1QVGU

Structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1qvgU00
1VQ7V 3CXCU 1VQ8V 1YHQV 1JJ2U 3CPWU 1VQNV 1K8AW 3G71V 4WFBV 3CCMV 3CCSV 3G4SV 1VQLV 3I56V 1N8RW 1W2BU 1Q7YW 3CC7V 3CC2V 1KQSU 1YJ9V 2QA4V 3CCVV 1VQMV 3I55V 1VQKV 1YITV 2D3OW 1K73W 1VQOV 1VQ6V 1YI2V 3CMEV 3CCRV 3CCQV 3CCJV 1NJIW 3CD6V 1M1KW 3CCUV 1Q82W 1YJNV 1VQPV 3CCLV 3G6EV 1K9MW 1VQ4V 1S72V 1Q81W 4WF9V 3OW2U 1QVGU 2QEXV 1R73A 1QVFU 2OTJV 3CCEV 3CMAV 5DM6V 1KC8W 1M90W 1KD1W 2OTLV 4WFAV 1YJWV 1VQ5V 1VQ9V 3CC4V 1Q86W 4WCEV 1YIJV
chains in the Genus database with same CATH superfamily
3ZCCA 4BAYA 2RCVA 3W7SA 3JARB 1K8AW 1VQLV 4JI5O 2X0LA 4B7EA 3FB7C 3LDDA 4TV8A 4DV2B 2HR3A 3H1LH 4LH6A 4PDRA 5CA1B 3LSSA 1OCCC 1K92A 1TA8A 4GYCB 4CS4A 3WFVA 3F7VC 4H37A 2GTAA 4DUZO 1YCIA 5JJEB 2A9HA 2ITCC 1KECA 2Q0AA 2Q7HA 3G67A 2ITDC 4FFKA 2ZKOA 1S5HC 3ZRXA 3RT3C 2XT9A 4RAIA 2P90A 3ZMSA 5H6QA 5KMGB 2QTSA 3ZHSA 2E3CA 3P3PA 2DYSC 1HDJA 4LNUB 2JGDB 3K03A 3N2KA 1BE3H 3QO7A 1QBZA 3HB3B 4DXWA 1G8MA 4B3RB 4MVRA 4A5UB 2A0LA 2UXBO 4TWKA 4FJCC 2DWDC 4GX0A 1R1BA 5IYDO 2ZINA 1Y67A 2EBOA 3ABMC 4D6TH 1WP8A 5GW7A 1U97A 1JMKC 3FAVA 4YJ3A 3L70H 4DUYB 4QE7A 1L8DA 4BW9A 4PA7A 4XDLA 5LP6C 1WJZA 2OIEA 2VQEO 3MDSA 4OPAA 1YF2A 3FB5C 1K4DC 1QVFU 3SPCA 4FZ1A 5EIBC 4H13B 4EFBA 3JATA 5IYCO 4U3FH 3AK1A 5JH7B 2EIKC 2EIJC 1KQSU 4X1YA 5J2UB 2B1GA 2FTKA 2UXCO 3LDCA 2WSSG 1MMMA 4UCRA 2HJDA 2NR5A 4DV0O 2ZR2A 4I0XB 3CE2A 4KHPO 3OAAG 3THOA 4NXMO 4YHHO 4G2KA 4GCZA 4DRXA 3CS5A 3MD0A 5B3SC 1ZSPA 1XUQA 5GTIZ 2OCHA 3EVKA 3JALA 2F23A 2OCCC 4ASUG 3ETQA 1WA8A 4PD4F 1WNSA 1W59A 1SQBH 4K8XA 1BSMA 2EILC 1TGOA 3GVMA 4AQYB 2XAGA 4PA9A 4Z2WA 1K33A 3FB8C 5K1XA 1KP3A 3ZX6A 4PA3A 4LFBO 2ZM6B 3D3QA 4PDLA 4LF5O 2QJ1A 2VS0A 2ZT9B 3ZHQA 1GN4A 5EK0A 2WA3A 5B1AC 5GTHZ 3VQVA 2Y48A 2P22C 1XMQB 4WBNA 4WFHA 4F6RB 1BQ0A 4JI1B 3KZIZ 1P7BA 1WB8A 3JSLA 1GK9A 3VQXA 4DR3B 3N2KB 1NJIW 4J7JA 4XDKA 4BWAA 2C2AA 2BE3A 2DYRC 2QSAA 1I7FA 2V7QG 3JASB 5LMUB 4U7OA 1HNWO 2QM8A 3UM7A 2Q7GA 4IHJA 2ZXWC 2JGUA 3L72H 5CA3A 2HHHB 4LNUA 1QU7A 3RW0A 1Y66A 4FLWA 2ZNIA 2PTMA 3HKBB 4JI4O 4YHHB 1X4TA 2Q0OC 5IWAB 2CUGA 1GM9A 3E8GA 2F1MA 4CH3A 4DR1O 1IXMA 2EULA 1PNMA 1ZL8B 3CC4V 1LNQA 4RUFA 1IBMB 2LP7A 5LP6B 3ABKB 4ZIBA 1XNRB 5CA1A 2QKCA 3TJTA 3CYOA 5B3SB 1M1KW 4MW3A 2F95B 2HVJC 1ZLZA 2FL4A 1YZBA 2HLDG 4JI8O 3OW2U 1XL6A 2H94A 4FK5C 1TAEA 4X1KA 4WCEV 3KCYA 2YUAA 4I0XA 3K9AA 2N04A 2VWKA 1YTFD 2PI5A 4U3JA 4QNHB 1MG1A 5D5PA 1XNRO 5EZYA 4X64O 2BSKB 3E2EA 4P9OA 1IBMO 2N74A 1FYJA 4DR2B 1H2NA 3LUTB 1Q86W 4JF3A 1N32B 2VQFO 1XQ8A 1GO3F 1K7DA 1I5XA 2EJ7A 1O9HA 2EILB 1Z5WA 4FFBA 3QTCA 3X2QC 2NNUA 3AG1B 2HHHO 3WB1A 2AZ0A 1DLBA 2F4VO 3ZHUA 4JAAA 4O4HA 1R73A 2HG5C 4NXNO 5LL6Y 4OPHA 4OX9B 4LF6O 3OE7G 1SZXA 4TUYA 3I5DA 2E75B 1Y74B 4ZI7A 1RM1C 4LF8B 1IX9A 3Q4HB 3ETEA 3E8BA 1M90W 2VQFB 1KB9F 4R6ZA 5LOVB 4KHPB 2KB1A 3JD2A 1S5JA 3ABMB 3AK2A 3M7MX 4JAVA 1S5LZ 2YICA 4U3JB 4FLUA 2JIZG 2D3OW 1N4CA 4FM0A 3U0ZA 3CCQV 1D2DA 5E79Z 3RFRA 2QKSA 1AI6A 3DTUB 1FS0G 1GMGA 3EFFK 2F66C 4WF9V 4JI7O 2ZR3A 2UUCB 1A32A 1NI8A 4O2BA 3WB2A 2XUMA 4UCOA 2KQXA 2UUBO 1L0LH 4LF8O 1K5QA 3CPWU 1MABG 1XL4A 2VQEB 1H2LA 2WLJA 1KMIZ 2W6JG 4O4JB 3P3NA 4RWUA 1PNLA 3OUFA 5JVDA 1AI5A 1O9GA 1B06A 1JX9A 1YVWA 3CRAA 3ETGA 3RYHB 5IYBO 2OYQA 4JYCA 1OCOB 1SC5B 3APQA 3ZBHA 3BCCH 4NR1A 1QLNA 1K4CC 1VP7A 5C93A 4JZ2A 4TV9B 4B3SB 1GN2A 4I4TB 3GWOA 5CBFA 1NR1A 3K5NA 1HR0B 2YIAA 4DR5O 4X20A 4J9YB 1Q6UA 3AG4B 5IYZB 3LSUA 2IJIA 2P06A 2IH3C 5JCOA 1NTKH 1XMOB 4MT8A 5EYPB 2Y69B 1HNXB 2QTOA 5LHGA 2O57A 3B2EE 1WB7A 2QWNB 4X65O 3MHHC 4BR6A 3N2GB 1FFTB 4DV3B 1M93A 4MVZA 2AZ2A 3RN4A 4JI1O 5FPRA 2K1EA 3JCUZ 1N8RW 4K0KO 4DR6O 2ILMA 1YJ9V 4FVMA 1R6NA 4LFBB 2PF4E 1ZTEA 2ZQMA 4J7ZA 2X6AA 3ZJZA 4LC1A 2UU9B 4PDMA 3CCUV 4TOIA 5LBQA 1J95A 1DK1A 3Q4HA 5DM6V 5L3CA 5H9CA 1HP8A 1MA1A 2GTSA 1VQ7V 1GH6A 3BAAA 3H1HH 5IY5C 1VQMV 1JFFB 4NVPA 1SESA 1PPJH 2WLHA 1UJWB 1IVSA 3SYCA 3OGCC 2A06H 1V9PA 1KBHA 3O65A 2UUCO 3ETDA 3H9VA 4Q6GA 2IU3A 2YC0A 4DV1O 3DGEA 3FB6C 1SERA 3GB7C 1YHQV 1YDXA 1W0JG 3K79A 3AG2C 3SPHA 1NVPD 4CZZA 2KKWA 2BSKA 3ZRSA 3C3SA 1GN3A 1XOUA 3UT5A 3OMAB 4GX5A 2P4KA 3DXRB 4C7UA 1OV9A 4I55B 4P9PA 4J7KA 5BMVB 3L73H 5KMGA 4IYHA 1V54B 5IE9A 4IIJB 5BZBA 4AILC 4N21A 3CWBH 2OCCB 4P30A 2ZE5A 4O4IB 5GONA 3HPLC 3K9SA 3G6EV 4LF6B 1AI7A 1RPOA 1WA8B 4UB8Z 1FFXA 3KCXA 2EINC 4X8AA 1RPRA 2YDEA 2OTLV 1THZA 4Z1MG 4J42A 2BTQB 2XNDG 2ADPA 1SKVA 3A0HZ 5KHJA 5C8YB 3ASOB 2XAHA 3HKCA 5BY1A 2L6LA 4MVMA 1P49A 1BHBA 1VQ4V 5JVDB 4NYKA 1M56B 2ADQB 1N36O 1DF4A 5IYZA 1JJOA 5IDJA 1VIBA 2WLIA 4ZKIA 2Y69C 4GUNA 2Q6AA 1SRYA 4DV5B 1XHXA 2AW9A 5LA6B 1NQTA 1AR5A 1Q82W 2RJZA 4P2ZA 1IURA 1OCRC 1EM1A 4I9WA 4I5SA 3P30A 4KUMA 4O4JA 3FYEB 1XILA 3APOA 3K58A 2DJVA 4CS3A 1Q6HA 3EHBB 4LF9B 3VBBA 1IBLO 2R9AA 2YXLA 3CXHF 4IT5A 3ABLB 4DV1B 4PDVA 4H33A 1SS3A 2D2CB 5KHIA 2Q68A 2P67A 2W6IG 2PZSA 3HKEA 1GM8A 2Z5UA 3BABA 5C8YA 3FAVB 4PI0A 4YJ3B 2E5LO 3L9DA 3K5MA 1Q6IA 3OEHG 3T1YB 2KSDA 3H1KH 1VF6A 5KHHA 5FL7G 3L74H 4LF7O 2DN9A 4X62O 4GKJO 2ZCEA 3AG3B 3RBZA 1GN6A 4J80A 4JYAO 2DWEC 4OX9O 2ZE6A 3ZMTA 1FAFA 2QWOB 5TISZ 4K3AA 3G71V 2QWPB 4W4LA 2F4VB 2Q4PA 3CC7V 1R6KA 4IIJA 3N27A 4UCVA 1OCZB 1BMFG 2ZIMA 3FYIB 3UO2A 3VQWA 5L3FA 3RYFA 4UV9A 4O4IA 4BIZA 1TUBA 2OTJV 4LFAO 4DK0A 2VWJA 2GV9A 4DV3O 4RUEA 5EIBD 2WLMA 2EINB 