1RM1C

Structure of a yeast tfiia/tbp/tata-box dna complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
285
structure length
116
Chain Sequence
SNAEASRVYEIIVESVVNEVREDFENAGIDEQTLQDLKNIWQKKLTETKVTTFSWDNQFNDYLISEDGPDENLMLCLYDKVTRTKARWKCSLKDGVVTINRNDYTFQKAQVEAEWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords 5'-D(*AP*TP*CP*GP*AP*TP*CP*GP*AP*TP*AP*TP*AP*AP*AP*AP*CP*G)-
publication title High Resolution Structure of a Yeast TFIIA/TBP/TATA-box DNA Complex
rcsb
source organism Saccharomyces cerevisiae
total genus 35
structure length 116
sequence length 285
ec nomenclature
pdb deposition date 2003-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03153 TFIIA Transcription factor IIA, alpha/beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1rm1C01
2.30.18.10 Mainly Beta Roll TATA box binding Protein, subunit D; domain 2 Transcription factor IIA (TFIIA), beta-barrel domain 1rm1C02
1NH2D 1YTFD 2P90A 5GW7A 3W7XA 1RM1B 1NVPD 1S3JA 3E35A 4HAMA 3W7WA 2WAMA 1RM1C 5IYBO 3W7TA 3BY6A 1NH2B 3D3IA 5CA3A 3W7SA 1YTFB 5IYCO 1NVPB 5IYDO 1NH2C 1YTFC 3W7UA 2HR3A 1NVPC 3IC7A
chains in the Genus database with same CATH superfamily
2PGGA 4H33A 1XBLA 3J7AU 3OUSA 4DV4O 2QSAA 4I4TA 2LJ2A 1RM1C 1GM9A 1IBLB 3RYIB 1R1BA 4LH7A 1S5LZ 4G28B 3CB2A 2BTOA 3AK1A 1HNWO 4GX1A 5C93A 2RDCA 1BT8A 3VQVA 3J81N 4DR2O 2FTKA 2WPDG 1K33A 2ZD9A 5KHJA 2HJFC 4BR6A 4LNUB 4FM1A 1BHBA 4UCVA 3ABMC 2VQFB 3D36C 3O9OA 2OYQA 1KP2A 1YJ9V 3ZN1A 4CS2A 3H1IH 3NR7A 1XNRB 5H6QA 1CEZA 4DO2A 4LF7B 1XHZA 1M93A 2QTOA 3B77A 1QR8A 3OGIB 2UXXA 1H2KA 3W7XA 1W0KG 1JR9A 1PPJH 5JVDB 4ZHQA 3RVZA 3JD3A 5CA3A 1EBOA 2EJ7A 4LF8O 3CHXA 4FVMA 4JI6B 3ZHQA 2HR3A 4DK0A 5JQGA 2UU9B 5KMGB 4X62B 1RFYA 1IBMB 2ADQB 1NQTA 4GX0A 2UXNA 4FFKA 4MW3A 5LMUB 3BPZA 4LF4B 3SR2C 2FL4A 3QTCA 4FM2A 4JZGA 4JAVA 3JD0A 1URFA 5A9GA 4JI8O 4K35A 5A2QN 1CPYA 4N23A 2WLIA 4WBNB 1NH2C 1V55C 1VQOV 3L75H 5FPOA 2Q69A 1M57C 4B3SO 3BRCA 2OWOA 1KMIZ 3B8NA 3CEIA 4GKJO 3KKYA 1IBLO 4OX9B 3CCMV 2Q9LA 2VWKA 4J41A 1R6KA 1YEWA 3BA8A 3W7SA 5D5QA 1Q7YW 1R6NA 1SF9A 1H8HG 1IURA 2F66C 3K3WA 1N4CA 2IJIA 2VQFO 3MDSA 3OTFA 2H3OA 2YUAA 1YTFD 1PNKA 2AGAA 4X1IB 4H13B 4O2AB 3OUFA 1SKVA 3E8FA 3APOA 2PYLA 1AI7A 4LF7O 1N0JA 1HDJA 5BMVB 5IWAB 2DQ3A 5JH7B 1VQ7V 2LW1A 1P84F 2W6JG 4MW8A 2YXLA 2ITCC 3E83A 1Z5VA 4D7TA 1WPBA 2JRIA 3ABLB 3OEEG 4JI6O 1MZEA 4TV9B 3GB7C 5B3SB 3Q4HA 1XUQA 2Q6AA 1I08A 2UUAO 2K1EA 3MD0A 2E75B 4U3FH 4GX2A 1LUVA 2WA4A 4CH6A 4JTAB 4JAAA 2Y0IA 2YS8A 4DUYB 2WWWA 3E89A 4BW9A 2KSDA 3CYOA 5EK0A 3SPIA 2EIMC 4WFAV 3IJ4A 5IYZA 2CTRA 2OT5A 4OX9O 2QEXV 3A0BZ 1P49A 5B3SC 1EM1A 3E86A 1Q6HA 5J2UA 3JAWB 5LOVA 2WLLA 1US6A 4H0LB 4UCUA 3JCZA 5JCOA 2HLDG 3ICXA 3ETEA 1TUBB 2C2AA 4HNAB 1YIJV 1YZBA 3UO3A 1RSOB 2Q7HA 3B8MA 3B09A 3ASNC 1D2DA 1R3IC 4PV1B 1H2SB 2JIZG 3RYCB 4GLXA 3SPHA 3ZMVA 1W0JG 4J7ZA 3UT5B 2GTSA 1IBKB 4CH3A 3AG2B 4NXMO 1XL6A 3D36A 2LGQA 1N0NA 1EZVH 1YCIA 3N27A 5KLVH 2GBOA 2XAGA 3JALB 1SS3A 3N2KA 5KHGA 2BTQA 1BQ0A 1V54C 1AP6A 1IXBA 2WLHA 3RFRA 3SJQC 4DW0A 4DR7B 3K0GA 4JV5B 4X9QA 3E8GA 1NU1H 5B1OA 3TETA 4JI2B 3ML0A 3B4SA 3FYIB 3OMAB 3K79A 4O2BA 4DUYO 3JATB 4FFBB 5BZBA 3S3WA 1N32B 5ITZB 5EBLC 1OCOB 3TXSA 2OCCB 1F23A 1CP9A 3TJTA 4UVAA 4J7KA 4CH4A 2LQTA 4MSWC 1XMQB 1YHQV 4RAIA 4O4JB 4UVBA 2JJ1G 5EBMC 4MVRA 4AHCA 3CRQA 5TISZ 2ZR3A 4UV8A 3ABKB 1KKCA 4KXRA 3JD4A 5E1AC 4D7SA 1FXVA 5H6RA 4LF5O 3ZRVA 5JVDA 3CE2A 1FS0G 4JI3O 2F93B 2NNUA 4Q20A 1L0NH 4N21A 1TUEB 4WFEA 1K9MW 2LO1A 3OFNG 1M5IA 4UCRA 3E8BA 5J2TB 1KU9A 1YDXA 3ZRXA 4JTCB 4JI5B 4I50A 2PZSA 2ETNA 1QVGU 2F43G 4ZHQB 5LP6C 4EFBA 1K5SA 4LF9O 4LFBO 4J42A 3WFVA 4JI0B 3ASOB 5K1PA 1VEWA 4JASA 1V9PA 3L73H 1QCEA 2ILMA 4WBNA 5JQGB 3RGBA 1Q90D 1YVWA 1H38A 4H44B 1NI8A 4EEQA 5BR8B 3QF7A 4W4KA 3K06A 2ZXWB 4JV5O 1NT2B 4LC1A 2Q67A 1GM7A 2QA4V 3CJHA 2WLIB 1NBMG 3SPGA 1Y76B 5EYPA 4MVUA 3FKSG 3J80N 4P2ZA 4CS4A 4JZ2A 4YHHB 2BOCC 1VQKV 4X1IA 4YJ3A 4PA4A 1YI2V 2HG5C 2DOSA 4FK5C 3BY6A 4PJ0Z 1GRJA 4TV8A 2WA3A 1YJWV 2YEVA 3SYQA 1S72V 5C8YA 4J10A 1YTFC 2QWNB 2HJDA 2H94A 4AILC 4G27B 3LSUA 2MW2B 4RQEA 2DWDC 4TQFA 4O4LA 2DYRB 4K0KB 2ITDC 3AEIA 2QWOB 1R73A 3THOA 3A2FA 3ZS8C 4TV9A 1M1KW 2GUZA 5GONB 4X65B 3W7UA 4JI5O 2QWPB 2Q0AA 2X0LA 1D5NA 4GUNA 1TA8A 2L35A 4JI0O 2XHBA 1QVFU 5L3EA 5KX5A 4J9ZB 2QWQB 4X8AA 1PNLA 2ZT9B 3Q4HB 1R3LC 4LWSB 4DV7B 2EX3A 5BR8O 5FPRA 2Y69B 5KA5A 2YIDA 2YI8A 2JVDA 4HZ3A 4Z2WA 4DR2B 1QLNA 2AZ0A 3B2EE 5IY5B 2UXBB 5KA6A 4FLVA 4PHZA 1YXBA 2V4DA 3KCYA 1SQVH 1TUBA 1DLBA 1N34B 2CH7A 2QKSA 4PDVA 5IYZB 4CH5A 1AJQA 1RSOA 1OJHA 4JAUA 2AW9A 1M56B 3E8HA 2NLJC 2AHYA 5IDJA 5J2UB 2A7WA 1GAXA 2WLLB 1GO3F 3RN4A 1FAFA 4IT5A 4K8XA 5D5PA 4FLXA 4I55B 4NTWA 3ZHRA 1TVKA 2QM8A 2Z0AA 4C7UA 2DYSC 3JASB 5IY5C 1K3EA 3JD1A 3UT5A 5KAFZ 3TGUH 4I9QA 5BXZA 1Y67A 1WPXA 4X1YA 5CA0A 2JEUA 4K0KO 1M56C 2H8PC 3TXQA 5CBFA 1RM1B 3R65A 4PA9A 4GZRB 1JQ0A 4B08A 3UQ8A 4B3MO 4X65O 1PD3A 4UB6Z 1NR1A 4NKGB 2XASA 3ZMZA 4J9YB 1HW7A 4UUJC 3CSXA 3ABMB 1ZLZA 5LGUA 3DXRB 4UXNA 3P30A 3JATA 3N2KB 4FFBA 4B3SB 4DW1A 3GWOA 2BTQB 4ZOLB 5ITZA 3R66A 2F95B 1PL0A 4X66B 2B5UA 4GKJB 2HHHB 2OCHA 3H1KH 4DV7O 4JI7B 5JJJB 2IH3C 3OGCC 4WF9V 3C3TA 4O4JA 3HKDA 5EIBD 2ZE5A 3JYCA 3SJBC 1U97A 4O2BB 2UXBO 2AXTZ 1D5AA 3G6EV 1N34O 5LP6A 4FLYA 1O9GA 3VQXA 1T5EA 3OMIB 3CP1A 1ROPA 3CRRA 2NR5A 1AVMA 2DJVA 2XUMA 2Z5UA 