1K9MW

Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1k9mW00
4WF9V 3G6EV 3CCJV 3CCMV 1VQKV 1VQ4V 1VQNV 1NJIW 1KQSU 3G4SV 3CMEV 2QA4V 1VQMV 1K8AW 1JJ2U 1QVFU 3CPWU 3CCLV 1VQLV 1R73A 2OTJV 1KD1W 1YJ9V 3G71V 1KC8W 2OTLV 3I56V 3CCEV 3CC7V 4WCEV 1YI2V 2D3OW 3CC4V 5DM6V 1YITV 1K73W 1S72V 1VQ5V 1QVGU 1VQ7V 1K9MW 3OW2U 4WFBV 3CD6V 1YJWV 1M1KW 1M90W 1VQ8V 4WFAV 3I55V 3CCUV 2QEXV 1VQPV 1YHQV 1Q82W 3CCRV 1VQ9V 1YJNV 1W2BU 1Q7YW 3CXCU 3CCVV 1Q86W 3CC2V 1VQ6V 3CCSV 1N8RW 3CCQV 1YIJV 1VQOV 3CMAV 1Q81W
chains in the Genus database with same CATH superfamily
1OCCC 2E5LB 5L3BA 4LWSA 2CTWA 5IJ9B 2MW2B 4FM2A 3CCEV 4MVSA 4JI1O 3FB6C 1J95A 3BHPA 4MTOA 1YITV 1BZKA 4QGPA 1Y67A 3LNMB 2WWWA 4JI5O 5B1NA 1AR5A 4PA9A 5CA1A 1F4NA 2EILB 3BY6A 3K3WA 2IU0A 5CA0A 4X65B 1KQSU 1BCCH 1G4YB 2KG7B 1NI8A 2NN4A 1R6NA 3TJTA 1GO3F 2Q68A 1HNZO 1Y76A 3OTOB 4U7OA 2JEUA 1JMKC 1N33B 3CYOA 2IM9A 4EB6A 1FXHA 4DUZB 1RPOA 1W0KG 1IDSA 2WAMA 2GDSA 1LUWA 1GM9A 2V1DA 3HKBA 4D7TA 1RFYA 1ORQC 3DTUB 4RUFA 2PYJA 1XQ8A 5ITZA 5EBMC 1V55C 5F2VO 1OCOB 5LMNB 4FM0A 2ZD9A 4LF5O 4B3RO 1HNWO 4TV9B 2QM8A 4FZ0A 4ICGA 3TGUH 1WPXA 4GT1A 3OD4A 4UV8A 2LFSA 1S0VA 3FX7A 5B1AB 2HJDA 1K5QA 3APOA 1RSOB 2GTAA 3L72H 5IJ0B 1BE3H 3T4DA 3JASB 3NXSA 3UQ8A 5H5NA 3OE7G 2FL4A 3JD3A 1VQLV 4W4KA 5KHJA 3P3PA 1ZSPA 1E1RG 4WCEV 2E5LO 3B4SA 1XHXA 1AILA 4GUNA 4DO2A 1SQBH 1KP3A 3JARB 4FLTA 2Z3YA 2ZE8A 4N23A 2OIEA 2Y4TA 3SJCC 3MAQA 3SJBC 2JRIA 3SR2C 1PNMA 2R9IA 1KKCA 5C93A 4JI0B 3CB2A 3PN1A 3K08A 2K9PA 3JAWB 1TVKA 3LUTB 2YIDA 3ZEDA 3LSQA 5B66Z 5H2FZ 4R7CA 3OGIB 1E79G 1PP9H 3H1JH 1I94B 2YICA 4JYYA 1AR1B 2KQXA 3ETDA 5JH7B 2Q0AA 1N33O 1V55B 3HKDB 2R72A 1LR1A 4GKKB 1AP5A 2R9RB 3K5OA 3RYHB 4DV4B 5GONA 4Q6GA 3N27A 1OV9A 4X62O 4RO2A 5LMNO 5EBWC 2NLJC 2UUBB 2W0XA 2QM4A 3SPIA 1W0JG 2QWPB 5J2UB 3ZRVA 1PL4A 3QVNA 2P90A 4DR1B 5KX5A 1YHQV 4B3MO 1V54C 5LHHA 1JJOA 4UXNA 1EFRG 2B1IA 2EIMB 2XASA 4PA7A 2F4VB 4PHZA 1B3QA 1JR9A 2KSDA 5LP6A 5KHGA 1MNGA 2BSKA 4XDLA 1M9NA 4MTGA 4ZI7A 2VQEO 1SC5B 4I9QA 2P4KA 1I5YA 4I55A 3R65A 1XMOB 4MVUA 4BAYA 2CGNA 3CRRA 3QF7A 4O2AB 5BMVB 1E1QG 5LOVB 3EVKA 1N32B 2CGOA 3OMAB 3HKCB 1H8EG 4QE7A 4UB6Z 3OM3B 5IY5C 5LXTB 2CDYA 4PDLA 4JI0O 5JQGB 2ZM6B 3K5NA 2A06H 2HHHB 4DV5B 4I0XB 1VQKV 3HKEA 1IBKO 1JX9A 3DGEA 2HR3A 1FFXA 2X0LA 3TXSA 3DSQA 4CS4A 1AP6A 5BR8B 3WFVA 5K1PA 4WFBV 1XNQB 3WB2A 3CCRV 1WA8A 4X9QA 1HNXB 2UXDB 4O4IA 1PV0A 3GVMA 3IAYA 1IZ3A 3JCZA 2ITDC 3RVYA 4PA4A 3ASOC 3FB8C 2LGWA 3RN4A 1V54B 2UXBB 3E83A 5LYJB 1TAEA 1VQ7V 2UUBO 4JI2B 3GWOA 3N2GB 1N4CA 1UPGA 4OPAA 4HZ3A 1QU7A 4GX5A 1FS0G 3OAAG 4DR1O 5IYDO 4H44B 1S3JA 3FB7C 1Q6HA 1QVFU 1NTMH 1SQXH 3OEHG 4LFBB 4LF4B 2QR4A 4LFAB 4XBFA 1GN6A 4DRXA 2F4VO 1MSDA 2PF4E 1S5LZ 4I9WA 3NR7A 2QKCA 3RYCB 5B1BC 3O65A 1YVWA 1ZL8B 2X6AA 1I7FA 3J7AU 5DECA 3OTFA 1K34A 3D36A 4LH7A 5JJJB 2IU3A 5IY5B 4L8JA 2DWDC 1CP9A 4JI3B 4GLXA 1KBHA 3G80A 2FKXA 3C3TA 3CRAA 4JI4B 1Q6IA 5GTIZ 3A2FA 3VQWA 4WFEA 2CUGA 4UCRA 3JALB 2WA3A 2PUSA 4BIUA 5JCOC 5C8YA 3IJ4A 1DF4A 2DQ0A 4X66B 2ZM6O 4AQYO 2HHHO 2Q7EA 3ZRWB 5LGTA 4DV5O 1IBLB 1ZWIC 4BIZA 2AZ2A 2ZNIA 4LR3A 4GX1A 4PD4F 1VQ8V 2YIBD 3ASOB 2WLLA 5BR8O 1WNSA 4ASUG 4JTDB 4RUEA 3ZS8C 2Z0AA 3BA9A 4GKJO 1SESA 2A3QA 3CCLV 3UO3A 1D5AA 3QO5A 2RNBA 3E8BA 3RYFA 2YI8A 1THZA 1SA0A 3RGBA 4JV5B 4WFAV 5KHKA 1X4TA 4PJ0Z 3ML0A 1XHZA 1OJHA 5GW7A 5LBQA 2UXBO 4O2BA 5IE9A 3W7SA 5B5EZ 4JI2O 4JYBA 4P30A 1L1FA 2F23A 5EYPA 2P22C 5B1BB 4X1KA 1HDJA 2EJRA 3JYCA 2WLKA 1ZLZA 3UM7A 2EBOA 4O4LA 5LHIA 1URFA 2A79B 1M5IA 3I55V 5J9PC 1HR0O 5IYBO 4LFAO 2HVJC 3W7WA 4FZ1A 4OGQB 4XDJA 1P84F 2PY5A 3IFXA 4G27B 1YXBA 3P3NA 4MVMA 4P9OA 1VMGA 1PKXA 4JYAB 1KUQA 2LFRA 2GTSA 3J81N 4KHPB 4H0LB 3EFFK 3ABUA 3FD9A 4UVCA 1KYOF 3HPLC 4JI7B 2V4DA 4F6RB 3CCJV 2BTQA 2VWKA 4GZRB 3ZHSA 1FKAO 4UFZA 4ZOLB 3E8HA 2XAQA 4DXWA 4MW3A 3B8MA 3SDLA 2K1EA 3DC5A 3CE2A 1R6TA 2JIZG 2ODMA 5HFMA 1FFTB 5B1OA 4LNUB 1H8HG 2EILC 1R1BA 3A0HZ 1NBMG 5LHGA 4O4HA 1IBLO 2QTSA 4DW0A 1FXKA 2X6CA 1NJIW 1MZFA 3AK2A 4LF7B 2EZOA 1N34O 1P4RA 5E79Z 3M7MX 2Q0OC 2ZNJA 4JASA 2YDEA 4U3JB 3G6BA 3RVZA 3B8NA 2HKOA 2FB5A 4G2KA 3DXRA 4DV3O 4LF8B 4WFHA 1TA8A 4NXMB 1WB8A 1I0HA 3S3XA 3CPWU 5LA6B 3W7TA 1SZTA 2PYLA 1SERA 1Z5WA 3OMIB 4UCTA 3E86A 3JD2A 4I50A 3N2KB 4X1YB 4MT8A 4EFEA 4H13B 2EINB 3FAVB 3UCSC 3OR6C 4JPRA 4O4JA 4CBCA 3BPZA 3AEIA 4TUYB 4QJFB 3O9OA 2DN9A 4K0KO 1A32A 3LDCA 4JYAO 1RP3B 2X6BA 2ZT9B 4KHPO 3CXCU 4JF3A 4LWSB 3OEEG 1Y66A 1XEQA 3P32A 5GTHZ 4JI7O 1GN2A 4BWAA 2Q7HA 3BAAA 1RM1C 1XNRO 2WLJA 3GWKC 2ZINA 4E2LA 1L0NH 2QJ1A 3SPGA 3T1YB 3SJAC 1FJGB 2JK5C 5CA1B 2PTMA 1J5EB 1DF5A 5CA0B 2JJ2G 4DUYB 1F23A 2QE7G 3ZX6A 5J2TA 4G28B 5LMUB 4B3SB 4CC5A 1M57C 1VF6A 4D7SA 3B40A 1SETA 1Y76B 2RDCA 3IC9A 3E8FA 2QWRB 3MHSC 4EB6B 4LF7O 1GTOA 2BOBC 1JQ0A 1U96A 2UUCB 1OCZB 4X64O 4W4LA 1HP8A 2XT9A 1FAFA 1IX9A 3CRMA 1VQOV 3L75H 1H2KA 1JPXA 2LGQA 3WU2Z 2ZCEA 4DR7O 1IVSA 3HKBB 1N36B 3BCCH 2F66C 5ITZB 4LF8O 4U7NA 2Q8VA 4NXMO 4CC6A 2RQ6A 3ZRXA 5IWAO 1RSOA 1W2BU 1WP7A 2EZPA 4DV6O 2M6YA 5A2QN 4YJ3A 3JASA 3A8TA 4X1IA 3FB5C 3I56V 2VS0A 4B08A 3QO8A 2F1MA 2EIMC 2AW9A 1RM1B 2YSUB 1G6UA 1VARA 1NU1H 1SRYA 2QKAA 3ETQA 3CCSV 1KECA 1GRJA 3AG1C 4DR3B 3H1LH 1GAXA 3OMNB 4DW1A 4DR2B 3TCUA 2EIJB 1XOUA 5LP6C 2F43G 2XAHA 4KP4A 4X65O 4CZZA 3AK1A 1M57B 2LP7A 1SKVA 2CTQA 5EC2C 3T1YO 4FJCC 