1K9MW

Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1k9mW00
1W2BU 2QEXV 4WCEV 1YJ9V 4WFBV 3I55V 3G6EV 3G4SV 3CCEV 3CCVV 2OTLV 3CCJV 3I56V 1KQSU 1VQKV 1VQOV 1K8AW 3CXCU 1YJNV 1QVGU 1Q7YW 1Q86W 3CC7V 3OW2U 1R73A 1VQ5V 3CCMV 3CMAV 1Q81W 1KC8W 1YI2V 1YHQV 1YITV 1VQMV 1VQ4V 3CPWU 1M90W 3CCSV 3G71V 1N8RW 3CCQV 3CD6V 1YIJV 1JJ2U 1M1KW 3CCRV 3CMEV 1VQ9V 3CC4V 1VQ6V 1Q82W 1QVFU 1K73W 4WF9V 5DM6V 4WFAV 1VQNV 1S72V 3CCUV 1KD1W 1K9MW 1NJIW 2OTJV 1VQLV 1VQ8V 1VQPV 2D3OW 3CC2V 1YJWV 2QA4V 1VQ7V 3CCLV
chains in the Genus database with same CATH superfamily
2W6JG 3FX7A 3P30A 3CCMV 3STZC 2HHHO 5IY5C 3DC6A 3MD0A 1NZ6A 3P3PA 2LGWA 3TXSA 1XL6A 3VBBA 5KMGA 2FB5A 2X7RB 4K0KB 1BGYH 1WAZA 4I55A 5L3EA 5IJ9B 4O4IA 2B9ZA 4P30A 2DOSA 4DR5O 3OR7C 2P5OA 4JTCB 2JVDA 1K34A 3SGIA 4FLZA 2PY5A 2E75B 1QR8A 5FNVA 1S0VA 3DTUB 5HFLA 2JS3A 2WLNA 4ZIBA 3U10A 4MTFA 5LP6C 4B7EA 3K59A 2XAHA 1TGOA 3K5OA 5JQGA 3D36C 1Q7YW 3SJAC 1XMOO 4GKJO 4DUZO 2UXNA 3LDDA 4FLTA 1BT8A 3W7WA 4LF4B 1Q90D 2HG5C 1UJWB 3JASA 4GX2A 1DF4A 2F43G 1KQSU 1FPOA 4PDMA 3QG5A 2P4VA 3CMAV 1YITV 4IYIA 4LFAO 2IU3A 5LMUB 1E1QG 1AI5A 4KUMA 2XAGA 4TV9B 4UB8Z 5E79Z 3JAWB 2VQFO 1NKDA 1OCCB 1BZKA 5CBFA 4GZRB 4AQYO 3L75H 4UV9A 4MVOA 5L3BA 1SQQH 1E1RG 1AP5A 4X89A 5EBWC 4JI4B 5IYCO 1Y67A 3WG7C 3L72H 4I9WA 5FPRA 3ZRWB 4JV5O 1HNZO 4DV2O 5IT9N 1N8RW 4LF5B 2ZIMA 1JJ2U 1PV0A 3ABLB 3E83A 1GRJA 1NS1A 1K73W 4X62O 4X66B 2QE7G 2LW7A 4HAMA 4AI8A 3ABUA 1PPJH 5JVDA 2ARHA 4QE7A 1W2BU 3RYHB 2Y4TA 1AP6A 3OUFA 1XMQO 1JOYA 4YIPA 1Q81W 3K79A 4TQDA 1TUBA 3WU2Z 4I7ZB 1U97A 4JI3B 1F4NA 1OZ0A 3JAKA 2VQEO 4J11A 5H5NA 3WFVA 2EBOA 2CE4A 1RSOB 4Z1VA 2PYLA 5CBHA 3SJBC 4LR3A 1W59A 4IHJB 1GN6A 1FFTB 2GSMB 3RVYA 1BHBA 4R7CA 4ASUG 1EN5A 2LJ2A 4BAYA 2XUMA 3JSNA 1WJZA 2OTJV 2YUAA 3HPLC 1AI7A 1YJ9V 2W0XA 4FIPC 2M7WA 5B66Z 1VQOV 1BQZA 3DC5A 3T1HO 4B3RB 1YSCA 2GUZB 2ETNA 2XNDG 2FTKA 3RYFA 4H0LB 2RMKB 1PP9H 1G1XB 4NXMO 4MT8A 1VMGA 2ZINA 3K5LA 4FLUA 1GM9A 4JI2O 3GB7C 3RGBA 3W7XA 4ZKIA 1R3LC 3L74H 3DXRB 2ADPA 2HP8A 1NT2B 5IWAB 1NBMG 2OWOA 2EIMC 1JFFA 2X6AA 2QKCA 3HKCB 3TJTA 2Q5ZA 5CA3A 3CCUV 4X1IB 3APOA 1V9PA 2JEXA 4PI0A 4IYHA 2YXYA 4GLXA 1G6UA 1UFIA 4JI8B 1FFXB 5BXZA 5LYJB 1EN4A 4DR4B 3JAMN 4LF7B 4DRXA 3IAYA 4MVUA 3K5MA 4DW1A 3H01A 2ZQMA 2XAQA 5BR8O 1NR7A 1K7DA 2AGAA 1YCIA 4MTOA 1I7FA 2DWDC 4RO2A 4C7UA 1IBKB 5EYPA 3AEIA 3W7TA 3JARB 2OTLV 3SYPA 1HNWO 1ZL8A 4G2KA 3GVMA 3OAAG 4O4HB 5B3SB 3LDEA 1YVWA 1NVPD 3G80A 4UCTA 1V54C 1JVMA 4KP4A 1JQ0A 2HKOA 2F93B 4K0KO 1IBLB 2Y48A 3SPGA 3ZHSA 3LSUA 1NTMH 1NTKH 3JATA 3CCLV 2ITCC 1RM1B 1N33O 1VARA 2QJ1A 4CS2A 1KP3A 4FFBB 1GN3A 2CGOA 3LSQA 2ZR3A 1X4TA 2Z0AA 3RBZA 3DSQA 4LFBB 3CJHB 4RWUA 1Q6HA 4YJ2B 1GAXA 4F4LA 3STLC 1SQGA 1QLEB 4UVBA 1R3IC 3CWBH 4NTXA 1MMMA 1XHZA 2FMLA 3CC2V 2Q68A 3JALA 3CRCA 1CP9A 4I50B 1PM9A 2FYUH 4O4LA 4NB5A 2OIEA 3MHSC 1NQTA 1TVKB 3F7YC 1ZX3A 4OX9B 1XILA 4DK1A 3K5NA 2PTMA 1QLNA 4EFEA 2BCCH 4QNHB 3FAVB 1YTFB 4LF4O 1E79G 1ZSPA 4G28B 4X1KA 5LMNB 3R65A 3ZMSA 1N0JA 3OMNB 4X1YA 4JAUA 4GYCB 3N27A 1FXKB 2IJHA 4MTGA 5ITZB 1YI2V 1IBMO 3SDLA 4YIOA 3CPWU 3O9OA 4UXNA 2OT5A 4FFKA 1ORQC 4MVSA 5D5QA 4F6RB 4WFAV 1GM7A 1SC5B 3ASNB 1SA0B 5JJEB 3OGIB 3FFQA 4R6ZA 3ABMB 3OMAB 1WLEA 2WWWA 2PZSA 3BFRA 5H6QA 5C93A 1KUQA 3OTFA 3H1KH 3FYEB 2HEPA 4FM2A 4LH7A 1GO3F 1QHTA 2H3OA 1NVPB 1WPBA 4ABMA 3BAAA 4DV4B 4LWSB 2V1DA 4CH4A 4B3MO 4DR1O 3K9AA 2IM9A 5JCOA 2RDCA 3QVNA 3K08A 1JR9A 1XNQB 4J41A 5IYZB 2A9HA 1H2MA 3BCCH 4LBEC 5J2TA 1OCCC 3EXAA 5FPOA 1S5JA 3CYOA 5EIBC 3KG2A 3OW2U 1Q5OA 2EINB 3ASOB 3ICXA 3FAVA 1IZ3A 1SKVA 1Z5VA 1S76D 3CC4V 3RYIB 4AILC 4X20B 4X65O 3ABLC 2JS5A 3IGAC 4OXSA 1SS3A 3OEHG 4B3RO 2R9RB 1R73A 3E8HA 1OJHA 2H94A 1EZVH 4FZ1A 4P2ZA 3C90A 4LP8A 2P6JA 1VF6C 2BTQA 1L8DA 1Y4MA 4O4JA 1NJIW 5KMGB 3E22A 4WFEA 2LQTA 1PNKA 1RP3B 3VQYA 4FK5C 4I55B 4O4IB 2UUBB 1N0NA 4YHHB 5IWAO 2VWJA 3THOA 2JRIA 1P7BA 4W4LA 1P7GA 2A7WA 1L0LH 2A79B 2EIKB 5FNVB 1GN4A 2K1EA 2DMXA 2NR5A 4D6TH 4XDLA 1WPXA 3ZMTA 5KAFZ 4DV5O 3L9DA 4DR4O 2IW5A 2MK3A 2QKSA 2KKWA 1H8EG 5B5EZ 5JQGB 2NLJC 1VQMV 4JI7B 3B77A 5JWPA 3X2QB 2ZM6O 3QNEA 3FD9A 3OT7A 3RFRA 3HR0A 4BWAA 1XDCA 4BIOA 1PL4A 3M8AA 1XOUA 2ZXWB 2Q9LA 3JASB 3B40A 1R6KA 2BOBC 3ZX6A 1KU9A 1MZEA 2A06H 4JYYA 4KHPO 4NR1A 5EIBD 4HZ3A 4Z2WA 1Q43A 2AW9A 4WFGA 3FB8C 4U7NA 4R8CA 4CC5A 5TISZ 4JI5B 3N2KA 2ZDIC 3GWKC 4JAAA 5LGNA 1WNSA 4RUFA 2ZE6A 4DK0A 3CCEV 5CA0A 4YY3O 1V55B 4LC1A 1Z2GA 3VQXA 2IBZH 3AG7A 3LSSA 2YEVA 1OV9A 5LL6Y 4NTYA 5DN6G 3LDCA 4CH3A 1AB3A 5JH7A 4DV3O 2WLIA 3NR7A 5L3CA 1J95A 3OMIB 5JVDB 3I56V 1H2SB 2Q8VA 1FD9A 1YDXA 2EIJB 5C8YA 2UUAB 4OX9O 3L73H 1KBHA 4DV7O 2BSKA 5LHIA 2CTRA 4PELA 5B3SC 1TUBB 3CEIA 4WF9V 3ZRXA 4KFMA 2E76B 5LXTA 2LW1A 2UXBB 2NNUA 3JAKB 1KP2A 4JI1O 1N34B 2DWEC 1UPGA 3C3SA 1K3EA 4TV8A 3M7MX 3A8TA 3J81N 1IDSA 3B09A 4DR2B 4JYAO 1RM1C 3E8BA 3KCYA 4ICGA 5L3DA 4DV0B 2Q7HA 3CHXA 1URFA 3T1CA 3ZIAG 3KZIZ 4KL1A 5KA5A 3CX5F 1VF5B 2IH3C 1QLEC 1ZWIC 4JI0B 2DE0X 1AI6A 2N74A 3ZMVA 4BR6A 2QWRB 3ABKB 2EZOA 1H8HG 2KG7A 1VQ4V 2Q7EA 3CCSV 2P4KA 2F1MA 4ZHQA 1XNRO 1XBLA 2IH1C 4B3TB 3K03A 3RYFB 4JZ2A 4DV4O 2WLLA 2EJ7A 1NU1H 1H38A 4OPAA 4PA7A 5GW7A 4X88A 1DLBA 1J5EO 4J9ZB 2L6LA 3OTOO 4DV1B 1VIBA 1YJNV 1QVGU 3S3XA 4FLYA 1AJQA 1XNQO 4RQEA 3JYCA 5LOVA 1WP7A 1YZBA 5KX5A 3WB2A 1FXKC 1TA8A 1JFFB 1TAEA 1B04A 