2ITDC

Potassium channel kcsa-fab complex in barium chloride
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
103
structure length
103
Chain Sequence
b'SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab fragment heavy chain
publication title Structural and Thermodynamic Properties of Selective Ion Binding in a K(+) Channel.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 40
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2itdC00
3RBZA 4PA6A 3K0DA 3AG1C 5CBFA 4P30A 3LDEA 4R50A 3RW0A 4PDMA 3SPGA 3TCUA 3ZJZA 1V54C 4GX2A 4GX5A 3RVYA 1K4CC 2EIMC 2Q69A 4R8CA 4MVQA 1S5HC 1LNQA 2HVKC 4MW3A 2WLMA 5EC2C 4JTDB 4ZBMA 3T1CA 4MVRA 3IFXA 4BW5A 5BZBA 1R3IC 4MSWC 4LBEC 1QLEC 3ABKC 4X8AA 4P9PA 2AHYA 5E1AC 3E86A 4MTFA 3T2MA 4P2ZA 3X2QC 4QNHB 2X6BA 1R3KC 4R6ZA 4GX1A 2K1EA 3OGCC 4G28B 5KUMA 3ZRSA 4PA4A 4QE7A 5B1BC 3STZC 5IY5C 5J9PC 2HFEC 2DWDC 3ABLC 4RUEA 4MVOA 4WFHA 4CBCA 1K4DC 2JK5C 3STLC 3SYCA 4I9WA 3PJSK 2BOBC 3T4DA 4H33A 4RAIA 3E89A 2H8PC 2QTOA 4XDLA 1OCOC 1ZWIC 1G4YB 4HYOA 3FB7C 1J95A 2IH1C 3ASOC 2WLLA 1M56C 3ASNC 3F7YC 4X88A 3SJQC 3TETA 2ZD9A 3E8BA 4G27B 4JTCB 4X89A 3E8HA 3K03A 5CBGA 1OCRC 2Q6AA 4H37A 3T4ZA 5B3SC 5EK0A 4HZ3A 5EBWC 3OR6C 2Q67A 4LP8A 3AG2C 3SYQA 3HPLC 1KKDA 3OUFA 2DYSC 3KG2A 2WLKA 4MVSA 3FB8C 2YEVA 2X6CA 4TWKA 3RVZA 5EBMC 4J9ZB 3E83A 3IGAC 2HJFC 4PA9A 3OUSA 4PA3A 3K04A 4MTOA 2WLIA 2Y69C 4OXSA 4GX0A 2NLJC 3K06A 3UM7A 5CBHA 2WLJA 2ATKC 3FB5C 4WFGA 2WLLB 4MW8A 3SPIA 3E8FA 3ABMC 1V55C 3LUTB 4EKWA 3OR7C 2IH3C 3AG4C 2A0LA 2HVJC 4R7CA 2W0FC 2A9HA 1XL4A 4PA7A 4P9OA 3JYCA 2HG5C 2DYRC 1OCZC 2KB1A 3WG7C 2DWEC 3VOUA 3SPJA 2EIKC 2QKSA 4QE9A 2Q68A 3SPCA 2WLIB 3LDDA 3E8GA 4WFFA 4MVUA 4LCUC 1R3JC 5EBLC 3GB7C 4J9YB 2EIJC 4JTAB 5EC1C 3FB6C 1JVMA 1R3LC 3LDCA 4KFMA 5B1AC 4UUJC 3K08A 1XL6A 4RUFA 3BEHA 3LNMB 3R65A 4WFEA 2R9RB 1P7BA 3F7VC 4MVMA 2WLHA 3K0GA 4F4LA 2ITCC 2WLNA 4PDLA 4XDKA 4MVZA 4PDRA 2P7TC 4RO2A 3SYOA 3UKMA 2AHZA 1ORQC 5KUKA 1OCCC 2EILC 3SYPA 4PDVA 4XDJA 4MS2A 1BL8A 2X6AA 2EINC 2BOCC 3SPHA 2ZXWC 3EFFK 3F5WC 2A79B 2ITDC 3AG3C 1M57C 3SYAA 4MTGA 2OCCC 4DXWA
chains in the Genus database with same CATH superfamily
3BABA 3P32A 4LFCB 3ICXA 1XNRO 1AJNA 5IDJA 3VQWA 1NH2B 1OCOB 4UXNA 1V54C 1AVMA 1XEQA 3L72H 3CJHB 5LHIA 1QVGU 1R73A 2X7RB 3MD0A 3ABKC 2XHBA 2P67A 4UV8A 1QLEB 1WA8B 3OGCC 1PPJH 2E74B 3ABLC 2YSUB 4WFHA 3RWRD 2JGUA 5K1XA 2EBOA 1N34B 1VQLV 1BHAA 4O4LA 3FYIB 1QR8A 3FB7C 4X88A 4BAYA 4EB6A 3ZN1A 2QEXV 5H5NA 1H8HG 1AR5A 1F23A 2P90A 4LP8A 2JJ1G 4K0KB 2N04A 3OUFA 1Q8IA 1K33A 5EBMC 4Z1VA 1YIJV 4PA3A 2UXBO 1HNWB 5BY1A 3ZHRA 5L3CA 4Z1MG 4ZIBA 2JGDA 4BIZA 4DUZO 2XAQA 2FL4A 2UUAB 1F4NA 1Y67A 3JAWB 2ZM6O 3WG7C 5L3GA 3C90A 2Q68A 4H44B 4CH4A 1FFTB 4J9YB 2RNBA 1L0LH 1R3LC 2IU3A 3K08A 4L8JA 4CH6A 1YEWA 2GBOA 3P30A 1JJ2U 4JI0B 3LNMB 2YIAA 1FXKA 5IYDO 5KA6A 1P7BA 5CMUA 4GZRB 2R9IA 3SPHA 4FLVA 4E2LA 3F5WC 4D7TA 2JVDA 3KKYA 4B3SO 3O65A 2FYUH 4KXRA 4MTGA 1UFIA 1ZUQA 1RSOB 1Y6XA 4JYAB 5LYJA 1WAZA 1EZJA 3T1CA 1P4RA 5KAFZ 3B4SA 3OMNB 3JCUZ 3E86A 3K5OA 2X6BA 3H1IH 3M99B 3AG2B 3LSQA 1BQ0A 5LGUA 3R66A 1GK9A 4JI4O 1SQGA 1TGOA 1VF6A 4RAIA 1Q81W 4O2AA 4XDLA 3B77A 2KG7B 2OWOA 2KSDA 3THOA 1O9GA 2ZD9A 3OEHG 3EHBB 1R6NA 1E1RG 4JGSA 1KU9A 3RYFB 5EBWC 1VARA 2Q67A 4DR6B 2XAHA 4J11A 3H1JH 2Y69C 3W7WA 5JH7B 3HKEA 4NTXA 3RT3C 1AJPA 4WBNB 1OV9A 1L0NH 1G8MA 2YDEA 4FVMA 2Y0IA 5CA3A 4UCTA 1IBKO 1GN6A 4P9OA 1IBMB 3CJHA 4Q6GA 3H01A 3ZRVA 2QKSA 1MSDA 3CYOA 1N33B 2WLIB 1F51A 2RN9A 4X65B 3AG3B 2EIJC 4DV4B 3DC6A 4F6RB 5LXTB 3LDCA 3FAVB 1BGYH 1L8DA 1MNGA 4GLXA 2F1MA 1QU7A 3BA8A 4O2BB 1J5EB 1KD1W 1YTFB 2N74A 1NVPB 2BOCC 1Y4MA 4X1KB 3JAKB 4DR5B 1Y66A 4LFAB 2Y4UA 3DSQA 4H0LB 4DXWA 3ZRWA 3ZHTA 3CSXA 3JCZA 3CC4V 4JI8B 4NXNO 2QJ1A 5LOVB 3RFRA 2OIGA 1EFRG 1QHTA 4X62O 4CS4A 4X64B 3CB2A 4PA4A 3QVNA 4PV1B 4GYCB 4TQFA 3FD9A 3A0HZ 1FXKC 2IM9A 1PV0A 4XBFA 2LQTA 4LF6B 1J95A 2IU0A 1OCRC 4H37A 2UUCO 3M7MX 5B3SB 3KZIZ 4ICGA 2F23A 2EZOA 4LF5O 2YC0A 3K04A 2XTAA 5LA6B 4DW1A 5FLXN 1WN7A 1ZL8B 3ABMC 2C2AA 3OEEG 3CCUV 3GWOA 2QWQB 4JI3B 1TA8A 4TV9B 1YVWA 4E4EA 5EIBC 2IJJA 2XT9A 1VF7A 1VF6C 4JAAA 5KHJA 2ZE8A 4DV7B 3CPWU 2B1GA 2DW4A 5B1AC 3AG1B 1JMKC 4LF7O 3W7XA 1Y76B 1S5JA 4PDLA 1XUQA 3E22B 1K34A 3KCYA 2EJRA 1VQ6V 5KUKA 1PM9A 2LGWA 2YEVB 3A2FA 4JI2O 1KP3A 2A79B 3CX5F 3PN1A 1S76D 2L6LA 1VF5B 3P3PA 4X1IB 4O4IB 1R6KA 2YXLA 2EIMC 4WBNA 4R8CA 1QLEC 2PUSA 5D5PA 2Q7GA 4LNUB 4QE7A 2DWDC 3K5NA 2GSMB 3LSUA 4UVBA 4F6RA 5LXTA 2ILMA 4F6EA 3FAVA 3ZMTA 4WCEV 1NTKH 1EN5A 1VQ8V 4GKKB 1GN4A 4FZ1A 4DYLA 3OR6C 1IBLB 1JJOA 4CZZA 4OPAA 3UO3A 3FYEB 4IL6Z 4K3AA 4MVSA 4X1KA 3JAKA 2OIEA 4PA9A 4EFEA 1N34O 5KHGA 2HKOA 2E5LB 4YJ2A 3K06A 4NB5A 2WLJA 2CE4A 1U97A 1ROPA 3CCEV 5EZYB 4TSFG 1N0NA 2ZIOA 1WB7A 4PA7A 2A9HA 4K0KO 1Y74B 3TK1A 3ZHQA 3MHSC 1AP5A 3L71H 5CN0A 3LDDA 3I56V 3E8GA 2ZR2A 4MVUA 4WFFA 1FFXA 1HNWO 4CS3A 1JQ0A 3APOA 1I0HA 2R70A 5B5EZ 5JQGA 5JCOA 3OAAG 1FAFA 1GH6A 4PI2A 2UUAO 3BCCH 2BTOA 4PDVA 1W2BU 1N4CA 3LSSA 4FLYA 4QPKA 4ZHQB 3CC7V 2P06A 1WP7A 4BW9A 4U3JB 4JI0O 2OCHA 1OZ0A 1ZL8A 3Q4HB 3B2EE 2EJ7A 4TV9A 3L9DA 1YJ9V 1GAXA 1E79G 1EN6A 5L3EA 4DV5B 1K73W 5A9GA 4G2KA 3JD2A 4LR3A 4EFBA 2VQEB 4JYAO 5KAIZ 3BHPA 1KP2A 4HNAA 1G4YB 1XREA 4BWAA 2WLLA 1Y76A 2GV9A 3E8BA 3ETDA 2YIDA 4LF9B 3AK2A 2QKCA 4LWSB 4RQFA 2WLKA 2YEVA 3ABTA 2CTPA 2CH7A 2Z0AA 3UM7A 4NXMB 4HAMA 1K92A 1Q43A 1YJWV 3P3NA 3F5TA 4O4IA 5KX5A 3T1YB 2A0LA 3OMIB 2P4VA 2DYRC 2Z3YA 5IYZB 1YXBA 4DV0B 1H38A 3IAYA 2ARHA 1N32B 2ADPA 4LNUA 5L3BA 1DK1A 1Q7YW 1JVMA 2WPDG 1G1XB 4N23A 4JAUA 1EN4A 4WF9V 4LF4B 1HWYA 2WLHA 3H1LH 1JX9A 2OTLV 4CC5A 3CWBH 4XDJA 1UJWB 1OCCB 2XOKG 1N33O 3CRMA 4X65O 4X9QA 2QSAA 4DV4O 2RDCA 4YY3O 3K3WA 4FJCC 4FLTA 1GN2A 1H2GA 3RW0A 