1RM1C

Structure of a yeast tfiia/tbp/tata-box dna complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
285
structure length
116
Chain Sequence
SNAEASRVYEIIVESVVNEVREDFENAGIDEQTLQDLKNIWQKKLTETKVTTFSWDNQFNDYLISEDGPDENLMLCLYDKVTRTKARWKCSLKDGVVTINRNDYTFQKAQVEAEWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Structure of a Yeast TFIIA/TBP/TATA-box DNA Complex
rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna
molecule keywords 5'-D(*AP*TP*CP*GP*AP*TP*CP*GP*AP*TP*AP*TP*AP*AP*AP*AP*CP*G)-
total genus 35
structure length 116
sequence length 285
ec nomenclature
pdb deposition date 2003-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03153 TFIIA Transcription factor IIA, alpha/beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1rm1C01
2.30.18.10 Mainly Beta Roll TATA box binding Protein, subunit D; domain 2 Transcription factor IIA (TFIIA), beta-barrel domain 1rm1C02
3W7UA 3W7TA 1NH2D 2P90A 3W7XA 2WAMA 5IYBO 3W7SA 4HAMA 5IYCO 1RM1B 3IC7A 3W7WA 1YTFC 1NVPC 1NVPD 1NVPB 5GW7A 1S3JA 3D3IA 2HR3A 5IYDO 3E35A 1RM1C 3BY6A 1NH2C 1YTFB 1NH2B 1YTFD 5CA3A
chains in the Genus database with same CATH superfamily
4FFKA 4MVRA 2GTAA 1B3QA 4RUFA 1KKDA 3P3PA 1SQVH 4LC1A 4LF5B 4PV1B 4U3FH 1SZTA 5KX5A 5IDJA 5CA1A 1VMGA 1B06A 4NTWA 3CWBH 1NTKH 5K1XA 2VWJA 4GUNA 3T4ZA 1K3EA 2FKXA 1Y76B 3OTOB 1DF4A 1KYOF 3GWOA 3SYCA 1AI5A 4U3JA 4AILC 2EZOA 2W6JG 1IDSA 2P4KA 3ZMZA 4JI5B 4QPJA 3OAAG 2DMXA 4LWSA 2AGAA 4RQEA 1IBLB 4FZ0A 4DR5O 2FL4A 2GTSA 1R3LC 5JH7B 2E5LO 2OCCB 1ENVA 2YIBA 4UB6Z 3H1LH 4UXNA 1PD3A 3GVMA 4IIJB 4J10A 2ZD9A 1WP7A 1VQKV 5EIBC 4ZHQB 5KHHA 2E3CA 2IJHA 1VQOV 5CA1B 1SA0B 3BVOA 1TAEA 2Y0PA 5FPRA 4X1KA 2OT5A 1R3KC 2P4VA 4FLVA 3CP1A 2JJ2G 2ZNIA 2N74A 4B3TO 3RT3C 4DR3B 1Q6HA 3E8BA 2IU0A 3OM3B 1S5JA 1SRYA 3ABKC 1ROPA 3P30A 1FYJA 2QSAA 1WN7A 1H8EG 3OEHG 3ZMTA 5HFLA 5IYDO 1F23A 3ZBHA 3ASNC 3IJ4A 3SR2C 3G6EV 1XNQO 1NH2C 4LF9B 4CH6A 1OCCC 1NZ6A 2LFRA 4IIJA 3JALB 3BAAA 3FAVB 5H9CA 4JYCA 2E74B 1YHQV 3ZHRA 5EIBD 1Q8IA 4TUYA 3J7AU 4TQFA 1BZKA 4GCZA 5LP6B 5CN0A 4K8ZA 2ZXWB 2WA3A 3ZHSA 3FD9A 3KG2A 2CTQA 4JZGA 2DWDC 4CS4A 3MHSC 1Q86W 2WAMA 4UCTA 3CS5A 4JI3B 1RP3B 1J5EB 4ZOLB 4DV5O 4B3SB 2XOKG 4PDMA 5JVDA 3ASNB 4DXWA 2YDEA 3STLC 4P30A 4BIOA 1BE3H 3T1YB 3B8NA 3BPZA 4MTFA 1NQTA 4LBEC 4JAAA 3ABTA 2Z3YA 4O4LB 2DQ0A 2QWOB 1KP2A 1NVPB 4LWSB 3U10A 1YIJV 1M93A 3K9AA 2YS8A 3F5WC 3FYEB 3MHHC 5KHIA 1AILA 1P7BA 3SJQC 1M57C 3JSLA 2RDCA 3JAKB 5CB4B 2V7QG 1RPOA 1GN6A 2UUAO 3ZMVA 2JEXA 2H3OA 2IW5A 2VWKA 1AVMA 5HFMA 5B1NA 3E83A 3ZS8C 2EIMC 4DUYB 3C90A 3ETEA 4LNUA 4RWUA 4NVPA 2CTRA 1W0JG 3MD0A 4I7ZB 3ABMC 2BOCC 3SYOA 1XL4A 2WA4A 4CH3A 3SJAC 4JI2O 2ODMA 2PZSA 4MS2A 4KHPB 5LGNA 2ITDC 2LP7A 4NXMB 5IJ0A 4GZRB 5CMUA 3HKBB 4F6EA 2DJVA 1W0KG 2LFSA 2ZIMA 2Y4TA 5EBMC 4KHPO 3DXRA 1SQGA 2X6CA 5LYJB 2E5LB 3L72H 4X88A 1DK1A 4D7TA 1I7FA 2UXCB 3K04A 5GW7A 2RMKB 3CSXA 3D36C 4B3RB 1FKAO 3DC5A 1N0JA 2ZE7A 4JTDB 4JAUA 4DR6B 1HNWB 1I5XA 4JI6O 1AB3A 4Z1VA 2HLDG 2ZQMA 1IXBA 3WG7B 5KLVH 1FFTB 4JI5O 1YSCA 3ETDA 1H2MA 5GTHZ 4IHJA 4H13B 2PYLA 4WFAV 1LR1A 1XHXA 4ZIBA 1GN2A 1YDXA 2OIGA 3SJBC 5LHGA 3CB2A 2PY5A 1ZLZA 2QKAA 4NYKA 4BWAA 4Q20A 2EBOA 1L1FA 3BA8A 1JQ0A 4NXNO 1WJZA 1OCOB 1XEQA 1JCHA 4O4JB 4EKWA 1K5QA 2A79B 2WLJA 3LSQA 1XHZA 3A0BZ 5LOVB 3N2KA 5C93A 1SQFA 1F4NA 4X65O 2R9AA 3HKCA 4O2BA 4YJ3B 2CH7B 1TUEB 3L74H 2CUGA 2JDIG 1EN4A 1N4CA 4JI7B 4LNUB 5L3DA 2ETNA 3JAMN 2QEXV 2XHBA 1K7DA 1S5LZ 4OPAA 1XQ8A 4IYHA 4QPKA 3CRRA 3CC4V 1FXKB 1WP8A 1JFFB 2EULA 4FVMA 4UV8A 4QNHB 3E22A 5KAFZ 1HNXB 1BS3A 2DYSC 3ETGA 2XAGA 4PA6A 3D8CA 3S3XA 3RYCB 4FZ1A 4NTYA 3E8HA 4DR5B 3JALA 3ZN0A 4WFBV 1Q43A 3OMIB 4JI7O 3D3QA 3H1IH 3B09A 3K0DA 2IJKA 1NTMH 3CHXA 2QTSA 1N0NA 3APQA 1RFYA 1K34A 2HJFC 4N21A 2ZCEA 4O2BB 5KX5B 2Q68A 3EHBB 4TOIA 3ZHTA 3N2GA 4TT3G 2FTKA 3LDDA 4P9OA 1XMOO 1R3JC 3H01A 1HNZO 1BMFG 3I55V 2R72A 4I9QA 5IYZB 5KHKA 1TA8A 3LNMB 1GMGA 3VQVA 1XI1A 1CEZA 3AEIA 2EJRA 4X1YB 2Q7EA 2IH3C 5B1AC 1M56C 3JASB 3OUFA 3K5OA 1KP3A 1US6A 1JVMA 2HG5C 3SGIA 3FKSG 2OCCC 3VQWA 1Y74B 2N04A 4PA3A 1FS0G 4Z2WA 1HR0B 1R73A 2C2AA 4X20A 1DGSA 4B7EA 2V1DA 4LFCO 1R6KA 1M56B 2RQ6A 1PNMA 4JASA 1Y6XA 4UUJC 4JPRA 3N2KB 3ZX6A 1ZUQA 2HKOA 3C3TA 4B3MB 1VARA 4JI2B 1THZA 3BCCH 1XREA 4JI4B 1NKDA 3AK1A 4YXWG 4MW3A 4FLXA 1MABG 4WF9V 2YXHA 4DV7B 3B8MA 3LSSA 4H37A 4Z1MG 5IYZA 1R3IC 1SETA 1YJNV 4YY3O 2JRIA 4PA7A 3J81N 2UXDO 1G6UA 1NR1A 1FJGO 4X1YA 4DUZO 4NXNB 2P22C 2Q0OC 2DYRB 4D7SA 2HHHB 1BSMA 2QWPB 2QTOA 4AQYB 3CCQV 4B3MO 1VQNV 4TSFG 2Y4UA 1HP8A 3G67A 1UPGA 5L3CA 3OE7G 3E22B 3CX5F 2WSSG 1Q90D 5LP6A 1RSOA 2XTAA 2KB1A 4JGSA 4AQYO 1GKFA 1Q6IA 1IURA 4NTXA 3CXHF 5LGTA 5JJNB 5DM6V 1OJHA 4TV8B 2ZR3A 5IT9N 5B5EZ 4DV2B 3BABA 5EYPA 4JI0B 3CCRV 4R8CA 5H2FZ 2ILMA 2N05A 4ZOLA 2R9RB 4EB6B 1GM8A 3THOA 4WFHA 5LA6A 1N34O 4PI0A 2RCVA 3OFNG 5EBLC 3UCSC 4JI0O 1GN3A 2EJ7A 1NBMG 5IY5C 2DQ3A 3ZCCA 4CC6A 4TV9A 3JD0A 4AHCA 1FXKA 4X66B 3RGBA 1DLBA 3LDEA 4FLYA 2HR3A 2P7TC 4DW1A 5JQGB 1YTFB 2BSKB 2OCHA 4DV3O 4KP4A 4A5UB 4K35A 5EC1C 1V55C 1G1XB 1XMQB 2HHHO 4FK5C 5L3FA 2PI4A 1NR7A 3R66A 1JMKC 2M6YA 2CTPA 1VQMV 2IU3A 5BZBA 1IBKO 3IFXA 4WBNB 2L6LA 1K5SA 4TUYB 2UU9B 4YIOA 5EC2C 1BGYH 1SERA 4CZZA 4G27B 2F4VB 2IJIA 3OGIB 3CC7V 2CH7A 4XBFA 4MVQA 3T1CA 1L8DA 2VQEB 4UCRA 4MTXA 1VIBA 2BCCH 3RYFA 3WG7C 3CPWU 5LMNO 