4DV0O

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 30
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dv0O00
4NXNO 4LFAO 1R6TA 3R66A 2E5LO 2UU9O 2DOSA 4KHPO 2DJVA 4DR4O 3T1HO 3F5TA 1F7YA 4B3SO 4JI8O 3RT3C 4JI4O 1FYJA 1J5EO 3JAMN 4NXMO 4B3RO 2AGAA 2VQFO 4LF7O 4DV4O 1N36O 1XNRO 2UUAO 1R1BA 2UUCO 2VQEO 3J80N 4X65O 2UXBO 5FLXN 4JI7O 3M8AA 4YY3O 4DR2O 4DUYO 1G1XB 1FJGO 4K0KO 4DV3O 4DR7O 1IBMO 2UXCO 1X59A 4GKJO 4JI5O 4JI6O 4JI2O 4X62O 4DV1O 2UXDO 1AILA 5BR8O 2N74A 1XMQO 2FKXA 4DV6O 4DV5O 4X64O 5LMUO 2UUBO 2ZM6O 3J7AU 5H5NA 4OPAA 5IT9N 4JI1O 4OX9O 2ZKOA 1KUQA 4OPHA 4LF9O 3T1YO 4YHHO 4B3TO 5BY1A 1N34O 1HR0O 4B3MO 4LFBO 3OTOO 4DR1O 1D2DA 4JI0O 1YZBA 1A32A 4DV7O 1N32O 1N33O 3O65A 4JI3O 1IBLO 1XNQO 4DR5O 1I94O 5BXZA 3J81N 1AB3A 2LW7A 3SDLA 4A5UB 4DV2O 4LFCO 4DR6O 4X66O 4DUZO 4LF4O 4LF8O 4JYAO 4LF6O 1IBKO 5LL6Y 4DV0O 5LMNO 1HNXO 1HNZO 4LF5O 4JV5O 5A2QN 1HNWO 1XEQA 2Z0AA 1XMOO 1NS1A 5IWAO 1DK1A 2F4VO 2HHHO 1FKAO 4DR3O 4AQYO 2JRIA 4GKKO
chains in the Genus database with same CATH superfamily
1EN5A 3KCXA 1VF6A 3A2FA 4YIOA 1BMFG 3U10A 3RYFB 3QO7A 1F4MA 4WFBV 4DR1B 3ABKC 4N23A 4O4JB 2OT5A 2P06A 1SQVH 2AXTZ 3I55V 3CCRV 4H13B 1SA0B 2MK3A 3E22B 1N36O 3ZHQA 1UJWB 4O2AB 3UT5B 4UV9A 2IH1C 2HJFC 1ZAUA 2N04A 2IJIA 2A3QA 3OGIB 1HNXB 3ASOB 3BFRA 2M6YA 3Q4HA 1VQ9V 2E74B 2UXCO 2F43G 1GN3A 1ORQC 1IVSA 5IY5C 4TV9A 2PI5A 3CCEV 4F6EA 5CA1B 2X6BA 2ZDIA 4UUJC 1U97A 1CP9A 2ETNA 3RYCA 4X1YB 5FPRA 1M57B 3E35A 2CGNA 4X20A 3MDSA 2YXHA 2D3OW 1KBHA 3FYIB 1AP6A 4UV8A 5BY1A 3CCVV 4QJFB 2QR4A 4X65B 1QHTA 1H2MA 1VF5B 4UCOA 4I50B 3L74H 3A0RA 1VQKV 4I55B 4U7NA 1EN6A 4K8ZA 5IJ0B 1Y74B 1VEWA 4A5UB 2RJZA 4DV1B 3TK1A 1COWG 2JIZG 2Y69B 4TSFG 4PDVA 3JD2A 1XDCA 2EJ7A 3G71V 2HLDG 4DR3O 4I7ZB 1YXBA 3CXHF 4MT8A 1Q3EA 5EYPB 1VQNV 1HR0B 4KFMA 4YJ3B 4B3MB 3QO8A 3GB7C 3CRMA 4DRXB 1S0VA 2CGOA 2ZR3A 4UB6Z 3RBZA 5B1BC 3JARB 3OMIB 1PL0A 2ADQB 1YIJV 2WA3A 3AEIA 3X2QC 5DM6V 4DR6B 4DUZB 5JQGA 1XOUA 5KHJA 4JI7O 1M5IA 1PKXA 4RUFA 1V55B 1BQ0A 3JYCA 4G28B 4MVOA 5IYCO 2V7QG 1THZA 1X59A 1H38A 4TOIA 5EIBC 1LUVA 3SJCC 4JI2O 2CTQA 4X1KA 2IW5A 2ZE6A 3ZN0A 4KHPB 3MAQA 4UXNA 5JH7A 2QWRB 4QIWF 4FM1A 5LMUO 1M90W 4JI4B 4JI1O 4X88A 4TV9B 4RWUA 2YC0A 4LP8A 2JJ2G 2NLJC 2A9HA 4R50A 1YSCA 3OTOO 4RQEA 3JAKB 5TISZ 2NNUA 4G2KA 4MVMA 1XL4A 4JGSA 4DUYB 4K3AA 4UCVA 5CA0B 4LWSA 2F66C 3E83A 1R3JC 3TCUA 2B5UA 3IC7A 3QVNA 4B7EA 3OR6C 1TUBB 3SYQA 1TAEA 2LP7A 4JV5O 5EBWC 3IAYA 2YIAA 3ZRWB 4JPRA 1LUWA 2X6CA 2JRIA 2Y4UA 3BA8A 2W6IG 1KMIZ 1R6TA 4JYBA 2IBZH 1K34A 2Y69C 2PF4E 1NH2B 4KUMA 4JI2B 1NKDA 1BQZA 2CH7A 4DV7B 1NH2D 4B3RO 3OAAG 1VQ5V 5LMUB 3HKEB 5A9GA 4JI1B 2VQEO 4X66B 3SJAC 1L0NH 3STZC 1XUQA 3SPJA 3M8AA 4DK0A 1G1XB 1VF6C 4P30A 1XMOB 2F4VB 1M1KW 1I5XA 3RYIA 4CC6A 2JK5C 3BEHA 2WLJA 4O4LB 3KG2A 1XQ8A 1RM1B 2VS0A 1H2NA 4AI8A 1WP7A 4Z1MG 4TWKA 1GRJA 1DGSA 1P7BA 5LOVB 1BHAA 2KSDA 4I0XA 5F2VO 3FKSG 5IYBO 2HFEC 4MS2A 2IU0A 3RGBA 3SPCA 4LF7B 4WBNA 1JVMA 2UUCB 2EX3A 1IURA 1QR9A 1N33O 3VQVA 4J7KA 2ZDIC 1F23A 3ABMB 1XNQO 2JS3A 4DW0A 3SDLA 2KB1A 2DN9A 4B3RB 2BE3A 1KKDA 3VQXA 1Y6XA 2BSKA 5LMNO 4DV0O 3TXSA 5KUMA 4LWSB 3K9AA 2CK3G 2XNDG 1G4YB 5JCOA 3STLC 3JASA 3CC7V 2ZINA 1AJPA 5LXTA 4YHHB 4Q20A 4UCRA 2PGGA 1UFIA 1H2SB 2ZXWC 2ZIOA 1XI1A 1VQ6V 4DK1A 5DN6G 3OM3B 2YI8A 1YHQV 4MTFA 5KX5A 2Q68A 1RFYA 4CS4A 2H8PC 4DW1A 1PD3A 4MVSA 4X8AA 1WA8A 2CTRA 1Q90D 4BW9A 3BABA 4DV2B 1V54B 1BE3H 3OFNG 1HWYA 4JYAB 1GO3F 4EB6B 3LSQA 4JAVA 1BL8A 4WFAV 1ZUQA 3T4DA 4JI6O 5LBQA 3E8GA 3L70H 4MTXA 5EBMC 3RYHB 5ITZA 3PJSK 1TVKB 2BTOA 3T1HB 1Q8IA 3RYIB 5KHHA 5LP6B 4O4IA 4LF9O 4XDLA 1L1FA 5LMNB 3AK3A 1RM1C 3K5OA 4LR3A 4LBEC 2FL4A 2NR5A 1FXHA 2EIMC 3K0DA 3E2EA 1MMMA 2XAGA 4CZZA 3G6EV 2JS5A 2LO1A 2Q7GA 3O9OA 1GAXA 2V4DA 2QWQB 5JWPA 4I0XB 5B5EZ 1FPOA 4YY3B 1FJGB 4DR7B 4XDKA 3ZBHA 1PL4A 3SPIA 1K5SA 4LF4O 1SERA 4PJ0Z 1HNZO 1QQCA 3FB5C 3FB7C 1XEQA 2WLLB 2Q0OC 4PA3A 1FXKA 2UUBB 5IWAO 3FAVB 3ABMC 4UFZA 1IX9A 4JTDB 2DMXA 4GKKO 4U3JA 4P2ZA 2IJHA 3E89A 3SJBC 2OCHA 4U7OA 4LFBB 1KECA 2CTWA 2LGQA 3MHHC 4JI6B 1P7GA 3K0GA 5IDJA 4E2LA 5IYZB 2XHBA 3ZMUA 3JASB 3OUFA 5IJ9A 4NVPA 3RYFA 4BIOA 4BW5A 2B1GA 3BHPA 1B3QA 1SC5B 4GYCB 1SF9A 5FLXN 5KX5B 2LGWA 1LNQA 4GT1A 4YIPA 2Y4TA 1W0KG 3E22A 4TQDA 