4DV0O

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 30
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dv0O00
2VQFO 1NS1A 4LFAO 5BR8O 4KHPO 1F7YA 4DR4O 5A2QN 1N33O 4B3RO 4X62O 1AILA 4GKKO 4AQYO 4B3SO 3J80N 1FKAO 3J81N 5BY1A 1DK1A 4DR7O 4DV3O 4DUYO 1HR0O 4JI5O 1J5EO 5LMUO 5LL6Y 4JI6O 1I94O 2UXDO 1X59A 3RT3C 1HNWO 4X66O 4JI1O 4DUZO 2UU9O 1G1XB 2LW7A 1R1BA 4NXNO 4DR1O 2Z0AA 4LF6O 5LMNO 2DJVA 1N34O 2UUBO 3O65A 4DR5O 4LFBO 4B3MO 1D2DA 1XNQO 4DV5O 4JI2O 1IBMO 4DV6O 4LF5O 1R6TA 4DV2O 4X65O 1IBLO 4JI3O 3OTOO 2UXCO 2DOSA 3J7AU 2FKXA 4LF8O 4DR2O 3SDLA 2UUCO 2VQEO 4DV0O 2N74A 4DV4O 4JI8O 4LF7O 4DR6O 4A5UB 2AGAA 1XMOO 1AB3A 4DV7O 4DR3O 3R66A 1HNZO 1KUQA 1N36O 1N32O 3T1YO 4JV5O 1XEQA 4OPAA 4JI4O 3M8AA 3JAMN 4K0KO 3F5TA 5BXZA 4LF4O 1XMQO 1IBKO 4LFCO 1YZBA 4NXMO 5FLXN 1FJGO 4B3TO 4JI0O 2UUAO 1HNXO 4GKJO 4OX9O 1FYJA 4OPHA 2ZM6O 2F4VO 5H5NA 2ZKOA 5IT9N 2UXBO 1XNRO 4DV1O 3T1HO 1A32A 4YHHO 2JRIA 4X64O 4YY3O 4JYAO 4JI7O 5IWAO 2HHHO 4LF9O 2E5LO
chains in the Genus database with same CATH superfamily
5J2TB 3RW0A 4LFAO 3ZRWA 5JH7B 3R65A 4AI8A 3LNMB 2QKAA 4B3RO 2VWJA 1IX9A 3OTOB 3Q4HA 5JCOC 3E8BA 2LGWA 1S77D 2DYSB 1WB7A 3ZRSA 3DC5A 3KCYA 4CS2A 4DR3B 5TISZ 3T1YB 1GN2A 1I08A 1FS0G 3CCMV 2UU9O 5H2FZ 4G2KA 2ZIOA 4JI0B 3OM3B 3LSSA 3O65A 3O9OA 2A79B 2Y69C 2YIBA 4DV1B 4NYKA 1RPOA 3RGBA 2GSMB 1SA0B 2NNUA 3ABKB 4QGPA 1VQOV 3FB8C 2BTQA 2NN4A 3RYCB 3J7AU 5JJJB 4DV0O 2IU0A 3H01A 4DV4O 1WPXA 2YSUB 1B6QA 1N33B 3K57A 1XMOO 1AB3A 1WP7A 1KKDA 1KP3A 1NT2B 3K08A 5LA6B 2JDIG 1N0NA 1EZJA 4QPJA 3VQWA 2LFSA 1VP7A 1PP9H 5BXZA 3HPLC 3OUSA 4O4HA 2E75B 4DUYB 3OTFA 1DTOA 4K35A 3P3PA 4YXWG 4JI6B 4ZIBA 2WLLA 5B66Z 5KAIZ 1MABG 4GZRB 3ZHUA 3VQXA 2YC0A 5IDJA 3OT7A 1MSDA 5LP6A 3CHXA 1WN7A 3HB3B 4I5SA 5A9GA 4MVMA 1Q8IA 1IXBA 2CUGA 3ZJZA 4AHCA 3TETA 3RYFA 1BGYH 2CH7B 1AILA 1IBLB 2UXCB 1SQPH 2CGOA 3K9AA 3OMAB 5IYBO 1FKAO 1XL4A 4GX5A 3F5WC 5JVDB 4TSFG 1Q6HA 1QR8A 2ITDC 3I55V 1ZLZA 3ZN1A 2XAGA 1YXBA 3K04A 2P67A 2XASA 4X1IA 2ZXWB 2BE3A 1TGOA 1UPGA 1VF6A 1LNQA 4K3AA 5KHKA 3ZX6A 1W2BU 2Y4TA 1FXKA 2A9HA 4TV9A 3OTOO 4LF9B 5EIBD 4DXWA 4LNUA 2XAFA 5LXTB 3JCUZ 3QTCA 1MOFA 4RO2A 5HFLA 3QNEA 4MVSA 3SPCA 3K59A 2AGAA 2JEXA 2HVKC 4DR3O 3B2EE 2R9IA 2NLJC 1KUQA 3ABUA 3T1YO 2YI9A 2FL4A 4ZI7B 2PGGA 2ZT9B 5JQGA 3F5TA 5LHIA 4FFKA 1R3LC 2HKOA 2OT5A 1H8HG 4BIUA 1NQTA 4I0XA 2P7TC 4OXSA 4JI0O 5EZYA 1M4UA 4MTGA 4OPHA 1Y74B 2QTSA 4G27B 2Q6AA 1S5HC 4FPPA 3BA9A 3P32A 4DV1O 4GX0A 3SJCC 3CXCU 3OR7C 1H2MA 4JTDB 5D5PA 2WA3A 4DUZB 2DYRC 2EILB 2CTRA 2RQ6A 3W7XA 3ZHTA 1PL0A 1DLBA 3AG2C 1W0JG 3QG5A 3LDDA 1N33O 2Q69A 4QE7A 5J2UA 1AP6A 4F4LA 2X6CA 1E1RG 4UFZA 3TK1A 1RPRA 4FK5C 4MVOA 1DK1A 3ZMVA 1M56C 4DUYO 1Y4MA 2JVDA 3FB7C 3CJHB 3K5OA 1M57B 3ZHQA 3ASOB 4JI6O 1R6KA 4R8CA 1X59A 1WA8A 1OZ0A 3JALA 3AG1B 2EULA 2UXXA 2HJDA 4X1YB 3JYCA 4F6RB 2BSKB 2QWQB 1OCRC 4YHHB 1H2LA 1D2DA 1Q5OA 3SJBC 1IBLO 2VRZA 2UXCO 3ZHVA 2QWNB 3MDSA 3B8NA 1O9GA 2QWRB 5EC1C 1AVMA 3RVZA 4GUNA 3OUFA 4X8AA 5LP6C 4EEQA 3ETQA 3SPIA 1VQ5V 2YEVB 1ORQC 4B3SB 1K73W 2EINC 1K4DC 3JD3A 4LCUC 1PNMA 2IM9A 1FYJA 4KUMA 4H13B 4O2BB 4JF3A 5GW7A 3ZMZA 4W4KA 1I94B 3AG3B 3K06A 4BIOA 5IJ9B 4J7JA 1Q86W 2CE4A 3JD2A 3K0GA 4LF9O 3JD1A 2BOCC 3JATA 4I4TB 1PL4A 3SYOA 1EN4A 3T2MA 2X0LA 1VF6C 4ZOLA 4JI2B 2XNDG 1URFA 3OW2U 4X65B 2OCCB 4MVZA 5B1NA 3CPWU 4DR2B 1FXKC 1YJWV 4JI8B 2O57A 4MW3A 1Q90D 1WLEA 3F7VC 1JR9A 2F43G 1YTFD 4JTCB 3ZEDA 4TWKA 3SGIA 4KHPB 1QBZA 4DUZO 4DR4B 2WLIB 1K5QA 1R1BA 3IC7A 5B1BB 2ZR3A 3C3SA 3CE2A 2WA4A 3ZRXA 5AG2A 4WBNB 1O9HA 3FAVA 2YI8A 5CN0A 5KMGB 1JMKC 4YY3B 3GWOA 4J7KA 2CK3G 1OCOC 4PA7A 1MMMA 3N2KB 4Q20A 2JK5C 4JTAB 2QEXV 1Y6XA 3SR2C 3CCVV 2C2AA 3KZIZ 3SJAC 1BS3A 1G6UA 2DQ3A 2Y48A 2EX3A 1I5YA 1QLNA 3JSLA 1NU1H 2KG7A 5KUMA 4PA3A 1NKDA 3IGAC 5IT9N 3ZS8C 3LDCA 1FFXB 4YHHO 1P4RA 4CBCA 3AG4B 2ETNA 3K0DA 4FZ0A 3RYIB 3CX5F 3RYHB 3BCCH 5FL7G 3N2GA 1VQ6V 5IYZB 3ABLC 1H2NA 2A7WA 3OD4A 2Q73A 1BQ0A 3B40A 1OCCC 1QU7A 4LF5B 1VF5B 4JI3B 4B3SO 3HKCA 3SYAA 4QPKA 1YCIA 4EB6A 1FD9A 4IGGA 1YHQV 2PI5A 1N32B 1I94O 4J42A 1XMQB 4J9YB 1HWYA 5D5QA 4EFBA 3CC7V 2WPDG 3AEIA 2AHZA 2GV9A 4RUFA 4FM0A 4EFEA 1XDCA 2AZ0A 3EFFK 3OFNG 4PI0A 2QTOA 4JI2O 4X65O 1EFRG 2DOSA 2VS0A 5C8YA 4TUYB 3FB6C 4DR2O 1YVWA 