2JS5A 3U10A 4R7CA 5L3BA 3A8TA 5J2TA 1XEQA 4MVMA 1VQ6V 3JAMN 2P06A 4B3RB 2HEPA 2M6YA 1WA8A 3W7TA 1OHHG 1NH2B 1V55B 3O65A 1JVMA 1M57B 1FPOA 5HFMA 1HNZO 2QTSA 1K97A 2EULA 4YIOA 5CBHA 3T1HO 4A5UB 2FB5A 2LFSA 4I50B 2UUAB 1B06A 2IJKA 4B3TO 2CDYA 3M8AA 1JPXA 2ZQMA 4O4IA 3OM3B 4AQYB 4LFAB 3FFQA 4W4LA 4AI8A 1WP7A 1Y76A 2ARHA 4KFMA 1FD9A 1QHTA 1FKAO 3L71H 5LA6A 4X66O 3G4SV 2HHHO 4TWKA 1SETA 1EN5A 3LNNA 3LSQA 2QKCA 4JI7O 2ZNIA 1FJGO 4I5SA 1BGYH 1QBZA 5IJ0A 3IAYA 3CJHB 1Q6UA 2RCVA 2X6BA 5EYPB 1KD1W 1PKXA 1LNQA 2BSKA 1L1FA 4LP8A 1AI4A 2PI4A 1X4TA 5LGNA 1ZL8A 3K5MA 4HYOA 1WB8A 4YJ3B 3ZHVA 2PYJA 1XHXA 4TV8B 2YEVB 1IVSA 5L3DA 5CB4B 1OCCC 5IYCO 5C8YB 1GN4A 1VMGA 4YIPA 3CRCA 5GONA 5JWPA 2A0LA 3LDCA 3CC2V 3RYHA 4B3RO 1YF2A 4O4LB 2GDSA 4NXMB 2Y48A 3ETQA 2EIMB 5KHKA 4ABMA 1PM9A 3QVNA 2GUZB 2O57A 2XAFA 2GV9A 4JI1B 4LWSA 2CTQA 5GTIZ 1GMGA 3AG4C 1RP3B 4LCUC 3C3SA 1MMMA 3T4DA 5B1BC 2EILC 2W0XA 3CXCU 1M9NA 4MTXA 3STZC 1K73W 4F6RA 4AQYO 4LFAO 5KX5B 3EHBB 4IYIA 3JD2A 2FMLA 3ASNB 1I94B 1VARA 5EBWC 3FD9A 1KB9F 1VP7A 2EZOA 3OR6C 3MHHC 4UVCA 5LHHA 2V7QG 1XREA 4NTYA 3AG3C 1NR7A 4NR1A 3PJSK 3OTOB 3H1HH 4MS2A 3ZN0A 4I55A 1BZKA 5HFLA 2PY5A 2CH7B 1QR9A 3JASA 2F23A 4DR3B 1ZX3A 4OPHA 4R8CA 4LF5B 4ASUG 4JI3B 1G8MA 3CC7V 5GW7A 1AP5A 2ODMA 2JEXA 3DC5A 1K34A 4UB8Z 4DUZO 1V54B 1OCZC 3K5OA 3SYPA 3JSNA 1TVKB 2PI5A 1WP8A 2VQEB 1JMKC 4PI2A 2XT9A 1BMFG 3SPCA 1ZAUA 3RYFA 4MVZA 4MT8A 4X1YB 4LF9B 5KHIA 4LFBB 5CA0B 4LR3A 2WLMA 2E76B 3DXRA 2OTLV 1TGOA 2JS3A 1VQLV 2EIJC 3KG2A 4FLUA 4RO2A 5E79Z 3SYAA 2WLJA 4ZOLA 1ZSPA 1FFTB 5LYJA 5GTHZ 4JI1O 4JYYA 1GKFA 1SQBH 3HKBA 5LGTA 4UCTA 3RVYA 4TSFG 1Y4MA 1K4DC 1R3JC 4MTGA 2ZINA 3LNMB 1I94O 4DR5O 4QPJA 4MVSA 2NN4A 4DV3B 5EIBC 2Q68A 3CXHF 4QJFB 3HKDB 1MOFA 1OCRC 3T2MA 4LBEC 1N36B 2PF4E 2Q7EA 5K1XA 3OTOO 2Y0PA 4DR1O 3FB6C 4IHJB 1NVPD 4I7ZB 5LP6B 4GT1A 4DR3O 4P9OA 1WN7A 2ZKOA 4Z1VA 1QLEB 1KBHA 1YJNV 4TOIA 3SYOA 3K0DA 1O9HA 3IC9A 1FXHA 1W2BU 2Z3YA 4DK1A 3AG1C 3K59A 5H5NA 3JSLA 2HP8A 3ZX6A 1XNQB 3LSSA 2VQEO 2N05A 3AK2A 3BVOA 1AROP 3VOUA 4FM0A 4B7EA 1B3QA 1WA8B 1U96A 3OE7G 4EKWA 4DV2O 3OW2U 5DN6G 2ZDIC 3JCUZ 4DXWA 1PV0A 1QLEC 2FKXA 3CWBH 2RJZA 1AR1B 1YITV 4WFHA 1WB7A 2X6CA 3T4ZA 4UCSA 3M7MX 1Z2GA 2WAMA 3L72H 4OGQB 1YTFB 4O4IB 3TCUA 1G6UA 2ZE6A 3H9VA 3SYCA 4BIUA 1ORQC 4WFFA 1GK9A 5EZYA 1NH2D 5LA6B 2B9ZA 2E5LB 3WB1A 1M4UA 3WU2Z 4MTFA 4DV3O 3CCRV 1L0LH 1NTKH 2YXYA 1GN3A 2QGNA 2YIAA 1IZ3A 2GTAA 3OEHG 5IJ0B 1N36O 2D3OW 5CB4A 5IYDO 2V1DA 2BSKB 2YI9A 3ETDA 3K08A 5LXTA 4ICGA 4X89A 2YSUB 1QU7A 4PDLA 1ZL8B 1UJWB 3TK1A 2OIEA 4CBCA 1VF5B 1MA1A 4PDRA 1AI6A 3JARA 3L74H 4D6TH 1Q81W 2XAHA 3K03A 4FZ0A 1XNQO 3APQA 4B3MB 1N8RW 2QKAA 2ZE8A 4GCZA 3RYHB 4UFZA 1HR0B 1JFFB 2Q7GA 4NYKA 1NKDA 3HPLC 2EIKC 1XOUA 2ZCEA 4XDKA 3CCUV 3H01A 3BHPA 2QR4A 4GKKB 1J95A 4BIZA 3F5WC 4J11A 1K8AW 2UXDO 3F7YC 3ZRWA 1SQXH 3BCCH 4B7KA 1VQ9V 1PP9H 2P5OA 5DEDA 3ZBHA 2DYSB 5IJ9A 3G80A 1WNSA 4F6RB 4IYHA 4KUMA 3X2QC 3WB0A 3ZMTA 2OTJV 3SDLA 3OMNB 3E22A 1GN2A 5L3GA 4MVQA 1H2NA 5KUKA 3CCVV 2E5LO 5CBGA 3B40A 3ZMSA 5JJNB 3D3QA 1Q86W 1ENVA 1QQCA 1H8EG 3A0RA 1SQGA 4QPKA 2P7TC 1FXKC 4EFEA 4X64B 2YIBD 2JGUA 4QE7A 3P3PA 4BAYA 4ZI7A 4NTXA 2A3QA 1Y74A 1HP8A 2CTPA 3CD6V 4WFGA 1HNXB 1K5QA 1FFXA 1I5YA 2YC0A 2F1MA 2XTAA 3H1LH 1HWYA 4CS3A 1HNZB 2KG7B 2IH1C 2IJHA 4F4LA 2ZR2A 1XL4A 2KB1A 4HBNA 5B5EZ 3T1HB 3KZIZ 4J7JA 3ZIAG 2CUGA 3UO2A 1XMOB 1UPGA 3RYFB 4B3TB 1BHAA 1N33B 3K57A 1HR0O 1XILA 1COWG 2W6IG 2WLNA 5LHIA 1XI1A 2ZM6B 3ZHTA 3M99B 1DGSA 4GKKO 3L70H 2LW7A 2ZIMA 3W7WA 1BCCH 5LYJB 1JCHA 3DC6A 4JTDB 2EZPA 3EVKA 5B1AC 5JJEB 3CC4V 2DMXA 2CAZC 4YJ2A 4YXWG 1FJGB 1ZUQA 1KC8W 3HKBB 4DR6B 5FNVA 2JGDA 4X20B 3LUTB 2EJRA 1VF6C 5LMNB 1BSMA 2Q0OC 2Y4TA 1Y6XA 1MNGA 2DWEC 4U7OA 4BIOA 1WLEA 1X59A 4IHJA 3QO7A 4DRXA 2UXCO 2E74B 2XOKG 2ZDIA 3OT7A 3IGAC 2X7RB 4TUYB 2W0FC 3CCJV 1NTZH 2M7WA 3GVMA 1NVPC 4CC6A 1DF5A 1SQQH 2UUBO 2RMKB 5B1NA 1Q43A 2UUCO 4JI4B 4X64O 2EINB 1EZJA 1Q82W 3EXAA 1Y66A 1VQ8V 1IXMA 1HNXO 3D8CA 2WLKA 1MSWD 4I9WA 3K04A 2HVJC 1F4NA 2EBOA 1KECA 2CGNA 1B04A 3CMEV 4JGSA 1AI5A 3NXSA 3DGEA 3A0HZ 2P4VA 1VQPV 4EB6A 2R9IA 2LP7A 4P9PA 4RWUA 3HR0A 1XMOO 1N33O 2EINC 1KUQA 2VRZA 2D2CB 4FPPA 1G4YB 2ZM6O 3E2EA 1EN4A 4JPRA 4XDLA 4R6ZA 3I5DA 1H2GA 4FJCC 4U3JA 2IU0A 4IIJB 4TT3G 1I0HA 5FLXN 2CK3G 1OCCB 4DR6O 1AB3A 3HKEB 1FYJA 4DV1B 5LMNO 4E2LA 5EZYB 3IC7A 4ZKIA 4BWAA 4ZBMA 3CCQV 1SERA 3OD4A 1RPRA 3KCXA 3CCLV 2XAJA 2P67A 1ZTEA 4F6EA 2Q8VA 3T1YB 4DUZB 2AHZA 5H9CA 2JJ2G 3AG4B 1BL8A 1BS3A 5B1BB 2EILB 3K9AA 4JI4O 3U11A 3G6BA 3CX5F 2BOBC 2LFRA 5LXTB 1Q3EA 1MSDA 2P90A 5KAIZ 4IGGA 2IBZH 1XNRO 3ZEDA 1JFFA 3UM7A 5CN0A 5J9PC 3JARB 2JK5C 1KKDA 2QE7G 3U0ZA 4JYBA 2GSMB 1E1QG 5CA1A 1GN6A 4KHPB 3FB7C 4QNHB 1THZA 3AG3B 2QM4A 4XBFA 1KQSU 4J80A 1VQ5V 2XAQA 1DTOA 1FXKA 2CGOA 4O4HB 2UU9O 2OIGA 4X62O 1IBMO 4Z1MG 4WCEV 3VQYA 4X1KB 2P22C 4DR5B 1JJOA 5LMUO 3ZRWB 1VQ4V 4LF4O 4FIPC 1M90W 3MHSC 3ZHSA 4PA3A 1GM8A 2N74A 1OCZB 3PN1A 4G2KA 4RUEA 3OAAG 4I0XA 1SRYA 4L8JA 5IJ9B 1SA0A 2B1GA 4DV1O 3I55V 4DR1B 3VBBA 5H2FZ 1LUWA 3F7VC 2HVKC 5EC1C 3E22B 2Y4UA 1AR5A 3ABLC 2YICA 1KP3A 3ZJZA 3SGIA 2EIJB 2GHYA 3SPJA 3T1YO 1XQ8A 2KG7A 4PDMA 1B6QA 1NZ6A 3FAVB 3JAKA 1TAEA 1F51A 4PELA 2QWRB 1SC5B 2PTMA 1CXZB 4FMTA 3N2GA 4ZI7B 1VF6A 1Y74B 1MABG 1NS1A 1FFXB 4DV2B 2IM9A 3BEHA 3HKCA 4FLWA 4CZZA 3STLC 1JA8A 3BAAA 1VIBA 