1QVGU

Structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1qvgU00
1KQSU 3CCEV 1VQNV 1N8RW 1VQ5V 1QVFU 1VQ9V 1Q7YW 1YJ9V 4WFBV 2QEXV 3CCLV 1S72V 1VQKV 1K8AW 1VQ7V 3I55V 1VQPV 3CCSV 3CCUV 1YJWV 1KC8W 3I56V 1VQOV 3G4SV 1M90W 3CC7V 3CC2V 1VQ4V 1VQ8V 1VQMV 3CMAV 4WFAV 4WCEV 1K73W 5DM6V 1Q82W 1KD1W 3CCMV 1VQLV 1Q81W 1VQ6V 3CXCU 3OW2U 1YITV 1Q86W 3CC4V 1K9MW 3CCVV 3G71V 1YIJV 2QA4V 3CCQV 1M1KW 3CCRV 3CPWU 1NJIW 1W2BU 1QVGU 1JJ2U 1R73A 2OTJV 3CCJV 1YHQV 4WF9V 3G6EV 3CMEV 1YI2V 1YJNV 2D3OW 2OTLV 3CD6V
chains in the Genus database with same CATH superfamily
3AK2A 5B1BC 4IIJA 3DC5A 3GB7C 5IJ9A 5LXTA 3CSXA 3FYIB 2UUCO 2IJKA 5TISZ 4AHCA 1JOYA 2HLDG 2P90A 3HB3B 3ABMC 2QKSA 3FB6C 4NKGB 2R9AA 3ABUA 3WG7B 1OCZC 2PYLA 3C3SA 3K9SA 4H13B 1MG1A 3VQVA 3CC2V 3DXRB 3CMAV 3GWKC 3B8NA 4IIJB 4G28B 4LFAB 1GM9A 1DF4A 5HFMA 3D36A 5A2QN 5DECA 3K0GA 4NTXA 3RW0A 4JI2B 4PA6A 3TK1A 3W7WA 1D5AA 2A0LA 2FMLA 3B8MA 4EB6B 4KHPB 2QWRB 4JI0B 2QKCA 3H1JH 2BOBC 1I08A 1MNGA 3H9VA 1GK9A 4DV1O 4MTFA 1ZL8A 5FNVA 4MVOA 1K5SA 1BGYH 3JD2A 3RWRD 1URFA 3JAKA 5GTIZ 2F66C 2HHHB 4FM0A 1PNKA 5KA5A 2QWNB 1M4UA 4GX5A 4P30A 4UVBA 2OWOA 4NB5A 4RWUA 5FL7G 1QLEB 4RQEA 1K3EA 2F4VB 3FKSG 4J11A 1VQMV 2UUBO 1YF2A 2UXNA 3E2EA 1PNLA 1WP8A 1FAFA 1WA8A 1Q86W 2XAGA 2YS8A 4DYLA 1XQ8A 1QVGU 3CE2A 1B3QA 4FLWA 2GBOA 5KHIA 2DYSC 3U11A 1FYJA 4AILC 1ZL8B 2UXXA 3OUFA 4LF4O 2AZ0A 4YIPA 2ZNIA 3JAKB 1BMFG 2RMKB 2EX3A 1BE3H 3IC7A 4B3TO 3ASOB 2EIJB 2YIDA 3OT7A 4I55A 4RO2A 3H01A 2NNUA 1KUQA 4BR6A 3HKEA 1EFRG 2Y0IA 1M56B 4CC6A 1NTKH 1XMQO 1S5HC 3BHPA 1QBZA 3CRQA 4X88A 1HW7A 1O9GA 3T1CA 1IBMO 4TWKA 4UVCA 4ABMA 1R6NA 3W7TA 4B3MO 2QTSA 5KX5A 2WLJA 5EBMC 1P49A 4O2AA 5HFLA 1D2DA 5GONB 1XEQA 4NXMB 2IH1C 4UV9A 3LDCA 3W7XA 2UXDB 1EN4A 2EULA 1NH2B 2WAMA 1KMIZ 5LP6C 4H37A 4I55B 3GWOA 2BTQA 2XOKG 3TJTA 3JARB 4OXSA 1ENVA 3HKEB 1LUVA 1WN7A 4LF6O 4P2ZA 4X64O 2K9PA 3JASA 1QQCA 1GN3A 1UJWB 4GKKB 1COWG 1AP6A 2LGWA 3ZN0A 1S3JA 1TAEA 1V55B 2YIBA 4IGGA 1GRJA 2DWDC 2P5OA 5KX5B 2CGOA 4O2AB 1Y74A 2Y4TA 1Q5OA 5H6QA 3ZRWB 5KHHA 3HR0A 5EYPB 2ZINA 2UUCB 2XUMA 3L74H 4PA7A 1VQLV 1ZUQA 4Z1MG 2E74B 2BTQB 1OHHG 4WFHA 1K92A 2LFRA 3N2KA 5LGNA 