4DV0O

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
87
structure length
87
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
publication title A structural basis for streptomycin resistance
rcsb
total genus 30
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dv0O00
1XNRO 3O65A 4DV0O 4X65O 4OX9O 4LF6O 4DV7O 4DV3O 4LF7O 4DUZO 5H5NA 5LL6Y 4JI7O 1FJGO 1IBKO 1KUQA 4DV4O 4B3RO 2UXCO 2DOSA 2UXBO 1F7YA 1DK1A 4NXMO 4DUYO 1NS1A 1AILA 4X64O 4DR7O 4GKJO 4A5UB 1N33O 1FYJA 1I94O 4LF9O 5BXZA 2UXDO 4JI3O 1YZBA 5BY1A 4LFCO 1A32A 1AB3A 1XMQO 2E5LO 1X59A 1XEQA 1FKAO 4JV5O 1HR0O 1IBLO 4JI4O 3F5TA 4LF8O 4LF5O 3J7AU 4JI8O 4AQYO 4GKKO 4JI5O 4OPHA 4YHHO 1HNWO 2VQEO 5LMUO 1D2DA 4DV6O 4JI6O 3M8AA 5IWAO 1HNXO 5FLXN 2DJVA 2N74A 1R1BA 2ZKOA 3RT3C 4JI1O 4LF4O 3J80N 4K0KO 4DV1O 2VQFO 1G1XB 3T1YO 5LMNO 2UUBO 3SDLA 5IT9N 2ZM6O 1XMOO 3OTOO 4DR1O 4LFBO 4JYAO 3R66A 1J5EO 2UUAO 4DV2O 2Z0AA 1HNZO 2UUCO 1N36O 4DR2O 4DV5O 2LW7A 4LFAO 4YY3O 4JI2O 2JRIA 2FKXA 2UU9O 2AGAA 5BR8O 3J81N 1IBMO 1R6TA 3T1HO 4KHPO 4JI0O 1XNQO 4DR6O 4B3MO 2F4VO 4DR5O 4X62O 4DR4O 4B3SO 5A2QN 4B3TO 4DR3O 4NXNO 4X66O 1N32O 4OPAA 2HHHO 3JAMN 1N34O
chains in the Genus database with same CATH superfamily
3Q4HA 2IH1C 2EZOA 3ABLB 4RUFA 1Q7YW 5BMVA 2KKWA 3TK1A 1K92A 1P84F 1OCRC 2YI8A 1Y66A 4X1KB 2DE0X 2EBOA 4NXMO 1BL8A 1NS1A 3CRRA 4HNAB 4CBCA 2L6LA 3K5MA 1WP7A 3STLC 4D7SA 2HLDG 4IL6Z 1KD1W 3K08A 1F4NA 1IXBA 1RSOB 2WA4A 1IX9A 1LUWA 4LBEC 4CH3A 5E1AC 1NH2D 2KG7A 3F5TA 4TQFA 2HG5C 2RJZA 3N2KB 2QSAA 2X0LA 3LDEA 2CK3G 1FFXA 5IJ0B 1M4UA 1O9GA 2ZKOA 4O2AB 1AI6A 2H8PC 2EILB 3OMIB 1G1XB 3D36C 4K3AA 4TUYB 1MMMA 4DRXB 3SDLA 4GT1A 5CB4B 2DW4A 4FMTA 3EXAA 3GVMA 5JJNB 1JCHA 2AZ2A 1YTFB 3AG4B 2Q9LA 3W7WA 4HZ3A 2Q4PA 3CX5F 4E2LA 5KAFZ 1ZL8B 2DWDC 3DXRB 3OW2U 5HFLA 1AJPA 1K4CC 1CP9A 5J2TB 4B3TB 1NTMH 2ARHA 3K59A 3K3WA 1XQ8A 3LNNA 3RYFB 4KHPB 3CP1A 2QWNB 3P32A 4HBNA 4X20A 2F4VB 4LF9B 4OGQB 1JMKC 3CHXA 2LGQA 3RW0A 1GN6A 2Q67A 4H37A 1RSOA 4ZOLA 4UV8A 3BCCH 4B3RO 1T5EA 2MK3A 4FFBB 2RMKB 5EZYB 1OCOB 2ZNIA 4WFEA 2ITDC 1VQ8V 2GHYA 2EIMB 2LFRA 2IH3C 1I7FA 1NVPD 4O4JA 2JEUA 1WPXA 3HPLC 2B1IA 1XMQB 3A0RA 1H2MA 3C90A 4RUEA 2P06A 1XEQA 2JS5A 1NVPB 3P3NA 1AROP 1SS3A 4AQYB 4O4LA 2HEPA 4C7UA 4JI8O 1AR4A 2PY5A 3K0GA 2CDYA 5EBLC 4KUMA 2BTQB 4CS2A 3OT7A 4ZKIA 5FNVB 1WJZA 2QE7G 1N34B 3R65A 4PJ0Z 5IT9N 3E89A 2ZM6O 2G38A 3E8BA 2ADQB 2NLJC 4QPJA 5D5QA 2PZSA 1OZ0A 2O57A 4B3SB 3BVOA 2LW7A 3TETA 1W0JG 2V7QG 2UXXA 4UCTA 4MW8A 2Y48A 1F23A 5JCOA 4BAYA 4FLXA 4B3SO 1G8MA 4NXNO 4X66O 4WFBV 4DV0B 1XUQA 4FM1A 5J2TA 3KG2A 2EIMC 2EILC 3OTOB 3T1HB 1L0LH 1XHZA 2WLMA 4DV3O 3RGBA 3P3PA 4PA7A 1SQVH 1QR9A 4KL1A 2UXBO 1IVSA 3E86A 1YJ9V 3VQXA 1KB9F 1FXVA 5KX5A 3CCVV 3D3IA 3HKBA 4O4HA 3E35A 4DRXA 3E2EA 1Q43A 3E8HA 4XDKA 5BXZA 1KMIZ 5EK0A 1PNMA 5FL7G 3CC7V 1UFIA 5GTHZ 4NVPA 1BCCH 5IJ9B 2FTKA 4D7TA 4EFEA 1FS0G 2Q0AA 1EBOA 1FFTB 1TVKA 3OD4A 3LNMB 3UQ8A 1S72V 1D5AA 4I9QA 4DUYB 3STZC 4R7CA 4X8AA 2WLJA 4O4LB 1Y74A 3QO5A 1VF5B 1RP3B 2UUAB 1H2SB 4MVOA 2Q8VA 1FXHA 1B6QA 5IY5C 1JFFB 5LMUB 2ADPA 1U96A 1UJWB 5LYJA 2XHBA 1XILA 4XDJA 1H8EG 3SPIA 3JATB 2HJFC 5BR8O 4YJ2A 1NI8A 2QM4A 5JWPA 3SPJA 4DR3O 1AI5A 4ABMA 4OX9B 4JPRA 1GH6A 4JZGA 1HNZB 1XNRO 1US6A 3O65A 4I5SA 4X65O 2AZ0A 4FLZA 1P49A 3CCSV 4I50B 3RN4A 4NB5A 3K5OA 3SJCC 1M56C 2QTSA 2IM9A 5H5NA 1L0NH 4JI7O 1P7GA 3AG7A 4P9PA 4PI0A 4DR2B 3QG5A 1AI7A 5J2UA 2VQEB 1THZA 3AG3C 2Y4TA 2W6JG 2YI9A 1FYJA 3L9DA 3S3XA 2H94A 1FD9A 3ZRVA 3O9OA 3ETGA 4PHZA 4AI8A 5CMUA 2GTSA 5CA1A 3OGIB 4MT8A 1AB3A 3ICXA 5CA0B 1FKAO 1M56B 4JV5O 2Q68A 2X6BA 5LHGA 1IBLO 1WB7A 3H1IH 1MSDA 1TUEB 3ZHRA 3CMEV 1U97A 5EIBC 1K97A 2ZR2A 5LMUO 2P6JA 2UXDB 4X1IA 3QTCA 1XMOB 5EC2C 2W0XA 1YITV 3OEEG 2EINB 1IZ3A 4WFGA 3RVYA 2CH7B 1WP8A 3JAWB 4CZZA 3JAKA 1QNMA 1XNQB 5DN6G 5EYPB 2P67A 3JATA 4NTXA 3N2GA 4ZI7B 1AP6A 3K58A 4DV2O 3CCEV 3ZN1A 1SETA 2UXCB 2A7WA 4JZ2A 4R50A 1XBLA 3VBBA 4DV5O 3AEIA 4LF4B 3HKDB 4PA6A 3JALB 1PL4A 3ASNB 1F51A 5JH7B 1N33B 4WFHA 5EYPA 1FAFA 2JJ2G 2CGOA 3VQVA 4DR5O 1FJGB 2XOKG 1OCOC 1K5QA 1MNGA 1SZXA 1G6UA 2L35A 4DV7O 3CCRV 4G27B 2ZQMA 1BE3H 3G80A 3ZIAG 2PUSA 4DYLA 1NQTA 3U10A 2Z5UA 4X64O 2ZCEA 2LJ2A 3VOUA 3FB8C 1KP3A 1AJQA 5IE9A 5K1XA 3CCLV 1YDXA 2EULA 1OV9A 3D3QA 1N32B 4MVUA 