4JI8O 1PD3A 1MZFA 3BRCA 2XAJA 4BWAA 1EBOA 1JVMA 5H6RA 4U7NA 1I0HA 3JAKB 2QWOB 3CC2V 5CB4A 4OPAA 4DV3B 2EIMB 3HKEB 4O4JB 3F7YC 2GDSA 3TGUH 2EZOA 2ZKOA 1QLEC 3GB7C 3UO2A 3ZN0A 5K1XA 3W7SA 3G6EV 1TVKA 4YY3O 5CA1A 4PJ0Z 1WAZA 2EJRA 2ODMA 4NR1A 4JASA 1SQQH 4MVQA 3RBZA 4ZKIA 2F23A 4ASUG 1Z5VA 3EHBB 3QO5A 3PJSK 1SZTA 3T4ZA 2OWOA 3UQ8A 1QHTA 5JJEB 4O4LA 4X1KA 5ITZB 3W7WA 5KHJA 4J41A 1AP5A 1R73A 2ZE5A 1JQ0A 4DR6B 3EVKA 1K33A 2Z5UA 3OGIB 2YIBD 5B3SC 2FTKA 3AG7A 1KMIZ 3VQYA 1IBKB 4NXMB 2WLKA 1NI8A 3BPZA 3CSXA 4O2AB 4ICGA 2F4VB 1ZL8A 3CCEV 3LNNA 4PHZA 3QO8A 4DW1A 3SPJA 3ZRVA 4JYAB 5J2TA 4JI7B 4LF5O 2JGDB 2CTWA 4UB6Z 4L87A 4JI3O 5JH7A 3BABA 2E5LB 4YJ3B 4IL6Z 3H1KH 4HBNA 1M9NA 2EJ7A 1JCHA 3OEEG 1Y76B 2NR5A 3QF7A 4A5UB 4X62B 3C90A 3DTUB 4GKKB 1N32O 5KX5B 2P6JA 2XOKG 1RSOB 1MG1A 3WG7C 3E8FA 4NTXA 4DR7B 4O4IB 2Q9LA 5LOVB 1XMQO 1QVGU 2EIJB 4B7KA 4MTXA 3PN1A 2PTMA 2PY5A 1SS3A 4UVBA 2QKCA 3E83A 1HNWB 3L71H 4PELA 4FLUA 1MSWD 3W7UA 1T5EA 4J7ZA 1RM1C 5CA3A 3K5NA 4LF6B 3AK2A 1DF4A 1SA0A 1IXMA 1R3JC 2G38A 2IH3C 4YIPA 2Z3YA 4LFBB 4FLYA 2H8PC 2AXTZ 5KHGA 5A2QN 3RYCA 4DV5B 3P30A 3ETDA 4R6ZA 2DMXA 2WLLB 3NXSA 1NVPD 1SESA 1VQMV 3J81N 4DV3O 1PPJH 5LA6A 4HZ3A 1SQFA 4I50B 4DV7B 1BQZA 4MW8A 3CD6V 1GO3F 4HNAB 4UCOA 5GONB 4JV5B 2JS5A 4RAIA 1Q6IA 4E2LA 2ZINA 2FMLA 3DC6A 2YUAA 2CTQA 2IJJA 5EC2C 3T1CA 5IY5C 2ZQMA 3ZMUA 1XNRB 4U3JB 4FJCC 2N05A 3T1HB 3K79A 5BMVB 1UJWB 4X89A 3MD0A 2AZ2A 1NVPB 2GTSA 2EIKC 1YJ9V 3SYQA 3CCJV 3ML0A 3AK1A 3OGCC 3ZCCA 4E4EA 2CH7A 1YITV 4N21A 4DR6O 1WB8A 4RWUA 2LJ2A 1XREA 3ASNC 1P7GA 4IYHA 2P4VA 4NVPA 2YXLA 4UV8A 2B5UA 1BSMA 1IBKO 4NXMO 1ZTEA 2OYQA 4JI5B 4NTWA 4I55A 2DE0X 4FFBB 5LMUB 2F4VO 4QE9A 1FPOA 3OMNB 1J95A 1K9MW 2VQEB 4JYAO 1KBHA 4JI7O 1Y66A 2XT9A 1Q81W 1IDSA 4NXNB 4DR1B 2E5LO 4MSWC 1HW7A 1JOYA 1AI4A 4Q6GA 5EZYB 4PA6A 1BZKA 3ABMC 3UT5B 3SPGA 4DK1A 5LXTA 2Q5ZA 4X62O 4GKKO 2XHBA 1BE3H 3B8MA 2IJKA 5C93A 2YXYA 3FYIB 4DR7O 4JGSA 4YJ2B 1D5AA 1QR9A 4BW5A 4KXRA 4TQDA 1N36B 5LHHA 3QO7A 4H33A 1K92A 1PNKA 1V9PA 1PNLA 1HNWO 4LF4B 5EBMC 1Y74A 1GM8A 1W59A 2DYSC 1NZ6A 1HNXB 1XILA 4U3FH 4OX9B 4LF6O 1M5IA 4AILC 4LFBO 1NR1A 4LWSB 2L35A 4JYCA 4DV5O 3A0BZ 1F4NA 4UV9A 5H9CA 3ABLB 4Z2WA 2ZR2A 1BL8A 2BTOA 2LQTA 4D7SA 1NTZH 1OHHG 4DV7O 3JD4A 1E79G 3ABKC 4GX1A 5JJNB 4JV5O 1Q43A 1XEQA 3M8AA 3CJHA 1NH2D 1HR0B 1OV9A 4FIPC 4DV2B 1PKXA 2H3OA 1L8DA 3L74H 4ZBMA 1NTKH 1EN6A 1XNRO 3L9DA 3ZIAG 1K4CC 3KKYA 3T1HO 4NB5A 3L70H 2RCVA 5BZBA 2BSKA 1K97A 3ICXA 3ETGA 2UUBB 3BFRA 1NS1A 5JWPA 1AI7A 1YIJV 2Q4PA 4R7CA 4DV6B 1XHZA 2GHYA 1SQVH 3JASB 3EXAA 3GVMA 4LF8B 2QKSA 1I7FA 4IIJA 2WLNA 2YEVA 2ADQB 5DM6V 2YS8A 4JI5O 1XHXA 4YIOA 1V54C 5LMUO 1GTOA 2LFRA 3CXHF 4IYIA 1DF5A 4FLVA 2DQ0A 4IT5A 4B7EA 4O2BA 4FLTA 3D3QA 2LW7A 4NXNO 4DR1O 2Y0IA 4XDJA 2ZM6B 5IJ9A 3CWBH 2Y4UA 5LGNA 1KQSU 1Z5WA 3OMIB 2JJ2G 2GBOA 5LYJB 3A8TA 5CBFA 4I4TA 2MK3A 2RMKB 4IHJB 5CBGA 2W0FC 4FZ1A 2QJ1A 2B1GA 2ARHA 2EBOA 3U0ZA 2OTLV 2ITCC 3K03A 4HYOA 2WLJA 4H44B 4I7ZB 3K58A 1WPBA 1SERA 4DO2A 3L75H 4CH6A 4AQYB 1N36O 4TOIA 1BHAA 3CMAV 2HFEC 3JAMN 4LF4O 3WFVA 5KHHA 1HNXO 4LC1A 4OX9O 1TUBB 4WFEA 2ZCEA 1MNGA 2WLIA 3IFXA 4DW0A 3I5DA 4JI1B 3CYOA 3BA8A 4PD4F 2ZE7A 4WBNA 4ABMA 2Q67A 1YTFB 4RUEA 2QM4A 5KMGA 4CS3A 1XI1A 1GM7A 4DR5B 3G67A 4MS2A 3N2KA 2F95B 4B3MB 1TUEB 1XNQB 1R3KC 5CA0B 1IBMB 2EILC 4JZGA 3RWRD 3NR7A 1P49A 2K9PA 4WFFA 1BT8A 2F93B 1GN4A 1TAEA 4H37A 2OIGA 1HR0O 1NR7A 3RFRA 3N2GB 3CRCA 3WB1A 5LL6Y 2Y69B 1ENVA 3BAAA 3RVYA 4JYBA 4JI4B 3H1IH 4UVCA 4QNHB 4FLXA 4MTOA 2M6YA 5EYPB 4QIWF 3OR6C 2HJFC 4PDLA 3JAWB 1G1XB 4B3TB 1US6A 2UUAB 1FFXA 4B3RB 4XBFA 4EB6B 1FAFA 1WP8A 3HKBB 2UUBO 1M57C 1JX9A 1F23A 2QGNA 4I9QA 3ASOC 3DSQA 3RYIA 2FB5A 3KG2A 3RYHA 3ETEA 2HVJC 3IAYA 5IYZA 1RM1B 4DYLA 4DV6O 3U11A 2X7RB 1COWG 2PUSA 2QA4V 4LF8O 1MZEA 3D8CA 1GN3A 4Z1MG 2CGNA 1CEZA 1H8EG 1V55C 3JARB 5B1AC 4PA9A 1HP8A 3ABTA 1SETA 4UUJC 4ZHQB 3M99B 4FM1A 4GT1A 4FLWA 4J9ZB 2HP8A 5C8YB 1VQ7V 1VQKV 3ZHSA 2VWKA 3APQA 2ZM6O 2A06H 5IJ0B 3G6BA 4X20A 4P9OA 5KUKA 2WWWA 3LSUA 1IURA 1WNSA 1ROPA 4N23A 2WLMA 1XMOB 4KHPO 2BOBC 1Q7YW 3CCUV 1K8AW 1AI6A 4DR4O 1KECA 3AG3C 5B5EZ 3I56V 1VQ9V 4TUYA 1S5JA 4U7OA 4AQYO 2EIKB 4GX2A 5F2VO 4K8XA 1JFFB 3E22A 3DXRA 4PDRA 5BY1A 2ZDIA 4CS4A 3A2FA 5FNVB 