1WPBA 1GRJA 5EZYA 2Q7HA 4JI5B 1ZX3A 4DR5O 4LFAO 2YIBD 4DK1A 1M93A 2LW7A 5J2UA 2E3CA 2CTQA 5B1BB 4MVOA 1SS3A 3SR2C 5B1NA 2P4KA 3K58A 5FPOA 1WLEA 1IVSA 3ZHSA 2DJVA 4DK0A 2HR3A 4I4TB 3ASNC 2NR5A 3AK1A 4WFBV 2Q73A 4TT3G 1M56B 4X64O 3E8HA 2Q6AA 3FKSG 5B3SC 2UXCB 2AW9A 1H2NA 3VQXA 1I7FA 1FXHA 3ZCCA 1S3JA 4FK5C 4ZHQA 4MTOA 5LL6Y 3BAAA 4LF6O 4NTWA 1D5AA 3LUTB 4QIWF 3N2GB 3AG4C 4R7CA 3Q4HA 2FTKA 1L1FA 4K8ZA 1QBZA 2HG5C 1WB8A 1S77D 1SQPH 1THZA 4X66O 4ZI7B 1JR9A 2EIKB 4LCUC 1R3JC 3GB7C 3K57A 4BR6A 1XHZA 1WNSA 2JS5A 4LFBB 4JI3O 5FL7G 2BTQA 1GTOA 2FKXA 2E76B 1F7YA 5KA5A 2LFRA 2P7TC 1XBLA 2JIZG 3TXQA 2HEPA 3SYOA 3TXSA 4TQDA 3X2QB 4DV2B 2QA4V 1TUEB 4DV7O 4LWSA 1IXMA 4DO2A 3ETEA 3WB0A 3N2KB 2ZDIA 1LUVA 3RYCA 2ADQB 2Q0OC 2VQFB 3JARB 4R50A 1IX9A 2UXNA 4PDMA 1KKCA 2HVKC 4ZBMA 3IFXA 1XMQB 1IDSA 1NJIW 1Q6IA 3JD0A 3A0BZ 3DXRB 4GT1A 1COWG 5IYZA 2PZSA 1BMFG 2LJ2A 1H2MA 4IHJB 4CC6A 1OJHA 3E35A 2EX3A 1TVKA 2F4VO 4DRXB 2ZR3A 3JAMN 3U10A 3K03A 3EVKA 4J80A 1ZLZA 1BS3A 1VQ4V 1MMMA 3HPLC 1H2KA 2UU9B 1SF9A 2DYSC 4NYKA 4JPRA 2PI5A 1JCHA 3CMEV 2JEUA 3ZN0A 1FD9A 2P22C 3UT5B 5EIBD 4FLWA 1EBOA 1KMIZ 3B8MA 3OE7G 3E8FA 2OTJV 3OR7C 4GKKO 2YXHA 1W59A 1IBLO 3CXCU 1Q5OA 2IW5A 5LGTA 2V7QG 1BE3H 2E5LO 1M57B 1PP9H 1CEZA 2ZE6A 4JASA 4TUYB 4DV6B 1AP6A 1Q82W 3O9OA 4OGQB 4I9QA 1P84F 2DMXA 1YJNV 2AHZA 1AJQA 2IJIA 1HDJA 1BL8A 2X6AA 4FM1A 2ZE7A 4B08A 1PD3A 2DQ3A 5TISZ 1WA8A 2MW2B 1VQNV 2OCCC 3CCJV 3K0DA 3JSLA 4DR1B 3QF7A 1XI1A 1FYJA 4DR4O 4JI6O 1SQFA 4X1YB 2CAZC 1Q90D 3ZJZA 4GX2A 1K4CC 3ASOB 1SQVH 3ZRSA 4BW5A 3M8AA 3N2GA 4ABMA 4FLZA 4QJFB 5KHKA 4A5UB 1MZEA 1U96A 1NTZH 1VQ5V 5KUMA 4ZI7A 2HFEC 2GTSA 4DR3B 2AZ2A 1VIBA 5IT9N 4H33A 3ZMUA 2F93B 2AGAA 4I0XB 4FZ0A 1SC5B 3HKDB 1ZWIC 2PGGA 3HKBB 2X0LA 1GO3F 5KHHA 2GUZB 4UCOA 5FPRA 2KQXA 4HZ3A 2ZINA 4AILC 2ZCEA 1N36B 2ZDIC 3JAWA 5KMGB 4DV5O 1YSCA 2BE3A 2VQEO 3J80N 1ZSPA 1BZKA 1SESA 1X4TA 2IH3C 1RP3B 1M9NA 2F66C 2HVJC 1NR7A 3ETQA 4LF9O 1OCZB 4BIUA 1N0JA 1NKDA 3CCLV 3DXRA 3SPCA 2ZQMA 1Q6UA 4RWUA 3L75H 3RN4A 4EEQA 4IHJA 4D7SA 2ETNA 4YHHB 1I5YA 1XL6A 1RSOA 4W4KA 3BEHA 4NVPA 3S3WA 3R65A 2ZT9B 5LBQA 3T1YO 4YXWG 3ZRXA 2D3OW 2WSSG 3UKMA 4GKJB 4DRXA 1SQQH 3ABKB 1ORQC 1OCCC 2JDIG 3SYPA 3K59A 2EINC 4DV0O 1N32O 3CEIA 3JALB 3A8TA 3ZMZA 4JV5B 4NTYA 3L74H 3ABLB 2OT5A 5ITZB 1JA8A 2HP8A 3RBZA 4JI1B 1HR0B 3UT5A 5AG2A 4LH7A 4LF4O 3TCUA 4FM0A 3TJTA 3RVYA 2WLMA 2KG7A 5FNVB 4K8XA 4PJ0Z 5E1AC 3QG5A 4QNHB 1P7GA 2B5UA 3U11A 2QR4A 2A3QA 3RYFA 1T5EA 5B1BC 5IY5C 2Z5UA 2JK5C 1Q3EA 5CA1B 3PJSK 2BOBC 1US6A 2XUMA 3OTFA 5JH7A 1OCOC 4ASUG 4TUYA 4HYOA 2IJKA 2DQ0A 1M56C 4Z2WA 2YXYA 4UB8Z 3SJBC 5H9CA 4JI5O 1TUBB 4IIJB 1K3EA 1M1KW 3APQA 1A32A 1OHHG 2HJFC 2WLIA 4C7UA 3B8NA 2IJHA 4LFCO 2B1IA 2YS8A 1NZ6A 1AI5A 1EZVH 4X1YA 3CRAA 1V55B 1Z2GA 5B66Z 5LMUB 2UXCO 4H13B 4O2BA 3OW2U 1DF4A 1FPOA 2EIKC 4QE9A 3K5MA 3CP1A 4NR1A 4JTAB 4TOIA 2PTMA 3FX7A 3H1HH 4I0XA 3ZEDA 4WFEA 3HKDA 4HBNA 5F2VO 4F4LA 4XDKA 4MVZA 1M5IA 5LOVA 2M7WA 4I50B 1EM1A 1AR1B 2PF4E 3CCMV 2WWWA 2AXTZ 2EULA 1SKVA 4B3TB 4DR7B 2PI4A 4LH6A 5KMGA 1GM9A 4PA6A 1UPGA 1VQPV 4J10A 5CBFA 4ZKIA 1PNKA 4LFBO 2ZNJA 4GX5A 1I08A 1IURA 3CD6V 3D36A 3ZHVA 1R3IC 4L87A 1RFYA 2W6JG 4DV2O 1N8RW 3ML0A 3AK3A 2XASA 4B3MB 1SQXH 5GONB 5J9PC 1W0KG 4CBCA 3ZBHA 1K4DC 3STLC 4FLUA 5HFLA 2A7WA 2VQFO 3RYHB 4JZ2A 2Y69B 1CP9A 3WFVA 2H8PC 5LA6A 2D2CB 5JJJB 2QM7A 1QR9A 1IZ3A 1FKAO 1SZTA 1SA0B 1XMQO 5CB4B 5EK0A 1RM1B 3CCQV 3AG2C 3KG2A 4UCVA 2LO1A 3RVZA 2VWJA 3IGAC 3JALA 2EIJB 5ITZA 2PY5A 4UV9A 5A2QN 3SPIA 1I94B 4EB6B 1JOYA 1SETA 2E75B 4J41A 1NU1H 1AILA 5FNVA 3E22A 1MA1A 3BFRA 2DOSA 2RQ6A 2XNDG 4X20B 1XNQB 2WA4A 3D3IA 3KCXA 5EC1C 2R72A 4B7EA 4YJ3B 2A06H 1HNZB 4U3FH 2JGDB 3W7SA 2ZIMA 2NN4A 4FIPC 1FS0G 1KQSU 2R9RB 4X1IA 4YIPA 3F7VC 4MVMA 3S3XA 5L3FA 3D8CA 2EILB 4IIJA 4DR6O 3CMAV 2ITDC 3SGIA 4LF5B 3AG3C 1K5QA 3ETGA 3LNNA 3VBBA 2QTSA 1F4MA 4DV1B 3K79A 1FXKB 4P30A 2UXXA 3WB2A 1XMOB 3BRCA 5GW7A 5EC2C 4MVRA 1IBMO 2G38A 4MSWC 3DTUB 1KC8W 1GM8A 1H8EG 4GX1A 3STZC 3L70H 3QO5A 4DR1O 4I9WA 4GUNA 5LYJB 1LUWA 1GMGA 5LHHA 2B9ZA 4U7NA 4KHPB 1WJZA 2VS0A 3ABMB 5E79Z 4G27B 1J5EO 3J7AU 3SYQA 1Y74A 4JYBA 4B3RB 5CA0B 4JI2B 4TWKA 4DR3O 3RGBA 1XQ8A 4O2AB 3NXSA 1KB9F 4JI8O 5JCOC 3OD4A 1BT8A 2YIBA 3D36C 1BHBA 3OFNG 3OM3B 1M90W 2BSKB 3CCVV 3OGIB 1NTMH 2KKWA 2W0FC 4IYHA 1MOFA 3JYCA 2CK3G 1OCZC 1N36O 3JD3A 2DWEC 4UCUA 4IT5A 1MG1A 2CGNA 3CRCA 4D6TH 5GONA 3HKEB 2OYQA 4J7KA 4I7ZB 3RYHA 1BQZA 5LGNA 2CUGA 1VQKV 2ZNIA 4U3JA 1VQMV 2EIMB 4BIOA 3T1HB 4UCRA 1SA0A 3WB1A 3OTOB 3K9AA 1JFFB 1NI8A 5CB4A 1QQCA 3I5DA 2Q0AA 1MABG 1WPXA 4J42A 1AROP 2K9PA 4YHHO 3ZMVA 3AG1C 1MZFA 5BMVB 2UXDB 2JEXA 3SPGA 3D3QA 3EXAA 4FMTA 3DGEA 4GKJO 5IJ0B 1PL4A 4AQYB 4P2ZA 1YI2V 1M4UA 4R6ZA 4JV5O 2JS3A 5IJ9B 4X20A 3ZRWB 3IC9A 1HR0O 4JI1O 4JI7B 3T4DA 1NQTA 2HHHB 3L73H 1KUQA 3RYIB 4YJ3A 1FJGB 2QTOA 2DE0X 2RCVA 1K9MW 5JJNB 2AZ0A 1PNLA 4JTCB 5LP6B 4X89A 4DR2B 3BY6A 2DN9A 4J7ZA 5IWAB 1GN3A 2EZPA 3BPZA 4W4LA 1KKDA 3FB8C 2FB5A 4JAVA 3WU2Z 2UUBB 5H6QA 3CHXA 1AI7A 2LP7A 2Q8VA 5JVDB 4GX0A 4MTXA 1K7DA 5IE9A 1V55C 5K1PA 4UB6Z 1HNXB 4U7OA 5DEDA 4PI0A 3U0ZA 5J2TB 5H2FZ 4J7JA 4AHCA 4UCSA 3G67A 1DGSA 3JASB 4RUFA 3SJAC 5LMUO 3ZHUA 1XILA 3JD1A 3NR7A 1K8AW 3OMAB 4RQEA 3H9VA 2LFSA 4YIOA 1PKXA 3MDSA 5CA0A 2ZXWB 4LF8B 3UQ8A 3SJQC 3C3TA 2Q5ZA 5EYPB 3IJ4A 2Q4PA 3AEIA 3FFQA 2Q69A 4MVQA 5CBGA 2BSKA 2NNUA 3BVOA 1AR4A 4I4TA 3MAQA 2YI8A 5B1OA 4DUYB 1GM7A 4B3TO 1NH2D 4DR7O 2WAMA 5JWPA 4RUEA 4PHZA 2VRZA 5KHIA 3QO8A 4K35A 2XAJA 3B40A 3TETA 4KL1A 2QWNB 2Y48A 5LMNB 1RM1C 5BR8B 3CXHF 2DYRB 4B3MO 4JF3A 1GKFA 1JFFA 3OT7A 4OX9B 4CH5A 4DV3B 3OUSA 4YY3B 4O4HB 4I55B 2F95B 2H3OA 2XAGA 1VQ7V 2ATKC 5BMVA 1YZBA 4FFKA 3ZX6A 3QO7A 2CDYA 2L35A 4GCZA 5IJ0A 1B04A 2LGQA 