5GTIZ 2ZR3A 5KX5B 1SQFA 4CH4A 4LF8O 1M57C 4NR1A 4O2AA 2P4VA 3E83A 4QIWF 5KUKA 4JI5O 3AG2C 1GKFA 4JYCA 3IFXA 4DK0A 1GM8A 3SYQA 3T2MA 4TWKA 1PV0A 3F7YC 2CTRA 4JI1B 5LHHA 4Z2WA 4EFBA 1JJ2U 1F4MA 1LUVA 2R9IA 2YIDA 4F6RB 2V1DA 1XHXA 2KB1A 2ZINA 3AK2A 5LMNO 2E76B 3WB0A 3CCJV 1SF9A 5GONA 3BEHA 4LNUA 4J41A 4JYYA 2PI4A 3SPGA 2CE4A 1PL0A 3UT5B 1VP7A 5JJEB 4R8CA 2XAGA 1QCEA 1S5HC 4DV2B 3T1HO 4DV3B 4B3MO 1GK9A 4JI3B 3NR7A 2XT9A 1D5NA 1NT2B 2WA3A 4J11A 2RCVA 4H0LB 1N34O 3JAWA 3CMAV 4D6TH 4ZIBA 1M57B 1WPBA 1FJGO 5IDJA 4FZ0A 3ABLC 3JD4A 3B09A 1EZJA 1DK1A 4DR7B 2DYSC 1NR7A 1I94B 1PM9A 3AG1B 4U3JA 4GKJO 2F93B 4XBFA 2EIKC 4I7ZB 4YXWG 2OCCB 2AHYA 1MZFA 1R3LC 3DSQA 4FPPA 5CA1B 4I4TA 4LH7A 1GN3A 3TXQA 2WLIA 1X59A 4LF5B 4QE9A 3N2GB 2JGDB 1BMFG 4IIJB 4PELA 1VQKV 3OAAG 4JYAB 1NR1A 2Q6AA 1QVFU 3G6BA 3C3SA 1KKCA 3APOA 1PNLA 1VF7A 4FK5C 1FXKC 5LP6A 5IWAO 1HNXO 3OUFA 1HDJA 4K8ZA 2N74A 5DEDA 1QLEC 3UM7A 4J9YB 4MW3A 1OHHG 4UCRA 1YSCA 1EFRG 3IC7A 5KHHA 4FLYA 4JTDB 1KU9A 3DXRA 4DR1B 4LFBB 2HP8A 4BW5A 1QLNA 4MTXA 5LP6B 2Y4UA 4PDLA 1NBMG 2VWJA 1J5EO 3I56V 4IYHA 4U3FH 4MVZA 1YVWA 3A8TA 4MTFA 2UU9O 1I08A 1KYOF 5KUMA 1IBMO 5CBGA 2WLKA 4DR6O 4N21A 5K1PA 1JFFA 5KLVH 4B3TO 4MVRA 1M93A 1Z5VA 1N4CA 4RO2A 2Y0PA 3H1HH 1O9HA 2JS3A 5A9GA 4DV4O 2DOSA 3DC6A 4UCUA 1HR0B 1V9PA 3L71H 1VEWA 2YS8A 2OTJV 4WF9V 3CJHA 1Q6UA 2QWRB 1K34A 2XAHA 4X88A 1NU1H 1N0JA 4TOIA 4F4LA 3EFFK 5CBHA 3SYOA 1TGOA 3BHPA 5IYZB 1QLEB 4F6EA 1I5XA 1VQOV 4P2ZA 3C3TA 4IT5A 4LP8A 1YJWV 4YIOA 2QEXV 4LF8B 1EN5A 4GKKO 4UUJC 2P90A 4TV9B 2Q73A 4JI8B 5LXTA 4UVBA 4OXSA 1RPOA 3B4SA 4RWUA 1SQXH 3W7XA 1K8AW 3CRAA 1HW7A 1V54B 1M1KW 1S0VA 2OIGA 3T1YB 3FD9A 4X20B 4JI4B 1B06A 2W0FC 2UUBB 4TQDA 3E8GA 3BY6A 2CTWA 3W7SA 4GZRB 3MHHC 4GCZA 2DYSB 3FYIB 1ZL8A 4KP4A 1Y6XA 2JDIG 1QVGU 1HNZO 4B3RB 3SPHA 2PYJA 3OEHG 4GUNA 2HKOA 2AGAA 2LW1A 4DV4B 1S3JA 4EKWA 4JAUA 4IIJA 2BE3A 1K3EA 3RYCA 5B1BC 2HHHB 1Q6HA 2R72A 5A2QN 1KQSU 3ETQA 4OPAA 1SA0A 4NXNB 2ZXWB 4JF3A 4FLWA 3BA9A 1GO3F 1VQMV 3ZMUA 3GWOA 4GX1A 3CS5A 3IC9A 4UVCA 2OWOA 4YIPA 2K1EA 4CC5A 1GAXA 2LQTA 3LUTB 1V55B 3CXHF 1IBLB 2BTQA 4AILC 2OTLV 3ZMSA 4MVMA 1GM9A 2HJDA 4DR7O 1Y67A 2MW2B 3JSNA 4O2BB 2YXLA 2D3OW 5KHIA 2FYUH 1AJNA 4IHJB 3CRMA 2AXTZ 3HKEB 1XMQO 1CPYA 4O4JB 4I55B 1WA8B 3KKYA 4AQYO 1OCZB 2PI5A 3W7UA 2F1MA 3H9VA 3WU2Z 3I5DA 2EX3A 2DWEC 4YJ3B 3K5NA 4TSFG 5FPRA 5BMVB 2XAFA 1K7DA 2GDSA 2BSKA 2CH7A 3J80N 1SQPH 2R9AA 3WG7C 1R3KC 2HR3A 1H38A 1M9NA 2WPDG 3RYIA 3RYFA 4X1IB 3ZEDA 1XMOO 4UB6Z 4BIUA 4QJFB 2Z0AA 3GB7C 5L3DA 2C2AA 5B3SB 4YY3O 2R70A 4DW1A 4ZHQB 1HWYA 1DF4A 1PPJH 4NKGB 4KHPO 2XNDG 2ZE7A 4X62O 2ZIOA 4DV5B 2XUMA 3OM3B 4FVMA 1MOFA 4H13B 2PF4E 4OX9O 4MTGA 1R3JC 1QQCA 3AK3A 1DGSA 3L74H 3KCXA 1YF2A 3ZHSA 1ORQC 1EZVH 4I0XB 5LL6Y 1FFXB 5IYDO 3AG4C 3N2KA 3JASB 2WLLB 3FKSG 3EHBB 4RAIA 3ZJZA 4DV7B 4UVAA 4DXWA 1S77D 1Y76B 2CTQA 2UXDO 3ABTA 1YZBA 4X66B 1VQLV 4P9OA 1WAZA 4X64B 2BTOA 5EIBD 5LGUA 2V4DA 2LO1A 2RDCA 4TV9A 3JD1A 5DECA 2Y69C 2B1GA 2ZIMA 5IYCO 4WBNB 4JV5B 3FB6C 2ETNA 1XOUA 3CWBH 4CS3A 1KKDA 2NN4A 3ZCCA 3DGEA 2F23A 2RQ6A 2IU0A 1BGYH 2OIEA 2E75B 4QE7A 3OMAB 1Q90D 3W7TA 2E74B 3FB7C 3LDCA 2ZE8A 3UKMA 3TXSA 2ZM6B 1WB8A 3JSLA 2DN9A 5DM6V 1SQGA 2WAMA 1HP8A 3CC2V 4BIZA 3ABKC 3SPCA 2UUCO 2N05A 4Q6GA 1N36O 4JI2B 1E1QG 3PN1A 3OMNB 1RM1C 5JCOC 5IJ9A 2QKAA 1S5LZ 5BR8B 5E79Z 3E22B 3L73H 2HHHO 4WFAV 1OCCC 2IJHA 3F7VC 4WBNA 3G4SV 2FL4A 3ZMTA 1M5IA 5EZYA 2W6IG 5B1NA 1WNSA 1MG1A 1JJOA 1IBKB 2P4KA 3M7MX 4MS2A 1DF5A 3BPZA 1JVMA 3K9AA 3B77A 2FMLA 3G67A 4JASA 5D5PA 4J7KA 4JTCB 1BZKA 1RPRA 2A0LA 2GV9A 1VMGA 4O4IA 3BAAA 2RNBA 5JQGB 4I50A 1VQ7V 1QR8A 2VRZA 1QBZA 2E5LB 2JEXA 3ETEA 2YDEA 1XL6A 1XNRB 1BHBA 2YC0A 1K9MW 3UO3A 4YJ2B 1OCRB 3T4ZA 2NNUA 1CEZA 1AR1B 4YHHB 1FXKB 1K73W 2JIZG 2BOCC 2QKCA 5LGNA 2JGDA 1W0KG 2K9PA 1GRJA 4JYBA 4JI6O 4LR3A 3ZS8C 4DV1B 4TV8A 1TAEA 3E22A 3QVNA 3U11A 5C8YA 1G4YB 1KECA 1N36B 4LFCB 1VQPV 2Q7HA 3A0BZ 5F2VO 4UV9A 3IJ4A 3TJTA 5JVDB 2R9RB 3ZRSA 4FJCC 3AK1A 1OCCB 4DR6B 1VQ4V 1LNQA 4O4IB 1YXBA 2FB5A 1BQ0A 1NKDA 1Q8IA 2IBZH 4K0KB 2Z3YA 1PD3A 3LSUA 1WLEA 4LFAO 3EVKA 3ZHVA 4UB8Z 3FYEB 2KSDA 2JRIA 3J81N 3S3WA 1NTKH 3FB5C 4EB6B 1RM1B 1J5EB 2ATKC 4X89A 4DR4B 4JI0O 1PKXA 1JR9A 3DTUB 1EN4A 3ABKB 4LFAB 5KAIZ 2IJJA 4LCUC 4NTWA 