4BR6A 4B08A 3HKDB 3S3XA 2OIEA 4UCVA 2OCCC 1QNMA 2Q7GA 3HKEA 2GUZB 4DRXA 4FM2A 4O4LB 4X1KB 4JI1O 1JJOA 1AR1B 4TV8B 3D36A 1H2GA 3GWKC 2UXBB 3K5MA 3OE7G 4DR5O 4NKGB 4B3MO 4X64B 1XNQO 3X2QC 1IBMO 4P2ZA 3ZRWB 5B1BC 3STZC 2PF4E 2PI4A 1Y67A 5BR8B 5CBHA 2WLHA 1FXHA 1K3EA 2IW5A 3Q4HB 5ITZA 2E76B 3P3NA 2BCCH 1EN5A 3WB0A 2CTPA 5E1AC 1QQCA 2YICA 4JI4O 1X4TA 2ZD9A 1SKVA 1N4CA 3ZMTA 1VARA 3JD0A 1YSCA 2DYRB 2DWDC 1KU9A 3SPHA 2LW1A 3K5LA 1YEWA 5GTHZ 2UUAO 4B3TO 4CC6A 3AG2B 2UXDB 4O2AA 1Q3EA 1IVSA 2QM8A 5KLVH 5CMUA 1XUQA 3TXQA 1I5XA 2P4KA 3THOA 1GMGA 4LR3A 2WAMA 1B3QA 4CC5A 4MVRA 5LGTA 2JGDA 1AR5A 1M56B 4JAAA 2BTQB 4YJ3A 2B9ZA 3VQVA 1M1KW 3AG4C 2HLDG 3G4SV 5B1OA 1Y76A 2QWPB 3B77A 1ZX3A 2UUCB 4PI2A 2F66C 2V4DA 2R9RB 1Q6UA 4JAVA 5HFMA 3S3WA 5KX5A 2KQXA 1RSOA 4LH7A 1VIBA 4O4IA 4O4HB 5LOVA 1KB9F 1OCRB 1JA8A 3L72H 1SZXA 2OTJV 1G8MA 3RT3C 2QE7G 4QJFB 5LHGA 3BVOA 2YIAA 4CZZA 1Q82W 2FYUH 4KL1A 1CXZB 1VMGA 1SC5B 3CB2A 1VQLV 1ZUQA 4Z1VA 4CH4A 2HG5C 5K1PA 2JGUA 1KYOF 5LP6B 3C3TA 5IWAB 1R6TA 3B4SA 1YI2V 2CDYA 1KKCA 3JCZA 2EINB 3RYFB 2VQFB 4KFMA 2IU3A 2N74A 3FFQA 1UFIA 2ZE8A 4TQFA 2B1IA 2QDOA 5H6QA 3ZMSA 3E86A 1YDXA 4I50A 1VQ8V 4HNAA 1W0KG 5GONA 3W7TA 4F6EA 2YDEA 1SQGA 4X1IB 1L0LH 1V54B 1R6NA 2ZDIC 4J10A 3AK3A 3FX7A 2JEUA 2UXBO 4TT3G 1BHBA 4KP4A 4D6TH 4FMTA 1A32A 4NTYA 4X64O 2EIMC 3A0RA 3CCSV 5JVDA 4U3JA 4JPRA 4P30A 1ZWIC 2R72A 1R3IC 5LMNB 5BMVA 1N34B 2V1DA 1FXKB 5BR8O 3IJ4A 2XTAA 1M90W 4TV9B 2Y0PA 2Q68A 4I55B 3D36C 4LNUB 2KB1A 1AJNA 3E89A 5L3GA 4G28B 3CP1A 4XDLA 3T4DA 1E1QG 1ZSPA 1XOUA 1KC8W 3H1LH 3H9VA 2HR3A 5JQGB 3G80A 2X6AA 4I0XB 5IYCO 2UXDO 1AI5A 5GTIZ 4FFBA 3FYEB 1OCZC 1OCOB 3G71V 2UXNA 1FJGB 2DN9A 2Q7EA 3UKMA 3CRRA 1JPXA 1S0VA 1PV0A 3B09A 5J9PC 1HDJA 1THZA 4ZI7A 4PDMA 1H38A 1FXVA 1VQ4V 1K5SA 2CAZC 2IBZH 2DWEC 5L3DA 5DN6G 2DW4A 1AJPA 3UT5A 4FVMA 2YIDA 5J2UB 2HEPA 2UUCO 2A0LA 3APOA 1TA8A 4JYYA 3N27A 4GYCB 3H1HH 2XUMA 2E74B 4YJ2A 2RN9A 4WFBV 2PYJA 5FPOA 1LUWA 1L1FA 4WFHA 1AROP 1SF9A 1VF7A 3L73H 1WA8B 4L8JA 5EBWC 1CP9A 2QSAA 2R70A 3JALB 1S5LZ 2A3QA 4HAMA 1GM9A 3VOUA 4X66B 1OCCB 1L0NH 5IWAO 2P5OA 1NBMG 5KA5A 1PM9A 1RP3B 3CC4V 2EIJC 2W6JG 3WU2Z 1D5NA 5DECA 4LWSA 2VQFO 1F4MA 4WCEV 1XBLA 1NTMH 3STLC 1U96A 5L3CA 1N0JA 1KD1W 4UB8Z 4XDKA 3TXSA 4C7UA 3J80N 2KKWA 2OCHA 3CCRV 4X1YA 1SQBH 4F6RA 1N8RW 1AR4A 4MTFA 1V55B 2D2CB 3BY6A 4K8ZA 5B1AB 3TCUA 1EM1A 1H2KA 2F1MA 2Q8VA 2JIZG 4X9QA 1ZAUA 4K0KB 5E79Z 4LFCB 3IC9A 2X6BA 3FB5C 3CRAA 2ATKC 5L3FA 3MHSC 4IIJB 2Q0AA 5LMNO 1N34O 1LR1A 4EKWA 1NH2B 1B06A 1Z2GA 3TJTA 1KP2A 4PV1B 3JATB 2WSSG 2RDCA 5DEDA 1VEWA 2ZNJA 2K1EA 2V7QG 4ZOLB 3LUTB 4LH6A 2W0XA 3SDLA 2VQEO 4LP8A 3JASA 3ZHRA 3CRQA 2D3OW 1H2SB 1QLEB 2XAQA 3DGEA 1VQNV 2LO1A 4PA4A 2ZXWC 5LGUA 5FLXN 2N04A 1FJGO 3FD9A 1J5EB 5H5NA 3SYPA 1BCCH 1OJHA 2JRIA 2Q7HA 3LDEA 2E3CA 4UVAA 1VQPV 3LSQA 3FAVB 5LYJA 4JAUA 2GTAA 1GKFA 4IHJA 1F7YA 1M93A 1SQXH 3UM7A 3X2QB 1P84F 5B3SB 3CCQV 2IJIA 5EBLC 3WB2A 5IE9A 2RJZA 3MHHC 4JZ2A 4LF7B 1LUVA 2JJ1G 1B04A 1K34A 4UCRA 1HNZB 2L6LA 3D3IA 4MVUA 2KG7B 1TUBA 4X66O 5KA6A 1CPYA 3BEHA 5L3BA 4GKJB 1YF2A 2Z0AA 5EIBC 5EK0A 2DJVA 4UCUA 2QR4A 1DGSA 4X88A 3QVNA 4P9PA 1K7DA 1G4YB 5JCOA 3E8GA 4MT8A 4RQFA 4DV2O 1WJZA 2XAHA 2HHHB 3WG7B 3FKSG 2FKXA 5CA0A 4LFAB 4DK0A 2LGQA 2EZPA 3HKCB 3JSNA 3K3WA 2MW2B 3R66A 1GN6A 4UCSA 3BHPA 4CH5A 4K0KO 2LP7A 3AG1C 2P90A 5KAFZ 1YZBA 4LFCO 1XQ8A 4GCZA 2IH1C 2Q0OC 4PDVA 5EYPA 1F51A 3JAWA 4WF9V 1EZVH 1MA1A 1S3JA 3OEHG 1S76D 1AJQA 1NJIW 3HKBA 2UU9B 4BIZA 4H0LB 3VBBA 1QCEA 2YXHA 5LBQA 4GLXA 2RNBA 4X20B 3H1JH 3SYCA 3CCLV 2IJHA 5L3EA 3E8HA 2JS3A 4DV0B 4DV4B 3JARA 1JJ2U 3MAQA 5CB4B 1J5EO 2AHYA 5IY5B 4ZHQA 3E2EA 4BAYA 2ZNIA 2R9AA 4WFGA 2ZIMA 3A0HZ 5IJ0A 3E35A 3E22B 3DXRB 4FLZA 1TVKB 1QVFU 1GK9A 3SJQC 5CA1B 1GRJA 1YJNV 3ZBHA 1SRYA 3JAKA 3M7MX 3RN4A 3OAAG 1S72V 4BW9A 1FFTB 3CS5A 1BMFG 1U97A 3CMEV 3ASNB 4DRXB 3KCXA 4CH3A 2M7WA 4J11A 4O4JA 3UO3A 3UCSC 4UCTA 4W4LA 4LF7O 1JFFA 5KHIA 4UXNA 1HNZO 1GH6A 3CRMA 2AW9A 5FNVA 2PYLA 4WFAV 3K9SA 1XL6A 2P22C 3U10A 3HKDA 4OGQB 5IYDO 2ZE6A 4I9WA 4J80A 1GAXA 2GUZA 2W6IG 4GKJO 1IZ3A 3HR0A 4TV8A 2QM7A 2P06A 2H94A 2KSDA 3ABMB 5FPRA 1OCZB 2ADPA 4RQEA 1ZL8B 2PZSA 1RFYA 2ILMA 4D7TA 1P7BA 4R50A 2HHHO 3CEIA 4LBEC
