1QVGU

Structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1qvgU00
3CCEV 1VQ9V 2QA4V 1Q81W 1VQLV 1KC8W 1K8AW 4WF9V 1K9MW 1KQSU 1R73A 3CD6V 3CCVV 1VQ6V 1YJNV 2D3OW 1NJIW 3I55V 3CC7V 5DM6V 1M90W 3CPWU 1KD1W 3OW2U 3CMEV 1YJ9V 2OTJV 3G6EV 3G4SV 1QVFU 1N8RW 3CCJV 3CC2V 1VQ8V 1Q7YW 3CCUV 1VQ7V 4WCEV 3G71V 1Q82W 1JJ2U 1VQNV 1K73W 4WFAV 4WFBV 3CCQV 3CC4V 2QEXV 2OTLV 3CCRV 3CMAV 1YJWV 1QVGU 3CCSV 1YI2V 1YITV 1Q86W 1VQKV 3CCLV 3CCMV 1YHQV 1YIJV 1S72V 1M1KW 1VQOV 1VQ4V 1VQ5V 1W2BU 3I56V 3CXCU 1VQPV 1VQMV
chains in the Genus database with same CATH superfamily
4X65O 2A3QA 4CH3A 1F7YA 2DJVA 1V55C 2CGNA 2QWPB 4LF4O 5J2UB 2OTJV 5LP6B 2WPDG 5IWAB 2A79B 3J7AU 1QU7A 1Q90D 1S3JA 1WB7A 4UCOA 3TCUA 2IBZH 3M99B 1YVWA 4LWSA 4MTXA 5BXZA 3WFVA 3KG2A 3BEHA 1KKCA 2YIDA 4WFGA 3LUTB 4E4EA 4BW9A 2V7QG 4I7ZB 4J41A 4DW0A 4UCSA 1FJGB 1PKXA 4DR7O 1J5EB 5GONA 1A32A 3RYFA 1PP9H 4Z1MG 3TJTA 1I5YA 2YEVA 5BZBA 3HKDA 4X1KA 2WLLA 4TQFA 2UXBO 1WLEA 3F7VC 2ETNA 3AG2B 4R50A 2UU9B 3FYIB 2LQTA 3RVZA 5A2QN 4QGPA 4DRXA 1IXMA 4JI6O 1ZUQA 1HNZO 1ZAUA 3E22A 3JD0A 2IU0A 5LA6B 2PZSA 4X1KB 2RMKB 4MVZA 3K03A 4MSWC 2E74B 3CXHF 4GLXA 2OYQA 3ABKC 3DC6A 3BVOA 2JVDA 5LHGA 3MD0A 4I50A 5KAFZ 1BHBA 4NKGB 4DV0B 2F93B 1IBMB 1CXZB 4QIWF 5E1AC 2IJHA 2XNDG 4JI2O 4FLXA 1W59A 3CE2A 1Q86W 1SQFA 4X62O 4F6RA 1VQ4V 1PNMA 1OCZC 3CHXA 3Q4HB 3TETA 4WF9V 1N4CA 5LA6A 1IURA 4GX2A 3I55V 4LH7A 2BTQB 1EN6A 2M7WA 5J2TB 3H1HH 4RAIA 5L3GA 2P4KA 4DR1B 3ASOB 3IC7A 4ICGA 2F4VO 1FFXB 1JFFB 2G38A 2HKOA 1E79G 1XNRO 2Z5UA 4B3TB 4DO2A 1H2LA 1Y66A 1XBLA 3OUFA 3DXRA 4G27B 3S3WA 1NR1A 2HVJC 4IL6Z 3ML0A 2X6BA 2WAMA 5JJJB 4LP8A 2ZR2A 1JVMA 5LP6C 1SERA 1HNWO 5L3FA 3CC2V 4ZHQB 1F4MA 1Y76B 3A0HZ 1ZTEA 4FFKA 4WFBV 4AHCA 4JI3O 1S77D 2KG7A 4U3JB 1P84F 4YIPA 4X20B 2CAZC 4LF7B 2WLHA 4N21A 1N0NA 3O9OA 1XNQO 4CS3A 2Q0AA 4R8CA 2BSKA 1XHXA 3GVMA 1MZFA 2EIKB 3CCQV 5BY1A 4ZOLB 1BHAA 3WB2A 3OTOB 1IBKO 1YHQV 4DV4B 1VQMV 4EKWA 4GYCB 1WPBA 3ETDA 4J11A 1WA8A 3ZS8C 3AG3B 5BMVB 3K08A 3E83A 5FPRA 2K9PA 2PYJA 1V55B 4FZ1A 5C8YA 3CRQA 2AXTZ 5F2VO 2UUAB 3OFNG 1NTKH 2A0LA 4PA7A 3SGIA 3K5NA 1VQ6V 4UFZA 3E8HA 4NB5A 4AQYB 4RUEA 5FLXN 4A5UB 1QHTA 3T1CA 1G6UA 2X0LA 2W0FC 2XAQA 3P3NA 4RQEA 4P9OA 1QQCA 3MDSA 1KKDA 2HFEC 4I0XB 4X64B 3ZRXA 1RP3B 4XDJA 2HG5C 3CYOA 2Y69B 4PA3A 1UPGA 5CBHA 1HNXB 3SPIA 4BIZA 4NR1A 1EM1A 5JQGA 3U11A 4RUFA 4H44B 3ZRSA 4FM0A 4P30A 4BAYA 4I4TA 3IC9A 2NR5A 3ZX6A 3I56V 4NXMO 4X65B 1YZBA 3GB7C 1VQLV 3B8NA 4U3FH 4DXWA 1I5XA 1NVPB 1D5NA 1PNKA 3LDCA 3CPWU 1N33O 2E75B 3QVNA 2CTQA 3AEIA 4TV8A 4JI0B 3SPJA 2XOKG 1TGOA 4JI5B 5B3SB 3ZHVA 1ZLZA 2ZDIC 2NN4A 2QDOA 5KLVH 1SQPH 4QE7A 5HFLA 1TAEA 3P30A 4X66B 1XILA 3ABMB 5CA0B 3T2MA 2DYSB 4WBNB 2YIAA 3A0RA 1XQ8A 3CCSV 2IH3C 2N04A 1DF5A 4G28B 3VQWA 2UXBB 3CWBH 1MMMA 4H0LB 3FB7C 3ZEDA 5IYZB 1JR9A 3T1HB 3E35A 4FPPA 1I94B 4GKKO 4JI6B 1Q6UA 1KP2A 1VQ8V 3CCUV 4O4HA 1MA1A 2GBOA 2Q68A 4J7ZA 1FKAO 4IYIA 4GUNA 3UT5B 4B7KA 1BT8A 1Q81W 3UCSC 4FLZA 5EBWC 4K8ZA 4QPJA 3CS5A 3LSQA 4NTWA 4JYAO 2EJ7A 3R66A 2IH1C 1VQ7V 1Q8IA 1XREA 5JH7A 4YIOA 3ETQA 5D5QA 3QNEA 5FNVA 3SYOA 4PJ0Z 5H6QA 2RJZA 3ABTA 3OGCC 3X2QC 3ZMTA 4MVMA 3IGAC 1L8DA 1DF4A 1WNSA 1BCCH 2ZE8A 3AG4C 5J2UA 4EFEA 1FXKB 4CZZA 3QO7A 2UUBO 1HWYA 4DR1O 4GKJO 4HNAA 1TVKA 4FZ0A 4JYYA 4DK1A 1HP8A 3CRCA 1I0HA 5JQGB 3JALB 2N05A 4TUYB 3ETEA 2LGWA 2YEVB 2YSUB 3A0BZ 1WJZA 4LFBB 2RDCA 3OUSA 2E76B 4O2BB 1NS1A 2YICA 3H1IH 1M56B 3AG4B 4JI3B 5LMUB 4DR3O 4YXWG 2XAJA 2Z3YA 5KHHA 3OTFA 1YSCA 4LF7O 4J42A 3JASB 3ZMUA 4EB6A 5CN0A 1SA0A 3ZRWA 1N34O 5B5EZ 3OEHG 4UXNA 1IDSA 5LOVB 3JCUZ 5KHIA 1NU1H 2ZM6O 2ADPA 1WPXA 5B66Z 2CDYA 4B3MO 1V54B 2YXHA 2QKCA 3ABLC 1WA8B 3RT3C 2E3CA 4CC5A 1EFRG 1GTOA 3C3SA 2HEPA 1S5LZ 3FB5C 4FFBB 3OEEG 4JZ2A 1XMQB 4NXNO 1IBLB 1WP7A 4J80A 1PM9A 5DECA 1ZL8B 2Q69A 4DUYB 3RBZA 1X4TA 1F23A 2HHHO 2KB1A 4IHJA 1SQQH 4JV5O 4ZI7A 2CH7A 5DM6V 3HKBA 2DE0X 1JA8A 2QM8A 4D7TA 1K97A 4LFAB 3BFRA 2Y4TA 3P32A 3CJHB 4JTCB 4ZI7B 4IGGA 3IAYA 4CH4A 3ZMVA 2FTKA 2ZT9B 2Y0IA 2EIJB 1AI4A 3JCZA 5CMUA 3OE7G 1FD9A 4JAAA 2ZNJA 4YHHB 4I4TB 3JD1A 2JRIA 2P4VA 1EN4A 4DW1A 4AI8A 1K3EA 3E89A 4DV6B 3DXRB 1MNGA 5JVDA 2HR3A 4U7NA 1VF6C 2B1IA 2CE4A 3FB6C 4G2KA 3RYIB 4LF8O 1FFXA 4LNUA 2R70A 2PYLA 1YCIA 2B9ZA 2M6YA 3ZHRA 1QVFU 3UO3A 2A06H 2PF4E 4XDKA 5KX5B 2EZOA 1XDCA 4CBCA 3G4SV 1SA0B 3ZRWB 3K3WA 3LDEA 4JI0O 1FXKC 2HJFC 1GRJA 3FYEB 3HKBB 1QLEB 1S0VA 3CRMA 4FLWA 1VARA 1DTOA 2FMLA 1H8EG 1R3KC 1V9PA 1K9MW 1YJNV 3T1YO 3JAWA 3HKCB 3JATB 1XL6A 2UUCB 4R7CA 2FYUH 1L1FA 3SPGA 1BL8A 3KCXA 4JI4B 2YUAA 3WB0A 2Q7GA 2IW5A 1KUQA 3JALA 3T4DA 1LNQA 2RQ6A 5JCOA 4X1YB 3C3TA 1QLEC 2ZIOA 3ASOC 4XDLA 4PDRA 2ADQB 1XNQB 1NTMH 2CK3G 3EHBB 1K4DC 1Q5OA 3FX7A 1IVSA 3QTCA 5H9CA 2HVKC 4GX1A 1NTZH 2UXCB 1KYOF 2FL4A 5JJEB 2FKXA 4CS4A 4DV5B 3OGIB 1SZTA 4MT8A 2AW9A 4DUZB 2QM7A 5LBQA 3RYFB 2ILMA 3EVKA 1PL0A 1JPXA 5LMNB 4N23A 2Q8VA 2ZE5A 5H2FZ 5BR8O 1M9NA 2B1GA 2HJDA 3KKYA 1EZVH 2JGDA 4I9QA 4ASUG 3EXAA 1K4CC 4JI1B 2Y4UA 2QWQB 1SZXA 2W6IG 4QNHB 5LP6A 3L73H 2ZXWB 1KU9A 2Q5ZA 5L3EA 4DV2O 2DN9A 3H9VA 4MVSA 1HR0B 4K0KB 4BW5A 3OT7A 2V4DA 3RN4A 5K1PA 1JJOA 2KSDA 4X1IA 3K57A 3AG7A 3NR7A 4KHPB 2A9HA 1AR1B 5B1OA 3B09A 3QO8A 2X7RB 4DR4O 2BOBC 2EILB 3ZHQA 1ROPA 2GSMB 4UB6Z 3UO2A 1EBOA 4JZGA 3K9SA 3AG1C 2CTWA 4H37A 3ZHSA 4UCUA 3TXQA 4L8JA 2HLDG 