1HP8A

Solution structure of human p8-mtcp1, a cysteine-rich protein encoded by the mtcp1 oncogene,reveals a new alpha-helical assembly motif, nmr, minimized average structure
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
68
structure length
68
Chain Sequence
MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cysteine motif
molecule keywords HU-P8
publication title Solution structure of human p8MTCP1, a cysteine-rich protein encoded by the MTCP1 oncogene, reveals a new alpha-helical assembly motif.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1997-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08991 MTCP1 Mature-T-Cell Proliferation I type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1130 Mainly Alpha Orthogonal Bundle Helix Hairpins CytochromE C oxidase copper chaperone 1hp8A00
2RNBA 1U96A 1Z2GA 2LQTA 2RN9A 1U97A 1HP8A 2LGQA 2HP8A
chains in the Genus database with same CATH superfamily
3F5TA 5KHJA 2WLNA 1KUQA 3FB8C 4FFBB 1HNZO 1F4MA 3LDDA 4X1KB 4N23A 1FAFA 2QR4A 3CP1A 5CBHA 3K5OA 1NVPD 1EZJA 3BA8A 3BY6A 5J2TA 2ZR2A 5BXZA 3MHHC 3WFVA 1AJNA 5BMVB 1I94B 4GLXA 5EBWC 4I0XB 3X2QB 4JI4B 2AXTZ 1GM9A 4B08A 1YITV 4W4KA 2DQ3A 2Q7HA 4NKGB 1JQ0A 4MTGA 4HYOA 3ZRWA 3W7XA 1R3LC 1VARA 1COWG 2WWWA 3ZMSA 4X64O 1N32B 4I9WA 4KP4A 3RVYA 5EZYA 5BY1A 4GUNA 4LCUC 4MT8A 1VF7A 2HFEC 2X0LA 3EFFK 1SS3A 1M57C 4LR3A 2W6IG 2ZM6O 1SQGA 1V54C 1WLEA 1MZEA 4GKJB 4NXNB 3E8FA 4BR6A 3MAQA 4FM0A 4U7NA 5EYPB 1WNSA 1S5HC 2HVJC 3ZX6A 4O4IB 1Q7YW 1B3QA 1W59A 4J9YB 2LFRA 1OCOC 3K5MA 4QE9A 1VQ4V 4UCUA 2Q0AA 3FB5C 4UVBA 2NN4A 3ICXA 1E1RG 4P2ZA 4X65O 2BTOA 3ZHQA 5H9CA 4WFFA 2L35A 3AG3B 4JI6B 2QWRB 4JI3O 1K4CC 3CSXA 1SQVH 4A5UB 3JASA 4JV5O 3OAAG 4PDVA 1R6KA 4PJ0Z 4DR7O 2ZE7A 5EC2C 5DEDA 3UM7A 1KKCA 5EK0A 1SA0A 2EIMB 1R3JC 3FYIB 2MW2B 1QBZA 3P3NA 4JGSA 3HKDA 1YVWA 1OHHG 1OCZB 2UXCO 3DXRA 4O4JA 4DUYB 3BRCA 1AI6A 3BPZA 3ZHRA 5CA0B 4FM2A 3HKEA 1Y66A 1QLEC 1JCHA 4X20A 2OTJV 4JYAO 4JI8O 1XDCA 4PI2A 4K8ZA 1VQ7V 2R9RB 3FAVB 2JGDA 4P30A 4WCEV 1HNWB 4KUMA 5LP6B 3NR7A 4JI1B 5KHIA 4UCRA 1MA1A 4G28B 1XQ8A 5JH7A 3N2KB 4UCTA 4UB8Z 1N34O 3JATA 5CBGA 4PDMA 1X4TA 3L9DA 2ZXWC 4CS4A 3ABMB 1NVPB 2E75B 1Y74B 2Q69A 2IJIA 4UCVA 4WF9V 4FLWA 1UFIA 4JYYA 1K4DC 4DV3O 1VQPV 2GUZB 2DN9A 5IJ0B 4LF4O 1I08A 4RAIA 1HP8A 4J7KA 1JA8A 3VQXA 1L1FA 3CJHA 1X59A 3P3PA 1PV0A 3K5LA 5A9GA 1EZVH 2PI5A 4O4HA 1HNXO 5J2UB 3G71V 3U0ZA 4BW9A 5KAFZ 4X64B 4X88A 3FKSG 1M9NA 2ARHA 3UT5A 2LW7A 3TJTA 5HFMA 2X6BA 2QJ1A 4LC1A 5L3GA 2HVKC 4UVCA 2ZNIA 2DE0X 3D3QA 2ZM6B 4X1IB 2XAHA 4CBCA 1WPXA 4K35A 2VQEO 2ZINA 3RYHB 4FIPC 5B1BC 2GDSA 4F6RA 3CCSV 4AQYB 3S3XA 3ZCCA 3FB7C 1W0KG 5BR8O 1Q6IA 4JTCB 2BOBC 2HHHB 2LO1A 4FLVA 2GV9A 5FNVA 2JVDA 3SPIA 1TVKA 2ZNJA 2QKAA 3KCYA 1XNRO 3ZEDA 4X65B 1AI4A 1QR9A 3IFXA 1M57B 3NXSA 4JYCA 3BCCH 4YJ3B 1GM7A 4JI3B 1WAZA 1V54B 1PM9A 2HJDA 4DV6O 4X1YA 2WAMA 1K92A 4J10A 4JV5B 2GBOA 4H37A 3VQVA 5IJ9B 4KL1A 1Y67A 1VF6C 3K9AA 5IY5B 3SJCC 4TT3G 3CCMV 4DR7B 4ASUG 2ATKC 3SPCA 4FLUA 5CB4B 2YDEA 2PYJA 2NLJC 3ETQA 1OCRC 1KD1W 5E1AC 3E8GA 1OCOB 4JPRA 3CRRA 4X1KA 4NXMO 1B06A 1H8HG 4JASA 4Z1MG 4NR1A 2JDIG 2KB1A 1XHZA 2UXCB 2L6LA 1K7DA 1VEWA 3H9VA 2OCCC 4JI8B 5LMNO 1D5AA 3IC7A 2JGUA 4LF8O 4ZHQB 4XDKA 3D8CA 1J95A 2BSKB 3X2QC 3EVKA 4LFCO 4D6TH 2YSUB 1Z5WA 4TQDA 3WB0A 1N34B 3N2GA 5GTHZ 4NTWA 3UO2A 1IURA 4OX9B 3RBZA 4J7JA 1W0JG 4WBNB 1ROPA 1B6QA 4QPJA 4DR4O 5KHKA 5KA6A 4DR2O 3RYIB 2A79B 2WLLB 4IT5A 5F2VO 1JMKC 4IYIA 1H38A 4DV3B 1IXMA 4J7ZA 4IL6Z 5EYPA 2CE4A 3DC6A 3M99B 4KHPO 2DOSA 4UB6Z 4O4IA 2P5OA 5H5NA 3OW2U 3RYFB 1WJZA 1FS0G 3FYEB 1UJWB 2BTQB 3CCRV 3AG2C 2ZXWB 2XAFA 2Y0IA 3JSNA 2FYUH 2MK3A 3ASNB 2AGAA 2P22C 3H1LH 1HNXB 3O9OA 3ZHVA 1THZA 4LNUB 2ZDIC 4UFZA 2WLIB 5KLVH 4R50A 1BHAA 1L8DA 2ITDC 2YXHA 5LHGA 5IYCO 3K06A 1YEWA 4CZZA 