4D6TH 5KHGA 1N34B 1MZFA 4CC5A 2OIEA 1SC5B 2NR5A 3HB3B 3OUSA 1MG1A 1N36B 1W59A 3D3IA 1Y67A 3OR6C 4K8XA 4DR4O 4BR6A 1E1RG 4JI4O 2QA4V 4YIPA 2GV9A 2ITCC 1RSOB 5JCOA 2P5OA 4WFGA 2BTQB 1V55B 1BHAA 4U7OA 2DYRC 1VQLV 4WBNA 3F5TA 2PGGA 3SPCA 2JJ1G 5IE9A 3NR7A 4JI1O 1SQQH 1FJGB 5TISZ 1M9NA 5D5QA 1MOFA 1KQSU 1OHHG 3JATA 3CXCU 1GK9A 4LCUC 1EN5A 3B77A 1GM9A 2QKCA 2MK3A 5EZYB 2WPDG 5B1BB 1HW7A 3AG1B 1SS3A 3B40A 5KUMA 3N27A 2IJJA 2XT9A 4B7KA 4P2ZA 1BQ0A 1FAFA 4KL1A 3Q4HA 3QNEA 5LBQA 4J9YB 4DR2B 4QE7A 2AHZA 3K03A 4MTOA 2B9ZA 5B1BC 4UB8Z 1IBLO 2MW2B 3GWKC 1WNSA 4L8JA 3W7SA 2CE4A 4U3JB 2UXCO 3H9VA 5H6QA 1Y66A 3KCYA 1WLEA 1B6QA 4QJFB 1F7YA 5ITZA 1R6TA 2F1MA 3ZRWA 2A0LA 2QM7A 1AI4A 4X89A 4LF8B 5LYJA 4U7NA 2R70A 2F93B 3S3WA 4DK0A 4GT1A 2F4VO 4J7JA 1PKXA 4KFMA 4FM0A 1U96A 2V4DA 3AK3A 4OPHA 2PI5A 4UVAA 4FFBA 3X2QC 4CS2A 3ABMB 3MDSA 3EVKA 3AG3C 5C8YA 1CXZB 1VF5B 2P90A 3EXAA 2XAHA 2VQEO 3U0ZA 1XL6A 1XOUA 2X7RB 4O2AB 3L73H 1N33B 1AI7A 2UXXA 4TWKA 5LP6C 3DSQA 5ITZB 1KKCA 4X8AA 2IM9A 4MW8A 2QWNB 1CPYA 3T1HO 1AJPA 2L35A 1KU9A 3ETQA 1PPJH 3PN1A 2F23A 5J2UA 3FAVA 2HVJC 4FLUA 2EINB 1SZXA 1JPXA 4JYYA 1ZX3A 1P84F 1WA8A 3T1HB 4TV8A 2ADQB 2VS0A 1OCCB 2FMLA 2Q7GA 2NN4A 4GKKO 1KB9F 1M57B 3TJTA 2DOSA 1VQ5V 1H2LA 2VRZA 3X2QB 3HKCB 4LF7B 3CE2A 5C8YB 1KECA 1XDCA 4IGGA 3CYOA 4K0KO 2HEPA 3H1JH 3UQ8A 1KMIZ 4JV5B 1JR9A 3SPIA 1QR9A 4MVSA 2RJZA 1IZ3A 4OGQB 2A7WA 4I55A 5JWPA 3Q4HB 1WB8A 3O65A 5IJ0B 1WAZA 4W4KA 2JIZG 2LO1A 4DR1O 1GTOA 1IBMB 3VQXA 2GDSA 4I0XB 1K4CC 4X64B 3CC2V 3CJHA 3K5LA 4H44B 5CBGA 4GX5A 3CD6V 2GSMB 1HR0O 3RN4A 4CBCA 2H8PC 3VQYA 4HZ3A 1HDJA 4J9ZB 1VQ6V 2Q6AA 4FIPC 1DTOA 3CCSV 3ASOB 3OMNB 4E4EA 4XDLA 1V54B 1MZEA 4JTCB 5J9PC 1NTZH 1L0NH 1Z5VA 3HKDA 1V9PA 1AI6A 2QM8A 3AG2B 4ZI7A 4HBNA 4UVBA 3STZC 2UUCB 4JI8O 2LJ2A 4FFBB 3CRCA 4JF3A 1A32A 3F7YC 2Z0AA 1MA1A 5H5NA 1JX9A 5LMUB 3OR7C 3U11A 3G80A 1PNKA 5DEDA 4DV6B 1NH2B 5E79Z 2DW4A 1QNMA 2X6BA 3UKMA 4JYAB 1D2DA 4DV4O 2QWQB 1RM1B 4JI1B 4YJ2A 1NI8A 4W4LA 4DV6O 3CCVV 3G6BA 1XNRO 4LFBB 3G71V 2Y69C 2WLIB 2LW7A 4LFAB 3D36A 4X20B 2Q8VA 3TXQA 4BAYA 2X0LA 4DRXA 1TGOA 3T2MA 3W7UA 2YI8A 3DXRB 4LP8A 1Z2GA 1IX9A 4X64O 3CCMV 4PD4F 5LA6B 1Q82W 5KUKA 3CRAA 1T5EA 1G4YB 2EZPA 2P6JA 3RYHB 5K1PA 1SQXH 2WLLB 5IY5B 3SYPA 4PDVA 4TV9B 3LNNA 3NXSA 1I94B 4O4HB 2XAQA 1VF6C 2WLNA 4L87A 1CP9A 5L3EA 2R9IA 1NS1A 3DTUB 1OV9A 1TVKA 2LW1A 5LMNB 3T4DA 2Q0AA 4X1IB 1I0HA 5KHJA 4PA9A 1AR4A 5JQGA 5CA0B 1YZBA 4YJ2B 2K9PA 2WLIA 2GUZB 2EINC 3A0HZ 4F6RB 1ZL8A 3SDLA 5JH7A 5JJJB 4J11A 4DV5B 4B3SO 2ZE5A 4DV7O 4C7UA 2A3QA 3JD4A 4O4LA 3QO5A 4FLWA 3RYIB 1H2GA 3UO2A 1QLEC 1DF5A 2ZKOA 4DV2O 4DR4B 3E89A 3CCJV 1FXHA 4PDLA 4RAIA 3JAWA 3OW2U 5BR8O 4Q6GA 1VQ8V 1GH6A 1XBLA 3QO8A 4JI3O 4ICGA 1Z5WA 2QE7G 4LH6A 2IH1C 2XNDG 5DECA 2YICA 2QM4A 5CBFA 4JV5O 1ZSPA 2ZM6B 3ZRXA 1QVGU 4QIWF 4ZI7B 1MSWD 1O9GA 1VEWA 3T1YO 3L71H 1F51A 3FB5C 2GUZA 4UCVA 1Y76A 2LQTA 1OCZB 3CCLV 1BHBA 3K0GA 3JCZA 1Y74A 3JCUZ 1M90W 3RYIA 5KMGA 1N8RW 3ZHUA 2HP8A 1MMMA 3ZRVA 2ATKC 4JYAO 1YJWV 2Q5ZA 4CH5A 5BMVA 4R50A 3OEEG 1YCIA 4NB5A 5A2QN 4NR1A 3K9SA 5AG2A 3TXSA 2YSUB 1K8AW 4FJCC 4FM2A 1H38A 2ARHA 5CBHA 4IL6Z 3ZJZA 2KKWA 4YY3B 4CS3A 1SESA 1I94O 4DR7O 1SA0A 5IWAO 1M1KW 3QVNA 5JCOC 1FFXA 1LUWA 2E76B 3A8TA 1SQBH 2EILC 2WLLA 5JVDB 5D5PA 2EILB 2PUSA 5B1OA 4CH4A 3WB1A 1N36O 2EIJB 3IC7A 2DN9A 1HNWO 2PF4E 1J95A 3K57A 5FNVB 1KUQA 4MT8A 2EIKC 1ZL8B 1G8MA 4AI8A 4OX9O 1JJ2U 3ZRWB 2BE3A 3RYCA 1GRJA 1E1QG 3ICXA 2YIBD 4O4IB 3ABKB 1JJOA 4ZHQA 1URFA 3CEIA 5A9GA 1XILA 4UFZA 3ZMSA 3DGEA 2EIKB 1ZAUA 1Q7YW 5LXTB 4BIUA 2DWEC 3I56V 2CDYA 3HPLC 3K5NA 4GX1A 5FLXN 2D2CB 3JD2A 4DO2A 2Q4PA 4YJ3A 2GHYA 2Q7HA 2CAZC 4J41A 1S0VA 3JSNA 2B5UA 1YEWA 4MVOA 2NNUA 1BQZA 4DUYO 2FB5A 3SPGA 5LHHA 5B3SB 4UCUA 3L70H 1H2SB 5IWAB 3HKBA 2QKSA 5L3GA 1JA8A 1VQ9V 2JVDA 3FYIB 2YIDA 2FYUH 4NXMO 1Y4MA 2BTOA 2A9HA 3ABLB 2UUCO 4RUEA 4JI8B 5J2TA 4JYBA 4FMTA 3FX7A 4BW9A 3M7MX 2D3OW 4DR6O 2OTJV 1XUQA 2B1GA 3UO3A 5E1AC 5DN6G 2CK3G 4MVUA 1HNXO 1OCZC 1XMQO 4J7KA 5BXZA 3JARB 3AG7A 3JYCA 1NJIW 1X4TA 3RVYA 1NVPC 2YC0A 4HNAA 2EX3A 3L75H 2HVKC 4EFBA 2XUMA 2JS3A 2DYSB 3AK2A 3RYFB 5B1AB 2YEVA 4MTGA 4DR1B 4I9WA 1Q3EA 2LGQA 1FFXB 2Y0IA 1QVFU 3DC6A 1K4DC 3B2EE 1W2BU 2WLMA 4X9QA 1HWYA 4JTAB 4J42A 1PL0A 3E8GA 4HYOA 1RM1C 2Q73A 1Q5OA 1M5IA 4RO2A 2JGUA 4WFFA 4DR7B 1QCEA 1AR5A 3R65A 4O2AA 2ZXWC 3CMAV 3FB6C 4BIZA 1BT8A 1YTFC 1P49A 4HNAB 5H6RA 1NVPD 1AR1B 1SQPH 1PM9A 3E86A 4O4IA 3OD4A 5LL6Y 2YXLA 1J5EO 1ZTEA 2W0FC 1K92A 4X62B 3WU2Z 2G38A 3K79A 4EB6A 5FL7G 3ZHVA 1QU7A 3W7TA 3ZMUA 4DR3O 3LDCA 5IYBO 2Q67A 1R1BA 2E75B 1EZVH 3ZN1A 3AG4B 1S76D 4GX0A 4FLTA 1EBOA 3CRMA 3AG1C 1S3JA 2ZE6A 3I5DA 2AXTZ 3EFFK 1O9HA 3P32A 1LUVA 3KZIZ 1UJWB 4I55B 4KXRA 4HAMA 2UXBO 4DRXB 4DUZB 4PELA 3TETA 1KD1W 2GBOA 2Z5UA 1GN4A 3OTFA 1P4RA 4J80A 4MVMA 4DR2O 4LFCB 3ZRSA 1P7GA 2JS5A 3WFVA 2QDOA 2ADPA 1I08A 4R7CA 3RYHA 2O57A 5F2VO 2P06A 5BMVB 1YF2A 4K3AA 2KG7A 3KKYA 4QE9A 2KQXA 2WWWA 1NU1H 4LF4O 5EYPB 3FFQA 1EM1A 1FD9A 4YHHO 3WB0A 2X6AA 3FB7C 1FPOA 1EN6A 4IHJB 5EZYA 4JI6B 1H2KA 4WCEV 1PNLA 3SPJA 4DV4B 2JEUA 5CA3A 3BEHA 2ZIOA 4IT5A 1VQ4V 4TQDA 4RQFA 5GONB 4PI2A 2QGNA 1L0LH 3C3SA 3J80N 4B3TB 2JK5C 5EK0A 1K33A 3K08A 3UM7A 3K5MA 3P3NA 4E2LA 4YHHB 4DV1B 3K3WA 2HFEC 3IGAC 3FB8C 1YTFD 4I50A 3QF7A 2XASA 1BCCH 5IYCO 1OCRC 1WA8B 3JATB 2KG7B 4OX9B 3ASOC 4EEQA 