1N4CA 5J2TA 3JASB 1NR1A 2ZDIA 4ZBMA 4MTOA 2ZT9B 3LSSA 5LGUA 2EILC 2WLKA 1ZAUA 4Q20A 2BE3A 4UV8A 4UFZA 1SQBH 3EFFK 3IJ4A 5CBGA 5IT9N 2ILMA 3SYOA 1F4MA 2KKWA 4FVMA 4GX2A 3E8FA 3WFVA 1FFXB 3BRCA 1PNMA 1S0VA 4X1KA 4CZZA 5KA6A 2ITCC 4RUEA 4MT8A 2XAFA 3JALB 3LSUA 2A7WA 2UXBO 2R9IA 1KC8W 3N2KB 3BFRA 3R66A 4WFAV 1BQZA 3ASNB 1JPXA 4DV1B 2W6IG 4QE7A 2EIKC 5JVDA 4LP8A 3ZMUA 1WB7A 1SC5B 1VF7A 2V7QG 4UB6Z 2JGUA 4I7ZB 2WA3A 3P3PA 3DSQA 1G6UA 4X1KB 5B1AB 1T5EA 4I5SA 3G6BA 5IYZB 2UUBB 1G1XB 2B1GA 1YZBA 1Q6HA 5JJEB 3A0HZ 4BIZA 4YXWG 2Q67A 3JD3A 1R3KC 2DJVA 4LFBB 5CN0A 3F7VC 5KAFZ 1NT2B 4GYCB 1CXZB 2F93B 1ZLZA 5JH7A 1MSWD 4FLVA 4ZHQA 4CS4A 5DN6G 3NXSA 4J7JA 4B3TB 4QGPA 2GHYA 4K0KB 4WF9V 2ZR2A 3SYCA 4X65O 1AROP 4EFBA 5IYDO 3UT5B 1OCRC 2EIMB 5CA3A 2JJ1G 4DV7O 2XAHA 3J7AU 4TOIA 3SYQA 4GCZA 1SF9A 1IBMB 3RFRA 1IZ3A 4JI3O 2UXCO 5LHGA 1SQVH 1QLEC 4B3MB 4F6RB 1E1QG 1XMOO 2N05A 3B2EE 1SS3A 2VWKA 4DXWA 5C8YB 1YJWV 2Q73A 1WPXA 3TGUH 2GSMB 1KU9A 3GVMA 4KL1A 1IBKO 2QA4V 1R3IC 1TA8A 2CTQA 1YJNV 2V1DA 3SYAA 1DGSA 3ZIAG 3ASOC 4LCUC 3ETQA 4JYYA 4RUFA 3CCLV 3ETGA 2Q6AA 5AG2A 1N32O 3OE7G 1TGOA 4X20A 1M56C 4TV9A 2LQTA 1S76D 4ZI7A 1RSOB 5J2UA 1AI5A 4LFCO 4PDMA 1YHQV 1GMGA 4YIOA 1U96A 4DV6O 4UB8Z 4XBFA 3IFXA 2X6CA 1P7BA 2P7TC 2IW5A 4Z2WA 3L72H 4LFAO 1WPBA 1SA0A 3H1LH 4UCRA 1R6KA 3CPWU 3A0RA 4JI2O 4X20B 4TV9B 2QEXV 2N74A 2UU9O 4KHPO 3UCSC 4JI0O 4ZI7B 5J2UB 1JA8A 1HNZO 4J7KA 4YJ3A 1I0HA 1S5LZ 2ZNJA 3MHHC 3P30A 4YJ2B 2HHHO 2AHZA 2CK3G 3CMEV 2AHYA 5JQGB 2P06A 1XHZA 4DV2O 2WLIA 4JAVA 1ZX3A 1SA0B 4KXRA 2UUAO 1FXKA 2VRZA 2ADQB 3E89A 3OM3B 3L73H 4FLTA 4TQDA 1TVKB 4TQFA 3STLC 2OYQA 3RYHB 2DOSA 3CWBH 4YJ3B 4UCSA 2OIGA 1GTOA 5IJ0A 2Y0PA 4I50A 3QNEA 4JV5B 3ML0A 4G27B 4I9WA 3OAAG 4PELA 3WB2A 1BL8A 3A2FA 1FXKB 1JR9A 2YUAA 1N34O 2HKOA 1V54B 1HNXO 2ZXWB 2ZDIC 4PD4F 3BAAA 4NTWA 4JI4O 5H6RA 2FTKA 4P9OA 5L3DA 1L0NH 3JAWA 4UCOA 1PKXA 1MZFA 1Z5WA 4DV7B 5IJ0B 4DV0O 2OIEA 2RDCA 2O57A 4D6TH 3CC4V 3K5MA 4I50B 2ZKOA 1FD9A 2YSUB 4JI3B 2UXCB 3CCEV 1XNRO 3E22B 1MABG 1OCCB 1Q6IA 1YVWA 1XMOB 3VQWA 3OR6C 1GM7A 3ZHRA 1QU7A 4IL6Z 2EBOA 2HVKC 2K1EA 3MDSA 2BSKB 3JAWB 4OGQB 2JK5C 2JJ2G 2ZR3A 1SQQH 2N04A 