2ITDC

Potassium channel kcsa-fab complex in barium chloride
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Thermodynamic Properties of Selective Ion Binding in a K(+) Channel.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
molecule keywords antibody Fab fragment heavy chain
total genus 40
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2itdC00
2A0LA 1BL8A 3RVZA 3ASOC 1OCRC 4MVQA 1M56C 3ZJZA 4X8AA 1R3LC 2WLLB 2Y69C 2DYRC 3ABMC 4JTCB 4RUEA 3F7VC 4P9PA 3IGAC 4R6ZA 4DXWA 3E86A 3LDCA 3VOUA 2AHZA 3OUFA 3F7YC 2P7TC 4HZ3A 4RO2A 4MS2A 5EC1C 5IY5C 1R3JC 4P9OA 2QKSA 2OCCC 1JVMA 3EFFK 3AG1C 3OGCC 4LP8A 2BOBC 3SYCA 3ZRSA 2QTOA 4G28B 4PDMA 3IFXA 3T4ZA 2DWEC 3ASNC 3E89A 4J9YB 4MVSA 4BW5A 4QNHB 2R9RB 1R3IC 4RUFA 2YEVA 2DYSC 4LCUC 3KG2A 4R7CA 3FB8C 2EIKC 2EILC 4PA9A 3AG4C 4MVMA 2AHYA 5EK0A 3SYOA 3SYAA 4P30A 4MTGA 4OXSA 1LNQA 4R8CA 5EBMC 2HJFC 2HVJC 3SYPA 3LNMB 4MW8A 5B3SC 4TWKA 3LDDA 2WLKA 4PA4A 3K06A 1J95A 3T1CA 4JTAB 2ATKC 3JYCA 3K08A 3R65A 4X88A 5EBLC 2Q69A 4F4LA 4HYOA 4G27B 2BOCC 2HFEC 4MVZA 1P7BA 4GX5A 4GX1A 3FB6C 4XDJA 3SPIA 2DWDC 3STZC 4JTDB 2Q67A 2X6AA 4PA3A 2IH1C 3FB7C 3K04A 4R50A 1XL4A 4MTOA 5KUMA 3STLC 1V55C 3E83A 3K03A 3AG3C 3ABLC 3GB7C 1R3KC 3UM7A 2EINC 4MVUA 5J9PC 3OR7C 4H33A 3OUSA 4GX2A 4RAIA 5KUKA 4WFGA 4WFFA 3SPGA 2KB1A 2X6CA 2WLNA 5BZBA 3E8GA 3E8HA 1OCCC 4P2ZA 5B1AC 3AG2C 1K4CC 1OCZC 2A79B 3E8BA 3HPLC 2A9HA 2EIMC 3LUTB 4KFMA 3X2QC 4MVOA 4XDLA 4WFHA 3SJQC 4QE7A 5EBWC 3SYQA 3TCUA 3LDEA 1XL6A 2EIJC 3RVYA 4GX0A 2WLIA 4UUJC 1K4DC 2WLJA 4I9WA 4EKWA 2WLIB 2X6BA 5B1BC 2Q68A 3PJSK 3T4DA 5CBHA 4H37A 5CBGA 4PDVA 2ZXWC 4PDLA 2WLHA 3BEHA 4PA6A 3E8FA 4PA7A 1V54C 1QLEC 2H8PC 1S5HC 2K1EA 4LBEC 5CBFA 1KKDA 4ZBMA 1M57C 3T2MA 4MVRA 1OCOC 2ZD9A 4J9ZB 2Q6AA 1ORQC 2WLMA 3ABKC 4MTFA 2NLJC 3TETA 2HG5C 3K0GA 3SPHA 3RBZA 3UKMA 2WLLA 2W0FC 3K0DA 4WFEA 4MW3A 4PDRA 3F5WC 2HVKC 4MSWC 4X89A 4CBCA 2ITDC 3RW0A 2JK5C 2IH3C 4QE9A 3SPCA 3WG7C 1G4YB 3SPJA 5EC2C 5E1AC 3FB5C 4XDKA 1ZWIC 2ITCC 3OR6C
chains in the Genus database with same CATH superfamily
4ZOLB 1KP3A 4I0XA 2NR5A 4I5SA 1S72V 2FTKA 4UVAA 5DECA 2EINB 2CAZC 4GLXA 3K79A 2BTQB 1IVSA 3OUFA 3F7YC 4DR6B 1R3JC 1AI4A 4JV5O 3P3NA 3AG1C 4DV0O 4I50B 3CXHF 5H6QA 2XAJA 4DRXA 5D5QA 3KG2A 4QPJA 1IXBA 5LYJB 2DOSA 3S3XA 3K5MA 4W4KA 5CA0B 3CRQA 3DC5A 4OXSA 4PI2A 5EBMC 3SYPA 5BMVB 4UXNA 4UVBA 3CCRV 1WPXA 3JAKA 4X20A 1T5EA 4O2BB 5L3GA 5JJEB 3W7TA 4YJ3B 2FYUH 3C90A 3AEIA 2YI8A 3UM7A 4DO2A 2GBOA 1RM1C 4WFGA 2PUSA 4J7KA 5LA6B 3SJAC 1R6TA 1SF9A 1MA1A 4DR4O 4J7JA 2JVDA 1ZL8B 1BGYH 1Q86W 4PJ0Z 3CCJV 4PELA 2YIBA 4EFEA 3E8FA 3G80A 2PTMA 1I5XA 5KX5B 3B8NA 1AP5A 1YXBA 5LA6A 3H01A 4L8JA 1M1KW 4N23A 1TVKA 4IIJA 1ZAUA 3A2FA 5CB4A 3GWOA 2HG5C 1YJ9V 2AXTZ 4JZ2A 4MW3A 4ZHQB 1OHHG 1Q6HA 2PGGA 3E22A 1G4YB 1OCOB 4TV9A 3CCUV 1QQCA 3VQXA 1VQ5V 4GKKB 2UXDB 3ZRVA 2OTLV 1HNXB 4LFAB 3CEIA 4NVPA 4X1YA 4RO2A 4MS2A 3E35A 2OCCC 4JYYA 3JD4A 3FYIB 1L0NH 4HNAA 2E3CA 2ZM6O 3BHPA 4PDMA 1TUEB 2DWEC 3U10A 3ABKB 2Q7GA 4K0KO 5B1OA 3FB8C 4QGPA 3G71V 2B1IA 2BCCH 5LMNO 3JCZA 3LNNA 1I0HA 2UUBO 3IC9A 3K9SA 4DR7B 2Z5UA 5IYBO 1NZ6A 3KKYA 3K08A 1XNQO 3ZHUA 1B3QA 1WP8A 3N27A 3CCLV 4GX5A 1NTMH 4ZIBA 2VS0A 1V55C 1ROPA 1VQ8V 1YEWA 5H5NA 1QR8A 4MVUA 2N04A 1WP7A 4RAIA 1FPOA 3OW2U 4X64B 4JI0O 4DR1B 2X6CA 4DV7B 1J5EB 4EEQA 1EM1A 2LP7A 1AILA 1OCCB 3TXQA 4DV2O 3DXRB 4GKJB 3LDEA 3CC2V 2ZKOA 5CA1B 4E2LA 1VQOV 2O57A 2X6BA 4LH6A 2H94A 1DF5A 4PA6A 5KLVH 3ZN0A 3MDSA 4ZBMA 5IWAO 3KCXA 5JCOA 3WG7B 1YVWA 3HKCB 1N32O 4X1YB 2CE4A 2EULA 3H9VA 2YS8A 2CTQA 2W0FC 2UUBB 5IYZA 1JOYA 1Z5WA 4JI5O 3JD2A 3QVNA 2LO1A 5B3SB 4OX9B 4EFBA 3OR6C 2A0LA 3WB1A 1SQFA 3L72H 4CC5A 3ABMC 4ZI7A 2FB5A 2LQTA 5FPRA 1BCCH 3B77A 1K5QA 3AG4B 1AJNA 1DLBA 1R73A 4FLXA 4DYLA 5KMGA 3ZRSA 3F5TA 3R66A 4GKKO 5J2UB 3G6EV 1H2LA 2E74B 1SA0B 4LCUC 5DM6V 1Y67A 3UT5A 4B3TO 5IY5B 3AG4C 1R6NA 2KKWA 5LGUA 3W7SA 1VQKV 2F4VB 2YC0A 3W7WA 2ZE7A 3OAAG 3LNMB 2LFRA 3ZHVA 4O4LB 4B3TB 2LGQA 1FS0G 1V9PA 1J95A 1SQQH 4X88A 4F4LA 2DE0X 2F93B 1P7BA 2IW5A 4JTDB 1PL0A 2WA3A 3JALA 2GUZA 5FPOA 1HR0O 2DJVA 2KB1A 1FFXA 5KHGA 4LR3A 1WNSA 1YHQV 1PNKA 1RPOA 4MVOA 1ZL8A 3BA8A 3VQYA 4O2BA 3ZMTA 3RVYA 4RQFA 1B6QA 2Q68A 3G67A 2ZT9B 4LF4O 3QTCA 2L35A 2P06A 5KHIA 2V4DA 2NN4A 4JPRA 2YIDA 1BQ0A 3K0DA 4RQEA 4CBCA 4KP4A 1AR4A 4DV5O 2UXNA 2YIAA 1P7GA 3UQ8A 5JVDA 4X8AA 4R6ZA 2EZOA 1KMIZ 2UXDO 1SZXA 3HKEB 3SJBC 1S77D 5LOVB 2CUGA 5B1BB 3T4ZA 3HKCA 2CH7A 1KP2A 1M4UA 4QNHB 4RUFA 2YEVA 2MK3A 4DR5O 2YI9A 2HVJC 5B3SC 2F23A 1N33O 1IXMA 5LBQA 1VMGA 2UUAB 5J2TB 4ICGA 2F1MA 1WA8B 2ZDIC 2K9PA 4X62B 4LF4B 1YSCA 4ASUG 2ZE8A 5GTIZ 4NTXA 2XHBA 4LF9O 4IGGA 3H1KH 1ZTEA 4I55B 5J9PC 3TK1A 2Q0OC 1OCRB 4AILC 4J7ZA 4K8ZA 4JI7B 1WA8A 3DC6A 4XDLA 2E75B 1WN7A 3H1JH 2RJZA 1S5JA 4QE7A 5IDJA 5KX5A 3JSNA 2EJ7A 5L3FA 5JJNB 3CWBH 4Z1MG 2EZPA 2FKXA 1GN6A 3QNEA 1NT2B 1PNLA 5CBGA 1S76D 1V54C 2H8PC 4JI6O 2CTRA 2QDOA 1N34B 2A7WA 2YXYA 1XBLA 3ZHTA 4CS2A 1K7DA 4WFEA 5IJ0A 1QR9A 4MT8A 5KHJA 1XMQB 4F6RB 1ZWIC 4WFBV 5IT9N 1R3LC 2CGNA 2WLLB 2Y69C 2JJ2G 4NB5A 3ZS8C 4LC1A 1N0JA 2DYRB 5BY1A 5IYCO 2P67A 2OIEA 4LP8A 3ZIAG 1VARA 5CB4B 4BW5A 3JCUZ 3JARA 1GO3F 1EZJA 3SYOA 4JAVA 4ZKIA 4LWSA 2HJFC 4NYKA 3GWKC 2OYQA 4ZI7B 4TQDA 2PYJA 1YCIA 1FFXB 2Q9LA 1EFRG 3ETDA 4LH7A 4MVZA 2F4VO 4GCZA 1WB7A 3HKDA 3FFQA 4R50A 3QG5A 3ZMVA 2XOKG 2PF4E 1XMQO 2V1DA 3C3TA 1HDJA 4FJCC 4JI1B 3JAKB 3A0BZ 1AJPA 4WFHA 1IBMO 1QBZA 2OCCB 2EJRA 3ASOB 1O9HA 1FD9A 2ODMA 2UU9B 2BSKA 1EBOA 3UCSC 2ZQMA 2Q7EA 1WPBA 5BMVA 2WLIB 1QVGU 1NBMG 4DR6O 4TUYA 4J41A 3HKBA 2JRIA 4FLZA 2XT9A 1QLNA 2N05A 1UJWB 1OCOC 4LF7O 3HR0A 1KKCA 1AR5A 1M56B 2F95B 2JGUA 4JASA 4X89A 1YI2V 1W0JG 2Q8VA 1S5LZ 3SPCA 2LW1A 1IBLB 4I7ZB 4I4TB 