1H2NA 3OMAB 4FPPA 4MVZA 1AROP 3RFRA 2ZDIA 1FXVA 2ZR2A 4XDKA 5L3BA 2F66C 4K0KB 2ZINA 4GLXA 4LF5O 4DV0O 5KAIZ 4B3RO 4I5SA 2VQFB 4GKKB 2JGDA 2BOBC 3H1KH 3HR0A 3QO7A 3GB7C 2YIAA 1QHTA 4B08A 4LF4B 4R6ZA 2F43G 4O4HA 1TVKB 2K1EA 1S5HC 2QR4A 3SYQA 1QQCA 1SKVA 1KBHA 5KMGB 3CMEV 4P9PA 3A0RA 3BRCA 1R6NA 1U97A 3QTCA 1K73W 3E8FA 2HJDA 4EFEA 3AG4C 1Q81W 4X62O 3BA9A 5BY1A 3O9OA 3ZEDA 4G28B 2M7WA 3G4SV 2CGNA 2WLKA 3JAWB 4QGPA 2NLJC 1S72V 4UV9A 1IBKB 3A2FA 2JGDB 3LUTB 5KA5A 2ZM6O 2KSDA 2ZNJA 1AJQA 3WB2A 5GTIZ 4LF7O 3KCXA 1K97A 1OZ0A 3ZHQA 2ZE8A 1MNGA 4H33A 4ABMA 4WFEA 4DYLA 3RVZA 1N33O 2XAFA 4ZBMA 4X65B 4DV3B 1EFRG 2IBZH 4UVCA 1AJNA 2EIJC 3JASA 1EZJA 2W6IG 5FPOA 1XNQB 1D5AA 1YVWA 4DV1O 4MSWC 4DK1A 2UXBB 3VOUA 2UXDB 3OGCC 1QLEB 3BY6A 5J2UB 3BHPA 2OTLV 3ABUA 2Y48A 4PJ0Z 3K58A 1V54C 3BFRA 1BL8A 3JD1A 3CJHB 1LNQA 2UUBB 1N32O 3OT7A 4I50B 3MAQA 1GM7A 1ZWIC 4JZ2A 3TK1A 2UUAB 3JAKA 5CB4A 5IJ9A 3ML0A 1AP5A 1IVSA 4J7ZA 3RW0A 1FXKC 1F4MA 4XDJA 2XAJA 4ZKIA 3IC9A 1VP7A 3W7XA 3K06A 2YI9A 2QJ1A 1K9MW 3W7WA 3TCUA 5CA0A 1WPBA 2VQFO 2F95B 5LGUA 2YXYA 3ABLC 1YXBA 4F6RA 5LHIA 4KUMA 2RN9A 3QG5A 3LSUA 1VQ7V 5B3SC 3UT5B 1NT2B 5FNVA 1GO3F 2BSKA 2LGWA 2W0XA 4I4TA 3RBZA 4PDRA 4GX2A 4GYCB 4O4JA 3CCEV 3HKEB 2BTQA 1MSDA 3SPHA 5LOVA 1IBMO 3AG2C 2CTWA 5JJEB 1TUBA 1UFIA 1WPXA 3JARA 4DW0A 5LXTA 1HNZB 5BR8B 3TGUH 1OCRB 1VQPV 1PP9H 2EIMB 2QWRB 4NKGB 1S77D 2ZT9B 2YEVB 1AP6A 4GKJB 3JD3A 1X59A 2UXNA 3CRQA 3AG3B 2Q69A 4LF6O 3F7VC 4PA4A 4GKJO 5GONA 3SJCC 1ORQC 4H0LB 4LH7A 1WB7A 2YUAA 1KC8W 2A06H 4OXSA 2PTMA 4FM1A 3OTOO 4F4LA 4I4TB 2Y69B 2ZDIC 2Q9LA 1RPRA 5J2TB 4UCSA 1XMOB 1H8HG 4I0XA 3VBBA 3PJSK 2RNBA 1OCOC 3M99B 2B1IA 4N23A 1M4UA 3N2GB 2AW9A 1PV0A 4BW5A 1E79G 3K59A 1VF7A 3IAYA 4LF6B 5EBWC 4UCOA 2P67A 4X66O 4X1KB 4IYIA 2UU9O 3M8AA 1COWG 1I5YA 4G2KA 3APOA 2CGOA 4X1IA 1QR8A 4LFAO 3B4SA 1QBZA 1Q6UA 1YI2V 4ASUG 5KA6A 3HKDB 4LF9O 3E2EA 4LF8O 4DV0B 2OYQA 1SF9A 2PYJA 1D5NA 1VF6A 3CCUV 3E35A 2AZ0A 1JFFA 1IXMA 4PHZA 1PL4A 2OWOA 5B66Z 3SYAA 5LMUO 1NH2D 3L9DA 1QLNA 4LR3A 2H94A 1GAXA 1YITV 1JOYA 2WLHA 2AHYA 4FLZA 3ZIAG 3UT5A 3RWRD 2DE0X 5IJ9B 2UUBO 1N32B 1YJ9V 3H1HH 3HKEA 1B04A 2AZ2A 1XNRB 4LFBO 1TUBB 4JAVA
chains in the Genus database with same CATH topology
1V54B 1JVMA 4MVRA 4JTCB 5J9PC 1UJWB 4RUFA 1KKDA 4HAMA 2HG5C 3FKSG 4LC1A 4PELA 3TETA 2OCCC 1AI6A 2QM8A 3AG2B 1KD1W 4PA3A 4UVBA 1FS0G 1SZTA 2Z5UA 3STZC 1R73A 2C2AA 1P4RA 4MVMA 5IDJA 3ZRSA 4JF3A 2V1DA 3WFVA 3F7YC 4R7CA 1R6KA 1JX9A 1M56B 3OR7C 1PNMA 1PNKA 1NH2B 4JASA 4QE9A 1K3EA 2DW4A 4UUJC 3T4ZA 4JPRA 2X6BA 2WWWA 3UKMA 1DF4A 2HKOA 3GWOA 1RM1B 3SYCA 1THZA 1AI5A 3CCVV 1NKDA 4YXWG 2EZOA 2W6JG 4MW3A 3ZMZA 3G71V 2Y69C 1MABG 2X6AA 3FB7C 4WF9V 2WLIB 4QPJA 3B8MA 3LSSA 3OAAG 4H37A 4Z1MG 1R3IC 4RQEA 3D36A 1SETA 4WCEV 1PNLA 1YJNV 4JAVA 1R3LC 4PA7A 1NR1A 2OCCB 4BAYA 3SPJA 2X0LA 1ENVA 2JEUA 5CA3A 3T2MA 3BEHA 3W7UA 4UXNA 1PD3A 1VQ4V 4RQFA 2ZD9A 4LP8A 1VQKV 3CCMV 2DYRB 1Q82W 5KUKA 1G4YB 2EZPA 2P6JA 2IJHA 2JK5C 2QTOA 1VQOV 5EK0A 1K33A 3K08A 3UM7A 3CCQV 1VQNV 4TSFG 2WLLB 5IY5B 3SYPA 4PDVA 4E2LA 3NXSA 5L3CA 3OE7G 2XAQA 3K3WA 2HFEC 2OT5A 3IGAC 1R3KC 2WLNA 3FB8C 4L87A 1YTFD 2WSSG 1CP9A 5L3EA 2R9IA 2KB1A 3CP1A 4JGSA 1GKFA 2XASA 2JJ2G 3DTUB 5IYCO 1OCRC 5LGTA 3E8BA 3T4DA 2IU0A 3OM3B 5DM6V 3ASOC 1SRYA 3ABKC 1ROPA 2ZR3A 3P30A 3OMAB 4FPPA 3OEHG 1H8EG 4PA9A 4MVZA 1AROP 3ZMTA 2ZDIA 1FXVA 2ZR2A 4XDKA 5L3BA 2WLIA 5HFLA 1F23A 2EINC 5IYDO 3CCRV 3ASNC 4R8CA 3G6EV 2R9RB 1NH2C 1OCCC 1GM8A 2LFRA 4WFHA 3JD4A 4I5SA 3QO5A 3OFNG 5EBLC 5H9CA 1H2GA 4JYCA 1YHQV 2BOBC 1NBMG 1QLEC 1DF5A 5IY5C 2DQ3A 3QO7A 3ZCCA 3GB7C 3E89A 3CCJV 1FXHA 3JD0A 4PDLA 4RAIA 1FXKA 4R6ZA 2F43G 2K1EA 1DLBA 3LDEA 2HR3A 1S5HC 2P7TC 3OW2U 4GCZA 3SYQA 5CN0A 2ZXWB 3CMEV 4P9PA 1YTFB 3KG2A 1VQ8V 2DWDC 3A0RA 3MHSC 1Q86W 1R6NA 3QO8A 4KP4A 1K73W 2WAMA 3E8FA 2QE7G 5EC1C 1V55C 3AG4C 1Q81W 2IH1C 2XNDG 4FK5C 5L3FA 2PI4A 2XOKG 1NR7A 4G28B 5CBFA 1VQMV 2IU3A 3ZRXA 4PDMA 1QVGU 2M7WA 3ASNB 4QIWF 4DXWA 3G4SV 1MSWD 5BZBA 3STLC 2WLKA 3IFXA 4P30A 1F51A 3FB5C 2NLJC 1S72V 4UV9A 1K5SA 3B8NA 3LUTB 5KA5A 4MTFA 1OCZB 1NQTA 3CCLV 4LBEC 5EC2C 1AJQA 1BHBA 3K0GA 1K97A 3ABTA 3JCZA 1SERA 1OZ0A 2Z3YA 4CZZA 1M90W 2DQ0A 4G27B 2IJIA 3CC7V 4H33A 1KP2A 1NVPB 1N8RW 4WFEA 4XBFA 3RVZA 4MVQA 3ZRVA 3T1CA 2ATKC 2XAFA 4ZBMA 1YJWV 1YIJV 3K9AA 3F5WC 3FYEB 1EFRG 4MTXA 3MHHC 4UVCA 1AJNA 2EIJC 4R50A 3OEEG 3WG7C 1P7BA 3CPWU 3SJQC 1EZJA 2W6IG 1M57C 2YSUB 2V7QG 4FJCC 1K8AW 1RPOA 3HB3B 1H38A 3OUSA 5CBHA 3ZJZA 3ZMVA 2JEXA 1SESA 2IW5A 1MG1A 4MSWC 3D3IA 3VOUA 1M1KW 3OR6C 5HFMA 3OGCC 1QLEB 3BY6A 5B1NA 1E1RG 3E83A 2OTLV 2EIMC 3ABUA 2Y48A 3ETEA 2QA4V 2EILC 2WLLA 2ITCC 1V54C 1BL8A 2EILB 3JD1A 4WFGA 5B1OA 1V55B 1BHAA 4U7OA 2DYRC 1LNQA 1VQLV 1W0JG 3MD0A 3ABMC 3SPCA 2BOCC 2EIJB 1GM7A 2JJ1G 3IC7A 1XL4A 1ZWIC 3SYOA 1J95A 1M9NA 3TK1A 1MOFA 1KQSU 4MS2A 5LGNA 4MT8A 1OHHG 3CXCU 2EIKC 1GK9A 3ML0A 2ITDC 1G8MA 2LP7A 4LCUC 3B77A 1GM9A 1JJ2U 2MK3A 3ZRWB 3RW0A 5CMUA 1FXKC 1F4MA 1W0KG 4XDJA 4XDLA 2LFSA 2WPDG 5B1BB 2XAJA 1E1QG 4ZKIA 5EBMC 3AG1B 3W7XA 3K06A 2X6CA 5KUMA 3ABKB 1K9MW 3W7WA 2IJJA 4X88A 4P2ZA 3TCUA 3ZMSA 3DGEA 3K04A 5LGUA 5GW7A 3ABLC 2EIKB 1Q7YW 3QNEA 5LBQA 4BIUA 4J9YB 2DWEC 3I56V 4JTDB 5LHIA 4KUMA 4QE7A 2AHZA 4JAUA 3K03A 3HPLC 4MTOA 5B1BC 4GX1A 1I5XA 1VQ7V 3JD2A 5B3SC 2HLDG 4DO2A 1GO3F 3W7SA 2GHYA 1S0VA 2B5UA 5H6QA 