3CSXA 1PD3A 4DUYO 2PI4A 2GTSA 4H13B 2L35A 3AG2B 3HKDB 1H2LA 2YIAA 4NYKA 2EJRA 3ASNC 3RW0A 4LF6B 2RNBA 3E35A 3ABMC 4IIJA 2UXXA 2YI9A 2A3QA 4CS4A 1SETA 4ZOLA 5E1AC 4DRXB 2R9AA 2YXHA 3ZRSA 1K9MW 1N36B 2UUCO 2QM7A 4JPRA 2UU9B 2CAZC 2UXDB 1NH2B 2CTWA 1QQCA 1FS0G 2F4VO 5EYPB 4FZ0A 1VQ5V 5EC1C 4E2LA 3FYIB 2PGGA 1L0NH 1AR4A 1ZL8B 4LFCB 1QNMA 1LUWA 2WLJA 4HNAA 3CMEV 3AG1B 1IXBA 5CA1A 3JCZA 4QIWF 2E5LB 3F7VC 4WCEV 4PA3A 5KHKA 3JATB 2YC0A 5BY1A 1I94B 1F4MA 2BE3A 3GWOA 1AR5A 3RYCA 2ITDC 2Q69A 2DJVA 3OEEG 4BW5A 5H2FZ 3B2EE 2PF4E 2EINC 3T4ZA 3ASOC 4J9YB 1NTZH 5EZYA 3UM7A 4FLWA 1M9NA 3H1LH 5J9PC 5DEDA 4Q6GA 3JALB 2N04A 4H37A 5KHJA 1FJGB 1O9GA 4O4LB 5K1XA 1YTFD 3E86A 2OIGA 3ZHQA 4FMTA 2IU0A 1HDJA 4TT3G 4LNUA 1DK1A 1EBOA 3E8GA 3CB2A 1Y74A 1THZA 1AILA 4UCOA 3HKDA 4L87A 3G67A 2Y4UA 4X1KB 1VQ7V 2W0FC 2QGNA 3I55V 1US6A 3MAQA 4X1YB 1YXBA 3CRAA 3TK1A 3ZHRA 3G71V 2Q0AA 1RPOA 4JI5O 3FB6C 1WP8A 2WLHA 2M6YA 4LF8O 3UT5A 3HKEA 2EIKC 1M5IA 3D3IA 1P49A 2XAJA 1IVSA 4MVMA 1CEZA 4X64B 4U3JA 2YIDA 4HBNA 5GONA 3AG3B 4CH5A 1Q82W 1HNXB 3X2QC 3SPJA 5K1PA 4DR3B 1VQPV 1GN2A 1Y66A 3JD3A 4PDRA 1F51A 5LGUA 1YF2A 2UUAO 2HJDA 4BIZA 2O57A 1VQKV 3CRMA 3OE7G 3ETGA 2IJKA 2C2AA 1N32B 2ZXWC 1B6QA 2KB1A 3ZHUA 1MG1A 1VF7A 4QE9A 3O65A 4AHCA 3H1HH 2UXBO 1R6NA 5KAIZ 4EFBA 1CXZB 1SRYA 4DXWA 5J2TB 2R72A 2JGDA 4DV0O 2IJIA 3BABA 1SZXA 1V55C 5EK0A 4J7KA 1M1KW 4FLXA 3NXSA 3ZJZA 3ZS8C 4LF8B 4XBFA 3SYQA 1S5LZ 1I08A 2WAMA 4WBNA 3HKBA 2X6CA 5F2VO 1ZAUA 1R3KC 4DR6B 1XREA 2DYRB 3EVKA 4O2BA 1M56B 2F95B 1HP8A 5LMUO 2Y0PA 1R3JC 1VF6A 2CDYA 2DYSB 2EIJC 2HVKC 4I4TA 4IL6Z 1K5SA 1FXHA 4B7KA 3CXHF 4KXRA 3SR2C 4CZZA 5KUKA 2BTQB 1LUVA 1NI8A 1S3JA 5B1NA 4O4JB 3QO7A 1SF9A 2VWKA 4JI4O 3ZN0A 1R1BA 3E22B 1YEWA 1K5QA 4PA4A 3SPHA 2V7QG 3TXQA 2YXLA 1H2GA 4LF5O 3RN4A 1XMOB 4JYBA 4GKJB 3CD6V 3H9VA 2YDEA 2GBOA 4X66O 3OUSA 3DGEA 4UB6Z 1WA8A 3CRQA 4NXNB 3F5TA 2P7TC 2CTQA 2HFEC 4GKKB 4LF6O 4O2AA 5EBLC 1QR9A 2WA3A 4GX1A 2ODMA 4BW9A 4FJCC 1M4UA 2AHZA 3PN1A 4R50A 3ABKC 4LFAB 5IJ0A 4JI3O 1OCZB 1ROPA 4QPKA 5LP6A 1QBZA 2VQFB 3P32A 3MDSA 1XI1A 4AQYB 2HJFC 3D36A 3LNNA 4WFHA 4P9OA 1VQ8V 2ATKC 4LCUC 4JZGA 4JF3A 1JCHA 3JD1A 3UO2A 3G4SV 1F7YA 1Q86W 2ZR2A 1FAFA 2Z3YA 4MVRA 1HNZB 3H1JH 2ZE7A 4DV2B 3BEHA 4QJFB 3E8FA 1EFRG 2Y69B 2QM8A 3OFNG 4X62B 4UVAA 2E5LO 5KHGA 4MTXA 2IJJA 3N2KB 2QWOB 3N2GA 3G6EV 1I94O 1M57B 1AR1B 1IURA 2AZ0A 3AG2C 5CB4A 5CA0B 3Q4HA 1XMQB 1GK9A 2ILMA 2LFRA 2Q4PA 4B3SB 1BMFG 4IGGA 3VOUA 3ZN1A 1AVMA 1GTOA 2YEVB 2D3OW 1RPRA 5JH7B 2QSAA 2DQ0A 2WLIB 3CCVV 3JSLA 1KB9F 3A0RA 1QU7A 5FL7G 3BA8A 5EBMC 4EEQA 5C8YB 2FL4A 3I5DA 3K57A 5LA6A 1MA1A 3CCRV 2BSKB 4PA6A 3OR6C 2P67A 2ZE5A 5BZBA 4JAVA 1KKDA 5LXTB 3AG1C 3U11A 3ZCCA 3K3WA 2ADQB 4JI8O 4TV8B 4CH6A 3QF7A 4LF7O 1SQXH 4UFZA 4UCVA 1OCRB 1GKFA 1PNLA 3CS5A 5B1BB 3BPZA 1KD1W 1T5EA 4G27B 3FB5C 1IBKO 2Q0OC 4NXMB 3W7SA 1SESA 5CBGA 1KECA 4P9PA 5L3GA 3WB0A 3CP1A 4JI2B 1IXMA 4EKWA 4I9QA 2HR3A 1MNGA 2EILB 2X0LA 1BCCH 4FPPA 4MSWC 1VQ9V 2KG7B 2XOKG 5LBQA 1HNXO 1ENVA 3EHBB 4ZHQB 2MW2B 1IBLO 3U0ZA 5EC2C 1Q8IA 2QWNB 1AJPA 2WLLB 2ZKOA 4UCUA 1IX9A 2LFSA 4N21A 5LHGA 4LFBO 3SJCC 1JMKC 1YIJV 5BR8B 5LOVB 5KX5B 2E74B 1Y6XA 3TETA 3ML0A 4I0XA 2DW4A 1QCEA 2GTAA 3FKSG 1F23A 4YJ3A 1HNWB 4TSFG 1Y76A 4RAIA 1I5XA 1M93A 2B1GA 2Y0IA 4IIJB 4K35A 2PYJA 3E89A 2BTOA 1DGSA 4JGSA 5LMNO 1NH2D 3B8MA 4ZOLB 2B1IA 3AG3C 4J10A 4GCZA 2QEXV 4DR6O 4K8ZA 2NN4A 3RWRD 1MABG 1ZUQA 1N33B 2CH7A 5FLXN 1K33A 1OCOB 1P4RA 4N23A 5CMUA 4UV8A 1U96A 2CTPA 1X59A 1EM1A 1G8MA 4HNAB 4MS2A 5JCOC 3SJQC 3SYCA 5KHHA 5CA1B 2Q67A 3IC7A 4EB6A 1JX9A 4TUYA 4JI6B 1KC8W 5BMVA 1K97A 2D2CB 3R66A 3RYCB 1KKCA 4GUNA 3A0HZ 3OD4A 4TQFA 2FKXA 2PUSA 4NXNO 1P84F 4YXWG 1VQLV 1BSMA 2YIBA 4BIUA 3BHPA 4GKKO 2QTSA 5EZYB 2JJ1G 2V4DA 5J2UA 2P06A 3CRRA 2G38A 4DR7B 2DYRC 2P90A 2YSUB 1IBMB 1M56C 4RUEA 4F6EA 3KCXA 5DM6V 4LNUB 4ZI7A 5HFMA 1ZLZA 2DYSC 1Y74B 2QWPB 4U7OA 1VEWA 2WA4A 1S77D 2ZT9B 2YICA 1D5NA 1JA8A 4PHZA 2LGQA 4D7TA 4UUJC 1D2DA 4UCRA 5IJ9A 2LO1A 3UT5B 4XDKA 3HKEB 4HYOA 4NVPA 3CXCU 2Q6AA 2JDIG 4B3MB 1W0KG 3P3NA 5B1AC 3ETEA 4DR1B 3KKYA 3K9SA 2H8PC 3M99B 4B3SO 4U3JB 1K92A 3AK3A 5GONB 3UCSC 3RT3C 2F23A 1VP7A 2QWQB 1VQNV 1OCZC 4GT1A 4A5UB 5IYDO 4W4KA 2JGUA 1B3QA 4CC6A 5L3FA 3W7UA 1Z5WA 1MZFA 2UUBO 3BA9A 4YHHO 2LP7A 2OYQA 1COWG 2W6IG 1SQVH 3K06A 3UKMA 2JJ2G 1DF5A 2CUGA 3B8NA 1K4DC 5LGTA 4X65B 3K0DA 2Y69C 2JEUA 2R70A 4K8XA 2QDOA 2Z5UA 2WLMA 2GV9A 3ETQA 4TV9A 3AG4B 1M57C 2JGDB 4JI7O 3JAWA 4FM1A 4J42A 1WN7A 3E2EA 2Q7GA 3ZRVA 3T4DA 4LF9B 2XHBA 1H2NA 2R9IA 4B08A 1HR0B 3S3WA 3CCQV 5JJNB 3T1YB 4WFBV 4WBNB 1FXVA 4OGQB 3HKBB 1PKXA 3ZRWA 2X6BA 3G6BA 3RVZA 3AK2A 2OCCB 2P22C 4O2BB 2WSSG 3LNMB 4PA9A 3F5WC 2DQ3A 5IE9A 4I4TB 1GH6A 4I5SA 2UXCB 3RYHA 5GTHZ 1MSWD 3K04A 2K9PA 5IDJA 1PL0A 4FLVA 4QPJA 5IY5B 4DV5B 3SPCA 4CBCA 1BS3A 3OGCC 1OHHG 4DV6B 2EX3A 2ZM6B 3ZHTA 1RSOA 4MW3A 5KUMA 4J7ZA 2OCHA 1OCRC 2YS8A 4NKGB 2XAFA 4RQFA 1WA8B 1Q6IA 1HW7A 3BVOA 3LUTB 5GTIZ 5B1BC 4IHJA 5B1OA 1K8AW 3VQWA 1CPYA 1AROP 4O2AB 4KHPB 3OM3B 4JASA 2JIZG 3CE2A 3EFFK 5IJ0B 4CS3A 1HWYA 1LR1A 2EILC 5LP6B 1Q6UA 1N34O 3K58A 1BHAA 1K4CC 1G4YB 5CN0A 4YY3B 4DR2O 4PD4F 2GUZA 1WB7A 4LH6A 1RFYA 2HHHB 2QR4A 3K0GA 3ETDA 3BY6A 2WLKA 5IYBO 5KHIA 4OPHA 1SERA 4DV3B 4JI0O 1LNQA 2EZPA 3N2GB 3DXRA 1XHXA 4JI6O 2VS0A 4DR5B 2ZDIA 