4JI8O 3J7AU 1SQBH 4CH5A 2M6YA 1M56C 3CCSV 3JATB 1KECA 2UU9O 2P4KA 3VOUA 5B5EZ 2P7TC 1K33A 4IT5A 3BVOA 1Q81W 1JVMA 3M8AA 3D8CA 4LFAO 2BOBC 2VQEO 4DR1O 4YJ2A 2DW4A 1JX9A 4KUMA 3RYHA 5LP6B 2YXLA 1OV9A 2PI5A 4K0KB 4X62O 4R8CA 2M7WA 3PN1A 4MW8A 3JD3A 1VQ7V 3OFNG 1EN4A 2P5OA 3JYCA 2Y69B 4OPAA 4O2AB 4IHJB 3BABA 3SPIA 3WU2Z 2RMKB 1VQMV 1Q6UA 3E22B 3ABLB 4X65B 3MAQA 4TV8B 1LUWA 5GONA 1WLEA 2ILMA 2KG7A 2GTSA 2R72A 3E8GA 1XNRO 1WB8A 1N0NA 2BTOA 3LUTB 1GM7A 1H2NA 4BIZA 4QPKA 5EBWC 1J5EO 4PD4F 5J2TA 1K8AW 4JI0B 5JJJB 3O65A 1HW7A 3CHXA 4JYBA 1K4DC 4J42A 1JR9A 2CTWA 3ASNB 3Q4HB 1SETA 1M57C 1ENVA 1GMGA 3N2GA 1BQZA 1I7FA 4PHZA 3ZMZA 2WAMA 3SPHA 5LOVA 1SRYA 5TISZ 1OZ0A 1LUVA 3JALB 2E76B 1NJIW 2CDYA 3APOA 3AK3A 1GM8A 1YDXA 5IYDO 3FB5C 4K8XA 4FLYA 4O4HA 3ASOC 2Y0PA 2PZSA 1JFFA 2DYRC 2B9ZA 3JD1A 5LHHA 1Q8IA 3F7VC 3IGAC 2IM9A 2D3OW 3CS5A 3KCYA 5CMUA 2QKAA 3AG1B 3ASNC 2ADQB 1KU9A 1MSWD 2YIBD 2C2AA 2A06H 3T1HO 5JQGB 3H1HH 1HNWO 3RGBA 4NTYA 1BT8A 5CN0A 1LNQA 2YDEA 4QJFB 2QKCA 3M99B 1XEQA 2VQEB 2B5UA 2EIJB 5KA5A 1OJHA 4D7SA 2JIZG 2QGNA 5EBLC 1KUQA 1GM9A 4UCSA 4FLWA 2AGAA 1RSOB 3OEHG 2P6JA 1IBMB 2HHHO 4DW0A 4JI3B 3RN4A 1GH6A 3SPGA 1RM1B 3MD0A 3E8BA 1OCZC 2A79B 4LNUA 4KFMA 3BPZA 2CGOA 1AB3A 4JAAA 4PI0A 1FKAO 3ABUA 3G6BA 1IBKB 5CBHA 1BSMA 1L1FA 4DK1A 1G8MA 1XHZA 1NVPD 1H8HG 3ETQA 3LSSA 1AI6A 4Q20A 3CYOA 2WLLA 4UVCA 1HNZO 4KXRA 1NU1H 2D2CB 2UXBB 2UUCO 4N21A 4LFBO 4MVQA 2XUMA 3ZJZA 5B1AB 1ZLZA 3N2KB 5JCOC 1NI8A 2IJJA 4JYAO 1K97A 1GRJA 4P9OA 4DR3B 4YJ2B 4NKGB 2ZDIA 5ITZB 1PKXA 4DV7O 3OTOB 2R9RB 2DYSC 4FFBB 3G4SV 4FZ1A 4CS4A 3N2KA 4JI1O 1O9GA 2IU0A 2DQ0A 4NXNB 2ZXWB 2NNUA 3B8MA 1JMKC 1XOUA 3U11A 4TT3G 1JCHA 2Y4UA 4TWKA 2ZM6B 1YJNV 1XHXA 3T1CA 3FYEB 2HFEC 4FMTA 3CSXA 5EZYB 3QO5A 5L3CA 4OGQB 2Q67A 1AJQA 2GSMB 4U7NA 5LXTB 4O4JA 4AQYO 2QEXV 4DR4B 3CJHA 1K9MW 2WLNA 5BZBA 3CC4V 2LGWA 5KAFZ 4KL1A 1SZTA 3M7MX 1DF4A 3H1IH 4LWSB 3T1YO 4CH4A 1H2KA 1W59A 4FLTA 4JYAB 2Y0IA 3VQWA 3Q4HA 1L0LH 1YITV 1HR0B 2EBOA 1K92A 2FMLA 4B3RB 2HKOA 3ZHQA 4PV1B 2VQFB 4XBFA 4PDVA 2ZXWC 1CXZB 4DV6B 1VQ4V 1IURA 1S5HC 1Y6XA 4K3AA 5BR8B 3JAMN 4YHHB 1ORQC 1AP6A 4LF6O 4TV8A 3BFRA 4PDRA 5K1PA 3RT3C 4FZ0A 2ADPA 4O4HB 3RW0A 4NXNO 1M9NA 4UB6Z 4XDKA 4DR2B 5KAIZ 3L71H 4B3SB 1H2MA 1BL8A 1Q90D 3ABMB 4DV4B 1SESA 2QTSA 1KB9F 4J11A 3RYFB 4TV9B 1Y74B 3P3PA 3X2QB 3LDCA 4DXWA 1CPYA 4JV5B 4HZ3A 4DV0B 4RWUA 3ZX6A 3EFFK 1AI5A 3L73H 1D5AA 2ZE6A 4X9QA 4J9YB 4MVSA 4WBNA 3ZN1A 2P90A 4JI7O 4MVMA 3TJTA 1G6UA 3L9DA 3B40A 1Q43A 1VQPV 2LFSA 3ABTA 4B7EA 5H9CA 4JGSA 1HNWB 3JASB 5IWAB 1MABG 2JEXA 3JATA 4DV1B 5GONB 3MHSC 2ZE5A 4I9QA 1NTZH 3B4SA 4UFZA 4W4LA 1S0VA 2Y48A 3CCMV 4LF8O 1I94O 2JJ1G 4EB6B 1K4CC 1XMOB 2EIMC 2IU3A 5HFMA 3FAVA 1FAFA 1PNMA 1N4CA 1SERA 3OMAB 5KHHA 3TCUA 1H8EG 1F51A 2PY5A 3B09A 5JWPA 4JI4O 2W0XA 3ZHSA 1FXKC 5F2VO 5CA0A 3H1LH 4DRXB 1M93A 1EZVH 2EIMB 4PA7A 1XUQA 1QU7A 1PL4A 2XAGA 5EYPB 2ZIOA 4UCOA 3UO2A 1E79G 3AG7A 1GAXA 2Z0AA 4JAUA 5JH7B 1I5YA 5D5PA 5LXTA 3UKMA 3JSLA 1AR1B 3WB0A 1K5SA 4U7OA 4TSFG 1VF6A 3IJ4A 1Y76B 4DR3O 3RVZA 1W0KG 3CRAA 4RUEA 1CP9A 3QO7A 3AK1A 3E86A 5LP6C 2AHZA 3C3SA 4LF9B 3K59A 4X65O 4DW1A 4FM1A 4FIPC 2VWJA 3ZRWA 1R1BA 3CMEV 4LFBB 4H0LB 2QWPB 2EILC 4PA9A 3FKSG 4HNAB 1RPRA 3VQVA 4HAMA 2XAFA 3OTOO 2GV9A 2QA4V 3LDDA 4FFKA 1F4MA 4D7TA 4UCTA 3RYIA 5FL7G 2EILB 4LFCO 3DGEA 2EX3A 1BMFG 3HB3B 3FX7A 4DUYB 2X6AA 5GW7A 3ZHRA 3A0RA 3RYCA 1R3KC 4HBNA 1Y66A 1GTOA 3OTFA 4B3MO 2UXBO 1H38A 1IZ3A 2RNBA 2X7RB 4TUYB 4DV2B 1VF7A 1YTFB 3AG2C 4CS3A 2W6JG 4FVMA 5HFLA 5AG2A 1V55B 4IYIA 2WLIA 1P84F 3ML0A 1Q6IA 3CCEV 3DTUB 2OWOA 3AG2B 5LL6Y 1MZEA 1QLEC 3CE2A 4YIPA 1NQTA 4I50A 3UT5B 2QJ1A 2YXHA 4LFCB 2ZR3A 3W7XA 3MHHC 1YIJV 2ZD9A 4MTFA 3HKDB 2XTAA 2EIKB 4NR1A 5BR8O 3OD4A 4U3JB 3WG7C 3SPJA 4LF6B 4X20B 2A3QA 4QIWF 3RYFA 4LBEC 4CH6A 1BHAA 3J81N 2MW2B 3W7UA 4I0XB 1TUBB 3BY6A 3LSQA 5IJ9B 4DUYO 3OM3B 1THZA 1URFA 5FLXN 5C8YA 4FFBA 1YJWV 1DTOA 4C7UA 3E2EA 5H6RA 4AI8A 2Q5ZA 4GYCB 3IFXA 1JA8A 1XQ8A 3OT7A 1AROP 2ZINA 4B08A 1R6KA 1FXVA 1JFFB 1VQLV 4O4IA 5L3BA 4PA4A 2XAQA 3D3QA 1D2DA 4LNUB 5EIBD 4JI6B 3ZEDA 3CB2A 3FB7C 4I55A 1TA8A 5DEDA 2YUAA 1Z5VA 1CEZA 4TQFA 1NTKH 2ETNA 3K5OA 2UUCB 2ZCEA 1XDCA 4AQYB 1KQSU 4I9WA 5B1BC 2CTPA 4OPHA 3SGIA 3SJQC 1VQ9V 1KKDA 5LMUO 4DR7O 4Q6GA 4UCRA 1HWYA 4MVRA 1S3JA 3TGUH 1F4NA 1SQPH 1MMMA 3RBZA 1GN3A 1K73W 3ZBHA 3ICXA 1Y76A 2HR3A 1N34O 4QE9A 3I5DA 3K3WA 1YTFD 4ZHQA 2UXCO 2Q0AA 4GZRB 4F6RA 1NS1A 1OCZB 2R70A 1KBHA 4FPPA 3K57A 2FL4A 2CK3G 1IBLO 3SYCA 2AW9A 4IL6Z 1IX9A 4LF5B 4LF8B 1Q5OA 3N2GB 2BTQA 3ZCCA 2EIKC 3HKBB 1N33B 1SS3A 4UCUA 1NR1A 3SJCC 1V54B 3J80N 4KHPO 3I55V 5CA1A 1B06A 1FYJA 1LR1A 5LMUB 4DV6O 2ATKC 1E1RG 4HYOA 1BZKA 2GUZB 1XILA 3FB6C 1NVPB 2KG7B 2R9AA 2WPDG 3CCQV 2P22C 2JGDB 4J80A 4YXWG 3ABLC 2X0LA 4U3FH 1FFTB 3CX5F 3ZMSA 4K35A 1D5NA 1A32A 5LHGA 3UO3A 1QHTA 3X2QC 4DR5B 4DR2O 4B3SO 2HHHB 4BW9A 5EYPA 3DXRA 4DK0A 4BR6A 2EIJC 1K3EA 1DGSA 3BAAA 2WA4A 1SQXH 3CRCA 1QNMA 2RQ6A 5GTHZ 2UUAO 4IYHA 1VP7A 2W6IG 1W2BU 1GN2A 1F7YA 3ABKC 1F23A 3OEEG 1Y74A 5CA3A 1P49A 1SKVA 4X1IB 4YHHO 3TXSA 4UV8A 4I4TA 3ETGA 4TOIA 4O4LA 2ITCC 4Z2WA 1N8RW 1OCRC 5IYZB 2QE7G 5IJ0B 3WB2A 5IE9A 2G38A 4NXMO 4X1IA 1X59A 2CH7B 3OGCC 4G2KA 3NR7A 3RFRA 2QWQB 4DUZO 2F66C 1DK1A 1PD3A 3GVMA 5KA6A 3SDLA 5J2UA 4R7CA 1XMOO 2HLDG 1XNRB 5EK0A 4CZZA 2XNDG 1TUBA 2OTJV 1QCEA 1MNGA 4D6TH 2QWNB 1TGOA 4YIOA 5A9GA 3K06A 2GHYA 4JTAB 3JD0A 4B3RO 4UCVA 1UPGA 1Z2GA 1YZBA 4FM2A 4XDJA 4E4EA 2DWDC 3STZC 4DV1O 3P30A 1RSOA 2F43G 2IH1C 1XL4A 3STLC 1JPXA 3B2EE 3E83A 1JJ2U 2EINC 5KUKA 1FXKB 1VIBA 4JYCA 3JASA 4JI8B 1M90W 3SYQA 1XL6A 1MZFA 1Q3EA 1GK9A 2WLJA 4DV3O 4CC6A 3AK2A 3PJSK 3BCCH 2LJ2A 4H37A 2WLHA 3BEHA 2K1EA 5CBFA 5LYJA 1IBKO 1IDSA 