1HP8A

Solution structure of human p8-mtcp1, a cysteine-rich protein encoded by the mtcp1 oncogene,reveals a new alpha-helical assembly motif, nmr, minimized average structure
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
68
structure length
68
Chain Sequence
b'MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HU-P8
publication title Solution structure of human p8MTCP1, a cysteine-rich protein encoded by the MTCP1 oncogene, reveals a new alpha-helical assembly motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cysteine motif
total genus 26
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1997-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08991 MTCP1 Mature-T-Cell Proliferation I type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1130 Mainly Alpha Orthogonal Bundle Helix Hairpins CytochromE C oxidase copper chaperone 1hp8A00
1U96A 1HP8A 1Z2GA 2LGQA 2RNBA 2HP8A 2RN9A 1U97A 2LQTA
chains in the Genus database with same CATH superfamily
3CWBH 1CEZA 2IH1C 2QSAA 1VQNV 2CAZC 1DGSA 2G38A 3A0RA 4DR2O 3CRCA 4U3JA 1YJ9V 1R3LC 5CB4B 2WLIB 3RYFB 5CBHA 1KP3A 4WFFA 3BAAA 3RVZA 5LOVA 4I7ZB 3BA9A 2F66C 3K06A 3ZHSA 4O2AA 2Z5UA 4NVPA 1QLEC 2H3OA 1COWG 1X59A 3TXSA 5IJ9B 3JCUZ 2V7QG 5A9GA 4I50A 1LUWA 2OWOA 5JH7A 2ADPA 1MA1A 2Q0OC 3L75H 5LMNB 5L3CA 5EZYA 2BTQB 2JEUA 3ZX6A 1N0JA 2UU9B 5KAIZ 1EM1A 3RYCA 5E79Z 3T1HB 1CXZB 3L72H 1WN7A 4U3FH 3TJTA 1N34B 3BY6A 5L3GA 3G71V 2QJ1A 3ZHTA 3W7SA 1OZ0A 4YHHO 3O9OA 2QTOA 5ITZB 3N2KA 3PN1A 3CRAA 1GM8A 1HNZB 5IWAB 1IBMO 1L1FA 4DR1B 5GONB 4RQFA 4DR5O 2ZE5A 1FS0G 2BOBC 1W0KG 1V55C 2XAGA 2FMLA 4FM0A 3ZRVA 2B1GA 3CX5F 1HW7A 3IFXA 2F93B 2UUCB 4B08A 4J10A 3UT5A 1NVPB 4JAAA 2ZDIC 1ROPA 4I0XA 3AG3B 3G6BA 1NVPD 3RW0A 5LGUA 1KYOF 4Z2WA 1HNXO 3CRRA 3OEHG 2OCCC 1VP7A 1AI6A 4DV0B 5H6QA 4U3JB 3DGEA 1BHAA 2QM4A 3L73H 1XI1A 4K0KB 1WB7A 4J7ZA 5JJNB 2WSSG 4LFBB 5GTIZ 1FFTB 5LOVB 2UXCO 3GWOA 5L3FA 1AJPA 4O2AB 3CCUV 3BA8A 4FK5C 1KECA 1IDSA 2ZDIA 4I50B 2HG5C 2XTAA 1JJOA 1Y66A 2W6IG 1SQXH 3TCUA 4QNHB 5JH7B 4DV5B 2KG7B 3ZRXA 3LSQA 1RM1C 5EZYB 1PP9H 5KA5A 2D2CB 4DV4B 2JGDA 1XHZA 2E75B 2RJZA 3RYCB 2X7RB 5H2FZ 4JI4O 3K59A 3T2MA 3T4DA 3JASA 5F2VO 2ZE7A 1M56B 2CGOA 5D5QA 1ZSPA 2HHHB 1QLEB 3OMIB 4GX2A 4PD4F 2VQEO 2UXBO 4R50A 3X2QB 3N2KB 3UO3A 4H13B 3BPZA 4CBCA 3U10A 3SYQA 4GKKO 3CMEV 4ZIBA 1LUVA 1W59A 4QPKA 4F6RB 1S0VA 2R9RB 3UT5B 1GKFA 1VMGA 4PDMA 1RFYA 4I0XB 3RYIA 4WFGA 3ZHRA 4JAUA 3H1LH 2ZIOA 1S77D 1GN3A 2ZCEA 1JMKC 2EZPA 2ILMA 3U0ZA 1NI8A 3RBZA 1URFA 1Q81W 3FD9A 3NR7A 5HFMA 3WFVA 3APQA 2EIJC 2Q7EA 1P84F 1QBZA 2CE4A 5H6RA 1V54C 2LFRA 4N23A 3ZN0A 4FLWA 3K57A 3ZN1A 3U11A 4MTOA 1XHXA 4XDJA 4X64O 2WLLA 1G4YB 2XAJA 2DW4A 1K97A 3RN4A 2C2AA 3OEEG 4JASA 4KHPB 1SQVH 3WB1A 4CZZA 2DE0X 3F7YC 4TWKA 3GB7C 3JASB 5JVDA 3E8BA 1GK9A 2WLMA 3QTCA 1DTOA 1WPXA 4MVRA 4IGGA 1BE3H 5JJEB 4I55A 2PTMA 2B9ZA 5B1BC 3K04A 4CC6A 1RM1B 4JAVA 3CP1A 4WBNA 2IW5A 5B3SC 5BZBA 2NNUA 5LL6Y 3CC7V 1BCCH 1P7GA 4FVMA 1FPOA 4WFBV 1W2BU 3VQVA 1A32A 4DR7B 4JI7O 3RYIB 4JI8B 1M1KW 4UVCA 3LNNA 4UCTA 1MG1A 2EBOA 1OCOB 4EFBA 4N21A 4PA4A 4H37A 4JV5O 4JI5O 4O2BA 2ZKOA 1WJZA 1J95A 1WNSA 2LQTA 3JARA 4DR6O 2Y0PA 4W4LA 1VQPV 3JSNA 1M5IA 1KD1W 2PI5A 1YCIA 3RVYA 2WLLB 4JI6O 1BQ0A 3ZHVA 3CCMV 4FFBA 1N32B 1VQOV 3EFFK 1NS1A 3AG1B 4JI2O 4H44B 2CUGA 4FM1A 3OGCC 2EIJB 1KP2A 1IURA 2UUAO 2LGQA 5JVDB 4LC1A 1P7BA 3OMAB 2GBOA 4YXWG 1KMIZ 3E89A 2XHBA 1PM9A 1K34A 2WLKA 1DF4A 2AZ0A 3AG2B 4B3TB 4GCZA 4DW0A 2JIZG 3JAWA 1ENVA 3F5WC 4I55B 3FFQA 2DOSA 1M90W 2WPDG 3C90A 2JJ2G 4J42A 4WBNB 4B3MB 3TK1A 1I94B 1H2GA 2PF4E 1PNLA 1JJ2U 1FJGB 2ZNIA 3CHXA 2XOKG 1HWYA 2B1IA 4UB6Z 1FXKC 4IIJA 1S76D 1GO3F 1K4CC 1N0NA 4JI0O 4X20A 1GMGA 4UVBA 2Q67A 1WPBA 2EINC 3P32A 2H94A 4O4HB 2VQFB 2ZM6B 4AHCA 5LMUO 5B1BB 4C7UA 3CCJV 4RAIA 1N8RW 