2ITDC

Potassium channel kcsa-fab complex in barium chloride
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords antibody Fab fragment heavy chain
publication title Structural and Thermodynamic Properties of Selective Ion Binding in a K(+) Channel.
pubmed doi rcsb
source organism Streptomyces lividans
total genus 40
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2itdC00
1V54C 4MSWC 3T4ZA 3AG4C 4R50A 3K06A 2HJFC 3K03A 4EKWA 3SYQA 2P7TC 2ZXWC 3FB6C 3JYCA 4PA9A 3SPIA 2EIKC 1M56C 3LDDA 4PA6A 4P30A 4GX5A 4QNHB 3ABLC 1P7BA 1ZWIC 2A79B 4PA3A 4RUFA 1J95A 5B3SC 4GX2A 3X2QC 4JTDB 4QE7A 4MVUA 2ZD9A 3AG1C 3E89A 3KG2A 5CBFA 4R6ZA 5J9PC 4PDRA 3STZC 3ZRSA 2ITDC 1XL6A 3OGCC 3T4DA 1OCCC 2WLIB 2X6BA 3E8GA 5EBLC 3SPJA 4CBCA 2K1EA 2OCCC 3TCUA 4H37A 4X8AA 5EC2C 4OXSA 4DXWA 2EIJC 3UKMA 3IFXA 3K08A 2WLNA 3RVYA 1K4CC 3E8HA 4MS2A 4XDJA 4HYOA 1V55C 3FB8C 2EILC 2QKSA 4F4LA 2A0LA 4JTCB 3SJQC 2R9RB 3OR6C 4LP8A 4PA4A 4ZBMA 4J9ZB 3SYOA 3SPHA 4XDLA 3SYAA 4WFGA 3SYCA 3E8FA 3T1CA 3T2MA 2X6AA 4LBEC 3OUFA 4R8CA 3LDEA 2BOCC 5KUKA 2Q68A 4MVRA 1KKDA 4MTOA 3K0DA 4HZ3A 4MVMA 4MVOA 4GX0A 3BEHA 4PDMA 1OCRC 5CBGA 2Q69A 3LDCA 5B1BC 3F7VC 3R65A 4X88A 5EBWC 4WFHA 5EC1C 2DYSC 2Q67A 2EINC 3OR7C 3VOUA 1G4YB 1M57C 4MVZA 5EK0A 1LNQA 2QTOA 4P9OA 2ATKC 3PJSK 5IY5C 3E86A 4WFEA 3AG2C 2Q6AA 3EFFK 3GB7C 4MVSA 4RAIA 4QE9A 1XL4A 3RBZA 3ZJZA 2HVJC 2IH1C 2NLJC 5KUMA 2WLLA 3RW0A 4PDLA 3LNMB 1K4DC 4X89A 2DYRC 2HG5C 5BZBA 2WLIA 3FB7C 4MTFA 4R7CA 2JK5C 3RVZA 3SPCA 1QLEC 1ORQC 3E8BA 1OCZC 4G27B 2AHZA 2YEVA 3FB5C 3ASNC 2X6CA 3F5WC 5B1AC 3TETA 2ITCC 1S5HC 1OCOC 1R3JC 3E83A 4PDVA 2W0FC 2DWDC 3OUSA 2WLKA 3F7YC 4LCUC 2DWEC 3K04A 3K0GA 4WFFA 1R3IC 3ABMC 4J9YB 4MW3A 3WG7C 2HVKC 1R3KC 1BL8A 4UUJC 4MW8A 2H8PC 1R3LC 4XDKA 3STLC 2A9HA 4RO2A 2HFEC 2WLMA 2Y69C 4JTAB 4P2ZA 5EBMC 3ASOC 4KFMA 5E1AC 5CBHA 4G28B 4I9WA 3AG3C 3HPLC 2WLLB 1JVMA 3UM7A 3SPGA 4PA7A 3LUTB 2IH3C 2WLJA 4TWKA 4P9PA 2EIMC 4MVQA 2KB1A 2WLHA 2AHYA 3ABKC 4H33A 4MTGA 3IGAC 4RUEA 4BW5A 4GX1A 3SYPA 2BOBC
chains in the Genus database with same CATH superfamily
2KG7A 2MK3A 4J80A 4JI8O 3CPWU 3ABTA 4EKWA 1NKDA 2L35A 4NTXA 1KQSU 3L70H 4JAAA 4GX2A 1J5EO 2XAHA 2Y4UA 3AG1C 1IVSA 4NKGB 1GN2A 3U11A 2WSSG 4F6RB 1KKCA 2BTQA 2B1GA 2X6BA 4CBCA 3B09A 4LF8B 1YHQV 5LHIA 1AILA 4HYOA 3ZMZA 5L3FA 4JGSA 4X1IA 2KG7B 2R9RB 2HEPA 1AP6A 4WFGA 3T2MA 5LOVB 3ZMUA 4LBEC 3BVOA 3I56V 1ZX3A 2BOCC 5BR8B 4LF5O 2CAZC 5KLVH 5KHHA 4X88A 2BTQB 2E76B 1FXKC 2ADQB 4P9OA 1SQXH 1WLEA 4X1YA 3AG2C 4J11A 1GO3F 3AG3B 3RBZA 3L74H 4DUZB 2QWOB 3D36C 3RW0A 4X1IB 4YJ3B 3ZHVA 1VF6C 3BY6A 3E8BA 4X62B 4O4LA 4CH3A 1P7GA 2ZDIA 3RYFB 2VS0A 3OD4A 4DV0B 3NR7A 3Q4HB 2WLKA 3ABLB 4DV6O 4YHHB 4MW8A 3N2KB 2QDOA 4P2ZA 5EBMC 4X1YB 4MT8A 4WFBV 1UPGA 3QTCA 4K8ZA 4JYAB 5LYJA 1MSWD 4O4IA 4MVQA 2UXBO 1W59A 3TXSA 5LMUO 1IURA 4O4LB 2LJ2A 4IHJA 2OCHA 3FFQA 3ZN1A 3HKEA 3LDDA 4DUYB 1SZXA 1F4MA 1H2LA 1N8RW 1BGYH 4TSFG 1KP2A 1YVWA 2RJZA 1OCRB 1M90W 2AGAA 3T4DA 2NN4A 4NVPA 5DN6G 3JD3A 1BT8A 4PI2A 5LYJB 3UKMA 2F95B 3BA9A 4O4IB 4K0KB 1PP9H 3DC6A 1XREA 1AB3A 1R6TA 1I7FA 4IHJB 5JCOA 4LP8A 2R9IA 3SYOA 4J9ZB 5CB4B 4XDLA 3HKEB 1H2MA 3AG7A 2X6AA 4NB5A 4YY3O 3IAYA 2RMKB 1KMIZ 3H1KH 2G38A 3GWOA 3C3TA 4PDMA 5JH7B 1AR1B 3LDCA 3JATA 4WFHA 3L71H 5BR8O 2HP8A 2ATKC 5BY1A 2JGUA 1HDJA 4LC1A 1HR0B 3CRCA 4XBFA 4BWAA 3FB5C 4DUZO 1ZSPA 3S3XA 5F2VO 4GLXA 3H1IH 1HNZB 1W0KG 1X4TA 5KHGA 1SETA 1BE3H 3OMAB 3RYHB 4WFFA 3JATB 2QKAA 1EFRG 4Z2WA 2PI5A 4LF7B 4DV0O 5CBHA 1VARA 4YHHO 3N27A 1DF4A 5GTIZ 1VF7A 3SPGA 2YIBD 2EIJB 2XAQA 2IU0A 4B7EA 3SYPA 5EIBD 3T4ZA 1IBKO 1B3QA 1ENVA 1L8DA 1N33B 4ZIBA 1QR8A 4GT1A 2XAFA 1BZKA 4DV7B 4H0LB 4EEQA 4QGPA 5IJ9B 4RQEA 1XL6A 2W6JG 1Z5VA 4TT3G 5EC2C 3RYIB 1I5XA 4JPRA 4TOIA 1BMFG 1ZL8A 4FPPA 2W0XA 2H3OA 1VQKV 1WB7A 3E8FA 4DR2B 4BIZA 4K0KO 3OUFA 3QNEA 4MVRA 3K0DA 3VBBA 1Q8IA 4GX0A 5IJ0A 3FYIB 3ZN0A 5FPOA 1DTOA 1WNSA 2QM8A 3OR7C 4FZ0A 1EN6A 4LH7A 2EZPA 2LGWA 2ZE8A 3A2FA 4JASA 3CRRA 4NXNO 1ZL8B 4O2AA 2EIMB 2ILMA 4TV8A 4LF4O 5KMGA 3U0ZA 5B1OA 1RM1C 4IYHA 5B1AC 3WB1A 3CC2V 1M56B 2JGDA 4UVAA 3H1LH 1HR0O 5IJ0B 1XMQB 3K5OA 3AK3A 2ZCEA 1MG1A 1PM9A 1B6QA 1OCCB 1CP9A 4LF7O 2D2CB 2QEXV 4O2AB 3WFVA 5L3DA 2XOKG 4TV8B 1O9HA 1VMGA 4CC5A 3AEIA 3SPIA 3ZCCA 2Q7EA 1GRJA 4DRXA 4N23A 1IX9A 4RUFA 2CH7B 1FYJA 3KG2A 1MOFA 3BFRA 2ITDC 1H2KA 4U3JA 2K1EA 1XHXA 2EJ7A 4B08A 3A0RA 3ICXA 1WA8B 1XHZA 3B2EE 4OPAA 4MS2A 4XDJA 3JAWA 4LF9O 4I9QA 2LGQA 4ZBMA 2JJ2G 1PL0A 2IJJA 2A7WA 3RN4A 1Q6HA 1AI4A 1TUBB 2ARHA 4UCUA 2AW9A 1WJZA 3QG5A 4JAUA 3VQWA 5JQGB 1FFXA 2BTOA 4DR2O 4Z1MG 5FLXN 4K8XA 4U3JB 3VOUA 1NI8A 4FM0A 1VEWA 1Y66A 4N21A 4JI3B 4QE9A 5LA6A 2WA3A 1IZ3A 3DTUB 2JJ1G 2CDYA 4J7ZA 3LNMB 1YI2V 1Y74A 1OJHA 2X7RB 1E79G 1G1XB 1JOYA 5K1PA 3J7AU 3JD4A 1AR5A 1IXMA 1HP8A 3RYCB 1FFXB 3UO2A 1EZJA 5B3SB 4CH6A 3K57A 1H8EG 2QM7A 4D7TA 1XBLA 4G28B 2FB5A 2OCCB 3AG3C 4HNAA 5LA6B 1XMQO 3DGEA 4X9QA 3R66A 1GN3A 3CCVV 1B06A 4LFCO 1Y74B 1GAXA 4H33A 3OW2U 1XMOB 3HB3B 1COWG 2PGGA 3K06A 5LMNB 5LHHA 2XT9A 1NTZH 3MD0A 4P30A 5IYZA 3ABLC 4CH5A 4KL1A 4O4JA 1AI5A 4UVCA 1KBHA 2F93B 2D3OW 2NR5A 2DW4A 3WB0A 2HHHB 4I50A 1BHBA 1NR7A 2JIZG 1M57B 4HNAB 4JI5O 5IY5B 1K34A 2L6LA 5IDJA 1QVGU 2IJIA 3L75H 1YITV 3ZX6A 3OAAG 3FB8C 4IL6Z 2A0LA 2CGNA 4BAYA 4DR3B 2ZDIC 1VQ6V 3T1CA 4O4HA 5IYZB 4O4JB 1JJOA 5H9CA 3IC7A 4NXMO 2KQXA 1OCRC 2Q69A 4I50B 5EBWC 2YICA 1LNQA 2QTOA 3KZIZ 1N36O 1ZAUA 1NQTA 2Q6AA 3GB7C 4RAIA 5AG2A 3K5MA 2NLJC 1ROPA 2CTPA 1YXBA 5H6QA 2JVDA 4QJFB 3P30A 5L3GA 1V54B 3E22A 3J80N 2ITCC 2QWNB 3ZBHA 3E83A 4WBNA 1KP3A 3F7YC 2DWEC 1Q5OA 5LL6Y 3VQVA 4DR5B 5JJJB 2H8PC 3C90A 5H5NA 4RO2A 3D3IA 2P5OA 4B3RB 2OIGA 3JSNA 4TWKA 5C8YB 1K33A 4P9PA 5JCOC 2QWQB 4I55A 4B7KA 