2PTMA 4WBNA 1IBKB 5B3SB 5LGTA 1OZ0A 2PI5A 1SQXH 3JAMN 3RGBA 4X62O 5EBLC 2AZ2A 5EZYA 2DYRB 1N32B 1D5NA 1I5YA 3D3IA 3M7MX 3AG4C 4EB6A 3LUTB 4JASA 1E1RG 2WPDG 4PHZA 4N21A 4LFCB 1VQ9V 3THOA 5LMNO 1GKFA 4OPAA 4JAAA 3SGIA 2ZE7A 3DTUB 4UCVA 4DV6B 4B7KA 4MVRA 4WBNB 1H2MA 2GUZB 4B3SO 4U3FH 1I5XA 5GW7A 3ZRVA 4FLXA 1F23A 2Q8VA 1N36B 3TXSA 2QM7A 2ZE8A 1L1FA 2W0FC 1BS3A 5EZYB 3K59A 3H1IH 1P84F 1VQPV 2UU9B 4DR3O 5E79Z 2CTRA 3LNMB 2VWJA 5LHIA 3QO7A 1HNZB 1KD1W 3WB1A 2WLLB 1H2KA 3ZHVA 2Q7EA 3X2QB 3PJSK 2Q0OC 1YI2V 4IYIA 1L8DA 1UFIA 4LH7A 4PDVA 4DV2B 2HFEC 1Y66A 2L35A 3QF7A 4NYKA 4K8XA 2UUAB 2Z5UA 1GAXA 4IHJB 3SJBC 5B1NA 4PI2A 2M7WA 1CP9A 3FB5C 3CRAA 1K9MW 3OEHG 3CCVV 4ASUG 2H8PC 2ITDC 1W59A 3E8BA 2QGNA 1BHBA 4BW5A 1THZA 4LFBO 2RJZA 1N0JA 1KP2A 2QWPB 4FZ0A 1BZKA 1PL4A 5GONA 2JVDA 4WFEA 2QDOA 2EZOA 1LR1A 4RAIA 4K0KO 4GT1A 3JARA 3ZMVA 1N34B 3QVNA 3L70H 1YEWA 2QTOA 1KQSU 1VQ5V 1HNXB 4N23A 4YHHO 1MSDA 5EIBC 3B4SA 4MW8A 1V9PA 2Q0AA 1H8EG 4JI4B 5JWPA 3K79A 4MVUA 1YTFD 1Q43A 1SZXA 3G71V 4XDJA 4DV0B 3ZRWA 3ZX6A 3CD6V 3IC9A 4AI8A 5EYPA 3JD4A 4I0XB 2Q7GA 4J42A 1LUWA 2R9RB 1XNRB 4JF3A 1R6TA 3K5LA 4DK1A 1TUBA 3B09A 3E35A 5FLXN 1J5EO 4MVMA 1I94O 2BCCH 1U97A 4ZKIA 4MSWC 4NTYA 1BSMA 2VQEO 3OFNG 3AG3B 4J9YB 4R6ZA 2ZM6O 1FXKC 5IDJA 3S3XA 2C2AA 2QM8A 4WFBV 1EBOA 1V54C 2Z3YA 2ZXWC 1QLNA 1FFXA 1PL0A 4F4LA 1PD3A 4X62B 1DTOA 1FXHA 2EINB 3JALA 3JSLA 1TUBB 4FM1A 4HYOA 3RBZA 3A8TA 3QG5A 2PF4E 1VIBA 2RCVA 4GX1A 4W4KA 1Q7YW 2CGNA 1H38A 2IBZH 5CBFA 1SERA 3CCSV 4FMTA 2FYUH 3T4ZA 2CTPA 5LMNB 4XDKA 3FAVA 3MAQA 2DQ3A 1OCCC 1M5IA 5FPRA 2LW1A 1QCEA 2NR5A 5LA6B 4B3SB 4CH3A 3CB2A 5KHJA 2YI8A 3FB7C 2OCCC 3DGEA 1IXMA 1WP7A 3K3WA 2B9ZA 4I9QA 5IYZA 4I4TA 5BXZA 4MVZA 5B3SC 4DR3B 4PA4A 1VEWA 3RYCA 4AQYB 3RVZA 2QWOB 3RYFB 3FAVB 2ZIMA 2DYRC 2XAJA 3B77A 1OV9A 2ATKC 3AG7A 1RFYA 4JYAO 1W0KG 3I55V 1AP5A 5J9PC 5LYJB 3BVOA 3ABKB 4U3JB 3O9OA 3WG7C 3NR7A 2NLJC 3K57A 2YXLA 1Y4MA 4TSFG 4F6EA 1A32A 1SRYA 1NBMG 5H5NA 4I4TB 4K8ZA 3UT5A 2ODMA 3E86A 3ZS8C 5H2FZ 3RYCB 1M93A 2ETNA 4W4LA 1S72V 2ZE5A 4JV5O 3JYCA 4HNAB 2H94A 2WLMA 4QJFB 4F6RA 1I7FA 2CAZC 4X8AA 4LWSA 4DK0A 1K73W 1O9HA 2Y4UA 4FM2A 4H33A 2HP8A 1SZTA 