2MW2B 4I5SA 1M57B 4O2BB 2QKAA 4YY3O 5B3SB 2WLNA 2ZIMA 1ZL8A 3F5TA 3K0GA 3JARB 4G2KA 1FXKA 1L0NH 3ABMC 2PYJA 3ZHQA 2X6AA 2A06H 4DV7B 4E2LA 3JSLA 3OD4A 2Q9LA 3E83A 5DM6V 3OR7C 4QE9A 4FFBB 3WB2A 1CPYA 1K8AW 3ABUA 3K08A 1SC5B 2CTPA 3OE7G 4F6EA 2P5OA 2HP8A 2Q0AA 4R8CA 3D36C 1D2DA 1N4CA 1AJNA 1NKDA 4MVUA 2JGUA 3JAWB 2Q5ZA 2CK3G 1QVGU 3IGAC 2IH3C 4GUNA 3JD1A 3OW2U 3H01A 2EULA 3DC5A 2Q8VA 4I4TA 1TUBA 3OUSA 2EJRA 2P4VA 1XNQB 3E8GA 2UXDB 4LF8O 1K7DA 1T5EA 3SGIA 1Y74A 3JALA 1LNQA 3CSXA 4GX5A 2A9HA 4IIJB 2R9IA 4K8ZA 3SJAC 2P22C 3D36A 4X20B 4UUJC 1JOYA 1CP9A 2QE7G 4LFAB 2QEXV 2CGNA 4JYBA 2DYRC 4J41A 1OV9A 2HJDA 2YXHA 1Y67A 4X88A 2IU0A 3QVNA 4R7CA 1BT8A 1VQ9V 4FFKA 1ZL8B 3STZC 5DECA 1FXKB 2ZR3A 5IY5B 1Q43A 4PV1B 3AK3A 1AP5A 5CB4A 1XMQB 1W0JG 4WFHA 4OPHA 2BCCH 3CCVV 3VBBA 4YIPA 4FMTA 4CH6A 1NTMH 2QWPB 5IYBO 1TGOA 3MHHC 5LGTA 4BWAA 5BY1A 3E2EA 4UCUA 3N2GA 2UU9O 1I5XA 3T1HO 1N34O 2E5LB 5JCOC 3BCCH 2LP7A 5CMUA 4I4TB 1TUBB 2XT9A 4F4LA 4P9PA 3ETDA 4GZRB 3VQWA 4X9QA 3ZJZA 2RMKB 1Y74B 1HNZO 3DC6A 3JALB 5KX5B 1P4RA 1M4UA 4PA6A 1QQCA 4JTDB 4MVMA 1Y6XA 4UV8A 1KBHA 4CS3A 2IJKA 2QWNB 5DEDA 1NZ6A 1WAZA 3G67A 1SQFA 1JX9A 3ML0A 4PI2A 3FX7A 5FLXN 4DV0O 1VQ8V 4LNUA 3UM7A 3ZCCA 3UQ8A 2RCVA 1AR1B 4BW9A 4K0KO 4IYHA 4X66B 2OTJV 3ICXA 5DN6G 4LFBO 2DWEC 1GN4A 1OCZB 1SQGA 4FLUA 2VS0A 2EILC 2YXLA 4DYLA 3ZMSA 1XMOO 2AGAA 2DYRB 1M56C 2CH7A 4GYCB 1H2KA 3B77A 4DV5O 4OX9B 3CS5A 4ZI7A 4EB6A 3GWKC 3X2QC 3N2GB 4DV4O 2KG7A 1TAEA 1KQSU 1NH2B 2LW7A 1DLBA 1NH2D 2RNBA 2HKOA 5JQGA 4KUMA 2JK5C 2ATKC 3E8HA 5IE9A 1BZKA 3SYPA 3K5MA 1YIJV 4MVOA 1EZJA 4FLXA 2BOCC 1JPXA 3M99B 4HZ3A 1NTKH 1RPRA 1K73W 2HJFC 3WU2Z 1VIBA 1Q5OA 1BL8A 2QWRB 1AR5A 2ODMA 4PDLA 3NXSA 4TV8A 5CN0A 1IBKB 3OMNB 3UCSC 3CXCU 4PELA 3W7UA 4LF9B 4L87A 4F6RA 3CCSV 4CS4A 4I9WA 4UB8Z 3KCXA 1YF2A 4JYCA 1PNKA 1G1XB 4LNUB 3ZRWA 3BABA 1J5EB 3LDEA 1YHQV 1N36B 3RYHA 5IJ0A 4FZ1A 1VQKV 4JGSA 3SYAA 4JI1B 3HKEA 4DV1B 3C3SA 2GTAA 4G28B 1D5NA 4DRXA 2CH7B 3ZEDA 2CDYA 2ARHA 2M7WA 4MVZA 4ZI7B 3ETQA 4DUYO 4ZOLA 4EB6B 1EN4A 1Q6IA 2A0LA 4KHPO 1FXVA 3A0HZ 4FLTA 2OT5A 1QLNA 2ITDC 2EILB 5H9CA 4O4IB 2XAQA 1Z5WA 3DTUB 4ZKIA 2Y4UA 1YVWA 3UKMA 5JQGB 3H1KH 3E8FA 1VQ5V 3JCZA 2LFSA 2Y69C 2YS8A 1VEWA 2E3CA 3LSUA 1MZFA 1OCOC 4YJ3A 1SZTA 3HPLC 4JPRA 4QPJA 4X1KA 3T1YB 5LXTA 1XNRB 4TV8B 3LDCA 2FYUH 5KHHA 4U7OA 4DR3B 1H8HG 3K5OA 5KLVH 4CH5A 1B3QA 4DR7O 2ZE8A 4JI8O 3ZMZA 1N33B 2FL4A 4B3SO 3HKBA 1S3JA 4TV9A 1SZXA 3B4SA 3ASNB 3FB7C 3ZRWB 2ZXWC 2W0FC 1IX9A 1ORQC 3OUFA 1I0HA 3RYHB 5IJ0B 2W0XA 3RT3C 3HKEB 1ZX3A 3AG1C 4MVQA 2Y4TA 2WWWA 4UFZA 5CA1A 3L71H 2DQ0A 4DRXB 4DXWA 1B04A 1E79G 5L3DA 5LYJA 3JD4A 3JAMN 3L74H 3AG2C 4HAMA 1XQ8A 3HKDA 4ZOLB 5CBGA 1HNXB 3KKYA 1BGYH 2P7TC 3OTOB 2OIGA 1XL4A 2ZNJA 2YXYA 4BIZA 1PD3A 3I5DA 4X62O 4B3TO 2EZOA 4U7NA 4MW3A 3THOA 3ZBHA 3LSSA 4B3RO 5LA6A 5CA0A 4R6ZA 2JVDA 2QM7A 2F4VB 1I94O 4YJ3B 4KXRA 1AR4A 4X1KB 1IBLB 1MABG 3KG2A 1FJGO 2PY5A 5LXTB 1M57C 1US6A 1G8MA 5L3BA 4O4LA 5LHGA 4TQDA 3AK2A 4TSFG 3HKBB 5EK0A 4TV9B 2OTLV 5LP6A 1Q7YW 2VQFO 3CE2A 2N05A 2ZM6O 2DN9A 1NTZH 2Y69B 1XREA 2VQEB 4O4HA 4NTWA 4DV6B 4XDLA 2ETNA 2NR5A 1S5JA 1VQMV 1ZTEA 3A8TA 3B40A 4PA9A 4GKKB 5BMVA 3ZRSA 3IJ4A 5CA1B 3QNEA 3BEHA 1R6KA 4Q6GA 1WA8A 4DV7O 5LYJB 1F7YA 4FLVA 1JFFB 3BRCA 4NXNB 2R9AA 3JYCA 3HKDB 5IDJA 2ZXWB 4DUZB 1R1BA 4UCRA 4FM2A 1IZ3A 2ADQB 1HNWB 1UJWB 1PPJH 1YTFD 4J9YB 5KHJA 2AHYA 3B09A 3SJBC 2IBZH 1YSCA 4NB5A 5BR8B 1NR7A 2YIBD 1NBMG 3N27A 2Q69A 2YDEA 1GN6A 4CH3A 2YICA 5LA6B 5CA0B 4WF9V 5CBFA 1ZWIC 1JR9A 2VWKA 2UXDO 2BTOA 4KP4A 3CCEV 4MTFA 5JWPA 4O4LB 3UO2A 4Z1MG 2RN9A 3Q4HA 1GM7A 4LFAO 3OT7A 5IY5C 5LP6B 4PA7A 5B5EZ 4X1IA 2IU3A 2PGGA 3HKCA 1M93A 3SDLA 5KMGA 1RSOB 4UCSA 2R70A 1GAXA 5EYPA 3CCLV 3CC2V 1GRJA 3SJCC 2RQ6A 5BMVB 1JQ0A 3FAVA 4MS2A 1VQLV 2O57A 4PDRA 1KB9F 5FNVA 1WA8B 4ASUG 1XMQO 4FIPC 