2Q9LA 1PKXA 3AG3C 2F95B 2Z0AA 1BE3H 2AHZA 3G6BA 4NTXA 2VQEB 4C7UA 2XASA 1JOYA 3TXSA 3CMEV 3IC9A 1K8AW 5KUMA 3CCJV 2GTAA 1N8RW 4DW0A 3FB6C 5GONB 1U96A 2Z5UA 3ZMZA 5CA0A 3CCLV 4EKWA 4OGQB 2UXXA 5LBQA 1BQ0A 2Q7EA 1XNRB 4PA9A 1N33O 2JIZG 4LH7A 5A2QN 3AK3A 2DYRC 3FAVA 1XHXA 4FVMA 5LP6A 1ZUQA 4IGGA 2JEUA 1NR7A 4CH4A 5B3SB 5LMUO 3SJQC 3SDLA 3N2KA 4DV6B 5B1BB 3JAWB 2ADPA 5E79Z 2P67A 1TUEB 5DN6G 3B09A 1Y74A 1OCCC 1VQMV 3E8HA 4UCOA 1KC8W 3AK1A 4DR3O 1LNQA 4ICGA 3E89A 3K08A 1BGYH 1XI1A 2Q7GA 4NXMB 1NR1A 5IWAO 1P7BA 1NS1A 3W7WA 2Y4UA 3K58A 2OYQA 1M93A 4JI7O 3CCUV 4DW1A 3D36A 4LF6O 2WA4A 4QNHB 2CK3G 5LMNB 1OJHA 4LF8B 2ZQMA 2C2AA 2Y69C 5BZBA 2FTKA 4MVZA 4LFCB 2HP8A 3QNEA 1SESA 1PPJH 1OCRB 3D36C 1AI7A 4JI5O 3AG1B 5J2UA 1PL0A 2OTLV 3T1HO 5FPRA 4B3TO 2ZE8A 1Q5OA 4BIZA 3OMIB 2CAZC 2IJJA 3A0BZ 5L3EA 2B1IA 3F5WC 3H1JH 3B2EE 3ZMVA 1MOFA 1S5JA 4TV9B 1Y76B 1WN7A 2N74A 1JJ2U 2AW9A 4DR4B 3N27A 3L74H 4DR2B 2OCCB 4JAUA 4PDRA 1SZXA 1KBHA 5B1AC 3RYHA 4ZI7B 2VWJA 4HNAB 4JI0B 2H94A 1L0NH 2WLJA 1BHBA 1FFTB 3EHBB 3TETA 5JJEB 1O9HA 1XILA 3I5DA 5JQGB 2YEVB 4KHPB 2JS3A 1V55C 5DM6V 3ZJZA 2M6YA 4QE7A 3OGIB 5EIBD 3ETGA 2CUGA 2EIJB 1H2LA 5JVDB 2X7RB 1GM8A 3B77A 3LSUA 1BL8A 4RQFA 5LGUA 3CRCA 3LDEA 3IJ4A 4PDLA 3S3WA 5DECA 5B66Z 1YF2A 4U3JA 2ETNA 3FFQA 2QWQB 2ZCEA 2IH3C 3K5NA 2W6JG 4X8AA 3T1CA 4B3MO 4MW8A 5IJ9A 1XMOO 3SPJA 3CRAA 3WG7C 1H2GA 2KSDA 5JCOC 1M90W 1FFXB 3WB2A 2CTPA 5CB4A 2EJ7A 2YIBD 1XOUA 4MVRA 2P90A 2UU9O 3AG2B 4AQYO 4XDLA 1IBLB 1KB9F 2KG7B 3ETEA 5IY5C 1SC5B 2HHHO 2ZE5A 4I4TB 1YCIA 2ZD9A 5KA5A 4CC5A 1YZBA 3K3WA 1SZTA 4PA3A 4MVUA 4GYCB 4I50A 3LSSA 1N33B 3RYCB 1CXZB 4DV2O 4ZHQA 1SQQH 4DV0B 4IIJB 2BSKA 4B7KA 3AG4C 3ETDA 2XOKG 4H33A 3J81N 4JTAB 5LL6Y 3E35A 1CP9A 5LMUB 2A0LA 2JJ2G 2EZOA 1G1XB 1NH2D 1NTZH 3JAMN 4Z1VA 4MTFA 1KECA 1K73W 3Q4HB 1BCCH 1BQZA 1AVMA 4WBNA 2XAJA 3J7AU 3JCUZ 1S3JA 4DR3B 1H2NA 1YJNV 4FLYA 3RYIA 3DGEA 3U10A 4O2BA 3WU2Z 5IWAB 4DR6O 4J11A 5LHIA 4X66O 3E22B 2DYRB 5L3DA 3CXCU 1L0LH 1P4RA 2B1GA 2QWPB 4DO2A 3AG7A 1VQNV 1QVFU 2Y48A 4TUYB 3K79A 4JI7B 3RYFA 5JJNB 4LF6B 5IYDO 2BTQA 2KQXA 3ZN0A 4GX2A 3SPHA 1B04A 4MVOA 3CCQV 3HB3B 1GK9A 1OCCB 3H01A 1JX9A 2M7WA 2Z3YA 5K1XA 4JI5B 3L72H 4LNUA 1HWYA 3PJSK 3T1HB 4OX9O 4B3TB 4AILC 4LH6A 5J9PC 3ASNC 3ZRSA 1R3IC 5L3FA 3JD3A 2V1DA 3P30A 4MS2A 3M8AA 1PNMA 1KQSU 1SRYA 3HKCA 4IHJB 4P9OA 2N05A 3JYCA 3D3IA 1YHQV 5L3BA 2Y69B 5KX5B 1SQFA 1JFFB 3ASOC 3G6EV 4JTDB 2ZIOA 2ZR3A 1R3KC 2PI4A 2EILC 2XUMA 5JWPA 1BSMA 4H0LB 1Y4MA 3KCXA 3ABKC 4X9QA 4I5SA 4U3FH 4GCZA 1XUQA 4AHCA 4YIPA 4WFAV 4Q6GA 2ODMA 3A2FA 5ITZB 1G8MA 1H2MA 5B1AB 3K59A 2ZE6A 5LXTA 2B5UA 2X6CA 1IBKO 4O2AB 4FPPA 3JD0A 3QO5A 4B3MB 3JAWA 1QR8A 2HLDG 1XMOB 2JS5A 2BE3A 1V55B 1FXKC 5B3SC 1YSCA 3SYQA 3OGCC 1Q82W 2UU9B 2QM4A 2HR3A 4F4LA 4BIUA 1Q86W 2F4VO 1H8EG 5LGTA 1Q6UA 3ZHTA 3BHPA 3HPLC 3TCUA 4I7ZB 3JARB 4RO2A 4YXWG 5AG2A 3F7VC 4DYLA 1AP6A 1FXVA 4DK0A 2AHYA 5L3CA 1XBLA 2UUBO 3CC4V 3ZHSA 1K97A 4PA4A 3CC2V 1KMIZ 4YY3O 4DV2B 1VF6A 2WLKA 3G67A 1DTOA 3WG7B 4R6ZA 4D7TA 1JPXA 2LGWA 4NVPA 1ENVA 1I5YA 3JD1A 4LP8A 1F7YA 4L8JA 2YC0A 2ZT9B 1P49A 5CMUA 3KZIZ 4RWUA 1ORQC 4FFBA 4TV9A 2HJFC 5FL7G 2P4VA 4JF3A 4I9QA 3DTUB 3AG1C 1H2KA 1LUVA 2CH7B 1GO3F 1BS3A 1U97A 2R72A 5EZYB 2IW5A 1VP7A 2ZKOA 4OPAA 1MZFA 1AR5A 1YI2V 4FJCC 1QHTA 4ZI7A 4DR6B 5FLXN 2OIEA 4MVMA 4X66B 3SJBC 5TISZ 3H1HH 3ZS8C 5BMVA 5LOVB 1M1KW 3CC7V 4EB6B 4ZOLB 4I0XA 5JQGA 3AG4B 3MHSC 1DLBA 4CS2A 3OFNG 4UCSA 3LNMB 1SQBH 1G4YB 4PELA 1JJOA 1GH6A 3ZIAG 1VQ6V 3LSQA 3CB2A 2E5LO 1IVSA 3HKBB 1Q90D 1AILA 5JVDA 4KFMA 2Y4TA 4BW5A 1E79G 1OZ0A 5D5PA 1IZ3A 1VQLV 1VQOV 3OUSA 3OD4A 2EIJC 2F66C 4FLXA 2RMKB 3QTCA 2XAGA 3JASB 1AI5A 4FFKA 1BZKA 1MSDA 4G27B 4JI0O 3SGIA 1ZL8B 1DF4A 2LP7A 2CTWA 3CCEV 2KG7A 3JSLA 1N36O 4I4TA 4GX1A 3CMAV 1QNMA 4H13B 1RPRA 3APOA 4MVQA 1Z5VA 