2ITDC

Potassium channel kcsa-fab complex in barium chloride
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
103
structure length
103
Chain Sequence
b'SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab fragment heavy chain
publication title Structural and Thermodynamic Properties of Selective Ion Binding in a K(+) Channel.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 40
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2itdC00
1K4DC 1OCCC 4X89A 4ZBMA 3STZC 2Q68A 4RUEA 2WLKA 4LBEC 3SYPA 1S5HC 1G4YB 2AHZA 3K08A 5B1AC 4XDJA 3SPHA 2BOBC 2EIMC 2X6BA 5EBLC 2ITCC 4PA3A 3GB7C 4X88A 4LCUC 3E8GA 3X2QC 2P7TC 3ABLC 3SPIA 3E8FA 2EINC 4MVRA 1J95A 2DWEC 3K0GA 4WFGA 3T2MA 4DXWA 3E8BA 4P9PA 1LNQA 4BW5A 3RVZA 3E86A 2ATKC 1XL6A 3UKMA 4WFHA 2A0LA 4RAIA 3E83A 1P7BA 4QE7A 5EBWC 4HYOA 4X8AA 2JK5C 1BL8A 3BEHA 4I9WA 2Y69C 3FB7C 4P30A 4PA7A 4PDMA 4R7CA 5EK0A 4H37A 3FB8C 1R3IC 3IFXA 3JYCA 4G28B 3FB5C 2WLLA 1R3LC 2ZD9A 2W0FC 4RUFA 3UM7A 4MTFA 2A9HA 2Q67A 4PDLA 4QE9A 4GX2A 4MW8A 4R8CA 1M56C 4GX0A 3SPCA 2AHYA 3RBZA 4F4LA 2Q6AA 3SJQC 2KB1A 2HVKC 2QKSA 3R65A 1KKDA 2HJFC 4H33A 5EBMC 2HG5C 4R6ZA 3VOUA 2Q69A 1V54C 4MVZA 4EKWA 2K1EA 4PA6A 4MSWC 2WLHA 3RW0A 2IH3C 4PDVA 1XL4A 3FB6C 5E1AC 4J9YB 2BOCC 1QLEC 1M57C 3OUSA 3F7VC 1OCRC 3AG2C 3HPLC 2EILC 3AG3C 4MVSA 4MVQA 2R9RB 2WLJA 2ITDC 5CBHA 3OR7C 2X6AA 3SPJA 3SYAA 3AG1C 3LDEA 3K06A 5J9PC 5EC2C 5CBGA 1JVMA 4MW3A 2WLIB 4MTGA 2EIJC 3SYCA 4OXSA 3KG2A 4MVUA 4XDKA 5KUKA 1ZWIC 4CBCA 2H8PC 4MS2A 5EC1C 2IH1C 1V55C 3K0DA 3ASOC 3E89A 3EFFK 3F5WC 3F7YC 3K04A 3OR6C 4JTDB 4RO2A 2X6CA 3LDDA 3PJSK 4WFFA 2OCCC 4MTOA 4PA4A 1OCOC 1OCZC 2NLJC 4P9OA 2WLMA 3TETA 3STLC 5CBFA 4PDRA 4GX1A 2DYRC 4MVMA 3ABMC 3SYQA 4GX5A 4QNHB 2ZXWC 3ABKC 5B3SC 2DYSC 1R3JC 3IGAC 4MVOA 2HFEC 3T4DA 2HVJC 3AG4C 3TCUA 4JTCB 3K03A 3LDCA 5KUMA 3RVYA 4JTAB 4UUJC 2EIKC 2DWDC 4LP8A 3OGCC 3ASNC 2WLIA 4KFMA 3SPGA 2YEVA 1R3KC 3LNMB 5B1BC 3WG7C 3OUFA 5IY5C 2A79B 1K4CC 4HZ3A 2WLNA 4P2ZA 3ZJZA 3LUTB 4TWKA 4R50A 3T1CA 5BZBA 4G27B 2WLLB 4WFEA 3ZRSA 1ORQC 3T4ZA 4XDLA 3SYOA 4PA9A 2QTOA 3E8HA 4J9ZB
chains in the Genus database with same CATH superfamily
3I55V 1KKCA 4X1KB 3LSQA 1GN4A 4PA3A 3OMIB 4I50A 2P7TC 2UXBB 4GYCB 1J95A 1XNQO 1LUWA 1ZX3A 3C3SA 1US6A 3DSQA 1XL6A 4WFHA 1Z5VA 1NVPB 1P7BA 5AG2A 3IAYA 4DV7B 3CYOA 2W0FC 3HB3B 3CPWU 2DN9A 3ZHQA 2QKAA 3K9SA 3SJQC 2KB1A 1JX9A 1JJ2U 4B3MB 2HG5C 4DR7O 4E4EA 1N0JA 2K1EA 1EBOA 2QGNA 1XI1A 3APQA 3ASOB 2ZQMA 2BOCC 4JI3B 1GK9A 2OT5A 1R6KA 2JGUA 4A5UB 4MVSA 1AI5A 5LA6B 4DV0B 1UFIA 4EB6B 1OJHA 5J9PC 1JVMA 3ABMB 4X65B 2PUSA 4MVUA 5KUKA 1FXHA 3ASOC 3D3IA 5JH7A 1T5EA 1UPGA 4YHHO 2YICA 4NB5A 5CBFA 2YIDA 3ABMC 1QR8A 1Y6XA 3U0ZA 2QTSA 4AQYO 2OIGA 5CA1A 3AG7A 3JD2A 1H2KA 4TUYA 1N34O 3LDCA 5HFMA 1RFYA 4LF9O 3RT3C 1RPOA 4LP8A 1Z5WA 3OUFA 1S5LZ 4IT5A 3T1CA 2WWWA 4LF7O 3CJHA 1LR1A 4XDLA 2BCCH 4Z1MG 5D5QA 4DV1O 3ICXA 1K7DA 4LWSA 1SQVH 3CSXA 2F4VB 1KB9F 3UT5A 2UU9O 2GTAA 1B6QA 3CP1A 1Q8IA 5KAIZ 2RNBA 1XUQA 1AP6A 1Y4MA 2GDSA 2DWEC 4DXWA 1XBLA 1YF2A 2PYLA 3ZEDA 3S3XA 2JK5C 1BL8A 3MHHC 4I9WA 1HR0O 3CX5F 1ZL8A 4JI0B 1N32B 1K97A 5LBQA 3I56V 5DEDA 2X0LA 2YI9A 1ZSPA 1QLEB 1XHZA 2L35A 1GM7A 3AG2B 4JI1O 5JH7B 1QLNA 2EJ7A 1H2NA 2QKSA 4DV6B 4I7ZB 4FLUA 4PHZA 4Z2WA 4PDVA 4U7OA 3WB0A 5B5EZ 2RDCA 5KHIA 3T1HB 1HNZB 5CA1B 1QLEC 1CP9A 3AG2C 4C7UA 4JF3A 4TUYB 3K79A 3ZHTA 3G4SV 3U10A 3FFQA 3ZHVA 1P84F 2ZE6A 4DR4B 2Q7GA 3SYCA 4B3TO 4O4IA 3JAKA 1XMOO 4X62O 2UXCB 2R70A 2EIKB 4X66O 4LWSB 3UT5B 4FFBA 4DR5O 3EXAA 1KD1W 2V7QG 4I9QA 1GM8A 2G38A 3K5NA 1Q6IA 5KHHA 3BCCH 5IYZA 4DV4O 4X9QA 2EIKC 2ZCEA 4KP4A 4U7NA 2LW1A 2EIMB 1NBMG 3ETQA 1ZL8B 4LH7A 1B04A 2PTMA 3H1KH 4DYLA 3ZRSA 3ZRWA 2LP7A 4HBNA 5LMUB 1K5SA 1BGYH 4JI2B 4DUYB 1FJGO 3K08A 2EIMC 3GB7C 4FM0A 4K0KO 2EZPA 1N0NA 1YITV 1I5YA 2IJJA 3L72H 4FPPA 1SQXH 1R1BA 1MNGA 2LJ2A 1R3IC 4E2LA 4TQFA 2WLLA 5BY1A 3K57A 4O4IB 3UM7A 3JAKB 2Q0OC 5LL6Y 3JD3A 1Q90D 4UCOA 3K59A 3UO3A 2IM9A 4BR6A 4GX0A 3AG3B 2HVKC 4ZOLA 2Q69A 1VP7A 4WCEV 4JI5B 1WB8A 4FFBB 4GKKO 5A9GA 3FB6C 5CB4A 4DO2A 4L87A 1OZ0A 3AG3C 5IYZB 1E1RG 1TVKA 4D7TA 4OPHA 1Q43A 2C2AA 3IJ4A 2ZXWB 3ZCCA 5EC1C 2BSKA 1H8EG 4NVPA 4MTOA 3ZRWB 3T1YO 3GWKC 2ZE7A 2OTLV 1EN4A 4IYIA 2HHHB 2ZXWC 1Y67A 3CWBH 4KUMA 1AI4A 1XNRO 3CE2A 3A8TA 3RYCA 4YHHB 3IC9A 4DUZB 3TJTA 4UVCA 3IC7A 3ZN1A 1YHQV 2OYQA 4TT3G 1J5EO 2JRIA 2WLLB 2EINB 5JVDB 3U11A 2JVDA 1N34B 3RYIA 3CCSV 4FFKA 5DECA 1G4YB 3SYPA 4XDJA 1M93A 4O2BA 1NJIW 4ZOLB 4LF6B 2LQTA 2EINC 3T2MA 2RMKB 4DV3O 2D2CB 3RVZA 5CB4B 3UKMA 4DV5B 2QJ1A 3DGEA 3E83A 4PJ0Z 1IX9A 3K5OA 3QO5A 5D5PA 3QVNA 2ZD9A 3LSUA 1Q82W 2YDEA 2Q67A 4YY3O 2BSKB 3AEIA 4JI8B 4DR6O 2X7RB 1R6TA 2UXDO 5KHGA 2Y0IA 2F43G 4MT8A 1F4NA 2XAHA 3SGIA 1KBHA 4GKJO 3JARA 3RYCB 3ZBHA 1JMKC 1VF5B 4JYAO 2VS0A 1IURA 1XREA 1ZWIC 4X1YA 2XUMA 1XDCA 1M9NA 2Q8VA 1URFA 2X6CA 2YIAA 4JI6O 4TV8A 1M90W 3RYIB 1QVGU 4RWUA 3O65A 4KHPB 4MVMA 3S3WA 4O2BB 3K3WA 4UB8Z 3CCEV 5EZYA 1AROP 4YXWG 3T4DA 1XMOB 3CXCU 5L3GA 4DK1A 1YTFB 5H9CA 3B09A 2YC0A 4X66B 2DWDC 2P6JA 1GMGA 2Q5ZA 5DN6G 2B9ZA 3DC6A 1SF9A 3SYOA 2ZM6O 1H38A 4DV4B 3Q4HA 5LHIA 1IBLO 2WSSG 2O57A 2Q68A 4GT1A 4B3RO 1YI2V 2Y69B 4F6EA 2BOBC 1SRYA 3E8FA 2HR3A 4WFGA 1VEWA 3J80N 1EN5A 1YEWA 1WAZA 1EZJA 2CE4A 1SQBH 1FJGB 4HYOA 1PNLA 3JARB 1TAEA 2Y69C 1VQOV 2QR4A 4K0KB 4CH3A 1HNWO 4JV5O 4ZIBA 1WN7A 3SJCC 4GX2A 2DOSA 4TV8B 1D5NA 1MZEA 3ZIAG 2FKXA 1YCIA 1AILA 4LFCO 2HJDA 1NT2B 2GHYA 5LGTA 5EZYB 3DXRA 2HKOA 2OCCB 3WFVA 1OCZB 2VWJA 3AG1C 2UUCB 2ZIMA 4GKKB 4D7SA 4W4KA 3ABKB 4XDKA 4J11A 5H6RA 1VQ6V 3ZHRA 3ZMTA 4YJ2A 4LNUA 1AR1B 3SPCA 2OCCC 1NVPD 3BY6A 1OCZC 3AG4B 2FL4A 3ZS8C 3Q4HB 4TQDA 4NXNO 3GVMA 3LNNA 1VF7A 1G8MA 3ABKC 2CGOA 1B06A 3VQYA 2HVJC 3AG4C 