2K9PA 4TOIA 1YEWA 4QIWF 3TGUH 4DV3O 1SS3A 3BVOA 1S72V 4DR4B 3ABKC 5KHKA 3QG5A 1F4NA 4JI5B 2YEVA 5LGNA 3TETA 5KUKA 4P2ZA 1KC8W 5EC1C 4OPAA 3FYIB 4ZBMA 4LH7A 2E5LO 1B6QA 1QCEA 2EIMB 2QTSA 3H1IH 5B1AC 5LHIA 2NLJC 3FYEB 4LP8A 4CS2A 3OM3B 4JI6B 4LCUC 1Q90D 1RPOA 4JYYA 4UV9A 1VF5B 4J7JA 1Z2GA 1QU7A 2QKSA 3Q4HB 2EX3A 1SKVA 1YDXA 5KX5A 3R66A 2DQ3A 5EBMC 3CD6V 1SA0A 1B06A 4X1IB 4HNAA 1Q6UA 1OCZC 2P6JA 3HKCB 5KMGB 1FAFA 1NU1H 1O9GA 4YJ2B 5TISZ 4NXMB 1BQZA 4LFCO 3VQXA 4NKGB 1JVMA 5EYPB 4X8AA 4BR6A 3FAVB 4X66O 4QJFB 4PI0A 5FNVB 4IL6Z 2Q68A 4JYAB 3CPWU 4JI0B 3MAQA 2AW9A 4BW5A 3FB8C 1K5QA 5LHHA 4LF6B 2PI4A 1AI4A 5J2TB 2EIKC 4DV2B 3ZMUA 1S5LZ 2LJ2A 4OX9O 2H8PC 1XL6A 4DO2A 3AG7A 1HR0B 5B66Z 4H0LB 4TUYA 2YEVB 1QNMA 3HR0A 3FKSG 1FFXB 5LMNO 3H1HH 1NR1A 3W7TA 2XASA 2HVJC 5JJJB 2GUZB 3AK1A 4JI3B 3OFNG 2GSMB 3ABKB 5KAFZ 1QR9A 3JD3A 5EIBD 2ZR2A 3SYCA 4B7EA 2ZD9A 3M8AA 1U96A 2IJHA 3SPIA 4FJCC 2FB5A 2KKWA 5IWAO 3G4SV 4DR1O 4J11A 4G27B 1SA0B 2F95B 4HNAB 2WA4A 3ZIAG 3I55V 4LF9O 5B1AB 2GDSA 3D3IA 2Q6AA 5GTHZ 2QWQB 3PJSK 1WP7A 3D8CA 2UUCO 5C8YA 2GV9A 4K8XA 2XAFA 5KHIA 4CH4A 3C3TA 1EFRG 3CRMA 2AXTZ 4B7KA 1J5EO 3L9DA 4RO2A 1SERA 1N36O 4LF8B 3JATA 2V1DA 4UXNA 2Q7GA 4JI1O 4DV1O 1V9PA 2N04A 4LF5B 1EN6A 5A2QN 5B1OA 1K9MW 3SPCA 2PYLA 2WLJA 2P4KA 2Z3YA 4Z1VA 5FL7G 1YJNV 2R72A 1Q86W 3MDSA 2XAHA 2DWDC 2E74B 2BE3A 2ZE6A 4TUYB 4UVAA 4TT3G 3TXQA 3P30A 1JCHA 2A7WA 2UUBB 4AQYB 1WP8A 2IM9A 2F1MA 2A3QA 2Q4PA 4LH6A 1R73A 2P67A 1GN2A 5IYCO 1YJWV 1JA8A 4BIOA 1U97A 3ASOC 2EIKB 3ZHUA 1KKDA 1AVMA 3ZMTA 4O4IA 2HHHO 1AILA 1EBOA 3AG4B 2A79B 3ASNC 4BIUA 2F23A 4I9QA 3T1YO 1VF7A 4GKJB 1PNMA 1XNRO 4YIOA 4P30A 4DR3O 1VQ7V 1IXMA 1ZUQA 1N33O 1H2LA 2NN4A 4X65B 4ZHQB 5C8YB 3IC9A 3QF7A 3ABLB 2MK3A 5C93A 2LGWA 4TQFA 3A0BZ 1YITV 3CEIA 3JATB 1PKXA 2AZ2A 5IYZA 3RGBA 4RQEA 3RFRA 4PHZA 1SQPH 2PZSA 2KSDA 1QVFU 1MNGA 3EHBB 2DJVA 4LF7B 2ZQMA 2DMXA 4OXSA 3WG7B 2QR4A 1WB8A 1HP8A 2X6CA 1DK1A 2BSKA 3KZIZ 1MSDA 4LF4B 1OCCC 4GX1A 4LR3A 2XNDG 1H2NA 3BHPA 3K9SA 5IYDO 3L70H 3OTOO 3E86A 2D3OW 4OGQB 1FKAO 1WLEA 2WAMA 4X1YA 4DR2B 1OCRB 1E1QG 4ICGA 2HFEC 2L35A 3LNMB 2HLDG 1XMOB 5BXZA 2OYQA 1QHTA 2F4VO 3W7WA 1IBLO 3R65A 1XUQA 4LBEC 1H2SB 4BAYA 1IVSA 2Q7HA 3E35A 2Y0IA 2P90A 5HFLA 2YC0A 1NQTA 3ASOB 2OCHA 5B1NA 2QDOA 2HR3A 3T1CA 5L3EA 4A5UB 3OGIB 4FLYA 5KHGA 4DV6O 1DF5A 3DSQA 4YHHB 5IYZB 3QO8A 4NTXA 4K3AA 3K0DA 3JD2A 1IBMB 1I08A 2YUAA 3LDDA 1AJQA 1D5AA 1THZA 1NT2B 2Q73A 4DR5B 4QGPA 1BMFG 1I7FA 4NXNO 3K79A 4J7KA 1VF6C 2BSKB 3APOA 1TVKA 4DUZO 1JFFA 4MVSA 1N32O 2IJIA 2YIDA 1HNWO 2V4DA 3QO5A 2XUMA 3CJHA 4X1YB 1XOUA 2P06A 4EEQA 3STLC 1V55B 3EXAA 5BR8O 1GH6A 2YI9A 1GM9A 2UXCB 2CTWA 4PJ0Z 1VF6A 5LP6C 2YIBA 4JTCB 2JS5A 3ZS8C 1MSWD 1MZEA 1OCCB 1F51A 2EJ7A 2OCCB 3E22A 4DUYB 4NTYA 1RP3B 2UXNA 4FZ0A 4B3MO 1G6UA 2JGDB 2WLHA 1R3JC 2ZINA 1I5YA 2W6JG 2YIAA 1LR1A 4XBFA 4KL1A 2Z0AA 5K1PA 4JI4B 1XDCA 4K35A 1UPGA 4X89A 1HDJA 4O4JA 5IT9N 2HEPA 1EZVH 3P3NA 2UXBB 1RSOA 4NR1A 3QO7A 3J80N 4WFEA 2DYSC 3HB3B 3SPGA 3B8MA 1AROP 2Y48A 3H1JH 2ITCC 3T4ZA 4JZ2A 2JEXA 1SQBH 5FPRA 4D6TH 2CTRA 1K3EA 1Z5VA 4J80A 1H38A 1H2MA 4B3SB 1TVKB 2WA3A 1AP6A 3WB0A 1VQ4V 3SYOA 2EIMC 5AG2A 4DR4O 4EKWA 1F23A 1BSMA 1MMMA 1YXBA 1GTOA 2FTKA 3CJHB 1K5SA 1M9NA 4JZGA 2F43G 4IHJA 4DK0A 1YTFB 4QE7A 1F4MA 2JRIA 5D5PA 3K9AA 1IXBA 4DK1A 4H33A 3AEIA 3E22B 2X6BA 4MW8A 3S3XA 4X64B 1XNQO 2LO1A 4L8JA 1SETA 3K5NA 3M7MX 1AB3A 5K1XA 5LBQA 3B2EE 3SR2C 3CB2A 1V54B 4X62B 4P9OA 2LW1A 4KFMA 4IYIA 1Q3EA 4O4JB 3O65A 3OR6C 1SF9A 3CYOA 4B3RB 4NXMO 2QGNA 4D7TA 5GW7A 1XBLA 1Q82W 1QR8A 4YJ2A 3K03A 2N74A 4WFAV 2AHZA 2L6LA 1TA8A 1PV0A 1X4TA 4JYAO 4W4KA 1Y76A 3DXRA 5EBWC 4LF6O 3ZMVA 4HBNA 4PDVA 5KUMA 4DV2O 1NJIW 1K92A 4IT5A 4JI7B 3RWRD 2CTQA 5J2UA 5J2TA 4LWSA 1HR0O 3CMAV 1FYJA 2DYSB 2X0LA 5EIBC 3KCYA 4IHJB 1BHBA 4JV5B 1XILA 3ETEA 3CC4V 