1SKVA

Crystal structure of d-63 from sulfolobus spindle virus 1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
64
structure length
64
Chain Sequence
SKEVLEKELFEMLDEDVRELLSLIHEIKIDRITGNMDKQKLGKAYFQVQKIEAELYQLIKVSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of d-63 from sulfolobus spindle-shaped virus 1: surface properties of the dimeric four-helix bundle suggest an adaptor protein function
pubmed doi rcsb
source organism Sulfolobus virus 1
molecule tags Viral protein
molecule keywords Hypothetical 7.5 kDa protein
total genus 25
structure length 64
sequence length 64
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1skvA00
3CSXA 3QG5A 3B2EE 3QF7A 2JS5A 1NT2B 3SJCC 2CAZC 3SJBC 3ICXA 2P22C 3SJAC 3ZS8C 1X4TA 1SKVA 3THOA 2F66C
chains in the Genus database with same CATH superfamily
1HNWO 3SPJA 4EB6A 5LYJB 3ZHRA 2B1GA 5CA0B 1FFXA 4L8JA 4YY3O 1VIBA 4DR3B 3APOA 5KHJA 3AEIA 2LFRA 2MW2B 3U10A 2DWEC 5JCOA 2EIJB 5KA6A 2WLMA 3R65A 5L3GA 3P32A 1SESA 1MABG 3OD4A 4CBCA 1GH6A 2ZE6A 2JGDA 4MVSA 3U0ZA 4GKKB 2OT5A 4D6TH 3ABKC 1S72V 5EIBD 4NXMO 3T2MA 1H2SB 4J42A 3FFQA 3SJBC 2W0FC 3ZEDA 2LQTA 3CWBH 2Q69A 4UV9A 3CD6V 2BTQA 3F5TA 4FLUA 4O2AB 2HEPA 1WP7A 1AI5A 2F95B 1P49A 3CEIA 3JALB 5CB4B 4WCEV 4G28B 2WSSG 3OM3B 3ASNC 5GONA 4DV5O 2A06H 5EK0A 3GVMA 1TVKB 4UCTA 4DV7B 4LR3A 4GKKO 4FLXA 4PA9A 4PA6A 3RGBA 1N36B 1K4DC 2HLDG 2XAGA 1FXKC 3BFRA 4YXWG 1WLEA 2ATKC 1D5NA 3OTOO 5B1OA 3AG2B 3ZBHA 4P9PA 3K0GA 2EIKB 3ZRVA 1WN7A 5K1XA 1IBKO 1OJHA 3C3TA 1QLNA 5IT9N 3JAKA 4B7EA 4I55A 3L71H 4O4JA 2WLJA 2Q6AA 4TV8B 1AJPA 1SETA 4PDLA 3BEHA 4AQYO 2Q67A 3AG3C 4TT3G 3ZRXA 2KKWA 1GM7A 4JYCA 2RDCA 3H1HH 5DM6V 2WAMA 3ZMVA 4J41A 2O57A 3TCUA 3ZHQA 2F4VO 4X62O 2W6IG 3OR6C 1Y76B 4MTXA 1NU1H 1Q8IA 3G67A 2GV9A 3H1KH 1XHXA 3AK3A 4LFAB 3BHPA 2JJ2G 3SR2C 3VQVA 3ETGA 2DMXA 1IBMB 3LDCA 4X1YA 1DTOA 1EBOA 1Y76A 2UXBO 1K7DA 3THOA 4I4TB 5IY5C 2PI5A 4W4LA 4XDKA 4JI4O 3ML0A 4B3RO 4ZHQA 5KMGA 5BR8B 3CCJV 4ASUG 3FAVB 2F66C 4I7ZB 4FLTA 4R7CA 1AROP 5EBWC 3OTOB 5J2TB 4MSWC 2Y69C 5EZYB 1HNZB 3QO8A 3P3NA 4P9OA 4ZIBA 1XMOO 1L0LH 3AG1C 4BW5A 3N2KA 1MSDA 4I55B 4B3TB 2MK3A 4DV3O 3AG4C 1AB3A 4UXNA 2G38A 4DRXA 3BA9A 3HKCB 1QCEA 1NH2B 3O65A 1KYOF 3CRCA 4PA7A 4B7KA 3I5DA 4WFGA 5IDJA 2X6BA 2UU9B 4J7JA 1NTZH 4X62B 3E86A 3ZS8C 5KAFZ 4RUFA 2P67A 1ZAUA 1B3QA 1VMGA 3IC9A 3ABMC 3H01A 1BZKA 2Q73A 4J10A 2NR5A 3HKEA 2PY5A 3IFXA 3P30A 2RCVA 1Q6IA 2R9RB 5KA5A 1H8HG 3UT5A 4TOIA 2KG7B 1XHZA 4O2AA 4K8ZA 5LMNO 1VEWA 1K8AW 3CJHA 4OGQB 2HVJC 1PL0A 2YIDA 3ETEA 4MT8A 1M4UA 3GB7C 4LF5O 4O4IA 3RYCB 1BE3H 4ZOLA 4CS4A 1IBMO 1DF4A 1KU9A 3MAQA 2JJ1G 5L3DA 1K5SA 2YICA 3CCVV 2ZIOA 2QKAA 3RYHB 3K04A 1N0JA 1N4CA 4LFCB 4LFBB 2A7WA 2GBOA 1ZSPA 4GYCB 5LYJA 4BIOA 2CGNA 2FKXA 2Q5ZA 4DR6O 4I0XA 1I0HA 3OAAG 2R72A 5EYPB 3T4ZA 4DV1O 1R3LC 3HKBA 1SQVH 2Z0AA 3JASB 3L72H 5LBQA 4KXRA 1QQCA 3W7SA 1HR0O 3KCXA 1SQQH 3STLC 2Q7GA 2UUCB 2UXBB 3MDSA 4X64O 4P30A 1M9NA 3ZHVA 2WLLB 4PHZA 1Y6XA 3G6EV 1EFRG 2Q9LA 4TQDA 4LH6A 5KAIZ 4D7TA 1K4CC 4BR6A 4UB8Z 5CB4A 2RJZA 1W0JG 2CH7B 4DV1B 4Z2WA 5JVDA 3TK1A 1VQ6V 1H8EG 5EC2C 1HP8A 3CE2A 3FB7C 4FLWA 1SS3A 1D5AA 3M8AA 2CE4A 4X1IB 3OMAB 4KL1A 4O4HA 1VQKV 3CC7V 2JEUA 3WFVA 4Z1MG 3A0HZ 2YIAA 3HPLC 5J2UA 1VQOV 2ODMA 1VQ8V 4DV6O 4F6RB 2A0LA 4WBNB 4DR5B 2P4VA 1Q7YW 4H37A 2ILMA 4JGSA 4I50B 4LF9O 1AJNA 2ZE8A 3JARA 4HYOA 4NYKA 3L70H 2H94A 2DYRB 4DR7B 4MTOA 1FFXB 1XMQO 4FLVA 4UCSA 3B2EE 2RQ6A 1XREA 1WP8A 2WLIB 4JASA 3HKDA 5IYZB 1ZUQA 5KMGB 3S3XA 5C8YA 1BGYH 2HFEC 3JAWB 2WLIA 5KLVH 1V55B 2RN9A 3OMNB 3ASOB 1KKDA 2UXNA 3FYEB 1BQZA 2AHZA 2CTQA 4RQEA 1IXBA 4DV4O 4JZGA 2UUBB 4JI7O 3KCYA 1M57C 1QR9A 2XAFA 3CCLV 3CP1A 1YI2V 1BCCH 2Y4UA 4JAUA 1NQTA 4ZBMA 3PJSK 1SKVA 3WU2Z 1BHAA 4DK0A 1L8DA 2CTWA 3IC7A 4ZI7A 1EN5A 1UJWB 1XUQA 1ROPA 2ZNJA 4TV8A 2F93B 5LA6B 3SJAC 1HNXB 4JI3O 1A32A 5FNVB 2CH7A 3ZX6A 4LF8B 3QVNA 1M93A 3JATA 3OEHG 2GTSA 1BL8A 1OHHG 2Y0PA 2WLKA 4JI6B 3K9SA 1B6QA 2FYUH 2N05A 2JIZG 3CXCU 3CB2A 1FKAO 2QJ1A 4G2KA 4TV9B 1ZX3A 2DYSC 5LOVB 1Z5WA 2UUCO 3CMAV 3HKBB 3FYIB 1AVMA 1IZ3A 2PTMA 1COWG 2RNBA 5EC1C 2YC0A 3RVZA 4EFEA 3OR7C 4CH3A 2HHHB 1AI7A 4B3RB 5LMUB 2UXDB 1K73W 1ENVA 3X2QC 5BR8O 1XNRB 4BAYA 1OCZC 2DWDC 4QGPA 1N36O 3K3WA 2QM7A 3RFRA 1XL6A 2IJIA 3D8CA 1YCIA 3H1LH 2GUZA 4B3MO 3RYFB 3U11A 5H9CA 2HP8A 4OXSA 1MZFA 4HAMA 4GX5A 5LGUA 4KHPO 2JDIG 3CSXA 1IURA 2PUSA 2QA4V 4E2LA 3DSQA 3JCUZ 3BCCH 1VF6C 2ZXWC 1N8RW 1V54C 1XILA 3S3WA 3SPCA 4NVPA 2WWWA 3M99B 3F7VC 3ETQA 2PGGA 1QLEC 1YSCA 4AI8A 1AI4A 3WG7C 3ZMTA 4LF5B 5IJ9B 2ZM6O 1IX9A 2E76B 1VQLV 4J7KA 4XDLA 1SA0B 1JA8A 4MTGA 4HNAB 2BCCH 4O4LA 3B40A 2YEVB 4YJ3B 5LHGA 4FZ0A 4RAIA 1SQFA 3RVYA 4FVMA 3ZMZA 3JARB 5JH7B 1QVFU 1O9HA 2X6CA 4JYBA 1VQNV 1NH2D 2IH1C 1PNLA 1ZLZA 4LWSB 1GO3F 