1FJGO 1TUBA 3CJHA 3D3QA 1BMFG 4I5SA 4I7ZB 4DV7B 3TK1A 3OTOO 5CBFA 1TVKB 2IJIA 4DUYO 2WLNA 3SYAA 4DUZO 5LMUO 3CXHF 2KB1A 3ABKC 4LCUC 1B06A 2E76B 3RFRA 2JS3A 1FPOA 4WFGA 2XHBA 4J10A 4LC1A 3ZRSA 5JJNB 1K33A 4IYIA 3EHBB 2W6JG 1M56C 2ZDIA 2EX3A 2Z5UA 1HW7A 3K59A 1PM9A 3WB0A 1S5HC 2DYRC 5B3SC 2ZQMA 1NS1A 2PI5A 2IH1C 2ADQB 3RWRD 5JVDA 1MOFA 2DE0X 3T1HB 4MW8A 4YJ2B 1G8MA 2QWNB 4B7EA 5FPOA 1AVMA 4JAUA 3D8CA 2EULA 1D5NA 2FYUH 3JSNA 2GHYA 2AHYA 2GUZA 5KX5B 2BOCC 3LDEA 2NR5A 2RCVA 1QVGU 3AG1B 2JGDA 1JA8A 1BSMA 4MVOA 1KKDA 3BABA 3HR0A 2ZIOA 5LP6B 1PNKA 3Q4HA 4IHJA 1R3KC 1VQ4V 1KB9F 3TETA 4IIJA 5TISZ 1S77D 2BSKB 5FLXN 5HFLA 1VIBA 5BMVA 2XNDG 4ZI7B 5LOVA 2QWQB 2Q73A 4DR3O 4TSFG 2QDOA 1S76D 4I55B 5LL6Y 4DR2O 4ZIBA 4I4TA 3B09A 2DWEC 4MVZA 4DYLA 4IGGA 4C7UA 2HVKC 3D36C 1NTKH 2D2CB 3ABKB 1F4MA 3MDSA 1K3EA 1UJWB 4FLXA 1I94O 4DV2B 1CXZB 1QLNA 1TUEB 4R50A 2JDIG 1P49A 1EN4A 4DV1B 1PD3A 5KMGA 1RPRA 4GX0A 1M56B 5DEDA 1HWYA 4JI8B 5CB4A 3HKEB 2W0FC 4GCZA 4GKKO 4F6EA 1FFXB 2DYRB 5B3SB 4CH3A 4DV4O 3A0BZ 1Q8IA 2ADPA 3OT7A 5IYZA 2N04A 2XAFA 2JGUA 1WA8B 4NTYA 4MS2A 4UCVA 2ETNA 1NR1A 4O4IB 4ABMA 3OW2U 3SYOA 1M1KW 1YTFD 3JAKA 1PL0A 1SQVH 5L3FA 3ZHUA 1EZVH 4CS2A 1NH2D 2HG5C 4DR5B 3T1HO 5IYCO 4K8ZA 1NVPD 1H2SB 3RYIB 1BT8A 3E89A 4K8XA 2KKWA 1BHAA 4TT3G 3T1CA 4Z1VA 3CHXA 3QO7A 4P9PA 3E22A 1GH6A 2YXYA 1IURA 4UV9A 4DRXB 2H94A 4EFBA 3ETGA 5K1XA 3APQA 3LSUA 1XMOO 1BGYH 2HP8A 3ZJZA 4YHHB 4U3FH 2YC0A 4DR4B 2IJHA 4NXNB 4AILC 1GMGA 2CTRA 3CD6V 5AG2A 1XI1A 1N32O 3S3WA 4X88A 4FLWA 1VQ6V 3ZBHA 4PELA 1YZBA 1Q90D 2Y4UA 4D6TH 3ZMZA 1L8DA 3CS5A 3G71V 2QM7A 4LBEC 4NYKA 1UFIA 3E35A 3W7UA 3CEIA 2ZE5A 3PJSK 2P5OA 1K73W 2P4VA 3ABLC 1R3IC 1WLEA 5C8YB 2IJKA 1XREA 1VF5B 4HBNA 3STLC 4B3TB 3SYPA 1AJQA 2LQTA 2WSSG 1VQNV 5L3EA 1XNQO 4JI8O 1OHHG 4X8AA 3KG2A 1HNXO 2UXDO 2JJ1G 4TQDA 3ABTA 5DM6V 2UUAB 2WA4A 2WLLB 3ZIAG 3OR7C 4FLYA 1SQFA 1WPBA 3QG5A 3RYFB 1ZX3A 1QNMA 3K58A 1SA0B 2Y0IA 1JJ2U 1NZ6A 3ZHRA 1FXKC 4NVPA 1QLEC 1W59A 3IC7A 1H2GA 5CN0A 5D5PA 2RJZA 4DR5O 1VQ5V 4ZHQA 4O2BB 1YTFB 4LFBO 4RQEA 4LF4O 1YJNV 2OIGA 1YSCA 4AI8A 3OFNG 2JEXA 4KUMA 3K0GA 5EYPB 1DTOA 3T2MA 5H6RA 1NH2B 2WLIA 4O4LB 3UT5A 2CH7A 1F7YA 3MHHC 1NVPB 2EINC 1O9HA 1SF9A 1LNQA 2V7QG 4HNAA 2P6JA 3FFQA 2UU9B 1U97A 4J41A 4R8CA 2YS8A 1B6QA 4JI3O 4YHHO 3AK3A 4N21A 1NR7A 4JI4O 5L3CA 3ABLB 2JVDA 1ZUQA 4FLZA 4LFCB 1XMQB 5KUMA 1JFFA 4X66O 2Q9LA 5KAFZ 4CH5A 2BTQB 3K04A 4LNUA 3F7YC 3VBBA 1AI5A 1H2MA 2OWOA 4GX2A 1WP8A 1AJPA 1HNZB 1JVMA 1R6KA 4WBNB 3K9AA 4LF9B 4O4HB 1FYJA 1GN4A 1IXMA 5FNVA 5H6QA 1FXKB 2PZSA 3G67A 2LJ2A 1QLEB 4FFBA 1QR9A 4JV5O 1MA1A 3CMEV 1B04A 4FK5C 1EN6A 3JATA 4ZKIA 1OCZC 4LH6A 4LF5B 4PDVA 4X20A 1QHTA 3DXRB 1HNWB 2BE3A 2YEVA 1N0NA 2P7TC 4H33A 5EZYA 3C3SA 2DYSC 1Y74A 4YIPA 1F51A 3H1KH 1I5XA 4TV8B 3SYQA 2QA4V 2IH3C 2X7RB 3JD1A 4Z2WA 1KD1W 4OPHA 1K7DA 4I50B 4PI2A 5CBHA 5A9GA 2CTPA 2AZ0A 5IJ9A 3FYEB 2CAZC 4O4JB 1IBMB 4NTWA 1EN5A 4H37A 2UU9O 3ZHQA 5H9CA 5L3GA 4WFFA 2L35A 1DLBA 5L3DA 2MK3A 2A7WA 5E1AC 3F5WC 2KG7A 2HEPA 4LFCO 3SJQC 1XMQO 3ZHTA 2EIJC 2ARHA 2E75B 1QBZA 1YIJV 2XTAA 4NB5A 3ZMUA 4UUJC 2GBOA 2M7WA 2AHZA 2YIAA 1K9MW 1Q43A 4J80A 4JZGA 1VQ9V 5J2TB 2ILMA 4LF9O 1TGOA 1Q7YW 4HAMA 1K4CC 2Q5ZA 3ICXA 1AROP 3AG2B 5KA5A 1VQMV 3AG4C 4TV9A 2DYSB 1Z2GA 4EKWA 2EIKC 4MTXA 4HYOA 1K4DC 1Q3EA 2XAJA 4LF6B 4X62B 5JJEB 1XILA 3RW0A 1S72V 4JI6B 2YXHA 1VQPV 4K3AA 3QTCA 1Q86W 3IGAC 3ZMVA 3CC2V 2PGGA 3U0ZA 1WAZA 4NTXA 3K0DA 2ATKC 5IT9N 1JOYA 5IJ0A 5JWPA 1H38A 3KKYA 3H1IH 4B3MB 1SQPH 2ZDIC 4E4EA 4FLVA 1T5EA 2DW4A 1L0LH 1OCCB 5FPRA 1Q6UA 4QE9A 1AR4A 3B2EE 3BVOA 3AG3C 3CCUV 4UB8Z 4YJ3B 3JD0A 4L87A 2QKSA 4BW5A 3GB7C 4X1IB 3I5DA 2WLMA 3JSLA 4F4LA 4JZ2A 3JARA 1SQQH 4BW9A 3OUFA 3BEHA 2VQEB 1YJ9V 1IBMO 3BA8A 4EEQA 4GYCB 4JAVA 1WB7A 3H01A 4J7KA 3UKMA 1YJWV 1OCRC 1ROPA 3OUSA 1DGSA 3JAWA 1H2LA 4AHCA 2HFEC 1MABG 4PI0A 1QCEA 2QGNA 1NT2B 3R66A 1XDCA 4RWUA 1J5EO 3ZHVA 3SYCA 1Y4MA 3SPJA 5JH7A 4B3SO 1M4UA 3HKDA 1GM7A 1IBKB 1TUBB 3CJHB 2HLDG 3AG4B 3CSXA 3JCUZ 3CRCA 3RYHA 2EIKB 1KMIZ 2Y69C 4J7JA 2UUCO 1BHBA 4MVQA 2OCCC 1WJZA 1H2NA 2H8PC 1Q5OA 1XL4A 5GONB 1R3LC 2UXNA 2F93B 2P67A 1N36O 5J2UA 1I08A 4LF6O 1N8RW 3ZMTA 4JI6O 4FFKA 5KLVH 1YCIA 1XUQA 5EBLC 3VOUA 4YJ2A 3ZN1A 3AG3B 2H3OA 1Z5VA 1KC8W 3JAMN 1AI6A 4FIPC 3UO2A 1YI2V 5JVDB 2CE4A 2ITCC 4CS3A 5BY1A 5KHIA 3X2QC 3LSSA 4FMTA 1AI4A 2Q6AA 3CWBH 3CMAV 4DR6B 2GUZB 5IDJA 2LW7A 3JD4A 4O2AA 1OCRB 3E8GA 3THOA 1EBOA 2JGDB 1S5JA 4OX9B 2D3OW 2ZXWC 3HKCA 5DN6G 3FKSG 3VQVA 2WPDG 3Q4HB 4PV1B 3M8AA 4IHJB 4IIJB 4QPJA 3L74H 5LXTA 3KZIZ 4OXSA 1K5SA 3E2EA 2Q4PA 5JQGA 2XUMA 3BFRA 3MD0A 3BRCA 2N74A 4LP8A 4I0XA 3H1HH 1AI7A 2LW1A 3U10A 1FXVA 4I4TB 3L71H 4JTAB 4K35A 4DV7O 4A5UB 2AXTZ 4QIWF 2Y69B 4IL6Z 4AQYB 2QSAA 2UXCB 4TWKA 4PA3A 2OCCB 1YDXA 4KXRA 1MMMA 1BQZA 2C2AA 2Q69A 4P2ZA 3WG7C 4UVBA 4CH6A 2FTKA 3RT3C 4BR6A 1BS3A 4UVAA 1LUVA 3FYIB 5KMGB 2QWOB 4FPPA 5CB4B 1YEWA 2OT5A 4GKJB 5FL7G 2GV9A 2W6IG 2DOSA 1EZJA 4DV0B 5LYJA 1VP7A 5IYZB 2Q7GA 3CX5F 3N2GA 4DK0A 4CH4A 2A0LA 1K8AW 4YIOA 4TQFA 1GKFA 3U11A 3K57A 1VEWA 3JAKB 3X2QB 4X89A 3TXQA 3RYIA 4QNHB 3AG7A 1ZTEA 3KCXA 2HJFC 1SZXA 4RAIA 2YI9A 4UCUA 3RYCA 3LNNA 1ZL8A 2ZXWB 2ZE7A 2DQ3A 2E3CA 4FVMA 4YXWG 3T4ZA 1FD9A 2B9ZA 1NKDA 4Q20A 1HR0B 1O9GA 2AGAA 4DR6O 1OZ0A 5LGNA 4PA6A 2GSMB 1BL8A 2IJJA 3CP1A 