1KC8W 2ZE7A 1YTFB 4O2AA 3UT5A 2PI4A 4JI5O 4GLXA 4H37A 1V54C 1UPGA 1YTFD 3OR7C 1KP3A 4PDLA 2EIJB 3AG3C 1X4TA 5FPOA 2GHYA 3SYOA 4JTAB 1Z2GA 1P49A 3ZEDA 3LDEA 4LF4B 2Q9LA 2XUMA 5KA5A 4B3TO 1N4CA 4X1YA 5ITZB 3K59A 2Q73A 4DR1O 1L0LH 1M93A 4O4IB 2XOKG 3CCJV 1YJWV 3FB6C 2GUZA 1NTZH 2LJ2A 5B3SC 4Q6GA 4EKWA 3M7MX 4H33A 4I55A 1HNXO 1NTMH 1SQBH 4TT3G 2EZPA 1Y74A 5B1OA 3WFVA 3CCSV 1OCCB 4MVZA 4FLTA 1K92A 3TETA 1FXKB 4HBNA 1Q6HA 3BA9A 2BOBC 1M9NA 5EYPA 3JD4A 1SRYA 3K08A 1I0HA 3TJTA 4DRXA 1I94B 1JJOA 3JSNA 1US6A 2QM8A 1AR5A 3JATB 4X65O 5CMUA 4LF8B 3H9VA 3JARA 5JCOC 3ETQA 4B3TB 4TUYA 4QE7A 5IJ9B 1QLEC 4WFGA 2AZ0A 3ZMZA 4AQYB 3K9SA 5GTIZ 4DV1O 4D6TH 2QWNB 3AK1A 2QA4V 1JFFA 4EFBA 2UU9B 2P5OA 5KAFZ 3CHXA 2QDOA 3B4SA 3D36A 1YI2V 1J5EB 1XHXA 2WLMA 1OZ0A 2EIJC 3IJ4A 1HR0O 4B3MO 4QGPA 1G8MA 2BOCC 2UXBB 3HKBA 1SQXH 2Q0AA 2F93B 1O9GA 5LA6B 2ZCEA 1QLNA 4NTWA 3VBBA 2HKOA 4UCTA 1K3EA 3JAKA 3J81N 4W4LA 4DR6O 4IT5A 4DUZO 2UXDB 2GTSA 1G6UA 3P32A 5CA0A 2GUZB 3BRCA 1WB8A 2FB5A 4MVQA 1TUBA 1SQFA 5KMGA 1S5JA 1BHBA 4KHPO 3ZRWA 2OTLV 1Y66A 1Q82W 3U0ZA 4JI4O 2P90A 2EINC 4JZ2A 3C3TA 1OCCC 4ASUG 3W7XA 5H6RA 2AGAA 2XASA 3DXRB 1ZLZA 1RSOB 2LQTA 2ARHA 3B8NA 1FXKC 3W7TA 1BS3A 1NZ6A 2EIKB 3HKCB 1M56C 1W0JG 3HKEA 1PNLA 4DUYO 1K97A 3SYCA 2GTAA 5AG2A 2Q7EA 3RWRD 3UQ8A 2Y0IA 1FAFA 1JX9A 1Q43A 2ZIMA 4TUYB 2Y48A 3OEEG 4H44B 1RPRA 2ZKOA 3AG7A 4O4LA 3ICXA 1JFFB 1DLBA 1MZFA 4UCUA 2UUAB 1VQLV 5LOVA 3H1LH 2B9ZA 3ZRXA 1ENVA 2QGNA 4DV7O 3ASOC 1GM8A 1YJNV 1J95A 4DV3B 3ASNB 3ABTA 4DXWA 3G67A 4X66O 3HKBB 5DECA 5LYJB 3L73H 1D5AA 4O2BA 4HNAB 4B7KA 4DV5B 3ZHTA 2R70A 4X64B 1XMOO 5K1XA 2F4VO 1B04A 3DC5A 3ZMVA 3EVKA 1M57C 1AVMA 4P9PA 1F51A 1AI6A 2DWDC 3APOA 3E8FA 2DOSA 1K73W 4GX1A 3NXSA 1FS0G 3ZIAG 5CA3A 4GUNA 4Z2WA 2W0XA 2EILB 3JAMN 3OT7A 4OGQB 3APQA 5EZYB 5BMVB 5KMGB 4IL6Z 3TXQA 4O4HA 4LF7O 3LDDA 4DR5B 2YS8A 2UUCO 4FFBB 3NR7A 3LNNA 1M4UA 1SQQH 5L3FA 5EK0A 4J9YB 4J11A 2OWOA 5IYDO 3R65A 4FLZA 4EB6A 3N2KA 3HB3B 3LNMB 3T4ZA 2YI9A 4J10A 2IU3A 1K9MW 1O9HA 3AG1B 4B3SB 2DYSB 2ZM6O 4YHHO 1YF2A 3RYHA 3SR2C 2YEVB 1TVKA 4PDMA 2P4KA 1F4NA 5LP6A 2QKSA 4FIPC 3O65A 1V55C 4DR2B 1SETA 4ZOLA 4GKJB 4DV2O 4FLXA 3H01A 1FFXA 1H8HG 3D36C 4JYAO 1XMQB 2DE0X 2WAMA 3JD3A 3KCYA 3W7WA 3TGUH 5E1AC 1NS1A 5CB4B 3CYOA 4OX9B 2E3CA 4E4EA 2P67A 4NR1A 3SJQC 1V9PA 2H3OA 3DGEA 2WLLA 2YIBD 3B8MA 4O2BB 3FAVA 1OJHA 2A79B 3T1HO 3HKDB 4FMTA 4W4KA 2ZE5A 4R7CA 1JR9A 1FYJA 1EBOA 4N21A 1AI7A 4QE9A 3CC2V 3G4SV 1WLEA 5H2FZ 2L35A 2W0FC 2ZM6B 3WG7B 1XNRO 5IYZA 4MW3A 1Q86W 1B6QA 2UXNA 3RFRA 1IBKB 2EILC 3K3WA 4YY3O 4O4HB 1FJGO 2ZT9B 3CX5F 4DR7O 2ZQMA 1EN4A 3ABLB 3AK2A 1PP9H 1VP7A 3JD0A 3QF7A 3JAWA 2CDYA 2OYQA 4KXRA 3RN4A 1QCEA 1PNMA 2UUBO 1E79G 5H5NA 4OPAA 5J2TB 5BZBA 4GX2A 3A0HZ 4NB5A 1BZKA 4WCEV 2QWOB 3OMAB 3N2KB 2E76B 2G38A 3OUSA 2VQFB 4WFFA 4LFBO 4F4LA 3AG1C 1XBLA 2KQXA 3THOA 2VWKA 2R9RB 3SYAA 3QG5A 2RQ6A 2A7WA 4BIUA 3F5WC 1OCRB 5E79Z 2P6JA 1ZSPA 3HR0A 4GX5A 1SZTA 4IYIA 3ZS8C 3JSLA 3CSXA 1WPXA 4IHJB 4WFEA 5GW7A 5LL6Y 1Z5WA 3M99B 4DV6B 1XNRB 4ZOLB 2P7TC 3CMAV 3CPWU 1KP2A 4X1IA 3K58A 1N0JA 1FFXB 4FVMA 4U3FH 2DQ0A 2XAQA 5FNVA 4ZHQB 5K1PA 5L3DA 5LGTA 4CC5A 1KKCA 4AHCA 2W6JG 2Q8VA 3AG4B 3ML0A 2QKCA 2FMLA 1P84F 2Q69A 3LSSA 2ZNJA 4WFHA 2ZNIA 3UO3A 3CP1A 3VQYA 2EJRA 2ILMA 1R1BA 1VQMV 4LFCB 4I9QA 1NTKH 3CXCU 2RDCA 3FD9A 2IJJA 4LF6B 3BCCH 4EFEA 3RW0A 5CBGA 1NI8A 3JATA 2BTQA 1L8DA 4RUEA 1I7FA 3WG7C 2QTSA 1AILA 4NXNB 4CH4A 3I56V 4LFAB 2N74A 4FZ0A 3ZHVA 4PA4A 2B1IA 1QVFU 4JI8B 2Z3YA 3J7AU 4QNHB 2K9PA 4BWAA 2A0LA 3ABLC 3VOUA 2NN4A 1PNKA 3JAWB 2HG5C 4I5SA 2Q67A 2ZD9A 5J2UB 2WWWA 2IH3C 4F6RB 3UCSC 3S3WA 4RAIA 2GBOA 2OIGA 1CXZB 4J7ZA 2O57A 1CPYA 5CBFA 1I94O 5LHIA 4JZGA 1TUEB 4LF8O 3ZCCA 5LA6A 2XAJA 4UVBA 4J7JA 2Z0AA 4JYCA 1Q7YW 2XTAA 1OCRC 1QBZA 3CCMV 1XHZA 3CJHB 3MD0A 1RP3B 4AQYO 5KAIZ 5LP6C 5C93A 3E8HA 2QWPB 2UU9O 1N34B 2DJVA 3LUTB 3H1IH 4J41A 4FM2A 3UM7A 4X1IB 1J5EO 1URFA 1S76D 1K4DC 5FNVB 1HP8A 1HDJA 2CUGA 1GH6A 4JI3B 4NYKA 2YSUB 2VWJA 3DTUB 4PA7A 2F1MA 3LSUA 1ROPA 2HVKC 2AW9A 4UB8Z 2UXBO 3SYPA 2YXYA 1GK9A 1I08A 2R9AA 2PY5A 4LF5B 5JJNB 4YJ2B 5GONB 1HNWB 3ZHUA 3DXRA 3PN1A 1RSOA 2WLKA 3U11A 4MTGA 1W59A 2OTJV 1JA8A 1R73A 5KUKA 1WJZA 4B08A 3HKCA 3ZRSA 2UXDO 4GCZA 2Q4PA 4PA6A 