1Q5OA 1JOYA 3WG7B 4QE7A 2P7TC 3RYIA 1Q86W 4P2ZA 3JSLA 3L74H 4FK5C 5LA6A 3N2KB 1KKCA 2HKOA 4X66O 4X9QA 1XDCA 1THZA 4I5SA 2XUMA 1UFIA 1JJOA 2EILB 3UM7A 5LGNA 4IGGA 4DUZO 3E8BA 4GUNA 4JI0O 2ZE5A 1R1BA 3ZHSA 1E1QG 1F7YA 4I9WA 4DR2B 1FJGB 2AGAA 2JVDA 2NN4A 4JI5O 5H6QA 3AG1B 1PNMA 1OCRC 1GKFA 1JFFA 1L1FA 3VQWA 2A3QA 1NBMG 1XBLA 3CRRA 5BMVA 1FXKA 4U3JB 5LL6Y 3VOUA 2VQEO 2OIGA 4NXMB 4O4LB 3T1HB 4XDJA 1H2GA 4PDRA 3BY6A 3E83A 4DV6B 2R70A 4K35A 5JWPA 3GWKC 3QO7A 3EFFK 4UV8A 4DV0B 1Z2GA 2ZM6B 1OCCB 5L3CA 4DR1O 2QM4A 4JZ2A 5C8YB 4NB5A 3UQ8A 5BZBA 1H2KA 3JAMN 2D3OW 2ITCC 4GT1A 1XNQO 2ZDIC 4MVOA 3SDLA 2AW9A 5KHKA 4QPJA 2YDEA 5DN6G 1DF5A 4EEQA 5B1BB 2KB1A 5GW7A 2AHYA 3AK1A 3LDDA 5HFLA 1JFFB 4LP8A 2OYQA 5FPOA 3BAAA 1Y66A 3ZRWA 1I5YA 1GM8A 2FTKA 3RWRD 1XL4A 2XAQA 1S76D 2WA4A 3C90A 4KFMA 1KQSU 4B3SB 3RT3C 2GUZB 4R8CA 2YS8A 5JVDB 1JPXA 2ZQMA 4MVZA 3OEEG 3OT7A 2FB5A 2QGNA 1EN4A 3CPWU 1R6KA 2UXCB 3W7UA 4H13B 2D2CB 2WLLA 3MHHC 4LH7A 5EIBC 3AK2A 2GDSA 4GX0A 2QE7G 1SQBH 4UVCA 4RQFA 4FIPC 3K9AA 1LNQA 2ADQB 4YJ2B 1YTFD 3AG4B 2IJJA 1LUVA 4LF9B 5LP6B 4DK1A 4X64B 3G6BA 1TA8A 2LFSA 4KP4A 2AZ2A 4J9YB 2Q7EA 1ZL8B 2HG5C 4GX2A 1VP7A 4IT5A 1K5QA 3JASA 5B66Z 5H2FZ 2F4VB 4IHJA 2XASA 1U97A 4K3AA 1WAZA 4JI2B 5FNVA 1MZEA 4Z1VA 3CMEV 4LF6O 1DGSA 4CS3A 1LUWA 3LSUA 1N0NA 1YJWV 3ZRSA 4LNUB 1KBHA 2P06A 1YXBA 3ZMSA 4H33A 3CCUV 1G8MA 3JYCA 1F4MA 1PD3A 3UKMA 3QO5A 3LSSA 2K9PA 4JI3B 3BA8A 2P22C 4FM0A 2EIJC 4CH5A 4O4IB 3D3IA 3CC2V 1CEZA 4D7SA 4UUJC 2GTAA 3K5LA 1MG1A 1WNSA 5JCOC 4ZOLB 2K1EA 2UU9O 4PA3A 2B1IA 5H5NA 3QNEA 1O9GA 3A2FA 3ICXA 4JTCB 2IJKA 2DN9A 3AG3B 3ABMB 3TETA 2DQ0A 4PA4A 4FFBB 4DR4O 1GN2A 3W7WA 1VF7A 4RWUA 4DUYO 2RMKB 4WFFA 4X1KA 3BPZA 1EM1A 3ZHUA 3QF7A 1H38A 4R6ZA 1VQ4V 5BY1A 1Y74A 3ZCCA 2P4KA 4DV2O 1YIJV 4DV4B 2E5LB 1FXKB 4U3JA 3L75H 2UXDO 3ASOC 1GN4A 5LGTA 2PZSA 2DW4A 2QKCA 1I94O 2EJ7A 2XAJA 1VQ5V 4DW1A 3JD3A 1N32B 4WBNA 1IVSA 3KZIZ 1K3EA 4NXNO 3G80A 3K08A 3SYOA 4PD4F 2XHBA 2IU3A 1SZXA 2N04A 5J2TA 4GX1A 2W6JG 4WF9V 4DV3B 3ABUA 1WA8A 3TGUH 5KHIA 4N23A 2H8PC 2LO1A 3VBBA 1HNWB 3QTCA 2CGOA 3JALA 1PPJH 4FLZA 1NTKH 1FAFA 2IW5A 4F4LA 2YI8A 2IM9A 4X1YB 4RO2A 4TSFG 1SF9A 2YSUB 3N2GA 1SZTA 4WFAV 4LF7B 1VF6A 1M1KW 2V1DA 4WFBV 3APQA 4PV1B 5IYCO 4DR5O 3DC6A 4YJ3A 1E1RG 4LBEC 1BS3A 5EYPA 4DW0A 2HR3A 4FMTA 2EZOA 4KUMA 5H6RA 2B5UA 2PYJA 3B8NA 2LW7A 1RPRA 4I0XB 2EIKC 1F4NA 2E5LO 2Z3YA 1XOUA 4JYYA 5LHIA 3R66A 3SYAA 3JCZA 3OE7G 1M56C 2NNUA 1J5EB 4O2BA 1S5HC 4AHCA 5LXTA 1KC8W 2WA3A 4G27B 1F23A 1V55C 5CA0A 3EHBB 4K8XA 1R6NA 5KX5A 2VQFB 3T1YO 5A9GA 1QBZA 2EILC 5C93A 2EJRA 2QWRB 3HR0A 4LCUC 4I9QA 1FFTB 3JAKB 2GHYA 4TQFA 4JYAO 1S3JA 4JAVA 4DUZB 1VQ9V 2Q0OC 2QSAA 1JX9A 1VQMV 4BIUA 5JQGA 1K97A 2L35A 4O4HB 1B04A 1TAEA 5LP6A 3K79A 4ABMA 3D3QA 3OMIB 3FB5C 4U7OA 4DO2A 3K58A 2JS5A 2YIBD 4H0LB 1X59A 2YXHA 2QR4A 5CMUA 2KG7A 4BWAA 5JJNB 1JR9A 4LF7O 2QTSA 1JCHA 2VWJA 4DR2O 2EINC 1OCCC 2Y48A 1SQPH 1ORQC 3CYOA 4AQYB 1Q43A 4IIJA 1RFYA 4GLXA 1N34B 3KG2A 2BOBC 3HKCA 1YITV 4QIWF 1N33O 1RP3B 4MW8A 1FPOA 5KUKA 2Q7HA 2ADPA 2HVKC 1P4RA 1UPGA 1J5EO 3DXRB 3K5OA 1QLEB 3SYQA 3CCQV 2Q4PA 3K59A 3F7YC 3K06A 5K1PA 2HJDA 1P7BA 1PNKA 3CHXA 4JPRA 4O2BB 5LXTB 1BHBA 3W7XA 3CCMV 4X65B 4HBNA 5TISZ 4EB6B 2OCHA 3ZN0A 1OCZB 5JJEB 4JI4B 1T5EA 1YDXA 4FM1A 3FX7A 1FD9A 1FXVA 4GZRB 2XOKG 2R9AA 1Q90D 2DQ3A 4UVAA 2EIMC 1H2NA 4TUYA 4WFHA 5IWAB 1IDSA 2QEXV 5E79Z 4RUEA 2N74A 3N2GB 5GTHZ 1W59A 4X89A 1YJNV 3ABLB 3LUTB 2JGUA 4X65O 4IYHA 3CX5F 1TUEB 1Y4MA 2ZINA 5BMVB 4TWKA 1JVMA 3CJHB 4DV7O 2JK5C 2JEXA 3JAWA 2X6AA 1AR1B 2H3OA 1HNXO 4CS2A 4QNHB 3HKDB 5IYZA 3JD1A 5CA3A 4J9ZB 5IY5B 2EINB 2ITDC 3BABA 1EZJA 1CXZB 2Y0IA 1NS1A 3E2EA 3A0BZ 1NR7A 3E8HA 5EBMC 1VQ7V 4UCRA 1NTMH 1JQ0A 4Q20A 3GWOA 4OPAA 4PDVA 4Q6GA 5DECA 3CCEV 2BTOA 3VQXA 1HR0B 3VQYA 4B3MB 1S0VA 3A0RA 4GCZA 4LF4B 2AZ0A 1YHQV 1EZVH 5EBLC 1F51A 2VQFO 1YJ9V 1NR1A 1ZL8A 3J80N 3Q4HB 4UFZA 1G1XB 5FLXN 2P6JA 4JYAB 2YXLA 4IL6Z 5CBGA 1Y74B 5CN0A 1RM1C 2IH3C 3B09A 5GONB 4PELA 5KX5B 3TXSA 1NJIW 1PV0A 2ZT9B 4JV5O 1TVKA 3K0DA 4AILC 4UVBA 3IAYA 2PI4A 4KHPB 4DV5B 2BE3A 2A79B 3JD0A 3FKSG 2CAZC 3T4DA 2DJVA 2VS0A 1M5IA 1US6A 1HW7A 2BTQB 4FFKA 1GM9A 4CZZA 3B77A 5IJ9A 4YIPA 2EBOA 5L3BA 4U3FH 2JRIA 3EVKA 1FJGO 1BT8A 1K33A 2VRZA 3ZHTA 1AILA 3B4SA 2NLJC 2ZE7A 5LMNB 1IXMA 2CK3G 5LHHA 3E89A 1XNRO 3J7AU 2F43G 1XMOB 3CS5A 2OTLV 1OV9A 1AP5A 1XMQB 1VARA 2QWOB 3ETDA 3OFNG 2AXTZ 3WB1A 4NXNB 2LJ2A 4GKJO 2M7WA 1PKXA 1Q82W 4LNUA 1KD1W 1BMFG 2ZNIA 2E3CA 1FS0G 2YI9A 3J81N 2OWOA 1WJZA 2A9HA 2Y4TA 4JI0B 4UB6Z 1S77D 5B3SC 4LFCO 4W4KA 1HWYA 2LP7A 4JI7B 3SYCA 2C2AA 2LW1A 2BOCC 2P90A 4LFAO 4JI8B 5F2VO 1R6TA 4DR6B 2ZR2A 3T1YB 4IIJB 1IBKB 2P5OA 3AG2C 3DC5A 2XTAA 5GTIZ 4DR4B 1FYJA 1XI1A 1IBLO 4LWSA 5AG2A 3WB0A 1WA8B 1P84F 5JH7A 