1K9MW

Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1k9mW00
1VQNV 1VQPV 4WCEV 3CCVV 1KD1W 3CCJV 1QVFU 1YJ9V 2D3OW 3G4SV 3CCRV 3I55V 3CCEV 3CCSV 1Q86W 1K73W 2QA4V 4WFBV 3CPWU 1KC8W 1YJWV 1VQ9V 4WFAV 3G6EV 1M1KW 3CC7V 1S72V 1R73A 1M90W 1VQ8V 3CD6V 1K9MW 1Q82W 3G71V 1QVGU 1N8RW 3CMEV 1VQLV 1K8AW 1VQ7V 1NJIW 3I56V 1Q81W 2QEXV 3CCQV 1Q7YW 1VQ5V 1VQ6V 3CCLV 3CC2V 1VQ4V 4WF9V 1W2BU 1YIJV 1YHQV 1YITV 1YJNV 1KQSU 2OTLV 3CCMV 3CCUV 1JJ2U 1VQOV 3OW2U 1VQKV 1YI2V 2OTJV 3CMAV 5DM6V 1VQMV 3CXCU 3CC4V
chains in the Genus database with same CATH superfamily
5IYZA 3ABTA 3P32A 3ZMZA 1I7FA 2HEPA 1IBMO 3K04A 1NS1A 4LFBB 3ZMUA 4JAVA 1M56C 4J9YB 2Q5ZA 4OX9O 2HFEC 4TV8A 4O4LB 4B3RB 2Y0PA 1H2LA 4ZHQB 4FLZA 1RFYA 1X4TA 1ZL8A 4N21A 1XEQA 1K5QA 4Z2WA 2ZCEA 1I5XA 3ZHSA 4WFAV 4CH3A 4ZIBA 3B4SA 3OMNB 2UXDB 4MTOA 4I5SA 3WB2A 4K8XA 1MOFA 3FB6C 4PDMA 1FXVA 1Q90D 1M5IA 1WB8A 5KMGB 2P4VA 3JAKA 2XHBA 2G38A 4DR2O 2Q0OC 4I7ZB 2QM8A 4DV2O 1VEWA 1N8RW 4IHJB 4DW1A 1HWYA 4QIWF 4U3JA 3SPJA 2YIBA 1WLEA 3T1CA 1VQ5V 1XL6A 1N33O 2BE3A 4JI4O 3LSUA 1VIBA 1MG1A 4J11A 1KB9F 3J80N 2OTJV 1L8DA 2DE0X 3A2FA 3H9VA 3ZN0A 5JJNB 2LO1A 4DK0A 3TGUH 1K33A 3OR6C 1KYOF 1EM1A 3I55V 4G2KA 4GZRB 2IJHA 2L6LA 2XAGA 4FZ0A 2Q7EA 2QKCA 5H9CA 1Q81W 4U7OA 3JSLA 1M93A 1SQFA 3TETA 1YHQV 2Q0AA 4PDLA 3E2EA 3RVZA 4MTGA 5HFMA 1NKDA 5KX5B 4FK5C 3H1HH 4IIJB 1MZEA 1J5EO 1SQPH 2Q9LA 1SZXA 4JAAA 5CBGA 3FAVA 3CB2A 1D5NA 1VQLV 4CH5A 4ICGA 4RQEA 3H1JH 3H1KH 3VQWA 5FNVA 1N36O 1V55C 5BMVA 1BQZA 3RYFB 1SC5B 5LXTA 2EJRA 2OCHA 4PJ0Z 2EIKB 1PPJH 1GRJA 5BR8O 2ARHA 4X1KB 5L3GA 2JGDB 1HNWB 5TISZ 4B08A 2F93B 2DQ3A 3CS5A 2E76B 5CB4B 3D8CA 2Q67A 1Y67A 4BIZA 4FLYA 4UCTA 1Z5WA 4DUZB 4PDRA 2H94A 1Q8IA 5LGNA 3WFVA 2KB1A 3M99B 1N34B 1I94B 4I55A 4RUEA 1BHAA 3Q4HB 2DQ0A 2ZXWC 3OEHG 5JJEB 2QJ1A 4FFBA 1XMQB 4KP4A 4R8CA 1RSOA 1R3KC 2FTKA 4FM2A 2UXXA 3TK1A 2QEXV 4DV3B 2N04A 1HNXO 4O4LA 4WF9V 5IY5B 4KL1A 1Y66A 1JJ2U 1M9NA 2GUZB 1HNZB 1AJNA 2Q6AA 3ZMVA 4B3TO 4LF6B 2LFRA 2YICA 1JCHA 3B77A 1JQ0A 5LMUO 1R73A 1KMIZ 4DO2A 3M8AA 1GN4A 2OIEA 5KUMA 5F2VO 3KZIZ 4YY3B 4N23A 2EIMC 2OCCB 3N2GB 3MD0A 4O4IB 2CTWA 4JI1O 1G6UA 4GX2A 4OXSA 4WFHA 3TXQA 1DF5A 1NH2D 3ZRWA 5KMGA 5LMNO 5IT9N 3QO5A 1LNQA 4E4EA 1GM8A 3K9AA 2E5LB 2OIGA 5HFLA 2GTAA 4FM1A 2B9ZA 3O65A 4B7KA 2WLMA 3EFFK 4Q6GA 2CTRA 2F43G 5B1BB 2WLKA 3ABUA 2CGNA 1KECA 4JI3B 3ABKC 3ZN1A 3SDLA 4LF8B 1WA8A 2UXCO 5KHGA 3WG7C 3CCEV 3CCSV 4DR6O 4WFBV 4QNHB 1HR0B 3ABMC 3F5WC 1Y4MA 2BCCH 5CN0A 1VP7A 3ZEDA 1YJNV 2E3CA 2OT5A 2WA3A 4OGQB 2JGUA 2PF4E 1Q5OA 2UXBB 3K0DA 4LFBO 1GM7A 1ZWIC 3QNEA 5KX5A 1DK1A 3L74H 2QWQB 3PN1A 4IIJA 4JF3A 3JCZA 1KKCA 3FX7A 1K97A 4FIPC 1OCOB 5CBFA 2F23A 1TA8A 4GKKB 1E1QG 2JJ2G 4DR4B 3CP1A 1YTFD 4FVMA 1JJOA 5E79Z 2QR4A 2EINC 1RPRA 2R9RB 1NZ6A 4X66B 4LF7B 2P6JA 5B66Z 3RYFA 1F7YA 2JK5C 4PI2A 1RM1C 3FD9A 1Z5VA 1EBOA 4X1KA 5J2UB 1K9MW 1QLNA 1H2KA 2JGDA 2UUAO 5JJJB 5CMUA 4H13B 1G4YB 1FYJA 4U7NA 5FLXN 1IBMB 3JALA 5IE9A 4DR1O 2DN9A 1UFIA 4OX9B 3B2EE 3UO3A 4QPKA 2CH7B 1AROP 1B04A 1PNMA 4O2BB 4EEQA 4MTFA 3F7YC 1OZ0A 4H44B 3HKDB 1JR9A 3CXHF 3MHHC 1OCZB 2ITDC 2YIDA 4KUMA 3L70H 4TSFG 2M7WA 4HYOA 5LHIA 5LGUA 3B40A 1L1FA 1GTOA 5GW7A 2EZOA 4WFEA 4I50A 1KBHA 4O4HB 3ZRSA 2O57A 3HKBB 3OEEG 4DR2B 1PM9A 1GMGA 5FPRA 4DV2B 1NI8A 1PL0A 1MSDA 3X2QB 1YITV 2ZNJA 3F7VC 1VQOV 1Z2GA 3N2GA 5KA5A 1RPOA 4O4IA 1B06A 1AJPA 3ABLC 1N33B 4JI4B 4UB6Z 4RUFA 5LBQA 4KHPO 1PL4A 1I08A 3QO7A 1HP8A 3SYOA 5IJ0B 4MVMA 4MT8A 2EX3A 2K1EA 3JCUZ 3RYIB 2ODMA 1BS3A 4J7ZA 4JI8O 1KQSU 2AHZA 1SS3A 3CCMV 2MW2B 1S5LZ 1HNWO 3APOA 1SERA 3JD2A 4LH6A 3N2KB 5GONB 4YJ2B 1EN4A 4I9QA 4B7EA 3T4DA 3CJHB 4XDLA 1TVKB 3NXSA 4O4JA 2A3QA 1XNQO 1J5EB 4XBFA 2QDOA 2IH1C 3RYHB 2OTLV 1TUEB 3K5OA 4DV6O 2CDYA 1BCCH 2JDIG 1ZLZA 1BHBA 3RBZA 1YZBA 1P49A 3BY6A 4MW3A 3WB1A 2ILMA 1JOYA 2F95B 1MMMA 1N36B 1WB7A 2X0LA 3DC5A 3K03A 1MSWD 3BHPA 2DYRB 3CWBH 3EVKA 5BR8B 1VQ7V 1FFTB 1AI7A 3HB3B 3BAAA 4K0KO 3ASOB 4W4LA 4EFBA 5LA6B 4GLXA 3HKEB 4MTXA 5B1OA 1YDXA 3L73H 2Q69A 1YJWV 3RFRA 4YY3O 2Q7HA 1LUWA 1N0NA 5J2UA 4UCRA 1T5EA 3AEIA 5ITZB 3CRMA 3OW2U 4JTDB 3GWKC 3WB0A 1HNXB 2M6YA 1QR8A 1EN6A 4NTYA 1XHXA 2WLLB 5LL6Y 1WN7A 3N27A 4O2BA 4QJFB 2B1GA 3P30A 4F6EA 2VRZA 5DECA 4B3TB 5L3DA 2XAQA 2YXYA 3HKDA 4JI3O 5LMUB 4DV5B 3K08A 1XUQA 2HHHO 4NXMO 4DV4O 2UU9O 1LR1A 2DYSB 3CPWU 4O4HA 2ZE8A 4I9WA 3T1HO 2EIKC 1HDJA 5LMNB 4H33A 1SQBH 1NBMG 1THZA 2Q4PA 2BTQB 3G67A 2RN9A 3CC2V 4F4LA 2F66C 4JZGA 3QO8A 2XAHA 4ASUG 4MVRA 1KD1W 3STLC 2JEXA 1EZJA 2PY5A 4YHHO 4PA7A 2LGQA 1ENVA 2PYJA 3E86A 4DR4O 1KP3A 2UXCB 3RWRD 2PYLA 5IJ0A 4DR6B 2AZ2A 3RYIA 5H2FZ 4LF9B 1S76D 5IY5C 4MS2A 2WLNA 1K7DA 1WP7A 4TQFA 4UVAA 3N2KA 2LFSA 4YJ2A 1DTOA 3C3TA 4DRXB 1SRYA 4LFAO 3KCYA 4UUJC 1W59A 4DR5O 1TVKA 1Q7YW 1I5YA 4AQYO 1BT8A 4UVBA 2H8PC 5K1XA 1XILA 2EILB 4DV7O 3RYHA 3K59A 3CCUV 3D3QA 4X62O 1R6KA 3GWOA 2OCCC 4FLTA 1W0KG 3A0HZ 2ZNIA 4TV9B 5D5QA 4AHCA 4BIOA 3OUFA 3LNMB 1VARA 2XT9A 3W7XA 4DR7B 2XUMA 4QE7A 1RP3B 3B8MA 2UUAB 4MVOA 4X88A 5B1BC 1AR5A 3BPZA 4DR1B 2UUCB 1YXBA 3HKEA 4EB6B 1GM9A 2VS0A 5EIBC 3RW0A 4CC6A 3CX5F 3VQYA 2JRIA 3VQVA 4O2AB 3AG1C 3OT7A 2V4DA 2Z0AA 5KLVH 2LQTA 1OCCB 1GH6A 4JV5O 2K9PA 3CSXA 5ITZA 3A0RA 4NVPA 2FB5A 4JGSA 4RAIA 1XL4A 2FMLA 2AW9A 1OV9A 4Z1MG 2GDSA 3VBBA 5LP6B 4J7JA 2WLLA 5IYBO 3OD4A 1F51A 3ETGA 