1Y66A 4MVOA 1WLEA 1B6QA 3RBZA 4QJFB 2NNUA 4GX2A 2ZQMA 4PDRA 3CCEV 3WG7B 3SPHA 1FFTB 3ZRWA 3SPGA 1YSCA 3AG2C 5LHHA 3ETDA 5B3SB 2A0LA 2QM7A 1AI4A 4WFAV 2QKSA 1WPXA 5L3GA 4X89A 1VQ9V 4U7NA 3FYIB 4GT1A 1Y4MA 5LHGA 2A9HA 3ABLB 1OCRB 4RUEA 1VQPV 2EIMB 1PKXA 4KFMA 4Q20A 2EBOA 1L1FA 4JYBA 4FMTA 1JQ0A 1S77D 2PI5A 4UVAA 2D3OW 1OCOB 2YEVB 3X2QC 3JD3A 2OTJV 1JCHA 4EKWA 3ABMB 1K5QA 2B1GA 5E1AC 5DN6G 2CK3G 3AG3C 2A79B 4MVUA 2WLJA 2UXNA 1OCZC 3AG3B 2P90A 3LSQA 2Q69A 3F7VC 4PA4A 2XAHA 5C93A 3JYCA 1ORQC 1NJIW 3RVYA 1XL6A 1KC8W 1F4NA 2X7RB 4OXSA 1NVPC 1TUEB 4F4LA 1AI7A 2HVKC 2UXXA 2Y69B 2ZDIC 2JDIG 4TWKA 1RPRA 2DYSB 1H8HG 4X8AA 3VBBA 4MW8A 3PJSK 1CPYA 5L3DA 1AJPA 5B1AB 2YEVA 4MTGA 2QEXV 1OCOC 4I9WA 3M99B 2HVJC 1K7DA 2B1IA 2EINB 4N23A 1JPXA 1QVFU 1K4DC 4BW5A 1W2BU 4QPKA 1E79G 2WLMA 3CC4V 1FXKB 1OCCB 1HWYA 4JTAB 4UV8A 4QNHB 5EBWC 1M57B 1PL0A 3E8GA 1VQ5V 2P67A 4HYOA 2DYSC 3X2QB 3ETGA 1RM1C 2XAGA 4PA6A 1KECA 4RO2A 1COWG 4WFFA 1I5YA 3CYOA 3E8HA 4G2KA 1QCEA 3R65A 3ZN0A 1QR8A 4WFBV 3SPIA 2ZXWC 3OMIB 1QBZA 1QR9A 3CMAV 3FB6C 4MVSA 4BIZA 1YI2V 4ASUG 5KA6A 1YTFC 5H6RA 3E2EA 1NVPD 3K0DA 2IJKA 1AR1B 3E86A 3CCUV 1K34A 3E35A 2HJFC 4N21A 2W0FC 2JIZG 1K92A 1IXMA 2Q68A 1GTOA 3K79A 3EHBB 3SYAA 4TT3G 5FL7G 2FTKA 3LDDA 4P9OA 1R3JC 3W7TA 3ZMUA 1NH2D 1QLNA 2H94A 3LDCA 1K4CC 1YITV 3H01A 3CC2V 2WLHA 5IYBO 1JOYA 2Q67A 1BMFG 3I55V 5CBGA 4GX5A 3CD6V 2AHYA 2GSMB 3ZN1A 4CBCA 3AG4B 1S76D 4GX0A 3ZIAG 2H8PC 3LNMB 1EBOA 1GMGA 1CEZA 3AG1C 1S3JA 4HZ3A 4J9ZB 1VQ6V 3AEIA 2Q6AA 4FIPC 2EJRA 1YJ9V 1DTOA 2IH3C 5B1AC 1M56C 3CCSV 3ASOB 3OUFA 3EFFK 3OMNB 1KP3A 3P32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W7U A;  3W7T A;  1NH2 D;  2P90 A;  3W7X A;  2WAM A;  5IYB O;  3W7S A;  4HAM A;  5IYC O;  1RM1 B;  3IC7 A;  3W7W A;  1YTF C;  1NVP C;  1NVP D;  1NVP B;  5GW7 A;  1S3J A;  3D3I A;  2HR3 A;  5IYD O;  3E35 A;  1RM1 C;  3BY6 A;  1NH2 C;  1YTF B;  1NH2 B;  1YTF D;  5CA3 A; 
#chains in the Genus database with same CATH topology
 4FFK A;  4MVR A;  2GTA A;  1B3Q A;  4RUF A;  1KKD A;  3P3P A;  1SQV H;  4LC1 A;  4LF5 B;  4PV1 B;  4U3F H;  1SZT A;  5KX5 A;  5IDJ A;  5CA1 A;  1VMG A;  1B06 A;  4NTW A;  3CWB H;  1NTK H;  5K1X A;  2VWJ A;  4GUN A;  3T4Z A;  1K3E A;  2FKX A;  1Y76 B;  3OTO B;  1DF4 A;  1KYO F;  3GWO A;  3SYC A;  1AI5 A;  4U3J A;  4AIL C;  2EZO A;  2W6J G;  1IDS A;  2P4K A;  3ZMZ A;  4JI5 B;  4QPJ A;  3OAA G;  2DMX A;  4LWS A;  2AGA A;  4RQE A;  1IBL B;  4FZ0 A;  4DR5 O;  2FL4 A;  2GTS A;  1R3L C;  5JH7 B;  2E5L O;  2OCC B;  1ENV A;  2YIB A;  4UB6 Z;  3H1L H;  4UXN A;  1PD3 A;  3GVM A;  4IIJ B;  4J10 A;  2ZD9 A;  1WP7 A;  1VQK V;  5EIB C;  4ZHQ B;  5KHH A;  2E3C A;  2IJH A;  1VQO V;  5CA1 B;  1SA0 B;  3BVO A;  1TAE A;  2Y0P A;  5FPR A;  4X1K A;  2OT5 A;  1R3K C;  2P4V A;  4FLV A;  3CP1 A;  2JJ2 G;  2ZNI A;  2N74 A;  4B3T O;  3RT3 C;  4DR3 B;  1Q6H A;  3E8B A;  2IU0 A;  3OM3 B;  1S5J A;  1SRY A;  3ABK C;  1ROP A;  3P30 A;  1FYJ A;  2QSA A;  1WN7 A;  1H8E G;  3OEH G;  3ZMT A;  5HFL A;  5IYD O;  1F23 A;  3ZBH A;  3ASN C;  3IJ4 A;  3SR2 C;  3G6E V;  1XNQ O;  1NH2 C;  4LF9 B;  4CH6 A;  1OCC C;  1NZ6 A;  2LFR A;  4IIJ A;  3JAL B;  3BAA A;  3FAV B;  5H9C A;  4JYC A;  2E74 B;  1YHQ V;  3ZHR A;  5EIB D;  1Q8I A;  4TUY A;  3J7A U;  4TQF A;  1BZK A;  4GCZ A;  5LP6 B;  5CN0 A;  4K8Z A;  2ZXW B;  2WA3 A;  3ZHS A;  3FD9 A;  3KG2 A;  2CTQ A;  4JZG A;  2DWD C;  4CS4 A;  3MHS C;  1Q86 W;  2WAM A;  4UCT A;  3CS5 A;  4JI3 B;  1RP3 B;  1J5E B;  4ZOL B;  4DV5 O;  4B3S B;  2XOK G;  4PDM A;  5JVD A;  3ASN B;  4DXW A;  2YDE A;  3STL C;  4P30 A;  4BIO A;  1BE3 H;  3T1Y B;  3B8N A;  3BPZ A;  4MTF A;  1NQT A;  4LBE C;  4JAA A;  3ABT A;  2Z3Y A;  4O4L B;  2DQ0 A;  2QWO B;  1KP2 A;  1NVP B;  4LWS B;  3U10 A;  1YIJ V;  1M93 A;  3K9A A;  2YS8 A;  3F5W C;  3FYE B;  3MHH C;  5KHI A;  1AIL A;  1P7B A;  3SJQ C;  1M57 C;  3JSL A;  2RDC A;  3JAK B;  5CB4 B;  2V7Q G;  1RPO A;  1GN6 A;  2UUA O;  3ZMV A;  2JEX A;  2H3O A;  2IW5 A;  2VWK A;  1AVM A;  5HFM A;  5B1N A;  3E83 A;  3ZS8 C;  2EIM C;  4DUY B;  3C90 A;  3ETE A;  4LNU A;  4RWU A;  4NVP A;  2CTR A;  1W0J G;  3MD0 A;  4I7Z B;  3ABM C;  2BOC C;  3SYO A;  1XL4 A;  2WA4 A;  4CH3 A;  3SJA C;  4JI2 O;  2ODM A;  2PZS A;  4MS2 A;  4KHP B;  5LGN A;  2ITD C;  2LP7 A;  4NXM B;  5IJ0 A;  4GZR B;  5CMU A;  3HKB B;  4F6E A;  2DJV A;  1W0K G;  2LFS A;  2ZIM A;  2Y4T A;  5EBM C;  4KHP O;  3DXR A;  1SQG A;  2X6C A;  5LYJ B;  2E5L B;  3L72 H;  4X88 A;  1DK1 A;  4D7T A;  1I7F A;  2UXC B;  3K04 A;  5GW7 A;  2RMK B;  3CSX A;  3D36 C;  4B3R B;  1FKA O;  3DC5 A;  1N0J A;  2ZE7 A;  4JTD B;  4JAU A;  4DR6 B;  1HNW B;  1I5X A;  4JI6 O;  1AB3 A;  4Z1V A;  2HLD G;  2ZQM A;  1IXB A;  3WG7 B;  5KLV H;  1FFT B;  4JI5 O;  1YSC A;  3ETD A;  1H2M A;  5GTH Z;  4IHJ A;  4H13 B;  2PYL A;  4WFA V;  1LR1 A;  1XHX A;  4ZIB A;  1GN2 A;  1YDX A;  2OIG A;  3SJB C;  5LHG A;  3CB2 A;  2PY5 A;  1ZLZ A;  2QKA A;  4NYK A;  4BWA A;  4Q20 A;  2EBO A;  1L1F A;  3BA8 A;  1JQ0 A;  4NXN O;  1WJZ A;  1OCO B;  1XEQ A;  1JCH A;  4O4J B;  4EKW A;  1K5Q A;  2A79 B;  2WLJ A;  3LSQ A;  1XHZ A;  3A0B Z;  5LOV B;  3N2K A;  5C93 A;  1SQF A;  1F4N A;  4X65 O;  2R9A A;  3HKC A;  4O2B A;  4YJ3 B;  2CH7 B;  1TUE B;  3L74 H;  2CUG A;  2JDI G;  1EN4 A;  1N4C