3FB7C 5CB4B 3HKCA 4H44B 2BOCC 2RJZA 4QGPA 3Q4HB 4DV7B 1A32A 4D7SA 2KQXA 4B3TO 4X1IA 3A0BZ 5H9CA 4Z1MG 3MHHC 3C3TA 3J80N 3J7AU 3BRCA 3PJSK 2QTOA 3WG7B 4JI1B 1FFXA 5LYJA 4DR7O 4DV1O 3JD2A 1SQPH 1H2KA 3JD4A 1GM8A 1D5AA 4JYAB 4NTWA 1MSDA 5LHHA 4DUZB 1OCOC 3SYAA 5LA6B 1WB8A 3ABTA 3QTCA 1JJOA 2E3CA 3JARA 4TOIA 3IFXA 1AJNA 1TUEB 5B1AB 1EZJA 4O4HA 3AK1A 5A2QN 4U3FH 1BL8A 1M90W 1I5YA 3IJ4A 2AXTZ 2EULA 1O9HA 3ZMUA 4TWKA 3ZHVA 1XNRB 1BE3H 5A9GA 1N36O 3A2FA 2UU9O 2UXDO 3VQVA 4FFBA 2N05A 4UVCA 1KMIZ 2GHYA 1J5EB 2XT9A 4X8AA 3OTOB 3CJHA 4YJ2A 4LFCO 3D8CA 4JV5B 2CK3G 1EN6A 2AHYA 2YIBD 2JK5C 4DUYB 1XUQA 1B06A 4JTDB 1R6TA 4I50A 1GMGA 4J7JA 2QKAA 5KA6A 1TVKA 4DYLA 3T2MA 2ZCEA 2XTAA 4UCSA 1DTOA 3H1IH 2ZNIA 2A0LA 3ZBHA 3UO3A 4MW8A 1SQFA 4IT5A 4J80A 3WB1A 4H33A 2VQEB 5D5PA 2UUCB 4JYCA 1W0JG 2ZNJA 4K3AA 1FXKA 4I0XB 1L1FA 2WPDG 3ZMZA 2EIMB 5ITZA 2F4VB 1FJGO 2F66C 2RCVA 1XEQA 4JTAB 4YJ3B 4GX5A 2Q73A 5JJJB 1Y76B 1FYJA 2XASA 4F6RA 4LF9O 3JCUZ 3D3QA 4PV1B 1SA0A 1BQ0A 1HR0O 3APQA 4MVQA 3L70H 4PDVA 4WFFA 3T1YO 2GDSA 4GX0A 3HB3B 1AI4A 1S5HC 2VRZA 4PDLA 4L8JA 2HVJC 2QM4A 2CH7B 3QO8A 5AG2A 4XDJA 3T1HB 1MOFA 2AZ2A 4E4EA 1XL4A 1XQ8A 1SZTA 3ZEDA 1FKAO 2UXCO 4LWSA 3TGUH 2ZE8A 1NR1A 5H6RA 1I0HA 3UQ8A 2B5UA 4FVMA 2ZD9A 3CCJV 2RN9A 2HLDG 4MVZA 3QO5A 1KYOF 4FM0A 1V54B 4X64O 1Q3EA 1N4CA 2KSDA 5KLVH 5DECA 1YHQV 4EB6B 4DV6O 4TUYB 5IYZA 2YI8A 2ZIOA 1JPXA 5BMVB 4DO2A 1VQ6V 3AG4C 3SYOA 3SPIA 2CGNA 3L71H 4PJ0Z 4DR3O 4Q20A 2PI5A 2QA4V 1S72V 4PI2A 3B4SA 1ZTEA 3CC7V 1PNMA 5J2UB 3IC9A 1N32O 4ZBMA 3RYIA 2RQ6A 4X9QA 4DW0A 2OCCC 4X20A 1QVFU 1SQBH 3JD0A 3TCUA 4ZI7B 2DN9A 1YJWV
chains in the Genus database with same CATH topology
1Y66A 3JD3A 3CYOA 4PDRA 1F51A 5LGUA 4XDKA 3KG2A 4HYOA 4BIZA 1VQKV 3CXCU 2W6JG 2Q6AA 2JDIG 2IJKA 3ETGA 3OE7G 3P30A 1W0KG 2C2AA 5B1AC 3OW2U 3ETEA 3CCMV 3STZC 2EINB 1B6QA 2ZXWC 3ASOB 2H8PC 2KB1A 5IY5C 3M99B 3MD0A 1K92A 1S76D 1MG1A 4QE9A 3CC4V 1XL6A 3VBBA 1VQNV 1R6NA 1OCZC 4GT1A 3ABLC 2X7RB 5IYDO 3IGAC 1SRYA 4DXWA 4OXSA 5L3EA 5L3FA 3W7UA 4P30A 3OEHG 3OR7C 4JTCB 1K34A 2R9RB 2LP7A 1R73A 1COWG 2W6IG 2H94A 3E8HA 2IJIA 1V55C 1QR8A 5EK0A 3K06A 3UKMA 2JJ2G 1M1KW 4P2ZA 1S0VA 3NXSA 4LP8A 2P6JA 3ZJZA 1DF5A 3DTUB 1Y4MA 4XBFA 5HFLA 3SYQA 2WLNA 1NJIW 3B8NA 1K4DC 2WAMA 5LGTA 2X6CA 4WFEA 1PNKA 1R3KC 3K0DA 2Y69C 2JEUA 4MTFA 2DYRB 2XAHA 4FK5C 1M56B 1Q7YW 2Z5UA 2WLMA 3AG4B 1M57C 1P7BA 1R3JC 3E2EA 2UXNA 3LDDA 2DYSB 2EIJC 2HVKC 1K5SA 2A79B 3ZRVA 1FXHA 3T4DA 2EIKB 3W7WA 4CZZA 2R9IA 2HG5C 5KUKA 2K1EA 1UJWB 4XDLA 1S3JA 5B1NA 3CCQV 4GX2A 3QO7A 4WFBV 1FXVA 1WPXA 3ZN0A 1DF4A 1PKXA 2F43G 1K5QA 3ZRWA 4PA4A 3ZMTA 1KQSU 2X6BA 3SPHA 3RVZA 4PDMA 2V7QG 2OCCB 2IW5A 3CMAV 2MK3A 2QKSA 1YITV 1H2GA 1H8EG 2IU3A 2NLJC 1E1QG 1AI5A 1VQMV 3B77A 4KUMA 2XAGA 4JYBA 3QNEA 2WSSG 3LNMB 3X2QB 3CD6V 4PA9A 1NKDA 1OCCB 3F5WC 5CBFA 2DQ3A 4UV9A 3OUSA 4MVOA 3DGEA 4I5SA 5L3BA 1MSWD 1E1RG 3K04A 5IDJA 4X89A 5EBWC 1PL0A 2ZXWB 2P7TC 2HFEC 4QPJA 5IY5B 5IYCO 1R6KA 2BOBC 5EBLC 1QR9A 4GX1A 3WG7C 3ZRWB 4FJCC 4I9WA 3SPCA 4CBCA 2AHZA 3OGCC 4HZ3A 1OHHG 4R50A 3ABKC 4WFGA 3FB8C 4U7NA 1N8RW 1OCZB 4R8CA 1JJ2U 1ROPA 3ABLB 4QPKA 3E83A 1QBZA 3P32A 1K73W 2HJFC 3D36A 2QE7G 2ZDIC 4MW3A 4HAMA 5KUMA 4WFHA 4P9OA 1VQ8V 2ATKC 5LGNA 1OCRC 3ABUA 4LCUC 2XAFA 4QE7A 4JF3A 1JCHA 3JD1A 4RUFA 4RQFA 3LUTB 1W2BU 5B1BC 3G4SV 3CCEV 5B1OA 3OUFA 1V55B 4LC1A 1K8AW 1CPYA 1Q86W 1AROP 1JOYA 1Q81W 2ZR2A 2Z3YA 3K79A 3OM3B 4MVRA 4JASA 2JIZG 3BEHA 4QJFB 3LSSA 2YEVA 3EFFK 3E8FA 1EFRG 1F4NA 1OZ0A 5DN6G 2Y69B 1HWYA 3LDCA 2EILC 2QM8A 3OFNG 4UVAA 3WFVA 2EBOA 2WLIA 4MTXA 2IJJA 5L3CA 1BHAA 1J95A 5CBHA 3G6EV 1M57B 1AR1B 3OMIB 1K4CC 1G4YB 3AG2C 3I56V 5CN0A 2EIJB 1FFTB 1GK9A 2GSMB 3RVYA 2LFRA 5LHIA 3K0GA 3ETDA 4PELA 3BY6A 4R7CA 1BHBA 4ASUG 1BMFG 3VOUA 2WLKA 5B3SC 3ZN1A 4BAYA 5IYBO 3ZRXA 1GTOA 4KFMA 4WF9V 2YEVB 2OTJV 2D3OW 1SERA 2NNUA 1KP2A 1RPRA 3HPLC 1AI7A 2DQ0A 1LNQA 1YJ9V 4FIPC 2DWEC 2M7WA 2WLIB 1K3EA 2EZPA 3CCVV 3A0RA 5FL7G 1VQOV 1RM1C 3E8BA 2ZDIA 3FB7C 5EBMC 5L3DA 2BOCC 1YSCA 3T1CA 3ZIAG 2XNDG 3CCRV 2FTKA 4PA6A 5H9CA 4Z1MG 3MHHC 3OR6C 5KA5A 2P67A 5BZBA 4JAVA 1KKDA 2IH3C 3PJSK 4MT8A 3AG1C 2QTOA 1QLEC 1ZWIC 3WG7B 3ZCCA 3K3WA 1AI6A 3ZMVA 3ABKB 3JD2A 1GM9A 2EZOA 3GB7C 3JD4A 3W7XA 4ZKIA 1GM8A 1R3LC 1H8HG 1NBMG 1VQ4V 2EIMC 3CCSV 5LHHA 2X6AA 1OCRB 1GKFA 1PNLA 2IH1C 1OCOC 3SYAA 3K03A 5B1BB 3ABTA 5CA3A 3CCUV 1KD1W 2WLLA 4G27B 3FB5C 1H38A 3W7SA 2JEXA 1SESA 5CBGA 1KECA 4PA7A 3IFXA 1AJNA 1TUEB 5B1AB 5GW7A 4P9PA 4X88A 1EZJA 5L3GA 1DLBA 4J9ZB 1YJNV 1QVGU 3CP1A 1IXMA 1AJQA 4EKWA 2HR3A 1BL8A 2EILB 2X0LA 4RQEA 1M90W 1I5YA 4MVUA 3JYCA 4FPPA 3H01A 4MSWC 2ZQMA 1FXKC 1VQ9V 2XAQA 2XOKG 3ZMUA 5LBQA 4TWKA 1ENVA 1NR7A 1PD3A 1K7DA 3EHBB 2PI4A 3AG2B 5EC2C 4MTOA 2DWDC 4RO2A 4UVCA 1AJPA 3AEIA 3W7TA 2WLLB 2OTLV 2EJRA 3ASNC 3SYPA 3RW0A 2GHYA 2LFSA 4G2KA 4X8AA 4N21A 3E35A 3ABMC 5B3SB 3OAAG 5LHGA 3LDEA 1NVPD 2UXXA 1V54C 1YIJV 1JVMA 4KP4A 2CK3G 1SETA 5E1AC 1JQ0A 2AHYA 2HKOA 2JK5C 3ZRSA 3TETA 1K9MW 2Y48A 3ML0A 4JTDB 2QM7A 4JPRA 3SPGA 1GMGA 3CCLV 2ITCC 1RM1B 1NH2B 2DW4A 1FS0G 1QCEA 5KA6A 1KP3A 3FKSG 1F23A 3T2MA 4TSFG 1VQ5V 4RAIA 5EC1C 1I5XA 3FYIB 2ZR3A 3LSQA 4E2LA 3RBZA 1DTOA 2B1GA 2A0LA 2WLJA 4F4LA 3CMEV 3E89A 3STLC 3AG1B 1QLEB 4JGSA 4UVBA 1NH2D 4MW8A 1R3IC 3B8MA 3JCZA 2B1IA 3AG3C 4GCZA 4H33A 2QEXV 