4BWAA 2W6JG 4MTGA 1NJIW 5C8YA 1NQTA 1NTZH 2JGDB 5GTHZ 2CUGA 2KSDA 4EKWA 4FJCC 1X4TA 2LW7A 4YHHB 3AG2B 2WLHA 1AJQA 1N33B 3VOUA 5BR8O 1JQ0A 4LWSB 1GM8A 2F95B 3SDLA 1DLBA 5FPOA 4J41A 1R3LC 3ABLB 5EK0A 1RSOA 3D3QA 5DEDA 4CS2A 5E1AC 3QTCA 2DMXA 3KKYA 3KZIZ 3OW2U 4E4EA 1B6QA 1AJPA 2PUSA 1J5EB 2XTAA 1I94B 3C90A 3HPLC 4PDRA 3CYOA 5L3BA 5KMGA 4DR7O 1PPJH 2VQEB 1YJ9V 2GV9A 2EIJC 2KG7A 2AW9A 3RVYA 2ZM6B 4DR4B 5F2VO 3H1KH 2ADPA 1CPYA 2DWEC 2YC0A 3TETA 1MZEA 4FIPC 1Z2GA 4JTAB 4JI6O 3CCRV 4DV5O 4HAMA 3STZC 4U7OA 3SJCC 1IXBA 4O2BA 2ZD9A 1MA1A 4YJ2A 2WWWA 3OEEG 1JFFB 1Q8IA 5KMGB 2F1MA 5JQGA 1N36O 2KG7B 3T2MA 4LF5O 3ZMZA 2YIBD 3CP1A 2ZCEA 5D5PA 3P32A 2EJ7A 4LC1A 3N2GA 1H2LA 2A06H 1TVKA 1K33A 1VQKV 2X7RB 3RYHA 4K3AA 2PYJA 4JYCA 3AG3C 1V55C 1GN4A 3CC7V 4DUYO 4CH4A 2HEPA 4O2BB 2P4KA 1IX9A 3JCUZ 1SESA 4TUYB 1HWYA 3M99B 1MMMA 2EINC 2HJFC 3OUSA 1L0LH 4Q6GA 4FFKA 2E76B 4H0LB 4JYAB 2GTAA 3N2GB 2LJ2A 5DM6V 4O4IB 1N0NA 4PA9A 3FX7A 2LFSA 5L3EA 4LH6A 3ZMSA 1OCOB 2P67A 1Q3EA 4DR2B 3Q4HB 2ARHA 3UQ8A 1IVSA 3K9AA 4DRXA 1Z5VA 3B40A 4MVQA 2VQFB 3DC6A 3ZMTA 4KFMA 4JZ2A 3IGAC 2CE4A 1H2NA 3E22A 3ZEDA 2Q4PA 2WA4A 3CRRA 3ETEA 1XUQA 2YICA 2OTLV 2A3QA 1HNWO 2Q9LA 4DV3O 4A5UB 4O4HB 1GH6A 3ASNC 4JZGA 2B1IA 2BSKA 5IY5B 4WCEV 1QR8A 4ZOLB 1NZ6A 1R1BA 4WFGA 4DRXB 4FLUA 1YXBA 3JCZA 1SQGA 3C3TA 1WJZA 1W2BU 1R73A 1W0JG 1YTFB 4LF9O 5B1AC 5B5EZ 1M57B 4H44B 5BR8B 3L71H 1QNMA 2IU3A 1S77D 3K58A 4NXNO 4LF7B 1JMKC 3E8HA 4JPRA 4J9ZB 3G80A 4JI7O 5LOVA 2F43G 1FFTB 4GUNA 1WAZA 4JTCB 4X1IB 5KAIZ 2GUZA 1WNSA 1DF5A 1KP3A 1Q90D 4ICGA 3EVKA 3CHXA 4PV1B 2PZSA 1EN5A 4DR7B 2JS3A 4O4JA 1K4CC 2EIMC 3F5WC 3H1HH 3UO3A 3IAYA 2CDYA 4CC5A 1NI8A 1Y6XA 4KUMA 4L8JA 4PDLA 4JI6B 5C93A 4DV5B 4U7NA 4DR1O 3ETDA 2QR4A 3I5DA 1VARA 2XT9A 5LOVB 2WLLA 5CA1B 2Y69B 3RYIA 5LL6Y 2EIKB 2KB1A 3WU2Z 1HR0O 3CXHF 4OX9O 2JEXA 2DE0X 3FFQA 2JIZG 1Q81W 4UUJC 3ABLC 1JVMA 3T4DA 1JJ2U 5D5QA 4O4JB 1FJGO 4LF5B 1VQNV 5LBQA 3SPGA 5CMUA 2DN9A 3CRMA 4TV8A 4IHJA 2BTOA 2X6BA 3HKDB 1J95A 3APOA 4AQYO 2F23A 3K5NA 5IJ9B 5LXTB 4DR5O 4DUYB 3WB0A 4B08A 3RYIB 2E5LO 4WFFA 2YI9A 2Q7HA 2QE7G 1DK1A 1FXVA 3ABTA 1XOUA 1VMGA 2X6AA 5EIBD 3OTOO 1AR4A 1UPGA 