2OCCB 1K73W 1JCHA 4DR3B 4FLTA 1VF5B 4EEQA 5K1XA 3BHPA 4OX9O 1M1KW 3K04A 1VQOV 1VQ5V 2P22C 4FM2A 3RYHA 1K8AW 1Z5WA 5CB4A 1Y74B 3QG5A 1N33B 2DMXA 2E5LB 4JTDB 3SJAC 2NNUA 4DR5O 1IXBA 1RSOB 5IJ9B 5KMGA 4K35A 2QWRB 1K5SA 4X8AA 2ZR3A 3L74H 1SS3A 4J7KA 2W6JG 1HW7A 1SF9A 3W7WA 4YJ3A 3O65A 4MTGA 2PTMA 4X66O 2CTRA 2LO1A 2IU3A 4LF5O 2LJ2A 4NXNB 1WB8A 3LNNA 3AK2A 4B08A 2B5UA 5TISZ 2XTAA 2YS8A 4EFBA 4DUYO 3W7UA 2WLKA 3UQ8A 1NR7A 4UUJC 1G1XB 3N27A 4CH6A 4L87A 5EBMC 1YTFB 2ZD9A 3U0ZA 3CMEV 2MK3A 3RW0A 2XHBA 1N36B 1TUBB 2XAFA 1QBZA 1AJNA 4LF4B 3N2KB 2QSAA 1ENVA 1Q6IA 1ZL8A 2YDEA 1YIJV 1F4NA 4LNUB 2EULA 1W2BU 1AP5A 4OXSA 1KC8W 1Y67A 4DV6O 4MVRA 5KUKA 4RWUA 1NKDA 3K5MA 1SETA 4U7OA 4JI8B 2EIMB 4Q20A 1H2GA 4NYKA 2OCHA 4TT3G 2ZXWC 4DR7B 1P49A 1VMGA 2LW7A 4HBNA 1QR8A 4LCUC 3W7XA 1NH2D 3Q4HA 1F51A 2BSKB 4JYBA 5H5NA 4GKJB 1M4UA 4LR3A 3MHSC 2GHYA 3G80A 4BWAA 1N0JA 1VQNV 3VOUA 2BOCC 2P06A 5EZYA 3BRCA 4X20A 4XBFA 2JJ1G 2QR4A 3TXSA 5C93A 2Q67A 4O2BA 1BMFG 1YXBA 4O4LB 4MW3A 2DYSC 4TV9A 4LFBO 4PD4F 2ZE7A 4B3RO 3ABMC 1AR5A 2C2AA 4PELA 4HYOA 1Q43A 5L3DA 5LMUO 4JI4O 2N74A 2CTPA 3E86A 2UU9O 4PDMA 5B1AB 2UXDO 4DYLA 1P7BA 1MOFA 4HNAB 4F4LA 4H13B 1VP7A 1H38A 1TA8A 1OCOC 3ZN0A 1RM1C 2IJJA 3HKDB 3HR0A 4B3SO 2VQEO 3CRRA 2OIEA 4O4IB 1URFA 3JASA 4D6TH 1H2MA 3WG7B 4YY3B 1M57C 2EINC 2PUSA 2KKWA 5FNVB 1IBMO 2XUMA 4DV1B 4HZ3A 2RCVA 1S72V 1AP6A 5JH7B 4JI2B 2CH7B 2P6JA 4PDVA 5KUMA 4CC6A 1YJ9V 1QR9A 1OCRB 1XOUA 1CPYA 3VQYA 1AJPA 3S3XA 3OM3B 4PI2A 3FKSG 1R1BA 3VBBA 4DK0A 4O4IA 1GAXA 2Q73A 3JYCA 1V54C 3SYAA 1OJHA 4QJFB 4MTOA 1NH2B 2JJ2G 5CBFA 3CXCU 4W4KA 3SYQA 1XL4A 2JS5A 2LP7A 2F4VB 1T5EA 4NTYA 2ITDC 2QKAA 1GK9A 1NZ6A 1XUQA 4FM1A 1MABG 4PA6A 2V1DA 4FMTA 3M8AA 4WFHA 2BTQA 2A7WA 5FL7G 3B8MA 4JPRA 3EFFK 2KQXA 2LFSA 1HNWB 4O4LA 4TV9B 5EYPB 3WU2Z 5LHHA 2Q7HA 3E8GA 3APQA 3STZC 1GM9A 5CA1A 2YI8A 1M90W 2AZ0A 4LH6A 4MW8A 3AG3C 2F66C 1HDJA 4JF3A 3ABUA 2QGNA 5EZYB 1Q7YW 5ITZA 1S5JA 4X89A 4CS2A 1AI5A 1FJGO 4RQFA 3H01A 3UM7A 2EBOA 5IYCO 2UUAO 1BQ0A 1R73A 4TV8B 3ZN1A 1FXHA 3OMNB 2E5LO 4LFCO 2WSSG 1JQ0A 4TUYA 4H33A 5LL6Y 2ARHA 5IYZA 5KHGA 1FAFA 1DGSA 1GM8A 4UV9A 2P67A 3MHHC 1GN4A 4O4JA 1COWG 3THOA 4B7EA 1J5EO 4Z1VA 3RWRD 3H1LH 3HPLC 2R9RB 3G6EV 2LW1A 3ZBHA 3B77A 1RM1B 1R6KA 2PGGA 1Q82W 1KBHA 5B1BC 4UB8Z 3CSXA 3OR7C 1HNXO 3SJCC 1VQPV 4Z2WA 3A8TA 4LWSB 1B3QA 5LYJB 1VIBA 4PV1B 3D36A 4F6EA 1CP9A 1N36O 1GN6A 4JGSA 2Q6AA 3P3PA 4C7UA 1EN5A 4OPAA 1YDXA 2YXYA 2H94A 1K5QA 4KUMA 1UJWB 4UV8A 2VRZA 4DV3O 4CH5A 2OWOA 2Y0PA 5GW7A 1TUEB 4P9PA 2Y48A 3G6BA 1U97A 1XNRB 3OW2U 3JSNA 1SQVH 5EK0A 3JARB 2GTSA 2GTAA 5J9PC 1SQBH 4UVCA 4JAVA 1OCOB 1RSOA 3CRAA 1Y4MA 2YIBA 1MSWD 3W7TA 4MVUA 4JI1O 4ZKIA 3PN1A 4PA9A 4Q6GA 2CGOA 1GN2A 4J9ZB 5JCOC 1AB3A 1WN7A 1M56C 1HR0O 4JASA 1X59A 5IE9A 4JI5O 1GN3A 1B6QA 1UFIA 3SYCA 1K92A 3SJQC 4JI7B 4O2AB 1FXVA 3AG2C 4GKKB 1K34A 2AHYA 2BCCH 4UVAA 3BABA 2YXLA 1Y76A 3FAVA 4ZHQA 3ZMSA 2JDIG 2PI5A 2OCCC 5C8YB 3E8FA 4MTFA 3ETGA 2D3OW 1MG1A 4B3RB 2BTOA 5EIBC 1IBKB 2JS3A 4DV4O 1BZKA 4E2LA 5L3CA 4NVPA 3STLC 4YJ3B 3CB2A 5B1NA 1LR1A 3CC4V 3ABLB 5IYBO 2R9IA 1AJQA 2R72A 2WA3A 1GO3F 3K59A 1M5IA 1FXKA 2Q4PA 1QLNA 3CCVV 4UCRA 1D5AA 1NBMG 3FAVB 2QKSA 3NXSA 3B40A 3WB1A 2VQEB 2AZ2A 3DC5A 3CJHA 1SESA 1Q3EA 2VWJA 3L75H 2UUBB 4KFMA 4DV1O 2QTSA 1AILA 4ZBMA 1VQKV 2KG7B 4JYAB 5B3SC 5H6RA 3LSUA 3K9AA 2AHZA 2F23A 5IJ0B 1AR4A 3K5LA 2ITCC 3DSQA 2LGQA 1R3IC 4X64O 4TQDA 4QE9A 4LF5B 5CBGA 4X9QA 1SQGA 4FFBA 2QJ1A 4IIJA 4YJ2B 4O4JB 2W0XA 4O4HB 4AQYO 2D2CB 4LC1A 3QF7A 3ZIAG 3LDDA 1OV9A 5IJ9A 2X6CA 1XMOB 4X1IB 5D5PA 3AK3A 2GUZB 1Y74A 2QEXV 2EILC 1LUWA 3IFXA 1NQTA 4I5SA 3JD2A 2ATKC 1KECA 1PL4A 3CD6V 4GX0A 5GONB 4QPKA 5ITZB 3WG7C 2ZM6B 1FYJA 3LSSA 1E1QG 3K5OA 4BIOA 4JAUA 1FPOA 2EX3A 3A2FA 3JD4A 1AI6A 4KL1A 2YI9A 2ZNIA 1YITV 4BIUA 5KX5A 3F7YC 4I55B 2R9AA 3ZCCA 3D3IA 3RGBA 1RFYA 3K06A 1L0NH 4DR6B 2ZINA 1BS3A 4LFCB 3AG1B 1GH6A 1OCCB 2OIGA 1N32O 5EC2C 1YF2A 3SYPA 5JWPA 1H8HG 3T1HO 2VQFO 4IYHA 1YJWV 1THZA 5J2TA 3SR2C 5HFMA 1DK1A 2XAGA 1XMQO 4I55A 2AGAA 4DR2B 3BCCH 2ZQMA 2JIZG 1N8RW 2Z0AA 3F5TA 3UKMA 2ZCEA 4YHHO 3ICXA 2BE3A 3JAWB 1ZX3A 4HAMA 3RFRA 4WFAV 1I7FA 3ASNB 2XASA 3HB3B 5KA5A 4LF6O 5B1AC 1YEWA 1I94O 2PY5A 1H2KA 3ASNC 2QTOA 1S76D 2IJIA 1I08A 2ZIMA 2WLIB 5KAIZ 2DQ0A 2JK5C 5IY5C 5EC1C 2QWOB 1P7GA 1AROP 2H3OA 1JJ2U 1B06A 2WA4A 5LGNA 1GM7A 3J81N 3CEIA 4X88A 5CA3A 4DV3B 2QWNB 3CX5F 4DRXB 5DEDA 2P5OA 3APOA 3E2EA 1VF6A 1NJIW 4LF9O 4FLUA 1D2DA 4IIJB 4YJ2A 1OCRC 3PJSK 1JOYA 3T1YB 5CA0A 3HKCA 3B2EE 1M93A 1K7DA 3JATA 1W0KG 2DWDC 5FPOA 3CMAV 1OCZB 2UXNA 2WWWA 4PDLA 3CCLV 3CCMV 1IX9A 1R6NA 3CCEV 1M57B 2WLIA 1TUBA 2CUGA 2EIMC 1PD3A 1H2NA 1WAZA 5E79Z 1BGYH 4JTAB 3SDLA 2MW2B 1ZWIC 4PI0A 4FVMA 1HNZB 5A9GA 1PNLA 2O57A 3JSLA 4FIPC 1NVPD 3K58A 2UUCO 3L9DA 3W7SA 1BSMA 1VQ9V 2H8PC 3FD9A 4AILC 3C90A 2GV9A 1RPOA 2Q9LA 4GZRB 4UCTA 4J9YB 1LUVA 1U96A 4UCVA 3ZJZA 5JVDB 1RPRA 1JFFA 2K1EA 2ZDIA 1XEQA 1QVGU 1N34B 3D8CA 3B4SA 5GTIZ 3R65A 1O9HA 1NI8A 2UXCO 3HKEA 4I9WA 3KCYA 3CC7V 4MS2A 4WFEA 3OMAB 3SPCA 4DUZO 4B3MB 5CB4B 1AVMA 4WCEV 4JV5B 3H1KH 4EB6B 1K33A 3ABKB 4K8XA 3ZRVA 2OT5A 5LMNO 3VQXA 2DYRB 5BR8B 5L3BA 4LFAO 4B3TO 4TSFG 3N2GA 4TWKA 4KHPO 1IBLO 2RN9A 3RVYA 5EYPA 1KB9F 2DQ3A 1PPJH 4LBEC 4TOIA 3RYCA 2HHHB 3BA9A 4DV7B 2WLMA 2GUZA 4K0KO 2Q0OC 2DYRC 