3K3WA 1WP8A 5EZYA 4WBNB 5H6RA 4ZHQA 1MABG 1XNQB 3LSUA 1NBMG 4JZGA 4TQDA 4E2LA 1XMOO 3T1HB 5LMNO 2BSKA 4J41A 1FS0G 3K9AA 4J7JA 2JEUA 3STZC 3OGCC 3MDSA 3TGUH 4UCSA 4FLVA 1QR9A 3OEEG 1FKAO 3CCJV 3JALA 4DXWA 2EIJC 1Q6UA 4F4LA 3ZRXA 2DN9A 1P49A 1SF9A 2QWPB 5EZYB 4Z1VA 3TXQA 4ZHQB 3SGIA 5KUKA 2IJHA 4CZZA 4FLWA 1N0JA 2GTAA 3OEHG 3TK1A 4MVOA 4DR3O 5CBGA 2JRIA 4I7ZB 3CEIA 1G4YB 3L73H 3RWRD 2JEXA 1VQ4V 4MVSA 3ZHQA 3ZJZA 2IH1C 3DC5A 5KUMA 2WLLA 4PDLA 4X89A 2UU9B 4B3MO 1AI6A 2WLIA 1WP7A 3NXSA 4R7CA 4FM2A 1IBLO 3THOA 1DF5A 1H2SB 2OYQA 5TISZ 3DSQA 5DEDA 2JS5A 1H38A 1QQCA 1M5IA 4DW0A 3CX5F 2KSDA 2EX3A 4UB6Z 4LF6B 4J9YB 1JR9A 3BABA 4JYYA 4DW1A 1K8AW 4LWSA 3DXRA 5FNVA 2WLLB 4DR5O 1Y6XA 5KHIA 3QO8A 2EIMC 3G6EV 4LFAB 4B3RO 1GH6A 2EILB 3L9DA 1Z2GA 4NR1A 2FKXA 1M56C 4YIPA 1I0HA 1NTKH 1HWYA 1WPXA 4GKKB 1XNQO 3ZRSA 1OCCC 4ZI7A 4LWSB 3DXRB 5FNVB 1LUWA 3T1HO 1K97A 1JMKC 1Q7YW 1NH2B 2UXNA 1URFA 2ZT9B 2E5LO 1JCHA 4X64B 2EULA 3LSSA 5IWAB 4LFBB 1VQMV 3A0BZ 3RGBA 2F4VB 1BQZA 3JCZA 3CYOA 3JARA 1PL4A 3BRCA 3ETGA 1L0NH 2LFRA 2P6JA 2WPDG 3BEHA 2DE0X 1JFFA 4L87A 2E3CA 4ZI7B 2B1IA 4MVZA 3ASOB 4UFZA 4U7NA 1F7YA 2ZIMA 5C93A 2FTKA 2Q9LA 4LF8O 1VF5B 3ABKB 1ORQC 2EBOA 2IBZH 3CRQA 1L1FA 3JARB 2DWDC 5B1NA 1GN6A 3UT5A 3SJBC 3BA8A 1SRYA 2VWJA 2UUCB 2Q0AA 4DO2A 1VQPV 2OT5A 3S3WA 1XNRB 1N34B 2IH3C 1VP7A 2WLJA 5J2UA 3K58A 4MTGA 2AHYA 4RUEA 5EIBC 4LR3A 2ZNJA 2PYJA 4HBNA 3ETQA 1EZVH 4X62O 4DV4B 1QU7A 1VQ8V 3B8MA 4PA9A 3RFRA 1KC8W 1TVKA 3WU2Z 5B3SC 1GTOA 1S5JA 2ZD9A 1RP3B 2UUAB 3HKBA 2DYSB 1E1RG 4PDRA 4RWUA 1O9GA 3CD6V 5EBLC 5L3EA 2OCCC 1JX9A 4GKKO 3D8CA 3IFXA 5CA3A 5J2UB 2VWKA 4JYAO 4BR6A 4DV3B 1QLEB 4JTCB 3JAKA 3OR6C 3GWKC 5B66Z 3CC7V 2GV9A 5GW7A 2B9ZA 3ZRVA 2YS8A 4X66B 2DMXA 1TVKB 4DUYO 4X64O 4UCVA 5IWAO 1R1BA 4LFBO 4FK5C 4MVMA 2F4VO 3HKBB 3ABMB 3WG7B 3W7XA 1NTMH 2HKOA 1XDCA 1Y4MA 4PD4F 3K5NA 1SQBH 2P4VA 4FLTA 1M57C 5IY5C 3CCSV 3W7UA 2OTJV 1UFIA 3O65A 5IYDO 1GMGA 5GONA 2VQFB 4FZ1A 3FB7C 2V4DA 1FJGB 1Y67A 3JAKB 3ZIAG 1KU9A 3UQ8A 2GTSA 1YCIA 4TV9A 2DQ3A 3D36A 4G2KA 3EXAA 4TQFA 1S5HC 4PDVA 1FAFA 1DGSA 1L0LH 1KB9F 4O2BA 1CXZB 1QCEA 4JI0B 5D5PA 1R3LC 2HFEC 3OT7A 1MA1A 3HPLC 1DLBA 2UUCO 2WLHA 1V55B 3G67A 2P90A 2LW1A 4TV9B 1XNRO 4X1KA 1V54C 1KECA 2BCCH 4ZOLA 3AK2A 1N34O 4JI6B 2P7TC 4NTYA 2WAMA 2PUSA 4O2BB 4GX5A 3CE2A 1P7BA 1HNZO 2N74A 3N2GA 1RPRA 2UXCB 4FLYA 4DV4O 3IC9A 2ZM6B 3SR2C 2EINB 2GBOA 4NYKA 3UCSC 2IM9A 2UXDB 3CRMA 4JI4B 4JI2B 3I55V 2UUAO 5KMGB 2WLNA 3OMNB 4L8JA 2R9AA 2JGDB 4FJCC 2NNUA 4X1KB 2F43G 1EN4A 1SESA 4JYCA 4CS2A 4OX9B 4PA4A 4RQFA 4C7UA 4MTOA 4UV8A 1N33O 2XTAA 4AHCA 3JD2A 3R65A 2Q67A 4X66O 2XASA 4DR1B 4DV7O 2V7QG 3HKCA 1PPJH 1QHTA 2EZOA 1HNWB 2QGNA 3B4SA 3G71V 2UUBB 4K3AA 4AI8A 2HG5C 4CC6A 1HNXB 5IE9A 3APOA 5IT9N 5LXTA 1SA0A 4G27B 2QWRB 4DRXB 1HW7A 2PI4A 2VQFO 1TA8A 5KA6A 2ZXWB 2W0FC 4YIOA 2VRZA 4MW3A 2N05A 4CH4A 1R3KC 4TUYA 4UUJC 3L72H 3PN1A 3EVKA 2Q0OC 3JAWB 3CJHA 3B8NA 2B5UA 4JI0O 1JVMA 1BSMA 2UXXA 1VQOV 1K7DA 2EJRA 5LXTB 5KA5A 4JI7B 2BOBC 1Q86W 3CHXA 4OPHA 1NVPB 3SYQA 1S77D 1TGOA 3H1HH 3FX7A 5LP6A 5CN0A 1J95A 4JI6O 5B1BB 1GKFA 3G4SV 3M99B 3FKSG 5K1XA 2UXCO 1XUQA 4DR6B 3MHSC 3T1YB 5KAIZ 3MHHC 2Y48A 3CMEV 2EILC 1ZTEA 5CA0A 1QBZA 2V1DA 5CMUA 4DK1A 3SYCA 1OCOB 4R8CA 2Q68A 5LP6B 3QVNA 4YJ2A 3SDLA 3FYEB 1KKDA 4GUNA 5L3CA 3F7VC 3KCYA 3CWBH 1YIJV 4WFAV 3CCLV 3ZHTA 2OIEA 3CMAV 5BMVA 1H2NA 4DR1O 5IYCO 4JI8B 4LNUA 1M4UA 1HNWO 1HNXO 4EFBA 2P67A 3B77A 4YJ2B 2EIKB 2Z3YA 4LCUC 1J5EB 4U3FH 4JZ2A 1R3IC 1GK9A 1ZUQA 5KAFZ 2A9HA 3ASOC 4KFMA 4GZRB 1SKVA 1AJPA 1NH2D 2PYLA 2N04A 4JI3O 3LUTB 3OTOB 1I5YA 1OHHG 2IU3A 1WB8A 3BCCH 4O4HB 2HLDG 5LGNA 3ABKC 4BW5A 4GX1A 4UB8Z 1SC5B 4LF5B 1X59A 1KYOF 2HR3A 2ZINA 1K3EA 4OGQB 5FPRA 3LSQA 4R6ZA 4PV1B 2Y0IA 3QO5A 1JA8A 1YDXA 1OZ0A 3E22B 2DYRB 4GYCB 1YTFB 3JASA 3SPHA 1R6KA 3T1YO 3G80A 4UCRA 1S5LZ 1XQ8A 3A8TA 3K79A 1FFTB 3JSLA 2DYSC 4J7KA 2HHHO 3HR0A 1JJ2U 2A06H 4QIWF 1VQ7V 3FAVA 3E86A 1AJQA 4FFBA 3CCRV 1XL4A 1IXBA 4I55B 3VQYA 5LMUB 3SPCA 1QLEC 2DQ0A 1I08A 3JASB 5B5EZ 1SS3A 2Y4TA 2YI8A 1K9MW 2CK3G 3IJ4A 3AG4B 2BSKB 2ADPA 4UCTA 2Z5UA 3K0GA 2K9PA 3UO3A 3ABMC 3WG7C 5LOVA 1P4RA 3X2QB 5A2QN 3JALB 1SQPH 1FD9A 4XDKA 1TAEA 4DR4B 1RPOA 3FAVB 1Q3EA 4FFBB 2YIDA 4PELA 4EFEA 1TUEB 2QJ1A 3J81N 2YXLA 3SJQC 4MSWC 1XI1A 3D3QA 4GKJB 3K03A 3OTOO 4YY3B 1YJNV 2IW5A 3ZRWA 4YJ3A 2E74B 4KUMA 1Q43A 1ZWIC 2Q4PA 4B3TB 4QE7A 1CEZA 4MVUA 3E89A 1WN7A 3RYFA 2AZ2A 1U97A 3CS5A 3Q4HA 2WLIB 3CCUV 4W4KA 3JD1A 4X8AA 5BXZA 3N2KA 4E4EA 4YXWG 1K4CC 2XNDG 3E8HA 2M6YA 5JVDA 4WCEV 1V55C 1YEWA 2PF4E 3ZRWB 3ASNB 1ZLZA 1K73W 1BS3A 3HKDA 2FMLA 4FIPC 4U7OA 2DJVA 1NR1A 2EINC 2GSMB 2P22C 5EK0A 2LQTA 3U10A 4FMTA 3EFFK 2HVJC 5JVDB 1YJWV 4BIUA 2AXTZ 1M93A 1I94B 1M1KW 1IBKB 2CTRA 3HKDB 1R6NA 4X20A 4JAVA 1B04A 3OUSA 1F4NA 5KHKA 4Q20A 1NJIW 2XUMA 1S76D 1BHAA 5CB4A 1M9NA 1BL8A 1GM9A 3ZHRA 1AR4A 4JTAB 3BPZA 5JJEB 5JH7A 1E1QG 2BE3A 2YI9A 1D2DA 3CC4V 5EYPA 2XAGA 3W7TA 5LGTA 3CXCU 4DR4O 4DV2B 2XHBA 3F5TA 2UU9O 1VQ5V 2CGOA 2QKCA 4R50A 2ODMA 2O57A 3AK1A 2ZXWC 4X20B 3FB6C 1YF2A 2RQ6A 4ICGA 1JFFB 3OMIB 2C2AA 1V9PA 2Q7HA 1PNKA 5GTHZ 1JQ0A 4JV5B 4GKJO 3OM3B 4I4TA 4LF6O 5CBFA 3G6BA 5J9PC 3CRAA 5HFLA 3RYHA 3ZHUA 1AVMA 1WPBA 5EYPB 4H37A 4B3TO 1S72V 4OXSA 4IIJA 4NXNB 2CE4A 4KP4A 3RVYA 2QR4A 4A5UB 2QKSA 1XEQA 4LF4B 1N4CA 2DOSA 4LFAO 1OCZB 4ABMA 4QPKA 4JI1B 3UT5B 1GM8A 3LDEA 4KHPB 2Q7GA 1Q81W 1NT2B 4DR7B 4QPJA 2Q5ZA 4J10A 4I4TB 2CTWA 3P3PA 5B1BC 1NU1H 3ETDA 1QLNA 4D6TH 2ZE6A 3ZHSA 1FXVA 2Y69B 3PJSK 4IIJB 2R72A 4PJ0Z 4UXNA 4FM1A 3JCUZ 4JYBA 3WB2A 5IJ9A 2HJDA 2F66C 1YZBA 3CP1A 1P84F 2YUAA 1NVPD 2LO1A 3RYIA 3OTFA 1IBMB 4CS4A 3OGIB 1OCOC 5LP6C 5ITZA 1I94O 3EHBB 4D7SA 4IT5A 4FLXA 1MSDA 1MZEA 2GUZA 3AG1B 