3K3WA 1XEQA 2FKXA 2KQXA 5KA6A 1FFXA 4AILC 4FPPA 4WCEV 4DW1A 1K4DC 4FLZA 4DR6B 4MSWC 4JI3O 3K5LA 2GUZA 1PL4A 1KKCA 4E4EA 3F7VC 2UXXA 2IJJA 2QWOB 3G6EV 1Q6HA 3B8NA 4ABMA 4JF3A 1PL0A 1Q8IA 3VQYA 1O9HA 3SPHA 4XDKA 4JI2B 3CCRV 4JTAB 1SRYA 2B5UA 1MOFA 3FB6C 3ETGA 1E1RG 2UUAB 3CXHF 2QKCA 4D7SA 2QA4V 4CC5A 3H9VA 1SESA 1SQQH 3SJQC 3JAKA 3MHSC 5EBLC 3ABTA 3LUTB 3BFRA 2OIEA 4UCOA 1OHHG 4NYKA 4LF5O 5CA3A 5FPOA 1YZBA 5EC2C 1Y76B 3DXRB 3FB5C 2RDCA 1R6NA 1Y4MA 5E1AC 5J2UB 4LWSB 4RUEA 5LMUB 3EVKA 3GVMA 2KB1A 2UUBO 1P49A 4RWUA 4AQYO 3AG4C 1UFIA 3K58A 3G80A 2GTSA 1H8EG 4YY3B 3CRQA 1AI7A 4HYOA 4MT8A 3VOUA 2EINB 2WLIA 1R3KC 1TUEB 3RYFA 1KUQA 2HVKC 1KU9A 2M6YA 4DV3B 5J9PC 2QM8A 1OJHA 3ABLC 1K33A 4GKJO 5IJ9A 3W7XA 5H5NA 2YI8A 1VQ6V 1EN5A 1BS3A 1L0LH 2E76B 4Q20A 3ABMB 3SPJA 2YSUB 4EFEA 1IBKO 3OAAG 3S3WA 2BTQA 4X65O 2PUSA 4PA3A 1ZAUA 3CCQV 4ZHQA 2K1EA 1FD9A 1R3IC 3JAKB 3WG7C 3A2FA 3AG3C 1ZLZA 3P3PA 3J7AU 1R6TA 2VRZA 4GLXA 1VARA 2GHYA 5ITZA 4GX0A 2JS3A 4AI8A 3MD0A 2ZT9B 3OTFA 4MTGA 1L8DA 2JDIG 4UCVA 5GONA 4LF7O 4GT1A 1OCRC 3D3QA 5JCOA 3IC7A 1YI2V 4RUFA 4J9ZB 4LF4O 4MTXA 1FXHA 3JD0A 2JJ1G 1AI5A 1S5HC 2VWJA 3I56V 4LFCB 3IAYA 3J81N
chains in the Genus database with same CATH topology
1U96A 1HP8A 1Z2GA 2LGQA 2RNBA 2HP8A 2RN9A 1U97A 2LQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U96 A;  1HP8 A;  1Z2G A;  2LGQ A;  2RNB A;  2HP8 A;  2RN9 A;  1U97 A;  2LQT A; 
#chains in the Genus database with same CATH topology
 3CWB H;  1CEZ A;  2IH1 C;  2QSA A;  1VQN V;  2CAZ C;  1DGS A;  2G38 A;  3A0R A;  4DR2 O;  3CRC A;  4U3J A;  1YJ9 V;  1R3L C;  5CB4 B;  2WLI B;  3RYF B;  5CBH A;  1KP3 A;  4WFF A;  3BAA A;  3RVZ A;  5LOV A;  4I7Z B;  3BA9 A;  2F66 C;  3K06 A;  3ZHS A;  4O2A A;  2Z5U A;  4NVP A;  1QLE C;  2H3O A;  1COW G;  1X59 A;  3TXS A;  5IJ9 B;  3JCU Z;  2V7Q G;  5A9G A;  4I50 A;  1LUW A;  2OWO A;  5JH7 A;  2ADP A;  1MA1 A;  2Q0O C;  3L75 H;  5LMN B;  5L3C A;  5EZY A;  2BTQ B;  2JEU A;  3ZX6 A;  1N0J A;  2UU9 B;  5KAI Z;  1EM1 A;  3RYC A;  5E79 Z;  3T1H B;  1CXZ B;  3L72 H;  1WN7 A;  4U3F H;  3TJT A;  1N34 B;  3BY6 A;  5L3G A;  3G71 V;  2QJ1 A;  3ZHT A;  3W7S A;  1OZ0 A;  4YHH O;  3O9O A;  2QTO A;  5ITZ B;  3N2K A;  3PN1 A;  3CRA A;  1GM8 A;  1HNZ B;  5IWA B;  1IBM O;  1L1F A;  4DR1 B;  5GON B;  4RQF A;  4DR5 O;  2ZE5 A;  1FS0 G;  2BOB C;  1W0K G;  1V55 C;  2XAG A;  2FML A;  4FM0 A;  3ZRV A;  2B1G A;  3CX5 F;  1HW7 A;  3IFX A;  2F93 B;  2UUC B;  4B08 A;  4J10 A;  3UT5 A;  1NVP B;  4JAA A;  2ZDI C;  1ROP A;  4I0X A;  3AG3 B;  3G6B A;  1NVP D;  3RW0 A;  5LGU A;  1KYO F;  4Z2W A;  1HNX O;  3CRR A;  3OEH G;  2OCC C;  1VP7 A;  1AI6 A;  4DV0 B;  5H6Q A;  4U3J B;  3DGE A;  1BHA A;  2QM4 A;  3L73 H;  1XI1 A;  4K0K B;  1WB7 A;  4J7Z A;  5JJN B;  2WSS G;  4LFB B;  5GTI Z;  1FFT B;  5LOV B;  2UXC O;  3GWO A;  5L3F A;  1AJP A;  4O2A B;  3CCU V;  3BA8 A;  4FK5 C;  1KEC A;  1IDS A;  2ZDI A;  4I50 B;  2HG5 C;  2XTA A;  1JJO A;  1Y66 A;  2W6I G;  1SQX H;  3TCU A;  4QNH B;  5JH7 B;  4DV5 B;  2KG7 B;  3ZRX A;  3LSQ A;  1RM1 C;  5EZY B;  1PP9 H;  5KA5 A;  2D2C B;  4DV4 B;  2JGD A;  1XHZ A;  2E75 B;  2RJZ A;  3RYC B;  2X7R B;  5H2F Z;  4JI4 O;  3K59 A;  3T2M A;  3T4D A;  3JAS A;  5F2V O;  2ZE7 A;  1M56 B;  2CGO A;  5D5Q A;  1ZSP A;  2HHH B;  1QLE B;  3OMI B;  4GX2 A;  4PD4 F;  2VQE O;  2UXB O;  4R50 A;  3X2Q B;  3N2K B;  3UO3 A;  4H13 B;  3BPZ A;  4CBC A;  3U10 A;  3SYQ A;  4GKK O;  3CME V;  4ZIB A;  1LUV A;  1W59 A;  4QPK A;  4F6R B;  1S0V A;  2R9R B;  3UT5 B;  1GKF A;  1VMG A;  4PDM A;  1RFY A;  4I0X B;  3RYI A;  4WFG A;  3ZHR A;  4JAU A;  3H1L H;  2ZIO A;  1S77 D;  1GN3 A;  2ZCE A;  1JMK C;  2EZP A;  2ILM A;  3U0Z A;  1NI8 A;  3RBZ A;  1URF A;  1Q81 W;  3FD9 A;  3NR7 A;  5HFM A;  3WFV A;  3APQ A;  2EIJ C;  