5KHHA 5IJ0A 3HKEB 1NVPD 2ZDIA 4WFEA 3IGAC 4JI1O 3K5MA 5ITZB 4FJCC 4DR7O 1D2DA 2IJHA 4ICGA 4LC1A 4JI6O 2ZR3A 5D5QA 5L3EA 3JD4A 2WLHA 1J95A 1PP9H 4K0KB 1I94B 3ASNB 2UXCO 4DYLA 4CC6A 3QG5A 2JGDB 4X66B 4LFBO 1AR4A 1FXHA 4MVUA 2ETNA 1MMMA 1V9PA 4J11A 2F1MA 2LGQA 4PI0A 4MW3A 3OUSA 5DEDA 1TUBA 1QNMA 2M6YA 4K0KO 4X1KB 3E22A 1I7FA 2UUAO 5FPRA 1QHTA 2YEVA 4EKWA 3IJ4A 3T1CA 1AR5A 1I08A 1RPOA 3FD9A 4GKJB 2ZD9A 1VF5B 1BSMA 1YZBA 1NKDA 1K34A 1NZ6A 4I4TA 4JV5B 1YEWA 1Z5VA 5L3FA 1H2MA 1GRJA 2JS3A 4X8AA 3SGIA 1K92A 1IBLB 1SQGA 2XNDG 4YHHO 1OCOB 4DR3O 2QDOA 3SPGA 4B3SO 3ABLC 1TUBB 5CBHA 2ZXWB 3UCSC 4X20A 2YIBA 4XBFA 4LF8O 5J9PC 2ZCEA 5E1AC 5LOVA 2GSMB 1V54B 4C7UA 1SRYA 1ZWIC 2DE0X 2KQXA 4MTFA 3NR7A 4JTDB 4YJ2A 1GTOA 1E79G 1M56B 2IU0A 3UO3A 2YXYA 4F6EA 3E35A 4FM2A 3BVOA 2CUGA 1L0NH 2EX3A 3SYPA 4R50A 4EFBA 3LDEA 4O4JB 1P7GA 4IHJB 2E75B 2ZIMA 4U7NA 3G71V 5HFMA 1AJQA 1N34O 2DYRC 3RYIB 4N21A 1YTFB 3JSNA 5D5PA 5B3SB 3H1IH 3JD2A 4DV2B 1GK9A 1OCOC 5B1NA 5LMUO 1Q6UA 3H9VA 4ZI7B 4FLYA 2YUAA 3OGCC 5A2QN 1Y67A 1SC5B 2DYSB 3ZIAG 2FL4A 4OPHA 4UCVA 2QM8A 2QKSA 3MHSC 4BIZA 3EXAA 4NR1A 2Q0AA 3RN4A 1S5LZ 4A5UB 2FMLA 2X0LA 4CH6A 1R73A 3SJCC 1YF2A 2WLNA 5IE9A 3TXQA 4HZ3A 4JI1B 3K57A 4HNAA 4JI5B 1GAXA 1NT2B 5KUMA 1KECA 1Q6HA 2QWPB 3G4SV 1CPYA 1S5JA 3FB8C 2QTOA 1SA0A 1GN6A 3RYHA 1NI8A 3OTFA 1B06A 1GN3A 1GMGA 1EN6A 4UCOA 4L87A 3H1JH 2OIEA 5LP6C 3T1HO 4OX9B 2EIMB 3E22B 4H44B 5JJJB 3D36C 1HNZO 1M57B 1ZTEA 3L9DA 3DGEA 4LF6B 4J7ZA 1JJ2U 2L6LA 4J80A 3OUFA 4B3TO 3D36A 4DUYB 4DV0O 4MS2A 1N32O 4LF4O 3DXRA 3RYCA 2LGWA 1W0KG 3W7TA 3B8MA 5FL7G 3SJQC 1WPXA 1R3IC 4DXWA 1MA1A 3RYFA 2F23A 1SQXH 3HB3B 1QVGU 3LSQA 2Y69B 2DOSA 3ZJZA 3I55V 2ARHA 3DTUB 5IWAO 3K5NA 1KB9F 2X7RB 1G4YB 2Q68A 2PYLA 1OZ0A 5B1AC 4YIOA 4PJ0Z 2R9IA 3I56V 3TJTA 1KMIZ 3LNNA 3MD0A 4MVMA 1NVPB 4B08A 2HHHO 3K03A 4CH4A 4PI2A 3CRAA 4QJFB 4YHHB 5CBFA 5JQGB 1X4TA 2V7QG 3A8TA 3CC4V 3KKYA 3ABKB 4DRXB 2EZPA 2VWKA 3STZC 2EULA 3E8GA 1MSWD 1R3JC 1YVWA 4YY3B 4IYIA 4NTYA 1XQ8A 4FPPA 2PF4E 5EZYA 3CXHF 2CTRA 5IYBO 3FAVA 1DLBA 3ZRWB 1RSOA 5CA1B 3O9OA 2UXXA 3LNMB 1MOFA 3PN1A 3SPIA 1PL4A 4E4EA 1XNQB 2CTPA 4MVQA 4JF3A 1WB7A 3ZN1A 1R3KC 4ZHQB 2BSKB 1BQ0A 2XAHA 4NTWA 2W0XA 4NTXA 1HDJA 3CRQA 2Z5UA 1N33B 5B5EZ 1Q81W 3E8FA 4QPKA 3ABTA 4X88A 2QWQB 4JI8O 1DK1A 1URFA 3FB6C 3ZMUA 3X2QB 4TUYB 2VQEB 1XEQA 1I5XA 1H2LA 1MNGA 5BXZA 1AI6A 2HJFC 3UT5B 3M7MX 4QE9A 1JMKC 3RW0A 3L73H 2B9ZA 2UUAB 2Q8VA 3RBZA 3N27A 4DR1B 3NXSA 1KUQA 5KHGA 1CP9A 2BSKA 3OW2U 3OGIB 4NKGB 5J2UB 4I50A 5B1BC 1RSOB 3UO2A 5CA1A 4OX9O 3Q4HA 1PM9A 1WB8A 4JAAA 4X1IA 3WB2A 2V4DA 4F6RA 1QU7A 1SERA 1G6UA 1WPBA 3CRMA 1M90W 1KP3A 4UCUA 2XT9A 5B1AB 2E74B 3P3PA 3CCRV 4JTAB 5ITZA 3SPHA 1Q3EA 5IJ0B 1U96A 4JI2O 1KP2A 4TV9A 3BRCA 4FFBA 1K9MW 4FZ1A 4MVRA 1OCRB 1LR1A 2OTJV 2KSDA 1AP6A 4PDMA 1VQPV 3JATB 4X20B 2WPDG 2ZKOA 2OCCC 3F5WC 2QWNB 3CCSV 2CDYA 3AG7A 5IYDO 1RM1B 3C3SA 2OCCB 2UUBO 2IBZH 4ZKIA 4BW9A 1TGOA 1W2BU 4CC5A 1QR8A
chains in the Genus database with same CATH topology
4K0KB 4EB6A 1I94B 5LYJB 5CA0B 1SKVA 4CC6A 4DK0A 1L8DA 3QG5A 1FFXA 4L8JA 1N32B 4WBNA 4ZI7A 4DR3B 5KHJA 4X66B 2ZNJA 4TV8A 2XHBA 2F93B 3U10A 5LA6B 5J2TA 5JCOA 3SJAC 1HNXB 4DV3B 1V9PA 2F1MA 5FNVB 4PI0A 1TUBA 5KHIA 4LF8B 1M93A 3JATA 3E22A 4X1KB 1HNWB 3QTCA 1I7FA 3U0ZA 3JALA 5FPRA 1QHTA 4GKKB 5EIBD 4FLZA 4JI6B 1H2SB 3FFQA 3SJBC 3ZEDA 2YI8A 3CB2A 2IM9A 2QJ1A 4GKJB 4X1YB 2BTQA 4TV9B 4FLUA 4I4TA 4JV5B 1YEWA 1Z5VA 4O2AB 2HEPA 5LOVB 1Z5WA 3N2GA 2F95B 3SGIA 3HKBB 1P49A 1IBLB 4LF7B 1SQGA 3JALB 5CB4B 2PTMA 5GONA 1TUBB 4YJ3A 1TVKB 4UCTA 4X20A 2YIBA 4DV7B 4LR3A 4EFEA 5EYPA 4CH3A 4FLXA 2ZCEA 2HHHB 2PYJA 4B3RB 5LOVA 5LMUB 2UXDB 3RGBA 1XNRB 1N36B 4YJ2A 3RFRA 3RYFB 1J5EB 3U11A 4O2BA 4AHCA 5LXTA 4FM2A 5CA0A 4K8XA 2EX3A 5KX5A 1WN7A 5K1XA 2VQFB 4EFBA 4O4JB 3CSXA 2PUSA 4IHJB 2ZIMA 3JAKA 3DSQA 4I55A 4O4JA 4TV8B 4I9QA 3JAKB 4TQFA 4NVPA 3RYIB 4DUZB 3JSNA 3ETQA 5D5PA 2KKWA 2PGGA 4LF5B 5IJ9B 4DV2B 5JQGA 4O4HB 4ZI7B 4FLYA 1B04A 1TAEA 5LP6A 3K58A 2JS5A 2YIBD 1SA0B 1Q8IA 4UCVA 2GV9A 1XHXA 4HNAB 4BWAA 4O4LA 4YJ3B 5JJNB 4LFAB 3BHPA 2Q0AA 1SQFA 3SR2C 3VQVA 2VWJA 4FVMA 1IBMB 3JARB 5JH7B 4CH6A 3SJCC 4X1YA 1O9HA 3THOA 4I4TB 3K57A 4JI1B 4HNAA 4JI5B 1NT2B 4ZHQA 4AQYB 1Q43A 4IIJA 5KMGA 5BR8B 4GLXA 1N34B 1S5JA 1Q5OA 1SA0A 3HKCA 3RYHA 2F66C 3OTFA 4FLTA 3RYIA 2Q7HA 4UCOA 3JSLA 5LP6C 3K5OA 4OX9B 5JJJB 3E22B 3OTOB 5LA6A 5EZYB 5J2TB 3N2KB 3K59A 1HNZB 4ZIBA 4LF6B 5K1PA 3N2KA 4I55B 4DUYB 3CHXA 1JJOA 4B3TB 4O2BB 5LXTB 3RYCA 4DRXA 4X65B 3BA9A 4HBNA 4DR2B 3HKCB 4EB6B 1FJGB 5JJEB 2JVDA 4JI4B 1T5EA 3RYFA 4FM1A 2UU9B 1JFFA 2R9AA 3VQWA 4X62B 3ZS8C 4TUYA 5BMVA 4U3JB 1ZAUA 5IWAB 3K5NA 4NXMB 4O4LB 3HKEA 3T1HB 3N2GB 2PY5A 2PYLA 2JGUA 4DV6B 2R70A 2ZINA 5BMVB 1KMIZ 3LNNA 3JAWA 3UT5A 4DV0B 