1SKVA

Crystal structure of d-63 from sulfolobus spindle virus 1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
64
structure length
64
Chain Sequence
b'SKEVLEKELFEMLDEDVRELLSLIHEIKIDRITGNMDKQKLGKAYFQVQKIEAELYQLIKVSHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical 7.5 kDa protein
publication title Structure of d-63 from sulfolobus spindle-shaped virus 1: surface properties of the dimeric four-helix bundle suggest an adaptor protein function
pubmed doi rcsb
source organism Sulfolobus virus 1
molecule tags Viral protein
total genus 25
structure length 64
sequence length 64
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1skvA00
3QG5A 2CAZC 1X4TA 3SJCC 3ZS8C 3QF7A 2F66C 3B2EE 2JS5A 3SJAC 3THOA 3CSXA 3SJBC 2P22C 1NT2B 1SKVA 3ICXA
chains in the Genus database with same CATH superfamily
3FB7C 4DV1B 3QF7A 4DR2B 1R6NA 3K5LA 2YC0A 3T1CA 2Z0AA 1N0JA 4KHPO 4O2AB 4LF4B 2BCCH 3SYQA 3TCUA 2YDEA 1GN2A 4YY3B 1FXVA 5LGNA 5EK0A 1M5IA 1W0JG 4DR2O 1WB8A 2IJIA 5CBGA 3AG4B 1EFRG 1UFIA 4DR1B 4R7CA 4G2KA 4I9QA 4LF8B 3AK1A 3FD9A 4RQFA 3VQVA 3JATA 2W0XA 2JVDA 1KECA 2IM9A 5E1AC 1QCEA 3G6EV 4DR1O 1FYJA 1YVWA 2QE7G 5JJNB 2ZM6B 4MVMA 4LF8O 4P30A 5LOVB 4LH7A 4WFHA 3E89A 1RPRA 2ZE8A 1VEWA 2QR4A 3JAWA 1TVKB 4ZKIA 3FB5C 3RVZA 3CXHF 4WFAV 1VQPV 2OYQA 4IIJB 3ZMSA 4RUFA 2ZM6O 2R9AA 3CC7V 1ENVA 3ASNB 2NN4A 3QO5A 3W7XA 5K1PA 2ATKC 1B06A 3CCLV 4WFGA 4PELA 4GT1A 1GK9A 4EB6B 2EINB 4JYYA 1K92A 1Y66A 1NVPD 1M57B 1AVMA 2X7RB 1AP6A 4UVAA 5KA5A 1K3EA 2EULA 2X6BA 1H2LA 3ZJZA 4IGGA 4JI2B 5BXZA 3F5TA 1P7BA 3RYCB 4QNHB 3MHHC 5IYZA 3A0BZ 4HNAA 3BFRA 3OR7C 3ZMVA 2DOSA 4JI2O 1K7DA 3ZHQA 5EZYA 2GV9A 5EIBD 1VF5B 3RYFB 5CA1A 3CB2A 4ZHQB 3RYIB 4UUJC 1NT2B 1ROPA 4J10A 4MVSA 4X1KB 4CH4A 5JWPA 1KKCA 2VRZA 4IHJA 3ZRSA 3N27A 1YDXA 4FVMA 4ZI7A 5D5PA 4I0XB 2ILMA 3WB0A 5HFLA 4P2ZA 3B4SA 2AGAA 2WLHA 1BQ0A 3FYIB 1JMKC 2ZCEA 1EN4A 5H2FZ 1F51A 1XQ8A 2E3CA 1X59A 2VQEO 3CRAA 3RFRA 3FB6C 5B3SB 1G8MA 1K33A 2WLMA 5KHGA 1NVPB 3CCJV 3U11A 2D3OW 1L8DA 3ZIAG 3RVYA 4K8XA 3QO8A 4LFCB 4B08A 1IX9A 1NKDA 1Z5WA 3ZEDA 5BY1A 3P3PA 3U0ZA 4QJFB 4TWKA 1XNQB 1V55B 3G80A 3CJHA 3JAWB 3ASOC 4PD4F 4LFCO 1CXZB 2OT5A 5KLVH 3ETDA 3DC6A 4JTDB 3K59A 4FPPA 3M99B 3IAYA 1MA1A 5IY5C 1RM1B 5BMVB 3FYEB 2W6IG 1M56C 4UB8Z 4FFBA 2Q67A 1CP9A 4FM1A 2HVKC 4DYLA 1XNQO 3AG2B 5EC1C 1E1QG 1PNKA 1MOFA 4FLUA 5ITZB 3X2QC 1LUVA 1GKFA 4UVBA 1WP8A 2P22C 2A79B 2YUAA 1KBHA 3UCSC 1U97A 3O65A 2FTKA 2JRIA 1S5HC 2E75B 4LFBB 4OPAA 3KKYA 4JASA 1S76D 4JI3B 1IZ3A 1DLBA 4PA3A 4LF5O 3M8AA 4W4LA 5IYZB 1YHQV 3ZRXA 5LP6A 3CC2V 4CBCA 4UCOA 5LP6C 1W59A 4HNAB 2BOBC 4NVPA 1RSOA 4MVZA 1K9MW 4LFBO 2FYUH 2F95B 5CA1B 1MNGA 4LWSA 4JI3O 2Y4UA 3E8HA 4JI5B 3A0HZ 3OUSA 4X8AA 4UCRA 5B1OA 2Q9LA 5EBLC 3L73H 1XOUA 4X65B 3CWBH 4NR1A 3OMAB 1TUEB 2H3OA 1NJIW 2EIJC 2KSDA 1NH2D 4KUMA 4IYIA 1G4YB 3JSNA 3OM3B 4YXWG 2EILC 3PJSK 4RWUA 4LC1A 1J5EB 3ZHTA 5JQGA 4J9ZB 4CC6A 4F6RB 4X65O 4GX5A 1BS3A 5BR8B 2XUMA 5LHGA 1K97A 4DRXA 1VQ4V 1VQNV 4FLWA 3H1IH 3QO7A 4FJCC 4TUYA 5LYJA 2QKCA 2OTLV 1GTOA 1J5EO 2XAHA 1Q82W 5H9CA 3E22A 3OMNB 3T1YB 1VQOV 5BR8O 4X1YA 1M90W 1AR1B 2JIZG 1AI6A 1BE3H 2F66C 4GKJB 2LO1A 4MVRA 1V9PA 3WFVA 4JI6O 3OT7A 1Q5OA 3SJAC 2EX3A 4BWAA 1M4UA 3T1YO 4MW3A 5LMUB 2DE0X 2W0FC 1NI8A 4O4LA 4GKJO 3WG7B 5C93A 4FFBB 1H2NA 3ZHRA 4NXMO 1NTMH 1BT8A 1SESA 4X64B 1H2KA 1FPOA 2FMLA 2HEPA 5B1AC 3O9OA 5TISZ 4BIZA 4U7NA 4I4TB 3OEHG 3I55V 5JH7A 2B1IA 1NH2B 1GM9A 2XAFA 1VMGA 4DR5B 4TQFA 1TGOA 1NR7A 1VP7A 2JJ1G 1YF2A 2ZT9B 1VQLV 5GTIZ 4X64O 5AG2A 1KYOF 4JTAB 2DYRB 3A0RA 4N23A 1S3JA 5DEDA 4B3SB 4FZ0A 4UCVA 1XHZA 1QVFU 2EZOA 1ZAUA 2QSAA 4CS4A 1WLEA 5JVDB 1QHTA 4KP4A 4X62O 4LWSB 1FXKC 3FKSG 5L3BA 4KFMA 3SPIA 1Q86W 4NTYA 2ZQMA 2P67A 2F93B 3BEHA 5B1NA 1OCCB 2LQTA 1LUWA 1H38A 2AZ0A 5LXTA 1WA8B 3SJBC 1UPGA 3OAAG 2QTOA 3DSQA 1KKDA 4H13B 2YS8A 2DW4A 2EILB 2Y69C 2QWPB 5KHIA 4JI8B 1ORQC 2WLIA 2ZE5A 1JVMA 1V54B 3OFNG 3DTUB 2G38A 1XMOB 4PDVA 4DRXB 2BTOA 3TETA 1XI1A 2QTSA 2JS3A 1H2MA 4DV7B 4TUYB 4E4EA 2B9ZA 3FX7A 4PDRA 2ZXWB 2PTMA 4GX1A 5IJ9B 3EHBB 5D5QA 3E22B 2WAMA 1XMOO 4PDMA 3IJ4A 2HP8A 3BVOA 1K8AW 1OCOB 4DW1A 3SJQC 4DV7O 1R3JC 3CSXA 4DUYB 3H01A 4LP8A 2ZE7A 2DWDC 3W7SA 3CEIA 4GCZA 3OTFA 3IC9A 4Q6GA 4GKKB 1RPOA 1E1RG 1KB9F 1EN5A 3TXQA 5JCOA 1KUQA 4O4LB 1H8EG 3IFXA 1XL6A 2HJFC 3ETQA 2JGUA 3KG2A 2GTAA 4DUYO 1FJGO 3J81N 2P06A 4K3AA 5J2TA 1DGSA 1BMFG 1K4CC 3E2EA 3AG3C 4GKKO 3L72H 1N4CA 5KHJA 3BRCA 5CBHA 1QR8A 4QPJA 1OCRC 2Q7EA 3H9VA 2MW2B 1O9GA 1HDJA 5H6QA 3K03A 2UUBB 2F4VB 1PL4A 2IW5A 2ZKOA 3BABA 4NXNB 3JD4A 5FNVB 4CS3A 3JCZA 3APQA 5KMGA 3IGAC 4YJ2A 3S3XA 2XAGA 4JYAB 1QVGU 3ABUA 2CH7A 2UUBO 2GDSA 1F4NA 3C3SA 1AR4A 2H94A 4NXNO 1XUQA 2HG5C 1R3IC 2HKOA 4D7SA 1D5AA 1H8HG 3HKCA 2WLNA 1VARA 4PA7A 4DV1O 