1RPOA 4CC5A 1MZFA 3OR7C 1AJPA 5IWAO 3ZHUA 4KHPO 4DR4B 2HKOA 5LL6Y 1P4RA 1OCRB 2RQ6A 2P6JA 4FLTA 4UCOA 1PL4A 4UV9A 3ZRSA 1I5XA 1SESA 2QM7A 3K5LA 5L3CA 1F7YA 1S5JA 4X20A 1S5HC 2PUSA 3I56V 1JX9A 1UFIA 3F5TA 4LFCB 1I7FA 1SZXA 5F2VO 1P7GA 2R72A 1ZWIC 3RW0A 3WB2A 3CRMA 3VQWA 3RYIA 2IJJA 2VWJA 2E3CA 1JOYA 2Q5ZA 4YJ2B 4FZ1A 3AG1B 2YDEA 3CRAA 4L87A 5FNVB 1E1RG 2ADPA 3IFXA 1H2MA 3RBZA 2JGDB 3RWRD 4TUYA 3CPWU 1VF7A 1IDSA 4LNUA 1S77D 3AG2C 3RT3C 3K58A 4GX5A 4I4TB 3WG7B 5CMUA 4QE9A 4DRXB 5KUMA 4JYCA 4DV0B 2JDIG 1SQPH 4Q6GA 3T1CA 1BQZA 1AILA 1YSCA 5DECA 4BW5A 3G71V 3H1JH 4R50A 2P4KA 1K92A 2ATKC 3C90A 1S3JA 1MG1A 4TQDA 1EFRG 4NVPA 4X88A 1OCOC 3K9SA 3WG7C 2OCCC 4WFBV 1KYOF 4KP4A 2BCCH 4KL1A 2IU3A 2F4VB 1H2LA 1QNMA 1R6TA 4RQFA 3MAQA 5KMGA 4MVOA 2UXDB 2YXHA 4EB6B 3UCSC 1OZ0A 4LH6A 5DM6V 3CCEV 4U7NA 4DR4O 2DQ0A 4IIJA 3ABKC 1IBKO 3SJAC 3HKEA 3ABTA 1P7BA 1L8DA 2QDOA 1K4CC 2K9PA 2QJ1A 4LFCO 3LDEA 3CMAV 1R3KC 5IE9A 1WAZA 4U3JB 2DN9A 4DR7O 1A32A 1DF4A 5IYBO 4IL6Z 2ZE7A 1SZTA 2MK3A 2X6AA 4PA6A 2CTWA 4JI2O 3SJCC 5B66Z 3FYEB 4DV6B 2KKWA 3ASOC 1N32O 1BE3H 2A06H 5FL7G 2R9AA 1E79G 1XDCA 2EIKB 1WJZA 3BABA 3CS5A 1Q8IA 1XMQO 1OV9A 4O2AA 4YY3B 4DV0O 4OXSA 4NXNB 2FYUH 3FB8C 4DV5B 1AR4A 2DW4A 4RUFA 3ETGA 1S0VA 2IW5A 2ZXWC 2KQXA 5BMVA 3K5NA 3BFRA 3G67A 1DK1A 5JH7A 2BE3A 3QNEA 3DSQA 4JYAB 1J5EB 3P3NA 3X2QB 2AZ2A 1NJIW 2LGWA 4LF6B 2F4VO 4O4HA 1VQMV 2N04A 5CA1B 4P30A 1F4MA 1K7DA 1LR1A 5LHGA 4X1KA 4PI0A 5EC2C 2RNBA 2A9HA 3AG7A 2YIBA 1FXKB 3QO8A 4GYCB 1W59A 4K3AA 2G38A 3E35A 3FX7A 3AK3A 2DYRC 3BA9A 4DV4B 3D3IA 3QG5A 3FB5C 4MTOA 2UXCB 1HNWB 2A79B 4K8ZA 3L9DA 1JJ2U 3JAWA 3LDDA 1Z5WA 3DTUB 4I0XB 4NB5A 4OPAA 3QO5A 1SA0B 2Q73A 4H37A 5BY1A 2UUBB 4JF3A 1SQFA 2R70A 3FAVA 4DV6O 2R9RB 2Q4PA 4PD4F 2UUCB 4HNAA 4ZIBA 5L3FA 1GH6A 4PA7A 4YHHO 5LBQA 4FLZA 2VS0A 5LOVB 4YY3O 1Q6IA 3EFFK 4NXNO 3HB3B 3GWKC 4QIWF 4DV5O 3S3XA 2Y69C 4XDJA 3RYCA 1G1XB 5B1AB 3JAKB 1VQNV 2XNDG 1GTOA 2L6LA 5AG2A 3N2GB 1AJNA 5IT9N 3CCSV 3ABUA 1EN6A 2ZNJA 4JYAO 1J5EO 3ZCCA 3HKCB 1PNMA 3P32A 1Q5OA 4LF8B 3JALA 2RN9A 4QGPA 4LF6O 2B1IA 1IX9A 2ZIOA 4HAMA 1NTMH 1S76D 5JCOC 4E4EA 4DYLA 2CE4A 1NVPB 2HFEC 4JI8B 3ZMUA 2DE0X 2WSSG 5KHHA 3UKMA
chains in the Genus database with same CATH topology
2BOBC 4H33A 3RVYA 4RQEA 2P90A 4TSFG 2DWDC 3OUSA 2DYRB 1Y4MA 1K4DC 3UM7A 1R3JC 4MTGA 5CN0A 5J9PC 3LNMB 2JK5C 1RM1C 2ITDC 1GM9A 3AEIA 4QPJA 1R73A 4G28B 4MVSA 1KKDA 2QE7G 2Q68A 4QJFB 4GX1A 5C93A 1M1KW 4JYBA 2GSMB 1E1QG 3W7UA 2FTKA 1MOFA 2WPDG 1OCRC 1K33A 2ZD9A 3T2MA 4LBEC 2HJFC 3FB7C 4QNHB 1THZA 3AG3B 2X0LA 1BHBA 4XBFA 1KQSU 1VQ5V 3ABMC 3FB6C 2XAQA 1DTOA 1NVPD 1FXKA 1KP2A 4GT1A 1YJ9V 3ZN1A 4P9OA 1QVFU 5L3EA 4J9ZB 1QLEB 5H6QA 1YJNV 4X8AA 1PNLA 3SYOA 4Z1MG 3K0DA 4DO2A 1R3LC 4WCEV 1CEZA 1FXHA 1W2BU 2Z3YA 2QTOA 3ZRWB 3B77A 1QR8A 3AG1C 1VQ4V 2Y69B 5KA5A 4FIPC 1M90W 3MHSC 4PA3A 1GM8A 4HZ3A 2UXXA 1OCZB 4G2KA 4RUEA 3LSSA 3W7XA 3OAAG 1QLNA 1SRYA 1AROP 1W0KG 2B1GA 3VOUA 5IY5B 5KA6A 3I55V 3RVZA 3VBBA 1DLBA 3JD3A 3F7VC 3OE7G 5CA3A 4EKWA 2HVKC 2QKSA 1EBOA 5EC1C 3ABLC 3OW2U 4PDVA 5DN6G 2ZDIC 1AJQA 4DXWA 4JAUA 1M56B 1QLEC 3E8HA 2HR3A 1KP3A 2NLJC 2AHYA 3ZJZA 5IDJA 2EIJB 1AR1B 1YITV 2WLLB 2GHYA 1GO3F 1NQTA 4GX0A 4WFHA 2UXNA 3SPJA 4MW3A 2X6CA 3T4ZA 4PDMA 1B6QA 3JD0A 2WAMA 4JAVA 1F51A 4PELA 2QM8A 2DYSC 1YTFB 4FMTA 5IY5C 3TCUA 1CPYA 4N23A 1K3EA 3JD1A 2WLIA 1NH2C 3SYCA 1MABG 4BIUA 1V55C 1ORQC 1VQOV 4WFFA 2Q69A 1M57C 1GK9A 1WPXA 2JEUA 3BEHA 3B8NA 1NH2D 4CZZA 3STLC 1M56C 2H8PC 5CBFA 1RM1B 3R65A 4MTFA 4PA9A 3CCRV 1RPOA 3CCMV 1JQ0A 3OR7C 1R6KA 1AJPA 1PD3A 3OEHG 3W7SA 3ZMZA 1NR1A 2XASA 1Q7YW 2HKOA 1P4RA 1OCRB 2D3OW 2P6JA 1R6NA 4J9YB 1H8HG 5IYDO 4UUJC 2V1DA 3K3WA 4UV9A 3ZRSA 1I5XA 1SESA 2IJIA 2QM7A 3ETDA 3ABMB 3K08A 5L3CA 5LGUA 1S5HC 4X89A 4UXNA 2YSUB 4PDLA 3I56V 1JX9A 1YTFD 1PNKA 3P30A 1UJWB 3TK1A 3OUFA 4CBCA 3GWOA 3E8FA 4PDRA 1AI6A 1PL0A 1ZWIC 2B5UA 3RW0A 1AI7A 1Q81W 2IJJA 2XAHA 1JOYA 2IH3C 3K03A 3AG1B 3OGCC 4L87A 4WF9V 1E1RG 3RBZA 3IFXA 2DQ3A 3JYCA 1VQ7V 1N8RW 3CPWU 1S77D 3AG2C 4GCZA 4GX5A 3G6EV 2W6JG 4MW8A 1NKDA 2ITCC 3WG7B 3HPLC 2EIKC 5CMUA 4QE9A 3E83A 3ABLB 3OEEG 4XDKA 5KUMA 4JYCA 3CCUV 2JDIG 3H01A 3OMIB 1J95A 3CP1A 4BIZA 3F5WC 1ROPA 3GB7C 5B3SB 3T1CA 1YSCA 1K8AW 4BW5A 2Q6AA 3F7YC 2Z5UA 3ZRWA 2K1EA 3G71V 3MD0A 4R50A 1VQ9V 4R7CA 4GX2A 5L3BA 4JTAB 1K92A 2ATKC 2DYSB 1S3JA 1MG1A 4MVMA 1VQ6V 4KUMA 2WWWA 3X2QC 1EFRG 3ZMTA 3E89A 2OTJV 4X88A 1OCOC 3W7TA 1OHHG 3OMNB 1NH2B 3CYOA 1V55B 5EK0A 3WG7C 2OCCC 3SPIA 1JVMA 4WFBV 1M57B 2EIMC 4WFAV 4KP4A 5HFMA 5L3GA 4MVQA 5KUKA 3CCVV 1K97A 2IU3A 2OT5A 5CBGA 4RQFA 2QEXV 5B3SC 3E86A 4MVOA 3ZMSA 5CBHA 2WLLA 3JCZA 1OZ0A 2LFSA 5DM6V 3CCEV 1Q86W 1ENVA 1H8EG 2HLDG 3A0RA 4U7NA 2IJKA 3ETEA 4QPKA 2DQ0A 2P7TC 3ABKC 1FXKC 2C2AA 1JPXA 1YIJV 2ZQMA 3ABTA 4QE7A 3OM3B 1P7BA 4BAYA 1K4CC 3B8MA 3CD6V 4WFGA 3ASNC 4KFMA 3LDEA 1K5QA 1I5YA 3CMAV 1R3KC 1R3IC 1HWYA 2JIZG 3G4SV 2IH1C 4TWKA 1SETA 2IJHA 3LSQA 4F4LA 2ZR2A 1DF4A 1XL4A 2KB1A 3SPHA 4I5SA 5IYBO 3ZMVA 1W0JG 1SZTA 2MK3A 2X6AA 4PA6A 3ZIAG 1QBZA 3FYEB 2X6BA 1KD1W 1BHAA 3ASOC 3AG2B 1PKXA 1LNQA 1COWG 2W6IG 1L1FA 4LP8A 1AI4A 1XL6A 3D36A 2WLNA 2PI4A 5FL7G 1E79G 2XAGA 5LHIA 2EIKB 5LGNA 3M99B 4HYOA 4OXSA 3W7WA 3FB8C 2DW4A 1V54C 4RUFA 3ETGA 1JCHA 4JTDB 2EZPA 5B1AC 2WLHA 3CC4V 2IW5A 2YEVB 2ZXWC 5L3DA 3SJQC 1OCCC 1S0VA 5IYCO 3K0GA 4YXWG 3E8GA 