1SKVA

Crystal structure of d-63 from sulfolobus spindle virus 1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
64
structure length
64
Chain Sequence
SKEVLEKELFEMLDEDVRELLSLIHEIKIDRITGNMDKQKLGKAYFQVQKIEAELYQLIKVSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical 7.5 kDa protein
publication title Structure of d-63 from sulfolobus spindle-shaped virus 1: surface properties of the dimeric four-helix bundle suggest an adaptor protein function
pubmed doi rcsb
source organism Sulfolobus virus 1
molecule tags Viral protein
total genus 25
structure length 64
sequence length 64
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1skvA00
2JS5A 1X4TA 2CAZC 3QF7A 1NT2B 3THOA 3B2EE 3SJAC 3ZS8C 3ICXA 3QG5A 2F66C 3SJBC 2P22C 1SKVA 3CSXA 3SJCC
chains in the Genus database with same CATH superfamily
4DV3B 4DV5B 3HKEB 2LFSA 5DM6V 3OEEG 4G2KA 3H9VA 1AJPA 1DF5A 1WA8B 5GW7A 2Y48A 4I4TA 1AI5A 1Y6XA 4UCRA 1VQ5V 3JCUZ 3ZEDA 4J11A 1PL4A 1OZ0A 1CP9A 1Q8IA 2CGNA 5CA1B 1WN7A 1D5NA 2DWDC 4B3SB 1DF4A 1R3JC 4FMTA 1SETA 4L8JA 4K35A 2X7RB 1WNSA 4GX0A 4NYKA 5B1BC 4NXNO 2RN9A 4X1KB 2OIEA 2IH1C 3APQA 2Q7GA 2ILMA 3JAKA 1H8HG 5E1AC 4B3MB 3TXQA 3QNEA 1SQVH 1Q43A 1JR9A 4CBCA 1E79G 2WSSG 4B3TB 3DC5A 3LNMB 4LFCB 3RYHB 1I5XA 5LGUA 3ZHTA 1PP9H 4XDJA 1NTKH 4QPKA 3JCZA 2V4DA 3CE2A 5KX5A 4MVUA 4ZIBA 5E79Z 3RN4A 1SZTA 5LA6B 4O4IA 2QTSA 1KC8W 4KP4A 2QWNB 3SPCA 2RDCA 2E76B 2D3OW 2HG5C 4NB5A 4FLXA 1X59A 4PV1B 1N36B 1NBMG 1ORQC 3QTCA 4LNUB 1EN5A 5LHHA 1VQOV 4OGQB 2MW2B 3N2GA 3C3TA 4JASA 4JI0B 4E4EA 1Z2GA 4DR5B 1K92A 2DYSB 1ZAUA 4GZRB 1XHZA 3P32A 4I5SA 5EK0A 5EC2C 1IBLO 4CS3A 2JJ2G 1K4CC 4DK0A 5JCOC 4O4LB 1VP7A 2GDSA 2CAZC 2KQXA 4X1YA 2UUBO 5FPRA 4F6RA 1URFA 3RYIB 3ASOC 5LYJA 5FNVA 2P4KA 3N2KA 2EINC 3L9DA 3JSNA 3JASA 4X1IA 3G4SV 1Q6HA 3SPHA 2ZE8A 1UFIA 1IVSA 3CX5F 2JVDA 3I55V 4LF6O 1OCOC 1PKXA 3X2QB 3ABKC 1V55C 1WLEA 1PPJH 3UO2A 5LP6C 2YEVA 4X89A 2HHHO 1GK9A 1JFFA 2O57A 1FPOA 2VS0A 1GM7A 2DMXA 4JV5B 3A8TA 4HYOA 2LW1A 4GT1A 3DGEA 1S72V 4DV1O 1US6A 2XAQA 1T5EA 3VQVA 2W0XA 1RP3B 3FYEB 3K0GA 2EIMC 1O9GA 1R6TA 3ICXA 4UVCA 4X65B 4UXNA 3FKSG 3FD9A 2VWKA 1FAFA 4TV9A 4QE9A 1RM1C 4UB6Z 3CEIA 3T1YO 3H1JH 3SGIA 4D6TH 4J9YB 2IBZH 1XMOB 3CC7V 3TJTA 2YICA 2X6BA 4ZKIA 1E1QG 4MVQA 2Q7HA 4DW0A 2LO1A 4O4HA 3UO3A 3T1HB 5JWPA 5IYBO 4JI2B 4MTXA 4JI6O 3QG5A 4FLWA 3CCUV 1HWYA 5LMUO 1SF9A 4LF8B 4DUYB 1I08A 1QCEA 1DTOA 2B1GA 3T1CA 1I94O 2L6LA 5BR8O 4PI2A 4PA3A 2A0LA 2YI8A 4PELA 4ZHQB 1XBLA 4FIPC 3L75H 3RW0A 5EIBD 2UU9O 3SJCC 1SA0A 1S3JA 3T1YB 5BY1A 2FYUH 2WLIA 5EZYA 2DQ0A 2ZXWB 1F7YA 4ZI7B 3ABUA 2IW5A 2R9IA 5EC1C 5LXTB 4DR1B 1Q81W 4LF5B 4DR7O 1H38A 1CEZA 4MW3A 4WFHA 1M9NA 4WCEV 4GYCB 2F95B 3AG4B 5JH7A 3W7WA 1JMKC 3SPIA 4JI5O 4E2LA 3CRQA 1IX9A 4TUYB 4HNAB 3MHSC 2B1IA 4BAYA 1S5JA 4TV8B 3BY6A 1QLNA 5IWAB 4NTWA 2XHBA 2ZIMA 1W0KG 1B04A 3ZN1A 1U97A 2UU9B 4U3FH 1NU1H 1NS1A 5BXZA 3Q4HA 4K0KO 1AJQA 3T2MA 2CTRA 4H33A 3W7SA 4RUFA 2R72A 4UFZA 4F6EA 1FD9A 4UCUA 1VQLV 2BOBC 4DUZO 5KA6A 2GUZB 2P7TC 5B3SB 1M57C 1YJ9V 2OCHA 2KSDA 1OCCB 3F5TA 2ARHA 5KHIA 3DXRA 2BE3A 4RQEA 3K3WA 1YJNV 1IDSA 4TWKA 4WFBV 1S5HC 3F5WC 4K0KB 2DYSC 3K06A 2M7WA 5LP6A 3PJSK 4X62O 3E8BA 2WLKA 4UUJC 5FLXN 2ZIOA 4CC5A 1FFTB 3ETEA 2X0LA 1N0JA 4D7TA 4GUNA 4IT5A 3CPWU 2PTMA 4EKWA 3UT5B 3THOA 1WB8A 3OGCC 4DR2O 5AG2A 1VQ9V 3RYCA 1BSMA 2BOCC 4JZ2A 2ZE6A 4IIJA 4K3AA 2PUSA 3OD4A 3CMAV 1Q82W 3SDLA 2NR5A 5F2VO 3JAWA 4JF3A 1R3KC 4BW9A 1Z5WA 4LR3A 2EIJB 3HKCB 4GKJB 1KYOF 2AXTZ 2PI5A 3FAVB 1QU7A 3CS5A 3RT3C 5KHKA 2WLLA 2EILC 1KP3A 4QE7A 5DN6G 3R65A 2WA3A 1YITV 2QWPB 1ZWIC 5JVDA 1R1BA 5LMNB 1Y74A 2Y69B 4DR3O 4UCSA 1RFYA 2Y4TA 4DV2O 3FB6C 4LF7B 1H2MA 3RGBA 5JJEB 1KKDA 1XREA 3CHXA 2Z0AA 2HP8A 3I56V 3ZRWB 3LSQA 2DE0X 2EIKB 3KKYA 5IJ9A 2HEPA 2N04A 1XQ8A 3F7VC 5KUKA 1K73W 2PI4A 2A79B 3E8HA 2ZNJA 1SQPH 3E89A 2HJFC 2GHYA 3ZIAG 4YIOA 3FB8C 3L70H 2P22C 4AI8A 1N33O 5GONA 4AQYO 5H6QA 4LF9B 2P5OA 1XOUA 3VOUA 2ZM6B 2QGNA 1TUBA 1MG1A 3HKEA 3ABLC 4N21A 1KUQA 4FZ1A 5JJNB 4XDLA 5IJ0B 2PZSA 2JDIG 1IZ3A 1E1RG 1WA8A 4I50B 5K1PA 3CXHF 3SYAA 4NTYA 3STLC 3K5NA 1OV9A 2X6AA 2HFEC 4BIZA 1LUVA 1WPBA 3GB7C 1MA1A 5CA1A 1BHAA 3AG1B 4CS4A 5IY5C 4FK5C 2ADQB 3PN1A 2Y0PA 1THZA 2IJKA 3B77A 5IE9A 2ZXWC 3G80A 3WFVA 2PYJA 2F66C 4X1KA 1H8EG 3ZJZA 4RAIA 1SQFA 3K9SA 4I9QA 1CPYA 4DV6B 2WLMA 3HPLC 3LDEA 4JI3O 2W6JG 2E74B 2KB1A 3CJHB 1VF6C 2JS3A 1IBKO 1SC5B 5LGTA 4PA7A 4GX2A 3TXSA 3ZHSA 3AG4C 2VQFO 5C8YB 3ZMVA 1XNRO 1FXKC 5LA6A 2QEXV 2UXNA 4LFBO 1L0NH 3T4DA 1Q7YW 1MSWD 3OM3B 2YXYA 4JI8B 4J7ZA 4LNUA 1JJOA 2K1EA 1FS0G 5CBHA 3OMIB 3K5LA 1M1KW 5B5EZ 3HKDB 3E86A 3QVNA 3DTUB 2JJ1G 1BMFG 1JQ0A 3SJBC 4Q6GA 2F4VB 1YDXA 5EBMC 4DV7B 1XDCA 2RNBA 2A7WA 1KBHA 1R6NA 5IYDO 5FPOA 4ZBMA 4FLUA 2Q0AA 3ZRVA 3OTOB 1TA8A 