5B1OA 1EN6A 1M90W 5IWAO 3MHSC 2R72A 1H2GA 2AGAA 1B06A 1BHAA 4TV8B 3CRCA 1OCRB 5KHKA 3CCQV 1NVPD 4D7TA 2IJHA 2YDEA 1NR7A 4L87A 1XBLA 4J80A 2V4DA 2VS0A 3TCUA 2JDIG 4NVPA 1BQ0A 4QPJA 5JJNB 1NTMH 4QE9A 1HDJA 2HVJC 4I0XA 4UVAA 2G38A 3O65A 4GKJB 1XDCA 1US6A 2YEVA 3P3NA 3F7YC 2EZPA 1PV0A 5FNVB 3S3WA 3BABA 2CH7A 3LDDA 4IT5A 1HNWB 4DV3B 2RN9A 3CCUV 2LP7A 1VQOV 1Y67A 4GX0A 3W7SA 5BY1A 1KBHA 1N33O 1XILA 2PGGA 4JYBA 3VQXA 3CX5F 4UCTA 3HKCA 2IM9A 4RQFA 4FFBA 4JTDB 3D8CA 5LHHA 2OTJV 1KYOF 3T1HO 4DV4B 1IBLO 3KCXA 3SPIA 1EZJA 1WA8B 1OCOC 1K8AW 4DW0A 1LNQA 4LF9B 4B7EA 1AJNA 2YEVB 4NXNB 4LF8O 2CH7B 3J80N 2IJIA 2JEUA 4JI7B 4DUZO 1JCHA 4PA3A 4DR4O 3OTFA 4PI0A 5JCOA 2QJ1A 3HKCB 1AVMA 5LA6A 4BAYA 4FFBB 3A0BZ 4CS3A 1H2SB 1HP8A 3RN4A 3T1YO 1VF6A 2LGQA 3APQA 5L3CA 2Q5ZA 4DR6O 4G2KA 1YITV 1XL4A 3U10A 1G4YB 3E8GA 5IY5C 2BOCC 1RM1B 1KECA 3K08A 4LR3A 1E79G 2YXHA 2ZIOA 2A79B 3SR2C 4DR1B 5H9CA 3G4SV 3PN1A 5KUMA 1VQ8V 3RYFA 1M57C 3K04A 4CH5A 4UCUA 1HR0B 4OX9B 1RP3B 5K1XA 3ZHSA 2OT5A 5LYJA 4U3JA 5CBHA 2W0XA 1F7YA 1FJGB 4XDLA 5K1PA 2XNDG 1KB9F 1XL6A 1IURA 2QKAA 4FPPA 1Y74B 2YIAA 2DW4A 1XHXA 2NN4A 4DR5B 4HNAA 2CTWA 4ZIBA 1QVFU 1ORQC 1X59A 5LMUO 2E5LB 3L9DA 2IU0A 5L3GA 1TUEB 4YY3O 3OMAB 1VQ7V 3OMIB 5JJJB 5J2TB 3OTOB 3MD0A 3CJHA 2JGDA 5IWAB 1B04A 3UM7A 4DR2O 3BCCH 2Y69C 1ZWIC 3UO2A 1M1KW 4X1YA 2RQ6A 3BY6A 3CEIA 4OPHA 4JI5O 2QSAA 3G6EV 4DW1A 1YDXA 1VP7A 4O4LA 2VQFO 1SKVA 4BIUA 3CS5A 4P9PA 3RT3C 1NKDA 3SPHA 4C7UA 1VF5B 2ZE6A 3ZBHA 5ITZA 3FB8C 1WLEA 1Y76A 3AG1B 3U0ZA 4Z1VA 1XNQO 1KKDA 1QHTA 1YCIA 4R7CA 4R8CA 4B3RO 1NS1A 2MW2B 3CJHB 5KUKA 3K06A 1NU1H 1GO3F 2FL4A 3KCYA 4LF4B 3X2QC 4X1YB 5JVDB 2YXYA 3VBBA 3FD9A 4FZ1A 1Q82W 4O4LB 3JD0A 5B1BB 4EEQA 2EJRA 2XASA 3ZHQA 5ITZB 2X0LA 4FLZA 3ABMB 1Y76B 3T1HB 1IBLB 4LF7O 4JI8O 4X9QA 3AG4B 1BT8A 3OMNB 1XMQB 1SQPH 5IYBO 3ZN1A 1KKCA 3D36C 3LSQA 1FPOA 1WB8A 2M6YA 2HJDA 4MS2A 1NH2D 1OCZB 5CB4A 4LF8B 4X66O 1YSCA 1CEZA 5JH7B 1JFFA 1OJHA 4JI1O 4ZHQB 4DUZB 4GLXA 3K5OA 2D2CB 3AK3A 3UKMA 4E2LA 3BPZA 5IYCO 4LF6B 3QO5A 4X64B 3BEHA 2RNBA 3T1YB 4K35A 1PP9H 1ROPA 1YIJV 1RPOA 4JAUA 4UXNA 4QNHB 4DR6B 2JRIA 1QR9A 3K03A 4QPKA 5A9GA 2QM4A 1N8RW 3FYEB 