4GX0A 4H44B 4B7EA 3HR0A 2X6CA 4IGGA 4UFZA 3N27A 4DUZO 4EB6A 3D36A 4J9ZB 4MTOA 2P22C 2YXYA 3BA8A 4NXMB 4MVSA 5GW7A 2BOBC 3I55V 2YSUB 1W59A 1YCIA 3ZRXA 2RN9A 4JGSA 3RFRA 4GKKB 1R3IC 2HFEC 2E3CA 1SKVA 4J7ZA 2Q7GA 2Y69B 4G28B 2PTMA 3SYPA 4CH5A 3UO2A 3VQWA 2LGWA 2EIJC 5AG2A 4U7NA 2VQEO 4BWAA 2F95B 3A0HZ 3QO7A 2IU3A 3K04A 4FM2A 3T1CA 3HKBB 4O4HB 4ZBMA 3OUSA 3MHSC 4LH6A 1SESA 4P30A 1N8RW 3RT3C 4JI1O 4RQFA 2ZDIC 1YTFD 4FFKA 1P7BA 5KA6A 4MVQA 2ILMA 2QJ1A 4YY3B 1W2BU 1GN4A 4DR1O 4LFBO 5JQGA 2HVKC 1JPXA 1P4RA 1ZTEA 2WLLA 4CC6A 2IJIA 1YJNV 4FZ1A 4IYIA 4DK1A 3RYIB 2QKSA 1DTOA 1S76D 2UUCB 1MZEA 4RQEA 2X7RB 3U0ZA 2X6AA 1R6TA 1Q81W 1I5YA 4LF6B 2YUAA 2VWKA 4YJ3A 4J10A 3JD0A 4CS4A 2DYRC 4B3MB 3JALA 3H1JH 4HYOA 4LWSA 3ML0A 3OTFA 4DV0O 2Y0IA 1B04A 1JX9A 4HNAA 4FIPC 1Q3EA 4XDLA 3RYHB 3JD2A 2A9HA 2Q69A 5ITZB 1JQ0A 2A3QA 3CPWU 1R6NA 3CD6V 3B8NA 4DUYO 1AILA 2A79B 3ETDA 4UXNA 3B2EE 2QTOA 3P30A 3Q4HB 4DUZB 3ABUA 3KCYA 1I94O 5KHJA 2AW9A 3K57A 4J42A 1BT8A 4J7JA 2BSKB 1UPGA 1A32A 4BIOA 2ZD9A 3J7AU 4DW0A 3RYHA 2HVJC 3OR6C 1NZ6A 4GYCB 4OPHA 3FX7A 1D2DA 3ABMC 3CB2A 1WA8A 2DQ3A 1ZWIC 1Q5OA 5KHKA 3B8MA 1V55C 3RYCB 2GUZB 4FLVA 5LA6A 4QPKA 3T4DA 4FFBA 1S5JA 4LF4O 3MDSA 1HNWB 3G6EV 2CGNA 1EM1A 1XL4A 4PA3A 1VQ6V 4X9QA 2WLHA 2UUBO 1Y4MA 4DR5B 5H6QA 3OTOO 1SQQH 3M99B 1ZSPA 3ZRWB 3TGUH 4TT3G 2UXBB 3SGIA 4UCSA 3L72H 4Z1VA 1N0NA 3WFVA 2KG7B 4PV1B 2VS0A 1MA1A 1Q82W 1XNQO 4LC1A 1H8HG 2F66C 2UXNA 3TCUA 3OE7G 4R6ZA 5LOVA 3ZMZA 2CTPA 3ZMVA 2EIJB 3JAMN 3ZBHA 3APQA 1GN2A 4NTYA 2XAJA 4TUYA 5BZBA 5C93A 4LF6O 3CRQA 3LDDA 3CC4V 1URFA 1FPOA 5IYZA 1GM7A 3JD3A 4B7KA 2ZE5A 3A2FA 2YIAA 3WB2A 5CA3A 4A5UB 1IBMB 1L8DA 2QWQB 3D8CA 2XTAA 2IW5A 3K06A 3PJSK 1Y74B 4BR6A 1R6KA 1COWG 5BY1A 5B1BB 4PDMA 3E8FA 3JARB 3B40A 2BCCH 4GX5A 3SJAC 1RFYA 4G2KA 2XASA 5JH7A 1J95A 1ZX3A 4L8JA 4DV6O 3HKDA 5EC1C 1JOYA 3M8AA 3ASOC 3K79A 1H2KA 1VQNV 1IURA 2QR4A 4U7OA 4EEQA 4X1YB 1VIBA 3MD0A 3UT5A 1R1BA 2EJ7A 3DC5A 5KMGB 3HKEA 4J80A 2LP7A 3UCSC 4K0KO 1V54C 1QHTA 2B5UA 3T1YO 4PA9A 4JI5B 1KC8W 3GWKC 5LOVB 3FAVA 3CJHB 4ASUG 1YEWA 3SR2C 4NYKA 1DLBA 3R66A 2QWOB 3SJBC 4DR2O 1AI4A 3MAQA 1BHAA 3HB3B 5TISZ 1YIJV 5IWAB 4L87A 2FKXA 1H2NA 2VQFB 1VQ9V 1BQZA 1TUBA 3ZRWA 4I0XA 1SA0B 3ASOB 4UCOA 2DMXA 3HKCA 3OGCC 5CB4A 3X2QB 2ZE6A 5LA6B 2M6YA 2F43G 1KUQA 2YICA 4BW9A 4K35A 1F7YA 4I4TB 3L75H 1NJIW 1ZLZA 1XREA 3WB1A 3H01A 4LF9O 4Q20A 2YIBA 5B1OA 2A06H 2QM8A 1YHQV 4W4LA 2OCCC 3OR7C 1B3QA 2WLNA 3ABMB 2ZDIA 1SERA 2DQ0A 3RBZA 1M90W 2YIBD 3FAVB 1Z5WA 3LSQA 5LXTB 2QA4V 1AR5A 3AG1C 2GUZA 5FLXN 1R73A 2WLIB 2DJVA 3KZIZ 4WCEV 2WSSG 1VQ5V 4X1YA 2JK5C 2UU9B 3CYOA 5L3EA 2OT5A 4DV1O 4X1KA 2VQFO 4LWSB 4FLTA 3BRCA 5KA5A 4PI2A 5H9CA 4JI0B 3IGAC 1AVMA 2H3OA 1PP9H 4U3JB 5L3CA 3CCMV 4IHJA 1GMGA 4WFFA 4K8XA 4O2BA 1GTOA 3JCZA 3JCUZ 2QDOA 1H2GA 4H33A 4F6RA 2ODMA 2Q7EA 3ZHTA 1SC5B 1Q86W 3NXSA 1IDSA 3QF7A 4LF7B 5B1AC 1TVKB 1VARA 3K5LA 3CCUV 3CSXA 3CE2A 1ZUQA 1N32O 3K9SA 1JA8A 5ITZA 4N23A 2JVDA 1OJHA 2JGUA 5B1AB 4DO2A 3L70H 4JI7B 5CN0A 2GBOA 1CXZB 3WG7B 5LHIA 1IBKO 4PA4A 2UXCO 3HKCB 1N33O 4JAAA 5J9PC 1E1RG 1E79G 5J2UB 4X62B 1BSMA 1EN6A 1Y76A 1TUBB 2P5OA 1SZTA 5LBQA 5LMNB 4LFCO 1HR0O 5CBFA 4JI4O 4QGPA 4CH6A 4JTAB 4LF5O 4B08A 2EJRA 4YHHO 2OCHA 1HNWO 2WWWA 2N04A 5KHGA 2DYRB 1X4TA 3CEIA 2EINC 3QNEA 4DV6B 4GX2A 5B66Z 1XDCA 2NR5A 1NTZH 1WN7A 5B5EZ 5KMGA 2QM7A 5B3SC 4I9WA 1H2LA 2Q0OC 4ZHQA 4PDVA 3K03A 3ZHQA 3IAYA 1AP5A 3BFRA 5FNVA 1K33A 3LSSA 5FPOA 4GLXA 3AG2B 4PD4F 3ASNC 3JAKB 3QO8A 4DR3B 3K0DA 2YXHA 3BABA 4JI2O 2YEVA 3X2QC 3JARA 2PYLA 3SYAA 4X65B 2IJKA 3H1LH 5LGTA 2EZPA 2JJ1G 2F4VO 5H6RA 5L3BA 2ITCC 4DR4O 3AG3B 1ZAUA 1OCZC 2Q5ZA 4FM0A 3CCQV 3RWRD 5JVDA 5JJJB 4LF7O 3ZHUA 3FFQA 2P7TC 4Z1MG 5C8YB 1MABG 5IYBO 1K5SA 5L3FA 4I55A 5HFMA 1L1FA 3SYCA 4GKJB 2AHZA 4TV8B 4ZI7A 2QWPB 4JI6B 4FLUA 1ROPA 4LNUB 5GONB 1FXKA 3ZX6A 1MSWD 4ZOLB 4JI3O 2XAQA 2M7WA 1KBHA 5EBMC 2E5LO 4KXRA 3VQYA 2D2CB 4UCVA 5L3GA 5LP6C 4E4EA 2ZXWC 3SJQC 2ZNJA 1PNKA 3CRCA 1SRYA 3JASA 1HNXB 5H2FZ 4W4KA 3F5WC 5CA0A 1VF6A 1ENVA 1XI1A 3G71V 2CAZC 4KFMA 2GSMB 2CUGA 3RVZA 1K4DC 1KP2A 5LYJB 2LFSA 3OFNG 1TA8A 1YI2V 4JYAO 2UUAO 2ZT9B 4HAMA 5EBWC 5IJ0A 1VF6C 3JYCA 2OYQA 3H1KH 3CXCU 2B9ZA 3ZN0A 2QGNA 4ICGA 1I0HA 2KQXA 1IXMA 1Q6IA 2GTAA 2EIKB 1LR1A 4PDRA 1NH2B 4JAVA 3THOA 4AHCA 4QNHB 1BS3A 4MSWC 1QU7A 1SQBH 2YEVB 5IY5B 1Z2GA 2PGGA