2QR4A 2QSAA 1K34A 1RPOA 1Q90D 1N32B 4OPAA 3TK1A 1NTMH 1ZL8B 3J80N 1HNWB 3DSQA 3CD6V 3JD3A 3IGAC 3G6BA 1TAEA 4OX9O 3WB1A 2QKAA 4DW1A 5CB4B 4JYAO 4ASUG 1FJGB 3LUTB 4YJ3B 3SPGA 4O2BB 2VQEB 4LF4O 1QR9A 4IHJB 3BEHA 1JA8A 2ITDC 1LR1A 4MVSA 5BMVB 2X6CA 2HJDA 5KMGB 3UM7A 3G71V 1HR0B 4BW5A 4NTXA 1I7FA 5DEDA 1Z5VA 5BZBA 3B40A 1BL8A 4DXWA 4NR1A 1EFRG 2YIAA 4UB8Z 3QO8A 4WFEA 1HNXO 1XI1A 1V54B 3JD1A 4A5UB 1GAXA 4JTCB 4K8XA 1NZ6A 2FTKA 3K5MA 3IC9A 1GN2A 1ZSPA 1KU9A 2B9ZA 4JGSA 4Z2WA 2R9AA 2GBOA 1J95A 2ZDIC 2EZOA 1XUQA 3ZMTA 2ITCC 4JYAB 3SJAC 1WPXA 3ZHVA 3RVYA 3IC7A 1XL6A 1M56B 4FLVA 2RQ6A 2QTOA 2UXCO 2ZR3A 5KLVH 1N0NA 5JQGB 3TGUH 4NXNB 5B1OA 1DLBA 4YHHO 1F4NA 2YI9A 5ITZA 1ENVA 5IT9N 3H1KH 1F4MA 4NKGB 4ZHQA 2ZNIA 1B06A 5TISZ 3D3QA 1TVKB 2EIKC 4GCZA 3JAMN 1QLEB 5H6RA 2GV9A 3CXCU 1EZJA 1RSOB 4F4LA 4JAAA 1VQ6V 4FLZA 1J5EO 4MTOA 4JI4O 2OWOA 4WBNB 5EYPA 1JCHA 4H37A 3ASNB 1ZX3A 4DO2A 1VF6A 2F23A 2CUGA 3ZX6A 5LBQA 2UXCB 3CRMA 3CP1A 3HR0A 1AI6A 1OJHA 3LDCA 1FXKA 4TUYA 3SJQC 4HNAA 2ZINA 1F51A 5A2QN 2Y4UA 3AG1C 1ZLZA 1OCZC 2DYRB 1DGSA 2XUMA 4EFBA 1IBLB 4PDLA 3BCCH 5KHJA 3JALB 1YHQV 3OR6C 2GTSA 1N34O 4CZZA 3ZS8C 4TSFG 4D7SA 1IXMA 2UUBB 4L87A 4MVZA 2OYQA 1FKAO 4N23A 2V7QG 3EFFK 4QIWF 4QNHB 3RYFA 3RWRD 4LF6B 1XMQO 2UXDO 1AVMA 2WLJA 1NR7A 2AGAA 4IL6Z 4CH4A 1KD1W 2UUCO 2LGQA 4EFEA 3B2EE 1VQPV 1FYJA 3CC2V 3U11A 2Q73A 4KUMA 2HHHB 2QKCA 3RBZA 1AR4A 4I7ZB 4LWSB 1WJZA 4OPHA 5IDJA 3CRCA 4DV1B 3AG3B 2BSKA 3AG2B 1JX9A 3BAAA 4DV0O 5EBWC 2QKSA 1Q6UA 2C2AA 4JZGA 4HAMA 4X64O 1SQGA 2CTWA 4UVBA 5KAIZ 2HLDG 4JYCA 4ZOLA 2E3CA 2N05A 3SPJA 1IBMO 2PY5A 3UT5A 2UXDB 1VQNV 2V1DA 5GTHZ 4CH3A 5B1AC 5KA5A 1H2GA 3OW2U 4H44B 4JI6B 3BA9A 4ICGA 5LMUB 2UUAO 4FM2A 3E35A 3E8GA 3E22B 3K04A 1I0HA 3ZRXA 2XAHA 3HKCA 2ZCEA 2DJVA 3ZBHA 1I94B 1HNZO 5BR8B 3KG2A 3B8NA 2LQTA 2ZDIA 4MT8A 4GX5A 3HKBB 1AP6A 3UKMA 2VRZA 2WWWA 2QJ1A 4DV4O 1AROP 5J2TB 4X64B 1XNQO 2Q69A 4XBFA 4PHZA 1Y76A 3ZHRA 3ETGA 3P3PA 3B09A 3CCMV 1AR5A 4LFAO 1GM9A 4MSWC 3WB2A 3W7UA 4DR7B 1PM9A 1X4TA 4YJ2B 3ZRWA 2UXBO 2H94A 3I5DA 2AZ2A 1JVMA 2AHYA 4JTDB 2DWEC 2UUAB 1JOYA 2A06H 3CCQV 4FVMA 4JI5B 4FLYA 3JD0A 2IM9A 3AK3A 5L3CA 2GTAA 4YY3O 3D36C 5CA0A 1H2SB 1YSCA 5LHIA 2NLJC 4O2AB 1K5QA 3OTFA 2QM8A 1KQSU 4LBEC 4DR6O 1NI8A 2XOKG 5IYZA 1LUWA 5IJ0A 2KG7B 2QDOA 3CRRA 4RQFA 4I50A 1AI7A 4EEQA 2H3OA 5CBGA 4I0XB 3H1LH 4KHPO 1NKDA 4DUZB 4LFAB 2BTQB 2Z5UA 1R3LC 1VIBA 1QLEC 2IJIA 4PDRA 4FFKA 2UXBB 5GTIZ 1PL0A 5LGNA 1Y4MA 4J9ZB 1Q3EA 3ZMUA 1M4UA 5EBLC 1P49A 5KHHA 1AP5A 2RJZA 3DC6A 1M90W 4X66O 2OIGA 2UXXA 4JPRA 1SA0B 5L3EA 1XEQA 3CJHA 2G38A 3EVKA 4P9PA 1S5LZ 4W4LA 4C7UA 1RPRA 5C8YA 2WPDG 3X2QC 5B1BB 4JYYA 4DR6B 2HVJC 4WFGA 1UJWB 1S0VA 4R8CA 5L3FA 1VARA 3BPZA 3WU2Z 1BS3A 2YUAA 2JGDB 4PJ0Z 1UPGA 2XT9A 4X62B 1F23A 1VF5B 3P3NA 1Y67A 1LNQA 1W0JG 1KB9F 3JYCA 3GVMA 1K5SA 1KMIZ 4GLXA 4MS2A 4DR2B 1KKCA 3EHBB 4J42A 4LH7A 2QWRB 1W59A 1QBZA 4I9WA 1EM1A 3SYPA 3JARB 4DRXA 1WP8A 1Q6IA 4O4JB 4PA9A 1P7GA 1SQQH 3K57A 2YXLA 3APOA 2CK3G 3O65A 3M8AA 2OCCB 4FFBB 1MOFA 2MK3A 3UCSC 4DYLA 4DR4O 1BQZA 3LNNA 2EULA 3FYIB 1M5IA 4B3RO 5KHGA 1VF7A 4OXSA 4DR3B 5CB4A 3ASOB 3DXRB 1ZTEA 2Q7EA 2EINB 4O2BA 3O9OA 4P9OA 4R7CA 4DV2B 4PI0A 2JEXA 1D2DA 4JI7O 2P4VA 2E75B 4GKKO 2ATKC 5BMVA 2AZ0A 1OCOB 3M99B 5KMGA 1YTFB 2FMLA 3ABKB 3OMAB 3CCVV 1SKVA 1BQ0A 4HZ3A 3A0HZ 2ZD9A 5LOVB 4LP8A 1B6QA 1K33A 1N33B 3CCSV 1GRJA 1YJWV 2PGGA 1YCIA 4AQYB 3RYHA 3LSUA 1P4RA 3C90A 1SZXA 4TQFA 1GTOA 2AHZA 2EIMB 2W6IG 4CH5A 3OFNG 4X20B 3RYCB 1NH2D 4IIJB 1SERA 2NNUA 4MW8A 4QPJA 3ZMZA 1G1XB 2P06A 3B8MA 2LJ2A 2FL4A 3D36A 4NXMO 2IJJA 2P90A 1Q5OA 4I55B 2Q4PA 4KFMA 1S77D 2JGUA 3OUSA 5L3BA 2F1MA 1EN6A 3OGIB 2XAFA 4JI1O 5B3SC 4BIUA 1MNGA 4DV3O 3OE7G 4JI3B 2WLLB 4G27B 3UQ8A 4FLTA 4IGGA 2RMKB 1IBKB 4O4LA 4UCTA 5JVDB 3CCLV 1YEWA 4JTAB 2VQFB 1JPXA 5FL7G 1V9PA 4JAVA 1XNRB 3A2FA 1NVPD 2H8PC 1OCCC 1GN6A 2QM4A 4RO2A 3RYIA 1RSOA 3D8CA 1G6UA 4LFBB 4B3SO 2NN4A 4MVMA 1H2KA 1O9HA 2BTOA 4WBNA 3ABMB 1VQ7V 1FFXB 2Q6AA 3K5OA 3CMEV 2CH7B 4MVRA 5J2UB 4B3MO 4J7KA 2Q67A 4RUEA 3CB2A 3CRAA 4UV8A 1QQCA 2EX3A 2ODMA 3L71H 3MAQA 4B3TO 3ZHUA 2DQ3A 1TUBB 3BRCA 4EB6B 3JALA 3AEIA 4PA6A 1EN4A 4H13B 3IAYA 1N36O 1L0LH 4B7EA 2ZR2A 2OTLV 3OT7A 2EIJC 2AW9A 4JI0O 3N27A 4DR5O 4OX9B 5H9CA 2K9PA 2EJRA 1YTFD 4LF4B 1HW7A 1M57B 4LWSA 3CWBH 2CE4A 2Y69C 3IFXA 3K59A 3QO5A 3AG7A 1SESA 1WB7A 3FB7C 4U3JB 3FX7A 3U0ZA 1COWG 4Z1VA 1HNXB 5KAFZ 2ETNA 3MHHC 1SQBH 2DN9A 4ZI7A 1HDJA 1YIJV 2KKWA 5LXTA 4P30A 1IXBA 3E2EA 4JV5O 2OCCC 3BABA 1P7BA 2Z3YA 5KUMA 3CCRV 2R70A 4CH6A 2CDYA 3KZIZ 2XTAA 3JATB 2ZE7A 4PDMA 1AI4A 2YIBA 1YZBA 3C3SA 4TQDA 4TT3G 4J80A 1QNMA 2HVKC 4X65O 3A0BZ 3E22A 3MD0A 3BHPA 3G6EV 3OEHG 2L35A 3VQWA 4YHHB 2ZE5A 4TV8A 1WP7A 1DK1A 1XMOO 2Y0IA 2FB5A 3HKBA 5D5QA 3ZHQA 1K3EA 