4TOIA 1XHZA 4O2AA 2ZM6B 4K8ZA 4B08A 4CS2A 4CH4A 4PI2A 3HKDB 5IYZA 2QM4A 4YHHB 5C8YB 3UQ8A 5JQGB 1X4TA 1M4UA 5KHKA 3BABA 4DRXB 4O4IA 3RYCB 2VWKA 4UCRA 4ZOLA 4EEQA 4YY3B 4Q6GA 4CS4A 2BTOA 3VQXA 1XQ8A 1HR0B 1JFFB 3VQYA 5EZYA 1KU9A 3MAQA 4B3MB 2OYQA 5FPOA 4LF4B 3BAAA 3RWRD 2ZIOA 4B3SB 3RYHB 5CA1B 1RSOA 3PN1A 1XNQB 4LFBB 4LFCB 4UFZA 4JYAB 4ZHQB 2YXLA 4GYCB 5JVDB 5LYJA 5KX5B 5GONB 1N33B 2R72A 2UXCB 5EYPB 4LH7A 5EIBC 1TVKA 3HKBA 4AILC 3JASB 3IAYA 4KHPB 1QQCA 4DV5B 4YJ2B 4TUYB 2VQEB 2CAZC 2Q7GA 2UUCB 2UXBB 4LF9B 1M5IA 5LP6B 4DK1A 1HW7A 2BTQB 4X64B 1TA8A 3UT5B 3M7MX 5IJ9A 4PHZA 2Q7EA 1JMKC 4TQDA 4LH6A 3JASA 4D7TA 2UUAB 5CB4A 2RJZA 5LMNB 4DV1B 4DR1B 5JVDA 2F4VB 4IHJA 4JI2B 5FNVA 5KHGA 1XMOB 4FLWA 1D5AA 1DGSA 4CS3A 4X1IB 5J2UB 1XMQB 4I50A 4KL1A 4O4HA 5CA1A 2YIAA 4LNUB 4F6RA 4X1IA 3WB2A 2V4DA 3WB1A 5J2UA 4NXNB 1G6UA 4F6RB 4WBNB 4LNUA 4DR5B 1WPBA 4I50B 4JI3B 3BA8A 2ZNIA 2E3CA 2P22C 2YI9A 4FM0A 4UCUA 2OWOA 4JI0B 4CH5A 4O4IB 3JARA 4D7SA 3K5LA 1WNSA 5JCOC 4ZOLB 5ITZA 4DR7B 4JI7B 1Q3EA 1FFXB 4FLVA 5IJ0B 3B2EE 2RQ6A 4UCSA 1O9GA 4TV9A 4JI8B 3A2FA 3ICXA 3BRCA 4FFBA 4DR6B 3HKDA 5IYZB 3T1YB 4IIJB 5KMGB 1IBKB 5C8YA 2P5OA 3JAWB 4FFBB 1VF7A 4DR4B 1XI1A 3JATB 4X1KA 4X20B 3WB0A 3BPZA 3QF7A 5JH7A 5KHHA 5IJ0A 3HKEB 3K5MA 5ITZB 4DV4B 2UUBB 2E5LB 4U3JA 4BW9A 5D5QA 1TGOA 2PZSA 4CC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CSX A;  3QG5 A;  3B2E E;  3QF7 A;  2JS5 A;  1NT2 B;  3SJC C;  2CAZ C;  3SJB C;  3ICX A;  2P22 C;  3SJA C;  3ZS8 C;  1X4T A;  1SKV A;  3THO A;  2F66 C; 
#chains in the Genus database with same CATH topology
 1HNW O;  3SPJ A;  4EB6 A;  5LYJ B;  3ZHR A;  2B1G A;  5CA0 B;  1FFX A;  4L8J A;  4YY3 O;  1VIB A;  4DR3 B;  3APO A;  5KHJ A;  3AEI A;  2LFR A;  2MW2 B;  3U10 A;  2DWE C;  5JCO A;  2EIJ B;  5KA6 A;  2WLM A;  3R65 A;  5L3G A;  3P32 A;  1SES A;  1MAB G;  3OD4 A;  4CBC A;  1GH6 A;  2ZE6 A;  2JGD A;  4MVS A;  3U0Z A;  4GKK B;  2OT5 A;  4D6T H;  3ABK C;  1S72 V;  5EIB D;  4NXM O;  3T2M A;  1H2S B;  4J42 A;  3FFQ A;  3SJB C;  2W0F C;  3ZED A;  2LQT A;  3CWB H;  2Q69 A;  4UV9 A;  3CD6 V;  2BTQ A;  3F5T A;  4FLU A;  4O2A B;  2HEP A;  1WP7 A;  1AI5 A;  2F95 B;  1P49 A;  3CEI A;  3JAL B;  5CB4 B;  4WCE V;  4G28 B;  2WSS G;  3OM3 B;  3ASN C;  5GON A;  4DV5 O;  2A06 H;  5EK0 A;  3GVM A;  1TVK B;  4UCT A;  4DV7 B;  4LR3 A;  4GKK O;  4FLX A;  4PA9 A;  4PA6 A;  3RGB A;  1N36 B;  1K4D C;  2HLD G;  2XAG A;  1FXK C;  3BFR A;  4YXW G;  1WLE A;  2ATK C;  1D5N A;  3OTO O;  5B1O A;  3AG2 B;  3ZBH A;  4P9P A;  3K0G A;  2EIK B;  3ZRV A;  1WN7 A;  5K1X A;  1IBK O;  1OJH A;  3C3T A;  1QLN A;  5IT9 N;  3JAK A;  4B7E A;  4I55 A;  3L71 H;  4O4J A;  2WLJ A;  2Q6A A;  4TV8 B;  1AJP A;  1SET A;  4PDL A;  3BEH A;  4AQY O;  2Q67 A;  3AG3 C;  4TT3 G;  3ZRX A;  2KKW A;  1GM7 A;  4JYC A;  2RDC A;  3H1H H;  5DM6 V;  2WAM A;  3ZMV A;  4J41 A;  2O57 A;  3TCU A;  3ZHQ A;  2F4V O;  4X62 O;  2W6I G;  3OR6 C;  1Y76 B;  4MTX A;  1NU1 H;  1Q8I A;  3G67 A;  2GV9 A;  3H1K H;  1XHX A;  3AK3 A;  4LFA B;  3BHP A;  2JJ2 G;  3SR2 C;  3VQV A;  3ETG A;  2DMX A;  1IBM B;  3LDC A;  4X1Y A;  1DTO A;  1EBO A;  1Y76 A;  2UXB O;  1K7D A;  3THO A;  4I4T B;  5IY5 C;  2PI5 A;  4W4L A;  4XDK A;  4JI4 O;  3ML0 A;  4B3R O;  4ZHQ A;  5KMG A;  5BR8 B;  3CCJ V;  4ASU G;  3FAV B;  2F66 C;  4I7Z B;  4FLT A;  4R7C A;  1ARO P;  5EBW C;  3OTO B;  5J2T B;  4MSW C;  2Y69 C;  5EZY B;  1HNZ B;  3QO8 A;  3P3N A;  4P9O A;  4ZIB A;  1XMO O;  1L0L H;  3AG1 C;  4BW5 A;  3N2K A;  1MSD A;  4I55 B;  4B3T B;  2MK3 A;  4DV3 O;  3AG4 C;  1AB3 A;  4UXN A;  2G38 A;  4DRX A;  3BA9 A;  3HKC B;  1QCE A;  1NH2 B;  3O65 A;  1KYO F;  3CRC A;  4PA7 A;  4B7K A;  3I5D A;  4WFG A;  5IDJ A;  2X6B A;  2UU9 B;  4J7J A;  1NTZ H;  4X62 B;  3E86 A;  3ZS8 C;  5KAF Z;  4RUF A;  2P67 A;  1ZAU A;  1B3Q A;  1VMG A;  3IC9 A;  3ABM C;  3H01 A;  1BZK A;  2Q73 A;  4J10 A;  2NR5 A;  3HKE A;  2PY5 A;  3IFX A;  3P30 A;  2RCV A;  1Q6I A;  2R9R B;  5KA5 A;  1H8H G;  3UT5 A;  4TOI A;  2KG7 B;  1XHZ A;  4O2A A;  4K8Z A;  5LMN O;  1VEW A;  1K8A W;  3CJH A;  4OGQ B;  2HVJ C;  1PL0 A;  2YID A;  3ETE A;  4MT8 A;  1M4U A;  3GB7 C;  4LF5 O;  4O4I A;  3RYC B;  1BE3 H;  4ZOL A;  4CS4 A;  1IBM O;  1DF4 A;  1KU9 A;  3MAQ A;  2JJ1 G;  5L3D A;  1K5S A;  2YIC A;  3CCV V;  2ZIO A;  2QKA A;  3RYH B;  3K04 A;  1N0J A;  1N4C A;  4LFC B;  4LFB B;  2A7W A;  2GBO A;  1ZSP A;  4GYC B;  5LYJ A;  4BIO A;  2CGN A;  2FKX A;  2Q5Z A;  4DR6 O;  4I0X A;  1I0H A;  3OAA G;  2R72 A;  5EYP B;  3T4Z A;  4DV1 O;  1R3L C;  3HKB A;  1SQV H;  2Z0A A;  3JAS B;  3L72 H;  5LBQ A;  4KXR A;  1QQC A;  3W7S A;  1HR0 O;  3KCX A;  1SQQ H;  3STL C;  2Q7G A;  2UUC B;  2UXB B;  3MDS A;  4X64 O;  4P30 