chains in the Genus database with same CATH topology
2VQFO 1NS1A 4LFAO 5BR8O 4KHPO 1F7YA 4DR4O 5A2QN 1N33O 4B3RO 4X62O 1AILA 4GKKO 4AQYO 4B3SO 3J80N 1FKAO 3J81N 5BY1A 1DK1A 4DR7O 4DV3O 4DUYO 1HR0O 4JI5O 1J5EO 5LMUO 5LL6Y 4JI6O 1I94O 2UXDO 1X59A 3RT3C 1HNWO 4X66O 4JI1O 4DUZO 2UU9O 1G1XB 2LW7A 1R1BA 4NXNO 4DR1O 2Z0AA 4LF6O 5LMNO 2DJVA 1N34O 2UUBO 3O65A 4DR5O 4LFBO 4B3MO 1D2DA 1XNQO 4DV5O 4JI2O 1IBMO 4DV6O 4LF5O 1R6TA 4DV2O 4X65O 1IBLO 4JI3O 3OTOO 2UXCO 2DOSA 3J7AU 2FKXA 4LF8O 4DR2O 3SDLA 2UUCO 2VQEO 4DV0O 2N74A 4DV4O 4JI8O 4LF7O 4DR6O 4A5UB 2AGAA 1XMOO 1AB3A 4DV7O 4DR3O 3R66A 1HNZO 1KUQA 1N36O 1N32O 3T1YO 4JV5O 1XEQA 4OPAA 4JI4O 3M8AA 3JAMN 4K0KO 3F5TA 5BXZA 4LF4O 1XMQO 1IBKO 4LFCO 1YZBA 4NXMO 5FLXN 1FJGO 4B3TO 4JI0O 2UUAO 1HNXO 4GKJO 4OX9O 1FYJA 4OPHA 2ZM6O 2F4VO 5H5NA 2ZKOA 5IT9N 2UXBO 1XNRO 4DV1O 3T1HO 1A32A 4YHHO 2JRIA 4X64O 4YY3O 4JYAO 4JI7O 5IWAO 2HHHO 4LF9O 2E5LO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQF O;  1NS1 A;  4LFA O;  5BR8 O;  4KHP O;  1F7Y A;  4DR4 O;  5A2Q N;  1N33 O;  4B3R O;  4X62 O;  1AIL A;  4GKK O;  4AQY O;  4B3S O;  3J80 N;  1FKA O;  3J81 N;  5BY1 A;  1DK1 A;  4DR7 O;  4DV3 O;  4DUY O;  1HR0 O;  4JI5 O;  1J5E O;  5LMU O;  5LL6 Y;  4JI6 O;  1I94 O;  2UXD O;  1X59 A;  3RT3 C;  1HNW O;  4X66 O;  4JI1 O;  4DUZ O;  2UU9 O;  1G1X B;  2LW7 A;  1R1B A;  4NXN O;  4DR1 O;  2Z0A A;  4LF6 O;  5LMN O;  2DJV A;  1N34 O;  2UUB O;  3O65 A;  4DR5 O;  4LFB O;  4B3M O;  1D2D A;  1XNQ O;  4DV5 O;  4JI2 O;  1IBM O;  4DV6 O;  4LF5 O;  1R6T A;  4DV2 O;  4X65 O;  1IBL O;  4JI3 O;  3OTO O;  2UXC O;  2DOS A;  3J7A U;  2FKX A;  4LF8 O;  4DR2 O;  3SDL A;  2UUC O;  2VQE O;  4DV0 O;  2N74 A;  4DV4 O;  4JI8 O;  4LF7 O;  4DR6 O;  4A5U B;  2AGA A;  1XMO O;  1AB3 A;  4DV7 O;  4DR3 O;  3R66 A;  1HNZ O;  1KUQ A;  1N36 O;  1N32 O;  3T1Y O;  4JV5 O;  1XEQ A;  4OPA A;  4JI4 O;  3M8A A;  3JAM N;  4K0K O;  3F5T A;  5BXZ A;  4LF4 O;  1XMQ O;  1IBK O;  4LFC O;  1YZB A;  4NXM O;  5FLX N;  1FJG O;  4B3T O;  4JI0 O;  2UUA O;  1HNX O;  4GKJ O;  4OX9 O;  1FYJ A;  4OPH A;  2ZM6 O;  2F4V O;  5H5N A;  2ZKO A;  5IT9 N;  2UXB O;  1XNR O;  4DV1 O;  3T1H O;  1A32 A;  4YHH O;  2JRI A;  4X64 O;  4YY3 O;  4JYA O;  4JI7 O;  5IWA O;  2HHH O;  4LF9 O;  2E5L O; 
#chains in the Genus database with same CATH topology
 5J2T B;  3RW0 A;  4LFA O;  3ZRW A;  5JH7 B;  3R65 A;  4AI8 A;  3LNM B;  2QKA A;  4B3R O;  2VWJ A;  1IX9 A;  3OTO B;  3Q4H A;  5JCO C;  3E8B A;  2LGW A;  1S77 D;  2DYS B;  1WB7 A;  3ZRS A;  3DC5 A;  3KCY A;  4CS2 A;  4DR3 B;  5TIS Z;  3T1Y B;  1GN2 A;  1I08 A;  1FS0 G;  3CCM V;  2UU9 O;  5H2F Z;  4G2K A;  2ZIO A;  4JI0 B;  3OM3 B;  3LSS A;  3O65 A;  3O9O A;  2A79 B;  2Y69 C;  2YIB A;  4DV1 B;  4NYK A;  1RPO A;  3RGB A;  2GSM B;  1SA0 B;  2NNU A;  3ABK B;  4QGP A;  1VQO V;  3FB8 C;  2BTQ A;  2NN4 A;  3RYC B;  3J7A U;  5JJJ B;  4DV0 O;  2IU0 A;  3H01 A;  4DV4 O;  1WPX A;  2YSU B;  1B6Q A;  1N33 B;  3K57 A;  1XMO O;  1AB3 A;  1WP7 A;  1KKD A;  1KP3 A;  1NT2 B;  3K08 A;  5LA6 B;  2JDI G;  1N0N A;  1EZJ A;  4QPJ A;  3VQW A;  2LFS A;  1VP7 A;  1PP9 H;  5BXZ A;  3HPL C;  3OUS A;  4O4H A;  2E75 B;  4DUY B;  3OTF A;  1DTO A;  4K35 A;  3P3P A;  4YXW G;  4JI6 B;  4ZIB A;  2WLL A;  5B66 Z;  5KAI Z;  1MAB G;  4GZR B;  3ZHU A;  3VQX A;  2YC0 A;  5IDJ A;  3OT7 A;  1MSD A;  5LP6 A;  3CHX A;  1WN7 A;  3HB3 B;  4I5S A;  5A9G A;  4MVM A;  1Q8I A;  1IXB A;  2CUG A;  3ZJZ A;  4AHC A;  3TET A;  3RYF A;  1BGY H;  2CH7 B;  1AIL A;  1IBL B;  2UXC B;  1SQP H;  2CGO A;  3K9A A;  3OMA B;  5IYB O;  1FKA O;  1XL4 A;  4GX5 A;  3F5W C;  5JVD B;  4TSF G;  1Q6H A;  1QR8 A;  2ITD C;  3I55 V;  1ZLZ A;  3ZN1 A;  2XAG A;  1YXB A;  3K04 A;  2P67 A;  2XAS A;  4X1I A;  2ZXW B;  2BE3 A;  1TGO A;  1UPG A;  1VF6 A;  1LNQ A;  4K3A A;  5KHK A;  3ZX6 A;  1W2B U;  2Y4T A;  1FXK A;  2A9H A;  4TV9 A;  3OTO O;  4LF9 B;  5EIB D;  4DXW A;  4LNU A;  2XAF A;  5LXT B;  3JCU Z;  3QTC A;  1MOF A;  4RO2 A;  5HFL A;  3QNE A;  4MVS A;  3SPC A;  3K59 A;  2AGA A;  2JEX A;  2HVK C;  4DR3 O;  3B2E E;  2R9I A;  2NLJ C;  1KUQ A;  3ABU A;  3T1Y O;  2YI9 A;  2FL4 A;  4ZI7 B;  2PGG A;  2ZT9 B;  5JQG A;  3F5T A;  5LHI A;  4FFK A;  1R3L C;  2HKO A;  2OT5 