3K0GA 1NR1A 1YF2A 2ETNA 4UCOA 3CCLV 4D6TH 2N05A 4TUYA 2OWOA 4IL6Z 3K58A 4MSWC 4GX1A 4BR6A 2XNDG 4KFMA 1COWG 1YEWA 4LF4B 4K3AA 1MABG 4CBCA 3G6EV 1BSMA 2P4KA 1GKFA 3T4ZA 4YJ3A 4KHPB 1EFRG 4ZOLB 2BSKB 1NVPD 1MNGA 2BTQA 3AG3B 2R70A 1CP9A 3CMAV 4J41A 2ZM6B 5H6QA 3FB7C 4JI8B 3L71H 5CA1B 2YDEA 1BE3H 2R72A 3S3WA 1N32O 3CCRV 4HAMA 2FKXA 3DXRA 5L3BA 1JFFB 4IYHA 2CTPA 1QLEB 3SPIA 4TWKA 2JVDA 2YS8A 2B5UA 1QCEA 2HG5C 5BZBA 4CC5A 4NR1A 1D5AA 4DW0A 1V54B 2GHYA 1X59A 1KU9A 3JD0A 1OCZC 4PA9A 1VQMV 1XNQB 3K79A 1FAFA 4I4TB 1A32A 4P30A 2JJ1G 4HZ3A 4DV6B 4CZZA 3W7SA 4ABMA 3DSQA 1SQGA 3OFNG 4F6RB 4X8AA 3BA9A 2Z3YA 4NB5A 5H5NA 5IDJA 3J81N 1JPXA 3CRAA 2CE4A 4UB8Z 4ZHQA 3X2QC 1BQ0A 3CCJV 2LJ2A 3OTFA 1IZ3A 3BEHA 4BW5A 3AK1A 4K0KB 2ZT9B 4XDJA 4DV5O 4LFCO 1L0NH 1EZVH 2D2CB 2V1DA 4EFEA 1HW7A 4WFFA 1H2NA 5EC2C 4P9PA 1R6TA 5GTHZ 2LW7A 4A5UB 4D7SA 2ZIMA 3ZMSA 4UCVA 5KHKA 1Q43A 1R3IC 4IHJA 4DR3O 1NTKH 3IC9A 4O2AA 4H37A 4DV1O 2IM9A 4PV1B 3SJQC 5KHHA 2JIZG 3SYQA 4JI0O 4PHZA 3D36A 1S0VA 4P9OA 4X20B 2HHHB 3FKSG 5LP6A 4NXMB 4DV4B 2UU9B 4LF9O 1W0JG 3I56V 5E1AC 4WBNB 2R9AA 4FPPA 3T1HB 5EYPB 4QPJA 3I5DA 3LSQA 2PI5A 2HR3A 1N4CA 5BY1A 3ASOC 1B3QA 2B1IA 3DC6A 4JYAB 3UM7A 1Q6HA 4UV8A 2DW4A 5EBMC 4YHHB 4NTWA 1Q6IA 3G6BA 2RNBA 3BA8A 4ZOLA 3K57A 1S5JA 2BSKA 3ZBHA 2W6IG 2ADQB 3UKMA 5IWAO 3IGAC 5J2TB 3K5LA 1WPBA 2EZPA 1QU7A 1ZSPA 2YXLA 3JSNA 5CA1A 4DR7O 5LOVB 3VOUA 3ZCCA 1V9PA 1WPXA 4X64O 4DV0O 3QG5A 2RJZA 1PD3A 5CB4A 1OCRC 1GK9A 2UUCO 4LFAB 5H6RA 4DR5B 4PA6A 1IBKO 3UCSC 1XNRO 4AQYB 3IC7A 3HR0A 3IFXA 1JX9A 4DV7B 1ROPA 3Q4HA 4I4TA 3MHSC 4X62B 3WU2Z 1CPYA 2DYSC 1MA1A 3OR7C 2X6BA 4WFGA 4F6RA 5DEDA 1VF7A 1G1XB 2YIBD 2RDCA 2YI9A 5AG2A 2DWEC 2FYUH 3QTCA 3U0ZA 1S77D 4WCEV 2Q7GA 2GUZA 1YJ9V 2D3OW 1PNKA 2V7QG 5EBWC 2Q8VA 3OGIB 1M57B 1H2SB 2PTMA 3STZC 4NXNO 2VWKA 3AG7A 2ITCC 4DUYO 3OM3B 2Z5UA 3UT5B 5CA0B 1NH2B 2ZDIC 1FJGO 1XBLA 4LF4O 2ZD9A 3H1LH 3AG2B 4JV5B 2QKSA 3SYCA 1R6NA 2W0XA 1Y74B 1VQ9V 3OMIB 4GT1A 3P3NA 2PI4A 1ZUQA 3ETQA 3QF7A 2CGOA 2ZM6O 2GTSA 2PUSA 4JI7B 2QE7G 2YIAA 3ZHVA 1O9GA 2EILC 4MVUA 2GSMB 3CCVV 2WPDG 4PA3A 1AP6A 3KG2A 1D2DA 4DXWA 3EHBB 4X1IB 5C8YB 2EBOA 4X20A 3ZHUA 1VF5B 2NNUA 3S3XA 1YSCA 2P7TC 1IDSA 4GCZA 4B3MO 3JATB 5EC1C 5KAIZ 2P5OA 1QHTA 3JD4A 3AK2A 4MVQA 2E74B 4J10A 1ZAUA 2NR5A 4R50A 3IAYA 2QKAA 2Y48A 3CMEV 1YTFB 3JAMN 3JAWB 1N32B 4L8JA 1LUVA 5K1PA 4YXWG 1ZL8B 4QE9A 1CXZB 1OCCC 4IGGA 5J2TA 1SA0B 4UFZA 4I0XB 1IX9A 2X7RB 4JYYA 1VMGA 2WLJA 1F4MA 3D36C 2LP7A 5FL7G 4HBNA 3ZJZA 1BZKA 5LP6C 4L87A 4MW8A 1FXKB 2QGNA 4X65B 1R3LC 1F23A 1YI2V 2BOBC 1PV0A 2RMKB 1N0JA 2CH7A 2QA4V 3ZHRA 1YCIA 4X89A 3ASNB 1R3JC 4H0LB 2WA4A 1W2BU 3E83A 1DF4A 2BOCC 4LFCB 1TGOA 4K8ZA 2KSDA 3HKCB 3AG3C 2H3OA 1U97A 3AG4B 2DOSA 2PZSA 2QWNB 1FKAO 5JVDB 3SJCC 1XREA 4JI2O 1K3EA 3HKBA 1QLEC 3K5MA 3B8NA 3UT5A 3RGBA 1Y6XA 2GV9A 1H2MA 4CH6A 4TOIA 4DR3B 1GN6A 4JYAO 4NYKA 5B1NA 4DV1B 2CK3G 4LC1A 1K73W 4PA4A 5L3FA 1G8MA 2Y4TA 2AXTZ 3R66A 1DGSA 4GX0A 1Y74A 3CE2A 4JI0B 3E8GA 2RCVA 1KKDA 1XI1A 3RT3C 1AILA 5LXTB 2KG7B 1JA8A 4KXRA 2IH3C 1NU1H 2HKOA 2IU0A 4PDVA 5KA6A 1TUBB 1IXBA 1IBLO 2EIJB 4UVCA 2X6CA 5GONA 2WLIB 2L35A 3THOA 3TCUA 1PKXA 2YSUB 4X1IA 3OE7G 5C8YA 3RVYA 2WWWA 1AR4A 3CJHA 2A06H 3JARB 1SZTA 4RWUA 3SGIA 3JATA 4FFBB 1H8EG 2ZE7A 5D5PA 4YIPA 5EZYB 3T1YO 2W0FC 3A0BZ 3H1IH 1RSOB 4TQDA 2YEVB 5IWAB 5KHJA 1NR7A 1R1BA 2Q73A 1FFXB 1Q82W 4CS3A 2F4VO 2N74A 2AHYA 4G27B 1VQ6V 4GKJO 3KKYA 3JAWA 1VQ4V 2YC0A 2Y69B 3PJSK 2CAZC 4JI6O 4X64B 3SPHA 4DV0B 4AILC 4LF5O 2IU3A 2QSAA 1B6QA 5LA6A 3HPLC 1NTMH 1SA0A 4I0XA 1IBKB 1XNRB 2DWDC 1URFA 1SQVH 2EJ7A 3SJBC 3D3IA 4GUNA 2P67A 2JS3A 3E89A 4EKWA 1VF6A 1XHZA 1FXKA 3ZRWB 4BIUA 1VQNV 1ORQC 3BABA 2ZKOA 1K4DC 2GBOA 4HNAB 1QNMA 1GAXA 1E1RG 4TT3G 1ZTEA 3W7TA 1Y76B 2XTAA 1AI4A 4JI7O 3K3WA 2RQ6A 1XMOO 3CRRA 1OHHG 2W6JG 4NXNB 3KCXA 2AZ0A 1H8HG 3QVNA 4DUYB 1OCOC 1WA8B 2ZQMA 2HLDG 1Q6UA 2HVKC 4JI5O 1O9HA 2R9IA 3ZIAG 2DMXA 3HKCA 3L75H 1AI5A 1PNLA 3SPCA 1FJGB 4X1YB 4IYIA 5EIBD 5JVDA 2PGGA 2XAJA 3L9DA 1PP9H 2ZR3A 3OAAG 4IT5A 4B3SO 5CBHA 3LDEA 3R65A 3W7UA 2MK3A 2VQEO 4JASA 3RYCB 4FLXA 3G80A 4CH4A 3FB8C 1F4NA 5C93A 2LGWA 3SPGA 2P22C 3O9OA 2NN4A 5B3SB 4JTCB 4LH7A 4XDKA 4X9QA 2ZDIA 1OJHA 3E8FA 3H01A 2KG7A 4CS2A 1K4CC 3FYIB 5B1AB 4B3MB 1J95A 3E22B 4NTXA 2QM4A 1AB3A 1TUBA 4X65O 3C90A 2WLIA 4DRXA 3JALB 1K8AW 1M57C 4JAUA 3OTOO 5JWPA 2YI8A 2A79B 3JARA 4U3FH 3CC4V 3ZHQA 3K9SA 4OPAA 5JH7B 1BGYH 5EZYA 3ZRXA 2OYQA 2CUGA 2XASA 2FL4A 3CD6V 3T2MA 5DN6G 2YEVA 1AP5A 3BVOA 3U11A 3AG2C 3K06A 4TV9A 1IURA 1FFXA 4W4KA 1SETA 2HJDA 3ZMTA 4I50B 4FMTA 1GN3A 2IJKA 3E35A 3LUTB 4LWSB 3ZRVA 1M56B 2A7WA 3AK3A 2UUBB 4JYBA 5LHHA 4EB6A 2NLJC 4RO2A 4Z1VA 4FLUA 3M7MX 4FFKA 1NT2B 4BAYA 1UJWB 1VQKV 2Y4UA 2ZR2A 3BFRA 1AVMA 1FXHA 4OPHA 2IJIA 2E75B 4HNAA 5B5EZ 3ZS8C 2VQFO 4BW9A 1BL8A 1Y76A 3VQXA 2QTOA 2ZIOA 2DYRC 3ICXA 2HVJC 4JI2B 4E2LA 2LW1A 4RQFA 1MZFA 1Q86W 3UO2A 3AG1B 5IJ9B 2KKWA 4FLWA 4O4JB 1NVPB 5KUKA 4X1YA 5LYJB 4YIOA 4J42A 3OGCC 3LDCA 4PD4F 1VF6C 1FXKC 4MVZA 4UXNA 4BWAA 4Q20A 1SF9A 1QR9A 1FS0G 5JCOA 4B3RO 1XOUA 3RYCA 4J7KA 3FB5C 4JTAB 2QWOB 3G71V 1JFFA 4JZ2A 1NJIW 1IBLB 3JYCA 1AI6A 3ASNC 5LGTA 4J9ZB 2C2AA 2UXDO 2IJJA 2QWRB 3E22A 1KC8W 5A9GA 3DGEA 3AG4C 3JD3A 3T1YB 1V55B 3APQA 3OMAB 4LNUB 3LNNA 1YVWA 2F4VB 2Q68A 4GKJB 4UV9A 3BCCH 