4WFEA 5L3DA 3HR0A 4RQFA 3I56V 3B8NA 3D36C 4PV1B 4Z1VA 3I55V 4G28B 2QWQB 3TXQA 3W7XA 1K34A 1R3JC 5B66Z 1ORQC 3SJAC 2JJ2G 2EX3A 1Q43A 4JI2B 4B3SO 2YIDA 1BHAA 3OM3B 2E76B 3HKBA 1XEQA 2Y4TA 3RWRD 1BS3A 5B1BC 3B09A 5LMNO 3ZN0A 3FKSG 3O9OA 2BOCC 5LXTB 2CTQA 5LYJB 3SPGA 3JYCA 4DR7B 5LA6A 1XNQB 1Q81W 5BR8B 2MK3A 2PGGA 4JYYA 1OZ0A 2QM4A 1FXVA 4O4LB 5LHHA 2XOKG 4I50B 4L87A 3A0BZ 3AG7A 4X1KB 1Q5OA 5KX5A 4BIOA 5B5EZ 3FFQA 1YITV 2GSMB 4MVSA 1SQPH 3UQ8A 1FXKA 2CH7B 4XDJA 1GM7A 1L0NH 3A0RA 4H44B 4KXRA 3A8TA 4PELA 4E4EA 4JI6B 3CMAV 4QIWF 4ZOLB 1DF5A 5JQGA 5B1NA 2MW2B 4DV6B 1SA0B 4MVUA 3TK1A 3F5WC 2AHYA 3S3WA 2ZDIC 2CDYA 4DR3O 3L75H 2WLLA 5LGNA 3OTOO 3CCLV 1NT2B 5LHIA 1SQGA 1OJHA 1SQFA 2DW4A 1M5IA 4FFBB 3OR7C 1OCCB 5LP6A 2QA4V 4IGGA 4CC5A 1OHHG 1U96A 1M4UA 4UVAA 4TV9A 4YJ2B 3BY6A 1HNZB 2ZE7A 5AG2A 3LNNA 3QO5A 4O4LA 1RFYA 2LGQA 4NXNB 2IH1C 2GHYA 2YIBA 3BHPA 5F2VO 2HFEC 3OT7A 1JCHA 1JPXA 3SJBC 3CCMV 2DQ3A 3PN1A 1Y74A 1QLEC 2PYLA 4ABMA 4K0KB 2LFSA 3ZMZA 3JD4A 4X9QA 5ITZA 1Q3EA 2NN4A 1K9MW 2RDCA 2UUAO 4ZOLA 3VOUA 1J5EB 3ABUA 4YIOA 5KA5A 4JV5B 2LW7A 3SGIA 1SF9A 1SQXH 3BVOA 2FYUH 1WLEA 1JJ2U 4AI8A 1HNXO 2DMXA 3CC2V 5CBGA 1GTOA 1HW7A 4DV2O 4UCTA 4H0LB 3T1CA 3IGAC 4QJFB 1VQ6V 3RVZA 3CCRV 1WP7A 4JZGA 2QGNA 1QCEA 4RQEA 3E22B 1HR0O 1S76D 4HNAB 3ICXA 1WPXA 3SDLA 1F4MA 4QPKA 1UFIA 4F6EA 1NTZH 3U11A 5IT9N 3E8FA 2W0XA 4MS2A 1M9NA 5KA6A 4QE9A 3K57A 4YXWG 1FXKB 1VQPV 4TQFA 1M57B 4ZI7B 4O4HB 4B08A 2HP8A 3W7TA 1N34O 2PYJA 4LF4B 4JGSA 1S77D 3M8AA 1B3QA 2EZOA 2Z0AA 4DR1B 3BFRA 1TVKA 5LOVA 4JYAB 1YXBA 2LFRA 2E74B 1JQ0A 4FMTA 4O2AB 3T1YO 1PKXA 1COWG 2CTPA 4GLXA 2L35A 2UXDB 4GT1A 3IJ4A 4JI2O 3ZMVA 2ZIOA 3CCEV 4OXSA 4D7TA 5LGUA 2YEVA 1HNWB 4DV4O 2CTRA 3K06A 4X89A 1OCZC 4O2BB 5JH7A 4N23A 1AJQA 3RYCA 5FNVA 2Z3YA 1VF6C 4CC6A 4DV7O 3F5TA 1VF7A 3X2QB 1YJNV 2YIBD 2XASA 2QE7G 4JYBA 5BXZA 4JV5O 4LFAB 1UPGA 1GRJA 5KLVH 4AHCA 4MTOA 2XTAA 1RSOA 1Q90D 4GX2A 5CA0A 3ABTA 2JEUA 3ZHVA 1VQNV 3RGBA 4B3MO 4LFCB 3EXAA 3BA9A 5L3BA 2P4VA 3CB2A 1D5AA 3IC7A 2LW1A 4R8CA 3ZHTA 2JJ1G 4J11A 3JSNA 2FB5A 2G38A 4CBCA 1WN7A 3JATB 1H8HG 1N36B 1XBLA 4X20B 3B77A 1US6A 3M99B 1PD3A 2DYSB 2YI8A 1X59A 3WB0A 5KUKA 3ZHRA 1V55C 3LSQA 2YI9A 3RYIB 5CN0A 3SR2C 1AVMA 3BA8A 2WLIB 3HKDB 4DR2O 3C3TA 1QNMA 3E8HA 3R66A 4NTWA 4RO2A 3CSXA 4CH4A 4U7NA 2X7RB 2Q67A 1F7YA 3OGIB 2ODMA 3OMNB 1KU9A 4UCUA 2P7TC 3FD9A 4J10A 3DXRA 2DE0X 3N2GA 1FPOA 1AROP 4LWSA 2BCCH 2V1DA 4FLYA 1YJWV 3ABKC 4JI6O 2EIMB 3D3IA 4GZRB 2AGAA 2JS3A 1EBOA 3F7YC 3STLC 2EIMC 2Q9LA 5E1AC 1BCCH 1FKAO 4JI3O 3T4ZA 3K5LA 2WLKA 4O2AA 1N33B 2OIGA 2YSUB 1WAZA 3ASNC 2B9ZA 3DC5A 3JALB 1P7GA 1MOFA 3P32A 5K1PA 2LQTA 4JPRA 4B3RO 2UXBB 4JTAB 3STZC 2R9RB 2ZD9A 3CCVV 1XDCA 2K9PA 4JI0B 4TSFG 1JVMA 2B5UA 5FNVB 4PA4A 1NKDA 1DGSA 3H1IH 1NS1A 3ASOC 3KG2A 2IM9A 1IBKB 1EFRG 1TVKB 2AHZA 2W0FC 4UCSA 1Z5VA 5FPOA 3CX5F 4UXNA 5H2FZ 5B1AB 1RP3B 1HNZO 4J9ZB 4K35A 4LFCO 3UO3A 5L3EA 1KYOF 5IJ0A 3H1JH 2JEXA 4L8JA 5JJNB 2Q5ZA 2XHBA 1XHZA 2R70A 2WAMA 3G80A 1IDSA 1LUWA 4DV7B 2FMLA 4X65B 2IBZH 3R65A 1JOYA 1KKCA 3G6BA 3UCSC 4LH7A 4X64B 1V55B 2ZXWB 4AQYO 4KP4A 3E86A 4DV4B 4JI5B 2HVKC 4R50A 2F43G 4EB6A 1RSOB 1E1RG 3K0GA 4UB6Z 4WFBV 3MHSC 4LBEC 1JA8A 4JI0O 1FXHA 4FPPA 2EZPA 3DSQA 2QDOA 2LJ2A 2P5OA 2WLNA 3SYAA 4LCUC 2BTOA 4NXMB 1EN4A 1F4NA 5DEDA 3A2FA 3SYQA 1Q8IA 2EIJB 4DV0B 4TUYB 1S0VA 2NLJC 2YEVB 1H8EG 1R3KC 3CP1A 3CRMA 4X1IA 5BR8O 2UXCB 1NU1H 3B40A 3AG3C 4MVOA 5IJ9B 3OEEG 2DQ0A 5J2TA 1ZWIC 5KAIZ 3ZRWB 3OUSA 2CE4A 2QM7A 2UUBB 1R3IC 1T5EA 1QR8A 5EBLC 5LMUO 4I9QA 3H01A 3MAQA 3D36A 2ARHA 1V54C 1NH2D 2PI4A 1BT8A 5DECA 1ROPA 1QHTA 3BEHA 4DK1A 4ZBMA 4DR5B 3QVNA 1SQQH 4B7KA 3HKEB 4OGQB 2A3QA 4PI2A 1XMQO 4DR4B 4I50A 5CBHA 3CJHB 1VQ8V 1BL8A 1G1XB 1XREA 2RN9A 5A9GA 1AP5A 4CS2A 1NZ6A 1BQZA 2IJKA 1VF5B 3AG1C 3RYHA 3W7UA 3T1HB 2XAFA 3JAKA 2LGWA 4I4TA 4DW1A 5JCOC 5IJ0B 2JK5C 1FJGO 3K3WA 4UVBA 3OMIB 4X1IB 2GBOA 3NXSA 5EC2C 1ZX3A 3LDEA 2QKAA 4FLVA 4NB5A 1Z2GA 1EZJA 1MZEA 3K04A 4PHZA 1EZVH 2OWOA 2ATKC 4MTXA 2IJHA 4MTFA 1PM9A 3S3XA 4JI7B 3ABLC 3OTOB 3GWKC 1R6TA 3SPIA 3AEIA 1JFFA 1AR4A 2ZDIA 2Y4UA 2CGOA 3SYPA 1ZUQA 4LP8A 2CGNA 1JR9A 4FM2A 2YXHA 1OCOC 5H5NA 4F6RA 1EN6A 2UXDO 4GKKO 4IL6Z 4UV8A 5CMUA 5B1OA 3QG5A 3W7WA 4YJ2A 1H2SB 2YXYA 2R72A 1XMOO 2Y0IA 3IAYA 2A79B 4DV5O 1IBKO 4YIPA 1S3JA 3J7AU 1B6QA 4I55A 3JAWB 1W0KG 3NR7A 1NVPB 2IJJA 4UFZA 3SPJA 2PY5A 2UXNA 1K73W 4UVCA 4DR7O 3K0DA 1VMGA 4IHJB 5HFMA 5KHKA 2UU9O 3E89A 5EZYB 3AK3A 5IJ9A 4G27B 5DN6G 1WPBA 1SA0A 4DR6B 2BOBC 1PL4A 2CH7A 1SZTA 1SETA 4JI4B 2Q7EA 4DRXB 2Q8VA 1K5SA 5LGTA 3TGUH 1AILA 4ICGA 4KL1A 5JQGB 3TETA 4B3TO 4QGPA 3CRRA 1GAXA 1M56C 3CCSV 4BIUA 4D7SA 1G4YB 4GX1A 2GUZB 1G6UA 4FM1A 1SQVH 1RM1B 4R7CA 4XBFA 2QEXV 1Y76A 4CH6A 1NBMG 1HWYA 5CA0B 3J81N 3JAKB 2X6BA 2UUAB 1AB3A 2A7WA 3LNMB 3E83A 1I94B 4W4KA 2RNBA 4IYIA 4FLZA 1URFA 5IY5B 3ZEDA 1AI4A 2ZM6O 5A2QN 2LO1A 3HKCB 1MZFA 5J2TB 1S72V 1OCRB 2DYRB 1AJNA 4X62B 4GKJB 4YY3B 1R3LC 2QWRB 1Y4MA 3ZS8C 1W2BU 2E5LB 1MSDA 4X1YB 5CB4A 1NH2B 2KG7B 3TXSA 5GONB 3HKDA 2F93B 4KFMA 1KKDA 3ZN1A 2XAQA 3JASA 1H38A 3JD0A 3UT5B 1FXKC 1F51A 4JASA 3ZMUA 4YY3O 1PNKA 2M7WA 5BMVA 1ZAUA 4I7ZB 3SYOA 1BGYH 1Q7YW 3U10A 1VQOV 5KAFZ 1YI2V 3ASNB 3K5OA 3CMEV 4DV6O 1CPYA 1F23A 1KP2A 1ZL8A 1KC8W 4NKGB 3L71H 4NTXA 4LF5B 1IXBA 2R9IA 1QQCA 3OD4A 