2ZDIA 1LR1A 4DUZO 1ZX3A 4XBFA 5LYJB 2XAQA 3RYCA 4DR1O 3L73H 5C93A 1KP2A 4LF7O 4R7CA 4OXSA 2PGGA 3W7TA 1F4NA 4X20B 5H2FZ 4I55B 4ZKIA 1QLNA 5FPOA 2QTOA 4FZ0A 2JGDB 5KHHA 1IBKB 2QGNA 3Q4HA 2QA4V 4EFBA 3ASOB 2P4KA 3R65A 2UUAO 4GX5A 2HEPA 1SETA 2EILB 3VQWA 1IBLO 4DR5B 2Q73A 1MG1A 1EN6A 2F4VB 1WB7A 3ABKB 4JI2O 3E22A 1KYOF 1I0HA 1YDXA 4BIOA 4NTYA 3KKYA 4P9PA 2FL4A 4ZIBA 4LFBO 2EJRA 3KG2A 4TUYA 3G4SV 2QKSA 2A9HA 4WFHA 1ZTEA 3QG5A 1WA8B 2UUBB 2W0XA 2K1EA 2G38A 2F23A 4DV0O 4YY3B 3UKMA 1AB3A 1FXKB 2LGQA 2LJ2A 4X62O 3UO3A 5EC1C 3T4DA 1K5SA 1R1BA 1ZAUA 4O4HB 3RT3C 1VQ5V 2PY5A 4ABMA 3B4SA 3GVMA 4JZGA 3AEIA 1EFRG 2VQFB 1AR1B 4F6EA 3T2MA 3R66A 2Q5ZA 3QO7A 5HFLA 4PI0A 1NU1H 3E2EA 1QU7A 1HR0O 1US6A 2GUZA 2H3OA 4B3SB 2K9PA 1GN2A 5IJ0A 2EBOA 3K57A 5B1NA 4N21A 1A32A 4DV4B 3K0DA 3IAYA 4WFGA 5KX5A 2BOCC 4F6RB 1H2SB 4K0KO 3BA9A 1N0NA 3CHXA 5EIBC 1GKFA 1TUBB 2Y0PA 2E5LB 3K0GA 4DV7O 3G80A 1KU9A 2XT9A 5CN0A 4JZ2A 3P32A 3ABLC 2X6AA 2A3QA 1FJGO 3MD0A 2YIBA 3ML0A 5KMGB 4FMTA 2IU3A 2O57A 4HBNA 3ZRXA 2DMXA 2WSSG 2RNBA 5C8YB 1Y6XA 4YJ2B 4PV1B 4DV5O 5LA6B 4O4LB 4X1IA 4X1YB 4X89A 1M56C 1FXHA 2BCCH 4J80A 3ZN1A 1XREA 1I5XA 1RSOB 2QEXV 1R6TA 4EFEA 2CTRA 3SR2C 2PZSA 1N36B 3JARA 3OMNB 3TK1A 2WLMA 4NYKA 1PNKA 1QVGU 4TV8B 2E76B 1TGOA 4DUZB 1M5IA 3OR6C 3JD4A 4DR1B 4LF7B 2DYSC 4DRXB 2JK5C 4YJ3A 5KUKA 5JCOA 4DK1A 3WB1A 1SQXH 2GTSA 1CPYA 1XEQA 5IYZB 1IXBA 2YXLA 2ADQB 1JVMA 2DWEC 4IYHA 4PA6A 2DW4A 3F7YC 2EINC 2UUAB 3N2GB 1IBMO 4LBEC 1NT2B 4JAVA 2CH7A 2EIKB 2N04A 1GN6A 2YIDA 4GX0A 1GN3A 1VF5B 5KHGA 4JI2B 2R9AA 4LF9B 2LFSA 3OT7A 1S72V 5LOVA 1XNQO 4EB6A 4ZOLA 3CRMA 3DC5A 4FK5C 5CBFA 4LFBB 4AI8A 2UXBO 1NTMH 3K9SA 1NTKH 4GT1A 3LNNA 4MTXA 4PHZA 1QCEA 3I55V 3CD6V 1K34A 4NB5A 2IJHA 2KKWA 3VOUA 3HKBA 1ZSPA 4QIWF 1VQKV 1WB8A 4UUJC 2XTAA 3OTOO 2EULA 1RM1B 4X62B 1VIBA 1LUWA 4CH3A 1SQPH 5EBMC 3QF7A 5KAIZ 2WA3A 3RN4A 1YIJV 2E74B 3W7SA 2Q68A 3AK2A 1ZLZA 1BMFG 3RGBA 2WLLA 1RPOA 2RDCA 1HR0B 1K33A 1K5QA 1ZL8A 2YI8A 1AJQA 3JALB 4H44B 2QE7G 5CA1B 4MSWC 3CPWU 2HG5C 3BVOA 2V7QG 4LWSB 4J41A 1K3EA 4JYBA 2EX3A 2A7WA 2D3OW 1R73A 3OMAB 3GB7C 3T1YO 4K0KB 1WP8A 3JAKB 2PF4E 1NJIW 3CXHF 2F43G 3THOA 5LYJA 1HDJA 1S76D 2R9IA 4DV7B 5JJJB 1EM1A 3CE2A 1S0VA 4I55A 2IBZH 2WLIA 1XMQO 4WFBV 1Q6HA 1FJGB 4TQFA 1R6NA 1EBOA 3B40A 3JD2A 3UCSC 4UVAA 2DJVA 2CGOA 3JCZA 2R70A 2UUCO 1FPOA 4DV5B 5IT9N 1CEZA 1D5NA 3OM3B 2QM8A 5GTIZ 3VBBA 1FKAO 4R8CA 1MMMA 4BAYA 1NBMG 2YI9A 3MDSA 4MTOA 1HNZB 4TSFG 3SPGA 5GONA 3GWKC 1N0JA 3L75H 2UXDO 3QO8A 2EZPA 1YTFD 4W4LA 3GWOA 3ABLB 2PTMA 4YHHO 2GHYA 1WA8A 2ZIMA 3L70H 4GKKO 3SJAC 1NZ6A 5GW7A 1M56B 4UV9A 1YJ9V 3TGUH 4B3RO 1FXKA 1Q81W 3IGAC 2V4DA 3B8NA 3OUFA 1YXBA 1S77D 2FMLA 1D2DA 4BWAA 1G6UA 1JR9A 3L71H 2P6JA 1DGSA 5LGNA 5IYBO 1URFA 2QKCA 2F1MA 1PP9H 3CRQA 2CTQA 4PA7A 1IBMB 4WFEA 4OPHA 4DR5O 1FYJA 1F51A 1VMGA 1V9PA 2QWOB 1Q43A 1AP5A 1PL4A 2DYSB 5B5EZ 1XNQB 4K3AA 2OT5A 2YUAA 5J2TB 2PUSA 4HAMA 2UXBB 4LFAO 2RCVA 3OEEG 3RFRA 4D7SA 3BFRA 1N4CA 1NH2B 1J5EO 3ZMTA 2YS8A 2P7TC 5B1OA 1P84F 1TUBA 3DSQA 1SF9A 2EINB 2D2CB 5H6QA 4XDJA 2WLHA 1VQ8V 1M4UA 3OTOB 1DK1A 1W2BU 3H1KH 3U11A 3ZRWB 3OTFA 2RQ6A 5KMGA 2YICA 2E3CA 1K9MW 4CC6A 1Y76A 2VQFO 4J9ZB 5C8YA 1Q3EA 4YJ2A 1NI8A 2Q4PA 4U3JB 5LA6A 4O4LA 4RUEA 1WPBA 1RP3B 3CEIA 4RQEA 1Q8IA 3I56V 4KXRA 4B3SO 1EN4A 4HNAA 1IDSA 1RSOA 1O9GA 2QDOA 1NKDA 4DV4O 2YIAA 1ZWIC 3LUTB 2ILMA 1NQTA 4CS3A 4JAAA 3UQ8A 3CS5A 2YEVA 1KKDA 2CGNA 3ABUA 2NNUA 2Q67A 5EBLC 4TV8A 3T1YB 4GZRB 3SYOA 4LF5O 4ZBMA 2CDYA 3BEHA 4CH5A 5D5QA 1GMGA 3ZBHA 4DRXA 4I50B 2FKXA 2GSMB 3ZHUA 4DV1O 4JYAB 2XNDG 1DF5A 3OE7G 2F93B 1XMQB 3RW0A 4UV8A 3W7UA 5IYZA 4CH6A 4HZ3A 4FLTA 3H1IH 3VQYA 4G2KA 3BABA 2AZ2A 2UUCB 1FFXA 1AROP 2DWDC 2H8PC 4FM1A 1YTFB 3A8TA 3ZMUA 3O65A 2Q8VA 1TAEA 4FZ1A 2HKOA 2OCHA 3CX5F 1SA0B 3CYOA 2LQTA 4QGPA 2UXDB 2W0FC 1QLEB 