3CC2V 4QIWF 2Q68A 3F7VC 4JYCA 1W0JG 4WCEV 1CP9A 4PA3A 1MABG 3ZMZA 1FXKA 1L1FA 2WPDG 2EIMB 1F4MA 3GWOA 3MHSC 1NQTA 1K33A 3F7YC 4JTAB 2ITDC 4GX5A 1OCOB 1P4RA 4N23A 5CMUA 4UV8A 2Q69A 3OEEG 2XASA 4BW5A 1QLNA 4QNHB 1YTFB 2EINC 3T4ZA 1E79G 1G8MA 4G28B 3ASOC 4MS2A 4J9YB 3R65A 3SJQC 4MVQA 4WFFA 4PDVA 3SYCA 3UM7A 1M9NA 3ZMSA 4GX0A 3HB3B 1AI4A 1S5HC 3OMNB 4JAUA 5J9PC 4PDLA 4H37A 2Q67A 3IC7A 2HVJC 1JX9A 1FXKB 3QO8A 2IJHA 4MTGA 1YTFD 1KC8W 1YI2V 4XDJA 3E86A 1K97A 1MOFA 4FMTA 2IU0A 3CPWU 4TT3G 4UXNA 2OT5A 1XL4A 1EBOA 1SZTA 1ORQC 3E8GA 4MVSA 1THZA 4WFAV 1GM7A 3ASNB 4L87A 4YXWG 1NR1A 1VQLV 5H6RA 1VQ7V 2W0FC 4BIUA 4R6ZA 2B5UA 3ABMB 3OMAB 3I55V 2ZD9A 1WLEA 2WWWA 2JJ1G 3CCJV 2HLDG 4MVZA 3QO5A 1V54B 5H6QA 5C93A 3TK1A 1YHQV 2DYRC 2P90A 2YSUB 3G71V 3FYEB 1M56C 1JPXA 1RPOA 4RUEA 4DO2A 3FB6C 1VQ6V 3AG4C 1GO3F 3SYOA 5DM6V 3SPIA 2WLHA 1NVPB 5HFMA 4Q20A 2PI5A 2DYSC 2QA4V 1S72V 2EIKC 2V1DA 3D3IA 4U7OA 1S77D 2XAJA 1CEZA 4MVMA 3CC7V 3K9AA 1PNMA 4ZBMA 3K08A 3AG3B 2OCCC 1Q82W 1QVFU 4UUJC 2A9HA 3JD0A 3X2QC 3TCUA 3SPJA 4LBEC 1OCCC 1VQPV 1YJWV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2B U;  2QEX V;  4WCE V;  1YJ9 V;  4WFB V;  3I55 V;  3G6E V;  3G4S V;  3CCE V;  3CCV V;  2OTL V;  3CCJ V;  3I56 V;  1KQS U;  1VQK V;  1VQO V;  1K8A W;  3CXC U;  1YJN V;  1QVG U;  1Q7Y W;  1Q86 W;  3CC7 V;  3OW2 U;  1R73 A;  1VQ5 V;  3CCM V;  3CMA V;  1Q81 W;  1KC8 W;  1YI2 V;  1YHQ V;  1YIT V;  1VQM V;  1VQ4 V;  3CPW U;  1M90 W;  3CCS V;  3G71 V;  1N8R W;  3CCQ V;  3CD6 V;  1YIJ V;  1JJ2 U;  1M1K W;  3CCR V;  3CME V;  1VQ9 V;  3CC4 V;  1VQ6 V;  1Q82 W;  1QVF U;  1K73 W;  4WF9 V;  5DM6 V;  4WFA V;  1VQN V;  1S72 V;  3CCU V;  1KD1 W;  1K9M W;  1NJI W;  2OTJ V;  1VQL V;  1VQ8 V;  1VQP V;  2D3O W;  3CC2 V;  1YJW V;  2QA4 V;  1VQ7 V;  3CCL V; 
#chains in the Genus database with same CATH topology
 2W6J G;  3FX7 A;  3P30 A;  3CCM V;  3STZ C;  2HHH O;  5IY5 C;  3DC6 A;  3MD0 A;  1NZ6 A;  3P3P A;  2LGW A;  3TXS A;  1XL6 A;  3VBB A;  5KMG A;  2FB5 A;  2X7R B;  4K0K B;  1BGY H;  1WAZ A;  4I55 A;  5L3E A;  5IJ9 B;  4O4I A;  2B9Z A;  4P30 A;  2DOS A;  4DR5 O;  3OR7 C;  2P5O A;  4JTC B;  2JVD A;  1K34 A;  3SGI A;  4FLZ A;  2PY5 A;  2E75 B;  1QR8 A;  5FNV A;  1S0V A;  3DTU B;  5HFL A;  2JS3 A;  2WLN A;  4ZIB A;  3U10 A;  4MTF A;  5LP6 C;  4B7E A;  3K59 A;  2XAH A;  1TGO A;  3K5O A;  5JQG A;  3D36 C;  1Q7Y W;  3SJA C;  1XMO O;  4GKJ O;  4DUZ O;  2UXN A;  3LDD A;  4FLT A;  1BT8 A;  3W7W A;  4LF4 B;  1Q90 D;  2HG5 C;  1UJW B;  3JAS A;  4GX2 A;  1DF4 A;  2F43 G;  1KQS U;  1FPO A;  4PDM A;  3QG5 A;  2P4V A;  3CMA V;  1YIT V;  4IYI A;  4LFA O;  2IU3 A;  5LMU B;  1E1Q G;  1AI5 A;  4KUM A;  2XAG A;  4TV9 B;  4UB8 Z;  5E79 Z;  3JAW B;  2VQF O;  1NKD A;  1OCC B;  1BZK A;  5CBF A;  4GZR B;  4AQY O;  3L75 H;  4UV9 A;  4MVO A;  5L3B A;  1SQQ H;  1E1R G;  1AP5 A;  4X89 A;  5EBW C;  4JI4 B;  5IYC O;  1Y67 A;  3WG7 C;  3L72 H;  4I9W A;  5FPR A;  3ZRW B;  4JV5 O;  1HNZ O;  4DV2 O;  5IT9 N;  1N8R W;  4LF5 B;  2ZIM A;  1JJ2 U;  1PV0 A;  3ABL B;  3E83 A;  1GRJ A;  1NS1 A;  1K73 W;  4X62 O;  4X66 B;  2QE7 G;  2LW7 A;  4HAM A;  4AI8 A;  3ABU A;  1PPJ H;  5JVD A;  2ARH A;  4QE7 A;  1W2B U;  3RYH B;  2Y4T A;  1AP6 A;  3OUF A;  1XMQ O;  1JOY A;  4YIP A;  1Q81 W;  3K79 A;  4TQD A;  1TUB A;  3WU2 Z;  4I7Z B;  1U97 A;  4JI3 B;  1F4N A;  1OZ0 A;  3JAK A;  2VQE O;  4J11 A;  5H5N A;  3WFV A;  2EBO A;  2CE4 A;  1RSO B;  4Z1V A;  2PYL A;  5CBH A;  3SJB C;  4LR3 A;  1W59 A;  4IHJ B;  1GN6 A;  1FFT B;  2GSM B;  3RVY A;  1BHB A;  4R7C A;  4ASU G;  1EN5 A;  2LJ2 A;  4BAY A;  2XUM A;  3JSN A;  1WJZ A;  2OTJ V;  2YUA A;  3HPL C;  1AI7 A;  1YJ9 V;  2W0X A;  4FIP C;  2M7W A;  5B66 Z;  1VQO V;  1BQZ A;  3DC5 A;  3T1H O;  4B3R B;  1YSC A;  2GUZ B;  2ETN A;  2XND G;  2FTK A;  3RYF A;  4H0L B;  2RMK B;  1PP9 H;  1G1X B;  4NXM O;  4MT8 A;  1VMG A;  2ZIN A;  3K5L A;  4FLU A;  1GM9 A;  4JI2 O;  3GB7 C;  3RGB A;  3W7X A;  4ZKI A;  1R3L C;  3L74 H;  3DXR B;  2ADP A;  2HP8 A;  1NT2 B;  5IWA B;  1NBM G;  2OWO A;  2EIM C;  1JFF A;  2X6A A;  2QKC A;  3HKC B;  3TJT A;  2Q5Z A;  5CA3 A;  3CCU V;  4X1I B;  3APO A;  1V9P A;  2JEX A;  4PI0 A;  4IYH A;  2YXY A;  4GLX A;  1G6U A;  1UFI A;  4JI8 B;  1FFX B;  5BXZ A;  5LYJ B;  1EN4 A;  4DR4 B;  3JAM N;  4LF7 B;  4DRX A;  3IAY A;  4MVU A;  3K5M A;  4DW1 A;  3H01 A;  2ZQM A;  2XAQ A;  5BR8 O;  1NR7 A;  1K7D A;  2AGA A;  1YCI A;  4MTO A;  1I7F A;  2DWD C;  4RO2 A;  4C7U A;  1IBK B;  5EYP A;  3AEI A;  3W7T A;  3JAR B;  2OTL V;  3SYP A;  1HNW O;  1ZL8 A;  4G2K A;  3GVM A;  3OAA G;  4O4H B;  5B3S B;  3LDE A;  1YVW A;  1NVP D;  3G80 A;  4UCT A;  1V54 C;  1JVM A;  4KP4 A;  1JQ0 A;  2HKO A;  2F93 B;  4K0K O;  1IBL B;  2Y48 A;  3SPG A;  3ZHS A;  3LSU A;  1NTM H;  1NTK H;  3JAT A;  3CCL V;  2ITC C;  1RM1 B;  1N33 O;  1VAR A;  2QJ1 A;  4CS2 A;  1KP3 A;  4FFB B;  1GN3 A;  2CGO A;  3LSQ A;  2ZR3 A;  1X4T A;  2Z0A A;  3RBZ A;  3DSQ A;  4LFB B;  3CJH B;  4RWU A;  1Q6H A;  4YJ2 B;  1GAX A;  4F4L A;  3STL C;  1SQG A;  1QLE B;  4UVB A;  1R3I C;  3CWB H;  4NTX A;  1MMM A;  1XHZ A;  2FML A;  3CC2 V;  2Q68 A;  3JAL A;  3CRC A;  1CP9 A;  4I50 B;  1PM9 A;  2FYU H;  4O4L A;  4NB5 A;  2OIE A;  3MHS C;  1NQT A;  1TVK B;  