3JD3A 1NT2B 3ZHUA 2F95B 4BR6A 4LF8B 4OPHA 1WP8A 3BAAA 3M7MX 3KZIZ 2WLLB 3TK1A 5GTHZ 5IWAO 4MVQA 3K0DA 2NLJC 3OMIB 5LGTA 4PA4A 1ORQC 4WFFA 3DGEA 3OTOO 1FFTB 3D36C 5EIBD 3J80N 4R6ZA 2PI4A 3E8BA 2IJKA 1FS0G 1JX9A 2P7TC 2UXXA 1SRYA 1Z5VA 2ZKOA 3QO5A 2QE7G 2RNBA 3SPHA 4P2ZA 2FB5A 1R3JC 3GWOA 2P90A 4DR5B 3OR6C 1Z2GA 4K3AA 1J95A 4JI7O 5AG2A 5DN6G 4FJCC 2VWKA 5KMGB 2VQFB 2ZE6A 2JEXA 3GWKC 4GCZA 3T4ZA 1XHZA 4KXRA 2IM9A 2XT9A 2QA4V 4KP4A 4NTXA 4F6RB 4PHZA 3OD4A 5EBLC 3RYHB 2JGDB 4DV0O 4DR2O 1QNMA 3VQVA 2YIBD 4RO2A 1O9GA 1SQXH 1KMIZ 2OTLV 3SJBC 3X2QB 5LXTA 5CA1B 1S5HC 4JI8O 3G67A 4OGQB 5B1BB 4X62B 1SC5B 3UT5A 1KQSU 2YC0A 4FLYA 1SKVA 4DV5O 5IY5B 4MVOA 2L35A 3TGUH 4UVBA 4DV2B 1AI7A 1R3LC 4ABMA 1EZJA 3JARA 2GDSA 1VEWA 3BA8A 3JAMN 3ZHTA 4ZIBA 1MZEA 1DLBA 3BY6A 5IDJA 1YTFD 3RYCB 4GX5A 4LF9B 1GMGA 4DR4B 4WBNA 3L72H 1H2SB 5KHJA 4J10A 1G8MA 3I5DA 3N2GB 3N2KA 4GT1A 5IJ0A 2EJRA 3LNMB 1Y6XA 2XAHA 3FB8C 5LHIA 1L0LH 3CCRV 1YI2V 4W4LA 4JYCA 1G4YB 3AK1A 4I0XA 1PV0A 2LFRA 3DTUB 5KA6A 4IT5A 4O2AA 1ZSPA 1VF7A 2JGUA 1OCCC 1XMOO 2VS0A 2ODMA 1OZ0A 2L6LA 4U3JA 4IHJB 3HKEB 2HP8A 3IJ4A 5IYDO 3D3QA 3U10A 3F5WC 4B3SB 4D7SA 2EIJC 1IZ3A 2DW4A 1JMKC 2EINB 2F43G 4YY3O 1OHHG 4X1YA 4J7JA 5BMVA 5JJNB 1KD1W 3L70H 4OX9B 2UXDB 2DOSA 5KHKA 2JEUA 3G71V 3CP1A 2EZPA 3MAQA 3H1JH 2QM4A 1BE3H 1US6A 1B04A 4ZOLA 1Q6HA 3JAKB 2WLNA 5LOVA 3ZMZA 1XI1A 4DR6O 2X6AA 2WLJA 4FK5C 2Y69C 4FLVA 1W0JG 1BQZA 3OAAG 3K0GA 1N32B 3CCJV 1R6TA 1KP3A 3BPZA 5LXTB 5LYJA 5LGUA 1QCEA 3K79A 2DWEC 5IT9N 3L71H 4I50B 1E1RG 3JAKA 2EIKC 2Q7EA 1P4RA 2F1MA 3RYIA 1MSDA 3E22B 4DV7O 1GKFA 3FFQA 4LF6B 1CEZA 1TVKB 4NXMB
chains in the Genus database with same CATH topology
2QTOA 4F4LA 1S76D 2IJIA 1H38A 3ZMUA 2WLIB 1OCOC 1V55C 5CN0A 3ZN0A 2DQ0A 2JK5C 1RM1C 2IJJA 3ZRWA 2OTJV 5IY5C 3OEHG 4UXNA 2WPDG 2A79B 5EC1C 1AROP 1JJ2U 1S3JA 3WG7B 3TCUA 5LGNA 1GM7A 3M99B 1M57C 2EINC 4MTXA 1WPXA 4X88A 5CA3A 3WFVA 1V54B 4HZ3A 1S72V 3KG2A 3BEHA 4WFGA 3LUTB 3ABLC 3E2EA 2V7QG 1EFRG 1NJIW 1GTOA 2P6JA 4PDVA 5KUMA 1YJ9V 1OCRC 3PJSK 1PKXA 1QR9A 1OCRB 3FB5C 1JOYA 3OEEG 1CPYA 1AJPA 4Z1MG 3OM3B 3VBBA 3FKSG 1K7DA 1I5YA 1W0KG 2DWDC 2Q69A 2YEVA 3JYCA 3CMAV 1OCZB 2UXNA 1V54C 2WWWA 3SYAA 5BZBA 4PDLA 4QJFB 3CCLV 4MTOA 3RBZA 2JJ2G 5CBFA 3CCMV 1NH2B 1F23A 2WLLA 1R6NA 3CXCU 1WLEA 3F7VC 3CCEV 3SYQA 1XL4A 1M57B 2WLIA 2KB1A 3AG2B 2LP7A 4R50A 2EIMC 1PD3A 3FYIB 2ITDC 1GK9A 5DM6V 3RVZA 4JTAB 1ZWIC 1IXMA 1MABG 2QM8A 4PA6A 2V1DA 1K97A 4FMTA 4JTCB 3P32A 4WFHA 3JD0A 2FTKA 5FL7G 2IU0A 1PNLA 3ZMVA 3B8MA 4JPRA 3EFFK 2EIJB 4FIPC 1NVPD 2LFSA 1AI4A 3JCZA 4MVZA 3K03A 4MSWC 3W7SA 5CMUA 1VQ9V 2H8PC 3ABKC 3OE7G 5LHHA 5LHGA 3MD0A 1RPOA 3E8GA 3JD1A 3STZC 1BHBA 1GM9A 3E89A 1K3EA 1M90W 4J9YB 4QIWF 4MW8A 3AG3C 5E1AC 4JF3A 2IJHA 2XNDG 3ABUA 2HR3A 4U7NA 1Q7YW 2B1IA 3ZJZA 3FB6C 1RPRA 4X89A 4G2KA 2K1EA 2ZDIA 1AI5A 1QVGU 4RQFA 3H01A 3UM7A 2EBOA 1Q86W 1VQ4V 1PNMA 1QVFU 1OCZC 5IYCO 3R65A 3TETA 4WF9V 1R73A 4GX2A 4I9WA 3ZN1A 3I55V 3CC7V 1FXHA 4MS2A 4WFEA 4XDKA 3OMAB 2EZOA 3SPCA 3OMNB 2WSSG 4CBCA 3G4SV 2M7WA 1JQ0A 3ZRWB 3K3WA 3LDEA 4RAIA 5L3GA 4H33A 1FXKC 2HJFC 3ASOB 3IC7A 4WCEV 3FYEB 1K33A 1QLEB 3ABKB 1S0VA 4UV9A 1GM8A 3ZRVA 2OT5A 2HKOA 1DTOA 1E79G 2P67A 3MHHC 1H8EG 2DYRB 1R3KC 1COWG 2Z5UA 5L3BA 4DO2A 1Y66A 3OUFA 1K9MW 4TSFG 4TWKA 4G27B 1YJNV 1NR1A 2HVJC 3ML0A 3RVYA 2X6BA 1XL6A 2WAMA 2DQ3A 3HPLC 4LP8A 2R9RB 2ZR2A 1JVMA 1SERA 4R7CA 3G6EV 1L1FA 5L3FA 3CC2V 4LBEC 3B77A 1RM1B 1R6KA 3SPGA 1BL8A 1F4MA 1Q82W 2WLMA 4WFBV 1S77D 5B1BC 3OR7C 2DYRC 2IW5A 3JD3A 3T4DA 1VQPV 2WLHA 1LNQA 1QLEC 3ASOC 4N21A 4PDRA 4XDLA 3D36A 2CK3G 3EHBB 1K4DC 1CP9A 4R8CA 2WLLB 5H9CA 3TK1A 2HVKC 4GX1A 4MVQA 4JGSA 3K0DA 2EIKB 2NLJC 3OMIB 2Q6AA 5LGTA 3CCQV 2H94A 1K5QA 4KUMA 4PA4A 1ORQC 4WFFA 1SZTA 4MT8A 1UJWB 1BHAA 4UV8A 2QM7A 5LBQA 3DGEA 1YHQV 1FFTB 5GW7A 1TUEB 4P9PA 1VQMV 4EKWA 2Y48A 1PL0A 4R6ZA 2PI4A 1JPXA 3E8BA 2IJKA 3ETDA 4N23A 1FS0G 1JX9A 2P7TC 3AG3B 3OW2U 1M9NA 5EK0A 5J9PC 2B1GA 3K08A 3E83A 2UXXA 1SRYA 4UVCA 4JAVA 1OCOB 1V55B 4ASUG 1K4CC 1Y4MA 1MSWD 3W7TA 4MVUA 3QO5A 4ZKIA 2QE7G 4PA9A 3SPHA 2W6IG 4QNHB 3OFNG 4P2ZA 2A0LA 2ZXWB 4J9ZB 4PA7A 1R3JC 3GWOA 5L3EA 2P90A 1M56C 1VQ6V 4MVSA 4JASA 4BW5A 3E8HA 1B6QA 4RUEA 3OR6C 1J95A 3T1CA 3SYCA 1K92A 2X0LA 2W0FC 2XAQA 3SJQC 5DN6G 4FJCC 4RQEA 4P9OA 1FXVA 2A9HA 3AG2C 2JEXA 1AR1B 5B1OA 4GCZA 1KKDA 1K34A 2HFEC 2AHYA 3QO8A 3T4ZA 2X7RB 4UVAA 2BOBC 2EILB 3ZRXA 1ROPA 2QA4V 3ZMSA 4XDJA 2GSMB 2JDIG 4KP4A 2PI5A 2OCCC 3E8FA 4MTFA 3ETGA 2D3OW 1EBOA 1MG1A 5EBLC 3AG1C 4H37A 2HG5C 3CYOA 4RO2A 2Y69B 4PA3A 5CBHA 4E2LA 5L3CA 3STLC 2HLDG 2OCCB 3SPIA 4BIZA 1K73W 1JCHA 5B1NA 3CC4V 4RUFA 3ABLB 2OTLV 5IYBO 3X2QB 2R9IA 1AJQA 3ZRSA 1S5HC 1M1KW 4P30A 3K04A 5B1BB 4BAYA 1VQOV 1GO3F 1VQ5V 3I56V 1VQLV 3GB7C 1K8AW 1KQSU 3B8NA 1FXKA 1QLNA 3CCVV 4DXWA 1NBMG 1I5XA 1NVPB 1PNKA 2QKSA 3LDCA 3NXSA 3CPWU 5IY5B 4JTDB 3AEIA 4MVOA 1SESA 2NNUA 3SPJA 4UVBA 1AI7A 2XOKG 1K5SA 1R3LC 4KFMA 5B3SB 4X8AA 1EZJA 2ZR3A 4ZBMA 1VQKV 2ZDIC 5B3SC 5H6RA 2W6JG 3K9AA 1DLBA 3BY6A 2AHZA 5IDJA 3W7WA 1YTFD 4GX5A 4QE7A 2ITCC 5HFLA 4MTGA 1GMGA 1R3IC 3P30A 4QE9A 3ABMB 2IU3A 3T2MA 2DYSB 5CBGA 1G8MA 2B5UA 4GT1A 3A0RA 2EJRA 3LNMB 2XAHA 5LHIA 3FB8C 3CCRV 3CCSV 2IH3C 1YI2V 4JYCA 1G4YB 1DF5A 4G28B 3W7UA 2WLKA 2LFRA 3DTUB 1NR7A 4UUJC 4LC1A 5KA6A 3ZIAG 