2Q7E A;  1P84 F;  1QBZ A;  2CE4 A;  5H6R A;  1V54 C;  2LFR A;  4N23 A;  3ZN0 A;  4FLW A;  3K57 A;  3ZN1 A;  3U11 A;  4MTO A;  1XHX A;  4XDJ A;  4X64 O;  2WLL A;  1G4Y B;  2XAJ A;  2DW4 A;  1K97 A;  3RN4 A;  2C2A A;  3OEE G;  4JAS A;  4KHP B;  1SQV H;  3WB1 A;  4CZZ A;  2DE0 X;  3F7Y C;  4TWK A;  3GB7 C;  3JAS B;  5JVD A;  3E8B A;  1GK9 A;  2WLM A;  3QTC A;  1DTO A;  1WPX A;  4MVR A;  4IGG A;  1BE3 H;  5JJE B;  4I55 A;  2PTM A;  2B9Z A;  5B1B C;  3K04 A;  4CC6 A;  1RM1 B;  4JAV A;  3CP1 A;  4WBN A;  2IW5 A;  5B3S C;  5BZB A;  2NNU A;  5LL6 Y;  3CC7 V;  1BCC H;  1P7G A;  4FVM A;  1FPO A;  4WFB V;  1W2B U;  3VQV A;  1A32 A;  4DR7 B;  4JI7 O;  3RYI B;  4JI8 B;  1M1K W;  4UVC A;  3LNN A;  4UCT A;  1MG1 A;  2EBO A;  1OCO B;  4EFB A;  4N21 A;  4PA4 A;  4H37 A;  4JV5 O;  4JI5 O;  4O2B A;  2ZKO A;  1WJZ A;  1J95 A;  1WNS A;  2LQT A;  3JAR A;  4DR6 O;  2Y0P A;  4W4L A;  1VQP V;  3JSN A;  1M5I A;  1KD1 W;  2PI5 A;  1YCI A;  3RVY A;  2WLL B;  4JI6 O;  1BQ0 A;  3ZHV A;  3CCM V;  4FFB A;  1N32 B;  1VQO V;  3EFF K;  1NS1 A;  3AG1 B;  4JI2 O;  4H44 B;  2CUG A;  4FM1 A;  3OGC C;  2EIJ B;  1KP2 A;  1IUR A;  2UUA O;  2LGQ A;  5JVD B;  4LC1 A;  1P7B A;  3OMA B;  2GBO A;  4YXW G;  1KMI Z;  3E89 A;  2XHB A;  1PM9 A;  1K34 A;  2WLK A;  1DF4 A;  2AZ0 A;  3AG2 B;  4B3T B;  4GCZ A;  4DW0 A;  2JIZ G;  3JAW A;  1ENV A;  3F5W C;  4I55 B;  3FFQ A;  2DOS A;  1M90 W;  2WPD G;  3C90 A;  2JJ2 G;  4J42 A;  4WBN B;  4B3M B;  3TK1 A;  1I94 B;  1H2G A;  2PF4 E;  1PNL A;  1JJ2 U;  1FJG B;  2ZNI A;  3CHX A;  2XOK G;  1HWY A;  2B1I A;  4UB6 Z;  1FXK C;  4IIJ A;  1S76 D;  1GO3 F;  1K4C C;  1N0N A;  4JI0 O;  4X20 A;  1GMG A;  4UVB A;  2Q67 A;  1WPB A;  2EIN C;  3P32 A;  2H94 A;  4O4H B;  2VQF B;  2ZM6 B;  4AHC A;  5LMU O;  5B1B B;  4C7U A;  3CCJ V;  4RAI A;  1N8R W;  2MW2 B;  4I5S A;  1M57 B;  4O2B B;  2QKA A;  4YY3 O;  5B3S B;  2WLN A;  2ZIM A;  1ZL8 A;  3F5T A;  3K0G A;  3JAR B;  4G2K A;  1FXK A;  1L0N H;  3ABM C;  2PYJ A;  3ZHQ A;  2X6A A;  2A06 H;  4DV7 B;  4E2L A;  3JSL A;  3OD4 A;  2Q9L A;  3E83 A;  5DM6 V;  3OR7 C;  4QE9 A;  4FFB B;  3WB2 A;  1CPY A;  1K8A W;  3ABU A;  3K08 A;  1SC5 B;  2CTP A;  3OE7 G;  4F6E A;  2P5O A;  2HP8 A;  2Q0A A;  4R8C A;  3D36 C;  1D2D A;  1N4C A;  1AJN A;  1NKD A;  4MVU A;  2JGU A;  3JAW B;  2Q5Z A;  2CK3 G;  1QVG U;  3IGA C;  2IH3 C;  4GUN A;  3JD1 A;  3OW2 U;  3H01 A;  2EUL A;  3DC5 A;  2Q8V A;  4I4T A;  1TUB A;  3OUS A;  2EJR A;  2P4V A;  1XNQ B;  3E8G A;  2UXD B;  4LF8 O;  1K7D A;  1T5E A;  3SGI A;  1Y74 A;  3JAL A;  1LNQ A;  3CSX A;  4GX5 A;  2A9H A;  4IIJ B;  2R9I A;  4K8Z A;  3SJA C;  2P22 C;  3D36 A;  4X20 B;  4UUJ C;  1JOY A;  1CP9 A;  2QE7 G;  4LFA B;  2QEX V;  2CGN A;  4JYB A;  2DYR C;  4J41 A;  1OV9 A;  2HJD A;  2YXH A;  1Y67 A;  4X88 A;  2IU0 A;  3QVN A;  4R7C A;  1BT8 A;  1VQ9 V;  4FFK A;  1ZL8 B;  3STZ C;  5DEC A;  1FXK B;  2ZR3 A;  5IY5 B;  1Q43 A;  4PV1 B;  3AK3 A;  1AP5 A;  5CB4 A;  1XMQ B;  1W0J G;  4WFH A;  4OPH A;  2BCC H;  3CCV V;  3VBB A;  4YIP A;  4FMT A;  4CH6 A;  1NTM H;  2QWP B;  5IYB O;  1TGO A;  3MHH C;  5LGT A;  4BWA A;  5BY1 A;  3E2E A;  4UCU A;  3N2G A;  2UU9 O;  1I5X A;  3T1H O;  1N34 O;  2E5L B;  5JCO C;  3BCC H;  2LP7 A;  5CMU A;  4I4T B;  1TUB B;  2XT9 A;  4F4L A;  4P9P A;  3ETD A;  4GZR B;  3VQW A;  4X9Q A;  3ZJZ A;  2RMK B;  1Y74 B;  1HNZ O;  3DC6 A;  3JAL B;  5KX5 B;  1P4R A;  1M4U A;  4PA6 A;  1QQC A;  4JTD B;  4MVM A;  1Y6X A;  4UV8 A;  1KBH A;  4CS3 A;  2IJK A;  2QWN B;  5DED A;  1NZ6 A;  1WAZ A;  3G67 A;  1SQF A;  1JX9 A;  3ML0 A;  4PI2 A;  3FX7 A;  5FLX N;  4DV0 O;  1VQ8 V;  4LNU A;  3UM7 A;  3ZCC A;  3UQ8 A;  2RCV A;  1AR1 B;  4BW9 A;  4K0K O;  4IYH A;  4X66 B;  2OTJ V;  3ICX A;  5DN6 G;  4LFB O;  2DWE C;  1GN4 A;  1OCZ B;  