3SPJA 1DTOA 4UVCA 4IGGA 4YJ2B 1VEWA 4MT8A 5EBLC 5IJ9A 4WFAV 2QM8A 3FB6C 4UFZA 3N2KA 4FM2A 1R6TA 1I94O 3JATB 1ZAUA 3RYIA 3G4SV 1D2DA 3JARA 1XNRB 3G80A 2WLNA 1KYOF 1CPYA 1SQBH 1PL0A 2IBZH 2GDSA 2ODMA 5LP6A 1BCCH 3CCSV 1SRYA 4AI8A 2EILC 3GWKC 2QM4A 5DN6G 4UVAA 1FFXB 4QPJA 3I55V 1XNQO 5C8YB 4CH3A 5JQGB 4NXMO 1HNZO 5JVDA 3G6BA 1VQOV 2YICA 4PD4F 3ZMSA 3DC5A 3C3SA 3ASNB 1V54B 4O4JB 4ZOLB 1G6UA 3AG7A 1R3KC 5C93A 4X66B 5J2TA 1O9HA 1NBMG 4DV1O 3SYCA 1S0VA 4FLXA 2UXBB 1QLNA 4I5SA 1XMOO 1VMGA 3JASA 3VQVA 2IH1C 3F7YC 4LC1A 1ZTEA 3AG4B 2JRIA 4DUZB 4QGPA 2ZM6B 2X6CA 2PYJA 1K97A 4J9ZB 2P5OA 2Y0PA 3ZIAG 1YHQV 2RJZA 1I5XA 2BCCH 4KHPO 4HNAB 5CBHA 3FB5C 4WFGA 2XAFA 2WLLB 3JD4A 4MW8A 5EYPA 1XL4A 2Q7EA 4FFBB 3ABUA 4B3RO 4JZGA 3VOUA 1Z5WA 2VWKA 3WG7B 2CH7B 3W7UA 1LR1A 3BA9A 4B3SB 2R9AA 2ZKOA 1YF2A 2WA3A 5KX5B 3G6EV 2F4VB 3A0RA 3N27A 1WP8A 1JPXA 3W7TA 4MS2A 2HJDA 4N21A 1Z5VA 3EFFK 5D5QA 1D5NA 1AI4A 3SYAA 4JI4B 4O4HA 4I55A 1YTFD 2QWOB 1NVPD 5GTHZ 1NT2B 3T1HO 4TV8B 2H94A 1S5HC 2V4DA 2JJ2G 3B09A 3OTOO 3HKBA 1KBHA 4LBEC 4X8AA 3E2EA 3HKCB 2AHYA 3T2MA 4MTFA 2GUZA 1ENVA 1TAEA 3X2QC 2W6IG 5IYCO 4G28B 2DYSB 2W0XA 5DECA 1VQ9V 1Q86W 1RPRA 2UXDO 4Q20A 3E89A 2GHYA 1SERA 3JATA 5LP6C 1NS1A 2Y4TA 1YITV 1AI6A 4AQYO 1IBKB 3T4ZA 2YUAA 5HFMA 1E1QG 1URFA 3SJCC 5J2UB 1W0JG 2F43G 2LW1A 4JI7O 3E83A 1XHXA 2HHHO 1V9PA 4OXSA 1XDCA 5C8YA 2NLJC 1FJGO 4DR4B 4JI6B 3HR0A 4DR2O 1KECA 5IWAO 1PNMA 2QGNA 4O4JA 4ZOLA 1BSMA 2QWPB 2UUBO 3UO2A 1YCIA 5H6RA 2OCCB 1K5SA 1NR1A 4O4LB 4UUJC 4KUMA 1IXBA 1H2LA 3GVMA 4NXNB 3K9SA 1S72V 2M6YA 3K0GA 1HNXO 2ITCC 1H2SB 3CRRA 4PDRA 2V1DA 3VQYA 4CS2A 2QWRB 1SZXA 4OPHA 4X62B 2UU9O 1XOUA 3CS5A 1P49A 2ZXWC 1DF5A 3QNEA 4JYYA 1M57C 1B3QA 3ZS8C 2QKAA 3K5LA 2QE7G 5CA1A 2BTQB 3LDEA 1AB3A 4MW3A 1LNQA 5BZBA 4JTDB 5L3DA 2CGOA 2HLDG 2RMKB 2ZE5A 5LHGA 1FXVA 4P9PA 1B6QA 2CTWA 2PYLA 1B06A 5BXZA 2UUCB 1DLBA 4FPPA 4FFBA 2K1EA 1TUBA 2QDOA 3QTCA 3UCSC 4IYIA 3RYCB 4LF8O 1RPOA 3CC2V 1QCEA 4DV6O 3ASOC 2N05A 4KP4A 5IYBO 1HW7A 3H1KH 1QNMA 4DUYO 1OCRB 5GTIZ 5DM6V 3IC7A 2MK3A 1CXZB 1TVKB 4DW0A 1R1BA 3MHHC 4JYCA 3CE2A 4EKWA 4NKGB 3G71V 4LF7B 3JSNA 5LMNO 5BR8O 4TV8A 1MSWD 1QVFU 1VP7A 2CTRA 2KB1A 4B7KA 3HKCA 4OX9O 4I50A 2FMLA 2Q9LA 2EINB 2YI9A 4DV3O 4PELA 1X59A 3TGUH 4KFMA 5JJEB 3HB3B 2GTAA 5B1AB 5KLVH 2P6JA 1S5LZ 4RO2A 1HP8A 1YDXA 3CRQA 3J81N 5IY5B 3CCRV 3SDLA 1Q6HA 2O57A
chains in the Genus database with same CATH topology
3RBZA 3P32A 1AJNA 5IDJA 1OZ0A 3AEIA 3TCUA 1NH2B 1OCOB 4UXNA 1V54C 3RVYA 2Q69A 4MVQA 5CBGA 2WLMA 2NNUA 5LHIA 1QVGU 1R73A 2X7RB 3MD0A 3ABKC 5E1AC 5B1OA 4QNHB 2B5UA 2P67A 4UV8A 1QLEB 1GM7A 3OGCC 1YJ9V 5B1BC 5IY5C 2Z5UA 1NH2D 1E79G 2WAMA 3ABLC 2YSUB 4RUEA 4WFHA 2JK5C 5L3EA 1K73W 2EBOA 3QO8A 3PJSK 2BOBC 4G2KA 3JD2A 2XAJA 1VQLV 1BHAA 3FYIB 1KP2A 1OCOC 4ASUG 1G4YB 1QR8A 4HYOA 3FB7C 2IJKA 3TETA 2DQ0A 2WLLA 1M56C 4X88A 4BAYA 2Y48A 3E8BA 3ETDA 3ZN1A 5H9CA 1RM1C 2QEXV 1H8HG 1F23A 2P90A 2DYRB 2JJ1G 4JF3A 1GKFA 4LP8A 1K3EA 1M1KW 3OUFA 4RQFA 2WLKA 2YEVA 3ABTA 1K33A 5EBMC 1OHHG 2HJFC 1YIJV 3OUSA 4PA3A 2WLIA 2XAGA 3B8NA 2IJHA 3UM7A 1VQ7V 2B1IA 4HAMA 1K92A 2ATKC 1YJWV 1AI5A 5L3CA 4Z1MG 1V55B 4BIZA 2A0LA 3QO7A 3OMIB 2XAQA 2DYRC 4GCZA 1F4NA 3OW2U 1DF4A 2Z3YA 3WG7C 5L3GA 3SPJA 2EIKC 4QE9A 2Q68A 1DTOA 4UVCA 1H38A 1FFTB 3CP1A 5L3BA 5EBLC 4MT8A 4J9YB 4JTAB 4WFAV 1Q7YW 2QM8A 3FB6C 1JVMA 1R3LC 2IU3A 3K08A 2WPDG 4N23A 3P30A 3G4SV 4JAUA 1JJ2U 3LNMB 4WFEA 1FXKA 5IYDO 5KA6A 1P7BA 4WF9V 1HWYA 4F4LA 2WLHA 2WLNA 4XDKA 1CPYA 4MVZA 1PL0A 5CMUA 1JX9A 2M7WA 2R9IA 1SRYA 1AR1B 3CCSV 2OTLV 3CCMV 2EILC 2WWWA 4XDJA 5DN6G 4UVAA 1UJWB 2XOKG 1OCCB 3SPHA 4QPJA 4E2LA 3F5WC 3I55V 2PI4A 3K3WA 4FJCC 4MTGA 1GM9A 4PA6A 1VQPV 5CBFA 4ZKIA 1PNKA 1VQOV 1H2GA 3RW0A 1EZJA 3ZMSA 4GX5A 3CD6V 3ASNB 1V54B 3D36A 1P4RA 3T1CA 1R3IC 3OMNB 4L87A 2W6JG 3E86A 2X6BA 3M99B 1N8RW 3ML0A 3AG2B 1R3KC 3LSQA 2XASA 5C93A 5LGUA 5J9PC 5B1BB 1GK9A 1W0KG 4MVOA 4CBCA 1NBMG 1K4DC 5B1NA 3STLC 5HFLA 3SYCA 1S0VA 4RAIA 1WLEA 2Y69B 4I5SA 1QLNA 1CP9A 3WFVA 2H8PC 1Q81W 4XDLA 2QM7A 2HR3A 3B77A 2IH1C 1QR9A 3F7YC 3ASNC 4LC1A 2ZD9A 3OEHG 1SZTA 3AG4B 3EHBB 4TT3G 4WFBV 1M56B 3E8HA 2Q6AA 3FKSG 1R6NA 1E1RG 4JGSA 5EK0A 5B3SC 5EBWC 1RM1B 2Q67A 3CCQV 3AG2C 1FXHA 3KG2A 3ZCCA 1S3JA 2XAHA 2X6CA 3RVZA 1K97A 4J9ZB 3IGAC 4FK5C 3ZIAG 1YHQV 4MTOA 1I5XA 2EIJB 2Y69C 3W7WA 4UV9A 5CBHA 3FB5C 4WFGA 2XAFA 2WLLB 3JD4A 4MW8A 3SPIA 1AJPA 3LUTB 1G8MA 4QIWF 3AG4C 1SETA 1JOYA 5CA3A 4R7CA 4P9OA 1XL4A 2FTKA 1L1FA 1QBZA 2HG5C 1S77D 3ABUA 3H01A 1THZA 3VOUA 3ZRVA 2QKSA 2XNDG 3WG7B 3CYOA 2EIKB 1F51A 2WLIB 3W7UA 4LCUC 1R3JC 3D3IA 3AG3B 3GB7C 2EIJC 5EC1C 3LDCA 3G6EV 3W7SA 5FL7G 4FIPC 1FS0G 1KQSU 2R9RB 3A0RA 1GTOA 3F7VC 4MVMA 5KA5A 2LFRA 2P7TC 2JIZG 1JPXA 3W7TA 3SYOA 1KD1W 1YTFB 1NVPB 3X2QB 4MS2A 5L3FA 2BOCC 1Y4MA 2EILB 4N21A 1Y66A 2QA4V 3EFFK 1TUEB 3CMAV 1IXMA 4DO2A 2ITDC 1AI4A 3AG3C 1K5QA 3ETEA 3ETGA 3SYAA 2ZDIA 3VBBA 1F4MA 4DXWA 3ZRWA 3K79A 1YTFD 3JCZA 3CC4V 1FXKB 4P30A 1NVPD 2UXXA 4R50A 2UXNA 4PDMA 5GW7A 2H94A 1S5HC 2HVKC 4ZBMA 5EC2C 2JJ2G 4MVRA 3IFXA 1EFRG 4MSWC 4LBEC 4X8AA 3E2EA 2AHYA 3T2MA 4MTFA 1ENVA 3DTUB 3X2QC 1NJIW 1KC8W 3JD0A 1GM8A 1H8EG 2W6IG 5IYCO 4GX1A 4G28B 4GT1A 1COWG 4PA4A 2DYSB 3STZC 1VQ9V 1Q86W 1RPRA 1BMFG 3QO5A 4I9WA 5LHHA 1GMGA 1FXKC 3E35A 4Q20A 4U7NA 3E89A 2GHYA 1SERA 4XBFA 3ABMB 1J95A 1YITV 4G27B 1AI6A 2IU0A 2ZR3A 3K03A 1OCRC 4H37A 3T4ZA 5HFMA 1E1QG 5B3SB 1W0JG 1VQ4V 3SYQA 3HPLC 4JYBA 2DYSC 2PI5A 4JPRA 2F43G 2EZOA 4TWKA 1JCHA 3E83A 3CMEV 2JEUA 3K04A 3ZN0A 4OXSA 3NXSA 2NLJC 1EBOA 3B8MA 1BHBA 3OE7G 3E8FA 3ABMC 2OTJV 2C2AA 3OFNG 3OM3B 3OEEG 3CCUV 1M90W 3OR7C 3GWOA 1KECA 3CCVV 1PNMA 2W0FC 1MOFA 3CXCU 3JYCA 2CK3G 1OCZC 2IW5A 5LGTA 3JD3A 2IJJA 2DWEC 2V7QG 