ H;  2FTK A;  4AIL C;  4LF8 B;  1HNZ B;  1WAZ A;  2P06 A;  1KQS U;  1K8A W;  4PI0 A;  1XMO B;  4JI2 O;  1L1F A;  5JCO A;  1R3K C;  5CB4 B;  4FFB B;  4H0L B;  3IC7 A;  2EIM C;  1GN3 A;  3RYI A;  1KD1 W;  1OHH G;  3K57 A;  3RN4 A;  2Q67 A;  1HNX B;  2DYS C;  2WAM A;  4GX2 A;  3WU2 Z;  3AK1 A;  2ZR2 A;  2ZE7 A;  4JYY A;  4TT3 G;  4LF6 B;  4X8A A;  4DR7 O;  3GVM A;  4XDK A;  4YY3 O;  1Y66 A;  3CJH A;  3GWK C;  4JTD B;  3OW2 U;  1QU7 A;  2A3Q A;  1ZUQ A;  4FLV A;  3ASN B;  1WPX A;  4MVU A;  2CGO A;  3AG2 B;  2F4V B;  2RMK B;  3DC6 A;  3ETG A;  4B3T B;  3JAS B;  4JI3 B;  4PJ0 Z;  1KB9 F;  2EIK B;  4IGG A;  4LR3 A;  1L0L H;  3LDE A;  4NYK A;  5J2U A;  3R65 A;  2WLH A;  5EBM C;  2UU9 B;  4MTF A;  3OFN G;  1B6Q A;  3AG3 C;  4UCV A;  1MA1 A;  3RVY A;  1SQQ H;  1N8R W;  3W7S A;  4UCS A;  4UVA A;  2XT9 A;  3I55 V;  4X1Y A;  5LMN B;  5IYB O;  3QO8 A;  3N2K B;  3RYF B;  1XHZ A;  1RM1 B;  4JI7 O;  4TV8 B;  1NVP B;  4IHJ B;  1KEC A;  1JJO A;  4JI8 B;  1JMK C;  1GN6 A;  5ITZ A;  4J10 A;  3HR0 A;  2UXC B;  3DXR A;  4RWU A;  3M8A A;  1L0N H;  2DWD C;  3T2M A;  3VQW A;  1NJI W;  3JAK A;  2RN9 A;  2R72 A;  3TET A;  2AGA A;  1QNM A;  2QM8 A;  1JQ0 A;  3W7U A;  4DR6 B;  2PTM A;  1AP5 A;  1XRE A;  4U3F H;  2AXT Z;  2JGU A;  4B3S O;  4PA7 A;  4I0X B;  4JYB A;  1XUQ A;  1LUV A;  3HPL C;  2EIJ C;  2QTS A;  3A0B Z;  3N2G B;  5BMV A;  4GUN A;  3MHS C;  3H1L H;  1P7B A;  2BSK A;  4X1I B;  1EN5 A;  1GM8 A;  4X64 B;  2VRZ A;  4NR1 A;  2KQX A;  1QHT A;  1IBL B;  3H9V A;  3E8G A;  2YUA A;  1R6N A;  4ASU G;  1G6U A;  3SYC A;  3K59 A;  2FML A;  3U0Z A;  3SJQ C;  1VQL V;  3TGU H;  1YHQ V;  4JI0 B;  4EFE A;  2UUC O;  4OX9 O;  1JX9 A;  2IJI A;  1XI1 A;  1DGS A;  2QWR B;  2Q68 A;  5CA0 B;  5IYC O;  4GZR B;  3OGC C;  2ZE8 A;  1HR0 B;  4N23 A;  3IC9 A;  2R9I A;  5LYJ A;  3U10 A;  2ADQ B;  2K9P A;  4ABM A;  1BE3 H;  5CA3 A;  2EUL A;  4DV5 O;  3SDL A;  2P7T C;  2YIB D;  2DYR B;  1G1X B;  1FXK C;  4LF9 O;  3L74 H;  4G28 B;  2OT5 A;  4P2Z A;  1AI6 A;  2LW1 A;  1Y76 B;  2GUZ B;  1K5S A;  1IZ3 A;  4YIP A;  1N34 B;  4DO2 A;  2AHY A;  2ZT9 B;  1BT8 A;  2OYQ A;  5IWA B;  2RJZ A;  3EFF K;  2GDS A;  2WLK A;  3G6E V;  