1VMGA 4PI2A 4QPKA 1H2KA 2BTQB 2RN9A 2JJ1G 3WB1A 3G80A 4LH6A 3W7UA 1MSWD 3BVOA 1Y4MA 3K03A 2GV9A 2K1EA 2P4VA 3FX7A 2Y0PA 4MSWC 3CC4V 1D2DA 2X6AA 1DTOA 1N32O 4FK5C 1U96A 2E75B 3E86A 2XAFA 1IBLO 4PA9A 1YEWA 4ICGA 3X2QB 3GVMA 1IBMB 1RPOA 2M7WA 2PZSA 1WPBA 5BR8B 2HJDA 4X9QA 2CAZC 1N0NA 1BCCH 1MA1A 3B09A 3JCUZ 5LYJA 1SQPH 2L6LA 2ITCC 3CRCA 4HNAA 2X7RB 5EIBD 1AI4A 2WSSG 4JI0B 2HP8A 4FZ1A 4L8JA 5EC2C 2YUAA 3K06A 2YXLA 3D8CA 4D7TA 4RO2A 4DO2A 3S3XA 3BY6A 2UUAO 3J80N 5EC1C 3ABUA 5EZYA 4UVCA 5BMVA 2ITDC 2CTPA 1PM9A 1WN7A 2ZE8A 5JVDB 4GZRB 4DV3O 4K0KO 4FFBA 2HHHB 4XDJA 1S3JA 1N32B 4X62O 3CRRA 3QTCA 1TGOA 1IBLB 3GWKC 4I4TA 4DV5O 1Q81W 4X64O 2JEXA 5CN0A 1YITV 3T1YO 5KHKA 1IXBA 4FLYA 2ADPA 1N36B 3ZMSA 3K57A 1QU7A 1ZX3A 2AHZA 1GN6A 4CH5A 5B66Z 4FPPA 1YZBA 3KKYA 2YEVA 1TA8A 1YCIA 4JAAA 4DR5O 1W2BU 2QTOA 2UXCB 5BXZA 1QR8A 4RQFA 1R3KC 3P3NA 2CE4A 1VIBA 1NR7A 1GN2A 4ABMA 1ZL8A 2AZ2A 1DK1A 2JDIG 3BAAA 4FLVA 3UO2A 4LNUA 1XILA 1VQPV 4K0KB 2WLHA 2QSAA 5CB4A 1EZVH 2YIBA 1JQ0A 4B3SO 4X62B 3D3QA 1WAZA 2UXXA 4NXMO 3C90A 5GTHZ 3I5DA 5J9PC 4IGGA 2C2AA 2GDSA 3HKDA 3Q4HB 3CB2A 1FFTB 2F23A 3T1YB 5JJJB 2LFSA 1BGYH 1MABG 1K4CC 5L3GA 4DR2O 1KU9A 4JAUA 2WLIA 1AR1B 2PYLA 3OMNB 4GKJO 3RYCB 1DF5A 4DR3B 3OGCC 3W7SA 1KD1W 4X20B 4JASA 1XMQO 2FKXA 1IZ3A 1Y67A 4PV1B 2OCCB 4D7SA 4OX9O 2AHYA 1KUQA 3QNEA 4AILC 1QVGU 5D5QA 2ZXWB 4H0LB 4I4TB 4KP4A 3DC6A 4FLUA 4I9WA 3ZHRA 5J2TA 2EULA 1OCOB 2N05A 4JI7B 2EIKC 2JGUA 1VQ4V 1Q6IA 4ZI7A 1JCHA 3CMEV 1NBMG 2LW7A 5LHHA 3ETGA 3H1JH 4NXMB 3K79A 3CE2A 3L75H 3N2GA 1IBKO 1S5LZ 4KL1A 4P9OA 2QM7A 4Z1VA 1NR1A 4LH7A 1JPXA 1EM1A 1EZJA 2YIDA 1LR1A 2FYUH 3EXAA 4IHJA 2IJKA 1S5HC 1GN4A 2P22C 2HEPA 2GSMB 3R66A 1ZL8B 3FB8C 3E8BA 1MZEA 3F7YC 3ZHSA 2KG7A 5KHIA 3CS5A 4BIZA 3OTOB 3T2MA 2D2CB 2A06H 3RT3C 1EFRG 3B77A 2WLNA 4ZHQA 4J9ZB 5JQGB 4LNUB 2JGDA 1SS3A 3L72H 2V1DA 3H1HH 4UVAA 2VQFO 4MTOA 2EIMB 4MW8A 3ASNC 3SPHA 3FFQA 4CH6A 4FJCC 2KKWA 4X1KB 4JV5B 5JJEB 3GWOA 4GX0A 4IYHA 4TV8A 1N8RW 5JH7B 3UKMA 3SGIA 3OTFA 3K5LA 2WPDG 1GKFA 4ZKIA 2ATKC 1B06A 2F95B 1DF4A 1AP5A 4DV6O 2WLIB 3CRQA 5LGNA 2QKAA 1K8AW 3WU2Z 1YJ9V 1H8EG 2EZOA 2VRZA 4PELA 4OPHA 4QPJA 4ZIBA 5L3EA 1SESA 3EFFK 3L9DA 3K5MA 1GM9A 4FLWA 3JCZA 3ZMTA 3CRAA 3L71H 2WA4A 3ETEA 4LCUC 1MG1A 4ZBMA 2VQEB 2OCCC 1VQOV 4PD4F 3WB2A 1Y76A 4L87A 1AJNA 2PUSA 4JYYA 5D5PA 5J2UA 3ETDA 1JJ2U 4F6RA 2DYRB 2H94A 4HAMA 4LFCO 1R3IC 1OHHG 4LF6O 1OCOC 2QM4A 1ZWIC 2RCVA 3BPZA 4MVRA 1SKVA 4ZI7B 2Q5ZA 1AI5A 1FD9A 2DYSC 3A0BZ 1D5NA 5H6QA 1FKAO 2JEUA 1K33A 3ZRVA 3AG3B 3N2GB 5C8YA 4LFAO 2CH7B 4NXNO 1S77D 2RMKB 4YXWG 1E1QG 1S72V 2JVDA 3QO5A 3CJHA 1F7YA 5L3CA 4K35A 4JI8O 2BCCH 2HR3A 5FL7G 4J42A 1N33B 1R6NA 1AJQA 3RVZA 3C3SA 1XNQB 1OV9A 4WF9V 2KG7B 4DV4O 1T5EA 2OIEA 4BAYA 1GMGA 1JOYA 2LFRA 2Q6AA 3FYEB 3H1KH 2XT9A 2JGDB 4DV0B 4CS2A 2EBOA 5LGUA 5B3SB 1VQ8V 4IIJA 2ZR2A 1YVWA 5B1AB 1ZTEA 4BR6A 1WP8A 1P4RA 4YJ2A 5GONA 1VQ7V 4PI0A 2HVJC 2YDEA 4MVUA 4TV8B 1Q5OA 4WBNB 4OXSA 1WNSA 4K8XA 1BT8A 5H9CA 1R3LC 3CEIA 4NKGB 1N34O 4CBCA 5KA6A 1OCZB 4EEQA 1H2GA 2XAHA 3OEHG 1Q6UA 4HYOA 1A32A 3N27A 1KQSU 1JMKC 2R72A 5EBLC 4JI3O 2BSKB 3AG2B 3CCLV 4NTYA 2PYJA 4X89A 1AB3A 5IE9A 1PPJH 5L3BA 3JALA 1Y76B 4UCSA 1KB9F 3SPGA 4C7UA 5LXTB 4LF5O 5KLVH 1HNWO 4DV4B 1QLEB 3CD6V 1MSDA 3P30A 3ABKB 3LDCA 4NTXA 1AR4A 1PV0A 2DYRC 4O4JA 3DSQA 1XL6A 1K5QA 3G6BA 4LF9B 3ZJZA 2DWEC 2RNBA 3ZN1A 2E5LO 1NQTA 3RVYA 5DEDA 4CS3A 4JF3A 2LW1A 1MOFA 1E1RG 3IFXA 1SA0A 4DR4O 1QNMA 1WA8B 3F5TA 4PDRA 1SZXA 2QE7G 2DW4A 5HFLA 1H2LA 3D3IA 3CCQV 5C8YB 3VQWA 3OD4A 1AROP 5IY5B 2Z5UA 4DYLA 3JD1A 1NJIW 4CH3A 5CA1A 4FM0A 2DQ3A 1KYOF 1FXVA 1HNZB 1BSMA 3T1CA 3CCUV 3WB0A 3B2EE 4R8CA 5IWAB 2MW2B 1NU1H 3IGAC 1IBMO 3HPLC 1XREA 5CBHA 2QJ1A 4GKKB 1YDXA 5BR8O 2YICA 3CWBH 4HZ3A 1NVPB 5JVDA 3EHBB 2FTKA 1I5YA 2PTMA 1K7DA 3AG4C 4IIJB 4LC1A 3K5NA 1GM7A 1Z5VA 5IT9N 1IXMA 3MHSC 2Q7HA 1NVPD 1NT2B 2ODMA 5KHGA 3IC9A 4I50A 4JTCB 5B1AC 4PHZA 1GTOA 1VF7A 3A8TA 4G27B 4R6ZA 2R9IA 1WB7A 5IJ0A 4JI0O 2EINB 5B1NA 1VARA 2IM9A 2E5LB 4FFKA 1CEZA 5HFMA 4DR4B 3F7VC 3OW2U 1MNGA 4JI5B 4TQFA 1OCZC 2QEXV 2X0LA 3KZIZ 3ZX6A 5LHGA 1M56B 4U3JB 3P3PA 5A2QN 1IDSA 3B40A 4XBFA 4YJ3A 3AG2C 1SQGA 2HHHO 3OE7G 1HW7A 4J80A 3K04A 3JALB 1R6KA 5B1BB