4JPRA 2ZINA 5JQGB 4D7TA 4K35A 5JH7A 4JI6B 1US6A 2WAMA 2QWPB 4LF5B 2ATKC 4PI0A 1KP2A 1UPGA 2AGAA 2ZXWB 4ZBMA 3EXAA 4LCUC 1M4UA 1WJZA 4ZI7B 1QBZA 4AI8A 1K34A 3CEIA 4FJCC 4PELA 1WNSA 2XOKG 1CEZA 4LWSA 2JEUA 3JASB 2EIJC 2IBZH 3ETDA 1P7GA 4DK1A 2HJFC 1H38A 4G28B 2EULA 4R6ZA 3F5TA 4QGPA 3CXCU 1XMOB 3W7WA 3B09A 2KQXA 5IYDO 1SQXH 1K5SA 1M90W 1M1KW 4JI5B 5J9PC 2EIMB 2HP8A 2P06A 3A8TA 2A9HA 5A2QN 3MAQA 1YIJV 4WBNA 1WP8A 1IXMA 3CRCA 5IYZB 3FFQA 4LR3A 1VQPV 5EYPA 1SKVA 2Y69C 4CS4A 4B3SB 5IYCO 4NKGB 4GYCB 3JD1A 4MVSA 2A0LA 2ZE5A 4R7CA 2VQEB 1E79G 5IJ9A 1QVGU 4TV8B 4DUZO 1N34O 1I94O 4ZKIA 3CCQV 3E8HA 5LYJA 2X6AA 3ABKB 3FYEB 1XMQO 5DM6V 3MDSA 3WG7B 4UCSA 2VWJA 1SESA 3CHXA 1AJQA 3GB7C 1EN5A 3ABMB 3LSSA 1P84F 5L3CA 4DV3O 4FM0A 1JVMA 3LDDA 1L0LH 4J80A 2QTSA 1FD9A 3TJTA 2ZE6A 4UCUA 5LOVA 1HNZO 1Q3EA 3BRCA 3DTUB 5KAFZ 1TAEA 4LF6O 4DYLA 5CA3A 3JAKB 4FZ1A 2UUBO 3OTOB 3IJ4A 3J7AU 2WLHA 4GX5A 1XQ8A 3SYPA 2F1MA 5GTIZ 4FLVA 4JYCA 3SR2C 1S72V 3C3SA 4U3JB 1I0HA 1WAZA 3ETEA 2EINB 2BTOA 1IVSA 4LNUA 1XDCA 1GN2A 2YXHA 1GO3F 1QQCA 1U96A 3NR7A 1H2GA 2JS5A 1RM1B 2E5LO 1KUQA 4LBEC 1NQTA 3ZHTA 1QVFU 3K5NA 3SJAC 4C7UA 1P7BA 2QM7A 2P90A 5JQGA 5JCOC 1VQ8V 3L72H 1OCRB 3GVMA 2DJVA 3RN4A 1DLBA 5BXZA 4TUYB 4LF8O 5CA0A 3U10A 5B3SC 3CRQA 3E8BA 1V54C 1HR0O 2IW5A 4ZI7A 5FPOA 4JI1B 1S3JA 3ZX6A 3FAVB 5B1AC 4YJ3B 2UXNA 5KHIA 3JASA 5EBLC 3TXSA 5FNVB 2UXBO 2VQFB 5BMVB 5L3EA 1BMFG 2CTQA 3P3PA 5LHGA 3DXRB 4LP8A 1NTZH 3OUSA 3G4SV 1SQQH 3ML0A 3SYAA 2XAFA 1K92A 3CC7V 4P2ZA 4GKKO 3UQ8A 1ZX3A 3CYOA 2WSSG 2YUAA 1S5HC 4LF7O 5EK0A 2ADPA 4X66O 3ABLB 2Y0IA 1FPOA 1P4RA 4I55B 1AR1B 1JMKC
chains in the Genus database with same CATH topology
4MW3A 3BY6A 3ABTA 1K4CC 3FYIB 3P32A 5B1AB 2EZPA 1JOYA 1J95A 3ZMZA 2X0LA 3K04A 3K03A 3ZMUA 4JAVA 1MSWD 3VOUA 1M56C 2DYRB 4J9YB 2WLIA 3ZCCA 1WPXA 2HFEC 1M57C 1VQ7V 1K8AW 1FFTB 4JAUA 1PD3A 1OCRC 1AI7A 1GK9A 3HB3B 2A79B 5H6RA 4PA6A 4N21A 3CC4V 3ASOB 3IC7A 4MTXA 5B1OA 3IFXA 1JX9A 1K5QA 1ROPA 3ZRXA 2XASA 2Q69A 3MHSC 1I5XA 1YJWV 4WFAV 3CD6V 3T2MA 5DN6G 2YEVA 3OMNB 1CPYA 3AG2C 2DYSC 3K06A 4MTOA 4I5SA 3OR7C 2X6BA 4WFGA 1MOFA 3FB6C 3AEIA 4PDMA 1SETA 1FXVA 3OW2U 4JTDB 3ZMTA 2DWEC 4FMTA 1S77D 2IJKA 3E35A 4WCEV 1QR8A 1YJ9V 2D3OW 1PNKA 3LUTB 3ZRVA 2V7QG 1M56B 5EBWC 2WLLB 2QM8A 1M57B 4JYBA 5LHHA 4QJFB 2B1GA 3STZC 3P30A 1N8RW 2ITCC 1HWYA 2NLJC 4RO2A 5L3DA 3OM3B 2Z5UA 4QIWF 3SPJA 2XAQA 1WLEA 3T1CA 1VQ5V 1XL6A 1NH2B 3K08A 1MG1A 4BAYA 1UJWB 1VQKV 2OTJV 2ZDIC 2ZR2A 3ZN0A 2ZD9A 1FXHA 1K33A 3OR6C 2IJIA 3AG2B 2DYSB 2QKSA 3SYCA 4G2KA 3I55V 1R6NA 3CPWU 1VQ9V 3OMIB 4GT1A 1BL8A 2IJHA 4I9WA 2EIKC 2XAGA 4H33A 2QTOA 2PI4A 1NBMG 1THZA 5H9CA 1Q81W 4U7OA 3CC2V 4F4LA 3TETA 1YHQV 2QE7G 2DYRC 2HVJC 4PDLA 3E2EA 4E2LA 3RVZA 4MTGA 5HFMA 3QO8A 1NKDA 4RQFA 2XAHA 4ASUG 2EILC 4MVUA 2GSMB 3CCVV 2WPDG 4MVRA 3STLC 1KD1W 4FK5C 2JEXA 4PA3A 3KG2A 1EZJA 1Q86W 4DXWA 3AG1B 3EHBB 4PA7A 5CBGA 1NVPB 1ENVA 5KUKA 2EBOA 3E86A 2NNUA 1KP3A 1VQLV 1YSCA 4RQEA 2P7TC 4GCZA 3OGCC 1V55C 3LDCA 5EC1C 1S76D 1FXKC 5IY5C 3JD4A 4MS2A 4MVZA 4MVQA 2WLNA 4UXNA 1K7DA 2EJRA 4Q20A 2EIKB 4R50A 1QR9A 4UVAA 1FS0G 2LFSA 2Y48A 5L3GA 1DTOA 3FB5C 4JTAB 2DQ3A 3G71V 1SRYA 4UUJC 3CMEV 1YTFB 1NJIW 3JYCA 1Q7YW 1I5YA 1AI6A 2Q67A 4UVBA 2H8PC 4YXWG 4BIZA 4QE9A 2EILB 3ASNC 2H94A 4PDRA 5LGNA 3CCUV 3WFVA 5LGTA 2KB1A 3M99B 1R6KA 3GWOA 4J9ZB 4RUEA 1BHAA 1OCCC 2OCCC 2ZXWC 2DQ0A 3OEHG 1W0KG 2C2AA 2IJJA 2X7RB 2WLJA 1F4MA 1KC8W 4KP4A 3DGEA 4R8CA 1R3KC 2FTKA 3AG4C 2LP7A 3OUFA 5FL7G 2UXXA 3LNMB 3JD3A 3ZJZA 3TK1A 3W7XA 2QEXV 1V55B 3OMAB 4L87A 4QE7A 4MW8A 1FXKB 4WF9V 5IY5B 3B8MA 1Y66A 1R3LC 1F23A 1JJ2U 4MVOA 1YI2V 1M9NA 4X88A 2Q68A 1AJNA 4UV9A 2Q6AA 2BOBC 5B1BC 3ZMVA 4JPRA 2LFRA 1JCHA 3B77A 2QA4V 1GM9A 1JQ0A 1R73A 2WAMA 3RW0A 2ATKC 4DO2A 4X89A 1KP2A 3ASNB 1R3JC 3AG1C 5KUMA 4N23A 1W2BU 3E83A 2EIMC 1OCCB 2OCCB 1DF4A 2ZXWB 3MD0A 2BOCC 4ZBMA 4GX2A 3A0RA 4LCUC 4OXSA 4WFHA 1QBZA 1DF5A 3AG3C 4JGSA 4RAIA 3ZRWA 1K34A 1XL4A 1NH2D 3QO5A 1LNQA 3AG4B 4FJCC 4PELA 4Z1MG 3VBBA 2XOKG 1GM8A 3K9AA 2JEUA 1CEZA 2WLLA 5IYBO 5HFLA 1F51A 2EIJC 3ETGA 1K3EA 3ETDA 3K0GA 2WLMA 3EFFK 1NR1A 1QLEC 2HJFC 3CCLV 3B8NA 2F43G 5B1BB 2WLKA 1H38A 4G28B 3ABUA 4R6ZA 1KECA 3CXCU 3ABKC 3ZN1A 5B1NA 4MSWC 4GX1A 3W7WA 2XNDG 2CK3G 4KFMA 4LC1A 3WG7C 3CCEV 1COWG 4PA4A 5L3FA 3CCSV 5IYDO 4WFBV 1K73W 1G8MA 1MABG 4CBCA 1K5SA 3G6EV 1M1KW 1M90W 4QNHB 4GX0A 5J9PC 3ABMC 3F5WC 2EIMB 1Y4MA 1GKFA 3T4ZA 3E8GA 5CN0A 1EFRG 2A9HA 1KKDA 1NVPD 1YIJV 1YJNV 3AG3B 2OT5A 1CP9A 3CMAV 1IXMA 2IH3C 5H6QA 1VQPV 3K0DA 2HKOA 2Y69C 3FB7C 2IU0A 4PDVA 1GM7A 1ZWIC 3QNEA 5KA6A 5IYCO 3CCRV 4HAMA 2EIJB 4UVCA 2X6CA 3JD1A 5L3BA 4MVSA 4JF3A 2A0LA 1QLEB 3SPIA 4R7CA 2WLIB 3JCZA 1E79G 1QVGU 4TWKA 3TCUA 1PKXA 2YSUB 2B5UA 1K97A 1QCEA 4FIPC 3OE7G 2HG5C 4ZKIA 3RVYA 1OCOB 5CBFA 3CCQV 2WWWA 5BZBA 3E8HA 1V54B 2GHYA 1SZTA 1E1QG 2JJ2G 2X6AA 3ABKB 3CP1A 3FYEB 1YTFD 3JD0A 1OCZC 4PA9A 5DM6V 1VQMV 3K79A 3WG7B 1H8EG 2EINC 1RPRA 2R9RB 2P6JA 1SESA 4P30A 2JJ1G 2W0FC 1AJQA 3GB7C 4HZ3A 2JK5C 3ABMB 4CZZA 3W7SA 3LSSA 2YEVB 1RM1C 5L3CA 1JVMA 3LDDA 1EBOA 1NR7A 1QLNA 1K9MW 1Q82W 5CMUA 2AHYA 1G4YB 4G27B 4U7NA 1VQ6V 3OFNG 4X8AA 3DTUB 1VQ4V 2Z3YA 3PJSK 2Y69B 5IDJA 5CA3A 1JPXA 3SPHA 4QPKA 3X2QC 2WLHA 4GX5A 2IU3A 1AROP 3SYPA 3CCJV 1B6QA 1PNMA 3BEHA 3HPLC 4BW5A 4JYCA 4MTFA 