3X2Q C;  4MVO A;  4IL6 Z;  4O4L A;  1JR9 A;  1PM9 A;  1TUE B;  4I50 A;  4FZ0 A;  2EBO A;  2GHY A;  2WLL B;  3JD0 A;  5EYP B;  1E1Q G;  3SJC C;  4DXW A;  5CB4 A;  4FFB A;  1Z2G A;  3M99 B;  3OTO O;  3WB2 A;  1OCZ C;  4DUZ B;  3I56 V;  3ZBH A;  3LDD A;  1DF4 A;  2IJK A;  4OXS A;  1J95 A;  3A2F A;  1WB8 A;  2DJV A;  3ABT A;  2RCV A;  2YEV B;  3AG1 C;  3D3Q A;  1R3L C;  3ML0 A;  2DWE C;  2L35 A;  1SQV H;  4GKJ B;  2JVD A;  2H3O A;  4YXW G;  4ZIB A;  3CC7 V;  3FKS G;  1GN4 A;  2WSS G;  3DGE A;  3JAS A;  5KAI Z;  4YIO A;  4DV0 B;  3CC2 V;  4KHP B;  1BHA A;  1M57 C;  3K5O A;  1SKV A;  3F5W C;  2GTA A;  3BA9 A;  3LSS A;  4XDJ A;  2XOK G;  4B08 A;  2A9H A;  3K9S A;  2YXH A;  4H37 A;  4PV1 B;  1XOU A;  1XNQ O;  3RVZ A;  2MW2 B;  3CME V;  1FYJ A;  2VWK A;  2GTS A;  5IJ0 B;  1XDC A;  1EBO A;  2P67 A;  5TIS Z;  1VQ7 V;  4BW9 A;  4DR2 O;  2V4D A;  3N2K A;  3RYF A;  1E1R G;  4AQY B;  2KG7 B;  1Q7Y W;  1OCO C;  1D5N A;  3DSQ A;  4TV8 A;  4DUY O;  4IHJ A;  2JDI G;  4AHC A;  4QPK A;  3ZHS A;  2OIG A;  2OIE A;  2OCH A;  2HEP A;  2X6C A;  2Q7H A;  3NR7 A;  2OTJ V;  3ZIA G;  4CH5 A;  3LNM B;  3ZHR A;  1I0H A;  1VQO V;  3OD4 A;  1QLE B;  4RQE A;  3KKY A;  2EIN B;  4LF8 O;  1A32 A;  3IGA C;  3CCU V;  1PL0 A;  3ETD A;  1HNZ O;  3RYI B;  1XMO O;  4UVC A;  2Q0O C;  1Q8I A;  1VQ6 V;  3E8F A;  4WF9 V;  1JCH A;  4I0X A;  4Z1M G;  2ETN A;  4B3M B;  2ZIM A;  3N2G A;  3ICX A;  1HNX O;  4X20 B;  1HWY A;  4X88 A;  4X1I A;  5H6Q A;  2Z5U A;  1GK9 A;  1SET A;  3CE2 A;  1N32 O;  1PV0 A;  3CRA A;  2W6I G;  3BVO A;  4J80 A;  3UO2 A;  1I94 B;  4JV5 O;  2HJF C;  3P32 A;  3SPC A;  2O57 A;  2F4V O;  4B3T O;  3E89 A;  4EB6 B;  4JI3 O;  2EJ7 A;  4PEL A;  3SGI A;  5KX5 B;  4KL1 A;  3P3P A;  5L3E A;  5B1A C;  3G71 V;  4H13 B;  3H1I H;  5H6R A;  4X1Y B;  3TXS A;  1BZK A;  4A5U B;  1NI8 A;  2HHH B;  1JJ2 U;  4HBN A;  1BMF G;  2Q7G A;  4QE9 A;  3HKB B;  1YTF B;  3H01 A;  4RUF A;  5LMN O;  1VF6 A;  1Q6U A;  3L9D A;  3ZRV A;  2P90 A;  5H2F Z;  1VF7 A;  2XAS A;  1UPG A;  3FX7 A;  4WFB V;  4QPJ A;  5H5N A;  1Y76 A;  2GUZ A;  3CWB H;  3R66 A;  2PF4 E;  4JI8 O;  1VQ4 V;  4TQF A;  2QGN A;  3OUF A;  1VMG A;  1YZB A;  5FNV B;  