chains in the Genus database with same CATH topology
4NXNO 4LFAO 1R6TA 3R66A 2E5LO 2UU9O 2DOSA 4KHPO 2DJVA 4DR4O 3T1HO 3F5TA 1F7YA 4B3SO 4JI8O 3RT3C 4JI4O 1FYJA 1J5EO 3JAMN 4NXMO 4B3RO 2AGAA 2VQFO 4LF7O 4DV4O 1N36O 1XNRO 2UUAO 1R1BA 2UUCO 2VQEO 3J80N 4X65O 2UXBO 5FLXN 4JI7O 3M8AA 4YY3O 4DR2O 4DUYO 1G1XB 1FJGO 4K0KO 4DV3O 4DR7O 1IBMO 2UXCO 1X59A 4GKJO 4JI5O 4JI6O 4JI2O 4X62O 4DV1O 2UXDO 1AILA 5BR8O 2N74A 1XMQO 2FKXA 4DV6O 4DV5O 4X64O 5LMUO 2UUBO 2ZM6O 3J7AU 5H5NA 4OPAA 5IT9N 4JI1O 4OX9O 2ZKOA 1KUQA 4OPHA 4LF9O 3T1YO 4YHHO 4B3TO 5BY1A 1N34O 1HR0O 4B3MO 4LFBO 3OTOO 4DR1O 1D2DA 4JI0O 1YZBA 1A32A 4DV7O 1N32O 1N33O 3O65A 4JI3O 1IBLO 1XNQO 4DR5O 1I94O 5BXZA 3J81N 1AB3A 2LW7A 3SDLA 4A5UB 4DV2O 4LFCO 4DR6O 4X66O 4DUZO 4LF4O 4LF8O 4JYAO 4LF6O 1IBKO 5LL6Y 4DV0O 5LMNO 1HNXO 1HNZO 4LF5O 4JV5O 5A2QN 1HNWO 1XEQA 2Z0AA 1XMOO 1NS1A 5IWAO 1DK1A 2F4VO 2HHHO 1FKAO 4DR3O 4AQYO 2JRIA 4GKKO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXN O;  4LFA O;  1R6T A;  3R66 A;  2E5L O;  2UU9 O;  2DOS A;  4KHP O;  2DJV A;  4DR4 O;  3T1H O;  3F5T A;  1F7Y A;  4B3S O;  4JI8 O;  3RT3 C;  4JI4 O;  1FYJ A;  1J5E O;  3JAM N;  4NXM O;  4B3R O;  2AGA A;  2VQF O;  4LF7 O;  4DV4 O;  1N36 O;  1XNR O;  2UUA O;  1R1B A;  2UUC O;  2VQE O;  3J80 N;  4X65 O;  2UXB O;  5FLX N;  4JI7 O;  3M8A A;  4YY3 O;  4DR2 O;  4DUY O;  1G1X B;  1FJG O;  4K0K O;  4DV3 O;  4DR7 O;  1IBM O;  2UXC O;  1X59 A;  4GKJ O;  4JI5 O;  4JI6 O;  4JI2 O;  4X62 O;  4DV1 O;  2UXD O;  1AIL A;  5BR8 O;  2N74 A;  1XMQ O;  2FKX A;  4DV6 O;  4DV5 O;  4X64 O;  5LMU O;  2UUB O;  2ZM6 O;  3J7A U;  5H5N A;  4OPA A;  5IT9 N;  4JI1 O;  4OX9 O;  2ZKO A;  1KUQ A;  4OPH A;  4LF9 O;  3T1Y O;  4YHH O;  4B3T O;  5BY1 A;  1N34 O;  1HR0 O;  4B3M O;  4LFB O;  3OTO O;  4DR1 O;  1D2D A;  4JI0 O;  1YZB A;  1A32 A;  4DV7 O;  1N32 O;  1N33 O;  3O65 A;  4JI3 O;  1IBL O;  1XNQ O;  4DR5 O;  1I94 O;  5BXZ A;  3J81 N;  1AB3 A;  2LW7 A;  3SDL A;  4A5U B;  4DV2 O;  4LFC O;  4DR6 O;  4X66 O;  4DUZ O;  4LF4 O;  4LF8 O;  4JYA O;  4LF6 O;  1IBK O;  5LL6 Y;  4DV0 O;  5LMN O;  1HNX O;  1HNZ O;  4LF5 O;  4JV5 O;  5A2Q N;  1HNW O;  1XEQ A;  2Z0A A;  1XMO O;  1NS1 A;  5IWA O;  1DK1 A;  2F4V O;  2HHH O;  1FKA O;  4DR3 O;  4AQY O;  2JRI A;  4GKK O; 
#chains in the Genus database with same CATH topology
 1EN5 A;  3KCX A;  1VF6 A;  3A2F A;  4YIO A;  1BMF G;  3U10 A;  3RYF B;  3QO7 A;  1F4M A;  4WFB V;  4DR1 B;  3ABK C;  4N23 A;  4O4J B;  2OT5 A;  2P06 A;  1SQV H;  2AXT Z;  3I55 V;  3CCR V;  4H13 B;  1SA0 B;  2MK3 A;  3E22 B;  1N36 O;  3ZHQ A;  1UJW B;  4O2A B;  3UT5 B;  4UV9 A;  2IH1 C;  2HJF C;  1ZAU A;  2N04 A;  2IJI A;  2A3Q A;  3OGI B;  1HNX B;  3ASO B;  3BFR A;  2M6Y A;  3Q4H A;  1VQ9 V;  2E74 B;  2UXC O;  2F43 G;  1GN3 A;  1ORQ C;  1IVS A;  5IY5 C;  4TV9 A;  2PI5 A;  3CCE V;  4F6E A;  5CA1 B;  2X6B A;  2ZDI A;  4UUJ C;  1U97 A;  1CP9 A;  2ETN A;  3RYC A;  4X1Y B;  5FPR A;  1M57 B;  3E35 A;  2CGN A;  4X20 A;  3MDS A;  2YXH A;  2D3O W;  1KBH A;  3FYI B;  1AP6 A;  4UV8 A;  5BY1 A;  3CCV V;  4QJF B;  2QR4 A;  4X65 B;  1QHT A;  1H2M A;  1VF5 B;  4UCO A;  4I50 B;  3L74 H;  3A0R A;  1VQK V;  4I55 B;  4U7N A;  1EN6 A;  4K8Z A;  5IJ0 B;  1Y74 B;  1VEW A;  4A5U B;  2RJZ A;  4DV1 B;  3TK1 A;  1COW G;  2JIZ G;  2Y69 B;  4TSF G;  4PDV A;  3JD2 A;  1XDC A;  2EJ7 A;  3G71 V;  2HLD G;  4DR3 O;  4I7Z B;  1YXB A;  3CXH F;  4MT8 A;  1Q3E A;  5EYP B;  1VQN V;  1HR0 B;  4KFM A;  4YJ3 B;  4B3M B;  3QO8 A;  3GB7 C;  3CRM A;  4DRX B;  1S0V A;  2CGO A;  2ZR3 A;  4UB6 Z;  3RBZ A;  5B1B C;  3JAR B;  3OMI B;  1PL0 A;  2ADQ B;  1YIJ V;  2WA3 A;  3AEI A;  3X2Q C;  5DM6 V;  4DR6 B;  4DUZ B;  5JQG A;  1XOU A;  5KHJ A;  4JI7 O;  1M5I A;  1PKX A;  4RUF A;  1V55 B;  1BQ0 A;  3JYC A;  4G28 B;  4MVO A;  5IYC O;  2V7Q G;  1THZ A;  1X59 A;  1H38 A;  4TOI A;  5EIB C;  1LUV A;  3SJC C;  4JI2 O;  2CTQ A;  4X1K A;  2IW5 A;  2ZE6 A;  3ZN0 A;  4KHP B;  3MAQ A;  4UXN A;  5JH7 A;  2QWR B;  4QIW F;  4FM1 A;  5LMU O;  1M90 W;  4JI4 B;  4JI1 O;  4X88 A;  4TV9 B;  4RWU A;  2YC0 A;  4LP8 A;  2JJ2 G;  2NLJ C;  2A9H A;  4R50 A;  1YSC A;  3OTO O;  4RQE A;  3JAK B;  5TIS Z;  2NNU A;  4G2K A;  4MVM A;  1XL4 A;  4JGS A;  4DUY B;  4K3A