3F7Y C;  1ZX3 A;  4OX9 B;  1XIL A;  4DK1 A;  3K5N A;  2PTM A;  1QLN A;  4EFE A;  2BCC H;  4QNH B;  3FAV B;  1YTF B;  4LF4 O;  1E79 G;  1ZSP A;  4G28 B;  4X1K A;  5LMN B;  3R65 A;  3ZMS A;  1N0J A;  3OMN B;  4X1Y A;  4JAU A;  4GYC B;  3N27 A;  1FXK B;  2IJH A;  4MTG A;  5ITZ B;  1YI2 V;  1IBM O;  3SDL A;  4YIO A;  3CPW U;  3O9O A;  4UXN A;  2OT5 A;  4FFK A;  1ORQ C;  4MVS A;  5D5Q A;  4F6R B;  4WFA V;  1GM7 A;  1SC5 B;  3ASN B;  1SA0 B;  5JJE B;  3OGI B;  3FFQ A;  4R6Z A;  3ABM B;  3OMA B;  1WLE A;  2WWW A;  2PZS A;  3BFR A;  5H6Q A;  5C93 A;  1KUQ A;  3OTF A;  3H1K H;  3FYE B;  2HEP A;  4FM2 A;  4LH7 A;  1GO3 F;  1QHT A;  2H3O A;  1NVP B;  1WPB A;  4ABM A;  3BAA A;  4DV4 B;  4LWS B;  2V1D A;  4CH4 A;  4B3M O;  4DR1 O;  3K9A A;  2IM9 A;  5JCO A;  2RDC A;  3QVN A;  3K08 A;  1JR9 A;  1XNQ B;  4J41 A;  5IYZ B;  2A9H A;  1H2M A;  3BCC H;  4LBE C;  5J2T A;  1OCC C;  3EXA A;  5FPO A;  1S5J A;  3CYO A;  5EIB C;  3KG2 A;  3OW2 U;  1Q5O A;  2EIN B;  3ASO B;  3ICX A;  3FAV A;  1IZ3 A;  1SKV A;  1Z5V A;  1S76 D;  3CC4 V;  3RYI B;  4AIL C;  4X20 B;  4X65 O;  3ABL C;  2JS5 A;  3IGA C;  4OXS A;  1SS3 A;  3OEH G;  4B3R O;  2R9R B;  1R73 A;  3E8H A;  1OJH A;  2H94 A;  1EZV H;  4FZ1 A;  4P2Z A;  3C90 A;  4LP8 A;  2P6J A;  1VF6 C;  2BTQ A;  1L8D A;  1Y4M A;  4O4J A;  1NJI W;  5KMG B;  3E22 A;  4WFE A;  2LQT A;  1PNK A;  1RP3 B;  3VQY A;  4FK5 C;  4I55 B;  4O4I B;  2UUB B;  1N0N A;  4YHH B;  5IWA O;  2VWJ A;  3THO A;  2JRI A;  1P7B A;  4W4L A;  1P7G A;  2A7W A;  1L0L H;  2A79 B;  2EIK B;  5FNV B;  1GN4 A;  2K1E A;  2DMX A;  2NR5 A;  4D6T H;  4XDL A;  1WPX A;  3ZMT A;  5KAF Z;  4DV5 O;  3L9D A;  4DR4 O;  2IW5 A;  2MK3 A;  2QKS A;  2KKW A;  1H8E G;  5B5E Z;  5JQG B;  2NLJ C;  1VQM V;  4JI7 B;  3B77 A;  5JWP A;  3X2Q B;  2ZM6 O;  3QNE A;  3FD9 A;  3OT7 A;  3RFR A;  3HR0 A;  4BWA A;  1XDC A;  4BIO A;  1PL4 A;  3M8A A;  1XOU A;  2ZXW B;  2Q9L A;  3JAS B;  3B40 A;  1R6K A;  2BOB C;  3ZX6 A;  1KU9 A;  1MZE A;  2A06 H;  4JYY A;  4KHP O;  4NR1 A;  5EIB D;  4HZ3 A;  4Z2W A;  1Q43 A;  2AW9 A;  4WFG A;  3FB8 C;  4U7N A;  4R8C A;  4CC5 A;  5TIS Z;  4JI5 B;  3N2K A;  2ZDI C;  3GWK C;  4JAA A;  5LGN A;  1WNS A;  4RUF A;  2ZE6 A;  4DK0 A;  3CCE V;  5CA0 A;  4YY3 O;  1V55 B;  4LC1 A;  1Z2G A;  3VQX A;  2IBZ H;  3AG7 A;  3LSS A;  2YEV A;  1OV9 A;  5LL6 Y;  4NTY A;  5DN6 G;  3LDC A;  4CH3 A;  1AB3 A;  5JH7 A;  4DV3 O;  2WLI A;  3NR7 A;  5L3C A;  1J95 A;  3OMI B;  5JVD B;  3I56 V;  1H2S B;  2Q8V A;  1FD9 A;  1YDX A;  2EIJ B;  5C8Y A;  2UUA B;  4OX9 O;  3L73 H;  1KBH A;  4DV7 O;  2BSK A;  5LHI A;  2CTR A;  4PEL A;  5B3S C;  1TUB B;  3CEI A;  4WF9 V;  3ZRX A;  4KFM A;  2E76 B;  5LXT A;  2LW1 A;  2UXB B;  2NNU A;  3JAK B;  1KP2 A;  4JI1 O;  1N34 B;  2DWE C;  1UPG A;  3C3S A;  1K3E A;  4TV8 A;  3M7M X;  3A8T A;  3J81 N;  1IDS A;  3B09 A;  4DR2 B;  4JYA O;  1RM1 C;  3E8B A;  3KCY A;  4ICG A;  5L3D A;  4DV0 B;  2Q7H A;  3CHX A;  1URF A;  3T1C A;  3ZIA G;  3KZI Z;  4KL1 A;  5KA5 A;  3CX5 F;  1VF5 B;  2IH3 C;  1QLE C;  1ZWI C;  4JI0 B;  2DE0 X;  1AI6 A;  2N74 A;  3ZMV A;  4BR6 A;  2QWR B;  3ABK B;  2EZO A;  1H8H G;  2KG7 A;  1VQ4 V;  2Q7E A;  3CCS V;  2P4K A;  2F1M A;  4ZHQ A;  1XNR O;  1XBL A;  2IH1 C;  4B3T B;  3K03 A;  3RYF B;  4JZ2 A;  4DV4 O;  2WLL A;  2EJ7 A;  1NU1 H;  1H38 A;  4OPA A;  4PA7 A;  5GW7 A;  4X88 A;  1DLB A;  1J5E O;  4J9Z B;  2L6L A;  3OTO O;  4DV1 B;  1VIB A;  1YJN V;  1QVG U;  3S3X A;  4FLY A;  1AJQ A;  1XNQ O;  4RQE A;  3JYC A;  5LOV A;  1WP7 A;  1YZB A;  5KX5 A;  3WB2 A;  1FXK C;  1TA8 A;  1JFF B;  1TAE A;  1B04 A;  3CSX A;  1PD3 A;  4DUY O;  2PI4 A;  2GTS A;  4H13 B;  2L35 A;  3AG2 B;  3HKD B;  1H2L A;  2YIA A;  4NYK A;  2EJR A;  3ASN C;  3RW0 A;  4LF6 B;  2RNB A;  3E35 A;  3ABM C;  4IIJ A;  2UXX A;  2YI9 A;  2A3Q A;  4CS4 A;  1SET A;  4ZOL A;  5E1A C;  4DRX B;  2R9A A;  2YXH A;  3ZRS A;  1K9M W;  1N36 B;  2UUC O;  2QM7 A;  4JPR A;  2UU9 B;  2CAZ C;  2UXD B;  1NH2 B;  2CTW A;  1QQC A;  1FS0 G;  2F4V O;  5EYP B;  4FZ0 A;  1VQ5 V;  5EC1 C;  4E2L A;  3FYI B;  2PGG A;  1L0N H;  1AR4 A;  1ZL8 B;  4LFC B;  1QNM A;  1LUW A;  2WLJ A;  4HNA A;  3CME V;  3AG1 B;  1IXB A;  5CA1 A;  3JCZ A;  4QIW F;  2E5L B;  3F7V C;  4WCE V;  4PA3 A;  5KHK A;  3JAT B;  2YC0 A;  5BY1 A;  1I94 B;  1F4M A;  2BE3 A;  3GWO A;  1AR5 A;  3RYC A;  2ITD C;  2Q69 A;  2DJV A;  3OEE G;  4BW5 A;  5H2F Z;  3B2E E;  2PF4 E;  2EIN C;  3T4Z A;  3ASO C;  4J9Y B;  1NTZ H;  5EZY A;  3UM7 A;  4FLW A;  1M9N A;  3H1L H;  5J9P C;  5DED A;  4Q6G A;  3JAL B;  2N04 A;  4H37 A;  5KHJ A;  1FJG B;  1O9G A;  4O4L B;  5K1X A;  1YTF D;  3E86 A;  2OIG A;  3ZHQ A;  4FMT A;  2IU0 A;  1HDJ A;  4TT3 G;  4LNU A;  1DK1 A;  1EBO A;  3E8G A;  3CB2 A;  1Y74 A;  1THZ A;  1AIL A;  4UCO A;  3HKD A;  4L87 A;  3G67 A;  2Y4U A;  4X1K B;  1VQ7 V;  2W0F C;  2QGN A;  3I55 V;  1US6 A;  3MAQ A;  4X1Y B;  1YXB A;  3CRA A;  3TK1 A;  3ZHR A;  3G71 V;  2Q0A A;  1RPO A;  4JI5 O;  3FB6 C;  1WP8 A;  2WLH A;  2M6Y A;  4LF8 O;  3UT5 A;  3HKE A;  2EIK C;  1M5I A;  3D3I A;  1P49 A;  2XAJ A;  1IVS A;  4MVM A;  1CEZ A;  4X64 B;  4U3J A;  2YID A;  4HBN A;  5GON A;  3AG3 B;  4CH5 A;  1Q82 W;  1HNX B;  3X2Q C;  3SPJ A;  5K1P A;  4DR3 B;  1VQP