3B77A 3E22B 4OX9O 2B5UA 3JALA 3G6EV 2FMLA 3K9SA 3D3IA 2OTJV 3VQXA 4YY3B 3L9DA 3CRQA 1PPJH 1IXBA 1EM1A 2WLHA 3WG7B 1CEZA 2L6LA 3ZRWA 2O57A 1M90W 3K03A 2ZR2A 5CBGA 4DV2O 3J80N 1R3JC 2A9HA 4J11A 3CCQV 5EK0A 3OGCC 4DV1O 1P7BA 4JTCB 2UXCO 2BCCH 4MSWC 5KAIZ 3W7XA 1PNLA 4B7KA 1KU9A 4NR1A 3CC4V 3F5TA 2N05A 4NKGB 1AB3A 1VF7A 2CK3G 1US6A 1N34B 1V9PA 1MSWD 5EC1C 3ASNC 1M93A 5EIBD 1DK1A 2BTOA 4DV0O 5D5QA 4IYHA 5LGUA 2E74B 4DV3B 2VQFB 2IW5A 1NQTA 5KA6A 3WB1A 3ZN0A 3K06A 2Q67A 3ETEA 4J7ZA 2DJVA 1GN3A 1X59A 4JGSA 4X1KB 3EXAA 1G1XB 1MZEA 4ZHQB 4XDKA 5KHHA 3SGIA 5EIBC 2PI4A 3P30A 3ABMC 1BQ0A 4J9YB 2F95B 1XL6A 2VWJA 1YF2A 1ENVA 2QTOA 3K5LA 5JCOA 2WLIB 5CMUA 1JCHA 4DR4O 3UT5B 2CH7B 3ZMSA 1Q81W 4NXNO 1WN7A 4JI1B 3A0RA 3QNEA 3RBZA 1COWG 4K0KB 2XAGA 4HNAB 1R73A 1SS3A 2ZE6A 4PDRA 4F6RA 3KCYA 4JI5B 2YUAA 3CC7V 4R6ZA 4MVRA 4ZOLA 1Y6XA 4YY3O 5CA3A 4JAAA 4Z1MG 2QEXV 2DMXA 1XNRB 3F7VC 1XBLA 3M99B 5BXZA 4WF9V 5BZBA 1QR8A 1ZAUA 4QPKA 1JFFB 3K5MA 4B3TO 3L70H 1K97A 3ASNB 4WBNA 2ZKOA 2OCHA 1KP2A 1GK9A 2VRZA 4IT5A 3H9VA 4U3JA 2UXXA 2RMKB 2RN9A 2ZR3A 3VQYA 1K92A 2UUAO 2R9AA 3HB3B 3CCMV 2YIBA 4PDMA 4UCSA 3SPHA 2XOKG 1CPYA 5FNVB 1N0JA 4X64B 1AJNA 2OTLV 4B3RB 3SPCA 1VF6C 2NNUA 3AG2C 4MTFA 5LA6A 2ZIMA 3C90A 2Y48A 1Q82W 4FFBB 4JYCA 5KUKA 1MG1A 4DR7B 2VQFO 2G38A 4UCOA 4RQFA 2Y0PA 3JATB 3DC6A 1SQGA 2IBZH 3N2KA 4ZBMA 4X20B 4X1YA 3ABMB 3G4SV 4DK1A 1OCOC 2JS5A 1QQCA 2YEVB 4TV8A 3LDDA 1GM8A 4KL1A 5IWAB 2B1GA 3L73H 2OYQA 5EZYB 3STZC 4KFMA 2P06A 4DV6B 1Y74B 3FAVA 4FM1A 2YXLA 4FLUA 4BIOA 4TUYA 1NTZH 1D2DA 2R70A 2EJ7A 3K79A 4TOIA 3ZCCA 4J42A 3CCVV 4J9ZB 2LO1A 5B1AC 1P7GA
chains in the Genus database with same CATH topology
1MABG 1OCCC 3W7SA 1QCEA 5L3BA 4JYBA 4P30A 1L1FA 5B1BB 2XAFA 3SYCA 3CCEV 4MVSA 2EJRA 1Y4MA 3FB6C 1J95A 3JYCA 2WLKA 4MTOA 3SPJA 3UM7A 2EBOA 4MS2A 5LHIA 1YITV 1NR1A 3OW2U 3SYOA 1M1KW 2A79B 1GM7A 1YTFD 3LNMB 3I55V 2WWWA 5J9PC 2HLDG 3AG4B 5B1NA 5IYBO 2HVJC 1PL0A 3W7WA 4PA9A 2EIKB 4XDJA 5L3FA 3IFXA 4G27B 1F4NA 2EILB 1NH2D 3BY6A 3K3WA 2Y69C 4MVMA 2HG5C 4P9OA 2IU0A 1KQSU 1G4YB 1PKXA 1BHBA 4MVQA 2OCCC 5IYCO 1R6NA 1NVPD 2LFRA 2H8PC 1XL4A 3EFFK 1R3LC 1GO3F 3E89A 2Q68A 3ABUA 2UXNA 2P67A 1BHAA 4UVCA 4TT3G 3HPLC 4U7OA 2JEUA 3T1CA 3CYOA 3QO7A 1N8RW 4P9PA 3ZMTA 1FXHA 3CCJV 1RPOA 1W0KG 5EBLC 3VOUA 2WAMA 4UV9A 3ZN1A 3E8HA 3AG3B 2H94A 2XAQA 4DXWA 1KC8W 4MW3A 3B8MA 3ETGA 1GM9A 2K1EA 1AI6A 2JIZG 4FIPC 3ZJZA 1YI2V 2V1DA 5HFMA 1FFTB 2IJHA 5B1OA 1H8HG 1ORQC 1GMGA 3DTUB 2EILC 4RUFA 5LHGA 3CD6V 1NBMG 5EBMC 1V55C 4X88A 1OCOB 2ITCC 2ZD9A 1VQ6V 3X2QC 3LSSA 4FMTA 1AI4A 2Q6AA 2QM8A 3CMAV 4PELA 5IDJA 1FXKA 2X6CA 1NJIW 1WPXA 3JD4A 4GT1A 3ZMZA 3G71V 2EZOA 2QM7A 4LBEC 1OCRB 3E8GA 4UV8A 3E35A 1EBOA 3W7UA 1P4RA 2LFSA 1S0VA 4JASA 5B1AB 2D3OW 1K5QA 2ZXWC 3PJSK 1K73W 5DN6G 3FKSG 3ABLC 1R3IC 3B8NA 3RVZA 1WLEA 2HKOA 2WPDG 4G2KA 2IJKA 4QPJA 3T4DA 3STLC 3SYPA 1AJQA 3NXSA 4WFHA 4OXSA 1K5SA 3E2EA 2WSSG 1VQNV 5L3EA 3MD0A 3OE7G 3JD3A 1OHHG 4LP8A 4X8AA 3CPWU 1VQLV 3KG2A 1E1RG 3W7TA 1AI7A 4WCEV 1SZTA 1FXVA 2JJ1G 3ABTA 1SERA 5DM6V 4JTAB 2WLLB 3OMIB 4QIWF 4DO2A 2Y69B 3E86A 3JD2A 3ZIAG 3OR7C 1KP3A 4TWKA 4PA3A 4MT8A 2OCCB 2Z3YA 2EINB 4N23A 2C2AA 2Q69A 4P2ZA 3WG7C 4UVBA 2FTKA 1JJ2U 3OR6C 4JPRA 4CBCA 1PNMA 1FXKC 2R9IA 3AEIA 4UVAA 5C93A 4QJFB 3FYIB 1QLEC 4FPPA 3IC7A 1H2GA 3K08A 5CN0A 2OT5A 3LDCA 3LUTB 1VQ5V 5FL7G 3LSQA 2W6IG 2X6BA 1YTFB 4RQEA 1EZJA 1YJNV 3CXCU 1YSCA 4R7CA 3OFNG 1E79G 4JF3A 2JEXA 3OEEG 4KUMA 1Y66A 3K0GA 1DTOA 1AR1B 3P32A 3T2MA 2A0LA 3ETDA 5H6RA 1NH2B 1K8AW 2WLIA 1GKFA 1RM1C 2WLJA 1V55B 3MHHC 1NVPB 4E2LA 2EINC 3X2QB 4X89A 3SPGA 2V7QG 1LNQA 2P6JA 2R9RB 2JK5C 4R8CA 4QNHB 1B6QA 1DF5A 2HJFC 4N21A 2JJ2G 1NR7A 4RAIA 1F23A 2QE7G 4RO2A 4G28B 5L3CA 2ZXWB 1M57C 2DQ3A 5EBWC 3ABLB 2NLJC 4YXWG 3T4ZA 1NKDA 4Q20A 1SETA 1OZ0A 5KUMA 1W0JG 3SPIA 3E8FA 5LGNA 3ZRVA 2P90A 4PA6A 2GSMB 3MHSC 1BL8A 2IJJA 1GTOA 2BOBC 3CP1A 1JQ0A 3B77A 1YHQV 1OCZB 3K04A 1V54C 3F7YC 3VBBA 1AI5A 5LHHA 2B5UA 4UXNA 1VQOV 1EFRG 2B1IA 3G6EV 2EIMB 4GX2A 1AJPA 2XASA 1JPXA 4PA7A 1JVMA 3D3IA 2OTJV 1R6KA 3K9AA 4U7NA 4XDLA 1M9NA 2WLHA 1IXMA 4MTGA 3WG7B 1CEZA 5H6QA 3ZRWA 3ZRXA 1M90W 3K03A 2ZR2A 5CBGA 1FXKB 1W2BU 2EZPA 1I5YA 1R3JC 2A9HA 3R65A 3CCQV 4MVUA 4BAYA 1QLEB 5EK0A 3OGCC 1QR9A 1P7BA 1E1QG 4JTCB 3CMEV 4FK5C 4MSWC 4ZKIA 1OCZC 3OMAB 3W7XA 3FB5C 4PDVA 1PNLA 3I56V 1H8EG 3QO8A 2YEVA 4QE7A 2EIMC 2P7TC 4H33A 3CC4V 3OM3B 5IY5C 2DYSC 4PDLA 1RM1B 1F51A 2CK3G 2YSUB 1SRYA 1MSWD 5EC1C 3ASNC 3CCSV 1I5XA 1KECA 3SYQA 1VQKV 3AG1C 2QA4V 1JX9A 2IH3C 2X7RB 3DGEA 2HR3A 3JD1A 3OMNB 1KD1W 5LGUA 2X0LA 3TCUA 2EIJB 1K7DA 2IW5A 2F43G 5CBHA 1NQTA 5KA6A 2XAHA 3WFVA 4KP4A 4CZZA 4WFBV 3ZN0A 1M57B 2LP7A 3CCRV 3FYEB 3K06A 5EC2C 2Q67A 3ETEA 4FJCC 4H37A 5H9CA 3JCZA 1BMFG 5L3GA 4I5SA 2ITDC 4WFFA 4JGSA 3RVYA 3TK1A 1DLBA 5CBFA 4PA4A 2IJIA 3ASOC 3FB8C 5L3DA 2WLNA 1V54B 2MK3A 4XDKA 5E1AC 3SYAA 3F5WC 3E83A 2PI4A 3P30A 2KB1A 3ABMC 4J9YB 3ABKC 1VQ7V 4LCUC 1XL6A 3GWOA 3SJQC 1ENVA 2QTOA 2EIJC 4HZ3A 4WFGA 2WLIB 4GX5A 5CMUA 1JCHA 1QBZA 1FS0G 1YIJV 4LC1A 3OAAG 3ZMSA 1Q81W 3A0RA 5IYDO 3QNEA 3RBZA 1COWG 3ZRSA 2XAGA 1K33A 1S3JA 3EHBB 3FB7C 4UUJC 2W6JG 3ZMUA 1M56C 2ZDIA 1QVFU 1R73A 2Z5UA 3OEHG 4PDRA 2M7WA 1S5HC 2DYRC 3CC7V 5B3SC 4XBFA 4R6ZA 2AHZA 4MVRA 2ZQMA 2PI5A 1K9MW 5CA3A 4Z1MG 2QEXV 4I9WA 