3JAWA 2RMKB 5KUMA 4DUYO 5JJJB 3WG7B 3CRCA 3SJQC 3TCUA 1E1QG 4X66B 3K59A 1Y6XA 4ZHQA 4EKWA 3IFXA 1NTMH 1J5EO 5CB4B 1K97A 2IU0A 2XAJA 4JI8B 4HYOA 1K3EA 3E35A 1NR7A 2CK3G 1VARA 3RYFB 2PUSA 1D5NA 4CH5A 2VRZA 4WFGA 4DO2A 1H2GA 4LWSB 5H6RA 1EN5A 3E22A 5EBMC 4MTGA 5FLXN 3FX7A 1LR1A 3VQYA 1LUVA 1FD9A 4LF7B 3RYCB 1VEWA 1MSWD 1P4RA 4DYLA 4FLXA 1L1FA 2X6CA 3BPZA 4MVQA 1BZKA 1CXZB 2HEPA 4LR3A 3CD6V 3K08A 3CRQA 1Y76B 4JTDB 1QVGU 3ML0A 4E2LA 4GKKB 1M57C 2EIKB 2JS5A 2YS8A 4DUZB 2CAZC 4X88A 2WPDG 1I5YA 3G4SV 1TUEB 1PV0A 5LXTA 1PL0A 3CEIA 1IBLB 5L3GA 2Q69A 2FKXA 4Q20A 2QR4A 1ENVA 2B1IA 1TUBB 3ZIAG 2H3OA 2ZE8A 4PA6A 1H2KA 4EFEA 3KKYA 3RYIA 3JD1A 1YTFB 5IWAO 4TV8B 5J9PC 5EYPA 2JGDA 4EEQA 5J2UA 3QF7A 2OT5A 4HZ3A 1AP6A 1YEWA 2JRIA 4DW0A 1IZ3A 3B8MA 3OTFA 3CCJV 3ZRVA 1P84F 1CEZA 1YSCA 2GUZA 2RQ6A 1FJGB 3T4DA 1E79G 1KD1W 2V4DA 2P6JA 1VQ9V 3OR6C 1YIJV 3T2MA 3QNEA 2JVDA 4JAUA 3JAMN 5D5QA 1MNGA 3T1HO 1XNQO 4LF9O 3J80N 2ZNJA 3JD3A 1AJPA 2JDIG 4B3MB 3SJCC 5LMNB 3AG4C 2WLLB 5LYJA 5EBWC 2ETNA 1I94O 4DR4O 3BRCA 4TT3G 3IC9A 1N32O 2CTWA 1QR9A 4X66O 4MSWC 3RVYA 1PP9H 3CJHA 3WU2Z 4EB6B 2M6YA 3D8CA 4NTYA 4FLTA 1QLEB 3JARA 4HAMA 2IW5A 4UUJC 1N33O 4HBNA 3WG7C 1B04A 2KG7A 5B1BB 1CP9A 4JI3B 4B3TB 2HKOA 3C90A 4J41A 3OFNG 4ZHQB 1XI1A 4FIPC 2WWWA 5KHGA 1H2MA 5JWPA 3JCZA 3QO8A 4TQDA 2GDSA 3CXCU 1KUQA 2Q73A 2EJRA 5KX5B 2DOSA 3B4SA 2AXTZ 4PJ0Z 3UKMA 1GKFA 3CHXA 5ITZB 4FZ0A 4WBNB 5EC1C 3DC6A 2HJFC 2UXXA 4JTCB 4WFFA 3ZRWA 1I08A 4WFAV 1VQ5V 4LF4O 1AR1B 1N34B 4MW8A 2BTQA 3PJSK 2H8PC 4K8ZA 2N05A 1VQKV 1I0HA 4F4LA 1DTOA 1FFXB 2WA4A 1N0JA 4BW5A 4QPJA 3AG2B 1N0NA 4HNAA 5HFLA 2Y0PA
chains in the Genus database with same CATH topology
2IJIA 3ZCCA 4BAYA 1JJ2U 1WLEA 3W7SA 1K8AW 1VQLV 2IH3C 2X0LA 3AEIA 3SPIA 3FB7C 3LDDA 1GTOA 5CBGA 3CC2V 3T1CA 4MT8A 2HR3A 3IGAC 2ZDIA 2Y69B 4QJFB 1VQ6V 3RVZA 4PDRA 3SYPA 3CCRV 3LSSA 2QTOA 4LP8A 1QCEA 5LHGA 4RQEA 1OCCC 1K92A 3MHHC 3WFVA 1S76D 3F7VC 1FFTB 1WPXA 4MVZA 4H37A 1F4MA 4QPKA 2K1EA 1OCOC 2A9HA 3E8FA 1N8RW 2ITCC 4UV8A 1KECA 5CMUA 2ITDC 5B1OA 1YJ9V 1R6NA 1S5HC 3W7WA 2ZQMA 3ZJZA 3ZRXA 2X6AA 4MS2A 1M9NA 4LC1A 4QE9A 5KA6A 4PDMA 3CCUV 2A79B 4RAIA 4YXWG 1FXKB 1VQPV 1M57B 3W7TA 5LBQA 1S3JA 2P90A 4JGSA 1J95A 1B6QA 1S77D 5DM6V 1W0KG 3ZMSA 1NVPB 5L3CA 5H9CA 2EZOA 2IJJA 3SPJA 5H6QA 2UXNA 1K73W 4UVCA 3K0DA 1VQ7V 2LFRA 5HFMA 2DYSC 3E89A 1JQ0A 4FMTA 4G27B 5DN6G 5IY5C 1VQMV 3K03A 1SESA 1PKXA 2BOBC 2WLHA 1UJWB 1COWG 3QO7A 3SYCA 1QBZA 3HB3B 4DXWA 1SETA 1SZTA 1G8MA 3OGCC 4MVRA 4GT1A 2A0LA 1K5SA 3ZMVA 3CCEV 4TWKA 5LGTA 4FJCC 4OXSA 3ETDA 5LGUA 2DWDC 2IU3A 3TETA 4GX0A 2YEVA 5IYDO 3DGEA 2EBOA 3FB6C 3ABMC 3GB7C 1SERA 3K06A 4X89A 1OCZC 5GW7A 1YHQV 1M56C 4QE7A 3CCSV 1W0JG 3K79A 3AG2C 4N23A 4BIUA 1G4YB 4PA7A 1AJQA 4GX1A 4XDLA 2Z3YA 3SPHA 1NVPD 4CZZA 3X2QB 3ZRSA 4R7CA 4XBFA 2XASA 1RM1B 2QE7G 1YJNV 4JYBA 3FB5C 1K4DC 3OMAB 4GX5A 3SPCA 2QEXV 1QVFU 1NBMG 1HWYA 4P9PA 2X6BA 4MTOA 5IYCO 3LNMB 3E83A 1V54B 4GX2A 3ABTA 2JEUA 1VQNV 2EIKC 5BZBA 5IY5B 2EIJC 1KQSU 4N21A 1AI4A 2B1GA 2OCCB 5L3BA 2FTKA 4P30A 3HPLC 3LDCA 3IC7A 2WSSG 4R8CA 3G6EV 1AI7A 1RPOA 2JJ1G 1OCRB 1S72V 2DYRB 1AJNA 2ZR2A 2EINC 4X8AA 1RPRA 2OTLV 1THZA 4CBCA 4Z1MG 3OAAG 1H8HG 2XNDG 1R3LC 1Y4MA 3B77A 3M99B 1PD3A 1W2BU 2DYSB 3ASOB 4G2KA 4GCZA 1NH2B 2XAHA 3MD0A 5B3SC 5KUKA 1V55C 4MVMA 3LSQA 4KFMA 1BHBA 1KKDA 5CN0A 1VQ4V 2OCCC 3ZN1A 2XAQA 1H38A 4ASUG 3JD0A 1FXKC 1F51A 2WLIB 1M56B 4JASA 3ZMUA 1DF4A 3E8HA 4RO2A 1PNKA 2M7WA 5IDJA 2EILC 3SYOA 2WLIA 4ZKIA 2Y69C 4U7NA 2XAGA 1Q7YW 2Q6AA 4PA9A 1SRYA 1K33A 3FB8C 1VQOV 2X7RB 2Q67A 1YI2V 3ASNB 3CMEV 1KP3A 3OMNB 1NQTA 4PA3A 1CPYA 2P7TC 1Q82W 4P2ZA 4PDLA 1F23A 1OCRC 1KP2A 1AROP 2V1DA 4I9WA 4I5SA 1KC8W 5EK0A 5B1AC 3P30A 1YJWV 2Y48A 3ABKC 4KUMA 4WFHA 3FYEB 2EIMB 3D3IA 1EBOA 3F7YC 3STLC 2EIMC 1P7BA 5E1AC 3T4ZA 1GK9A 2WLKA 3EHBB 2R9IA 3VBBA 3ABLB 2YSUB 1NJIW 3ASNC 4XDKA 5KUMA 2C2AA 4PDVA 2DYRC 2V7QG 4H33A 3WG7B 4U7OA 3SJQC 3TCUA 1MOFA 2Q68A 1E1QG 2P67A 2QM8A 2W6IG 3P32A 3UM7A 4EKWA 1GM8A 3IFXA 2ZXWC 2Z5UA 4JPRA 5CA3A 4JTAB 1K97A 2IU0A 3STZC 2XAJA 4HYOA 1K3EA 3RW0A 3E35A 1Y66A 2R9RB 2ZD9A 3CCVV 1NR7A 4TSFG 3OEHG 2CK3G 1JVMA 2B5UA 4PA4A 1NKDA 1GM9A 5FL7G 3E8GA 1IXMA 4WFGA 3AG3B 4DO2A 3ASOC 1H2GA 3RBZA 1PNMA 5H6RA 3KG2A 2DWEC 3ZMTA 3CC4V 1LNQA 5EBMC 4MTGA 4RUFA 1EFRG 2LP7A 2AHZA 2W0FC 3G71V 3ABKB 4UXNA 5B1AB 3CC7V 1R6KA 1MSWD 1P4RA 4J9ZB 1L1FA 2X6CA 1OCZB 1BMFG 3FYIB 4MVQA 5L3EA 5L3FA 3CYOA 5B3SB 3CD6V 1M1KW 4MW3A 2HVJC 3K08A 4UV9A 4BIZA 2JEXA 4JTDB 2HLDG 1QVGU 3ML0A 3OW2U 4E2LA 2OTJV 1M57C 2EIKB 1XL6A 2H94A 4FK5C 2WAMA 4WCEV 4X88A 2WPDG 4RUEA 3K9AA 2WLMA 2EINB 1I5YA 4WFEA 5L3DA 3G4SV 1TUEB 4RQFA 3I56V 3R65A 3B8NA 1YTFD 2PI5A 1JOYA 3I55V 4G28B 4QNHB 1MG1A 1PL0A 1V55B 2ZXWB 4KP4A 3W7XA 5L3GA 1K34A 2Q69A 1R3JC 3E2EA 3E86A 4Q20A 4P9OA 1ENVA 1ORQC 2B1IA 2JJ2G 3ZIAG 2HVKC 4R50A 4PA6A 2F43G 3JD1A 3LUTB 1Q86W 1YTFB 4JF3A 1BHAA 1GO3F 1E1RG 3OM3B 3K0GA 5J9PC 4WFBV 1K7DA 3MHSC 4LBEC 1I5XA 1FXHA 4FPPA 2OT5A 2EZPA 4HZ3A 5B1BC 2EILB 3ZN0A 3FKSG 3X2QC 2NNUA 2BOCC 3AG1B 2WLNA 3SYAA 4LCUC 3B8MA 3CCJV 3SPGA 3ZRVA 3JYCA 1CEZA 1DLBA 1YSCA 1F4NA 1Q81W 3SYQA 1R73A 2MK3A 2EIJB 1OZ0A 2HG5C 1FXVA 1E79G 3T4DA 5LHHA 1KD1W 2P6JA 1VQ9V 2XOKG 1S0VA 3OR6C 2NLJC 4L87A 3T2MA 2YEVB 1YIJV 3OE7G 1H8EG 1R3KC 3CP1A 3QNEA 4JAUA 