3SYAA 4O2BB 3FX7A 3HR0A 2EIKC 4MW3A 4QPKA 3HKDB 3DXRB 2RN9A 4O4JB 4LF4B 4YHHB 1BT8A 1I94O 2Q6AA 1EN5A 3HKEB 3BAAA 1UPGA 4JI4O 3RVZA 4GKKB 4IIJA 3A0HZ 4L87A 4B3RB 5K1PA 3J80N 4E2LA 1GRJA 2NR5A 3EXAA 3OEHG 3RWRD 3QVNA 2AZ0A 5JH7B 1SKVA 4PD4F 1N32O 3K03A 3JATB 2UXNA 2IU0A 1S5LZ 3FD9A 1RM1C 2P06A 4QJFB 2QTSA 1VQ9V 4E4EA 3STLC 5H6RA 4LF9O 3C90A 3JALA 1P7GA 2IJKA 5CA1A 3M7MX 4TWKA 4YIOA 1XL4A 4UXNA 1OV9A 1YJWV 4GKJO 3HKCB 4LWSA 5IDJA 4NXNO 1GAXA 2VRZA 4LFAB 4EEQA 3SYPA 1PNLA 3TXQA 2IM9A 1F23A 3APQA 1FD9A 3JAKA 1J5EB 5BR8B 3CWBH 3LDCA 2JJ1G 2EIMC 3E83A 4TOIA 2FB5A 1AR4A 3CJHB 2VS0A 1TA8A 3A0RA 2QWNB 3OR7C 4MVSA 3K04A 2OWOA 1OCZC 4J42A 1MABG 3T4ZA 4JI6O 5CA3A 1GN4A 2JRIA 1I7FA 3UT5B 5LXTB 1QQCA 2IH1C 1WP7A 1HW7A 4IHJA 2JEXA 3C3TA 5LP6C 3SYCA 4B7EA 1IX9A 1E1QG 1JFFA 2Q0OC 2VWKA 2XHBA 4DXWA 1KP3A 2RJZA 3ABTA 4FLZA 2A06H 2ITCC 1PD3A 4K8XA 3ABMC 2OIGA 1RFYA 5LHHA 3PN1A 4DUYO 4LF5B 1MNGA 5FNVB 3C3SA 2QM7A 1TVKB 2YXYA 5IE9A 4Q20A 1AJPA 4RUFA 5ITZA 1MSWD 4Z2WA 4DV1B 2B9ZA 1GTOA 2LW1A 3CCVV 1Z2GA 3E8BA 3STZC 1HNWO 1T5EA 4O2AA 4JI1O 2DQ0A 1SERA 3E86A 3ZRVA 4U7OA 2PYLA 1XL6A 2WPDG 3B8MA 2QSAA
chains in the Genus database with same CATH topology
2RNBA 1U96A 1Z2GA 2LQTA 2RN9A 1U97A 1HP8A 2LGQA 2HP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RNB A;  1U96 A;  1Z2G A;  2LQT A;  2RN9 A;  1U97 A;  1HP8 A;  2LGQ A;  2HP8 A; 
#chains in the Genus database with same CATH topology
 3F5T A;  5KHJ A;  2WLN A;  1KUQ A;  3FB8 C;  4FFB B;  1HNZ O;  1F4M A;  3LDD A;  4X1K B;  4N23 A;  1FAF A;  2QR4 A;  3CP1 A;  5CBH A;  3K5O A;  1NVP D;  1EZJ A;  3BA8 A;  3BY6 A;  5J2T A;  2ZR2 A;  5BXZ A;  3MHH C;  3WFV A;  1AJN A;  5BMV B;  1I94 B;  4GLX A;  5EBW C;  4I0X B;  3X2Q B;  4JI4 B;  2AXT Z;  1GM9 A;  4B08 A;  1YIT V;  4W4K A;  2DQ3 A;  2Q7H A;  4NKG B;  1JQ0 A;  4MTG A;  4HYO A;  3ZRW A;  3W7X A;  1R3L C;  1VAR A;  1COW G;  2WWW A;  3ZMS A;  4X64 O;  1N32 B;  4I9W A;  4KP4 A;  3RVY A;  5EZY A;  5BY1 A;  4GUN A;  4LCU C;  4MT8 A;  1VF7 A;  2HFE C;  2X0L A;  3EFF K;  1SS3 A;  1M57 C;  4LR3 A;  2W6I G;  2ZM6 O;  1SQG A;  1V54 C;  1WLE A;  1MZE A;  4GKJ B;  4NXN B;  3E8F A;  4BR6 A;  3MAQ A;  4FM0 A;  4U7N A;  5EYP B;  1WNS A;  1S5H C;  2HVJ C;  3ZX6 A;  4O4I B;  1Q7Y W;  1B3Q A;  1W59 A;  4J9Y B;  2LFR A;  1OCO C;  3K5M A;  4QE9 A;  1VQ4 V;  4UCU A;  2Q0A A;  3FB5 C;  4UVB A;  2NN4 A;  3ICX A;  1E1R G;  4P2Z A;  4X65 O;  2BTO A;  3ZHQ A;  5H9C A;  4WFF A;  2L35 A;  3AG3 B;  4JI6 B;  2QWR B;  4JI3 O;  1K4C C;  3CSX A;  1SQV H;  4A5U B;  3JAS A;  4JV5 O;  3OAA G;  4PDV A;  1R6K A;  4PJ0 Z;  4DR7 O;  2ZE7 A;  5EC2 C;  5DED A;  3UM7 A;  1KKC A;  5EK0 A;  1SA0 A;  2EIM B;  1R3J C;  3FYI B;  2MW2 B;  1QBZ A;  3P3N A;  4JGS A;  3HKD A;  1YVW A;  1OHH G;  1OCZ B;  2UXC O;  3DXR A;  4O4J A;  4DUY B;  3BRC A;  1AI6 A;  3BPZ A;  3ZHR A;  5CA0 B;  4FM2 A;  3HKE A;  1Y66 A;  1QLE C;  1JCH A;  4X20 A;  2OTJ V;  4JYA O;  4JI8 O;  1XDC A;  4PI2 A;  4K8Z A;  1VQ7 V;  2R9R B;  3FAV B;  2JGD A;  4P30 A;  4WCE V;  1HNW B;  4KUM A;  5LP6 B;  3NR7 A;  4JI1 B;  5KHI A;  4UCR A;  1MA1 A;  4G28 B;  1XQ8 A;  5JH7 A;  3N2K B;  4UCT A;  4UB8 Z;  1N34 O;  3JAT A;  5CBG A;  4PDM A;  1X4T A;  3L9D A;  2ZXW C;  4CS4 A;  3ABM B;  1NVP B;  2E75 B;  1Y74 B;  2Q69 A;  2IJI A;  4UCV A;  4WF9 V;  4FLW A;  1UFI A;  4JYY A;  1K4D C;  4DV3 O;  1VQP V;  2GUZ B;  2DN9 A;  5IJ0 B;  4LF4 O;  1I08 A;  4RAI A;  1HP8 A;  4J7K A;  1JA8 A;  3VQX A;  1L1F A;  3CJH A;  1X59 A;  3P3P A;  1PV0 A;  3K5L A;  5A9G A;  1EZV H;  2PI5 A;  4O4H A;  1HNX O;  5J2U B;  3G71 V;  3U0Z A;  4BW9 A;  5KAF Z;  4X64 B;  4X88 A;  3FKS G;  1M9N A;  2ARH A;  3UT5 A;  2LW7 A;  3TJT A;  5HFM A;  2X6B A;  2QJ1 A;  4LC1 A;  5L3G A;  2HVK C;  4UVC A;  2ZNI A;  2DE0 