A;  4JI7 B;  4LNU B;  5L3D A;  2ETN A;  3JAM N;  2QEX V;  2XHB A;  1K7D A;  1S5L Z;  4OPA A;  1XQ8 A;  4IYH A;  4QPK A;  3CRR A;  3CC4 V;  1FXK B;  1WP8 A;  1JFF B;  2EUL A;  4FVM A;  4UV8 A;  4QNH B;  3E22 A;  5KAF Z;  1HNX B;  1BS3 A;  2DYS C;  3ETG A;  2XAG A;  4PA6 A;  3D8C A;  3S3X A;  3RYC B;  4FZ1 A;  4NTY A;  3E8H A;  4DR5 B;  3JAL A;  3ZN0 A;  4WFB V;  1Q43 A;  3OMI B;  4JI7 O;  3D3Q A;  3H1I H;  3B09 A;  3K0D A;  2IJK A;  1NTM H;  3CHX A;  2QTS A;  1N0N A;  3APQ A;  1RFY A;  1K34 A;  2HJF C;  4N21 A;  2ZCE A;  4O2B B;  5KX5 B;  2Q68 A;  3EHB B;  4TOI A;  3ZHT A;  3N2G A;  4TT3 G;  2FTK A;  3LDD A;  4P9O A;  1XMO O;  1R3J C;  3H01 A;  1HNZ O;  1BMF G;  3I55 V;  2R72 A;  4I9Q A;  5IYZ B;  5KHK A;  1TA8 A;  3LNM B;  1GMG A;  3VQV A;  1XI1 A;  1CEZ A;  3AEI A;  2EJR A;  4X1Y B;  2Q7E A;  2IH3 C;  5B1A C;  1M56 C;  3JAS B;  3OUF A;  3K5O A;  1KP3 A;  1US6 A;  1JVM A;  2HG5 C;  3SGI A;  3FKS G;  2OCC C;  3VQW A;  1Y74 B;  2N04 A;  4PA3 A;  1FS0 G;  4Z2W A;  1HR0 B;  1R73 A;  2C2A A;  4X20 A;  1DGS A;  4B7E A;  2V1D A;  4LFC O;  1R6K A;  1M56 B;  2RQ6 A;  1PNM A;  4JAS A;  1Y6X A;  4UUJ C;  4JPR A;  3N2K B;  3ZX6 A;  1ZUQ A;  2HKO A;  3C3T A;  4B3M B;  1VAR A;  4JI2 B;  1THZ A;  3BCC H;  1XRE A;  4JI4 B;  1NKD A;  3AK1 A;  4YXW G;  4MW3 A;  4FLX A;  1MAB G;  4WF9 V;  2YXH A;  4DV7 B;  3B8M A;  3LSS A;  4H37 A;  4Z1M G;  5IYZ A;  1R3I C;  1SET A;  1YJN V;  4YY3 O;  2JRI A;  4PA7 A;  3J81 N;  2UXD O;  1G6U A;  1NR1 A;  1FJG O;  4X1Y A;  4DUZ O;  4NXN B;  2P22 C;  2Q0O C;  2DYR B;  4D7S A;  2HHH B;  1BSM A;  2QWP B;  2QTO A;  4AQY B;  3CCQ V;  4B3M O;  1VQN V;  4TSF G;  2Y4U A;  1HP8 A;  3G67 A;  1UPG A;  5L3C A;  3OE7 G;  3E22 B;  3CX5 F;  2WSS G;  1Q90 D;  5LP6 A;  1RSO A;  2XTA A;  2KB1 A;  4JGS A;  4AQY O;  1GKF A;  1Q6I A;  1IUR A;  4NTX A;  3CXH F;  5LGT A;  5JJN B;  5DM6 V;  1OJH A;  4TV8 B;  2ZR3 A;  5IT9 N;  5B5E Z;  4DV2 B;  3BAB A;  5EYP A;  4JI0 B;  3CCR V;  4R8C A;  5H2F Z;  2ILM A;  2N05 A;  4ZOL A;  2R9R B;  4EB6 B;  1GM8 A;  3THO A;  4WFH A;  5LA6 A;  1N34 O;  4PI0 A;  2RCV A;  3OFN G;  5EBL C;  3UCS C;  4JI0 O;  1GN3 A;  2EJ7 A;  1NBM G;  5IY5 C;  2DQ3 A;  3ZCC A;  4CC6 A;  4TV9 A;  3JD0 A;  4AHC A;  1FXK A;  4X66 B;  3RGB A;  1DLB A;  3LDE A;  4FLY A;  2HR3 A;  2P7T C;  4DW1 A;  5JQG B;  1YTF B;  2BSK B;  2OCH A;  4DV3 O;  4KP4 A;  4A5U B;  4K35 A;  5EC1 C;  1V55 C;  1G1X B;  1XMQ B;  2HHH O;  4FK5 C;  5L3F A;  2PI4 A;  1NR7 A;  3R66 A;  1JMK C;  2M6Y A;  2CTP A;  1VQM V;  2IU3 A;  5BZB A;  1IBK O;  3IFX A;  4WBN B;  2L6L A;  1K5S A;  4TUY B;  2UU9 B;  4YIO A;  5EC2 C;  1BGY H;  1SER A;  4CZZ A;  4G27 B;  2F4V B;  2IJI A;  3OGI B;  3CC7 V;  2CH7 A;  4XBF A;  4MVQ A;  3T1C A;  1L8D A;  2VQE B;  4UCR A;  4MTX A;  1VIB A;  2BCC H;  3RYF A;  3WG7 C;  3CPW U;  5LMN O;  4D6T H;  5KHG A;  1N34 B;  1MZF A;  4CC5 A;  2OIE A;  1SC5 B;  2NR5 A;  3HB3 B;  3OUS A;  1MG1 A;  1N36 B;  1W59 A;  3D3I A;  1Y67 A;  3OR6 C;  4K8X A;  4DR4 O;  4BR6 A;  1E1R G;  4JI4 O;  2QA4 V;  4YIP A;  2GV9 A;  2ITC C;  1RSO B;  5JCO A;  2P5O A;  4WFG A;  2BTQ B;  1V55 B;  1BHA A;  4U7O A;  2DYR C;  1VQL V;  4WBN A;  3F5T A;  2PGG A;  3SPC A;  2JJ1 G;  5IE9 A;  3NR7 A;  4JI1 O;  1SQQ H;  1FJG B;  5TIS Z;  1M9N A;  5D5Q A;  1MOF A;  1KQS U;  1OHH G;  3JAT A;  3CXC U;  1GK9 A;  4LCU C;  1EN5 A;  3B77 A;  1GM9 A;  2QKC A;  2MK3 A;  5EZY B;  2WPD G;  5B1B B;  1HW7 A;  3AG1 B;  1SS3 A;  3B40 A;  5KUM A;  3N27 A;  2IJJ A;  2XT9 A;  4B7K A;  4P2Z A;  1BQ0 A;  1FAF A;  4KL1 A;  3Q4H A;  3QNE A;  5LBQ A;  4J9Y B;  4DR2 B;  4QE7 A;  2AHZ A;  3K03 A;  4MTO A;  2B9Z A;  5B1B C;  4UB8 Z;  1IBL O;  2MW2 B;  3GWK C;  1WNS A;  4L8J A;  3W7S A;  2CE4 A;  4U3J B;  2UXC O;  3H9V A;  5H6Q A;  1Y66 A;  3KCY A;  1WLE A;  1B6Q A;  4QJF B;  1F7Y A;  5ITZ A;  1R6T A;  2F1M A;  3ZRW A;  2A0L A;  2QM7 A;  1AI4 A;  4X89 A;  4LF8 B;  5LYJ A;  4U7N A;  2R70 A;  2F93 B;  3S3W A;  4DK0 A;  4GT1 A;  2F4V O;  4J7J A;  1PKX A;  4KFM A;  4FM0 A;  1U96 A;  2V4D A;  3AK3 A;  4OPH A;  2PI5 A;  4UVA A;  4FFB A;  3X2Q C;  4CS2 A;  3ABM B;  3MDS A;  3EVK A;  3AG3 C;  5C8Y A;  1CXZ B;  1VF5 B;  2P90 A;  3EXA A;  2XAH A;  2VQE O;  3U0Z A;  1XL6 A;  1XOU A;  2X7R B;  4O2A B;  3L73 H;  1N33 B;  1AI7 A;  2UXX A;  4TWK A;  5LP6 C;  3DSQ A;  5ITZ B;  1KKC A;  4X8A A;  2IM9 A;  4MW8 A;  2QWN B;  1CPY A;  3T1H O;  1AJP A;  2L35 A;  1KU9 A;  3ETQ A;  1PPJ H;  3PN1 A;  2F23 A;  5J2U A;  3FAV A;  2HVJ C;  4FLU A;  2EIN B;  1SZX A;  1JPX A;  4JYY A;  1ZX3 A;  1P84 F;  1WA8 A;  3T1H B;  4TV8 A;  2ADQ B;  2VS0 A;  1OCC B;  2FML A;  2Q7G A;  2NN4 A;  4GKK O;  1KB9 F;  1M57 B;  3TJT A;  2DOS A;  1VQ5 V;  1H2L A;  2VRZ A;  3X2Q B;  3HKC B;  4LF7 B;  3CE2 A;  5C8Y B;  1KEC A;  1XDC A;  4IGG A;  3CYO A;  4K0K O;  2HEP A;  3H1J H;  3UQ8 A;  1KMI Z;  4JV5 B;  1JR9 A;  3SPI A;  1QR9 A;  4MVS A;  2RJZ A;  1IZ3 A;  4OGQ B;  2A7W A;  4I55 A;  5JWP A;  3Q4H B;  1WB8 A;  3O65 A;  5IJ0 B;  1WAZ A;  4W4K A;  2JIZ G;  2LO1 A;  4DR1 O;  1GTO A;  1IBM B;  3VQX A;  2GDS A;  4I0X B;  1K4C C;  4X64 B;  3CC2 V;  3CJH A;  3K5L A;  4H44 B;  5CBG A;  4GX5 A;  3CD6 V;  2GSM B;  1HR0 O;  3RN4 A;  4CBC A;  2H8P C;  3VQY A;  4HZ3 A;  1HDJ A;  4J9Z B;  1VQ6 V;  