1IBMB 4UCVA 3H1IH 2LGQA 2WLIA 1SESA 3SPGA 2KQXA 3RGBA 5BZBA 1Q7YW 3BFRA 3C3TA 1GO3F 4LF5O 5CA0A 1ORQC 2LFSA 1HDJA 1AJNA 2M7WA 1K4DC 4UVAA 2HEPA 4JASA 2ITCC 2Q0AA 2AZ2A 5KMGA 1CXZB 4BAYA 3A0HZ 3MAQA 1ROPA 4IGGA 2ATKC 5IWAB 1YIJV 3DXRB 3P30A 4QE7A 2GSMB 1VQ4V 3CCUV 1BMFG 4HNAA 1HP8A 4DV3B 1BHBA 1RP3B 2YXHA 5CMUA 2CTPA 4YJ2B 4LNUB 4QJFB 1H2MA 3E2EA 4DR3O 2V4DA 4CH4A 4R6ZA 1Q81W 2XHBA 4AILC 3RW0A 4J41A 2YIBA 4MVQA 1XMQO 3UCSC 5EC2C 5C93A 2WLIB 2UXDB 2DQ0A 4UCTA 1I94O 2DE0X 1THZA 1Q6UA 4YJ3A 5CA0B 2K9PA 4JAVA 2MW2B 5IJ9A 3CCMV 4EFEA 4JYAB 2FMLA 3ZMVA 4Q6GA 4PD4F 3SJAC 1AVMA 4PELA 5KMGB 2Y0PA 1NH2D 3TCUA 2KKWA 4NXMO 5GW7A 1TGOA 5LMNO 4KFMA 5BR8O 4J7KA 1DLBA 4R50A 3CCVV 2ZE5A 4HNAB 2XNDG 1S72V 3T4ZA 2UUBB 1MMMA 5LHGA 1FKAO 4JI4B 2P5OA 2E76B 1QHTA 1KQSU 1WA8A 5E79Z 4I50B 4MTXA 3G6BA 3SPHA 2BE3A 4LCUC 3JD4A 3CRCA 1DF5A 1BE3H 3ABTA 3KKYA 2UUAO 4LFBB 4BW5A 1SS3A 2A0LA 2V1DA 1PL0A 2YXYA 3JAMN 3ETEA 5EBWC 4LF8O 4B3RB 4PA7A 5EIBC 1RPRA 5K1XA 5IT9N 5KLVH 4PDLA 4YJ3B 3OEEG 1NR7A 5IJ9B 1FPOA 2IJHA 1B3QA 3RN4A 4EKWA 1WPBA 2QEXV 4JV5B 4NR1A 1Y74A 5ITZA 3ZRVA 3RYFA 1XOUA 4NYKA 2QA4V 3HKEA 2CK3G 5LHHA 4ZI7A 3OTOO 1NH2B 1S77D 3JAWA 3CMAV 3CS5A 2CTWA 1K33A 2YI8A 2NNUA 1WA8B 3ZRXA 3L74H 4NTWA 2QWPB 4UCRA 1JA8A 2JEUA 1YXBA 1MOFA 2IU3A 1I08A 2E75B 4IIJA 2M6YA 1I7FA 1U97A 3MHSC 4UUJC 2E5LB 4JI7B 3BVOA 1MSWD 5B1AB 2P4VA 3CJHB 1H2SB 4WFAV 3E22A 5EYPA 3VQXA 2R72A 3W7WA 3E8HA 3A0BZ 3CMEV 4JPRA 5FNVA 1BSMA 3D3QA 5B1AC 5H2FZ 5K1PA 1SQGA 2HLDG 3E8GA 3SDLA 3WB2A 4PV1B 3N2GA 5KX5A 2VQFB 4LF4B 2Q7EA 4OGQB 4DV2O 1Y74B 5ITZB 4CH5A 3RYFB 4DR1O 2W0XA 1IDSA 3HKEB 3JALA 3P3PA 1VQ9V 2ZT9B 4ZI7B 4B08A 4BWAA 3JAWB 2XOKG 4BW9A 3SJBC 1ZLZA 3B8NA 4PA6A 1V9PA 1GH6A 2IH3C 1VQLV 1OHHG 2ILMA 4B3SO 1M4UA 5B1BB 1BCCH 4IIJB 3MD0A 3OUSA 4QGPA 2D3OW 3KCYA 5IYCO 5H6QA 4H0LB 4DR3B 1XNQB 1AJQA 3OD4A 4CBCA 3FYEB 4MS2A 3E22B 1NTKH 5EYPB 2IJIA 2JS5A 4RQFA 4PA4A 4DR2O 1I0HA 3ASNB 5FNVB 3JASA 1L0NH 4QNHB 2PI5A 2CTRA 3RWRD 2P06A 3N2GB 5KX5B 3K5LA 4DR7B 5KUMA 3AK3A 4EEQA 4FMTA 3ASNC 3CCLV 4JAUA 3JALB 1NKDA 4P2ZA 1ZTEA 3ZJZA 4I0XA 2XT9A 1MABG 2N04A 5FPOA 3TK1A 2Q9LA 3JCZA 1N36O 4PA9A 3BHPA 3OE7G 4K35A 4PI0A 1YJNV 2QM7A 4ZBMA 3H9VA 2IU0A 1N33O 2EULA 2ZE8A 4X88A 5F2VO 1MG1A 4FVMA 2P67A 3W7XA 1PNMA 4AQYB 4R7CA 2HP8A 5EK0A 2P4KA 5KA6A 3HKDA 3B4SA 2ZR3A 4LF9B 2F23A 4JYBA 1QQCA 2E3CA 1YTFD 2VWKA 2OCHA 4LF8B 2EILB 3RFRA 5LGNA 2HJFC 4LF7B 1SZXA 4DV1B 2EIJB 3JASB 2WLHA 4TSFG 4FM1A 5L3FA 1M5IA 5E1AC 2UU9B 4J9YB 4UCSA 1GAXA 1TVKB 2EILC 2WLJA 2WA3A 2X6AA 1AB3A 1GN6A 3SYAA 5FLXN 1GKFA 3CHXA 3OFNG 4GUNA 2EIJC 2Q73A 1E79G 3KG2A 2DYSB 4I0XB 4BIUA 3NXSA 4LH6A 3F7YC 3E89A 1HR0B 3WU2Z 3B77A 3K04A 4I4TA 3LDDA 2QM4A 1JQ0A 1YZBA 1D2DA 4OPAA 3O9OA 2L6LA 3BAAA 4GX5A 3N2KA 1QVFU 3OTOB 4JI1B 1FFTB 2DYSC 1R3JC 2EZOA 4MVOA 3KCXA 1JR9A 2DMXA 4JTCB 4DV7O 2Q7HA 1OCCB 2ZDIA 3OGCC 1NQTA 1VQMV 2OTJV 4H44B 3HKDB 4J42A 4ABMA 2ZIOA 4B3MO 2AXTZ 2KG7A 1JOYA 1FXVA 1H2LA 1UJWB 4B3TB 1OCCC 1Y76A 1S5HC 5EBLC 1GRJA 3HKCA 5JCOA 4X62B 4DV0O 4MVRA 3K0GA 1AR5A 3B2EE 3E8BA 4FLYA 2QWOB 1KP3A 4X65O 4DR5B 1NI8A 3L75H 3C90A 4G28B 2KSDA 5B1NA 3CXHF 1QBZA 2YSUB 4K8XA 1BS3A 3CEIA 1SERA 1IVSA 4R8CA 4I4TB 1M1KW 1IZ3A 1ZAUA 3VOUA 5GTHZ 5IDJA 1EM1A 3G71V 4FLWA 4K8ZA 3ZX6A 3N2KB 4F6RA 1SKVA 3WG7B 2W6JG 2PGGA 2IW5A 1FXKA 1NTZH 5FPRA 1F23A 2CTQA 2R9RB 2RN9A 3G67A 4FZ0A 5IYBO 5BXZA 3LDEA 4X1YB 3L71H 4MTGA 5J2UA 1AI7A 2F4VO 3UQ8A 4WFFA 3BA9A 4CH6A 2ADQB 2KG7B 3CRRA 2GBOA 1PM9A 2ZDIC 1Y76B 3SYQA 3A2FA 3JD1A 5IY5B 1YDXA 4IHJA 3HKCB 3QTCA 2HFEC 4LFAO 4JI0O 2YXLA 1QNMA 3FX7A 3RVYA 2CUGA 4DW0A 4J80A 4Q20A 5IY5C 2A79B 1JCHA 2WLNA 2LGWA 5JCOC 1HWYA 3UO2A 4DV6O 1VQKV 3D36A 2ZNJA 1PNKA 3STZC 3T1HO 2AHZA 2R9AA 2W6IG 2B1GA 2PZSA 3T1YB 1H2GA 1F4MA 2ODMA 3SPIA 2FB5A 1WP7A 4F6RB 4I5SA 1N36B 3OGIB 1COWG 1K5QA 3BPZA 4DR4O 1VF6A 4IYHA 1W0JG 1FXKB 4U3JA 3EVKA 1N33B 5KHKA 1AJPA 1XNRB 3EHBB 3FB7C 1XEQA 3JYCA 4B7KA 3FB5C 4G2KA 2UXCO 4UFZA 5J2UB 4CZZA 1SC5B 3CCQV 4QE9A 1YJWV 1FXKC 1J5EB 3H01A 5EBMC 1KC8W 2Y4UA 3H1HH 1S5JA 3I5DA 2YUAA 2H3OA 3L70H 1XL4A 4N23A 4IHJB 3P32A 4O2AA 1GN2A 2QWQB 2F95B 2MK3A 3HPLC 1TA8A 4UCUA 5EIBD 2ITDC 5CBHA 5CBGA 1NZ6A 4OXSA 3W7TA 5B3SB 4DUYO 1VQNV 3EFFK 4L8JA 4W4LA 1SETA 2QE7G 4P9OA 2A06H 2YIBD 4KXRA 4FK5C 2FYUH 4PDRA 4YY3B 3ZMUA 1MA1A 3JD0A 1K9MW 5LP6A 3K9AA 5B3SC 1VARA 3L9DA 4UB6Z 3PN1A 4DR6B 4NTYA 4UXNA 2OWOA 4TOIA 3N27A 3K03A 5DM6V 3RYHA 3D36C 1GTOA 4U3JB 2QWRB 1VQPV 3F5TA 2GUZA 1R3KC 1ENVA 4GKJB 3JCUZ 1AP5A 4J9ZB 1WNSA 3WB1A 5J2TA 1KECA 1VF6C 4JI5O 3JATA 2IJKA 3B8MA 1FS0G 1FYJA 2XAGA 1QCEA 3HKBA 4JI6B 4EFBA 3OT7A 4LR3A 1MZFA 5KAFZ 4O2AB 1F51A 3VQVA 2IBZH 1ZUQA 1M56B 1PP9H 2FTKA 3BEHA 1OV9A 4H37A 3DC5A 1QU7A 4RQEA 2E74B 1BHAA 1KMIZ 1R6NA 3ZN0A 4MTFA 1O9HA 2A9HA 2LW7A 4K3AA 2HHHO 2ZNIA 1AR4A 3CD6V 1PL4A 2N74A 1M56C 1OCRB 1P49A 1K92A 3QO8A 3RBZA 4JZGA 1KKDA 4FLTA 3CRQA 1P7GA 1IBKO 1LUVA 2ZM6B 2XTAA 1W2BU 4MSWC 1IBLB 5LP6B 1PPJH 4DUZO 4FM2A 5C8YA 1SA0A 1OCRC 2QWNB 3RYHB 1SQPH 4U3FH 3OR7C 2GV9A 4JYYA 3APOA 2DYRB 1YSCA 4MW3A 2N05A 2GUZB 4HAMA 2XASA 5LP6C 3G6EV 5IJ0A 2IH1C 1JFFA 3ABUA 3H1LH 3PJSK 5GONA 2ZR2A 4LF6O 3SR2C 3CRAA 2NN4A 5J2TB 3OW2U 1D5AA 3JATB 4NTXA 5GTIZ 1HNWB 2DYRC 3BABA 4DV5O 4JAAA 3G80A 2LFRA 3HKBB 1NU1H 5LGUA 1SQQH 3L73H 3J7AU 3BA8A 5B1OA 4CS2A 4LFCB 1K8AW 4ZKIA 4O4HA 1L0LH 4HZ3A 4G27B 4WFEA 2ARHA 4JI8O 4LFAB 3GWOA 3VQWA 1CPYA 5L3DA 3FYIB 4X89A 3DTUB 1Q5OA 4GZRB 1XHXA 1R73A 3P3NA 1XQ8A 3W7UA 2OIEA 2BTQA 4NXNB 3QF7A 1E1QG 2CAZC 5C8YB 1EFRG 1SA0B 2UXXA 5L3BA 1VQ5V 5JJNB 1KP2A 3IFXA 1CEZA 1Z2GA 2RQ6A 2BTOA 3FKSG 5IJ0B 4KHPO 2JIZG 3THOA 1M57B 1JFFB 3KZIZ 2AHYA 4F4LA 5GONB 4LF5B 2P90A 2DQ3A 2EX3A 5CA3A 5LOVA 4ASUG 3ZMZA 1M57C 1IXMA 