5LXTB 1JA8A 4JYAO 1QU7A 2L6LA 5LGTA 4JV5B 3I5DA 3B8MA 4LF4O 2YIDA 4ASUG 3ZMTA 2HHHB 2CGNA 3AG1C 3B77A 3H1LH 4MT8A 2HFEC 2QJ1A 4YY3O 4ZOLB 3RT3C 3P3NA 4GZRB 4JV5O 1AJQA 1DF4A 2ODMA 2R9IA 4WCEV 1ZSPA 4Z1MG 4X1IA 2HHHO 3FB8C 1ZTEA 2MK3A 1OV9A 2CE4A 2Q73A 2GUZA 3Q4HB 3ETGA 1HR0B 2Q6AA 5LBQA 4JGSA 1G1XB 1SKVA 3CHXA 5L3GA 2CTQA 4DR6B 1IBKB 2P5OA 3OTOB 4OXSA 2WLLA 3CCUV 1BL8A 3CE2A 1SQBH 2EIMB 1HR0O 1JOYA 2EIKC 2QWOB 5EIBC 2F43G 2YIBA 1Q81W 2DMXA 1QLNA 1FS0G 4DR6O 1IBKO 2R9RB 5B1BB 5LHIA 1SETA 3OTOO 1SRYA 3JASA 4RAIA 5J2TB 1SA0B 3ZBHA 1U96A 4DR4B 1I08A 3RGBA 4FM2A 1DF5A 4PA4A 1YJNV 4MVQA 4PI2A 1SF9A 3CCRV 3QVNA 3B09A 1L0NH 3ZX6A 2JEXA 2DYSB 4TV8A 4O2BB 4K8ZA 3EFFK 1Q6HA 1JR9A 4DR4O 2WA4A 2RJZA 4BIUA 4IL6Z 3CYOA 4CH5A 4J7ZA 1S5JA 1GRJA 4FLYA 2CK3G 2PI5A 1R1BA 2CH7B 3SPGA 3K08A 4XDKA 4R6ZA 2N04A 1R6KA 1K4DC 4DW0A 2OIEA 1YZBA 3HKCB 4D7TA 1K5SA 2P4VA 3G67A 4TQDA 4U3JA 4YIOA 2UXXA 3G71V 5EYPA 1BQZA 1BHAA 1LNQA 5IDJA 4BW9A 1P7GA 3ICXA 3ZRWA 3W7UA 1Y74A 4PJ0Z 2RCVA 3JATB 2P7TC 4CS2A 4O4IA 4C7UA 1I0HA 1P4RA 3ZMZA 1AILA 1VQ5V 2XNDG 1FFTB 3CXCU 5LA6A 2Q0OC 5JJEB 4DV4B 4CC5A 4LNUA 1MZFA 2ZIMA 2CTRA 4B3TB 2GUZB 4LFAB 3K04A 2VQFB 3SGIA 3AEIA 2JGDA 3SYCA 4LF9B 3CRRA 3L74H 4DV4O 2RDCA 3DGEA 3M7MX 4I55A 1Z5VA 4GX2A 4EFEA 2WLLB 4EEQA 4UV8A 1GN3A 4LFAO 5FL7G 4J41A 4P9PA 1AI4A 3RW0A 2OCCC 4K35A 3UQ8A 2Q69A 2VQFO 5F2VO 1YEWA 4LF9O 4UV9A 1ZWIC 3ZN0A 5GW7A 3AK2A 2ITCC 5FPOA 2EJ7A 3JAMN 1IVSA 3JASB 3RYHA 1BCCH 4LF7B 1SQQH 2CTWA 3OMIB 2CDYA 1T5EA 1WPBA 1B6QA 3BHPA 4J11A 1GM8A 4UB6Z 3WB2A 4A5UB 2WLJA 1TUBA 3T1HB 4LR3A 1QLEC 5EZYB 4MVOA 1WJZA 4TV8B 1KP2A 4JYBA 3ABKC 2V7QG 5EBWC 4LF7O 2QGNA 1SS3A 3JD3A 3JARA 4OGQB 2IJJA 3CPWU 1D2DA 4QIWF 3UO3A 3JALA 3T1HO 1FKAO 4IHJB 2EBOA 1LR1A 1WB7A 1YJWV 4JAAA 3CCVV 1HNZB 4ZI7B 1AB3A 5DECA 1WP7A 2YXYA 4UCSA 1PL0A 4JI5O 3LNNA 4P9OA 2M7WA 3S3WA 3JAKA 5GONA 3K06A 3TK1A 1H2GA 5L3DA 4AHCA 3FAVA 3T2MA 1J95A 1VQ9V 4WFFA 5EYPB 2YIAA 1HNZO 4LH6A 4QGPA 2P90A 2ZIOA 4B7KA 3OE7G 4J9YB 3SJCC 1K5QA 3HPLC 3ZRWB 1Y74B 2YEVA 3ABLC 4YJ3A 1M1KW 2X6CA 2ZDIA 1O9HA 4O4JA 2ZDIC 1N36B 2Q0AA 3QG5A 5LA6B 2LW7A 3CRQA 5CN0A 4JPRA 2BE3A 3MD0A 1I7FA 5CB4A 1XMQB 4AQYB 4LNUB 1OCZC 3JD1A 3N2GA 4DV0B 5B5EZ 3ASOB 3CJHB 2UUCB 1JCHA 4CZZA 4I50A 4DR7B 1QNMA 1RFYA 3K5MA 1YJ9V 3KCYA 5CBFA 5IY5B 2VS0A 2YXLA 3SPJA 1M56B 4NB5A 1SQPH 1XMQO 4I55B 4AQYO 4FM0A 2ZINA 4N21A 3OGCC 5A9GA 3NR7A 1QBZA 4HYOA 3CCSV 1XBLA 2W6JG 3P32A 1F7YA 3JYCA 3X2QB 2UUCO 3BA8A 4FLXA 4FLTA 1BHBA 1I5YA 3H1JH 3QNEA 3D8CA 5LMUO 1AROP 1VIBA 4X20A 4RQEA 2F23A 4ZBMA 4HZ3A 2QM7A 3D36A 1AJPA 3D36C 3RYHB 2JK5C 3VOUA 1Y67A 1H2SB 3DC5A 5IYCO 5LP6B 3C90A 2WPDG 1VF7A 1SQFA 1TUBB 4DR5O 1RSOB 3UT5A 1VQMV 2Q7GA 5L3FA 2Z5UA 1N34B 4YIPA 2JJ2G 1FXKA 2DQ3A 3OW2U 1R6TA 1JJOA 3HKEA 4B3SO 2A7WA 4G27B 2E5LB 4X9QA 1Q90D 1KMIZ 1XILA 3K57A 3CS5A 1WAZA 1JX9A 2Y0PA 1NZ6A 2GBOA 4OPHA 1R3KC 3CP1A 1N34O 1L1FA 1SZTA 2EIJB 4H37A 1PPJH 3LDCA 4UFZA 1GO3F 1YI2V 4O2AA 5FLXN 1EM1A 1RP3B 2LGQA 4CH6A 3JAKB 1B04A 2E5LO 2XOKG 1W0KG 5EC2C 5JQGB 3FAVB 4NKGB 2O57A 1BZKA 3FFQA 5GTHZ 3ZMUA 2X0LA 3RBZA 2KG7A 3KCXA 1Y6XA 2ARHA 1PD3A 3AG4C 5LYJB 2YEVB 4YJ3B 3LSQA 3AG7A 1WPXA 1I94B 2UXCB 4JI8O 4O4JB 5KUKA 4ICGA 2DQ0A 4JAUA 4WFBV 4PHZA 1VQ7V 2EZPA 3K79A 4X1YB 5CB4B 1Q8IA 4DR3B 2GSMB 2YI9A 2LFSA 2LW1A 5J2UA 2NNUA 1E79G 3N2GB 2OIGA 3MHSC 3ZCCA 1I94O 1TAEA 3HB3B 1GH6A 2A0LA 5H5NA 3LDDA 1L0LH 1VQKV 4U3FH 4DK0A 3RN4A 2AW9A 4I50B 4DXWA 2UU9B 3SDLA 3L9DA 1TVKA 5CMUA 1NU1H 1Q6UA 4DR3O 4XBFA 1OHHG 2DWEC 4IIJA 2QKSA 3GB7C 1ZUQA 1OJHA 2C2AA 2JS5A 3LSUA 4MW8A 4G28B 5B1AB 4JF3A 4DV5B 5H6RA 3I56V 2UU9O 3R65A 3AK3A 4FZ1A 5JH7B 5LHHA 1F23A 2KQXA 4X20B 2EINC 1Q43A 1XHXA 1M57C 4QE7A 4ZIBA 2CUGA 2K9PA 1GN4A 5EBMC 1PNLA 4DV5O 2WA3A 1OZ0A 4X89A 3SYAA 4JI4B 2FL4A 3E8BA 4MTGA 4FIPC 4LBEC 1NBMG 4EFBA 2EJRA 2BSKA 5KHHA 2V4DA 3K58A 3BPZA 3JCUZ 4WF9V 1VF6C 1R73A 1FXKB 2LFRA 2RMKB 2F4VO 1DTOA 4JI4O 1FAFA 1MMMA 4ZHQA 3HKEB 5CA0A 2CGOA 3RYIA 3W7WA 3MAQA 4X1KA 4FK5C 1EZVH 1IBLB 2XASA 1EBOA 1YXBA 2B1GA 2RQ6A 4NTXA 4BR6A 2Y69B 5DN6G 2WLIB 2IU0A 4DV2B 4I0XA 1DK1A 4JI0B 3A8TA 2PYLA 3LNMB 4UXNA 1ZL8A 4IYHA 3D3IA 3WU2Z 5IYDO 4TOIA 1QR9A 1IBLO 1PP9H 2KG7B 4J7KA 1JFFA 1G6UA 1KU9A 5B3SC 3JSLA 1MABG 3ZRVA 5KUMA 1MZEA 2BTQA 4DV2O 2BOCC 4WFEA 4JI0O 1GMGA 2ZNJA 3J80N 3CC4V 2Q5ZA 3UO2A 1HP8A 4J7JA 1KP3A 1I5XA 3CRCA 4MS2A 1ZLZA 3IC7A 4I9WA 5J2UB 1KQSU 1XL4A 2PY5A 1FD9A 4WBNA 1IBMB 3ABMC 3VBBA 3STZC 2IBZH 1V55C 2QWNB 3OEEG 1R3LC 1M93A 2HJDA 4MSWC 2QKAA 3BY6A 5BMVA 1RM1C 1IBMO 4PI0A 4XDJA 1Q3EA 2K1EA 4J42A 2P6JA 1XEQA 3THOA 3F5WC 3ZHUA 3ZHVA 3AG3B 2RN9A 1NQTA 3AG2C 2PUSA 1EZJA 2XHBA 5ITZA 1VQ8V 1OCRB 4XDLA 1P84F 5KAFZ 1Q7YW 2IJHA 4FFKA 2ZD9A 4EKWA 4O4HA 1N8RW 1NTZH 3SYPA 5KMGB 2YSUB 1TA8A 1IXMA 4YJ2B 