1MG1A 1M57B 5H6RA 3CPWU 2OCCB 1K5SA 2B1GA 1CEZA 1NR1A 2DW4A 5B1AC 4UUJC 4KUMA 3AG1B 5LGNA 4JASA 1VQKV 1Q82W 3W7XA 1S72V 1VQMV 3K0GA 2EIMB 2ITCC 4PDLA 4PDRA 1K34A 2V1DA 2EJRA 1YJNV 2AHZA 1AJQA 3K9AA 1VQ6V 2IJIA 5KUKA 1BL8A 2X6AA 1MABG 1WPXA 2YEVB 1PD3A 1KP3A 2DQ3A 2ZXWC 2A79B 1DF5A 3QNEA 1S76D 1M57C 1AROP 1VQNV 2OCCC 3ZMVA 3CCJV 3K0DA 3AG1C 2QE7G 2JEXA 3LDEA 1R6KA 3SPGA 3ZJZA 4GX2A 1K4CC 2EIMC 4FMTA 3ASOB 3DGEA 4R8CA 4MW3A 1LNQA 3ZRSA 4BW5A 5BZBA 4JTDB 5L3DA 2HLDG 5LHGA 1FXVA 1QLEC 4P9PA 1B6QA 4P2ZA 4QJFB 1YI2V 1VQ5V 1DLBA 4R6ZA 4FPPA 2K1EA 5KUMA 4QE7A 2HFEC 2DWDC 2GSMB 3ZRWB 3T4DA 1NQTA 4H33A 1RPOA 4UVBA 3ZMUA 3CC2V 1QCEA 2QTOA 1ZWIC 1K9MW 2X0LA 3ASOC 4KP4A 1GO3F 3ZMTA 5IYBO 1PNLA 4JTCB 4WCEV 4X89A 3BY6A 1VQ8V 2EZPA 4HZ3A 1OCRB 3OR6C 4CZZA 1KKDA 3FYEB 2ZDIC 5DM6V 4MVSA 3FB8C 3IC7A 2MK3A 4JAVA 1YSCA 4PA9A 5H6QA 1AI7A 2LP7A 2HKOA 4GX0A 3K06A 3MHHC 4MTXA 4JYCA 2WLJA 1K7DA 3CC7V 1ROPA 4EKWA 1V55C 3G71V 3CCEV 1SESA 2IH3C 4TSFG 1M9NA 2HVJC 1NR7A 4PA7A 2A9HA 1MSWD 1QVFU 4U7OA 3TK1A 2KB1A 1OCZB 3MHSC 4BIUA 1NKDA 2EINB 3CCLV 5CN0A 3SPCA 3LDDA 2ZQMA 3I56V 3E8GA 2ZR2A 4MVUA 4WFFA 4PELA 1JQ0A 4KFMA 3HB3B 1I5YA 1XL6A 4RUFA 5B1AB 3BEHA 3R65A 3OAAG 5LBQA 4YXWG 3ZRXA 2P6JA 3JD1A 2D3OW 2WSSG 4RO2A 3UKMA 1K8AW 3ABKB 1ORQC 1OCCC 2JDIG 3SYPA 3OMAB 4PDVA 4RQEA 1W2BU 2EINC 2LFSA 3LSSA 1PKXA 4QPKA 3ZMZA 5IY5B 2ZXWB 3ABLB 2OT5A 3CCRV 3SJQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RBZ A;  4PA6 A;  3K0D A;  3AG1 C;  5CBF A;  4P30 A;  3LDE A;  4R50 A;  3RW0 A;  4PDM A;  3SPG A;  3TCU A;  3ZJZ A;  1V54 C;  4GX2 A;  4GX5 A;  3RVY A;  1K4C C;  2EIM C;  2Q69 A;  4R8C A;  4MVQ A;  1S5H C;  1LNQ A;  2HVK C;  4MW3 A;  2WLM A;  5EC2 C;  4JTD B;  4ZBM A;  3T1C A;  4MVR A;  3IFX A;  4BW5 A;  5BZB A;  1R3I C;  4MSW C;  4LBE C;  1QLE C;  3ABK C;  4X8A A;  4P9P A;  2AHY A;  5E1A C;  3E86 A;  4MTF A;  3T2M A;  4P2Z A;  3X2Q C;  4QNH B;  2X6B A;  1R3K C;  4R6Z A;  4GX1 A;  2K1E A;  3OGC C;  4G28 B;  5KUM A;  3ZRS A;  4PA4 A;  4QE7 A;  5B1B C;  3STZ C;  5IY5 C;  5J9P C;  2HFE C;  2DWD C;  3ABL C;  4RUE A;  4MVO A;  4WFH A;  4CBC A;  1K4D C;  2JK5 C;  3STL C;  3SYC A;  4I9W A;  3PJS K;  2BOB C;  3T4D A;  4H33 A;  4RAI A;  3E89 A;  2H8P C;  2QTO A;  4XDL A;  1OCO C;  1ZWI C;  1G4Y B;  4HYO A;  3FB7 C;  1J95 A;  2IH1 C;  3ASO C;  2WLL A;  1M56 C;  3ASN C;  3F7Y C;  4X88 A;  3SJQ C;  3TET A;  2ZD9 A;  3E8B A;  4G27 B;  4JTC B;  4X89 A;  3E8H A;  3K03 A;  5CBG A;  1OCR C;  2Q6A A;  4H37 A;  3T4Z A;  5B3S C;  5EK0 A;  4HZ3 A;  5EBW C;  3OR6 C;  2Q67 A;  4LP8 A;  3AG2 C;  3SYQ A;  3HPL C;  1KKD A;  3OUF A;  2DYS C;  3KG2 A;  2WLK A;  4MVS A;  3FB8 C;  2YEV A;  2X6C A;  4TWK A;  3RVZ A;  5EBM C;  4J9Z B;  3E83 A;  3IGA C;  2HJF C;  4PA9 A;  3OUS A;  4PA3 A;  3K04 A;  4MTO A;  2WLI A;  2Y69 C;  4OXS A;  4GX0 A;  2NLJ C;  3K06 A;  3UM7 A;  5CBH A;  2WLJ A;  2ATK C;  3FB5 C;  4WFG A;  2WLL B;  4MW8 A;  3SPI A;  3E8F A;  3ABM C;  1V55 C;  3LUT B;  4EKW A;  3OR7 C;  2IH3 C;  3AG4 C;  2A0L A;  2HVJ C;  4R7C A;  2W0F C;  2A9H A;  1XL4 A;  4PA7 A;  4P9O A;  3JYC A;  2HG5 C;  2DYR C;  1OCZ C;  2KB1 A;  3WG7 C;  2DWE C;  3VOU A;  3SPJ A;  2EIK C;  2QKS A;  4QE9 A;  2Q68 A;  3SPC A;  2WLI B;  3LDD A;  3E8G A;  4WFF A;  4MVU A;  4LCU C;  1R3J C;  5EBL C;  3GB7 C;  4J9Y B;  2EIJ C;  4JTA B;  5EC1 C;  3FB6 C;  1JVM A;  1R3L C;  3LDC A;  4KFM A;  5B1A C;  4UUJ C;  3K08 A;  1XL6 A;  4RUF A;  3BEH A;  3LNM B;  3R65 A;  4WFE A;  2R9R B;  1P7B A;  3F7V C;  4MVM A;  2WLH A;  3K0G A;  4F4L A;  2ITC C;  2WLN A;  4PDL A;  4XDK A;  4MVZ A;  4PDR A;  2P7T C;  4RO2 A;  3SYO A;  3UKM A;  2AHZ A;  1ORQ C;  5KUK A;  1OCC C;  2EIL C;  3SYP A;  4PDV A;  4XDJ A;  4MS2 A;  1BL8 A;  2X6A A;  2EIN C;  2BOC C;  3SPH A;  2ZXW C;  3EFF K;  3F5W C;  2A79 B;  2ITD C;  3AG3 C;  1M57 C;  3SYA A;  4MTG A;  2OCC C;  4DXW A; 
#chains in the Genus database with same CATH topology
 3BAB A;  3P32 A;  4LFC B;  3ICX A;  1XNR O;  1AJN A;  5IDJ A;  3VQW A;  1NH2 B;  1OCO B;  4UXN A;  1V54 C;  1AVM A;  1XEQ A;  3L72 H;  3CJH B;  5LHI A;  1QVG U;  1R73 A;  2X7R B;  3MD0 A;  3ABK C;  2XHB A;  2P67 A;  4UV8 A;  1QLE B;  1WA8 B;  3OGC C;  1PPJ H;  2E74 B;  3ABL C;  2YSU B;  4WFH A;  3RWR D;  2JGU A;  5K1X A;  2EBO A;  1N34 B;  1VQL V;  1BHA A;  4O4L A;  3FYI B;  1QR8 A;  3FB7 C;  4X88 A;  4BAY A;  4EB6 A;  3ZN1 A;  2QEX V;  5H5N A;  1H8H G;  1AR5 A;  1F23 A;  2P90 A;  4LP8 A;  2JJ1 G;  4K0K B;  2N04 A;  3OUF A;  1Q8I A;  1K33 A;  5EBM C;  4Z1V A;  1YIJ V;  4PA3 A;  2UXB O;  1HNW B;  5BY1 A;  3ZHR A;  5L3C A;  4Z1M G;  4ZIB A;  2JGD A;  4BIZ A;  4DUZ O;  2XAQ A;  2FL4 A;  2UUA B;  1F4N A;  1Y67 A;  3JAW B;  2ZM6 O;  3WG7 C;  5L3G A;  3C90 A;  2Q68 A;  4H44 B;  4CH4 A;  1FFT B;  4J9Y B;  2RNB A;  1L0L H;  1R3L C;  2IU3 A;  3K08 A;  4L8J A;  4CH6 A;  1YEW A;  2GBO A;  3P30 A;  1JJ2 U;  4JI0 B;  3LNM B;  2YIA A;  1FXK A;  5IYD O;  5KA6 A;  1P7B A;  5CMU A;  4GZR B;  2R9I A;  3SPH A;  4FLV A;  4E2L A;  3F5W C;  4D7T A;  2JVD A;  3KKY A;  4B3S O;  3O65 A;  2FYU H;  4KXR A;  4MTG A;  1UFI A;  1ZUQ A;  1RSO B;  1Y6X A;  4JYA B;  5LYJ A;  1WAZ A;  1EZJ A;  3T1C A;  1P4R A;  5KAF Z;  3B4S A;  3OMN B;  3JCU Z;  3E86 A;  3K5O A;  2X6B A;  3H1I H;  3M99 B;  3AG2 B;  3LSQ A;  1BQ0 A;  5LGU A;  3R66 A;  1GK9 A;  4JI4 O;  1SQG A;  1TGO A;  1VF6 A;  4RAI A;  1Q81 W;  4O2A A;  4XDL A;  3B77 A;  2KG7 B;  2OWO A;  2KSD A;  3THO A;  1O9G A;  2ZD9 A;  3OEH G;  3EHB B;  1R6N A;  1E1R G;  4JGS A;  1KU9 A;  3RYF B;  5EBW C;  1VAR A;  2Q67 A;  4DR6 B;  2XAH A;  4J11 A;  3H1J H;  2Y69 C;  3W7W A;  5JH7 B;  3HKE A;  4NTX A;  3RT3 C;  1AJP