V;  1GN2 A;  1Y66 A;  3JD3 A;  4PDR A;  1F51 A;  5LGU A;  1YF2 A;  2UUA O;  2HJD A;  4BIZ A;  2O57 A;  1VQK V;  3CRM A;  3OE7 G;  3ETG A;  2IJK A;  2C2A A;  1N32 B;  2ZXW C;  1B6Q A;  2KB1 A;  3ZHU A;  1MG1 A;  1VF7 A;  4QE9 A;  3O65 A;  4AHC A;  3H1H H;  2UXB O;  1R6N A;  5KAI Z;  4EFB A;  1CXZ B;  1SRY A;  4DXW A;  5J2T B;  2R72 A;  2JGD A;  4DV0 O;  2IJI A;  3BAB A;  1SZX A;  1V55 C;  5EK0 A;  4J7K A;  1M1K W;  4FLX A;  3NXS A;  3ZJZ A;  3ZS8 C;  4LF8 B;  4XBF A;  3SYQ A;  1S5L Z;  1I08 A;  2WAM A;  4WBN A;  3HKB A;  2X6C A;  5F2V O;  1ZAU A;  1R3K C;  4DR6 B;  1XRE A;  2DYR B;  3EVK A;  4O2B A;  1M56 B;  2F95 B;  1HP8 A;  5LMU O;  2Y0P A;  1R3J C;  1VF6 A;  2CDY A;  2DYS B;  2EIJ C;  2HVK C;  4I4T A;  4IL6 Z;  1K5S A;  1FXH A;  4B7K A;  3CXH F;  4KXR A;  3SR2 C;  4CZZ A;  5KUK A;  2BTQ B;  1LUV A;  1NI8 A;  1S3J A;  5B1N A;  4O4J B;  3QO7 A;  1SF9 A;  2VWK A;  4JI4 O;  3ZN0 A;  1R1B A;  3E22 B;  1YEW A;  1K5Q A;  4PA4 A;  3SPH A;  2V7Q G;  3TXQ A;  2YXL A;  1H2G A;  4LF5 O;  3RN4 A;  1XMO B;  4JYB A;  4GKJ B;  3CD6 V;  3H9V A;  2YDE A;  2GBO A;  4X66 O;  3OUS A;  3DGE A;  4UB6 Z;  1WA8 A;  3CRQ A;  4NXN B;  3F5T A;  2P7T C;  2CTQ A;  2HFE C;  4GKK B;  4LF6 O;  4O2A A;  5EBL C;  1QR9 A;  2WA3 A;  4GX1 A;  2ODM A;  4BW9 A;  4FJC C;  1M4U A;  2AHZ A;  3PN1 A;  4R50 A;  3ABK C;  4LFA B;  5IJ0 A;  4JI3 O;  1OCZ B;  1ROP A;  4QPK A;  5LP6 A;  1QBZ A;  2VQF B;  3P32 A;  3MDS A;  1XI1 A;  4AQY B;  2HJF C;  3D36 A;  3LNN A;  4WFH A;  4P9O A;  1VQ8 V;  2ATK C;  4LCU C;  4JZG A;  4JF3 A;  1JCH A;  3JD1 A;  3UO2 A;  3G4S V;  1F7Y A;  1Q86 W;  2ZR2 A;  1FAF A;  2Z3Y A;  4MVR A;  1HNZ B;  3H1J H;  2ZE7 A;  4DV2 B;  3BEH A;  4QJF B;  3E8F A;  1EFR G;  2Y69 B;  2QM8 A;  3OFN G;  4X62 B;  4UVA A;  2E5L O;  5KHG A;  4MTX A;  2IJJ A;  3N2K B;  2QWO B;  3N2G A;  3G6E V;  1I94 O;  1M57 B;  1AR1 B;  1IUR A;  2AZ0 A;  3AG2 C;  5CB4 A;  5CA0 B;  3Q4H A;  1XMQ B;  1GK9 A;  2ILM A;  2LFR A;  2Q4P A;  4B3S B;  1BMF G;  4IGG A;  3VOU A;  3ZN1 A;  1AVM A;  1GTO A;  2YEV B;  2D3O W;  1RPR A;  5JH7 B;  2QSA A;  2DQ0 A;  2WLI B;  3CCV V;  3JSL A;  1KB9 F;  3A0R A;  1QU7 A;  5FL7 G;  3BA8 A;  5EBM C;  4EEQ A;  5C8Y B;  2FL4 A;  3I5D A;  3K57 A;  5LA6 A;  1MA1 A;  3CCR V;  2BSK B;  4PA6 A;  3OR6 C;  2P67 A;  2ZE5 A;  5BZB A;  4JAV A;  1KKD A;  5LXT B;  3AG1 C;  3U11 A;  3ZCC A;  3K3W A;  2ADQ B;  4JI8 O;  4TV8 B;  4CH6 A;  3QF7 A;  4LF7 O;  1SQX H;  4UFZ A;  4UCV A;  1OCR B;  1GKF A;  1PNL A;  3CS5 A;  5B1B B;  3BPZ A;  1KD1 W;  1T5E A;  4G27 B;  3FB5 C;  1IBK O;  2Q0O C;  4NXM B;  3W7S A;  1SES A;  5CBG A;  1KEC A;  4P9P A;  5L3G A;  3WB0 A;  3CP1 A;  4JI2 B;  1IXM A;  4EKW A;  4I9Q A;  2HR3 A;  1MNG A;  2EIL B;  2X0L A;  1BCC H;  4FPP A;  4MSW C;  1VQ9 V;  2KG7 B;  2XOK G;  5LBQ A;  1HNX O;  1ENV A;  3EHB B;  4ZHQ B;  2MW2 B;  1IBL O;  3U0Z A;  5EC2 C;  1Q8I A;  2QWN B;  1AJP A;  2WLL B;  2ZKO A;  4UCU A;  1IX9 A;  2LFS A;  4N21 A;  5LHG A;  4LFB O;  3SJC C;  1JMK C;  1YIJ V;  5BR8 B;  5LOV B;  5KX5 B;  2E74 B;  1Y6X A;  3TET A;  3ML0 A;  4I0X A;  2DW4 A;  1QCE A;  2GTA A;  3FKS G;  1F23 A;  4YJ3 A;  1HNW B;  4TSF G;  1Y76 A;  4RAI A;  1I5X A;  1M93 A;  2B1G A;  2Y0I A;  4IIJ B;  4K35 A;  2PYJ A;  3E89 A;  2BTO A;  1DGS A;  4JGS A;  5LMN O;  1NH2 D;  3B8M A;  4ZOL B;  2B1I A;  3AG3 C;  4J10 A;  4GCZ A;  2QEX V;  4DR6 O;  4K8Z A;  2NN4 A;  3RWR D;  1MAB G;  1ZUQ A;  1N33 B;  2CH7 A;  5FLX N;  1K33 A;  1OCO B;  1P4R A;  4N23 A;  5CMU A;  4UV8 A;  1U96 A;  2CTP A;  1X59 A;  1EM1 A;  1G8M A;  4HNA B;  4MS2 A;  5JCO C;  3SJQ C;  3SYC A;  5KHH A;  5CA1 B;  2Q67 A;  3IC7 A;  4EB6 A;  1JX9 A;  4TUY A;  4JI6 B;  1KC8 W;  5BMV A;  1K97 A;  2D2C B;  3R66 A;  3RYC B;  1KKC A;  4GUN A;  3A0H Z;  3OD4 A;  4TQF A;  2FKX A;  2PUS A;  4NXN O;  1P84 F;  4YXW G;  1VQL V;  1BSM A;  2YIB A;  4BIU A;  3BHP A;  4GKK O;  2QTS A;  5EZY B;  2JJ1 G;  2V4D A;  5J2U A;  2P06 A;  3CRR A;  2G38 A;  4DR7 B;  2DYR C;  2P90 A;  2YSU B;  1IBM B;  1M56 C;  4RUE A;  4F6E A;  3KCX A;  5DM6 V;  4LNU B;  4ZI7 A;  5HFM A;  1ZLZ A;  2DYS C;  1Y74 B;  2QWP B;  4U7O A;  1VEW A;  2WA4 A;  1S77 D;  2ZT9 B;  2YIC A;  1D5N A;  1JA8 A;  4PHZ A;  2LGQ A;  4D7T A;  4UUJ C;  1D2D A;  4UCR A;  5IJ9 A;  2LO1 A;  3UT5 B;  4XDK A;  3HKE B;  4HYO A;  4NVP A;  3CXC U;  2Q6A A;  2JDI G;  4B3M B;  1W0K G;  3P3N A;  5B1A C;  3ETE A;  4DR1 B;  3KKY A;  3K9S A;  2H8P C;  3M99 B;  4B3S O;  4U3J B;  1K92 A;  3AK3 A;  5GON B;  3UCS C;  3RT3 C;  2F23 A;  1VP7 A;  2QWQ B;  1VQN V;  1OCZ C;  4GT1 A;  4A5U B;  5IYD O;  4W4K A;  2JGU A;  1B3Q A;  4CC6 A;  5L3F A;  3W7U A;  1Z5W A;  1MZF A;  2UUB O;  3BA9 A;  4YHH O;  2LP7 A;  2OYQ A;  1COW G;  2W6I G;  1SQV H;  3K06 A;  3UKM A;  2JJ2 G;  1DF5 A;  2CUG A;  3B8N A;  1K4D C;  5LGT A;  4X65 B;  3K0D A;  2Y69 C;  2JEU A;  2R70 A;  4K8X A;  2QDO A;  2Z5U A;  2WLM A;  2GV9 A;  3ETQ A;  4TV9 A;  3AG4 B;  1M57 C;  2JGD B;  4JI7 O;  3JAW A;  4FM1 A;  4J42 A;  1WN7 A;  3E2E A;  2Q7G A;  3ZRV A;  3T4D A;  4LF9 B;  2XHB A;  1H2N A;  2R9I A;  4B08 A;  1HR0 B;  3S3W A;  3CCQ V;  5JJN B;  3T1Y B;  4WFB V;  4WBN B;  1FXV A;  4OGQ B;  3HKB B;  1PKX A;  3ZRW A;  2X6B A;  3G6B A;  3RVZ A;  