2IH1C 5B1BC 1VQ9V 1Q7YW 2X6AA 1MOFA 3F7VC 4HAMA 1K34A 1K4CC 4MW8A 3D36A 3M99B 1AROP 1G8MA 2IU3A 3AG2B 4WF9V 5BZBA 5KA5A 1QR8A 1VQMV 4JAUA 4QPKA 5IY5B 3AG4C 2DWDC 2DYSB 1CP9A 4EKWA 2GHYA 2EIKC 4MTXA 2AHYA 2BOCC 4HYOA 1K4DC 1K97A 3ASNB 3LDEA 2XAJA 4WFEA 3RW0A 1S72V 1QVGU 1KP2A 3AG1B 1GK9A 1VQPV 1Q86W 2UXXA 3IGAC 4MVOA 3ZMVA 3CC2V 1KKDA 2ZR3A 3K0DA 1K92A 4BIUA 2ATKC 1PNKA 3HB3B 1R3KC 3CCMV 1VQ4V 3TETA 1JOYA 1DF4A 4PDMA 2DQ0A 1H38A 1S77D 3SPHA 2XOKG 1CPYA 5HFLA 2XNDG 2ZDIC 1AJNA 3ZRWB 5LGTA 2OTLV 3SPCA 2DW4A 3AG2C 2NNUA 4MTFA 1OCCB 1ZWIC 4TSFG 4BIZA 1S76D 4QE9A 4GX1A 3AG3C 1VQ8V 3CCUV 2Y48A 1Q82W 4JYCA 5KUKA 1MG1A 3JD0A 4L87A 2DWEC 2QKSA 2WLLA 3ASOB 4BW5A 4MVZA 4RQFA 3GB7C 4ASUG 4JTDB 2WLMA 4F4LA 4RUEA 4ZBMA 2HVKC 3ABMB 3G4SV 3OUFA 1SESA 3ABKB 1OCOC 3CCLV 2YEVB 1F4MA 3BEHA 1YJ9V 1K3EA 1GM8A 3LDDA 1UJWB 3QO5A 2B1GA 3E8BA 3STZC 4KFMA 1QLNA 1THZA 1TUEB 4R50A 2JDIG 4JAVA 3UKMA 3H01A 1YJWV 1PD3A 4WFAV 1RPRA 3K79A 1M56B 4GX0A 1HWYA 1OCRC 1ROPA 3OUSA 3ML0A 2W0FC 3ZCCA 4GCZA 5GW7A 3CCVV 5LBQA 4J9ZB 5B1AC 2DYRB 2HFEC 5B3SB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WF9 V;  3G6E V;  3CCJ V;  3CCM V;  1VQK V;  1VQ4 V;  1VQN V;  1NJI W;  1KQS U;  3G4S V;  3CME V;  2QA4 V;  1VQM V;  1K8A W;  1JJ2 U;  1QVF U;  3CPW U;  3CCL V;  1VQL V;  1R73 A;  2OTJ V;  1KD1 W;  1YJ9 V;  3G71 V;  1KC8 W;  2OTL V;  3I56 V;  3CCE V;  3CC7 V;  4WCE V;  1YI2 V;  2D3O W;  3CC4 V;  5DM6 V;  1YIT V;  1K73 W;  1S72 V;  1VQ5 V;  1QVG U;  1VQ7 V;  1K9M W;  3OW2 U;  4WFB V;  3CD6 V;  1YJW V;  1M1K W;  1M90 W;  1VQ8 V;  4WFA V;  3I55 V;  3CCU V;  2QEX V;  1VQP V;  1YHQ V;  1Q82 W;  3CCR V;  1VQ9 V;  1YJN V;  1W2B U;  1Q7Y W;  3CXC U;  3CCV V;  1Q86 W;  3CC2 V;  1VQ6 V;  3CCS V;  1N8R W;  3CCQ V;  1YIJ V;  1VQO V;  3CMA V;  1Q81 W; 
#chains in the Genus database with same CATH topology
 1OCC C;  2E5L B;  5L3B A;  4LWS A;  2CTW A;  5IJ9 B;  2MW2 B;  4FM2 A;  3CCE V;  4MVS A;  4JI1 O;  3FB6 C;  1J95 A;  3BHP A;  4MTO A;  1YIT V;  1BZK A;  4QGP A;  1Y67 A;  3LNM B;  2WWW A;  4JI5 O;  5B1N A;  1AR5 A;  4PA9 A;  5CA1 A;  1F4N A;  2EIL B;  3BY6 A;  3K3W A;  2IU0 A;  5CA0 A;  4X65 B;  1KQS U;  1BCC H;  1G4Y B;  2KG7 B;  1NI8 A;  2NN4 A;  1R6N A;  3TJT A;  1GO3 F;  2Q68 A;  1HNZ O;  1Y76 A;  3OTO B;  4U7O A;  2JEU A;  1JMK C;  1N33 B;  3CYO A;  2IM9 A;  4EB6 A;  1FXH A;  4DUZ B;  1RPO A;  1W0K G;  1IDS A;  2WAM A;  2GDS A;  1LUW A;  1GM9 A;  2V1D A;  3HKB A;  4D7T A;  1RFY A;  1ORQ C;  3DTU B;  4RUF A;  2PYJ A;  1XQ8 A;  5ITZ A;  5EBM C;  1V55 C;  5F2V O;  1OCO B;  5LMN B;  4FM0 A;  2ZD9 A;  4LF5 O;  4B3R O;  1HNW O;  4TV9 B;  2QM8 A;  4FZ0 A;  4ICG A;  3TGU H;  1WPX A;  4GT1 A;  3OD4 A;  4UV8 A;  2LFS A;  1S0V A;  3FX7 A;  5B1A B;  2HJD A;  1K5Q A;  3APO A;  1RSO B;  2GTA A;  3L72 H;  5IJ0 B;  1BE3 H;  3T4D A;  3JAS B;  3NXS A;  3UQ8 A;  5H5N A;  3OE7 G;  2FL4 A;  3JD3 A;  1VQL V;  4W4K A;  5KHJ A;  3P3P A;  1ZSP A;  1E1R G;  4WCE V;  2E5L O;  3B4S A;  1XHX A;  1AIL A;  4GUN A;  4DO2 A;  1SQB H;  1KP3 A;  3JAR B;  4FLT A;  2Z3Y A;  2ZE8 A;  4N23 A;  2OIE A;  2Y4T A;  3SJC C;  3MAQ A;  3SJB C;  2JRI A;  3SR2 C;  1PNM A;  2R9I A;  1KKC A;  5C93 A;  4JI0 B;  3CB2 A;  3PN1 A;  3K08 A;  2K9P A;  3JAW B;  1TVK A;  3LUT B;  2YID A;  3ZED A;  3LSQ A;  5B66 Z;  5H2F Z;  4R7C A;  3OGI B;  1E79 G;  1PP9 H;  3H1J H;  1I94 B;  2YIC A;  4JYY A;  1AR1 B;  2KQX A;  3ETD A;  5JH7 B;  2Q0A A;  1N33 O;  1V55 B;  3HKD B;  2R72 A;  1LR1 A;  4GKK B;  1AP5 A;  2R9R B;  3K5O A;  3RYH B;  4DV4 B;  5GON A;  4Q6G A;  3N27 A;  1OV9 A;  4X62 O;  4RO2 A;  5LMN O;  5EBW C;  2NLJ C;  2UUB B;  2W0X A;  2QM4 A;  3SPI A;  1W0J G;  2QWP B;  5J2U B;  3ZRV A;  1PL4 A;  3QVN A;  2P90 A;  4DR1 B;  5KX5 A;  1YHQ V;  4B3M O;  1V54 C;  5LHH A;  1JJO A;  4UXN A;  1EFR G;  2B1I A;  2EIM B;  2XAS A;  4PA7 A;  2F4V B;  4PHZ A;  1B3Q A;  1JR9 A;  2KSD A;  5LP6 A;  5KHG A;  1MNG A;  2BSK A;  4XDL A;  1M9N A;  4MTG A;  4ZI7 A;  2VQE O;  1SC5 B;  4I9Q A;  2P4K A;  1I5Y A;  4I55 A;  3R65 A;  1XMO B;  4MVU A;  4BAY A;  2CGN A;  3CRR A;  3QF7 A;  4O2A B;  5BMV B;  1E1Q G;  5LOV B;  3EVK A;  1N32 B;  2CGO A;  3OMA B;  3HKC B;  1H8E G;  4QE7 A;  4UB6 Z;  3OM3 B;  5IY5 C;  5LXT B;  2CDY A;  4PDL A;  4JI0 O;  5JQG B;  2ZM6 B;  3K5N A;  2A06 H;  2HHH B;  4DV5 B;  4I0X B;  1VQK V;  3HKE A;  1IBK O;  1JX9 A;  3DGE A;  2HR3 A;  1FFX A;  2X0L A;  3TXS A;  3DSQ A;  4CS4 A;  1AP6 A;  5BR8 B;  3WFV A;  5K1P A;  4WFB V;  1XNQ B;  3WB2 A;  3CCR V;  1WA8 A;  4X9Q A;  1HNX B;  2UXD B;  4O4I A;  1PV0 A;  3GVM A;  3IAY A;  1IZ3 A;  3JCZ A;  2ITD C;  3RVY A;  4PA4 A;  3ASO C;  3FB8 C;  2LGW A;  3RN4 A;  1V54 B;  2UXB B;  3E83 A;  5LYJ B;  1TAE A;  1VQ7 V;  2UUB O;  4JI2 B;  3GWO A;  3N2G B;  1N4C A;  1UPG A;  4OPA A;  4HZ3 A;  1QU7 A;  4GX5 A;  1FS0 G;  3OAA G;  4DR1 O;  5IYD O;  4H44 B;  1S3J A;  3FB7 C;  1Q6H A;  1QVF U;  1NTM H;  1SQX H;  3OEH G;  4LFB B;  4LF4 B;  2QR4 A;  4LFA B;  4XBF A;  1GN6 A;  4DRX A;  2F4V O;  1MSD A;  2PF4 E;  1S5L Z;  4I9W A;  3NR7 A;  2QKC A;  3RYC B;  5B1B C;  3O65 A;  1YVW A;  1ZL8 B;  2X6A A;  1I7F A;  3J7A U;  5DEC A;  3OTF A;  1K34 A;  3D36 A;  4LH7 A;  5JJJ B;  2IU3 A;  5IY5 B;  4L8J A;  2DWD C;  1CP9 A;  