1KC8W 5B1OA 3TETA 3ML0A 3LUTB 2EJRA 3FYIB 2A0LA 3OMAB 3QNEA 3LDCA 3CC2V 3K79A 5BZBA 2DWEC 4U7OA 3X2QB 1WLEA 5EBLC 1OCOB 3QO7A 2Y48A 2OCCB 1F23A 1CP9A 2EIMB 4UVAA 1NJIW 2XOKG 2ZDIA 4MSWC 1YHQV 1VQMV 4RAIA 4P30A 3IGAC 2XAFA 4UVBA 1F4MA 1K7DA 2JJ1G 2X7RB 5LHGA 2W0FC 3CCJV 5EC2C 2M7WA 1GMGA 3AG4C 1NVPC 5EBMC 2A9HA 1DF5A 4LCUC 4MVRA 3T4DA 5B1BC 2EILC 3CXCU 2ZR3A 4UV8A 5B1NA 1M9NA 3ABKB 1FXKB 3QO8A 5E1AC 3JD4A 4MTXA 2EINB 3STZC 1FXVA 5H6RA 3E35A 1K73W 1EZJA 3ZRVA 1Q82W 3EHBB 2DYRC 1FS0G 1Y66A 3D3IA 1VQ8V 1IXMA 3JD2A 2NNUA 4Q20A 4N21A 3ASNB 1TUEB 2WLKA 3FB5C 1MSWD 4I9WA 3K04A 2HVJC 1F4NA 2EBOA 4WFEA 5EBWC 4MTOA 1KECA 1K9MW 3CMEV 2A79B 4JGSA 1AI5A 3NXSA 2EZOA 3OFNG 3OR6C 3DGEA 1JJ2U 3MHHC 3E8BA 3LDDA 4UVCA 3DTUB 3ZRXA 5LHHA 1VQPV 2V7QG 2R9IA 4JTCB 3QO5A 2LP7A 3AG3C 1NR7A 4P9PA 3PJSK 4MS2A 3ZN0A 4H37A 1QVGU 2F43G 4JF3A 1K5SA 5HFLA 2R9RB 1QR9A 3WFVA 2EINC 3ASOB 5L3FA 4JASA 4R8CA 4PA7A 4FPPA 1QCEA 5LBQA 1G4YB 4ASUG 3E2EA 1G8MA 3CC7V 4JPRA 4XDLA 4R6ZA 3EFFK 1H2GA 3HB3B 1H38A 4QIWF 5GW7A 4FJCC 2Y69C 2JEXA 1K34A 4XDJA 1V54B 2IU0A 1OCZC 4TT3G 5B1AB 3SYPA 3K06A 2CK3G 2ZXWB 2PI5A 1OCCB 4LC1A 2Q67A 1VQNV 1GM7A 2XNDG 1GTOA 2QA4V 1BMFG 2WLIB 1AJNA 3SPCA 1NBMG 3SPGA 4E2LA 3ABUA 3CCSV 4MVZA 4MT8A 4MVUA 3IC7A 3ZCCA 3FKSG 4ZKIA 1PNMA 3P32A 4P2ZA 2WLMA 4ZBMA 3CCQV 1SERA 2OTLV 2BOCC 1RPRA 1VQKV 3CCLV 2EIJC 1VQLV 3KG2A 2B1IA 2XAJA 2P67A 4RO2A 3SYAA 2WLJA 4HAMA 4PA4A 1S76D 1FFTB 1YI2V 2HG5C 4FK5C 3BY6A 2AHZA 1YJWV 2YEVA 5H9CA 3SYQA 2JJ2G 1S72V 1NVPB 1GKFA 3AG4B 2HFEC 3ZMUA 1BL8A 1YTFC 5LGTA 2H94A 2WSSG 2EILB 3K9AA 5B1BB 4G27B 3UKMA 2LFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NH2 D;  1YTF D;  2P90 A;  5GW7 A;  3W7X A;  1RM1 B;  1NVP D;  1S3J A;  3E35 A;  4HAM A;  3W7W A;  2WAM A;  1RM1 C;  5IYB O;  3W7T A;  3BY6 A;  1NH2 B;  3D3I A;  5CA3 A;  3W7S A;  1YTF B;  5IYC O;  1NVP B;  5IYD O;  1NH2 C;  1YTF C;  3W7U A;  2HR3 A;  1NVP C;  3IC7 A; 
#chains in the Genus database with same CATH topology
 2PGG A;  4H33 A;  1XBL A;  3J7A U;  3OUS A;  4DV4 O;  2QSA A;  4I4T A;  2LJ2 A;  1RM1 C;  1GM9 A;  1IBL B;  3RYI B;  1R1B A;  4LH7 A;  1S5L Z;  4G28 B;  3CB2 A;  2BTO A;  3AK1 A;  1HNW O;  4GX1 A;  5C93 A;  2RDC A;  1BT8 A;  3VQV A;  3J81 N;  4DR2 O;  2FTK A;  2WPD G;  1K33 A;  2ZD9 A;  5KHJ A;  2HJF C;  4BR6 A;  4LNU B;  4FM1 A;  1BHB A;  4UCV A;  3ABM C;  2VQF B;  3D36 C;  3O9O A;  2OYQ A;  1KP2 A;  1YJ9 V;  3ZN1 A;  4CS2 A;  3H1I H;  3NR7 A;  1XNR B;  5H6Q A;  1CEZ A;  4DO2 A;  4LF7 B;  1XHZ A;  1M93 A;  2QTO A;  3B77 A;  1QR8 A;  3OGI B;  2UXX A;  1H2K A;  3W7X A;  1W0K G;  1JR9 A;  1PPJ H;  5JVD B;  4ZHQ A;  3RVZ A;  3JD3 A;  5CA3 A;  1EBO A;  2EJ7 A;  4LF8 O;  3CHX A;  4FVM A;  4JI6 B;  3ZHQ A;  2HR3 A;  4DK0 A;  5JQG A;  2UU9 B;  5KMG B;  4X62 B;  1RFY A;  1IBM B;  2ADQ B;  1NQT A;  4GX0 A;  2UXN A;  4FFK A;  4MW3 A;  5LMU B;  3BPZ A;  4LF4 B;  3SR2 C;  2FL4 A;  3QTC A;  4FM2 A;  4JZG A;  4JAV A;  3JD0 A;  1URF A;  5A9G A;  4JI8 O;  4K35 A;  5A2Q N;  1CPY A;  4N23 A;  2WLI A;  4WBN B;  1NH2 C;  1V55 C;  1VQO V;  3L75 H;  5FPO A;  2Q69 A;  1M57 C;  4B3S O;  3BRC A;  2OWO A;  1KMI Z;  3B8N A;  3CEI A;  4GKJ O;  3KKY A;  1IBL O;  4OX9 B;  3CCM V;  2Q9L A;  2VWK A;  4J41 A;  1R6K A;  1YEW A;  3BA8 A;  3W7S A;  5D5Q A;  1Q7Y W;  1R6N A;  1SF9 A;  1H8H G;  1IUR A;  2F66 C;  3K3W A;  1N4C A;  2IJI A;  2VQF O;  3MDS A;  3OTF A;  2H3O A;  2YUA A;  1YTF D;  1PNK A;  2AGA A;  4X1I B;  4H13 B;  4O2A B;  3OUF A;  1SKV A;  3E8F A;  3APO A;  2PYL A;  1AI7 A;  4LF7 O;  1N0J A;  1HDJ A;  5BMV B;  5IWA B;  2DQ3 A;  5JH7 B;  1VQ7 V;  2LW1 A;  1P84 F;  2W6J G;  4MW8 A;  2YXL A;  2ITC C;  3E83 A;  1Z5V A;  4D7T A;  1WPB A;  2JRI A;  3ABL B;  3OEE G;  4JI6 O;  1MZE A;  4TV9 B;  3GB7 C;  5B3S B;  3Q4H A;  1XUQ A;  2Q6A A;  1I08 A;  2UUA O;  2K1E A;  3MD0 A;  2E75 B;  4U3F H;  4GX2 A;  1LUV A;  2WA4 A;  4CH6 A;  4JTA B;  4JAA A;  2Y0I A;  2YS8 A;  4DUY B;  2WWW A;  3E89 A;  4BW9 A;  2KSD A;  3CYO A;  5EK0 A;  3SPI A;  2EIM C;  4WFA V;  3IJ4 A;  5IYZ A;  2CTR A;  2OT5 A;  4OX9 O;  2QEX V;  3A0B Z;  1P49 A;  5B3S C;  1EM1 A;  3E86 A;  1Q6H A;  5J2U A;  3JAW B;  5LOV A;  2WLL A;  1US6 A;  4H0L B;  4UCU A;  3JCZ A;  5JCO A;  2HLD G;  3ICX A;  3ETE A;  1TUB B;  2C2A A;  4HNA B;  1YIJ V;  1YZB A;  3UO3 A;  1RSO B;  2Q7H A;  3B8M A;  3B09 A;  3ASN C;  1D2D A;  1R3I C;  4PV1 B;  1H2S B;  2JIZ G;  3RYC B;  4GLX A;  3SPH A;  3ZMV A;  1W0J G;  4J7Z A;  3UT5 B;  2GTS A;  1IBK B;  4CH3 A;  3AG2 B;  4NXM O;  1XL6 A;  3D36 A;  2LGQ A;  1N0N A;  1EZV H;  1YCI A;  3N27 A;  5KLV H;  2GBO A;  2XAG A;  3JAL B;  1SS3 A;  3N2K A;  5KHG A;  2BTQ A;  1BQ0 A;  1V54 C;  1AP6 A;  1IXB A;  2WLH A;  3RFR A;  3SJQ C;  4DW0 A;  4DR7 B;  3K0G A;  4JV5 B;  4X9Q A;  3E8G A;  1NU1 H;  5B1O A;  3TET A;  4JI2 B;  3ML0 A;  3B4S A;  3FYI B;  3OMA B;  3K79 A;  4O2B A;  4DUY O;  3JAT B;  4FFB B;  5BZB A;  3S3W A;  1N32 B;  5ITZ B;  5EBL C;  1OCO B;  3TXS A;  2OCC B;  1F23 A;  1CP9 A;  3TJT A;  4UVA A;  4J7K A;  4CH4 A;  2LQT A;  4MSW C;  1XMQ B;  1YHQ V;  4RAI A;  4O4J B;  4UVB A;  2JJ1 G;  5EBM C;  4MVR A;  4AHC A;  3CRQ A;  5TIS Z;  2ZR3 A;  4UV8 A;  3ABK B;  1KKC A;  4KXR A;  3JD4 A;  5E1A C;  4D7S A;  1FXV A;  5H6R A;  4LF5 O;  3ZRV A;  