3AK2 A;  2OCC B;  2P22 C;  4O2B B;  2WSS G;  3LNM B;  4PA9 A;  3F5W C;  2DQ3 A;  5IE9 A;  4I4T B;  1GH6 A;  4I5S A;  2UXC B;  3RYH A;  5GTH Z;  1MSW D;  3K04 A;  2K9P A;  5IDJ A;  1PL0 A;  4FLV A;  4QPJ A;  5IY5 B;  4DV5 B;  3SPC A;  4CBC A;  1BS3 A;  3OGC C;  1OHH G;  4DV6 B;  2EX3 A;  2ZM6 B;  3ZHT A;  1RSO A;  4MW3 A;  5KUM A;  4J7Z A;  2OCH A;  1OCR C;  2YS8 A;  4NKG B;  2XAF A;  4RQF A;  1WA8 B;  1Q6I A;  1HW7 A;  3BVO A;  3LUT B;  5GTI Z;  5B1B C;  4IHJ A;  5B1O A;  1K8A W;  3VQW A;  1CPY A;  1ARO P;  4O2A B;  4KHP B;  3OM3 B;  4JAS A;  2JIZ G;  3CE2 A;  3EFF K;  5IJ0 B;  4CS3 A;  1HWY A;  1LR1 A;  2EIL C;  5LP6 B;  1Q6U A;  1N34 O;  3K58 A;  1BHA A;  1K4C C;  1G4Y B;  5CN0 A;  4YY3 B;  4DR2 O;  4PD4 F;  2GUZ A;  1WB7 A;  4LH6 A;  1RFY A;  2HHH B;  2QR4 A;  3K0G A;  3ETD A;  3BY6 A;  2WLK A;  5IYB O;  5KHI A;  4OPH A;  1SER A;  4DV3 B;  4JI0 O;  1LNQ A;  2EZP A;  3N2G B;  3DXR A;  1XHX A;  4JI6 O;  2VS0 A;  4DR5 B;  2ZDI A;  3FB7 C;  5CB4 B;  3HKC A;  4H44 B;  2BOC C;  2RJZ A;  4QGP A;  3Q4H B;  4DV7 B;  1A32 A;  4D7S A;  2KQX A;  4B3T O;  4X1I A;  3A0B Z;  5H9C A;  4Z1M G;  3MHH C;  3C3T A;  3J80 N;  3J7A U;  3BRC A;  3PJS K;  2QTO A;  3WG7 B;  4JI1 B;  1FFX A;  5LYJ A;  4DR7 O;  4DV1 O;  3JD2 A;  1SQP H;  1H2K A;  3JD4 A;  1GM8 A;  1D5A A;  4JYA B;  4NTW A;  1MSD A;  5LHH A;  4DUZ B;  1OCO C;  3SYA A;  5LA6 B;  1WB8 A;  3ABT A;  3QTC A;  1JJO A;  2E3C A;  3JAR A;  4TOI A;  3IFX A;  1AJN A;  1TUE B;  5B1A B;  1EZJ A;  4O4H A;  3AK1 A;  5A2Q N;  4U3F H;  1BL8 A;  1M90 W;  1I5Y A;  3IJ4 A;  2AXT Z;  2EUL A;  1O9H A;  3ZMU A;  4TWK A;  3ZHV A;  1XNR B;  1BE3 H;  5A9G A;  1N36 O;  3A2F A;  2UU9 O;  2UXD O;  3VQV A;  4FFB A;  2N05 A;  4UVC A;  1KMI Z;  2GHY A;  1J5E B;  2XT9 A;  4X8A A;  3OTO B;  3CJH A;  4YJ2 A;  4LFC O;  3D8C A;  4JV5 B;  2CK3 G;  1EN6 A;  2AHY A;  2YIB D;  2JK5 C;  4DUY B;  1XUQ A;  1B06 A;  4JTD B;  1R6T A;  4I50 A;  1GMG A;  4J7J A;  2QKA A;  5KA6 A;  1TVK A;  4DYL A;  3T2M A;  2ZCE A;  2XTA A;  4UCS A;  1DTO A;  3H1I H;  2ZNI A;  2A0L A;  3ZBH A;  3UO3 A;  4MW8 A;  1SQF A;  4IT5 A;  4J80 A;  3WB1 A;  4H33 A;  2VQE B;  5D5P A;  2UUC B;  4JYC A;  1W0J G;  2ZNJ A;  4K3A A;  1FXK A;  4I0X B;  1L1F A;  2WPD G;  3ZMZ A;  2EIM B;  5ITZ A;  2F4V B;  1FJG O;  2F66 C;  2RCV A;  1XEQ A;  4JTA B;  4YJ3 B;  4GX5 A;  2Q73 A;  5JJJ B;  1Y76 B;  1FYJ A;  2XAS A;  4F6R A;  4LF9 O;  3JCU Z;  3D3Q A;  4PV1 B;  1SA0 A;  1BQ0 A;  1HR0 O;  3APQ A;  4MVQ A;  3L70 H;  4PDV A;  4WFF A;  3T1Y O;  2GDS A;  4GX0 A;  3HB3 B;  1AI4 A;  1S5H C;  2VRZ A;  4PDL A;  4L8J A;  2HVJ C;  2QM4 A;  2CH7 B;  3QO8 A;  5AG2 A;  4XDJ A;  3T1H B;  1MOF A;  2AZ2 A;  4E4E A;  1XL4 A;  1XQ8 A;  1SZT A;  3ZED A;  1FKA O;  2UXC O;  4LWS A;  3TGU H;  2ZE8 A;  1NR1 A;  5H6R A;  1I0H A;  3UQ8 A;  2B5U A;  4FVM A;  2ZD9 A;  3CCJ V;  2RN9 A;  2HLD G;  4MVZ A;  3QO5 A;  1KYO F;  4FM0 A;  1V54 B;  4X64 O;  1Q3E A;  1N4C A;  2KSD A;  5KLV H;  5DEC A;  1YHQ V;  4EB6 B;  4DV6 O;  4TUY B;  5IYZ A;  2YI8 A;  2ZIO A;  1JPX A;  5BMV B;  4DO2 A;  1VQ6 V;  3AG4 C;  3SYO A;  3SPI A;  2CGN A;  3L71 H;  4PJ0 Z;  4DR3 O;  4Q20 A;  2PI5 A;  2QA4 V;  1S72 V;  4PI2 A;  3B4S A;  1ZTE A;  3CC7 V;  1PNM A;  5J2U B;  3IC9 A;  1N32 O;  4ZBM A;  3RYI A;  2RQ6 A;  4X9Q A;  4DW0 A;  2OCC C;  4X20 A;  1QVF U;  1SQB H;  3JD0 A;  3TCU A;  4ZI7 B;  2DN9 A;  1YJW V; 
#chains in the Genus database with same CATH homology
 1Y66 A;  3JD3 A;  3CYO A;  4PDR A;  1F51 A;  5LGU A;  4XDK A;  3KG2 A;  4HYO A;  4BIZ A;  1VQK V;  3CXC U;  2W6J G;  2Q6A A;  2JDI G;  2IJK A;  3ETG A;  3OE7 G;  3P30 A;  1W0K G;  2C2A A;  5B1A C;  3OW2 U;  3ETE A;  3CCM V;  3STZ C;  2EIN B;  1B6Q A;  2ZXW C;  3ASO B;  2H8P C;  2KB1 A;  5IY5 C;  3M99 B;  3MD0 A;  1K92 A;  1S76 D;  1MG1 A;  4QE9 A;  3CC4 V;  1XL6 A;  3VBB A;  1VQN V;  1R6N A;  1OCZ C;  4GT1 A;  3ABL C;  2X7R B;  5IYD O;  3IGA C;  1SRY A;  4DXW A;  4OXS A;  5L3E A;  5L3F A;  3W7U A;  4P30 A;  3OEH G;  3OR7 C;  4JTC B;  1K34 A;  2R9R B;  2LP7 A;  1R73 A;  1COW G;  2W6I G;  2H94 A;  3E8H A;  2IJI A;  1V55 C;  1QR8 A;  5EK0 A;  3K06 A;  3UKM A;  2JJ2 G;  1M1K W;  4P2Z A;  1S0V A;  3NXS A;  4LP8 A;  2P6J A;  3ZJZ A;  1DF5 A;  3DTU B;  1Y4M A;  4XBF A;  5HFL A;  3SYQ A;  2WLN A;  1NJI W;  3B8N A;  1K4D C;  2WAM A;  5LGT A;  2X6C A;  4WFE A;  1PNK A;  1R3K C;  3K0D A;  2Y69 C;  2JEU A;  4MTF A;  2DYR B;  2XAH A;  4FK5 C;  1M56 B;  1Q7Y W;  2Z5U A;  2WLM A;  3AG4 B;  1M57 C;  1P7B A;  1R3J C;  3E2E A;  2UXN A;  3LDD A;  2DYS B;  2EIJ C;  2HVK C;  1K5S A;  2A79 B;  3ZRV A;  1FXH A;  3T4D A;  2EIK B;  3W7W A;  4CZZ A;  2R9I A;  2HG5 C;  5KUK A;  2K1E A;  1UJW B;  4XDL A;  1S3J A;  5B1N A;  3CCQ V;  4GX2 A;  3QO7 A;  4WFB V;  1FXV A;  1WPX A;  3ZN0 A;  1DF4 A;  1PKX A;  2F43 G;  1K5Q A;  3ZRW A;  4PA4 A;  3ZMT A;  1KQS U;  2X6B A;  3SPH A;  3RVZ A;  4PDM A;  2V7Q G;  2OCC B;  2IW5 A;  3CMA V;  2MK3 A;  2QKS A;  1YIT V;  1H2G A;  1H8E G;  2IU3 A;  2NLJ C;  1E1Q G;  1AI5 A;  1VQM V;  3B77 A;  4KUM A;  2XAG A;  4JYB A;  3QNE A;  2WSS G;  3LNM B;  3X2Q B;  3CD6 V;  4PA9 A;  1NKD A;  1OCC B;  3F5W C;  5CBF A;  2DQ3 A;  4UV9 A;  3OUS A;  4MVO A;  3DGE A;  4I5S A;  5L3B