3FB7C 3LDDA 4L87A 5EBMC 1OCCC 2X6CA 1YTFB 2ZD9A 3E35A 4FPPA 3CMEV 1OZ0A 2MK3A 1KP2A 3RW0A 1VQ8V 3CCUV 2XAFA 1QBZA 2Q68A 5IYDO 2QEXV 1AJNA 3F5WC 2EILC 1ENVA 2EIJC 3IFXA 2DW4A 1NQTA 4I5SA 1YIJV 1F4NA 3JD2A 1W2BU 2ATKC 1KECA 2EINB 1Q81W 2F43G 4OXSA 1KC8W 3CD6V 4GX0A 4QPKA 5EBWC 3WG7C 3LSSA 1OHHG 1E1QG 4MVRA 4QPJA 3LSQA 1KD1W 5KUKA 1NKDA 4JAUA 1SETA 4U7OA 2EIMB 2IH1C 2JEUA 1H2GA 3JD4A 4Q20A 1VQ7V 1AI6A 3G71V 3CP1A 2EZPA 4TT3G 2ZXWC 3QNEA 3SYOA 1YITV 5H6QA 4BIUA 3ABTA 3OGCC 3F7YC 3X2QC 4MVMA 3IGAC 3ZMTA 1QR8A 2WLNA 1DF4A 3ZCCA 3D3IA 3ZMZA 4LCUC 3W7XA 3K06A 2X6AA 3AG4C 1NH2D 2WLJA 4FK5C 2Y69C 1W0JG 1FXKB 4CZZA 1F51A 3OAAG 3K0GA 3QO7A 4JYBA 3AG1B 1HWYA 1OCCB 3CCJV 1KP3A 3MHSC 2GHYA 1VQNV 5EC2C 3VOUA 2BOCC 5LGUA 3SYPA 1H8HG 1QCEA 3K79A 1YJWV 1THZA 4XBFA 5HFMA 2JJ1G 3ETEA 2DWEC 2YEVB 5C93A 2Q67A 2XAGA 1E1RG 2YSUB 1BMFG 2EIKC 4MW3A 2DYSC 3ABMC 1P4RA 2ZQMA 2JIZG 3OUSA 1N8RW 2C2AA 4PELA 4HYOA 3UKMA 1M56B 5L3DA 3AG4B 4HAMA 1GKFA 4WFAV 3E86A 4YXWG 2XAJA 3ASNB 2XASA 3HB3B 5KA5A 1CEZA 2Z3YA 4PDMA 5B1AB 5B1AC 1YSCA 1P7BA 3ASNC 1MOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCE V;  1VQ9 V;  2QA4 V;  1Q81 W;  1VQL V;  1KC8 W;  1K8A W;  4WF9 V;  1K9M W;  1KQS U;  1R73 A;  3CD6 V;  3CCV V;  1VQ6 V;  1YJN V;  2D3O W;  1NJI W;  3I55 V;  3CC7 V;  5DM6 V;  1M90 W;  3CPW U;  1KD1 W;  3OW2 U;  3CME V;  1YJ9 V;  2OTJ V;  3G6E V;  3G4S V;  1QVF U;  1N8R W;  3CCJ V;  3CC2 V;  1VQ8 V;  1Q7Y W;  3CCU V;  1VQ7 V;  4WCE V;  3G71 V;  1Q82 W;  1JJ2 U;  1VQN V;  1K73 W;  4WFA V;  4WFB V;  3CCQ V;  3CC4 V;  2QEX V;  2OTL V;  3CCR V;  3CMA V;  1YJW V;  1QVG U;  3CCS V;  1YI2 V;  1YIT V;  1Q86 W;  1VQK V;  3CCL V;  3CCM V;  1YHQ V;  1YIJ V;  1S72 V;  1M1K W;  1VQO V;  1VQ4 V;  1VQ5 V;  1W2B U;  3I56 V;  3CXC U;  1VQP V;  1VQM V; 
#chains in the Genus database with same CATH topology
 4X65 O;  2A3Q A;  4CH3 A;  1F7Y A;  2DJV A;  1V55 C;  2CGN A;  2QWP B;  4LF4 O;  5J2U B;  2OTJ V;  5LP6 B;  2WPD G;  5IWA B;  2A79 B;  3J7A U;  1QU7 A;  1Q90 D;  1S3J A;  1WB7 A;  4UCO A;  3TCU A;  2IBZ H;  3M99 B;  1YVW A;  4LWS A;  4MTX A;  5BXZ A;  3WFV A;  3KG2 A;  3BEH A;  1KKC A;  2YID A;  4WFG A;  3LUT B;  4E4E A;  4BW9 A;  2V7Q G;  4I7Z B;  4J41 A;  4DW0 A;  4UCS A;  1FJG B;  1PKX A;  4DR7 O;  1J5E B;  5GON A;  1A32 A;  3RYF A;  1PP9 H;  4Z1M G;  3TJT A;  1I5Y A;  2YEV A;  5BZB A;  3HKD A;  4X1K A;  2WLL A;  4TQF A;  2UXB O;  1WLE A;  3F7V C;  2ETN A;  3AG2 B;  4R50 A;  2UU9 B;  3FYI B;  2LQT A;  3RVZ A;  5A2Q N;  4QGP A;  4DRX A;  1IXM A;  4JI6 O;  1ZUQ A;  1HNZ O;  1ZAU A;  3E22 A;  3JD0 A;  2IU0 A;  5LA6 B;  2PZS A;  4X1K B;  2RMK B;  4MVZ A;  3K03 A;  4MSW C;  2E74 B;  3CXH F;  4GLX A;  2OYQ A;  3ABK C;  3DC6 A;  3BVO A;  2JVD A;  5LHG A;  3MD0 A;  4I50 A;  5KAF Z;  1BHB A;  4NKG B;  4DV0 B;  2F93 B;  1IBM B;  1CXZ B;  4QIW F;  5E1A C;  2IJH A;  2XND G;  4JI2 O;  4FLX A;  1W59 A;  3CE2 A;  1Q86 W;  1SQF A;  4X62 O;  4F6R A;  1VQ4 V;  1PNM A;  1OCZ C;  3CHX A;  3Q4H B;  3TET A;  4WF9 V;  1N4C A;  5LA6 A;  1IUR A;  4GX2 A;  3I55 V;  4LH7 A;  2BTQ B;  1EN6 A;  2M7W A;  5J2T B;  3H1H H;  4RAI A;  5L3G A;  2P4K A;  4DR1 B;  3ASO B;  3IC7 A;  4ICG A;  2F4V O;  1FFX B;  1JFF B;  2G38 A;  2HKO A;  1E79 G;  1XNR O;  2Z5U A;  4B3T B;  4DO2 A;  1H2L A;  1Y66 A;  1XBL A;  3OUF A;  3DXR A;  4G27 B;  3S3W A;  1NR1 A;  2HVJ C;  4IL6 Z;  3ML0 A;  2X6B A;  2WAM A;  5JJJ B;  4LP8 A;  2ZR2 A;  1JVM A;  5LP6 C;  1SER A;  1HNW O;  5L3F A;  3CC2 V;  4ZHQ B;  1F4M A;  1Y76 B;  3A0H Z;  1ZTE A;  4FFK A;  4WFB V;  4AHC A;  4JI3 O;  1S77 D;  2KG7 A;  4U3J B;  1P84 F;  4YIP A;  4X20 B;  2CAZ C;  4LF7 B;  2WLH A;  4N21 A;  1N0N A;  3O9O A;  1XNQ O;  4CS3 A;  2Q0A A;  4R8C A;  2BSK A;  1XHX A;  3GVM A;  1MZF A;  2EIK B;  3CCQ V;  5BY1 A;  4ZOL B;  1BHA A;  3WB2 A;  3OTO B;  1IBK O;  1YHQ V;  4DV4 B;  1VQM V;  4EKW A;  4GYC B;  1WPB A;  3ETD A;  4J11 A;  1WA8 A;  3ZS8 C;  3AG3 B;  5BMV B;  3K08 A;  3E83 A;  5FPR A;  2K9P A;  2PYJ A;  1V55 B;  4FZ1 A;  5C8Y A;  3CRQ A;  2AXT Z;  5F2V O;  2UUA B;  3OFN G;  1NTK H;  2A0L A;  4PA7 A;  3SGI A;  3K5N A;  1VQ6 V;  4UFZ A;  3E8H A;  4NB5 A;  4AQY B;  4RUE A;  5FLX N;  4A5U B;  1QHT A;  3T1C A;  1G6U A;  2X0L A;  2W0F C;  2XAQ A;  3P3N A;  4RQE A;  4P9O A;  1QQC A;  3MDS A;  1KKD A;  2HFE C;  4I0X B;  4X64 B;  3ZRX A;  1RP3 B;  4XDJ A;  2HG5 C;  3CYO A;  2Y69 B;  4PA3 A;  1UPG A;  5CBH A;  1HNX B;  3SPI A;  4BIZ A;  4NR1 A;  1EM1 A;  5JQG A;  3U11 A;  4RUF A;  4H44 B;  3ZRS A;  4FM0 A;  4P30 A;  4BAY A;  4I4T A;  3IC9 A;  2NR5 A;  3ZX6 A;  3I56 V;  4NXM O;  4X65 B;  1YZB A;  3GB7 C;  1VQL V;  3B8N A;  4U3F H;  4DXW A;  1I5X A;  1NVP B;  1D5N A;  1PNK A;  3LDC A;  3CPW U;  1N33 O;  2E75 B;  3QVN A;  2CTQ A;  3AEI A;  4TV8 A;  4JI0 B;  3SPJ A;  2XOK G;  1TGO A;  4JI5 B;  5B3S B;  3ZHV A;  1ZLZ A;  2ZDI C;  2NN4 A;  2QDO A;  5KLV H;  1SQP H;  4QE7 A;  5HFL A;  1TAE A;  3P30 A;  4X66 B;  1XIL A;  3ABM B;  5CA0 B;  3T2M A;  2DYS B;  4WBN B;  2YIA A;  3A0R A;  1XQ8 A;  3CCS V;  2IH3 C;  2N04 A;  1DF5 A;  4G28 B;  3VQW A;  2UXB B;  3CWB H;  1MMM A;  4H0L B;  3FB7 C;  3ZED A;  5IYZ B;  1JR9 A;  3T1H B;  3E35 A;  4FPP A;  1I94 B;  4GKK O;  4JI6 B;  1Q6U A;  1KP2 