1AROP 3CSXA 1MZFA 3H01A 5E1AC 2WWWA 1FXKA 3VQXA 1JPXA 4KXRA 4DK0A 4PA7A 4CS3A 1G6UA 2PY5A 2FL4A 2CUGA 4LF9B 1XILA 4ZKIA 1H8HG 1VF6A 2FYUH 1AP5A 1BQ0A 4DV2O 2R70A 3JYCA 5ITZB 2EIKC 2YXHA 4AILC 5LHGA 3A0HZ 1WAZA 1PV0A 2GUZB 1K5SA 3ZEDA 1RFYA 2H94A 2Y0PA 5GONB 1Z5WA 1FXKB 3TCUA 4JV5O 1MNGA 3AG2B 3RT3C 4DV5B 5E79Z 2ZR3A 1U96A 2ZNIA 1G8MA 1D5AA 4GCZA 3SYAA 5H2FZ 1SQVH 1THZA 2RN9A 4H44B 4JI1O 1MMMA 2GHYA 2XAJA 1EN5A 5EC1C 4KHPO 2JS3A 1NZ6A 2ZIOA 1QNMA 3CCEV 4DR7O 1F51A 1D5NA 3H9VA 2CH7A 3P3NA 4WFEA 5DECA 4FLZA 4UV9A 2YC0A 4JF3A 4LFCB 1K4DC 4ZOLB 2DYRC 2LFSA 1DK1A 1F23A 1OV9A 2QM4A 3RVZA 3APQA 3OE7G 2P06A 4UCOA 2YEVA 4DV3O 3N2GB 1RSOA 1WA8A 2QSAA 1PKXA 1GM7A 5D5QA 1US6A 3ZMSA 1R73A 1N32B 3E35A 1LR1A 3H1JH 3K04A 3GVMA 1A32A 1IBMO 4BIOA 3E2EA 3M7MX 3OFNG 3STLC 1TUBA 4JI5B 4WF9V 2WLMA 2JDIG 5JQGA 1S3JA 2RDCA 4W4LA 4IGGA 2QA4V 1YTFD 3IGAC 2YEVB 2M7WA 4HAMA 5KX5A 1SQQH 1FJGO 1AJNA 1RSOB 1W0JG 2F23A 2YIBA 3AG4C 1VQLV 4J42A 3FD9A 1YSCA 4PA6A 4NXMB 4QNHB 3SJCC 1LUVA 1S0VA 2YXYA 2E75B 4PA3A 3HKCB 3X2QC 4JTDB 1Y76A 4DV1B 1N36B 2LP7A 3RYCA 3E8GA 4NTWA 3SPJA 1SA0B 4BW9A 1GN4A 5LBQA 1IDSA 3M8AA 4F6EA 1T5EA 5KX5B 2VQEB 4DV5O 3ABUA 1VIBA 3MAQA 3JAMN 2QTSA 1Q82W 4TUYB 1FPOA 4HZ3A 3CJHB 1K92A 1Y76B 3QO7A 2RCVA 2PTMA 3ML0A 5FL7G 4I0XA 2ZM6O 4FFKA 3KCXA 1SQGA 2OTLV 2UXDO 4B3SB 4JI4O 4EB6A 4JI2O 2KKWA 4MTXA 5BZBA 4X65B 2JK5C 1YJ9V 3W7SA 3SJAC 3ASNC 1NS1A 2QE7G 4OX9O 4IYIA 1UJWB 4FLUA 1Q90D 1PNLA 2ZKOA 3W7WA 1SERA 1K5QA 4H13B 3CCMV 3KKYA 4I0XB 4DYLA 5A9GA 3ZS8C 1N32O 4AQYB 4PHZA 3BAAA 4I9WA 5CA0B 3ZMVA 4EB6B 2W6IG 2CTQA 2UUBO 3P32A 5IYBO 3QF7A 3ETEA 3I5DA 3K5LA 2HJFC 2GDSA 4PI0A 2A79B 3CB2A 3C3SA 5J2TA 5BMVB 1H2GA 2PZSA 2X0LA 2A3QA 5JWPA 1XOUA 1SQFA 4UVBA 2LW7A 2ZE5A 1CPYA 4LNUB 2RNBA 5CA1A 4B3MB 3K08A 3LNNA 4DV1O 1IBLB 2ZQMA 2YDEA 1EM1A 2ETNA 5JJNB 4JI7O 2YSUB 5DM6V 5C8YA 1RM1B 5B1AB 2AZ0A 2ZE7A 2VQEO 5J2TB 1VQNV 1QVFU 4FVMA 1VQ9V 2IJKA 3CCQV 2Q8VA 5L3BA 1N0NA 2Z0AA 5CA1B 3JD0A 3TJTA 4DR6O 4MTFA 3ZMTA 1OCZC 2AHZA 4B3SO 3K59A 1AI7A 5HFMA 3K9SA 4ASUG 4DV6B 1KD1W 2X6CA 1PD3A 2Q73A 3F5WC 2ZR2A 3TETA 4X65O 1R3JC 4I5SA 3B40A 1PNMA 1KUQA 1FXHA 2YIAA 3O9OA 2HVKC 2P4KA 1W2BU 3BHPA 2Y69C 5LGUA 2OWOA 1Q6IA 4F6RA 1EBOA 4Q6GA 5KHJA 1BCCH 2UXBB 3UM7A 2F1MA 4K35A 2E5LB 4AQYO 2KB1A 4LH6A 2MW2B 3CXHF 1SZTA 2WA4A
chains in the Genus database with same CATH topology
1V54C 2MK3A 1KECA 3HB3B 1COWG 3K06A 3ABTA 4R50A 4EKWA 3CPWU 5LHHA 1NKDA 2P7TC 2ZXWC 3FB6C 2WAMA 3OMIB 3MD0A 4GX5A 4P30A 3ABLC 2C2AA 1P7BA 1AI5A 1RPRA 4UVCA 1PNKA 2D3OW 1JQ0A 1KQSU 3OM3B 4GX2A 2DW4A 2XAHA 3AG1C 5CBFA 2WSSG 5J9PC 2EINB 1BHBA 2B1GA 1NR7A 2JIZG 5HFLA 2X6BA 1M57B 4CBCA 5IY5B 1K34A 5IDJA 4H37A 3I55V 1S72V 1QVGU 4OXSA 2IJIA 4KP4A 1YHQV 2WLNA 3OMNB 3RVYA 1YITV 5LHIA 4HYOA 3OAAG 3FB8C 2QKSA 3ZMZA 4JGSA 5L3FA 2A0LA 4FJCC 4BAYA 2NNUA 2R9RB 1OCZB 2F43G 4JYCA 1SESA 4QPKA 4PA4A 2ZDIC 4WFGA 1VQ6V 4RQFA 3T2MA 3T1CA 1GM8A 3ZMUA 4LBEC 3I56V 3LDEA 2BOCC 1Q81W 5H9CA 3IC7A 4QPJA 4MTOA 4UV8A 1OCRC 2Q69A 5B1BC 3JD2A 3R65A 3ETDA 4X88A 5EBWC 2Q67A 1QLNA 2XASA 1FXVA 1FXKC 2V7QG 2Y69B 1LNQA 2QTOA 4P9OA 1WLEA 3PJSK 2EZOA 3AG2C 1GO3F 1NQTA 2Q6AA 3AG3B 3GB7C 4RAIA 3RBZA 4UXNA 2NLJC 1ROPA 4JYBA 3RW0A 3G71V 2HG5C 5H6QA 3CP1A 3BY6A 3P30A 4QJFB 1NVPD 3E8BA 4G27B 5L3GA 1V54B 2PI4A 2ITCC 5KA6A 1OCOC 2ZDIA 2ZXWB 3E83A 2W0FC 1KP3A 2WLKA 3ABLB 3F7YC 3EHBB 2DWEC 4MW3A 1R3KC 4UUJC 3AG1B 4MW8A 2H8PC 1AROP 4RO2A 3H01A 4P2ZA 5EBMC 5E1AC 3D3IA 4MT8A 2WWWA 1FXKA 4WFBV 1JPXA 3B8NA 2B5UA 1JVMA 4PA7A 2UXXA 1VQOV 1K7DA 4TWKA 1MSWD 1K33A 4P9PA 2EJRA 4ZKIA 4MVQA 5KA5A 2BOBC 1H8HG 1Q86W 3K3WA 3ZN1A 1NVPB 3SYQA 1S77D 3JYCA 5H6RA 2EIKC 3LDDA 1MABG 5LHGA 1F4MA 1NBMG 1N8RW 4E2LA 4TSFG 5CN0A 1J95A 1KP2A 1K5SA 1OCRB 5B1BB 1M90W 1GKFA 1FS0G 3K9AA 2H94A 2JEUA 3G4SV 3M99B 3STZC 3T4DA 3OGCC 1FXKB 3FKSG 1QR9A 5DN6G 3TCUA 3JD3A 3OEEG 3AG2B 3CCJV 3MHSC 4DXWA 2EIJC 3UKMA 2ZR3A 1G8MA 3MHHC 2Y48A 3CMEV 4F4LA 2EILC 3ZRXA 1QBZA 2V1DA 4LP8A 2R9IA 5CMUA 4J9ZB 3SYOA 4GCZA 4XDLA 3SYAA 3SYCA 2X6AA 1OCOB 4R8CA 5KUKA 2Q68A 2IJHA 4CZZA 1THZA 3FYEB 1KKDA 3OEHG 3TK1A 2GHYA 3GWOA 4MVOA 4PDMA 1AR1B 5CBGA 2XAJA 3LDCA 5L3CA 3F7VC 4WFHA 5EC1C 1YIJV 4WFAV 3CCLV 3CCEV 1F51A 1G4YB 2JEXA 2ATKC 1VQ4V 4WFEA 3CMAV 4MVSA 4UV9A 3ZJZA 2IH1C 4JF3A 5KUMA 2WLLA 4PDLA 1K4DC 4X89A 2DYRC 2LFSA 1AI6A 2WLIA 1F23A 3NXSA 4LC1A 4R7CA 5IYCO 3RVZA 4XBFA 1DF5A 3OE7G 2YEVA 3FB5C 1PKXA 1GM7A 1H38A 3ZMSA 1R73A 2P67A 3B77A 1W0KG 2EIKB 1SETA 2Z3YA 3E35A 4LCUC 3K04A 3OMAB 4WFFA 1R3IC 4J9YB 1GK9A 1EFRG 2PI5A 3E2EA 3OFNG 3STLC 2A9HA 4WF9V 2WLMA 2JDIG 3ASOC 4KFMA 5CBHA 1K8AW 1AJPA 1S3JA 1NH2D 2WLLB 1DF4A 3SPGA 3LUTB 2QA4V 2EIJB 1YTFD 1I5YA 1OHHG 2IU3A 2XAQA 3QO8A 5LGNA 2HLDG 2EIMC 3G6EV 2IU0A 3ABKC 4BW5A 2EILB 2YEVB 2M7WA 3IGAC 4HAMA 4GX1A 1AJNA 3SYPA 1W0JG 3T4ZA 3AG4C 1VQLV 1M56C 1YSCA 4PA6A 1ENVA 4QNHB 1S0VA 2HR3A 4PA3A 1HWYA 1K3EA 1WPXA 3X2QC 4JTDB 1QR8A 4GT1A 2XAFA 3LSQA 4R6ZA 3ZRSA 4RQEA 1XL6A 2LP7A 3QO5A 2W6JG 1OCCC 3E8GA 3SPJA 1OZ0A 4TT3G 1K97A 5EC2C 5LBQA 1Q7YW 1I5XA 4JPRA 2DYRB 1NH2B 2UXNA 1BMFG 4FPPA 1YTFB 1JCHA 3ABUA 3LSSA 1VQMV 3SPHA 1R6KA 1VQKV 3E8FA 3JCZA 4BIZA 3CYOA 1Q82W 3OUFA 3QNEA 4MVRA 3ETGA 2LFRA 3K0DA 3VBBA 4HZ3A 2P6JA 2WPDG 4GX0A 1K92A 3BEHA 3FYIB 3K79A 3QO7A 1FFTB 2DYSC 3ML0A 4L87A 5FL7G 1DTOA 3ZN0A 2QM8A 3OR7C 2B1IA 4MVZA 1JJ2U 3ASOB 4QIWF 1VQ7V 3E86A 1AJQA 2EZPA 3CCRV 1XL4A 2OTLV 4JASA 4U7NA 4MTXA 5C93A 5BZBA 2FTKA 2JK5C 2EIMB 3SPCA 1QLEC 2DQ0A 1YJ9V 3ABKB 1ORQC 2EBOA 3W7SA 1K9MW 2CK3G 3ASNC 5B1OA 2QE7G 3AG4B 1L1FA 1RM1C 5B1AC 1UJWB 2Z5UA 3CC2V 2DWDC 1M56B 4UVAA 1PNLA 5B1NA 3W7WA 1SERA 3K0GA 1K5QA 3ABMC 3WG7C 3CCMV 1P4RA 3X2QB 1SRYA 1MG1A 4XDKA 1RPOA 4DO2A 1B6QA 