A;  4UCV A;  5CA0 B;  4LWS A;  2F66 C;  3E83 A;  1R3J C;  3TCU A;  2B5U A;  3IC7 A;  3QVN A;  4B7E A;  3OR6 C;  1TUB B;  3SYQ A;  1TAE A;  2LP7 A;  4JV5 O;  5EBW C;  3IAY A;  2YIA A;  3ZRW B;  4JPR A;  1LUW A;  2X6C A;  2JRI A;  2Y4U A;  3BA8 A;  2W6I G;  1KMI Z;  1R6T A;  4JYB A;  2IBZ H;  1K34 A;  2Y69 C;  2PF4 E;  1NH2 B;  4KUM A;  4JI2 B;  1NKD A;  1BQZ A;  2CH7 A;  4DV7 B;  1NH2 D;  4B3R O;  3OAA G;  1VQ5 V;  5LMU B;  3HKE B;  5A9G A;  4JI1 B;  2VQE O;  4X66 B;  3SJA C;  1L0N H;  3STZ C;  1XUQ A;  3SPJ A;  3M8A A;  4DK0 A;  1G1X B;  1VF6 C;  4P30 A;  1XMO B;  2F4V B;  1M1K W;  1I5X A;  3RYI A;  4CC6 A;  2JK5 C;  3BEH A;  2WLJ A;  4O4L B;  3KG2 A;  1XQ8 A;  1RM1 B;  2VS0 A;  1H2N A;  4AI8 A;  1WP7 A;  4Z1M G;  4TWK A;  1GRJ A;  1DGS A;  1P7B A;  5LOV B;  1BHA A;  2KSD A;  4I0X A;  5F2V O;  3FKS G;  5IYB O;  2HFE C;  4MS2 A;  2IU0 A;  3RGB A;  3SPC A;  4LF7 B;  4WBN A;  1JVM A;  2UUC B;  2EX3 A;  1IUR A;  1QR9 A;  1N33 O;  3VQV A;  4J7K A;  2ZDI C;  1F23 A;  3ABM B;  1XNQ O;  2JS3 A;  4DW0 A;  3SDL A;  2KB1 A;  2DN9 A;  4B3R B;  2BE3 A;  1KKD A;  3VQX A;  1Y6X A;  2BSK A;  5LMN O;  4DV0 O;  3TXS A;  5KUM A;  4LWS B;  3K9A A;  2CK3 G;  2XND G;  1G4Y B;  5JCO A;  3STL C;  3JAS A;  3CC7 V;  2ZIN A;  1AJP A;  5LXT A;  4YHH B;  4Q20 A;  4UCR A;  2PGG A;  1UFI A;  1H2S B;  2ZXW C;  2ZIO A;  1XI1 A;  1VQ6 V;  4DK1 A;  5DN6 G;  3OM3 B;  2YI8 A;  1YHQ V;  4MTF A;  5KX5 A;  2Q68 A;  1RFY A;  4CS4 A;  2H8P C;  4DW1 A;  1PD3 A;  4MVS A;  4X8A A;  1WA8 A;  2CTR A;  1Q90 D;  4BW9 A;  3BAB A;  4DV2 B;  1V54 B;  1BE3 H;  3OFN G;  1HWY A;  4JYA B;  1GO3 F;  4EB6 B;  3LSQ A;  4JAV A;  1BL8 A;  4WFA V;  1ZUQ A;  3T4D A;  4JI6 O;  5LBQ A;  3E8G A;  3L70 H;  4MTX A;  5EBM C;  3RYH B;  5ITZ A;  3PJS K;  1TVK B;  2BTO A;  3T1H B;  1Q8I A;  3RYI B;  5KHH A;  5LP6 B;  4O4I A;  4LF9 O;  4XDL A;  1L1F A;  5LMN B;  3AK3 A;  1RM1 C;  3K5O A;  4LR3 A;  4LBE C;  2FL4 A;  2NR5 A;  1FXH A;  2EIM C;  3K0D A;  3E2E A;  1MMM A;  2XAG A;  4CZZ A;  3G6E V;  2JS5 A;  2LO1 A;  2Q7G A;  3O9O A;  1GAX A;  2V4D A;  2QWQ B;  5JWP A;  4I0X B;  5B5E Z;  1FPO A;  4YY3 B;  1FJG B;  4DR7 B;  4XDK A;  3ZBH A;  1PL4 A;  3SPI A;  1K5S A;  4LF4 O;  1SER A;  4PJ0 Z;  1HNZ O;  1QQC A;  3FB5 C;  3FB7 C;  1XEQ A;  2WLL B;  2Q0O C;  4PA3 A;  1FXK A;  2UUB B;  5IWA O;  3FAV B;  3ABM C;  4UFZ A;  1IX9 A;  4JTD B;  2DMX A;  4GKK O;  4U3J A;  4P2Z A;  2IJH A;  3E89 A;  3SJB C;  2OCH A;  4U7O A;  4LFB B;  1KEC A;  2CTW A;  2LGQ A;  3MHH C;  4JI6 B;  1P7G A;  3K0G A;  5IDJ A;  4E2L A;  5IYZ B;  2XHB A;  3ZMU A;  3JAS B;  3OUF A;  5IJ9 A;  4NVP A;  3RYF A;  4BIO A;  4BW5 A;  2B1G A;  3BHP A;  1B3Q A;  1SC5 B;  4GYC B;  1SF9 A;  5FLX N;  5KX5 B;  2LGW A;  1LNQ A;  4GT1 A;  4YIP A;  2Y4T A;  1W0K G;  3E22 A;  4TQD A;  1KC8 W;  2ZE7 A;  1YTF B;  4O2A A;  3UT5 A;  2PI4 A;  4JI5 O;  4GLX A;  4H37 A;  1V54 C;  1UPG A;  1YTF D;  3OR7 C;  1KP3 A;  4PDL A;  2EIJ B;  3AG3 C;  1X4T A;  5FPO A;  2GHY A;  3SYO A;  4JTA B;  1Z2G A;  1P49 A;  3ZED A;  3LDE A;  4LF4 B;  2Q9L A;  2XUM A;  5KA5 A;  4B3T O;  1N4C A;  4X1Y A;  5ITZ B;  3K59 A;  2Q73 A;  4DR1 O;  1L0L H;  1M93 A;  4O4I B;  2XOK G;  3CCJ V;  1YJW V;  3FB6 C;  2GUZ A;  1NTZ H;  2LJ2 A;  5B3S C;  4Q6G A;  4EKW A;  3M7M X;  4H33 A;  4I55 A;  1HNX O;  1NTM H;  1SQB H;  4TT3 G;  2EZP A;  1Y74 A;  5B1O A;  3WFV A;  3CCS V;  1OCC B;  4MVZ A;  4FLT A;  1K92 A;  3TET A;  1FXK B;  4HBN A;  1Q6H A;  3BA9 A;  2BOB C;  1M9N A;  5EYP A;  3JD4 A;  1SRY A;  3K08 A;  1I0H A;  3TJT A;  4DRX A;  1I94 B;  1JJO A;  3JSN A;  1US6 A;  2QM8 A;  1AR5 A;  3JAT B;  4X65 O;  5CMU A;  4LF8 B;  3H9V A;  3JAR A;  5JCO C;  3ETQ A;  4B3T B;  4TUY A;  4QE7 A;  5IJ9 B;  1QLE C;  4WFG A;  2AZ0 A;  3ZMZ A;  4AQY B;  3K9S A;  5GTI Z;  4DV1 O;  4D6T H;  2QWN B;  3AK1 A;  2QA4 V;  1JFF A;  4EFB A;  2UU9 B;  2P5O A;  5KAF Z;  3CHX A;  2QDO A;  3B4S A;  3D36 A;  1YI2 V;  1J5E B;  1XHX A;  2WLM A;  1OZ0 A;  2EIJ C;  3IJ4 A;  1HR0 O;  4B3M O;  4QGP A;  1G8M A;  2BOC C;  2UXB B;  3HKB A;  1SQX H;  2Q0A A;  2F93 B;  1O9G A;  5LA6 B;  2ZCE A;  1QLN A;  4NTW A;  3VBB A;  2HKO A;  4UCT A;  1K3E A;  3JAK A;  3J81 N;  4W4L A;  4DR6 O;  4IT5 A;  4DUZ O;  2UXD B;  2GTS A;  1G6U A;  3P32 A;  5CA0 A;  2GUZ B;  3BRC A;  1WB8 A;  2FB5 A;  4MVQ A;  1TUB A;  1SQF A;  5KMG A;  1S5J A;  1BHB A;  4KHP O;  3ZRW A;  2OTL V;  1Y66 A;  1Q82 W;  3U0Z A;  4JI4 O;  2P90 A;  2EIN C;  4JZ2 A;  3C3T A;  1OCC C;  4ASU G;  3W7X A;  5H6R A;  2AGA A;  2XAS A;  3DXR B;  1ZLZ A;  1RSO B;  2LQT A;  2ARH A;  3B8N A;  1FXK C;  3W7T A;  1BS3 A;  1NZ6 A;  2EIK B;  3HKC B;  1M56 C;  1W0J G;  3HKE A;  1PNL A;  4DUY O;  1K97 A;  3SYC A;  2GTA A;  5AG2 A;  2Q7E A;  3RWR D;  3UQ8 A;  2Y0I A;  1FAF A;  1JX9 A;  1Q43 A;  2ZIM A;  4TUY B;  2Y48 A;  3OEE G;  4H44 B;  1RPR A;  2ZKO A;  3AG7 A;  4O4L A;  3ICX A;  1JFF B;  1DLB A;  1MZF A;  4UCU A;  2UUA B;  1VQL V;  5LOV A;  3H1L H;  2B9Z A;  3ZRX A;  1ENV A;  2QGN A;  4DV7 O;  3ASO C;  1GM8 A;  1YJN V;  1J95 A;  4DV3 B;  3ASN B;  3ABT A;  4DXW A;  3G67 A;  4X66 O;  3HKB B;  5DEC A;  5LYJ B;  3L73 H;  1D5A A;  4O2B A;  4HNA B;  4B7K A;  4DV5 B;  3ZHT A;  2R70 A;  4X64 B;  1XMO O;  5K1X A;  2F4V O;  1B04 A;  3DC5 A;  3ZMV A;  3EVK A;  1M57 C;  1AVM A;  4P9P A;  1F51 A;  1AI6 A;  2DWD C;  3APO A;  3E8F A;  2DOS A;  1K73 W;  4GX1 A;  3NXS A;  1FS0 G;  3ZIA G;  5CA3 A;  4GUN A;  4Z2W A;  2W0X A;  2EIL B;  3JAM N;  3OT7 A;  4OGQ B;  3APQ A;  5EZY B;  5BMV B;  5KMG B;  4IL6 Z;  3TXQ A;  4O4H A;  4LF7 O;  3LDD A;  4DR5 B;  2YS8 A;  2UUC O;  4FFB B;  3NR7 A;  3LNN A;  1M4U A;  1SQQ H;  5L3F A;  5EK0 A;  4J9Y B;  4J11 A;  2OWO A;  5IYD O;  3R65 A;  4FLZ A;  4EB6 A;  3N2K A;  3HB3 B;  3LNM B;  3T4Z A;  2YI9 A;  4J10 A;  2IU3 A;  1K9M W;  1O9H A;  3AG1 B;  4B3S B;  2DYS B;  2ZM6 O;  4YHH O;  1YF2 A;  3RYH A;  3SR2 C;  2YEV B;  1TVK A;  4PDM A;  2P4K A;  1F4N A;  5LP6 A;  2QKS A;  4FIP C;  3O65 A;  1V55 C;  4DR2 B;  1SET A;  4ZOL A;  4GKJ B;  4DV2 O;  4FLX A;  3H01 A;  1FFX A;  1H8H G;  3D36 C;  4JYA O;  1XMQ B;  2DE0 X;  2WAM A;  3JD3 A;  3KCY A;  3W7W A;  3TGU H;  5E1A C;  1NS1 A;  5CB4 B;  3CYO A;  4OX9 B;  2E3C A;  4E4E A;  2P67 A;  4NR1 A;  3SJQ C;  1V9P A;  2H3O A;  3DGE A;  2WLL A;  2YIB D;  3B8M A;  4O2B B;  3FAV A;  1OJH A;  2A79 B;  3T1H O;  3HKD B;  4FMT A;  4W4K A;  2ZE5 A;  4R7C A;  1JR9 A;  1FYJ A;  1EBO A;  4N21 A;  1AI7 A;  4QE9 A;  3CC2 V;  3G4S V;  1WLE A;  5H2F Z;  2L35 A;  2W0F C;  2ZM6 B;  3WG7 B;  1XNR O;  5IYZ A;  4MW3 A;  1Q86 W;  1B6Q A;  2UXN A;  3RFR A;  1IBK B;  2EIL C;  3K3W A;  4YY3 O;  4O4H B;  1FJG O;  2ZT9 B;  3CX5 F;  4DR7 O;  2ZQM A;  1EN4 A;  3ABL B;  3AK2 A;  1PP9 H;  1VP7 A;  3JD0 A;  3QF7 A;  3JAW A;  2CDY A;  2OYQ A;  4KXR A;  3RN4 A;  1QCE A;  1PNM A;  2UUB O;  1E79 G;  5H5N A;  4OPA A;  5J2T B;  5BZB A;  4GX2 A;  3A0H Z;  4NB5 A;  1BZK A;  4WCE V;  2QWO B;  3OMA B;  3N2K B;  2E76 B;  2G38 A;  3OUS A;  2VQF B;  4WFF A;  4LFB O;  4F4L A;  3AG1 C;  1XBL A;  2KQX A;  3THO A;  2VWK A;  2R9R B;  3SYA A;  3QG5 A;  2RQ6 A;  2A7W A;  4BIU A;  3F5W C;  1OCR B;  5E79 Z;  2P6J A;  1ZSP A;  3HR0 A;  4GX5 A;  1SZT A;  4IYI A;  3ZS8 C;  3JSL A;  3CSX A;  1WPX A;  4IHJ B;  4WFE A;  5GW7 A;  5LL6 Y;  1Z5W A;  3M99 B;  4DV6 B;  1XNR B;  4ZOL B;  2P7T C;  3CMA V;  3CPW U;  1KP2 A;  4X1I A;  3K58 A;  1N0J A;  1FFX B;  4FVM A;  4U3F H;  2DQ0 A;  2XAQ A;  5FNV A;  4ZHQ B;  5K1P A;  5L3D A;  5LGT A;  4CC5 A;  1KKC A;  4AHC A;  2W6J G;  2Q8V A;  3AG4 B;  3ML0 A;  2QKC A;  2FML A;  1P84 F;  2Q69 A;  3LSS A;  2ZNJ A;  4WFH A;  2ZNI A;  3UO3 A;  3CP1 A;  3VQY A;  2EJR A;  2ILM A;  1R1B A;  1VQM V;  4LFC B;  4I9Q A;  1NTK H;  3CXC U;  2RDC A;  3FD9 A;  2IJJ A;  4LF6 B;  3BCC H;  4EFE A;  3RW0 A;  5CBG A;  1NI8 A;  3JAT A;  2BTQ A;  1L8D A;  4RUE A;  1I7F A;  3WG7 C;  2QTS A;  1AIL A;  4NXN B;  4CH4 A;  3I56 V;  4LFA B;  2N74 A;  4FZ0 A;  3ZHV A;  4PA4 A;  2B1I A;  1QVF U;  4JI8 B;  2Z3Y A;  3J7A U;  4QNH B;  2K9P A;  4BWA A;  2A0L A;  3ABL C;  3VOU A;  2NN4 A;  1PNK A;  3JAW B;  2HG5 C;  4I5S A;  2Q67 A;  2ZD9 A;  5J2U B;  2WWW A;  2IH3 C;  4F6R B;  3UCS C;  3S3W A;  4RAI A;  2GBO A;  2OIG A;  1CXZ B;  4J7Z A;  2O57 A;  1CPY A;  5CBF A;  1I94 O;  5LHI A;  4JZG A;  1TUE B;  4LF8 O;  3ZCC A;  5LA6 A;  2XAJ A;  4UVB A;  4J7J A;  2Z0A A;  4JYC