A;  1M9N A;  3ZHV A;  2WLL B;  4PHZ A;  1Y6X A;  3G6E V;  1EFR G;  2Q9L A;  4TQD A;  4LH6 A;  5KAI Z;  4D7T A;  1K4C C;  4BR6 A;  4UB8 Z;  5CB4 A;  2RJZ A;  1W0J G;  2CH7 B;  4DV1 B;  4Z2W A;  5JVD A;  3TK1 A;  1VQ6 V;  1H8E G;  5EC2 C;  1HP8 A;  3CE2 A;  3FB7 C;  4FLW A;  1SS3 A;  1D5A A;  3M8A A;  2CE4 A;  4X1I B;  3OMA B;  4KL1 A;  4O4H A;  1VQK V;  3CC7 V;  2JEU A;  3WFV A;  4Z1M G;  3A0H Z;  2YIA A;  3HPL C;  5J2U A;  1VQO V;  2ODM A;  1VQ8 V;  4DV6 O;  4F6R B;  2A0L A;  4WBN B;  4DR5 B;  2P4V A;  1Q7Y W;  4H37 A;  2ILM A;  4JGS A;  4I50 B;  4LF9 O;  1AJN A;  2ZE8 A;  3JAR A;  4HYO A;  4NYK A;  3L70 H;  2H94 A;  2DYR B;  4DR7 B;  4MTO A;  1FFX B;  1XMQ O;  4FLV A;  4UCS A;  3B2E E;  2RQ6 A;  1XRE A;  1WP8 A;  2WLI B;  4JAS A;  3HKD A;  5IYZ B;  1ZUQ A;  5KMG B;  3S3X A;  5C8Y A;  1BGY H;  2HFE C;  3JAW B;  2WLI A;  5KLV H;  1V55 B;  2RN9 A;  3OMN B;  3ASO B;  1KKD A;  2UXN A;  3FYE B;  1BQZ A;  2AHZ A;  2CTQ A;  4RQE A;  1IXB A;  4DV4 O;  4JZG A;  2UUB B;  4JI7 O;  3KCY A;  1M57 C;  1QR9 A;  2XAF A;  3CCL V;  3CP1 A;  1YI2 V;  1BCC H;  2Y4U A;  4JAU A;  1NQT A;  4ZBM A;  3PJS K;  1SKV A;  3WU2 Z;  1BHA A;  4DK0 A;  1L8D A;  2CTW A;  3IC7 A;  4ZI7 A;  1EN5 A;  1UJW B;  1XUQ A;  1ROP A;  2ZNJ A;  4TV8 A;  2F93 B;  5LA6 B;  3SJA C;  1HNX B;  4JI3 O;  1A32 A;  5FNV B;  2CH7 A;  3ZX6 A;  4LF8 B;  3QVN A;  1M93 A;  3JAT A;  3OEH G;  2GTS A;  1BL8 A;  1OHH G;  2Y0P A;  2WLK A;  4JI6 B;  3K9S A;  1B6Q A;  2FYU H;  2N05 A;  2JIZ G;  3CXC U;  3CB2 A;  1FKA O;  2QJ1 A;  4G2K A;  4TV9 B;  1ZX3 A;  2DYS C;  5LOV B;  1Z5W A;  2UUC O;  3CMA V;  3HKB B;  3FYI B;  1AVM A;  1IZ3 A;  2PTM A;  1COW G;  2RNB A;  5EC1 C;  2YC0 A;  3RVZ A;  4EFE A;  3OR7 C;  4CH3 A;  2HHH B;  1AI7 A;  4B3R B;  5LMU B;  2UXD B;  1K73 W;  1ENV A;  3X2Q C;  5BR8 O;  1XNR B;  4BAY A;  1OCZ C;  2DWD C;  4QGP A;  1N36 O;  3K3W A;  2QM7 A;  3RFR A;  1XL6 A;  2IJI A;  3D8C A;  1YCI A;  3H1L H;  2GUZ A;  4B3M O;  3RYF B;  3U11 A;  5H9C A;  2HP8 A;  4OXS A;  1MZF A;  4HAM A;  4GX5 A;  5LGU A;  4KHP O;  2JDI G;  3CSX A;  1IUR A;  2PUS A;  2QA4 V;  4E2L A;  3DSQ A;  3JCU Z;  3BCC H;  1VF6 C;  2ZXW C;  1N8R W;  1V54 C;  1XIL A;  3S3W A;  3SPC A;  4NVP A;  2WWW A;  3M99 B;  3F7V C;  3ETQ A;  2PGG A;  1QLE C;  1YSC A;  4AI8 A;  1AI4 A;  3WG7 C;  3ZMT A;  4LF5 B;  5IJ9 B;  2ZM6 O;  1IX9 A;  2E76 B;  1VQL V;  4J7K A;  4XDL A;  1SA0 B;  1JA8 A;  4MTG A;  4HNA B;  2BCC H;  4O4L A;  3B40 A;  2YEV B;  4YJ3 B;  5LHG A;  4FZ0 A;  4RAI A;  1SQF A;  3RVY A;  4FVM A;  3ZMZ A;  3JAR B;  5JH7 B;  1QVF U;  1O9H A;  2X6C A;  4JYB A;  1VQN V;  1NH2 D;  2IH1 C;  1PNL A;  1ZLZ A;  4LWS B;  1GO3 F;  1Q5O A;  1JOY A;  3WG7 B;  4QE7 A;  2P7T C;  3RYI A;  1Q86 W;  4P2Z A;  3JSL A;  3L74 H;  4FK5 C;  5LA6 A;  3N2K B;  1KKC A;  2HKO A;  4X66 O;  4X9Q A;  1XDC A;  1THZ A;  4I5S A;  2XUM A;  1UFI A;  1JJO A;  2EIL B;  3UM7 A;  5LGN A;  4IGG A;  4DUZ O;  3E8B A;  4GUN A;  4JI0 O;  2ZE5 A;  1R1B A;  3ZHS A;  1E1Q G;  1F7Y A;  4I9W A;  4DR2 B;  1FJG B;  2AGA A;  2JVD A;  2NN4 A;  4JI5 O;  5H6Q A;  3AG1 B;  1PNM A;  1OCR C;  1GKF A;  1JFF A;  1L1F A;  3VQW A;  2A3Q A;  1NBM G;  1XBL A;  3CRR A;  5BMV A;  1FXK A;  4U3J B;  5LL6 Y;  3VOU A;  2VQE O;  2OIG A;  4NXM B;  4O4L B;  3T1H B;  4XDJ A;  1H2G A;  4PDR A;  3BY6 A;  3E83 A;  4DV6 B;  2R70 A;  4K35 A;  5JWP A;  3GWK C;  3QO7 A;  3EFF K;  4UV8 A;  4DV0 B;  1Z2G A;  2ZM6 B;  1OCC B;  5L3C A;  4DR1 O;  2QM4 A;  4JZ2 A;  5C8Y B;  4NB5 A;  3UQ8 A;  5BZB A;  1H2K A;  3JAM N;  2D3O W;  2ITC C;  4GT1 A;  1XNQ O;  2ZDI C;  4MVO A;  3SDL A;  2AW9 A;  5KHK A;  4QPJ A;  2YDE A;  5DN6 G;  1DF5 A;  4EEQ A;  5B1B B;  2KB1 A;  5GW7 A;  2AHY A;  3AK1 A;  3LDD A;  5HFL A;  1JFF B;  4LP8 A;  2OYQ A;  5FPO A;  3BAA A;  1Y66 A;  3ZRW A;  1I5Y A;  1GM8 A;  2FTK A;  3RWR D;  1XL4 A;  2XAQ A;  1S76 D;  2WA4 A;  3C90 A;  4KFM A;  1KQS U;  4B3S B;  3RT3 C;  2GUZ B;  4R8C A;  2YS8 A;  5JVD B;  1JPX A;  2ZQM A;  4MVZ A;  3OEE G;  3OT7 A;  2FB5 A;  2QGN A;  1EN4 A;  3CPW U;  1R6K A;  2UXC B;  3W7U A;  4H13 B;  2D2C B;  2WLL A;  3MHH C;  4LH7 A;  5EIB C;  3AK2 A;  2GDS A;  4GX0 A;  2QE7 G;  1SQB H;  4UVC A;  4RQF A;  4FIP C;  3K9A A;  1LNQ A;  2ADQ B;  4YJ2 B;  1YTF D;  3AG4 B;  2IJJ A;  1LUV A;  4LF9 B;  5LP6 B;  4DK1 A;  4X64 B;  3G6B A;  1TA8 A;  2LFS A;  4KP4 A;  2AZ2 A;  4J9Y B;  2Q7E A;  1ZL8 B;  2HG5 C;  4GX2 A;  1VP7 A;  4IT5 A;  1K5Q A;  3JAS A;  5B66 Z;  5H2F Z;  2F4V B;  4IHJ A;  2XAS A;  1U97 A;  4K3A A;  1WAZ A;  4JI2 B;  5FNV A;  1MZE A;  4Z1V A;  3CME V;  4LF6 O;  1DGS A;  4CS3 A;  1LUW A;  3LSU A;  1N0N A;  1YJW V;  3ZRS A;  4LNU B;  1KBH A;  2P06 A;  1YXB A;  3ZMS A;  