5H5NA 2F93B 1BQ0A 5A2QN 1K34A 3CCRV 4B7EA 1WP8A 2VRZA 4O4HB 4X1IA 1N8RW 2ADPA 2ETNA 1BZKA 4J10A 2H8PC 4TV9A 1TUEB 4JTDB 1VQ7V 3TETA 2CDYA 3D8CA 3M99B 3QO7A 1FFXA 2Q4PA 4GX1A 4XBFA 2WAMA 3JSLA 5IE9A 4X64O 2BTQB 3W7SA 2R9IA 4JYCA 1NTMH 1HNXO 5B1BC 2UXNA 4LC1A 4QPKA 3OM3B 3M8AA 3NR7A 4BIOA 1EZVH 1XMQB 5JVDA 2WA4A 1I94B 4FJCC 2PY5A 5JJJB 4FLZA 3J81N 2AZ0A 2F66C 2JGDA 2X6BA 3HR0A 1DGSA 5JWPA 2PYJA 5B66Z 1K73W 5LOVB 1RSOA 1H8HG 1LNQA 2UUCO 4RAIA 3A0RA 3CC2V 3FB8C 4O4JA 1P4RA 1FAFA 4NXMB 4X1IB 5CN0A 1R3LC 1HW7A 1S0VA 4RUFA 2VQEO 2QM8A 3ETDA 1XILA 5LMNB 4TV9B 5BR8B 3OAAG 2NR5A 1L8DA 4H33A 1FFXB 1IBMO 5LXTA 4OX9O 1S76D 5LYJA 1OCOB 4WF9V 3OEHG 4AI8A 1IBKB 3SPJA 2UUAB 1JPXA 3K06A 4WFBV 4X20A 4O4LA 1W0KG 3OTFA 4DRXA 2Z3YA 1OCOC 2NLJC 5L3EA 4CS3A 2WPDG 2RCVA 1G1XB 1K3EA 4UV9A 5IWAO 1JJOA 3CC7V 2JGDB 2Y48A 2CGNA 3IGAC 2H94A 1KYOF 3CCJV 1RSOB 4H13B 3QNEA 1RM1B 1VMGA 2A7WA 2QKCA 2YEVA 3LNMB 1K4CC 2YS8A 4O4JB 3X2QB 3ABLB 2JS3A 2UXBO 1A32A 4FLXA 2QTOA 3CRMA 3LSSA 2QDOA 1RM1C 4RUEA 3OMNB 3H1JH 4J7JA 4QIWF 3E35A 5JQGA 4D6TH 3CB2A 3X2QC 3MDSA 3ABLC 4FIPC 3B40A 3VBBA 5LXTB 4P9PA 4NKGB 4DW1A 1X59A 2RJZA 5LYJB 2DW4A 3OMAB 1Y66A 3TXQA 2QSAA 4PDMA 1V54B 3JSNA 4IL6Z 1F7YA 4X20B 2JJ1G 1WB7A 1EN6A 4O4LB 4MW8A 4JI3O 4DRXB 3TGUH 2Q6AA 2CH7A 2Y4TA 4AHCA 3R65A 1BQZA 1V54C 5IYDO 2DJVA 1V55B 5BMVA 3F7VC 1BT8A 1GN3A 3M7MX 2UUBO 4GCZA 3QG5A 4DV2B 4JI4O 2YEVB 4DR1B 1W59A 1V55C 1AI6A 4RO2A 2AW9A 3AK2A 3STLC 1WLEA 4I55A 4LFBO 2JEXA 5JQGB 1IXBA 1NS1A 1DF4A 4J7ZA 2PI4A 2Z5UA 3AK1A 4JTAB 4B3SB 2LO1A 3WG7C 5TISZ 1G6UA 2B1IA 2A3QA 3LUTB 4X64B 2GTSA 2XAJA 2XAFA 4DK0A 5FL7G 5L3CA 1I5XA 1DK1A 4N21A 4WBNA 2WLKA 4LBEC 1HNXB 2CH7B 4JZ2A 1NR1A 1WJZA 2ZINA 1WPXA 5HFLA 1N32O 4ZHQA 1TUBA 4DR2B 3ZHSA 2EBOA 3AG1B 1QR9A 2EJRA 1PV0A 3E86A 3FAVA 3R66A 2B5UA 4FZ1A 5BMVB 2JDIG 1X4TA 4X8AA 4P30A 1YJ9V 1DTOA 1Q6HA 4KL1A 2ZKOA 3ML0A 1HNZO 2AGAA 1SQFA 4Z1VA 1MSDA 3ZMSA 4X1KA 4CC6A 2PF4E 4BIZA 4I55B 1O9GA 4MVZA 5JJEB 1L1FA 2VQEB 2E5LO 1N4CA 4JI7O 3K58A 2XAQA 4CS4A 1PKXA 1S3JA 1Q3EA 4YIPA 3TXSA 3ZHUA 3BRCA 3ETGA 4OX9B 1VQ8V 3K0DA 3F5WC 3OR6C 2F1MA 3CC4V 2WLMA 1KUQA 1FD9A 4QPJA 2VQFO 4LF4O 4UVBA 1VIBA 1KU9A 4WBNB 1PD3A 5KA5A 1U96A 2Z0AA 4ZHQB 4UV8A 1TUBB 5KHJA 4ICGA 5LA6A 3FAVB 4EB6A 5LMUO 1SZTA 4YIOA 1YVWA 4JI2O 2P22C 4PI2A 4CC5A 4TWKA 3K5MA 3FD9A 1GM9A 4FLVA 2JJ2G 1Q86W 4GLXA 4JGSA
chains in the Genus database with same CATH topology
2QM7A 4X89A 2WSSG 4ZBMA 2Q68A 3DTUB 4GT1A 3I55V 2IU0A 1YI2V 2Y69B 1R73A 3LSQA 2BOBC 4PA3A 3OMIB 4X88A 2P7TC 1SRYA 3E8FA 1MG1A 2HR3A 1J95A 4WFGA 3W7UA 1EZJA 1E1QG 1XL6A 2P67A 4WFHA 1NVPB 1EFRG 1P7BA 2UXXA 5L3BA 1PNMA 3W7XA 4HYOA 1VQ5V 1PNLA 4R7CA 1VQOV 2Y69C 5EK0A 1KP2A 3IFXA 5KA6A 1CEZA 2ZR3A 3FKSG 3CYOA 2W0FC 3HB3B 3CPWU 4JYBA 2JIZG 1YTFD 1M57B 4GX2A 2AHYA 2EILB 5LGNA 4F4LA 3SJQC 2KB1A 1JX9A 1JJ2U 2HJFC 2P90A 3ZIAG 2HG5C 2DQ3A 2K1EA 2EIJB 5CA3A 1EBOA 2WLHA 4TSFG 4ASUG 5L3FA 3ZMZA 5E1AC 2GHYA 3ASOB 2ZQMA 4J9YB 2BOCC 5LGTA 1M57C 2HKOA 1IXMA 2OCCB 1GK9A 2OT5A 1OCZB 1R6KA 3WFVA 2EILC 4MVSA 1AI5A 1K34A 3CCRV 2WLJA 2X6AA 3SYAA 3AG1C 5J9PC 1GKFA 3OFNG 1JVMA 3ABMB 1N8RW 2EIJC 1E79G 3ABKB 3KG2A 4MVUA 4XDKA 5KUKA 2DYSB 4BIUA 5H6RA 1VQ6V 2H8PC 1FXHA 3NXSA 3ZMTA 3ASOC 3E89A 3D3IA 1TUEB 3B77A 3F7YC 3K04A 4JTDB 1AR1B 1VQ7V 3LDDA 3SPCA 2OCCC 1NVPD 3BY6A 1OCZC 3AG4B 3TETA 1JQ0A 3M99B 3QO7A 5CBFA 4GX1A 4XBFA 3ABMC 1QR8A 2WAMA 1G8MA 4GX5A 1YJNV 1QVFU 3ABKC 1FFTB 2DYSC 1R3JC 2EZOA 4MVOA 2HVJC 3JD2A 3AG4C 4JTCB 3LDCA 5HFMA 3W7SA 2R9IA 1OCCB 2ZDIA 4JYCA 1RPOA 3OGCC 4LP8A 2WLIA 1SESA 3SPGA 1NQTA 5B1BC 3OUFA 1VQMV 2UXNA 2OTJV 4LC1A 4QPKA 3T1CA 5BZBA 1Q7YW 1GO3F 3OM3B 2WWWA 1ORQC 2LFSA 4XDLA 1JOYA 1AJNA 1FXVA 4Z1MG 2M7WA 1K7DA 1UJWB 1K4DC 1OCCC 4FJCC 4UVAA 1S5HC 1B6QA 2X6BA 3CP1A 4JASA 2ITCC 5EBLC 4MVRA 1Y4MA 1K73W 2DWEC 3K0GA 4BAYA 4DXWA 1ROPA 3E8BA 1H8HG 1LNQA 2ATKC 1KP3A 4RAIA 1YIJV 3A0RA 3P30A 4QE7A 3CC2V 2GSMB 1BL8A 2JK5C 3MHHC 4I9WA 1VQ4V 3CCUV 1BMFG 3FB8C 1P4RA 4G28B 1K97A 5CN0A 1R3LC 5LBQA 1S0VA 5B1NA 3I56V 4RUFA 1QBZA 2QM8A 2YSUB 3ETDA 2X0LA 1BHBA 5CMUA 1SERA 1QLEB 3OAAG 4R8CA 1GM7A 3AG2B 4QJFB 1M1KW 1QLNA 2QKSA 3E2EA 4H33A 4R6ZA 3VOUA 5IDJA 3G71V 1Q81W 3RW0A 4PDVA 1S76D 4U7OA 3WG7B 2W6JG 1QLEC 1CP9A 2IW5A 1FXKA 1OCOB 3AG2C 4WF9V 4JF3A 3OEHG 4MVQA 1F23A 3K79A 2R9RB 3G4SV 5IYBO 3SPJA 1JPXA 3LDEA 3K06A 5EC2C 5C93A 4WFBV 2WLIB 2DQ0A 4MTGA 3SYCA 1AI7A 1THZA 1W0KG 4WFFA 2Z3YA 4JAVA 1OCOC 2NLJC 5L3EA 3CCMV 2WPDG 2EIKB 2ZDIC 3ZMVA 3SYQA 1K3EA 4UV9A 3JD1A 5IY5B 3CC7V 2Y48A 1KD1W 2V7QG 4PELA 3IGAC 1GM8A 2H94A 2HFEC 3CCJV 1NH2D 3TCUA 3QNEA 3RVYA 5GW7A 2EIKC 1RM1B 4KP4A 4U7NA 4KFMA 2YEVA 3LNMB 4Q20A 2EIMB 5IY5C 2A79B 1JCHA 1K4CC 1NBMG 2WLNA 3X2QB 1DLBA 3ABLB 4R50A 3CCVV 2XNDG 1HWYA 1S72V 3ZRSA 3T4ZA 3ZRWA 2LP7A 2QTOA 1VQKV 5LHGA 3LSSA 3D36A 1K5SA 1PNKA 3STZC 1KQSU 1RM1C 4RUEA 2AHZA 3K08A 3OMNB 4MTXA 2W6IG 2B1GA 3SPHA 2EIMC 4QIWF 3E35A 3GB7C 4LCUC 3JD4A 3X2QC 1H2GA 1F4MA 3ABLC 2EZPA 4FIPC 3SPIA 1DF5A 3ABTA 3VBBA 1YITV 4I5SA 4P9PA 1I5YA 2IJJA 4BW5A 1COWG 4FPPA 1K5QA 2DW4A 2A0LA 2V1DA 3OMAB 1W0JG 1FXKB 1Y66A 1PL0A 3ETEA 5EBWC 4PA7A 1AJPA 3EHBB 3FB7C 4PDMA 1R3IC 4E2LA 1V54B 3JYCA 3FB5C 4G2KA 2WLLA 1RPRA 2JJ1G 3UM7A 4CZZA 3JD3A 4PDLA 3CCQV 4QE9A 4MW8A 3OEEG 1FXKC 1NR7A 4GX0A 1YJWV 3AG3B 2Q6AA 2IJHA 2HVKC 3H01A 3R65A 5EBMC 1KC8W 1V54C 2Q69A 4WCEV 4EKWA 5IYDO 2QEXV 1XL4A 4N23A 3FB6C 4JGSA 4DO2A 4L87A 1V55B 3P32A 3ZRVA 1OZ0A 2QA4V 3F7VC 2MK3A 3HPLC 3AG3C 2ITDC 5CBHA 1E1RG 4GCZA 2CK3G 5CBGA 5LHHA 2C2AA 2YEVB 2ZXWB 4OXSA 3W7TA 5B3SB 1NH2B 1S77D 3ZCCA 5EC1C 1V55C 1VQNV 3EFFK 1SETA 1AI6A 4RO2A 1H8EG 2QE7G 3CMAV 4MTOA 4P9OA 3ZRWB 1K33A 4FK5C 3STLC 2NNUA 2OTLV 1WLEA 3ZRXA 4PDRA 2JEXA 