3ZRX A;  2VWJ A;  3LNN A;  4G2K A;  1Y6X A;  3J7A U;  1SQG A;  1YCI A;  4LNU B;  3MAQ A;  1MNG A;  4LH7 A;  4BIO A;  4P9O A;  4CZZ A;  4DR6 O;  2WLL A;  1H2N A;  5EYP A;  4DV6 B;  4X65 B;  1BSM A;  2HVK C;  2LP7 A;  2XAG A;  2IBZ H;  3FB6 C;  4B3R B;  1MAB G;  5J9P C;  2K1E A;  4JTA B;  4X64 O;  2KB1 A;  1YSC A;  2UUA B;  1PD3 A;  2YEV A;  3P3N A;  3IJ4 A;  5HFL A;  3BAA A;  1IBL O;  1E79 G;  3ZMZ A;  1HW7 A;  3RGB A;  1Y74 A;  2Z3Y A;  3C3S A;  2ARH A;  3ZX6 A;  4JI0 O;  4PA4 A;  4PDV A;  4LFB B;  3OUS A;  3BRC A;  1S77 D;  3UO3 A;  2PI5 A;  3CRM A;  5IJ9 B;  2LGW A;  3K79 A;  2XAQ A;  1M90 W;  3ZN0 A;  4C7U A;  2EIM B;  1QR8 A;  2W0X A;  1V54 B;  4W4L A;  1HR0 O;  4NTW A;  3ZMU A;  3A0H Z;  1VQK V;  3HKD A;  2DYS B;  3QO5 A;  4PDL A;  4JPR A;  1N0J A;  3UCS C;  4UCR A;  1WP8 A;  3SPG A;  5IJ0 A;  1UFI A;  1IBM B;  3ASO C;  1Q6H A;  5B3S B;  1Q90 D;  4FM2 A;  2KG7 A;  2YDE A;  2JIZ G;  3ABK B;  4K3A A;  4MTO A;  1IUR A;  5CBG A;  3QTC A;  5L3B A;  3AK3 A;  1ZTE A;  1YDX A;  1D5A A;  3L73 H;  4ZHQ B;  5IWA O;  4I50 B;  2HJD A;  2Y69 C;  5FL7 G;  1CPY A;  3AG4 C;  4GYC B;  3WFV A;  5EC1 C;  3Q4H B;  2E5L B;  5DN6 G;  1VAR A;  1BQZ A;  1AR4 A;  1GM9 A;  2CAZ C;  2Q5Z A;  3STL C;  2UXD O;  1OZ0 A;  3AG3 B;  5LHG A;  1XMQ O;  2Q6A A;  1ZX3 A;  2ITC C;  1Q3E A;  4J9Z B;  3OM3 B;  1KC8 W;  3O65 A;  1O9H A;  4UVB A;  4DUZ O;  4Q20 A;  2IM9 A;  2WPD G;  4N21 A;  5A9G A;  4LF7 B;  1Z5V A;  4X20 A;  3OR6 C;  3T1Y B;  1JFF B;  2QWP B;  2LJ2 A;  4GX0 A;  2YC0 A;  1H2S B;  4CH6 A;  5DEC A;  1TUB B;  2QKC A;  3QVN A;  3W7X A;  1VQM V;  1KMI Z;  4GKJ O;  4BW5 A;  1IBK B;  1NTZ H;  4D7T A;  2IJH A;  2N04 A;  4MW8 A;  4L87 A;  1BCC H;  1XNR B;  4EB6 A;  4DV0 O;  2LQT A;  4KHP O;  5K1X A;  1WLE A;  3FYE B;  5KX5 A;  4MT8 A;  5KA5 A;  1Q82 W;  1MZE A;  3G67 A;  3J81 N;  4JF3 A;  2ZXW C;  4GT1 A;  4JI6 B;  2N74 A;  1K97 A;  2EIJ B;  1AIL A;  4HYO A;  4LFC O;  1URF A;  1S5H C;  1W0K G;  3DTU B;  4UB8 Z;  2AZ0 A;  4FLZ A;  1FJG B;  3CB2 A;  3JAR A;  4IIJ B;  4L8J A;  3ZHU A;  3HKB A;  4UCO A;  3MHH C;  4RAI A;  2NN4 A;  2OCC B;  4Q6G A;  4DR5 B;  2WA3 A;  2BOC C;  4TUY B;  3L71 H;  4AQY