1OCCB 2OT5A 1VQPV 4I9WA 3ZMVA 2W6IG 1CP9A 4PELA 2QEXV 2IH3C 1TUEB 2WLJA 3WFVA 5L3DA 2XOKG 3P32A 2AHYA 4MTGA 4RUEA 5IYBO 3SJQC 3ETEA 4MSWC 2HJFC 3K03A 1YJNV 2IW5A 3ZRWA 3B8MA 3AEIA 1VQ8V 3SPIA 4PA9A 4KUMA 3ZCCA 1ZWIC 2A79B 4N23A 1KC8W 4RUFA 5B3SC 1GTOA 4QE7A 1H2GA 4MVUA 2ZD9A 3E89A 3KG2A 1CEZA 1MOFA 2DYSB 1E1RG 2X0LA 4PDRA 2ITDC 2WLIB 3CD6V 5EBLC 3CCUV 3JD1A 5L3EA 2K1EA 2OCCC 4UVBA 1JX9A 1CPYA 4X8AA 3A0RA 3IFXA 3K08A 5CA3A 4YXWG 1K4CC 2XNDG 3E8HA 4MS2A 4XDJA 2ZQMA 4WCEV 1V55C 1QLEB 4JTCB 3OR6C 3CC7V 4ZBMA 2JJ2G 1PL0A 3ZRWB 3ASNB 5GW7A 2YSUB 5DM6V 2IJJA 1RM1B 5B1AB 1K73W 3ZRVA 1AI4A 4FIPC 1VQNV 1QVFU 4JAUA 1VQ9V 2IJKA 4FK5C 4MVMA 4U7OA 3CCQV 1NR1A 3ABMB 3WG7B 3W7XA 4Z1MG 5L3BA 2EINC 2HKOA 1Y4MA 2GSMB 3VOUA 1M57C 5EK0A 5IY5C 1Y66A 4N21A 3W7UA 3CCSV 2OTJV 3JD0A 3EFFK 4FMTA 4QE9A 5IYDO 2HVJC 3DTUB 2JJ1G 1GMGA 3LNMB 3FB7C 4MTFA 1YJWV 4BIUA 3ZIAG 3ZMTA 1YI2V 1OCZC 2X7RB 2AHZA 1AI7A 1E79G 5HFMA 1M1KW 2DQ3A 3D36A 4G2KA 4ASUG 2X6CA 1KD1W 1PD3A 1JOYA 3F5WC 1R6NA 2ZR2A 3JD4A 3TETA 1S5HC 1R3JC 4PDVA 3OUSA 1IXMA 4I5SA 1F4NA 4JAVA 4Q20A 1PNMA 1NJIW 1S76D 1BHAA 1QCEA 1FXHA 1EZJA 5B3SB 1M9NA 2HVKC 1BL8A 1GM9A 1W2BU 1R3LC 1H8EG 2HFEC 2Y69C 5LGUA 4JTAB 2QM7A 1EBOA 4G28B 2OCCB 3AG3C 1E1QG 3DGEA 3HPLC 3UM7A 3CC4V 3CCVV 2XAGA 1DLBA 5LGTA 3W7TA 3CXCU 2KB1A 2WLHA 4H33A 1V55B 1VQ5V 2P90A 3OW2U 1SZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V54 C;  4MSW C;  3T4Z A;  3AG4 C;  4R50 A;  3K06 A;  2HJF C;  3K03 A;  4EKW A;  3SYQ A;  2P7T C;  2ZXW C;  3FB6 C;  3JYC A;  4PA9 A;  3SPI A;  2EIK C;  1M56 C;  3LDD A;  4PA6 A;  4P30 A;  4GX5 A;  4QNH B;  3ABL C;  1P7B A;  1ZWI C;  2A79 B;  4PA3 A;  4RUF A;  1J95 A;  5B3S C;  4GX2 A;  3X2Q C;  4JTD B;  4QE7 A;  4MVU A;  2ZD9 A;  3AG1 C;  3E89 A;  3KG2 A;  5CBF A;  4R6Z A;  5J9P C;  4PDR A;  3STZ C;  3ZRS A;  2ITD C;  1XL6 A;  3OGC C;  3T4D A;  1OCC C;  2WLI B;  2X6B A;  3E8G A;  5EBL C;  3SPJ A;  4CBC A;  2K1E A;  2OCC C;  3TCU A;  4H37 A;  4X8A A;  5EC2 C;  4OXS A;  4DXW A;  2EIJ C;  3UKM A;  3IFX A;  3K08 A;  2WLN A;  3RVY A;  1K4C C;  3E8H A;  4MS2 A;  4XDJ A;  4HYO A;  1V55 C;  3FB8 C;  2EIL C;  2QKS A;  4F4L A;  2A0L A;  4JTC B;  3SJQ C;  2R9R B;  3OR6 C;  4LP8 A;  4PA4 A;  4ZBM A;  4J9Z B;  3SYO A;  3SPH A;  4XDL A;  3SYA A;  4WFG A;  3SYC A;  3E8F A;  3T1C A;  3T2M A;  2X6A A;  4LBE C;  3OUF A;  4R8C A;  3LDE A;  2BOC C;  5KUK A;  2Q68 A;  4MVR A;  1KKD A;  4MTO A;  3K0D A;  4HZ3 A;  4MVM A;  4MVO A;  4GX0 A;  3BEH A;  4PDM A;  1OCR C;  5CBG A;  2Q69 A;  3LDC A;  5B1B C;  3F7V C;  3R65 A;  4X88 A;  5EBW C;  4WFH A;  5EC1 C;  2DYS C;  2Q67 A;  2EIN C;  3OR7 C;  3VOU A;  1G4Y B;  1M57 C;  4MVZ A;  5EK0 A;  1LNQ A;  2QTO A;  4P9O A;  2ATK C;  3PJS K;  5IY5 C;  3E86 A;  4WFE A;  3AG2 C;  2Q6A A;  3EFF K;  3GB7 C;  4MVS A;  4RAI A;  4QE9 A;  1XL4 A;  3RBZ A;  3ZJZ A;  2HVJ C;  2IH1 C;  2NLJ C;  5KUM A;  2WLL A;  3RW0 A;  4PDL A;  3LNM B;  1K4D C;  4X89 A;  2DYR C;  2HG5 C;  5BZB A;  2WLI A;  3FB7 C;  4MTF A;  4R7C A;  2JK5 C;  3RVZ A;  3SPC A;  1QLE C;  1ORQ C;  3E8B A;  1OCZ C;  4G27 B;  2AHZ A;  2YEV A;  3FB5 C;  3ASN C;  2X6C A;  3F5W C;  5B1A C;  3TET A;  2ITC C;  1S5H C;  1OCO C;  1R3J C;  3E83 A;  4PDV A;  2W0F C;  2DWD C;  3OUS A;  2WLK A;  3F7Y C;  4LCU C;  2DWE C;  3K04 A;  3K0G A;  4WFF A;  1R3I C;  3ABM C;  4J9Y B;  4MW3 A;  3WG7 C;  2HVK C;  1R3K C;  1BL8 A;  4UUJ C;  4MW8 A;  2H8P C;  1R3L C;  4XDK A;  3STL C;  2A9H A;  4RO2 A;  2HFE C;  2WLM A;  2Y69 C;  4JTA B;  4P2Z A;  5EBM C;  3ASO C;  4KFM A;  5E1A C;  5CBH A;  4G28 B;  4I9W A;  3AG3 C;  3HPL C;  2WLL B;  1JVM A;  3UM7 A;  3SPG A;  4PA7 A;  3LUT B;  2IH3 C;  2WLJ A;  4TWK A;  4P9P A;  2EIM C;  4MVQ A;  2KB1 A;  2WLH A;  2AHY A;  3ABK C;  4H33 A;  4MTG A;  3IGA C;  4RUE A;  4BW5 A;  4GX1 A;  3SYP A;  2BOB C; 
#chains in the Genus database with same CATH topology
 2KG7 A;  2MK3 A;  4J80 A;  4JI8 O;  3CPW U;  3ABT A;  4EKW A;  1NKD A;  2L35 A;  4NTX A;  1KQS U;  3L70 H;  4JAA A;  4GX2 A;  1J5E O;  2XAH A;  2Y4U A;  3AG1 C;  1IVS A;  4NKG B;  1GN2 A;  3U11 A;  2WSS G;  4F6R B;  1KKC A;  2BTQ A;  2B1G A;  2X6B A;  4CBC A;  3B09 A;  4LF8 B;  1YHQ V;  5LHI A;  1AIL A;  4HYO A;  3ZMZ A;  5L3F A;  4JGS A;  4X1I A;  2KG7 B;  2R9R B;  2HEP A;  1AP6 A;  4WFG A;  3T2M A;  5LOV B;  3ZMU A;  4LBE C;  3BVO A;  3I56 V;  1ZX3 A;  2BOC C;  5BR8 B;  4LF5 O;  2CAZ C;  5KLV H;  5KHH A;  4X88 A;  2BTQ B;  2E76 B;  1FXK C;  2ADQ B;  4P9O A;  1SQX H;  1WLE A;  4X1Y A;  3AG2 C;  4J11 A;  1GO3 F;  3AG3 B;  3RBZ A;  3L74 H;  4DUZ B;  2QWO B;  3D36 C;  3RW0 A;  4X1I B;  4YJ3 B;  3ZHV A;  1VF6 C;  3BY6 A;  3E8B A;  4X62 B;  4O4L A;  4CH3 A;  1P7G A;  2ZDI A;  3RYF B;  2VS0 A;  3OD4 A;  4DV0 B;  3NR7 A;  3Q4H B;  2WLK A;  3ABL B;  4DV6 O;  4YHH B;  4MW8 A;  3N2K B;  2QDO A;  4P2Z A;  5EBM C;  4X1Y B;  4MT8 A;  4WFB V;  1UPG A;  3QTC A;  4K8Z A;  4JYA B;  5LYJ A;  1MSW D;  4O4I A;  4MVQ A;  2UXB O;  1W59 A;  3TXS A;  5LMU O;  1IUR A;  4O4L B;  2LJ2 A;  4IHJ A;  2OCH A;  3FFQ A;  3ZN1 A;  3HKE A;  3LDD A;  4DUY B;  1SZX A;  1F4M A;  1H2L A;  1N8R W;  1BGY H;  4TSF G;  1KP2 A;  1YVW A;  2RJZ A;  1OCR B;  1M90 W;  2AGA A;  3T4D A;  2NN4 A;  4NVP A;  5DN6 G;  3JD3 A;  1BT8 A;  4PI2 A;  5LYJ B;  3UKM A;  2F95 B;  3BA9 A;  4O4I B;  4K0K B;  1PP9 H;  3DC6 A;  1XRE A;  1AB3 A;  1R6T A;  1I7F A;  4IHJ B;  5JCO A;  4LP8 A;  2R9I A;  3SYO A;  4J9Z B;  5CB4 B;  4XDL A;  3HKE B;  1H2M A;  3AG7 A;  2X6A A;  4NB5 A;  4YY3 O;  3IAY A;  2RMK B;  1KMI Z;  3H1K H;  2G38 A;  3GWO A;  3C3T A;  4PDM A;  5JH7 B;  1AR1 B;  3LDC A;  3JAT A;  4WFH A;  3L71 H;  5BR8 O;  