3ZMUA 3JD0A 2ZXWC 1K9MW 3K9AA 5B3SC 2JEUA 1MOFA 2IU3A 4KUMA 1AI4A 1DF4A 4UXNA 2PI4A 5DM6V 3K03A 2Z5UA 4JTAB 3MHSC 4UUJC 1GTOA 1VQPV 1MSWD 5B1AB 4UVCA 3WG7C 1R3KC 2B1IA 4WFAV 1ENVA 3IC7A 3ZN1A 3LUTB 1YHQV 4TT3G 2WLLB 2EINB 2XAJA 2XAFA 5FL7G 3W7WA 3E8HA 4J9ZB 5L3CA 3CCSV 1KECA 1I5XA 3CMEV 4N21A 4JPRA 2WLKA 2IJKA 3B8MA 4LBEC 1FS0G 3SYPA 1G4YB 5B1AC 1NR1A 4XDJA 2XAGA 1QCEA 1WPXA 5HFLA 1NJIW 2HLDG 3E8GA 2EINC 2EBOA 3AG1B 3T2MA 1QR9A 2EJRA 3RVZA 3E86A 3UKMA 1F51A 2B5UA 1M56B 3DGEA 3E83A 2FTKA 2JDIG 4X8AA 3BEHA 4P30A 3QO5A 4H37A 1YJ9V 1VQ9V 1DTOA 2ZD9A 4RQEA 1BHAA 1R6NA 3ZN0A 4MTFA 2A9HA 1Q82W 2Q67A 3ML0A 3CD6V 1M56C 1OCRB 1K92A 2XOKG 3QO8A 3RBZA 3ZMSA 1KKDA 3AEIA 4BIZA 2X7RB 4MVZA 3B8NA 4PA6A 1W2BU 4MSWC 1L1FA 2IH3C 1VQLV 1OHHG 2F43G 4MT8A 2XAQA 5B1BB 3MD0A 3OUSA 1F4NA 2D3OW 2XAHA 1PKXA 5IYCO 5H6QA 1OCRC 1S3JA 3OR7C 1AJQA 2DYRB 1YSCA 4MW3A 4HAMA 3ETGA 2XASA 3G6EV 1ZWIC 4CBCA 3FYEB 4MS2A 2IH1C 1VQ8V 3K0DA 1M9NA 3F5WC 3OR6C 3ABUA 2IJIA 2X6CA 3PJSK 4RQFA 3CC4V 4PA4A 2WLMA 2ZR2A 1M90W 1QVGU 4QPJA 3OW2U 4UVBA 3ASNB 2DYRC 4MVMA 1PD3A 4QNHB 5KA5A 3CCEV 3K3WA 2PI5A 2LFRA 4UV8A 1AROP 4YXWG 3T4DA 3CXCU 5LGUA 5L3GA 5KUMA 1YTFB 5B1OA 5H9CA 4FMTA 1SZTA 1K8AW 2DWDC 2P6JA 4ZKIA 1GMGA 3ASNC 5DN6G 3CCLV 4JAUA 1NKDA 4HZ3A 4P2ZA 3ZJZA 4TWKA 1MABG 4G27B 4WFEA 3TK1A 1GM9A 3JCZA 2JJ2G 1Q86W 3GWOA 3SYOA 4PA9A 1H38A 3OE7G 1CPYA 5L3DA 5LHIA 3FYIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K4D C;  1OCC C;  4X89 A;  4ZBM A;  3STZ C;  2Q68 A;  4RUE A;  2WLK A;  4LBE C;  3SYP A;  1S5H C;  1G4Y B;  2AHZ A;  3K08 A;  5B1A C;  4XDJ A;  3SPH A;  2BOB C;  2EIM C;  2X6B A;  5EBL C;  2ITC C;  4PA3 A;  3GB7 C;  4X88 A;  4LCU C;  3E8G A;  3X2Q C;  2P7T C;  3ABL C;  3SPI A;  3E8F A;  2EIN C;  4MVR A;  1J95 A;  2DWE C;  3K0G A;  4WFG A;  3T2M A;  4DXW A;  3E8B A;  4P9P A;  1LNQ A;  4BW5 A;  3RVZ A;  3E86 A;  2ATK C;  1XL6 A;  3UKM A;  4WFH A;  2A0L A;  4RAI A;  3E83 A;  1P7B A;  4QE7 A;  5EBW C;  4HYO A;  4X8A A;  2JK5 C;  1BL8 A;  3BEH A;  4I9W A;  2Y69 C;  3FB7 C;  4P30 A;  4PA7 A;  4PDM A;  4R7C A;  5EK0 A;  4H37 A;  3FB8 C;  1R3I C;  3IFX A;  3JYC A;  4G28 B;  3FB5 C;  2WLL A;  1R3L C;  2ZD9 A;  2W0F C;  4RUF A;  3UM7 A;  4MTF A;  2A9H A;  2Q67 A;  4PDL A;  4QE9 A;  4GX2 A;  4MW8 A;  4R8C A;  1M56 C;  4GX0 A;  3SPC A;  2AHY A;  3RBZ A;  4F4L A;  2Q6A A;  3SJQ C;  2KB1 A;  2HVK C;  2QKS A;  3R65 A;  1KKD A;  2HJF C;  4H33 A;  5EBM C;  2HG5 C;  4R6Z A;  3VOU A;  2Q69 A;  1V54 C;  4MVZ A;  4EKW A;  2K1E A;  4PA6 A;  4MSW C;  2WLH A;  3RW0 A;  2IH3 C;  4PDV A;  1XL4 A;  3FB6 C;  5E1A C;  4J9Y B;  2BOC C;  1QLE C;  1M57 C;  3OUS A;  3F7V C;  1OCR C;  3AG2 C;  3HPL C;  2EIL C;  3AG3 C;  4MVS A;  4MVQ A;  2R9R B;  2WLJ A;  2ITD C;  5CBH A;  3OR7 C;  2X6A A;  3SPJ A;  3SYA A;  3AG1 C;  3LDE A;  3K06 A;  5J9P C;  5EC2 C;  5CBG A;  1JVM A;  4MW3 A;  2WLI B;  4MTG A;  2EIJ C;  3SYC A;  4OXS A;  3KG2 A;  4MVU A;  4XDK A;  5KUK A;  1ZWI C;  4CBC A;  2H8P C;  4MS2 A;  5EC1 C;  2IH1 C;  1V55 C;  3K0D A;  3ASO C;  3E89 A;  3EFF K;  3F5W C;  3F7Y C;  3K04 A;  3OR6 C;  4JTD B;  4RO2 A;  2X6C A;  3LDD A;  3PJS K;  4WFF A;  2OCC C;  4MTO A;  4PA4 A;  1OCO C;  1OCZ C;  2NLJ C;  4P9O A;  2WLM A;  3TET A;  3STL C;  5CBF A;  4PDR A;  4GX1 A;  2DYR C;  4MVM A;  3ABM C;  3SYQ A;  4GX5 A;  4QNH B;  2ZXW C;  3ABK C;  5B3S C;  2DYS C;  1R3J C;  3IGA C;  4MVO A;  2HFE C;  3T4D A;  2HVJ C;  3AG4 C;  3TCU A;  4JTC B;  3K03 A;  3LDC A;  5KUM A;  3RVY A;  4JTA B;  4UUJ C;  2EIK C;  2DWD C;  4LP8 A;  3OGC C;  3ASN C;  2WLI A;  4KFM A;  3SPG A;  2YEV A;  1R3K C;  3LNM B;  5B1B C;  3WG7 C;  3OUF A;  5IY5 C;  2A79 B;  1K4C C;  4HZ3 A;  2WLN A;  4P2Z A;  3ZJZ A;  3LUT B;  4TWK A;  4R50 A;  3T1C A;  5BZB A;  4G27 B;  2WLL B;  4WFE A;  3ZRS A;  1ORQ C;  3T4Z A;  4XDL A;  3SYO A;  4PA9 A;  2QTO A;  3E8H A;  4J9Z B; 
#chains in the Genus database with same CATH topology
 3I55 V;  1KKC A;  4X1K B;  3LSQ A;  1GN4 A;  4PA3 A;  3OMI B;  4I50 A;  2P7T C;  2UXB B;  4GYC B;  1J95 A;  1XNQ O;  1LUW A;  1ZX3 A;  3C3S A;  1US6 A;  3DSQ A;  1XL6 A;  4WFH A;  1Z5V A;  1NVP B;  1P7B A;  5AG2 A;  3IAY A;  4DV7 B;  3CYO A;  2W0F C;  3HB3 B;  3CPW U;  2DN9 A;  3ZHQ A;  2QKA A;  3K9S A;  3SJQ C;  2KB1 A;  1JX9 A;  1JJ2 U;  4B3M B;  2HG5 C;  4DR7 O;  4E4E A;  1N0J A;  2K1E A;  1EBO A;  2QGN A;  1XI1 A;  3APQ A;  3ASO B;  2ZQM A;  2BOC C;  4JI3 B;  1GK9 A;  2OT5 A;  1R6K A;  2JGU A;  4A5U B;  4MVS A;  1AI5 A;  5LA6 B;  4DV0 B;  1UFI A;  4EB6 B;  1OJH A;  5J9P C;  1JVM A;  3ABM B;  4X65 B;  2PUS A;  4MVU A;  5KUK A;  1FXH A;  3ASO C;  3D3I A;  5JH7 A;  1T5E A;  1UPG A;  4YHH O;  2YIC A;  4NB5 A;  5CBF A;  2YID A;  3ABM C;  1QR8 A;  1Y6X A;  3U0Z A;  2QTS A;  4AQY O;  2OIG A;  5CA1 A;  3AG7 A;  3JD2 A;  1H2K A;  4TUY A;  1N34 O;  3LDC A;  5HFM A;  1RFY A;  4LF9 O;  3RT3 C;  1RPO A;  4LP8 A;  1Z5W A;  3OUF A;  1S5L Z;  4IT5 A;  3T1C A;  2WWW A;  4LF7 O;  3CJH A;  1LR1 A;  4XDL A;  2BCC H;  4Z1M G;  5D5Q A;  4DV1 O;  3ICX A;  1K7D A;  4LWS A;  1SQV H;  3CSX A;  2F4V B;  1KB9 F;  3UT5 A;  2UU9 O;  2GTA A;  1B6Q A;  3CP1 A;  1Q8I A;  5KAI Z;  2RNB A;  1XUQ A;  1AP6 A;  1Y4M A;  2GDS A;  2DWE C;  4DXW A;  1XBL A;  1YF2 A;  2PYL A;  3ZED A;  3S3X A;  2JK5 C;  1BL8 A;  3MHH C;  4I9W A;  1HR0 O;  3CX5 F;  1ZL8 A;  4JI0 B;  1N32 B;  1K97 A;  5LBQ A;  3I56 V;  5DED A;  2X0L A;  2YI9 A;  1ZSP A;  1QLE B;  1XHZ A;  2L35 A;  1GM7 A;  3AG2 B;  4JI1 O;  5JH7 B;  1QLN A;  2EJ7 A;  1H2N A;  2QKS A;  4DV6 B;  4I7Z B;  4FLU A;  4PHZ A;  4Z2W A;  4PDV A;  4U7O A;  3WB0 A;  5B5E Z;  2RDC A;  5KHI A;  3T1H B;  1HNZ B;  5CA1 B;  1QLE