2JEUA 2KQXA 4Z1VA 3IC7A 3TETA 3K0GA 1VF6C 2XASA 4WCEV 1MOFA 4JF3A 4MSWC 2HVKC 3NXSA 3WFVA 2JK5C 5C8YB 2IH3C 1RP3B 3CC7V 5E1AC 1MSDA 4GUNA 4JTCB 3D36A 3K5NA 4P9PA 1GKFA 4GKJO 4B7KA 3RYHB 4J10A 4F6EA 1PP9H 2QKSA 3ZRWB 3ZMUA 5ITZA 3APQA 5KMGB 3JARB 2Q4PA 1H2GA 4A5UB 1XI1A 3CPWU 5LMNB 2Q73A 2ARHA 3K5LA 3LSUA 1M5IA 3BA9A 1Q82W 4JI5B 2HJDA 2JDIG 3D36C 2PYLA 2AZ0A 5IJ9A 2HP8A 3R65A 2QWRB 3RWRD 2Q69A 1NR7A 3OGIB 4EB6A 2JGDA 3THOA 4KHPB 5LGNA 4ABMA 3CJHB 3K04A 3K03A 5L3EA 1U97A 3OR7C 3OUSA 4GX2A 4WFFA 2YICA 4YJ3A 1KYOF 3E8HA 2KSDA 4B3MB 3HPLC 2Y4TA 1COWG 3DSQA 3RYIB 1M57B 2IBZH 2DQ3A 3OE7G 5JQGA 1N36O 1VF5B 3BRCA 5BXZA 1SA0A 3T4DA 4MTXA 1BS3A 4YY3O 2V7QG 4H13B 2QWOB 4CH3A 4DV5B 5KHKA 5A2QN 5EIBC 1AI7A 3HKEA 4J9ZB 2JS5A 2OT5A 1EN6A 2QM7A 4JI4B 1WJZA 1I08A 1NH2D 1G1XB 3F5WC 3L75H 1KC8W 1JJOA 5C93A 5EC2C 4UB8Z 4IHJA 2HEPA 5JVDB 3AG3B 4DUZB 2GTAA 1N36B 5IY5C 2QM8A 4YY3B 4O4IB 3CP1A 1P4RA 1SC5B 5JH7A 2QTOA 5K1XA 1KD1W 3U0ZA 3EXAA 3E89A 4DV4O 1SQVH 4WBNB 1R3IC 4JZGA 1NH2B 5L3DA 1QLEB 2B1GA 4UV9A 4BWAA 3SYAA 1NKDA 4LF7B 4AHCA 1PM9A 4MTGA 4X66O 3IAYA 5B1NA 4ZOLA 1FJGB 4LF5O 2VWKA 2IJIA 1HP8A 2WLKA 4GT1A 1YF2A 4G27B 2BOCC 2ZNIA 4GX1A 4U3JA 5E79Z 4PA3A 3SR2C 1BE3H 2QSAA 4MTOA 5DN6G 3AG3C 3CD6V 2OCHA 2R9IA 3L74H 2WWWA 4H33A 5FNVA 3JAWB 1XREA 5B1AC 4JI3O 2ZIMA 2H3OA 3A8TA 4BIUA 3OMNB 4UUJC 4EKWA 2YEVB 2E5LO 3L70H 1QVFU 1U96A 2DMXA 5LHIA 4FK5C 2QM4A 1WAZA 3OMIB 3T2MA 3RYCB 3EHBB 1XNQB 2Q6AA 1FXKA 2IJHA 2PI4A 2NLJC 2VQFO 1K34A 3T1HB 4DV3B 1E1QG 1FJGO 4O2AA 2ITDC 4NTWA 1JQ0A 2RN9A 1SQGA 2ZR2A 3ZRXA 3S3WA 5EZYA 2N74A 5B66Z 5LGTA 3QO8A 4FLUA 4FM0A 2GDSA 1GN4A 3EVKA 3VBBA 5EC1C 2UXCB 3CCVV 1ZUQA 2DN9A 2Z3YA 1B04A 3KZIZ 4G28B 4WF9V 1HNXO 1TAEA 3D3IA 1UFIA 2XAHA 2UXXA 1FXHA 2ZNJA 2RDCA 2IJKA 3CMAV 2AHYA 2AZ2A 1L8DA 1HNZB 4P30A 1VQ6V 2OIGA 4JI2O 1BHBA 1PV0A 3JAWA 1PPJH 4FLVA 4O4JB 4BIOA 3K58A 2LW7A 2VRZA 5FNVB 1Y4MA 5KUMA 1VEWA 1TVKB 2JS3A 3O9OA 4IIJB 3CXCU 3GB7C 3QF7A 3FD9A 1ZSPA 4L87A 3CRRA 3T1YB 1MG1A 1OCCC 4P2ZA 2A9HA 4X1KA 2YSUB 1EN5A 1X4TA 4WFAV 3A0HZ 1Q7YW 1VQNV 2DYSB 1I94B 4NXMB 2BE3A 4GX0A 1AVMA 5H2FZ 3FAVB 3ETEA 3K9AA 2BSKB 2RCVA 2L6LA 2Q7HA 4PDLA 1N32B 4X1KB 3P32A 5LP6A 2WLMA 4OX9O 1RFYA 4BAYA 2P4VA 3I56V 2E5LB 2QR4A 4JI2B 4X66B 1H2SB 1ZX3A 4X64O 4H44B 3CRMA 2WSSG 1US6A
chains in the Genus database with same CATH topology
1BL8A 1KP3A 3ABMB 1N8RW 1OCRC 2QE7G 1SESA 4I5SA 1R3LC 2FTKA 2WLLB 2Y69C 2JJ2G 4UVAA 1S72V 2EINB 4LC1A 4DXWA 3X2QB 3LDCA 3K79A 1CPYA 2DYRB 3OUFA 3F7YC 4HZ3A 1R3JC 5IYCO 1AI4A 3EFFK 1AI5A 2P67A 3AG1C 3OGCC 4LP8A 3ZIAG 4G2KA 5H6QA 2XAJA 4J9YB 1PD3A 5KA6A 4MVSA 4BW5A 3ZN1A 2P90A 3KG2A 4R7CA 4QPJA 2HLDG 1GO3F 1EZJA 4MVMA 5EK0A 4JAVA 3SYOA 2XNDG 4CZZA 4ZKIA 1VQPV 2LFSA 3ABTA 4OXSA 5EBMC 3SYPA 1QCEA 2OTJV 2HJFC 5H9CA 4UXNA 4UVBA 4JGSA 3CCRV 1WPXA 1MABG 2JEXA 3K06A 2GHYA 4JTAB 3JD0A 5L3GA 1EFRG 3MHSC 3ETDA 4MVZA 3W7TA 4XDJA 4GCZA 2DWDC 3STZC 3P30A 3AEIA 2F43G 2IH1C 4R50A 1XL4A 3STLC 1S0VA 1JPXA 3E83A 3UM7A 3ZMVA 4DO2A 2Y48A 1JJ2U 2EINC 2XOKG 3CCMV 1RM1C 2V1DA 5KUKA 4WFGA 1FXKB 4FJCC 2JJ1G 4JYCA 1K4CC 2EIMC 2IU3A 5HFMA 1AJPA 4WFHA 1QBZA 1PNMA 1SERA 3OMAB 2OCCB 2EJRA 3ASOB 3SYQA 1M90W 3TCUA 1XL6A 1GK9A 1H8EG 1F51A 1Q86W 1EBOA 2WLJA 2ZQMA 2WLIB 1FXKC 3PJSK 1QVGU 1NBMG 3CCJV 4H37A 4PELA 2WLHA 3BEHA 2EIMB 3E8FA 2K1EA 4PA7A 5CBFA 1I5XA 2XAGA 3B8NA 1QLNA 3H01A 1UJWB 2JEUA 1M1KW 1E79G 1OCOC 4N23A 3GWOA 4JAUA 3IC7A 1I5YA 3TETA 2HG5C 1YJ9V 1M56B 3K0GA 3UKMA 2XASA 1AR1B 4WCEV 1MOFA 4MW3A 4JF3A 4JASA 4MSWC 2HVKC 4X89A 3NXSA 1YI2V 3WFVA 1OHHG 1K5SA 1W0JG 2JK5C 2IH3C 3SPCA 1G4YB 3CC7V 5E1AC 1OCOB 4U7OA 4TSFG 3CCUV 3RVZA 1W0KG 1VQ5V 1M56C 3CCSV 3ZRVA 4RUEA 2OTLV 1CP9A 3QO7A 4JTCB 3D36A 1KECA 4P9PA 1GKFA 3E86A 3VOUA 2AHZA 2P7TC 1K33A 4RO2A 4MS2A 3E35A 2QKSA 2OCCC 3ZRWB 1JVMA 1Q81W 3JD4A 3FYIB 3ZMUA 2BOBC 4PDMA 1TUEB 4FIPC 2DWEC 1H2GA 3ABKB 3ZRWA 3CMEV 2DW4A 3CPWU 1JX9A 4KUMA 5B1OA 3FB8C 2EILC 4PA9A 3G71V 2B1IA 3FKSG 2PI5A 1Q82W 1RPRA 3JCZA 4R8CA 4HAMA 2XAFA 2JDIG 2M7WA 4MW8A 3JD3A 1VQ7V 2QA4V 3OFNG 2Z5UA 3LDDA 1F4MA 5IYBO 3JYCA 2Y69B 3K08A 3R65A 5FL7G 2EILB 2Q69A 1NR7A 3CCLV 3DGEA 4GX5A 1BMFG 5LGNA 3SPIA 1VQMV 3HB3B 2X6AA 5GW7A 3ABLB 3K04A 3A0RA 1V55C 1ROPA 3K03A 5L3EA 1VQ8V 1R3KC 1QR8A 4MVUA 1Y66A 1GTOA 3OR7C 3OUSA 1WLEA 4GX2A 4RAIA 4WFFA 3OW2U 1H38A 2X6CA 2X7RB 3E8GA 3E8HA 1YTFB 2LP7A 3AG2C 3HPLC 3LUTB 1GM7A 1COWG 2W6JG 1OCCB 4BIZA 1M57B 4QPKA 5EBWC 5HFLA 1V55B 1K8AW 2DQ3A 3LDEA 3OE7G 3CC2V 2WLIA 4JYBA 1K4DC 3ML0A 4E2LA 1VQOV 2X6BA 4MTXA 3T4DA 3ASNB 3CCEV 3DTUB 2H94A 2V7QG 1DF5A 3AG2B 4PA6A 1QLEC 3ZN0A 1NQTA 1SETA 4ZBMA 1M57C 1ENVA 1GMGA 2ZR3A 3W7XA 1AI7A 3MHHC 3WG7B 1YIJV 2ZD9A 4J9ZB 2OT5A 4MTFA 3ZMZA 2QM7A 2WAMA 3SPHA 1SRYA 2W0FC 2EIKB 1NH2D 1OZ0A 3F5WC 1JOYA 1NJIW 1KC8W 3JD2A 3WG7C 3SPJA 1GM8A 5C93A 5EC2C 5B3SB 5IYDO 3FB5C 4QIWF 4LBEC 1BHAA 3OR6C 2A0LA 3ASOC 3W7UA 3BY6A 3LSQA 3AG3B 2DYRC 3ABMC 3JD1A 5LHHA 3F7VC 3IGAC 3OM3B 1THZA 2D3OW 3B77A 5IY5C 2QM8A 1K5QA 3AG4B 1YJWV 3CP1A 1P4RA 1AJNA 1DLBA 1DTOA 1R73A 3E2EA 5H6RA 3ZRSA 2QTOA 1KD1W 5CMUA 3AG1B 3IFXA 3E89A 3ASNC 1R3IC 3G6EV 1AROP 4LCUC 5DM6V 1NH2B 5L3DA 1QLEB 2B1GA 1MSWD 2C2AA 4UV9A 1R6KA 5IY5B 3AG4C 1R6NA 1FXVA 3SYAA 1NKDA 1VQLV 5CN0A 5LGUA 3W7SA 1VQKV 4MTGA 1LNQA 3W7WA 5B1NA 3OAAG 4QJFB 3LNMB 3M99B 2LFRA 2B5UA 2EIJB 2IJIA 5KA5A 5L3BA 2WLKA 4PA4A 1FS0G 4GT1A 1J95A 2XAQA 4X88A 2JIZG 5EBLC 4F4LA 4G27B 2BOCC 1P7BA 4GX1A 1GM9A 2IW5A 4JTDB 1PL0A 4PA3A 3OEHG 2P6JA 3FB7C 4MTOA 5DN6G 3AG3C 3CD6V 2R9IA 2WWWA 4H33A 1CEZA 3SPGA 2KB1A 1RM1B 3MD0A 5B1AC 1YHQV 3E8BA 1OCZC 1PNKA 1RPOA 2A79B 4KFMA 4MVOA 4BIUA 3ABUA 3OMNB 3ZMTA 3RVYA 4UUJC 1KQSU 4I9WA 4EKWA 4RQFA 2YEVB 5B1BC 1QVFU 1B6QA 