A;  1H8H G;  4BIU A;  1NQT A;  4I0X A;  2P7T C;  4OXS A;  4JI0 O;  5EZY A;  1M4U A;  4MTG A;  4OPH A;  1Y74 B;  2QTS A;  4G27 B;  2Q6A A;  1S5H C;  4FPP A;  3BA9 A;  3P32 A;  4DV1 O;  4GX0 A;  3SJC C;  3CXC U;  3OR7 C;  1H2M A;  4JTD B;  5D5P A;  2WA3 A;  4DUZ B;  2DYR C;  2EIL B;  2CTR A;  2RQ6 A;  3W7X A;  3ZHT A;  1PL0 A;  1DLB A;  3AG2 C;  1W0J G;  3QG5 A;  3LDD A;  1N33 O;  2Q69 A;  4QE7 A;  5J2U A;  1AP6 A;  4F4L A;  2X6C A;  1E1R G;  4UFZ A;  3TK1 A;  1RPR A;  4FK5 C;  4MVO A;  1DK1 A;  3ZMV A;  1M56 C;  4DUY O;  1Y4M A;  2JVD A;  3FB7 C;  3CJH B;  3K5O A;  1M57 B;  3ZHQ A;  3ASO B;  4JI6 O;  1R6K A;  4R8C A;  1X59 A;  1WA8 A;  1OZ0 A;  3JAL A;  3AG1 B;  2EUL A;  2UXX A;  2HJD A;  4X1Y B;  3JYC A;  4F6R B;  2BSK B;  2QWQ B;  1OCR C;  4YHH B;  1H2L A;  1D2D A;  1Q5O A;  3SJB C;  1IBL O;  2VRZ A;  2UXC O;  3ZHV A;  2QWN B;  3MDS A;  3B8N A;  1O9G A;  2QWR B;  5EC1 C;  1AVM A;  3RVZ A;  4GUN A;  3OUF A;  4X8A A;  5LP6 C;  4EEQ A;  3ETQ A;  3SPI A;  1VQ5 V;  2YEV B;  1ORQ C;  4B3S B;  1K73 W;  2EIN C;  1K4D C;  3JD3 A;  4LCU C;  1PNM A;  2IM9 A;  1FYJ A;  4KUM A;  4H13 B;  4O2B B;  4JF3 A;  5GW7 A;  3ZMZ A;  4W4K A;  1I94 B;  3AG3 B;  3K06 A;  4BIO A;  5IJ9 B;  4J7J A;  1Q86 W;  2CE4 A;  3JD2 A;  3K0G A;  4LF9 O;  3JD1 A;  2BOC C;  3JAT A;  4I4T B;  1PL4 A;  3SYO A;  1EN4 A;  3T2M A;  2X0L A;  1VF6 C;  4ZOL A;  4JI2 B;  2XND G;  1URF A;  3OW2 U;  4X65 B;  2OCC B;  4MVZ A;  5B1N A;  3CPW U;  4DR2 B;  1FXK C;  1YJW V;  4JI8 B;  2O57 A;  4MW3 A;  1Q90 D;  1WLE A;  3F7V C;  1JR9 A;  2F43 G;  1YTF D;  4JTC B;  3ZED A;  4TWK A;  3SGI A;  4KHP B;  1QBZ A;  4DUZ O;  4DR4 B;  2WLI B;  1K5Q A;  1R1B A;  3IC7 A;  5B1B B;  2ZR3 A;  3C3S A;  3CE2 A;  2WA4 A;  3ZRX A;  5AG2 A;  4WBN B;  1O9H A;  3FAV A;  2YI8 A;  5CN0 A;  5KMG B;  1JMK C;  4YY3 B;  3GWO A;  4J7K A;  2CK3 G;  1OCO C;  4PA7 A;  1MMM A;  3N2K B;  4Q20 A;  2JK5 C;  4JTA B;  2QEX V;  1Y6X A;  3SR2 C;  3CCV V;  2C2A A;  3KZI Z;  3SJA C;  1BS3 A;  1G6U A;  2DQ3 A;  2Y48 A;  2EX3 A;  1I5Y A;  1QLN A;  3JSL A;  1NU1 H;  2KG7 A;  5KUM A;  4PA3 A;  1NKD A;  3IGA C;  5IT9 N;  3ZS8 C;  3LDC A;  1FFX B;  4YHH O;  1P4R A;  4CBC A;  3AG4 B;  2ETN A;  3K0D A;  4FZ0 A;  3RYI B;  3CX5 F;  3RYH B;  3BCC H;  5FL7 G;  3N2G A;  1VQ6 V;  5IYZ B;  3ABL C;  1H2N A;  2A7W A;  3OD4 A;  2Q73 A;  1BQ0 A;  3B40 A;  1OCC C;  1QU7 A;  4LF5 B;  1VF5 B;  4JI3 B;  4B3S O;  3HKC A;  3SYA A;  4QPK A;  1YCI A;  4EB6 A;  1FD9 A;  4IGG A;  1YHQ V;  2PI5 A;  1N32 B;  1I94 O;  4J42 A;  1XMQ B;  4J9Y B;  1HWY A;  5D5Q A;  4EFB A;  3CC7 V;  2WPD G;  3AEI A;  2AHZ A;  2GV9 A;  4RUF A;  4FM0 A;  4EFE A;  1XDC A;  2AZ0 A;  3EFF K;  3OFN G;  4PI0 A;  2QTO A;  4JI2 O;  4X65 O;  1EFR G;  2DOS A;  2VS0 A;  5C8Y A;  4TUY B;  3FB6 C;  4DR2 O;  1YVW A;  4JI8 O;  1PD3 A;  1MZF A;  3BRC A;  2XAJ A;  4BWA A;  1EBO A;  1JVM A;  5H6R A;  4U7N A;  1I0H A;  3JAK B;  2QWO B;  3CC2 V;  5CB4 A;  4OPA A;  4DV3 B;  2EIM B;  3HKE B;  4O4J B;  3F7Y C;  2GDS A;  3TGU H;  2EZO A;  2ZKO A;  1QLE C;  3GB7 C;  3UO2 A;  3ZN0 A;  5K1X A;  3W7S A;  3G6E V;  1TVK A;  4YY3 O;  5CA1 A;  4PJ0 Z;  1WAZ A;  2EJR A;  2ODM A;  4NR1 A;  4JAS A;  1SQQ H;  4MVQ A;  3RBZ A;  4ZKI A;  2F23 A;  4ASU G;  1Z5V A;  3EHB B;  3QO5 A;  3PJS K;  1SZT A;  3T4Z A;  2OWO A;  3UQ8 A;  1QHT A;  5JJE B;  4O4L A;  4X1K A;  5ITZ B;  3W7W A;  5KHJ A;  4J41 A;  1AP5 A;  1R73 A;  2ZE5 A;  1JQ0 A;  4DR6 B;  3EVK A;  1K33 A;  2Z5U A;  3OGI B;  2YIB D;  5B3S C;  2FTK A;  3AG7 A;  1KMI Z;  3VQY A;  1IBK B;  4NXM B;  2WLK A;  1NI8 A;  3BPZ A;  3CSX A;  4O2A B;  4ICG A;  2F4V B;  1ZL8 A;  3CCE V;  3LNN A;  4PHZ A;  3QO8 A;  4DW1 A;  3SPJ A;  3ZRV A;  4JYA B;  5J2T A;  4JI7 B;  4LF5 O;  2JGD B;  2CTW A;  4UB6 Z;  4L87 A;  4JI3 O;  5JH7 A;  3BAB A;  2E5L B;  4YJ3 B;  4IL6 Z;  3H1K H;  4HBN A;  1M9N A;  2EJ7 A;  1JCH A;  3OEE G;  1Y76 B;  2NR5 A;  3QF7 A;  4A5U B;  4X62 B;  3C90 A;  3DTU B;  4GKK B;  1N32 O;  5KX5 B;  2P6J A;  2XOK G;  1RSO B;  1MG1 A;  3WG7 C;  3E8F A;  4NTX A;  4DR7 B;  4O4I B;  2Q9L A;  5LOV B;  1XMQ O;  1QVG U;  2EIJ B;  4B7K A;  4MTX A;  3PN1 A;  2PTM A;  2PY5 A;  1SS3 A;  4UVB A;  