4H33 A;  3CCU V;  1G8M A;  3JYC A;  1F4M A;  1PD3 A;  3UKM A;  3QO5 A;  3LSS A;  2K9P A;  4JI3 B;  3BA8 A;  2P22 C;  4FM0 A;  2EIJ C;  4CH5 A;  4O4I B;  3D3I A;  3CC2 V;  1CEZ A;  4D7S A;  4UUJ C;  2GTA A;  3K5L A;  1MG1 A;  1WNS A;  5JCO C;  4ZOL B;  2K1E A;  2UU9 O;  4PA3 A;  2B1I A;  5H5N A;  3QNE A;  1O9G A;  3A2F A;  3ICX A;  4JTC B;  2IJK A;  2DN9 A;  3AG3 B;  3ABM B;  3TET A;  2DQ0 A;  4PA4 A;  4FFB B;  4DR4 O;  1GN2 A;  3W7W A;  1VF7 A;  4RWU A;  4DUY O;  2RMK B;  4WFF A;  4X1K A;  3BPZ A;  1EM1 A;  3ZHU A;  3QF7 A;  1H38 A;  4R6Z A;  1VQ4 V;  5BY1 A;  1Y74 A;  3ZCC A;  2P4K A;  4DV2 O;  1YIJ V;  4DV4 B;  2E5L B;  1FXK B;  4U3J A;  3L75 H;  2UXD O;  3ASO C;  1GN4 A;  5LGT A;  2PZS A;  2DW4 A;  2QKC A;  1I94 O;  2EJ7 A;  2XAJ A;  1VQ5 V;  4DW1 A;  3JD3 A;  1N32 B;  4WBN A;  1IVS A;  3KZI Z;  1K3E A;  4NXN O;  3G80 A;  3K08 A;  3SYO A;  4PD4 F;  2XHB A;  2IU3 A;  1SZX A;  2N04 A;  5J2T A;  4GX1 A;  2W6J G;  4WF9 V;  4DV3 B;  3ABU A;  1WA8 A;  3TGU H;  5KHI A;  4N23 A;  2H8P C;  2LO1 A;  3VBB A;  1HNW B;  3QTC A;  2CGO A;  3JAL A;  1PPJ H;  4FLZ A;  1NTK H;  1FAF A;  2IW5 A;  4F4L A;  2YI8 A;  2IM9 A;  4X1Y B;  4RO2 A;  4TSF G;  1SF9 A;  2YSU B;  3N2G A;  1SZT A;  4WFA V;  4LF7 B;  1VF6 A;  1M1K W;  2V1D A;  4WFB V;  3APQ A;  4PV1 B;  5IYC O;  4DR5 O;  3DC6 A;  4YJ3 A;  1E1R G;  4LBE C;  1BS3 A;  5EYP A;  4DW0 A;  2HR3 A;  4FMT A;  2EZO A;  4KUM A;  5H6R A;  2B5U A;  2PYJ A;  3B8N A;  2LW7 A;  1RPR A;  4I0X B;  2EIK C;  1F4N A;  2E5L O;  2Z3Y A;  1XOU A;  4JYY A;  5LHI A;  3R66 A;  3SYA A;  3JCZ A;  3OE7 G;  1M56 C;  2NNU A;  1J5E B;  4O2B A;  1S5H C;  4AHC A;  5LXT A;  1KC8 W;  2WA3 A;  4G27 B;  1F23 A;  1V55 C;  5CA0 A;  3EHB B;  4K8X A;  1R6N A;  5KX5 A;  2VQF B;  3T1Y O;  5A9G A;  1QBZ A;  2EIL C;  5C93 A;  2EJR A;  2QWR B;  3HR0 A;  4LCU C;  4I9Q A;  1FFT B;  3JAK B;  2GHY A;  4TQF A;  4JYA O;  1S3J A;  4JAV A;  4DUZ B;  1VQ9 V;  2Q0O C;  2QSA A;  1JX9 A;  1VQM V;  4BIU A;  5JQG A;  1K97 A;  2L35 A;  4O4H B;  1B04 A;  1TAE A;  5LP6 A;  3K79 A;  4ABM A;  3D3Q A;  3OMI B;  3FB5 C;  4U7O A;  4DO2 A;  3K58 A;  2JS5 A;  2YIB D;  4H0L B;  1X59 A;  2YXH A;  2QR4 A;  5CMU A;  2KG7 A;  4BWA A;  5JJN B;  1JR9 A;  4LF7 O;  2QTS A;  1JCH A;  2VWJ A;  4DR2 O;  2EIN C;  1OCC C;  2Y48 A;  1SQP H;  1ORQ C;  3CYO A;  4AQY B;  1Q43 A;  4IIJ A;  1RFY A;  4GLX A;  1N34 B;  3KG2 A;  2BOB C;  3HKC A;  1YIT V;  4QIW F;  1N33 O;  1RP3 B;  4MW8 A;  1FPO A;  5KUK A;  2Q7H A;  2ADP A;  2HVK C;  1P4R A;  1UPG A;  1J5E O;  3DXR B;  3K5O A;  1QLE B;  3SYQ A;  3CCQ V;  2Q4P A;  3K59 A;  3F7Y C;  3K06 A;  5K1P A;  2HJD A;  1P7B A;  1PNK A;  3CHX A;  4JPR A;  4O2B B;  5LXT B;  1BHB A;  3W7X A;  3CCM V;  4X65 B;  4HBN A;  5TIS Z;  4EB6 B;  2OCH A;  3ZN0 A;  1OCZ B;  5JJE B;  4JI4 B;  1T5E A;  1YDX A;  4FM1 A;  3FX7 A;  1FD9 A;  1FXV A;  4GZR B;  2XOK G;  2R9A A;  1Q90 D;  2DQ3 A;  4UVA A;  2EIM C;  1H2N A;  4TUY A;  4WFH A;  5IWA B;  1IDS A;  2QEX V;  5E79 Z;  4RUE A;  2N74 A;  3N2G B;  5GTH Z;  1W59 A;  4X89 A;  1YJN V;  3ABL B;  3LUT B;  2JGU A;  4X65 O;  4IYH A;  3CX5 F;  1TUE B;  1Y4M A;  2ZIN A;  5BMV B;  4TWK A;  1JVM A;  3CJH B;  4DV7 O;  2JK5 C;  2JEX A;  3JAW A;  2X6A A;  1AR1 B;  2H3O A;  1HNX O;  4CS2 A;  4QNH B;  3HKD B;  5IYZ A;  3JD1 A;  5CA3 A;  4J9Z B;  5IY5 B;  2EIN B;  2ITD C;  3BAB A;  1EZJ A;  1CXZ B;  2Y0I A;  1NS1 A;  3E2E A;  3A0B Z;  1NR7 A;  3E8H A;  5EBM C;  1VQ7 V;  4UCR A;  1NTM H;  1JQ0 A;  4Q20 A;  3GWO A;  4OPA A;  4PDV A;  4Q6G A;  5DEC A;  3CCE V;  2BTO A;  3VQX A;  1HR0 B;  3VQY A;  4B3M B;  1S0V A;  3A0R A;  4GCZ A;  4LF4 B;  2AZ0 A;  1YHQ V;  1EZV H;  5EBL C;  1F51 A;  2VQF O;  1YJ9 V;  1NR1 A;  1ZL8 A;  3J80 N;  3Q4H B;  4UFZ A;  1G1X B;  5FLX N;  2P6J A;  4JYA B;  2YXL A;  4IL6 Z;  5CBG A;  1Y74 B;  5CN0 A;  1RM1 C;  2IH3 C;  3B09 A;  5GON B;  4PEL A;  5KX5 B;  3TXS A;  1NJI W;  1PV0 A;  2ZT9 B;  4JV5 O;  1TVK A;  3K0D A;  4AIL C;  4UVB A;  3IAY A;  2PI4 A;  4KHP B;  4DV5 B;  2BE3 A;  2A79 B;  3JD0 A;  3FKS G;  2CAZ C;  3T4D A;  2DJV A;  2VS0 A;  1M5I A;  1US6 A;  1HW7 A;  2BTQ B;  4FFK A;  1GM9 A;  4CZZ A;  3B77 A;  5IJ9 A;  4YIP A;  2EBO A;  5L3B A;  4U3F H;  2JRI A;  3EVK A;  1FJG O;  1BT8 A;  1K33 A;  2VRZ A;  3ZHT A;  1AIL A;  3B4S A;  2NLJ C;  2ZE7 A;  5LMN B;  1IXM A;  2CK3 G;  5LHH A;  3E89 A;  1XNR O;  3J7A U;  2F43 G;  1XMO B;  3CS5 A;  2OTL V;  1OV9 A;  1AP5 A;  1XMQ B;  1VAR A;  2QWO B;  3ETD A;  3OFN G;  2AXT Z;  3WB1 A;  4NXN B;  2LJ2 A;  4GKJ O;  2M7W A;  1PKX A;  1Q82 W;  4LNU A;  1KD1 W;  1BMF G;  2ZNI A;  2E3C A;  1FS0 G;  2YI9 A;  3J81 N;  2OWO A;  1WJZ A;  2A9H A;  2Y4T A;  4JI0 B;  4UB6 Z;  1S77 