X;  3D3Q A;  2ZM6 B;  4X1I B;  2XAH A;  4CBC A;  1WPX A;  4K35 A;  2VQE O;  2ZIN A;  3RYH B;  4FIP C;  5B1B C;  2GDS A;  4F6R A;  3CCS V;  4AQY B;  3S3X A;  3ZCC A;  3FB7 C;  1W0K G;  5BR8 O;  1Q6I A;  4JTC B;  2BOB C;  2HHH B;  2LO1 A;  4FLV A;  2GV9 A;  5FNV A;  2JVD A;  3SPI A;  1TVK A;  2ZNJ A;  2QKA A;  3KCY A;  1XNR O;  3ZED A;  4X65 B;  1AI4 A;  1QR9 A;  3IFX A;  1M57 B;  3NXS A;  4JYC A;  3BCC H;  4YJ3 B;  1GM7 A;  4JI3 B;  1WAZ A;  1V54 B;  1PM9 A;  2HJD A;  4DV6 O;  4X1Y A;  2WAM A;  1K92 A;  4J10 A;  4JV5 B;  2GBO A;  4H37 A;  3VQV A;  5IJ9 B;  4KL1 A;  1Y67 A;  1VF6 C;  3K9A A;  5IY5 B;  3SJC C;  4TT3 G;  3CCM V;  4DR7 B;  4ASU G;  2ATK C;  3SPC A;  4FLU A;  5CB4 B;  2YDE A;  2PYJ A;  2NLJ C;  3ETQ A;  1OCR C;  1KD1 W;  5E1A C;  3E8G A;  1OCO B;  4JPR A;  3CRR A;  4X1K A;  4NXM O;  1B06 A;  1H8H G;  4JAS A;  4Z1M G;  4NR1 A;  2JDI G;  2KB1 A;  1XHZ A;  2UXC B;  2L6L A;  1K7D A;  1VEW A;  3H9V A;  2OCC C;  4JI8 B;  5LMN O;  1D5A A;  3IC7 A;  2JGU A;  4LF8 O;  4ZHQ B;  4XDK A;  3D8C A;  1J95 A;  2BSK B;  3X2Q C;  3EVK A;  4LFC O;  4D6T H;  2YSU B;  1Z5W A;  4TQD A;  3WB0 A;  1N34 B;  3N2G A;  5GTH Z;  4NTW A;  3UO2 A;  1IUR A;  4OX9 B;  3RBZ A;  4J7J A;  1W0J G;  4WBN B;  1ROP A;  1B6Q A;  4QPJ A;  4DR4 O;  5KHK A;  5KA6 A;  4DR2 O;  3RYI B;  2A79 B;  2WLL B;  4IT5 A;  5F2V O;  1JMK C;  4IYI A;  1H38 A;  4DV3 B;  1IXM A;  4J7Z A;  4IL6 Z;  5EYP A;  2CE4 A;  3DC6 A;  3M99 B;  4KHP O;  2DOS A;  4UB6 Z;  4O4I A;  2P5O A;  5H5N A;  3OW2 U;  3RYF B;  1WJZ A;  1FS0 G;  3FYE B;  1UJW B;  2BTQ B;  3CCR V;  3AG2 C;  2ZXW B;  2XAF A;  2Y0I A;  3JSN A;  2FYU H;  2MK3 A;  3ASN B;  2AGA A;  2P22 C;  3H1L H;  1HNX B;  3O9O A;  3ZHV A;  1THZ A;  4LNU B;  2ZDI C;  4UFZ A;  2WLI B;  5KLV H;  4R50 A;  1BHA A;  1L8D A;  2ITD C;  2YXH A;  5LHG A;  5IYC O;  3K06 A;  1YEW A;  4CZZ A;  2Q9L A;  1PKX A;  3AG3 C;  2F95 B;  2Z0A A;  1BE3 H;  2AHZ A;  3G6B A;  4NTX A;  2VQE B;  4C7U A;  2XAS A;  1JOY A;  3TXS A;  3CME V;  3IC9 A;  1K8A W;  5KUM A;  3CCJ V;  2GTA A;  1N8R W;  4DW0 A;  3FB6 C;  5GON B;  1U96 A;  2Z5U A;  3ZMZ A;  5CA0 A;  3CCL V;  4EKW A;  4OGQ B;  2UXX A;  5LBQ A;  1BQ0 A;  2Q7E A;  1XNR B;  4PA9 A;  1N33 O;  2JIZ G;  4LH7 A;  5A2Q N;  3AK3 A;  2DYR C;  3FAV A;  1XHX A;  4FVM A;  5LP6 A;  1ZUQ A;  4IGG A;  2JEU A;  1NR7 A;  4CH4 A;  5B3S B;  5LMU O;  3SJQ C;  3SDL A;  3N2K A;  4DV6 B;  5B1B B;  3JAW B;  2ADP A;  5E79 Z;  2P67 A;  1TUE B;  5DN6 G;  3B09 A;  1Y74 A;  1OCC C;  1VQM V;  3E8H A;  4UCO A;  1KC8 W;  3AK1 A;  4DR3 O;  1LNQ A;  4ICG A;  3E89 A;  3K08 A;  1BGY H;  1XI1 A;  2Q7G A;  4NXM B;  1NR1 A;  5IWA O;  1P7B A;  1NS1 A;  3W7W A;  2Y4U A;  3K58 A;  2OYQ A;  1M93 A;  4JI7 O;  3CCU V;  4DW1 A;  3D36 A;  4LF6 O;  2WA4 A;  4QNH B;  2CK3 G;  5LMN B;  1OJH A;  4LF8 B;  2ZQM A;  2C2A A;  2Y69 C;  5BZB A;  2FTK A;  4MVZ A;  4LFC B;  2HP8 A;  3QNE A;  1SES A;  1PPJ H;  1OCR B;  3D36 C;  1AI7 A;  4JI5 O;  3AG1 B;  5J2U A;  1PL0 A;  2OTL V;  3T1H O;  5FPR A;  4B3T O;  2ZE8 A;  1Q5O A;  4BIZ A;  3OMI B;  2CAZ C;  2IJJ A;  3A0B Z;  5L3E A;  2B1I A;  3F5W C;  3H1J H;  3B2E E;  3ZMV A;  1MOF A;  1S5J A;  4TV9 B;  1Y76 B;  1WN7 A;  2N74 A;  1JJ2 U;  2AW9 A;  4DR4 B;  3N27 A;  3L74 H;  4DR2 B;  2OCC B;  4JAU A;  4PDR A;  1SZX A;  1KBH A;  5B1A C;  3RYH A;  4ZI7 B;  2VWJ A;  4HNA B;  4JI0 B;  2H94 A;  1L0N H;  2WLJ A;  1BHB A;  1FFT B;  3EHB B;  3TET A;  5JJE B;  1O9H A;  1XIL A;  3I5D A;  5JQG B;  2YEV B;  4KHP B;  2JS3 A;  1V55 C;  5DM6 V;  3ZJZ A;  2M6Y A;  4QE7 A;  3OGI B;  5EIB D;  3ETG A;  2CUG A;  2EIJ B;  1H2L A;  5JVD B;  2X7R B;  1GM8 A;  3B77 A;  3LSU A;  1BL8 A;  4RQF A;  5LGU A;  3CRC A;  3LDE A;  3IJ4 A;  4PDL A;  3S3W A;  5DEC A;  5B66 Z;  1YF2 A;  