A;  1Q7Y W;  2XTA A;  1OCR C;  1QBZ A;  3CCM V;  1XHZ A;  3CJH B;  3MD0 A;  1RP3 B;  4AQY O;  5KAI Z;  5LP6 C;  5C93 A;  3E8H A;  2QWP B;  2UU9 O;  1N34 B;  2DJV A;  3LUT B;  3H1I H;  4J41 A;  4FM2 A;  3UM7 A;  4X1I B;  1J5E O;  1URF A;  1S76 D;  1K4D C;  5FNV B;  1HP8 A;  1HDJ A;  2CUG A;  1GH6 A;  4JI3 B;  4NYK A;  2YSU B;  2VWJ A;  3DTU B;  4PA7 A;  2F1M A;  3LSU A;  1ROP A;  2HVK C;  2AW9 A;  4UB8 Z;  2UXB O;  3SYP A;  2YXY A;  1GK9 A;  1I08 A;  2R9A A;  2PY5 A;  4LF5 B;  5JJN B;  4YJ2 B;  5GON B;  1HNW B;  3ZHU A;  3DXR A;  3PN1 A;  1RSO A;  2WLK A;  3U11 A;  4MTG A;  1W59 A;  2OTJ V;  1JA8 A;  1R73 A;  5KUK A;  1WJZ A;  4B08 A;  3HKC A;  3ZRS A;  2UXD O;  4GCZ A;  2Q4P A;  4PA6 A;  1VMG A;  4PI2 A;  4QPK A;  1H2K A;  2BTQ B;  2RN9 A;  2JJ1 G;  3WB1 A;  3G80 A;  4LH6 A;  3W7U A;  1MSW D;  3BVO A;  1Y4M A;  3K03 A;  2GV9 A;  2K1E A;  2P4V A;  3FX7 A;  2Y0P A;  4MSW C;  3CC4 V;  1D2D A;  2X6A A;  1DTO A;  1N32 O;  4FK5 C;  1U96 A;  2E75 B;  3E86 A;  2XAF A;  1IBL O;  4PA9 A;  1YEW A;  4ICG A;  3X2Q B;  3GVM A;  1IBM B;  1RPO A;  2M7W A;  2PZS A;  1WPB A;  5BR8 B;  2HJD A;  4X9Q A;  2CAZ C;  1N0N A;  1BCC H;  1MA1 A;  3B09 A;  3JCU Z;  5LYJ A;  1SQP H;  2L6L A;  2ITC C;  3CRC A;  4HNA A;  2X7R B;  5EIB D;  1AI4 A;  2WSS G;  4JI0 B;  2HP8 A;  4FZ1 A;  4L8J A;  5EC2 C;  2YUA A;  3K06 A;  2YXL A;  3D8C A;  4D7T A;  4RO2 A;  4DO2 A;  3S3X A;  3BY6 A;  2UUA O;  3J80 N;  5EC1 C;  3ABU A;  5EZY A;  4UVC A;  5BMV A;  2ITD C;  2CTP A;  1PM9 A;  1WN7 A;  2ZE8 A;  5JVD B;  4GZR B;  4DV3 O;  4K0K O;  4FFB A;  2HHH B;  4XDJ A;  1S3J A;  1N32 B;  4X62 O;  3CRR A;  3QTC A;  1TGO A;  1IBL B;  3GWK C;  4I4T A;  4DV5 O;  1Q81 W;  4X64 O;  2JEX A;  5CN0 A;  1YIT V;  3T1Y O;  5KHK A;  1IXB A;  4FLY A;  2ADP A;  1N36 B;  3ZMS A;  3K57 A;  1QU7 A;  1ZX3 A;  2AHZ A;  1GN6 A;  4CH5 A;  5B66 Z;  4FPP A;  1YZB A;  3KKY A;  2YEV A;  1TA8 A;  1YCI A;  4JAA A;  4DR5 O;  1W2B U;  2QTO A;  2UXC B;  5BXZ A;  1QR8 A;  4RQF A;  1R3K C;  3P3N A;  2CE4 A;  1VIB A;  1NR7 A;  1GN2 A;  4ABM A;  1ZL8 A;  2AZ2 A;  1DK1 A;  2JDI G;  3BAA A;  4FLV A;  3UO2 A;  4LNU A;  1XIL A;  1VQP V;  4K0K B;  2WLH A;  2QSA A;  5CB4 A;  1EZV H;  2YIB A;  1JQ0 A;  4B3S O;  4X62 B;  3D3Q A;  1WAZ A;  2UXX A;  4NXM O;  3C90 A;  5GTH Z;  3I5D A;  5J9P C;  4IGG A;  2C2A A;  2GDS A;  3HKD A;  3Q4H B;  3CB2 A;  1FFT B;  2F23 A;  3T1Y B;  5JJJ B;  2LFS A;  1BGY H;  1MAB G;  1K4C C;  5L3G A;  4DR2 O;  1KU9 A;  4JAU A;  2WLI A;  1AR1 B;  2PYL A;  3OMN B;  4GKJ O;  3RYC B;  1DF5 A;  4DR3 B;  3OGC C;  3W7S A;  1KD1 W;  4X20 B;  4JAS A;  1XMQ O;  2FKX A;  1IZ3 A;  1Y67 A;  4PV1 B;  2OCC B;  4D7S A;  4OX9 O;  2AHY A;  1KUQ A;  3QNE A;  4AIL C;  1QVG U;  5D5Q A;  2ZXW B;  4H0L B;  4I4T B;  4KP4 A;  3DC6 A;  4FLU A;  4I9W A;  3ZHR A;  5J2T A;  2EUL A;  1OCO B;  2N05 A;  4JI7 B;  2EIK C;  2JGU A;  1VQ4 V;  1Q6I A;  4ZI7 A;  1JCH A;  3CME V;  1NBM G;  2LW7 A;  5LHH A;  3ETG A;  3H1J H;  4NXM B;  3K79 A;  3CE2 A;  3L75 H;  3N2G A;  1IBK O;  1S5L Z;  4KL1 A;  4P9O A;  2QM7 A;  4Z1V A;  1NR1 A;  4LH7 A;  1JPX A;  1EM1 A;  1EZJ A;  2YID A;  1LR1 A;  2FYU H;  3EXA A;  4IHJ A;  2IJK A;  1S5H C;  1GN4 A;  2P22 C;  2HEP A;  2GSM B;  3R66 A;  1ZL8 B;  3FB8 C;  3E8B A;  1MZE A;  3F7Y C;  3ZHS A;  2KG7 A;  5KHI A;  3CS5 A;  4BIZ A;  3OTO B;  3T2M A;  2D2C B;  2A06 H;  3RT3 C;  1EFR G;  3B77 A;  2WLN A;  4ZHQ A;  4J9Z B;  5JQG B;  4LNU B;  2JGD A;  1SS3 A;  3L72 H;  2V1D A;  3H1H H;  4UVA A;  2VQF O;  4MTO A;  2EIM B;  4MW8 A;  3ASN C;  3SPH A;  3FFQ A;  4CH6 A;  4FJC C;  2KKW A;  4X1K B;  4JV5 B;  5JJE B;  3GWO A;  4GX0 A;  4IYH A;  4TV8 A;  1N8R W;  5JH7 B;  3UKM A;  3SGI A;  3OTF A;  3K5L A;  2WPD G;  1GKF A;  4ZKI A;  2ATK C;  1B06 A;  2F95 B;  1DF4 A;  1AP5 A;  4DV6 O;  2WLI B;  3CRQ A;  5LGN A;  2QKA A;  1K8A W;  3WU2 Z;  1YJ9 V;  1H8E G;  2EZO A;  2VRZ A;  4PEL A;  4OPH A;  4QPJ A;  4ZIB A;  5L3E A;  1SES A;  3EFF K;  3L9D A;  3K5M A;  1GM9 A;  4FLW A;  3JCZ A;  3ZMT A;  3CRA A;  3L71 H;  2WA4 A;  3ETE A;  4LCU C;  1MG1 A;  4ZBM A;  2VQE B;  2OCC C;  1VQO V;  4PD4 F;  3WB2 A;  1Y76 A;  4L87 A;  1AJN A;  2PUS A;  4JYY A;  5D5P