chains in the Genus database with same CATH topology
1XNRO 3O65A 4DV0O 4X65O 4OX9O 4LF6O 4DV7O 4DV3O 4LF7O 4DUZO 5H5NA 5LL6Y 4JI7O 1FJGO 1IBKO 1KUQA 4DV4O 4B3RO 2UXCO 2DOSA 2UXBO 1F7YA 1DK1A 4NXMO 4DUYO 1NS1A 1AILA 4X64O 4DR7O 4GKJO 4A5UB 1N33O 1FYJA 1I94O 4LF9O 5BXZA 2UXDO 4JI3O 1YZBA 5BY1A 4LFCO 1A32A 1AB3A 1XMQO 2E5LO 1X59A 1XEQA 1FKAO 4JV5O 1HR0O 1IBLO 4JI4O 3F5TA 4LF8O 4LF5O 3J7AU 4JI8O 4AQYO 4GKKO 4JI5O 4OPHA 4YHHO 1HNWO 2VQEO 5LMUO 1D2DA 4DV6O 4JI6O 3M8AA 5IWAO 1HNXO 5FLXN 2DJVA 2N74A 1R1BA 2ZKOA 3RT3C 4JI1O 4LF4O 3J80N 4K0KO 4DV1O 2VQFO 1G1XB 3T1YO 5LMNO 2UUBO 3SDLA 5IT9N 2ZM6O 1XMOO 3OTOO 4DR1O 4LFBO 4JYAO 3R66A 1J5EO 2UUAO 4DV2O 2Z0AA 1HNZO 2UUCO 1N36O 4DR2O 4DV5O 2LW7A 4LFAO 4YY3O 4JI2O 2JRIA 2FKXA 2UU9O 2AGAA 5BR8O 3J81N 1IBMO 1R6TA 3T1HO 4KHPO 4JI0O 1XNQO 4DR6O 4B3MO 2F4VO 4DR5O 4X62O 4DR4O 4B3SO 5A2QN 4B3TO 4DR3O 4NXNO 4X66O 1N32O 4OPAA 2HHHO 3JAMN 1N34O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNR O;  3O65 A;  4DV0 O;  4X65 O;  4OX9 O;  4LF6 O;  4DV7 O;  4DV3 O;  4LF7 O;  4DUZ O;  5H5N A;  5LL6 Y;  4JI7 O;  1FJG O;  1IBK O;  1KUQ A;  4DV4 O;  4B3R O;  2UXC O;  2DOS A;  2UXB O;  1F7Y A;  1DK1 A;  4NXM O;  4DUY O;  1NS1 A;  1AIL A;  4X64 O;  4DR7 O;  4GKJ O;  4A5U B;  1N33 O;  1FYJ A;  1I94 O;  4LF9 O;  5BXZ A;  2UXD O;  4JI3 O;  1YZB A;  5BY1 A;  4LFC O;  1A32 A;  1AB3 A;  1XMQ O;  2E5L O;  1X59 A;  1XEQ A;  1FKA O;  4JV5 O;  1HR0 O;  1IBL O;  4JI4 O;  3F5T A;  4LF8 O;  4LF5 O;  3J7A U;  4JI8 O;  4AQY O;  4GKK O;  4JI5 O;  4OPH A;  4YHH O;  1HNW O;  2VQE O;  5LMU O;  1D2D A;  4DV6 O;  4JI6 O;  3M8A A;  5IWA O;  1HNX O;  5FLX N;  2DJV A;  2N74 A;  1R1B A;  2ZKO A;  3RT3 C;  4JI1 O;  4LF4 O;  3J80 N;  4K0K O;  4DV1 O;  2VQF O;  1G1X B;  3T1Y O;  5LMN O;  2UUB O;  3SDL A;  5IT9 N;  2ZM6 O;  1XMO O;  3OTO O;  4DR1 O;  4LFB O;  4JYA O;  3R66 A;  1J5E O;  2UUA O;  4DV2 O;  2Z0A A;  1HNZ O;  2UUC O;  1N36 O;  4DR2 O;  4DV5 O;  2LW7 A;  4LFA O;  4YY3 O;  4JI2 O;  2JRI A;  2FKX A;  2UU9 O;  2AGA A;  5BR8 O;  3J81 N;  1IBM O;  1R6T A;  3T1H O;  4KHP O;  4JI0 O;  1XNQ O;  4DR6 O;  4B3M O;  2F4V O;  4DR5 O;  4X62 O;  4DR4 O;  4B3S O;  5A2Q N;  4B3T O;  4DR3 O;  4NXN O;  4X66 O;  1N32 O;  4OPA A;  2HHH O;  3JAM N;  1N34 O; 
#chains in the Genus database with same CATH topology
 3Q4H A;  2IH1 C;  2EZO A;  3ABL B;  4RUF A;  1Q7Y W;  5BMV A;  2KKW A;  3TK1 A;  1K92 A;  1P84 F;  1OCR C;  2YI8 A;  1Y66 A;  4X1K B;  2DE0 X;  2EBO A;  4NXM O;  1BL8 A;  1NS1 A;  3CRR A;  4HNA B;  4CBC A;  2L6L A;  3K5M A;  1WP7 A;  3STL C;  4D7S A;  2HLD G;  4IL6 Z;  1KD1 W;  3K08 A;  1F4N A;  1IXB A;  1RSO B;  2WA4 A;  1IX9 A;  1LUW A;  4LBE C;  4CH3 A;  5E1A C;  1NH2 D;  2KG7 A;  3F5T A;  4TQF A;  2HG5 C;  2RJZ A;  3N2K B;  2QSA A;  2X0L A;  3LDE A;  2CK3 G;  1FFX A;  5IJ0 B;  1M4U A;  1O9G A;  2ZKO A;  4O2A B;  1AI6 A;  2H8P C;  2EIL B;  3OMI B;  1G1X B;  3D36 C;  4K3A A;  4TUY B;  1MMM A;  4DRX B;  3SDL A;  4GT1 A;  5CB4 B;  2DW4 A;  4FMT A;  3EXA A;  3GVM A;  5JJN B;  1JCH A;  2AZ2 A;  1YTF B;  3AG4 B;  2Q9L A;  3W7W A;  4HZ3 A;  2Q4P A;  3CX5 F;  4E2L A;  5KAF Z;  1ZL8 B;  2DWD C;  3DXR B;  3OW2 U;  5HFL A;  1AJP A;  1K4C C;  1CP9 A;  5J2T B;  4B3T B;  1NTM H;  2ARH A;  3K59 A;  3K3W A;  1XQ8 A;  3LNN A;  3RYF B;  4KHP B;  3CP1 A;  2QWN B;  3P32 A;  4HBN A;  4X20 A;  2F4V B;  4LF9 B;  4OGQ B;  1JMK C;  3CHX A;  2LGQ A;  3RW0 A;  1GN6 A;  2Q67 A;  4H37 A;  1RSO A;  4ZOL A;  4UV8 A;  3BCC H;  4B3R O;  1T5E A;  2MK3 A;  4FFB B;  2RMK B;  5EZY B;  1OCO B;  2ZNI A;  4WFE A;  2ITD C;  1VQ8 V;  2GHY A;  2EIM B;  2LFR A;  2IH3 C;  1I7F A;  1NVP D;  4O4J A;  2JEU A;  1WPX A;  3HPL C;  2B1I A;  1XMQ B;  3A0R A;  1H2M A;  3C90 A;  4RUE A;  2P06 A;  1XEQ A;  2JS5 A;  1NVP B;  3P3N A;  1ARO P;  1SS3 A;  4AQY B;  4O4L A;  2HEP A;  4C7U A;  4JI8 O;  1AR4 A;  2PY5 A;  3K0G A;  2CDY A;  5EBL C;  4KUM A;  2BTQ B;  4CS2 A;  3OT7 A;  4ZKI A;  5FNV B;  1WJZ A;  2QE7 G;  1N34 B;  3R65 A;  4PJ0 Z;  5IT9 N;  3E89 A;  2ZM6 O;  2G38 A;  3E8B A;  2ADQ B;  2NLJ C;  4QPJ A;  5D5Q A;  2PZS A;  1OZ0 A;  2O57 A;  4B3S B;  3BVO