5JVD A;  3CE2 A;  1FS0 G;  4JI3 O;  2F93 B;  2NNU A;  4Q20 A;  1L0N H;  4N21 A;  1TUE B;  4WFE A;  1K9M W;  2LO1 A;  3OFN G;  1M5I A;  4UCR A;  3E8B A;  5J2T B;  1KU9 A;  1YDX A;  3ZRX A;  4JTC B;  4JI5 B;  4I50 A;  2PZS A;  2ETN A;  1QVG U;  2F43 G;  4ZHQ B;  5LP6 C;  4EFB A;  1K5S A;  4LF9 O;  4LFB O;  4J42 A;  3WFV A;  4JI0 B;  3ASO B;  5K1P A;  1VEW A;  4JAS A;  1V9P A;  3L73 H;  1QCE A;  2ILM A;  4WBN A;  5JQG B;  3RGB A;  1Q90 D;  1YVW A;  1H38 A;  4H44 B;  1NI8 A;  4EEQ A;  5BR8 B;  3QF7 A;  4W4K A;  3K06 A;  2ZXW B;  4JV5 O;  1NT2 B;  4LC1 A;  2Q67 A;  1GM7 A;  2QA4 V;  3CJH A;  2WLI B;  1NBM G;  3SPG A;  1Y76 B;  5EYP A;  4MVU A;  3FKS G;  3J80 N;  4P2Z A;  4CS4 A;  4JZ2 A;  4YHH B;  2BOC C;  1VQK V;  4X1I A;  4YJ3 A;  4PA4 A;  1YI2 V;  2HG5 C;  2DOS A;  4FK5 C;  3BY6 A;  4PJ0 Z;  1GRJ A;  4TV8 A;  2WA3 A;  1YJW V;  2YEV A;  3SYQ A;  1S72 V;  5C8Y A;  4J10 A;  1YTF C;  2QWN B;  2HJD A;  2H94 A;  4AIL C;  4G27 B;  3LSU A;  2MW2 B;  4RQE A;  2DWD C;  4TQF A;  4O4L A;  2DYR B;  4K0K B;  2ITD C;  3AEI A;  2QWO B;  1R73 A;  3THO A;  3A2F A;  3ZS8 C;  4TV9 A;  1M1K W;  2GUZ A;  5GON B;  4X65 B;  3W7U A;  4JI5 O;  2QWP B;  2Q0A A;  2X0L A;  1D5N A;  4GUN A;  1TA8 A;  2L35 A;  4JI0 O;  2XHB A;  1QVF U;  5L3E A;  5KX5 A;  4J9Z B;  2QWQ B;  4X8A A;  1PNL A;  2ZT9 B;  3Q4H B;  1R3L C;  4LWS B;  4DV7 B;  2EX3 A;  5BR8 O;  5FPR A;  2Y69 B;  5KA5 A;  2YID A;  2YI8 A;  2JVD A;  4HZ3 A;  4Z2W A;  4DR2 B;  1QLN A;  2AZ0 A;  3B2E E;  5IY5 B;  2UXB B;  5KA6 A;  4FLV A;  4PHZ A;  1YXB A;  2V4D A;  3KCY A;  1SQV H;  1TUB A;  1DLB A;  1N34 B;  2CH7 A;  2QKS A;  4PDV A;  5IYZ B;  4CH5 A;  1AJQ A;  1RSO A;  1OJH A;  4JAU A;  2AW9 A;  1M56 B;  3E8H A;  2NLJ C;  2AHY A;  5IDJ A;  5J2U B;  2A7W A;  1GAX A;  2WLL B;  1GO3 F;  3RN4 A;  1FAF A;  4IT5 A;  4K8X A;  5D5P A;  4FLX A;  4I55 B;  4NTW A;  3ZHR A;  1TVK A;  2QM8 A;  2Z0A A;  4C7U A;  2DYS C;  3JAS B;  5IY5 C;  1K3E A;  3JD1 A;  3UT5 A;  5KAF Z;  3TGU H;  4I9Q A;  5BXZ A;  1Y67 A;  1WPX A;  4X1Y A;  5CA0 A;  2JEU A;  4K0K O;  1M56 C;  2H8P C;  3TXQ A;  5CBF A;  1RM1 B;  3R65 A;  4PA9 A;  4GZR B;  1JQ0 A;  4B08 A;  3UQ8 A;  4B3M O;  4X65 O;  1PD3 A;  4UB6 Z;  1NR1 A;  4NKG B;  2XAS A;  3ZMZ A;  4J9Y B;  1HW7 A;  4UUJ C;  3CSX A;  3ABM B;  1ZLZ A;  5LGU A;  3DXR B;  4UXN A;  3P30 A;  3JAT A;  3N2K B;  4FFB A;  4B3S B;  4DW1 A;  3GWO A;  2BTQ B;  4ZOL B;  5ITZ A;  3R66 A;  2F95 B;  1PL0 A;  4X66 B;  2B5U A;  4GKJ B;  2HHH B;  2OCH A;  3H1K H;  4DV7 O;  4JI7 B;  5JJJ B;  2IH3 C;  3OGC C;  4WF9 V;  3C3T A;  4O4J A;  3HKD A;  5EIB D;  2ZE5 A;  3JYC A;  3SJB C;  1U97 A;  4O2B B;  2UXB O;  2AXT Z;  1D5A A;  3G6E V;  1N34 O;  5LP6 A;  4FLY A;  1O9G A;  3VQX A;  1T5E A;  3OMI B;  3CP1 A;  1ROP A;  3CRR A;  2NR5 A;  1AVM A;  2DJV A;  2XUM A;  2Z5U A;  2JS5 A;  3U10 A;  4R7C A;  5L3B A;  3A8T A;  5J2T A;  1XEQ A;  4MVM A;  1VQ6 V;  3JAM N;  2P06 A;  4B3R B;  2HEP A;  2M6Y A;  1WA8 A;  3W7T A;  1OHH G;  1NH2 B;  1V55 B;  3O65 A;  1JVM A;  1M57 B;  1FPO A;  5HFM A;  1HNZ O;  2QTS A;  1K97 A;  2EUL A;  4YIO A;  5CBH A;  3T1H O;  4A5U B;  2FB5 A;  2LFS A;  4I50 B;  2UUA B;  1B06 A;  2IJK A;  4B3T O;  2CDY A;  3M8A A;  1JPX A;  2ZQM A;  4O4I A;  3OM3 B;  4AQY B;  4LFA B;  3FFQ A;  4W4L A;  4AI8 A;  1WP7 A;  1Y76 A;  2ARH A;  4KFM A;  1FD9 A;  1QHT A;  1FKA O;  3L71 H;  5LA6 A;  4X66 O;  3G4S V;  2HHH O;  4TWK A;  1SET A;  1EN5 A;  3LNN A;  3LSQ A;  2QKC A;  4JI7 O;  2ZNI A;  1FJG O;  4I5S A;  1BGY H;  1QBZ A;  5IJ0 A;  3IAY A;  3CJH B;  1Q6U A;  2RCV A;  2X6B A;  5EYP B;  1KD1 W;  1PKX A;  1LNQ A;  2BSK A;  1L1F A;  4LP8 A;  1AI4 A;  2PI4 A;  1X4T A;  5LGN A;  1ZL8 A;  3K5M A;  4HYO A;  1WB8 A;  4YJ3 B;  3ZHV A;  2PYJ A;  1XHX A;  4TV8 B;  2YEV B;  1IVS A;  5L3D A;  5CB4 B;  1OCC C;  5IYC O;  5C8Y B;  1GN4 A;  1VMG A;  4YIP A;  3CRC A;  5GON A;  5JWP A;  2A0L A;  3LDC A;  3CC2 V;  3RYH A;  4B3R O;  1YF2 A;  4O4L B;  2GDS A;  4NXM B;  2Y48 A;  3ETQ A;  2EIM B;  5KHK A;  4ABM A;  1PM9 A;  3QVN A;  2GUZ B;  2O57 A;  2XAF A;  2GV9 A;  4JI1 B;  4LWS A;  2CTQ A;  5GTI Z;  1GMG A;  3AG4 C;  1RP3 B;  4LCU C;  3C3S A;  1MMM A;  3T4D A;  5B1B C;  2EIL C;  2W0X A;  3CXC U;  1M9N A;  4MTX A;  3STZ C;  1K73 W;  4F6R A;  4AQY O;  4LFA O;  5KX5 B;  3EHB B;  4IYI A;  3JD2 A;  2FML A;  3ASN B;  1I94 B;  1VAR A;  5EBW C;  3FD9 A;  1KB9 F;  1VP7 A;  2EZO A;  3OR6 C;  3MHH C;  4UVC A;  5LHH A;  2V7Q G;  1XRE A;  4NTY A;  3AG3 C;  1NR7 A;  4NR1 A;  3PJS K;  3OTO B;  3H1H H;  4MS2 A;  3ZN0 A;  4I55 A;  1BZK A;  5HFL A;  2PY5 A;  2CH7 B;  1QR9 A;  3JAS A;  2F23 A;  4DR3 B;  1ZX3 A;  4OPH A;  4R8C A;  4LF5 B;  4ASU G;  4JI3 B;  1G8M A;  3CC7 V;  5GW7 A;  1AP5 A;  2ODM A;  2JEX A;  3DC5 A;  1K34 A;  4UB8 Z;  4DUZ O;  1V54 B;  1OCZ C;  3K5O A;  3SYP A;  3JSN A;  1TVK B;  2PI5 A;  1WP8 A;  2VQE B;  1JMK C;  4PI2 A;  2XT9 A;  1BMF G;  3SPC A;  1ZAU A;  3RYF A;  4MVZ A;  4MT8 A;  4X1Y B;  4LF9 B;  5KHI A;  4LFB B;  5CA0 B;  4LR3 A;  2WLM A;  2E76 B;  3DXR A;  2OTL V;  1TGO A;  2JS3 A;  1VQL V;  2EIJ C;  3KG2 A;  4FLU A;  4RO2 A;  5E79 Z;  3SYA A;  2WLJ A;  4ZOL A;  1ZSP A;  1FFT B;  5LYJ A;  5GTH Z;  4JI1 O;  4JYY A;  1GKF A;  1SQB H;  3HKB A;  5LGT A;  4UCT A;  3RVY A;  