3F7YC 1S72V 1OZ0A 2DWDC 4XDJA 3D3IA 3MHHC 1OCZB 2P67A 2ITDC 3ETEA 3E89A 4EKWA 2EINB 2V1DA 4KUMA 4TSFG 1FXKA 2M7WA 4HYOA 3ZRWB 5LHIA 1GO3F 4BIUA 1H2GA 1L1FA 1ORQC 5LGUA 1GTOA 5GW7A 1RM1B 1VQNV 1K4DC 4LBEC 1NQTA 2EZOA 4WFFA 4WFEA 5EC2C 1QVFU 1P7BA 1E1RG 2QM7A 4TT3G 3ZRSA 2P90A 4P9PA 3W7TA 1VQ8V 1OCRB 3ZMSA 1AI4A 3OEEG 3K3WA 1DLBA 1R3IC 1GMGA 1OHHG 2W6JG 1PL0A 4H37A 3X2QB 3SJQC 1YITV 1H8HG 3F7VC 1VQOV 2JIZG 1OCOC 5B3SC 1RPOA 2ZQMA 5KA5A 1AJPA 3ABLC 2HLDG 3E8BA 1V54C 2HVKC 2R9IA 3ZIAG 2IW5A 3SYQA 4RUFA 5LBQA 1AI5A 1PNLA 1S3JA 3D36A 3SPCA 3QO7A 4P9OA 1S0VA 5B1AC 3FKSG 2UXNA 3SYOA 4MVMA 4MT8A 2K1EA 1W0JG 3I56V 2XAJA 5E1AC 5EBLC 2ZR3A 3OAAG 4FPPA 1KQSU 2AHZA 5CBHA 5L3EA 3CCMV 3LDEA 1BMFG 4QPJA 3R65A 3W7UA 3LSQA 2MK3A 1SERA 3JD2A 5LHGA 4LP8A 4JASA 2PI5A 2HR3A 3OUSA 3G4SV 3ASOC 3ML0A 3SYAA 2B1IA 2XAFA 1K92A 3UM7A 3T4DA 4P2ZA 3CC7V 3FB8C 1F4NA 5C93A 4UV8A 4XDLA 2DW4A 3SPGA 3NXSA 3CYOA 2WSSG 5EBMC 1S5HC 4XBFA 5B3SB 2IH1C 4JTCB 5EK0A 3ABLB 2OTLV 1TUEB 4XDKA 2ZDIA 2JDIG 1P4RA 2W6IG 3E8FA 3H01A 3UKMA 1BHBA 1AR1B 3IGAC 3RBZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQN V;  1VQP V;  4WCE V;  3CCV V;  1KD1 W;  3CCJ V;  1QVF U;  1YJ9 V;  2D3O W;  3G4S V;  3CCR V;  3I55 V;  3CCE V;  3CCS V;  1Q86 W;  1K73 W;  2QA4 V;  4WFB V;  3CPW U;  1KC8 W;  1YJW V;  1VQ9 V;  4WFA V;  3G6E V;  1M1K W;  3CC7 V;  1S72 V;  1R73 A;  1M90 W;  1VQ8 V;  3CD6 V;  1K9M W;  1Q82 W;  3G71 V;  1QVG U;  1N8R W;  3CME V;  1VQL V;  1K8A W;  1VQ7 V;  1NJI W;  3I56 V;  1Q81 W;  2QEX V;  3CCQ V;  1Q7Y W;  1VQ5 V;  1VQ6 V;  3CCL V;  3CC2 V;  1VQ4 V;  4WF9 V;  1W2B U;  1YIJ V;  1YHQ V;  1YIT V;  1YJN V;  1KQS U;  2OTL V;  3CCM V;  3CCU V;  1JJ2 U;  1VQO V;  3OW2 U;  1VQK V;  1YI2 V;  2OTJ V;  3CMA V;  5DM6 V;  1VQM V;  3CXC U;  3CC4 V; 
#chains in the Genus database with same CATH topology
 5IYZ A;  3ABT A;  3P32 A;  3ZMZ A;  1I7F A;  2HEP A;  1IBM O;  3K04 A;  1NS1 A;  4LFB B;  3ZMU A;  4JAV A;  1M56 C;  4J9Y B;  2Q5Z A;  4OX9 O;  2HFE C;  4TV8 A;  4O4L B;  4B3R B;  2Y0P A;  1H2L A;  4ZHQ B;  4FLZ A;  1RFY A;  1X4T A;  1ZL8 A;  4N21 A;  1XEQ A;  1K5Q A;  4Z2W A;  2ZCE A;  1I5X A;  3ZHS A;  4WFA V;  4CH3 A;  4ZIB A;  3B4S A;  3OMN B;  2UXD B;  4MTO A;  4I5S A;  3WB2 A;  4K8X A;  1MOF A;  3FB6 C;  4PDM A;  1FXV A;  1Q90 D;  1M5I A;  1WB8 A;  5KMG B;  2P4V A;  3JAK A;  2XHB A;  2G38 A;  4DR2 O;  2Q0O C;  4I7Z B;  2QM8 A;  4DV2 O;  1VEW A;  1N8R W;  4IHJ B;  4DW1 A;  1HWY A;  4QIW F;  4U3J A;  3SPJ A;  2YIB A;  1WLE A;  3T1C A;  1VQ5 V;  1XL6 A;  1N33 O;  2BE3 A;  4JI4 O;  3LSU A;  1VIB A;  1MG1 A;  4J11 A;  1KB9 F;  3J80 N;  2OTJ V;  1L8D A;  2DE0 X;  3A2F A;  3H9V A;  3ZN0 A;  5JJN B;  2LO1 A;  4DK0 A;  3TGU H;  1K33 A;  3OR6 C;  1KYO F;  1EM1 A;  3I55 V;  4G2K A;  4GZR B;  2IJH A;  2L6L A;  2XAG A;  4FZ0 A;  2Q7E A;  2QKC A;  5H9C A;  1Q81 W;  4U7O A;  3JSL A;  1M93 A;  1SQF A;  3TET A;  1YHQ V;  2Q0A A;  4PDL A;  3E2E A;  3RVZ A;  4MTG A;  5HFM A;  1NKD A;  5KX5 B;  4FK5 C;  3H1H H;  4IIJ B;  1MZE A;  1J5E O;  1SQP H;  2Q9L A;  1SZX A;  4JAA A;  5CBG A;  3FAV A;  3CB2 A;  1D5N A;  1VQL V;  4CH5 A;  4ICG A;  4RQE A;  3H1J H;  3H1K H;  3VQW A;  5FNV A;  1N36 O;  1V55 C;  5BMV A;  1BQZ A;  3RYF B;  1SC5 B;  5LXT A;  2EJR A;  2OCH A;  4PJ0 Z;  2EIK B;  1PPJ H;  1GRJ A;  5BR8 O;  2ARH A;  4X1K B;  5L3G A;  2JGD B;  1HNW B;  5TIS Z;  4B08 A;  2F93 B;  2DQ3 A;  3CS5 A;  2E76 B;  5CB4 B;  3D8C A;  2Q67 A;  1Y67 A;  4BIZ A;  4FLY A;  4UCT A;  1Z5W A;  4DUZ B;  4PDR A;  2H94 A;  1Q8I A;  5LGN A;  3WFV A;  2KB1 A;  3M99 B;  1N34 B;  1I94 B;  4I55 A;  4RUE A;  1BHA A;  3Q4H B;  2DQ0 A;  2ZXW C;  3OEH G;  5JJE B;  2QJ1 A;  4FFB A;  1XMQ B;  4KP4 A;  4R8C A;  1RSO A;  1R3K C;  2FTK A;  4FM2 A;  2UXX A;  3TK1 A;  2QEX V;  4DV3 B;  2N04 A;  1HNX O;  4O4L A;  4WF9 V;  5IY5 B;  4KL1 A;  1Y66 A;  1JJ2 U;  1M9N A;  2GUZ B;  1HNZ B;  1AJN A;  2Q6A A;  3ZMV A;  4B3T O;  4LF6 B;  2LFR A;  2YIC A;  1JCH A;  3B77 A;  1JQ0 A;  5LMU O;  1R73 A;  1KMI Z;  4DO2 A;  3M8A A;  1GN4 A;  2OIE A;  5KUM A;  5F2V O;  3KZI Z;  4YY3 B;  4N23 A;  2EIM C;  2OCC B;  3N2G B;  3MD0 A;  4O4I B;  2CTW A;  4JI1 O;  1G6U A;  4GX2 A;  4OXS A;  4WFH A;  3TXQ A;  1DF5 A;  1NH2 D;  3ZRW A;  5KMG A;  5LMN O;  5IT9 N;  3QO5 A;  1LNQ A;  4E4E A;  1GM8 A;  3K9A A;  2E5L B;  2OIG A;  5HFL A;  2GTA A;  4FM1 A;  2B9Z A;  3O65 A;  4B7K A;  2WLM A;  3EFF K;  4Q6G A;  2CTR A;  2F43 G;  5B1B B;  2WLK A;  3ABU A;  2CGN A;  1KEC A;  4JI3 B;  3ABK C;  3ZN1 A;  3SDL A;  4LF8 B;  1WA8 A;  2UXC O;  5KHG A;  3WG7 C;  3CCE V;  3CCS V;  4DR6 O;  4WFB V;  4QNH B;  1HR0 B;  3ABM C;  3F5W C;  1Y4M A;  2BCC H;  5CN0 A;  1VP7 A;  3ZED A;  1YJN V;  2E3C A;  2OT5 A;  2WA3 A;  4OGQ B;  2JGU A;  2PF4 E;  1Q5O A;  2UXB B;  3K0D A;  4LFB O;  1GM7 A;  1ZWI C;  3QNE A;  5KX5 A;  1DK1 A;  3L74 H;  2QWQ B;  3PN1 A;  4IIJ A;  4JF3 A;  3JCZ A;  1KKC A;  3FX7 A;  1K97 A;  4FIP C;  1OCO B;  5CBF A;  2F23 A;  1TA8 A;  4GKK B;  1E1Q G;  2JJ2 G;  4DR4 B;  3CP1 A;  1YTF D;  4FVM A;  1JJO A;  5E79 Z;  2QR4 A;  2EIN C;  1RPR A;  2R9R B;  1NZ6 A;  4X66 B;  4LF7 B;  2P6J A;  5B66 Z;  3RYF A;  1F7Y A;  2JK5 C;  4PI2 A;  1RM1 C;  3FD9 A;  1Z5V A;  1EBO A;  4X1K A;  