1SQG A;  4FLU A;  2VS0 A;  2EIL C;  2YXL A;  4DYL A;  3ZMS A;  1XMO O;  2AGA A;  2DYR B;  1M56 C;  2CH7 A;  4GYC B;  1H2K A;  3B77 A;  4DV5 O;  4OX9 B;  3CS5 A;  4ZI7 A;  4EB6 A;  3GWK C;  3X2Q C;  3N2G B;  4DV4 O;  2KG7 A;  1TAE A;  1KQS U;  1NH2 B;  2LW7 A;  1DLB A;  1NH2 D;  2RNB A;  2HKO A;  5JQG A;  4KUM A;  2JK5 C;  2ATK C;  3E8H A;  5IE9 A;  1BZK A;  3SYP A;  3K5M A;  1YIJ V;  4MVO A;  1EZJ A;  4FLX A;  2BOC C;  1JPX A;  3M99 B;  4HZ3 A;  1NTK H;  1RPR A;  1K73 W;  2HJF C;  3WU2 Z;  1VIB A;  1Q5O A;  1BL8 A;  2QWR B;  1AR5 A;  2ODM A;  4PDL A;  3NXS A;  4TV8 A;  5CN0 A;  1IBK B;  3OMN B;  3UCS C;  3CXC U;  4PEL A;  3W7U A;  4LF9 B;  4L87 A;  4F6R A;  3CCS V;  4CS4 A;  4I9W A;  4UB8 Z;  3KCX A;  1YF2 A;  4JYC A;  1PNK A;  1G1X B;  4LNU B;  3ZRW A;  3BAB A;  1J5E B;  3LDE A;  1YHQ V;  1N36 B;  3RYH A;  5IJ0 A;  4FZ1 A;  1VQK V;  4JGS A;  3SYA A;  4JI1 B;  3HKE A;  4DV1 B;  3C3S A;  2GTA A;  4G28 B;  1D5N A;  4DRX A;  2CH7 B;  3ZED A;  2CDY A;  2ARH A;  2M7W A;  4MVZ A;  4ZI7 B;  3ETQ A;  4DUY O;  4ZOL A;  4EB6 B;  1EN4 A;  1Q6I A;  2A0L A;  4KHP O;  1FXV A;  3A0H Z;  4FLT A;  2OT5 A;  1QLN A;  2ITD C;  2EIL B;  5H9C A;  4O4I B;  2XAQ A;  1Z5W A;  3DTU B;  4ZKI A;  2Y4U A;  1YVW A;  3UKM A;  5JQG B;  3H1K H;  3E8F A;  1VQ5 V;  3JCZ A;  2LFS A;  2Y69 C;  2YS8 A;  1VEW A;  2E3C A;  3LSU A;  1MZF A;  1OCO C;  4YJ3 A;  1SZT A;  3HPL C;  4JPR A;  4QPJ A;  4X1K A;  3T1Y B;  5LXT A;  1XNR B;  4TV8 B;  3LDC A;  2FYU H;  5KHH A;  4U7O A;  4DR3 B;  1H8H G;  3K5O A;  5KLV H;  4CH5 A;  1B3Q A;  4DR7 O;  2ZE8 A;  4JI8 O;  3ZMZ A;  1N33 B;  2FL4 A;  4B3S O;  3HKB A;  1S3J A;  4TV9 A;  1SZX A;  3B4S A;  3ASN B;  3FB7 C;  3ZRW B;  2ZXW C;  2W0F C;  1IX9 A;  1ORQ C;  3OUF A;  1I0H A;  3RYH B;  5IJ0 B;  2W0X A;  3RT3 C;  3HKE B;  1ZX3 A;  3AG1 C;  4MVQ A;  2Y4T A;  2WWW A;  4UFZ A;  5CA1 A;  3L71 H;  2DQ0 A;  4DRX B;  4DXW A;  1B04 A;  1E79 G;  5L3D A;  5LYJ A;  3JD4 A;  3JAM N;  3L74 H;  3AG2 C;  4HAM A;  1XQ8 A;  3HKD A;  4ZOL B;  5CBG A;  1HNX B;  3KKY A;  1BGY H;  2P7T C;  3OTO B;  2OIG A;  1XL4 A;  2ZNJ A;  2YXY A;  4BIZ A;  1PD3 A;  3I5D A;  4X62 O;  4B3T O;  2EZO A;  4U7N A;  4MW3 A;  3THO A;  3ZBH A;  3LSS A;  4B3R O;  5LA6 A;  5CA0 A;  4R6Z A;  2JVD A;  2QM7 A;  2F4V B;  1I94 O;  4YJ3 B;  4KXR A;  1AR4 A;  4X1K B;  1IBL B;  1MAB G;  3KG2 A;  1FJG O;  2PY5 A;  5LXT B;  1M57 C;  1US6 A;  1G8M A;  5L3B A;  4O4L A;  5LHG A;  4TQD A;  3AK2 A;  4TSF G;  3HKB B;  5EK0 A;  4TV9 B;  2OTL V;  5LP6 A;  1Q7Y W;  2VQF O;  3CE2 A;  2N05 A;  2ZM6 O;  2DN9 A;  1NTZ H;  2Y69 B;  1XRE A;  2VQE B;  4O4H A;  4NTW A;  4DV6 B;  4XDL A;  2ETN A;  2NR5 A;  1S5J A;  1VQM V;  1ZTE A;  3A8T A;  3B40 A;  4PA9 A;  4GKK B;  5BMV A;  3ZRS A;  3IJ4 A;  5CA1 B;  3QNE A;  3BEH A;  1R6K A;  4Q6G A;  1WA8 A;  4DV7 O;  5LYJ B;  1F7Y A;  4FLV A;  1JFF B;  3BRC A;  4NXN B;  2R9A A;  3JYC A;  3HKD B;  5IDJ A;  2ZXW B;  4DUZ B;  1R1B A;  4UCR A;  4FM2 A;  1IZ3 A;  2ADQ B;  1HNW B;  1UJW B;  1PPJ H;  1YTF D;  4J9Y B;  5KHJ A;  2AHY A;  3B09 A;  3SJB C;  2IBZ H;  1YSC A;  4NB5 A;  5BR8 B;  1NR7 A;  2YIB D;  1NBM G;  3N27 A;  2Q69 A;  2YDE A;  1GN6 A;  4CH3 A;  2YIC A;  5LA6 B;  5CA0 B;  4WF9 V;  5CBF A;  1ZWI C;  1JR9 A;  2VWK A;  2UXD O;  2BTO A;  4KP4 A;  3CCE V;  4MTF A;  5JWP A;  4O4L B;  3UO2 A;  4Z1M G;  2RN9 A;  3Q4H A;  1GM7 A;  4LFA O;  3OT7 A;  5IY5 C;  5LP6 B;  4PA7 A;  5B5E Z;  4X1I A;  2IU3 A;  2PGG A;  3HKC A;  1M93 A;  3SDL A;  5KMG A;  1RSO B;  4UCS A;  2R70 A;  1GAX A;  5EYP A;  3CCL V;  3CC2 V;  1GRJ A;  3SJC C;  2RQ6 A;  5BMV B;  1JQ0 A;  3FAV A;  4MS2 A;  1VQL V;  2O57 A;  4PDR A;  1KB9 F;  5FNV A;  1WA8 B;  4ASU G;  1XMQ O;  4FIP C;  2K9P A;  4TOI A;  1YEW A;  4QIW F;  3TGU H;  4DV3 O;  1SS3 