2Q6A A;  4FIP C;  1DTO A;  3CCS V;  3ASO B;  3OMN B;  4E4E A;  4XDL A;  1V54 B;  1MZE A;  4JTC B;  5J9P C;  1NTZ H;  1L0N H;  1Z5V A;  3HKD A;  1V9P A;  1AI6 A;  2QM8 A;  3AG2 B;  4ZI7 A;  4HBN A;  4UVB A;  3STZ C;  2UUC B;  4JI8 O;  2LJ2 A;  4FFB B;  3CRC A;  4JF3 A;  1A32 A;  3F7Y C;  2Z0A A;  1MA1 A;  5H5N A;  1JX9 A;  5LMU B;  3OR7 C;  3U11 A;  3G80 A;  1PNK A;  5DED A;  4DV6 B;  1NH2 B;  5E79 Z;  2DW4 A;  1QNM A;  2X6B A;  3UKM A;  4JYA B;  1D2D A;  4DV4 O;  2QWQ B;  1RM1 B;  4JI1 B;  4YJ2 A;  1NI8 A;  4W4L A;  4DV6 O;  3CCV V;  3G6B A;  1XNR O;  4LFB B;  3G71 V;  2Y69 C;  2WLI B;  2LW7 A;  4LFA B;  3D36 A;  4X20 B;  2Q8V A;  3TXQ A;  4BAY A;  2X0L A;  4DRX A;  1TGO A;  3T2M A;  3W7U A;  2YI8 A;  3DXR B;  4LP8 A;  1Z2G A;  1IX9 A;  4X64 O;  3CCM V;  4PD4 F;  5LA6 B;  1Q82 W;  5KUK A;  3CRA A;  1T5E A;  1G4Y B;  2EZP A;  2P6J A;  3RYH B;  5K1P A;  1SQX H;  2WLL B;  5IY5 B;  3SYP A;  4PDV A;  4TV9 B;  3LNN A;  3NXS A;  1I94 B;  4O4H B;  2XAQ A;  1VF6 C;  2WLN A;  4L87 A;  1CP9 A;  5L3E A;  2R9I A;  1NS1 A;  3DTU B;  1OV9 A;  1TVK A;  2LW1 A;  5LMN B;  3T4D A;  2Q0A A;  4X1I B;  1I0H A;  5KHJ A;  4PA9 A;  1AR4 A;  5JQG A;  5CA0 B;  1YZB A;  4YJ2 B;  2K9P A;  2WLI A;  2GUZ B;  2EIN C;  3A0H Z;  4F6R B;  1ZL8 A;  3SDL A;  5JH7 A;  5JJJ B;  4J11 A;  4DV5 B;  4B3S O;  2ZE5 A;  4DV7 O;  4C7U A;  2A3Q A;  3JD4 A;  4O4L A;  3QO5 A;  4FLW A;  3RYI B;  1H2G A;  3UO2 A;  1QLE C;  1DF5 A;  2ZKO A;  4DV2 O;  4DR4 B;  3E89 A;  3CCJ V;  1FXH A;  4PDL A;  4RAI A;  3JAW A;  3OW2 U;  5BR8 O;  4Q6G A;  1VQ8 V;  1GH6 A;  1XBL A;  3QO8 A;  4JI3 O;  4ICG A;  1Z5W A;  2QE7 G;  4LH6 A;  2IH1 C;  2XND G;  5DEC A;  2YIC A;  2QM4 A;  5CBF A;  4JV5 O;  1ZSP A;  2ZM6 B;  3ZRX A;  1QVG U;  4QIW F;  4ZI7 B;  1MSW D;  1O9G A;  1VEW A;  3T1Y O;  3L71 H;  1F51 A;  3FB5 C;  2GUZ A;  4UCV A;  1Y76 A;  2LQT A;  1OCZ B;  3CCL V;  1BHB A;  3K0G A;  3JCZ A;  1Y74 A;  3JCU Z;  1M90 W;  3RYI A;  5KMG A;  1N8R W;  3ZHU A;  2HP8 A;  1MMM A;  3ZRV A;  2ATK C;  4JYA O;  1YJW V;  2Q5Z A;  4CH5 A;  5BMV A;  4R50 A;  3OEE G;  1YCI A;  4NB5 A;  5A2Q N;  4NR1 A;  3K9S A;  5AG2 A;  3TXS A;  2YSU B;  1K8A W;  4FJC C;  4FM2 A;  1H38 A;  2ARH A;  5CBH A;  4IL6 Z;  3ZJZ A;  2KKW A;  4YY3 B;  4CS3 A;  1SES A;  1I94 O;  4DR7 O;  1SA0 A;  5IWA O;  1M1K W;  3QVN A;  5JCO C;  1FFX A;  1LUW A;  2E76 B;  3A8T A;  1SQB H;  2EIL C;  2WLL A;  5JVD B;  5D5P A;  2EIL B;  2PUS A;  5B1O A;  4CH4 A;  3WB1 A;  1N36 O;  2EIJ B;  3IC7 A;  2DN9 A;  1HNW O;  2PF4 E;  1J95 A;  3K57 A;  5FNV B;  1KUQ A;  4MT8 A;  2EIK C;  1ZL8 B;  1G8M A;  4AI8 A;  4OX9 O;  1JJ2 U;  3ZRW B;  2BE3 A;  3RYC A;  1GRJ A;  1E1Q G;  3ICX A;  2YIB D;  4O4I B;  3ABK B;  1JJO A;  4ZHQ A;  1URF A;  3CEI A;  5A9G A;  1XIL A;  4UFZ A;  3ZMS A;  3DGE A;  2EIK B;  1ZAU A;  1Q7Y W;  5LXT B;  4BIU A;  2DWE C;  3I56 V;  2CDY A;  3HPL C;  3K5N A;  4GX1 A;  5FLX N;  2D2C B;  3JD2 A;  4DO2 A;  2Q4P A;  4YJ3 A;  2GHY A;  2Q7H A;  2CAZ C;  4J41 A;  1S0V A;  3JSN A;  2B5U A;  1YEW A;  4MVO A;  2NNU A;  1BQZ A;  4DUY O;  2FB5 A;  3SPG A;  5LHH A;  5B3S B;  4UCU A;  3L70 H;  1H2S B;  5IWA B;  3HKB A;  2QKS A;  5L3G A;  1JA8 A;  1VQ9 V;  2JVD A;  3FYI B;  2YID A;  2FYU H;  4NXM O;  1Y4M A;  2BTO A;  2A9H A;  3ABL B;  2UUC O;  4RUE A;  4JI8 B;  5J2T A;  4JYB A;  4FMT A;  3FX7 A;  4BW9 A;  3M7M X;  2D3O W;  4DR6 O;  2OTJ V;  1XUQ A;  2B1G A;  3UO3 A;  5E1A C;  5DN6 G;  2CK3 G;  4MVU A;  1HNX O;  1OCZ C;  1XMQ O;  4J7K A;  5BXZ A;  3JAR B;  3AG7 A;  3JYC A;  1NJI W;  1X4T A;  3RVY A;  1NVP C;  2YC0 A;  4HNA A;  2EX3 A;  3L75 H;  2HVK C;  4EFB A;  2XUM A;  2JS3 A;  2DYS B;  3AK2 A;  3RYF B;  5B1A B;  2YEV A;  4MTG A;  4DR1 B;  4I9W A;  1Q3E A;  2LGQ A;  1FFX B;  2Y0I A;  1QVF U;  3DC6 A;  1K4D C;  3B2E E;  1W2B U;  2WLM A;  4X9Q A;  1HWY A;  4JTA B;  4J42 A;  1PL0 A;  3E8G A;  4HYO A;  1RM1 C;  2Q73 A;  1Q5O A;  1M5I A;  4RO2 A;  2JGU A;  4WFF A;  4DR7 B;  1QCE A;  1AR5 A;  3R65 A;  4O2A A;  2ZXW C;  3CMA V;  3FB6 C;  4BIZ A;  1BT8 A;  1YTF C;  1P49 A;  4HNA B;  5H6R A;  1NVP D;  1AR1 B;  1SQP H;  1PM9 A;  3E86 A;  4O4I A;  3OD4 A;  5LL6 Y;  2YXL A;  1J5E O;  1ZTE A;  2W0F C;  1K92 A;  4X62 B;  3WU2 Z;  2G38 A;  3K79 A;  4EB6 A;  5FL7 G;  3ZHV A;  1QU7 A;  3W7T A;  3ZMU A;  4DR3 O;  3LDC A;  5IYB O;  2Q67 A;  1R1B A;  2E75 B;  1EZV H;  3ZN1 A;  3AG4 B;  1S76 D;  4GX0 A;  4FLT A;  1EBO A;  3CRM A;  3AG1 C;  1S3J A;  2ZE6 A;  3I5D A;  2AXT Z;  3EFF K;  1O9H A;  3P32 A;  1LUV A;  3KZI Z;  1UJW B;  4I55 B;  4KXR A;  4HAM A;  2UXB O;  4DRX B;  4DUZ B;  4PEL A;  3TET A;  1KD1 W;  2GBO A;  2Z5U A;  1GN4 A;  3OTF A;  1P4R A;  4J80 A;  4MVM A;  4DR2 O;  4LFC B;  3ZRS A;  1P7G A;  2JS5 A;  3WFV A;  2QDO A;  2ADP A;  1I08 A;  4R7C A;  3RYH A;  2O57 A;  5F2V O;  2P06 A;  5BMV B;  1YF2 A;  4K3A A;  2KG7 A;  3KKY A;  4QE9 A;  2KQX A;  2WWW A;  1NU1 H;  4LF4 O;  5EYP B;  3FFQ A;  1EM1 A;  1FD9 A;  4YHH O;  3WB0 A;  2X6A A;  3FB7 C;  1FPO A;  1EN6 A;  4IHJ B;  5EZY A;  4JI6 B;  1H2K A;  4WCE V;  1PNL A;  3SPJ A;  4DV4 B;  2JEU A;  5CA3 A;  3BEH A;  2ZIO A;  4IT5 A;  1VQ4 V;  4TQD A;  4RQF A;  5GON B;  4PI2 A;  2QGN A;  1L0L H;  3C3S A;  3J80 N;  4B3T B;  2JK5 C;  5EK0 A;  1K33 A;  3K08 A;  3UM7 