A;  1VQ8 V;  3CCU V;  4O4H A;  1MA1 A;  2GBO A;  2Q68 A;  4J7Z A;  1FKA O;  4IYI A;  4GUN A;  3UT5 B;  4B7K A;  1BT8 A;  1Q81 W;  3UCS C;  4FLZ A;  5EBW C;  4K8Z A;  4QPJ A;  3CS5 A;  3LSQ A;  4NTW A;  4JYA O;  2EJ7 A;  3R66 A;  2IH1 C;  1VQ7 V;  1Q8I A;  1XRE A;  5JH7 A;  4YIO A;  3ETQ A;  5D5Q A;  3QNE A;  5FNV A;  3SYO A;  4PJ0 Z;  5H6Q A;  2RJZ A;  3ABT A;  3OGC C;  3X2Q C;  3ZMT A;  4MVM A;  3IGA C;  1L8D A;  1DF4 A;  1WNS A;  1BCC H;  2ZE8 A;  3AG4 C;  5J2U A;  4EFE A;  1FXK B;  4CZZ A;  3QO7 A;  2UUB O;  1HWY A;  4DR1 O;  4GKJ O;  4HNA A;  1TVK A;  4FZ0 A;  4JYY A;  4DK1 A;  1HP8 A;  3CRC A;  1I0H A;  5JQG B;  3JAL B;  2N05 A;  4TUY B;  3ETE A;  2LGW A;  2YEV B;  2YSU B;  3A0B Z;  1WJZ A;  4LFB B;  2RDC A;  3OUS A;  2E76 B;  4O2B B;  1NS1 A;  2YIC A;  3H1I H;  1M56 B;  3AG4 B;  4JI3 B;  5LMU B;  4DR3 O;  4YXW G;  2XAJ A;  2Z3Y A;  5KHH A;  3OTF A;  1YSC A;  4LF7 O;  4J42 A;  3JAS B;  3ZMU A;  4EB6 A;  5CN0 A;  1SA0 A;  3ZRW A;  1N34 O;  5B5E Z;  3OEH G;  4UXN A;  1IDS A;  5LOV B;  3JCU Z;  5KHI A;  1NU1 H;  2ZM6 O;  2ADP A;  1WPX A;  5B66 Z;  2CDY A;  4B3M O;  1V54 B;  2YXH A;  2QKC A;  3ABL C;  1WA8 B;  3RT3 C;  2E3C A;  4CC5 A;  1EFR G;  1GTO A;  3C3S A;  2HEP A;  1S5L Z;  3FB5 C;  4FFB B;  3OEE G;  4JZ2 A;  1XMQ B;  4NXN O;  1IBL B;  1WP7 A;  4J80 A;  1PM9 A;  5DEC A;  1ZL8 B;  2Q69 A;  4DUY B;  3RBZ A;  1X4T A;  1F23 A;  2HHH O;  2KB1 A;  4IHJ A;  1SQQ H;  4JV5 O;  4ZI7 A;  2CH7 A;  5DM6 V;  3HKB A;  2DE0 X;  1JA8 A;  2QM8 A;  4D7T A;  1K97 A;  4LFA B;  3BFR A;  2Y4T A;  3P32 A;  3CJH B;  4JTC B;  4ZI7 B;  4IGG A;  3IAY A;  4CH4 A;  3ZMV A;  2FTK A;  2ZT9 B;  2Y0I A;  2EIJ B;  1AI4 A;  3JCZ A;  5CMU A;  3OE7 G;  1FD9 A;  4JAA A;  2ZNJ A;  4YHH B;  4I4T B;  3JD1 A;  2JRI A;  2P4V A;  1EN4 A;  4DW1 A;  4AI8 A;  1K3E A;  3E89 A;  4DV6 B;  3DXR B;  1MNG A;  5JVD A;  2HR3 A;  4U7N A;  1VF6 C;  2B1I A;  2CE4 A;  3FB6 C;  4G2K A;  3RYI B;  4LF8 O;  1FFX A;  4LNU A;  2R70 A;  2PYL A;  1YCI A;  2B9Z A;  2M6Y A;  3ZHR A;  1QVF U;  3UO3 A;  2A06 H;  2PF4 E;  4XDK A;  5KX5 B;  2EZO A;  1XDC A;  4CBC A;  3G4S V;  1SA0 B;  3ZRW B;  3K3W A;  3LDE A;  4JI0 O;  1FXK C;  2HJF C;  1GRJ A;  3FYE B;  3HKB B;  1QLE B;  1S0V A;  3CRM A;  4FLW A;  1VAR A;  1DTO A;  2FML A;  1H8E G;  1R3K C;  1V9P A;  1K9M W;  1YJN V;  3T1Y O;  3JAW A;  3HKC B;  3JAT B;  1XL6 A;  2UUC B;  4R7C A;  2FYU H;  1L1F A;  3SPG A;  1BL8 A;  3KCX A;  4JI4 B;  2YUA A;  3WB0 A;  2Q7G A;  2IW5 A;  1KUQ A;  3JAL A;  3T4D A;  1LNQ A;  2RQ6 A;  5JCO A;  4X1Y B;  3C3T A;  1QLE C;  2ZIO A;  3ASO C;  4XDL A;  4PDR A;  2ADQ B;  1XNQ B;  1NTM H;  2CK3 G;  3EHB B;  1K4D C;  1Q5O A;  3FX7 A;  1IVS A;  3QTC A;  5H9C A;  2HVK C;  4GX1 A;  1NTZ H;  2UXC B;  1KYO F;  2FL4 A;  5JJE B;  2FKX A;  4CS4 A;  4DV5 B;  3OGI B;  1SZT A;  4MT8 A;  2AW9 A;  4DUZ B;  2QM7 A;  5LBQ A;  3RYF B;  2ILM A;  3EVK A;  1PL0 A;  1JPX A;  5LMN B;  4N23 A;  2Q8V A;  2ZE5 A;  5H2F Z;  5BR8 O;  1M9N A;  2B1G A;  2HJD A;  3KKY A;  1EZV H;  2JGD A;  4I9Q A;  4ASU G;  3EXA A;  1K4C C;  4JI1 B;  2Y4U A;  2QWQ B;  1SZX A;  2W6I G;  4QNH B;  5LP6 A;  3L73 H;  2ZXW B;  1KU9 A;  2Q5Z A;  5L3E A;  4DV2 O;  2DN9 A;  3H9V A;  4MVS A;  1HR0 B;  4K0K B;  4BW5 A;  3OT7 A;  2V4D A;  3RN4 A;  5K1P A;  1JJO A;  2KSD A;  4X1I A;  3K57 A;  3AG7 A;  3NR7 A;  4KHP B;  2A9H A;  1AR1 B;  5B1O A;  3B09 A;  3QO8 A;  2X7R B;  4DR4 O;  2BOB C;  2EIL B;  3ZHQ A;  1ROP A;  2GSM B;  4UB6 Z;  3UO2 A;  1EBO A;  4JZG A;  3K9S A;  3AG1 C;  2CTW A;  4H37 A;  3ZHS A;  4UCU A;  3TXQ A;  4L8J A;  2HLD G;  2OCC B;  1K73 W;  1JCH A;  4DR3 B;  4FLT A;  1VF5 B;  4EEQ A;  5K1X A;  3BHP A;  4OX9 O;  1M1K W;  3K04 A;  1VQO V;  1VQ5 V;  2P22 C;  4FM2 A;  3RYH A;  1K8A W;  1Z5W A;  5CB4 A;  1Y74 B;  3QG5 A;  1N33 B;  2DMX A;  2E5L B;  4JTD B;  3SJA C;  2NNU A;  4DR5 O;  1IXB A;  1RSO B;  5IJ9 B;  5KMG A;  4K35 A;  2QWR B;  1K5S A;  4X8A A;  2ZR3 A;  3L74 H;  1SS3 A;  4J7K A;  2W6J G;  1HW7 A;  1SF9 A;  3W7W A;  4YJ3 A;  3O65 A;  4MTG A;  2PTM A;  4X66 O;  2CTR A;  2LO1 A;  2IU3 A;  4LF5 O;  2LJ2 A;  4NXN B;  1WB8 A;  3LNN A;  3AK2 A;  4B08 A;  2B5U A;  5TIS Z;  2XTA A;  2YS8 A;  4EFB A;  4DUY O;  3W7U A;  2WLK A;  3UQ8 A;  1NR7 A;  4UUJ C;  1G1X B;  3N27 A;  4CH6 A;  4L87 A;  5EBM C;  1YTF B;  2ZD9 A;  3U0Z A;  3CME V;  2MK3 A;  3RW0 A;  2XHB A;  1N36 B;  1TUB B;  2XAF A;  1QBZ A;  1AJN A;  4LF4 B;  3N2K B;  2QSA A;  1ENV A;  1Q6I A;  1ZL8 A;  2YDE A;  1YIJ V;  1F4N A;  4LNU B;  2EUL A;  1W2B U;  1AP5 A;  4OXS A;  1KC8 W;  1Y67 A;  4DV6 O;  4MVR A;  5KUK A;  4RWU A;  1NKD A;  3K5M A;  1SET A;  4U7O A;  4JI8 B;  2EIM B;  4Q20 A;  1H2G A;  4NYK A;  2OCH A;  4TT3 G;  2ZXW C;  4DR7 B;  1P49 A;  1VMG A;  2LW7 A;  4HBN A;  1QR8 A;  4LCU C;  3W7X A;  1NH2 D;  3Q4H A;  1F51 A;  2BSK B;  4JYB A;  5H5N A;  4GKJ B;  1M4U A;  4LR3 A;  3MHS C;  2GHY A;  3G80 A;  4BWA A;  1N0J A;  1VQN V;  3VOU A;  2BOC C;  2P06 A;  5EZY A;  3BRC A;  4X20 A;  4XBF A;  2JJ1 G;  2QR4 A;  3TXS A;  5C93 A;  2Q67 A;  4O2B A;  1BMF G;  1YXB A;  4O4L B;  4MW3 A;  2DYS C;  4TV9 A;  4LFB O;  4PD4 F;  2ZE7 A;  4B3R O;  3ABM C;  1AR5 A;  2C2A A;  4PEL A;  4HYO A;  1Q43 A;  5L3D A;  5LMU O;  