3CMEV 2BSKB 2WSSG 2AZ2A 3OUFA 1SERA 1GM7A 2XT9A 3VQWA 1NR1A 5BZBA 3UM7A 2Y48A 2NR5A 3T4ZA 2YIBD 4QPKA 2Z3YA 5CA0B 3APOA 2FB5A 5K1XA 4F6EA 3W7TA 3KZIZ 2PYJA 2UUAB 3CMAV 5FPRA 2ADQB 4X66B 3J7AU 2VQEB 3L75H 3LSSA 1AI7A 3LUTB 4DUZB 2AHYA 3K9SA 4CH3A 2ZR2A 3AG1B 3BA9A 4B3RB 4HBNA 2VWJA 2OWOA 4B7EA 3K0GA 2JEUA 4F4LA 1ZL8B 2UUAO 1HNXB 3L71H 3DXRA 4NTWA 4X66O 4F6RA 2DN9A 2GTSA 1JFFB 4R50A 4TV9A 4DUZO 4B3RO 4X1IB 2BTQB 2QA4V 4YHHB 1XNRB 2WLKA 2YXHA 2HVJC 4RUEA 5KHKA 4AILC 1SC5B 1HNXO 1S0VA 3GWOA 2LP7A 3LDEA 4LCUC 5A2QN 3ZN1A 4R8CA 4DK1A 2KB1A 3ABMB 1WNSA 4WBNB 2QWQB 5LGUA 2YI8A 4YHHO 4DV6B 1XNRO 2M6YA 4JZGA 4NYKA 3K9AA 2EIKB 4B3TO 4H44B 4DV3B 3CD6V 1BGYH 2YICA 1COWG 4QE9A 1PV0A 3ML0A 4MTXA 3VQYA 2P4KA 4JI1B 3P30A 4DV6O 3WG7C 1N0NA 2IU3A 4DV3O 4OX9B 1F4MA 4PA9A 5LMNB 4I5SA 4LF5B 2ZR3A 1N33B 4I4TA 4X88A 1PM9A 4JI1O 3SYOA 4Q20A 3H1HH 3N2KA 4TSFG 5C8YA 1VQ6V 4UCUA 3K3WA 4OX9O 4Z2WA 1Q6IA 5IYBO 4MVUA 1S77D 4KL1A 5LMNO 4O4HB 1XREA 2IJKA 1YITV 1N33O 2DYRC 1EN6A 4FLZA 2R72A 4AI8A 4GX0A 4H33A 4PA6A 3BCCH 3E8GA 1YIJV 1UJWB 3K5NA 5DM6V 3E83A 3ZHSA 1M9NA 1AI5A 2AHZA 2A06H 3G4SV 4Z1VA 5JVDA 1YTFD 1GN6A 3F7YC 1GAXA 3EVKA 4U7OA 5L3EA 1AP5A 3VQXA 2QEXV 2Q68A 3OR6C 2UXDB 4U3JB 4JTCB 1SZXA 1OCCC 2OTJV 2JDIG 1WA8A 3R66A 2XAQA 2VWKA 4O4IB 2OCHA 2UXDO 1CPYA 3DXRB 4JYCA 3PN1A 1FFXA 2GHYA 1V54C 2N74A 2KKWA 3HR0A 4TV9B 3HKDA 4W4KA 5KAIZ 2F1MA 5B66Z 2N05A 2PI4A 3HKBA 3CRMA 4JI6B 3E8FA 2ZXWC 1D5NA 1N36O 4IT5A 5IJ0A 5IJ9A 2HLDG 3MDSA 2FKXA 2ZE6A 2E76B 4I7ZB 1SQVH 2JGDB 2V1DA 4E2LA 3K5OA 4GYCB 1THZA 2PF4E 3ETEA 2QM8A 3CCMV 2AXTZ 4FMTA 1Z2GA 1OCOC 3NXSA 1NTKH 4DV0O 2ZNIA 4NXMB 4GLXA 3CCEV 2LJ2A 2OCCB 1MSWD 5IWAB 2DJVA 2Q4PA 2D2CB 1FXHA 4DR7O 1A32A 3D3QA 3B2EE 1YTFB 5J9PC 1Y76A 1B3QA 1IURA 3WB1A 4J80A 3SPHA 1ZX3A 1JQ0A 3C3TA 2IH3C 2LGWA 4FLVA 5IWAO 2Y4TA 1HNWB 2QM4A 1XDCA 3ABTA 4L8JA 3G6BA 4B3MB 1PNMA 5KX5A 3N2KB 1QLEB 3RWRD 3F7VC 3TXSA 5C8YB 5KA6A 4HAMA 1WN7A 2X6AA 3ABKB 4H0LB 4X62B 1SQGA 1HNWO 1YSCA 3JARB 1W2BU 5FNVA 1URFA 4B3MO 1P49A 1IXBA 3SR2C 4LF6B 3JALB 3STLC 4K0KB 4JAVA 3SPCA 4JI7B 3K0DA 2ADPA 1N32B 4DO2A 2XTAA 3B8NA 2UXNA 5GONB 4LF6O 4K0KO 1US6A 3T4DA 3JD2A 2NLJC 1K73W 4BW5A 5E79Z 1JPXA 4JI7O 3QTCA 3CX5F 4TT3G 3ABLB 1N32O 1SQXH 2Y0IA 4UVCA 2CAZC 4BAYA 1YCIA 2XAJA 4ABMA 1FFXB 3TJTA 4ZOLA 3GVMA 3BAAA 5CA3A 3HKDB 2B5UA 2QDOA 1OCZB 1IDSA 3GWKC 1CEZA 3HKBB 2R70A 4GUNA 1QQCA 5LOVA 1JJ2U 2UXCO 1HWYA 5IJ0B 1BSMA 4D6TH 3EXAA 1S72V 3Q4HA 2QWRB 5LL6Y 2H8PC 5IT9N 2PGGA 4PV1B 2WWWA 2ETNA 3E35A 2UXBB 1FJGB 3H1KH 2IH1C 1MSDA 3ASNC 3UKMA 2Q8VA 2EIMC 2Q7HA 2PZSA 1Y76B 2CTPA 4EB6A 5JJJB 5IE9A 3A2FA 2E74B 2L35A 1K34A 5JCOC 2UXBO 1AR5A 5L3CA 5B1BC 1Y4MA 3JD0A 5HFMA 1S5LZ 3TGUH 4BIOA 1AJNA 3U10A 1SA0A 4MTFA 3E86A 3OGIB 4PDLA 3RYCA 5KX5B 2HR3A 4L87A 1MG1A 4RO2A 4MTOA 1PKXA 1KC8W 1HW7A 3UT5B 3OD4A 1KD1W 4JZ2A 1VF6A 4UCTA 1NS1A 2RNBA 1X4TA 3ZS8C 3L70H 4O2BA 3CCQV 3RYFA 4KHPB 2DYSC 3B40A 4KXRA 2ITDC 2A9HA 2A3QA
chains in the Genus database with same CATH topology
2YIBD 3JALA 4DV1B 3QF7A 5CA0B 4IHJB 4DR2B 3K5LA 5K1XA 1HNZB 4ZI7B 2F93B 2PYJA 2UUAB 4O2AB 4UCSA 5FPRA 4LF4B 3LNNA 5LXTA 4X66B 3SJBC 2VQEB 3JAKA 5GONA 4DUZB 3DSQA 4CH3A 4AHCA 4YY3B 3BA9A 4B3RB 4HBNA 1M5IA 2VWJA 5EYPB 4JI8B 2YIAA 5KHIA 4LH6A 2OWOA 4DR1B 2ZIOA 4I9QA 3SJCC 4LF8B 1HNXB 4F6RA 1XMOB 4YJ3A 4DRXB 2BTOA 1XI1A 1JFFB 1O9HA 3VQVA 4O4JA 1N36B 3JATA 4TV9A 2JVDA 4DV7B 4TUYB 2Q0AA 3QG5A 4X1IB 2BTQB 2IM9A 2PTMA 4YHHB 5LA6B 1XNRB 1I7FA 5CB4A 5IJ9B 5JJNB 5KHKA 1XMQB 2ZM6B 4AQYB 4AILC 4LNUB 5D5QA 5LOVB 3E22B 4LH7A 3N2GA 4DV0B 4DK1A 2UUCB 3JAWA 1TVKB 1WNSA 4I50A 4WBNB 3CSXA 4DR7B 4DUYB 2YI8A 3K5MA 4DV6B 2YXLA 2OYQA 4IIJB 4DV3B 2R9AA 4I55B 3OTFA 4FM0A 2ZINA 4Q6GA 4GKKB 5K1PA 3VQYA 4JI1B 5JCOA 4O4LB 3ETQA 3BA8A 4FLXA 2JGUA 4FLTA 4EB6B 4OX9B 4X20A 5J2TA 1DGSA 5LMNB 4LF5B 1N33B 4I4TA 4JI2B 5KHJA 3RYHB 3BRCA 3N2KA 2Q7EA 1H2SB 5C8YA 1O9GA 3RYCB 4UCUA 5LP6B 5IYZA 1VF7A 1SQFA 1TUBB 2UUBB 2F4VB 4HNAA 4KL1A 4O4HB 3BABA 4NXNB 5FNVB 4CS3A 3UT5A 5EZYA 4FLZA 2Q7GA 2GV9A 2R72A 5KMGA 5EIBD 1N34B 3K5NA 3RYFB 4YJ2A 5CA1A 3CB2A 4ZHQB 3RYIB 4JYAB 1NT2B 1JJOA 3HKEA 2E5LB 5JVDA 1KMIZ 4X1KB 4CH4A 3K57A 3VQXA 4IHJA 4D7SA 1D5AA 4FVMA 4ZI7A 3HKCA 2UXDB 4U3JB 4UFZA 5LXTB 4O2AA 5D5PA 4CH6A 3WB0A 3JAKB 1B04A 4JV5B 5JQGB 1JMKC 2ZCEA 3FFQA 1XQ8A 2HHHB 2E3CA 3RFRA 2VWKA 4O4IB 5LYJB 5KHGA 2QJ1A 4ZOLB 4YJ3B 3U11A 1I94B 3PN1A 1L8DA 1FFXA 2UXCB 4O4JB 2KKWA 4TV9B 3HKDA 4K8XA 4PHZA 2F1MA 4LFCB 3HKBA 4B08A 4X1IA 4JI6B 4X1YB 5CB4B 1Q8IA 4DR3B 5IJ0A 1HR0B 5IJ9A 2YI9A 1Z5WA 3ZEDA 5J2UA 3N2GB 1SKVA 3U0ZA 1TAEA 3K5OA 3CHXA 4GYCB 4DK0A 1XNQB 4DR6B 1IBKB 3JAWB 4I50B 2UU9B 2P5OA 1TVKA 3OTOB 2ZNIA 4NXMB 4GLXA 3K59A 5IWAB 3IAYA 4IIJA 5BMVB 3B2EE 2JS5A 4FFBA 5EIBC 4FM1A 2YIBA 