2Q68A 5CBHA 3SJQC 1L1FA 1VQ9V 1KKDA 5LHIA 4FK5C 1G8MA 3OMIB 3T2MA 1HWYA 4MVRA 3EHBB 2Q6AA 1FXKA 2IJHA 1S3JA 1F4NA 2PI4A 2NLJC 1NVPD 1H8HG 3LSSA 4JPRA 1AI6A 1K34A 3CYOA 4Q20A 3RBZA 1K73W 2WLLA 3K0DA 1E1QG 4RQEA 4UVCA 4CBCA 2ITDC 4KP4A 2HR3A 1JQ0A 3ZRXA 2ZR2A 4QE9A 2UXNA 4N21A 3K3WA 1YTFD 4MVQA 3ZJZA 5LGTA 4X8AA 3QO8A 5B1AB 4R6ZA 1OCZB 2IJJA 3VBBA 1K97A 2EZOA 5EC1C 3CCVV 4P9OA 1S77D 4FPPA 2Z3YA 2ZDIA 2CK3G 3SYCA 1PKXA 4G28B 4WF9V 5B1BB 3T4ZA 1KP2A 3D3IA 4QNHB 2R9RB 4RUFA 2YEVA 2DYSC 2XAHA 2UXXA 2MK3A 1FXHA 3G4SV 3ZCCA 2EIKC 2IJKA 3CMAV 2IU0A 2AHYA 2DQ0A 2ZXWB 1NR1A 2NNUA 1V54B 4P30A 1VQ6V 2HVJC 3B8MA 3I55V 5B3SC 4TT3G 1BHBA 1IXMA 1JCHA 5LBQA 4TWKA 1YJNV 3T1CA 2ATKC 3FYEB 1E1RG 4HYOA 2HFEC 2ZDIC 4FMTA 3QO5A 3FB6C 1NVPB 5L3CA 1YSCA 4ASUG 2Q67A 1AJQA 1Y4MA 2WPDG 5KUMA 3CCQV 2GSMB 3CXCU 3GB7C 3ABLC 2X0LA 4U7NA 4YXWG 4L87A 1FFTB 3ZMSA 5J9PC 3TK1A 2QEXV 1OCRB 1K9MW 2WLNA 5BZBA 1MG1A 5LHGA 3CC4V 1OCCC 4P2ZA 1SZTA 3X2QC 2A9HA 2YSUB 4XDLA 1DF4A 4WFAV 4QE7A 5IDJA 1Q7YW 5L3FA 1VQNV 2DYSB 2EIJC 1YITV 4Z1MG 1K3EA 4GX0A 2EZPA 3ETEA 2EBOA 3K9AA 1K92A 3QNEA 2HKOA 1PNLA 4PDVA 2ZXWC 4XBFA 4PDLA 5CBGA 1VQ4V 1S76D 1V54C 2H8PC 1S5HC 3P32A 2W6IG 1W2BU 1ORQC 2WLMA 3ABKC 1F23A 1K7DA 3OEEG 4BAYA 3I56V 5CA3A 4WFEA 4PDRA 1QR9A 4MT8A 3RW0A 4UV8A 3ETGA 1M9NA 4XDKA 2WSSG 1ZWIC 4WFBV 2ITCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A0L A;  1BL8 A;  3RVZ A;  3ASO C;  1OCR C;  4MVQ A;  1M56 C;  3ZJZ A;  4X8A A;  1R3L C;  2WLL B;  2Y69 C;  2DYR C;  3ABM C;  4JTC B;  4RUE A;  3F7V C;  4P9P A;  3IGA C;  4R6Z A;  4DXW A;  3E86 A;  3LDC A;  3VOU A;  2AHZ A;  3OUF A;  3F7Y C;  2P7T C;  4HZ3 A;  4RO2 A;  4MS2 A;  5EC1 C;  5IY5 C;  1R3J C;  4P9O A;  2QKS A;  2OCC C;  1JVM A;  3EFF K;  3AG1 C;  3OGC C;  4LP8 A;  2BOB C;  3SYC A;  3ZRS A;  2QTO A;  4G28 B;  4PDM A;  3IFX A;  3T4Z A;  2DWE C;  3ASN C;  3E89 A;  4J9Y B;  4MVS A;  4BW5 A;  4QNH B;  2R9R B;  1R3I C;  4RUF A;  2YEV A;  2DYS C;  4LCU C;  3KG2 A;  4R7C A;  3FB8 C;  2EIK C;  2EIL C;  4PA9 A;  3AG4 C;  4MVM A;  2AHY A;  5EK0 A;  3SYO A;  3SYA A;  4P30 A;  4MTG A;  4OXS A;  1LNQ A;  4R8C A;  5EBM C;  2HJF C;  2HVJ C;  3SYP A;  3LNM B;  4MW8 A;  5B3S C;  4TWK A;  3LDD A;  2WLK A;  4PA4 A;  3K06 A;  1J95 A;  3T1C A;  4JTA B;  2ATK C;  3JYC A;  3K08 A;  3R65 A;  4X88 A;  5EBL C;  2Q69 A;  4F4L A;  4HYO A;  4G27 B;  2BOC C;  2HFE C;  4MVZ A;  1P7B A;  4GX5 A;  4GX1 A;  3FB6 C;  4XDJ A;  3SPI A;  2DWD C;  3STZ C;  4JTD B;  2Q67 A;  2X6A A;  4PA3 A;  2IH1 C;  3FB7 C;  3K04 A;  4R50 A;  1XL4 A;  4MTO A;  5KUM A;  3STL C;  1V55 C;  3E83 A;  3K03 A;  3AG3 C;  3ABL C;  3GB7 C;  1R3K C;  3UM7 A;  2EIN C;  4MVU A;  5J9P C;  3OR7 C;  4H33 A;  3OUS A;  4GX2 A;  4RAI A;  5KUK A;  4WFG A;  4WFF A;  3SPG A;  2KB1 A;  2X6C A;  2WLN A;  5BZB A;  3E8G A;  3E8H A;  1OCC C;  4P2Z A;  5B1A C;  3AG2 C;  1K4C C;  1OCZ C;  2A79 B;  3E8B A;  3HPL C;  2A9H A;  2EIM C;  3LUT B;  4KFM A;  3X2Q C;  4MVO A;  4XDL A;  4WFH A;  3SJQ C;  4QE7 A;  5EBW C;  3SYQ A;  3TCU A;  3LDE A;  1XL6 A;  2EIJ C;  3RVY A;  4GX0 A;  2WLI A;  4UUJ C;  1K4D C;  2WLJ A;  4I9W A;  4EKW A;  2WLI B;  2X6B A;  5B1B C;  2Q68 A;  3PJS K;  3T4D A;  5CBH A;  4H37 A;  5CBG A;  4PDV A;  2ZXW C;  4PDL A;  2WLH A;  3BEH A;  4PA6 A;  3E8F A;  4PA7 A;  1V54 C;  1QLE C;  2H8P C;  1S5H C;  2K1E A;  4LBE C;  5CBF A;  1KKD A;  4ZBM A;  1M57 C;  3T2M A;  4MVR A;  1OCO C;  2ZD9 A;  4J9Z B;  2Q6A A;  1ORQ C;  2WLM A;  3ABK C;  4MTF A;  2NLJ C;  3TET A;  2HG5 C;  3K0G A;  3SPH A;  3RBZ A;  3UKM A;  2WLL A;  2W0F C;  3K0D A;  4WFE A;  4MW3 A;  4PDR A;  3F5W C;  2HVK C;  4MSW C;  4X89 A;  4CBC A;  2ITD C;  3RW0 A;  2JK5 C;  2IH3 C;  4QE9 A;  3SPC A;  3WG7 C;  1G4Y B;  3SPJ A;  5EC2 C;  5E1A C;  3FB5 C;  4XDK A;  1ZWI C;  2ITC C;  3OR6 C; 
#chains in the Genus database with same CATH topology
 4ZOL B;  1KP3 A;  4I0X A;  2NR5 A;  4I5S A;  1S72 V;  2FTK A;  4UVA A;  5DEC A;  2EIN B;  2CAZ C;  4GLX A;  3K79 A;  2BTQ B;  1IVS A;  3OUF A;  3F7Y C;  4DR6 B;  1R3J C;  1AI4 A;  4JV5 O;  3P3N A;  3AG1 C;  4DV0 O;  4I50 B;  3CXH F;  5H6Q A;  2XAJ A;  4DRX A;  5D5Q A;  3KG2 A;  4QPJ A;  1IXB A;  5LYJ B;  2DOS A;  3S3X A;  3K5M A;  4W4K A;  5CA0 B;  3CRQ A;  3DC5 A;  4OXS A;  4PI2 A;  5EBM C;  3SYP A;  5BMV B;  4UXN A;  4UVB A;  3CCR V;  1WPX A;  3JAK A;  4X20 A;  1T5E A;  4O2B B;  5L3G A;  5JJE B;  3W7T A;  4YJ3 B;  2FYU H;  3C90 A;  3AEI A;  2YI8 A;  3UM7 A;  4DO2 A;  2GBO A;  1RM1 C;  4WFG A;  2PUS A;  4J7K A;  5LA6 B;  3SJA C;  1R6T A;  1SF9 A;  1MA1 A;  4DR4 O;  4J7J A;  2JVD A;  1ZL8 B;  1BGY H;  1Q86 W;  4PJ0 Z;  3CCJ V;  4PEL A;  2YIB A;  4EFE A;  3E8F A;  3G80 A;  2PTM A;  1I5X A;  5KX5 B;  3B8N A;  1AP5 A;  1YXB A;  5LA6 A;  3H01 A;  4L8J A;  1M1K W;  4N23 A;  1TVK A;  4IIJ A;  1ZAU A;  3A2F A;  5CB4 A;  3GWO A;  2HG5 C;  1YJ9 V;  2AXT Z;  4JZ2 A;  4MW3 A;  4ZHQ B;  1OHH G;  1Q6H A;  2PGG A;  3E22 A;  1G4Y B;  1OCO B;  4TV9 A;  3CCU V;  1QQC A;  3VQX A;  1VQ5 V;  4GKK B;  2UXD B;  3ZRV A;  2OTL V;  1HNX B;  4LFA B;  3CEI A;  4NVP A;  4X1Y A;  4RO2 A;  4MS2 A;  3E35 A;  2OCC C;  4JYY A;  3JD4 A;  3FYI B;  1L0N H;  4HNA A;  2E3C A;  2ZM6 O;  3BHP A;  4PDM A;  1TUE B;  2DWE C;  3U10 A;  3ABK B;  2Q7G A;  4K0K O;  5B1O A;  3FB8 C;  4QGP A;  3G71 V;  2B1I A;  2BCC H;  5LMN O;  3JCZ A;  3LNN A;  1I0H A;  2UUB O;  3IC9 A;  3K9S A;  4DR7 B;  2Z5U A;  5IYB O;  1NZ6 A;  3KKY A;  3K08 A;  1XNQ O;  3ZHU A;  1B3Q A;  1WP8 A;  3N27 A;  3CCL V;  4GX5 A;  1NTM H;  4ZIB A;  2VS0 A;  1V55 C;  1ROP A;  1VQ8 V;  1YEW A;  5H5N A;  1QR8 A;  4MVU A;  2N04 A;  1WP7 A;  4RAI A;  1FPO