4JI4 O;  2N74 A;  2CTP A;  3E86 A;  2UU9 O;  4PDM A;  5B1A B;  2UXD O;  4DYL A;  1P7B A;  1MOF A;  4HNA B;  4F4L A;  4H13 B;  1VP7 A;  1H38 A;  1TA8 A;  1OCO C;  3ZN0 A;  1RM1 C;  2IJJ A;  3HKD B;  3HR0 A;  4B3S O;  2VQE O;  3CRR A;  2OIE A;  4O4I B;  1URF A;  3JAS A;  4D6T H;  1H2M A;  3WG7 B;  4YY3 B;  1M57 C;  2EIN C;  2PUS A;  2KKW A;  5FNV B;  1IBM O;  2XUM A;  4DV1 B;  4HZ3 A;  2RCV A;  1S72 V;  1AP6 A;  5JH7 B;  4JI2 B;  2CH7 B;  2P6J A;  4PDV A;  5KUM A;  4CC6 A;  1YJ9 V;  1QR9 A;  1OCR B;  1XOU A;  1CPY A;  3VQY A;  1AJP A;  3S3X A;  3OM3 B;  4PI2 A;  3FKS G;  1R1B A;  3VBB A;  4DK0 A;  4O4I A;  1GAX A;  2Q73 A;  3JYC A;  1V54 C;  3SYA A;  1OJH A;  4QJF B;  4MTO A;  1NH2 B;  2JJ2 G;  5CBF A;  3CXC U;  4W4K A;  3SYQ A;  1XL4 A;  2JS5 A;  2LP7 A;  2F4V B;  1T5E A;  4NTY A;  2ITD C;  2QKA A;  1GK9 A;  1NZ6 A;  1XUQ A;  4FM1 A;  1MAB G;  4PA6 A;  2V1D A;  4FMT A;  3M8A A;  4WFH A;  2BTQ A;  2A7W A;  5FL7 G;  3B8M A;  4JPR A;  3EFF K;  2KQX A;  2LFS A;  1HNW B;  4O4L A;  4TV9 B;  5EYP B;  3WU2 Z;  5LHH A;  2Q7H A;  3E8G A;  3APQ A;  3STZ C;  1GM9 A;  5CA1 A;  2YI8 A;  1M90 W;  2AZ0 A;  4LH6 A;  4MW8 A;  3AG3 C;  2F66 C;  1HDJ A;  4JF3 A;  3ABU A;  2QGN A;  5EZY B;  1Q7Y W;  5ITZ A;  1S5J A;  4X89 A;  4CS2 A;  1AI5 A;  1FJG O;  4RQF A;  3H01 A;  3UM7 A;  2EBO A;  5IYC O;  2UUA O;  1BQ0 A;  1R73 A;  4TV8 B;  3ZN1 A;  1FXH A;  3OMN B;  2E5L O;  4LFC O;  2WSS G;  1JQ0 A;  4TUY A;  4H33 A;  5LL6 Y;  2ARH A;  5IYZ A;  5KHG A;  1FAF A;  1DGS A;  1GM8 A;  4UV9 A;  2P67 A;  3MHH C;  1GN4 A;  4O4J A;  1COW G;  3THO A;  4B7E A;  1J5E O;  4Z1V A;  3RWR D;  3H1L H;  3HPL C;  2R9R B;  3G6E V;  2LW1 A;  3ZBH A;  3B77 A;  1RM1 B;  1R6K A;  2PGG A;  1Q82 W;  1KBH A;  5B1B C;  4UB8 Z;  3CSX A;  3OR7 C;  1HNX O;  3SJC C;  1VQP V;  4Z2W A;  3A8T A;  4LWS B;  1B3Q A;  5LYJ B;  1VIB A;  4PV1 B;  3D36 A;  4F6E A;  1CP9 A;  1N36 O;  1GN6 A;  4JGS A;  2Q6A A;  3P3P A;  4C7U A;  1EN5 A;  4OPA A;  1YDX A;  2YXY A;  2H94 A;  1K5Q A;  4KUM A;  1UJW B;  4UV8 A;  2VRZ A;  4DV3 O;  4CH5 A;  2OWO A;  2Y0P A;  5GW7 A;  1TUE B;  4P9P A;  2Y48 A;  3G6B A;  1U97 A;  1XNR B;  3OW2 U;  3JSN A;  1SQV H;  5EK0 A;  3JAR B;  2GTS A;  2GTA A;  5J9P C;  1SQB H;  4UVC A;  4JAV A;  1OCO B;  1RSO A;  3CRA A;  1Y4M A;  2YIB A;  1MSW D;  3W7T A;  4MVU A;  4JI1 O;  4ZKI A;  3PN1 A;  4PA9 A;  4Q6G A;  2CGO A;  1GN2 A;  4J9Z B;  5JCO C;  1AB3 A;  1WN7 A;  1M56 C;  1HR0 O;  4JAS A;  1X59 A;  5IE9 A;  4JI5 O;  1GN3 A;  1B6Q A;  1UFI A;  3SYC A;  1K92 A;  3SJQ C;  4JI7 B;  4O2A B;  1FXV A;  3AG2 C;  4GKK B;  1K34 A;  2AHY A;  2BCC H;  4UVA A;  3BAB A;  2YXL A;  1Y76 A;  3FAV A;  4ZHQ A;  3ZMS A;  2JDI G;  2PI5 A;  2OCC C;  5C8Y B;  3E8F A;  4MTF A;  3ETG A;  2D3O W;  1MG1 A;  4B3R B;  2BTO A;  5EIB C;  1IBK B;  2JS3 A;  4DV4 O;  1BZK A;  4E2L A;  5L3C A;  4NVP A;  3STL C;  4YJ3 B;  3CB2 A;  5B1N A;  1LR1 A;  3CC4 V;  3ABL B;  5IYB O;  2R9I A;  1AJQ A;  2R72 A;  2WA3 A;  1GO3 F;  3K59 A;  1M5I A;  1FXK A;  2Q4P A;  1QLN A;  3CCV V;  4UCR A;  1D5A A;  1NBM G;  3FAV B;  2QKS A;  3NXS A;  3B40 A;  3WB1 A;  2VQE B;  2AZ2 A;  3DC5 A;  3CJH A;  1SES A;  1Q3E A;  2VWJ A;  3L75 H;  2UUB B;  4KFM A;  4DV1 O;  2QTS A;  1AIL A;  4ZBM A;  1VQK V;  2KG7 B;  4JYA B;  5B3S C;  5H6R A;  3LSU A;  3K9A A;  2AHZ A;  2F23 A;  5IJ0 B;  1AR4 A;  3K5L A;  2ITC C;  3DSQ A;  2LGQ A;  1R3I C;  4X64 O;  4TQD A;  4QE9 A;  4LF5 B;  5CBG A;  4X9Q A;  1SQG A;  4FFB A;  2QJ1 A;  4IIJ A;  4YJ2 B;  4O4J B;  2W0X A;  4O4H B;  4AQY O;  2D2C B;  4LC1 A;  3QF7 A;  3ZIA G;  3LDD A;  1OV9 A;  5IJ9 A;  2X6C A;  1XMO B;  4X1I B;  5D5P A;  3AK3 A;  2GUZ B;  1Y74 A;  2QEX V;  2EIL C;  1LUW A;  3IFX A;  1NQT A;  4I5S A;  3JD2 A;  2ATK C;  1KEC A;  1PL4 A;  3CD6 V;  4GX0 A;  5GON B;  4QPK A;  5ITZ B;  3WG7 C;  2ZM6 B;  1FYJ A;  3LSS A;  1E1Q G;  3K5O A;  4BIO A;  4JAU A;  1FPO A;  2EX3 A;  3A2F A;  3JD4 A;  1AI6 A;  4KL1 A;  2YI9 A;  2ZNI A;  1YIT V;  4BIU A;  5KX5 A;  3F7Y C;  4I55 B;  2R9A A;  3ZCC A;  3D3I A;  3RGB A;  1RFY A;  3K06 A;  1L0N H;  4DR6 B;  2ZIN A;  1BS3 A;  4LFC B;  3AG1 B;  1GH6 A;  1OCC B;  2OIG A;  1N32 O;  5EC2 C;  1YF2 A;  3SYP A;  5JWP A;  1H8H G;  3T1H O;  2VQF O;  4IYH A;  1YJW V;  1THZ A;  5J2T A;  3SR2 C;  5HFM A;  1DK1 A;  2XAG A;  1XMQ O;  4I55 A;  2AGA A;  4DR2 B;  3BCC H;  2ZQM A;  2JIZ G;  1N8R W;  2Z0A A;  3F5T A;  3UKM A;  2ZCE A;  4YHH O;  3ICX A;  2BE3 A;  3JAW B;  1ZX3 A;  4HAM A;  3RFR A;  4WFA V;  1I7F A;  3ASN B;  2XAS A;  3HB3 B;  5KA5 A;  4LF6 O;  5B1A C;  1YEW A;  1I94 O;  2PY5 A;  1H2K A;  3ASN C;  2QTO A;  1S76 D;  2IJI A;  1I08 A;  2ZIM A;  2WLI B;  5KAI Z;  2DQ0 A;  2JK5 C;  5IY5 C;  5EC1 C;  2QWO B;  1P7G A;  1ARO P;  2H3O A;  1JJ2 U;  1B06 A;  2WA4 A;  5LGN A;  1GM7 A;  3J81 N;  3CEI A;  4X88 A;  5CA3 A;  4DV3 B;  2QWN B;  3CX5 F;  4DRX B;  5DED A;  2P5O A;  3APO A;  3E2E A;  1VF6 A;  1NJI W;  4LF9 O;  4FLU A;  1D2D A;  4IIJ B;  4YJ2 A;  1OCR C;  3PJS K;  1JOY A;  3T1Y B;  5CA0 A;  3HKC A;  3B2E E;  1M93 A;  1K7D A;  3JAT A;  1W0K G;  2DWD C;  5FPO A;  3CMA V;  1OCZ B;  2UXN A;  2WWW A;  4PDL A;  3CCL V;  3CCM V;  1IX9 A;  1R6N A;  3CCE V;  1M57 B;  2WLI A;  1TUB A;  2CUG