A;  4WBN B;  1OV9 A;  1L0N H;  1G8M A;  2YDE A;  4FVM A;  2Y0I A;  5CA3 A;  4UCT A;  1IBK O;  1GN6 A;  4P9O A;  1IBM B;  3CJH A;  4Q6G A;  3H01 A;  3ZRV A;  2QKS A;  1MSD A;  3CYO A;  1N33 B;  2WLI B;  1F51 A;  2RN9 A;  4X65 B;  3AG3 B;  2EIJ C;  4DV4 B;  3DC6 A;  4F6R B;  5LXT B;  3LDC A;  3FAV B;  1BGY H;  1L8D A;  1MNG A;  4GLX A;  2F1M A;  1QU7 A;  3BA8 A;  4O2B B;  1J5E B;  1KD1 W;  1YTF B;  2N74 A;  1NVP B;  2BOC C;  1Y4M A;  4X1K B;  3JAK B;  4DR5 B;  1Y66 A;  4LFA B;  2Y4U A;  3DSQ A;  4H0L B;  4DXW A;  3ZRW A;  3ZHT A;  3CSX A;  3JCZ A;  3CC4 V;  4JI8 B;  4NXN O;  2QJ1 A;  5LOV B;  3RFR A;  2OIG A;  1EFR G;  1QHT A;  4X62 O;  4CS4 A;  4X64 B;  3CB2 A;  4PA4 A;  3QVN A;  4PV1 B;  4GYC B;  4TQF A;  3FD9 A;  3A0H Z;  1FXK C;  2IM9 A;  1PV0 A;  4XBF A;  2LQT A;  4LF6 B;  1J95 A;  2IU0 A;  1OCR C;  4H37 A;  2UUC O;  3M7M X;  5B3S B;  3KZI Z;  4ICG A;  2F23 A;  2EZO A;  4LF5 O;  2YC0 A;  3K04 A;  2XTA A;  5LA6 B;  4DW1 A;  5FLX N;  1WN7 A;  1ZL8 B;  3ABM C;  2C2A A;  3OEE G;  3CCU V;  3GWO A;  2QWQ B;  4JI3 B;  1TA8 A;  4TV9 B;  1YVW A;  4E4E A;  5EIB C;  2IJJ A;  2XT9 A;  1VF7 A;  1VF6 C;  4JAA A;  5KHJ A;  2ZE8 A;  4DV7 B;  3CPW U;  2B1G A;  2DW4 A;  5B1A C;  3AG1 B;  1JMK C;  4LF7 O;  3W7X A;  1Y76 B;  1S5J A;  4PDL A;  1XUQ A;  3E22 B;  1K34 A;  3KCY A;  2EJR A;  1VQ6 V;  5KUK A;  1PM9 A;  2LGW A;  2YEV B;  3A2F A;  4JI2 O;  1KP3 A;  2A79 B;  3CX5 F;  3PN1 A;  1S76 D;  2L6L A;  1VF5 B;  3P3P A;  4X1I B;  4O4I B;  1R6K A;  2YXL A;  2EIM C;  4WBN A;  4R8C A;  1QLE C;  2PUS A;  5D5P A;  2Q7G A;  4LNU B;  4QE7 A;  2DWD C;  3K5N A;  2GSM B;  3LSU A;  4UVB A;  4F6R A;  5LXT A;  2ILM A;  4F6E A;  3FAV A;  3ZMT A;  4WCE V;  1NTK H;  1EN5 A;  1VQ8 V;  4GKK B;  1GN4 A;  4FZ1 A;  4DYL A;  3OR6 C;  1IBL B;  1JJO A;  4CZZ A;  4OPA A;  3UO3 A;  3FYE B;  4IL6 Z;  4K3A A;  4MVS A;  4X1K A;  3JAK A;  2OIE A;  4PA9 A;  4EFE A;  1N34 O;  5KHG A;  2HKO A;  2E5L B;  4YJ2 A;  3K06 A;  4NB5 A;  2WLJ A;  2CE4 A;  1U97 A;  1ROP A;  3CCE V;  5EZY B;  4TSF G;  1N0N A;  2ZIO A;  1WB7 A;  4PA7 A;  2A9H A;  4K0K O;  1Y74 B;  3TK1 A;  3ZHQ A;  3MHS C;  1AP5 A;  3L71 H;  5CN0 A;  3LDD A;  3I56 V;  3E8G A;  2ZR2 A;  4MVU A;  4WFF A;  1FFX A;  1HNW O;  4CS3 A;  1JQ0 A;  3APO A;  1I0H A;  2R70 A;  5B5E Z;  5JQG A;  5JCO A;  3OAA G;  1FAF A;  1GH6 A;  4PI2 A;  2UUA O;  3BCC H;  2BTO A;  4PDV A;  1W2B U;  1N4C A;  3LSS A;  4FLY A;  4QPK A;  4ZHQ B;  3CC7 V;  2P06 A;  1WP7 A;  4BW9 A;  4U3J B;  4JI0 O;  2OCH A;  1OZ0 A;  1ZL8 A;  3Q4H B;  3B2E E;  2EJ7 A;  4TV9 A;  3L9D A;  1YJ9 V;  1GAX A;  1E79 G;  1EN6 A;  5L3E A;  4DV5 B;  1K73 W;  5A9G A;  4G2K A;  3JD2 A;  4LR3 A;  4EFB A;  2VQE B;  4JYA O;  5KAI Z;  3BHP A;  1KP2 A;  4HNA A;  1G4Y B;  1XRE A;  4BWA A;  2WLL A;  1Y76 A;  2GV9 A;  3E8B A;  3ETD A;  2YID A;  4LF9 B;  3AK2 A;  2QKC A;  4LWS B;  4RQF A;  2WLK A;  2YEV A;  3ABT A;  2CTP A;  2CH7 A;  2Z0A A;  3UM7 A;  4NXM B;  4HAM A;  1K92 A;  1Q43 A;  1YJW V;  3P3N A;  3F5T A;  4O4I A;  5KX5 A;  3T1Y B;  2A0L A;  3OMI B;  2P4V A;  2DYR C;  2Z3Y A;  5IYZ B;  1YXB A;  4DV0 B;  1H38 A;  3IAY A;  2ARH A;  1N32 B;  2ADP A;  4LNU A;  5L3B A;  1DK1 A;  1Q7Y W;  1JVM A;  2WPD G;  1G1X B;  4N23 A;  4JAU A;  1EN4 A;  4WF9 V;  4LF4 B;  1HWY A;  2WLH A;  3H1L H;  1JX9 A;  2OTL V;  4CC5 A;  3CWB H;  4XDJ A;  1UJW B;  1OCC B;  2XOK G;  1N33 O;  3CRM A;  4X65 O;  4X9Q A;  2QSA A;  4DV4 O;  2RDC A;  4YY3 O;  3K3W A;  4FJC C;  4FLT A;  1GN2 A;  1H2G A;  3RW0 A;  1WPB A;  1GRJ A;  5EZY A;  2Q7H A;  4JI5 B;  1ZX3 A;  4DR5 O;  4LFA O;  2YIB D;  4DK1 A;  1M93 A;  2LW7 A;  5J2U A;  2E3C A;  2CTQ A;  5B1B B;  4MVO A;  1SS3 A;  3SR2 C;  5B1N A;  2P4K A;  3K58 A;  5FPO A;  1WLE A;  1IVS A;  3ZHS A;  2DJV A;  4DK0 A;  2HR3 A;  4I4T B;  3ASN C;  2NR5 A;  3AK1 A;  4WFB V;  2Q73 A;  4TT3 G;  1M56 B;  4X64 O;  3E8H A;  2Q6A A;  3FKS G;  5B3S C;  2UXC B;  2AW9 A;  1H2N A;  3VQX A;  1I7F A;  1FXH A;  3ZCC A;  1S3J A;  4FK5 C;  4ZHQ A;  4MTO A;  5LL6 Y;  3BAA A;  4LF6 O;  4NTW A;  1D5A A;  3LUT B;  4QIW F;  3N2G B;  3AG4 C;  4R7C A;  3Q4H A;  2FTK A;  1L1F A;  4K8Z A;  1QBZ A;  2HG5 C;  1WB8 A;  1S77 D;  1SQP H;  1THZ A;  4X66 O;  4ZI7 B;  1JR9 A;  2EIK B;  4LCU C;  1R3J C;  3GB7 C;  3K57 A;  4BR6 A;  1XHZ A;  1WNS A;  2JS5 A;  4LFB B;  4JI3 O;  5FL7 G;  2BTQ A;  1GTO A;  2FKX A;  2E76 B;  1F7Y A;  5KA5 A;  2LFR A;  2P7T C;  1XBL A;  2JIZ G;  3TXQ A;  2HEP A;  3SYO A;  3TXS A;  4TQD A;  3X2Q B;  4DV2 B;  2QA4 V;  1TUE B;  4DV7 O;  4LWS A;  1IXM A;  4DO2 A;  3ETE A;  3WB0 A;  3N2K B;  2ZDI A;  1LUV A;  3RYC A;  2ADQ B;  2Q0O C;  2VQF B;  3JAR B;  4R50 A;  1IX9 A;  2UXN A;  4PDM A;  1KKC A;  2HVK C;  4ZBM A;  3IFX A;  1XMQ B;  1IDS A;  1NJI W;  1Q6I A;  3JD0 A;  3A0B Z;  3DXR B;  4GT1 A;  1COW G;  5IYZ A;  2PZS A;  1BMF G;  2LJ2 A;  1H2M A;  4IHJ B;  4CC6 A;  1OJH A;  3E35 A;  2EX3 A;  1TVK A;  2F4V O;  4DRX B;  2ZR3 A;  3JAM N;  3U10 A;  3K03 A;  3EVK A;  4J80 A;  1ZLZ A;  1BS3 A;  1VQ4 V;  1MMM A;  3HPL C;  1H2K A;  2UU9 B;  1SF9 A;  2DYS C;  4NYK A;  4JPR A;  2PI5 A;  1JCH A;  3CME V;  2JEU A;  3ZN0 A;  1FD9 A;  2P22 C;  3UT5 B;  5EIB D;  4FLW A;  1EBO A;  1KMI Z;  3B8M A;  3OE7 G;  3E8F A;  2OTJ V;  3OR7 C;  4GKK O;  2YXH A;  1W59 A;  1IBL O;  3CXC U;  1Q5O A;  2IW5 A;  5LGT A;  2V7Q G;  1BE3 H;  2E5L O;  1M57 B;  1PP9 H;  1CEZ A;  2ZE6 A;  4JAS A;  4TUY B;  4DV6 B;  1AP6 A;  1Q82 W;  3O9O A;  4OGQ B;  4I9Q A;  1P84 F;  2DMX A;  1YJN V;  2AHZ A;  1AJQ A;  2IJI A;  1HDJ A;  1BL8 A;  2X6A A;  4FM1 A;  2ZE7 A;  4B08 A;  1PD3 A;  2DQ3 A;  5TIS Z;  1WA8 A;  2MW2 B;  1VQN V;  