3AG3C 4MVOA 3OEEG 2DQ0A 1YITV 2GSMB 4MVSA 3JD3A 1FXKA 1AJPA 2JDIG 1RM1C 3AG4C 2WLLB 5EBWC 4XDJA 1GM7A 1ZWIC 3A0RA 3ETEA 4PELA 3E8BA 3ZRWB 1M90W 3OUSA 2QM7A 4QIWF 4TT3G 3CMAV 1R3IC 4R6ZA 1QR9A 4MSWC 3RVYA 1DF5A 2KB1A 3JD2A 1QR8A 5EBLC 3ABMB 5B1NA 3H01A 4JAVA 4MVUA 3D36A 1QLEB 2JIZG 3TK1A 2D3OW 3F5WC 2AHYA 4HAMA 1V54C 2IW5A 1NH2D 2ZDIC 4UUJC 2PI4A 3CCQV 2WLLA 5LGNA 3WG7C 1ROPA 3BEHA 3CCLV 5B1BB 1CP9A 2QKSA 1AI6A 3DTUB 1FS0G 2HKOA 1GMGA 4ZBMA 3EFFK 4WF9V 2ZR3A 5LHIA 3OFNG 4FIPC 2WWWA 2DW4A 5CBHA 3JCZA 1BL8A 3QO8A 3CXCU 1K5QA 3CPWU 1VQ8V 3OR7C 1MABG 2EJRA 1XL4A 1OCCB 2QA4V 1OHHG 2WLJA 3UKMA 1GKFA 4UVAA 2IJKA 2W6JG 3BY6A 3AG1C 3QO5A 3W7UA 1PNLA 5EC1C 2XAFA 3OUFA 2HJFC 2UXXA 4JTCB 1AI5A 4WFFA 2IH1C 2JK5C 3ZRWA 1JX9A 3K3WA 4WFAV 4UVBA 3ETGA 3OMIB 2GHYA 1AR1B 1VQ5V 5IYBO 3NXSA 4MW8A 2HFEC 4JYCA 1JCHA 1OCOB 5EC2C 3PJSK 1JPXA 2H8PC 3LDEA 3CCMV 2DQ3A 1QLEC 1VQKV 1QLNA 1EZJA 1K4CC 2LFSA 3ZMZA 3JD4A 5C93A 3K04A 4F4LA 1DTOA 1K9MW 5CBFA 3GWOA 2ATKC 4QPJA 3AG2B 3VOUA 1NR1A 4MTXA 4BW5A 2IJHA 3ABUA 4MTFA 5HFLA 5KA5A 4J9YB 3ABLC 3AG4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ7 V;  3CXC U;  1VQ8 V;  1YHQ V;  1JJ2 U;  3CPW U;  1VQN V;  1K8A W;  3G71 V;  4WFB V;  3CCM V;  3CCS V;  3G4S V;  1VQL V;  3I56 V;  1N8R W;  1W2B U;  1Q7Y W;  3CC7 V;  3CC2 V;  1KQS U;  1YJ9 V;  2QA4 V;  3CCV V;  1VQM V;  3I55 V;  1VQK V;  1YIT V;  2D3O W;  1K73 W;  1VQO V;  1VQ6 V;  1YI2 V;  3CME V;  3CCR V;  3CCQ V;  3CCJ V;  1NJI W;  3CD6 V;  1M1K W;  3CCU V;  1Q82 W;  1YJN V;  1VQP V;  3CCL V;  3G6E V;  1K9M W;  1VQ4 V;  1S72 V;  1Q81 W;  4WF9 V;  3OW2 U;  1QVG U;  2QEX V;  1R73 A;  1QVF U;  2OTJ V;  3CCE V;  3CMA V;  5DM6 V;  1KC8 W;  1M90 W;  1KD1 W;  2OTL V;  4WFA V;  1YJW V;  1VQ5 V;  1VQ9 V;  3CC4 V;  1Q86 W;  4WCE V;  1YIJ V; 
#chains in the Genus database with same CATH topology
 3ZCC A;  4BAY A;  2RCV A;  3W7S A;  3JAR B;  1K8A W;  1VQL V;  4JI5 O;  2X0L A;  4B7E A;  3FB7 C;  3LDD A;  4TV8 A;  4DV2 B;  2HR3 A;  3H1L H;  4LH6 A;  4PDR A;  5CA1 B;  3LSS A;  1OCC C;  1K92 A;  1TA8 A;  4GYC B;  4CS4 A;  3WFV A;  3F7V C;  4H37 A;  2GTA A;  4DUZ O;  1YCI A;  5JJE B;  2A9H A;  2ITC C;  1KEC A;  2Q0A A;  2Q7H A;  3G67 A;  2ITD C;  4FFK A;  2ZKO A;  1S5H C;  3ZRX A;  3RT3 C;  2XT9 A;  4RAI A;  2P90 A;  3ZMS A;  5H6Q A;  5KMG B;  2QTS A;  3ZHS A;  2E3C A;  3P3P A;  2DYS C;  1HDJ A;  4LNU B;  2JGD B;  3K03 A;  3N2K A;  1BE3 H;  3QO7 A;  1QBZ A;  3HB3 B;  4DXW A;  1G8M A;  4B3R B;  4MVR A;  4A5U B;  2A0L A;  2UXB O;  4TWK A;  4FJC C;  2DWD C;  4GX0 A;  1R1B A;  5IYD O;  2ZIN A;  1Y67 A;  2EBO A;  3ABM C;  4D6T H;  1WP8 A;  5GW7 A;  1U97 A;  1JMK C;  3FAV A;  4YJ3 A;  3L70 H;  4DUY B;  4QE7 A;  1L8D A;  4BW9 A;  4PA7 A;  4XDL A;  5LP6 C;  1WJZ A;  2OIE A;  2VQE O;  3MDS A;  4OPA A;  1YF2 A;  3FB5 C;  1K4D C;  1QVF U;  3SPC A;  4FZ1 A;  5EIB C;  4H13 B;  4EFB A;  3JAT A;  5IYC O;  4U3F H;  3AK1 A;  5JH7 B;  2EIK C;  2EIJ C;  1KQS U;  4X1Y A;  5J2U B;  2B1G A;  2FTK A;  2UXC O;  3LDC A;  2WSS G;  1MMM A;  4UCR A;  2HJD A;  2NR5 A;  4DV0 O;  2ZR2 A;  4I0X B;  3CE2 A;  4KHP O;  3OAA G;  3THO A;  4NXM O;  4YHH O;  4G2K A;  4GCZ A;  4DRX A;  3CS5 A;  3MD0 A;  5B3S C;  1ZSP A;  1XUQ A;  5GTI Z;  2OCH A;  3EVK A;  3JAL A;  2F23 A;  2OCC C;  4ASU G;  3ETQ A;  1WA8 A;  4PD4 F;  1WNS A;  1W59 A;  1SQB H;  4K8X A;  1BSM A;  2EIL C;  1TGO A;  3GVM A;  4AQY B;  2XAG A;  4PA9 A;  4Z2W A;  1K33 A;  3FB8 C;  5K1X A;  1KP3 A;  3ZX6 A;  4PA3 A;  4LFB O;  2ZM6 B;  3D3Q A;  4PDL A;  4LF5 O;  2QJ1 A;  2VS0 A;  2ZT9 B;  3ZHQ A;  1GN4 A;  5EK0 A;  2WA3 A;  5B1A C;  5GTH Z;  3VQV A;  2Y48 A;  2P22 C;  1XMQ B;  4WBN A;  4WFH A;  4F6R B;  1BQ0 A;  4JI1 B;  3KZI Z;  1P7B A;  1WB8 A;  3JSL A;  1GK9 A;  3VQX A;  4DR3 B;  3N2K B;  1NJI W;  4J7J A;  4XDK A;  4BWA A;  2C2A A;  2BE3 A;  2DYR C;  2QSA A;  1I7F A;  2V7Q G;  3JAS B;  5LMU B;  4U7O A;  1HNW O;  2QM8 A;  3UM7 A;  2Q7G A;  4IHJ A;  2ZXW C;  2JGU A;  3L72 H;  5CA3 A;  2HHH B;  4LNU A;  1QU7 A;  3RW0 A;  1Y66 A;  4FLW A;  2ZNI A;  2PTM A;  3HKB B;  4JI4 O;  4YHH B;  1X4T A;  2Q0O C;  5IWA B;  2CUG A;  1GM9 A;  3E8G A;  2F1M A;  4CH3 A;  4DR1 O;  1IXM A;  2EUL A;  1PNM A;  1ZL8 B;  3CC4 V;  1LNQ A;  4RUF A;  1IBM B;  2LP7 A;  5LP6 B;  3ABK B;  4ZIB A;  1XNR B;  5CA1 A;  2QKC A;  3TJT A;  3CYO A;  5B3S B;  1M1K W;  4MW3 A;  2F95 B;  2HVJ C;  1ZLZ A;  2FL4 A;  1YZB A;  2HLD G;  4JI8 O;  3OW2 U;  1XL6 A;  2H94 A;  4FK5 C;  1TAE A;  4X1K A;  4WCE V;  3KCY A;  2YUA A;  4I0X A;  3K9A A;  2N04 A;  2VWK A;  1YTF D;  2PI5 A;  4U3J A;  4QNH B;  1MG1 A;  5D5P A;  1XNR O;  5EZY A;  4X64 O;  2BSK B;  3E2E A;  4P9O A;  1IBM O;  2N74 A;  1FYJ A;  4DR2 B;  1H2N A;  3LUT B;  1Q86 W;  4JF3 A;  1N32 B;  2VQF O;  1XQ8 A;  1GO3 F;  1K7D A;  1I5X A;  2EJ7 A;  1O9H A;  2EIL B;  1Z5W A;  4FFB A;  3QTC A;  3X2Q C;  2NNU A;  3AG1 B;  2HHH O;  3WB1 A;  2AZ0 A;  1DLB A;  2F4V O;  3ZHU A;  4JAA A;  4O4H A;  1R73 A;  2HG5 C;  4NXN O;  5LL6 Y;  4OPH A;  4OX9 B;  4LF6 O;  3OE7 G;  1SZX A;  4TUY A;  3I5D A;  2E75 B;  1Y74 B;  4ZI7 A;  1RM1 C;  4LF8 B;  1IX9 A;  3Q4H B;  3ETE A;  3E8B A;  1M90 W;  2VQF B;  1KB9 F;  4R6Z A;  5LOV B;  4KHP B;  2KB1 A;  3JD2 A;  1S5J A;  3ABM