4U3J A;  2ETN A;  3FFQ A;  2QWQ B;  2ZCE A;  2IH3 C;  3K5N A;  2W6J G;  4X8A A;  3T1C A;  4B3M O;  4MW8 A;  5IJ9 A;  1XMO O;  3SPJ A;  3CRA A;  3WG7 C;  1H2G A;  2KSD A;  5JCO C;  1M90 W;  1FFX B;  3WB2 A;  2CTP A;  5CB4 A;  2EJ7 A;  2YIB D;  1XOU A;  4MVR A;  2P90 A;  2UU9 O;  3AG2 B;  4AQY O;  4XDL A;  1IBL B;  1KB9 F;  2KG7 B;  3ETE A;  5IY5 C;  1SC5 B;  2HHH O;  2ZE5 A;  4I4T B;  1YCI A;  2ZD9 A;  5KA5 A;  4CC5 A;  1YZB A;  3K3W A;  1SZT A;  4PA3 A;  4MVU A;  4GYC B;  4I50 A;  3LSS A;  1N33 B;  3RYC B;  1CXZ B;  4DV2 O;  4ZHQ A;  1SQQ H;  4DV0 B;  4IIJ B;  2BSK A;  4B7K A;  3AG4 C;  3ETD A;  2XOK G;  4H33 A;  3J81 N;  4JTA B;  5LL6 Y;  3E35 A;  1CP9 A;  5LMU B;  2A0L A;  2JJ2 G;  2EZO A;  1G1X B;  1NH2 D;  1NTZ H;  3JAM N;  4Z1V A;  4MTF A;  1KEC A;  1K73 W;  3Q4H B;  1BCC H;  1BQZ A;  1AVM A;  4WBN A;  2XAJ A;  3J7A U;  3JCU Z;  1S3J A;  4DR3 B;  1H2N A;  1YJN V;  4FLY A;  3RYI A;  3DGE A;  3U10 A;  4O2B A;  3WU2 Z;  5IWA B;  4DR6 O;  4J11 A;  5LHI A;  4X66 O;  3E22 B;  2DYR B;  5L3D A;  3CXC U;  1L0L H;  1P4R A;  2B1G A;  2QWP B;  4DO2 A;  3AG7 A;  1VQN V;  1QVF U;  2Y48 A;  4TUY B;  3K79 A;  4JI7 B;  3RYF A;  5JJN B;  4LF6 B;  5IYD O;  2BTQ A;  2KQX A;  3ZN0 A;  4GX2 A;  3SPH A;  1B04 A;  4MVO A;  3CCQ V;  3HB3 B;  1GK9 A;  1OCC B;  3H01 A;  1JX9 A;  2M7W A;  2Z3Y A;  5K1X A;  4JI5 B;  3L72 H;  4LNU A;  1HWY A;  3PJS K;  3T1H B;  4OX9 O;  4B3T B;  4AIL C;  4LH6 A;  5J9P C;  3ASN C;  3ZRS A;  1R3I C;  5L3F A;  3JD3 A;  2V1D A;  3P30 A;  4MS2 A;  3M8A A;  1PNM A;  1KQS U;  1SRY A;  3HKC A;  4IHJ B;  4P9O A;  2N05 A;  3JYC A;  3D3I A;  1YHQ V;  5L3B A;  2Y69 B;  5KX5 B;  1SQF A;  1JFF B;  3ASO C;  3G6E V;  4JTD B;  2ZIO A;  2ZR3 A;  1R3K C;  2PI4 A;  2EIL C;  2XUM A;  5JWP A;  1BSM A;  4H0L B;  1Y4M A;  3KCX A;  3ABK C;  4X9Q A;  4I5S A;  4U3F H;  4GCZ A;  1XUQ A;  4AHC A;  4YIP A;  4WFA V;  4Q6G A;  2ODM A;  3A2F A;  5ITZ B;  1G8M A;  1H2M A;  5B1A B;  3K59 A;  2ZE6 A;  5LXT A;  2B5U A;  2X6C A;  1IBK O;  4O2A B;  4FPP A;  3JD0 A;  3QO5 A;  4B3M B;  3JAW A;  1QR8 A;  2HLD G;  1XMO B;  2JS5 A;  2BE3 A;  1V55 B;  1FXK C;  5B3S C;  1YSC A;  3SYQ A;  3OGC C;  1Q82 W;  2UU9 B;  2QM4 A;  2HR3 A;  4F4L A;  4BIU A;  1Q86 W;  2F4V O;  1H8E G;  5LGT A;  1Q6U A;  3ZHT A;  3BHP A;  3HPL C;  3TCU A;  4I7Z B;  3JAR B;  4RO2 A;  4YXW G;  5AG2 A;  3F7V C;  4DYL A;  1AP6 A;  1FXV A;  4DK0 A;  2AHY A;  5L3C A;  1XBL A;  2UUB O;  3CC4 V;  3ZHS A;  1K97 A;  4PA4 A;  3CC2 V;  1KMI Z;  4YY3 O;  4DV2 B;  1VF6 A;  2WLK A;  3G67 A;  1DTO A;  3WG7 B;  4R6Z A;  4D7T A;  1JPX A;  2LGW A;  4NVP A;  1ENV A;  1I5Y A;  3JD1 A;  4LP8 A;  1F7Y A;  4L8J A;  2YC0 A;  2ZT9 B;  1P49 A;  5CMU A;  3KZI Z;  4RWU A;  1ORQ C;  4FFB A;  4TV9 A;  2HJF C;  5FL7 G;  2P4V A;  4JF3 A;  4I9Q A;  3DTU B;  3AG1 C;  1H2K A;  1LUV A;  2CH7 B;  1GO3 F;  1BS3 A;  1U97 A;  2R72 A;  5EZY B;  2IW5 A;  1VP7 A;  2ZKO A;  4OPA A;  1MZF A;  1AR5 A;  1YI2 V;  4FJC C;  1QHT A;  4ZI7 A;  4DR6 B;  5FLX N;  2OIE A;  4MVM A;  4X66 B;  3SJB C;  5TIS Z;  3H1H H;  3ZS8 C;  5BMV A;  5LOV B;  1M1K W;  3CC7 V;  4EB6 B;  4ZOL B;  4I0X A;  5JQG A;  3AG4 B;  3MHS C;  1DLB A;  4CS2 A;  3OFN G;  4UCS A;  3LNM B;  1SQB H;  1G4Y B;  4PEL A;  1JJO A;  1GH6 A;  3ZIA G;  1VQ6 V;  3LSQ A;  3CB2 A;  2E5L O;  1IVS A;  3HKB B;  1Q90 D;  1AIL A;  5JVD A;  4KFM A;  2Y4T A;  4BW5 A;  1E79 G;  1OZ0 A;  5D5P A;  1IZ3 A;  1VQL V;  1VQO V;  3OUS A;  3OD4 A;  2EIJ C;  2F66 C;  4FLX A;  2RMK B;  3QTC A;  2XAG A;  3JAS B;  1AI5 A;  4FFK A;  1BZK A;  1MSD A;  4G27 B;  4JI0 O;  3SGI A;  1ZL8 B;  1DF4 A;  2LP7 A;  2CTW A;  3CCE V;  2KG7 A;  3JSL A;  1N36 O;  4I4T A;  4GX1 A;  3CMA V;  1QNM A;  4H13 B;  1RPR A;  3APO A;  4MVQ A;  1Z5V A;  2ZDI A;  1LR1 