2OCC C;  3CCJ V;  3K0D A;  3JSL A;  4DR1 B;  3QF7 A;  1XI1 A;  1FYJ A;  4DR4 O;  4JI6 O;  1SQF A;  4X1Y B;  2CAZ C;  1Q90 D;  3ZJZ A;  4GX2 A;  1K4C C;  3ASO B;  1SQV H;  3ZRS A;  4BW5 A;  3M8A A;  3N2G A;  4ABM A;  4FLZ A;  4QJF B;  5KHK A;  4A5U B;  1MZE A;  1U96 A;  1NTZ H;  1VQ5 V;  5KUM A;  4ZI7 A;  2HFE C;  2GTS A;  4DR3 B;  2AZ2 A;  1VIB A;  5IT9 N;  4H33 A;  3ZMU A;  2F93 B;  2AGA A;  4I0X B;  4FZ0 A;  1SC5 B;  3HKD B;  1ZWI C;  2PGG A;  3HKB B;  2X0L A;  1GO3 F;  5KHH A;  2GUZ B;  4UCO A;  5FPR A;  2KQX A;  4HZ3 A;  2ZIN A;  4AIL C;  2ZCE A;  1N36 B;  2ZDI C;  3JAW A;  5KMG B;  4DV5 O;  1YSC A;  2BE3 A;  2VQE O;  3J80 N;  1ZSP A;  1BZK A;  1SES A;  1X4T A;  2IH3 C;  1RP3 B;  1M9N A;  2F66 C;  2HVJ C;  1NR7 A;  3ETQ A;  4LF9 O;  1OCZ B;  4BIU A;  1N0J A;  1NKD A;  3CCL V;  3DXR A;  3SPC A;  2ZQM A;  1Q6U A;  4RWU A;  3L75 H;  3RN4 A;  4EEQ A;  4IHJ A;  4D7S A;  2ETN A;  4YHH B;  1I5Y A;  1XL6 A;  1RSO A;  4W4K A;  3BEH A;  4NVP A;  3S3W A;  3R65 A;  2ZT9 B;  5LBQ A;  3T1Y O;  4YXW G;  3ZRX A;  2D3O W;  2WSS G;  3UKM A;  4GKJ B;  4DRX A;  1SQQ H;  3ABK B;  1ORQ C;  1OCC C;  2JDI G;  3SYP A;  3K59 A;  2EIN C;  4DV0 O;  1N32 O;  3CEI A;  3JAL B;  3A8T A;  3ZMZ A;  4JV5 B;  4NTY A;  3L74 H;  3ABL B;  2OT5 A;  5ITZ B;  1JA8 A;  2HP8 A;  3RBZ A;  4JI1 B;  1HR0 B;  3UT5 A;  5AG2 A;  4LH7 A;  4LF4 O;  3TCU A;  4FM0 A;  3TJT A;  3RVY A;  2WLM A;  2KG7 A;  5FNV B;  4K8X A;  4PJ0 Z;  5E1A C;  3QG5 A;  4QNH B;  1P7G A;  2B5U A;  3U11 A;  2QR4 A;  2A3Q A;  3RYF A;  1T5E A;  5B1B C;  5IY5 C;  2Z5U A;  2JK5 C;  1Q3E A;  5CA1 B;  3PJS K;  2BOB C;  1US6 A;  2XUM A;  3OTF A;  5JH7 A;  1OCO C;  4ASU G;  4TUY A;  4HYO A;  2IJK A;  2DQ0 A;  1M56 C;  4Z2W A;  2YXY A;  4UB8 Z;  3SJB C;  5H9C A;  4JI5 O;  1TUB B;  4IIJ B;  1K3E A;  1M1K W;  3APQ A;  1A32 A;  1OHH G;  2HJF C;  2WLI A;  4C7U A;  3B8N A;  2IJH A;  4LFC O;  2B1I A;  2YS8 A;  1NZ6 A;  1AI5 A;  1EZV H;  4X1Y A;  3CRA A;  1V55 B;  1Z2G A;  5B66 Z;  5LMU B;  2UXC O;  4H13 B;  4O2B A;  3OW2 U;  1DF4 A;  1FPO A;  2EIK C;  4QE9 A;  3K5M A;  3CP1 A;  4NR1 A;  4JTA B;  4TOI A;  2PTM A;  3FX7 A;  3H1H H;  4I0X A;  3ZED A;  4WFE A;  3HKD A;  4HBN A;  5F2V O;  4F4L A;  4XDK A;  4MVZ A;  1M5I A;  5LOV A;  2M7W A;  4I50 B;  1EM1 A;  1AR1 B;  2PF4 E;  3CCM V;  2WWW A;  2AXT Z;  2EUL A;  1SKV A;  4B3T B;  4DR7 B;  2PI4 A;  4LH6 A;  5KMG A;  1GM9 A;  4PA6 A;  1UPG A;  1VQP V;  4J10 A;  5CBF A;  4ZKI A;  1PNK A;  4LFB O;  2ZNJ A;  4GX5 A;  1I08 A;  1IUR A;  3CD6 V;  3D36 A;  3ZHV A;  1R3I C;  4L87 A;  1RFY A;  2W6J G;  4DV2 O;  1N8R W;  3ML0 A;  3AK3 A;  2XAS A;  4B3M B;  1SQX H;  5GON B;  5J9P C;  1W0K G;  4CBC A;  3ZBH A;  1K4D C;  3STL C;  4FLU A;  5HFL A;  2A7W A;  2VQF O;  3RYH B;  4JZ2 A;  2Y69 B;  1CP9 A;  3WFV A;  2H8P C;  5LA6 A;  2D2C B;  5JJJ B;  2QM7 A;  1QR9 A;  1IZ3 A;  1FKA O;  1SZT A;  1SA0 B;  1XMQ O;  5CB4 B;  5EK0 A;  1RM1 B;  3CCQ V;  3AG2 C;  3KG2 A;  4UCV A;  2LO1 A;  3RVZ A;  2VWJ A;  3IGA C;  3JAL A;  2EIJ B;  5ITZ A;  2PY5 A;  4UV9 A;  5A2Q N;  3SPI A;  1I94 B;  4EB6 B;  1JOY A;  1SET A;  2E75 B;  4J41 A;  1NU1 H;  1AIL A;  5FNV A;  3E22 A;  1MA1 A;  3BFR A;  2DOS A;  2RQ6 A;  2XND G;  4X20 B;  1XNQ B;  2WA4 A;  3D3I A;  3KCX A;  5EC1 C;  2R72 A;  4B7E A;  4YJ3 B;  2A06 H;  1HNZ B;  4U3F H;  2JGD B;  3W7S A;  2ZIM A;  2NN4 A;  4FIP C;  1FS0 G;  1KQS U;  2R9R B;  4X1I A;  4YIP A;  3F7V C;  4MVM A;  3S3X A;  5L3F A;  3D8C A;  2EIL B;  4IIJ A;  4DR6 O;  3CMA V;  2ITD C;  3SGI A;  4LF5 B;  3AG3 C;  1K5Q A;  3ETG A;  3LNN A;  3VBB A;  2QTS A;  1F4M A;  4DV1 B;  3K79 A;  1FXK B;  4P30 A;  2UXX A;  3WB2 A;  1XMO B;  3BRC A;  5GW7 A;  5EC2 C;  4MVR A;  1IBM O;  2G38 A;  4MSW C;  3DTU B;  1KC8 W;  1GM8 A;  1H8E G;  4GX1 A;  3STZ C;  3L70 H;  3QO5 A;  4DR1 O;  4I9W A;  4GUN A;  5LYJ B;  1LUW A;  1GMG A;  5LHH A;  2B9Z A;  4U7N A;  4KHP B;  1WJZ A;  2VS0 A;  3ABM B;  5E79 Z;  4G27 B;  1J5E O;  3J7A U;  3SYQ A;  1Y74 A;  4JYB A;  4B3R B;  5CA0 B;  4JI2 B;  4TWK A;  4DR3 O;  3RGB A;  1XQ8 A;  4O2A B;  3NXS A;  1KB9 F;  4JI8 O;  5JCO C;  3OD4 A;  1BT8 A;  2YIB A;  3D36 C;  1BHB A;  3OFN G;  3OM3 B;  1M90 W;  2BSK B;  3CCV V;  3OGI B;  1NTM H;  2KKW A;  2W0F C;  4IYH A;  1MOF A;  3JYC A;  2CK3 G;  1OCZ C;  1N36 O;  3JD3 A;  2DWE C;  4UCU A;  4IT5 A;  1MG1 A;  2CGN A;  3CRC A;  4D6T H;  5GON A;  3HKE B;  2OYQ A;  4J7K A;  4I7Z B;  3RYH A;  1BQZ A;  5LGN A;  2CUG A;  1VQK V;  2ZNI A;  4U3J A;  1VQM V;  2EIM B;  4BIO A;  3T1H B;  4UCR A;  1SA0 A;  3WB1 A;  3OTO B;  3K9A A;  1JFF B;  1NI8 A;  5CB4 A;  1QQC A;  3I5D A;  2Q0A A;  1MAB G;  1WPX A;  4J42 A;  1ARO P;  2K9P A;  4YHH O;  3ZMV A;  3AG1 C;  1MZF A;  5BMV B;  2UXD B;  2JEX A;  3SPG A;  3D3Q A;  3EXA A;  4FMT A;  3DGE A;  4GKJ O;  5IJ0 B;  1PL4 A;  4AQY B;  4P2Z A;  1YI2 V;  1M4U A;  4R6Z A;  4JV5 O;  2JS3 A;  5IJ9 B;  4X20 A;  3ZRW B;  3IC9 A;  1HR0 O;  4JI1 O;  4JI7 B;  3T4D A;  1NQT A;  2HHH B;  3L73 H;  1KUQ A;  3RYI B;  4YJ3 A;  1FJG B;  2QTO A;  2DE0 X;  2RCV A;  1K9M W;  5JJN B;  2AZ0 A;  1PNL A;  4JTC B;  5LP6 B;  4X89 A;  4DR2 B;  3BY6 A;  2DN9 A;  4J7Z A;  5IWA B;  1GN3 A;  2EZP A;  3BPZ A;  4W4L A;  1KKD A;  3FB8 C;  2FB5 A;  4JAV A;  3WU2 Z;  2UUB B;  5H6Q A;  3CHX A;  1AI7 A;  2LP7 A;  2Q8V A;  5JVD B;  4GX0 A;  4MTX A;  1K7D A;  5IE9 A;  1V55 C;  5K1P A;  4UB6 Z;  1HNX B;  4U7O A;  5DED A;  4PI0 A;  3U0Z A;  5J2T B;  5H2F Z;  4J7J A;  4AHC A;  4UCS A;  3G67 A;  1DGS A;  3JAS B;  4RUF A;  3SJA C;  5LMU O;  3ZHU A;  1XIL A;  3JD1 A;  3NR7 A;  1K8A W;  3OMA B;  4RQE A;  3H9V A;  2LFS A;  4YIO A;  1PKX A;  3MDS