A;  2LW7 A;  3TET A;  1W0J G;  2V7Q G;  2UXX A;  4UCT A;  4MW8 A;  2Y48 A;  1F23 A;  5JCO A;  4BAY A;  4FLX A;  4B3S O;  1G8M A;  4NXN O;  4X66 O;  4WFB V;  4DV0 B;  1XUQ A;  4FM1 A;  5J2T A;  3KG2 A;  2EIM C;  2EIL C;  3OTO B;  3T1H B;  1L0L H;  1XHZ A;  2WLM A;  4DV3 O;  3RGB A;  3P3P A;  4PA7 A;  1SQV H;  1QR9 A;  4KL1 A;  2UXB O;  1IVS A;  3E86 A;  1YJ9 V;  3VQX A;  1KB9 F;  1FXV A;  5KX5 A;  3CCV V;  3D3I A;  3HKB A;  4O4H A;  3E35 A;  4DRX A;  3E2E A;  1Q43 A;  3E8H A;  4XDK A;  5BXZ A;  1KMI Z;  5EK0 A;  1PNM A;  5FL7 G;  3CC7 V;  1UFI A;  5GTH Z;  4NVP A;  1BCC H;  5IJ9 B;  2FTK A;  4D7T A;  4EFE A;  1FS0 G;  2Q0A A;  1EBO A;  1FFT B;  1TVK A;  3OD4 A;  3LNM B;  3UQ8 A;  1S72 V;  1D5A A;  4I9Q A;  4DUY B;  3STZ C;  4R7C A;  4X8A A;  2WLJ A;  4O4L B;  1Y74 A;  3QO5 A;  1VF5 B;  1RP3 B;  2UUA B;  1H2S B;  4MVO A;  2Q8V A;  1FXH A;  1B6Q A;  5IY5 C;  1JFF B;  5LMU B;  2ADP A;  1U96 A;  1UJW B;  5LYJ A;  2XHB A;  1XIL A;  4XDJ A;  1H8E G;  3SPI A;  3JAT B;  2HJF C;  5BR8 O;  4YJ2 A;  1NI8 A;  2QM4 A;  5JWP A;  3SPJ A;  4DR3 O;  1AI5 A;  4ABM A;  4OX9 B;  4JPR A;  1GH6 A;  4JZG A;  1HNZ B;  1XNR O;  1US6 A;  3O65 A;  4I5S A;  4X65 O;  2AZ0 A;  4FLZ A;  1P49 A;  3CCS V;  4I50 B;  3RN4 A;  4NB5 A;  3K5O A;  3SJC C;  1M56 C;  2QTS A;  2IM9 A;  5H5N A;  1L0N H;  4JI7 O;  1P7G A;  3AG7 A;  4P9P A;  4PI0 A;  4DR2 B;  3QG5 A;  1AI7 A;  5J2U A;  2VQE B;  1THZ A;  3AG3 C;  2Y4T A;  2W6J G;  2YI9 A;  1FYJ A;  3L9D A;  3S3X A;  2H94 A;  1FD9 A;  3ZRV A;  3O9O A;  3ETG A;  4PHZ A;  4AI8 A;  5CMU A;  2GTS A;  5CA1 A;  3OGI B;  4MT8 A;  1AB3 A;  3ICX A;  5CA0 B;  1FKA O;  1M56 B;  4JV5 O;  2Q68 A;  2X6B A;  5LHG A;  1IBL O;  1WB7 A;  3H1I H;  1MSD A;  1TUE B;  3ZHR A;  3CME V;  1U97 A;  5EIB C;  1K97 A;  2ZR2 A;  5LMU O;  2P6J A;  2UXD B;  4X1I A;  3QTC A;  1XMO B;  5EC2 C;  2W0X A;  1YIT V;  3OEE G;  2EIN B;  1IZ3 A;  4WFG A;  3RVY A;  2CH7 B;  1WP8 A;  3JAW B;  4CZZ A;  3JAK A;  1QNM A;  1XNQ B;  5DN6 G;  5EYP B;  2P67 A;  3JAT A;  4NTX A;  3N2G A;  4ZI7 B;  1AP6 A;  3K58 A;  4DV2 O;  3CCE V;  3ZN1 A;  1SET A;  2UXC B;  2A7W A;  4JZ2 A;  4R50 A;  1XBL A;  3VBB A;  4DV5 O;  3AEI A;  4LF4 B;  3HKD B;  4PA6 A;  3JAL B;  1PL4 A;  3ASN B;  1F51 A;  5JH7 B;  1N33 B;  4WFH A;  5EYP A;  1FAF A;  2JJ2 G;  2CGO A;  3VQV A;  4DR5 O;  1FJG B;  2XOK G;  1OCO C;  1K5Q A;  1MNG A;  1SZX A;  1G6U A;  2L35 A;  4DV7 O;  3CCR V;  4G27 B;  2ZQM A;  1BE3 H;  3G80 A;  3ZIA G;  2PUS A;  4DYL A;  1NQT A;  3U10 A;  2Z5U A;  4X64 O;  2ZCE A;  2LJ2 A;  3VOU A;  3FB8 C;  1KP3 A;  1AJQ A;  5IE9 A;  5K1X A;  3CCL V;  1YDX A;  2EUL A;  1OV9 A;  3D3Q A;  1N32 B;  4MVU A;  5GTI Z;  2ZR3 A;  5KX5 B;  1SQF A;  4CH4 A;  4LF8 O;  1M57 C;  4NR1 A;  4O2A A;  2P4V A;  3E83 A;  4QIW F;  5KUK A;  4JI5 O;  3AG2 C;  1GKF A;  4JYC A;  3IFX A;  4DK0 A;  1GM8 A;  3SYQ A;  3T2M A;  4TWK A;  1PV0 A;  3F7Y C;  2CTR A;  4JI1 B;  5LHH A;  4Z2W A;  4EFB A;  1JJ2 U;  1F4M A;  1LUV A;  2R9I A;  2YID A;  4F6R B;  2V1D A;  1XHX A;  2KB1 A;  2ZIN A;  3AK2 A;  5LMN O;  2E76 B;  3WB0 A;  3CCJ V;  1SF9 A;  5GON A;  3BEH A;  4LNU A;  4J41 A;  4JYY A;  2PI4 A;  3SPG A;  2CE4 A;  1PL0 A;  3UT5 B;  1VP7 A;  5JJE B;  4R8C A;  2XAG A;  1QCE A;  1S5H C;  4DV2 B;  3T1H O;  4DV3 B;  4B3M O;  1GK9 A;  4JI3 B;  3NR7 A;  2XT9 A;  1D5N A;  1NT2 B;  2WA3 A;  4J11 A;  2RCV A;  4H0L B;  1N34 O;  3JAW A;  3CMA V;  4D6T H;  4ZIB A;  1M57 B;  1WPB A;  1FJG O;  5IDJ A;  4FZ0 A;  3ABL C;  3JD4 A;  3B09 A;  1EZJ A;  1DK1 A;  4DR7 B;  2DYS C;  1NR7 A;  1I94 B;  1PM9 A;  3AG1 B;  4U3J A;  4GKJ O;  2F93 B;  4XBF A;  2EIK C;  4I7Z B;  4YXW G;  2OCC B;  2AHY A;  1MZF A;  1R3L C;  3DSQ A;  4FPP A;  5CA1 B;  4I4T A;  4LH7 A;  1GN3 A;  3TXQ A;  2WLI A;  1X59 A;  4LF5 B;  4QE9 A;  3N2G B;  2JGD B;  1BMF G;  4IIJ B;  4PEL A;  1VQK V;  3OAA G;  4JYA B;  1NR1 A;  2Q6A A;  1QVF U;  3G6B A;  3C3S A;  1KKC A;  3APO A;  1PNL A;  1VF7 A;  4FK5 C;  1FXK C;  5LP6 A;  5IWA O;  1HNX O;  3OUF A;  1HDJ A;  4K8Z A;  2N74 A;  5DED A;  1QLE C;  3UM7 A;  4J9Y B;  4MW3 A;  1OHH G;  4UCR A;  1YSC A;  1EFR G;  3IC7 A;  5KHH A;  4FLY A;  4JTD B;  1KU9 A;  3DXR A;  4DR1 B;  4LFB B;  2HP8 