A;  3OW2 U;  4X64 B;  4JI0 O;  4DR1 B;  2X6C A;  4DV7 B;  1J5E B;  4EEQ A;  1EM1 A;  2LP7 A;  1AIL A;  1OCC B;  3TXQ A;  4DV2 O;  3DXR B;  4GKJ B;  3LDE A;  3CC2 V;  2ZKO A;  5CA1 B;  4E2L A;  1VQO V;  2O57 A;  2X6B A;  4LH6 A;  2H94 A;  1DF5 A;  4PA6 A;  5KLV H;  3ZN0 A;  3MDS A;  4ZBM A;  5IWA O;  3KCX A;  5JCO A;  3WG7 B;  1YVW A;  3HKC B;  1N32 O;  4X1Y B;  2CE4 A;  2EUL A;  3H9V A;  2YS8 A;  2CTQ A;  2W0F C;  2UUB B;  5IYZ A;  1JOY A;  1Z5W A;  4JI5 O;  3JD2 A;  3QVN A;  2LO1 A;  5B3S B;  4OX9 B;  4EFB A;  3OR6 C;  2A0L A;  3WB1 A;  1SQF A;  3L72 H;  4CC5 A;  3ABM C;  4ZI7 A;  2FB5 A;  2LQT A;  5FPR A;  1BCC H;  3B77 A;  1K5Q A;  3AG4 B;  1AJN A;  1DLB A;  1R73 A;  4FLX A;  4DYL A;  5KMG A;  3ZRS A;  3F5T A;  3R66 A;  4GKK O;  5J2U B;  3G6E V;  1H2L A;  2E74 B;  1SA0 B;  4LCU C;  5DM6 V;  1Y67 A;  3UT5 A;  4B3T O;  5IY5 B;  3AG4 C;  1R6N A;  2KKW A;  5LGU A;  3W7S A;  1VQK V;  2F4V B;  2YC0 A;  3W7W A;  2ZE7 A;  3OAA G;  3LNM B;  2LFR A;  3ZHV A;  4O4L B;  4B3T B;  2LGQ A;  1FS0 G;  1V9P A;  1J95 A;  1SQQ H;  4X88 A;  4F4L A;  2DE0 X;  2F93 B;  1P7B A;  2IW5 A;  4JTD B;  1PL0 A;  2WA3 A;  3JAL A;  2GUZ A;  5FPO A;  1HR0 O;  2DJV A;  2KB1 A;  1FFX A;  5KHG A;  4LR3 A;  1WNS A;  1YHQ V;  1PNK A;  1RPO A;  4MVO A;  1ZL8 A;  3BA8 A;  3VQY A;  4O2B A;  3ZMT A;  3RVY A;  4RQF A;  1B6Q A;  2Q68 A;  3G67 A;  2ZT9 B;  4LF4 O;  3QTC A;  2L35 A;  2P06 A;  5KHI A;  2V4D A;  2NN4 A;  4JPR A;  2YID A;  1BQ0 A;  3K0D A;  4RQE A;  4CBC A;  4KP4 A;  1AR4 A;  4DV5 O;  2UXN A;  2YIA A;  1P7G A;  3UQ8 A;  5JVD A;  4X8A A;  4R6Z A;  2EZO A;  1KMI Z;  2UXD O;  1SZX A;  3HKE B;  3SJB C;  1S77 D;  5LOV B;  2CUG A;  5B1B B;  3T4Z A;  3HKC A;  2CH7 A;  1KP2 A;  1M4U A;  4QNH B;  4RUF A;  2YEV A;  2MK3 A;  4DR5 O;  2YI9 A;  2HVJ C;  5B3S C;  2F23 A;  1N33 O;  1IXM A;  5LBQ A;  1VMG A;  2UUA B;  5J2T B;  4ICG A;  2F1M A;  1WA8 B;  2ZDI C;  2K9P A;  4X62 B;  4LF4 B;  1YSC A;  4ASU G;  2ZE8 A;  5GTI Z;  4NTX A;  2XHB A;  4LF9 O;  4IGG A;  3H1K H;  1ZTE A;  4I55 B;  5J9P C;  3TK1 A;  2Q0O C;  1OCR B;  4AIL C;  4J7Z A;  4K8Z A;  4JI7 B;  1WA8 A;  3DC6 A;  4XDL A;  2E75 B;  1WN7 A;  3H1J H;  2RJZ A;  1S5J A;  4QE7 A;  5IDJ A;  5KX5 A;  3JSN A;  2EJ7 A;  5L3F A;  5JJN B;  3CWB H;  4Z1M G;  2EZP A;  2FKX A;  1GN6 A;  3QNE A;  1NT2 B;  1PNL A;  5CBG A;  1S76 D;  1V54 C;  2H8P C;  4JI6 O;  2CTR A;  2QDO A;  1N34 B;  2A7W A;  2YXY A;  1XBL A;  3ZHT A;  4CS2 A;  1K7D A;  4WFE A;  5IJ0 A;  1QR9 A;  4MT8 A;  5KHJ A;  1XMQ B;  4F6R B;  1ZWI C;  4WFB V;  5IT9 N;  1R3L C;  2CGN A;  2WLL B;  2Y69 C;  2JJ2 G;  4NB5 A;  3ZS8 C;  4LC1 A;  1N0J A;  2DYR B;  5BY1 A;  5IYC O;  2P67 A;  2OIE A;  4LP8 A;  3ZIA G;  1VAR A;  5CB4 B;  4BW5 A;  3JCU Z;  3JAR A;  1GO3 F;  1EZJ A;  3SYO A;  4JAV A;  4ZKI A;  4LWS A;  2HJF C;  4NYK A;  3GWK C;  2OYQ A;  4ZI7 B;  4TQD A;  2PYJ A;  1YCI A;  1FFX B;  2Q9L A;  1EFR G;  3ETD A;  4LH7 A;  4MVZ A;  2F4V O;  4GCZ A;  1WB7 A;  3HKD A;  3FFQ A;  4R50 A;  3QG5 A;  3ZMV A;  2XOK G;  2PF4 E;  1XMQ O;  2V1D A;  3C3T A;  1HDJ A;  4FJC C;  4JI1 B;  3JAK B;  3A0B Z;  1AJP A;  4WFH A;  1IBM O;  1QBZ A;  2OCC B;  2EJR A;  3ASO B;  1O9H A;  1FD9 A;  2ODM A;  2UU9 B;  2BSK A;  1EBO A;  3UCS C;  2ZQM A;  2Q7E A;  1WPB A;  5BMV A;  2WLI B;  1QVG U;  1NBM G;  4DR6 O;  4TUY A;  4J41 A;  3HKB A;  2JRI A;  4FLZ A;  2XT9 A;  1QLN A;  2N05 A;  1UJW B;  1OCO C;  4LF7 O;  3HR0 A;  1KKC A;  1AR5 A;  1M56 B;  2F95 B;  2JGU A;  4JAS A;  4X89 A;  1YI2 V;  1W0J G;  2Q8V A;  1S5L Z;  3SPC A;  2LW1 A;  1IBL B;  4I7Z B;  4I4T B;  4JI8 O;  3J7A U;  1SQB H;  4CH5 A;  2M6Y A;  1M56 C;  3CCS V;  3JAT B;  1KEC A;  2UU9 O;  2P4K A;  3VOU A;  5B5E Z;  2P7T C;  1K33 A;  4IT5 A;  3BVO A;  1Q81 W;  1JVM A;  3M8A A;  3D8C A;  4LFA O;  2BOB C;  2VQE O;  4DR1 O;  4YJ2 A;  2DW4 A;  1JX9 A;  4KUM A;  3RYH A;  5LP6 B;  2YXL A;  1OV9 A;  2PI5 A;  4K0K B;  4X62 O;  4R8C A;  2M7W A;  3PN1 A;  4MW8 A;  3JD3 A;  1VQ7 V;  3OFN G;  1EN4 A;  2P5O A;  3JYC A;  2Y69 B;  4OPA A;  4O2A B;  4IHJ B;  3BAB A;  3SPI A;  3WU2 Z;  2RMK B;  1VQM V;  1Q6U A;  3E22 B;  3ABL B;  4X65 B;  3MAQ A;  4TV8 B;  1LUW A;  5GON A;  1WLE A;  2ILM A;  2KG7 A;  2GTS A;  2R72 A;  3E8G A;  1XNR O;  1WB8 A;  1N0N A;  2BTO A;  3LUT B;  1GM7 A;  1H2N A;  4BIZ A;  4QPK A;  5EBW C;  1J5E O;  4PD4 F;  5J2T A;  1K8A W;  4JI0 B;  5JJJ B;  3O65 A;  1HW7 A;  3CHX A;  4JYB A;  1K4D C;  4J42 A;  1JR9 A;  2CTW A;  3ASN B;  3Q4H B;  1SET A;  1M57 C;  1ENV A;  1GMG A;  3N2G A;  1BQZ A;  1I7F A;  4PHZ A;  3ZMZ A;  2WAM A;  3SPH A;  5LOV A;  1SRY A;  5TIS Z;  1OZ0 A;  1LUV A;  3JAL B;  2E76 B;  1NJI W;  2CDY A;  3APO A;  3AK3 A;  1GM8 A;  1YDX A;  5IYD O;  3FB5 C;  4K8X A;  4FLY A;  4O4H A;  3ASO C;  2Y0P A;  2PZS A;  1JFF A;  2DYR C;  2B9Z A;  3JD1 A;  5LHH A;  1Q8I A;  3F7V C;  3IGA C;  2IM9 A;  2D3O W;  3CS5 A;  3KCY A;  5CMU A;  2QKA A;  3AG1 B;  3ASN C;  2ADQ B;  1KU9 A;  1MSW D;  2YIB D;  2C2A A;  2A06 H;  3T1H O;  5JQG B;  3H1H H;  1HNW O;  3RGB A;  4NTY A;  1BT8 A;  5CN0 A;  1LNQ A;  2YDE A;  4QJF B;  2QKC A;  3M99 B;  1XEQ A;  2VQE B;  2B5U A;  2EIJ B;  5KA5 A;  1OJH A;  4D7S A;  2JIZ G;  2QGN A;  5EBL C;  1KUQ A;  1GM9 A;  4UCS A;  4FLW A;  2AGA A;  1RSO B;  3OEH G;  2P6J A;  1IBM B;  2HHH O;  4DW0 A;  4JI3 B;  3RN4 A;  1GH6 A;  3SPG A;  1RM1 B;  3MD0 A;  3E8B A;  1OCZ C;  2A79 B;  4LNU A;  4KFM A;  3BPZ A;  2CGO A;  1AB3 A;  4JAA A;  4PI0 A;  1FKA O;  3ABU A;  3G6B A;  1IBK B;  5CBH A;  1BSM A;  1L1F A;  4DK1 A;  1G8M A;  1XHZ A;  1NVP D;  1H8H G;  3ETQ A;  3LSS A;  1AI6 A;  4Q20 A;  3CYO A;  2WLL