C;  1CP9 A;  3AG2 C;  4C7U A;  4JF3 A;  4TUY B;  3K79 A;  3ZHT A;  3G4S V;  3U10 A;  3FFQ A;  3ZHV A;  1P84 F;  2ZE6 A;  4DR4 B;  2Q7G A;  3SYC A;  4B3T O;  4O4I A;  3JAK A;  1XMO O;  4X62 O;  2UXC B;  2R70 A;  2EIK B;  4X66 O;  4LWS B;  3UT5 B;  4FFB A;  4DR5 O;  3EXA A;  1KD1 W;  2V7Q G;  4I9Q A;  1GM8 A;  2G38 A;  3K5N A;  1Q6I A;  5KHH A;  3BCC H;  5IYZ A;  4DV4 O;  4X9Q A;  2EIK C;  2ZCE A;  4KP4 A;  4U7N A;  2LW1 A;  2EIM B;  1NBM G;  3ETQ A;  1ZL8 B;  4LH7 A;  1B04 A;  2PTM A;  3H1K H;  4DYL A;  3ZRS A;  3ZRW A;  2LP7 A;  4HBN A;  5LMU B;  1K5S A;  1BGY H;  4JI2 B;  4DUY B;  1FJG O;  3K08 A;  2EIM C;  3GB7 C;  4FM0 A;  4K0K O;  2EZP A;  1N0N A;  1YIT V;  1I5Y A;  2IJJ A;  3L72 H;  4FPP A;  1SQX H;  1R1B A;  1MNG A;  2LJ2 A;  1R3I C;  4E2L A;  4TQF A;  2WLL A;  5BY1 A;  3K57 A;  4O4I B;  3UM7 A;  3JAK B;  2Q0O C;  5LL6 Y;  3JD3 A;  1Q90 D;  4UCO A;  3K59 A;  3UO3 A;  2IM9 A;  4BR6 A;  4GX0 A;  3AG3 B;  2HVK C;  4ZOL A;  2Q69 A;  1VP7 A;  4WCE V;  4JI5 B;  1WB8 A;  4FFB B;  4GKK O;  5A9G A;  3FB6 C;  5CB4 A;  4DO2 A;  4L87 A;  1OZ0 A;  3AG3 C;  5IYZ B;  1E1R G;  1TVK A;  4D7T A;  4OPH A;  1Q43 A;  2C2A A;  3IJ4 A;  2ZXW B;  3ZCC A;  5EC1 C;  2BSK A;  1H8E G;  4NVP A;  4MTO A;  3ZRW B;  3T1Y O;  3GWK C;  2ZE7 A;  2OTL V;  1EN4 A;  4IYI A;  2HHH B;  2ZXW C;  1Y67 A;  3CWB H;  4KUM A;  1AI4 A;  1XNR O;  3CE2 A;  3A8T A;  3RYC A;  4YHH B;  3IC9 A;  4DUZ B;  3TJT A;  4UVC A;  3IC7 A;  3ZN1 A;  1YHQ V;  2OYQ A;  4TT3 G;  1J5E O;  2JRI A;  2WLL B;  2EIN B;  5JVD B;  3U11 A;  2JVD A;  1N34 B;  3RYI A;  3CCS V;  4FFK A;  5DEC A;  1G4Y B;  3SYP A;  4XDJ A;  1M93 A;  4O2B A;  1NJI W;  4ZOL B;  4LF6 B;  2LQT A;  2EIN C;  3T2M A;  2RMK B;  4DV3 O;  2D2C B;  3RVZ A;  5CB4 B;  3UKM A;  4DV5 B;  2QJ1 A;  3DGE A;  3E83 A;  4PJ0 Z;  1IX9 A;  3K5O A;  3QO5 A;  5D5P A;  3QVN A;  2ZD9 A;  3LSU A;  1Q82 W;  2YDE A;  2Q67 A;  4YY3 O;  2BSK B;  3AEI A;  4JI8 B;  4DR6 O;  2X7R B;  1R6T A;  2UXD O;  5KHG A;  2Y0I A;  2F43 G;  4MT8 A;  1F4N A;  2XAH A;  3SGI A;  1KBH A;  4GKJ O;  3JAR A;  3RYC B;  3ZBH A;  1JMK C;  1VF5 B;  4JYA O;  2VS0 A;  1IUR A;  1XRE A;  1ZWI C;  4X1Y A;  2XUM A;  1XDC A;  1M9N A;  2Q8V A;  1URF A;  2X6C A;  2YIA A;  4JI6 O;  4TV8 A;  1M90 W;  3RYI B;  1QVG U;  4RWU A;  3O65 A;  4KHP B;  4MVM A;  3S3W A;  4O2B B;  3K3W A;  4UB8 Z;  3CCE V;  5EZY A;  1ARO P;  4YXW G;  3T4D A;  1XMO B;  3CXC U;  5L3G A;  4DK1 A;  1YTF B;  5H9C A;  3B09 A;  2YC0 A;  4X66 B;  2DWD C;  2P6J A;  1GMG A;  2Q5Z A;  5DN6 G;  2B9Z A;  3DC6 A;  1SF9 A;  3SYO A;  2ZM6 O;  1H38 A;  4DV4 B;  3Q4H A;  5LHI A;  1IBL O;  2WSS G;  2O57 A;  2Q68 A;  4GT1 A;  4B3R O;  1YI2 V;  2Y69 B;  4F6E A;  2BOB C;  1SRY A;  3E8F A;  2HR3 A;  4WFG A;  1VEW A;  3J80 N;  1EN5 A;  1YEW A;  1WAZ A;  1EZJ A;  2CE4 A;  1SQB H;  1FJG B;  4HYO A;  1PNL A;  3JAR B;  1TAE A;  2Y69 C;  1VQO V;  2QR4 A;  4K0K B;  4CH3 A;  1HNW O;  4JV5 O;  4ZIB A;  1WN7 A;  3SJC C;  4GX2 A;  2DOS A;  4TV8 B;  1D5N A;  1MZE A;  3ZIA G;  2FKX A;  1YCI A;  1AIL A;  4LFC O;  2HJD A;  1NT2 B;  2GHY A;  5LGT A;  5EZY B;  3DXR A;  2HKO A;  2OCC B;  3WFV A;  1OCZ B;  2VWJ A;  3AG1 C;  2UUC B;  2ZIM A;  4GKK B;  4D7S A;  4W4K A;  3ABK B;  4XDK A;  4J11 A;  5H6R A;  1VQ6 V;  3ZHR A;  3ZMT A;  4YJ2 A;  4LNU A;  1AR1 B;  3SPC A;  2OCC C;  1NVP D;  3BY6 A;  1OCZ C;  3AG4 B;  2FL4 A;  3ZS8 C;  3Q4H B;  4TQD A;  4NXN O;  3GVM A;  3LNN A;  1VF7 A;  1G8M A;  3ABK C;  2CGO A;  1B06 A;  3VQY A;  2HVJ C;  3AG4 C;  1IBM B;  4UCV A;  3H1I H;  2LGQ A;  2WLI A;  1SES A;  3SPG A;  2KQX A;  3RGB A;  5BZB A;  1Q7Y W;  3BFR A;  3C3T A;  1GO3 F;  4LF5 O;  5CA0 A;  1ORQ C;  2LFS A;  1HDJ A;  1AJN A;  2M7W A;  1K4D C;  4UVA A;  2HEP A;  4JAS A;  2ITC C;  2Q0A A;  2AZ2 A;  5KMG A;  1CXZ B;  4BAY A;  3A0H Z;  3MAQ A;  1ROP A;  4IGG A;  2ATK C;  5IWA B;  1YIJ V;  3DXR B;  3P30 A;  4QE7 A;  2GSM B;  1VQ4 V;  3CCU V;  1BMF G;  4HNA A;  1HP8 A;  4DV3 B;  1BHB A;  1RP3 B;  2YXH A;  5CMU A;  2CTP A;  4YJ2 B;  4LNU B;  4QJF B;  1H2M A;  3E2E A;  4DR3 O;  2V4D A;  4CH4 A;  4R6Z A;  1Q81 W;  2XHB A;  4AIL C;  3RW0 A;  4J41 A;  2YIB A;  4MVQ A;  1XMQ O;  3UCS C;  5EC2 C;  5C93 A;  2WLI B;  2UXD B;  2DQ0 A;  4UCT A;  1I94 O;  2DE0 X;  1THZ A;  1Q6U A;  4YJ3 A;  5CA0 B;  2K9P A;  4JAV A;  2MW2 B;  5IJ9 A;  3CCM V;  4EFE A;  4JYA B;  2FML A;  3ZMV A;  4Q6G A;  4PD4 F;  3SJA C;  1AVM A;  4PEL A;  5KMG B;  2Y0P A;  1NH2 D;  3TCU A;  2KKW A;  4NXM O;  5GW7 A;  1TGO A;  5LMN O;  4KFM A;  5BR8 O;  4J7K A;  1DLB A;  4R50 A;  3CCV V;  2ZE5 A;  4HNA B;  2XND G;  1S72 V;  3T4Z A;  2UUB B;  1MMM A;  5LHG A;  1FKA O;  4JI4 B;  2P5O A;  2E76 B;  1QHT A;  1KQS U;  1WA8 A;  5E79 Z;  4I50 B;  4MTX A;  3G6B A;  3SPH A;  2BE3 A;  4LCU C;  3JD4 A;  3CRC A;  1DF5 A;  1BE3 H;  3ABT A;  3KKY A;  2UUA O;  4LFB B;  4BW5 A;  1SS3 A;  2A0L A;  2V1D A;  1PL0 A;  2YXY A;  3JAM N;  3ETE A;  5EBW C;  4LF8 O;  4B3R B;  4PA7 A;  5EIB C;  1RPR A;  5K1X A;  5IT9 N;  5KLV H;  4PDL A;  4YJ3 B;  3OEE G;  1NR7 A;  5IJ9 B;  1FPO A;  2IJH A;  1B3Q A;  3RN4 A;  4EKW A;  1WPB A;  2QEX V;  4JV5 B;  4NR1 A;  1Y74 A;  5ITZ A;  3ZRV A;  3RYF A;  1XOU A;  4NYK A;  2QA4 V;  3HKE A;  2CK3 G;  5LHH A;  4ZI7 A;  3OTO O;  1NH2 B;  1S77 D;  3JAW A;  3CMA V;  3CS5 A;  2CTW A;  1K33 A;  2YI8 A;  2NNU A;  1WA8 B;  3ZRX A;  3L74 H;  4NTW A;  2QWP B;  4UCR A;  1JA8 A;  2JEU A;  1YXB A;  1MOF A;  2IU3 A;  1I08 A;  2E75 B;  4IIJ A;  2M6Y A;  1I7F A;  1U97 A;  3MHS C;  4UUJ C;  2E5L B;  4JI7 B;  3BVO A;  1MSW D;  5B1A B;  2P4V A;  3CJH B;  1H2S B;  4WFA V;  3E22 A;  5EYP A;  3VQX A;  2R72 A;  