5J2TA 4G28B 2LW7A 2HR3A 1ZUQA 4I4TB 3T1HO 4JI2O 1OCRB 1M93A 4R50A 4W4KA 3RFRA 3B4SA 1J5EB 3G67A 2GUZA 4JI4B 4LF8O 2IH3C 4DUYO 3L72H 2EILB 3WG7B 4YJ2A 3JAKB 1U96A 1R73A 2QE7G 3U10A 2R9RB 1W2BU 2WLNA 3K03A 2A3QA 2QA4V 2DOSA 2QM7A 5HFLA 2Q8VA 4MTFA 3SYQA 2Q0OC 3A0RA 5KX5B 4O2AA 3LDDA 4O4IB 3ETDA 1PD3A 1N34B 3EXAA 4DR1O 2B5UA 3W7TA 2KG7A 4LF5O 2LP7A 1Q86W 3SR2C 4DK1A 3GWKC 1I5YA 4PDVA 3E83A 4I0XA 4AILC 2YC0A 4UV9A 2BTQA 4KXRA 1BHBA 1B3QA 3N2GB 3ABLB 2WA4A 5B1NA 1MSDA 1KP2A 2Q68A 4J10A 3WB0A 2CGOA 3BVOA 1N4CA 1XMQB 5ITZB 5IWAO 4CC6A 1EZVH 5CA3A 2UUCB 4X88A 1MZFA 4IYIA 1S76D 2WAMA 3ABMC 3BA8A 3H01A 5IY5B 3FFQA 2XASA 1GO3F 2LGWA 4X1YB 1NJIW 4NVPA 1QVFU 4F6RB 1WAZA 2M6YA 3AK1A 5LYJB 5FNVB 3N2KB 4DV0B 3SYOA 1YF2A 3JASB 3RVZA 3FAVA 4X1IB 5EYPB 5IYCO 1R6KA 1L1FA 3L73H 2JGDA 4X8AA 3JD2A 1GM8A 3K0DA 1BCCH 2YS8A 4FJCC 1QVGU 3K58A 3H1HH 3OR7C 2RCVA 4JYBA 1FXKB 4FZ0A 3F7YC 2YEVB 1G8MA 1D5AA 2EZPA 1JFFB 2CTQA 5D5PA 1IBMB 4ABMA 2HKOA 1V54C 3D3IA 1K8AW 1MABG 1IURA 3JARA 3QO7A 3AK2A 4O4JA 1PNMA 1FXVA 2VWJA 1VEWA 5EIBC 4UCVA 4BWAA 1QHTA 3CC4V 2DW4A 4TV9B 3ZMSA 4WF9V 5CN0A 1HNZB 4HBNA 1M56C 3STZC 4BIOA 4FFBA 2E5LO 4QJFB 3RYFB 5JCOA 4DV4B 1TGOA 2PF4E 1HP8A 2IU0A 2QWOB 1XNQB 4O4HB 5L3DA 5H2FZ 1Y66A 2EBOA 4IYHA 1SRYA 3MDSA 4JAUA 3J81N 5K1XA 1K9MW 5LL6Y 1A32A 4YXWG 2FKXA 4FM1A 1PV0A 1K7DA 1NH2B 2BSKB 3S3XA 4GKJO 2JIZG 1N8RW 3VQYA 1H2NA 4KL1A 1PNKA 5LOVA 3CSXA 2EJ7A 3ASNC 4YY3B 4LCUC 1EBOA 4LC1A 3ETQA 2WLIB 5EZYB 5LMNO 4ZOLB 1AB3A 2BCCH 3S3WA 2E5LB 3OAAG 4WFAV 3JSLA 4LF7O 4X20A 4LH6A 3IJ4A 2DYRC 1AILA 3NR7A 1NVPB 2P6JA 2A9HA 4KHPB 2OT5A 5JH7B 2XNDG 1JJ2U 1K4DC 1VQMV 2ZT9B 4I55A 1GKFA 1GN3A 1OCRC 3VBBA 4AHCA 4XDKA 2PYLA 3JD4A 4LF9O 2LFRA 5CBFA 3HKDA 2ZM6O 5DECA 5HFMA 3ZRSA 4X66B 3WG7C 1G4YB 4UCOA 3Q4HB 3GWOA 1VQKV 4PD4F 2W0FC 1CXZB 1XL4A 3CCEV 1Y76B 2WLHA 2XAJA 2YIBD 3K08A 3VQXA 1VQ4V 2P67A 4PA4A 1GN4A 2OTJV 1ZL8A 3CYOA 2YIDA 1FFXA 2Q9LA 2XAGA 2CH7A 3AG3C 5C93A 3AG2C 1MZEA 4P2ZA 1BT8A 5J2UA 4MTGA 4DV6O 3TCUA 4R6ZA 1SQXH 4YJ3A 5CA0B 4U7OA 4IHJA 3T4ZA 1YI2V 5IYZB 4EB6A 2Q5ZA 3HB3B 3TETA 1OHHG 1YVWA 1NR1A 2ZKOA 4GX1A 2YSUB 1R3IC 1V55B 3QF7A 5B66Z 1QR8A 5LP6B 5H5NA 3OUFA 5CMUA 1NT2B 4FPPA 1MMMA 4JI8O 1OCZB 3J7AU 2GSMB 1L8DA 4YIPA 3KCYA 5L3GA 4K8ZA 4DR4B 4QGPA 1ROPA 4BR6A 3OMNB 5JJJB 4B3RB 5LHGA 4J7JA 3K79A 2F4VO 3FB5C 1SS3A 3E8FA 3M7MX 2N74A 1TUEB 5A9GA 4J41A 4WFFA 1NTZH 4DV7O 1RM1B 1BE3H 3JAWB 2JK5C 1YXBA 2F93B 3BFRA 4JI7B 1H2LA 1AJNA 1VMGA 2ZQMA 4GKKB 3P30A 4Q20A 1K97A 3OTOO 5JQGA 2ADPA 1PNLA 3ZN0A 2JS5A 2YXHA 1N32O 4Z1MG 2F43G 3L74H 1BGYH 3NXSA 2IJHA 1HNWO 3K9AA 4U3JA 4DV5O 4UVAA 1BZKA 4FM0A 1KECA 1TVKA 4X9QA 2D2CB 4H0LB 1Y74B 4U7NA 1AR1B 3ABTA 4MVOA 1FJGO 1XILA 2YDEA 5J9PC 1NQTA 4RWUA 1VQ8V 3R66A 2VQEO 3ML0A 1XHXA 4DRXB 3ZCCA 4CS2A 1GH6A 4TOIA 3SYCA 4B7KA 1P84F 5IJ9B 2IU3A 3CCJV 3JATA 1HR0O 1FXHA 4NXMB 4B08A 3H1IH 2JRIA 3LSSA 2QWQB 3KCXA 1GMGA 2CTPA 5GONB 2JEUA 3W7XA 4JI1B 4LFCO 5B1AB
chains in the Genus database with same CATH topology
1X4TA 4DV3B 4DV5B 3HKEB 4YJ2B 1M93A 2P22C 3RFRA 5GONA 4LF9B 2UUAB 2P5OA 1J5EB 4I4TA 2ZM6B 4FVMA 4JI4B 4UCRA 1TUBA 4JI5B 4FLYA 3ZEDA 2IM9A 3HKEA 4YJ2A 1Q8IA 5CA1B 3JAKB 5JJNB 1WN7A 5IJ0B 2PZSA 5CA0A 3U10A 1H2SB 4I50B 5K1PA 4B3SB 4O2AB 3OTFA 4L8JA 3K5NA 1WNSA 5IYZA 4X1KB 1WPBA 2Q7GA 5CA1A 3JAKA 4CS4A 5IJ0A 4B3MB 1Q43A 4I50A 3PN1A 4EEQA 5KX5B 4O2AA 2PYJA 2F66C 4O4IB 4X1KA 4B3TB 1N34B 1SQFA 4LFCB 3RYHB 4DUZB 4LFAB 2BTQB 4I9QA 4DV6B 3SR2C 2V4DA 4DK1A 5KX5A 4ZIBA 2UXBB 5LA6B 4AILC 4O4IA 1Q3EA 2BTQA 5C8YB 1M4UA 1P49A 5KHHA 2RJZA 3N2GB 1SA0B 5LA6A 3WB0A 4FLXA 1N36B 1XMQB 4DR7B 5ITZB 3QTCA 4LNUB 4CC6A 5C8YA 2UUCB 3N2GA 4DR6B 3BA8A 4JI0B 3FFQA 4JI8B 4DR5B 1ZAUA 3BPZA 1XHZA 4X1YB 4LNUA 1JJOA 4NVPA 4F6RB 4CS3A 3K5LA 4DK0A 4X62B 5JCOC 5FNVB 4O4LB 5LYJB 2CAZC 3HKDB 3N2KB 4DV0B 3JASB 3SJBC 4X1YA 4X1IB 5EYPB 4Q6GA 5FPRA 2F4VB 4F6RA 3RYIB 1KMIZ 5LYJA 5FNVA 4DV7B 4GLXA 3K58A 3N2KA 4DR2B 3JSNA 4LH7A 3JASA 5FPOA 4X1IA 4FLUA 2Q0AA 3JARB 4DRXA 1D5AA 2JVDA 1JFFB 3OTOB 5D5PA 1TA8A 1IBMB 4O4JB 1N32B 3K57A 2YXLA 1HNWB 3DSQA 5LP6C 3JARA 1JFFA 1TAEA 4O4JA 2VWJA 5EIBC 4UCVA 4BWAA 1QHTA 4JV5B 4FFBB 3WB1A 5CB4B 1FJGB 4TV9B 4YJ3B 3LNNA 1M5IA 1T5EA 3VQVA 1HNZB 4O2BB 2VQEB 1O9GA 4IHJB 3ICXA 5KHGA 4HBNA 1VF7A 4FFBA 4X65B 4DR3B 5CB4A 2VWKA 3RYFB 4TV9A 5JCOA 5BMVB 1TGOA 4DV4B 2Q7EA 4O2BA 5KMGB 4DV2B 4PI0A 3SGIA 1HR0B 4O4HB 1XNQB 1XMOB 1I7FA 1Z5VA 5K1XA 2YIAA 5BMVA 2Q7HA 4FM1A 1XI1A 5KMGA 4K8XA 4O4HA 3K5MA 1SKVA 3T1HB 4JI2B 1KU9A 5LOVB 3QG5A 4FLWA 1N33B 3VQYA 2PGGA 4AQYB 2R9AA 3RYHA 4JYAB 4KL1A 3SJAC 4LF8B 4DUYB 4TQFA 5LOVA 3CSXA 4CH5A 4X20B 4YY3B 4PI2A 3RYCB 4FLVA 2RQ6A 3ETQA 4IIJB 5EZYB 4ZOLB 2YI8A 4ZHQB 2E5LB 5JQGB 4NXNB 5EIBD 3JSLA 3SJCC 1SA0A 4X20A 3T1YB 4LH6A 