2E75B 5KLVH 2Q68A 3JATA 5CB4B 1P7GA 3KG2A 4TUYA 3OD4A 3I56V 2Z0AA 1PM9A 1VQ4V 3ZJZA 5BMVA 1SQFA 1FS0G 3ZRXA 3BA8A 2IJJA 4FLYA 1AR5A 1GN2A 2Y48A 4KP4A 1G8MA 1K7DA 2OCHA 3OR7C 3OGIB 3L75H 2DQ0A 2JS5A 4O4IA 1S5JA 1EZVH 3HKBA 1ZSPA 2XAQA 3AEIA 3G67A 3J81N 3ZHTA 3SPCA 4DO2A 3SJAC 3Q4HA 4CH6A 2IH3C 2DYSB 2AXTZ 3JATB 3OGCC 4TT3G 1K4DC 1R3JC 3BA9A 3CCJV 3SYPA 5BMVB 2Q69A 1K97A 3EXAA 4MVSA 2GDSA 2QWQB 2FB5A 3N27A 3W7UA 4GZRB 5LMUB 2WLNA 1RM1C 5LP6A 3K0DA 4HBNA 4YY3B 2UXBB 3JSNA 1AB3A 2E3CA 3E83A 3JD1A 1F51A 3HKBB 4BIOA 4O4HA 4X89A 1IDSA 1F4NA 2H3OA 3VQYA 2ZQMA 3AK1A 5JCOC 4ZOLA 2XHBA 4JI5B 3R65A 1Q6UA 2F4VO 2WSSG 5B66Z 1NVPB 1GN6A 3F5TA 2L6LA 1AI4A 1VF6C 2KQXA 4LNUA 3SJQC 4GKJO 1BCCH 3TXQA 1K5QA 5LP6B 3ICXA 4NR1A 2GTSA 4J10A 4HZ3A 2R70A 1AI6A 1MOFA 4EFEA 4LBEC 3M8AA 1AI7A 1XNQB 3LDEA 5BZBA 3SPJA 4B3RB 3LNNA 4FK5C 1AR1B 3ZHUA 2WLIB 5KHGA 1P4RA 4X1IA 2MK3A 3CCMV 5EC2C 2B5UA 1H8HG 4DV4O 1M9NA 1RPRA 3ABKC 5EBWC 4LNUB 2P22C 4BW9A 5CA0A 1JJOA 4X65B 2HR3A 4IYHA 4JGSA 4CBCA 1SETA 1JX9A 1ZTEA 4JI8B 1XREA 4MTXA 1K34A 5IE9A 5EC1C 2PY5A 1VQ6V 3CXCU 4NXMO 4MW3A 2FKXA 2EILB 2UXDO 2LO1A 4PJ0Z 5CA1A 3EHBB 4D7SA 3ZRSA 4X66B 3AG1C 2P4VA 1XI1A 1AILA 4JI1B 2A9HA 2PI4A 4R50A 4GKKO 2HG5C 1FKAO 3QO8A 5L3FA 1EM1A 2P6JA 2OCCB 4QIWF 5CA0B 3HKDA 3ZCCA 2D3OW 4J7ZA 3DXRA 3AG2C
chains in the Genus database with same CATH topology
1EZJA 5B1BC 3GB7C 1OCOC 3FYIB 1S72V 1K8AW 1LNQA 3JYCA 2IJKA 2H94A 1JOYA 2WLMA 2HLDG 4QJFB 2P90A 1AJNA 3HB3B 2YEVB 4X8AA 1K73W 3ABMC 2QKSA 4H33A 1SZTA 2IJIA 2W6JG 4MTGA 3MHHC 3P30A 3FB6C 2AHZA 2CK3G 1NJIW 1NQTA 2JEUA 3CMEV 1JCHA 2AHYA 4PA3A 2WLIA 3ABUA 4JAVA 3WG7B 1OCZC 1FXKA 4EKWA 4FJCC 4BAYA 3E89A 1MG1A 3OM3B 3CC2V 3CMAV 3B8NA 3AG2B 2WLHA 4G28B 3STLC 5L3CA 1AJQA 1GM9A 1DF4A 4G2KA 5HFMA 3D36A 1YITV 1XL4A 3K0GA 1G4YB 3E8GA 3VOUA 5IY5C 2BOCC 1JQ0A 1RM1B 1KECA 3RW0A 1GM8A 3K08A 1GTOA 1E79G 1DLBA 4PA6A 3TK1A 3W7WA 2A0LA 1R3LC 3B8MA 3ABLB 5EK0A 2A79B 3QNEA 5H9CA 3G4SV 3ML0A 4G27B 5KUMA 5E1AC 1VQ8V 2BOBC 1M57C 3OAAG 4I9WA 4PELA 1GK9A 3K04A 4MTFA 1BL8A 1FXKB 3OW2U 4MVOA 1K5SA 3JD2A 1B6QA 1AJPA 2HKOA 1V54B 2ZXWB 3HPLC 2OT5A 4PDRA 2ZDIC 3CYOA 5L3BA 1PNKA 