3W7W A;  3E8H A;  3A0B Z;  3CME V;  4JPR A;  5FNV A;  1BSM A;  3D3Q A;  5B1A C;  5H2F Z;  5K1P A;  1SQG A;  2HLD G;  3E8G A;  3SDL A;  3WB2 A;  4PV1 B;  3N2G A;  5KX5 A;  2VQF B;  4LF4 B;  2Q7E A;  4OGQ B;  4DV2 O;  1Y74 B;  5ITZ B;  4CH5 A;  3RYF B;  4DR1 O;  2W0X A;  1IDS A;  3HKE B;  3JAL A;  3P3P A;  1VQ9 V;  2ZT9 B;  4ZI7 B;  4B08 A;  4BWA A;  3JAW B;  2XOK G;  4BW9 A;  3SJB C;  1ZLZ A;  3B8N A;  4PA6 A;  1V9P A;  1GH6 A;  2IH3 C;  1VQL V;  1OHH G;  2ILM A;  4B3S O;  1M4U A;  5B1B B;  1BCC H;  4IIJ B;  3MD0 A;  3OUS A;  4QGP A;  2D3O W;  3KCY A;  5IYC O;  5H6Q A;  4H0L B;  4DR3 B;  1XNQ B;  1AJQ A;  3OD4 A;  4CBC A;  3FYE B;  4MS2 A;  3E22 B;  1NTK H;  5EYP B;  2IJI A;  2JS5 A;  4RQF A;  4PA4 A;  4DR2 O;  1I0H A;  3ASN B;  5FNV B;  3JAS A;  1L0N H;  4QNH B;  2PI5 A;  2CTR A;  3RWR D;  2P06 A;  3N2G B;  5KX5 B;  3K5L A;  4DR7 B;  5KUM A;  3AK3 A;  4EEQ A;  4FMT A;  3ASN C;  3CCL V;  4JAU A;  3JAL B;  1NKD A;  4P2Z A;  1ZTE A;  3ZJZ A;  4I0X A;  2XT9 A;  1MAB G;  2N04 A;  5FPO A;  3TK1 A;  2Q9L A;  3JCZ A;  1N36 O;  4PA9 A;  3BHP A;  3OE7 G;  4K35 A;  4PI0 A;  1YJN V;  2QM7 A;  4ZBM A;  3H9V A;  2IU0 A;  1N33 O;  2EUL A;  2ZE8 A;  4X88 A;  5F2V O;  1MG1 A;  4FVM A;  2P67 A;  3W7X A;  1PNM A;  4AQY B;  4R7C A;  2HP8 A;  5EK0 A;  2P4K A;  5KA6 A;  3HKD A;  3B4S A;  2ZR3 A;  4LF9 B;  2F23 A;  4JYB A;  1QQC A;  2E3C A;  1YTF D;  2VWK A;  2OCH A;  4LF8 B;  2EIL B;  3RFR A;  5LGN A;  2HJF C;  4LF7 B;  1SZX A;  4DV1 B;  2EIJ B;  3JAS B;  2WLH A;  4TSF G;  4FM1 A;  5L3F A;  1M5I A;  5E1A C;  2UU9 B;  4J9Y B;  4UCS A;  1GAX A;  1TVK B;  2EIL C;  2WLJ A;  2WA3 A;  2X6A A;  1AB3 A;  1GN6 A;  3SYA A;  5FLX N;  1GKF A;  3CHX A;  3OFN G;  4GUN A;  2EIJ C;  2Q73 A;  1E79 G;  3KG2 A;  2DYS B;  4I0X B;  4BIU A;  3NXS A;  4LH6 A;  3F7Y C;  3E89 A;  1HR0 B;  3WU2 Z;  3B77 A;  3K04 A;  4I4T A;  3LDD A;  2QM4 A;  1JQ0 A;  1YZB A;  1D2D A;  4OPA A;  3O9O A;  2L6L A;  3BAA A;  4GX5 A;  3N2K A;  1QVF U;  3OTO B;  4JI1 B;  1FFT B;  2DYS C;  1R3J C;  2EZO A;  4MVO A;  3KCX A;  1JR9 A;  2DMX A;  4JTC B;  4DV7 O;  2Q7H A;  1OCC B;  2ZDI A;  3OGC C;  1NQT A;  1VQM V;  2OTJ V;  4H44 B;  3HKD B;  4J42 A;  4ABM A;  2ZIO A;  4B3M O;  2AXT Z;  2KG7 A;  1JOY A;  1FXV A;  1H2L A;  1UJW B;  4B3T B;  1OCC C;  1Y76 A;  1S5H C;  5EBL C;  1GRJ A;  3HKC A;  5JCO A;  4X62 B;  4DV0 O;  4MVR A;  3K0G A;  1AR5 A;  3B2E E;  3E8B A;  4FLY A;  2QWO B;  1KP3 A;  4X65 O;  4DR5 B;  1NI8 A;  3L75 H;  3C90 A;  4G28 B;  2KSD A;  5B1N A;  3CXH F;  1QBZ A;  2YSU B;  4K8X A;  1BS3 A;  3CEI A;  1SER A;  1IVS A;  4R8C A;  4I4T B;  1M1K W;  1IZ3 A;  1ZAU A;  3VOU A;  5GTH Z;  5IDJ A;  1EM1 A;  3G71 V;  4FLW A;  4K8Z A;  3ZX6 A;  3N2K B;  4F6R A;  1SKV A;  3WG7 B;  2W6J G;  2PGG A;  2IW5 A;  1FXK A;  1NTZ H;  5FPR A;  1F23 A;  2CTQ A;  2R9R B;  2RN9 A;  3G67 A;  4FZ0 A;  5IYB O;  5BXZ A;  3LDE A;  4X1Y B;  3L71 H;  4MTG A;  5J2U A;  1AI7 A;  2F4V O;  3UQ8 A;  4WFF A;  3BA9 A;  4CH6 A;  2ADQ B;  2KG7 B;  3CRR A;  2GBO A;  1PM9 A;  2ZDI C;  1Y76 B;  3SYQ A;  3A2F A;  3JD1 A;  5IY5 B;  1YDX A;  4IHJ A;  3HKC B;  3QTC A;  2HFE C;  4LFA O;  4JI0 O;  2YXL A;  1QNM A;  3FX7 A;  3RVY A;  2CUG A;  4DW0 A;  4J80 A;  4Q20 A;  5IY5 C;  2A79 B;  1JCH A;  2WLN A;  2LGW A;  5JCO C;  1HWY A;  3UO2 A;  4DV6 O;  1VQK V;  3D36 A;  2ZNJ A;  1PNK A;  3STZ C;  3T1H O;  2AHZ A;  2R9A A;  2W6I G;  2B1G A;  2PZS A;  3T1Y B;  1H2G A;  1F4M A;  2ODM A;  3SPI A;  2FB5 A;  1WP7 A;  4F6R B;  4I5S A;  1N36 B;  3OGI B;  1COW G;  1K5Q A;  3BPZ A;  4DR4 O;  1VF6 A;  4IYH A;  1W0J G;  1FXK B;  4U3J A;  3EVK A;  1N33 B;  5KHK A;  1AJP A;  1XNR B;  3EHB B;  3FB7 C;  1XEQ A;  3JYC A;  4B7K A;  3FB5 C;  4G2K A;  2UXC O;  4UFZ A;  5J2U B;  4CZZ A;  1SC5 B;  3CCQ V;  4QE9 A;  1YJW V;  1FXK C;  1J5E B;  3H01 A;  5EBM C;  1KC8 W;  2Y4U A;  3H1H H;  1S5J A;  3I5D A;  2YUA A;  2H3O A;  3L70 H;  1XL4 A;  4N23 A;  4IHJ B;  3P32 A;  4O2A A;  1GN2 A;  2QWQ B;  2F95 B;  2MK3 A;  3HPL C;  1TA8 A;  4UCU A;  5EIB D;  2ITD C;  5CBH A;  5CBG A;  1NZ6 A;  4OXS A;  3W7T A;  5B3S B;  4DUY O;  1VQN V;  3EFF K;  4L8J A;  4W4L A;  1SET A;  2QE7 G;  4P9O A;  2A06 H;  2YIB D;  4KXR A;  4FK5 C;  2FYU H;  4PDR A;  4YY3 B;  3ZMU A;  1MA1 A;  3JD0 A;  1K9M W;  5LP6 A;  3K9A A;  5B3S C;  1VAR A;  3L9D A;  4UB6 Z;  3PN1 A;  4DR6 B;  4NTY A;  4UXN A;  2OWO A;  4TOI A;  3N27 A;  3K03 A;  5DM6 V;  3RYH A;  3D36 C;  1GTO A;  4U3J B;  2QWR B;  1VQP V;  3F5T A;  2GUZ A;  1R3K C;  1ENV A;  4GKJ B;  3JCU Z;  1AP5 A;  4J9Z B;  1WNS A;  3WB1 A;  5J2T A;  1KEC A;  1VF6 C;  4JI5 O;  3JAT A;  2IJK A;  3B8M A;  1FS0 G;  1FYJ A;  2XAG A;  1QCE A;  3HKB A;  4JI6 B;  4EFB A;  3OT7 A;  4LR3 A;  1MZF A;  5KAF Z;  4O2A B;  1F51 A;  3VQV A;  2IBZ H;  1ZUQ A;  1M56 B;  1PP9 H;  2FTK A;  3BEH A;  1OV9 A;  4H37 A;  3DC5 A;  1QU7 A;  4RQE A;  2E74 B;  1BHA A;  1KMI Z;  1R6N A;  3ZN0 A;  4MTF A;  1O9H A;  2A9H A;  2LW7 A;  4K3A A;  2HHH O;  2ZNI A;  1AR4 A;  3CD6 V;  1PL4 A;  2N74 A;  1M56 C;  1OCR B;  1P49 A;  1K92 A;  3QO8 A;  3RBZ A;  4JZG A;  1KKD A;  4FLT A;  3CRQ A;  1P7G A;  1IBK O;  1LUV A;  2ZM6 B;  2XTA A;  1W2B U;  4MSW C;  1IBL B;  5LP6 B;  1PPJ H;  4DUZ O;  4FM2 A;  5C8Y A;  1SA0 A;  1OCR C;  2QWN B;  3RYH B;  1SQP H;  4U3F H;  3OR7 C;  2GV9 A;  4JYY A;  3APO A;  2DYR B;  1YSC A;  4MW3 A;  2N05 A;  2GUZ B;  4HAM A;  2XAS A;  5LP6 C;  3G6E V;  5IJ0 A;  2IH1 C;  1JFF A;  3ABU A;  3H1L H;  3PJS K;  5GON A;  2ZR2 A;  4LF6 O;  3SR2 C;  3CRA A;  2NN4 A;  5J2T B;  3OW2 U;  1D5A A;  3JAT B;  4NTX A;  5GTI Z;  1HNW B;  2DYR C;  3BAB A;  4DV5 O;  4JAA A;  3G80 