A;  4UVC A;  1HNZ O;  4KXR A;  1NU1 H;  2D2C B;  2UXB B;  2UUC O;  4N21 A;  4LFB O;  4MVQ A;  2XUM A;  3ZJZ A;  5B1A B;  1ZLZ A;  3N2K B;  5JCO C;  1NI8 A;  2IJJ A;  4JYA O;  1K97 A;  1GRJ A;  4P9O A;  4DR3 B;  4YJ2 B;  4NKG B;  2ZDI A;  5ITZ B;  1PKX A;  4DV7 O;  3OTO B;  2R9R B;  2DYS C;  4FFB B;  3G4S V;  4FZ1 A;  4CS4 A;  3N2K A;  4JI1 O;  1O9G A;  2IU0 A;  2DQ0 A;  4NXN B;  2ZXW B;  2NNU A;  3B8M A;  1JMK C;  1XOU A;  3U11 A;  4TT3 G;  1JCH A;  2Y4U A;  4TWK A;  2ZM6 B;  1YJN V;  1XHX A;  3T1C A;  3FYE B;  2HFE C;  4FMT A;  3CSX A;  5EZY B;  3QO5 A;  5L3C A;  4OGQ B;  2Q67 A;  1AJQ A;  2GSM B;  4U7N A;  5LXT B;  4O4J A;  4AQY O;  2QEX V;  4DR4 B;  3CJH A;  1K9M W;  2WLN A;  5BZB A;  3CC4 V;  2LGW A;  5KAF Z;  4KL1 A;  1SZT A;  3M7M X;  1DF4 A;  3H1I H;  4LWS B;  3T1Y O;  4CH4 A;  1H2K A;  1W59 A;  4FLT A;  4JYA B;  2Y0I A;  3VQW A;  3Q4H A;  1L0L H;  1YIT V;  1HR0 B;  2EBO A;  1K92 A;  2FML A;  4B3R B;  2HKO A;  3ZHQ A;  4PV1 B;  2VQF B;  4XBF A;  4PDV A;  2ZXW C;  1CXZ B;  4DV6 B;  1VQ4 V;  1IUR A;  1S5H C;  1Y6X A;  4K3A A;  5BR8 B;  3JAM N;  4YHH B;  1ORQ C;  1AP6 A;  4LF6 O;  4TV8 A;  3BFR A;  4PDR A;  5K1P A;  3RT3 C;  4FZ0 A;  2ADP A;  4O4H B;  3RW0 A;  4NXN O;  1M9N A;  4UB6 Z;  4XDK A;  4DR2 B;  5KAI Z;  3L71 H;  4B3S B;  1H2M A;  1BL8 A;  1Q90 D;  3ABM B;  4DV4 B;  1SES A;  2QTS A;  1KB9 F;  4J11 A;  3RYF B;  4TV9 B;  1Y74 B;  3P3P A;  3X2Q B;  3LDC A;  4DXW A;  1CPY A;  4JV5 B;  4HZ3 A;  4DV0 B;  4RWU A;  3ZX6 A;  3EFF K;  1AI5 A;  3L73 H;  1D5A A;  2ZE6 A;  4X9Q A;  4J9Y B;  4MVS A;  4WBN A;  3ZN1 A;  2P90 A;  4JI7 O;  4MVM A;  3TJT A;  1G6U A;  3L9D A;  3B40 A;  1Q43 A;  1VQP V;  2LFS A;  3ABT A;  4B7E A;  5H9C A;  4JGS A;  1HNW B;  3JAS B;  5IWA B;  1MAB G;  2JEX A;  3JAT A;  4DV1 B;  5GON B;  3MHS C;  2ZE5 A;  4I9Q A;  1NTZ H;  3B4S A;  4UFZ A;  4W4L A;  1S0V A;  2Y48 A;  3CCM V;  4LF8 O;  1I94 O;  2JJ1 G;  4EB6 B;  1K4C C;  1XMO B;  2EIM C;  2IU3 A;  5HFM A;  3FAV A;  1FAF A;  1PNM A;  1N4C A;  1SER A;  3OMA B;  5KHH A;  3TCU A;  1H8E G;  1F51 A;  2PY5 A;  3B09 A;  5JWP A;  4JI4 O;  2W0X A;  3ZHS A;  1FXK C;  5F2V O;  5CA0 A;  3H1L H;  4DRX B;  1M93 A;  1EZV H;  2EIM B;  4PA7 A;  1XUQ A;  1QU7 A;  1PL4 A;  2XAG A;  5EYP B;  2ZIO A;  4UCO A;  3UO2 A;  1E79 G;  3AG7 A;  1GAX A;  2Z0A A;  4JAU A;  5JH7 B;  1I5Y A;  5D5P A;  5LXT A;  3UKM A;  3JSL A;  1AR1 B;  3WB0 A;  1K5S A;  4U7O A;  4TSF G;  1VF6 A;  3IJ4 A;  1Y76 B;  4DR3 O;  3RVZ A;  1W0K G;  3CRA A;  4RUE A;  1CP9 A;  3QO7 A;  3AK1 A;  3E86 A;  5LP6 C;  2AHZ A;  3C3S A;  4LF9 B;  3K59 A;  4X65 O;  4DW1 A;  4FM1 A;  4FIP C;  2VWJ A;  3ZRW A;  1R1B A;  3CME V;  4LFB B;  4H0L B;  2QWP B;  2EIL C;  4PA9 A;  3FKS G;  4HNA B;  1RPR A;  3VQV A;  4HAM A;  2XAF A;  3OTO O;  2GV9 A;  2QA4 V;  3LDD A;  4FFK A;  1F4M A;  4D7T A;  4UCT A;  3RYI A;  5FL7 G;  2EIL B;  4LFC O;  3DGE A;  2EX3 A;  1BMF G;  3HB3 B;  3FX7 A;  4DUY B;  2X6A A;  5GW7 A;  3ZHR A;  3A0R A;  3RYC A;  1R3K C;  4HBN A;  1Y66 A;  1GTO A;  3OTF A;  4B3M O;  2UXB O;  1H38 A;  1IZ3 A;  2RNB A;  2X7R B;  4TUY B;  4DV2 B;  1VF7 A;  1YTF B;  3AG2 C;  4CS3 A;  2W6J G;  4FVM A;  5HFL A;  5AG2 A;  1V55 B;  4IYI A;  2WLI A;  1P84 F;  3ML0 A;  1Q6I A;  3CCE V;  3DTU B;  2OWO A;  3AG2 B;  5LL6 Y;  1MZE A;  1QLE C;  3CE2 A;  4YIP A;  1NQT A;  4I50 A;  3UT5 B;  2QJ1 A;  2YXH A;  4LFC B;  2ZR3 A;  3W7X A;  3MHH C;  1YIJ V;  2ZD9 A;  4MTF A;  3HKD B;  2XTA A;  2EIK B;  4NR1 A;  5BR8 O;  3OD4 A;  4U3J B;  3WG7 C;  3SPJ A;  4LF6 B;  4X20 B;  2A3Q A;  4QIW F;  3RYF A;  4LBE C;  4CH6 A;  1BHA A;  3J81 N;  2MW2 B;  3W7U A;  4I0X B;  1TUB B;  3BY6 A;  3LSQ A;  5IJ9 B;  4DUY O;  3OM3 B;  1THZ A;  1URF A;  5FLX N;  5C8Y A;  4FFB A;  1YJW V;  1DTO A;  4C7U A;  3E2E A;  5H6R A;  4AI8 A;  2Q5Z A;  4GYC B;  3IFX A;  1JA8 A;  1XQ8 A;  3OT7 A;  1ARO P;  2ZIN A;  4B08 A;  1R6K A;  1FXV A;  1JFF B;  1VQL V;  4O4I A;  5L3B A;  4PA4 A;  2XAQ A;  3D3Q A;  1D2D A;  4LNU B;  5EIB D;  4JI6 B;  3ZED A;  3CB2 A;  3FB7 C;  4I55 A;  1TA8 A;  5DED A;  2YUA A;  1Z5V A;  1CEZ A;  4TQF A;  1NTK H;  2ETN A;  3K5O A;  2UUC B;  2ZCE A;  1XDC A;  4AQY B;  1KQS U;  4I9W A;  5B1B C;  2CTP A;  4OPH A;  3SGI A;  3SJQ C;  1VQ9 V;  1KKD A;  5LMU O;  4DR7 O;  4Q6G A;  4UCR A;  1HWY A;  4MVR A;  1S3J A;  3TGU H;  1F4N A;  1SQP H;  1MMM A;  3RBZ A;  1GN3 A;  1K73 W;  3ZBH A;  3ICX A;  1Y76 A;  2HR3 A;  1N34 O;  4QE9 A;  3I5D A;  3K3W A;  1YTF D;  4ZHQ A;  2UXC O;  2Q0A A;  4GZR B;  4F6R A;  1NS1 A;  1OCZ B;  2R70 A;  1KBH A;  4FPP A;  3K57 A;  2FL4 A;  2CK3 G;  1IBL O;  3SYC A;  2AW9 A;  4IL6 Z;  1IX9 A;  4LF5 B;  4LF8 B;  1Q5O A;  3N2G B;  2BTQ A;  3ZCC A;  2EIK C;  3HKB B;  1N33 B;  1SS3 A;  4UCU A;  1NR1 A;  3SJC C;  1V54 B;  3J80 N;  4KHP O;  3I55 V;  5CA1 A;  1B06 A;  1FYJ A;  1LR1 A;  5LMU B;  4DV6 O;  2ATK C;  1E1R G;  4HYO A;  1BZK A;  2GUZ B;  1XIL A;  3FB6 C;  1NVP B;  2KG7 B;  2R9A A;  2WPD G;  3CCQ V;  2P22 C;  2JGD B;  4J80 A;  4YXW G;  3ABL C;  2X0L A;  4U3F H;  1FFT B;  3CX5 F;  3ZMS A;  4K35 A;  1D5N A;  1A32 A;  5LHG A;  3UO3 A;  1QHT A;  3X2Q C;  4DR5 B;  4DR2 O;  4B3S O;  2HHH B;  4BW9 A;  5EYP A;  3DXR A;  4DK0 A;  4BR6 A;  2EIJ C;  1K3E A;  1DGS A;  3BAA A;  2WA4 A;  1SQX H;  3CRC A;  1QNM A;  2RQ6 A;  5GTH Z;  2UUA O;  4IYH A;  1VP7 A;  2W6I G;  1W2B U;  1GN2 A;  1F7Y A;  3ABK C;  1F23 A;  3OEE G;  1Y74 A;  5CA3 A;  1P49 A;  1SKV A;  4X1I B;  4YHH O;  3TXS A;  4UV8 A;  4I4T A;  3ETG A;  4TOI A;  4O4L A;  2ITC C;  4Z2W A;  1N8R W;  1OCR C;  5IYZ B;  2QE7 G;  5IJ0 B;  3WB2 A;  5IE9 A;  2G38 A;  4NXM O;  4X1I A;  