4DV5B 3WB1A 4FLUA 5ITZB 5JH7B 4FLVA 4X20B 2P22C 3JASA 1Q43A 5J2TB 1XHXA 1SA0B 1HNWB 2QM4A 4DR4B 4L8JA 3RGBA 4ZIBA 4LFBB 4B3MB 4FM2A 5KX5A 3N2KB 3RWRD 5C8YB 4JI3B 4JI4B 4PI2A 1WN7A 5IYZB 5LP6A 4EFBA 4TV8A 5LP6C 4O2BB 4HNAB 4UCOA 4X62B 4K8ZA 1SQGA 4NVPA 5KHHA 1RSOA 2V4DA 2RJZA 3JARB 3K58A 3BPZA 5FNVA 1P49A 3SR2C 4CH5A 4LF6B 3JALB 2F95B 1S5JA 4FLYA 5CA1B 4K0KB 4ZHQA 3HKEB 5CA0A 4JI5B 3RYIA 4JI7B 4UCRA 3MAQA 4X1KA 1N32B 4X65B 1IBLB 5GONB 3HKCB 4D7TA 2RQ6A 4TQDA 4U3JA 4DV2B 3JSNA 4JI0B 5EYPA 2PYLA 3QTCA 1J5EB 5JQGA 4CC6A 4F6RB 4TOIA 4BW9A 3ICXA 2CAZC 5BR8B 4DRXA 3JATB 1JFFA 4CS2A 4FLWA 4O4IA 1KU9A 1G6UA 3JSLA 4TUYA 5LYJA 1FFXB 4ZOLA 3BAAA 2BTQA 5LA6A 3HKDB 5JJEB 4DV4B 2ZNJA 3HKBB 2R70A 4LNUA 4CC5A 1QQCA 5LOVA 3E22A 3T1YB 2ZIMA 4B3TB 5IJ0B 4X1YA 4LFAB 5J2UB 2F66C 4GKJB 2VQFB 2PY5A 3SGIA 1IBMB 4WBNA 1V9PA 2PGGA 1Q5OA 3SJAC 4LF9B 2EX3A 4BWAA 3M7MX 2UXBB 4I55A 1Z5VA 1M4UA 4EFEA 1FJGB 4EEQA 1M93A 5LMUB 4O4LA 3UQ8A 5BMVA 2Q7HA 4FFBB 2PZSA 4PI0A 1Q3EA 3THOA 4EB6A 5JJJB 3A2FA 1YEWA 4X64B 5JCOC 2HEPA 4I4TB 5FPOA 2PUSA 2XHBA 5ITZA 5JH7A 3JASB 3RYHA 4LF7B 3U10A 4DR5B 4TQFA 1T5EA 1SA0A 1WPBA 1TGOA 3BHPA 3RYCA 5KX5B 3WB2A 1TUBA 3T1HB 4LR3A 1HW7A 3UT5B 5EZYB 4O4HA 5KMGB 4B3SB 4TV8B 4UCTA 1TA8A 4YJ2B 1X4TA 3ZS8C 4UCVA 4O2BA 1XHZA 3RYFA 4KHPB 1ZAUA 3VQWA 3JARA 4CS4A 5JVDB 1QHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QG5 A;  2CAZ C;  1X4T A;  3SJC C;  3ZS8 C;  3QF7 A;  2F66 C;  3B2E E;  2JS5 A;  3SJA C;  3THO A;  3CSX A;  3SJB C;  2P22 C;  1NT2 B;  1SKV A;  3ICX A; 
#chains in the Genus database with same CATH topology
 3FB7 C;  4DV1 B;  3QF7 A;  4DR2 B;  1R6N A;  3K5L A;  2YC0 A;  3T1C A;  2Z0A A;  1N0J A;  4KHP O;  4O2A B;  4LF4 B;  2BCC H;  3SYQ A;  3TCU A;  2YDE A;  1GN2 A;  4YY3 B;  1FXV A;  5LGN A;  5EK0 A;  1M5I A;  1W0J G;  4DR2 O;  1WB8 A;  2IJI A;  5CBG A;  3AG4 B;  1EFR G;  1UFI A;  4DR1 B;  4R7C A;  4G2K A;  4I9Q A;  4LF8 B;  3AK1 A;  3FD9 A;  4RQF A;  3VQV A;  3JAT A;  2W0X A;  2JVD A;  1KEC A;  2IM9 A;  5E1A C;  1QCE A;  3G6E V;  4DR1 O;  1FYJ A;  1YVW A;  2QE7 G;  5JJN B;  2ZM6 B;  4MVM A;  4LF8 O;  4P30 A;  5LOV B;  4LH7 A;  4WFH A;  3E89 A;  1RPR A;  2ZE8 A;  1VEW A;  2QR4 A;  3JAW A;  1TVK B;  4ZKI A;  3FB5 C;  3RVZ A;  3CXH F;  4WFA V;  1VQP V;  2OYQ A;  4IIJ B;  3ZMS A;  4RUF A;  2ZM6 O;  2R9A A;  3CC7 V;  1ENV A;  3ASN B;  2NN4 A;  3QO5 A;  3W7X A;  5K1P A;  2ATK C;  1B06 A;  3CCL V;  4WFG A;  4PEL A;  4GT1 A;  1GK9 A;  4EB6 B;  2EIN B;  4JYY A;  1K92 A;  1Y66 A;  1NVP D;  1M57 B;  1AVM A;  2X7R B;  1AP6 A;  4UVA A;  5KA5 A;  1K3E A;  2EUL A;  2X6B A;  1H2L A;  3ZJZ A;  4IGG A;  4JI2 B;  5BXZ A;  3F5T A;  1P7B A;  3RYC B;  4QNH B;  3MHH C;  5IYZ A;  3A0B Z;  4HNA A;  3BFR A;  3OR7 C;  3ZMV A;  2DOS A;  4JI2 O;  1K7D A;  3ZHQ A;  5EZY A;  2GV9 A;  5EIB D;  1VF5 B;  3RYF B;  5CA1 A;  3CB2 A;  4ZHQ B;  3RYI B;  4UUJ C;  1NT2 B;  1ROP A;  4J10 A;  4MVS A;  4X1K B;  4CH4 A;  5JWP A;  1KKC A;  2VRZ A;  4IHJ A;  3ZRS A;  3N27 A;  1YDX A;  4FVM A;  4ZI7 A;  5D5P A;  4I0X B;  2ILM A;  3WB0 A;  5HFL A;  4P2Z A;  3B4S A;  2AGA A;  2WLH A;  1BQ0 A;  3FYI B;  1JMK C;  2ZCE A;  1EN4 A;  5H2F Z;  1F51 A;  1XQ8 A;  2E3C A;  1X59 A;  2VQE O;  3CRA A;  3RFR A;  3FB6 C;  5B3S B;  1G8M A;  1K33 A;  2WLM A;  5KHG A;  1NVP B;  3CCJ V;  3U11 A;  2D3O W;  1L8D A;  3ZIA G;  3RVY A;  4K8X A;  3QO8 A;  4LFC B;  4B08 A;  1IX9 A;  1NKD A;  1Z5W A;  3ZED A;  5BY1 A;  3P3P A;  3U0Z A;  4QJF B;  4TWK A;  1XNQ B;  1V55 B;  3G80 A;  3CJH A;  3JAW B;  3ASO C;  4PD4 F;  4LFC O;  1CXZ B;  2OT5 A;  5KLV H;  3ETD A;  3DC6 A;  4JTD B;  3K59 A;  4FPP A;  3M99 B;  3IAY A;  1MA1 A;  5IY5 C;  1RM1 B;  5BMV B;  3FYE B;  2W6I G;  1M56 C;  4UB8 Z;  4FFB A;  2Q67 A;  1CP9 A;  4FM1 A;  2HVK C;  4DYL A;  1XNQ O;  3AG2 B;  5EC1 C;  1E1Q G;  1PNK A;  1MOF A;  4FLU A;  5ITZ B;  3X2Q C;  1LUV A;  1GKF A;  4UVB A;  1WP8 A;  2P22 C;  2A79 B;  2YUA A;  1KBH A;  3UCS C;  1U97 A;  3O65 A;  2FTK A;  2JRI A;  1S5H C;  2E75 B;  4LFB B;  4OPA A;  3KKY A;  4JAS A;  1S76 D;  4JI3 B;  1IZ3 A;  1DLB A;  4PA3 A;  4LF5 O;  3M8A A;  4W4L A;  5IYZ B;  1YHQ V;  3ZRX A;  5LP6 A;  3CC2 V;  4CBC A;  4UCO A;  5LP6 C;  1W59 A;  4HNA B;  2BOB C;  4NVP A;  1RSO A;  4MVZ A;  1K9M W;  4LFB O;  2FYU H;  2F95 B;  5CA1 B;  1MNG A;  4LWS A;  4JI3 O;  2Y4U A;  3E8H A;  4JI5 B;  3A0H Z;  3OUS A;  4X8A A;  4UCR A;  5B1O A;  2Q9L A;  5EBL C;  3L73 H;  1XOU A;  4X65 B;  3CWB H;  4NR1 A;  3OMA B;  1TUE B;  2H3O A;  1NJI W;  2EIJ C;  2KSD A;  1NH2 D;  4KUM A;  4IYI A;  1G4Y B;  3JSN A;  3OM3 B;  4YXW G;  2EIL C;  3PJS K;  4RWU A;  4LC1 A;  1J5E B;  3ZHT A;  5JQG A;  4J9Z B;  4CC6 A;  4F6R B;  4X65 O;  4GX5 A;  