D;  5B3S C;  4LFC O;  4W4K A;  1HWY A;  2LP7 A;  4JI7 B;  3SYC A;  2C2A A;  2LW1 A;  2BOC C;  2P90 A;  4LFA O;  4JI8 B;  5F2V O;  1R6T A;  4DR6 B;  2ZR2 A;  3T1Y B;  4IIJ B;  1IBK B;  2P5O A;  3AG2 C;  3DC5 A;  2XTA A;  5GTI Z;  4DR4 B;  1FYJ A;  1XI1 A;  1IBL O;  4LWS A;  5AG2 A;  3WB0 A;  1WA8 B;  1P84 F;  5JH7 A;  5KHH A;  5IJ0 A;  3HKE B;  1NVP D;  2ZDI A;  4WFE A;  3IGA C;  4JI1 O;  3K5M A;  5ITZ B;  4FJC C;  4DR7 O;  1D2D A;  2IJH A;  4ICG A;  4LC1 A;  4JI6 O;  2ZR3 A;  5D5Q A;  5L3E A;  3JD4 A;  2WLH A;  1J95 A;  1PP9 H;  4K0K B;  1I94 B;  3ASN B;  2UXC O;  4DYL A;  4CC6 A;  3QG5 A;  2JGD B;  4X66 B;  4LFB O;  1AR4 A;  1FXH A;  4MVU A;  2ETN A;  1MMM A;  1V9P A;  4J11 A;  2F1M A;  2LGQ A;  4PI0 A;  4MW3 A;  3OUS A;  5DED A;  1TUB A;  1QNM A;  2M6Y A;  4K0K O;  4X1K B;  3E22 A;  1I7F A;  2UUA O;  5FPR A;  1QHT A;  2YEV A;  4EKW A;  3IJ4 A;  3T1C A;  1AR5 A;  1I08 A;  1RPO A;  3FD9 A;  4GKJ B;  2ZD9 A;  1VF5 B;  1BSM A;  1YZB A;  1NKD A;  1K34 A;  1NZ6 A;  4I4T A;  4JV5 B;  1YEW A;  1Z5V A;  5L3F A;  1H2M A;  1GRJ A;  2JS3 A;  4X8A A;  3SGI A;  1K92 A;  1IBL B;  1SQG A;  2XND G;  4YHH O;  1OCO B;  4DR3 O;  2QDO A;  3SPG A;  4B3S O;  3ABL C;  1TUB B;  5CBH A;  2ZXW B;  3UCS C;  4X20 A;  2YIB A;  4XBF A;  4LF8 O;  5J9P C;  2ZCE A;  5E1A C;  5LOV A;  2GSM B;  1V54 B;  4C7U A;  1SRY A;  1ZWI C;  2DE0 X;  2KQX A;  4MTF A;  3NR7 A;  4JTD B;  4YJ2 A;  1GTO A;  1E79 G;  1M56 B;  2IU0 A;  3UO3 A;  2YXY A;  4F6E A;  3E35 A;  4FM2 A;  3BVO A;  2CUG A;  1L0N H;  2EX3 A;  3SYP A;  4R50 A;  4EFB A;  3LDE A;  4O4J B;  1P7G A;  4IHJ B;  2E75 B;  2ZIM A;  4U7N A;  3G71 V;  5HFM A;  1AJQ A;  1N34 O;  2DYR C;  3RYI B;  4N21 A;  1YTF B;  3JSN A;  5D5P A;  5B3S B;  3H1I H;  3JD2 A;  4DV2 B;  1GK9 A;  1OCO C;  5B1N A;  5LMU O;  1Q6U A;  3H9V A;  4ZI7 B;  4FLY A;  2YUA A;  3OGC C;  5A2Q N;  1Y67 A;  1SC5 B;  2DYS B;  3ZIA G;  2FL4 A;  4OPH A;  4UCV A;  2QM8 A;  2QKS A;  3MHS C;  4BIZ A;  3EXA A;  4NR1 A;  2Q0A A;  3RN4 A;  1S5L Z;  4A5U B;  2FML A;  2X0L A;  4CH6 A;  1R73 A;  3SJC C;  1YF2 A;  2WLN A;  5IE9 A;  3TXQ A;  4HZ3 A;  4JI1 B;  3K57 A;  4HNA A;  4JI5 B;  1GAX A;  1NT2 B;  5KUM A;  1KEC A;  1Q6H A;  2QWP B;  3G4S V;  1CPY A;  1S5J A;  3FB8 C;  2QTO A;  1SA0 A;  1GN6 A;  3RYH A;  1NI8 A;  3OTF A;  1B06 A;  1GN3 A;  1GMG A;  1EN6 A;  4UCO A;  4L87 A;  3H1J H;  2OIE A;  5LP6 C;  3T1H O;  4OX9 B;  2EIM B;  3E22 B;  4H44 B;  5JJJ B;  3D36 C;  1HNZ O;  1M57 B;  1ZTE A;  3L9D A;  3DGE A;  4LF6 B;  4J7Z A;  1JJ2 U;  2L6L A;  4J80 A;  3OUF A;  4B3T O;  3D36 A;  4DUY B;  4DV0 O;  4MS2 A;  1N32 O;  4LF4 O;  3DXR A;  3RYC A;  2LGW A;  1W0K G;  3W7T A;  3B8M A;  5FL7 G;  3SJQ C;  1WPX A;  1R3I C;  4DXW A;  1MA1 A;  3RYF A;  2F23 A;  1SQX H;  3HB3 B;  1QVG U;  3LSQ A;  2Y69 B;  2DOS A;  3ZJZ A;  3I55 V;  2ARH A;  3DTU B;  5IWA O;  3K5N A;  1KB9 F;  2X7R B;  1G4Y B;  2Q68 A;  2PYL A;  1OZ0 A;  5B1A C;  4YIO A;  4PJ0 Z;  2R9I A;  3I56 V;  3TJT A;  1KMI Z;  3LNN A;  3MD0 A;  4MVM A;  1NVP B;  4B08 A;  2HHH O;  3K03 A;  4CH4 A;  4PI2 A;  3CRA A;  4QJF B;  4YHH B;  5CBF A;  5JQG B;  1X4T A;  2V7Q G;  3A8T A;  3CC4 V;  3KKY A;  3ABK B;  4DRX B;  2EZP A;  2VWK A;  3STZ C;  2EUL A;  3E8G A;  1MSW D;  1R3J C;  1YVW A;  4YY3 B;  4IYI A;  4NTY A;  1XQ8 A;  4FPP A;  2PF4 E;  5EZY A;  3CXH F;  2CTR A;  5IYB O;  3FAV A;  1DLB A;  3ZRW B;  1RSO A;  5CA1 B;  3O9O A;  2UXX A;  3LNM B;  1MOF A;  3PN1 A;  3SPI A;  1PL4 A;  4E4E A;  1XNQ B;  2CTP A;  4MVQ A;  4JF3 A;  1WB7 A;  3ZN1 A;  1R3K C;  4ZHQ B;  2BSK B;  1BQ0 A;  2XAH A;  4NTW A;  2W0X A;  4NTX A;  1HDJ A;  3CRQ A;  2Z5U A;  1N33 B;  5B5E Z;  1Q81 W;  3E8F A;  4QPK A;  3ABT A;  4X88 A;  2QWQ B;  4JI8 O;  1DK1 A;  1URF A;  3FB6 C;  3ZMU A;  3X2Q B;  4TUY B;  2VQE B;  1XEQ A;  1I5X A;  1H2L A;  1MNG A;  5BXZ A;  1AI6 A;  2HJF C;  3UT5 B;  3M7M X;  4QE9 A;  1JMK C;  3RW0 A;  3L73 H;  2B9Z A;  2UUA B;  2Q8V A;  3RBZ A;  3N27 A;  4DR1 B;  3NXS A;  1KUQ A;  5KHG A;  1CP9 A;  2BSK A;  3OW2 U;  3OGI B;  4NKG B;  5J2U B;  4I50 A;  5B1B C;  1RSO B;  3UO2 A;  5CA1 A;  4OX9 O;  3Q4H A;  1PM9 A;  1WB8 A;  4JAA A;  4X1I A;  3WB2 A;  2V4D A;  4F6R A;  1QU7 A;  1SER A;  1G6U A;  1WPB A;  3CRM A;  1M90 W;  1KP3 A;  4UCU A;  2XT9 A;  5B1A B;  2E74 B;  3P3P A;  3CCR V;  4JTA B;  5ITZ A;  3SPH A;  1Q3E A;  5IJ0 B;  1U96 A;  4JI2 O;  1KP2 A;  4TV9 A;  3BRC A;  4FFB A;  1K9M W;  4FZ1 A;  4MVR A;  1OCR B;  1LR1 A;  2OTJ V;  2KSD A;  1AP6 A;  4PDM A;  1VQP V;  3JAT B;  4X20 B;  2WPD G;  2ZKO A;  2OCC C;  3F5W C;  2QWN B;  3CCS V;  2CDY A;  3AG7 A;  5IYD O;  1RM1 B;  3C3S A;  2OCC B;  2UUB O;  2IBZ H;  4ZKI A;  4BW9 A;  1TGO A;  1W2B U;  4CC5 A;  1QR8 A; 