4JI3 B;  4GLX A;  1KBH A;  3G80 A;  2FKX A;  3C3T A;  3CRA A;  4JI4 B;  1Q6I A;  5GTI Z;  3A2F A;  3VQW A;  4WFE A;  2CUG A;  4UCR A;  3JAL B;  2WA3 A;  2PUS A;  4BIU A;  5JCO C;  5C8Y A;  3IJ4 A;  1DF4 A;  2DQ0 A;  4X66 B;  2ZM6 O;  4AQY O;  2HHH O;  2Q7E A;  3ZRW B;  5LGT A;  4DV5 O;  1IBL B;  1ZWI C;  4BIZ A;  2AZ2 A;  2ZNI A;  4LR3 A;  4GX1 A;  4PD4 F;  1VQ8 V;  2YIB D;  3ASO B;  2WLL A;  5BR8 O;  1WNS A;  4ASU G;  4JTD B;  4RUE A;  3ZS8 C;  2Z0A A;  3BA9 A;  4GKJ O;  1SES A;  2A3Q A;  3CCL V;  3UO3 A;  1D5A A;  3QO5 A;  2RNB A;  3E8B A;  3RYF A;  2YI8 A;  1THZ A;  1SA0 A;  3RGB A;  4JV5 B;  4WFA V;  5KHK A;  1X4T A;  4PJ0 Z;  3ML0 A;  1XHZ A;  1OJH A;  5GW7 A;  5LBQ A;  2UXB O;  4O2B A;  5IE9 A;  3W7S A;  5B5E Z;  4JI2 O;  4JYB A;  4P30 A;  1L1F A;  2F23 A;  5EYP A;  2P22 C;  5B1B B;  4X1K A;  1HDJ A;  2EJR A;  3JYC A;  2WLK A;  1ZLZ A;  3UM7 A;  2EBO A;  4O4L A;  5LHI A;  1URF A;  2A79 B;  1M5I A;  3I55 V;  5J9P C;  1HR0 O;  5IYB O;  4LFA O;  2HVJ C;  3W7W A;  4FZ1 A;  4OGQ B;  4XDJ A;  1P84 F;  2PY5 A;  3IFX A;  4G27 B;  1YXB A;  3P3N A;  4MVM A;  4P9O A;  1VMG A;  1PKX A;  4JYA B;  1KUQ A;  2LFR A;  2GTS A;  3J81 N;  4KHP B;  4H0L B;  3EFF K;  3ABU A;  3FD9 A;  4UVC A;  1KYO F;  3HPL C;  4JI7 B;  2V4D A;  4F6R B;  3CCJ V;  2BTQ A;  2VWK A;  4GZR B;  3ZHS A;  1FKA O;  4UFZ A;  4ZOL B;  3E8H A;  2XAQ A;  4DXW A;  4MW3 A;  3B8M A;  3SDL A;  2K1E A;  3DC5 A;  3CE2 A;  1R6T A;  2JIZ G;  2ODM A;  5HFM A;  1FFT B;  5B1O A;  4LNU B;  1H8H G;  2EIL C;  1R1B A;  3A0H Z;  1NBM G;  5LHG A;  4O4H A;  1IBL O;  2QTS A;  4DW0 A;  1FXK A;  2X6C A;  1NJI W;  1MZF A;  3AK2 A;  4LF7 B;  2EZO A;  1N34 O;  1P4R A;  5E79 Z;  3M7M X;  2Q0O C;  2ZNJ A;  4JAS A;  2YDE A;  4U3J B;  3G6B A;  3RVZ A;  3B8N A;  2HKO A;  2FB5 A;  4G2K A;  3DXR A;  4DV3 O;  4LF8 B;  4WFH A;  1TA8 A;  4NXM B;  1WB8 A;  1I0H A;  3S3X A;  3CPW U;  5LA6 B;  3W7T A;  1SZT A;  2PYL A;  1SER A;  1Z5W A;  3OMI B;  4UCT A;  3E86 A;  3JD2 A;  4I50 A;  3N2K B;  4X1Y B;  4MT8 A;  4EFE A;  4H13 B;  2EIN B;  3FAV B;  3UCS C;  3OR6 C;  4JPR A;  4O4J A;  4CBC A;  3BPZ A;  3AEI A;  4TUY B;  4QJF B;  3O9O A;  2DN9 A;  4K0K O;  1A32 A;  3LDC A;  4JYA O;  1RP3 B;  2X6B A;  2ZT9 B;  4KHP O;  3CXC U;  4JF3 A;  4LWS B;  3OEE G;  1Y66 A;  1XEQ A;  3P32 A;  5GTH Z;  4JI7 O;  1GN2 A;  4BWA A;  2Q7H A;  3BAA A;  1RM1 C;  1XNR O;  2WLJ A;  3GWK C;  2ZIN A;  4E2L A;  1L0N H;  2QJ1 A;  3SPG A;  3T1Y B;  3SJA C;  1FJG B;  2JK5 C;  5CA1 B;  2PTM A;  1J5E B;  1DF5 A;  5CA0 B;  2JJ2 G;  4DUY B;  1F23 A;  2QE7 G;  3ZX6 A;  5J2T A;  4G28 B;  5LMU B;  4B3S B;  4CC5 A;  1M57 C;  1VF6 A;  4D7S A;  3B40 A;  1SET A;  1Y76 B;  2RDC A;  3IC9 A;  3E8F A;  2QWR B;  3MHS C;  4EB6 B;  4LF7 O;  1GTO A;  2BOB C;  1JQ0 A;  1U96 A;  2UUC B;  1OCZ B;  4X64 O;  4W4L A;  1HP8 A;  2XT9 A;  1FAF A;  1IX9 A;  3CRM A;  1VQO V;  3L75 H;  1H2K A;  1JPX A;  2LGQ A;  3WU2 Z;  2ZCE A;  4DR7 O;  1IVS A;  3HKB B;  1N36 B;  3BCC H;  2F66 C;  5ITZ B;  4LF8 O;  4U7N A;  2Q8V A;  4NXM O;  4CC6 A;  2RQ6 A;  3ZRX A;  5IWA O;  1RSO A;  1W2B U;  1WP7 A;  2EZP A;  4DV6 O;  2M6Y A;  5A2Q N;  4YJ3 A;  3JAS A;  3A8T A;  4X1I A;  3FB5 C;  3I56 V;  2VS0 A;  4B08 A;  3QO8 A;  2F1M A;  2EIM C;  2AW9 A;  1RM1 B;  2YSU B;  1G6U A;  1VAR A;  1NU1 H;  1SRY A;  2QKA A;  3ETQ A;  3CCS V;  1KEC A;  1GRJ A;  3AG1 C;  4DR3 B;  3H1L H;  1GAX A;  3OMN B;  4DW1 A;  4DR2 B;  3TCU A;  2EIJ B;  1XOU A;  5LP6 C;  2F43 G;  2XAH A;  4KP4 A;  4X65 O;  4CZZ A;  3AK1 A;  1M57 B;  2LP7 A;  1SKV A;  2CTQ A;  5EC2 C;  3T1Y O;  4FJC C;  1FJG O;  1TUB A;  3CJH A;  3D3Q A;  1BMF G;  4I5S A;  4I7Z B;  4DV7 B;  3TK1 A;  3OTO O;  5CBF A;  1TVK B;  2IJI A;  4DUY O;  2WLN A;  3SYA A;  4DUZ O;  5LMU O;  3CXH F;  2KB1 A;  3ABK C;  4LCU C;  1B06 A;  2E76 B;  3RFR A;  2JS3 A;  1FPO A;  4WFG A;  2XHB A;  4J10 A;  4LC1 A;  3ZRS A;  5JJN B;  1K33 A;  4IYI A;  3EHB B;  2W6J G;  1M56 C;  2ZDI A;  2EX3 A;  2Z5U A;  1HW7 A;  3K59 A;  1PM9 A;  3WB0 A;  1S5H C;  2DYR C;  5B3S C;  2ZQM A;  1NS1 A;  2PI5 A;  2IH1 C;  2ADQ B;  3RWR D;  5JVD A;  1MOF A;  2DE0 X;  3T1H B;  4MW8 A;  4YJ2 B;  1G8M A;  2QWN B;  4B7E A;  5FPO A;  1AVM A;  4JAU A;  3D8C A;  2EUL A;  1D5N A;  2FYU H;  3JSN A;  2GHY A;  2AHY A;  2GUZ A;  5KX5 B;  2BOC C;  3LDE A;  2NR5 A;  2RCV A;  1QVG U;  3AG1 B;  2JGD A;  1JA8 A;  1BSM A;  4MVO A;  1KKD A;  3BAB A;  3HR0 A;  2ZIO A;  5LP6 B;  1PNK A;  3Q4H A;  4IHJ A;  1R3K C;  1VQ4 V;  1KB9 F;  3TET A;  4IIJ A;  5TIS Z;  1S77 D;  2BSK B;  5FLX N;  5HFL A;  1VIB A;  5BMV A;  2XND G;  4ZI7 B;  5LOV A;  2QWQ B;  2Q73 A;  4DR3 O;  4TSF G;  2QDO A;  1S76 D;  4I55 B;  5LL6 Y;  4DR2 O;  4ZIB A;  4I4T A;  3B09 A;  2DWE C;  4MVZ A;  4DYL A;  4IGG A;  4C7U A;  2HVK C;  3D36 C;  1NTK H;  2D2C B;  3ABK B;  1F4M A;  3MDS A;  1K3E A;  1UJW B;  4FLX A;  1I94 O;  4DV2 B;  1CXZ B;  1QLN A;  1TUE B;  4R50 A;  2JDI G;  1P49 A;  1EN4 A;  4DV1 B;  1PD3 A;  5KMG A;  1RPR A;  4GX0 A;  1M56 B;  5DED A;  1HWY A;  4JI8 B;  5CB4 A;  3HKE B;  2W0F C;  4GCZ A;  4GKK O;  4F6E A;  1FFX B;  2DYR B;  5B3S B;  4CH3 A;  4DV4 O;  3A0B Z;  1Q8I A;  2ADP A;  3OT7 A;  5IYZ A;  2N04 A;  2XAF A;  2JGU A;  1WA8 B;  4NTY