4TSF G;  1Y4M A;  1K4D C;  1R3J C;  4MTG A;  2ZIN A;  3LNM B;  1I94 O;  4DR5 O;  4QPJ A;  4MVS A;  2NN4 A;  4DV3 B;  5EIB C;  2Q68 A;  3CXH F;  4QJF B;  3HKD B;  1MOF A;  1OCR C;  3T2M A;  4LBE C;  1N36 B;  2PF4 E;  2Q7E A;  5K1X A;  3OTO O;  2Y0P A;  4DR1 O;  3FB6 C;  4IHJ B;  1NVP D;  4I7Z B;  5LP6 B;  4GT1 A;  4DR3 O;  4P9O A;  1WN7 A;  2ZKO A;  4Z1V A;  1QLE B;  1KBH A;  1YJN V;  4TOI A;  3SYO A;  3K0D A;  1O9H A;  3IC9 A;  1FXH A;  1W2B U;  2Z3Y A;  4DK1 A;  3AG1 C;  3K59 A;  5H5N A;  3JSL A;  2HP8 A;  3ZX6 A;  1XNQ B;  3LSS A;  2VQE O;  2N05 A;  3AK2 A;  3BVO A;  1ARO P;  3VOU A;  4FM0 A;  4B7E A;  1B3Q A;  1WA8 B;  1U96 A;  3OE7 G;  4EKW A;  4DV2 O;  3OW2 U;  5DN6 G;  2ZDI C;  3JCU Z;  4DXW A;  1PV0 A;  1QLE C;  2FKX A;  3CWB H;  2RJZ A;  1AR1 B;  1YIT V;  4WFH A;  1WB7 A;  2X6C A;  3T4Z A;  4UCS A;  3M7M X;  1Z2G A;  2WAM A;  3L72 H;  4OGQ B;  1YTF B;  4O4I B;  3TCU A;  1G6U A;  2ZE6 A;  3H9V A;  3SYC A;  4BIU A;  1ORQ C;  4WFF A;  1GK9 A;  5EZY A;  1NH2 D;  5LA6 B;  2B9Z A;  2E5L B;  3WB1 A;  1M4U A;  3WU2 Z;  4MTF A;  4DV3 O;  3CCR V;  1L0L H;  1NTK H;  2YXY A;  1GN3 A;  2QGN A;  2YIA A;  1IZ3 A;  2GTA A;  3OEH G;  5IJ0 B;  1N36 O;  2D3O W;  5CB4 A;  5IYD O;  2V1D A;  2BSK B;  2YI9 A;  3ETD A;  3K08 A;  5LXT A;  4ICG A;  4X89 A;  2YSU B;  1QU7 A;  4PDL A;  1ZL8 B;  1UJW B;  3TK1 A;  2OIE A;  4CBC A;  1VF5 B;  1MA1 A;  4PDR A;  1AI6 A;  3JAR A;  3L74 H;  4D6T H;  1Q81 W;  2XAH A;  3K03 A;  4FZ0 A;  1XNQ O;  3APQ A;  4B3M B;  1N8R W;  2QKA A;  2ZE8 A;  4GCZ A;  3RYH B;  4UFZ A;  1HR0 B;  1JFF B;  2Q7G A;  4NYK A;  1NKD A;  3HPL C;  2EIK C;  1XOU A;  2ZCE A;  4XDK A;  3CCU V;  3H01 A;  3BHP A;  2QR4 A;  4GKK B;  1J95 A;  4BIZ A;  3F5W C;  4J11 A;  1K8A W;  2UXD O;  3F7Y C;  3ZRW A;  1SQX H;  3BCC H;  4B7K A;  1VQ9 V;  1PP9 H;  2P5O A;  5DED A;  3ZBH A;  2DYS B;  5IJ9 A;  3G80 A;  1WNS A;  4F6R B;  4IYH A;  4KUM A;  3X2Q C;  3WB0 A;  3ZMT A;  2OTJ V;  3SDL A;  3OMN B;  3E22 A;  1GN2 A;  5L3G A;  4MVQ A;  1H2N A;  5KUK A;  3CCV V;  2E5L O;  5CBG A;  3B40 A;  3ZMS A;  5JJN B;  3D3Q A;  1Q86 W;  1ENV A;  1QQC A;  1H8E G;  3A0R A;  1SQG A;  4QPK A;  2P7T C;  1FXK C;  4EFE A;  4X64 B;  2YIB D;  2JGU A;  4QE7 A;  3P3P A;  4BAY A;  4ZI7 A;  4NTX A;  2A3Q A;  1Y74 A;  1HP8 A;  2CTP A;  3CD6 V;  4WFG A;  1HNX B;  1K5Q A;  1FFX A;  1I5Y A;  2YC0 A;  2F1M A;  2XTA A;  3H1L H;  1HWY A;  4CS3 A;  1HNZ B;  2KG7 B;  2IH1 C;  2IJH A;  4F4L A;  2ZR2 A;  1XL4 A;  2KB1 A;  4HBN A;  5B5E Z;  3T1H B;  3KZI Z;  4J7J A;  3ZIA G;  2CUG A;  3UO2 A;  1XMO B;  1UPG A;  3RYF B;  4B3T B;  1BHA A;  1N33 B;  3K57 A;  1HR0 O;  1XIL A;  1COW G;  2W6I G;  2WLN A;  5LHI A;  1XI1 A;  2ZM6 B;  3ZHT A;  3M99 B;  1DGS A;  4GKK O;  3L70 H;  2LW7 A;  2ZIM A;  3W7W A;  1BCC H;  5LYJ B;  1JCH A;  3DC6 A;  4JTD B;  2EZP A;  3EVK A;  5B1A C;  5JJE B;  3CC4 V;  2DMX A;  2CAZ C;  4YJ2 A;  4YXW G;  1FJG B;  1ZUQ A;  1KC8 W;  3HKB B;  4DR6 B;  5FNV A;  2JGD A;  4X20 B;  3LUT B;  2EJR A;  1VF6 C;  5LMN B;  1BSM A;  2Q0O C;  2Y4T A;  1Y6X A;  1MNG A;  2DWE C;  4U7O A;  4BIO A;  1WLE A;  1X59 A;  4IHJ A;  3QO7 A;  4DRX A;  2UXC O;  2E74 B;  2XOK G;  2ZDI A;  3OT7 A;  3IGA C;  2X7R B;  4TUY B;  2W0F C;  3CCJ V;  1NTZ H;  2M7W A;  3GVM A;  1NVP C;  4CC6 A;  1DF5 A;  1SQQ H;  2UUB O;  2RMK B;  5B1N A;  1Q43 A;  2UUC O;  4JI4 B;  4X64 O;  2EIN B;  1EZJ A;  1Q82 W;  3EXA A;  1Y66 A;  1VQ8 V;  1IXM A;  1HNX O;  3D8C A;  2WLK A;  1MSW D;  4I9W A;  3K04 A;  2HVJ C;  1F4N A;  2EBO A;  1KEC A;  2CGN A;  1B04 A;  3CME V;  4JGS A;  1AI5 A;  3NXS A;  3DGE A;  3A0H Z;  2P4V A;  1VQP V;  4EB6 A;  2R9I A;  2LP7 A;  4P9P A;  4RWU A;  3HR0 A;  1XMO O;  1N33 O;  2EIN C;  1KUQ A;  2VRZ A;  2D2C B;  4FPP A;  1G4Y B;  2ZM6 O;  3E2E A;  1EN4 A;  4JPR A;  4XDL A;  4R6Z A;  3I5D A;  1H2G A;  4FJC C;  4U3J A;  2IU0 A;  4IIJ B;  4TT3 G;  1I0H A;  5FLX N;  2CK3 G;  1OCC B;  4DR6 O;  1AB3 A;  3HKE B;  1FYJ A;  4DV1 B;  5LMN O;  4E2L A;  5EZY B;  3IC7 A;  4ZKI A;  4BWA A;  4ZBM A;  3CCQ V;  1SER A;  3OD4 A;  1RPR A;  3KCX A;  3CCL V;  2XAJ A;  2P67 A;  1ZTE A;  4F6E A;  2Q8V A;  3T1Y B;  4DUZ B;  2AHZ A;  5H9C A;  2JJ2 G;  3AG4 B;  1BL8 A;  1BS3 A;  5B1B B;  2EIL B;  3K9A A;  4JI4 O;  3U11 A;  3G6B A;  3CX5 F;  2BOB C;  2LFR A;  5LXT B;  1Q3E A;  1MSD A;  2P90 A;  5KAI Z;  4IGG A;  2IBZ H;  1XNR O;  3ZED A;  1JFF A;  3UM7 A;  5CN0 A;  5J9P C;  3JAR B;  2JK5 C;  1KKD A;  2QE7 G;  3U0Z A;  4JYB A;  2GSM B;  1E1Q G;  5CA1 A;  1GN6 A;  4KHP B;  3FB7 C;  4QNH B;  1THZ A;  3AG3 B;  2QM4 A;  4XBF A;  1KQS U;  4J80 A;  1VQ5 V;  2XAQ A;  1DTO A;  1FXK A;  2CGO A;  4O4H B;  2UU9 O;  2OIG A;  4X62 O;  1IBM O;  4Z1M G;  4WCE V;  3VQY A;  4X1K B;  2P22 C;  4DR5 B;  1JJO A;  5LMU O;  3ZRW B;  1VQ4 V;  4LF4 O;  4FIP C;  1M90 W;  3MHS C;  3ZHS A;  4PA3 A;  1GM8 A;  2N74 A;  1OCZ B;  3PN1 A;  4G2K A;  4RUE A;  3OAA G;  4I0X A;  1SRY A;  4L8J A;  5IJ9 B;  1SA0 A;  2B1G A;  4DV1 O;  3I55 V;  4DR1 B;  3VBB A;  5H2F Z;  1LUW A;  3F7V C;  2HVK C;  5EC1 C;  3E22 B;  2Y4U A;  1AR5 A;  3ABL C;  2YIC A;  1KP3 A;  3ZJZ A;  3SGI A;  2EIJ B;  2GHY A;  3SPJ A;  3T1Y O;  1XQ8 A;  2KG7 A;  4PDM A;  1B6Q A;  1NZ6 A;  3FAV B;  3JAK A;  1TAE A;  1F51 A;  4PEL A;  2QWR