A;  3K5M A;  3P3N A;  4E2L A;  4YHH B;  4DV1 B;  3K3W A;  2HFE C;  3IGA C;  3FB8 C;  1YTF D;  4I50 A;  3QF7 A;  2XAS A;  1BCC H;  5IYC O;  1OCR C;  1WA8 B;  3JAT B;  2KG7 B;  4OX9 B;  3ASO C;  4EEQ A;  1H2N A;  3OMA B;  4FPP A;  4MVZ A;  1ARO P;  3RFR A;  2ZDI A;  1FXV A;  2ZR2 A;  4XDK A;  5L3B A;  2F66 C;  4K0K B;  2ZIN A;  4GLX A;  4LF5 O;  4DV0 O;  5KAI Z;  4B3R O;  4I5S A;  2VQF B;  4GKK B;  2JGD A;  2BOB C;  3H1K H;  3HR0 A;  3QO7 A;  3GB7 C;  2YIA A;  1QHT A;  4B08 A;  4LF4 B;  4R6Z A;  2F43 G;  4O4H A;  1TVK B;  2K1E A;  1S5H C;  2QR4 A;  3SYQ A;  1QQC A;  1SKV A;  1KBH A;  5KMG B;  3CME V;  4P9P A;  3A0R A;  3BRC A;  1R6N A;  1U97 A;  3QTC A;  1K73 W;  3E8F A;  2HJD A;  4EFE A;  3AG4 C;  1Q81 W;  4X62 O;  3BA9 A;  5BY1 A;  3O9O A;  3ZED A;  4G28 B;  2M7W A;  3G4S V;  2CGN A;  2WLK A;  3JAW B;  4QGP A;  2NLJ C;  1S72 V;  4UV9 A;  1IBK B;  3A2F A;  2JGD B;  3LUT B;  5KA5 A;  2ZM6 O;  2KSD A;  2ZNJ A;  1AJQ A;  3WB2 A;  5GTI Z;  4LF7 O;  3KCX A;  1K97 A;  1OZ0 A;  3ZHQ A;  2ZE8 A;  1MNG A;  4H33 A;  4ABM A;  4WFE A;  4DYL A;  3RVZ A;  1N33 O;  2XAF A;  4ZBM A;  4X65 B;  4DV3 B;  1EFR G;  2IBZ H;  4UVC A;  1AJN A;  2EIJ C;  3JAS A;  1EZJ A;  2W6I G;  5FPO A;  1XNQ B;  1D5A A;  1YVW A;  4DV1 O;  4MSW C;  4DK1 A;  2UXB B;  3VOU A;  2UXD B;  3OGC C;  1QLE B;  3BY6 A;  5J2U B;  3BHP A;  2OTL V;  3ABU A;  2Y48 A;  4PJ0 Z;  3K58 A;  1V54 C;  3BFR A;  1BL8 A;  3JD1 A;  3CJH B;  1LNQ A;  2UUB B;  1N32 O;  3OT7 A;  4I50 B;  3MAQ A;  1GM7 A;  1ZWI C;  4JZ2 A;  3TK1 A;  2UUA B;  3JAK A;  5CB4 A;  5IJ9 A;  3ML0 A;  1AP5 A;  1IVS A;  4J7Z A;  3RW0 A;  1FXK C;  1F4M A;  4XDJ A;  2XAJ A;  4ZKI A;  3IC9 A;  1VP7 A;  3W7X A;  3K06 A;  2YI9 A;  2QJ1 A;  1K9M W;  3W7W A;  3TCU A;  5CA0 A;  1WPB A;  2VQF O;  2F95 B;  5LGU A;  2YXY A;  3ABL C;  1YXB A;  4F6R A;  5LHI A;  4KUM A;  2RN9 A;  3QG5 A;  3LSU A;  1VQ7 V;  5B3S C;  3UT5 B;  1NT2 B;  5FNV A;  1GO3 F;  2BSK A;  2LGW A;  2W0X A;  4I4T A;  3RBZ A;  4PDR A;  4GX2 A;  4GYC B;  4O4J A;  3CCE V;  3HKE B;  2BTQ A;  1MSD A;  3SPH A;  5LOV A;  1IBM O;  3AG2 C;  2CTW A;  5JJE B;  1TUB A;  1UFI A;  1WPX A;  3JAR A;  4DW0 A;  5LXT A;  1HNZ B;  5BR8 B;  3TGU H;  1OCR B;  1VQP V;  1PP9 H;  2EIM B;  2QWR B;  4NKG B;  1S77 D;  2ZT9 B;  2YEV B;  1AP6 A;  4GKJ B;  3JD3 A;  1X59 A;  2UXN A;  3CRQ A;  3AG3 B;  2Q69 A;  4LF6 O;  3F7V C;  4PA4 A;  4GKJ O;  5GON A;  3SJC C;  1ORQ C;  4H0L B;  4LH7 A;  1WB7 A;  2YUA A;  1KC8 W;  2A06 H;  4OXS A;  2PTM A;  4FM1 A;  3OTO O;  4F4L A;  4I4T B;  2Y69 B;  2ZDI C;  2Q9L A;  1RPR A;  5J2T B;  4UCS A;  1XMO B;  1H8H G;  4I0X A;  3VBB A;  3PJS K;  2RNB A;  1OCO C;  3M99 B;  2B1I A;  4N23 A;  1M4U A;  3N2G B;  2AW9 A;  1PV0 A;  4BW5 A;  1E79 G;  3K59 A;  1VF7 A;  3IAY A;  4LF6 B;  5EBW C;  4UCO A;  2P67 A;  4X66 O;  4X1K B;  4IYI A;  2UU9 O;  3M8A A;  1COW G;  1I5Y A;  4G2K A;  3APO A;  2CGO A;  4X1I A;  1QR8 A;  4LFA O;  3B4S A;  1QBZ A;  1Q6U A;  1YI2 V;  4ASU G;  5KA6 A;  3HKD B;  4LF9 O;  3E2E A;  4LF8 O;  4DV0 B;  2OYQ A;  1SF9 A;  2PYJ A;  1D5N A;  1VF6 A;  3CCU V;  3E35 A;  2AZ0 A;  1JFF A;  1IXM A;  4PHZ A;  1PL4 A;  2OWO A;  5B66 Z;  3SYA A;  5LMU O;  1NH2 D;  3L9D A;  1QLN A;  4LR3 A;  2H94 A;  1GAX A;  1YIT V;  1JOY A;  2WLH A;  2AHY A;  4FLZ A;  3ZIA G;  3UT5 A;  3RWR D;  2DE0 X;  5IJ9 B;  2UUB O;  1N32 B;  1YJ9 V;  3H1H H;  3HKE A;  1B04 A;  2AZ2 A;  1XNR B;  4LFB O;  1TUB B;  4JAV A; 
#chains in the Genus database with same CATH homology
 1V54 B;  1JVM A;  4MVR A;  4JTC B;  5J9P C;  1UJW B;  4RUF A;  1KKD A;  4HAM A;  2HG5 C;  3FKS G;  4LC1 A;  4PEL A;  3TET A;  2OCC C;  1AI6 A;  2QM8 A;  3AG2 B;  1KD1 W;  4PA3 A;  4UVB A;  1FS0 G;  1SZT A;  2Z5U A;  3STZ C;  1R73 A;  2C2A A;  1P4R A;  4MVM A;  5IDJ A;  3ZRS A;  4JF3 A;  2V1D A;  3WFV A;  3F7Y C;  4R7C A;  1R6K A;  1JX9 A;  1M56 B;  3OR7 C;  1PNM A;  1PNK A;  1NH2 B;  4JAS A;  4QE9 A;  1K3E A;  2DW4 A;  4UUJ C;  3T4Z A;  4JPR A;  2X6B A;  2WWW A;  3UKM A;  1DF4 A;  2HKO A;  3GWO A;  1RM1 B;  3SYC A;  1THZ A;  1AI5 A;  3CCV V;  1NKD A;  4YXW G;  2EZO A;  2W6J G;  4MW3 A;  3ZMZ A;  3G71 V;  2Y69 C;  1MAB G;  2X6A A;  3FB7 C;  4WF9 V;  2WLI B;  4QPJ A;  3B8M A;  3LSS A;  3OAA G;  4H37 A;  4Z1M G;  1R3I C;  4RQE A;  3D36 A;  1SET A;  4WCE V;  1PNL A;  1YJN V;  4JAV A;  1R3L C;  4PA7 A;  1NR1 A;  2OCC B;  4BAY A;  3SPJ A;  2X0L A;  1ENV A;  2JEU A;  5CA3 A;  3T2M A;  3BEH A;  3W7U A;  4UXN A;  1PD3 A;  1VQ4 V;  4RQF A;  2ZD9 A;  4LP8 A;  1VQK V;  3CCM V;  2DYR B;  1Q82 W;  5KUK A;  1G4Y B;  2EZP A;  2P6J A;  2IJH A;  2JK5 C;  2QTO A;  1VQO V;  5EK0 A;  1K33 A;  3K08 A;  3UM7 A;  3CCQ V;  1VQN V;  4TSF G;  2WLL B;  5IY5 B;  3SYP A;  4PDV A;  4E2L A;  3NXS A;  5L3C A;  3OE7 G;  2XAQ A;  3K3W A;  2HFE C;  2OT5 A;  3IGA C;  1R3K C;  2WLN A;  3FB8 C;  4L87 A;  1YTF D;  2WSS G;  1CP9 A;  5L3E A;  2R9I A;  2KB1 A;  3CP1 A;  4JGS A;  1GKF A;  2XAS A;  2JJ2 G;  3DTU B;  5IYC O;  1OCR C;  5LGT A;  3E8B A;  3T4D A;  2IU0 A;  3OM3 B;  5DM6 V;  3ASO C;  1SRY A;  3ABK C;  1ROP A;  2ZR3 A;  3P30 A;  3OMA B;  4FPP A;  3OEH G;  1H8E G;  4PA9 A;  4MVZ A;  1ARO P;  3ZMT A;  2ZDI A;  1FXV A;  2ZR2 A;  4XDK A;  5L3B A;  2WLI A;  5HFL A;  1F23 A;  2EIN C;  5IYD O;  