O;  3LSU A;  2EZP A;  2UXX A;  1Y4M A;  4DR3 O;  2JRI A;  1NTK H;  3CP1 A;  1JVM A;  5E79 Z;  2ADP A;  4X66 B;  3CXH F;  5FNV A;  5DED A;  4DV1 B;  3L75 H;  2V7Q G;  1MMM A;  4LNU A;  3ASN C;  5EZY B;  1OCC C;  4EKW A;  3K0G A;  2OWO A;  1NVP D;  3AG2 C;  3DC5 A;  2HVJ C;  4OPH A;  3A0R A;  3HKC B;  3P30 A;  4WFF A;  1I08 A;  1QLN A;  4R8C A;  3FB8 C;  1N36 B;  3GWO A;  1YJN V;  3RYC B;  3RYH B;  3BA8 A;  3PN1 A;  1DTO A;  4WBN B;  3L70 H;  1FKA O;  1Q43 A;  1FXK B;  3OEH G;  4PA6 A;  4WFH A;  2F93 B;  5B1B C;  4FM1 A;  2HR3 A;  3OE7 G;  5C8Y A;  1AR1 B;  5EIB D;  5EK0 A;  2QKA A;  3F7V C;  2CUG A;  4MSW C;  1QQC A;  3X2Q B;  5FLX N;  3UQ8 A;  4DV7 B;  1I94 O;  5EBL C;  3D8C A;  4J42 A;  2Q8V A;  5AG2 A;  4LF5 B;  2ZQM A;  3C90 A;  4GLX A;  1Z5W A;  4LCU C;  4JYA B;  1KKD A;  5DM6 V;  3CRR A;  3K04 A;  4IT5 A;  2Q4P A;  2YI9 A;  5IJ9 A;  4CS3 A;  3AK2 A;  1W0J G;  2GV9 A;  1S76 D;  4TSF G;  2N05 A;  1OCZ B;  4MS2 A;  2ZE6 A;  3OTF A;  2HHH O;  5LMU O;  5CMU A;  4PHZ A;  1NS1 A;  4F6R B;  1BL8 A;  5EIB C;  4DR1 B;  2ATK C;  3B4S A;  3AG1 B;  2XHB A;  4WCE V;  3E22 B;  5JQG B;  4NTX A;  3ZRW B;  1AJP A;  2VQF B;  2ZDI C;  5LA6 B;  1YJW V;  2XTA A;  1VQ9 V;  1BS3 A;  2Q9L A;  4ZHQ A;  2ILM A;  5LXT B;  1SZX A;  1V55 B;  2UXB O;  3ABM C;  2EZO A;  1MG1 A;  1QVF U;  1NR7 A;  5BXZ A;  2Y4T A;  3KCX A;  3Q4H A;  4ZKI A;  3B8M A;  3RBZ A;  3TXQ A;  1DK1 A;  4FPP A;  4K0K B;  2DN9 A;  1DF5 A;  5IYZ B;  1M56 C;  3RW0 A;  4DV6 O;  4GKK B;  4MTG A;  4OGQ B;  5JJJ B;  3OAA G;  1PKX A;  2QWQ B;  4ZI7 A;  4XBF A;  4D7S A;  3FB7 C;  3OR7 C;  4RQF A;  3CSX A;  3K08 A;  2B9Z A;  3CPW U;  3CX5 F;  2PGG A;  3QG5 A;  1EN4 A;  4FMT A;  2DE0 X;  1OCO B;  5KA6 A;  1R73 A;  1JFF A;  3BPZ A;  1Q81 W;  2L6L A;  1Y74 B;  2UUA O;  2QA4 V;  2IH1 C;  2CH7 B;  1G4Y B;  1KU9 A;  1ZWI C;  4WFE A;  1TUB A;  2BE3 A; 
#chains in the Genus database with same CATH homology