5KA5A 5CBHA 1YJ9V 5H6RA 2FTKA 4P9OA 2EIJC 4XDLA 5L3DA 3RVYA 4GX5A 4P30A 1PKXA 4UVBA 2XNDG 1XL6A 5FL7G 1QLEB 4RQEA 1K3EA 3FKSG 1VQMV 1CPYA 2DWEC 2UXNA 4FPPA 3E2EA 3TETA 1PNLA 2DW4A 4FIPC 1Q86W 2XAGA 3CC4V 4JTAB 3CCRV 4HAMA 3STZC 1QVGU 2YSUB 4U7OA 2DYSC 3CCEV 1QVFU 1ORQC 2UXXA 1MABG 1OCCB 3OUFA 2ZD9A 2IU0A 5L3GA 1TUEB 3OMAB 1VQ7V 3OMIB 3OR6C 1BMFG 1GM7A 2WWWA 3OEEG 2EBOA 3MD0A 2HVKC 2K1EA 3IC7A 3ASOB 3T2MA 3UM7A 2EIJB 2Y69C 1ZWIC 4RO2A 3H01A 2JK5C 2JJ2G 2NNUA 3ZMZA 1M1KW 2ZR3A 3CP1A 3BY6A 3G6EV 1EFRG 3P32A 1M56B 4LC1A 5B3SB 5LGTA 1OZ0A 2PI5A 1K33A 4BIUA 1VQKV 2X7RB 1S5HC 4JYCA 1QBZA 4P9PA 3AG3C 1NKDA 1V55C 4X88A 3SPHA 3T1CA 3CC7V 4TWKA 5EBLC 4UVCA 1R6NA 2DYRB 3W7TA 1I5YA 3FB8C 1WLEA 3D3IA 2WLJA 5EBMC 1SESA 3AG1B 1HWYA 3AG4C 3M99B 5HFLA 1KKDA 3LUTB 2IH1C 4UV9A 3LDCA 4JASA 4R7CA 3W7XA 4R8CA 1E1RG 2WPDG 4N21A 5KUKA 1VQ9V 3K06A 2EINC 1NH2B 2WAMA 1GKFA 1GO3F 4H37A 2HJFC 3DTUB 3GWOA 3OUSA 2XOKG 3X2QC 4OXSA 1ENVA 4MVRA 3VBBA 4P2ZA 5GW7A 1I5XA 5DM6V 1Q82W 3ZRVA 3JD0A 4PA9A 5B1BB 1UJWB 1COWG 2LFSA 5L3EA 1F23A 3ZMSA 1OCOB 2EJRA 2P67A 3ZN0A 1S3JA 2XASA 1V55B 2QM7A 1L1FA 2W0FC 3K9AA 2DWDC 2X0LA 3ABMB 4MVQA 1VQPV 3AG4B 3OMNB 5H6QA 3ZRWB 3LNMB 5IYBO 5LHIA 3ZN1A 3QO7A 3LSQA 1KD1W 4PA7A 3ZMTA 4KFMA 3IGAC 1VQLV 4Z1MG 2WLLB 4MS2A 1NH2D 1OCZB 3X2QB 3PJSK 1OHHG 4WFHA 3ETEA 1K92A 2LFRA 1YSCA 5LGNA 1YI2V 2OTLV 1CEZA 1NR1A 2ZDIA 4ZBMA 4MTOA 3LSSA 4PDVA 2EILC 5LGUA 2WLKA 3ASNC 2HFEC 1Y66A 2B1IA 4Q20A 4UV8A 2Z5UA 5IY5B 3UKMA 4WCEV 1QR8A 3EFFK 5CBGA 4E2LA 4WFGA 5IYCO 5B1NA 2M7WA 1CP9A 3FB5C 3QO5A 3JCZA 3BEHA 3SYOA 1F4MA 4GX2A 1K9MW 3OEHG 1ROPA 3CCVV 4ASUG 2H8PC 2ITDC 3E8FA 1YIJV 1RPOA 4JAUA 3E8BA 4UXNA 3WFVA 1W2BU 4QNHB 1R73A 1PNMA 4BW5A 1BHBA 1S0VA 1W0JG 4CZZA 1QR9A 3K03A 4QPKA 1THZA 1YTFB 5KA6A 5B1AC 1N8RW 1M57B 2ITCC 3FYEB 4RUEA 4MT8A 2XAFA 1KP2A 2Q68A 3KG2A 2IU3A 1S77D 2R9IA 3I56V 1KC8W 1VQ4V 4WFAV 3ZJZA 1FS0G 3ZRXA 3E8HA 2IJJA 4WFEA 2EZOA 4JPRA 4RAIA 4J9ZB 2F43G 3ASNB 2Y48A 1FFTB 1JPXA 4KP4A 2W6IG 1G8MA 1K7DA 4GT1A 4QE7A 4JTCB 3ZMVA 2EIKC 3OR7C 4LP8A 2QTOA 3ZMUA 2DQ0A 1KQSU 1DF5A 1KP3A 1VQ5V 4N23A 2V7QG 4MW8A 2XAQA 3AEIA 1H8EG 3SPCA 4DO2A 3K79A 1K4CC 