A;  4MS2 A;  4UCV A;  2ETN A;  1NR1 A;  4O4I B;  4ABM A;  3OW2 U;  3SYO A;  1M1K W;  1YTF D;  3JAK A;  1PL0 A;  1SQV H;  5L3F A;  3ZHU A;  1EZV H;  4CS2 A;  1NH2 D;  2HG5 C;  4DR5 B;  3T1H O;  5IYC O;  4K8Z A;  1NVP D;  1H2S B;  3RYI B;  1BT8 A;  3E89 A;  4K8X A;  2KKW A;  1BHA A;  4TT3 G;  3T1C A;  4Z1V A;  3CHX A;  3QO7 A;  4P9P A;  3E22 A;  1GH6 A;  2YXY A;  1IUR A;  4UV9 A;  4DRX B;  2H94 A;  4EFB A;  3ETG A;  5K1X A;  3APQ A;  3LSU A;  1XMO O;  1BGY H;  2HP8 A;  3ZJZ A;  4YHH B;  4U3F H;  2YC0 A;  4DR4 B;  2IJH A;  4NXN B;  4AIL C;  1GMG A;  2CTR A;  3CD6 V;  5AG2 A;  1XI1 A;  1N32 O;  3S3W A;  4X88 A;  4FLW A;  1VQ6 V;  3ZBH A;  4PEL A;  1YZB A;  1Q90 D;  2Y4U A;  4D6T H;  3ZMZ A;  1L8D A;  3CS5 A;  3G71 V;  2QM7 A;  4LBE C;  4NYK A;  1UFI A;  3E35 A;  3W7U A;  3CEI A;  2ZE5 A;  3PJS K;  2P5O A;  1K73 W;  2P4V A;  3ABL C;  1R3I C;  1WLE A;  5C8Y B;  2IJK A;  1XRE A;  1VF5 B;  4HBN A;  3STL C;  4B3T B;  3SYP A;  1AJQ A;  2LQT A;  2WSS G;  1VQN V;  5L3E A;  1XNQ O;  4JI8 O;  1OHH G;  4X8A A;  3KG2 A;  1HNX O;  2UXD O;  2JJ1 G;  4TQD A;  3ABT A;  5DM6 V;  2UUA B;  2WA4 A;  2WLL B;  3ZIA G;  3OR7 C;  4FLY A;  1SQF A;  1WPB A;  3QG5 A;  3RYF B;  1ZX3 A;  1QNM A;  3K58 A;  1SA0 B;  2Y0I A;  1JJ2 U;  1NZ6 A;  3ZHR A;  1FXK C;  4NVP A;  1QLE C;  1W59 A;  3IC7 A;  1H2G A;  5CN0 A;  5D5P A;  2RJZ A;  4DR5 O;  1VQ5 V;  4ZHQ A;  4O2B B;  1YTF B;  4LFB O;  4RQE A;  4LF4 O;  1YJN V;  2OIG A;  1YSC A;  4AI8 A;  3OFN G;  2JEX A;  4KUM A;  3K0G A;  5EYP B;  1DTO A;  3T2M A;  5H6R A;  1NH2 B;  2WLI A;  4O4L B;  3UT5 A;  2CH7 A;  1F7Y A;  3MHH C;  1NVP B;  2EIN C;  1O9H A;  1SF9 A;  1LNQ A;  2V7Q G;  4HNA A;  2P6J A;  3FFQ A;  2UU9 B;  1U97 A;  4J41 A;  4R8C A;  2YS8 A;  1B6Q A;  4JI3 O;  4YHH O;  3AK3 A;  4N21 A;  1NR7 A;  4JI4 O;  5L3C A;  3ABL B;  2JVD A;  1ZUQ A;  4FLZ A;  4LFC B;  1XMQ B;  5KUM A;  1JFF A;  4X66 O;  2Q9L A;  5KAF Z;  4CH5 A;  2BTQ B;  3K04 A;  4LNU A;  3F7Y C;  3VBB A;  1AI5 A;  1H2M A;  2OWO A;  4GX2 A;  1WP8 A;  1AJP A;  1HNZ B;  1JVM A;  1R6K A;  4WBN B;  3K9A A;  4LF9 B;  4O4H B;  1FYJ A;  1GN4 A;  1IXM A;  5FNV A;  5H6Q A;  1FXK B;  2PZS A;  3G67 A;  2LJ2 A;  1QLE B;  4FFB A;  1QR9 A;  4JV5 O;  1MA1 A;  3CME V;  1B04 A;  4FK5 C;  1EN6 A;  3JAT A;  4ZKI A;  1OCZ C;  4LH6 A;  4LF5 B;  4PDV A;  4X20 A;  1QHT A;  3DXR B;  1HNW B;  2BE3 A;  2YEV A;  1N0N A;  2P7T C;  4H33 A;  5EZY A;  3C3S A;  2DYS C;  1Y74 A;  4YIP A;  1F51 A;  3H1K H;  1I5X A;  4TV8 B;  3SYQ A;  2QA4 V;  2IH3 C;  2X7R B;  3JD1 A;  4Z2W A;  1KD1 W;  4OPH A;  1K7D A;  4I50 B;  4PI2 A;  5CBH A;  5A9G A;  2CTP A;  2AZ0 A;  5IJ9 A;  3FYE B;  2CAZ C;  4O4J B;  1IBM B;  4NTW A;  1EN5 A;  4H37 A;  2UU9 O;  3ZHQ A;  5H9C A;  5L3G A;  4WFF A;  2L35 A;  1DLB A;  5L3D A;  2MK3 A;  2A7W A;  5E1A C;  3F5W C;  2KG7 A;  2HEP A;  4LFC O;  3SJQ C;  1XMQ O;  3ZHT A;  2EIJ C;  2ARH A;  2E75 B;  1QBZ A;  1YIJ V;  2XTA A;  4NB5 A;  3ZMU A;  4UUJ C;  2GBO A;  2M7W A;  2AHZ A;  2YIA A;  1K9M W;  1Q43 A;  4J80 A;  4JZG A;  1VQ9 V;  5J2T B;  2ILM A;  4LF9 O;  1TGO A;  1Q7Y W;  4HAM A;  1K4C C;  2Q5Z A;  3ICX A;  1ARO P;  3AG2 B;  5KA5 A;  1VQM V;  3AG4 C;  4TV9 A;  2DYS B;  1Z2G A;  4EKW A;  2EIK C;  4MTX A;  4HYO A;  1K4D C;  1Q3E A;  2XAJ A;  4LF6 B;  4X62 B;  5JJE B;  1XIL A;  3RW0 A;  1S72 V;  4JI6 B;  2YXH A;  1VQP V;  4K3A A;  3QTC A;  1Q86 W;  3IGA C;  3ZMV A;  3CC2 V;  2PGG A;  3U0Z A;  1WAZ A;  4NTX A;  3K0D A;  2ATK C;  5IT9 N;  1JOY A;  5IJ0 A;  5JWP A;  1H38 A;  3KKY A;  3H1I H;  4B3M B;  1SQP H;  2ZDI C;  4E4E A;  4FLV A;  1T5E A;  2DW4 A;  1L0L H;  1OCC B;  5FPR A;  1Q6U A;  4QE9 A;  1AR4 A;  3B2E E;  3BVO A;  3AG3 C;  3CCU V;  4UB8 Z;  4YJ3 B;  3JD0 A;  4L87 A;  2QKS A;  4BW5 A;  3GB7 C;  4X1I B;  3I5D A;  2WLM A;  3JSL A;  4F4L A;  4JZ2 A;  3JAR A;  1SQQ H;  4BW9 A;  3OUF A;  3BEH A;  2VQE B;  1YJ9 V;  1IBM O;  3BA8 A;  4EEQ A;  4GYC B;  4JAV A;  1WB7 A;  3H01 A;  4J7K A;  3UKM A;  1YJW V;  1OCR C;  1ROP A;  3OUS A;  1DGS A;  3JAW A;  1H2L A;  4AHC A;  2HFE C;  1MAB G;  4PI0 A;  1QCE A;  2QGN A;  1NT2 B;  3R66 A;  1XDC A;  4RWU A;  1J5E O;  3ZHV A;  3SYC A;  1Y4M A;  3SPJ A;  5JH7 A;  4B3S O;  1M4U A;  3HKD A;  1GM7 A;  1IBK B;  1TUB B;  3CJH B;  2HLD G;  3AG4 B;  3CSX A;  3JCU Z;  3CRC A;  3RYH A;  2EIK B;  1KMI Z;  2Y69 C;  4J7J A;  2UUC O;  1BHB A;  4MVQ A;  2OCC C;  1WJZ A;  1H2N A;  2H8P C;  1Q5O A;  1XL4 A;  5GON B;  1R3L C;  2UXN A;  2F93 B;  2P67 A;  1N36 O;  5J2U A;  1I08 A;  4LF6 O;  1N8R W;  3ZMT A;  4JI6 O;  4FFK A;  5KLV H;  1YCI A;  1XUQ A;  5EBL C;  3VOU A;  4YJ2 A;  3ZN1 A;  3AG3 B;  2H3O A;  1Z5V A;  1KC8 W;  3JAM N;  1AI6 A;  4FIP C;  3UO2 A;  1YI2 V;  5JVD B;  2CE4 A;  2ITC C;  4CS3 A;  5BY1 A;  5KHI A;  3X2Q C;  3LSS A;  4FMT A;  1AI4 A;  2Q6A A;  3CWB H;  3CMA V;  4DR6 B;  2GUZ B;  5IDJ A;  2LW7 A;  3JD4 A;  4O2A A;  1OCR B;  3E8G A;  3THO A;  1EBO A;  2JGD B;  1S5J A;  4OX9 B;  2D3O W;  2ZXW C;  3HKC A;  5DN6 G;  3FKS G;  3VQV A;  2WPD G;  3Q4H B;  4PV1 B;  3M8A A;  4IHJ B;  4IIJ B;  4QPJ A;  3L74 H;  5LXT A;  3KZI Z;  4OXS A;  1K5S A;  3E2E A;  2Q4P A;  5JQG A;  2XUM A;  3BFR A;  3MD0 A;  3BRC A;  2N74 A;  4LP8 A;  4I0X A;  3H1H H;  