A;  2EIM C;  1PD3 A;  1H2N A;  1WAZ A;  5E79 Z;  1BGY H;  4JTA B;  3SDL A;  2MW2 B;  1ZWI C;  4PI0 A;  4FVM A;  1HNZ B;  5A9G A;  1PNL A;  2O57 A;  3JSL A;  4FIP C;  1NVP D;  3K58 A;  2UUC O;  3L9D A;  3W7S A;  1BSM A;  1VQ9 V;  2H8P C;  3FD9 A;  4AIL C;  3C90 A;  2GV9 A;  1RPO A;  2Q9L A;  4GZR B;  4UCT A;  4J9Y B;  1LUV A;  1U96 A;  4UCV A;  3ZJZ A;  5JVD B;  1RPR A;  1JFF A;  2K1E A;  2ZDI A;  1XEQ A;  1QVG U;  1N34 B;  3D8C A;  3B4S A;  5GTI Z;  3R65 A;  1O9H A;  1NI8 A;  2UXC O;  3HKE A;  4I9W A;  3KCY A;  3CC7 V;  4MS2 A;  4WFE A;  3OMA B;  3SPC A;  4DUZ O;  4B3M B;  5CB4 B;  1AVM A;  4WCE V;  4JV5 B;  3H1K H;  4EB6 B;  1K33 A;  3ABK B;  4K8X A;  3ZRV A;  2OT5 A;  5LMN O;  3VQX A;  2DYR B;  5BR8 B;  5L3B A;  4LFA O;  4B3T O;  4TSF G;  3N2G A;  4TWK A;  4KHP O;  1IBL O;  2RN9 A;  3RVY A;  5EYP A;  1KB9 F;  2DQ3 A;  1PPJ H;  4LBE C;  4TOI A;  3RYC A;  2HHH B;  3BA9 A;  4DV7 B;  2WLM A;  2GUZ A;  4K0K O;  2Q0O C;  2DYR C;  3JD3 A;  1NT2 B;  3ZHU A;  2F95 B;  4BR6 A;  4LF8 B;  4OPH A;  1WP8 A;  3BAA A;  3M7M X;  3KZI Z;  2WLL B;  3TK1 A;  5GTH Z;  5IWA O;  4MVQ A;  3K0D A;  2NLJ C;  3OMI B;  5LGT A;  4PA4 A;  1ORQ C;  4WFF A;  3DGE A;  3OTO O;  1FFT B;  3D36 C;  5EIB D;  3J80 N;  4R6Z A;  2PI4 A;  3E8B A;  2IJK A;  1FS0 G;  1JX9 A;  2P7T C;  2UXX A;  1SRY A;  1Z5V A;  2ZKO A;  3QO5 A;  2QE7 G;  2RNB A;  3SPH A;  4P2Z A;  2FB5 A;  1R3J C;  3GWO A;  2P90 A;  4DR5 B;  3OR6 C;  1Z2G A;  4K3A A;  1J95 A;  4JI7 O;  5AG2 A;  5DN6 G;  4FJC C;  2VWK A;  5KMG B;  2VQF B;  2ZE6 A;  2JEX A;  3GWK C;  4GCZ A;  3T4Z A;  1XHZ A;  4KXR A;  2IM9 A;  2XT9 A;  2QA4 V;  4KP4 A;  4NTX A;  4F6R B;  4PHZ A;  3OD4 A;  5EBL C;  3RYH B;  2JGD B;  4DV0 O;  4DR2 O;  1QNM A;  3VQV A;  2YIB D;  4RO2 A;  1O9G A;  1SQX H;  1KMI Z;  2OTL V;  3SJB C;  3X2Q B;  5LXT A;  5CA1 B;  1S5H C;  4JI8 O;  3G67 A;  4OGQ B;  5B1B B;  4X62 B;  1SC5 B;  3UT5 A;  1KQS U;  2YC0 A;  4FLY A;  1SKV A;  4DV5 O;  5IY5 B;  4MVO A;  2L35 A;  3TGU H;  4UVB A;  4DV2 B;  1AI7 A;  1R3L C;  4ABM A;  1EZJ A;  3JAR A;  2GDS A;  1VEW A;  3BA8 A;  3JAM N;  3ZHT A;  4ZIB A;  1MZE A;  1DLB A;  3BY6 A;  5IDJ A;  1YTF D;  3RYC B;  4GX5 A;  4LF9 B;  1GMG A;  4DR4 B;  4WBN A;  3L72 H;  1H2S B;  5KHJ A;  4J10 A;  1G8M A;  3I5D A;  3N2G B;  3N2K A;  4GT1 A;  5IJ0 A;  2EJR A;  3LNM B;  1Y6X A;  2XAH A;  3FB8 C;  5LHI A;  1L0L H;  3CCR V;  1YI2 V;  4W4L A;  4JYC A;  1G4Y B;  3AK1 A;  4I0X A;  1PV0 A;  2LFR A;  3DTU B;  5KA6 A;  4IT5 A;  4O2A A;  1ZSP A;  1VF7 A;  2JGU A;  1OCC C;  1XMO O;  2VS0 A;  2ODM A;  1OZ0 A;  2L6L A;  4U3J A;  4IHJ B;  3HKE B;  2HP8 A;  3IJ4 A;  5IYD O;  3D3Q A;  3U10 A;  3F5W C;  4B3S B;  4D7S A;  2EIJ C;  1IZ3 A;  2DW4 A;  1JMK C;  2EIN B;  2F43 G;  4YY3 O;  1OHH G;  4X1Y A;  4J7J A;  5BMV A;  5JJN B;  1KD1 W;  3L70 H;  4OX9 B;  2UXD B;  2DOS A;  5KHK A;  2JEU A;  3G71 V;  3CP1 A;  2EZP A;  3MAQ A;  3H1J H;  2QM4 A;  1BE3 H;  1US6 A;  1B04 A;  4ZOL A;  1Q6H A;  3JAK B;  2WLN A;  5LOV A;  3ZMZ A;  1XI1 A;  4DR6 O;  2X6A A;  2WLJ A;  4FK5 C;  2Y69 C;  4FLV A;  1W0J G;  1BQZ A;  3OAA G;  3K0G A;  1N32 B;  3CCJ V;  1R6T A;  1KP3 A;  3BPZ A;  5LXT B;  5LYJ A;  5LGU A;  1QCE A;  3K79 A;  2DWE C;  5IT9 N;  3L71 H;  4I50 B;  1E1R G;  3JAK A;  2EIK C;  2Q7E A;  1P4R A;  2F1M A;  3RYI A;  1MSD A;  3E22 B;  4DV7 O;  1GKF A;  3FFQ A;  4LF6 B;  1CEZ A;  1TVK B;  4NXM B; 
#chains in the Genus database with same CATH homology
 2QTO A;  4F4L A;  1S76 D;  2IJI A;  1H38 A;  3ZMU A;  2WLI B;  1OCO C;  1V55 C;  5CN0 A;  3ZN0 A;  2DQ0 A;  2JK5 C;  1RM1 C;  2IJJ A;  3ZRW A;  2OTJ V;  5IY5 C;  3OEH G;  4UXN A;  2WPD G;  2A79 B;  5EC1 C;  1ARO P;  1JJ2 U;  1S3J A;  3WG7 B;  3TCU A;  5LGN A;  1GM7 A;  3M99 B;  1M57 C;  2EIN C;  4MTX A;  1WPX A;  4X88 A;  5CA3 A;  3WFV A;  1V54 B;  4HZ3 A;  1S72 V;  3KG2 A;  3BEH A;  4WFG A;  3LUT B;  3ABL C;  3E2E A;  2V7Q G;  1EFR G;  1NJI W;  1GTO A;  2P6J A;  4PDV A;  5KUM A;  1YJ9 V;  1OCR C;  3PJS K;  1PKX A;  1QR9 A;  1OCR B;  3FB5 C;  1JOY A;  3OEE G;  1CPY A;  1AJP A;  4Z1M G;  3OM3 B;  3VBB A;  3FKS G;  1K7D A;  1I5Y A;  1W0K G;  2DWD C;  2Q69 A;  2YEV A;  3JYC A;  3CMA V;  1OCZ B;  2UXN A;  1V54 C;  2WWW A;  3SYA A;  5BZB A;  4PDL A;  4QJF B;  3CCL V;  4MTO A;  3RBZ A;  2JJ2 G;  5CBF A;  3CCM V;  1NH2 B;  1F23 A;  2WLL A;  1R6N A;  3CXC U;  1WLE A;  3F7V C;  3CCE V;  3SYQ A;  1XL4 A;  1M57 B;  2WLI A;  2KB1 A;  3AG2 B;  2LP7 A;  4R50 A;  2EIM C;  1PD3 A;  3FYI B;  2ITD C;  1GK9 A;  5DM6 V;  3RVZ A;  4JTA B;  1ZWI C;  1IXM A;  1MAB G;  2QM8 A;  4PA6 A;  2V1D A;  1K97 A;  4FMT A;  4JTC B;  3P32 A;  4WFH A;  3JD0 A;  2FTK A;  5FL7 G;  2IU0 A;  1PNL A;  3ZMV A;  3B8M A;  4JPR A;  3EFF K;  2EIJ B;  4FIP C;  1NVP D;  2LFS A;  1AI4 A;  3JCZ A;  4MVZ A;  3K03 A;  4MSW C;  3W7S A;  5CMU A;  1VQ9 V;  2H8P C;  3ABK C;  3OE7 G;  5LHH A;  5LHG A;  3MD0 A;  1RPO A;  3E8G A;  3JD1 A;  3STZ C;  1BHB A;  1GM9 A;  3E89 A;  1K3E A;  1M90 W;  4J9Y B;  4QIW F;  4MW8 A;  3AG3 C;  5E1A C;  4JF3 A;  2IJH A;  2XND G;  3ABU A;  2HR3 A;  4U7N A;  1Q7Y W;  2B1I A;  3ZJZ A;  3FB6 C;  1RPR A;  4X89 A;  4G2K A;  2K1E A;  2ZDI A;  1AI5 A;  1QVG U;  4RQF A;  3H01 A;  3UM7 A;  2EBO A;  