A;  4DUZ O;  1ZX3 A;  4XBF A;  5LYJ B;  2XAQ A;  3RYC A;  4DR1 O;  3L73 H;  5C93 A;  1KP2 A;  4LF7 O;  4R7C A;  4OXS A;  2PGG A;  3W7T A;  1F4N A;  4X20 B;  5H2F Z;  4I55 B;  4ZKI A;  1QLN A;  5FPO A;  2QTO A;  4FZ0 A;  2JGD B;  5KHH A;  1IBK B;  2QGN A;  3Q4H A;  2QA4 V;  4EFB A;  3ASO B;  2P4K A;  3R65 A;  2UUA O;  4GX5 A;  2HEP A;  1SET A;  2EIL B;  3VQW A;  1IBL O;  4DR5 B;  2Q73 A;  1MG1 A;  1EN6 A;  2F4V B;  1WB7 A;  3ABK B;  4JI2 O;  3E22 A;  1KYO F;  1I0H A;  1YDX A;  4BIO A;  4NTY A;  3KKY A;  4P9P A;  2FL4 A;  4ZIB A;  4LFB O;  2EJR A;  3KG2 A;  4TUY A;  3G4S V;  2QKS A;  2A9H A;  4WFH A;  1ZTE A;  3QG5 A;  1WA8 B;  2UUB B;  2W0X A;  2K1E A;  2G38 A;  2F23 A;  4DV0 O;  4YY3 B;  3UKM A;  1AB3 A;  1FXK B;  2LGQ A;  2LJ2 A;  4X62 O;  3UO3 A;  5EC1 C;  3T4D A;  1K5S A;  1R1B A;  1ZAU A;  4O4H B;  3RT3 C;  1VQ5 V;  2PY5 A;  4ABM A;  3B4S A;  3GVM A;  4JZG A;  3AEI A;  1EFR G;  2VQF B;  1AR1 B;  4F6E A;  3T2M A;  3R66 A;  2Q5Z A;  3QO7 A;  5HFL A;  4PI0 A;  1NU1 H;  3E2E A;  1QU7 A;  1HR0 O;  1US6 A;  2GUZ A;  2H3O A;  4B3S B;  2K9P A;  1GN2 A;  5IJ0 A;  2EBO A;  3K57 A;  5B1N A;  4N21 A;  1A32 A;  4DV4 B;  3K0D A;  3IAY A;  4WFG A;  5KX5 A;  2BOC C;  4F6R B;  1H2S B;  4K0K O;  3BA9 A;  1N0N A;  3CHX A;  5EIB C;  1GKF A;  1TUB B;  2Y0P A;  2E5L B;  3K0G A;  4DV7 O;  3G80 A;  1KU9 A;  2XT9 A;  5CN0 A;  4JZ2 A;  3P32 A;  3ABL C;  2X6A A;  2A3Q A;  1FJG O;  3MD0 A;  2YIB A;  3ML0 A;  5KMG B;  4FMT A;  2IU3 A;  2O57 A;  4HBN A;  3ZRX A;  2DMX A;  2WSS G;  2RNB A;  5C8Y B;  1Y6X A;  4YJ2 B;  4PV1 B;  4DV5 O;  5LA6 B;  4O4L B;  4X1I A;  4X1Y B;  4X89 A;  1M56 C;  1FXH A;  2BCC H;  4J80 A;  3ZN1 A;  1XRE A;  1I5X A;  1RSO B;  2QEX V;  1R6T A;  4EFE A;  2CTR A;  3SR2 C;  2PZS A;  1N36 B;  3JAR A;  3OMN B;  3TK1 A;  2WLM A;  4NYK A;  1PNK A;  1QVG U;  4TV8 B;  2E76 B;  1TGO A;  4DUZ B;  1M5I A;  3OR6 C;  3JD4 A;  4DR1 B;  4LF7 B;  2DYS C;  4DRX B;  2JK5 C;  4YJ3 A;  5KUK A;  5JCO A;  4DK1 A;  3WB1 A;  1SQX H;  2GTS A;  1CPY A;  1XEQ A;  5IYZ B;  1IXB A;  2YXL A;  2ADQ B;  1JVM A;  2DWE C;  4IYH A;  4PA6 A;  2DW4 A;  3F7Y C;  2EIN C;  2UUA B;  3N2G B;  1IBM O;  4LBE C;  1NT2 B;  4JAV A;  2CH7 A;  2EIK B;  2N04 A;  1GN6 A;  2YID A;  4GX0 A;  1GN3 A;  1VF5 B;  5KHG A;  4JI2 B;  2R9A A;  4LF9 B;  2LFS A;  3OT7 A;  1S72 V;  5LOV A;  1XNQ O;  4EB6 A;  4ZOL A;  3CRM A;  3DC5 A;  4FK5 C;  5CBF A;  4LFB B;  4AI8 A;  2UXB O;  1NTM H;  3K9S A;  1NTK H;  4GT1 A;  3LNN A;  4MTX A;  4PHZ A;  1QCE A;  3I55 V;  3CD6 V;  1K34 A;  4NB5 A;  2IJH A;  2KKW A;  3VOU A;  3HKB A;  1ZSP A;  4QIW F;  1VQK V;  1WB8 A;  4UUJ C;  2XTA A;  3OTO O;  2EUL A;  1RM1 B;  4X62 B;  1VIB A;  1LUW A;  4CH3 A;  1SQP H;  5EBM C;  3QF7 A;  5KAI Z;  2WA3 A;  3RN4 A;  1YIJ V;  2E74 B;  3W7S A;  2Q68 A;  3AK2 A;  1ZLZ A;  1BMF G;  3RGB A;  2WLL A;  1RPO A;  2RDC A;  1HR0 B;  1K33 A;  1K5Q A;  1ZL8 A;  2YI8 A;  1AJQ A;  3JAL B;  4H44 B;  2QE7 G;  5CA1 B;  4MSW C;  3CPW U;  2HG5 C;  3BVO A;  2V7Q G;  4LWS B;  4J41 A;  1K3E A;  4JYB A;  2EX3 A;  2A7W A;  2D3O W;  1R73 A;  3OMA B;  3GB7 C;  3T1Y O;  4K0K B;  1WP8 A;  3JAK B;  2PF4 E;  1NJI W;  3CXH F;  2F43 G;  3THO A;  5LYJ A;  1HDJ A;  1S76 D;  2R9I A;  4DV7 B;  5JJJ B;  1EM1 A;  3CE2 A;  1S0V A;  4I55 A;  2IBZ H;  2WLI A;  1XMQ O;  4WFB V;  1Q6H A;  1FJG B;  4TQF A;  1R6N A;  1EBO A;  3B40 A;  3JD2 A;  3UCS C;  4UVA A;  2DJV A;  2CGO A;  3JCZ A;  2R70 A;  2UUC O;  1FPO A;  4DV5 B;  5IT9 N;  1CEZ A;  1D5N A;  3OM3 B;  2QM8 A;  5GTI Z;  3VBB A;  1FKA O;  4R8C A;  1MMM A;  4BAY A;  1NBM G;  2YI9 A;  3MDS A;  4MTO A;  1HNZ B;  4TSF G;  3SPG A;  5GON A;  3GWK C;  1N0J A;  3L75 H;  2UXD O;  3QO8 A;  2EZP A;  1YTF D;  4W4L A;  3GWO A;  3ABL B;  2PTM A;  4YHH O;  