1BS3 A;  5BR8 B;  2XUM A;  5LHG A;  1K97 A;  4DRX A;  1VQ4 V;  1VQN V;  4FLW A;  3H1I H;  3QO7 A;  4FJC C;  4TUY A;  5LYJ A;  2QKC A;  2OTL V;  1GTO A;  1J5E O;  2XAH A;  1Q82 W;  5H9C A;  3E22 A;  3OMN B;  3T1Y B;  1VQO V;  5BR8 O;  4X1Y A;  1M90 W;  1AR1 B;  2JIZ G;  1AI6 A;  1BE3 H;  2F66 C;  4GKJ B;  2LO1 A;  4MVR A;  1V9P A;  3WFV A;  4JI6 O;  3OT7 A;  1Q5O A;  3SJA C;  2EX3 A;  4BWA A;  1M4U A;  3T1Y O;  4MW3 A;  5LMU B;  2DE0 X;  2W0F C;  1NI8 A;  4O4L A;  4GKJ O;  3WG7 B;  5C93 A;  4FFB B;  1H2N A;  3ZHR A;  4NXM O;  1NTM H;  1BT8 A;  1SES A;  4X64 B;  1H2K A;  1FPO A;  2FML A;  2HEP A;  5B1A C;  3O9O A;  5TIS Z;  4BIZ A;  4U7N A;  4I4T B;  3OEH G;  3I55 V;  5JH7 A;  2B1I A;  1NH2 B;  1GM9 A;  2XAF A;  1VMG A;  4DR5 B;  4TQF A;  1TGO A;  1NR7 A;  1VP7 A;  2JJ1 G;  1YF2 A;  2ZT9 B;  1VQL V;  5GTI Z;  4X64 O;  5AG2 A;  1KYO F;  4JTA B;  2DYR B;  3A0R A;  4N23 A;  1S3J A;  5DED A;  4B3S B;  4FZ0 A;  4UCV A;  1XHZ A;  1QVF U;  2EZO A;  1ZAU A;  2QSA A;  4CS4 A;  1WLE A;  5JVD B;  1QHT A;  4KP4 A;  4X62 O;  4LWS B;  1FXK C;  3FKS G;  5L3B A;  4KFM A;  3SPI A;  1Q86 W;  4NTY A;  2ZQM A;  2P67 A;  2F93 B;  3BEH A;  5B1N A;  1OCC B;  2LQT A;  1LUW A;  1H38 A;  2AZ0 A;  5LXT A;  1WA8 B;  3SJB C;  1UPG A;  3OAA G;  2QTO A;  3DSQ A;  1KKD A;  4H13 B;  2YS8 A;  2DW4 A;  2EIL B;  2Y69 C;  2QWP B;  5KHI A;  4JI8 B;  1ORQ C;  2WLI A;  2ZE5 A;  1JVM A;  1V54 B;  3OFN G;  3DTU B;  2G38 A;  1XMO B;  4PDV A;  4DRX B;  2BTO A;  3TET A;  1XI1 A;  2QTS A;  2JS3 A;  1H2M A;  4DV7 B;  4TUY B;  4E4E A;  2B9Z A;  3FX7 A;  4PDR A;  2ZXW B;  2PTM A;  4GX1 A;  5IJ9 B;  3EHB B;  5D5Q A;  3E22 B;  2WAM A;  1XMO O;  4PDM A;  3IJ4 A;  2HP8 A;  3BVO A;  1K8A W;  1OCO B;  4DW1 A;  3SJQ C;  4DV7 O;  1R3J C;  3CSX A;  4DUY B;  3H01 A;  4LP8 A;  2ZE7 A;  2DWD C;  3W7S A;  3CEI A;  4GCZ A;  3OTF A;  3IC9 A;  4Q6G A;  4GKK B;  1RPO A;  1E1R G;  1KB9 F;  1EN5 A;  3TXQ A;  5JCO A;  1KUQ A;  4O4L B;  1H8E G;  3IFX A;  1XL6 A;  2HJF C;  3ETQ A;  2JGU A;  3KG2 A;  2GTA A;  4DUY O;  1FJG O;  3J81 N;  2P06 A;  4K3A A;  5J2T A;  1DGS A;  1BMF G;  1K4C C;  3E2E A;  3AG3 C;  4GKK O;  3L72 H;  1N4C A;  5KHJ A;  3BRC A;  5CBH A;  1QR8 A;  4QPJ A;  1OCR C;  2Q7E A;  3H9V A;  2MW2 B;  1O9G A;  1HDJ A;  5H6Q A;  3K03 A;  2UUB B;  2F4V B;  1PL4 A;  2IW5 A;  2ZKO A;  3BAB A;  4NXN B;  3JD4 A;  5FNV B;  4CS3 A;  3JCZ A;  3APQ A;  5KMG A;  3IGA C;  4YJ2 A;  3S3X A;  2XAG A;  4JYA B;  1QVG U;  3ABU A;  2CH7 A;  2UUB O;  2GDS A;  1F4N A;  3C3S A;  1AR4 A;  2H94 A;  4NXN O;  1XUQ A;  2HG5 C;  1R3I C;  2HKO A;  4D7S A;  1D5A A;  1H8H G;  3HKC A;  2WLN A;  1VAR A;  4PA7 A;  4DV1 O;  5LXT B;  1JA8 A;  4JYA O;  1QU7 A;  2L6L A;  5LGT A;  4JV5 B;  3I5D A;  3B8M A;  4LF4 O;  2YID A;  4ASU G;  3ZMT A;  2HHH B;  2CGN A;  3AG1 C;  3B77 A;  3H1L H;  4MT8 A;  2HFE C;  2QJ1 A;  4YY3 O;  4ZOL B;  3RT3 C;  3P3N A;  4GZR B;  4JV5 O;  1AJQ A;  1DF4 A;  2ODM A;  2R9I A;  4WCE V;  1ZSP A;  4Z1M G;  4X1I A;  2HHH O;  3FB8 C;  1ZTE A;  2MK3 A;  1OV9 A;  2CE4 A;  2Q73 A;  2GUZ A;  3Q4H B;  3ETG A;  1HR0 B;  2Q6A A;  5LBQ A;  4JGS A;  1G1X B;  1SKV A;  3CHX A;  5L3G A;  2CTQ A;  4DR6 B;  1IBK B;  2P5O A;  3OTO B;  4OXS A;  2WLL A;  3CCU V;  1BL8 A;  3CE2 A;  1SQB H;  2EIM B;  1HR0 O;  1JOY A;  2EIK C;  2QWO B;  5EIB C;  2F43 G;  2YIB A;  1Q81 W;  2DMX A;  1QLN A;  1FS0 G;  4DR6 O;  1IBK O;  2R9R B;  5B1B B;  5LHI A;  1SET A;  3OTO O;  1SRY A;  3JAS A;  4RAI A;  5J2T B;  1SA0 B;  3ZBH A;  1U96 A;  4DR4 B;  1I08 A;  3RGB A;  4FM2 A;  1DF5 A;  4PA4 A;  1YJN V;  4MVQ A;  4PI2 A;  1SF9 A;  3CCR V;  3QVN A;  3B09 A;  1L0N H;  3ZX6 A;  2JEX A;  2DYS B;  4TV8 A;  4O2B B;  4K8Z A;  3EFF K;  1Q6H A;  1JR9 A;  4DR4 O;  2WA4 A;  2RJZ A;  4BIU A;  4IL6 Z;  3CYO A;  4CH5 A;  4J7Z A;  1S5J A;  1GRJ A;  4FLY A;  2CK3 G;  2PI5 A;  1R1B A;  2CH7 B;  3SPG A;  3K08 A;  4XDK A;  4R6Z A;  2N04 A;  1R6K A;  1K4D C;  4DW0 A;  2OIE A;  1YZB A;  3HKC B;  4D7T A;  1K5S A;  2P4V A;  3G67 A;  4TQD A;  4U3J A;  4YIO A;  2UXX A;  3G71 V;  5EYP A;  1BQZ A;  1BHA A;  1LNQ A;  5IDJ A;  4BW9 A;  1P7G A;  3ICX A;  3ZRW A;  3W7U A;  1Y74 A;  4PJ0 Z;  2RCV A;  3JAT B;  2P7T C;  4CS2 A;  4O4I A;  4C7U A;  1I0H A;  1P4R A;  3ZMZ A;  1AIL A;  1VQ5 V;  2XND G;  1FFT B;  3CXC U;  5LA6 A;  2Q0O C;  5JJE B;  4DV4 B;  4CC5 A;  4LNU A;  1MZF A;  2ZIM A;  2CTR A;  4B3T B;  2GUZ B;  4LFA B;  3K04 A;  2VQF B;  3SGI A;  3AEI A;  2JGD A;  3SYC A;  4LF9 B;  3CRR A;  3L74 H;  4DV4 O;  2RDC A;  3DGE A;  3M7M X;  4I55 A;  1Z5V A;  4GX2 A;  4EFE A;  2WLL B;  4EEQ A;  4UV8 A;  1GN3 A;  4LFA O;  5FL7 G;  4J41 A;  4P9P A;  1AI4 A;  3RW0 A;  2OCC C;  4K35 A;  3UQ8 A;  