B;  1SC5 B;  2PTM A;  1CXZ B;  4FMT A;  3N2G A;  4ZI7 B;  1VF6 A;  1Y74 B;  1MAB G;  1NS1 A;  1FFX B;  4DV2 B;  2IM9 A;  3BEH A;  3HKC A;  4FLW A;  4CZZ A;  3STL C;  1JA8 A;  3BAA A;  1VIB A;  1RPO A;  4CC5 A;  1MZF A;  3OR7 C;  1AJP A;  5IWA O;  3ZHU A;  4KHP O;  4DR4 B;  2HKO A;  5LL6 Y;  1P4R A;  1OCR B;  2RQ6 A;  2P6J A;  4FLT A;  4UCO A;  1PL4 A;  4UV9 A;  3ZRS A;  1I5X A;  1SES A;  2QM7 A;  3K5L A;  5L3C A;  1F7Y A;  1S5J A;  4X20 A;  1S5H C;  2PUS A;  3I56 V;  1JX9 A;  1UFI A;  3F5T A;  4LFC B;  1I7F A;  1SZX A;  5F2V O;  1P7G A;  2R72 A;  1ZWI C;  3RW0 A;  3WB2 A;  3CRM A;  3VQW A;  3RYI A;  2IJJ A;  2VWJ A;  2E3C A;  1JOY A;  2Q5Z A;  4YJ2 B;  4FZ1 A;  3AG1 B;  2YDE A;  3CRA A;  4L87 A;  5FNV B;  1E1R G;  2ADP A;  3IFX A;  1H2M A;  3RBZ A;  2JGD B;  3RWR D;  4TUY A;  3CPW U;  1VF7 A;  1IDS A;  4LNU A;  1S77 D;  3AG2 C;  3RT3 C;  3K58 A;  4GX5 A;  4I4T B;  3WG7 B;  5CMU A;  4QE9 A;  4DRX B;  5KUM A;  4JYC A;  4DV0 B;  2JDI G;  1SQP H;  4Q6G A;  3T1C A;  1BQZ A;  1AIL A;  1YSC A;  5DEC A;  4BW5 A;  3G71 V;  3H1J H;  4R50 A;  2P4K A;  1K92 A;  2ATK C;  3C90 A;  1S3J A;  1MG1 A;  4TQD A;  1EFR G;  4NVP A;  4X88 A;  1OCO C;  3K9S A;  3WG7 C;  2OCC C;  4WFB V;  1KYO F;  4KP4 A;  2BCC H;  4KL1 A;  2IU3 A;  2F4V B;  1H2L A;  1QNM A;  1R6T A;  4RQF A;  3MAQ A;  5KMG A;  4MVO A;  2UXD B;  2YXH A;  4EB6 B;  3UCS C;  1OZ0 A;  4LH6 A;  5DM6 V;  3CCE V;  4U7N A;  4DR4 O;  2DQ0 A;  4IIJ A;  3ABK C;  1IBK O;  3SJA C;  3HKE A;  3ABT A;  1P7B A;  1L8D A;  2QDO A;  1K4C C;  2K9P A;  2QJ1 A;  4LFC O;  3LDE A;  3CMA V;  1R3K C;  5IE9 A;  1WAZ A;  4U3J B;  2DN9 A;  4DR7 O;  1A32 A;  1DF4 A;  5IYB O;  4IL6 Z;  2ZE7 A;  1SZT A;  2MK3 A;  2X6A A;  4PA6 A;  2CTW A;  4JI2 O;  3SJC C;  5B66 Z;  3FYE B;  4DV6 B;  2KKW A;  3ASO C;  1N32 O;  1BE3 H;  2A06 H;  5FL7 G;  2R9A A;  1E79 G;  1XDC A;  2EIK B;  1WJZ A;  3BAB A;  3CS5 A;  1Q8I A;  1XMQ O;  1OV9 A;  4O2A A;  4YY3 B;  4DV0 O;  4OXS A;  4NXN B;  2FYU H;  3FB8 C;  4DV5 B;  1AR4 A;  2DW4 A;  4RUF A;  3ETG A;  1S0V A;  2IW5 A;  2ZXW C;  2KQX A;  5BMV A;  3K5N A;  3BFR A;  3G67 A;  1DK1 A;  5JH7 A;  2BE3 A;  3QNE A;  3DSQ A;  4JYA B;  1J5E B;  3P3N A;  3X2Q B;  2AZ2 A;  1NJI W;  2LGW A;  4LF6 B;  2F4V O;  4O4H A;  1VQM V;  2N04 A;  5CA1 B;  4P30 A;  1F4M A;  1K7D A;  1LR1 A;  5LHG A;  4X1K A;  4PI0 A;  5EC2 C;  2RNB A;  2A9H A;  3AG7 A;  2YIB A;  1FXK B;  3QO8 A;  4GYC B;  1W59 A;  4K3A A;  2G38 A;  3E35 A;  3FX7 A;  3AK3 A;  2DYR C;  3BA9 A;  4DV4 B;  3D3I A;  3QG5 A;  3FB5 C;  4MTO A;  2UXC B;  1HNW B;  2A79 B;  4K8Z A;  3L9D A;  1JJ2 U;  3JAW A;  3LDD A;  1Z5W A;  3DTU B;  4I0X B;  4NB5 A;  4OPA A;  3QO5 A;  1SA0 B;  2Q73 A;  4H37 A;  5BY1 A;  2UUB B;  4JF3 A;  1SQF A;  2R70 A;  3FAV A;  4DV6 O;  2R9R B;  2Q4P A;  4PD4 F;  2UUC B;  4HNA A;  4ZIB A;  5L3F A;  1GH6 A;  4PA7 A;  4YHH O;  5LBQ A;  4FLZ A;  2VS0 A;  5LOV B;  4YY3 O;  1Q6I A;  3EFF K;  4NXN O;  3HB3 B;  3GWK C;  4QIW F;  4DV5 O;  3S3X A;  2Y69 C;  4XDJ A;  3RYC A;  1G1X B;  5B1A B;  3JAK B;  1VQN V;  2XND G;  1GTO A;  2L6L A;  5AG2 A;  3N2G B;  1AJN A;  5IT9 N;  3CCS V;  3ABU A;  1EN6 A;  2ZNJ A;  4JYA O;  1J5E O;  3ZCC A;  3HKC B;  1PNM A;  3P32 A;  1Q5O A;  4LF8 B;  3JAL A;  2RN9 A;  4QGP A;  4LF6 O;  2B1I A;  1IX9 A;  2ZIO A;  4HAM A;  1NTM H;  1S76 D;  5JCO C;  4E4E A;  4DYL A;  2CE4 A;  1NVP B;  2HFE C;  4JI8 B;  3ZMU A;  2DE0 X;  2WSS G;  5KHH A;  3UKM A; 
#chains in the Genus database with same CATH homology
 2BOB C;  4H33 A;  3RVY A;  4RQE A;  2P90 A;  4TSF G;  2DWD C;  3OUS A;  2DYR B;  1Y4M A;  1K4D C;  3UM7 A;  1R3J C;  4MTG A;  5CN0 A;  5J9P C;  3LNM B;  2JK5 C;  1RM1 C;  2ITD C;  1GM9 A;  3AEI A;  4QPJ A;  1R73 A;  4G28 B;  4MVS A;  1KKD A;  2QE7 G;  2Q68 A;  4QJF B;  4GX1 A;  5C93 A;  1M1K W;  4JYB A;  2GSM B;  1E1Q G;  3W7U A;  2FTK A;  1MOF A;  2WPD G;  1OCR C;  1K33 A;  2ZD9 A;  3T2M A;  4LBE C;  2HJF C;  3FB7 C;  4QNH B;  1THZ A;  3AG3 B;  2X0L A;  1BHB A;  4XBF A;  1KQS U;  1VQ5 V;  3ABM C;  3FB6 C;  2XAQ A;  1DTO A;  1NVP D;  1FXK A;  1KP2 A;  4GT1 A;  1YJ9 V;  3ZN1 A;  4P9O A;  1QVF U;  5L3E A;  4J9Z B;  1QLE B;  5H6Q A;  1YJN V;  4X8A A;  1PNL A;  3SYO A;  4Z1M G;  3K0D A;  4DO2 A;  1R3L C;  4WCE V;  1CEZ A;  1FXH A;  1W2B U;  2Z3Y A;  2QTO A;  3ZRW B;  3B77 A;  1QR8 A;  3AG1 C;  1VQ4 V;  2Y69 B;  5KA5 A;  4FIP C;  1M90 W;  3MHS C;  4PA3 A;  1GM8 A;  4HZ3 A;  2UXX A;  1OCZ B;  4G2K A;  4RUE A;  3LSS A;  3W7X A;  3OAA G;  1QLN A;  1SRY A;  1ARO P;  1W0K G;  2B1G A;  3VOU A;  5IY5 B;  5KA6 A;  3I55 V;  3RVZ A;  3VBB A;  1DLB A;  3JD3 A;  3F7V C;  3OE7 G;  5CA3 A;  4EKW A;  2HVK C;  2QKS A;  1EBO A;  5EC1 C;  3ABL C;  3OW2 U;  4PDV A;  5DN6 G;  2ZDI C;  1AJQ A;  4DXW A;  4JAU A;  1M56 B;  1QLE C;  3E8H A;  2HR3 A;  1KP3 A;  2NLJ C;  2AHY A;  3ZJZ A;  5IDJ A;  2EIJ B;  1AR1 B;  1YIT V;  2WLL B;  2GHY A;  1GO3 F;  1NQT A;  4GX0 A;  4WFH A;  2UXN A;  3SPJ A;  4MW3 A;  2X6C A;  3T4Z A;  4PDM A;  1B6Q A;  3JD0 A;  2WAM A;  4JAV A;  1F51 A;  4PEL A;  2QM8 A;  2DYS C;  1YTF B;  4FMT A;  5IY5 C;  3TCU A;  1CPY A;  4N23 A;  1K3E A;  3JD1 A;  2WLI A;  1NH2 C;  3SYC A;  1MAB G;  4BIU A;  1V55 C;  1ORQ C;  1VQO V;  4WFF A;  2Q69 A;  1M57 C;  1GK9 A;  1WPX A;  