5J2U B;  1K9M W;  1QLN A;  1H2K A;  2JGD A;  2UUA O;  5JJJ B;  5CMU A;  4H13 B;  1G4Y B;  1FYJ A;  4U7N A;  5FLX N;  1IBM B;  3JAL A;  5IE9 A;  4DR1 O;  2DN9 A;  1UFI A;  4OX9 B;  3B2E E;  3UO3 A;  4QPK A;  2CH7 B;  1ARO P;  1B04 A;  1PNM A;  4O2B B;  4EEQ A;  4MTF A;  3F7Y C;  1OZ0 A;  4H44 B;  3HKD B;  1JR9 A;  3CXH F;  3MHH C;  1OCZ B;  2ITD C;  2YID A;  4KUM A;  3L70 H;  4TSF G;  2M7W A;  4HYO A;  5LHI A;  5LGU A;  3B40 A;  1L1F A;  1GTO A;  5GW7 A;  2EZO A;  4WFE A;  4I50 A;  1KBH A;  4O4H B;  3ZRS A;  2O57 A;  3HKB B;  3OEE G;  4DR2 B;  1PM9 A;  1GMG A;  5FPR A;  4DV2 B;  1NI8 A;  1PL0 A;  1MSD A;  3X2Q B;  1YIT V;  2ZNJ A;  3F7V C;  1VQO V;  1Z2G A;  3N2G A;  5KA5 A;  1RPO A;  4O4I A;  1B06 A;  1AJP A;  3ABL C;  1N33 B;  4JI4 B;  4UB6 Z;  4RUF A;  5LBQ A;  4KHP O;  1PL4 A;  1I08 A;  3QO7 A;  1HP8 A;  3SYO A;  5IJ0 B;  4MVM A;  4MT8 A;  2EX3 A;  2K1E A;  3JCU Z;  3RYI B;  2ODM A;  1BS3 A;  4J7Z A;  4JI8 O;  1KQS U;  2AHZ A;  1SS3 A;  3CCM V;  2MW2 B;  1S5L Z;  1HNW O;  3APO A;  1SER A;  3JD2 A;  4LH6 A;  3N2K B;  5GON B;  4YJ2 B;  1EN4 A;  4I9Q A;  4B7E A;  3T4D A;  3CJH B;  4XDL A;  1TVK B;  3NXS A;  4O4J A;  2A3Q A;  1XNQ O;  1J5E B;  4XBF A;  2QDO A;  2IH1 C;  3RYH B;  2OTL V;  1TUE B;  3K5O A;  4DV6 O;  2CDY A;  1BCC H;  2JDI G;  1ZLZ A;  1BHB A;  3RBZ A;  1YZB A;  1P49 A;  3BY6 A;  4MW3 A;  3WB1 A;  2ILM A;  1JOY A;  2F95 B;  1MMM A;  1N36 B;  1WB7 A;  2X0L A;  3DC5 A;  3K03 A;  1MSW D;  3BHP A;  2DYR B;  3CWB H;  3EVK A;  5BR8 B;  1VQ7 V;  1FFT B;  1AI7 A;  3HB3 B;  3BAA A;  4K0K O;  3ASO B;  4W4L A;  4EFB A;  5LA6 B;  4GLX A;  3HKE B;  4MTX A;  5B1O A;  1YDX A;  3L73 H;  2Q69 A;  1YJW V;  3RFR A;  4YY3 O;  2Q7H A;  1LUW A;  1N0N A;  5J2U A;  4UCR A;  1T5E A;  3AEI A;  5ITZ B;  3CRM A;  3OW2 U;  4JTD B;  3GWK C;  3WB0 A;  1HNX B;  2M6Y A;  1QR8 A;  1EN6 A;  4NTY A;  1XHX A;  2WLL B;  5LL6 Y;  1WN7 A;  3N27 A;  4O2B A;  4QJF B;  2B1G A;  3P30 A;  4F6E A;  2VRZ A;  5DEC A;  4B3T B;  5L3D A;  2XAQ A;  2YXY A;  3HKD A;  4JI3 O;  5LMU B;  4DV5 B;  3K08 A;  1XUQ A;  2HHH O;  4NXM O;  4DV4 O;  2UU9 O;  1LR1 A;  2DYS B;  3CPW U;  4O4H A;  2ZE8 A;  4I9W A;  3T1H O;  2EIK C;  1HDJ A;  5LMN B;  4H33 A;  1SQB H;  1NBM G;  1THZ A;  2Q4P A;  2BTQ B;  3G67 A;  2RN9 A;  3CC2 V;  4F4L A;  2F66 C;  4JZG A;  3QO8 A;  2XAH A;  4ASU G;  4MVR A;  1KD1 W;  3STL C;  2JEX A;  1EZJ A;  2PY5 A;  4YHH O;  4PA7 A;  2LGQ A;  1ENV A;  2PYJ A;  3E86 A;  4DR4 O;  1KP3 A;  2UXC B;  3RWR D;  2PYL A;  5IJ0 A;  4DR6 B;  2AZ2 A;  3RYI A;  5H2F Z;  4LF9 B;  1S76 D;  5IY5 C;  4MS2 A;  2WLN A;  1K7D A;  1WP7 A;  4TQF A;  4UVA A;  3N2K A;  2LFS A;  4YJ2 A;  1DTO A;  3C3T A;  4DRX B;  1SRY A;  4LFA O;  3KCY A;  4UUJ C;  1W59 A;  4DR5 O;  1TVK A;  1Q7Y W;  1I5Y A;  4AQY O;  1BT8 A;  4UVB A;  2H8P C;  5K1X A;  1XIL A;  2EIL B;  4DV7 O;  3RYH A;  3K59 A;  3CCU V;  3D3Q A;  4X62 O;  1R6K A;  3GWO A;  2OCC C;  4FLT A;  1W0K G;  3A0H Z;  2ZNI A;  4TV9 B;  5D5Q A;  4AHC A;  4BIO A;  3OUF A;  3LNM B;  1VAR A;  2XT9 A;  3W7X A;  4DR7 B;  2XUM A;  4QE7 A;  1RP3 B;  3B8M A;  2UUA B;  4MVO A;  4X88 A;  5B1B C;  1AR5 A;  3BPZ A;  4DR1 B;  2UUC B;  1YXB A;  3HKE A;  4EB6 B;  1GM9 A;  2VS0 A;  5EIB C;  3RW0 A;  4CC6 A;  3CX5 F;  3VQY A;  2JRI A;  3VQV A;  4O2A B;  3AG1 C;  3OT7 A;  2V4D A;  2Z0A A;  5KLV H;  2LQT A;  1OCC B;  1GH6 A;  4JV5 O;  2K9P A;  3CSX A;  5ITZ A;  3A0R A;  4NVP A;  2FB5 A;  4JGS A;  4RAI A;  1XL4 A;  2FML A;  2AW9 A;  1OV9 A;  4Z1M G;  2GDS A;  3VBB A;  5LP6 B;  4J7J A;  2WLL A;  5IYB O;  3OD4 A;  1F51 A;  3ETG A;  3K0G A;  1NR1 A;  1YF2 A;  2ETN A;  4UCO A;  3CCL V;  4D6T H;  2N05 A;  4TUY A;  2OWO A;  4IL6 Z;  3K58 A;  4MSW C;  4GX1 A;  4BR6 A;  2XND G;  4KFM A;  1COW G;  1YEW A;  4LF4 B;  4K3A A;  1MAB G;  4CBC A;  3G6E V;  1BSM A;  2P4K A;  1GKF A;  3T4Z A;  4YJ3 A;  4KHP B;  1EFR G;  4ZOL B;  2BSK B;  1NVP D;  1MNG A;  2BTQ A;  3AG3 B;  2R70 A;  1CP9 A;  3CMA V;  4J41 A;  2ZM6 B;  5H6Q A;  3FB7 C;  4JI8 B;  3L71 H;  5CA1 B;  2YDE A;  1BE3 H;  2R72 A;  3S3W A;  1N32 O;  3CCR V;  4HAM A;  2FKX A;  3DXR A;  5L3B A;  1JFF B;  4IYH A;  2CTP A;  1QLE B;  3SPI A;  4TWK A;  2JVD A;  2YS8 A;  2B5U A;  1QCE A;  2HG5 C;  5BZB A;  4CC5 A;  4NR1 A;  1D5A A;  4DW0 A;  1V54 B;  2GHY A;  1X59 A;  1KU9 A;  3JD0 A;  1OCZ C;  4PA9 A;  1VQM V;  1XNQ B;  3K79 A;  1FAF A;  4I4T B;  1A32 A;  4P30 A;  2JJ1 G;  4HZ3 A;  4DV6 B;  4CZZ A;  3W7S A;  4ABM A;  3DSQ A;  1SQG A;  3OFN G;  4F6R B;  4X8A A;  3BA9 A;  2Z3Y A;  4NB5 A;  5H5N A;  5IDJ A;  3J81 N;  1JPX A;  3CRA A;  2CE4 A;  4UB8 Z;  4ZHQ A;  3X2Q C;  1BQ0 A;  3CCJ V;  2LJ2 A;  3OTF A;  1IZ3 A;  3BEH A;  4BW5 A;  3AK1 A;  4K0K B;  2ZT9 B;  4XDJ A;  4DV5 O;  4LFC O;  1L0N H;  1EZV H;  2D2C B;  2V1D A;  4EFE A;  1HW7 A;  4WFF A;  1H2N A;  5EC2 C;  4P9P A;  1R6T A;  5GTH Z;  2LW7 A;  4A5U B;  4D7S A;  2ZIM A;  3ZMS A;  4UCV A;  5KHK A;  1Q43 A;  1R3I C;  4IHJ A;  4DR3 O;  1NTK H;  3IC9 A;  4O2A A;  4H37 A;  4DV1 O;  2IM9 A;  4PV1 B;  3SJQ C;  5KHH A;  2JIZ G;  3SYQ A;  4JI0 O;  4PHZ A;  3D36 A;  1S0V A;  4P9O A;  4X20 B;  2HHH B;  3FKS G;  5LP6 A;  4NXM B;  4DV4 B;  2UU9 B;  4LF9 O;  1W0J G;  3I56 V;  5E1A C;  4WBN