1AI7 A;  2LW1 A;  3U10 A;  1FXV A;  4I4T B;  3L71 H;  4JTA B;  4K35 A;  4DV7 O;  4A5U B;  2AXT Z;  4QIW F;  2Y69 B;  4IL6 Z;  4AQY B;  2QSA A;  2UXC B;  4TWK A;  4PA3 A;  2OCC B;  1YDX A;  4KXR A;  1MMM A;  1BQZ A;  2C2A A;  2Q69 A;  4P2Z A;  3WG7 C;  4UVB A;  4CH6 A;  2FTK A;  3RT3 C;  4BR6 A;  1BS3 A;  4UVA A;  1LUV A;  3FYI B;  5KMG B;  2QWO B;  4FPP A;  5CB4 B;  1YEW A;  2OT5 A;  4GKJ B;  5FL7 G;  2GV9 A;  2W6I G;  2DOS A;  1EZJ A;  4DV0 B;  5LYJ A;  1VP7 A;  5IYZ B;  2Q7G A;  3CX5 F;  3N2G A;  4DK0 A;  4CH4 A;  2A0L A;  1K8A W;  4YIO A;  4TQF A;  1GKF A;  3U11 A;  3K57 A;  1VEW A;  3JAK B;  3X2Q B;  4X89 A;  3TXQ A;  3RYI A;  4QNH B;  3AG7 A;  1ZTE A;  3KCX A;  2HJF C;  1SZX A;  4RAI A;  2YI9 A;  4UCU A;  3RYC A;  3LNN A;  1ZL8 A;  2ZXW B;  2ZE7 A;  2DQ3 A;  2E3C A;  4FVM A;  4YXW G;  3T4Z A;  1FD9 A;  2B9Z A;  1NKD A;  4Q20 A;  1HR0 B;  1O9G A;  2AGA A;  4DR6 O;  1OZ0 A;  5LGN A;  4PA6 A;  2GSM B;  1BL8 A;  2IJJ A;  3CP1 A;  3B77 A;  3E22 B;  4OX9 O;  2B5U A;  3JAL A;  3G6E V;  2FML A;  3K9S A;  3D3I A;  2OTJ V;  3VQX A;  4YY3 B;  3L9D A;  3CRQ A;  1PPJ H;  1IXB A;  1EM1 A;  2WLH A;  3WG7 B;  1CEZ A;  2L6L A;  3ZRW A;  2O57 A;  1M90 W;  3K03 A;  2ZR2 A;  5CBG A;  4DV2 O;  3J80 N;  1R3J C;  2A9H A;  4J11 A;  3CCQ V;  5EK0 A;  3OGC C;  4DV1 O;  1P7B A;  4JTC B;  2UXC O;  2BCC H;  4MSW C;  5KAI Z;  3W7X A;  1PNL A;  4B7K A;  1KU9 A;  4NR1 A;  3CC4 V;  3F5T A;  2N05 A;  4NKG B;  1AB3 A;  1VF7 A;  2CK3 G;  1US6 A;  1N34 B;  1V9P A;  1MSW D;  5EC1 C;  3ASN C;  1M93 A;  5EIB D;  1DK1 A;  2BTO A;  4DV0 O;  5D5Q A;  4IYH A;  5LGU A;  2E74 B;  4DV3 B;  2VQF B;  2IW5 A;  1NQT A;  5KA6 A;  3WB1 A;  3ZN0 A;  3K06 A;  2Q67 A;  3ETE A;  4J7Z A;  2DJV A;  1GN3 A;  1X59 A;  4JGS A;  4X1K B;  3EXA A;  1G1X B;  1MZE A;  4ZHQ B;  4XDK A;  5KHH A;  3SGI A;  5EIB C;  2PI4 A;  3P30 A;  3ABM C;  1BQ0 A;  4J9Y B;  2F95 B;  1XL6 A;  2VWJ A;  1YF2 A;  1ENV A;  2QTO A;  3K5L A;  5JCO A;  2WLI B;  5CMU A;  1JCH A;  4DR4 O;  3UT5 B;  2CH7 B;  3ZMS A;  1Q81 W;  4NXN O;  1WN7 A;  4JI1 B;  3A0R A;  3QNE A;  3RBZ A;  1COW G;  4K0K B;  2XAG A;  4HNA B;  1R73 A;  1SS3 A;  2ZE6 A;  4PDR A;  4F6R A;  3KCY A;  4JI5 B;  2YUA A;  3CC7 V;  4R6Z A;  4MVR A;  4ZOL A;  1Y6X A;  4YY3 O;  5CA3 A;  4JAA A;  4Z1M G;  2QEX V;  2DMX A;  1XNR B;  3F7V C;  1XBL A;  3M99 B;  5BXZ A;  4WF9 V;  5BZB A;  1QR8 A;  1ZAU A;  4QPK A;  1JFF B;  3K5M A;  4B3T O;  3L70 H;  1K97 A;  3ASN B;  4WBN A;  2ZKO A;  2OCH A;  1KP2 A;  1GK9 A;  2VRZ A;  4IT5 A;  3H9V A;  4U3J A;  2UXX A;  2RMK B;  2RN9 A;  2ZR3 A;  3VQY A;  1K92 A;  2UUA O;  2R9A A;  3HB3 B;  3CCM V;  2YIB A;  4PDM A;  4UCS A;  3SPH A;  2XOK G;  1CPY A;  5FNV B;  1N0J A;  4X64 B;  1AJN A;  2OTL V;  4B3R B;  3SPC A;  1VF6 C;  2NNU A;  3AG2 C;  4MTF A;  5LA6 A;  2ZIM A;  3C90 A;  2Y48 A;  1Q82 W;  4FFB B;  4JYC A;  5KUK A;  1MG1 A;  4DR7 B;  2VQF O;  2G38 A;  4UCO A;  4RQF A;  2Y0P A;  3JAT B;  3DC6 A;  1SQG A;  2IBZ H;  3N2K A;  4ZBM A;  4X20 B;  4X1Y A;  3ABM B;  3G4S V;  4DK1 A;  1OCO C;  2JS5 A;  1QQC A;  2YEV B;  4TV8 A;  3LDD A;  1GM8 A;  4KL1 A;  5IWA B;  2B1G A;  3L73 H;  2OYQ A;  5EZY B;  3STZ C;  4KFM A;  2P06 A;  4DV6 B;  1Y74 B;  3FAV A;  4FM1 A;  2YXL A;  4FLU A;  4BIO A;  4TUY A;  1NTZ H;  1D2D A;  2R70 A;  2EJ7 A;  3K79 A;  4TOI A;  3ZCC A;  4J42 A;  3CCV V;  4J9Z B;  2LO1 A;  5B1A C;  1P7G A; 
#chains in the Genus database with same CATH homology
 1MAB G;  1OCC C;  3W7S A;  1QCE A;  5L3B A;  4JYB A;  4P30 A;  1L1F A;  5B1B B;  2XAF A;  3SYC A;  3CCE V;  4MVS A;  2EJR A;  1Y4M A;  3FB6 C;  1J95 A;  3JYC A;  2WLK A;  4MTO A;  3SPJ A;  3UM7 A;  2EBO A;  4MS2 A;  5LHI A;  1YIT V;  1NR1 A;  3OW2 U;  3SYO A;  1M1K W;  2A79 B;  1GM7 A;  1YTF D;  3LNM B;  3I55 V;  2WWW A;  5J9P C;  2HLD G;  3AG4 B;  5B1N A;  5IYB O;  2HVJ C;  1PL0 A;  3W7W A;  4PA9 A;  2EIK B;  4XDJ A;  5L3F A;  3IFX A;  4G27 B;  1F4N A;  2EIL B;  1NH2 D;  3BY6 A;  3K3W A;  2Y69 C;  4MVM A;  2HG5 C;  4P9O A;  2IU0 A;  1KQS U;  1G4Y B;  1PKX A;  1BHB A;  4MVQ A;  2OCC C;  5IYC O;  1R6N A;  1NVP D;  2LFR A;  2H8P C;  1XL4 A;  3EFF K;  1R3L C;  1GO3 F;  3E89 A;  2Q68 A;  3ABU A;  2UXN A;  2P67 A;  1BHA A;  4UVC A;  4TT3 G;  3HPL C;  4U7O A;  2JEU A;  3T1C A;  3CYO A;  3QO7 A;  1N8R W;  4P9P A;  3ZMT A;  1FXH A;  3CCJ V;  1RPO A;  1W0K G;  5EBL C;  3VOU A;  2WAM A;  4UV9 A;  3ZN1 A;  3E8H A;  3AG3 B;  2H94 A;  2XAQ A;  4DXW A;  1KC8 W;  4MW3 A;  3B8M A;  3ETG A;  1GM9 A;  2K1E A;  1AI6 A;  2JIZ G;  4FIP C;  3ZJZ A;  1YI2 V;  2V1D A;  5HFM A;  1FFT B;  2IJH A;  5B1O A;  1H8H G;  1ORQ C;  1GMG A;  3DTU B;  2EIL C;  4RUF A;  5LHG A;  3CD6 V;  1NBM G;  5EBM C;  1V55 C;  4X88 A;  1OCO B;  2ITC C;  2ZD9 A;  1VQ6 V;  3X2Q C;  3LSS A;  4FMT A;  1AI4 A;  2Q6A A;  2QM8 A;  3CMA V;  4PEL A;  5IDJ A;  1FXK A;  2X6C A;  1NJI W;  1WPX A;  3JD4 A;  4GT1 A;  3ZMZ A;  3G71 V;  2EZO A;  2QM7 A;  4LBE C;  1OCR B;  3E8G A;  4UV8 A;  3E35 A;  1EBO A;  3W7U A;  1P4R A;  2LFS A;  1S0V A;  4JAS A;  5B1A B;  2D3O W;  1K5Q A;  2ZXW C;  3PJS K;  1K73 W;  5DN6 G;  3FKS G;  3ABL C;  1R3I C;  3B8N A;  3RVZ A;  1WLE A;  2HKO A;  2WPD G;  4G2K A;  2IJK A;  4QPJ A;  3T4D A;  3STL C;  3SYP