1Q5OA 5EZYA 2YI9A 4I55B 5ITZA 4ZHQA 2ZNIA 4ZI7B 2JGUA 2F1MA 1TVKB 5LXTB 4KHPB 4DR1B 5JH7B 4LF5B 4I55A 4JI3B 2GV9A 3UQ8A 4FLTA 4GYCB 4AHCA 1IBKB 2PYLA 4O4LA 4UCTA 5JVDB 1YEWA 4FLZA 3HKDA 2F95B 5JH7A 2VQFB 1JMKC 1V9PA 2OWOA 4WBNB 1XNRB 3A2FA 5EYPA 4TUYB 4HNAB 4X66B 2QM4A 4UCOA 1S5JA 4TV8B 1RSOA 3RYIA 1G6UA 2UXCB 5IWAB 4LFBB 2XHBA 2ZIMA 1O9HA 2BTOA 1B04A 4WBNA 1FFXB 4TUYA 4HNAA 3K5OA 2YIBD 2UU9B 2ZINA 3VQXA 5J2UB 1DGSA 3CB2A 2R72A 1QQCA 4EFBA 4UFZA 2EX3A 1IBLB 5KHJA 1FFXA 3JALB 3MAQA 4UCUA 3ZS8C 5J2UA 1TUBB 4D7SA 2UUBB 3BRCA 4EB6B 3JALA 4YJ3A 2OYQA 5CA0B 4IHJA 5KHIA 5IYZB 3RYFA 4EB6A 3RWRD 4LF6B 3IAYA 4CH4A 3QF7A 5LP6B 4EFEA 3B2EE 3U11A 2HHHB 4K0KB 1NT2B 4OX9B 1L8DA 5LP6A 4K8ZA 4DV1B 4DR4B 5JJJB 4B3RB 3BAAA 4LF4B 2ZIOA 4CC5A 1HW7A 4D7TA 3M7MX 3K59A 2PTMA 3UT5B 3THOA 3JAWB 1SQGA 3RYCA 2F93B 4IIJA 4JI7B 4U3JB 4ZOLA 2E3CA 2PUSA 3U0ZA 4GKKB 5JQGA 2PY5A 2JS5A 3UT5A 2UXDB 1HNXB 3JAWA 4BW9A 1Z5WA 4LR3A 4CH3A 4U3JA 3HKCB 4GKJB 4JI6B 4ZI7A 4FM0A 1TVKA 2KKWA 3BA9A 5LXTA 5LMUB 4FM2A 3BABA 3E22B 2R70A 3HKCA 4CH6A 2ZCEA 5KHKA 1I94B 5BR8B 3JATB 4TQDA 2YIBA 5JVDA 5LMNB 1XHXA 4DRXB 3E22A 4CS2A 3HKBB 4TOIA 4UCSA 3BHPA 2QJ1A 5J2TB 5IJ9B 4X64B 3JATA 3VQWA 4LF7B 4YHHB 4TV8A 4NXMB 4B08A 3RGBA 5JJEB 3CHXA 4PHZA 3HKBA 5D5QA 5J2TA 5IJ9A 2HEPA 1XQ8A 5GONB 4JI1B 4I4TB 3WB2A 2ZNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JS5 A;  1X4T A;  2CAZ C;  3QF7 A;  1NT2 B;  3THO A;  3B2E E;  3SJA C;  3ZS8 C;  3ICX A;  3QG5 A;  2F66 C;  3SJB C;  2P22 C;  1SKV A;  3CSX A;  3SJC C; 
#chains in the Genus database with same CATH topology
 4DV3 B;  4DV5 B;  3HKE B;  2LFS A;  5DM6 V;  3OEE G;  4G2K A;  3H9V A;  1AJP A;  1DF5 A;  1WA8 B;  5GW7 A;  2Y48 A;  4I4T A;  1AI5 A;  1Y6X A;  4UCR A;  1VQ5 V;  3JCU Z;  3ZED A;  4J11 A;  1PL4 A;  1OZ0 A;  1CP9 A;  1Q8I A;  2CGN A;  5CA1 B;  1WN7 A;  1D5N A;  2DWD C;  4B3S B;  1DF4 A;  1R3J C;  4FMT A;  1SET A;  4L8J A;  4K35 A;  2X7R B;  1WNS A;  4GX0 A;  4NYK A;  5B1B C;  4NXN O;  2RN9 A;  4X1K B;  2OIE A;  2IH1 C;  3APQ A;  2Q7G A;  2ILM A;  3JAK A;  1H8H G;  5E1A C;  4B3M B;  3TXQ A;  3QNE A;  1SQV H;  1Q43 A;  1JR9 A;  4CBC A;  1E79 G;  2WSS G;  4B3T B;  3DC5 A;  3LNM B;  4LFC B;  3RYH B;  1I5X A;  5LGU A;  3ZHT A;  1PP9 H;  4XDJ A;  1NTK H;  4QPK A;  3JCZ A;  2V4D A;  3CE2 A;  5KX5 A;  4MVU A;  4ZIB A;  5E79 Z;  3RN4 A;  1SZT A;  5LA6 B;  4O4I A;  2QTS A;  1KC8 W;  4KP4 A;  2QWN B;  3SPC A;  2RDC A;  2E76 B;  2D3O W;  2HG5 C;  4NB5 A;  4FLX A;  1X59 A;  4PV1 B;  1N36 B;  1NBM G;  1ORQ C;  3QTC A;  4LNU B;  1EN5 A;  5LHH A;  1VQO V;  4OGQ B;  2MW2 B;  3N2G A;  3C3T A;  4JAS A;  4JI0 B;  4E4E A;  1Z2G A;  4DR5 B;  1K92 A;  2DYS B;  1ZAU A;  4GZR B;  1XHZ A;  3P32 A;  4I5S A;  5EK0 A;  5EC2 C;  1IBL O;  4CS3 A;  2JJ2 G;  1K4C C;  4DK0 A;  5JCO C;  4O4L B;  1VP7 A;  2GDS A;  2CAZ C;  2KQX A;  4X1Y A;  2UUB O;  5FPR A;  4F6R A;  1URF A;  3RYI B;  3ASO C;  5LYJ A;  5FNV A;  2P4K A;  3N2K A;  2EIN C;  3L9D A;  3JSN A;  3JAS A;  4X1I A;  3G4S V;  1Q6H A;  3SPH A;  2ZE8 A;  1UFI A;  1IVS A;  3CX5 F;  2JVD A;  3I55 V;  4LF6 O;  1OCO C;  1PKX A;  3X2Q B;  3ABK C;  1V55 C;  1WLE A;  1PPJ H;  3UO2 A;  5LP6 C;  2YEV A;  4X89 A;  2HHH O;  1GK9 A;  1JFF A;  2O57 A;  1FPO A;  2VS0 A;  1GM7 A;  2DMX A;  4JV5 B;  3A8T A;  4HYO A;  2LW1 A;  4GT1 A;  3DGE A;  1S72 V;  4DV1 O;  1US6 A;  2XAQ A;  1T5E A;  3VQV A;  2W0X A;  1RP3 B;  3FYE B;  3K0G A;  2EIM C;  1O9G A;  1R6T A;  3ICX A;  4UVC A;  4X65 B;  4UXN A;  3FKS G;  3FD9 A;  2VWK A;  1FAF A;  4TV9 A;  4QE9 A;  1RM1 C;  4UB6 Z;  3CEI A;  3T1Y O;  3H1J H;  3SGI A;  4D6T H;  4J9Y B;  2IBZ H;  1XMO B;  3CC7 V;  3TJT A;  2YIC A;  2X6B A;  4ZKI A;  1E1Q G;  4MVQ A;  2Q7H A;  4DW0 A;  2LO1 A;  4O4H A;  3UO3 A;  3T1H B;  5JWP A;  5IYB O;  4JI2 B;  4MTX A;  4JI6 O;  3QG5 A;  4FLW A;  3CCU V;  1HWY A;  5LMU O;  1SF9 A;  4LF8 B;  4DUY B;  1I08 A;  1QCE A;  1DTO A;  2B1G A;  3T1C A;  1I94 O;  2L6L A;  5BR8 O;  4PI2 A;  4PA3 A;  2A0L A;  2YI8 A;  4PEL A;  4ZHQ B;  1XBL A;  4FIP C;  3L75 H;  3RW0 A;  5EIB D;  2UU9 O;  3SJC C;  1SA0 A;  1S3J A;  3T1Y B;  5BY1 A;  2FYU H;  2WLI A;  5EZY A;  2DQ0 A;  2ZXW B;  1F7Y A;  4ZI7 B;  3ABU A;  2IW5 A;  2R9I A;  5EC1 C;  5LXT B;  4DR1 B;  1Q81 W;  4LF5 B;  4DR7 O;  1H38 A;  1CEZ A;  4MW3 A;  4WFH A;  1M9N A;  4WCE V;  4GYC B;  2F95 B;  3AG4 B;  5JH7 A;  3W7W A;  1JMK C;  3SPI A;  4JI5 O;  4E2L A;  3CRQ A;  1IX9 A;  4TUY B;  4HNA B;  3MHS C;  2B1I A;  4BAY A;  1S5J A;  4TV8 B;  3BY6 A;  1QLN A;  5IWA B;  4NTW A;  2XHB A;  2ZIM A;  1W0K G;  1B04 A;  3ZN1 A;  1U97 A;  2UU9 B;  4U3F H;  1NU1 H;  1NS1 A;  5BXZ A;  3Q4H A;  4K0K O;  1AJQ A;  3T2M A;  2CTR A;  4H33 A;  3W7S