A;  3BVO A;  1S72 V;  4DR4 B;  3ABK C;  5KHK A;  3QG5 A;  1F4N A;  4JI5 B;  2YEV A;  5LGN A;  3TET A;  5KUK A;  4P2Z A;  1KC8 W;  5EC1 C;  4OPA A;  3FYI B;  4ZBM A;  4LH7 A;  2E5L O;  1B6Q A;  1QCE A;  2EIM B;  2QTS A;  3H1I H;  5B1A C;  5LHI A;  2NLJ C;  3FYE B;  4LP8 A;  4CS2 A;  3OM3 B;  4JI6 B;  4LCU C;  1Q90 D;  1RPO A;  4JYY A;  4UV9 A;  1VF5 B;  4J7J A;  1Z2G A;  1QU7 A;  2QKS A;  3Q4H B;  2EX3 A;  1SKV A;  1YDX A;  5KX5 A;  3R66 A;  2DQ3 A;  5EBM C;  3CD6 V;  1SA0 A;  1B06 A;  4X1I B;  4HNA A;  1Q6U A;  1OCZ C;  2P6J A;  3HKC B;  5KMG B;  1FAF A;  1NU1 H;  1O9G A;  4YJ2 B;  5TIS Z;  4NXM B;  1BQZ A;  4LFC O;  3VQX A;  4NKG B;  1JVM A;  5EYP B;  4X8A A;  4BR6 A;  3FAV B;  4X66 O;  4QJF B;  4PI0 A;  5FNV B;  4IL6 Z;  2Q68 A;  4JYA B;  3CPW U;  4JI0 B;  3MAQ A;  2AW9 A;  4BW5 A;  3FB8 C;  1K5Q A;  5LHH A;  4LF6 B;  2PI4 A;  1AI4 A;  5J2T B;  2EIK C;  4DV2 B;  3ZMU A;  1S5L Z;  2LJ2 A;  4OX9 O;  2H8P C;  1XL6 A;  4DO2 A;  3AG7 A;  1HR0 B;  5B66 Z;  4H0L B;  4TUY A;  2YEV B;  1QNM A;  3HR0 A;  3FKS G;  1FFX B;  5LMN O;  3H1H H;  1NR1 A;  3W7T A;  2XAS A;  2HVJ C;  5JJJ B;  2GUZ B;  3AK1 A;  4JI3 B;  3OFN G;  2GSM B;  3ABK B;  5KAF Z;  1QR9 A;  3JD3 A;  5EIB D;  2ZR2 A;  3SYC A;  4B7E A;  2ZD9 A;  3M8A A;  1U96 A;  2IJH A;  3SPI A;  4FJC C;  2FB5 A;  2KKW A;  5IWA O;  3G4S V;  4DR1 O;  4J11 A;  4G27 B;  1SA0 B;  2F95 B;  4HNA B;  2WA4 A;  3ZIA G;  3I55 V;  4LF9 O;  5B1A B;  2GDS A;  3D3I A;  2Q6A A;  5GTH Z;  2QWQ B;  3PJS K;  1WP7 A;  3D8C A;  2UUC O;  5C8Y A;  2GV9 A;  4K8X A;  2XAF A;  5KHI A;  4CH4 A;  3C3T A;  1EFR G;  3CRM A;  2AXT Z;  4B7K A;  1J5E O;  3L9D A;  4RO2 A;  1SER A;  1N36 O;  4LF8 B;  3JAT A;  2V1D A;  4UXN A;  2Q7G A;  4JI1 O;  4DV1 O;  1V9P A;  2N04 A;  4LF5 B;  1EN6 A;  5A2Q N;  5B1O A;  1K9M W;  3SPC A;  2PYL A;  2WLJ A;  2P4K A;  2Z3Y A;  4Z1V A;  5FL7 G;  1YJN V;  2R72 A;  1Q86 W;  3MDS A;  2XAH A;  2DWD C;  2E74 B;  2BE3 A;  2ZE6 A;  4TUY B;  4UVA A;  4TT3 G;  3TXQ A;  3P30 A;  1JCH A;  2A7W A;  2UUB B;  4AQY B;  1WP8 A;  2IM9 A;  2F1M A;  2A3Q A;  2Q4P A;  4LH6 A;  1R73 A;  2P67 A;  1GN2 A;  5IYC O;  1YJW V;  1JA8 A;  4BIO A;  1U97 A;  3ASO C;  2EIK B;  3ZHU A;  1KKD A;  1AVM A;  3ZMT A;  4O4I A;  2HHH O;  1AIL A;  1EBO A;  3AG4 B;  2A79 B;  3ASN C;  4BIU A;  2F23 A;  4I9Q A;  3T1Y O;  1VF7 A;  4GKJ B;  1PNM A;  1XNR O;  4YIO A;  4P30 A;  4DR3 O;  1VQ7 V;  1IXM A;  1ZUQ A;  1N33 O;  1H2L A;  2NN4 A;  4X65 B;  4ZHQ B;  5C8Y B;  3IC9 A;  3QF7 A;  3ABL B;  2MK3 A;  5C93 A;  2LGW A;  4TQF A;  3A0B Z;  1YIT V;  3CEI A;  3JAT B;  1PKX A;  2AZ2 A;  5IYZ A;  3RGB A;  4RQE A;  3RFR A;  4PHZ A;  1SQP H;  2PZS A;  2KSD A;  1QVF U;  1MNG A;  3EHB B;  2DJV A;  4LF7 B;  2ZQM A;  2DMX A;  4OXS A;  3WG7 B;  2QR4 A;  1WB8 A;  1HP8 A;  2X6C A;  1DK1 A;  2BSK A;  3KZI Z;  1MSD A;  4LF4 B;  1OCC C;  4GX1 A;  4LR3 A;  2XND G;  1H2N A;  3BHP A;  3K9S A;  5IYD O;  3L70 H;  3OTO O;  3E86 A;  2D3O W;  4OGQ B;  1FKA O;  1WLE A;  2WAM A;  4X1Y A;  4DR2 B;  1OCR B;  1E1Q G;  4ICG A;  2HFE C;  2L35 A;  3LNM B;  2HLD G;  1XMO B;  5BXZ A;  2OYQ A;  1QHT A;  2F4V O;  3W7W A;  1IBL O;  3R65 A;  1XUQ A;  4LBE C;  1H2S B;  4BAY A;  1IVS A;  2Q7H A;  3E35 A;  2Y0I A;  2P90 A;  5HFL A;  2YC0 A;  1NQT A;  3ASO B;  2OCH A;  5B1N A;  2QDO A;  2HR3 A;  3T1C A;  5L3E A;  4A5U B;  3OGI B;  4FLY A;  5KHG A;  4DV6 O;  1DF5 A;  3DSQ A;  4YHH B;  5IYZ B;  3QO8 A;  4NTX A;  4K3A A;  3K0D A;  3JD2 A;  1IBM B;  1I08 A;  2YUA A;  3LDD A;  1AJQ A;  1D5A A;  1THZ A;  1NT2 B;  2Q73 A;  4DR5 B;  4QGP A;  1BMF G;  1I7F A;  4NXN O;  3K79 A;  4J7K A;  1VF6 C;  2BSK B;  3APO A;  1TVK A;  4DUZ O;  1JFF A;  4MVS A;  1N32 O;  2IJI A;  2YID A;  1HNW O;  2V4D A;  3QO5 A;  2XUM A;  3CJH A;  4X1Y