2HP8 A;  2ATK C;  5BY1 A;  2JGU A;  1HDJ A;  4LC1 A;  1HR0 B;  3CRC A;  4XBF A;  4BWA A;  3FB5 C;  4DUZ O;  1ZSP A;  3S3X A;  5F2V O;  4GLX A;  3H1I H;  1HNZ B;  1W0K G;  1X4T A;  5KHG A;  1SET A;  1BE3 H;  3OMA B;  3RYH B;  4WFF A;  3JAT B;  2QKA A;  1EFR G;  4Z2W A;  2PI5 A;  4LF7 B;  4DV0 O;  5CBH A;  1VAR A;  4YHH O;  3N27 A;  1DF4 A;  5GTI Z;  1VF7 A;  3SPG A;  2YIB D;  2EIJ B;  2XAQ A;  2IU0 A;  4B7E A;  3SYP A;  5EIB D;  3T4Z A;  1IBK O;  1B3Q A;  1ENV A;  1L8D A;  1N33 B;  4ZIB A;  1QR8 A;  4GT1 A;  2XAF A;  1BZK A;  4DV7 B;  4H0L B;  4EEQ A;  4QGP A;  5IJ9 B;  4RQE A;  1XL6 A;  2W6J G;  1Z5V A;  4TT3 G;  5EC2 C;  3RYI B;  1I5X A;  4JPR A;  4TOI A;  1BMF G;  1ZL8 A;  4FPP A;  2W0X A;  2H3O A;  1VQK V;  1WB7 A;  3E8F A;  4DR2 B;  4BIZ A;  4K0K O;  3OUF A;  3QNE A;  4MVR A;  3K0D A;  3VBB A;  1Q8I A;  4GX0 A;  5IJ0 A;  3FYI B;  3ZN0 A;  5FPO A;  1DTO A;  1WNS A;  2QM8 A;  3OR7 C;  4FZ0 A;  1EN6 A;  4LH7 A;  2EZP A;  2LGW A;  2ZE8 A;  3A2F A;  4JAS A;  3CRR A;  4NXN O;  1ZL8 B;  4O2A A;  2EIM B;  2ILM A;  4TV8 A;  4LF4 O;  5KMG A;  3U0Z A;  5B1O A;  1RM1 C;  4IYH A;  5B1A C;  3WB1 A;  3CC2 V;  1M56 B;  2JGD A;  4UVA A;  3H1L H;  1HR0 O;  5IJ0 B;  1XMQ B;  3K5O A;  3AK3 A;  2ZCE A;  1MG1 A;  1PM9 A;  1B6Q A;  1OCC B;  1CP9 A;  4LF7 O;  2D2C B;  2QEX V;  4O2A B;  3WFV A;  5L3D A;  2XOK G;  4TV8 B;  1O9H A;  1VMG A;  4CC5 A;  3AEI A;  3SPI A;  3ZCC A;  2Q7E A;  1GRJ A;  4DRX A;  4N23 A;  1IX9 A;  4RUF A;  2CH7 B;  1FYJ A;  3KG2 A;  1MOF A;  3BFR A;  2ITD C;  1H2K A;  4U3J A;  2K1E A;  1XHX A;  2EJ7 A;  4B08 A;  3A0R A;  3ICX A;  1WA8 B;  1XHZ A;  3B2E E;  4OPA A;  4MS2 A;  4XDJ A;  3JAW A;  4LF9 O;  4I9Q A;  2LGQ A;  4ZBM A;  2JJ2 G;  1PL0 A;  2IJJ A;  2A7W A;  3RN4 A;  1Q6H A;  1AI4 A;  1TUB B;  2ARH A;  4UCU A;  2AW9 A;  1WJZ A;  3QG5 A;  4JAU A;  3VQW A;  5JQG B;  1FFX A;  2BTO A;  4DR2 O;  4Z1M G;  5FLX N;  4K8X A;  4U3J B;  3VOU A;  1NI8 A;  4FM0 A;  1VEW A;  1Y66 A;  4N21 A;  4JI3 B;  4QE9 A;  5LA6 A;  2WA3 A;  1IZ3 A;  3DTU B;  2JJ1 G;  2CDY A;  4J7Z A;  3LNM B;  1YI2 V;  1Y74 A;  1OJH A;  2X7R B;  1E79 G;  1G1X B;  1JOY A;  5K1P A;  3J7A U;  3JD4 A;  1AR5 A;  1IXM A;  1HP8 A;  3RYC B;  1FFX B;  3UO2 A;  1EZJ A;  5B3S B;  4CH6 A;  3K57 A;  1H8E G;  2QM7 A;  4D7T A;  1XBL A;  4G28 B;  2FB5 A;  2OCC B;  3AG3 C;  4HNA A;  5LA6 B;  1XMQ O;  3DGE A;  4X9Q A;  3R66 A;  1GN3 A;  3CCV V;  1B06 A;  4LFC O;  1Y74 B;  1GAX A;  4H33 A;  3OW2 U;  1XMO B;  3HB3 B;  1COW G;  2PGG A;  3K06 A;  5LMN B;  5LHH A;  2XT9 A;  1NTZ H;  3MD0 A;  4P30 A;  5IYZ A;  3ABL C;  4CH5 A;  4KL1 A;  4O4J A;  1AI5 A;  4UVC A;  1KBH A;  2F93 B;  2D3O W;  2NR5 A;  2DW4 A;  3WB0 A;  2HHH B;  4I50 A;  1BHB A;  1NR7 A;  2JIZ G;  1M57 B;  4HNA B;  4JI5 O;  5IY5 B;  1K34 A;  2L6L A;  5IDJ A;  1QVG U;  2IJI A;  3L75 H;  1YIT V;  3ZX6 A;  3OAA G;  3FB8 C;  4IL6 Z;  2A0L A;  2CGN A;  4BAY A;  4DR3 B;  2ZDI C;  1VQ6 V;  3T1C A;  4O4H A;  5IYZ B;  4O4J B;  1JJO A;  5H9C A;  3IC7 A;  4NXM O;  2KQX A;  1OCR C;  2Q69 A;  4I50 B;  5EBW C;  2YIC A;  1LNQ A;  2QTO A;  3KZI Z;  1N36 O;  1ZAU A;  1NQT A;  2Q6A A;  3GB7 C;  4RAI A;  5AG2 A;  3K5M A;  2NLJ C;  1ROP A;  2CTP A;  1YXB A;  5H6Q A;  2JVD A;  4QJF B;  3P30 A;  5L3G A;  1V54 B;  3E22 A;  3J80 N;  2ITC C;  2QWN B;  3ZBH A;  3E83 A;  4WBN A;  1KP3 A;  3F7Y C;  2DWE C;  1Q5O A;  5LL6 Y;  3VQV A;  4DR5 B;  5JJJ B;  2H8P C;  3C90 A;  5H5N A;  4RO2 A;  3D3I A;  2P5O A;  4B3R B;  2OIG A;  3JSN A;  4TWK A;  5C8Y B;  1K33 A;  4P9P A;  5JCO C;  2QWQ B;  4I55 A;  4B7K A;  3K3W A;  1WP8 A;  5EZY A;  4WBN B;  5H6R A;  4ZHQ A;  1MAB G;  1XNQ B;  3LSU A;  1NBM G;  4JZG A;  4TQD A;  4E2L A;  1XMO O;  3T1H B;  5LMN O;  2BSK A;  4J41 A;  1FS0 G;  3K9A A;  4J7J A;  2JEU A;  3STZ C;  3OGC C;  3MDS A;  3TGU H;  4UCS A;  4FLV A;  1QR9 A;  3OEE G;  1FKA O;  3CCJ V;  3JAL A;  4DXW A;  2EIJ C;  1Q6U A;  4F4L A;  3ZRX A;  2DN9 A;  1P49 A;  1SF9 A;  2QWP B;  5EZY B;  4Z1V A;  3TXQ A;  4ZHQ B;  3SGI A;  5KUK A;  2IJH A;  4CZZ A;  4FLW A;  1N0J A;  2GTA A;  3OEH G;  3TK1 A;  4MVO A;  4DR3 O;  5CBG A;  2JRI A;  4I7Z B;  3CEI A;  1G4Y B;  3L73 H;  3RWR D;  2JEX A;  1VQ4 V;  4MVS A;  3ZHQ A;  3ZJZ A;  2IH1 C;  3DC5 A;  5KUM A;  2WLL A;  4PDL A;  4X89 A;  2UU9 B;  4B3M O;  1AI6 A;  2WLI A;  1WP7 A;  3NXS A;  4R7C A;  4FM2 A;  1IBL O;  3THO A;  1DF5 A;  1H2S B;  2OYQ A;  5TIS Z;  3DSQ A;  5DED A;  2JS5 A;  1H38 A;  1QQC A;  1M5I A;  4DW0 A;  3CX5 F;  2KSD A;  2EX3 A;  4UB6 Z;  4LF6 B;  4J9Y B;  1JR9 A;  3BAB A;  4JYY A;  4DW1 A;  1K8A W;  4LWS A;  3DXR A;  5FNV A;  2WLL B;  4DR5 O;  1Y6X A;  5KHI A;  3QO8 A;  2EIM C;  3G6E V;  4LFA B;  4B3R O;  1GH6 A;  2EIL B;  3L9D A;  1Z2G A;  4NR1 A;  2FKX A;  1M56 C;  4YIP A;  1I0H A;  1NTK H;  1HWY A;  1WPX A;  4GKK B;  1XNQ O;  3ZRS A;  1OCC C;  4ZI7 A;  4LWS B;  3DXR B;  5FNV B;  1LUW A;  3T1H O;  1K97 A;  1JMK C;  1Q7Y W;  1NH2 B;  2UXN A;  1URF A;  2ZT9 B;  2E5L O;  1JCH A;  4X64 B;  2EUL A;  3LSS A;  5IWA B;  4LFB B;  1VQM V;  3A0B Z;  3RGB A;  2F4V B;  1BQZ A;  3JCZ A;  3CYO A;  3JAR A;  1PL4 A;  3BRC A;  3ETG A;  1L0N H;  2LFR A;  2P6J A;  2WPD G;  3BEH A;  2DE0 X;  1JFF A;  4L87 A;  2E3C A;  4ZI7 B;  2B1I A;  4MVZ A;  3ASO B;  4UFZ A;  4U7N A;  1F7Y A;  2ZIM A;  5C93 A;  2FTK A;  2Q9L A;  4LF8 O;  1VF5 B;  3ABK B;  1ORQ C;  2EBO A;  2IBZ H;  3CRQ A;  1L1F A;  3JAR B;  2DWD C;  5B1N A;  1GN6 A;  3UT5 A;  3SJB C;  3BA8 A;  1SRY A;  2VWJ A;  2UUC B;  2Q0A A;  4DO2 A;  1VQP V;  2OT5 A;  3S3W A;  1XNR B;  1N34 B;  2IH3 C;  1VP7 A;  2WLJ A;  5J2U A;  3K58 A;  4MTG A;  2AHY A;  4RUE A;  