A;  4RUF A;  2R72 A;  4UFZ A;  4F6E A;  1FD9 A;  4UCU A;  1VQL V;  2BOB C;  4DUZ O;  5KA6 A;  2GUZ B;  2P7T C;  5B3S B;  1M57 C;  1YJ9 V;  2OCH A;  2KSD A;  1OCC B;  3F5T A;  2ARH A;  5KHI A;  3DXR A;  2BE3 A;  4RQE A;  3K3W A;  1YJN V;  1IDS A;  4TWK A;  4WFB V;  1S5H C;  3F5W C;  4K0K B;  2DYS C;  3K06 A;  2M7W A;  5LP6 A;  3PJS K;  4X62 O;  3E8B A;  2WLK A;  4UUJ C;  5FLX N;  2ZIO A;  4CC5 A;  1FFT B;  3ETE A;  2X0L A;  1N0J A;  4D7T A;  4GUN A;  4IT5 A;  3CPW U;  2PTM A;  4EKW A;  3UT5 B;  3THO A;  1WB8 A;  3OGC C;  4DR2 O;  5AG2 A;  1VQ9 V;  3RYC A;  1BSM A;  2BOC C;  4JZ2 A;  2ZE6 A;  4IIJ A;  4K3A A;  2PUS A;  3OD4 A;  3CMA V;  1Q82 W;  3SDL A;  2NR5 A;  5F2V O;  3JAW A;  4JF3 A;  1R3K C;  4BW9 A;  1Z5W A;  4LR3 A;  2EIJ B;  3HKC B;  4GKJ B;  1KYO F;  2AXT Z;  2PI5 A;  3FAV B;  1QU7 A;  3CS5 A;  3RT3 C;  5KHK A;  2WLL A;  2EIL C;  1KP3 A;  4QE7 A;  5DN6 G;  3R65 A;  2WA3 A;  1YIT V;  2QWP B;  1ZWI C;  5JVD A;  1R1B A;  5LMN B;  1Y74 A;  2Y69 B;  4DR3 O;  4UCS A;  1RFY A;  2Y4T A;  4DV2 O;  3FB6 C;  4LF7 B;  1H2M A;  3RGB A;  5JJE B;  1KKD A;  1XRE A;  3CHX A;  2Z0A A;  2HP8 A;  3I56 V;  3ZRW B;  3LSQ A;  2DE0 X;  2EIK B;  3KKY A;  5IJ9 A;  2HEP A;  2N04 A;  1XQ8 A;  3F7V C;  5KUK A;  1K73 W;  2PI4 A;  2A79 B;  3E8H A;  2ZNJ A;  1SQP H;  3E89 A;  2HJF C;  2GHY A;  3ZIA G;  4YIO A;  3FB8 C;  3L70 H;  2P22 C;  4AI8 A;  1N33 O;  5GON A;  4AQY O;  5H6Q A;  4LF9 B;  2P5O A;  1XOU A;  3VOU A;  2ZM6 B;  2QGN A;  1TUB A;  1MG1 A;  3HKE A;  3ABL C;  4N21 A;  1KUQ A;  4FZ1 A;  5JJN B;  4XDL A;  5IJ0 B;  2PZS A;  2JDI G;  1IZ3 A;  1E1R G;  1WA8 A;  4I50 B;  5K1P A;  3CXH F;  3SYA A;  4NTY A;  3STL C;  3K5N A;  1OV9 A;  2X6A A;  2HFE C;  4BIZ A;  1LUV A;  1WPB A;  3GB7 C;  1MA1 A;  5CA1 A;  1BHA A;  3AG1 B;  4CS4 A;  5IY5 C;  4FK5 C;  2ADQ B;  3PN1 A;  2Y0P A;  1THZ A;  2IJK A;  3B77 A;  5IE9 A;  2ZXW C;  3G80 A;  3WFV A;  2PYJ A;  2F66 C;  4X1K A;  1H8E G;  3ZJZ A;  4RAI A;  1SQF A;  3K9S A;  4I9Q A;  1CPY A;  4DV6 B;  2WLM A;  3HPL C;  3LDE A;  4JI3 O;  2W6J G;  2E74 B;  2KB1 A;  3CJH B;  1VF6 C;  2JS3 A;  1IBK O;  1SC5 B;  5LGT A;  4PA7 A;  4GX2 A;  3TXS A;  3ZHS A;  3AG4 C;  2VQF O;  5C8Y B;  3ZMV A;  1XNR O;  1FXK C;  5LA6 A;  2QEX V;  2UXN A;  4LFB O;  1L0N H;  3T4D A;  1Q7Y W;  1MSW D;  3OM3 B;  2YXY A;  4JI8 B;  4J7Z A;  4LNU A;  1JJO A;  2K1E A;  1FS0 G;  5CBH A;  3OMI B;  3K5L A;  1M1K W;  5B5E Z;  3HKD B;  3E86 A;  3QVN A;  3DTU B;  2JJ1 G;  1BMF G;  1JQ0 A;  3SJB C;  4Q6G A;  2F4V B;  1YDX A;  5EBM C;  4DV7 B;  1XDC A;  2RNB A;  2A7W A;  1KBH A;  1R6N A;  5IYD O;  5FPO A;  4ZBM A;  4FLU A;  2Q0A A;  3ZRV A;  3OTO B;  1TA8 A;  2QR4 A;  2QSA A;  1K34 A;  1RPO A;  1Q90 D;  1N32 B;  4OPA A;  3TK1 A;  1NTM H;  1ZL8 B;  3J80 N;  1HNW B;  3DSQ A;  3CD6 V;  3JD3 A;  3IGA C;  3G6B A;  1TAE A;  4OX9 O;  3WB1 A;  2QKA A;  4DW1 A;  5CB4 B;  4JYA O;  4ASU G;  1FJG B;  3LUT B;  4YJ3 B;  3SPG A;  4O2B B;  2VQE B;  4LF4 O;  1QR9 A;  4IHJ B;  3BEH A;  1JA8 A;  2ITD C;  1LR1 A;  4MVS A;  5BMV B;  2X6C A;  2HJD A;  5KMG B;  3UM7 A;  3G71 V;  1HR0 B;  4BW5 A;  4NTX A;  1I7F A;  5DED A;  1Z5V A;  5BZB A;  3B40 A;  1BL8 A;  4DXW A;  4NR1 A;  1EFR G;  2YIA A;  4UB8 Z;  3QO8 A;  4WFE A;  1HNX O;  1XI1 A;  1V54 B;  3JD1 A;  4A5U B;  1GAX A;  4JTC B;  4K8X A;  1NZ6 A;  2FTK A;  3K5M A;  3IC9 A;  1GN2 A;  1ZSP A;  1KU9 A;  2B9Z A;  4JGS A;  4Z2W A;  2R9A A;  2GBO A;  1J95 A;  2ZDI C;  2EZO A;  1XUQ A;  3ZMT A;  2ITC C;  4JYA B;  3SJA C;  1WPX A;  3ZHV A;  3RVY A;  3IC7 A;  1XL6 A;  1M56 B;  4FLV A;  2RQ6 A;  2QTO A;  2UXC O;  2ZR3 A;  5KLV H;  1N0N A;  5JQG B;  3TGU H;  4NXN B;  5B1O A;  1DLB A;  4YHH O;  1F4N A;  2YI9 A;  5ITZ A;  1ENV A;  5IT9 N;  3H1K H;  1F4M A;  4NKG B;  4ZHQ A;  2ZNI A;  1B06 A;  5TIS Z;  3D3Q A;  1TVK B;  2EIK C;  4GCZ A;  3JAM N;  1QLE B;  5H6R A;  2GV9 A;  3CXC U;  1EZJ A;  1RSO B;  4F4L A;  4JAA A;  1VQ6 V;  4FLZ A;  1J5E O;  4MTO A;  4JI4 O;  2OWO A;  4WBN B;  5EYP A;  1JCH A;  4H37 A;  3ASN B;  1ZX3 A;  4DO2 A;  1VF6 A;  2F23 A;  2CUG A;  3ZX6 A;  5LBQ A;  2UXC B;  3CRM A;  3CP1 A;  3HR0 A;  1AI6 A;  1OJH A;  3LDC A;  1FXK A;  4TUY A;  3SJQ C;  4HNA A;  2ZIN A;  1F51 A;  5A2Q N;  2Y4U A;  3AG1 C;  1ZLZ A;  1OCZ C;  2DYR B;  1DGS A;  2XUM A;  4EFB A;  1IBL B;  4PDL A;  3BCC H;  5KHJ A;  3JAL B;  1YHQ V;  3OR6 C;  2GTS A;  1N34 O;  4CZZ A;  3ZS8 C;  4TSF G;  4D7S A;  1IXM A;  2UUB B;  4L87 A;  4MVZ A;  2OYQ A;  1FKA O;  4N23 A;  2V7Q G;  3EFF K;  4QIW F;  4QNH B;  3RYF A;  3RWR D;  4LF6 B;  1XMQ O;  2UXD O;  1AVM A;  2WLJ A;  1NR7 A;  2AGA A;  4IL6 Z;  4CH4 A;  1KD1 W;  2UUC O;  2LGQ A;  4EFE A;  3B2E E;  1VQP V;  1FYJ A;  