B;  2R9A A;  4FPP A;  3T1H B;  5EYP B;  4QPJ A;  3I5D A;  3LSQ A;  2PI5 A;  2HR3 A;  1N4C A;  5BY1 A;  3ASO C;  1B3Q A;  2B1I A;  3DC6 A;  4JYA B;  3UM7 A;  1Q6H A;  4UV8 A;  2DW4 A;  5EBM C;  4YHH B;  4NTW A;  1Q6I A;  3G6B A;  2RNB A;  3BA8 A;  4ZOL A;  3K57 A;  1S5J A;  2BSK A;  3ZBH A;  2W6I G;  2ADQ B;  3UKM A;  5IWA O;  3IGA C;  5J2T B;  3K5L A;  1WPB A;  2EZP A;  1QU7 A;  1ZSP A;  2YXL A;  3JSN A;  5CA1 A;  4DR7 O;  5LOV B;  3VOU A;  3ZCC A;  1V9P A;  1WPX A;  4X64 O;  4DV0 O;  3QG5 A;  2RJZ A;  1PD3 A;  5CB4 A;  1OCR C;  1GK9 A;  2UUC O;  4LFA B;  5H6R A;  4DR5 B;  4PA6 A;  1IBK O;  3UCS C;  1XNR O;  4AQY B;  3IC7 A;  3HR0 A;  3IFX A;  1JX9 A;  4DV7 B;  1ROP A;  3Q4H A;  4I4T A;  3MHS C;  4X62 B;  3WU2 Z;  1CPY A;  2DYS C;  1MA1 A;  3OR7 C;  2X6B A;  4WFG A;  4F6R A;  5DED A;  1VF7 A;  1G1X B;  2YIB D;  2RDC A;  2YI9 A;  5AG2 A;  2DWE C;  2FYU H;  3QTC A;  3U0Z A;  1S77 D;  4WCE V;  2Q7G A;  2GUZ A;  1YJ9 V;  2D3O W;  1PNK A;  2V7Q G;  5EBW C;  2Q8V A;  3OGI B;  1M57 B;  1H2S B;  2PTM A;  3STZ C;  4NXN O;  2VWK A;  3AG7 A;  2ITC C;  4DUY O;  3OM3 B;  2Z5U A;  3UT5 B;  5CA0 B;  1NH2 B;  2ZDI C;  1FJG O;  1XBL A;  4LF4 O;  2ZD9 A;  3H1L H;  3AG2 B;  4JV5 B;  2QKS A;  3SYC A;  1R6N A;  2W0X A;  1Y74 B;  1VQ9 V;  3OMI B;  4GT1 A;  3P3N A;  2PI4 A;  1ZUQ A;  3ETQ A;  3QF7 A;  2CGO A;  2ZM6 O;  2GTS A;  2PUS A;  4JI7 B;  2QE7 G;  2YIA A;  3ZHV A;  1O9G A;  2EIL C;  4MVU A;  2GSM B;  3CCV V;  2WPD G;  4PA3 A;  1AP6 A;  3KG2 A;  1D2D A;  4DXW A;  3EHB B;  4X1I B;  5C8Y B;  2EBO A;  4X20 A;  3ZHU A;  1VF5 B;  2NNU A;  3S3X A;  1YSC A;  2P7T C;  1IDS A;  4GCZ A;  4B3M O;  3JAT B;  5EC1 C;  5KAI Z;  2P5O A;  1QHT A;  3JD4 A;  3AK2 A;  4MVQ A;  2E74 B;  4J10 A;  1ZAU A;  2NR5 A;  4R50 A;  3IAY A;  2QKA A;  2Y48 A;  3CME V;  1YTF B;  3JAM N;  3JAW B;  1N32 B;  4L8J A;  1LUV A;  5K1P A;  4YXW G;  1ZL8 B;  4QE9 A;  1CXZ B;  1OCC C;  4IGG A;  5J2T A;  1SA0 B;  4UFZ A;  4I0X B;  1IX9 A;  2X7R B;  4JYY A;  1VMG A;  2WLJ A;  1F4M A;  3D36 C;  2LP7 A;  5FL7 G;  4HBN A;  3ZJZ A;  1BZK A;  5LP6 C;  4L87 A;  4MW8 A;  1FXK B;  2QGN A;  4X65 B;  1R3L C;  1F23 A;  1YI2 V;  2BOB C;  1PV0 A;  2RMK B;  1N0J A;  2CH7 A;  2QA4 V;  3ZHR A;  1YCI A;  4X89 A;  3ASN B;  1R3J C;  4H0L B;  2WA4 A;  1W2B U;  3E83 A;  1DF4 A;  2BOC C;  4LFC B;  1TGO A;  4K8Z A;  2KSD A;  3HKC B;  3AG3 C;  2H3O A;  1U97 A;  3AG4 B;  2DOS A;  2PZS A;  2QWN B;  1FKA O;  5JVD B;  3SJC C;  1XRE A;  4JI2 O;  1K3E A;  3HKB A;  1QLE C;  3K5M A;  3B8N A;  3UT5 A;  3RGB A;  1Y6X A;  2GV9 A;  1H2M A;  4CH6 A;  4TOI A;  4DR3 B;  1GN6 A;  4JYA O;  4NYK A;  5B1N A;  4DV1 B;  2CK3 G;  4LC1 A;  1K73 W;  4PA4 A;  5L3F A;  1G8M A;  2Y4T A;  2AXT Z;  3R66 A;  1DGS A;  4GX0 A;  1Y74 A;  3CE2 A;  4JI0 B;  3E8G A;  2RCV A;  1KKD A;  1XI1 A;  3RT3 C;  1AIL A;  5LXT B;  2KG7 B;  1JA8 A;  4KXR A;  2IH3 C;  1NU1 H;  2HKO A;  2IU0 A;  4PDV A;  5KA6 A;  1TUB B;  1IXB A;  1IBL O;  2EIJ B;  4UVC A;  2X6C A;  5GON A;  2WLI B;  2L35 A;  3THO A;  3TCU A;  1PKX A;  2YSU B;  4X1I A;  3OE7 G;  5C8Y A;  3RVY A;  2WWW A;  1AR4 A;  3CJH A;  2A06 H;  3JAR B;  1SZT A;  4RWU A;  3SGI A;  3JAT A;  4FFB B;  1H8E G;  2ZE7 A;  5D5P A;  4YIP A;  5EZY B;  3T1Y O;  2W0F C;  3A0B Z;  3H1I H;  1RSO B;  4TQD A;  2YEV B;  5IWA B;  5KHJ A;  1NR7 A;  1R1B A;  2Q73 A;  1FFX B;  1Q82 W;  4CS3 A;  2F4V O;  2N74 A;  2AHY A;  4G27 B;  1VQ6 V;  4GKJ O;  3KKY A;  3JAW A;  1VQ4 V;  2YC0 A;  2Y69 B;  3PJS K;  2CAZ C;  4JI6 O;  4X64 B;  3SPH A;  4DV0 B;  4AIL C;  4LF5 O;  2IU3 A;  2QSA A;  1B6Q A;  5LA6 A;  3HPL C;  1NTM H;  1SA0 A;  4I0X A;  1IBK B;  1XNR B;  2DWD C;  1URF A;  1SQV H;  2EJ7 A;  3SJB C;  3D3I A;  4GUN A;  2P67 A;  2JS3 A;  3E89 A;  4EKW A;  1VF6 A;  1XHZ A;  1FXK A;  3ZRW B;  4BIU A;  1VQN V;  1ORQ C;  3BAB A;  2ZKO A;  1K4D C;  2GBO A;  4HNA B;  1QNM A;  1GAX A;  1E1R G;  4TT3 G;  1ZTE A;  3W7T A;  1Y76 B;  2XTA A;  1AI4 A;  4JI7 O;  3K3W A;  2RQ6 A;  1XMO O;  3CRR A;  1OHH G;  2W6J G;  4NXN B;  3KCX A;  2AZ0 A;  1H8H G;  3QVN A;  4DUY B;  1OCO C;  1WA8 B;  2ZQM A;  2HLD G;  1Q6U A;  2HVK C;  4JI5 O;  1O9H A;  2R9I A;  3ZIA G;  2DMX A;  3HKC A;  3L75 H;  1AI5 A;  1PNL A;  3SPC A;  1FJG B;  4X1Y B;  4IYI A;  5EIB D;  5JVD A;  2PGG A;  2XAJ A;  3L9D A;  1PP9 H;  2ZR3 A;  3OAA G;  4IT5 A;  4B3S O;  5CBH A;  3LDE A;  3R65 A;  3W7U A;  2MK3 A;  2VQE O;  4JAS A;  3RYC B;  4FLX A;  3G80 A;  4CH4 A;  3FB8 C;  1F4N A;  5C93 A;  2LGW A;  3SPG A;  2P22 C;  3O9O A;  2NN4 A;  5B3S B;  4JTC B;  4LH7 A;  4XDK A;  4X9Q A;  2ZDI A;  1OJH A;  3E8F A;  3H01 A;  2KG7 A;  4CS2 A;  1K4C C;  3FYI B;  5B1A B;  4B3M B;  1J95 A;  3E22 B;  4NTX A;  2QM4 A;  1AB3 A;  1TUB A;  4X65 O;  3C90 A;  2WLI A;  4DRX A;  3JAL B;  1K8A W;  1M57 C;  4JAU A;  3OTO O;  5JWP A;  2YI8 A;  2A79 B;  3JAR A;  4U3F H;  3CC4 V;  3ZHQ A;  3K9S A;  4OPA A;  5JH7 B;  1BGY H;  5EZY A;  3ZRX A;  2OYQ A;  2CUG A;  2XAS A;  2FL4 A;  3CD6 V;  3T2M A;  5DN6 G;  2YEV A;  1AP5 A;  3BVO A;  3U11 A;  3AG2 C;  3K06 A;  4TV9 A;  1IUR A;  1FFX A;  4W4K A;  1SET A;  2HJD A;  3ZMT A;  4I50 B;  4FMT A;  1GN3 A;  2IJK A;  3E35 A;  3LUT B;  4LWS B;  3ZRV A;  1M56 B;  2A7W A;  3AK3 A;  