5EIB C;  4LR3 A;  2ZNJ A;  2PYJ A;  4HBN A;  3ETQ A;  1EZV H;  4X62 O;  4DV4 B;  1QU7 A;  1VQ8 V;  3B8M A;  4PA9 A;  3RFR A;  1KC8 W;  1TVK A;  3WU2 Z;  5B3S C;  1GTO A;  1S5J A;  2ZD9 A;  1RP3 B;  2UUA B;  3HKB A;  2DYS B;  1E1R G;  4PDR A;  4RWU A;  1O9G A;  3CD6 V;  5EBL C;  5L3E A;  2OCC C;  1JX9 A;  4GKK O;  3D8C A;  3IFX A;  5CA3 A;  5J2U B;  2VWK A;  4JYA O;  4BR6 A;  4DV3 B;  1QLE B;  4JTC B;  3JAK A;  3OR6 C;  3GWK C;  5B66 Z;  3CC7 V;  2GV9 A;  5GW7 A;  2B9Z A;  3ZRV A;  2YS8 A;  4X66 B;  2DMX A;  1TVK B;  4DUY O;  4X64 O;  4UCV A;  5IWA O;  1R1B A;  4LFB O;  4FK5 C;  4MVM A;  2F4V O;  3HKB B;  3ABM B;  3WG7 B;  3W7X A;  1NTM H;  2HKO A;  1XDC A;  1Y4M A;  4PD4 F;  3K5N A;  1SQB H;  2P4V A;  4FLT A;  1M57 C;  5IY5 C;  3CCS V;  3W7U A;  2OTJ V;  1UFI A;  3O65 A;  5IYD O;  1GMG A;  5GON A;  2VQF B;  4FZ1 A;  3FB7 C;  2V4D A;  1FJG B;  1Y67 A;  3JAK B;  3ZIA G;  1KU9 A;  3UQ8 A;  2GTS A;  1YCI A;  4TV9 A;  2DQ3 A;  3D36 A;  4G2K A;  3EXA A;  4TQF A;  1S5H C;  4PDV A;  1FAF A;  1DGS A;  1L0L H;  1KB9 F;  4O2B A;  1CXZ B;  1QCE A;  4JI0 B;  5D5P A;  1R3L C;  2HFE C;  3OT7 A;  1MA1 A;  3HPL C;  1DLB A;  2UUC O;  2WLH A;  1V55 B;  3G67 A;  2P90 A;  2LW1 A;  4TV9 B;  1XNR O;  4X1K A;  1V54 C;  1KEC A;  2BCC H;  4ZOL A;  3AK2 A;  1N34 O;  4JI6 B;  2P7T C;  4NTY A;  2WAM A;  2PUS A;  4O2B B;  4GX5 A;  3CE2 A;  1P7B A;  1HNZ O;  2N74 A;  3N2G A;  1RPR A;  2UXC B;  4FLY A;  4DV4 O;  3IC9 A;  2ZM6 B;  3SR2 C;  2EIN B;  2GBO A;  4NYK A;  3UCS C;  2IM9 A;  2UXD B;  3CRM A;  4JI4 B;  4JI2 B;  3I55 V;  2UUA O;  5KMG B;  2WLN A;  3OMN B;  4L8J A;  2R9A A;  2JGD B;  4FJC C;  2NNU A;  4X1K B;  2F43 G;  1EN4 A;  1SES A;  4JYC A;  4CS2 A;  4OX9 B;  4PA4 A;  4RQF A;  4C7U A;  4MTO A;  4UV8 A;  1N33 O;  2XTA A;  4AHC A;  3JD2 A;  3R65 A;  2Q67 A;  4X66 O;  2XAS A;  4DR1 B;  4DV7 O;  2V7Q G;  3HKC A;  1PPJ H;  1QHT A;  2EZO A;  1HNW B;  2QGN A;  3B4S A;  3G71 V;  2UUB B;  4K3A A;  4AI8 A;  2HG5 C;  4CC6 A;  1HNX B;  5IE9 A;  3APO A;  5IT9 N;  5LXT A;  1SA0 A;  4G27 B;  2QWR B;  4DRX B;  1HW7 A;  2PI4 A;  2VQF O;  1TA8 A;  5KA6 A;  2ZXW B;  2W0F C;  4YIO A;  2VRZ A;  4MW3 A;  2N05 A;  4CH4 A;  1R3K C;  4TUY A;  4UUJ C;  3L72 H;  3PN1 A;  3EVK A;  2Q0O C;  3JAW B;  3CJH A;  3B8N A;  2B5U A;  4JI0 O;  1JVM A;  1BSM A;  2UXX A;  1VQO V;  1K7D A;  2EJR A;  5LXT B;  5KA5 A;  4JI7 B;  2BOB C;  1Q86 W;  3CHX A;  4OPH A;  1NVP B;  3SYQ A;  1S77 D;  1TGO A;  3H1H H;  3FX7 A;  5LP6 A;  5CN0 A;  1J95 A;  4JI6 O;  5B1B B;  1GKF A;  3G4S V;  3M99 B;  3FKS G;  5K1X A;  2UXC O;  1XUQ A;  4DR6 B;  3MHS C;  3T1Y B;  5KAI Z;  3MHH C;  2Y48 A;  3CME V;  2EIL C;  1ZTE A;  5CA0 A;  1QBZ A;  2V1D A;  5CMU A;  4DK1 A;  3SYC A;  1OCO B;  4R8C A;  2Q68 A;  5LP6 B;  3QVN A;  4YJ2 A;  3SDL A;  3FYE B;  1KKD A;  4GUN A;  5L3C A;  3F7V C;  3KCY A;  3CWB H;  1YIJ V;  4WFA V;  3CCL V;  3ZHT A;  2OIE A;  3CMA V;  5BMV A;  1H2N A;  4DR1 O;  5IYC O;  4JI8 B;  4LNU A;  1M4U A;  1HNW O;  1HNX O;  4EFB A;  2P67 A;  3B77 A;  4YJ2 B;  2EIK B;  2Z3Y A;  4LCU C;  1J5E B;  4U3F H;  4JZ2 A;  1R3I C;  1GK9 A;  1ZUQ A;  5KAF Z;  2A9H A;  3ASO C;  4KFM A;  4GZR B;  1SKV A;  1AJP A;  1NH2 D;  2PYL A;  2N04 A;  4JI3 O;  3LUT B;  3OTO B;  1I5Y A;  1OHH G;  2IU3 A;  1WB8 A;  3BCC H;  4O4H B;  2HLD G;  5LGN A;  3ABK C;  4BW5 A;  4GX1 A;  4UB8 Z;  1SC5 B;  4LF5 B;  1X59 A;  1KYO F;  2HR3 A;  2ZIN A;  1K3E A;  4OGQ B;  5FPR A;  3LSQ A;  4R6Z A;  4PV1 B;  2Y0I A;  3QO5 A;  1JA8 A;  1YDX A;  1OZ0 A;  3E22 B;  2DYR B;  4GYC B;  1YTF B;  3JAS A;  3SPH A;  1R6K A;  3T1Y O;  3G80 A;  4UCR A;  1S5L Z;  1XQ8 A;  3A8T A;  3K79 A;  1FFT B;  3JSL A;  2DYS C;  4J7K A;  2HHH O;  3HR0 A;  1JJ2 U;  2A06 H;  4QIW F;  1VQ7 V;  3FAV A;  3E86 A;  1AJQ A;  4FFB A;  3CCR V;  1XL4 A;  1IXB A;  4I55 B;  3VQY A;  5LMU B;  3SPC A;  1QLE C;  2DQ0 A;  1I08 A;  3JAS B;  5B5E Z;  1SS3 A;  2Y4T A;  2YI8 A;  1K9M W;  2CK3 G;  3IJ4 A;  3AG4 B;  2BSK B;  2ADP A;  4UCT A;  2Z5U A;  3K0G A;  2K9P A;  3UO3 A;  3ABM C;  3WG7 C;  5LOV A;  1P4R A;  3X2Q B;  5A2Q N;  3JAL B;  1SQP H;  1FD9 A;  4XDK A;  1TAE A;  4DR4 B;  1RPO A;  3FAV B;  1Q3E A;  4FFB B;  2YID A;  4PEL A;  4EFE A;  1TUE B;  2QJ1 A;  3J81 N;  2YXL A;  3SJQ C;  4MSW C;  1XI1 A;  3D3Q A;  4GKJ B;  3K03 A;  3OTO O;  4YY3 B;  1YJN V;  2IW5 A;  3ZRW A;  4YJ3 A;  2E74 B;  4KUM A;  1Q43 A;  1ZWI C;  2Q4P A;  4B3T B;  4QE7 A;  1CEZ A;  4MVU A;  3E89 A;  1WN7 A;  3RYF A;  2AZ2 A;  1U97 A;  3CS5 A;  3Q4H A;  2WLI B;  3CCU V;  4W4K A;  3JD1 A;  4X8A A;  5BXZ A;  3N2K A;  4E4E A;  4YXW G;  1K4C C;  2XND G;  3E8H A;  2M6Y A;  5JVD A;  4WCE V;  1V55 C;  1YEW A;  2PF4 E;  3ZRW B;  3ASN B;  1ZLZ A;  1K73 W;  1BS3 A;  3HKD A;  2FML A;  4FIP C;  4U7O A;  2DJV A;  1NR1 A;  2EIN C;  2GSM B;  2P22 C;  5EK0 A;  2LQT A;  3U10 A;  4FMT A;  3EFF K;  2HVJ C;  5JVD B;  1YJW V;  4BIU A;  2AXT Z;  1M93 A;  1I94 B;  1M1K W;  1IBK B;  2CTR A;  3HKD B;  1R6N A;  4X20 A;  4JAV A;  1B04 A;  3OUS A;  1F4N A;  5KHK A;  4Q20 A;  1NJI W;  2XUM A;  1S76 D;  1BHA A;  5CB4 A;  1M9N A;  1BL8 A;  1GM9 A;  3ZHR A;  1AR4 A;  4JTA B;  3BPZ A;  5JJE B;  5JH7 A;  1E1Q G;  2BE3 A;  2YI9 A;  1D2D A;  3CC4 V;  5EYP A;  2XAG A;  3W7T A;  5LGT A;  3CXC U;  4DR4 O;  4DV2 B;  2XHB A;  3F5T A;  2UU9 O;  1VQ5 V;  2CGO A;  2QKC A;  4R50 A;  2ODM A;  2O57 A;  3AK1 A;  2ZXW C;  4X20 B;  3FB6 C;  1YF2 A;  2RQ6 A;  4ICG A;  1JFF B;  3OMI B;  2C2A A;  1V9P A;  2Q7H A;  1PNK A;  5GTH Z;  1JQ0 A;  4JV5 B;  4GKJ O;  3OM3 B;  4I4T A;  4LF6 O;  5CBF A;  3G6B A;  5J9P C;  3CRA A;  5HFL A;  3RYH A;  3ZHU A;  1AVM