2QKC A;  3E83 A;  1HNW B;  3L71 H;  4PEL A;  4FLU A;  1MSW D;  3W7U A;  1T5E A;  4J7Z A;  1RM1 C;  5CA3 A;  3K5N A;  4LF6 B;  3AK2 A;  1DF4 A;  1SA0 A;  1IXM A;  1R3J C;  2G38 A;  2IH3 C;  4YIP A;  2Z3Y A;  4LFB B;  4FLY A;  2H8P C;  2AXT Z;  5KHG A;  5A2Q N;  3RYC A;  4DV5 B;  3P30 A;  3ETD A;  4R6Z A;  2DMX A;  2WLL B;  3NXS A;  1NVP D;  1SES A;  1VQM V;  3J81 N;  4DV3 O;  1PPJ H;  5LA6 A;  4HZ3 A;  1SQF A;  4I50 B;  4DV7 B;  1BQZ A;  4MW8 A;  3CD6 V;  1GO3 F;  4HNA B;  4UCO A;  5GON B;  4JV5 B;  2JS5 A;  4RAI A;  1Q6I A;  4E2L A;  2ZIN A;  2FML A;  3DC6 A;  2YUA A;  2CTQ A;  2IJJ A;  5EC2 C;  3T1C A;  5IY5 C;  2ZQM A;  3ZMU A;  1XNR B;  4U3J B;  4FJC C;  2N05 A;  3T1H B;  3K79 A;  5BMV B;  1UJW B;  4X89 A;  3MD0 A;  2AZ2 A;  1NVP B;  2GTS A;  2EIK C;  1YJ9 V;  3SYQ A;  3CCJ V;  3ML0 A;  3AK1 A;  3OGC C;  3ZCC A;  4E4E A;  2CH7 A;  1YIT V;  4N21 A;  4DR6 O;  1WB8 A;  4RWU A;  2LJ2 A;  1XRE A;  3ASN C;  1P7G A;  4IYH A;  2P4V A;  4NVP A;  2YXL A;  4UV8 A;  2B5U A;  1BSM A;  1IBK O;  4NXM O;  1ZTE A;  2OYQ A;  4JI5 B;  4NTW A;  4I55 A;  2DE0 X;  4FFB B;  5LMU B;  2F4V O;  4QE9 A;  1FPO A;  3OMN B;  1J95 A;  1K9M W;  2VQE B;  4JYA O;  1KBH A;  4JI7 O;  1Y66 A;  2XT9 A;  1Q81 W;  1IDS A;  4NXN B;  4DR1 B;  2E5L O;  4MSW C;  1HW7 A;  1JOY A;  1AI4 A;  4Q6G A;  5EZY B;  4PA6 A;  1BZK A;  3ABM C;  3UT5 B;  3SPG A;  4DK1 A;  5LXT A;  2Q5Z A;  4X62 O;  4GKK O;  2XHB A;  1BE3 H;  3B8M A;  2IJK A;  5C93 A;  2YXY A;  3FYI B;  4DR7 O;  4JGS A;  4YJ2 B;  1D5A A;  1QR9 A;  4BW5 A;  4KXR A;  4TQD A;  1N36 B;  5LHH A;  3QO7 A;  4H33 A;  1K92 A;  1PNK A;  1V9P A;  1PNL A;  1HNW O;  4LF4 B;  5EBM C;  1Y74 A;  1GM8 A;  1W59 A;  2DYS C;  1NZ6 A;  1HNX B;  1XIL A;  4U3F H;  4OX9 B;  4LF6 O;  1M5I A;  4AIL C;  4LFB O;  1NR1 A;  4LWS B;  2L35 A;  4JYC A;  4DV5 O;  3A0B Z;  1F4N A;  4UV9 A;  5H9C A;  3ABL B;  4Z2W A;  2ZR2 A;  1BL8 A;  2BTO A;  2LQT A;  4D7S A;  1NTZ H;  1OHH G;  4DV7 O;  3JD4 A;  1E79 G;  3ABK C;  4GX1 A;  5JJN B;  4JV5 O;  1Q43 A;  1XEQ A;  3M8A A;  3CJH A;  1NH2 D;  1HR0 B;  1OV9 A;  4FIP C;  4DV2 B;  1PKX A;  2H3O A;  1L8D A;  3L74 H;  4ZBM A;  1NTK H;  1EN6 A;  1XNR O;  3L9D A;  3ZIA G;  1K4C C;  3KKY A;  3T1H O;  4NB5 A;  3L70 H;  2RCV A;  5BZB A;  2BSK A;  1K97 A;  3ICX A;  3ETG A;  2UUB B;  3BFR A;  1NS1 A;  5JWP A;  1AI7 A;  1YIJ V;  2Q4P A;  4R7C A;  4DV6 B;  1XHZ A;  2GHY A;  1SQV H;  3JAS B;  3EXA A;  3GVM A;  4LF8 B;  2QKS A;  1I7F A;  4IIJ A;  2WLN A;  2YEV A;  2ADQ B;  5DM6 V;  2YS8 A;  4JI5 O;  1XHX A;  4YIO A;  1V54 C;  5LMU O;  1GTO A;  2LFR A;  3CXH F;  4IYI A;  1DF5 A;  4FLV A;  2DQ0 A;  4IT5 A;  4B7E A;  4O2B A;  4FLT A;  3D3Q A;  2LW7 A;  4NXN O;  4DR1 O;  2Y0I A;  4XDJ A;  2ZM6 B;  5IJ9 A;  3CWB H;  2Y4U A;  5LGN A;  1KQS U;  1Z5W A;  3OMI B;  2JJ2 G;  2GBO A;  5LYJ B;  3A8T A;  5CBF A;  4I4T A;  2MK3 A;  2RMK B;  4IHJ B;  5CBG A;  2W0F C;  4FZ1 A;  2QJ1 A;  2B1G A;  2ARH A;  2EBO A;  3U0Z A;  2OTL V;  2ITC C;  3K03 A;  4HYO A;  2WLJ A;  4H44 B;  4I7Z B;  3K58 A;  1WPB A;  1SER A;  4DO2 A;  3L75 H;  4CH6 A;  4AQY B;  1N36 O;  4TOI A;  1BHA A;  3CMA V;  2HFE C;  3JAM N;  4LF4 O;  3WFV A;  5KHH A;  1HNX O;  4LC1 A;  4OX9 O;  1TUB B;  4WFE A;  2ZCE A;  1MNG A;  2WLI A;  3IFX A;  4DW0 A;  3I5D A;  4JI1 B;  3CYO A;  3BA8 A;  4PD4 F;  2ZE7 A;  4WBN A;  4ABM A;  2Q67 A;  1YTF B;  4RUE A;  2QM4 A;  5KMG A;  4CS3 A;  1XI1 A;  1GM7 A;  4DR5 B;  3G67 A;  4MS2 A;  3N2K A;  2F95 B;  4B3M B;  1TUE B;  1XNQ B;  1R3K C;  5CA0 B;  1IBM B;  2EIL C;  4JZG A;  3RWR D;  3NR7 A;  1P49 A;  2K9P A;  4WFF A;  1BT8 A;  2F93 B;  1GN4 A;  1TAE A;  4H37 A;  2OIG A;  1HR0 O;  1NR7 A;  3RFR A;  3N2G B;  3CRC A;  3WB1 A;  5LL6 Y;  2Y69 B;  1ENV A;  3BAA A;  3RVY A;  4JYB A;  4JI4 B;  3H1I H;  4UVC A;  4QNH B;  4FLX A;  4MTO A;  2M6Y A;  5EYP B;  4QIW F;  3OR6 C;  2HJF C;  4PDL A;  3JAW B;  1G1X B;  4B3T B;  1US6 A;  2UUA B;  1FFX A;  4B3R B;  4XBF A;  4EB6 B;  1FAF A;  1WP8 A;  3HKB B;  2UUB O;  1M57 C;  1JX9 A;  1F23 A;  2QGN A;  4I9Q A;  3ASO C;  3DSQ A;  3RYI A;  2FB5 A;  3KG2 A;  3RYH A;  3ETE A;  2HVJ C;  3IAY A;  5IYZ A;  1RM1 B;  4DYL A;  4DV6 O;  3U11 