1Q86 W;  1VQ4 V;  1PNM A;  1QVF U;  1OCZ C;  5IYC O;  3R65 A;  3TET A;  4WF9 V;  1R73 A;  4GX2 A;  4I9W A;  3ZN1 A;  3I55 V;  3CC7 V;  1FXH A;  4MS2 A;  4WFE A;  4XDK A;  3OMA B;  2EZO A;  3SPC A;  3OMN B;  2WSS G;  4CBC A;  3G4S V;  2M7W A;  1JQ0 A;  3ZRW B;  3K3W A;  3LDE A;  4RAI A;  5L3G A;  4H33 A;  1FXK C;  2HJF C;  3ASO B;  3IC7 A;  4WCE V;  3FYE B;  1K33 A;  1QLE B;  3ABK B;  1S0V A;  4UV9 A;  1GM8 A;  3ZRV A;  2OT5 A;  2HKO A;  1DTO A;  1E79 G;  2P67 A;  3MHH C;  1H8E G;  2DYR B;  1R3K C;  1COW G;  2Z5U A;  5L3B A;  4DO2 A;  1Y66 A;  3OUF A;  1K9M W;  4TSF G;  4TWK A;  4G27 B;  1YJN V;  1NR1 A;  2HVJ C;  3ML0 A;  3RVY A;  2X6B A;  1XL6 A;  2WAM A;  2DQ3 A;  3HPL C;  4LP8 A;  2R9R B;  2ZR2 A;  1JVM A;  1SER A;  4R7C A;  3G6E V;  1L1F A;  5L3F A;  3CC2 V;  4LBE C;  3B77 A;  1RM1 B;  1R6K A;  3SPG A;  1BL8 A;  1F4M A;  1Q82 W;  2WLM A;  4WFB V;  1S77 D;  5B1B C;  3OR7 C;  2DYR C;  2IW5 A;  3JD3 A;  3T4D A;  1VQP V;  2WLH A;  1LNQ A;  1QLE C;  3ASO C;  4N21 A;  4PDR A;  4XDL A;  3D36 A;  2CK3 G;  3EHB B;  1K4D C;  1CP9 A;  4R8C A;  2WLL B;  5H9C A;  3TK1 A;  2HVK C;  4GX1 A;  4MVQ A;  4JGS A;  3K0D A;  2EIK B;  2NLJ C;  3OMI B;  2Q6A A;  5LGT A;  3CCQ V;  2H94 A;  1K5Q A;  4KUM A;  4PA4 A;  1ORQ C;  4WFF A;  1SZT A;  4MT8 A;  1UJW B;  1BHA A;  4UV8 A;  2QM7 A;  5LBQ A;  3DGE A;  1YHQ V;  1FFT B;  5GW7 A;  1TUE B;  4P9P A;  1VQM V;  4EKW A;  2Y48 A;  1PL0 A;  4R6Z A;  2PI4 A;  1JPX A;  3E8B A;  2IJK A;  3ETD A;  4N23 A;  1FS0 G;  1JX9 A;  2P7T C;  3AG3 B;  3OW2 U;  1M9N A;  5EK0 A;  5J9P C;  2B1G A;  3K08 A;  3E83 A;  2UXX A;  1SRY A;  4UVC A;  4JAV A;  1OCO B;  1V55 B;  4ASU G;  1K4C C;  1Y4M A;  1MSW D;  3W7T A;  4MVU A;  3QO5 A;  4ZKI A;  2QE7 G;  4PA9 A;  3SPH A;  2W6I G;  4QNH B;  3OFN G;  4P2Z A;  2A0L A;  2ZXW B;  4J9Z B;  4PA7 A;  1R3J C;  3GWO A;  5L3E A;  2P90 A;  1M56 C;  1VQ6 V;  4MVS A;  4JAS A;  4BW5 A;  3E8H A;  1B6Q A;  4RUE A;  3OR6 C;  1J95 A;  3T1C A;  3SYC A;  1K92 A;  2X0L A;  2W0F C;  2XAQ A;  3SJQ C;  5DN6 G;  4FJC C;  4RQE A;  4P9O A;  1FXV A;  2A9H A;  3AG2 C;  2JEX A;  1AR1 B;  5B1O A;  4GCZ A;  1KKD A;  1K34 A;  2HFE C;  2AHY A;  3QO8 A;  3T4Z A;  2X7R B;  4UVA A;  2BOB C;  2EIL B;  3ZRX A;  1ROP A;  2QA4 V;  3ZMS A;  4XDJ A;  2GSM B;  2JDI G;  4KP4 A;  2PI5 A;  2OCC C;  3E8F A;  4MTF A;  3ETG A;  2D3O W;  1EBO A;  1MG1 A;  5EBL C;  3AG1 C;  4H37 A;  2HG5 C;  3CYO A;  4RO2 A;  2Y69 B;  4PA3 A;  5CBH A;  4E2L A;  5L3C A;  3STL C;  2HLD G;  2OCC B;  3SPI A;  4BIZ A;  1K73 W;  1JCH A;  5B1N A;  3CC4 V;  4RUF A;  3ABL B;  2OTL V;  5IYB O;  3X2Q B;  2R9I A;  1AJQ A;  3ZRS A;  1S5H C;  1M1K W;  4P30 A;  3K04 A;  5B1B B;  4BAY A;  1VQO V;  1GO3 F;  1VQ5 V;  3I56 V;  1VQL V;  3GB7 C;  1K8A W;  1KQS U;  3B8N A;  1FXK A;  1QLN A;  3CCV V;  4DXW A;  1NBM G;  1I5X A;  1NVP B;  1PNK A;  2QKS A;  3LDC A;  3NXS A;  3CPW U;  5IY5 B;  4JTD B;  3AEI A;  4MVO A;  1SES A;  2NNU A;  3SPJ A;  4UVB A;  1AI7 A;  2XOK G;  1K5S A;  1R3L C;  4KFM A;  5B3S B;  4X8A A;  1EZJ A;  2ZR3 A;  4ZBM A;  1VQK V;  2ZDI C;  5B3S C;  5H6R A;  2W6J G;  3K9A A;  1DLB A;  3BY6 A;  2AHZ A;  5IDJ A;  3W7W A;  1YTF D;  4GX5 A;  4QE7 A;  2ITC C;  5HFL A;  4MTG A;  1GMG A;  1R3I C;  3P30 A;  4QE9 A;  3ABM B;  2IU3 A;  3T2M A;  2DYS B;  5CBG A;  1G8M A;  2B5U A;  4GT1 A;  3A0R A;  2EJR A;  3LNM B;  2XAH A;  5LHI A;  3FB8 C;  3CCR V;  3CCS V;  2IH3 C;  1YI2 V;  4JYC A;  1G4Y B;  1DF5 A;  4G28 B;  3W7U A;  2WLK A;  2LFR A;  3DTU B;  1NR7 A;  4UUJ C;  4LC1 A;  5KA6 A;  3ZIA G;  3FB7 C;  3LDD A;  4L87 A;  5EBM C;  1OCC C;  2X6C A;  1YTF B;  2ZD9 A;  3E35 A;  4FPP A;  3CME V;  1OZ0 A;  2MK3 A;  1KP2 A;  3RW0 A;  1VQ8 V;  3CCU V;  2XAF A;  1QBZ A;  2Q68 A;  5IYD O;  2QEX V;  1AJN A;  3F5W C;  2EIL C;  1ENV A;  2EIJ C;  3IFX A;  2DW4 A;  1NQT A;  4I5S A;  1YIJ V;  1F4N A;  3JD2 A;  1W2B U;  2ATK C;  1KEC A;  2EIN B;  1Q81 W;  2F43 G;  4OXS A;  1KC8 W;  3CD6 V;  4GX0 A;  4QPK A;  5EBW C;  3WG7 C;  3LSS A;  1OHH G;  1E1Q G;  4MVR A;  4QPJ A;  3LSQ A;  1KD1 W;  5KUK A;  1NKD A;  4JAU A;  1SET A;  4U7O A;  2EIM B;  2IH1 C;  2JEU A;  1H2G A;  3JD4 A;  4Q20 A;  1VQ7 V;  1AI6 A;  3G71 V;  3CP1 A;  2EZP A;  4TT3 G;  2ZXW C;  3QNE A;  3SYO A;  1YIT V;  5H6Q A;  4BIU A;  3ABT A;  3OGC C;  3F7Y C;  3X2Q C;  4MVM A;  3IGA C;  3ZMT A;  1QR8 A;  2WLN A;  1DF4 A;  3ZCC A;  3D3I A;  3ZMZ A;  4LCU C;  3W7X A;  3K06 A;  2X6A A;  3AG4 C;  1NH2 D;  2WLJ A;  4FK5 C;  2Y69 C;  1W0J G;  1FXK B;  4CZZ A;  1F51 A;  3OAA G;  3K0G A;  3QO7 A;  4JYB A;  3AG1 B;  1HWY A;  1OCC B;  3CCJ V;  1KP3 A;  3MHS C;  2GHY A;  1VQN V;  5EC2 C;  3VOU A;  2BOC C;  5LGU A;  3SYP A;  1H8H G;  1QCE A;  3K79 A;  1YJW V;  1THZ A;  4XBF A;  5HFM A;  2JJ1 G;  3ETE A;  2DWE C;  2YEV B;  5C93 A;  2Q67 A;  2XAG A;  1E1R G;  2YSU B;  1BMF G;  2EIK C;  4MW3 A;  2DYS C;  3ABM C;  1P4R A;  2ZQM A;  2JIZ G;  3OUS A;  1N8R W;  2C2A A;  4PEL A;  4HYO A;  3UKM A;  1M56 B;  5L3D A;  3AG4 B;  4HAM A;  1GKF A;  4WFA V;  3E86 A;  4YXW G;  2XAJ A;  3ASN B;  2XAS A;  3HB3 B;  5KA5 A;  1CEZ A;  2Z3Y A;  4PDM A;  5B1A B;  5B1A C;  1YSC A;  1P7B A;  3ASN C;  1MOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...