A;  1WPB A;  5EYP B;  4H37 A;  4B3T O;  1S72 V;  4OXS A;  4IIJ A;  4NXN B;  2CE4 A;  4KP4 A;  3RVY A;  2QR4 A;  4A5U B;  2QKS A;  1XEQ A;  4LF4 B;  1N4C A;  2DOS A;  4LFA O;  1OCZ B;  4ABM A;  4QPK A;  4JI1 B;  3UT5 B;  1GM8 A;  3LDE A;  4KHP B;  2Q7G A;  1Q81 W;  1NT2 B;  4DR7 B;  4QPJ A;  2Q5Z A;  4J10 A;  4I4T B;  2CTW A;  3P3P A;  5B1B C;  1NU1 H;  3ETD A;  1QLN A;  4D6T H;  2ZE6 A;  3ZHS A;  1FXV A;  2Y69 B;  3PJS K;  4IIJ B;  2R72 A;  4PJ0 Z;  4UXN A;  4FM1 A;  3JCU Z;  4JYB A;  3WB2 A;  5IJ9 A;  2HJD A;  2F66 C;  1YZB A;  3CP1 A;  1P84 F;  2YUA A;  1NVP D;  2LO1 A;  3RYI A;  3OTF A;  1IBM B;  4CS4 A;  3OGI B;  1OCO C;  5LP6 C;  5ITZ A;  1I94 O;  3EHB B;  4D7S A;  4IT5 A;  4FLX A;  1MSD A;  1MZE A;  2GUZ A;  3AG1 B;  1ARO P;  3CSX A;  1MZF A;  3H01 A;  5E1A C;  2WWW A;  1FXK A;  3VQX A;  1JPX A;  4KXR A;  4DK0 A;  4PA7 A;  4CS3 A;  1G6U A;  2PY5 A;  2FL4 A;  2CUG A;  4LF9 B;  1XIL A;  4ZKI A;  1H8H G;  1VF6 A;  2FYU H;  1AP5 A;  1BQ0 A;  4DV2 O;  2R70 A;  3JYC A;  5ITZ B;  2EIK C;  2YXH A;  4AIL C;  5LHG A;  3A0H Z;  1WAZ A;  1PV0 A;  2GUZ B;  1K5S A;  3ZED A;  1RFY A;  2H94 A;  2Y0P A;  5GON B;  1Z5W A;  1FXK B;  3TCU A;  4JV5 O;  1MNG A;  3AG2 B;  3RT3 C;  4DV5 B;  5E79 Z;  2ZR3 A;  1U96 A;  2ZNI A;  1G8M A;  1D5A A;  4GCZ A;  3SYA A;  5H2F Z;  1SQV H;  1THZ A;  2RN9 A;  4H44 B;  4JI1 O;  1MMM A;  2GHY A;  2XAJ A;  1EN5 A;  5EC1 C;  4KHP O;  2JS3 A;  1NZ6 A;  2ZIO A;  1QNM A;  3CCE V;  4DR7 O;  1F51 A;  1D5N A;  3H9V A;  2CH7 A;  3P3N A;  4WFE A;  5DEC A;  4FLZ A;  4UV9 A;  2YC0 A;  4JF3 A;  4LFC B;  1K4D C;  4ZOL B;  2DYR C;  2LFS A;  1DK1 A;  1F23 A;  1OV9 A;  2QM4 A;  3RVZ A;  3APQ A;  3OE7 G;  2P06 A;  4UCO A;  2YEV A;  4DV3 O;  3N2G B;  1RSO A;  1WA8 A;  2QSA A;  1PKX A;  1GM7 A;  5D5Q A;  1US6 A;  3ZMS A;  1R73 A;  1N32 B;  3E35 A;  1LR1 A;  3H1J H;  3K04 A;  3GVM A;  1A32 A;  1IBM O;  4BIO A;  3E2E A;  3M7M X;  3OFN G;  3STL C;  1TUB A;  4JI5 B;  4WF9 V;  2WLM A;  2JDI G;  5JQG A;  1S3J A;  2RDC A;  4W4L A;  4IGG A;  2QA4 V;  1YTF D;  3IGA C;  2YEV B;  2M7W A;  4HAM A;  5KX5 A;  1SQQ H;  1FJG O;  1AJN A;  1RSO B;  1W0J G;  2F23 A;  2YIB A;  3AG4 C;  1VQL V;  4J42 A;  3FD9 A;  1YSC A;  4PA6 A;  4NXM B;  4QNH B;  3SJC C;  1LUV A;  1S0V A;  2YXY A;  2E75 B;  4PA3 A;  3HKC B;  3X2Q C;  4JTD B;  1Y76 A;  4DV1 B;  1N36 B;  2LP7 A;  3RYC A;  3E8G A;  4NTW A;  3SPJ A;  1SA0 B;  4BW9 A;  1GN4 A;  5LBQ A;  1IDS A;  3M8A A;  4F6E A;  1T5E A;  5KX5 B;  2VQE B;  4DV5 O;  3ABU A;  1VIB A;  3MAQ A;  3JAM N;  2QTS A;  1Q82 W;  4TUY B;  1FPO A;  4HZ3 A;  3CJH B;  1K92 A;  1Y76 B;  3QO7 A;  2RCV A;  2PTM A;  3ML0 A;  5FL7 G;  4I0X A;  2ZM6 O;  4FFK A;  3KCX A;  1SQG A;  2OTL V;  2UXD O;  4B3S B;  4JI4 O;  4EB6 A;  4JI2 O;  2KKW A;  4MTX A;  5BZB A;  4X65 B;  2JK5 C;  1YJ9 V;  3W7S A;  3SJA C;  3ASN C;  1NS1 A;  2QE7 G;  4OX9 O;  4IYI A;  1UJW B;  4FLU A;  1Q90 D;  1PNL A;  2ZKO A;  3W7W A;  1SER A;  1K5Q A;  4H13 B;  3CCM V;  3KKY A;  4I0X B;  4DYL A;  5A9G A;  3ZS8 C;  1N32 O;  4AQY B;  4PHZ A;  3BAA A;  4I9W A;  5CA0 B;  3ZMV A;  4EB6 B;  2W6I G;  2CTQ A;  2UUB O;  3P32 A;  5IYB O;  3QF7 A;  3ETE A;  3I5D A;  3K5L A;  2HJF C;  2GDS A;  4PI0 A;  2A79 B;  3CB2 A;  3C3S A;  5J2T A;  5BMV B;  1H2G A;  2PZS A;  2X0L A;  2A3Q A;  5JWP A;  1XOU A;  1SQF A;  4UVB A;  2LW7 A;  2ZE5 A;  1CPY A;  4LNU B;  2RNB A;  5CA1 A;  4B3M B;  3K08 A;  3LNN A;  4DV1 O;  1IBL B;  2ZQM A;  2YDE A;  1EM1 A;  2ETN A;  5JJN B;  4JI7 O;  2YSU B;  5DM6 V;  5C8Y A;  1RM1 B;  5B1A B;  2AZ0 A;  2ZE7 A;  2VQE O;  5J2T B;  1VQN V;  1QVF U;  4FVM A;  1VQ9 V;  2IJK A;  3CCQ V;  2Q8V A;  5L3B A;  1N0N A;  2Z0A A;  5CA1 B;  3JD0 A;  3TJT A;  4DR6 O;  4MTF A;  3ZMT A;  1OCZ C;  2AHZ A;  4B3S O;  3K59 A;  1AI7 A;  5HFM A;  3K9S A;  4ASU G;  4DV6 B;  1KD1 W;  2X6C A;  1PD3 A;  2Q73 A;  3F5W C;  2ZR2 A;  3TET A;  4X65 O;  1R3J C;  4I5S A;  3B40 A;  1PNM A;  1KUQ A;  1FXH A;  2YIA A;  3O9O A;  2HVK C;  2P4K A;  1W2B U;  3BHP A;  2Y69 C;  5LGU A;  2OWO A;  1Q6I A;  4F6R A;  1EBO A;  4Q6G A;  5KHJ A;  1BCC H;  2UXB B;  3UM7 A;  2F1M A;  4K35 A;  2E5L B;  4AQY O;  2KB1 A;  4LH6 A;  2MW2 B;  3CXH F;  1SZT A;  2WA4 A; 
#chains in the Genus database with same CATH homology
 1V54 C;  2MK3 A;  1KEC A;  3HB3 B;  1COW G;  3K06 A;  3ABT A;  4R50 A;  4EKW A;  3CPW U;  5LHH A;  1NKD A;  2P7T C;  2ZXW C;  3FB6 C;  2WAM A;  3OMI B;  3MD0 A;  4GX5 A;  4P30 A;  3ABL C;  2C2A A;  1P7B A;  1AI5 A;  1RPR A;  4UVC A;  1PNK A;  2D3O W;  1JQ0 A;  1KQS U;  3OM3 B;  4GX2 A;  2DW4 A;  2XAH A;  3AG1 C;  5CBF A;  2WSS G;  5J9P C;  2EIN B;  1BHB A;  2B1G A;  1NR7 A;  2JIZ G;  5HFL A;  2X6B A;  1M57 B;  4CBC A;  5IY5 B;  1K34 A;  5IDJ A;  4H37 A;  3I55 V;  1S72 V;  1QVG U;  4OXS A;  2IJI A;  4KP4 A;  1YHQ V;  2WLN A;  3OMN B;  3RVY A;  1YIT V;  5LHI A;  4HYO A;  3OAA G;  3FB8 C;  2QKS A;  3ZMZ A;  4JGS A;  5L3F A;  2A0L A;  4FJC C;  4BAY A;  2NNU A;  2R9R B;  1OCZ B;  2F43 G;  4JYC A;  1SES A;  4QPK A;  4PA4 A;  2ZDI C;  4WFG A;  1VQ6 V;  4RQF A;  3T2M A;  3T1C A;  1GM8 A;  3ZMU A;  4LBE C;  3I56 V;  3LDE A;  2BOC C;  1Q81 W;  5H9C A;  3IC7 A;  4QPJ A;  4MTO A;  4UV8 A;  1OCR C;  2Q69 A;  5B1B C;  3JD2 A;  3R65 A;  3ETD A;  4X88 A;  5EBW C;  2Q67 A;  1QLN A;  2XAS A;  1FXV A;  1FXK C;  2V7Q G;  2Y69 B;  1LNQ A;  2QTO A;  4P9O A;  1WLE A;  3PJS K;  2EZO A;  3AG2 C;  1GO3 F;  1NQT A;  2Q6A A;  3AG3 B;  3GB7 C;  4RAI A;  3RBZ A;  4UXN A;  2NLJ C;  1ROP A;  4JYB A;  3RW0 A;  3G71 V;  2HG5 C;  5H6Q A;  3CP1 A;  3BY6 A;  3P30 A;  4QJF B;  1NVP D;  3E8B A;  4G27 B;  5L3G A;  1V54 B;  