A;  4BW5 A;  1QLN A;  4MTX A;  5LP6 B;  2Y4U A;  4PDL A;  1NBM G;  2VWJ A;  1J5E O;  3I56 V;  4IYH A;  4U3F H;  4MVZ A;  1YVW A;  3A8T A;  4MTF A;  2UU9 O;  1I08 A;  1KYO F;  5KUM A;  1IBM O;  5CBG A;  2WLK A;  4DR6 O;  4N21 A;  5K1P A;  1JFF A;  5KLV H;  4B3T O;  4MVR A;  1M93 A;  1Z5V A;  1N4C A;  4RO2 A;  2Y0P A;  3H1H H;  1O9H A;  2JS3 A;  5A9G A;  4DV4 O;  2DOS A;  3DC6 A;  4UCU A;  1HR0 B;  1V9P A;  3L71 H;  1VEW A;  2YS8 A;  2OTJ V;  4WF9 V;  3CJH A;  1Q6U A;  2QWR B;  1K34 A;  2XAH A;  4X88 A;  1NU1 H;  1N0J A;  4TOI A;  4F4L A;  3EFF K;  5CBH A;  3SYO A;  1TGO A;  3BHP A;  5IYZ B;  1QLE B;  4F6E A;  1I5X A;  1VQO V;  4P2Z A;  3C3T A;  4IT5 A;  4LP8 A;  1YJW V;  4YIO A;  2QEX V;  4LF8 B;  1EN5 A;  4GKK O;  4UUJ C;  2P90 A;  4TV9 B;  2Q73 A;  4JI8 B;  5LXT A;  4UVB A;  4OXS A;  1RPO A;  3B4S A;  4RWU A;  1SQX H;  3W7X A;  1K8A W;  3CRA A;  1HW7 A;  1V54 B;  1M1K W;  1S0V A;  2OIG A;  3T1Y B;  3FD9 A;  4X20 B;  4JI4 B;  1B06 A;  2W0F C;  2UUB B;  4TQD A;  3E8G A;  3BY6 A;  2CTW A;  3W7S A;  4GZR B;  3MHH C;  4GCZ A;  2DYS B;  3FYI B;  1ZL8 A;  4KP4 A;  1Y6X A;  2JDI G;  1QVG U;  1HNZ O;  4B3R B;  3SPH A;  2PYJ A;  3OEH G;  4GUN A;  2HKO A;  2AGA A;  2LW1 A;  4DV4 B;  1S3J A;  4EKW A;  4JAU A;  4IIJ A;  2BE3 A;  1K3E A;  3RYC A;  5B1B C;  2HHH B;  1Q6H A;  2R72 A;  5A2Q N;  1KQS U;  3ETQ A;  4OPA A;  1SA0 A;  4NXN B;  2ZXW B;  4JF3 A;  4FLW A;  3BA9 A;  1GO3 F;  1VQM V;  3ZMU A;  3GWO A;  4GX1 A;  3CS5 A;  3IC9 A;  4UVC A;  2OWO A;  4YIP A;  2K1E A;  4CC5 A;  1GAX A;  2LQT A;  3LUT B;  1V55 B;  3CXH F;  1IBL B;  2BTQ A;  4AIL C;  2OTL V;  3ZMS A;  4MVM A;  1GM9 A;  2HJD A;  4DR7 O;  1Y67 A;  2MW2 B;  3JSN A;  4O2B B;  2YXL A;  2D3O W;  5KHI A;  2FYU H;  1AJN A;  4IHJ B;  3CRM A;  2AXT Z;  3HKE B;  1XMQ O;  1CPY A;  4O4J B;  4I55 B;  1WA8 B;  3KKY A;  4AQY O;  1OCZ B;  2PI5 A;  3W7U A;  2F1M A;  3H9V A;  3WU2 Z;  3I5D A;  2EX3 A;  2DWE C;  4YJ3 B;  3K5N A;  4TSF G;  5FPR A;  5BMV B;  2XAF A;  1K7D A;  2GDS A;  2BSK A;  2CH7 A;  3J80 N;  1SQP H;  2R9A A;  3WG7 C;  1R3K C;  2HR3 A;  1H38 A;  1M9N A;  2WPD G;  3RYI A;  3RYF A;  4X1I B;  3ZED A;  1XMO O;  4UB6 Z;  4BIU A;  4QJF B;  2Z0A A;  3GB7 C;  5L3D A;  2C2A A;  5B3S B;  4YY3 O;  2R70 A;  4DW1 A;  4ZHQ B;  1HWY A;  1DF4 A;  1PPJ H;  4NKG B;  4KHP O;  2XND G;  2ZE7 A;  4X62 O;  2ZIO A;  4DV5 B;  2XUM A;  3OM3 B;  4FVM A;  1MOF A;  4H13 B;  2PF4 E;  4OX9 O;  4MTG A;  1R3J C;  1QQC A;  3AK3 A;  1DGS A;  3L74 H;  3KCX A;  1YF2 A;  3ZHS A;  1ORQ C;  1EZV H;  4I0X B;  5LL6 Y;  1FFX B;  5IYD O;  3AG4 C;  3N2K A;  3JAS B;  2WLL B;  3FKS G;  3EHB B;  4RAI A;  3ZJZ A;  4DV7 B;  4UVA A;  4DXW A;  1S77 D;  1Y76 B;  2CTQ A;  2UXD O;  3ABT A;  1YZB A;  4X66 B;  1VQL V;  4P9O A;  1WAZ A;  4X64 B;  2BTO A;  5EIB D;  5LGU A;  2V4D A;  2LO1 A;  2RDC A;  4TV9 A;  3JD1 A;  5DEC A;  2Y69 C;  2B1G A;  2ZIM A;  5IYC O;  4WBN B;  4JV5 B;  3FB6 C;  2ETN A;  1XOU A;  3CWB H;  4CS3 A;  1KKD A;  2NN4 A;  3ZCC A;  3DGE A;  2F23 A;  2RQ6 A;  2IU0 A;  1BGY H;  2OIE A;  2E75 B;  4QE7 A;  3OMA B;  1Q90 D;  3W7T A;  2E74 B;  3FB7 C;  3LDC A;  2ZE8 A;  3UKM A;  3TXS A;  2ZM6 B;  1WB8 A;  3JSL A;  2DN9 A;  5DM6 V;  1SQG A;  2WAM A;  1HP8 A;  3CC2 V;  4BIZ A;  3ABK C;  3SPC A;  2UUC O;  2N05 A;  4Q6G A;  1N36 O;  4JI2 B;  1E1Q G;  3PN1 A;  3OMN B;  1RM1 C;  5JCO C;  5IJ9 A;  2QKA A;  1S5L Z;  5BR8 B;  5E79 Z;  3E22 B;  3L73 H;  2HHH O;  4WFA V;  1OCC C;  2IJH A;  3F7V C;  4WBN A;  3G4S V;  2FL4 A;  3ZMT A;  1M5I A;  5EZY A;  2W6I G;  5B1N A;  1WNS A;  1MG1 A;  1JJO A;  1IBK B;  2P4K A;  3M7M X;  4MS2 A;  1DF5 A;  3BPZ A;  1JVM A;  3K9A A;  3B77 A;  2FML A;  3G67 A;  4JAS A;  5D5P A;  4J7K A;  4JTC B;  1BZK A;  1RPR A;  2A0L A;  2GV9 A;  1VMG A;  4O4I A;  3BAA A;  2RNB A;  5JQG B;  4I50 A;  1VQ7 V;  1QR8 A;  2VRZ A;  1QBZ A;  2E5L B;  2JEX A;  3ETE A;  2YDE A;  1XL6 A;  1XNR B;  1BHB A;  2YC0 A;  1K9M W;  3UO3 A;  4YJ2 B;  1OCR B;  3T4Z A;  2NNU A;  1CEZ A;  1AR1 B;  4YHH B;  1FXK B;  1K73 W;  2JIZ G;  2BOC C;  2QKC A;  5LGN A;  2JGD A;  1W0K G;  2K9P A;  1GRJ A;  4JYB A;  4JI6 O;  4LR3 A;  3ZS8 C;  4DV1 B;  4TV8 A;  1TAE A;  3E22 A;  3QVN A;  