A;  1MSW D;  1E1R G;  3K04 A;  5IDJ A;  4X89 A;  5EBW C;  1PL0 A;  2ZXW B;  2P7T C;  2HFE C;  4QPJ A;  5IY5 B;  5IYC O;  1R6K A;  2BOB C;  5EBL C;  1QR9 A;  4GX1 A;  3WG7 C;  3ZRW B;  4FJC C;  4I9W A;  3SPC A;  4CBC A;  2AHZ A;  3OGC C;  4HZ3 A;  1OHH G;  4R50 A;  3ABK C;  4WFG A;  3FB8 C;  4U7N A;  1N8R W;  1OCZ B;  4R8C A;  1JJ2 U;  1ROP A;  3ABL B;  4QPK A;  3E83 A;  1QBZ A;  3P32 A;  1K73 W;  2HJF C;  3D36 A;  2QE7 G;  2ZDI C;  4MW3 A;  4HAM A;  5KUM A;  4WFH A;  4P9O A;  1VQ8 V;  2ATK C;  5LGN A;  1OCR C;  3ABU A;  4LCU C;  2XAF A;  4QE7 A;  4JF3 A;  1JCH A;  3JD1 A;  4RUF A;  4RQF A;  3LUT B;  1W2B U;  5B1B C;  3G4S V;  3CCE V;  5B1O A;  3OUF A;  1V55 B;  4LC1 A;  1K8A W;  1CPY A;  1Q86 W;  1ARO P;  1JOY A;  1Q81 W;  2ZR2 A;  2Z3Y A;  3K79 A;  3OM3 B;  4MVR A;  4JAS A;  2JIZ G;  3BEH A;  4QJF B;  3LSS A;  2YEV A;  3EFF K;  3E8F A;  1EFR G;  1F4N A;  1OZ0 A;  5DN6 G;  2Y69 B;  1HWY A;  3LDC A;  2EIL C;  2QM8 A;  3OFN G;  4UVA A;  3WFV A;  2EBO A;  2WLI A;  4MTX A;  2IJJ A;  5L3C A;  1BHA A;  1J95 A;  5CBH A;  3G6E V;  1M57 B;  1AR1 B;  3OMI B;  1K4C C;  1G4Y B;  3AG2 C;  3I56 V;  5CN0 A;  2EIJ B;  1FFT B;  1GK9 A;  2GSM B;  3RVY A;  2LFR A;  5LHI A;  3K0G A;  3ETD A;  4PEL A;  3BY6 A;  4R7C A;  1BHB A;  4ASU G;  1BMF G;  3VOU A;  2WLK A;  5B3S C;  3ZN1 A;  4BAY A;  5IYB O;  3ZRX A;  1GTO A;  4KFM A;  4WF9 V;  2YEV B;  2OTJ V;  2D3O W;  1SER A;  2NNU A;  1KP2 A;  1RPR A;  3HPL C;  1AI7 A;  2DQ0 A;  1LNQ A;  1YJ9 V;  4FIP C;  2DWE C;  2M7W A;  2WLI B;  1K3E A;  2EZP A;  3CCV V;  3A0R A;  5FL7 G;  1VQO V;  1RM1 C;  3E8B A;  2ZDI A;  3FB7 C;  5EBM C;  5L3D A;  2BOC C;  1YSC A;  3T1C A;  3ZIA G;  2XND G;  3CCR V;  2FTK A;  4PA6 A;  5H9C A;  4Z1M G;  3MHH C;  3OR6 C;  5KA5 A;  2P67 A;  5BZB A;  4JAV A;  1KKD A;  2IH3 C;  3PJS K;  4MT8 A;  3AG1 C;  2QTO A;  1QLE C;  1ZWI C;  3WG7 B;  3ZCC A;  3K3W A;  1AI6 A;  3ZMV A;  3ABK B;  3JD2 A;  1GM9 A;  2EZO A;  3GB7 C;  3JD4 A;  3W7X A;  4ZKI A;  1GM8 A;  1R3L C;  1H8H G;  1NBM G;  1VQ4 V;  2EIM C;  3CCS V;  5LHH A;  2X6A A;  1OCR B;  1GKF A;  1PNL A;  2IH1 C;  1OCO C;  3SYA A;  3K03 A;  5B1B B;  3ABT A;  5CA3 A;  3CCU V;  1KD1 W;  2WLL A;  4G27 B;  3FB5 C;  1H38 A;  3W7S A;  2JEX A;  1SES A;  5CBG A;  1KEC A;  4PA7 A;  3IFX A;  1AJN A;  1TUE B;  5B1A B;  5GW7 A;  4P9P A;  4X88 A;  1EZJ A;  5L3G A;  1DLB A;  4J9Z B;  1YJN V;  1QVG U;  3CP1 A;  1IXM A;  1AJQ A;  4EKW A;  2HR3 A;  1BL8 A;  2EIL B;  2X0L A;  4RQE A;  1M90 W;  1I5Y A;  4MVU A;  3JYC A;  4FPP A;  3H01 A;  4MSW C;  2ZQM A;  1FXK C;  1VQ9 V;  2XAQ A;  2XOK G;  3ZMU A;  5LBQ A;  4TWK A;  1ENV A;  1NR7 A;  1PD3 A;  1K7D A;  3EHB B;  2PI4 A;  3AG2 B;  5EC2 C;  4MTO A;  2DWD C;  4RO2 A;  4UVC A;  1AJP A;  3AEI A;  3W7T A;  2WLL B;  2OTL V;  2EJR A;  3ASN C;  3SYP A;  3RW0 A;  2GHY A;  2LFS A;  4G2K A;  4X8A A;  4N21 A;  3E35 A;  3ABM C;  5B3S B;  3OAA G;  5LHG A;  3LDE A;  1NVP D;  2UXX A;  1V54 C;  1YIJ V;  1JVM A;  4KP4 A;  2CK3 G;  1SET A;  5E1A C;  1JQ0 A;  2AHY A;  2HKO A;  2JK5 C;  3ZRS A;  3TET A;  1K9M W;  2Y48 A;  3ML0 A;  4JTD B;  2QM7 A;  4JPR A;  3SPG A;  1GMG A;  3CCL V;  2ITC C;  1RM1 B;  1NH2 B;  2DW4 A;  1FS0 G;  1QCE A;  5KA6 A;  1KP3 A;  3FKS G;  1F23 A;  3T2M A;  4TSF G;  1VQ5 V;  4RAI A;  5EC1 C;  1I5X A;  3FYI B;  2ZR3 A;  3LSQ A;  4E2L A;  3RBZ A;  1DTO A;  2B1G A;  2A0L A;  2WLJ A;  4F4L A;  3CME V;  3E89 A;  3STL C;  3AG1 B;  1QLE B;  4JGS A;  4UVB A;  1NH2 D;  4MW8 A;  1R3I C;  3B8M A;  3JCZ A;  2B1I A;  3AG3 C;  4GCZ A;  4H33 A;  2QEX V;  3CC2 V;  4QIW F;  2Q68 A;  3F7V C;  4JYC A;  1W0J G;  4WCE V;  1CP9 A;  4PA3 A;  1MAB G;  3ZMZ A;  1FXK A;  1L1F A;  2WPD G;  2EIM B;  1F4M A;  3GWO A;  3MHS C;  1NQT A;  1K33 A;  3F7Y C;  4JTA B;  2ITD C;  4GX5 A;  1OCO B;  1P4R A;  4N23 A;  5CMU A;  4UV8 A;  2Q69 A;  3OEE G;  2XAS A;  4BW5 A;  1QLN A;  4QNH B;  1YTF B;  2EIN C;  3T4Z A;  1E79 G;  1G8M A;  4G28 B;  3ASO C;  4MS2 A;  4J9Y B;  3R65 A;  3SJQ C;  4MVQ A;  4WFF A;  4PDV A;  3SYC A;  3UM7 A;  1M9N A;  3ZMS A;  4GX0 A;  3HB3 B;  1AI4 A;  1S5H C;  3OMN B;  4JAU A;  5J9P C;  4PDL A;  4H37 A;  2Q67 A;  3IC7 A;  2HVJ C;  1JX9 A;  1FXK B;  3QO8 A;  2IJH A;  4MTG A;  1YTF D;  1KC8 W;  1YI2 V;  4XDJ A;  3E86 A;  1K97 A;  1MOF A;  4FMT A;  2IU0 A;  3CPW U;  4TT3 G;  4UXN A;  2OT5 A;  1XL4 A;  1EBO A;  1SZT A;  1ORQ C;  3E8G A;  4MVS A;  1THZ A;  4WFA V;  1GM7 A;  3ASN B;  4L87 A;  4YXW G;  1NR1 A;  1VQL V;  5H6R A;  1VQ7 V;  2W0F C;  4BIU A;  4R6Z A;  2B5U A;  3ABM B;  3OMA B;  3I55 V;  2ZD9 A;  1WLE A;  2WWW A;  2JJ1 G;  3CCJ V;  2HLD G;  4MVZ A;  3QO5 A;  1V54 B;  5H6Q A;  5C93 A;  3TK1 A;  1YHQ V;  2DYR C;  2P90 A;  2YSU B;  3G71 V;  3FYE B;  1M56 C;  1JPX A;  1RPO A;  4RUE A;  4DO2 A;  3FB6 C;  1VQ6 V;  3AG4 C;  1GO3 F;  3SYO A;  5DM6 V;  3SPI A;  2WLH A;  1NVP B;  5HFM A;  4Q20 A;  2PI5 A;  2DYS C;  2QA4 V;  1S72 V;  2EIK C;  2V1D A;  3D3I A;  4U7O A;  1S77 D;  2XAJ A;  1CEZ A;  4MVM A;  3CC7 V;  3K9A A;  1PNM A;  4ZBM A;  3K08 A;  3AG3 B;  2OCC C;  1Q82 W;  1QVF U;  4UUJ C;  2A9H A;  3JD0 A;  3X2Q C;  3TCU A;  3SPJ A;  4LBE C;  1OCC C;  1VQP V;  1YJW V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...