2Q69 A;  2VQF O;  5F2V O;  1YEW A;  4LF9 O;  4UV9 A;  1ZWI C;  3ZN0 A;  5GW7 A;  3AK2 A;  2ITC C;  5FPO A;  2EJ7 A;  3JAM N;  1IVS A;  3JAS B;  3RYH A;  1BCC H;  4LF7 B;  1SQQ H;  2CTW A;  3OMI B;  2CDY A;  1T5E A;  1WPB A;  1B6Q A;  3BHP A;  4J11 A;  1GM8 A;  4UB6 Z;  3WB2 A;  4A5U B;  2WLJ A;  1TUB A;  3T1H B;  4LR3 A;  1QLE C;  5EZY B;  4MVO A;  1WJZ A;  4TV8 B;  1KP2 A;  4JYB A;  3ABK C;  2V7Q G;  5EBW C;  4LF7 O;  2QGN A;  1SS3 A;  3JD3 A;  3JAR A;  4OGQ B;  2IJJ A;  3CPW U;  1D2D A;  4QIW F;  3UO3 A;  3JAL A;  3T1H O;  1FKA O;  4IHJ B;  2EBO A;  1LR1 A;  1WB7 A;  1YJW V;  4JAA A;  3CCV V;  1HNZ B;  4ZI7 B;  1AB3 A;  5DEC A;  1WP7 A;  2YXY A;  4UCS A;  1PL0 A;  4JI5 O;  3LNN A;  4P9O A;  2M7W A;  3S3W A;  3JAK A;  5GON A;  3K06 A;  3TK1 A;  1H2G A;  5L3D A;  4AHC A;  3FAV A;  3T2M A;  1J95 A;  1VQ9 V;  4WFF A;  5EYP B;  2YIA A;  1HNZ O;  4LH6 A;  4QGP A;  2P90 A;  2ZIO A;  4B7K A;  3OE7 G;  4J9Y B;  3SJC C;  1K5Q A;  3HPL C;  3ZRW B;  1Y74 B;  2YEV A;  3ABL C;  4YJ3 A;  1M1K W;  2X6C A;  2ZDI A;  1O9H A;  4O4J A;  2ZDI C;  1N36 B;  2Q0A A;  3QG5 A;  5LA6 B;  2LW7 A;  3CRQ A;  5CN0 A;  4JPR A;  2BE3 A;  3MD0 A;  1I7F A;  5CB4 A;  1XMQ B;  4AQY B;  4LNU B;  1OCZ C;  3JD1 A;  3N2G A;  4DV0 B;  5B5E Z;  3ASO B;  3CJH B;  2UUC B;  1JCH A;  4CZZ A;  4I50 A;  4DR7 B;  1QNM A;  1RFY A;  3K5M A;  1YJ9 V;  3KCY A;  5CBF A;  5IY5 B;  2VS0 A;  2YXL A;  3SPJ A;  1M56 B;  4NB5 A;  1SQP H;  1XMQ O;  4I55 B;  4AQY O;  4FM0 A;  2ZIN A;  4N21 A;  3OGC C;  5A9G A;  3NR7 A;  1QBZ A;  4HYO A;  3CCS V;  1XBL A;  2W6J G;  3P32 A;  1F7Y A;  3JYC A;  3X2Q B;  2UUC O;  3BA8 A;  4FLX A;  4FLT A;  1BHB A;  1I5Y A;  3H1J H;  3QNE A;  3D8C A;  5LMU O;  1ARO P;  1VIB A;  4X20 A;  4RQE A;  2F23 A;  4ZBM A;  4HZ3 A;  2QM7 A;  3D36 A;  1AJP A;  3D36 C;  3RYH B;  2JK5 C;  3VOU A;  1Y67 A;  1H2S B;  3DC5 A;  5IYC O;  5LP6 B;  3C90 A;  2WPD G;  1VF7 A;  1SQF A;  1TUB B;  4DR5 O;  1RSO B;  3UT5 A;  1VQM V;  2Q7G A;  5L3F A;  2Z5U A;  1N34 B;  4YIP A;  2JJ2 G;  1FXK A;  2DQ3 A;  3OW2 U;  1R6T A;  1JJO A;  3HKE A;  4B3S O;  2A7W A;  4G27 B;  2E5L B;  4X9Q A;  1Q90 D;  1KMI Z;  1XIL A;  3K57 A;  3CS5 A;  1WAZ A;  1JX9 A;  2Y0P A;  1NZ6 A;  2GBO A;  4OPH A;  1R3K C;  3CP1 A;  1N34 O;  1L1F A;  1SZT A;  2EIJ B;  4H37 A;  1PPJ H;  3LDC A;  4UFZ A;  1GO3 F;  1YI2 V;  4O2A A;  5FLX N;  1EM1 A;  1RP3 B;  2LGQ A;  4CH6 A;  3JAK B;  1B04 A;  2E5L O;  2XOK G;  1W0K G;  5EC2 C;  5JQG B;  3FAV B;  4NKG B;  2O57 A;  1BZK A;  3FFQ A;  5GTH Z;  3ZMU A;  2X0L A;  3RBZ A;  2KG7 A;  3KCX A;  1Y6X A;  2ARH A;  1PD3 A;  3AG4 C;  5LYJ B;  2YEV B;  4YJ3 B;  3LSQ A;  3AG7 A;  1WPX A;  1I94 B;  2UXC B;  4JI8 O;  4O4J B;  5KUK A;  4ICG A;  2DQ0 A;  4JAU A;  4WFB V;  4PHZ A;  1VQ7 V;  2EZP A;  3K79 A;  4X1Y B;  5CB4 B;  1Q8I A;  4DR3 B;  2GSM B;  2YI9 A;  2LFS A;  2LW1 A;  5J2U A;  2NNU A;  1E79 G;  3N2G B;  2OIG A;  3MHS C;  3ZCC A;  1I94 O;  1TAE A;  3HB3 B;  1GH6 A;  2A0L A;  5H5N A;  3LDD A;  1L0L H;  1VQK V;  4U3F H;  4DK0 A;  3RN4 A;  2AW9 A;  4I50 B;  4DXW A;  2UU9 B;  3SDL A;  3L9D A;  1TVK A;  5CMU A;  1NU1 H;  1Q6U A;  4DR3 O;  4XBF A;  1OHH G;  2DWE C;  4IIJ A;  2QKS A;  3GB7 C;  1ZUQ A;  1OJH A;  2C2A A;  2JS5 A;  3LSU A;  4MW8 A;  4G28 B;  5B1A B;  4JF3 A;  4DV5 B;  5H6R A;  3I56 V;  2UU9 O;  3R65 A;  3AK3 A;  4FZ1 A;  5JH7 B;  5LHH A;  1F23 A;  2KQX A;  4X20 B;  2EIN C;  1Q43 A;  1XHX A;  1M57 C;  4QE7 A;  4ZIB A;  2CUG A;  2K9P A;  1GN4 A;  5EBM C;  1PNL A;  4DV5 O;  2WA3 A;  1OZ0 A;  4X89 A;  3SYA A;  4JI4 B;  2FL4 A;  3E8B A;  4MTG A;  4FIP C;  4LBE C;  1NBM G;  4EFB A;  2EJR A;  2BSK A;  5KHH A;  2V4D A;  3K58 A;  3BPZ A;  3JCU Z;  4WF9 V;  1VF6 C;  1R73 A;  1FXK B;  2LFR A;  2RMK B;  2F4V O;  1DTO A;  4JI4 O;  1FAF A;  1MMM A;  4ZHQ A;  3HKE B;  5CA0 A;  2CGO A;  3RYI A;  3W7W A;  3MAQ A;  4X1K A;  4FK5 C;  1EZV H;  1IBL B;  2XAS A;  1EBO A;  1YXB A;  2B1G A;  2RQ6 A;  4NTX A;  4BR6 A;  2Y69 B;  5DN6 G;  2WLI B;  2IU0 A;  4DV2 B;  4I0X A;  1DK1 A;  4JI0 B;  3A8T A;  2PYL A;  3LNM B;  4UXN A;  1ZL8 A;  4IYH A;  3D3I A;  3WU2 Z;  5IYD O;  4TOI A;  1QR9 A;  1IBL O;  1PP9 H;  2KG7 B;  4J7K A;  1JFF A;  1G6U A;  1KU9 A;  5B3S C;  3JSL A;  1MAB G;  3ZRV A;  5KUM A;  1MZE A;  2BTQ A;  4DV2 O;  2BOC C;  4WFE A;  4JI0 O;  1GMG A;  2ZNJ A;  3J80 N;  3CC4 V;  2Q5Z A;  3UO2 A;  1HP8 A;  4J7J A;  1KP3 A;  1I5X A;  3CRC A;  4MS2 A;  1ZLZ A;  3IC7 A;  4I9W A;  5J2U B;  1KQS U;  1XL4 A;  2PY5 A;  1FD9 A;  4WBN A;  1IBM B;  3ABM C;  3VBB A;  3STZ C;  2IBZ H;  1V55 C;  2QWN B;  3OEE G;  1R3L C;  1M93 A;  2HJD A;  4MSW C;  2QKA A;  3BY6 A;  5BMV A;  1RM1 C;  1IBM O;  4PI0 A;  4XDJ A;  1Q3E