A;  5CA0 A;  2ZXW B;  4LF8 B;  3UQ8 A;  3SJQ C;  3C3T A;  2Q5Z A;  5EYP B;  3IJ4 A;  2Q4P A;  3AEI A;  3FFQ A;  2Q69 A;  4MVQ A;  5CBG A;  2BSK A;  2NNU A;  3BVO A;  1AR4 A;  4I4T A;  3MAQ A;  2YI8 A;  5B1O A;  4DUY B;  1GM7 A;  4B3T O;  1NH2 D;  4DR7 O;  2WAM A;  5JWP A;  4RUE A;  4PHZ A;  2VRZ A;  5KHI A;  3QO8 A;  4K35 A;  2XAJ A;  3B40 A;  3TET A;  4KL1 A;  2QWN B;  2Y48 A;  5LMN B;  1RM1 C;  5BR8 B;  3CXH F;  2DYR B;  4B3M O;  4JF3 A;  1GKF A;  1JFF A;  3OT7 A;  4OX9 B;  4CH5 A;  4DV3 B;  3OUS A;  4YY3 B;  4O4H B;  4I55 B;  2F95 B;  2H3O A;  2XAG A;  1VQ7 V;  2ATK C;  5BMV A;  1YZB A;  4FFK A;  3ZX6 A;  3QO7 A;  2CDY A;  2L35 A;  4GCZ A;  5IJ0 A;  1B04 A;  2LGQ A;  3SPJ A;  1DTO A;  4UVC A;  4IGG A;  4YJ2 B;  1VEW A;  4MT8 A;  5EBL C;  5IJ9 A;  4WFA V;  2QM8 A;  3FB6 C;  4UFZ A;  3N2K A;  4FM2 A;  1R6T A;  1I94 O;  3JAT B;  1ZAU A;  3RYI A;  3G4S V;  1D2D A;  3JAR A;  1XNR B;  3G80 A;  2WLN A;  1KYO F;  1CPY A;  1SQB H;  1PL0 A;  2IBZ H;  2GDS A;  2ODM A;  5LP6 A;  1BCC H;  3CCS V;  1SRY A;  4AI8 A;  2EIL C;  3GWK C;  2QM4 A;  5DN6 G;  4UVA A;  1FFX B;  4QPJ A;  3I55 V;  1XNQ O;  5C8Y B;  4CH3 A;  5JQG B;  4NXM O;  1HNZ O;  5JVD A;  3G6B A;  1VQO V;  2YIC A;  4PD4 F;  3ZMS A;  3DC5 A;  3C3S A;  3ASN B;  1V54 B;  4O4J B;  4ZOL B;  1G6U A;  3AG7 A;  1R3K C;  5C93 A;  4X66 B;  5J2T A;  1O9H A;  1NBM G;  4DV1 O;  3SYC A;  1S0V A;  4FLX A;  2UXB B;  1QLN A;  4I5S A;  1XMO O;  1VMG A;  3JAS A;  3VQV A;  2IH1 C;  3F7Y C;  4LC1 A;  1ZTE A;  3AG4 B;  2JRI A;  4DUZ B;  4QGP A;  2ZM6 B;  2X6C A;  2PYJ A;  1K97 A;  4J9Z B;  2P5O A;  2Y0P A;  3ZIA G;  1YHQ V;  2RJZ A;  1I5X A;  2BCC H;  4KHP O;  4HNA B;  5CBH A;  3FB5 C;  4WFG A;  2XAF A;  2WLL B;  3JD4 A;  4MW8 A;  5EYP A;  1XL4 A;  2Q7E A;  4FFB B;  3ABU A;  4B3R O;  4JZG A;  3VOU A;  1Z5W A;  2VWK A;  3WG7 B;  2CH7 B;  3W7U A;  1LR1 A;  3BA9 A;  4B3S B;  2R9A A;  2ZKO A;  1YF2 A;  2WA3 A;  5KX5 B;  3G6E V;  2F4V B;  3A0R A;  3N27 A;  1WP8 A;  1JPX A;  3W7T A;  4MS2 A;  2HJD A;  4N21 A;  1Z5V A;  3EFF K;  5D5Q A;  1D5N A;  1AI4 A;  3SYA A;  4JI4 B;  4O4H A;  4I55 A;  1YTF D;  2QWO B;  1NVP D;  5GTH Z;  1NT2 B;  3T1H O;  4TV8 B;  2H94 A;  1S5H C;  2V4D A;  2JJ2 G;  3B09 A;  3OTO O;  3HKB A;  1KBH A;  4LBE C;  4X8A A;  3E2E A;  3HKC B;  2AHY A;  3T2M A;  4MTF A;  2GUZ A;  1ENV A;  1TAE A;  3X2Q C;  2W6I G;  5IYC O;  4G28 B;  2DYS B;  2W0X A;  5DEC A;  1VQ9 V;  1Q86 W;  1RPR A;  2UXD O;  4Q20 A;  3E89 A;  2GHY A;  1SER A;  3JAT A;  5LP6 C;  1NS1 A;  2Y4T A;  1YIT V;  1AI6 A;  4AQY O;  1IBK B;  3T4Z A;  2YUA A;  5HFM A;  1E1Q G;  1URF A;  3SJC C;  5J2U B;  1W0J G;  2F43 G;  2LW1 A;  4JI7 O;  3E83 A;  1XHX A;  2HHH O;  1V9P A;  4OXS A;  1XDC A;  5C8Y A;  2NLJ C;  1FJG O;  4DR4 B;  4JI6 B;  3HR0 A;  4DR2 O;  1KEC A;  5IWA O;  1PNM A;  2QGN A;  4O4J A;  4ZOL A;  1BSM A;  2QWP B;  2UUB O;  3UO2 A;  1YCI A;  5H6R A;  2OCC B;  1K5S A;  1NR1 A;  4O4L B;  4UUJ C;  4KUM A;  1IXB A;  1H2L A;  3GVM A;  4NXN B;  3K9S A;  1S72 V;  2M6Y A;  3K0G A;  1HNX O;  2ITC C;  1H2S B;  3CRR A;  4PDR A;  2V1D A;  3VQY A;  4CS2 A;  2QWR B;  1SZX A;  4OPH A;  4X62 B;  2UU9 O;  1XOU A;  3CS5 A;  1P49 A;  2ZXW C;  1DF5 A;  3QNE A;  4JYY A;  1M57 C;  1B3Q A;  3ZS8 C;  2QKA A;  3K5L A;  2QE7 G;  5CA1 A;  2BTQ B;  3LDE A;  1AB3 A;  4MW3 A;  1LNQ A;  5BZB A;  4JTD B;  5L3D A;  2CGO A;  2HLD G;  2RMK B;  2ZE5 A;  5LHG A;  1FXV A;  4P9P A;  1B6Q A;  2CTW A;  2PYL A;  1B06 A;  5BXZ A;  2UUC B;  1DLB A;  4FPP A;  4FFB A;  2K1E A;  1TUB A;  2QDO A;  3QTC A;  3UCS C;  4IYI A;  3RYC B;  4LF8 O;  1RPO A;  3CC2 V;  1QCE A;  4DV6 O;  3ASO C;  2N05 A;  4KP4 A;  5IYB O;  1HW7 A;  3H1K H;  1QNM A;  4DUY O;  1OCR B;  5GTI Z;  5DM6 V;  3IC7 A;  2MK3 A;  1CXZ B;  1TVK B;  4DW0 A;  1R1B A;  3MHH C;  4JYC A;  3CE2 A;  4EKW A;  4NKG B;  3G71 V;  4LF7 B;  3JSN A;  5LMN O;  5BR8 O;  4TV8 A;  1MSW D;  1QVF U;  1VP7 A;  2CTR A;  2KB1 A;  4B7K A;  3HKC A;  4OX9 O;  4I50 A;  2FML A;  2Q9L A;  2EIN B;  2YI9 A;  4DV3 O;  4PEL A;  1X59 A;  3TGU H;  4KFM A;  5JJE B;  3HB3 B;  2GTA A;  5B1A B;  5KLV H;  2P6J A;  1S5L Z;  4RO2 A;  1HP8 A;  1YDX A;  3CRQ A;  3J81 N;  5IY5 B;  3CCR V;  3SDL A;  1Q6H A;  2O57 A; 
#chains in the Genus database with same CATH homology
 3RBZ A;  3P32 A;  1AJN A;  5IDJ A;  1OZ0 A;  3AEI A;  3TCU A;  1NH2 B;  1OCO B;  4UXN A;  1V54 C;  3RVY A;  2Q69 A;  4MVQ A;  5CBG A;  2WLM A;  2NNU A;  5LHI A;  1QVG U;  1R73 A;  2X7R B;  3MD0 A;  3ABK C;  5E1A C;  5B1O A;  4QNH B;  2B5U A;  2P67 A;  4UV8 A;  1QLE B;  1GM7 A;  3OGC C;  1YJ9 V;  5B1B C;  5IY5 C;  2Z5U A;  1NH2 D;  1E79 G;  2WAM A;  3ABL C;  2YSU B;  4RUE A;  4WFH A;  2JK5 C;  5L3E A;  1K73 W;  2EBO A;  3QO8 A;  3PJS K;  2BOB C;  4G2K A;  3JD2 A;  2XAJ A;  1VQL V;  1BHA A;  3FYI B;  1KP2 A;  1OCO C;  4ASU G;  1G4Y B;  1QR8 A;  4HYO A;  3FB7 C;  2IJK A;  3TET A;  2DQ0 A;  2WLL A;  1M56 C;  4X88 A;  4BAY A;  2Y48 A;  3E8B A;  3ETD A;  3ZN1 A;  5H9C A;  1RM1 C;  2QEX V;  1H8H G;  1F23 A;  2P90 A;  2DYR B;  2JJ1 G;  4JF3 A;  1GKF A;  4LP8 A;  1K3E A;  1M1K W;  3OUF A;  4RQF A;  2WLK A;  2YEV A;  3ABT A;  1K33 A;  5EBM C;  1OHH G;  2HJF C;  1YIJ V;  3OUS A;  4PA3 A;  2WLI A;  2XAG A;  3B8N A;  2IJH A;  3UM7 A;  1VQ7 V;  2B1I A;  4HAM A;  1K92 A;  2ATK C;  1YJW V;  1AI5 A;  5L3C A;  4Z1M G;  1V55 B;  4BIZ A;  2A0L A;  3QO7 A;  3OMI B;  2XAQ A;  2DYR C;  4GCZ A;  1F4N A;  3OW2 U;  1DF4 A;  2Z3Y A;  3WG7 C;  5L3G A;  3SPJ A;  2EIK C;  4QE9 A;  2Q68 A;  1DTO A;  4UVC A;  1H38 A;  1FFT B;  3CP1 A;  5L3B A;  5EBL C;  4MT8 A;  4J9Y B;  4JTA B;  4WFA V;  1Q7Y W;  2QM8 A;  