2PI4 A;  2ITC C;  5KA6 A;  1OCO C;  2ZDI A;  2ZXW B;  3E83 A;  2W0F C;  1KP3 A;  2WLK A;  3ABL B;  3F7Y C;  3EHB B;  2DWE C;  4MW3 A;  1R3K C;  4UUJ C;  3AG1 B;  4MW8 A;  2H8P C;  1ARO P;  4RO2 A;  3H01 A;  4P2Z A;  5EBM C;  5E1A C;  3D3I A;  4MT8 A;  2WWW A;  1FXK A;  4WFB V;  1JPX A;  3B8N A;  2B5U A;  1JVM A;  4PA7 A;  2UXX A;  1VQO V;  1K7D A;  4TWK A;  1MSW D;  1K33 A;  4P9P A;  2EJR A;  4ZKI A;  4MVQ A;  5KA5 A;  2BOB C;  1H8H G;  1Q86 W;  3K3W A;  3ZN1 A;  1NVP B;  3SYQ A;  1S77 D;  3JYC A;  5H6R A;  2EIK C;  3LDD A;  1MAB G;  5LHG A;  1F4M A;  1NBM G;  1N8R W;  4E2L A;  4TSF G;  5CN0 A;  1J95 A;  1KP2 A;  1K5S A;  1OCR B;  5B1B B;  1M90 W;  1GKF A;  1FS0 G;  3K9A A;  2H94 A;  2JEU A;  3G4S V;  3M99 B;  3STZ C;  3T4D A;  3OGC C;  1FXK B;  3FKS G;  1QR9 A;  5DN6 G;  3TCU A;  3JD3 A;  3OEE G;  3AG2 B;  3CCJ V;  3MHS C;  4DXW A;  2EIJ C;  3UKM A;  2ZR3 A;  1G8M A;  3MHH C;  2Y48 A;  3CME V;  4F4L A;  2EIL C;  3ZRX A;  1QBZ A;  2V1D A;  4LP8 A;  2R9I A;  5CMU A;  4J9Z B;  3SYO A;  4GCZ A;  4XDL A;  3SYA A;  3SYC A;  2X6A A;  1OCO B;  4R8C A;  5KUK A;  2Q68 A;  2IJH A;  4CZZ A;  1THZ A;  3FYE B;  1KKD A;  3OEH G;  3TK1 A;  2GHY A;  3GWO A;  4MVO A;  4PDM A;  1AR1 B;  5CBG A;  2XAJ A;  3LDC A;  5L3C A;  3F7V C;  4WFH A;  5EC1 C;  1YIJ V;  4WFA V;  3CCL V;  3CCE V;  1F51 A;  1G4Y B;  2JEX A;  2ATK C;  1VQ4 V;  4WFE A;  3CMA V;  4MVS A;  4UV9 A;  3ZJZ A;  2IH1 C;  4JF3 A;  5KUM A;  2WLL A;  4PDL A;  1K4D C;  4X89 A;  2DYR C;  2LFS A;  1AI6 A;  2WLI A;  1F23 A;  3NXS A;  4LC1 A;  4R7C A;  5IYC O;  3RVZ A;  4XBF A;  1DF5 A;  3OE7 G;  2YEV A;  3FB5 C;  1PKX A;  1GM7 A;  1H38 A;  3ZMS A;  1R73 A;  2P67 A;  3B77 A;  1W0K G;  2EIK B;  1SET A;  2Z3Y A;  3E35 A;  4LCU C;  3K04 A;  3OMA B;  4WFF A;  1R3I C;  4J9Y B;  1GK9 A;  1EFR G;  2PI5 A;  3E2E A;  3OFN G;  3STL C;  2A9H A;  4WF9 V;  2WLM A;  2JDI G;  3ASO C;  4KFM A;  5CBH A;  1K8A W;  1AJP A;  1S3J A;  1NH2 D;  2WLL B;  1DF4 A;  3SPG A;  3LUT B;  2QA4 V;  2EIJ B;  1YTF D;  1I5Y A;  1OHH G;  2IU3 A;  2XAQ A;  3QO8 A;  5LGN A;  2HLD G;  2EIM C;  3G6E V;  2IU0 A;  3ABK C;  4BW5 A;  2EIL B;  2YEV B;  2M7W A;  3IGA C;  4HAM A;  4GX1 A;  1AJN A;  3SYP A;  1W0J G;  3T4Z A;  3AG4 C;  1VQL V;  1M56 C;  1YSC A;  4PA6 A;  1ENV A;  4QNH B;  1S0V A;  2HR3 A;  4PA3 A;  1HWY A;  1K3E A;  1WPX A;  3X2Q C;  4JTD B;  1QR8 A;  4GT1 A;  2XAF A;  3LSQ A;  4R6Z A;  3ZRS A;  4RQE A;  1XL6 A;  2LP7 A;  3QO5 A;  2W6J G;  1OCC C;  3E8G A;  3SPJ A;  1OZ0 A;  4TT3 G;  1K97 A;  5EC2 C;  5LBQ A;  1Q7Y W;  1I5X A;  4JPR A;  2DYR B;  1NH2 B;  2UXN A;  1BMF G;  4FPP A;  1YTF B;  1JCH A;  3ABU A;  3LSS A;  1VQM V;  3SPH A;  1R6K A;  1VQK V;  3E8F A;  3JCZ A;  4BIZ A;  3CYO A;  1Q82 W;  3OUF A;  3QNE A;  4MVR A;  3ETG A;  2LFR A;  3K0D A;  3VBB A;  4HZ3 A;  2P6J A;  2WPD G;  4GX0 A;  1K92 A;  3BEH A;  3FYI B;  3K79 A;  3QO7 A;  1FFT B;  2DYS C;  3ML0 A;  4L87 A;  5FL7 G;  1DTO A;  3ZN0 A;  2QM8 A;  3OR7 C;  2B1I A;  4MVZ A;  1JJ2 U;  3ASO B;  4QIW F;  1VQ7 V;  3E86 A;  1AJQ A;  2EZP A;  3CCR V;  1XL4 A;  2OTL V;  4JAS A;  4U7N A;  4MTX A;  5C93 A;  5BZB A;  2FTK A;  2JK5 C;  2EIM B;  3SPC A;  1QLE C;  2DQ0 A;  1YJ9 V;  3ABK B;  1ORQ C;  2EBO A;  3W7S A;  1K9M W;  2CK3 G;  3ASN C;  5B1O A;  2QE7 G;  3AG4 B;  1L1F A;  1RM1 C;  5B1A C;  1UJW B;  2Z5U A;  3CC2 V;  2DWD C;  1M56 B;  4UVA A;  1PNL A;  5B1N A;  3W7W A;  1SER A;  3K0G A;  1K5Q A;  3ABM C;  3WG7 C;  3CCM V;  1P4R A;  3X2Q B;  1SRY A;  1MG1 A;  4XDK A;  1RPO A;  4DO2 A;  1B6Q A;  1OCC B;  2OT5 A;  1VQP V;  4I9W A;  3ZMV A;  2W6I G;  1CP9 A;  4PEL A;  2QEX V;  2IH3 C;  1TUE B;  2WLJ A;  3WFV A;  5L3D A;  2XOK G;  3P32 A;  2AHY A;  4MTG A;  4RUE A;  5IYB O;  3SJQ C;  3ETE A;  4MSW C;  2HJF C;  3K03 A;  1YJN V;  2IW5 A;  3ZRW A;  3B8M A;  3AEI A;  1VQ8 V;  3SPI A;  4PA9 A;  4KUM A;  3ZCC A;  1ZWI C;  2A79 B;  4N23 A;  1KC8 W;  4RUF A;  5B3S C;  1GTO A;  4QE7 A;  1H2G A;  4MVU A;  2ZD9 A;  3E89 A;  3KG2 A;  1CEZ A;  1MOF A;  2DYS B;  1E1R G;  2X0L A;  4PDR A;  2ITD C;  2WLI B;  3CD6 V;  5EBL C;  3CCU V;  3JD1 A;  5L3E A;  2K1E A;  2OCC C;  4UVB A;  1JX9 A;  1CPY A;  4X8A A;  3A0R A;  3IFX A;  3K08 A;  5CA3 A;  4YXW G;  1K4C C;  2XND G;  3E8H A;  4MS2 A;  4XDJ A;  2ZQM A;  4WCE V;  1V55 C;  1QLE B;  4JTC B;  3OR6 C;  3CC7 V;  4ZBM A;  2JJ2 G;  1PL0 A;  3ZRW B;  3ASN B;  5GW7 A;  2YSU B;  5DM6 V;  2IJJ A;  1RM1 B;  5B1A B;  1K73 W;  3ZRV A;  1AI4 A;  4FIP C;  1VQN V;  1QVF U;  4JAU A;  1VQ9 V;  2IJK A;  4FK5 C;  4MVM A;  4U7O A;  3CCQ V;  1NR1 A;  3ABM B;  3WG7 B;  3W7X A;  4Z1M G;  5L3B A;  2EIN C;  2HKO A;  1Y4M A;  2GSM B;  3VOU A;  1M57 C;  5EK0 A;  5IY5 C;  1Y66 A;  4N21 A;  3W7U A;  3CCS V;  2OTJ V;  3JD0 A;  3EFF K;  4FMT A;  4QE9 A;  5IYD O;  2HVJ C;  3DTU B;  2JJ1 G;  1GMG A;  3LNM B;  3FB7 C;  4MTF A;  1YJW V;  4BIU A;  3ZIA G;  3ZMT A;  1YI2 V;  1OCZ C;  2X7R B;  2AHZ A;  1AI7 A;  1E79 G;  5HFM A;  1M1K W;  2DQ3 A;  3D36 A;  4G2K A;  4ASU G;  2X6C A;  1KD1 W;  1PD3 A;  1JOY A;  3F5W C;  1R6N A;  2ZR2 A;  3JD4 A;  3TET A;  1S5H C;  1R3J C;  4PDV A;  3OUS A;  1IXM A;  4I5S A;  1F4N A;  4JAV A;  4Q20 A;  1PNM A;  1NJI W;  1S76 D;  1BHA A;  1QCE A;  1FXH A;  1EZJ A;  5B3S B;  1M9N A;  2HVK C;  1BL8 A;  1GM9 A;  1W2B U;  1R3L C;  1H8E G;  2HFE C;  2Y69 C;  5LGU A;  4JTA B;  2QM7 A;  1EBO A;  4G28 B;  2OCC B;  3AG3 C;  1E1Q G;  3DGE A;  3HPL C;  3UM7 A;  3CC4 V;  3CCV V;  2XAG A;  1DLB A;  5LGT A;  3W7T A;  3CXC U;  2KB1 A;  2WLH A;  4H33 A;  1V55 B;  1VQ5 V;  2P90 A;  3OW2 U;  1SZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...