A;  5J2U A;  3ETD A;  1JJ2 U;  4F6R A;  2DYR B;  2H94 A;  4HAM A;  4LFC O;  1R3I C;  1OHH G;  4LF6 O;  1OCO C;  2QM4 A;  1ZWI C;  2RCV A;  3BPZ A;  4MVR A;  1SKV A;  4ZI7 B;  2Q5Z A;  1AI5 A;  1FD9 A;  2DYS C;  3A0B Z;  1D5N A;  5H6Q A;  1FKA O;  2JEU A;  1K33 A;  3ZRV A;  3AG3 B;  3N2G B;  5C8Y A;  4LFA O;  2CH7 B;  4NXN O;  1S77 D;  2RMK B;  4YXW G;  1E1Q G;  1S72 V;  2JVD A;  3QO5 A;  3CJH A;  1F7Y A;  5L3C A;  4K35 A;  4JI8 O;  2BCC H;  2HR3 A;  5FL7 G;  4J42 A;  1N33 B;  1R6N A;  1AJQ A;  3RVZ A;  3C3S A;  1XNQ B;  1OV9 A;  4WF9 V;  2KG7 B;  4DV4 O;  1T5E A;  2OIE A;  4BAY A;  1GMG A;  1JOY A;  2LFR A;  2Q6A A;  3FYE B;  3H1K H;  2XT9 A;  2JGD B;  4DV0 B;  4CS2 A;  2EBO A;  5LGU A;  5B3S B;  1VQ8 V;  4IIJ A;  2ZR2 A;  1YVW A;  5B1A B;  1ZTE A;  4BR6 A;  1WP8 A;  1P4R A;  4YJ2 A;  5GON A;  1VQ7 V;  4PI0 A;  2HVJ C;  2YDE A;  4MVU A;  4TV8 B;  1Q5O A;  4WBN B;  4OXS A;  1WNS A;  4K8X A;  1BT8 A;  5H9C A;  1R3L C;  3CEI A;  4NKG B;  1N34 O;  4CBC A;  5KA6 A;  1OCZ B;  4EEQ A;  1H2G A;  2XAH A;  3OEH G;  1Q6U A;  4HYO A;  1A32 A;  3N27 A;  1KQS U;  1JMK C;  2R72 A;  5EBL C;  4JI3 O;  2BSK B;  3AG2 B;  3CCL V;  4NTY A;  2PYJ A;  4X89 A;  1AB3 A;  5IE9 A;  1PPJ H;  5L3B A;  3JAL A;  1Y76 B;  4UCS A;  1KB9 F;  3SPG A;  4C7U A;  5LXT B;  4LF5 O;  5KLV H;  1HNW O;  4DV4 B;  1QLE B;  3CD6 V;  1MSD A;  3P30 A;  3ABK B;  3LDC A;  4NTX A;  1AR4 A;  1PV0 A;  2DYR C;  4O4J A;  3DSQ A;  1XL6 A;  1K5Q A;  3G6B A;  4LF9 B;  3ZJZ A;  2DWE C;  2RNB A;  3ZN1 A;  2E5L O;  1NQT A;  3RVY A;  5DED A;  4CS3 A;  4JF3 A;  2LW1 A;  1MOF A;  1E1R G;  3IFX A;  1SA0 A;  4DR4 O;  1QNM A;  1WA8 B;  3F5T A;  4PDR A;  1SZX A;  2QE7 G;  2DW4 A;  5HFL A;  1H2L A;  3D3I A;  3CCQ V;  5C8Y B;  3VQW A;  3OD4 A;  1ARO P;  5IY5 B;  2Z5U A;  4DYL A;  3JD1 A;  1NJI W;  4CH3 A;  5CA1 A;  4FM0 A;  2DQ3 A;  1KYO F;  1FXV A;  1HNZ B;  1BSM A;  3T1C A;  3CCU V;  3WB0 A;  3B2E E;  4R8C A;  5IWA B;  2MW2 B;  1NU1 H;  3IGA C;  1IBM O;  3HPL C;  1XRE A;  5CBH A;  2QJ1 A;  4GKK B;  1YDX A;  5BR8 O;  2YIC A;  3CWB H;  4HZ3 A;  1NVP B;  5JVD A;  3EHB B;  2FTK A;  1I5Y A;  2PTM A;  1K7D A;  3AG4 C;  4IIJ B;  4LC1 A;  3K5N A;  1GM7 A;  1Z5V A;  5IT9 N;  1IXM A;  3MHS C;  2Q7H A;  1NVP D;  1NT2 B;  2ODM A;  5KHG A;  3IC9 A;  4I50 A;  4JTC B;  5B1A C;  4PHZ A;  1GTO A;  1VF7 A;  3A8T A;  4G27 B;  4R6Z A;  2R9I A;  1WB7 A;  5IJ0 A;  4JI0 O;  2EIN B;  5B1N A;  1VAR A;  2IM9 A;  2E5L B;  4FFK A;  1CEZ A;  5HFM A;  4DR4 B;  3F7V C;  3OW2 U;  1MNG A;  4JI5 B;  4TQF A;  1OCZ C;  2QEX V;  2X0L A;  3KZI Z;  3ZX6 A;  5LHG A;  1M56 B;  4U3J B;  3P3P A;  5A2Q N;  1IDS A;  3B40 A;  4XBF A;  4YJ3 A;  3AG2 C;  1SQG A;  2HHH O;  3OE7 G;  1HW7 A;  4J80 A;  3K04 A;  3JAL B;  1R6K A;  5B1B B; 
#chains in the Genus database with same CATH homology
 4NXN O;  4LFA O;  1R6T A;  3R66 A;  2E5L O;  2UU9 O;  2DOS A;  4KHP O;  2DJV A;  4DR4 O;  3T1H O;  3F5T A;  1F7Y A;  4B3S O;  4JI8 O;  3RT3 C;  4JI4 O;  1FYJ A;  1J5E O;  3JAM N;  4NXM O;  4B3R O;  2AGA A;  2VQF O;  4LF7 O;  4DV4 O;  1N36 O;  1XNR O;  2UUA O;  1R1B A;  2UUC O;  2VQE O;  3J80 N;  4X65 O;  2UXB O;  5FLX N;  4JI7 O;  3M8A A;  4YY3 O;  4DR2 O;  4DUY O;  1G1X B;  1FJG O;  4K0K O;  4DV3 O;  4DR7 O;  1IBM O;  2UXC O;  1X59 A;  4GKJ O;  4JI5 O;  4JI6 O;  4JI2 O;  4X62 O;  4DV1 O;  2UXD O;  1AIL A;  5BR8 O;  2N74 A;  1XMQ O;  2FKX A;  4DV6 O;  4DV5 O;  4X64 O;  5LMU O;  2UUB O;  2ZM6 O;  3J7A U;  5H5N A;  4OPA A;  5IT9 N;  4JI1 O;  4OX9 O;  2ZKO A;  1KUQ A;  4OPH A;  4LF9 O;  3T1Y O;  4YHH O;  4B3T O;  5BY1 A;  1N34 O;  1HR0 O;  4B3M O;  4LFB O;  3OTO O;  4DR1 O;  1D2D A;  4JI0 O;  1YZB A;  1A32 A;  4DV7 O;  1N32 O;  1N33 O;  3O65 A;  4JI3 O;  1IBL O;  1XNQ O;  4DR5 O;  1I94 O;  5BXZ A;  3J81 N;  1AB3 A;  2LW7 A;  3SDL A;  4A5U B;  4DV2 O;  4LFC O;  4DR6 O;  4X66 O;  4DUZ O;  4LF4 O;  4LF8 O;  4JYA O;  4LF6 O;  1IBK O;  5LL6 Y;  4DV0 O;  5LMN O;  1HNX O;  1HNZ O;  4LF5 O;  4JV5 O;  5A2Q N;  1HNW O;  1XEQ A;  2Z0A A;  1XMO O;  1NS1 A;  5IWA O;  1DK1 A;  2F4V O;  2HHH O;  1FKA O;  4DR3 O;  4AQY O;  2JRI A;  4GKK O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...