3FB6 C;  1JVM A;  1R3L C;  2IU3 A;  3K08 A;  2WPD G;  4N23 A;  3P30 A;  3G4S V;  4JAU A;  1JJ2 U;  3LNM B;  4WFE A;  1FXK A;  5IYD O;  5KA6 A;  1P7B A;  4WF9 V;  1HWY A;  4F4L A;  2WLH A;  2WLN A;  4XDK A;  1CPY A;  4MVZ A;  1PL0 A;  5CMU A;  1JX9 A;  2M7W A;  2R9I A;  1SRY A;  1AR1 B;  3CCS V;  2OTL V;  3CCM V;  2EIL C;  2WWW A;  4XDJ A;  5DN6 G;  4UVA A;  1UJW B;  2XOK G;  1OCC B;  3SPH A;  4QPJ A;  4E2L A;  3F5W C;  3I55 V;  2PI4 A;  3K3W A;  4FJC C;  4MTG A;  1GM9 A;  4PA6 A;  1VQP V;  5CBF A;  4ZKI A;  1PNK A;  1VQO V;  1H2G A;  3RW0 A;  1EZJ A;  3ZMS A;  4GX5 A;  3CD6 V;  3ASN B;  1V54 B;  3D36 A;  1P4R A;  3T1C A;  1R3I C;  3OMN B;  4L87 A;  2W6J G;  3E86 A;  2X6B A;  3M99 B;  1N8R W;  3ML0 A;  3AG2 B;  1R3K C;  3LSQ A;  2XAS A;  5C93 A;  5LGU A;  5J9P C;  5B1B B;  1GK9 A;  1W0K G;  4MVO A;  4CBC A;  1NBM G;  1K4D C;  5B1N A;  3STL C;  5HFL A;  3SYC A;  1S0V A;  4RAI A;  1WLE A;  2Y69 B;  4I5S A;  1QLN A;  1CP9 A;  3WFV A;  2H8P C;  1Q81 W;  4XDL A;  2QM7 A;  2HR3 A;  3B77 A;  2IH1 C;  1QR9 A;  3F7Y C;  3ASN C;  4LC1 A;  2ZD9 A;  3OEH G;  1SZT A;  3AG4 B;  3EHB B;  4TT3 G;  4WFB V;  1M56 B;  3E8H A;  2Q6A A;  3FKS G;  1R6N A;  1E1R G;  4JGS A;  5EK0 A;  5B3S C;  5EBW C;  1RM1 B;  2Q67 A;  3CCQ V;  3AG2 C;  1FXH A;  3KG2 A;  3ZCC A;  1S3J A;  2XAH A;  2X6C A;  3RVZ A;  1K97 A;  4J9Z B;  3IGA C;  4FK5 C;  3ZIA G;  1YHQ V;  4MTO A;  1I5X A;  2EIJ B;  2Y69 C;  3W7W A;  4UV9 A;  5CBH A;  3FB5 C;  4WFG A;  2XAF A;  2WLL B;  3JD4 A;  4MW8 A;  3SPI A;  1AJP A;  3LUT B;  1G8M A;  4QIW F;  3AG4 C;  1SET A;  1JOY A;  5CA3 A;  4R7C A;  4P9O A;  1XL4 A;  2FTK A;  1L1F A;  1QBZ A;  2HG5 C;  1S77 D;  3ABU A;  3H01 A;  1THZ A;  3VOU A;  3ZRV A;  2QKS A;  2XND G;  3WG7 B;  3CYO A;  2EIK B;  1F51 A;  2WLI B;  3W7U A;  4LCU C;  1R3J C;  3D3I A;  3AG3 B;  3GB7 C;  2EIJ C;  5EC1 C;  3LDC A;  3G6E V;  3W7S A;  5FL7 G;  4FIP C;  1FS0 G;  1KQS U;  2R9R B;  3A0R A;  1GTO A;  3F7V C;  4MVM A;  5KA5 A;  2LFR A;  2P7T C;  2JIZ G;  1JPX A;  3W7T A;  3SYO A;  1KD1 W;  1YTF B;  1NVP B;  3X2Q B;  4MS2 A;  5L3F A;  2BOC C;  1Y4M A;  2EIL B;  4N21 A;  1Y66 A;  2QA4 V;  3EFF K;  1TUE B;  3CMA V;  1IXM A;  4DO2 A;  2ITD C;  1AI4 A;  3AG3 C;  1K5Q A;  3ETE A;  3ETG A;  3SYA A;  2ZDI A;  3VBB A;  1F4M A;  4DXW A;  3ZRW A;  3K79 A;  1YTF D;  3JCZ A;  3CC4 V;  1FXK B;  4P30 A;  1NVP D;  2UXX A;  4R50 A;  2UXN A;  4PDM A;  5GW7 A;  2H94 A;  1S5H C;  2HVK C;  4ZBM A;  5EC2 C;  2JJ2 G;  4MVR A;  3IFX A;  1EFR G;  4MSW C;  4LBE C;  4X8A A;  3E2E A;  2AHY A;  3T2M A;  4MTF A;  1ENV A;  3DTU B;  3X2Q C;  1NJI W;  1KC8 W;  3JD0 A;  1GM8 A;  1H8E G;  2W6I G;  5IYC O;  4GX1 A;  4G28 B;  4GT1 A;  1COW G;  4PA4 A;  2DYS B;  3STZ C;  1VQ9 V;  1Q86 W;  1RPR A;  1BMF G;  3QO5 A;  4I9W A;  5LHH A;  1GMG A;  1FXK C;  3E35 A;  4Q20 A;  4U7N A;  3E89 A;  2GHY A;  1SER A;  4XBF A;  3ABM B;  1J95 A;  1YIT V;  4G27 B;  1AI6 A;  2IU0 A;  2ZR3 A;  3K03 A;  1OCR C;  4H37 A;  3T4Z A;  5HFM A;  1E1Q G;  5B3S B;  1W0J G;  1VQ4 V;  3SYQ A;  3HPL C;  4JYB A;  2DYS C;  2PI5 A;  4JPR A;  2F43 G;  2EZO A;  4TWK A;  1JCH A;  3E83 A;  3CME V;  2JEU A;  3K04 A;  3ZN0 A;  4OXS A;  3NXS A;  2NLJ C;  1EBO A;  3B8M A;  1BHB A;  3OE7 G;  3E8F A;  3ABM C;  2OTJ V;  2C2A A;  3OFN G;  3OM3 B;  3OEE G;  3CCU V;  1M90 W;  3OR7 C;  3GWO A;  1KEC A;  3CCV V;  1PNM A;  2W0F C;  1MOF A;  3CXC U;  3JYC A;  2CK3 G;  1OCZ C;  2IW5 A;  5LGT A;  3JD3 A;  2IJJ A;  2DWE C;  2V7Q G;  1MG1 A;  1M57 B;  5H6R A;  3CPW U;  2OCC B;  1K5S A;  2B1G A;  1CEZ A;  1NR1 A;  2DW4 A;  5B1A C;  4UUJ C;  4KUM A;  3AG1 B;  5LGN A;  4JAS A;  1VQK V;  1Q82 W;  3W7X A;  1S72 V;  1VQM V;  3K0G A;  2EIM B;  2ITC C;  4PDL A;  4PDR A;  1K34 A;  2V1D A;  2EJR A;  1YJN V;  2AHZ A;  1AJQ A;  3K9A A;  1VQ6 V;  2IJI A;  5KUK A;  1BL8 A;  2X6A A;  1MAB G;  1WPX A;  2YEV B;  1PD3 A;  1KP3 A;  2DQ3 A;  2ZXW C;  2A79 B;  1DF5 A;  3QNE A;  1S76 D;  1M57 C;  1ARO P;  1VQN V;  2OCC C;  3ZMV A;  3CCJ V;  3K0D A;  3AG1 C;  2QE7 G;  2JEX A;  3LDE A;  1R6K A;  3SPG A;  3ZJZ A;  4GX2 A;  1K4C C;  2EIM C;  4FMT A;  3ASO B;  3DGE A;  4R8C A;  4MW3 A;  1LNQ A;  3ZRS A;  4BW5 A;  5BZB A;  4JTD B;  5L3D A;  2HLD G;  5LHG A;  1FXV A;  1QLE C;  4P9P A;  1B6Q A;  4P2Z A;  4QJF B;  1YI2 V;  1VQ5 V;  1DLB A;  4R6Z A;  4FPP A;  2K1E A;  5KUM A;  4QE7 A;  2HFE C;  2DWD C;  2GSM B;  3ZRW B;  3T4D A;  1NQT A;  4H33 A;  1RPO A;  4UVB A;  3ZMU A;  3CC2 V;  1QCE A;  2QTO A;  1ZWI C;  1K9M W;  2X0L A;  3ASO C;  4KP4 A;  1GO3 F;  3ZMT A;  5IYB O;  1PNL A;  4JTC B;  4WCE V;  4X89 A;  3BY6 A;  1VQ8 V;  2EZP A;  4HZ3 A;  1OCR B;  3OR6 C;  4CZZ A;  1KKD A;  3FYE B;  2ZDI C;  5DM6 V;  4MVS A;  3FB8 C;  3IC7 A;  2MK3 A;  4JAV A;  1YSC A;  4PA9 A;  5H6Q A;  1AI7 A;  2LP7 A;  2HKO A;  4GX0 A;  3K06 A;  3MHH C;  4MTX A;  4JYC A;  2WLJ A;  1K7D A;  3CC7 V;  1ROP A;  4EKW A;  1V55 C;  3G71 V;  3CCE V;  1SES A;  2IH3 C;  4TSF G;  1M9N A;  2HVJ C;  1NR7 A;  4PA7 A;  2A9H A;  1MSW D;  1QVF U;  4U7O A;  3TK1 A;  2KB1 A;  1OCZ B;  3MHS C;  4BIU A;  1NKD A;  2EIN B;  3CCL V;  5CN0 A;  3SPC A;  3LDD A;  2ZQM A;  3I56 V;  3E8G A;  2ZR2 A;  4MVU A;  4WFF A;  4PEL A;  1JQ0 A;  4KFM A;  3HB3 B;  1I5Y A;  1XL6 A;  4RUF A;  5B1A B;  3BEH A;  3R65 A;  3OAA G;  5LBQ A;  4YXW G;  3ZRX A;  2P6J A;  3JD1 A;  2D3O W;  2WSS G;  4RO2 A;  3UKM A;  1K8A W;  3ABK B;  1ORQ C;  1OCC C;  2JDI G;  3SYP A;  3OMA B;  4PDV A;  4RQE A;  1W2B U;  2EIN C;  2LFS A;  3LSS A;  1PKX A;  4QPK A;  3ZMZ A;  5IY5 B;  2ZXW B;  3ABL B;  2OT5 A;  3CCR V;  3SJQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...