B;  3AK2 A;  3M7M X;  4JAV A;  1S5L Z;  2YIC A;  4U3J B;  4FLU A;  2JIZ G;  2D3O W;  1N4C A;  4FM0 A;  3U0Z A;  3CCQ V;  1D2D A;  5E79 Z;  3RFR A;  2QKS A;  1AI6 A;  3DTU B;  1FS0 G;  1GMG A;  3EFF K;  2F66 C;  4WF9 V;  4JI7 O;  2ZR3 A;  2UUC B;  1A32 A;  1NI8 A;  4O2B A;  3WB2 A;  2XUM A;  4UCO A;  2KQX A;  2UUB O;  1L0L H;  4LF8 O;  1K5Q A;  3CPW U;  1MAB G;  1XL4 A;  2VQE B;  1H2L A;  2WLJ A;  1KMI Z;  2W6J G;  4O4J B;  3P3N A;  4RWU A;  1PNL A;  3OUF A;  5JVD A;  1AI5 A;  1O9G A;  1B06 A;  1JX9 A;  1YVW A;  3CRA A;  3ETG A;  3RYH B;  5IYB O;  2OYQ A;  4JYC A;  1OCO B;  1SC5 B;  3APQ A;  3ZBH A;  3BCC H;  4NR1 A;  1QLN A;  1K4C C;  1VP7 A;  5C93 A;  4JZ2 A;  4TV9 B;  4B3S B;  1GN2 A;  4I4T B;  3GWO A;  5CBF A;  1NR1 A;  3K5N A;  1HR0 B;  2YIA A;  4DR5 O;  4X20 A;  4J9Y B;  1Q6U A;  3AG4 B;  5IYZ B;  3LSU A;  2IJI A;  2P06 A;  2IH3 C;  5JCO A;  1NTK H;  1XMO B;  4MT8 A;  5EYP B;  2Y69 B;  1HNX B;  2QTO A;  5LHG A;  2O57 A;  3B2E E;  1WB7 A;  2QWN B;  4X65 O;  3MHH C;  4BR6 A;  3N2G B;  1FFT B;  4DV3 B;  1M93 A;  4MVZ A;  2AZ2 A;  3RN4 A;  4JI1 O;  5FPR A;  2K1E A;  3JCU Z;  1N8R W;  4K0K O;  4DR6 O;  2ILM A;  1YJ9 V;  4FVM A;  1R6N A;  4LFB B;  2PF4 E;  1ZTE A;  2ZQM A;  4J7Z A;  2X6A A;  3ZJZ A;  4LC1 A;  2UU9 B;  4PDM A;  3CCU V;  4TOI A;  5LBQ A;  1J95 A;  1DK1 A;  3Q4H A;  5DM6 V;  5L3C A;  5H9C A;  1HP8 A;  1MA1 A;  2GTS A;  1VQ7 V;  1GH6 A;  3BAA A;  3H1H H;  5IY5 C;  1VQM V;  1JFF B;  4NVP A;  1SES A;  1PPJ H;  2WLH A;  1UJW B;  1IVS A;  3SYC A;  3OGC C;  2A06 H;  1V9P A;  1KBH A;  3O65 A;  2UUC O;  3ETD A;  3H9V A;  4Q6G A;  2IU3 A;  2YC0 A;  4DV1 O;  3DGE A;  3FB6 C;  1SER A;  3GB7 C;  1YHQ V;  1YDX A;  1W0J G;  3K79 A;  3AG2 C;  3SPH A;  1NVP D;  4CZZ A;  2KKW A;  2BSK A;  3ZRS A;  3C3S A;  1GN3 A;  1XOU A;  3UT5 A;  3OMA B;  4GX5 A;  2P4K A;  3DXR B;  4C7U A;  1OV9 A;  4I55 B;  4P9P A;  4J7K A;  5BMV B;  3L73 H;  5KMG A;  4IYH A;  1V54 B;  5IE9 A;  4IIJ B;  5BZB A;  4AIL C;  4N21 A;  3CWB H;  2OCC B;  4P30 A;  2ZE5 A;  4O4I B;  5GON A;  3HPL C;  3K9S A;  3G6E V;  4LF6 B;  1AI7 A;  1RPO A;  1WA8 B;  4UB8 Z;  1FFX A;  3KCX A;  2EIN C;  4X8A A;  1RPR A;  2YDE A;  2OTL V;  1THZ A;  4Z1M G;  4J42 A;  2BTQ B;  2XND G;  2ADP A;  1SKV A;  3A0H Z;  5KHJ A;  5C8Y B;  3ASO B;  2XAH A;  3HKC A;  5BY1 A;  2L6L A;  4MVM A;  1P49 A;  1BHB A;  1VQ4 V;  5JVD B;  4NYK A;  1M56 B;  2ADQ B;  1N36 O;  1DF4 A;  5IYZ A;  1JJO A;  5IDJ A;  1VIB A;  2WLI A;  4ZKI A;  2Y69 C;  4GUN A;  2Q6A A;  1SRY A;  4DV5 B;  1XHX A;  2AW9 A;  5LA6 B;  1NQT A;  1AR5 A;  1Q82 W;  2RJZ A;  4P2Z A;  1IUR A;  1OCR C;  1EM1 A;  4I9W A;  4I5S A;  3P30 A;  4KUM A;  4O4J A;  3FYE B;  1XIL A;  3APO A;  3K58 A;  2DJV A;  4CS3 A;  1Q6H A;  3EHB B;  4LF9 B;  3VBB A;  1IBL O;  2R9A A;  2YXL A;  3CXH F;  4IT5 A;  3ABL B;  4DV1 B;  4PDV A;  4H33 A;  1SS3 A;  2D2C B;  5KHI A;  2Q68 A;  2P67 A;  2W6I G;  2PZS A;  3HKE A;  1GM8 A;  2Z5U A;  3BAB A;  5C8Y A;  3FAV B;  4PI0 A;  4YJ3 B;  2E5L O;  3L9D A;  3K5M A;  1Q6I A;  3OEH G;  3T1Y B;  2KSD A;  3H1K H;  1VF6 A;  5KHH A;  5FL7 G;  3L74 H;  4LF7 O;  2DN9 A;  4X62 O;  4GKJ O;  2ZCE A;  3AG3 B;  3RBZ A;  1GN6 A;  4J80 A;  4JYA O;  2DWE C;  4OX9 O;  2ZE6 A;  3ZMT A;  1FAF A;  2QWO B;  5TIS Z;  4K3A A;  3G71 V;  2QWP B;  4W4L A;  2F4V B;  2Q4P A;  3CC7 V;  1R6K A;  4IIJ A;  3N27 A;  4UCV A;  1OCZ B;  1BMF G;  2ZIM A;  3FYI B;  3UO2 A;  3VQW A;  5L3F A;  3RYF A;  4UV9 A;  4O4I A;  4BIZ A;  1TUB A;  2OTJ V;  4LFA O;  4DK0 A;  2VWJ A;  2GV9 A;  4DV3 O;  4RUE A;  5EIB D;  2WLM A;  2EIN B;  4WFE A;  5L3D A;  3HR0 A;  4RQF A;  3I56 V;  3B8N A;  3D36 C;  4PV1 B;  4Z1V A;  3I55 V;  4G28 B;  2QWQ B;  3TXQ A;  3W7X A;  1K34 A;  1R3J C;  5B66 Z;  1ORQ C;  3SJA C;  2JJ2 G;  2EX3 A;  1Q43 A;  4JI2 B;  4B3S O;  2YID A;  1BHA A;  3OM3 B;  2E76 B;  3HKB A;  1XEQ A;  2Y4T A;  3RWR D;  1BS3 A;  5B1B C;  3B09 A;  5LMN O;  3ZN0 A;  3FKS G;  3O9O A;  2BOC C;  5LXT B;  2CTQ A;  5LYJ B;  3SPG A;  3JYC A;  4DR7 B;  5LA6 A;  1XNQ B;  1Q81 W;  5BR8 B;  2MK3 A;  2PGG A;  4JYY A;  1OZ0 A;  2QM4 A;  1FXV A;  4O4L B;  5LHH A;  2XOK G;  4I50 B;  4L87 A;  3A0B Z;  3AG7 A;  4X1K B;  1Q5O A;  5KX5 A;  4BIO A;  5B5E Z;  3FFQ A;  1YIT V;  2GSM B;  4MVS A;  1SQP H;  3UQ8 A;  1FXK A;  2CH7 B;  4XDJ A;  1GM7 A;  1L0N H;  3A0R A;  4H44 B;  4KXR A;  3A8T A;  4PEL A;  4E4E A;  4JI6 B;  3CMA V;  4QIW F;  4ZOL B;  1DF5 A;  5JQG A;  5B1N A;  2MW2 B;  4DV6 B;  1SA0 B;  4MVU A;  3TK1 A;  3F5W C;  2AHY A;  3S3W A;  2ZDI C;  2CDY A;  4DR3 O;  3L75 H;  2WLL A;  5LGN A;  3OTO O;  3CCL V;  1NT2 B;  5LHI A;  1SQG A;  1OJH A;  1SQF A;  2DW4 A;  1M5I A;  4FFB B;  3OR7 C;  1OCC B;  5LP6 A;  2QA4 V;  4IGG A;  4CC5 A;  1OHH G;  1U96 A;  1M4U A;  4UVA A;  4TV9 A;  4YJ2 B;  3BY6 A;  1HNZ B;  2ZE7 A;  5AG2 A;  3LNN A;  3QO5 A;  4O4L A;  1RFY A;  2LGQ A;  4NXN B;  2IH1 C;  2GHY A;  2YIB A;  3BHP A;  5F2V O;  2HFE C;  3OT7 A;  1JCH A;  1JPX A;  3SJB C;  3CCM V;  2DQ3 A;  3PN1 A;  1Y74 A;  1QLE C;  2PYL A;  4ABM A;  4K0K B;  2LFS A;  3ZMZ A;  3JD4 A;  4X9Q A;  5ITZ A;  1Q3E A;  2NN4 A;  1K9M W;  2RDC A;  2UUA O;  4ZOL A;  3VOU A;  1J5E B;  3ABU A;  4YIO A;  5KA5 A;  4JV5 B;  2LW7 A;  