A;  2X7R B;  1COW G;  2PUS A;  2QA4 V;  4LF8 O;  1MZE A;  3D8C A;  1GN3 A;  4Z1M G;  2CGN A;  1CEZ A;  1H8E G;  1V55 C;  3JAR B;  5B1A C;  4PA9 A;  1HP8 A;  3ABT A;  1SET A;  4UUJ C;  4ZHQ B;  3M99 B;  4FM1 A;  4GT1 A;  4FLW A;  4J9Z B;  2HP8 A;  5C8Y B;  1VQ7 V;  1VQK V;  3ZHS A;  2VWK A;  3APQ A;  2ZM6 O;  2A06 H;  5IJ0 B;  3G6B A;  4X20 A;  4P9O A;  5KUK A;  2WWW A;  3LSU A;  1IUR A;  1WNS A;  1ROP A;  4N23 A;  2WLM A;  1XMO B;  4KHP O;  2BOB C;  1Q7Y W;  3CCU V;  1K8A W;  1AI6 A;  4DR4 O;  1KEC A;  3AG3 C;  5B5E Z;  3I56 V;  1VQ9 V;  4TUY A;  1S5J A;  4U7O A;  4AQY O;  2EIK B;  4GX2 A;  5F2V O;  4K8X A;  1JFF B;  3E22 A;  3DXR A;  4PDR A;  5BY1 A;  2ZDI A;  4CS4 A;  3A2F A;  5FNV B;  4BR6 A;  4B08 A;  3HKD B;  3S3X A;  2OIE A;  4UCV A;  2OCC C;  1QNM A;  2Q7G A;  3HKE A;  2GUZ B;  4DRX A;  4FM2 A;  4O4L B;  4X1K B;  4JI1 O;  1JJO A;  1AR1 B;  4TV8 B;  3D36 A;  1H2G A;  3GWK C;  2UXB B;  3K5M A;  3OE7 G;  4DR5 O;  4NKG B;  4B3M O;  4X64 B;  1XNQ O;  3X2Q C;  1IBM O;  4P2Z A;  3ZRW B;  5B1B C;  3STZ C;  2PF4 E;  2PI4 A;  1Y67 A;  5BR8 B;  5CBH A;  2WLH A;  1FXH A;  1K3E A;  2IW5 A;  3Q4H B;  5ITZ A;  2E76 B;  3P3N A;  2BCC H;  1EN5 A;  3WB0 A;  2CTP A;  5E1A C;  1QQC A;  2YIC A;  4JI4 O;  1X4T A;  2ZD9 A;  1SKV A;  1N4C A;  3ZMT A;  1VAR A;  3JD0 A;  1YSC A;  2DYR B;  2DWD C;  1KU9 A;  3SPH A;  2LW1 A;  3K5L A;  1YEW A;  5GTH Z;  2UUA O;  4B3T O;  4CC6 A;  3AG2 B;  2UXD B;  4O2A A;  1Q3E A;  1IVS A;  2QM8 A;  5KLV H;  5CMU A;  1XUQ A;  3TXQ A;  1I5X A;  2P4K A;  3THO A;  1GMG A;  4LR3 A;  2WAM A;  1B3Q A;  4CC5 A;  4MVR A;  5LGT A;  2JGD A;  1AR5 A;  1M56 B;  4JAA A;  2BTQ B;  4YJ3 A;  2B9Z A;  3VQV A;  1M1K W;  3AG4 C;  2HLD G;  3G4S V;  5B1O A;  1Y76 A;  2QWP B;  3B77 A;  1ZX3 A;  2UUC B;  4PI2 A;  2F66 C;  2V4D A;  2R9R B;  1Q6U A;  4JAV A;  5HFM A;  3S3W A;  5KX5 A;  2KQX A;  1RSO A;  4LH7 A;  1VIB A;  4O4I A;  4O4H B;  5LOV A;  1KB9 F;  1OCR B;  1JA8 A;  3L72 H;  1SZX A;  2OTJ V;  1G8M A;  3RT3 C;  2QE7 G;  4QJF B;  5LHG A;  3BVO A;  2YIA A;  4CZZ A;  1Q82 W;  2FYU H;  4KL1 A;  1CXZ B;  1VMG A;  1SC5 B;  3CB2 A;  1VQL V;  1ZUQ A;  4Z1V A;  4CH4 A;  2HG5 C;  5K1P A;  2JGU A;  1KYO F;  5LP6 B;  3C3T A;  5IWA B;  1R6T A;  3B4S A;  1YI2 V;  2CDY A;  1KKC A;  3JCZ A;  2EIN B;  3RYF B;  2VQF B;  4KFM A;  2IU3 A;  2N74 A;  3FFQ A;  1UFI A;  2ZE8 A;  4TQF A;  2B1I A;  2QDO A;  5H6Q A;  3ZMS A;  3E86 A;  1YDX A;  4I50 A;  1VQ8 V;  4HNA A;  1W0K G;  5GON A;  3W7T A;  4F6E A;  2YDE A;  1SQG A;  4X1I B;  1L0L H;  1V54 B;  1R6N A;  2ZDI C;  4J10 A;  3AK3 A;  3FX7 A;  2JEU A;  2UXB O;  4TT3 G;  1BHB A;  4KP4 A;  4D6T H;  4FMT A;  1A32 A;  4NTY A;  4X64 O;  2EIM C;  3A0R A;  3CCS V;  5JVD A;  4U3J A;  4JPR A;  4P30 A;  1ZWI C;  2R72 A;  1R3I C;  5LMN B;  5BMV A;  1N34 B;  2V1D A;  1FXK B;  5BR8 O;  3IJ4 A;  2XTA A;  1M90 W;  4TV9 B;  2Y0P A;  2Q68 A;  4I55 B;  3D36 C;  4LNU B;  2KB1 A;  1AJN A;  3E89 A;  5L3G A;  4G28 B;  3CP1 A;  4XDL A;  3T4D A;  1E1Q G;  1ZSP A;  1XOU A;  1KC8 W;  3H1L H;  3H9V A;  2HR3 A;  5JQG B;  3G80 A;  2X6A A;  4I0X B;  5IYC O;  2UXD O;  1AI5 A;  5GTI Z;  4FFB A;  3FYE B;  1OCZ C;  1OCO B;  3G71 V;  2UXN A;  1FJG B;  2DN9 A;  2Q7E A;  3UKM A;  3CRR A;  1JPX A;  1S0V A;  1PV0 A;  3B09 A;  5J9P C;  1HDJ A;  1THZ A;  4ZI7 A;  4PDM A;  1H38 A;  1FXV A;  1VQ4 V;  1K5S A;  2CAZ C;  2IBZ H;  2DWE C;  5L3D A;  5DN6 G;  2DW4 A;  1AJP A;  3UT5 A;  4FVM A;  2YID A;  5J2U B;  2HEP A;  2UUC O;  2A0L A;  3APO A;  1TA8 A;  4JYY A;  3N27 A;  4GYC B;  3H1H H;  2XUM A;  2E74 B;  4YJ2 A;  2RN9 A;  4WFB V;  2PYJ A;  5FPO A;  1LUW A;  1L1F A;  4WFH A;  1ARO P;  1SF9 A;  1VF7 A;  3L73 H;  1WA8 B;  4L8J A;  5EBW C;  1CP9 A;  2QSA A;  2R70 A;  3JAL B;  1S5L Z;  2A3Q A;  4HAM A;  1GM9 A;  3VOU A;  4X66 B;  1OCC B;  1L0N H;  5IWA O;  2P5O A;  1NBM G;  5KA5 A;  1PM9 A;  1RP3 B;  3CC4 V;  2EIJ C;  2W6J G;  3WU2 Z;  1D5N A;  5DEC A;  4LWS A;  2VQF O;  1F4M A;  4WCE V;  1XBL A;  1NTM H;  3STL C;  1U96 A;  5L3C A;  1N0J A;  1KD1 W;  4UB8 Z;  4XDK A;  3TXS A;  4C7U A;  3J80 N;  2KKW A;  2OCH A;  3CCR V;  4X1Y A;  1SQB H;  4F6R A;  1N8R W;  1AR4 A;  4MTF A;  1V55 