3U11 A;  5C8Y A;  1G4Y B;  1KEC A;  1N36 B;  4LFC B;  1VQP V;  2Q7H A;  3A0B Z;  5F2V O;  4UV9 A;  3IJ4 A;  3TJT A;  5JVD B;  2R9R B;  3ZRS A;  4FJC C;  3AK1 A;  1OCC B;  4DR6 B;  1VQ4 V;  1LNQ A;  4O4I B;  1YXB A;  2FB5 A;  1BQ0 A;  1NKD A;  1Q8I A;  2IBZ H;  4K0K B;  2Z3Y A;  1PD3 A;  3LSU A;  1WLE A;  4LFA O;  3EVK A;  3ZHV A;  4UB8 Z;  3FYE B;  2KSD A;  2JRI A;  3J81 N;  3S3W A;  1NTK H;  3FB5 C;  4EB6 B;  1RM1 B;  1J5E B;  2ATK C;  4X89 A;  4DR4 B;  4JI0 O;  1PKX A;  1JR9 A;  3DTU B;  1EN4 A;  3ABK B;  4LFA B;  5KAI Z;  2IJJ A;  4LCU C;  4NTW A;  4GX0 A;  4H44 B;  4B7E A;  3HR0 A;  2X6C A;  4IGG A;  4UFZ A;  3N27 A;  4DUZ O;  4EB6 A;  3D36 A;  4J9Z B;  4MTO A;  2P22 C;  2YXY A;  3BA8 A;  4NXM B;  4MVS A;  5GW7 A;  2BOB C;  3I55 V;  2YSU B;  1W59 A;  1YCI A;  3ZRX A;  2RN9 A;  4JGS A;  3RFR A;  4GKK B;  1R3I C;  2HFE C;  2E3C A;  1SKV A;  4J7Z A;  2Q7G A;  2Y69 B;  4G28 B;  2PTM A;  3SYP A;  4CH5 A;  3UO2 A;  3VQW A;  2LGW A;  2EIJ C;  5AG2 A;  4U7N A;  2VQE O;  4BWA A;  2F95 B;  3A0H Z;  3QO7 A;  2IU3 A;  3K04 A;  4FM2 A;  3T1C A;  3HKB B;  4O4H B;  4ZBM A;  3OUS A;  3MHS C;  4LH6 A;  1SES A;  4P30 A;  1N8R W;  3RT3 C;  4JI1 O;  4RQF A;  2ZDI C;  1YTF D;  4FFK A;  1P7B A;  5KA6 A;  4MVQ A;  2ILM A;  2QJ1 A;  4YY3 B;  1W2B U;  1GN4 A;  4DR1 O;  4LFB O;  5JQG A;  2HVK C;  1JPX A;  1P4R A;  1ZTE A;  2WLL A;  4CC6 A;  2IJI A;  1YJN V;  4FZ1 A;  4IYI A;  4DK1 A;  3RYI B;  2QKS A;  1DTO A;  1S76 D;  2UUC B;  1MZE A;  4RQE A;  2X7R B;  3U0Z A;  2X6A A;  1R6T A;  1Q81 W;  1I5Y A;  4LF6 B;  2YUA A;  2VWK A;  4YJ3 A;  4J10 A;  3JD0 A;  4CS4 A;  2DYR C;  4B3M B;  3JAL A;  3H1J H;  4HYO A;  4LWS A;  3ML0 A;  3OTF A;  4DV0 O;  2Y0I A;  1B04 A;  1JX9 A;  4HNA A;  4FIP C;  1Q3E A;  4XDL A;  3RYH B;  3JD2 A;  2A9H A;  2Q69 A;  5ITZ B;  1JQ0 A;  2A3Q A;  3CPW U;  1R6N A;  3CD6 V;  3B8N A;  4DUY O;  1AIL A;  2A79 B;  3ETD A;  4UXN A;  3B2E E;  2QTO A;  3P30 A;  3Q4H B;  4DUZ B;  3ABU A;  3KCY A;  1I94 O;  5KHJ A;  2AW9 A;  3K57 A;  4J42 A;  1BT8 A;  4J7J A;  2BSK B;  1UPG A;  1A32 A;  4BIO A;  2ZD9 A;  3J7A U;  4DW0 A;  3RYH A;  2HVJ C;  3OR6 C;  1NZ6 A;  4GYC B;  4OPH A;  3FX7 A;  1D2D A;  3ABM C;  3CB2 A;  1WA8 A;  2DQ3 A;  1ZWI C;  1Q5O A;  5KHK A;  3B8M A;  1V55 C;  3RYC B;  2GUZ B;  4FLV A;  5LA6 A;  4QPK A;  3T4D A;  4FFB A;  1S5J A;  4LF4 O;  3MDS A;  1HNW B;  3G6E V;  2CGN A;  1EM1 A;  1XL4 A;  4PA3 A;  1VQ6 V;  4X9Q A;  2WLH A;  2UUB O;  1Y4M A;  4DR5 B;  5H6Q A;  3OTO O;  1SQQ H;  3M99 B;  1ZSP A;  3ZRW B;  3TGU H;  4TT3 G;  2UXB B;  3SGI A;  4UCS A;  3L72 H;  4Z1V A;  1N0N A;  3WFV A;  2KG7 B;  4PV1 B;  2VS0 A;  1MA1 A;  1Q82 W;  1XNQ O;  4LC1 A;  1H8H G;  2F66 C;  2UXN A;  3TCU A;  3OE7 G;  4R6Z A;  5LOV A;  3ZMZ A;  2CTP A;  3ZMV A;  2EIJ B;  3JAM N;  3ZBH A;  3APQ A;  1GN2 A;  4NTY A;  2XAJ A;  4TUY A;  5BZB A;  5C93 A;  4LF6 O;  3CRQ A;  3LDD A;  3CC4 V;  1URF A;  1FPO A;  5IYZ A;  1GM7 A;  3JD3 A;  4B7K A;  2ZE5 A;  3A2F A;  2YIA A;  3WB2 A;  5CA3 A;  4A5U B;  1IBM B;  1L8D A;  2QWQ B;  3D8C A;  2XTA A;  2IW5 A;  3K06 A;  3PJS K;  1Y74 B;  4BR6 A;  1R6K A;  1COW G;  5BY1 A;  5B1B B;  4PDM A;  3E8F A;  3JAR B;  3B40 A;  2BCC H;  4GX5 A;  3SJA C;  1RFY A;  4G2K A;  2XAS A;  5JH7 A;  1J95 A;  1ZX3 A;  4L8J A;  4DV6 O;  3HKD A;  5EC1 C;  1JOY A;  3M8A A;  3ASO C;  3K79 A;  1H2K A;  1VQN V;  1IUR A;  2QR4 A;  4U7O A;  4EEQ A;  4X1Y B;  1VIB A;  3MD0 A;  3UT5 A;  1R1B A;  2EJ7 A;  3DC5 A;  5KMG B;  3HKE A;  4J80 A;  2LP7 A;  3UCS C;  4K0K O;  1V54 C;  1QHT A;  2B5U A;  3T1Y O;  4PA9 A;  4JI5 B;  1KC8 W;  3GWK C;  5LOV B;  3FAV A;  3CJH B;  4ASU G;  1YEW A;  3SR2 C;  4NYK A;  1DLB A;  3R66 A;  2QWO B;  3SJB C;  4DR2 O;  1AI4 A;  3MAQ A;  1BHA A;  3HB3 B;  5TIS Z;  1YIJ V;  5IWA B;  4L87 A;  2FKX A;  1H2N A;  2VQF B;  1VQ9 V;  1BQZ A;  1TUB A;  3ZRW A;  4I0X A;  1SA0 B;  3ASO B;  4UCO A;  2DMX A;  3HKC A;  3OGC C;  5CB4 A;  3X2Q B;  2ZE6 A;  5LA6 B;  2M6Y A;  2F43 G;  1KUQ A;  2YIC A;  4BW9 A;  4K35 A;  1F7Y A;  4I4T B;  3L75 H;  1NJI W;  1ZLZ A;  1XRE A;  3WB1 A;  3H01 A;  4LF9 O;  4Q20 A;  2YIB A;  5B1O A;  2A06 H;  2QM8 A;  1YHQ V;  4W4L A;  2OCC C;  3OR7 C;  1B3Q A;  