A;  2LFR A;  3HKB B;  1NU1 H;  5LGU A;  1SQQ H;  3L73 H;  3J7A U;  3BA8 A;  5B1O A;  4CS2 A;  4LFC B;  1K8A W;  4ZKI A;  4O4H A;  1L0L H;  4HZ3 A;  4G27 B;  4WFE A;  2ARH A;  4JI8 O;  4LFA B;  3GWO A;  3VQW A;  1CPY A;  5L3D A;  3FYI B;  4X89 A;  3DTU B;  1Q5O A;  4GZR B;  1XHX A;  1R73 A;  3P3N A;  1XQ8 A;  3W7U A;  2OIE A;  2BTQ A;  4NXN B;  3QF7 A;  1E1Q G;  2CAZ C;  5C8Y B;  1EFR G;  1SA0 B;  2UXX A;  5L3B A;  1VQ5 V;  5JJN B;  1KP2 A;  3IFX A;  1CEZ A;  1Z2G A;  2RQ6 A;  2BTO A;  3FKS G;  5IJ0 B;  4KHP O;  2JIZ G;  3THO A;  1M57 B;  1JFF B;  3KZI Z;  2AHY A;  4F4L A;  5GON B;  4LF5 B;  2P90 A;  2DQ3 A;  2EX3 A;  5CA3 A;  5LOV A;  4ASU G;  3ZMZ A;  1M57 C;  1IXM A;  5H5N A;  2F93 B;  1BQ0 A;  5A2Q N;  1K34 A;  3CCR V;  4B7E A;  1WP8 A;  2VRZ A;  4O4H B;  4X1I A;  1N8R W;  2ADP A;  2ETN A;  1BZK A;  4J10 A;  2H8P C;  4TV9 A;  1TUE B;  4JTD B;  1VQ7 V;  3TET A;  2CDY A;  3D8C A;  3M99 B;  3QO7 A;  1FFX A;  2Q4P A;  4GX1 A;  4XBF A;  2WAM A;  3JSL A;  5IE9 A;  4X64 O;  2BTQ B;  3W7S A;  2R9I A;  4JYC A;  1NTM H;  1HNX O;  5B1B C;  2UXN A;  4LC1 A;  4QPK A;  3OM3 B;  3M8A A;  3NR7 A;  4BIO A;  1EZV H;  1XMQ B;  5JVD A;  2WA4 A;  1I94 B;  4FJC C;  2PY5 A;  5JJJ B;  4FLZ A;  3J81 N;  2AZ0 A;  2F66 C;  2JGD A;  2X6B A;  3HR0 A;  1DGS A;  5JWP A;  2PYJ A;  5B66 Z;  1K73 W;  5LOV B;  1RSO A;  1H8H G;  1LNQ A;  2UUC O;  4RAI A;  3A0R A;  3CC2 V;  3FB8 C;  4O4J A;  1P4R A;  1FAF A;  4NXM B;  4X1I B;  5CN0 A;  1R3L C;  1HW7 A;  1S0V A;  4RUF A;  2VQE O;  2QM8 A;  3ETD A;  1XIL A;  5LMN B;  4TV9 B;  5BR8 B;  3OAA G;  2NR5 A;  1L8D A;  4H33 A;  1FFX B;  1IBM O;  5LXT A;  4OX9 O;  1S76 D;  5LYJ A;  1OCO B;  4WF9 V;  3OEH G;  4AI8 A;  1IBK B;  3SPJ A;  2UUA B;  1JPX A;  3K06 A;  4WFB V;  4X20 A;  4O4L A;  1W0K G;  3OTF A;  4DRX A;  2Z3Y A;  1OCO C;  2NLJ C;  5L3E A;  4CS3 A;  2WPD G;  2RCV A;  1G1X B;  1K3E A;  4UV9 A;  5IWA O;  1JJO A;  3CC7 V;  2JGD B;  2Y48 A;  2CGN A;  3IGA C;  2H94 A;  1KYO F;  3CCJ V;  1RSO B;  4H13 B;  3QNE A;  1RM1 B;  1VMG A;  2A7W A;  2QKC A;  2YEV A;  3LNM B;  1K4C C;  2YS8 A;  4O4J B;  3X2Q B;  3ABL B;  2JS3 A;  2UXB O;  1A32 A;  4FLX A;  2QTO A;  3CRM A;  3LSS A;  2QDO A;  1RM1 C;  4RUE A;  3OMN B;  3H1J H;  4J7J A;  4QIW F;  3E35 A;  5JQG A;  4D6T H;  3CB2 A;  3X2Q C;  3MDS A;  3ABL C;  4FIP C;  3B40 A;  3VBB A;  5LXT B;  4P9P A;  4NKG B;  4DW1 A;  1X59 A;  2RJZ A;  5LYJ B;  2DW4 A;  3OMA B;  1Y66 A;  3TXQ A;  2QSA A;  4PDM A;  1V54 B;  3JSN A;  4IL6 Z;  1F7Y A;  4X20 B;  2JJ1 G;  1WB7 A;  1EN6 A;  4O4L B;  4MW8 A;  4JI3 O;  4DRX B;  3TGU H;  2Q6A A;  2CH7 A;  2Y4T A;  4AHC A;  3R65 A;  1BQZ A;  1V54 C;  5IYD O;  2DJV A;  1V55 B;  5BMV A;  3F7V C;  1BT8 A;  1GN3 A;  3M7M X;  2UUB O;  4GCZ A;  3QG5 A;  4DV2 B;  4JI4 O;  2YEV B;  4DR1 B;  1W59 A;  1V55 C;  1AI6 A;  4RO2 A;  2AW9 A;  3AK2 A;  3STL C;  1WLE A;  4I55 A;  4LFB O;  2JEX A;  5JQG B;  1IXB A;  1NS1 A;  1DF4 A;  4J7Z A;  2PI4 A;  2Z5U A;  3AK1 A;  4JTA B;  4B3S B;  2LO1 A;  3WG7 C;  5TIS Z;  1G6U A;  2B1I A;  2A3Q A;  3LUT B;  4X64 B;  2GTS A;  2XAJ A;  2XAF A;  4DK0 A;  5FL7 G;  5L3C A;  1I5X A;  1DK1 A;  4N21 A;  4WBN A;  2WLK A;  4LBE C;  1HNX B;  2CH7 B;  4JZ2 A;  1NR1 A;  1WJZ A;  2ZIN A;  1WPX A;  5HFL A;  1N32 O;  4ZHQ A;  1TUB A;  4DR2 B;  3ZHS A;  2EBO A;  3AG1 B;  1QR9 A;  2EJR A;  1PV0 A;  3E86 A;  3FAV A;  3R66 A;  2B5U A;  4FZ1 A;  5BMV B;  2JDI G;  1X4T A;  4X8A A;  4P30 A;  1YJ9 V;  1DTO A;  1Q6H A;  4KL1 A;  2ZKO A;  3ML0 A;  1HNZ O;  2AGA A;  1SQF A;  4Z1V A;  1MSD A;  3ZMS A;  4X1K A;  4CC6 A;  2PF4 E;  4BIZ A;  4I55 B;  1O9G A;  4MVZ A;  5JJE B;  1L1F A;  2VQE B;  2E5L O;  1N4C A;  4JI7 O;  3K58 A;  2XAQ A;  4CS4 A;  1PKX A;  1S3J A;  1Q3E A;  4YIP A;  3TXS A;  3ZHU A;  3BRC A;  3ETG A;  4OX9 B;  1VQ8 V;  3K0D A;  3F5W C;  3OR6 C;  2F1M A;  3CC4 V;  2WLM A;  1KUQ A;  1FD9 A;  4QPJ A;  2VQF O;  4LF4 O;  4UVB A;  1VIB A;  1KU9 A;  4WBN B;  1PD3 A;  5KA5 A;  1U96 A;  2Z0A A;  4ZHQ B;  4UV8 A;  1TUB B;  5KHJ A;  4ICG A;  5LA6 A;  3FAV B;  4EB6 A;  5LMU O;  1SZT A;  4YIO A;  1YVW A;  4JI2 O;  2P22 C;  4PI2 A;  4CC5 A;  4TWK A;  3K5M A;  3FD9 A;  1GM9 A;  4FLV A;  2JJ2 G;  1Q86 W;  4GLX A;  4JGS A; 
#chains in the Genus database with same CATH homology
 2QM7 A;  4X89 A;  2WSS G;  4ZBM A;  2Q68 A;  3DTU B;  4GT1 A;  3I55 V;  2IU0 A;  1YI2 V;  2Y69 B;  1R73 A;  3LSQ A;  2BOB C;  4PA3 A;  3OMI B;  4X88 A;  2P7T C;  1SRY A;  3E8F A;  1MG1 A;  2HR3 A;  1J95 A;  4WFG A;  3W7U A;  1EZJ A;  1E1Q G;  1XL6 A;  2P67 A;  4WFH A;  1NVP B;  1EFR G;  1P7B A;  2UXX A;  5L3B A;  1PNM A;  3W7X A;  4HYO A;  1VQ5 V;  1PNL A;  4R7C A;  1VQO V;  2Y69 C;  5EK0 A;  1KP2 A;  3IFX A;  5KA6 A;  1CEZ A;  2ZR3 A;  3FKS G;  3CYO A;  2W0F C;  3HB3 B;  3CPW U;  4JYB A;  2JIZ G;  1YTF D;  1M57 B;  4GX2 A;  2AHY A;  2EIL B;  5LGN A;  4F4L A;  3SJQ C;  2KB1 A;  1JX9 A;  1JJ2 U;  2HJF C;  2P90 A;  3ZIA G;  2HG5 C;  2DQ3 A;  2K1E A;  2EIJ B;  5CA3 A;  1EBO A;  2WLH A;  4TSF G;  4ASU G;  5L3F A;  3ZMZ A;  5E1A C;  2GHY A;  3ASO B;  2ZQM A;  4J9Y B;  2BOC C;  5LGT A;  1M57 C;  2HKO A;  1IXM A;  2OCC B;  1GK9 A;  2OT5 A;  1OCZ B;  1R6K A;  3WFV A;  2EIL C;  4MVS A;  1AI5 A;  1K34 A;  3CCR V;  2WLJ A;  2X6A A;  3SYA A;  3AG1 C;  5J9P C;  1GKF A;  3OFN G;  1JVM A;  3ABM B;  1N8R W;  2EIJ C;  1E79 G;  3ABK B;  3KG2 A;  4MVU A;  4XDK A;  5KUK A;  2DYS B;  4BIU A;  5H6R A;  1VQ6 V;  2H8P C;  1FXH A;  3NXS A;  3ZMT A;  3ASO C;  3E89 A;  3D3I A;  1TUE B;  3B77 A;  3F7Y C;  3K04 A;  4JTD B;  1AR1 B;  1VQ7 V;  3LDD A;  3SPC A;  2OCC C;  1NVP D;  3BY6 A;  1OCZ C;  3AG4 B;  