2UUB B;  4JYB A;  5LHH A;  4EB6 A;  2NLJ C;  4RO2 A;  4Z1V A;  4FLU A;  3M7M X;  4FFK A;  1NT2 B;  4BAY A;  1UJW B;  1VQK V;  2Y4U A;  2ZR2 A;  3BFR A;  1AVM A;  1FXH A;  4OPH A;  2IJI A;  2E75 B;  4HNA A;  5B5E Z;  3ZS8 C;  2VQF O;  4BW9 A;  1BL8 A;  1Y76 A;  3VQX A;  2QTO A;  2ZIO A;  2DYR C;  3ICX A;  2HVJ C;  4JI2 B;  4E2L A;  2LW1 A;  4RQF A;  1MZF A;  1Q86 W;  3UO2 A;  3AG1 B;  5IJ9 B;  2KKW A;  4FLW A;  4O4J B;  1NVP B;  5KUK A;  4X1Y A;  5LYJ B;  4YIO A;  4J42 A;  3OGC C;  3LDC A;  4PD4 F;  1VF6 C;  1FXK C;  4MVZ A;  4UXN A;  4BWA A;  4Q20 A;  1SF9 A;  1QR9 A;  1FS0 G;  5JCO A;  4B3R O;  1XOU A;  3RYC A;  4J7K A;  3FB5 C;  4JTA B;  2QWO B;  3G71 V;  1JFF A;  4JZ2 A;  1NJI W;  1IBL B;  3JYC A;  1AI6 A;  3ASN C;  5LGT A;  4J9Z B;  2C2A A;  2UXD O;  2IJJ A;  2QWR B;  3E22 A;  1KC8 W;  5A9G A;  3DGE A;  3AG4 C;  3JD3 A;  3T1Y B;  1V55 B;  3APQ A;  3OMA B;  4LNU B;  3LNN A;  1YVW A;  2F4V B;  2Q68 A;  4GKJ B;  4UV9 A;  3BCC H;  4JPR A;  2ZIN A;  5JQG B;  4D7T A;  4K35 A;  5JH7 A;  4JI6 B;  1US6 A;  2WAM A;  2QWP B;  4LF5 B;  2ATK C;  4PI0 A;  1KP2 A;  1UPG A;  2AGA A;  2ZXW B;  4ZBM A;  3EXA A;  4LCU C;  1M4U A;  1WJZ A;  4ZI7 B;  1QBZ A;  4AI8 A;  1K34 A;  3CEI A;  4FJC C;  4PEL A;  1WNS A;  2XOK G;  1CEZ A;  4LWS A;  2JEU A;  3JAS B;  2EIJ C;  2IBZ H;  3ETD A;  1P7G A;  4DK1 A;  2HJF C;  1H38 A;  4G28 B;  2EUL A;  4R6Z A;  3F5T A;  4QGP A;  3CXC U;  1XMO B;  3W7W A;  3B09 A;  2KQX A;  5IYD O;  1SQX H;  1K5S A;  1M90 W;  1M1K W;  4JI5 B;  5J9P C;  2EIM B;  2HP8 A;  2P06 A;  3A8T A;  2A9H A;  5A2Q N;  3MAQ A;  1YIJ V;  4WBN A;  1WP8 A;  1IXM A;  3CRC A;  5IYZ B;  3FFQ A;  4LR3 A;  1VQP V;  5EYP A;  1SKV A;  2Y69 C;  4CS4 A;  4B3S B;  5IYC O;  4NKG B;  4GYC B;  3JD1 A;  4MVS A;  2A0L A;  2ZE5 A;  4R7C A;  2VQE B;  1E79 G;  5IJ9 A;  1QVG U;  4TV8 B;  4DUZ O;  1N34 O;  1I94 O;  4ZKI A;  3CCQ V;  3E8H A;  5LYJ A;  2X6A A;  3ABK B;  3FYE B;  1XMQ O;  5DM6 V;  3MDS A;  3WG7 B;  4UCS A;  2VWJ A;  1SES A;  3CHX A;  1AJQ A;  3GB7 C;  1EN5 A;  3ABM B;  3LSS A;  1P84 F;  5L3C A;  4DV3 O;  4FM0 A;  1JVM A;  3LDD A;  1L0L H;  4J80 A;  2QTS A;  1FD9 A;  3TJT A;  2ZE6 A;  4UCU A;  5LOV A;  1HNZ O;  1Q3E A;  3BRC A;  3DTU B;  5KAF Z;  1TAE A;  4LF6 O;  4DYL A;  5CA3 A;  3JAK B;  4FZ1 A;  2UUB O;  3OTO B;  3IJ4 A;  3J7A U;  2WLH A;  4GX5 A;  1XQ8 A;  3SYP A;  2F1M A;  5GTI Z;  4FLV A;  4JYC A;  3SR2 C;  1S72 V;  3C3S A;  4U3J B;  1I0H A;  1WAZ A;  3ETE A;  2EIN B;  2BTO A;  1IVS A;  4LNU A;  1XDC A;  1GN2 A;  2YXH A;  1GO3 F;  1QQC A;  1U96 A;  3NR7 A;  1H2G A;  2JS5 A;  1RM1 B;  2E5L O;  1KUQ A;  4LBE C;  1NQT A;  3ZHT A;  1QVF U;  3K5N A;  3SJA C;  4C7U A;  1P7B A;  2QM7 A;  2P90 A;  5JQG A;  5JCO C;  1VQ8 V;  3L72 H;  1OCR B;  3GVM A;  2DJV A;  3RN4 A;  1DLB A;  5BXZ A;  4TUY B;  4LF8 O;  5CA0 A;  3U10 A;  5B3S C;  3CRQ A;  3E8B A;  1V54 C;  1HR0 O;  2IW5 A;  4ZI7 A;  5FPO A;  4JI1 B;  1S3J A;  3ZX6 A;  3FAV B;  5B1A C;  4YJ3 B;  2UXN A;  5KHI A;  3JAS A;  5EBL C;  3TXS A;  5FNV B;  2UXB O;  2VQF B;  5BMV B;  5L3E A;  1BMF G;  2CTQ A;  3P3P A;  5LHG A;  3DXR B;  4LP8 A;  1NTZ H;  3OUS A;  3G4S V;  1SQQ H;  3ML0 A;  3SYA A;  2XAF A;  1K92 A;  3CC7 V;  4P2Z A;  4GKK O;  3UQ8 A;  1ZX3 A;  3CYO A;  2WSS G;  2YUA A;  1S5H C;  4LF7 O;  5EK0 A;  2ADP A;  4X66 O;  3ABL B;  2Y0I A;  1FPO A;  1P4R A;  4I55 B;  1AR1 B;  1JMK C; 
#chains in the Genus database with same CATH homology
 4MW3 A;  3BY6 A;  3ABT A;  1K4C C;  3FYI B;  3P32 A;  5B1A B;  2EZP A;  1JOY A;  1J95 A;  3ZMZ A;  2X0L A;  3K04 A;  3K03 A;  3ZMU A;  4JAV A;  1MSW D;  3VOU A;  1M56 C;  2DYR B;  4J9Y B;  2WLI A;  3ZCC A;  1WPX A;  2HFE C;  1M57 C;  1VQ7 V;  1K8A W;  1FFT B;  4JAU A;  1PD3 A;  1OCR C;  1AI7 A;  1GK9 A;  3HB3 B;  2A79 B;  5H6R A;  4PA6 A;  4N21 A;  3CC4 V;  3ASO B;  3IC7 A;  4MTX A;  5B1O A;  3IFX A;  1JX9 A;  1K5Q A;  1ROP A;  3ZRX A;  2XAS A;  2Q69 A;  3MHS C;  1I5X A;  1YJW V;  4WFA V;  3CD6 V;  3T2M A;  5DN6 G;  2YEV A;  3OMN B;  1CPY A;  3AG2 C;  2DYS C;  3K06 A;  4MTO A;  4I5S A;  3OR7 C;  2X6B A;  4WFG A;  1MOF A;  3FB6 C;  3AEI A;  4PDM A;  1SET A;  1FXV A;  3OW2 U;  4JTD B;  3ZMT A;  2DWE C;  4FMT A;  1S77 D;  2IJK A;  3E35 A;  4WCE V;  1QR8 A;  1YJ9 V;  2D3O W;  1PNK A;  3LUT B;  3ZRV A;  2V7Q G;  1M56 B;  5EBW C;  2WLL B;  2QM8 A;  1M57 B;  4JYB A;  5LHH A;  4QJF B;  2B1G A;  3STZ C;  3P30 A;  1N8R W;  2ITC C;  1HWY A;  2NLJ C;  4RO2 A;  5L3D A;  3OM3 B;  2Z5U A;  4QIW F;  3SPJ A;  2XAQ A;  1WLE A;  3T1C A;  1VQ5 V;  1XL6 A;  1NH2 B;  3K08 A;  1MG1 A;  4BAY A;  1UJW B;  1VQK V;  2OTJ V;  2ZDI C;  2ZR2 A;  3ZN0 A;  2ZD9 A;  1FXH A;  1K33 A;  3OR6 C;  2IJI A;  3AG2 B;  2DYS B;  2QKS A;  3SYC A;  4G2K A;  3I55 V;  1R6N A;  3CPW U;  1VQ9 V;  3OMI B;  4GT1 A;  1BL8 A;  2IJH A;  4I9W A;  2EIK C;  2XAG A;  4H33 A;  2QTO A;  2PI4 A;  1NBM G;  1THZ A;  5H9C A;  1Q81 W;  4U7O A;  3CC2 V;  4F4L A;  3TET A;  1YHQ V;  2QE7 G;  2DYR C;  2HVJ C;  4PDL A;  3E2E A;  4E2L A;  3RVZ A;  4MTG A;  5HFM A;  3QO8 A;  1NKD A;  4RQF A;  2XAH A;  4ASU G;  2EIL C;  4MVU A;  2GSM B;  3CCV V;  2WPD G;  4MVR A;  3STL C;  1KD1 W;  4FK5 C;  2JEX A;  4PA3 A;  3KG2 A;  1EZJ A;  1Q86 W;  