A;  2K1E A;  4J42 A;  2P6J A;  1XEQ A;  3THO A;  3F5W C;  3ZHU A;  3ZHV A;  3AG3 B;  2RN9 A;  1NQT A;  3AG2 C;  2PUS A;  1EZJ A;  2XHB A;  5ITZ A;  1VQ8 V;  1OCR B;  4XDL A;  1P84 F;  5KAF Z;  1Q7Y W;  2IJH A;  4FFK A;  2ZD9 A;  4EKW A;  4O4H A;  1N8R W;  1NTZ H;  3SYP A;  5KMG B;  2YSU B;  1TA8 A;  1IXM A;  4YJ2 B;  3CME V;  2BSK B;  2WSS G;  2AZ2 A;  3OUF A;  1SER A;  1GM7 A;  2XT9 A;  3VQW A;  1NR1 A;  5BZB A;  3UM7 A;  2Y48 A;  2NR5 A;  3T4Z A;  2YIB D;  4QPK A;  2Z3Y A;  5CA0 B;  3APO A;  2FB5 A;  5K1X A;  4F6E A;  3W7T A;  3KZI Z;  2PYJ A;  2UUA B;  3CMA V;  5FPR A;  2ADQ B;  4X66 B;  3J7A U;  2VQE B;  3L75 H;  3LSS A;  1AI7 A;  3LUT B;  4DUZ B;  2AHY A;  3K9S A;  4CH3 A;  2ZR2 A;  3AG1 B;  3BA9 A;  4B3R B;  4HBN A;  2VWJ A;  2OWO A;  4B7E A;  3K0G A;  2JEU A;  4F4L A;  1ZL8 B;  2UUA O;  1HNX B;  3L71 H;  3DXR A;  4NTW A;  4X66 O;  4F6R A;  2DN9 A;  2GTS A;  1JFF B;  4R50 A;  4TV9 A;  4DUZ O;  4B3R O;  4X1I B;  2BTQ B;  2QA4 V;  4YHH B;  1XNR B;  2WLK A;  2YXH A;  2HVJ C;  4RUE A;  5KHK A;  4AIL C;  1SC5 B;  1HNX O;  1S0V A;  3GWO A;  2LP7 A;  3LDE A;  4LCU C;  5A2Q N;  3ZN1 A;  4R8C A;  4DK1 A;  2KB1 A;  3ABM B;  1WNS A;  4WBN B;  2QWQ B;  5LGU A;  2YI8 A;  4YHH O;  4DV6 B;  1XNR O;  2M6Y A;  4JZG A;  4NYK A;  3K9A A;  2EIK B;  4B3T O;  4H44 B;  4DV3 B;  3CD6 V;  1BGY H;  2YIC A;  1COW G;  4QE9 A;  1PV0 A;  3ML0 A;  4MTX A;  3VQY A;  2P4K A;  4JI1 B;  3P30 A;  4DV6 O;  3WG7 C;  1N0N A;  2IU3 A;  4DV3 O;  4OX9 B;  1F4M A;  4PA9 A;  5LMN B;  4I5S A;  4LF5 B;  2ZR3 A;  1N33 B;  4I4T A;  4X88 A;  1PM9 A;  4JI1 O;  3SYO A;  4Q20 A;  3H1H H;  3N2K A;  4TSF G;  5C8Y A;  1VQ6 V;  4UCU A;  3K3W A;  4OX9 O;  4Z2W A;  1Q6I A;  5IYB O;  4MVU A;  1S77 D;  4KL1 A;  5LMN O;  4O4H B;  1XRE A;  2IJK A;  1YIT V;  1N33 O;  2DYR C;  1EN6 A;  4FLZ A;  2R72 A;  4AI8 A;  4GX0 A;  4H33 A;  4PA6 A;  3BCC H;  3E8G A;  1YIJ V;  1UJW B;  3K5N A;  5DM6 V;  3E83 A;  3ZHS A;  1M9N A;  1AI5 A;  2AHZ A;  2A06 H;  3G4S V;  4Z1V A;  5JVD A;  1YTF D;  1GN6 A;  3F7Y C;  1GAX A;  3EVK A;  4U7O A;  5L3E A;  1AP5 A;  3VQX A;  2QEX V;  2Q68 A;  3OR6 C;  2UXD B;  4U3J B;  4JTC B;  1SZX A;  1OCC C;  2OTJ V;  2JDI G;  1WA8 A;  3R66 A;  2XAQ A;  2VWK A;  4O4I B;  2OCH A;  2UXD O;  1CPY A;  3DXR B;  4JYC A;  3PN1 A;  1FFX A;  2GHY A;  1V54 C;  2N74 A;  2KKW A;  3HR0 A;  4TV9 B;  3HKD A;  4W4K A;  5KAI Z;  2F1M A;  5B66 Z;  2N05 A;  2PI4 A;  3HKB A;  3CRM A;  4JI6 B;  3E8F A;  2ZXW C;  1D5N A;  1N36 O;  4IT5 A;  5IJ0 A;  5IJ9 A;  2HLD G;  3MDS A;  2FKX A;  2ZE6 A;  2E76 B;  4I7Z B;  1SQV H;  2JGD B;  2V1D A;  4E2L A;  3K5O A;  4GYC B;  1THZ A;  2PF4 E;  3ETE A;  2QM8 A;  3CCM V;  2AXT Z;  4FMT A;  1Z2G A;  1OCO C;  3NXS A;  1NTK H;  4DV0 O;  2ZNI A;  4NXM B;  4GLX A;  3CCE V;  2LJ2 A;  2OCC B;  1MSW D;  5IWA B;  2DJV A;  2Q4P A;  2D2C B;  1FXH A;  4DR7 O;  1A32 A;  3D3Q A;  3B2E E;  1YTF B;  5J9P C;  1Y76 A;  1B3Q A;  1IUR A;  3WB1 A;  4J80 A;  3SPH A;  1ZX3 A;  1JQ0 A;  3C3T A;  2IH3 C;  2LGW A;  4FLV A;  5IWA O;  2Y4T A;  1HNW B;  2QM4 A;  1XDC A;  3ABT A;  4L8J A;  3G6B A;  4B3M B;  1PNM A;  5KX5 A;  3N2K B;  1QLE B;  3RWR D;  3F7V C;  3TXS A;  5C8Y B;  5KA6 A;  4HAM A;  1WN7 A;  2X6A A;  3ABK B;  4H0L B;  4X62 B;  1SQG A;  1HNW O;  1YSC A;  3JAR B;  1W2B U;  5FNV A;  1URF A;  4B3M O;  1P49 A;  1IXB A;  3SR2 C;  4LF6 B;  3JAL B;  3STL C;  4K0K B;  4JAV A;  3SPC A;  4JI7 B;  3K0D A;  2ADP A;  1N32 B;  4DO2 A;  2XTA A;  3B8N A;  2UXN A;  5GON B;  4LF6 O;  4K0K O;  1US6 A;  3T4D A;  3JD2 A;  2NLJ C;  1K73 W;  4BW5 A;  5E79 Z;  1JPX A;  4JI7 O;  3QTC A;  3CX5 F;  4TT3 G;  3ABL B;  1N32 O;  1SQX H;  2Y0I A;  4UVC A;  2CAZ C;  4BAY A;  1YCI A;  2XAJ A;  4ABM A;  1FFX B;  3TJT A;  4ZOL A;  3GVM A;  3BAA A;  5CA3 A;  3HKD B;  2B5U A;  2QDO A;  1OCZ B;  1IDS A;  3GWK C;  1CEZ A;  3HKB B;  2R70 A;  4GUN A;  1QQC A;  5LOV A;  1JJ2 U;  2UXC O;  1HWY A;  5IJ0 B;  1BSM A;  4D6T H;  3EXA A;  1S72 V;  3Q4H A;  2QWR B;  5LL6 Y;  2H8P C;  5IT9 N;  2PGG A;  4PV1 B;  2WWW A;  2ETN A;  3E35 A;  2UXB B;  1FJG B;  3H1K H;  2IH1 C;  1MSD A;  3ASN C;  3UKM A;  2Q8V A;  2EIM C;  2Q7H A;  2PZS A;  1Y76 B;  2CTP A;  4EB6 A;  5JJJ B;  5IE9 A;  3A2F A;  2E74 B;  2L35 A;  1K34 A;  5JCO C;  2UXB O;  1AR5 A;  5L3C A;  5B1B C;  1Y4M A;  3JD0 A;  5HFM A;  1S5L Z;  3TGU H;  4BIO A;  1AJN A;  3U10 A;  1SA0 A;  4MTF A;  3E86 A;  3OGI B;  4PDL A;  3RYC A;  5KX5 B;  2HR3 A;  4L87 A;  1MG1 A;  4RO2 A;  4MTO A;  1PKX A;  1KC8 W;  1HW7 A;  3UT5 B;  3OD4 A;  1KD1 W;  4JZ2 A;  1VF6 A;  4UCT A;  1NS1 A;  2RNB A;  1X4T A;  3ZS8 C;  3L70 H;  4O2B A;  3CCQ V;  3RYF A;  4KHP B;  2DYS C;  3B40 A;  4KXR A;  2ITD C;  2A9H A;  2A3Q A; 