 4DK1 A;  2HHH B;  5FPO A;  4HBN A;  2Q7G A;  3VQY A;  4O4L B;  3HKB B;  4PI2 A;  2ZM6 B;  2BTO A;  2ZCE A;  4ZOL B;  3K5L A;  4AIL C;  4LF8 B;  4O4H B;  1VF7 A;  3JAT A;  1HNZ B;  3VQV A;  4PI0 A;  1XMO B;  2YXL A;  3HKD B;  5JCO A;  5CB4 B;  4FFB B;  3WB0 A;  3HKE B;  3RYI A;  4TQF A;  5BR8 B;  3K57 A;  5FNV B;  3FFQ A;  2VWJ A;  3LNN A;  1WN7 A;  1SQG A;  2F1M A;  1HNX B;  1SA0 B;  4HNA A;  4LNU B;  4DK0 A;  4IIJ A;  3MAQ A;  3K58 A;  4I55 A;  4LH7 A;  4O4I B;  3U11 A;  4LF6 B;  1ZAU A;  4TUY A;  4JI7 B;  5EYP A;  4DV6 B;  5KMG B;  4FLV A;  4O2A A;  4X65 B;  1SQF A;  3SJB C;  4YJ3 B;  2F4V B;  1TVK B;  4B3T B;  3JAS B;  4JI3 B;  2F95 B;  4LR3 A;  5EZY A;  4B3R B;  5K1P A;  2PYL A;  4JI5 B;  5J2U A;  4CC5 A;  5D5Q A;  3HKC A;  4JI1 B;  1M5I A;  2UUA B;  2UU9 B;  3JAW B;  4U3J A;  3JSN A;  3BAA A;  4UCV A;  1HW7 A;  4EEQ A;  3RYC A;  3RGB A;  3RYH A;  3QF7 A;  4UCS A;  4B3S B;  4FVM A;  4WBN A;  2R9A A;  5JH7 B;  2ZIO A;  3B2E E;  2PUS A;  4X1Y A;  2P22 C;  2F66 C;  4NVP A;  5LMN B;  1NT2 B;  1X4T A;  4O4J B;  2BTQ A;  3N2K B;  3RYF B;  2UUB B;  1XHZ A;  1RSO A;  4LFB B;  3BRC A;  4TV8 B;  4YHH B;  4JI2 B;  4IHJ B;  5IJ9 B;  4DV3 B;  2UXD B;  1JJO A;  4DRX B;  4JI8 B;  1JMK C;  1XMQ B;  2PYJ A;  1M4U A;  5ITZ A;  3HKD A;  2UXC B;  5GON B;  2EX3 A;  4TV9 B;  4UCU A;  3VQW A;  4UCR A;  5IJ0 A;  1TA8 A;  1IBM B;  3JAK A;  4DR7 B;  2R72 A;  4YY3 B;  4FM2 A;  4DR6 B;  2PTM A;  5CA1 B;  3THO A;  5JVD B;  5KHG A;  2YIB A;  2JGU A;  4O2B B;  2Q7E A;  2RQ6 A;  3QTC A;  1FFX B;  3JAR B;  5JCO C;  1I7F A;  1D5A A;  4ZHQ B;  3K5M A;  4I50 B;  3N2G B;  5BMV A;  4F6R A;  4GYC B;  4X1I B;  2E5L B;  4X64 B;  2CAZ C;  3JAL B;  3E22 A;  1B04 A;  5JQG A;  1Q3E A;  1IBL B;  1QHT A;  4X1K B;  2JS5 A;  4YJ2 B;  3T1H B;  1G6U A;  3RFR A;  2KKW A;  3K59 A;  5LA6 A;  3U0Z A;  1O9H A;  4LFC B;  2IM9 A;  5LXT A;  4LF7 B;  4DR4 B;  4JI0 B;  5LP6 B;  1Z5V A;  4EFE A;  4X20 A;  5J2T A;  5LOV B;  3T1Y B;  1XQ8 A;  1JFF B;  1XI1 A;  1DGS A;  1H2S B;  4CH6 A;  5CA0 B;  5IYZ A;  1HR0 B;  4CS4 A;  1TUB B;  3U10 A;  5LYJ A;  1KMI Z;  4DR3 B;  1IBK B;  4D7T A;  4UCT A;  2QJ1 A;  1XNR B;  4EB6 A;  2YIB D;  5GON A;  1HNW B;  1M93 A;  5K1X A;  4LH6 A;  5C8Y B;  4CC6 A;  5KX5 A;  4FLU A;  2ZNJ A;  4JI6 B;  3K5N A;  1N34 B;  1TGO A;  4I9Q A;  4I4T A;  4TOI A;  2OYQ A;  5IWA B;  2RJZ A;  4LFA B;  4FLZ A;  4FLX A;  4HNA B;  1FJG B;  5KHI A;  