3TET A;  1JQ0 A;  3M99 B;  3QO7 A;  5CBF A;  4GX1 A;  4XBF A;  3ABM C;  1QR8 A;  2WAM A;  1G8M A;  4GX5 A;  1YJN V;  1QVF U;  3ABK C;  1FFT B;  2DYS C;  1R3J C;  2EZO A;  4MVO A;  2HVJ C;  3JD2 A;  3AG4 C;  4JTC B;  3LDC A;  5HFM A;  3W7S A;  2R9I A;  1OCC B;  2ZDI A;  4JYC A;  1RPO A;  3OGC C;  4LP8 A;  2WLI A;  1SES A;  3SPG A;  1NQT A;  5B1B C;  3OUF A;  1VQM V;  2UXN A;  2OTJ V;  4LC1 A;  4QPK A;  3T1C A;  5BZB A;  1Q7Y W;  1GO3 F;  3OM3 B;  2WWW A;  1ORQ C;  2LFS A;  4XDL A;  1JOY A;  1AJN A;  1FXV A;  4Z1M G;  2M7W A;  1K7D A;  1UJW B;  1K4D C;  1OCC C;  4FJC C;  4UVA A;  1S5H C;  1B6Q A;  2X6B A;  3CP1 A;  4JAS A;  2ITC C;  5EBL C;  4MVR A;  1Y4M A;  1K73 W;  2DWE C;  3K0G A;  4BAY A;  4DXW A;  1ROP A;  3E8B A;  1H8H G;  1LNQ A;  2ATK C;  1KP3 A;  4RAI A;  1YIJ V;  3A0R A;  3P30 A;  4QE7 A;  3CC2 V;  2GSM B;  1BL8 A;  2JK5 C;  3MHH C;  4I9W A;  1VQ4 V;  3CCU V;  1BMF G;  3FB8 C;  1P4R A;  4G28 B;  1K97 A;  5CN0 A;  1R3L C;  5LBQ A;  1S0V A;  5B1N A;  3I56 V;  4RUF A;  1QBZ A;  2QM8 A;  2YSU B;  3ETD A;  2X0L A;  1BHB A;  5CMU A;  1SER A;  1QLE B;  3OAA G;  4R8C A;  1GM7 A;  3AG2 B;  4QJF B;  1M1K W;  1QLN A;  2QKS A;  3E2E A;  4H33 A;  4R6Z A;  3VOU A;  5IDJ A;  3G71 V;  1Q81 W;  3RW0 A;  4PDV A;  1S76 D;  4U7O A;  3WG7 B;  2W6J G;  1QLE C;  1CP9 A;  2IW5 A;  1FXK A;  1OCO B;  3AG2 C;  4WF9 V;  4JF3 A;  3OEH G;  4MVQ A;  1F23 A;  3K79 A;  2R9R B;  3G4S V;  5IYB O;  3SPJ A;  1JPX A;  3LDE A;  3K06 A;  5EC2 C;  5C93 A;  4WFB V;  2WLI B;  2DQ0 A;  4MTG A;  3SYC A;  1AI7 A;  1THZ A;  1W0K G;  4WFF A;  2Z3Y A;  4JAV A;  1OCO C;  2NLJ C;  5L3E A;  3CCM V;  2WPD G;  2EIK B;  2ZDI C;  3ZMV A;  3SYQ A;  1K3E A;  4UV9 A;  3JD1 A;  5IY5 B;  3CC7 V;  2Y48 A;  1KD1 W;  2V7Q G;  4PEL A;  3IGA C;  1GM8 A;  2H94 A;  2HFE C;  3CCJ V;  1NH2 D;  3TCU A;  3QNE A;  3RVY A;  5GW7 A;  2EIK C;  1RM1 B;  4KP4 A;  4U7N A;  4KFM A;  2YEV A;  3LNM B;  4Q20 A;  2EIM B;  5IY5 C;  2A79 B;  1JCH A;  1K4C C;  1NBM G;  2WLN A;  3X2Q B;  1DLB A;  3ABL B;  4R50 A;  3CCV V;  2XND G;  1HWY A;  1S72 V;  3ZRS A;  3T4Z A;  3ZRW A;  2LP7 A;  2QTO A;  1VQK V;  5LHG A;  3LSS A;  3D36 A;  1K5S A;  1PNK A;  3STZ C;  1KQS U;  1RM1 C;  4RUE A;  2AHZ A;  3K08 A;  3OMN B;  4MTX A;  2W6I G;  2B1G A;  3SPH A;  2EIM C;  4QIW F;  3E35 A;  3GB7 C;  4LCU C;  3JD4 A;  3X2Q C;  1H2G A;  1F4M A;  3ABL C;  2EZP A;  4FIP C;  3SPI A;  1DF5 A;  3ABT A;  3VBB A;  1YIT V;  4I5S A;  4P9P A;  1I5Y A;  2IJJ A;  4BW5 A;  1COW G;  4FPP A;  1K5Q A;  2DW4 A;  2A0L A;  2V1D A;  3OMA B;  1W0J G;  1FXK B;  1Y66 A;  1PL0 A;  3ETE A;  5EBW C;  4PA7 A;  1AJP A;  3EHB B;  3FB7 C;  4PDM A;  1R3I C;  4E2L A;  1V54 B;  3JYC A;  3FB5 C;  4G2K A;  2WLL A;  1RPR A;  2JJ1 G;  3UM7 A;  4CZZ A;  3JD3 A;  4PDL A;  3CCQ V;  4QE9 A;  4MW8 A;  3OEE G;  1FXK C;  1NR7 A;  4GX0 A;  1YJW V;  3AG3 B;  2Q6A A;  2IJH A;  2HVK C;  3H01 A;  3R65 A;  5EBM C;  1KC8 W;  1V54 C;  2Q69 A;  4WCE V;  4EKW A;  5IYD O;  2QEX V;  1XL4 A;  4N23 A;  3FB6 C;  4JGS A;  4DO2 A;  4L87 A;  1V55 B;  3P32 A;  3ZRV A;  1OZ0 A;  2QA4 V;  3F7V C;  2MK3 A;  3HPL C;  3AG3 C;  2ITD C;  5CBH A;  1E1R G;  4GCZ A;  2CK3 G;  5CBG A;  5LHH A;  2C2A A;  2YEV B;  2ZXW B;  4OXS A;  3W7T A;  5B3S B;  1NH2 B;  1S77 D;  3ZCC A;  5EC1 C;  1V55 C;  1VQN V;  3EFF K;  1SET A;  1AI6 A;  4RO2 A;  1H8E G;  2QE7 G;  3CMA V;  4MTO A;  4P9O A;  3ZRW B;  1K33 A;  4FK5 C;  3STL C;  2NNU A;  2OTL V;  1WLE A;  3ZRX A;  4PDR A;  2JEX A;  3ZMU A;  3JD0 A;  2ZXW C;  1K9M W;  3K9A A;  5B3S C;  2JEU A;  1MOF A;  2IU3 A;  4KUM A;  1AI4 A;  1DF4 A;  4UXN A;  2PI4 A;  5DM6 V;  3K03 A;  2Z5U A;  4JTA B;  3MHS C;  4UUJ C;  1GTO A;  1VQP V;  1MSW D;  5B1A B;  4UVC A;  3WG7 C;  1R3K C;  2B1I A;  4WFA V;  1ENV A;  3IC7 A;  3ZN1 A;  3LUT B;  1YHQ V;  4TT3 G;  2WLL B;  2EIN B;  2XAJ A;  2XAF A;  5FL7 G;  3W7W A;  3E8H A;  4J9Z B;  5L3C A;  3CCS V;  1KEC A;  1I5X A;  3CME V;  4N21 A;  4JPR A;  2WLK A;  2IJK A;  3B8M A;  4LBE C;  1FS0 G;  3SYP A;  1G4Y B;  5B1A C;  1NR1 A;  4XDJ A;  2XAG A;  1QCE A;  1WPX A;  5HFL A;  1NJI W;  2HLD G;  3E8G A;  2EIN C;  2EBO A;  3AG1 B;  3T2M A;  1QR9 A;  2EJR A;  3RVZ A;  3E86 A;  3UKM A;  1F51 A;  2B5U A;  1M56 B;  3DGE A;  3E83 A;  2FTK A;  2JDI G;  4X8A A;  3BEH A;  4P30 A;  3QO5 A;  4H37 A;  1YJ9 V;  1VQ9 V;  1DTO A;  2ZD9 A;  4RQE A;  1BHA A;  1R6N A;  3ZN0 A;  4MTF A;  2A9H A;  1Q82 W;  2Q67 A;  3ML0 A;  3CD6 V;  1M56 C;  1OCR B;  1K92 A;  2XOK G;  3QO8 A;  3RBZ A;  3ZMS A;  1KKD A;  3AEI A;  4BIZ A;  2X7R B;  4MVZ A;  3B8N A;  4PA6 A;  1W2B U;  4MSW C;  1L1F A;  2IH3 C;  1VQL V;  1OHH G;  2F43 G;  4MT8 A;  2XAQ A;  5B1B B;  3MD0 A;  3OUS A;  1F4N A;  2D3O W;  2XAH A;  1PKX A;  5IYC O;  5H6Q A;  1OCR C;  1S3J A;  3OR7 C;  1AJQ A;  2DYR B;  1YSC A;  4MW3 A;  4HAM A;  3ETG A;  2XAS A;  3G6E V;  1ZWI C;  4CBC A;  3FYE B;  4MS2 A;  2IH1 C;  1VQ8 V;  3K0D A;  1M9N A;  3F5W C;  3OR6 C;  3ABU A;  2IJI A;  2X6C A;  3PJS K;  4RQF A;  3CC4 V;  4PA4 A;  2WLM A;  2ZR2 A;  1M90 W;  1QVG U;  4QPJ A;  3OW2 U;  4UVB A;  3ASN B;  2DYR C;  4MVM A;  1PD3 A;  4QNH B;  5KA5 A;  3CCE V;  3K3W A;  2PI5 A;  2LFR A;  4UV8 A;  1ARO P;  4YXW G;  3T4D A;  3CXC U;  5LGU A;  5L3G A;  5KUM A;  1YTF B;  5B1O A;  5H9C A;  4FMT A;  1SZT A;  1K8A W;  2DWD C;  2P6J A;  4ZKI A;  1GMG A;  3ASN C;  5DN6 G;  3CCL V;  4JAU A;  1NKD A;  4HZ3 A;  4P2Z A;  3ZJZ A;  4TWK A;  1MAB G;  4G27 B;  4WFE A;  3TK1 A;  1GM9 A;  3JCZ A;  2JJ2 G;  1Q86 W;  3GWO A;  3SYO A;  4PA9 A;  1H38 A;  3OE7 G;  1CPY A;  5L3D A;  5LHI A;  3FYI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...