3SGI A;  1SF9 A;  1SQX H;  3BVO A;  2FYU H;  1WLE A;  1JJ2 U;  4AI8 A;  1HNX O;  2DMX A;  3CC2 V;  5CBG A;  1GTO A;  1HW7 A;  4DV2 O;  4UCT A;  4H0L B;  3T1C A;  3IGA C;  4QJF B;  1VQ6 V;  3RVZ A;  3CCR V;  1WP7 A;  4JZG A;  2QGN A;  1QCE A;  4RQE A;  3E22 B;  1HR0 O;  1S76 D;  4HNA B;  3ICX A;  1WPX A;  3SDL A;  1F4M A;  4QPK A;  1UFI A;  4F6E A;  1NTZ H;  3U11 A;  5IT9 N;  3E8F A;  2W0X A;  4MS2 A;  1M9N A;  5KA6 A;  4QE9 A;  3K57 A;  4YXW G;  1FXK B;  1VQP V;  4TQF A;  1M57 B;  4ZI7 B;  4O4H B;  4B08 A;  2HP8 A;  3W7T A;  1N34 O;  2PYJ A;  4LF4 B;  4JGS A;  1S77 D;  3M8A A;  1B3Q A;  2EZO A;  2Z0A A;  4DR1 B;  3BFR A;  1TVK A;  5LOV A;  4JYA B;  1YXB A;  2LFR A;  2E74 B;  1JQ0 A;  4FMT A;  4O2A B;  3T1Y O;  1PKX A;  1COW G;  2CTP A;  4GLX A;  2L35 A;  2UXD B;  4GT1 A;  3IJ4 A;  4JI2 O;  3ZMV A;  2ZIO A;  3CCE V;  4OXS A;  4D7T A;  5LGU A;  2YEV A;  1HNW B;  4DV4 O;  2CTR A;  3K06 A;  4X89 A;  1OCZ C;  4O2B B;  5JH7 A;  4N23 A;  1AJQ A;  3RYC A;  5FNV A;  2Z3Y A;  1VF6 C;  4CC6 A;  4DV7 O;  3F5T A;  1VF7 A;  3X2Q B;  1YJN V;  2YIB D;  2XAS A;  2QE7 G;  4JYB A;  5BXZ A;  4JV5 O;  4LFA B;  1UPG A;  1GRJ A;  5KLV H;  4AHC A;  4MTO A;  2XTA A;  1RSO A;  1Q90 D;  4GX2 A;  5CA0 A;  3ABT A;  2JEU A;  3ZHV A;  1VQN V;  3RGB A;  4B3M O;  4LFC B;  3EXA A;  3BA9 A;  5L3B A;  2P4V A;  3CB2 A;  1D5A A;  3IC7 A;  2LW1 A;  4R8C A;  3ZHT A;  2JJ1 G;  4J11 A;  3JSN A;  2FB5 A;  2G38 A;  4CBC A;  1WN7 A;  3JAT B;  1H8H G;  1N36 B;  1XBL A;  4X20 B;  3B77 A;  1US6 A;  3M99 B;  1PD3 A;  2DYS B;  2YI8 A;  1X59 A;  3WB0 A;  5KUK A;  3ZHR A;  1V55 C;  3LSQ A;  2YI9 A;  3RYI B;  5CN0 A;  3SR2 C;  1AVM A;  3BA8 A;  2WLI B;  3HKD B;  4DR2 O;  3C3T A;  1QNM A;  3E8H A;  3R66 A;  4NTW A;  4RO2 A;  3CSX A;  4CH4 A;  4U7N A;  2X7R B;  2Q67 A;  1F7Y A;  3OGI B;  2ODM A;  3OMN B;  1KU9 A;  4UCU A;  2P7T C;  3FD9 A;  4J10 A;  3DXR A;  2DE0 X;  3N2G A;  1FPO A;  1ARO P;  4LWS A;  2BCC H;  2V1D A;  4FLY A;  1YJW V;  3ABK C;  4JI6 O;  2EIM B;  3D3I A;  4GZR B;  2AGA A;  2JS3 A;  1EBO A;  3F7Y C;  3STL C;  2EIM C;  2Q9L A;  5E1A C;  1BCC H;  1FKA O;  4JI3 O;  3T4Z A;  3K5L A;  2WLK A;  4O2A A;  1N33 B;  2OIG A;  2YSU B;  1WAZ A;  3ASN C;  2B9Z A;  3DC5 A;  3JAL B;  1P7G A;  1MOF A;  3P32 A;  5K1P A;  2LQT A;  4JPR A;  4B3R O;  2UXB B;  4JTA B;  3STZ C;  2R9R B;  2ZD9 A;  3CCV V;  1XDC A;  2K9P A;  4JI0 B;  4TSF G;  1JVM A;  2B5U A;  5FNV B;  4PA4 A;  1NKD A;  1DGS A;  3H1I H;  1NS1 A;  3ASO C;  3KG2 A;  2IM9 A;  1IBK B;  1EFR G;  1TVK B;  2AHZ A;  2W0F C;  4UCS A;  1Z5V A;  5FPO A;  3CX5 F;  4UXN A;  5H2F Z;  5B1A B;  1RP3 B;  1HNZ O;  4J9Z B;  4K35 A;  4LFC O;  3UO3 A;  5L3E A;  1KYO F;  5IJ0 A;  3H1J H;  2JEX A;  4L8J A;  5JJN B;  2Q5Z A;  2XHB A;  1XHZ A;  2R70 A;  2WAM A;  3G80 A;  1IDS A;  1LUW A;  4DV7 B;  2FML A;  4X65 B;  2IBZ H;  3R65 A;  1JOY A;  1KKC A;  3G6B A;  3UCS C;  4LH7 A;  4X64 B;  1V55 B;  2ZXW B;  4AQY O;  4KP4 A;  3E86 A;  4DV4 B;  4JI5 B;  2HVK C;  4R50 A;  2F43 G;  4EB6 A;  1RSO B;  1E1R G;  3K0G A;  4UB6 Z;  4WFB V;  3MHS C;  4LBE C;  1JA8 A;  4JI0 O;  1FXH A;  4FPP A;  2EZP A;  3DSQ A;  2QDO A;  2LJ2 A;  2P5O A;  2WLN A;  3SYA A;  4LCU C;  2BTO A;  4NXM B;  1EN4 A;  1F4N A;  5DED A;  3A2F A;  3SYQ A;  1Q8I A;  2EIJ B;  4DV0 B;  4TUY B;  1S0V A;  2NLJ C;  2YEV B;  1H8E G;  1R3K C;  3CP1 A;  3CRM A;  4X1I A;  5BR8 O;  2UXC B;  1NU1 H;  3B40 A;  3AG3 C;  4MVO A;  5IJ9 B;  3OEE G;  2DQ0 A;  5J2T A;  1ZWI C;  5KAI Z;  3ZRW B;  3OUS A;  2CE4 A;  2QM7 A;  2UUB B;  1R3I C;  1T5E A;  1QR8 A;  5EBL C;  5LMU O;  4I9Q A;  3H01 A;  3MAQ A;  3D36 A;  2ARH A;  1V54 C;  1NH2 D;  2PI4 A;  1BT8 A;  5DEC A;  1ROP A;  1QHT A;  3BEH A;  4DK1 A;  4ZBM A;  4DR5 B;  3QVN A;  1SQQ H;  4B7K A;  3HKE B;  4OGQ B;  2A3Q A;  4PI2 A;  1XMQ O;  4DR4 B;  4I50 A;  5CBH A;  3CJH B;  1VQ8 V;  1BL8 A;  1G1X B;  1XRE A;  2RN9 A;  5A9G A;  1AP5 A;  4CS2 A;  1NZ6 A;  1BQZ A;  2IJK A;  1VF5 B;  3AG1 C;  3RYH A;  3W7U A;  3T1H B;  2XAF A;  3JAK A;  2LGW A;  4I4T A;  4DW1 A;  5JCO C;  5IJ0 B;  2JK5 C;  1FJG O;  3K3W A;  4UVB A;  3OMI B;  4X1I B;  2GBO A;  3NXS A;  5EC2 C;  1ZX3 A;  3LDE A;  2QKA A;  4FLV A;  4NB5 A;  1Z2G A;  1EZJ A;  1MZE A;  3K04 A;  4PHZ A;  1EZV H;  2OWO A;  2ATK C;  4MTX A;  2IJH A;  4MTF A;  1PM9 A;  3S3X A;  4JI7 B;  3ABL C;  3OTO B;  3GWK C;  1R6T A;  3SPI A;  3AEI A;  1JFF A;  1AR4 A;  2ZDI A;  2Y4U A;  2CGO A;  3SYP A;  1ZUQ A;  4LP8 A;  2CGN A;  1JR9 A;  4FM2 A;  2YXH A;  1OCO C;  5H5N A;  4F6R A;  1EN6 A;  2UXD O;  4GKK O;  4IL6 Z;  4UV8 A;  5CMU A;  5B1O A;  3QG5 A;  3W7W A;  4YJ2 A;  1H2S B;  2YXY A;  2R72 A;  1XMO O;  2Y0I A;  3IAY A;  2A79 B;  4DV5 O;  1IBK O;  4YIP A;  1S3J A;  3J7A U;  1B6Q A;  4I55 A;  3JAW B;  1W0K G;  3NR7 A;  1NVP B;  2IJJ A;  4UFZ A;  3SPJ A;  2PY5 A;  2UXN A;  1K73 W;  4UVC A;  4DR7 O;  3K0D A;  1VMG A;  4IHJ B;  5HFM A;  5KHK A;  2UU9 O;  3E89 A;  5EZY B;  3AK3 A;  5IJ9 A;  4G27 B;  5DN6 G;  1WPB A;  1SA0 A;  4DR6 B;  2BOB C;  1PL4 A;  2CH7 A;  1SZT A;  1SET A;  4JI4 B;  2Q7E A;  4DRX B;  2Q8V A;  1K5S A;  5LGT A;  3TGU H;  1AIL A;  4ICG A;  4KL1 A;  5JQG B;  3TET A;  4B3T O;  4QGP A;  3CRR A;  1GAX A;  1M56 C;  3CCS