B;  2D2C B;  3BY6 A;  4K8Z A;  5B1A B;  3TCU A;  1EM1 A;  1H2K A;  2F1M A;  2Q8V A;  2JIZ G;  4X9Q A;  1ZAU A;  4K0K B;  5E79 Z;  4LFC B;  3IC9 A;  2X6B A;  3FB5 C;  3CRA A;  2ATK C;  5L3F A;  3MHS C;  4IIJ B;  2Q0A A;  5LMN O;  1N34 O;  1LR1 A;  4EKW A;  1NH2 B;  1B06 A;  1Z2G A;  3TJT A;  1KP2 A;  4PV1 B;  3JAT B;  2WSS G;  2RDC A;  5DED A;  1VEW A;  2ZNJ A;  2K1E A;  2V7Q G;  4ZOL B;  3LUT B;  4LH6 A;  2W0X A;  3SDL A;  2VQE O;  4LP8 A;  3JAS A;  3ZHR A;  3CRQ A;  2D3O W;  1H2S B;  1QLE B;  2XAQ A;  3DGE A;  1VQN V;  2LO1 A;  4PA4 A;  2ZXW C;  5LGU A;  5FLX N;  2N04 A;  1FJG O;  3FD9 A;  1J5E B;  5H5N A;  3SYP A;  1BCC H;  1OJH A;  2JRI A;  2Q7H A;  3LDE A;  2E3C A;  4UVA A;  1VQP V;  3LSQ A;  3FAV B;  5LYJ A;  4JAU A;  2GTA A;  1GKF A;  4IHJ A;  1F7Y A;  1M93 A;  1SQX H;  3UM7 A;  3X2Q B;  1P84 F;  5B3S B;  3CCQ V;  2IJI A;  5EBL C;  3WB2 A;  5IE9 A;  2RJZ A;  3MHH C;  4JZ2 A;  4LF7 B;  1LUV A;  2JJ1 G;  1B04 A;  1K34 A;  4UCR A;  1HNZ B;  2L6L A;  3D3I A;  4MVU A;  2KG7 B;  1TUB A;  4X66 O;  5KA6 A;  1CPY A;  3BEH A;  5L3B A;  4GKJ B;  1YF2 A;  2Z0A A;  5EIB C;  5EK0 A;  2DJV A;  4UCU A;  2QR4 A;  1DGS A;  4X88 A;  3QVN A;  4P9P A;  1K7D A;  1G4Y B;  5JCO A;  3E8G A;  4MT8 A;  4RQF A;  4DV2 O;  1WJZ A;  2XAH A;  2HHH B;  3WG7 B;  3FKS G;  2FKX A;  5CA0 A;  4LFA B;  4DK0 A;  2LGQ A;  2EZP A;  3HKC B;  3JSN A;  3K3W A;  2MW2 B;  3R66 A;  1GN6 A;  4UCS A;  3BHP A;  4CH5 A;  4K0K O;  2LP7 A;  3AG1 C;  2P90 A;  5KAF Z;  1YZB A;  4LFC O;  1XQ8 A;  4GCZ A;  2IH1 C;  2Q0O C;  4PDV A;  5EYP A;  1F51 A;  3JAW A;  4WF9 V;  1EZV H;  1MA1 A;  1S3J A;  3OEH G;  1S76 D;  1AJQ A;  1NJI W;  3HKB A;  2UU9 B;  4BIZ A;  4H0L B;  3VBB A;  1QCE A;  2YXH A;  5LBQ A;  4GLX A;  2RNB A;  4X20 B;  3H1J H;  3SYC A;  3CCL V;  2IJH A;  5L3E A;  3E8H A;  2JS3 A;  4DV0 B;  4DV4 B;  3JAR A;  1JJ2 U;  3MAQ A;  5CB4 B;  1J5E O;  2AHY A;  5IY5 B;  4ZHQ A;  3E2E A;  4BAY A;  2ZNI A;  2R9A A;  4WFG A;  2ZIM A;  3A0H Z;  5IJ0 A;  3E35 A;  3E22 B;  3DXR B;  4FLZ A;  1TVK B;  1QVF U;  1GK9 A;  3SJQ C;  5CA1 B;  1GRJ A;  1YJN V;  3ZBH A;  1SRY A;  3JAK A;  3M7M X;  3RN4 A;  3OAA G;  1S72 V;  4BW9 A;  1FFT B;  3CS5 A;  1BMF G;  1U97 A;  3CME V;  3ASN B;  4DRX B;  3KCX A;  4CH3 A;  2M7W A;  4J11 A;  4O4J A;  3UO3 A;  3UCS C;  4UCT A;  4W4L A;  4LF7 O;  1JFF A;  5KHI A;  4UXN A;  1HNZ O;  1GH6 A;  3CRM A;  2AW9 A;  5FNV A;  2PYL A;  4WFA V;  3K9S A;  1XL6 A;  2P22 C;  3U10 A;  3HKD A;  4OGQ B;  5IYD O;  2ZE6 A;  4I9W A;  4J80 A;  1GAX A;  2GUZ A;  2W6I G;  4GKJ O;  1IZ3 A;  3HR0 A;  4TV8 A;  2QM7 A;  2P06 A;  2H94 A;  2KSD A;  3ABM B;  5FPR A;  1OCZ B;  2ADP A;  4RQE A;  1ZL8 B;  2PZS A;  1RFY A;  2ILM A;  4D7T A;  1P7B A;  4R50 A;  2HHH O;  3CEI A;  4LBE C; 
#chains in the Genus database with same CATH homology
 2VQF O;  1NS1 A;  4LFA O;  5BR8 O;  4KHP O;  1F7Y A;  4DR4 O;  5A2Q N;  1N33 O;  4B3R O;  4X62 O;  1AIL A;  4GKK O;  4AQY O;  4B3S O;  3J80 N;  1FKA O;  3J81 N;  5BY1 A;  1DK1 A;  4DR7 O;  4DV3 O;  4DUY O;  1HR0 O;  4JI5 O;  1J5E O;  5LMU O;  5LL6 Y;  4JI6 O;  1I94 O;  2UXD O;  1X59 A;  3RT3 C;  1HNW O;  4X66 O;  4JI1 O;  4DUZ O;  2UU9 O;  1G1X B;  2LW7 A;  1R1B A;  4NXN O;  4DR1 O;  2Z0A A;  4LF6 O;  5LMN O;  2DJV A;  1N34 O;  2UUB O;  3O65 A;  4DR5 O;  4LFB O;  4B3M O;  1D2D A;  1XNQ O;  4DV5 O;  4JI2 O;  1IBM O;  4DV6 O;  4LF5 O;  1R6T A;  4DV2 O;  4X65 O;  1IBL O;  4JI3 O;  3OTO O;  2UXC O;  2DOS A;  3J7A U;  2FKX A;  4LF8 O;  4DR2 O;  3SDL A;  2UUC O;  2VQE O;  4DV0 O;  2N74 A;  4DV4 O;  4JI8 O;  4LF7 O;  4DR6 O;  4A5U B;  2AGA A;  1XMO O;  1AB3 A;  4DV7 O;  4DR3 O;  3R66 A;  1HNZ O;  1KUQ A;  1N36 O;  1N32 O;  3T1Y O;  4JV5 O;  1XEQ A;  4OPA A;  4JI4 O;  3M8A A;  3JAM N;  4K0K O;  3F5T A;  5BXZ A;  4LF4 O;  1XMQ O;  1IBK O;  4LFC O;  1YZB A;  4NXM O;  5FLX N;  1FJG O;  4B3T O;  4JI0 O;  2UUA O;  1HNX O;  4GKJ O;  4OX9 O;  1FYJ A;  4OPH A;  2ZM6 O;  2F4V O;  5H5N A;  2ZKO A;  5IT9 N;  2UXB O;  1XNR O;  4DV1 O;  3T1H O;  1A32 A;  4YHH O;  2JRI A;  4X64 O;  4YY3 O;  4JYA O;  4JI7 O;  5IWA O;  2HHH O;  4LF9 O;  2E5L O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...