3CC2 V;  3U11 A;  2Q73 A;  4KUM A;  2HHH B;  2QKC A;  3RBZ A;  1AR4 A;  4I7Z B;  4LWS B;  1WJZ A;  4OPH A;  5IDJ A;  3CRC A;  4DV1 B;  3AG3 B;  2BSK A;  3AG2 B;  1JX9 A;  3BAA A;  4DV0 O;  5EBW C;  2QKS A;  1Q6U A;  2C2A A;  4JZG A;  4HAM A;  4X64 O;  1SQG A;  2CTW A;  4UVB A;  5KAI Z;  2HLD G;  4JYC A;  4ZOL A;  2E3C A;  2N05 A;  3SPJ A;  1IBM O;  2PY5 A;  3UT5 A;  2UXD B;  1VQN V;  2V1D A;  5GTH Z;  4CH3 A;  5B1A C;  5KA5 A;  1H2G A;  3OW2 U;  4H44 B;  4JI6 B;  3BA9 A;  4ICG A;  5LMU B;  2UUA O;  4FM2 A;  3E35 A;  3E8G A;  3E22 B;  3K04 A;  1I0H A;  3ZRX A;  2XAH A;  3HKC A;  2ZCE A;  2DJV A;  3ZBH A;  1I94 B;  1HNZ O;  5BR8 B;  3KG2 A;  3B8N A;  2LQT A;  2ZDI A;  4MT8 A;  4GX5 A;  3HKB B;  1AP6 A;  3UKM A;  2VRZ A;  2WWW A;  2QJ1 A;  4DV4 O;  1ARO P;  5J2T B;  4X64 B;  1XNQ O;  2Q69 A;  4XBF A;  4PHZ A;  1Y76 A;  3ZHR A;  3ETG A;  3P3P A;  3B09 A;  3CCM V;  1AR5 A;  4LFA O;  1GM9 A;  4MSW C;  3WB2 A;  3W7U A;  4DR7 B;  1PM9 A;  1X4T A;  4YJ2 B;  3ZRW A;  2UXB O;  2H94 A;  3I5D A;  2AZ2 A;  1JVM A;  2AHY A;  4JTD B;  2DWE C;  2UUA B;  1JOY A;  2A06 H;  3CCQ V;  4FVM A;  4JI5 B;  4FLY A;  3JD0 A;  2IM9 A;  3AK3 A;  5L3C A;  2GTA A;  4YY3 O;  3D36 C;  5CA0 A;  1H2S B;  1YSC A;  5LHI A;  2NLJ C;  4O2A B;  1K5Q A;  3OTF A;  2QM8 A;  1KQS U;  4LBE C;  4DR6 O;  1NI8 A;  2XOK G;  5IYZ A;  1LUW A;  5IJ0 A;  2KG7 B;  2QDO A;  3CRR A;  4RQF A;  4I50 A;  1AI7 A;  4EEQ A;  2H3O A;  5CBG A;  4I0X B;  3H1L H;  4KHP O;  1NKD A;  4DUZ B;  4LFA B;  2BTQ B;  2Z5U A;  1R3L C;  1VIB A;  1QLE C;  2IJI A;  4PDR A;  4FFK A;  2UXB B;  5GTI Z;  1PL0 A;  5LGN A;  1Y4M A;  4J9Z B;  1Q3E A;  3ZMU A;  1M4U A;  5EBL C;  1P49 A;  5KHH A;  1AP5 A;  2RJZ A;  3DC6 A;  1M90 W;  4X66 O;  2OIG A;  2UXX A;  4JPR A;  1SA0 B;  5L3E A;  1XEQ A;  3CJH A;  2G38 A;  3EVK A;  4P9P A;  1S5L Z;  4W4L A;  4C7U A;  1RPR A;  5C8Y A;  2WPD G;  3X2Q C;  5B1B B;  4JYY A;  4DR6 B;  2HVJ C;  4WFG A;  1UJW B;  1S0V A;  4R8C A;  5L3F A;  1VAR A;  3BPZ A;  3WU2 Z;  1BS3 A;  2YUA A;  2JGD B;  4PJ0 Z;  1UPG A;  2XT9 A;  4X62 B;  1F23 A;  1VF5 B;  3P3N A;  1Y67 A;  1LNQ A;  1W0J G;  1KB9 F;  3JYC A;  3GVM A;  1K5S A;  1KMI Z;  4GLX A;  4MS2 A;  4DR2 B;  1KKC A;  3EHB B;  4J42 A;  4LH7 A;  2QWR B;  1W59 A;  1QBZ A;  4I9W A;  1EM1 A;  3SYP A;  3JAR B;  4DRX A;  1WP8 A;  1Q6I A;  4O4J B;  4PA9 A;  1P7G A;  1SQQ H;  3K57 A;  2YXL A;  3APO A;  2CK3 G;  3O65 A;  3M8A A;  2OCC B;  4FFB B;  1MOF A;  2MK3 A;  3UCS C;  4DYL A;  4DR4 O;  1BQZ A;  3LNN A;  2EUL A;  3FYI B;  1M5I A;  4B3R O;  5KHG A;  1VF7 A;  4OXS A;  4DR3 B;  5CB4 A;  3ASO B;  3DXR B;  1ZTE A;  2Q7E A;  2EIN B;  4O2B A;  3O9O A;  4P9O A;  4R7C A;  4DV2 B;  4PI0 A;  2JEX A;  1D2D A;  4JI7 O;  2P4V A;  2E75 B;  4GKK O;  2ATK C;  5BMV A;  2AZ0 A;  1OCO B;  3M99 B;  5KMG A;  1YTF B;  2FML A;  3ABK B;  3OMA B;  3CCV V;  1SKV A;  1BQ0 A;  4HZ3 A;  3A0H Z;  2ZD9 A;  5LOV B;  4LP8 A;  1B6Q A;  1K33 A;  1N33 B;  3CCS V;  1GRJ A;  1YJW V;  2PGG A;  1YCI A;  4AQY B;  3RYH A;  3LSU A;  1P4R A;  3C90 A;  1SZX A;  4TQF A;  1GTO A;  2AHZ A;  2EIM B;  2W6I G;  4CH5 A;  3OFN G;  4X20 B;  3RYC B;  1NH2 D;  4IIJ B;  1SER A;  2NNU A;  4MW8 A;  4QPJ A;  3ZMZ A;  1G1X B;  2P06 A;  3B8M A;  2LJ2 A;  2FL4 A;  3D36 A;  4NXM O;  2IJJ A;  2P90 A;  1Q5O A;  4I55 B;  2Q4P A;  4KFM A;  1S77 D;  2JGU A;  3OUS A;  5L3B A;  2F1M A;  1EN6 A;  3OGI B;  2XAF A;  4JI1 O;  5B3S C;  4BIU A;  1MNG A;  4DV3 O;  3OE7 G;  4JI3 B;  2WLL B;  4G27 B;  3UQ8 A;  4FLT A;  4IGG A;  2RMK B;  1IBK B;  4O4L A;  4UCT A;  5JVD B;  3CCL V;  1YEW A;  4JTA B;  2VQF B;  1JPX A;  5FL7 G;  1V9P A;  4JAV A;  1XNR B;  3A2F A;  1NVP D;  2H8P C;  1OCC C;  1GN6 A;  2QM4 A;  4RO2 A;  3RYI A;  1RSO A;  3D8C A;  1G6U A;  4LFB B;  4B3S O;  2NN4 A;  4MVM A;  1H2K A;  1O9H A;  2BTO A;  4WBN A;  3ABM B;  1VQ7 V;  1FFX B;  2Q6A A;  3K5O A;  3CME V;  2CH7 B;  4MVR A;  5J2U B;  4B3M O;  4J7K A;  2Q67 A;  4RUE A;  3CB2 A;  3CRA A;  4UV8 A;  1QQC A;  2EX3 A;  2ODM A;  3L71 H;  3MAQ A;  4B3T O;  3ZHU A;  2DQ3 A;  1TUB B;  3BRC A;  4EB6 B;  3JAL A;  3AEI A;  4PA6 A;  1EN4 A;  4H13 B;  3IAY A;  1N36 O;  1L0L H;  4B7E A;  2ZR2 A;  2OTL V;  3OT7 A;  2EIJ C;  2AW9 A;  4JI0 O;  3N27 A;  4DR5 O;  4OX9 B;  5H9C A;  2K9P A;  2EJR A;  1YTF D;  4LF4 B;  1HW7 A;  1M57 B;  4LWS A;  3CWB H;  2CE4 A;  2Y69 C;  3IFX A;  3K59 A;  3QO5 A;  3AG7 A;  1SES A;  1WB7 A;  3FB7 C;  4U3J B;  3FX7 A;  3U0Z A;  1COW G;  4Z1V A;  1HNX B;  5KAF Z;  2ETN A;  3MHH C;  1SQB H;  2DN9 A;  4ZI7 A;  1HDJ A;  1YIJ V;  2KKW A;  5LXT A;  4P30 A;  1IXB A;  3E2E A;  4JV5 O;  2OCC C;  3BAB A;  1P7B A;  2Z3Y A;  5KUM A;  3CCR V;  2R70 A;  4CH6 A;  2CDY