V;  4BIU A;  4D7S A;  1G4Y B;  4GX1 A;  2GUZ B;  1G6U A;  4FM1 A;  1SQV H;  1RM1 B;  4R7C A;  4XBF A;  2QEX V;  1Y76 A;  4CH6 A;  1NBM G;  1HWY A;  5CA0 B;  3J81 N;  3JAK B;  2X6B A;  2UUA B;  1AB3 A;  2A7W A;  3LNM B;  3E83 A;  1I94 B;  4W4K A;  2RNB A;  4IYI A;  4FLZ A;  1URF A;  5IY5 B;  3ZED A;  1AI4 A;  2ZM6 O;  5A2Q N;  2LO1 A;  3HKC B;  1MZF A;  5J2T B;  1S72 V;  1OCR B;  2DYR B;  1AJN A;  4X62 B;  4GKJ B;  4YY3 B;  1R3L C;  2QWR B;  1Y4M A;  3ZS8 C;  1W2B U;  2E5L B;  1MSD A;  4X1Y B;  5CB4 A;  1NH2 B;  2KG7 B;  3TXS A;  5GON B;  3HKD A;  2F93 B;  4KFM A;  1KKD A;  3ZN1 A;  2XAQ A;  3JAS A;  1H38 A;  3JD0 A;  3UT5 B;  1FXK C;  1F51 A;  4JAS A;  3ZMU A;  4YY3 O;  1PNK A;  2M7W A;  5BMV A;  1ZAU A;  4I7Z B;  3SYO A;  1BGY H;  1Q7Y W;  3U10 A;  1VQO V;  5KAF Z;  1YI2 V;  3ASN B;  3K5O A;  3CME V;  4DV6 O;  1CPY A;  1F23 A;  1KP2 A;  1ZL8 A;  1KC8 W;  4NKG B;  3L71 H;  4NTX A;  4LF5 B;  1IXB A;  2R9I A;  1QQC A;  3OD4 A;  3JAW A;  2RMK B;  5KUM A;  4DUY O;  5JJJ B;  3WG7 B;  3CRC A;  3SJQ C;  3TCU A;  1E1Q G;  4X66 B;  3K59 A;  1Y6X A;  4ZHQ A;  4EKW A;  3IFX A;  1NTM H;  1J5E O;  5CB4 B;  1K97 A;  2IU0 A;  2XAJ A;  4JI8 B;  4HYO A;  1K3E A;  3E35 A;  1NR7 A;  2CK3 G;  1VAR A;  3RYF B;  2PUS A;  1D5N A;  4CH5 A;  2VRZ A;  4WFG A;  4DO2 A;  1H2G A;  4LWS B;  5H6R A;  1EN5 A;  3E22 A;  5EBM C;  4MTG A;  5FLX N;  3FX7 A;  1LR1 A;  3VQY A;  1LUV A;  1FD9 A;  4LF7 B;  3RYC B;  1VEW A;  1MSW D;  1P4R A;  4DYL A;  4FLX A;  1L1F A;  2X6C A;  3BPZ A;  4MVQ A;  1BZK A;  1CXZ B;  2HEP A;  4LR3 A;  3CD6 V;  3K08 A;  3CRQ A;  1Y76 B;  4JTD B;  1QVG U;  3ML0 A;  4E2L A;  4GKK B;  1M57 C;  2EIK B;  2JS5 A;  2YS8 A;  4DUZ B;  2CAZ C;  4X88 A;  2WPD G;  1I5Y A;  3G4S V;  1TUE B;  1PV0 A;  5LXT A;  1PL0 A;  3CEI A;  1IBL B;  5L3G A;  2Q69 A;  2FKX A;  4Q20 A;  2QR4 A;  1ENV A;  2B1I A;  1TUB B;  3ZIA G;  2H3O A;  2ZE8 A;  4PA6 A;  1H2K A;  4EFE A;  3KKY A;  3RYI A;  3JD1 A;  1YTF B;  5IWA O;  4TV8 B;  5J9P C;  5EYP A;  2JGD A;  4EEQ A;  5J2U A;  3QF7 A;  2OT5 A;  4HZ3 A;  1AP6 A;  1YEW A;  2JRI A;  4DW0 A;  1IZ3 A;  3B8M A;  3OTF A;  3CCJ V;  3ZRV A;  1P84 F;  1CEZ A;  1YSC A;  2GUZ A;  2RQ6 A;  1FJG B;  3T4D A;  1E79 G;  1KD1 W;  2V4D A;  2P6J A;  1VQ9 V;  3OR6 C;  1YIJ V;  3T2M A;  3QNE A;  2JVD A;  4JAU A;  3JAM N;  5D5Q A;  1MNG A;  3T1H O;  1XNQ O;  4LF9 O;  3J80 N;  2ZNJ A;  3JD3 A;  1AJP A;  2JDI G;  4B3M B;  3SJC C;  5LMN B;  3AG4 C;  2WLL B;  5LYJ A;  5EBW C;  2ETN A;  1I94 O;  4DR4 O;  3BRC A;  4TT3 G;  3IC9 A;  1N32 O;  2CTW A;  1QR9 A;  4X66 O;  4MSW C;  3RVY A;  1PP9 H;  3CJH A;  3WU2 Z;  4EB6 B;  2M6Y A;  3D8C A;  4NTY A;  4FLT A;  1QLE B;  3JAR A;  4HAM A;  2IW5 A;  4UUJ C;  1N33 O;  4HBN A;  3WG7 C;  1B04 A;  2KG7 A;  5B1B B;  1CP9 A;  4JI3 B;  4B3T B;  2HKO A;  3C90 A;  4J41 A;  3OFN G;  4ZHQ B;  1XI1 A;  4FIP C;  2WWW A;  5KHG A;  1H2M A;  5JWP A;  3JCZ A;  3QO8 A;  4TQD A;  2GDS A;  3CXC U;  1KUQ A;  2Q73 A;  2EJR A;  5KX5 B;  2DOS A;  3B4S A;  2AXT Z;  4PJ0 Z;  3UKM A;  1GKF A;  3CHX A;  5ITZ B;  4FZ0 A;  4WBN B;  5EC1 C;  3DC6 A;  2HJF C;  2UXX A;  4JTC B;  4WFF A;  3ZRW A;  1I08 A;  4WFA V;  1VQ5 V;  4LF4 O;  1AR1 B;  1N34 B;  4MW8 A;  2BTQ A;  3PJS K;  2H8P C;  4K8Z A;  2N05 A;  1VQK V;  1I0H A;  4F4L A;  1DTO A;  1FFX B;  2WA4 A;  1N0J A;  4BW5 A;  4QPJ A;  3AG2 B;  1N0N A;  4HNA A;  5HFL A;  2Y0P A; 
#chains in the Genus database with same CATH homology
 2IJI A;  3ZCC A;  4BAY A;  1JJ2 U;  1WLE A;  3W7S A;  1K8A W;  1VQL V;  2IH3 C;  2X0L A;  3AEI A;  3SPI A;  3FB7 C;  3LDD A;  1GTO A;  5CBG A;  3CC2 V;  3T1C A;  4MT8 A;  2HR3 A;  3IGA C;  2ZDI A;  2Y69 B;  4QJF B;  1VQ6 V;  3RVZ A;  4PDR A;  3SYP A;  3CCR V;  3LSS A;  2QTO A;  4LP8 A;  1QCE A;  5LHG A;  4RQE A;  1OCC C;  1K92 A;  3MHH C;  3WFV A;  1S76 D;  3F7V C;  1FFT B;  1WPX A;  4MVZ A;  4H37 A;  1F4M A;  4QPK A;  2K1E A;  1OCO C;  2A9H A;  3E8F A;  1N8R W;  2ITC C;  4UV8 A;  1KEC A;  5CMU A;  2ITD C;  5B1O A;  1YJ9 V;  1R6N A;  1S5H C;  3W7W A;  2ZQM A;  3ZJZ A;  3ZRX A;  2X6A A;  4MS2 A;  1M9N A;  4LC1 A;  4QE9 A;  5KA6 A;  4PDM A;  3CCU V;  2A79 B;  4RAI A;  4YXW G;  1FXK B;  1VQP V;  1M57 B;  3W7T A;  5LBQ A;  1S3J A;  2P90 A;  4JGS A;  1J95 A;  1B6Q A;  1S77 D;  5DM6 V;  1W0K G;  3ZMS A;  1NVP B;  5L3C A;  5H9C A;  2EZO A;  2IJJ A;  3SPJ A;  5H6Q A;  2UXN A;  1K73 W;  4UVC A;  3K0D A;  1VQ7 V;  2LFR A;  5HFM A;  2DYS C;  3E89 A;  1JQ0 A;  4FMT A;  4G27 B;  5DN6 G;  5IY5 C;  1VQM V;  3K03 A;  1SES A;  1PKX A;  2BOB C;  2WLH A;  1UJW B;  1COW G;  3QO7 A;  3SYC A;  1QBZ A;  3HB3 B;  4DXW A;  1SET A;  1SZT A;  1G8M A;  3OGC C;  4MVR A;  4GT1 A;  2A0L A;  1K5S A;  3ZMV A;  3CCE V;  4TWK A;  5LGT A;  4FJC C;  4OXS A;  3ETD A;  5LGU A;  2DWD C;  2IU3 A;  3TET A;  4GX0 A;  2YEV A;  5IYD O;  3DGE A;  2EBO A;  3FB6 C;  3ABM C;  3GB7 C;  1SER A;  3K06 A;  4X89 A;  1OCZ C;  5GW7 A;  1YHQ V;  1M56 C;  4QE7 A;  3CCS V;  1W0J G;  3K79 A;  3AG2 C;  4N23 A;  4BIU A;  1G4Y B;  4PA7 A;  1AJQ A;  4GX1 A;  4XDL A;  2Z3Y A;  3SPH A;  1NVP D;  4CZZ A;  3X2Q B;  3ZRS A;  4R7C A;  4XBF A;  2XAS A;  1RM1 B;  2QE7 G;  1YJN V;  4JYB A;  3FB5 C;  1K4D C;  3OMA B;  4GX5 A;  3SPC A;  