2JEU A;  3BEH A;  3B8N A;  1NH2 D;  4CZZ A;  3STL C;  1M56 C;  2H8P C;  5CBF A;  1RM1 B;  3R65 A;  4MTF A;  4PA9 A;  3CCR V;  1RPO A;  3CCM V;  1JQ0 A;  3OR7 C;  1R6K A;  1AJP A;  1PD3 A;  3OEH G;  3W7S A;  3ZMZ A;  1NR1 A;  2XAS A;  1Q7Y W;  2HKO A;  1P4R A;  1OCR B;  2D3O W;  2P6J A;  1R6N A;  4J9Y B;  1H8H G;  5IYD O;  4UUJ C;  2V1D A;  3K3W A;  4UV9 A;  3ZRS A;  1I5X A;  1SES A;  2IJI A;  2QM7 A;  3ETD A;  3ABM B;  3K08 A;  5L3C A;  5LGU A;  1S5H C;  4X89 A;  4UXN A;  2YSU B;  4PDL A;  3I56 V;  1JX9 A;  1YTF D;  1PNK A;  3P30 A;  1UJW B;  3TK1 A;  3OUF A;  4CBC A;  3GWO A;  3E8F A;  4PDR A;  1AI6 A;  1PL0 A;  1ZWI C;  2B5U A;  3RW0 A;  1AI7 A;  1Q81 W;  2IJJ A;  2XAH A;  1JOY A;  2IH3 C;  3K03 A;  3AG1 B;  3OGC C;  4L87 A;  4WF9 V;  1E1R G;  3RBZ A;  3IFX A;  2DQ3 A;  3JYC A;  1VQ7 V;  1N8R W;  3CPW U;  1S77 D;  3AG2 C;  4GCZ A;  4GX5 A;  3G6E V;  2W6J G;  4MW8 A;  1NKD A;  2ITC C;  3WG7 B;  3HPL C;  2EIK C;  5CMU A;  4QE9 A;  3E83 A;  3ABL B;  3OEE G;  4XDK A;  5KUM A;  4JYC A;  3CCU V;  2JDI G;  3H01 A;  3OMI B;  1J95 A;  3CP1 A;  4BIZ A;  3F5W C;  1ROP A;  3GB7 C;  5B3S B;  3T1C A;  1YSC A;  1K8A W;  4BW5 A;  2Q6A A;  3F7Y C;  2Z5U A;  3ZRW A;  2K1E A;  3G71 V;  3MD0 A;  4R50 A;  1VQ9 V;  4R7C A;  4GX2 A;  5L3B A;  4JTA B;  1K92 A;  2ATK C;  2DYS B;  1S3J A;  1MG1 A;  4MVM A;  1VQ6 V;  4KUM A;  2WWW A;  3X2Q C;  1EFR G;  3ZMT A;  3E89 A;  2OTJ V;  4X88 A;  1OCO C;  3W7T A;  1OHH G;  3OMN B;  1NH2 B;  3CYO A;  1V55 B;  5EK0 A;  3WG7 C;  2OCC C;  3SPI A;  1JVM A;  4WFB V;  1M57 B;  2EIM C;  4WFA V;  4KP4 A;  5HFM A;  5L3G A;  4MVQ A;  5KUK A;  3CCV V;  1K97 A;  2IU3 A;  2OT5 A;  5CBG A;  4RQF A;  2QEX V;  5B3S C;  3E86 A;  4MVO A;  3ZMS A;  5CBH A;  2WLL A;  3JCZ A;  1OZ0 A;  2LFS A;  5DM6 V;  3CCE V;  1Q86 W;  1ENV A;  1H8E G;  2HLD G;  3A0R A;  4U7N A;  2IJK A;  3ETE A;  4QPK A;  2DQ0 A;  2P7T C;  3ABK C;  1FXK C;  2C2A A;  1JPX A;  1YIJ V;  2ZQM A;  3ABT A;  4QE7 A;  3OM3 B;  1P7B A;  4BAY A;  1K4C C;  3B8M A;  3CD6 V;  4WFG A;  3ASN C;  4KFM A;  3LDE A;  1K5Q A;  1I5Y A;  3CMA V;  1R3K C;  1R3I C;  1HWY A;  2JIZ G;  3G4S V;  2IH1 C;  4TWK A;  1SET A;  2IJH A;  3LSQ A;  4F4L A;  2ZR2 A;  1DF4 A;  1XL4 A;  2KB1 A;  3SPH A;  4I5S A;  5IYB O;  3ZMV A;  1W0J G;  1SZT A;  2MK3 A;  2X6A A;  4PA6 A;  3ZIA G;  1QBZ A;  3FYE B;  2X6B A;  1KD1 W;  1BHA A;  3ASO C;  3AG2 B;  1PKX A;  1LNQ A;  1COW G;  2W6I G;  1L1F A;  4LP8 A;  1AI4 A;  1XL6 A;  3D36 A;  2WLN A;  2PI4 A;  5FL7 G;  1E79 G;  2XAG A;  5LHI A;  2EIK B;  5LGN A;  3M99 B;  4HYO A;  4OXS A;  3W7W A;  3FB8 C;  2DW4 A;  1V54 C;  4RUF A;  3ETG A;  1JCH A;  4JTD B;  2EZP A;  5B1A C;  2WLH A;  3CC4 V;  2IW5 A;  2YEV B;  2ZXW C;  5L3D A;  3SJQ C;  1OCC C;  1S0V A;  5IYC O;  3K0G A;  4YXW G;  3E8G A;  1KC8 W;  5B1O A;  3TET A;  3ML0 A;  3LUT B;  2EJR A;  3FYI B;  2A0L A;  3OMA B;  3QNE A;  3LDC A;  3CC2 V;  3K79 A;  5BZB A;  2DWE C;  4U7O A;  3X2Q B;  1WLE A;  5EBL C;  1OCO B;  3QO7 A;  2Y48 A;  2OCC B;  1F23 A;  1CP9 A;  2EIM B;  4UVA A;  1NJI W;  2XOK G;  2ZDI A;  4MSW C;  1YHQ V;  1VQM V;  4RAI A;  4P30 A;  3IGA C;  2XAF A;  4UVB A;  1F4M A;  1K7D A;  2JJ1 G;  2X7R B;  5LHG A;  2W0F C;  3CCJ V;  5EC2 C;  2M7W A;  1GMG A;  3AG4 C;  1NVP C;  5EBM C;  2A9H A;  1DF5 A;  4LCU C;  4MVR A;  3T4D A;  5B1B C;  2EIL C;  3CXC U;  2ZR3 A;  4UV8 A;  5B1N A;  1M9N A;  3ABK B;  1FXK B;  3QO8 A;  5E1A C;  3JD4 A;  4MTX A;  2EIN B;  3STZ C;  1FXV A;  5H6R A;  3E35 A;  1K73 W;  1EZJ A;  3ZRV A;  1Q82 W;  3EHB B;  2DYR C;  1FS0 G;  1Y66 A;  3D3I A;  1VQ8 V;  1IXM A;  3JD2 A;  2NNU A;  4Q20 A;  4N21 A;  3ASN B;  1TUE B;  2WLK A;  3FB5 C;  1MSW D;  4I9W A;  3K04 A;  2HVJ C;  1F4N A;  2EBO A;  4WFE A;  5EBW C;  4MTO A;  1KEC A;  1K9M W;  3CME V;  2A79 B;  4JGS A;  1AI5 A;  3NXS A;  2EZO A;  3OFN G;  3OR6 C;  3DGE A;  1JJ2 U;  3MHH C;  3E8B A;  3LDD A;  4UVC A;  3DTU B;  3ZRX A;  5LHH A;  1VQP V;  2V7Q G;  2R9I A;  4JTC B;  3QO5 A;  2LP7 A;  3AG3 C;  1NR7 A;  4P9P A;  3PJS K;  4MS2 A;  3ZN0 A;  4H37 A;  1QVG U;  2F43 G;  4JF3 A;  1K5S A;  5HFL A;  2R9R B;  1QR9 A;  3WFV A;  2EIN C;  3ASO B;  5L3F A;  4JAS A;  4R8C A;  4PA7 A;  4FPP A;  1QCE A;  5LBQ A;  1G4Y B;  4ASU G;  3E2E A;  1G8M A;  3CC7 V;  4JPR A;  4XDL A;  4R6Z A;  3EFF K;  1H2G A;  3HB3 B;  1H38 A;  4QIW F;  5GW7 A;  4FJC C;  2Y69 C;  2JEX A;  1K34 A;  4XDJ A;  1V54 B;  2IU0 A;  1OCZ C;  4TT3 G;  5B1A B;  3SYP A;  3K06 A;  2CK3 G;  2ZXW B;  2PI5 A;  1OCC B;  4LC1 A;  2Q67 A;  1VQN V;  1GM7 A;  2XND G;  1GTO A;  2QA4 V;  1BMF G;  2WLI B;  1AJN A;  3SPC A;  1NBM G;  3SPG A;  4E2L A;  3ABU A;  3CCS V;  4MVZ A;  4MT8 A;  4MVU A;  3IC7 A;  3ZCC A;  3FKS G;  4ZKI A;  1PNM A;  3P32 A;  4P2Z A;  2WLM A;  4ZBM A;  3CCQ V;  1SER A;  2OTL V;  2BOC C;  1RPR A;  1VQK V;  3CCL V;  2EIJ C;  1VQL V;  3KG2 A;  2B1I A;  2XAJ A;  2P67 A;  4RO2 A;  3SYA A;  2WLJ A;  4HAM A;  4PA4 A;  1S76 D;  1FFT B;  1YI2 V;  2HG5 C;  4FK5 C;  3BY6 A;  2AHZ A;  1YJW V;  2YEV A;  5H9C A;  3SYQ A;  2JJ2 G;  1S72 V;  1NVP B;  1GKF A;  3AG4 B;  2HFE C;  3ZMU A;  1BL8 A;  1YTF C;  5LGT A;  2H94 A;  2WSS G;  2EIL B;  3K9A A;  5B1B B;  4G27 B;  3UKM A;  2LFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...