2WLN A;  3ABM B;  2ZDI A;  1SER A;  2DQ0 A;  3RBZ A;  1M90 W;  2YIB D;  3FAV B;  1Z5W A;  3LSQ A;  5LXT B;  2QA4 V;  1AR5 A;  3AG1 C;  2GUZ A;  5FLX N;  1R73 A;  2WLI B;  2DJV A;  3KZI Z;  4WCE V;  2WSS G;  1VQ5 V;  4X1Y A;  2JK5 C;  2UU9 B;  3CYO A;  5L3E A;  2OT5 A;  4DV1 O;  4X1K A;  2VQF O;  4LWS B;  4FLT A;  3BRC A;  5KA5 A;  4PI2 A;  5H9C A;  4JI0 B;  3IGA C;  1AVM A;  2H3O A;  1PP9 H;  4U3J B;  5L3C A;  3CCM V;  4IHJ A;  1GMG A;  4WFF A;  4K8X A;  4O2B A;  1GTO A;  3JCZ A;  3JCU Z;  2QDO A;  1H2G A;  4H33 A;  4F6R A;  2ODM A;  2Q7E A;  3ZHT A;  1SC5 B;  1Q86 W;  3NXS A;  1IDS A;  3QF7 A;  4LF7 B;  5B1A C;  1TVK B;  1VAR A;  3K5L A;  3CCU V;  3CSX A;  3CE2 A;  1ZUQ A;  1N32 O;  3K9S A;  1JA8 A;  5ITZ A;  4N23 A;  2JVD A;  1OJH A;  2JGU A;  5B1A B;  4DO2 A;  3L70 H;  4JI7 B;  5CN0 A;  2GBO A;  1CXZ B;  3WG7 B;  5LHI A;  1IBK O;  4PA4 A;  2UXC O;  3HKC B;  1N33 O;  4JAA A;  5J9P C;  1E1R G;  1E79 G;  5J2U B;  4X62 B;  1BSM A;  1EN6 A;  1Y76 A;  1TUB B;  2P5O A;  1SZT A;  5LBQ A;  5LMN B;  4LFC O;  1HR0 O;  5CBF A;  4JI4 O;  4QGP A;  4CH6 A;  4JTA B;  4LF5 O;  4B08 A;  2EJR A;  4YHH O;  2OCH A;  1HNW O;  2WWW A;  2N04 A;  5KHG A;  2DYR B;  1X4T A;  3CEI A;  2EIN C;  3QNE A;  4DV6 B;  4GX2 A;  5B66 Z;  1XDC A;  2NR5 A;  1NTZ H;  1WN7 A;  5B5E Z;  5KMG A;  2QM7 A;  5B3S C;  4I9W A;  1H2L A;  2Q0O C;  4ZHQ A;  4PDV A;  3K03 A;  3ZHQ A;  3IAY A;  1AP5 A;  3BFR A;  5FNV A;  1K33 A;  3LSS A;  5FPO A;  4GLX A;  3AG2 B;  4PD4 F;  3ASN C;  3JAK B;  3QO8 A;  4DR3 B;  3K0D A;  2YXH A;  3BAB A;  4JI2 O;  2YEV A;  3X2Q C;  3JAR A;  2PYL A;  3SYA A;  4X65 B;  2IJK A;  3H1L H;  5LGT A;  2EZP A;  2JJ1 G;  2F4V O;  5H6R A;  5L3B A;  2ITC C;  4DR4 O;  3AG3 B;  1ZAU A;  1OCZ C;  2Q5Z A;  4FM0 A;  3CCQ V;  3RWR D;  5JVD A;  5JJJ B;  4LF7 O;  3ZHU A;  3FFQ A;  2P7T C;  4Z1M G;  5C8Y B;  1MAB G;  5IYB O;  1K5S A;  5L3F A;  4I55 A;  5HFM A;  1L1F A;  3SYC A;  4GKJ B;  2AHZ A;  4TV8 B;  4ZI7 A;  2QWP B;  4JI6 B;  4FLU A;  1ROP A;  4LNU B;  5GON B;  1FXK A;  3ZX6 A;  1MSW D;  4ZOL B;  4JI3 O;  2XAQ A;  2M7W A;  1KBH A;  5EBM C;  2E5L O;  4KXR A;  3VQY A;  2D2C B;  4UCV A;  5L3G A;  5LP6 C;  4E4E A;  2ZXW C;  3SJQ C;  2ZNJ A;  1PNK A;  3CRC A;  1SRY A;  3JAS A;  1HNX B;  5H2F Z;  4W4K A;  3F5W C;  5CA0 A;  1VF6 A;  1ENV A;  1XI1 A;  3G71 V;  2CAZ C;  4KFM A;  2GSM B;  2CUG A;  3RVZ A;  1K4D C;  1KP2 A;  5LYJ B;  2LFS A;  3OFN G;  1TA8 A;  1YI2 V;  4JYA O;  2UUA O;  2ZT9 B;  4HAM A;  5EBW C;  5IJ0 A;  1VF6 C;  3JYC A;  2OYQ A;  3H1K H;  3CXC U;  2B9Z A;  3ZN0 A;  2QGN A;  4ICG A;  1I0H A;  2KQX A;  1IXM A;  1Q6I A;  2GTA A;  2EIK B;  1LR1 A;  4PDR A;  1NH2 B;  4JAV A;  3THO A;  4AHC A;  4QNH B;  1BS3 A;  4MSW C;  1QU7 A;  1SQB H;  2YEV B;  5IY5 B;  1Z2G A;  2PGG A; 
#chains in the Genus database with same CATH homology
 1XNR O;  3O65 A;  4DV0 O;  4X65 O;  4OX9 O;  4LF6 O;  4DV7 O;  4DV3 O;  4LF7 O;  4DUZ O;  5H5N A;  5LL6 Y;  4JI7 O;  1FJG O;  1IBK O;  1KUQ A;  4DV4 O;  4B3R O;  2UXC O;  2DOS A;  2UXB O;  1F7Y A;  1DK1 A;  4NXM O;  4DUY O;  1NS1 A;  1AIL A;  4X64 O;  4DR7 O;  4GKJ O;  4A5U B;  1N33 O;  1FYJ A;  1I94 O;  4LF9 O;  5BXZ A;  2UXD O;  4JI3 O;  1YZB A;  5BY1 A;  4LFC O;  1A32 A;  1AB3 A;  1XMQ O;  2E5L O;  1X59 A;  1XEQ A;  1FKA O;  4JV5 O;  1HR0 O;  1IBL O;  4JI4 O;  3F5T A;  4LF8 O;  4LF5 O;  3J7A U;  4JI8 O;  4AQY O;  4GKK O;  4JI5 O;  4OPH A;  4YHH O;  1HNW O;  2VQE O;  5LMU O;  1D2D A;  4DV6 O;  4JI6 O;  3M8A A;  5IWA O;  1HNX O;  5FLX N;  2DJV A;  2N74 A;  1R1B A;  2ZKO A;  3RT3 C;  4JI1 O;  4LF4 O;  3J80 N;  4K0K O;  4DV1 O;  2VQF O;  1G1X B;  3T1Y O;  5LMN O;  2UUB O;  3SDL A;  5IT9 N;  2ZM6 O;  1XMO O;  3OTO O;  4DR1 O;  4LFB O;  4JYA O;  3R66 A;  1J5E O;  2UUA O;  4DV2 O;  2Z0A A;  1HNZ O;  2UUC O;  1N36 O;  4DR2 O;  4DV5 O;  2LW7 A;  4LFA O;  4YY3 O;  4JI2 O;  2JRI A;  2FKX A;  2UU9 O;  2AGA A;  5BR8 O;  3J81 N;  1IBM O;  1R6T A;  3T1H O;  4KHP O;  4JI0 O;  1XNQ O;  4DR6 O;  4B3M O;  2F4V O;  4DR5 O;  4X62 O;  4DR4 O;  4B3S O;  5A2Q N;  4B3T O;  4DR3 O;  4NXN O;  4X66 O;  1N32 O;  4OPA A;  2HHH O;  3JAM N;  1N34 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...