2QEX V;  1QVF U;  1NBM G;  1HWY A;  4P9P A;  2X6B A;  4MTO A;  5IYC O;  3LNM B;  3E83 A;  1V54 B;  4GX2 A;  3ABT A;  2JEU A;  1VQN V;  2EIK C;  5BZB A;  5IY5 B;  2EIJ C;  1KQS U;  4N21 A;  1AI4 A;  2B1G A;  2OCC B;  5L3B A;  2FTK A;  4P30 A;  3HPL C;  3LDC A;  3IC7 A;  2WSS G;  4R8C A;  3G6E V;  1AI7 A;  1RPO A;  2JJ1 G;  1OCR B;  1S72 V;  2DYR B;  1AJN A;  2ZR2 A;  2EIN C;  4X8A A;  1RPR A;  2OTL V;  1THZ A;  4CBC A;  4Z1M G;  3OAA G;  1H8H G;  2XND G;  1R3L C;  1Y4M A;  3B77 A;  3M99 B;  1PD3 A;  1W2B U;  2DYS B;  3ASO B;  4G2K A;  4GCZ A;  1NH2 B;  2XAH A;  3MD0 A;  5B3S C;  5KUK A;  1V55 C;  4MVM A;  3LSQ A;  4KFM A;  1BHB A;  1KKD A;  5CN0 A;  1VQ4 V;  2OCC C;  3ZN1 A;  2XAQ A;  1H38 A;  4ASU G;  3JD0 A;  1FXK C;  1F51 A;  2WLI B;  1M56 B;  4JAS A;  3ZMU A;  1DF4 A;  3E8H A;  4RO2 A;  1PNK A;  2M7W A;  5IDJ A;  2EIL C;  3SYO A;  2WLI A;  4ZKI A;  2Y69 C;  4U7N A;  2XAG A;  1Q7Y W;  2Q6A A;  4PA9 A;  1SRY A;  1K33 A;  3FB8 C;  1VQO V;  2X7R B;  2Q67 A;  1YI2 V;  3ASN B;  3CME V;  1KP3 A;  3OMN B;  1NQT A;  4PA3 A;  1CPY A;  2P7T C;  1Q82 W;  4P2Z A;  4PDL A;  1F23 A;  1OCR C;  1KP2 A;  1ARO P;  2V1D A;  4I9W A;  4I5S A;  1KC8 W;  5EK0 A;  5B1A C;  3P30 A;  1YJW V;  2Y48 A;  3ABK C;  4KUM A;  4WFH A;  3FYE B;  2EIM B;  3D3I A;  1EBO A;  3F7Y C;  3STL C;  2EIM C;  1P7B A;  5E1A C;  3T4Z A;  1GK9 A;  2WLK A;  3EHB B;  2R9I A;  3VBB A;  3ABL B;  2YSU B;  1NJI W;  3ASN C;  4XDK A;  5KUM A;  2C2A A;  4PDV A;  2DYR C;  2V7Q G;  4H33 A;  3WG7 B;  4U7O A;  3SJQ C;  3TCU A;  1MOF A;  2Q68 A;  1E1Q G;  2P67 A;  2QM8 A;  2W6I G;  3P32 A;  3UM7 A;  4EKW A;  1GM8 A;  3IFX A;  2ZXW C;  2Z5U A;  4JPR A;  5CA3 A;  4JTA B;  1K97 A;  2IU0 A;  3STZ C;  2XAJ A;  4HYO A;  1K3E A;  3RW0 A;  3E35 A;  1Y66 A;  2R9R B;  2ZD9 A;  3CCV V;  1NR7 A;  4TSF G;  3OEH G;  2CK3 G;  1JVM A;  2B5U A;  4PA4 A;  1NKD A;  1GM9 A;  5FL7 G;  3E8G A;  1IXM A;  4WFG A;  3AG3 B;  4DO2 A;  3ASO C;  1H2G A;  3RBZ A;  1PNM A;  5H6R A;  3KG2 A;  2DWE C;  3ZMT A;  3CC4 V;  1LNQ A;  5EBM C;  4MTG A;  4RUF A;  1EFR G;  2LP7 A;  2AHZ A;  2W0F C;  3G71 V;  3ABK B;  4UXN A;  5B1A B;  3CC7 V;  1R6K A;  1MSW D;  1P4R A;  4J9Z B;  1L1F A;  2X6C A;  1OCZ B;  1BMF G;  3FYI B;  4MVQ A;  5L3E A;  5L3F A;  3CYO A;  5B3S B;  3CD6 V;  1M1K W;  4MW3 A;  2HVJ C;  3K08 A;  4UV9 A;  4BIZ A;  2JEX A;  4JTD B;  2HLD G;  1QVG U;  3ML0 A;  3OW2 U;  4E2L A;  2OTJ V;  1M57 C;  2EIK B;  1XL6 A;  2H94 A;  4FK5 C;  2WAM A;  4WCE V;  4X88 A;  2WPD G;  4RUE A;  3K9A A;  2WLM A;  2EIN B;  1I5Y A;  4WFE A;  5L3D A;  3G4S V;  1TUE B;  4RQF A;  3I56 V;  3R65 A;  3B8N A;  1YTF D;  2PI5 A;  1JOY A;  3I55 V;  4G28 B;  4QNH B;  1MG1 A;  1PL0 A;  1V55 B;  2ZXW B;  4KP4 A;  3W7X A;  5L3G A;  1K34 A;  2Q69 A;  1R3J C;  3E2E A;  3E86 A;  4Q20 A;  4P9O A;  1ENV A;  1ORQ C;  2B1I A;  2JJ2 G;  3ZIA G;  2HVK C;  4R50 A;  4PA6 A;  2F43 G;  3JD1 A;  3LUT B;  1Q86 W;  1YTF B;  4JF3 A;  1BHA A;  1GO3 F;  1E1R G;  3OM3 B;  3K0G A;  5J9P C;  4WFB V;  1K7D A;  3MHS C;  4LBE C;  1I5X A;  1FXH A;  4FPP A;  2OT5 A;  2EZP A;  4HZ3 A;  5B1B C;  2EIL B;  3ZN0 A;  3FKS G;  3X2Q C;  2NNU A;  2BOC C;  3AG1 B;  2WLN A;  3SYA A;  4LCU C;  3B8M A;  3CCJ V;  3SPG A;  3ZRV A;  3JYC A;  1CEZ A;  1DLB A;  1YSC A;  1F4N A;  1Q81 W;  3SYQ A;  1R73 A;  2MK3 A;  2EIJ B;  1OZ0 A;  2HG5 C;  1FXV A;  1E79 G;  3T4D A;  5LHH A;  1KD1 W;  2P6J A;  1VQ9 V;  2XOK G;  1S0V A;  3OR6 C;  2NLJ C;  4L87 A;  3T2M A;  2YEV B;  1YIJ V;  3OE7 G;  1H8E G;  1R3K C;  3CP1 A;  3QNE A;  4JAU A;  3AG3 C;  4MVO A;  3OEE G;  2DQ0 A;  1YIT V;  2GSM B;  4MVS A;  3JD3 A;  1FXK A;  1AJP A;  2JDI G;  1RM1 C;  3AG4 C;  2WLL B;  5EBW C;  4XDJ A;  1GM7 A;  1ZWI C;  3A0R A;  3ETE A;  4PEL A;  3E8B A;  3ZRW B;  1M90 W;  3OUS A;  2QM7 A;  4QIW F;  4TT3 G;  3CMA V;  1R3I C;  4R6Z A;  1QR9 A;  4MSW C;  3RVY A;  1DF5 A;  2KB1 A;  3JD2 A;  1QR8 A;  5EBL C;  3ABM B;  5B1N A;  3H01 A;  4JAV A;  4MVU A;  3D36 A;  1QLE B;  2JIZ G;  3TK1 A;  2D3O W;  3F5W C;  2AHY A;  4HAM A;  1V54 C;  2IW5 A;  1NH2 D;  2ZDI C;  4UUJ C;  2PI4 A;  3CCQ V;  2WLL A;  5LGN A;  3WG7 C;  1ROP A;  3BEH A;  3CCL V;  5B1B B;  1CP9 A;  2QKS A;  1AI6 A;  3DTU B;  1FS0 G;  2HKO A;  1GMG A;  4ZBM A;  3EFF K;  4WF9 V;  2ZR3 A;  5LHI A;  3OFN G;  4FIP C;  2WWW A;  2DW4 A;  5CBH A;  3JCZ A;  1BL8 A;  3QO8 A;  3CXC U;  1K5Q A;  3CPW U;  1VQ8 V;  3OR7 C;  1MAB G;  2EJR A;  1XL4 A;  1OCC B;  2QA4 V;  1OHH G;  2WLJ A;  3UKM A;  1GKF A;  4UVA A;  2IJK A;  2W6J G;  3BY6 A;  3AG1 C;  3QO5 A;  3W7U A;  1PNL A;  5EC1 C;  2XAF A;  3OUF A;  2HJF C;  2UXX A;  4JTC B;  1AI5 A;  4WFF A;  2IH1 C;  2JK5 C;  3ZRW A;  1JX9 A;  3K3W A;  4WFA V;  4UVB A;  3ETG A;  3OMI B;  2GHY A;  1AR1 B;  1VQ5 V;  5IYB O;  3NXS A;  4MW8 A;  2HFE C;  4JYC A;  1JCH A;  1OCO B;  5EC2 C;  3PJS K;  1JPX A;  2H8P C;  3LDE A;  3CCM V;  2DQ3 A;  1QLE C;  1VQK V;  1QLN A;  1EZJ A;  1K4C C;  2LFS A;  3ZMZ A;  3JD4 A;  5C93 A;  3K04 A;  4F4L A;  1DTO A;  1K9M W;  5CBF A;  3GWO A;  2ATK C;  4QPJ A;  3AG2 B;  3VOU A;  1NR1 A;  4MTX A;  4BW5 A;  2IJH A;  3ABU A;  4MTF A;  5HFL A;  5KA5 A;  4J9Y B;  3ABL C;  3AG4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...