3CCR V;  3ASN C;  4R8C A;  3G6E V;  2R9R B;  1NH2 C;  1OCC C;  1GM8 A;  2LFR A;  4WFH A;  3JD4 A;  4I5S A;  3QO5 A;  3OFN G;  5EBL C;  5H9C A;  1H2G A;  4JYC A;  1YHQ V;  2BOB C;  1NBM G;  1QLE C;  1DF5 A;  5IY5 C;  2DQ3 A;  3QO7 A;  3ZCC A;  3GB7 C;  3E89 A;  3CCJ V;  1FXH A;  3JD0 A;  4PDL A;  4RAI A;  1FXK A;  4R6Z A;  2F43 G;  2K1E A;  1DLB A;  3LDE A;  2HR3 A;  1S5H C;  2P7T C;  3OW2 U;  4GCZ A;  3SYQ A;  5CN0 A;  2ZXW B;  3CME V;  4P9P A;  1YTF B;  3KG2 A;  1VQ8 V;  2DWD C;  3A0R A;  3MHS C;  1Q86 W;  1R6N A;  3QO8 A;  4KP4 A;  1K73 W;  2WAM A;  3E8F A;  2QE7 G;  5EC1 C;  1V55 C;  3AG4 C;  1Q81 W;  2IH1 C;  2XND G;  4FK5 C;  5L3F A;  2PI4 A;  2XOK G;  1NR7 A;  4G28 B;  5CBF A;  1VQM V;  2IU3 A;  3ZRX A;  4PDM A;  1QVG U;  2M7W A;  3ASN B;  4QIW F;  4DXW A;  3G4S V;  1MSW D;  5BZB A;  3STL C;  2WLK A;  3IFX A;  4P30 A;  1F51 A;  3FB5 C;  2NLJ C;  1S72 V;  4UV9 A;  1K5S A;  3B8N A;  3LUT B;  5KA5 A;  4MTF A;  1OCZ B;  1NQT A;  3CCL V;  4LBE C;  5EC2 C;  1AJQ A;  1BHB A;  3K0G A;  1K97 A;  3ABT A;  3JCZ A;  1SER A;  1OZ0 A;  2Z3Y A;  4CZZ A;  1M90 W;  2DQ0 A;  4G27 B;  2IJI A;  3CC7 V;  4H33 A;  1KP2 A;  1NVP B;  1N8R W;  4WFE A;  4XBF A;  3RVZ A;  4MVQ A;  3ZRV A;  3T1C A;  2ATK C;  2XAF A;  4ZBM A;  1YJW V;  1YIJ V;  3K9A A;  3F5W C;  3FYE B;  1EFR G;  4MTX A;  3MHH C;  4UVC A;  1AJN A;  2EIJ C;  4R50 A;  3OEE G;  3WG7 C;  1P7B A;  3CPW U;  3SJQ C;  1EZJ A;  2W6I G;  1M57 C;  2YSU B;  2V7Q G;  4FJC C;  1K8A W;  1RPO A;  3HB3 B;  1H38 A;  3OUS A;  5CBH A;  3ZJZ A;  3ZMV A;  2JEX A;  1SES A;  2IW5 A;  1MG1 A;  4MSW C;  3D3I A;  3VOU A;  1M1K W;  3OR6 C;  5HFM A;  3OGC C;  1QLE B;  3BY6 A;  5B1N A;  1E1R G;  3E83 A;  2OTL V;  2EIM C;  3ABU A;  2Y48 A;  3ETE A;  2QA4 V;  2EIL C;  2WLL A;  2ITC C;  1V54 C;  1BL8 A;  2EIL B;  3JD1 A;  4WFG A;  5B1O A;  1V55 B;  1BHA A;  4U7O A;  2DYR C;  1LNQ A;  1VQL V;  1W0J G;  3MD0 A;  3ABM C;  3SPC A;  2BOC C;  2EIJ B;  1GM7 A;  2JJ1 G;  3IC7 A;  1XL4 A;  1ZWI C;  3SYO A;  1J95 A;  1M9N A;  3TK1 A;  1MOF A;  1KQS U;  4MS2 A;  5LGN A;  4MT8 A;  1OHH G;  3CXC U;  2EIK C;  1GK9 A;  3ML0 A;  2ITD C;  1G8M A;  2LP7 A;  4LCU C;  3B77 A;  1GM9 A;  1JJ2 U;  2MK3 A;  3ZRW B;  3RW0 A;  5CMU A;  1FXK C;  1F4M A;  1W0K G;  4XDJ A;  4XDL A;  2LFS A;  2WPD G;  5B1B B;  2XAJ A;  1E1Q G;  4ZKI A;  5EBM C;  3AG1 B;  3W7X A;  3K06 A;  2X6C A;  5KUM A;  3ABK B;  1K9M W;  3W7W A;  2IJJ A;  4X88 A;  4P2Z A;  3TCU A;  3ZMS A;  3DGE A;  3K04 A;  5LGU A;  5GW7 A;  3ABL C;  2EIK B;  1Q7Y W;  3QNE A;  5LBQ A;  4BIU A;  4J9Y B;  2DWE C;  3I56 V;  4JTD B;  5LHI A;  4KUM A;  4QE7 A;  2AHZ A;  4JAU A;  3K03 A;  3HPL C;  4MTO A;  5B1B C;  4GX1 A;  1I5X A;  1VQ7 V;  3JD2 A;  5B3S C;  2HLD G;  4DO2 A;  1GO3 F;  3W7S A;  2GHY A;  1S0V A;  2B5U A;  5H6Q A;  1Y66 A;  4MVO A;  1WLE A;  1B6Q A;  3RBZ A;  4QJF B;  2NNU A;  4GX2 A;  2ZQM A;  4PDR A;  3CCE V;  3WG7 B;  3SPH A;  1FFT B;  3ZRW A;  3SPG A;  1YSC A;  3AG2 C;  5LHH A;  3ETD A;  5B3S B;  2A0L A;  2QM7 A;  1AI4 A;  4WFA V;  2QKS A;  1WPX A;  5L3G A;  4X89 A;  1VQ9 V;  4U7N A;  3FYI B;  4GT1 A;  1Y4M A;  5LHG A;  2A9H A;  3ABL B;  1OCR B;  4RUE A;  1VQP V;  2EIM B;  1PKX A;  4KFM A;  4Q20 A;  2EBO A;  1L1F A;  4JYB A;  4FMT A;  1JQ0 A;  1S77 D;  2PI5 A;  4UVA A;  2D3O W;  1OCO B;  2YEV B;  3X2Q C;  3JD3 A;  2OTJ V;  1JCH A;  4EKW A;  3ABM B;  1K5Q A;  2B1G A;  5E1A C;  5DN6 G;  2CK3 G;  3AG3 C;  2A79 B;  4MVU A;  2WLJ A;  2UXN A;  1OCZ C;  3AG3 B;  2P90 A;  3LSQ A;  2Q69 A;  3F7V C;  4PA4 A;  2XAH A;  5C93 A;  3JYC A;  1ORQ C;  1NJI W;  3RVY A;  1XL6 A;  1KC8 W;  1F4N A;  2X7R B;  4OXS A;  1NVP C;  1TUE B;  4F4L A;  1AI7 A;  2HVK C;  2UXX A;  2Y69 B;  2ZDI C;  2JDI G;  4TWK A;  1RPR A;  2DYS B;  1H8H G;  4X8A A;  3VBB A;  4MW8 A;  3PJS K;  1CPY A;  5L3D A;  1AJP A;  5B1A B;  2YEV A;  4MTG A;  2QEX V;  1OCO C;  4I9W A;  3M99 B;  2HVJ C;  1K7D A;  2B1I A;  2EIN B;  4N23 A;  1JPX A;  1QVF U;  1K4D C;  4BW5 A;  1W2B U;  4QPK A;  1E79 G;  2WLM A;  3CC4 V;  1FXK B;  1OCC B;  1HWY A;  4JTA B;  4UV8 A;  4QNH B;  5EBW C;  1M57 B;  1PL0 A;  3E8G A;  1VQ5 V;  2P67 A;  4HYO A;  2DYS C;  3X2Q B;  3ETG A;  1RM1 C;  2XAG A;  4PA6 A;  1KEC A;  4RO2 A;  1COW G;  4WFF A;  1I5Y A;  3CYO A;  3E8H A;  4G2K A;  1QCE A;  3R65 A;  3ZN0 A;  1QR8 A;  4WFB V;  3SPI A;  2ZXW C;  3OMI B;  1QBZ A;  1QR9 A;  3CMA V;  3FB6 C;  4MVS A;  4BIZ A;  1YI2 V;  4ASU G;  5KA6 A;  1YTF C;  5H6R A;  3E2E A;  1NVP D;  3K0D A;  2IJK A;  1AR1 B;  3E86 A;  3CCU V;  1K34 A;  3E35 A;  2HJF C;  4N21 A;  2W0F C;  2JIZ G;  1K92 A;  1IXM A;  2Q68 A;  1GTO A;  3K79 A;  3EHB B;  3SYA A;  4TT3 G;  5FL7 G;  2FTK A;  3LDD A;  4P9O A;  1R3J C;  3W7T A;  3ZMU A;  1NH2 D;  1QLN A;  2H94 A;  3LDC A;  1K4C C;  1YIT V;  3H01 A;  3CC2 V;  2WLH A;  5IYB O;  1JOY A;  2Q67 A;  1BMF G;  3I55 V;  5CBG A;  4GX5 A;  3CD6 V;  2AHY A;  2GSM B;  3ZN1 A;  4CBC A;  3AG4 B;  1S76 D;  4GX0 A;  3ZIA G;  2H8P C;  3LNM B;  1EBO A;  1GMG A;  1CEZ A;  3AG1 C;  1S3J A;  4HZ3 A;  4J9Z B;  1VQ6 V;  3AEI A;  2Q6A A;  4FIP C;  2EJR A;  1YJ9 V;  1DTO A;  2IH3 C;  5B1A C;  1M56 C;  3CCS V;  3ASO B;  3OUF A;  3EFF K;  3OMN B;  1KP3 A;  3P32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...