#chains in the Genus database with same CATH homology
 2YIB D;  3JAL A;  4DV1 B;  3QF7 A;  5CA0 B;  4IHJ B;  4DR2 B;  3K5L A;  5K1X A;  1HNZ B;  4ZI7 B;  2F93 B;  2PYJ A;  2UUA B;  4O2A B;  4UCS A;  5FPR A;  4LF4 B;  3LNN A;  5LXT A;  4X66 B;  3SJB C;  2VQE B;  3JAK A;  5GON A;  4DUZ B;  3DSQ A;  4CH3 A;  4AHC A;  4YY3 B;  3BA9 A;  4B3R B;  4HBN A;  1M5I A;  2VWJ A;  5EYP B;  4JI8 B;  2YIA A;  5KHI A;  4LH6 A;  2OWO A;  4DR1 B;  2ZIO A;  4I9Q A;  3SJC C;  4LF8 B;  1HNX B;  4F6R A;  1XMO B;  4YJ3 A;  4DRX B;  2BTO A;  1XI1 A;  1JFF B;  1O9H A;  3VQV A;  4O4J A;  1N36 B;  3JAT A;  4TV9 A;  2JVD A;  4DV7 B;  4TUY B;  2Q0A A;  3QG5 A;  4X1I B;  2BTQ B;  2IM9 A;  2PTM A;  4YHH B;  5LA6 B;  1XNR B;  1I7F A;  5CB4 A;  5IJ9 B;  5JJN B;  5KHK A;  1XMQ B;  2ZM6 B;  4AQY B;  4AIL C;  4LNU B;  5D5Q A;  5LOV B;  3E22 B;  4LH7 A;  3N2G A;  4DV0 B;  4DK1 A;  2UUC B;  3JAW A;  1TVK B;  1WNS A;  4I50 A;  4WBN B;  3CSX A;  4DR7 B;  4DUY B;  2YI8 A;  3K5M A;  4DV6 B;  2YXL A;  2OYQ A;  4IIJ B;  4DV3 B;  2R9A A;  4I55 B;  3OTF A;  4FM0 A;  2ZIN A;  4Q6G A;  4GKK B;  5K1P A;  3VQY A;  4JI1 B;  5JCO A;  4O4L B;  3ETQ A;  3BA8 A;  4FLX A;  2JGU A;  4FLT A;  4EB6 B;  4OX9 B;  4X20 A;  5J2T A;  1DGS A;  5LMN B;  4LF5 B;  1N33 B;  4I4T A;  4JI2 B;  5KHJ A;  3RYH B;  3BRC A;  3N2K A;  2Q7E A;  1H2S B;  5C8Y A;  1O9G A;  3RYC B;  4UCU A;  5LP6 B;  5IYZ A;  1VF7 A;  1SQF A;  1TUB B;  2UUB B;  2F4V B;  4HNA A;  4KL1 A;  4O4H B;  3BAB A;  4NXN B;  5FNV B;  4CS3 A;  3UT5 A;  5EZY A;  4FLZ A;  2Q7G A;  2GV9 A;  2R72 A;  5KMG A;  5EIB D;  1N34 B;  3K5N A;  3RYF B;  4YJ2 A;  5CA1 A;  3CB2 A;  4ZHQ B;  3RYI B;  4JYA B;  1NT2 B;  1JJO A;  3HKE A;  2E5L B;  5JVD A;  1KMI Z;  4X1K B;  4CH4 A;  3K57 A;  3VQX A;  4IHJ A;  4D7S A;  1D5A A;  4FVM A;  4ZI7 A;  3HKC A;  2UXD B;  4U3J B;  4UFZ A;  5LXT B;  4O2A A;  5D5P A;  4CH6 A;  3WB0 A;  3JAK B;  1B04 A;  4JV5 B;  5JQG B;  1JMK C;  2ZCE A;  3FFQ A;  1XQ8 A;  2HHH B;  2E3C A;  3RFR A;  2VWK A;  4O4I B;  5LYJ B;  5KHG A;  2QJ1 A;  4ZOL B;  4YJ3 B;  3U11 A;  1I94 B;  3PN1 A;  1L8D A;  1FFX A;  2UXC B;  4O4J B;  2KKW A;  4TV9 B;  3HKD A;  4K8X A;  4PHZ A;  2F1M A;  4LFC B;  3HKB A;  4B08 A;  4X1I A;  4JI6 B;  4X1Y B;  5CB4 B;  1Q8I A;  4DR3 B;  5IJ0 A;  1HR0 B;  5IJ9 A;  2YI9 A;  1Z5W A;  3ZED A;  5J2U A;  3N2G B;  1SKV A;  3U0Z A;  1TAE A;  3K5O A;  3CHX A;  4GYC B;  4DK0 A;  1XNQ B;  4DR6 B;  1IBK B;  3JAW B;  4I50 B;  2UU9 B;  2P5O A;  1TVK A;  3OTO B;  2ZNI A;  4NXM B;  4GLX A;  3K59 A;  5IWA B;  3IAY A;  4IIJ A;  5BMV B;  3B2E E;  2JS5 A;  4FFB A;  5EIB C;  4FM1 A;  2YIB A;  4DV5 B;  3WB1 A;  4FLU A;  5ITZ B;  5JH7 B;  4FLV A;  4X20 B;  2P22 C;  3JAS A;  1Q43 A;  5J2T B;  1XHX A;  1SA0 B;  1HNW B;  2QM4 A;  4DR4 B;  4L8J A;  3RGB A;  4ZIB A;  4LFB B;  4B3M B;  4FM2 A;  5KX5 A;  3N2K B;  3RWR D;  5C8Y B;  4JI3 B;  4JI4 B;  4PI2 A;  1WN7 A;  5IYZ B;  5LP6 A;  4EFB A;  4TV8 A;  5LP6 C;  4O2B B;  4HNA B;  4UCO A;  4X62 B;  4K8Z A;  1SQG A;  4NVP A;  5KHH A;  1RSO A;  2V4D A;  2RJZ A;  3JAR B;  3K58 A;  3BPZ A;  5FNV A;  1P49 A;  3SR2 C;  4CH5 A;  4LF6 B;  3JAL B;  2F95 B;  1S5J A;  4FLY A;  5CA1 B;  4K0K B;  4ZHQ A;  3HKE B;  5CA0 A;  4JI5 B;  3RYI A;  4JI7 B;  4UCR A;  3MAQ A;  4X1K A;  1N32 B;  4X65 B;  1IBL B;  5GON B;  3HKC B;  4D7T A;  2RQ6 A;  4TQD A;  4U3J A;  4DV2 B;  3JSN A;  4JI0 B;  5EYP A;  2PYL A;  3QTC A;  1J5E B;  5JQG A;  4CC6 A;  4F6R B;  4TOI A;  4BW9 A;  3ICX A;  2CAZ C;  5BR8 B;  4DRX A;  3JAT B;  1JFF A;  4CS2 A;  4FLW A;  4O4I A;  1KU9 A;  1G6U A;  3JSL A;  4TUY A;  5LYJ A;  1FFX B;  4ZOL A;  3BAA A;  2BTQ A;  5LA6 A;  3HKD B;  5JJE B;  4DV4 B;  2ZNJ A;  3HKB B;  2R70 A;  4LNU A;  4CC5 A;  1QQC A;  5LOV A;  3E22 A;  3T1Y B;  2ZIM A;  4B3T B;  5IJ0 B;  4X1Y A;  4LFA B;  5J2U B;  2F66 C;  4GKJ B;  2VQF B;  2PY5 A;  3SGI A;  1IBM B;  4WBN A;  1V9P A;  2PGG A;  1Q5O A;  3SJA C;  4LF9 B;  2EX3 A;  4BWA A;  3M7M X;  2UXB B;  4I55 A;  1Z5V A;  1M4U A;  4EFE A;  1FJG B;  4EEQ A;  1M93 A;  5LMU B;  4O4L A;  3UQ8 A;  5BMV A;  2Q7H A;  4FFB B;  2PZS A;  4PI0 A;  1Q3E A;  3THO A;  4EB6 A;  5JJJ B;  3A2F A;  1YEW A;  4X64 B;  5JCO C;  2HEP A;  4I4T B;  5FPO A;  2PUS A;  2XHB A;  5ITZ A;  5JH7 A;  3JAS B;  3RYH A;  4LF7 B;  3U10 A;  4DR5 B;  4TQF A;  1T5E A;  1SA0 A;  1WPB A;  1TGO A;  3BHP A;  3RYC A;  5KX5 B;  3WB2 A;  1TUB A;  3T1H B;  4LR3 A;  1HW7 A;  3UT5 B;  5EZY B;  4O4H A;  5KMG B;  4B3S B;  4TV8 B;  4UCT A;  1TA8 A;  4YJ2 B;  1X4T A;  3ZS8 C;  4UCV A;  4O2B A;  1XHZ A;  3RYF A;  4KHP B;  1ZAU A;  3VQW A;  3JAR A;  4CS4 A;  5JVD B;  1QHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...