2GHY A;  1WA8 A;  2ZIM A;  3L70 H;  4GKK O;  3SJA C;  1NZ6 A;  5GW7 A;  1M56 B;  4UV9 A;  1YJ9 V;  3TGU H;  4B3R O;  1FXK A;  1Q81 W;  3IGA C;  2V4D A;  3B8N A;  3OUF A;  1YXB A;  1S77 D;  2FML A;  1D2D A;  4BWA A;  1G6U A;  1JR9 A;  3L71 H;  2P6J A;  1DGS A;  5LGN A;  5IYB O;  1URF A;  2QKC A;  2F1M A;  1PP9 H;  3CRQ A;  2CTQ A;  4PA7 A;  1IBM B;  4WFE A;  4OPH A;  4DR5 O;  1FYJ A;  1F51 A;  1VMG A;  1V9P A;  2QWO B;  1Q43 A;  1AP5 A;  1PL4 A;  2DYS B;  5B5E Z;  1XNQ B;  4K3A A;  2OT5 A;  2YUA A;  5J2T B;  2PUS A;  4HAM A;  2UXB B;  4LFA O;  2RCV A;  3OEE G;  3RFR A;  4D7S A;  3BFR A;  1N4C A;  1NH2 B;  1J5E O;  3ZMT A;  2YS8 A;  2P7T C;  5B1O A;  1P84 F;  1TUB A;  3DSQ A;  1SF9 A;  2EIN B;  2D2C B;  5H6Q A;  4XDJ A;  2WLH A;  1VQ8 V;  1M4U A;  3OTO B;  1DK1 A;  1W2B U;  3H1K H;  3U11 A;  3ZRW B;  3OTF A;  2RQ6 A;  5KMG A;  2YIC A;  2E3C A;  1K9M W;  4CC6 A;  1Y76 A;  2VQF O;  4J9Z B;  5C8Y A;  1Q3E A;  4YJ2 A;  1NI8 A;  2Q4P A;  4U3J B;  5LA6 A;  4O4L A;  4RUE A;  1WPB A;  1RP3 B;  3CEI A;  4RQE A;  1Q8I A;  3I56 V;  4KXR A;  4B3S O;  1EN4 A;  4HNA A;  1IDS A;  1RSO A;  1O9G A;  2QDO A;  1NKD A;  4DV4 O;  2YIA A;  1ZWI C;  3LUT B;  2ILM A;  1NQT A;  4CS3 A;  4JAA A;  3UQ8 A;  3CS5 A;  2YEV A;  1KKD A;  2CGN A;  3ABU A;  2NNU A;  2Q67 A;  5EBL C;  4TV8 A;  3T1Y B;  4GZR B;  3SYO A;  4LF5 O;  4ZBM A;  2CDY A;  3BEH A;  4CH5 A;  5D5Q A;  1GMG A;  3ZBH A;  4DRX A;  4I50 B;  2FKX A;  2GSM B;  3ZHU A;  4DV1 O;  4JYA B;  2XND G;  1DF5 A;  3OE7 G;  2F93 B;  1XMQ B;  3RW0 A;  4UV8 A;  3W7U A;  5IYZ A;  4CH6 A;  4HZ3 A;  4FLT A;  3H1I H;  3VQY A;  4G2K A;  3BAB A;  2AZ2 A;  2UUC B;  1FFX A;  1ARO P;  2DWD C;  2H8P C;  4FM1 A;  1YTF B;  3A8T A;  3ZMU A;  3O65 A;  2Q8V A;  1TAE A;  4FZ1 A;  2HKO A;  2OCH A;  3CX5 F;  1SA0 B;  3CYO A;  2LQT A;  4QGP A;  2UXD B;  2W0F C;  1QLE B;  3SYA A;  4O2B B;  3FX7 A;  3HR0 A;  2EIK C;  4MW3 A;  4QPK A;  3HKD B;  3DXR B;  2RN9 A;  4O4J B;  4LF4 B;  4YHH B;  1BT8 A;  1I94 O;  2Q6A A;  1EN5 A;  3HKE B;  3BAA A;  1UPG A;  4JI4 O;  3RVZ A;  4GKK B;  4IIJ A;  3A0H Z;  4L87 A;  4B3R B;  5K1P A;  3J80 N;  4E2L A;  1GRJ A;  2NR5 A;  3EXA A;  3OEH G;  3RWR D;  3QVN A;  2AZ0 A;  5JH7 B;  1SKV A;  4PD4 F;  1N32 O;  3K03 A;  3JAT B;  2UXN A;  2IU0 A;  1S5L Z;  3FD9 A;  1RM1 C;  2P06 A;  4QJF B;  2QTS A;  1VQ9 V;  4E4E A;  3STL C;  5H6R A;  4LF9 O;  3C90 A;  3JAL A;  1P7G A;  2IJK A;  5CA1 A;  3M7M X;  4TWK A;  4YIO A;  1XL4 A;  4UXN A;  1OV9 A;  1YJW V;  4GKJ O;  3HKC B;  4LWS A;  5IDJ A;  4NXN O;  1GAX A;  2VRZ A;  4LFA B;  4EEQ A;  3SYP A;  1PNL A;  3TXQ A;  2IM9 A;  1F23 A;  3APQ A;  1FD9 A;  3JAK A;  1J5E B;  5BR8 B;  3CWB H;  3LDC A;  2JJ1 G;  2EIM C;  3E83 A;  4TOI A;  2FB5 A;  1AR4 A;  3CJH B;  2VS0 A;  1TA8 A;  3A0R A;  2QWN B;  3OR7 C;  4MVS A;  3K04 A;  2OWO A;  1OCZ C;  4J42 A;  1MAB G;  3T4Z A;  4JI6 O;  5CA3 A;  1GN4 A;  2JRI A;  1I7F A;  3UT5 B;  5LXT B;  1QQC A;  2IH1 C;  1WP7 A;  1HW7 A;  4IHJ A;  2JEX A;  3C3T A;  5LP6 C;  3SYC A;  4B7E A;  1IX9 A;  1E1Q G;  1JFF A;  2Q0O C;  2VWK A;  2XHB A;  4DXW A;  1KP3 A;  2RJZ A;  3ABT A;  4FLZ A;  2A06 H;  2ITC C;  1PD3 A;  4K8X A;  3ABM C;  2OIG A;  1RFY A;  5LHH A;  3PN1 A;  4DUY O;  4LF5 B;  1MNG A;  5FNV B;  3C3S A;  2QM7 A;  1TVK B;  2YXY A;  5IE9 A;  4Q20 A;  1AJP A;  4RUF A;  5ITZ A;  1MSW D;  4Z2W A;  4DV1 B;  2B9Z A;  1GTO A;  2LW1 A;  3CCV V;  1Z2G A;  3E8B A;  3STZ C;  1HNW O;  1T5E A;  4O2A A;  4JI1 O;  2DQ0 A;  1SER A;  3E86 A;  3ZRV A;  4U7O A;  2PYL A;  1XL6 A;  2WPD G;  3B8M A;  2QSA A; 
#chains in the Genus database with same CATH homology
 2RNB A;  1U96 A;  1Z2G A;  2LQT A;  2RN9 A;  1U97 A;  1HP8 A;  2LGQ A;  2HP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...