4DXW A;  3AG1 B;  3EHB B;  4PA7 A;  5CBG A;  1NVP B;  1ENV A;  5KUK A;  2EBO A;  3E86 A;  2NNU A;  1KP3 A;  1VQL V;  1YSC A;  4RQE A;  2P7T C;  4GCZ A;  3OGC C;  1V55 C;  3LDC A;  5EC1 C;  1S76 D;  1FXK C;  5IY5 C;  3JD4 A;  4MS2 A;  4MVZ A;  4MVQ A;  2WLN A;  4UXN A;  1K7D A;  2EJR A;  4Q20 A;  2EIK B;  4R50 A;  1QR9 A;  4UVA A;  1FS0 G;  2LFS A;  2Y48 A;  5L3G A;  1DTO A;  3FB5 C;  4JTA B;  2DQ3 A;  3G71 V;  1SRY A;  4UUJ C;  3CME V;  1YTF B;  1NJI W;  3JYC A;  1Q7Y W;  1I5Y A;  1AI6 A;  2Q67 A;  4UVB A;  2H8P C;  4YXW G;  4BIZ A;  4QE9 A;  2EIL B;  3ASN C;  2H94 A;  4PDR A;  5LGN A;  3CCU V;  3WFV A;  5LGT A;  2KB1 A;  3M99 B;  1R6K A;  3GWO A;  4J9Z B;  4RUE A;  1BHA A;  1OCC C;  2OCC C;  2ZXW C;  2DQ0 A;  3OEH G;  1W0K G;  2C2A A;  2IJJ A;  2X7R B;  2WLJ A;  1F4M A;  1KC8 W;  4KP4 A;  3DGE A;  4R8C A;  1R3K C;  2FTK A;  3AG4 C;  2LP7 A;  3OUF A;  5FL7 G;  2UXX A;  3LNM B;  3JD3 A;  3ZJZ A;  3TK1 A;  3W7X A;  2QEX V;  1V55 B;  3OMA B;  4L87 A;  4QE7 A;  4MW8 A;  1FXK B;  4WF9 V;  5IY5 B;  3B8M A;  1Y66 A;  1R3L C;  1F23 A;  1JJ2 U;  4MVO A;  1YI2 V;  1M9N A;  4X88 A;  2Q68 A;  1AJN A;  4UV9 A;  2Q6A A;  2BOB C;  5B1B C;  3ZMV A;  4JPR A;  2LFR A;  1JCH A;  3B77 A;  2QA4 V;  1GM9 A;  1JQ0 A;  1R73 A;  2WAM A;  3RW0 A;  2ATK C;  4DO2 A;  4X89 A;  1KP2 A;  3ASN B;  1R3J C;  3AG1 C;  5KUM A;  4N23 A;  1W2B U;  3E83 A;  2EIM C;  1OCC B;  2OCC B;  1DF4 A;  2ZXW B;  3MD0 A;  2BOC C;  4ZBM A;  4GX2 A;  3A0R A;  4LCU C;  4OXS A;  4WFH A;  1QBZ A;  1DF5 A;  3AG3 C;  4JGS A;  4RAI A;  3ZRW A;  1K34 A;  1XL4 A;  1NH2 D;  3QO5 A;  1LNQ A;  3AG4 B;  4FJC C;  4PEL A;  4Z1M G;  3VBB A;  2XOK G;  1GM8 A;  3K9A A;  2JEU A;  1CEZ A;  2WLL A;  5IYB O;  5HFL A;  1F51 A;  2EIJ C;  3ETG A;  1K3E A;  3ETD A;  3K0G A;  2WLM A;  3EFF K;  1NR1 A;  1QLE C;  2HJF C;  3CCL V;  3B8N A;  2F43 G;  5B1B B;  2WLK A;  1H38 A;  4G28 B;  3ABU A;  4R6Z A;  1KEC A;  3CXC U;  3ABK C;  3ZN1 A;  5B1N A;  4MSW C;  4GX1 A;  3W7W A;  2XND G;  2CK3 G;  4KFM A;  4LC1 A;  3WG7 C;  3CCE V;  1COW G;  4PA4 A;  5L3F A;  3CCS V;  5IYD O;  4WFB V;  1K73 W;  1G8M A;  1MAB G;  4CBC A;  1K5S A;  3G6E V;  1M1K W;  1M90 W;  4QNH B;  4GX0 A;  5J9P C;  3ABM C;  3F5W C;  2EIM B;  1Y4M A;  1GKF A;  3T4Z A;  3E8G A;  5CN0 A;  1EFR G;  2A9H A;  1KKD A;  1NVP D;  1YIJ V;  1YJN V;  3AG3 B;  2OT5 A;  1CP9 A;  3CMA V;  1IXM A;  2IH3 C;  5H6Q A;  1VQP V;  3K0D A;  2HKO A;  2Y69 C;  3FB7 C;  2IU0 A;  4PDV A;  1GM7 A;  1ZWI C;  3QNE A;  5KA6 A;  5IYC O;  3CCR V;  4HAM A;  2EIJ B;  4UVC A;  2X6C A;  3JD1 A;  5L3B A;  4MVS A;  4JF3 A;  2A0L A;  1QLE B;  3SPI A;  4R7C A;  2WLI B;  3JCZ A;  1E79 G;  1QVG U;  4TWK A;  3TCU A;  1PKX A;  2YSU B;  2B5U A;  1K97 A;  1QCE A;  4FIP C;  3OE7 G;  2HG5 C;  4ZKI A;  3RVY A;  1OCO B;  5CBF A;  3CCQ V;  2WWW A;  5BZB A;  3E8H A;  1V54 B;  2GHY A;  1SZT A;  1E1Q G;  2JJ2 G;  2X6A A;  3ABK B;  3CP1 A;  3FYE B;  1YTF D;  3JD0 A;  1OCZ C;  4PA9 A;  5DM6 V;  1VQM V;  3K79 A;  3WG7 B;  1H8E G;  2EIN C;  1RPR A;  2R9R B;  2P6J A;  1SES A;  4P30 A;  2JJ1 G;  2W0F C;  1AJQ A;  3GB7 C;  4HZ3 A;  2JK5 C;  3ABM B;  4CZZ A;  3W7S A;  3LSS A;  2YEV B;  1RM1 C;  5L3C A;  1JVM A;  3LDD A;  1EBO A;  1NR7 A;  1QLN A;  1K9M W;  1Q82 W;  5CMU A;  2AHY A;  1G4Y B;  4G27 B;  4U7N A;  1VQ6 V;  3OFN G;  4X8A A;  3DTU B;  1VQ4 V;  2Z3Y A;  3PJS K;  2Y69 B;  5IDJ A;  5CA3 A;  1JPX A;  3SPH A;  4QPK A;  3X2Q C;  2WLH A;  4GX5 A;  2IU3 A;  1ARO P;  3SYP A;  3CCJ V;  1B6Q A;  1PNM A;  3BEH A;  3HPL C;  4BW5 A;  4JYC A;  4MTF A;  3F7Y C;  1S72 V;  1OZ0 A;  2DWD C;  4XDJ A;  3D3I A;  3MHH C;  1OCZ B;  2P67 A;  2ITD C;  3ETE A;  3E89 A;  4EKW A;  2EIN B;  2V1D A;  4KUM A;  4TSF G;  1FXK A;  2M7W A;  4HYO A;  3ZRW B;  5LHI A;  1GO3 F;  4BIU A;  1H2G A;  1L1F A;  1ORQ C;  5LGU A;  1GTO A;  5GW7 A;  1RM1 B;  1VQN V;  1K4D C;  4LBE C;  1NQT A;  2EZO A;  4WFF A;  4WFE A;  5EC2 C;  1QVF U;  1P7B A;  1E1R G;  2QM7 A;  4TT3 G;  3ZRS A;  2P90 A;  4P9P A;  3W7T A;  1VQ8 V;  1OCR B;  3ZMS A;  1AI4 A;  3OEE G;  3K3W A;  1DLB A;  1R3I C;  1GMG A;  1OHH G;  2W6J G;  1PL0 A;  4H37 A;  3X2Q B;  3SJQ C;  1YIT V;  1H8H G;  3F7V C;  1VQO V;  2JIZ G;  1OCO C;  5B3S C;  1RPO A;  2ZQM A;  5KA5 A;  1AJP A;  3ABL C;  2HLD G;  3E8B A;  1V54 C;  2HVK C;  2R9I A;  3ZIA G;  2IW5 A;  3SYQ A;  4RUF A;  5LBQ A;  1AI5 A;  1PNL A;  1S3J A;  3D36 A;  3SPC A;  3QO7 A;  4P9O A;  1S0V A;  5B1A C;  3FKS G;  2UXN A;  3SYO A;  4MVM A;  4MT8 A;  2K1E A;  1W0J G;  3I56 V;  2XAJ A;  5E1A C;  5EBL C;  2ZR3 A;  3OAA G;  4FPP A;  1KQS U;  2AHZ A;  5CBH A;  5L3E A;  3CCM V;  3LDE A;  1BMF G;  4QPJ A;  3R65 A;  3W7U A;  3LSQ A;  2MK3 A;  1SER A;  3JD2 A;  5LHG A;  4LP8 A;  4JAS A;  2PI5 A;  2HR3 A;  3OUS A;  3G4S V;  3ASO C;  3ML0 A;  3SYA A;  2B1I A;  2XAF A;  1K92 A;  3UM7 A;  3T4D A;  4P2Z A;  3CC7 V;  3FB8 C;  1F4N A;  5C93 A;  4UV8 A;  4XDL A;  2DW4 A;  3SPG A;  3NXS A;  3CYO A;  2WSS G;  5EBM C;  1S5H C;  4XBF A;  5B3S B;  2IH1 C;  4JTC B;  5EK0 A;  3ABL B;  2OTL V;  1TUE B;  4XDK A;  2ZDI A;  2JDI G;  1P4R A;  2W6I G;  3E8F A;  3H01 A;  3UKM A;  1BHB A;  1AR1 B;  3IGA C;  3RBZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...