#chains in the Genus database with same CATH homology
 4K0K B;  4EB6 A;  1I94 B;  5LYJ B;  5CA0 B;  1SKV A;  4CC6 A;  4DK0 A;  1L8D A;  3QG5 A;  1FFX A;  4L8J A;  1N32 B;  4WBN A;  4ZI7 A;  4DR3 B;  5KHJ A;  4X66 B;  2ZNJ A;  4TV8 A;  2XHB A;  2F93 B;  3U10 A;  5LA6 B;  5J2T A;  5JCO A;  3SJA C;  1HNX B;  4DV3 B;  1V9P A;  2F1M A;  5FNV B;  4PI0 A;  1TUB A;  5KHI A;  4LF8 B;  1M93 A;  3JAT A;  3E22 A;  4X1K B;  1HNW B;  3QTC A;  1I7F A;  3U0Z A;  3JAL A;  5FPR A;  1QHT A;  4GKK B;  5EIB D;  4FLZ A;  4JI6 B;  1H2S B;  3FFQ A;  3SJB C;  3ZED A;  2YI8 A;  3CB2 A;  2IM9 A;  2QJ1 A;  4GKJ B;  4X1Y B;  2BTQ A;  4TV9 B;  4FLU A;  4I4T A;  4JV5 B;  1YEW A;  1Z5V A;  4O2A B;  2HEP A;  5LOV B;  1Z5W A;  3N2G A;  2F95 B;  3SGI A;  3HKB B;  1P49 A;  1IBL B;  4LF7 B;  1SQG A;  3JAL B;  5CB4 B;  2PTM A;  5GON A;  1TUB B;  4YJ3 A;  1TVK B;  4UCT A;  4X20 A;  2YIB A;  4DV7 B;  4LR3 A;  4EFE A;  5EYP A;  4CH3 A;  4FLX A;  2ZCE A;  2HHH B;  2PYJ A;  4B3R B;  5LOV A;  5LMU B;  2UXD B;  3RGB A;  1XNR B;  1N36 B;  4YJ2 A;  3RFR A;  3RYF B;  1J5E B;  3U11 A;  4O2B A;  4AHC A;  5LXT A;  4FM2 A;  5CA0 A;  4K8X A;  2EX3 A;  5KX5 A;  1WN7 A;  5K1X A;  2VQF B;  4EFB A;  4O4J B;  3CSX A;  2PUS A;  4IHJ B;  2ZIM A;  3JAK A;  3DSQ A;  4I55 A;  4O4J A;  4TV8 B;  4I9Q A;  3JAK B;  4TQF A;  4NVP A;  3RYI B;  4DUZ B;  3JSN A;  3ETQ A;  5D5P A;  2KKW A;  2PGG A;  4LF5 B;  5IJ9 B;  4DV2 B;  5JQG A;  4O4H B;  4ZI7 B;  4FLY A;  1B04 A;  1TAE A;  5LP6 A;  3K58 A;  2JS5 A;  2YIB D;  1SA0 B;  1Q8I A;  4UCV A;  2GV9 A;  1XHX A;  4HNA B;  4BWA A;  4O4L A;  4YJ3 B;  5JJN B;  4LFA B;  3BHP A;  2Q0A A;  1SQF A;  3SR2 C;  3VQV A;  2VWJ A;  4FVM A;  1IBM B;  3JAR B;  5JH7 B;  4CH6 A;  3SJC C;  4X1Y A;  1O9H A;  3THO A;  4I4T B;  3K57 A;  4JI1 B;  4HNA A;  4JI5 B;  1NT2 B;  4ZHQ A;  4AQY B;  1Q43 A;  4IIJ A;  5KMG A;  5BR8 B;  4GLX A;  1N34 B;  1S5J A;  1Q5O A;  1SA0 A;  3HKC A;  3RYH A;  2F66 C;  3OTF A;  4FLT A;  3RYI A;  2Q7H A;  4UCO A;  3JSL A;  5LP6 C;  3K5O A;  4OX9 B;  5JJJ B;  3E22 B;  3OTO B;  5LA6 A;  5EZY B;  5J2T B;  3N2K B;  3K59 A;  1HNZ B;  4ZIB A;  4LF6 B;  5K1P A;  3N2K A;  4I55 B;  4DUY B;  3CHX A;  1JJO A;  4B3T B;  4O2B B;  5LXT B;  3RYC A;  4DRX A;  4X65 B;  3BA9 A;  4HBN A;  4DR2 B;  3HKC B;  4EB6 B;  1FJG B;  5JJE B;  2JVD A;  4JI4 B;  1T5E A;  3RYF A;  4FM1 A;  2UU9 B;  1JFF A;  2R9A A;  3VQW A;  4X62 B;  3ZS8 C;  4TUY A;  5BMV A;  4U3J B;  1ZAU A;  5IWA B;  3K5N A;  4NXM B;  4O4L B;  3HKE A;  3T1H B;  3N2G B;  2PY5 A;  2PYL A;  2JGU A;  4DV6 B;  2R70 A;  2ZIN A;  5BMV B;  1KMI Z;  3LNN A;  3JAW A;  3UT5 A;  4DV0 B;  4TOI A;  1XHZ A;  4O2A A;  2ZM6 B;  4K8Z A;  4B08 A;  4CS2 A;  4CH4 A;  4PI2 A;  3HKD B;  5IYZ A;  2QM4 A;  4YHH B;  5C8Y B;  3UQ8 A;  5JQG B;  1X4T A;  1M4U A;  5KHK A;  3BAB A;  4DRX B;  4O4I A;  3RYC B;  2VWK A;  4UCR A;  4ZOL A;  4EEQ A;  4YY3 B;  4Q6G A;  4CS4 A;  2BTO A;  3VQX A;  1XQ8 A;  1HR0 B;  1JFF B;  3VQY A;  5EZY A;  1KU9 A;  3MAQ A;  4B3M B;  2OYQ A;  5FPO A;  4LF4 B;  3BAA A;  3RWR D;  2ZIO A;  4B3S B;  3RYH B;  5CA1 B;  1RSO A;  3PN1 A;  1XNQ B;  4LFB B;  4LFC B;  4UFZ A;  4JYA B;  4ZHQ B;  2YXL A;  4GYC B;  5JVD B;  5LYJ A;  5KX5 B;  5GON B;  1N33 B;  2R72 A;  2UXC B;  5EYP B;  4LH7 A;  5EIB C;  1TVK A;  3HKB A;  4AIL C;  3JAS B;  3IAY A;  4KHP B;  1QQC A;  4DV5 B;  4YJ2 B;  4TUY B;  2VQE B;  2CAZ C;  2Q7G A;  2UUC B;  2UXB B;  4LF9 B;  1M5I A;  5LP6 B;  4DK1 A;  1HW7 A;  2BTQ B;  4X64 B;  1TA8 A;  3UT5 B;  3M7M X;  5IJ9 A;  4PHZ A;  2Q7E A;  1JMK C;  4TQD A;  4LH6 A;  3JAS A;  4D7T A;  2UUA B;  5CB4 A;  2RJZ A;  5LMN B;  4DV1 B;  4DR1 B;  5JVD A;  2F4V B;  4IHJ A;  4JI2 B;  5FNV A;  5KHG A;  1XMO B;  4FLW A;  1D5A A;  1DGS A;  4CS3 A;  4X1I B;  5J2U B;  1XMQ B;  4I50 A;  4KL1 A;  4O4H A;  5CA1 A;  2YIA A;  4LNU B;  4F6R A;  4X1I A;  3WB2 A;  2V4D A;  3WB1 A;  5J2U A;  4NXN B;  1G6U A;  4F6R B;  4WBN B;  4LNU A;  4DR5 B;  1WPB A;  4I50 B;  4JI3 B;  3BA8 A;  2ZNI A;  2E3C A;  2P22 C;  2YI9 A;  4FM0 A;  4UCU A;  2OWO A;  4JI0 B;  4CH5 A;  4O4I B;  3JAR A;  4D7S A;  3K5L A;  1WNS A;  5JCO C;  4ZOL B;  5ITZ A;  4DR7 B;  4JI7 B;  1Q3E A;  1FFX B;  4FLV A;  5IJ0 B;  3B2E E;  2RQ6 A;  4UCS A;  1O9G A;  4TV9 A;  4JI8 B;  3A2F A;  3ICX A;  3BRC A;  4FFB A;  4DR6 B;  3HKD A;  5IYZ B;  3T1Y B;  4IIJ B;  5KMG B;  1IBK B;  5C8Y A;  2P5O A;  3JAW B;  4FFB B;  1VF7 A;  4DR4 B;  1XI1 A;  3JAT B;  4X1K A;  4X20 B;  3WB0 A;  3BPZ A;  3QF7 A;  5JH7 A;  5KHH A;  5IJ0 A;  3HKE B;  3K5M A;  5ITZ B;  4DV4 B;  2UUB B;  2E5L B;  4U3J A;  4BW9 A;  5D5Q A;  1TGO A;  2PZS A;  4CC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...