3CB2 A;  3JAR A;  4IIJ B;  4L8J A;  4O4L A;  3HKB A;  4I55 B;  4UCO A;  4K8Z A;  4ZOL A;  4I50 A;  1N33 B;  3SR2 C;  4Q6G A;  4O4H A;  4DR5 B;  4TUY B;  5EYP B;  3SJC C;  4NXM B;  4O2A B;  1XHX A;  4FFB A;  5CB4 A;  3HKE A;  4X66 B;  1O9G A;  3WB2 A;  4DUZ B;  5FNV A;  4DV1 B;  1SA0 A;  3CHX A;  2UUC B;  3UT5 B;  4LNU A;  4CH4 A;  5JJE B;  4LF4 B;  5EZY B;  1YEW A;  1TAE A;  3M7M X;  3A2F A;  4O4I A;  2OWO A;  4OX9 B;  5J2U B;  3HKC B;  2Q0A A;  3RWR D;  4DUY B;  5KMG A;  1N36 B;  3RYC B;  3RYH B;  3BA8 A;  3PN1 A;  1V9P A;  4GKJ B;  2JVD A;  4WBN B;  4FM0 A;  5CA0 A;  4DV5 B;  4YJ3 A;  4ZIB A;  1TVK A;  5JJN B;  2ZIN A;  3JAS A;  4DV0 B;  4EFB A;  5LMU B;  4KHP B;  1Q43 A;  2BTQ B;  3K5O A;  1SKV A;  3SJA C;  5KHH A;  4LF9 B;  3BA9 A;  2F93 B;  4B08 A;  4FM1 A;  4ZI7 B;  3JAW A;  5C8Y A;  2PZS A;  5EIB D;  2YI8 A;  5ITZ B;  1Q5O A;  2QM4 A;  1QQC A;  4DV7 B;  3UQ8 A;  4TQD A;  4DV4 B;  4FLW A;  5JH7 A;  2VWK A;  4LF5 B;  5IJ0 B;  4O4J A;  3JAK B;  4BW9 A;  2V4D A;  3N2K A;  3RYF A;  4GLX A;  1Z5W A;  4JYA B;  2UXB B;  2YIA A;  4X62 B;  4AQY B;  4CH3 A;  3DSQ A;  4TV8 A;  4K8X A;  2YI9 A;  1WNS A;  4IHJ A;  5IJ9 A;  4CS3 A;  4AHC A;  1N32 B;  2P5O A;  4DRX A;  2GV9 A;  1T5E A;  3OTO B;  2HEP A;  3OTF A;  2Q7H A;  4CH5 A;  4TV9 A;  2E3C A;  5BMV B;  4PHZ A;  4JV5 B;  4F6R B;  3JAT B;  1S5J A;  5EIB C;  4DR1 B;  3ZS8 C;  2XHB A;  4DV2 B;  3UT5 A;  3E22 B;  4CS2 A;  5JQG B;  3RYI B;  5CA1 A;  3WB1 A;  3JSL A;  2VQF B;  5JVD A;  1Q8I A;  4O2B A;  1FFX A;  5LA6 B;  4FLT A;  4ZHQ A;  4B3M B;  2ZIM A;  4FLY A;  5LXT B;  3N2G A;  1J5E B;  3ICX A;  3VQX A;  4X20 B;  2ZNI A;  3BHP A;  5J2T B;  5D5P A;  4X1I A;  2R70 A;  4JI4 B;  4K0K B;  3BAB A;  3JAL A;  1XNQ B;  5LP6 C;  5KHJ A;  5IYZ B;  4X1K A;  4UFZ A;  4GKK B;  4YJ2 A;  1L8D A;  5JJJ B;  5LYJ B;  1I94 B;  5KHK A;  4ZI7 A;  4D7S A;  4NXN B;  3CSX A;  3IAY A;  2PGG A;  3QG5 A;  4EB6 B;  2VQE B;  5LP6 A;  4DR2 B;  2PY5 A;  3SGI A;  4U3J B;  5KX5 B;  5LOV A;  4KL1 A;  1JFF A;  3BPZ A;  5FPR A;  1WPB A;  3ETQ A;  4BWA A;  1KU9 A;  4I4T B;  4X1Y B;  1TUB A;  1P49 A;  3ZED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...