B;  1XOU A;  2P06 A;  4EEQ A;  3STL C;  1V55 B;  3EXA A;  5BR8 O;  1GH6 A;  2YI9 A;  1GM9 A;  2UXC B;  2CTW A;  4PJ0 Z;  1VF6 A;  5LP6 C;  2YIB A;  4JTC B;  2JS5 A;  3ZS8 C;  1MSW D;  1MZE A;  1OCC B;  1F51 A;  2EJ7 A;  2OCC B;  3E22 A;  4DUY B;  4NTY A;  1RP3 B;  2UXN A;  4FZ0 A;  4B3M O;  1G6U A;  2JGD B;  2WLH A;  1R3J C;  2ZIN A;  1I5Y A;  2W6J G;  2YIA A;  1LR1 A;  4XBF A;  4KL1 A;  2Z0A A;  5K1P A;  4JI4 B;  1XDC A;  4K35 A;  1UPG A;  4X89 A;  1HDJ A;  4O4J A;  5IT9 N;  2HEP A;  1EZV H;  3P3N A;  2UXB B;  1RSO A;  4NR1 A;  3QO7 A;  3J80 N;  4WFE A;  2DYS C;  3HB3 B;  3SPG A;  3B8M A;  1ARO P;  2Y48 A;  3H1J H;  2ITC C;  3T4Z A;  4JZ2 A;  2JEX A;  1SQB H;  5FPR A;  4D6T H;  2CTR A;  1K3E A;  1Z5V A;  4J80 A;  1H38 A;  1H2M A;  4B3S B;  1TVK B;  2WA3 A;  1AP6 A;  3WB0 A;  1VQ4 V;  3SYO A;  2EIM C;  5AG2 A;  4DR4 O;  4EKW A;  1F23 A;  1BSM A;  1MMM A;  1YXB A;  1GTO A;  2FTK A;  3CJH B;  1K5S A;  1M9N A;  4JZG A;  2F43 G;  4IHJ A;  4DK0 A;  1YTF B;  4QE7 A;  1F4M A;  2JRI A;  5D5P A;  3K9A A;  1IXB A;  4DK1 A;  4H33 A;  3AEI A;  3E22 B;  2X6B A;  4MW8 A;  3S3X A;  4X64 B;  1XNQ O;  2LO1 A;  4L8J A;  1SET A;  3K5N A;  3M7M X;  1AB3 A;  5K1X A;  5LBQ A;  3B2E E;  3SR2 C;  3CB2 A;  1V54 B;  4X62 B;  4P9O A;  2LW1 A;  4KFM A;  4IYI A;  1Q3E A;  4O4J B;  3O65 A;  3OR6 C;  1SF9 A;  3CYO A;  4B3R B;  4NXM O;  2QGN A;  4D7T A;  5GW7 A;  1XBL A;  1Q82 W;  1QR8 A;  4YJ2 A;  3K03 A;  2N74 A;  4WFA V;  2AHZ A;  2L6L A;  1TA8 A;  1PV0 A;  1X4T A;  4JYA O;  4W4K A;  1Y76 A;  3DXR A;  5EBW C;  4LF6 O;  3ZMV A;  4HBN A;  4PDV A;  5KUM A;  4DV2 O;  1NJI W;  1K92 A;  4IT5 A;  4JI7 B;  3RWR D;  2CTQ A;  5J2U A;  5J2T A;  4LWS A;  1HR0 O;  3CMA V;  1FYJ A;  2DYS B;  2X0L A;  5EIB C;  3KCY A;  4IHJ B;  1BHB A;  4JV5 B;  1XIL A;  3ETE A;  3CC4 V;  3K3W A;  1XEQ A;  2FKX A;  2KQX A;  5KA6 A;  1FFX A;  4AIL C;  4FPP A;  4WCE V;  4DW1 A;  1K4D C;  4FLZ A;  4DR6 B;  4MSW C;  4JI3 O;  3K5L A;  2GUZ A;  1PL4 A;  1KKC A;  4E4E A;  3F7V C;  2UXX A;  2IJJ A;  2QWO B;  3G6E V;  1Q6H A;  3B8N A;  4ABM A;  4JF3 A;  1PL0 A;  1Q8I A;  3VQY A;  1O9H A;  3SPH A;  4XDK A;  4JI2 B;  3CCR V;  4JTA B;  1SRY A;  2B5U A;  1MOF A;  3FB6 C;  3ETG A;  1E1R G;  2UUA B;  3CXH F;  2QKC A;  4D7S A;  2QA4 V;  4CC5 A;  3H9V A;  1SES A;  1SQQ H;  3SJQ C;  3JAK A;  3MHS C;  5EBL C;  3ABT A;  3LUT B;  3BFR A;  2OIE A;  4UCO A;  1OHH G;  4NYK A;  4LF5 O;  5CA3 A;  5FPO A;  1YZB A;  5EC2 C;  1Y76 B;  3DXR B;  3FB5 C;  2RDC A;  1R6N A;  1Y4M A;  5E1A C;  5J2U B;  4LWS B;  4RUE A;  5LMU B;  3EVK A;  3GVM A;  2KB1 A;  2UUB O;  1P49 A;  4RWU A;  4AQY O;  3AG4 C;  1UFI A;  3K58 A;  3G80 A;  2GTS A;  1H8E G;  4YY3 B;  3CRQ A;  1AI7 A;  4HYO A;  4MT8 A;  3VOU A;  2EIN B;  2WLI A;  1R3K C;  1TUE B;  3RYF A;  1KUQ A;  2HVK C;  1KU9 A;  2M6Y A;  4DV3 B;  5J9P C;  2QM8 A;  1OJH A;  3ABL C;  1K33 A;  4GKJ O;  5IJ9 A;  3W7X A;  5H5N A;  2YI8 A;  1VQ6 V;  1EN5 A;  1BS3 A;  1L0L H;  2E76 B;  4Q20 A;  3ABM B;  3SPJ A;  2YSU B;  4EFE A;  1IBK O;  3OAA G;  3S3W A;  2BTQ A;  4X65 O;  2PUS A;  4PA3 A;  1ZAU A;  3CCQ V;  4ZHQ A;  2K1E A;  1FD9 A;  1R3I C;  3JAK B;  3WG7 C;  3A2F A;  3AG3 C;  1ZLZ A;  3P3P A;  3J7A U;  1R6T A;  2VRZ A;  4GLX A;  1VAR A;  2GHY A;  5ITZ A;  4GX0 A;  2JS3 A;  4AI8 A;  3MD0 A;  2ZT9 B;  3OTF A;  4MTG A;  1L8D A;  2JDI G;  4UCV A;  5GON A;  4LF7 O;  4GT1 A;  1OCR C;  3D3Q A;  5JCO A;  3IC7 A;  1YI2 V;  4RUF A;  4J9Z B;  4LF4 O;  4MTX A;  1FXH A;  3JD0 A;  2JJ1 G;  1AI5 A;  1S5H C;  2VWJ A;  3I56 V;  4LFC B;  3IAY A;  3J81 N; 
#chains in the Genus database with same CATH homology
 1U96 A;  1HP8 A;  1Z2G A;  2LGQ A;  2RNB A;  2HP8 A;  2RN9 A;  1U97 A;  2LQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...