1X59 A;  2CH7 B;  3OGC C;  4G2K A;  3NR7 A;  3RFR A;  2QWQ B;  4DUZ O;  2F66 C;  1DK1 A;  1PD3 A;  3GVM A;  5KA6 A;  3SDL A;  5J2U A;  4R7C A;  1XMO O;  2HLD G;  1XNR B;  5EK0 A;  4CZZ A;  2XND G;  1TUB A;  2OTJ V;  1QCE A;  1MNG A;  4D6T H;  2QWN B;  1TGO A;  4YIO A;  5A9G A;  3K06 A;  2GHY A;  4JTA B;  3JD0 A;  4B3R O;  4UCV A;  1UPG A;  1Z2G A;  1YZB A;  4FM2 A;  4XDJ A;  4E4E A;  2DWD C;  3STZ C;  4DV1 O;  3P30 A;  1RSO A;  2F43 G;  2IH1 C;  1XL4 A;  3STL C;  1JPX A;  3B2E E;  3E83 A;  1JJ2 U;  2EIN C;  5KUK A;  1FXK B;  1VIB A;  4JYC A;  3JAS A;  4JI8 B;  1M90 W;  3SYQ A;  1XL6 A;  1MZF A;  1Q3E A;  1GK9 A;  2WLJ A;  4DV3 O;  4CC6 A;  3AK2 A;  3PJS K;  3BCC H;  2LJ2 A;  4H37 A;  2WLH A;  3BEH A;  2K1E A;  5CBF A;  5LYJ A;  1IBK O;  1IDS A;  2JEU A;  2KQX A;  4Z1V A;  3IC7 A;  3TET A;  3K0G A;  1VF6 C;  2XAS A;  4WCE V;  1MOF A;  4JF3 A;  4MSW C;  2HVK C;  3NXS A;  3WFV A;  2JK5 C;  5C8Y B;  2IH3 C;  1RP3 B;  3CC7 V;  5E1A C;  1MSD A;  4GUN A;  4JTC B;  3D36 A;  3K5N A;  4P9P A;  1GKF A;  4GKJ O;  4B7K A;  3RYH B;  4J10 A;  4F6E A;  1PP9 H;  2QKS A;  3ZRW B;  3ZMU A;  5ITZ A;  3APQ A;  5KMG B;  3JAR B;  2Q4P A;  1H2G A;  4A5U B;  1XI1 A;  3CPW U;  5LMN B;  2Q73 A;  2ARH A;  3K5L A;  3LSU A;  1M5I A;  3BA9 A;  1Q82 W;  4JI5 B;  2HJD A;  2JDI G;  3D36 C;  2PYL A;  2AZ0 A;  5IJ9 A;  2HP8 A;  3R65 A;  2QWR B;  3RWR D;  2Q69 A;  1NR7 A;  3OGI B;  4EB6 A;  2JGD A;  3THO A;  4KHP B;  5LGN A;  4ABM A;  3CJH B;  3K04 A;  3K03 A;  5L3E A;  1U97 A;  3OR7 C;  3OUS A;  4GX2 A;  4WFF A;  2YIC A;  4YJ3 A;  1KYO F;  3E8H A;  2KSD A;  4B3M B;  3HPL C;  2Y4T A;  1COW G;  3DSQ A;  3RYI B;  1M57 B;  2IBZ H;  2DQ3 A;  3OE7 G;  5JQG A;  1N36 O;  1VF5 B;  3BRC A;  5BXZ A;  1SA0 A;  3T4D A;  4MTX A;  1BS3 A;  4YY3 O;  2V7Q G;  4H13 B;  2QWO B;  4CH3 A;  4DV5 B;  5KHK A;  5A2Q N;  5EIB C;  1AI7 A;  3HKE A;  4J9Z B;  2JS5 A;  2OT5 A;  1EN6 A;  2QM7 A;  4JI4 B;  1WJZ A;  1I08 A;  1NH2 D;  1G1X B;  3F5W C;  3L75 H;  1KC8 W;  1JJO A;  5C93 A;  5EC2 C;  4UB8 Z;  4IHJ A;  2HEP A;  5JVD B;  3AG3 B;  4DUZ B;  2GTA A;  1N36 B;  5IY5 C;  2QM8 A;  4YY3 B;  4O4I B;  3CP1 A;  1P4R A;  1SC5 B;  5JH7 A;  2QTO A;  5K1X A;  1KD1 W;  3U0Z A;  3EXA A;  3E89 A;  4DV4 O;  1SQV H;  4WBN B;  1R3I C;  4JZG A;  1NH2 B;  5L3D A;  1QLE B;  2B1G A;  4UV9 A;  4BWA A;  3SYA A;  1NKD A;  4LF7 B;  4AHC A;  1PM9 A;  4MTG A;  4X66 O;  3IAY A;  5B1N A;  4ZOL A;  1FJG B;  4LF5 O;  2VWK A;  2IJI A;  1HP8 A;  2WLK A;  4GT1 A;  1YF2 A;  4G27 B;  2BOC C;  2ZNI A;  4GX1 A;  4U3J A;  5E79 Z;  4PA3 A;  3SR2 C;  1BE3 H;  2QSA A;  4MTO A;  5DN6 G;  3AG3 C;  3CD6 V;  2OCH A;  2R9I A;  3L74 H;  2WWW A;  4H33 A;  5FNV A;  3JAW B;  1XRE A;  5B1A C;  4JI3 O;  2ZIM A;  2H3O A;  3A8T A;  4BIU A;  3OMN B;  4UUJ C;  4EKW A;  2YEV B;  2E5L O;  3L70 H;  1QVF U;  1U96 A;  2DMX A;  5LHI A;  4FK5 C;  2QM4 A;  1WAZ A;  3OMI B;  3T2M A;  3RYC B;  3EHB B;  1XNQ B;  2Q6A A;  1FXK A;  2IJH A;  2PI4 A;  2NLJ C;  2VQF O;  1K34 A;  3T1H B;  4DV3 B;  1E1Q G;  1FJG O;  4O2A A;  2ITD C;  4NTW A;  1JQ0 A;  2RN9 A;  1SQG A;  2ZR2 A;  3ZRX A;  3S3W A;  5EZY A;  2N74 A;  5B66 Z;  5LGT A;  3QO8 A;  4FLU A;  4FM0 A;  2GDS A;  1GN4 A;  3EVK A;  3VBB A;  5EC1 C;  2UXC B;  3CCV V;  1ZUQ A;  2DN9 A;  2Z3Y A;  1B04 A;  3KZI Z;  4G28 B;  4WF9 V;  1HNX O;  1TAE A;  3D3I A;  1UFI A;  2XAH A;  2UXX A;  1FXH A;  2ZNJ A;  2RDC A;  2IJK A;  3CMA V;  2AHY A;  2AZ2 A;  1L8D A;  1HNZ B;  4P30 A;  1VQ6 V;  2OIG A;  4JI2 O;  1BHB A;  1PV0 A;  3JAW A;  1PPJ H;  4FLV A;  4O4J B;  4BIO A;  3K58 A;  2LW7 A;  2VRZ A;  5FNV B;  1Y4M A;  5KUM A;  1VEW A;  1TVK B;  2JS3 A;  3O9O A;  4IIJ B;  3CXC U;  3GB7 C;  3QF7 A;  3FD9 A;  1ZSP A;  4L87 A;  3CRR A;  3T1Y B;  1MG1 A;  1OCC C;  4P2Z A;  2A9H A;  4X1K A;  2YSU B;  1EN5 A;  1X4T A;  4WFA V;  3A0H Z;  1Q7Y W;  1VQN V;  2DYS B;  1I94 B;  4NXM B;  2BE3 A;  4GX0 A;  1AVM A;  5H2F Z;  3FAV B;  3ETE A;  3K9A A;  2BSK B;  2RCV A;  2L6L A;  2Q7H A;  4PDL A;  1N32 B;  4X1K B;  3P32 A;  5LP6 A;  2WLM A;  4OX9 O;  1RFY A;  4BAY A;  2P4V A;  3I56 V;  2E5L B;  2QR4 A;  4JI2 B;  4X66 B;  1H2S B;  1ZX3 A;  4X64 O;  4H44 B;  3CRM A;  2WSS G;  1US6 A; 
#chains in the Genus database with same CATH homology
 1BL8 A;  1KP3 A;  3ABM B;  1N8R W;  1OCR C;  2QE7 G;  1SES A;  4I5S A;  1R3L C;  2FTK A;  2WLL B;  2Y69 C;  2JJ2 G;  4UVA A;  1S72 V;  2EIN B;  4LC1 A;  4DXW A;  3X2Q B;  3LDC A;  3K79 A;  1CPY A;  2DYR B;  3OUF A;  3F7Y C;  4HZ3 A;  1R3J C;  5IYC O;  1AI4 A;  3EFF K;  1AI5 A;  2P67 A;  3AG1 C;  3OGC C;  4LP8 A;  3ZIA G;  4G2K A;  5H6Q A;  2XAJ A;  4J9Y B;  1PD3 A;  5KA6 A;  4MVS A;  4BW5 A;  3ZN1 A;  2P90 A;  3KG2 A;  4R7C A;  4QPJ A;  2HLD G;  1GO3 F;  1EZJ A;  4MVM A;  5EK0 A;  4JAV A;  3SYO A;  2XND G;  4CZZ A;  4ZKI A;  1VQP V;  2LFS A;  3ABT A;  4OXS A;  5EBM C;  3SYP A;  1QCE A;  2OTJ V;  2HJF C;  5H9C A;  4UXN A;  4UVB A;  4JGS A;  3CCR V;  1WPX A;  1MAB G;  2JEX A;  3K06 A;  2GHY A;  4JTA B;  3JD0 A;  5L3G A;  1EFR G;  3MHS C;  3ETD A;  4MVZ A;  3W7T A;  4XDJ A;  4GCZ A;  2DWD C;  3STZ C;  3P30 A;  3AEI A;  2F43 G;  2IH1 C;  4R50 A;  1XL4 A;  3STL C;  1S0V A;  1JPX A;  3E83 A;  3UM7 A;  3ZMV A;  4DO2 A;  2Y48 A;  1JJ2 U;  2EIN C;  2XOK G;  3CCM V;  1RM1 C;  2V1D A;  5KUK A;  4WFG A;  1FXK B;  4FJC C;  2JJ1 G;  4JYC A;  1K4C C;  2EIM C;  2IU3 A;  5HFM A;  1AJP A;  4WFH A;  1QBZ A;  1PNM A;  1SER A;  3OMA B;  2OCC B;  2EJR A;  3ASO B;  3SYQ A;  1M90 W;  3TCU A;  1XL6 A;  1GK9 A;  1H8E G;  1F51 A;  1Q86 W;  1EBO A;  2WLJ A;  2ZQM A;  2WLI B;  1FXK C;  3PJS K;  1QVG U;  1NBM G;  3CCJ V;  4H37 A;  4PEL A;  2WLH A;  3BEH A;  2EIM B;  3E8F A;  2K1E A;  4PA7 A;  5CBF A;  1I5X A;  2XAG A;  3B8N A;  1QLN A;  3H01 A;  1UJW B;  2JEU A;  1M1K W;  1E79 G;  1OCO C;  4N23 A;  3GWO A;  4JAU A;  3IC7 A;  1I5Y A;  3TET A;  2HG5 C;  1YJ9 V;  1M56 B;  3K0G A;  3UKM A;  2XAS A;  1AR1 B;  4WCE V;  1MOF A;  4MW3 A;  4JF3 A;  4JAS A;  4MSW C;  2HVK C;  4X89 A;  3NXS A;  1YI2 V;  3WFV A;  1OHH G;  1K5S A;  1W0J G;  2JK5 C;  2IH3 C;  3SPC A;  1G4Y B;  3CC7 V;  5E1A C;  1OCO B;  4U7O A;  4TSF G;  3CCU V;  3RVZ A;  1W0K G;  1VQ5 V;  1M56 C;  3CCS V;  3ZRV A;  4RUE A;  2OTL V;  1CP9 A;  3QO7 A;  4JTC B;  3D36 A;  1KEC A;  4P9P A;  1GKF A;  3E86 A;  3VOU A;  2AHZ A;  2P7T C;  1K33 A;  4RO2 A;  4MS2 A;  3E35 A;  2QKS A;  2OCC C;  3ZRW B;  1JVM A;  1Q81 W;  3JD4 A;  3FYI B;  3ZMU A;  2BOB C;  4PDM A;  1TUE B;  4FIP C;  2DWE C;  1H2G A;  3ABK B;  3ZRW A;  3CME V;  2DW4 A;  3CPW U;  1JX9 A;  4KUM A;  5B1O A;  3FB8 C;  2EIL C;  4PA9 A;  3G71 V;  2B1I A;  3FKS G;  2PI5 A;  1Q82 W;  1RPR A;  3JCZ A;  4R8C A;  4HAM A;  2XAF A;  2JDI G;  2M7W A;  4MW8 A;  3JD3 A;  1VQ7 V;  2QA4 V;  3OFN G;  2Z5U A;  3LDD A;  1F4M A;  5IYB O;  3JYC A;  2Y69 B;  3K08 A;  3R65 A;  5FL7 G;  2EIL B;  2Q69 A;  1NR7 A;  3CCL V;  3DGE A;  4GX5 A;  1BMF G;  5LGN A;  3SPI A;  1VQM V;  3HB3 B;  2X6A A;  5GW7 A;  3ABL B;  3K04 A;  3A0R A;  1V55 C;  1ROP A;  3K03 A;  5L3E A;  1VQ8 V;  1R3K C;  1QR8 A;  4MVU A;  1Y66 A;  1GTO A;  3OR7 C;  3OUS A;  1WLE A;  4GX2 A;  4RAI A;  4WFF A;  3OW2 U;  1H38 A;  2X6C A;  2X7R B;  3E8G A;  3E8H A;  1YTF B;  2LP7 A;  3AG2 C;  3HPL C;  3LUT B;  1GM7 A;  1COW G;  2W6J G;  1OCC B;  4BIZ A;  1M57 B;  4QPK A;  5EBW C;  5HFL A;  1V55 B;  1K8A W;  2DQ3 A;  3LDE A;  3OE7 G;  3CC2 V;  2WLI A;  4JYB A;  1K4D C;  3ML0 A;  4E2L A;  1VQO V;  2X6B A;  4MTX A;  3T4D A;  3ASN B;  3CCE V;  3DTU B;  2H94 A;  2V7Q G;  1DF5 A;  3AG2 B;  4PA6 A;  1QLE C;  3ZN0 A;  1NQT A;  1SET A;  4ZBM A;  1M57 C;  1ENV A;  1GMG A;  2ZR3 A;  3W7X A;  1AI7 A;  3MHH C;  3WG7 B;  1YIJ V;  2ZD9 A;  4J9Z B;  2OT5 A;  4MTF A;  3ZMZ A;  2QM7 A;  2WAM A;  3SPH A;  1SRY A;  2W0F C;  2EIK B;  1NH2 D;  1OZ0 A;  3F5W C;  1JOY A;  1NJI W;  1KC8 W;  3JD2 A;  3WG7 C;  3SPJ A;  1GM8 A;  5C93 A;  5EC2 C;  5B3S B;  5IYD O;  3FB5 C;  4QIW F;  4LBE C;  1BHA A;  3OR6 C;  2A0L A;  3ASO C;  3W7U A;  3BY6 A;  3LSQ A;  3AG3 B;  2DYR C;  3ABM C;  3JD1 A;  5LHH A;  3F7V C;  3IGA C;  3OM3 B;  1THZ A;  2D3O W;  3B77 A;  5IY5 C;  2QM8 A;  1K5Q A;  3AG4 B;  1YJW V;  3CP1 A;  1P4R A;  1AJN A;  1DLB A;  1DTO A;  1R73 A;  3E2E A;  5H6R A;  3ZRS A;  2QTO A;  1KD1 W;  5CMU A;  3AG1 B;  3IFX A;  3E89 A;  3ASN C;  1R3I C;  3G6E V;  1ARO P;  4LCU C;  5DM6 V;  1NH2 B;  5L3D A;  1QLE B;  2B1G A;  1MSW D;  2C2A A;  4UV9 A;  1R6K A;  5IY5 B;  3AG4 C;  1R6N A;  1FXV A;  3SYA A;  1NKD A;  1VQL V;  5CN0 A;  5LGU A;  3W7S A;  1VQK V;  4MTG A;  1LNQ A;  3W7W A;  5B1N A;  3OAA G;  4QJF B;  3LNM B;  3M99 B;  2LFR A;  2B5U A;  2EIJ B;  2IJI A;  5KA5 A;  5L3B A;  2WLK A;  4PA4 A;  1FS0 G;  4GT1 A;  1J95 A;  2XAQ A;  4X88 A;  2JIZ G;  5EBL C;  4F4L A;  4G27 B;  2BOC C;  1P7B A;  4GX1 A;  1GM9 A;  2IW5 A;  4JTD B;  1PL0 A;  4PA3 A;  3OEH G;  2P6J A;  3FB7 C;  4MTO A;  5DN6 G;  3AG3 C;  3CD6 V;  2R9I A;  2WWW A;  4H33 A;  1CEZ A;  3SPG A;  2KB1 A;  1RM1 B;  3MD0 A;  5B1A C;  1YHQ V;  3E8B A;  1OCZ C;  1PNK A;  1RPO A;  2A79 B;  4KFM A;  4MVO A;  4BIU A;  3ABU A;  3OMN B;  3ZMT A;  3RVY A;  4UUJ C;  1KQS U;  4I9W A;  4EKW A;  4RQF A;  2YEV B;  5B1B C;  1QVF U;  1B6Q A;  2Q68 A;  5CBH A;  3SJQ C;  1L1F A;  1VQ9 V;  1KKD A;  5LHI A;  4FK5 C;  1G8M A;  3OMI B;  3T2M A;  1HWY A;  4MVR A;  3EHB B;  2Q6A A;  1FXK A;  2IJH A;  1S3J A;  1F4N A;  2PI4 A;  2NLJ C;  1NVP D;  1H8H G;  3LSS A;  4JPR A;  1AI6 A;  1K34 A;  3CYO A;  4Q20 A;  3RBZ A;  1K73 W;  2WLL A;  3K0D A;  1E1Q G;  4RQE A;  4UVC A;  4CBC A;  2ITD C;  4KP4 A;  2HR3 A;  1JQ0 A;  3ZRX A;  2ZR2 A;  4QE9 A;  2UXN A;  4N21 A;  3K3W A;  1YTF D;  4MVQ A;  3ZJZ A;  5LGT A;  4X8A A;  3QO8 A;  5B1A B;  4R6Z A;  1OCZ B;  2IJJ A;  3VBB A;  1K97 A;  2EZO A;  5EC1 C;  3CCV V;  4P9O A;  1S77 D;  4FPP A;  2Z3Y A;  2ZDI A;  2CK3 G;  3SYC A;  1PKX A;  4G28 B;  4WF9 V;  5B1B B;  3T4Z A;  1KP2 A;  3D3I A;  4QNH B;  2R9R B;  4RUF A;  2YEV A;  2DYS C;  2XAH A;  2UXX A;  2MK3 A;  1FXH A;  3G4S V;  3ZCC A;  2EIK C;  2IJK A;  3CMA V;  2IU0 A;  2AHY A;  2DQ0 A;  2ZXW B;  1NR1 A;  2NNU A;  1V54 B;  4P30 A;  1VQ6 V;  2HVJ C;  3B8M A;  3I55 V;  5B3S C;  4TT3 G;  1BHB A;  1IXM A;  1JCH A;  5LBQ A;  4TWK A;  1YJN V;  3T1C A;  2ATK C;  3FYE B;  1E1R G;  4HYO A;  2HFE C;  2ZDI C;  4FMT A;  3QO5 A;  3FB6 C;  1NVP B;  5L3C A;  1YSC A;  4ASU G;  2Q67 A;  1AJQ A;  1Y4M A;  2WPD G;  5KUM A;  3CCQ V;  2GSM B;  3CXC U;  3GB7 C;  3ABL C;  2X0L A;  4U7N A;  4YXW G;  4L87 A;  1FFT B;  3ZMS A;  5J9P C;  3TK1 A;  2QEX V;  1OCR B;  1K9M W;  2WLN A;  5BZB A;  1MG1 A;  5LHG A;  3CC4 V;  1OCC C;  4P2Z A;  1SZT A;  3X2Q C;  2A9H A;  2YSU B;  4XDL A;  1DF4 A;  4WFA V;  4QE7 A;  5IDJ A;  1Q7Y W;  5L3F A;  1VQN V;  2DYS B;  2EIJ C;  1YIT V;  4Z1M G;  1K3E A;  4GX0 A;  2EZP A;  3ETE A;  2EBO A;  3K9A A;  1K92 A;  3QNE A;  2HKO A;  1PNL A;  4PDV A;  2ZXW C;  4XBF A;  4PDL A;  5CBG A;  1VQ4 V;  1S76 D;  1V54 C;  2H8P C;  1S5H C;  3P32 A;  2W6I G;  1W2B U;  1ORQ C;  2WLM A;  3ABK C;  1F23 A;  1K7D A;  3OEE G;  4BAY A;  3I56 V;  5CA3 A;  4WFE A;  4PDR A;  1QR9 A;  4MT8 A;  3RW0 A;  4UV8 A;  3ETG A;  1M9N A;  4XDK A;  2WSS G;  1ZWI C;  4WFB V;  2ITC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...