A;  1AJQ A;  3NXS A;  4WFH A;  4OXS A;  1K5S A;  3E2E A;  2WSS G;  1VQN V;  5L3E A;  3MD0 A;  3OE7 G;  3JD3 A;  1OHH G;  4LP8 A;  4X8A A;  3CPW U;  1VQL V;  3KG2 A;  1E1R G;  3W7T A;  1AI7 A;  4WCE V;  1SZT A;  1FXV A;  2JJ1 G;  3ABT A;  1SER A;  5DM6 V;  4JTA B;  2WLL B;  3OMI B;  4QIW F;  4DO2 A;  2Y69 B;  3E86 A;  3JD2 A;  3ZIA G;  3OR7 C;  1KP3 A;  4TWK A;  4PA3 A;  4MT8 A;  2OCC B;  2Z3Y A;  2EIN B;  4N23 A;  2C2A A;  2Q69 A;  4P2Z A;  3WG7 C;  4UVB A;  2FTK A;  1JJ2 U;  3OR6 C;  4JPR A;  4CBC A;  1PNM A;  1FXK C;  2R9I A;  3AEI A;  4UVA A;  5C93 A;  4QJF B;  3FYI B;  1QLE C;  4FPP A;  3IC7 A;  1H2G A;  3K08 A;  5CN0 A;  2OT5 A;  3LDC A;  3LUT B;  1VQ5 V;  5FL7 G;  3LSQ A;  2W6I G;  2X6B A;  1YTF B;  4RQE A;  1EZJ A;  1YJN V;  3CXC U;  1YSC A;  4R7C A;  3OFN G;  1E79 G;  4JF3 A;  2JEX A;  3OEE G;  4KUM A;  1Y66 A;  3K0G A;  1DTO A;  1AR1 B;  3P32 A;  3T2M A;  2A0L A;  3ETD A;  5H6R A;  1NH2 B;  1K8A W;  2WLI A;  1GKF A;  1RM1 C;  2WLJ A;  1V55 B;  3MHH C;  1NVP B;  4E2L A;  2EIN C;  3X2Q B;  4X89 A;  3SPG A;  2V7Q G;  1LNQ A;  2P6J A;  2R9R B;  2JK5 C;  4R8C A;  4QNH B;  1B6Q A;  1DF5 A;  2HJF C;  4N21 A;  2JJ2 G;  1NR7 A;  4RAI A;  1F23 A;  2QE7 G;  4RO2 A;  4G28 B;  5L3C A;  2ZXW B;  1M57 C;  2DQ3 A;  5EBW C;  3ABL B;  2NLJ C;  4YXW G;  3T4Z A;  1NKD A;  4Q20 A;  1SET A;  1OZ0 A;  5KUM A;  1W0J G;  3SPI A;  3E8F A;  5LGN A;  3ZRV A;  2P90 A;  4PA6 A;  2GSM B;  3MHS C;  1BL8 A;  2IJJ A;  1GTO A;  2BOB C;  3CP1 A;  1JQ0 A;  3B77 A;  1YHQ V;  1OCZ B;  3K04 A;  1V54 C;  3F7Y C;  3VBB A;  1AI5 A;  5LHH A;  2B5U A;  4UXN A;  1VQO V;  1EFR G;  2B1I A;  3G6E V;  2EIM B;  4GX2 A;  1AJP A;  2XAS A;  1JPX A;  4PA7 A;  1JVM A;  3D3I A;  2OTJ V;  1R6K A;  3K9A A;  4U7N A;  4XDL A;  1M9N A;  2WLH A;  1IXM A;  4MTG A;  3WG7 B;  1CEZ A;  5H6Q A;  3ZRW A;  3ZRX A;  1M90 W;  3K03 A;  2ZR2 A;  5CBG A;  1FXK B;  1W2B U;  2EZP A;  1I5Y A;  1R3J C;  2A9H A;  3R65 A;  3CCQ V;  4MVU A;  4BAY A;  1QLE B;  5EK0 A;  3OGC C;  1QR9 A;  1P7B A;  1E1Q G;  4JTC B;  3CME V;  4FK5 C;  4MSW C;  4ZKI A;  1OCZ C;  3OMA B;  3W7X A;  3FB5 C;  4PDV A;  1PNL A;  3I56 V;  1H8E G;  3QO8 A;  2YEV A;  4QE7 A;  2EIM C;  2P7T C;  4H33 A;  3CC4 V;  3OM3 B;  5IY5 C;  2DYS C;  4PDL A;  1RM1 B;  1F51 A;  2CK3 G;  2YSU B;  1SRY A;  1MSW D;  5EC1 C;  3ASN C;  3CCS V;  1I5X A;  1KEC A;  3SYQ A;  1VQK V;  3AG1 C;  2QA4 V;  1JX9 A;  2IH3 C;  2X7R B;  3DGE A;  2HR3 A;  3JD1 A;  3OMN B;  1KD1 W;  5LGU A;  2X0L A;  3TCU A;  2EIJ B;  1K7D A;  2IW5 A;  2F43 G;  5CBH A;  1NQT A;  5KA6 A;  2XAH A;  3WFV A;  4KP4 A;  4CZZ A;  4WFB V;  3ZN0 A;  1M57 B;  2LP7 A;  3CCR V;  3FYE B;  3K06 A;  5EC2 C;  2Q67 A;  3ETE A;  4FJC C;  4H37 A;  5H9C A;  3JCZ A;  1BMF G;  5L3G A;  4I5S A;  2ITD C;  4WFF A;  4JGS A;  3RVY A;  3TK1 A;  1DLB A;  5CBF A;  4PA4 A;  2IJI A;  3ASO C;  3FB8 C;  5L3D A;  2WLN A;  1V54 B;  2MK3 A;  4XDK A;  5E1A C;  3SYA A;  3F5W C;  3E83 A;  2PI4 A;  3P30 A;  2KB1 A;  3ABM C;  4J9Y B;  3ABK C;  1VQ7 V;  4LCU C;  1XL6 A;  3GWO A;  3SJQ C;  1ENV A;  2QTO A;  2EIJ C;  4HZ3 A;  4WFG A;  2WLI B;  4GX5 A;  5CMU A;  1JCH A;  1QBZ A;  1FS0 G;  1YIJ V;  4LC1 A;  3OAA G;  3ZMS A;  1Q81 W;  3A0R A;  5IYD O;  3QNE A;  3RBZ A;  1COW G;  3ZRS A;  2XAG A;  1K33 A;  1S3J A;  3EHB B;  3FB7 C;  4UUJ C;  2W6J G;  3ZMU A;  1M56 C;  2ZDI A;  1QVF U;  1R73 A;  2Z5U A;  3OEH G;  4PDR A;  2M7W A;  1S5H C;  2DYR C;  3CC7 V;  5B3S C;  4XBF A;  4R6Z A;  2AHZ A;  4MVR A;  2ZQM A;  2PI5 A;  1K9M W;  5CA3 A;  4Z1M G;  2QEX V;  4I9W A;  2IH1 C;  5B1B C;  1VQ9 V;  1Q7Y W;  2X6A A;  1MOF A;  3F7V C;  4HAM A;  1K34 A;  1K4C C;  4MW8 A;  3D36 A;  3M99 B;  1ARO P;  1G8M A;  2IU3 A;  3AG2 B;  4WF9 V;  5BZB A;  5KA5 A;  1QR8 A;  1VQM V;  4JAU A;  4QPK A;  5IY5 B;  3AG4 C;  2DWD C;  2DYS B;  1CP9 A;  4EKW A;  2GHY A;  2EIK C;  4MTX A;  2AHY A;  2BOC C;  4HYO A;  1K4D C;  1K97 A;  3ASN B;  3LDE A;  2XAJ A;  4WFE A;  3RW0 A;  1S72 V;  1QVG U;  1KP2 A;  3AG1 B;  1GK9 A;  1VQP V;  1Q86 W;  2UXX A;  3IGA C;  4MVO A;  3ZMV A;  3CC2 V;  1KKD A;  2ZR3 A;  3K0D A;  1K92 A;  4BIU A;  2ATK C;  1PNK A;  3HB3 B;  1R3K C;  3CCM V;  1VQ4 V;  3TET A;  1JOY A;  1DF4 A;  4PDM A;  2DQ0 A;  1H38 A;  1S77 D;  3SPH A;  2XOK G;  1CPY A;  5HFL A;  2XND G;  2ZDI C;  1AJN A;  3ZRW B;  5LGT A;  2OTL V;  3SPC A;  2DW4 A;  3AG2 C;  2NNU A;  4MTF A;  1OCC B;  1ZWI C;  4TSF G;  4BIZ A;  1S76 D;  4QE9 A;  4GX1 A;  3AG3 C;  1VQ8 V;  3CCU V;  2Y48 A;  1Q82 W;  4JYC A;  5KUK A;  1MG1 A;  3JD0 A;  4L87 A;  2DWE C;  2QKS A;  2WLL A;  3ASO B;  4BW5 A;  4MVZ A;  4RQF A;  3GB7 C;  4ASU G;  4JTD B;  2WLM A;  4F4L A;  4RUE A;  4ZBM A;  2HVK C;  3ABM B;  3G4S V;  3OUF A;  1SES A;  3ABK B;  1OCO C;  3CCL V;  2YEV B;  1F4M A;  3BEH A;  1YJ9 V;  1K3E A;  1GM8 A;  3LDD A;  1UJW B;  3QO5 A;  2B1G A;  3E8B A;  3STZ C;  4KFM A;  1QLN A;  1THZ A;  1TUE B;  4R50 A;  2JDI G;  4JAV A;  3UKM A;  3H01 A;  1YJW V;  1PD3 A;  4WFA V;  1RPR A;  3K79 A;  1M56 B;  4GX0 A;  1HWY A;  1OCR C;  1ROP A;  3OUS A;  3ML0 A;  2W0F C;  3ZCC A;  4GCZ A;  5GW7 A;  3CCV V;  5LBQ A;  4J9Z B;  5B1A C;  2DYR B;  2HFE C;  5B3S B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...