A;  3KZI Z;  2XTA A;  3JAT B;  2ZE7 A;  4PDM A;  1AI4 A;  2YIB A;  1YZB A;  3C3S A;  4TQD A;  4TT3 G;  4J80 A;  1QNM A;  2HVK C;  4X65 O;  3A0B Z;  3E22 A;  3MD0 A;  3BHP A;  3G6E V;  3OEH G;  2L35 A;  3VQW A;  4YHH B;  2ZE5 A;  4TV8 A;  1WP7 A;  1DK1 A;  1XMO O;  2Y0I A;  2FB5 A;  3HKB A;  5D5Q A;  3ZHQ A;  1K3E A;  5J2T A;  4G28 B;  2LW7 A;  2HR3 A;  1ZUQ A;  4I4T B;  3T1H O;  4JI2 O;  1OCR B;  1M93 A;  4R50 A;  4W4K A;  3RFR A;  3B4S A;  1J5E B;  3G67 A;  2GUZ A;  4JI4 B;  4LF8 O;  2IH3 C;  4DUY O;  3L72 H;  2EIL B;  3WG7 B;  4YJ2 A;  3JAK B;  1U96 A;  1R73 A;  2QE7 G;  3U10 A;  2R9R B;  1W2B U;  2WLN A;  3K03 A;  2A3Q A;  2QA4 V;  2DOS A;  2QM7 A;  5HFL A;  2Q8V A;  4MTF A;  3SYQ A;  2Q0O C;  3A0R A;  5KX5 B;  4O2A A;  3LDD A;  4O4I B;  3ETD A;  1PD3 A;  1N34 B;  3EXA A;  4DR1 O;  2B5U A;  3W7T A;  2KG7 A;  4LF5 O;  2LP7 A;  1Q86 W;  3SR2 C;  4DK1 A;  3GWK C;  1I5Y A;  4PDV A;  3E83 A;  4I0X A;  4AIL C;  2YC0 A;  4UV9 A;  2BTQ A;  4KXR A;  1BHB A;  1B3Q A;  3N2G B;  3ABL B;  2WA4 A;  5B1N A;  1MSD A;  1KP2 A;  2Q68 A;  4J10 A;  3WB0 A;  2CGO A;  3BVO A;  1N4C A;  1XMQ B;  5ITZ B;  5IWA O;  4CC6 A;  1EZV H;  5CA3 A;  2UUC B;  4X88 A;  1MZF A;  4IYI A;  1S76 D;  2WAM A;  3ABM C;  3BA8 A;  3H01 A;  5IY5 B;  3FFQ A;  2XAS A;  1GO3 F;  2LGW A;  4X1Y B;  1NJI W;  4NVP A;  1QVF U;  4F6R B;  1WAZ A;  2M6Y A;  3AK1 A;  5LYJ B;  5FNV B;  3N2K B;  4DV0 B;  3SYO A;  1YF2 A;  3JAS B;  3RVZ A;  3FAV A;  4X1I B;  5EYP B;  5IYC O;  1R6K A;  1L1F A;  3L73 H;  2JGD A;  4X8A A;  3JD2 A;  1GM8 A;  3K0D A;  1BCC H;  2YS8 A;  4FJC C;  1QVG U;  3K58 A;  3H1H H;  3OR7 C;  2RCV A;  4JYB A;  1FXK B;  4FZ0 A;  3F7Y C;  2YEV B;  1G8M A;  1D5A A;  2EZP A;  1JFF B;  2CTQ A;  5D5P A;  1IBM B;  4ABM A;  2HKO A;  1V54 C;  3D3I A;  1K8A W;  1MAB G;  1IUR A;  3JAR A;  3QO7 A;  3AK2 A;  4O4J A;  1PNM A;  1FXV A;  2VWJ A;  1VEW A;  5EIB C;  4UCV A;  4BWA A;  1QHT A;  3CC4 V;  2DW4 A;  4TV9 B;  3ZMS A;  4WF9 V;  5CN0 A;  1HNZ B;  4HBN A;  1M56 C;  3STZ C;  4BIO A;  4FFB A;  2E5L O;  4QJF B;  3RYF B;  5JCO A;  4DV4 B;  1TGO A;  2PF4 E;  1HP8 A;  2IU0 A;  2QWO B;  1XNQ B;  4O4H B;  5L3D A;  5H2F Z;  1Y66 A;  2EBO A;  4IYH A;  1SRY A;  3MDS A;  4JAU A;  3J81 N;  5K1X A;  1K9M W;  5LL6 Y;  1A32 A;  4YXW G;  2FKX A;  4FM1 A;  1PV0 A;  1K7D A;  1NH2 B;  2BSK B;  3S3X A;  4GKJ O;  2JIZ G;  1N8R W;  3VQY A;  1H2N A;  4KL1 A;  1PNK A;  5LOV A;  3CSX A;  2EJ7 A;  3ASN C;  4YY3 B;  4LCU C;  1EBO A;  4LC1 A;  3ETQ A;  2WLI B;  5EZY B;  5LMN O;  4ZOL B;  1AB3 A;  2BCC H;  3S3W A;  2E5L B;  3OAA G;  4WFA V;  3JSL A;  4LF7 O;  4X20 A;  4LH6 A;  3IJ4 A;  2DYR C;  1AIL A;  3NR7 A;  1NVP B;  2P6J A;  2A9H A;  4KHP B;  2OT5 A;  5JH7 B;  2XND G;  1JJ2 U;  1K4D C;  1VQM V;  2ZT9 B;  4I55 A;  1GKF A;  1GN3 A;  1OCR C;  3VBB A;  4AHC A;  4XDK A;  2PYL A;  3JD4 A;  4LF9 O;  2LFR A;  5CBF A;  3HKD A;  2ZM6 O;  5DEC A;  5HFM A;  3ZRS A;  4X66 B;  3WG7 C;  1G4Y B;  4UCO A;  3Q4H B;  3GWO A;  1VQK V;  4PD4 F;  2W0F C;  1CXZ B;  1XL4 A;  3CCE V;  1Y76 B;  2WLH A;  2XAJ A;  2YIB D;  3K08 A;  3VQX A;  1VQ4 V;  2P67 A;  4PA4 A;  1GN4 A;  2OTJ V;  1ZL8 A;  3CYO A;  2YID A;  1FFX A;  2Q9L A;  2XAG A;  2CH7 A;  3AG3 C;  5C93 A;  3AG2 C;  1MZE A;  4P2Z A;  1BT8 A;  5J2U A;  4MTG A;  4DV6 O;  3TCU A;  4R6Z A;  1SQX H;  4YJ3 A;  5CA0 B;  4U7O A;  4IHJ A;  3T4Z A;  1YI2 V;  5IYZ B;  4EB6 A;  2Q5Z A;  3HB3 B;  3TET A;  1OHH G;  1YVW A;  1NR1 A;  2ZKO A;  4GX1 A;  2YSU B;  1R3I C;  1V55 B;  3QF7 A;  5B66 Z;  1QR8 A;  5LP6 B;  5H5N A;  3OUF A;  5CMU A;  1NT2 B;  4FPP A;  1MMM A;  4JI8 O;  1OCZ B;  3J7A U;  2GSM B;  1L8D A;  4YIP A;  3KCY A;  5L3G A;  4K8Z A;  4DR4 B;  4QGP A;  1ROP A;  4BR6 A;  3OMN B;  5JJJ B;  4B3R B;  5LHG A;  4J7J A;  3K79 A;  2F4V O;  3FB5 C;  1SS3 A;  3E8F A;  3M7M X;  2N74 A;  1TUE B;  5A9G A;  4J41 A;  4WFF A;  1NTZ H;  4DV7 O;  1RM1 B;  1BE3 H;  3JAW B;  2JK5 C;  1YXB A;  2F93 B;  3BFR A;  4JI7 B;  1H2L A;  1AJN A;  1VMG A;  2ZQM A;  4GKK B;  3P30 A;  4Q20 A;  1K97 A;  3OTO O;  5JQG A;  2ADP A;  1PNL A;  3ZN0 A;  2JS5 A;  2YXH A;  1N32 O;  4Z1M G;  2F43 G;  3L74 H;  1BGY H;  3NXS A;  2IJH A;  1HNW O;  3K9A A;  4U3J A;  4DV5 O;  4UVA A;  1BZK A;  4FM0 A;  1KEC A;  1TVK A;  4X9Q A;  2D2C B;  4H0L B;  1Y74 B;  4U7N A;  1AR1 B;  3ABT A;  4MVO A;  1FJG O;  1XIL A;  2YDE A;  5J9P C;  1NQT A;  4RWU A;  1VQ8 V;  3R66 A;  2VQE O;  3ML0 A;  1XHX A;  4DRX B;  3ZCC A;  4CS2 A;  1GH6 A;  4TOI A;  3SYC A;  4B7K A;  1P84 F;  5IJ9 B;  2IU3 A;  3CCJ V;  3JAT A;  1HR0 O;  1FXH A;  4NXM B;  4B08 A;  3H1I H;  2JRI A;  3LSS A;  2QWQ B;  3KCX A;  1GMG A;  2CTP A;  5GON B;  2JEU A;  3W7X A;  4JI1 B;  4LFC O;  5B1A B; 
#chains in the Genus database with same CATH homology
 1X4T A;  4DV3 B;  4DV5 B;  3HKE B;  4YJ2 B;  1M93 A;  2P22 C;  3RFR A;  5GON A;  4LF9 B;  2UUA B;  2P5O A;  1J5E B;  4I4T A;  2ZM6 B;  4FVM A;  4JI4 B;  4UCR A;  1TUB A;  4JI5 B;  4FLY A;  3ZED A;  2IM9 A;  3HKE A;  4YJ2 A;  1Q8I A;  5CA1 B;  3JAK B;  5JJN B;  1WN7 A;  5IJ0 B;  2PZS A;  5CA0 A;  3U10 A;  1H2S B;  4I50 B;  5K1P A;  4B3S B;  4O2A B;  3OTF A;  4L8J A;  3K5N A;  1WNS A;  5IYZ A;  4X1K B;  1WPB A;  2Q7G A;  5CA1 A;  3JAK A;  4CS4 A;  5IJ0 A;  4B3M B;  1Q43 A;  4I50 A;  3PN1 A;  4EEQ A;  5KX5 B;  4O2A A;  2PYJ A;  2F66 C;  4O4I B;  4X1K A;  4B3T B;  1N34 B;  1SQF A;  4LFC B;  3RYH B;  4DUZ B;  4LFA B;  2BTQ B;  4I9Q A;  4DV6 B;  3SR2 C;  2V4D A;  4DK1 A;  5KX5 A;  4ZIB A;  2UXB B;  5LA6 B;  4AIL C;  4O4I A;  1Q3E A;  2BTQ A;  5C8Y B;  1M4U A;  1P49 A;  5KHH A;  2RJZ A;  3N2G B;  1SA0 B;  5LA6 A;  3WB0 A;  4FLX A;  1N36 B;  1XMQ B;  4DR7 B;  5ITZ B;  3QTC A;  4LNU B;  4CC6 A;  5C8Y A;  2UUC B;  3N2G A;  4DR6 B;  3BA8 A;  4JI0 B;  3FFQ A;  4JI8 B;  4DR5 B;  1ZAU A;  3BPZ A;  1XHZ A;  4X1Y B;  4LNU A;  1JJO A;  4NVP A;  4F6R B;  4CS3 A;  3K5L A;  4DK0 A;  4X62 B;  5JCO C;  5FNV B;  4O4L B;  5LYJ B;  2CAZ C;  3HKD B;  3N2K B;  4DV0 B;  3JAS B;  3SJB C;  4X1Y A;  4X1I B;  5EYP B;  4Q6G A;  5FPR A;  2F4V B;  4F6R A;  3RYI B;  1KMI Z;  5LYJ A;  5FNV A;  4DV7 B;  4GLX A;  3K58 A;  3N2K A;  4DR2 B;  3JSN A;  4LH7 A;  3JAS A;  5FPO A;  4X1I A;  4FLU A;  2Q0A A;  3JAR B;  4DRX A;  1D5A A;  2JVD A;  1JFF B;  3OTO B;  5D5P A;  1TA8 A;  1IBM B;  4O4J B;  1N32 B;  3K57 A;  2YXL A;  1HNW B;  3DSQ A;  5LP6 C;  3JAR A;  1JFF A;  1TAE A;  4O4J A;  2VWJ A;  5EIB C;  4UCV A;  4BWA A;  1QHT A;  4JV5 B;  4FFB B;  3WB1 A;  5CB4 B;  1FJG B;  4TV9 B;  4YJ3 B;  3LNN A;  1M5I A;  1T5E A;  3VQV A;  1HNZ B;  4O2B B;  2VQE B;  1O9G A;  4IHJ B;  3ICX A;  5KHG A;  4HBN A;  1VF7 A;  4FFB A;  4X65 B;  4DR3 B;  5CB4 A;  2VWK A;  3RYF B;  4TV9 A;  5JCO A;  5BMV B;  1TGO A;  4DV4 B;  2Q7E A;  4O2B A;  5KMG B;  4DV2 B;  4PI0 A;  3SGI A;  1HR0 B;  4O4H B;  1XNQ B;  1XMO B;  1I7F A;  1Z5V A;  5K1X A;  2YIA A;  5BMV A;  2Q7H A;  4FM1 A;  1XI1 A;  5KMG A;  4K8X A;  4O4H A;  3K5M A;  1SKV A;  3T1H B;  4JI2 B;  1KU9 A;  5LOV B;  3QG5 A;  4FLW A;  1N33 B;  3VQY A;  2PGG A;  4AQY B;  2R9A A;  3RYH A;  4JYA B;  4KL1 A;  3SJA C;  4LF8 B;  4DUY B;  4TQF A;  5LOV A;  3CSX A;  4CH5 A;  4X20 B;  4YY3 B;  4PI2 A;  3RYC B;  4FLV A;  2RQ6 A;  3ETQ A;  4IIJ B;  5EZY B;  4ZOL B;  2YI8 A;  4ZHQ B;  2E5L B;  5JQG B;  4NXN B;  5EIB D;  3JSL A;  3SJC C;  1SA0 A;  4X20 A;  3T1Y B;  4LH6 A;  1Q5O A;  5EZY A;  2YI9 A;  4I55 B;  5ITZ A;  4ZHQ A;  2ZNI A;  4ZI7 B;  2JGU A;  2F1M A;  1TVK B;  5LXT B;  4KHP B;  4DR1 B;  5JH7 B;  4LF5 B;  4I55 A;  4JI3 B;  2GV9 A;  3UQ8 A;  4FLT A;  4GYC B;  4AHC A;  1IBK B;  2PYL A;  4O4L A;  4UCT A;  5JVD B;  1YEW A;  4FLZ A;  3HKD A;  2F95 B;  5JH7 A;  2VQF B;  1JMK C;  1V9P A;  2OWO A;  4WBN B;  1XNR B;  3A2F A;  5EYP A;  4TUY B;  4HNA B;  4X66 B;  2QM4 A;  4UCO A;  1S5J A;  4TV8 B;  1RSO A;  3RYI A;  1G6U A;  2UXC B;  5IWA B;  4LFB B;  2XHB A;  2ZIM A;  1O9H A;  2BTO A;  1B04 A;  4WBN A;  1FFX B;  4TUY A;  4HNA A;  3K5O A;  2YIB D;  2UU9 B;  2ZIN A;  3VQX A;  5J2U B;  1DGS A;  3CB2 A;  2R72 A;  1QQC A;  4EFB A;  4UFZ A;  2EX3 A;  1IBL B;  5KHJ A;  1FFX A;  3JAL B;  3MAQ A;  4UCU A;  3ZS8 C;  5J2U A;  1TUB B;  4D7S A;  2UUB B;  3BRC A;  4EB6 B;  3JAL A;  4YJ3 A;  2OYQ A;  5CA0 B;  4IHJ A;  5KHI A;  5IYZ B;  3RYF A;  4EB6 A;  3RWR D;  4LF6 B;  3IAY A;  4CH4 A;  3QF7 A;  5LP6 B;  4EFE A;  3B2E E;  3U11 A;  2HHH B;  4K0K B;  1NT2 B;  4OX9 B;  1L8D A;  5LP6 A;  4K8Z A;  4DV1 B;  4DR4 B;  5JJJ B;  4B3R B;  3BAA A;  4LF4 B;  2ZIO A;  4CC5 A;  1HW7 A;  4D7T A;  3M7M X;  3K59 A;  2PTM A;  3UT5 B;  3THO A;  3JAW B;  1SQG A;  3RYC A;  2F93 B;  4IIJ A;  4JI7 B;  4U3J B;  4ZOL A;  2E3C A;  2PUS A;  3U0Z A;  4GKK B;  5JQG A;  2PY5 A;  2JS5 A;  3UT5 A;  2UXD B;  1HNX B;  3JAW A;  4BW9 A;  1Z5W A;  4LR3 A;  4CH3 A;  4U3J A;  3HKC B;  4GKJ B;  4JI6 B;  4ZI7 A;  4FM0 A;  1TVK A;  2KKW A;  3BA9 A;  5LXT A;  5LMU B;  4FM2 A;  3BAB A;  3E22 B;  2R70 A;  3HKC A;  4CH6 A;  2ZCE A;  5KHK A;  1I94 B;  5BR8 B;  3JAT B;  4TQD A;  2YIB A;  5JVD A;  5LMN B;  1XHX A;  4DRX B;  3E22 A;  4CS2 A;  3HKB B;  4TOI A;  4UCS A;  3BHP A;  2QJ1 A;  5J2T B;  5IJ9 B;  4X64 B;  3JAT A;  3VQW A;  4LF7 B;  4YHH B;  4TV8 A;  4NXM B;  4B08 A;  3RGB A;  5JJE B;  3CHX A;  4PHZ A;  3HKB A;  5D5Q A;  5J2T A;  5IJ9 A;  2HEP A;  1XQ8 A;  5GON B;  4JI1 B;  4I4T B;  3WB2 A;  2ZNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...