4MVUA 1YTFD 2IH3C 5B1AB 4I5SA 2DYSB 2B1GA 3OGCC 4TT3G 2EIMC 3G71V 1K4DC 4XDJA 3F5WC 1R3JC 4BIZA 4YXWG 3ZRWA 3CCJV 3CD6V 2Q67A 3SYPA 2Q69A 1K97A 4KUMA 4PDLA 3JD4A 5C93A 4MVSA 3JD3A 4U7NA 1R3KC 3ETDA 5CN0A 3W7UA 2WLLA 2R9RB 3F7VC 2WLNA 4JF3A 1RM1C 2Y69B 3K0DA 3E35A 2EIKB 2KB1A 4MVMA 2JEXA 3E83A 2JIZG 3JD1A 4UUJC 1F51A 1Q81W 3ABLC 1MSWD 1JVMA 3T4DA 4ZKIA 4MSWC 4X89A 5DN6G 3NXSA 1JJ2U 1F4NA 2GHYA 3AG3B 3OFNG 4J9YB 4WF9V 1VQNV 5LBQA 4R6ZA 2ZQMA 5CMUA 3SPGA 1FXKC 2ZR2A 5IDJA 3SYCA 1AROP 2X6BA 2C2AA 2QM8A 5IYDO 4WFBV 1EBOA 3R65A 1OCRC 1V54C 2EIMB 2WSSG 5CA3A 2Z3YA 2JJ1G 1J95A 2ZXWC 1NVPB 1QLNA 1PL0A 1AI4A 2XAHA 4F4LA 1PD3A 3SJQC 3SYQA 1DTOA 4GCZA 1FXHA 5LHGA 2EINB 1K5QA 1QLEC 1E1QG 4HYOA 4HZ3A 1AI6A 1MOFA 3RBZA 4WFFA 4LBEC 1AI7A 2QE7G 1FXVA 3ABTA 4GX1A 3LDEA 1Q7YW 5BZBA 1H38A 5CBFA 2X6AA 3SPJA 1SERA 4DXWA 3CCSV 4FMTA 4FK5C 5B1OA 1YJWV 1AR1B 3T4ZA 1M90W 3MHSC 4XDKA 1WPXA 1H2GA 2WLIB 2GSMB 1P4RA 2DQ3A 1OCCC 1BHAA 2MK3A 3CCMV 5EC2C 2B5UA 1QCEA 1H8HG 2QA4V 1OCRB 1R3IC 3CCQV 1M9NA 1NVPD 1YJNV 2V1DA 3SYAA 1RPRA 3ABKC 5EBWC 2IJHA 3ZIAG 3FB7C 2OCCC 3ASOC 1NR7A 4LCUC 4L87A 3DGEA 1IXMA 3K3WA 4RUFA 3CCLV 3ETGA 2HR3A 2Q6AA 3TCUA 4JGSA 4CBCA 1SETA 3OE7G 2JDIG 1JX9A 1M56C 4MVZA 4QPJA 5B3SC 4MTXA 1K34A 4PA4A 4QE9A 1S76D 2HVJC 5EC1C 1VQ6V 3CXCU 3RVZA 4UVAA 4MW3A 2EILB 1AI5A 4PDMA 1YHQV 3EHBB 1GMGA 2DYRC 2XAJA 2YEVA 3B77A 3F7YC 2EZPA 3ZRSA 3AG1C 3LDDA 2ATKC 1W0KG 3I55V 3CCUV 4XBFA 3IFXA 2A9HA 2X6CA 5J9PC 2LP7A 1VQOV 2PI4A 1P7BA 2P7TC 2IW5A 4R50A 3ABKB 2HG5C 4GX0A 3W7SA 3QO8A 3WG7C 5L3FA 2P6JA 2OCCB 2NLJC 4QIWF 4JYBA 1Y4MA 4TSFG 1SRYA 1NBMG 1R6KA 4RQFA 3CPWU 3A0RA 3ZCCA 4JTDB 5LHHA 2OTJV 2D3OW 3E86A 2QEXV 3SPIA 3AG2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQS U;  3CCE V;  1VQN V;  1N8R W;  1VQ5 V;  1QVF U;  1VQ9 V;  1Q7Y W;  1YJ9 V;  4WFB V;  2QEX V;  3CCL V;  1S72 V;  1VQK V;  1K8A W;  1VQ7 V;  3I55 V;  1VQP V;  3CCS V;  3CCU V;  1YJW V;  1KC8 W;  3I56 V;  1VQO V;  3G4S V;  1M90 W;  3CC7 V;  3CC2 V;  1VQ4 V;  1VQ8 V;  1VQM V;  3CMA V;  4WFA V;  4WCE V;  1K73 W;  5DM6 V;  1Q82 W;  1KD1 W;  3CCM V;  1VQL V;  1Q81 W;  1VQ6 V;  3CXC U;  3OW2 U;  1YIT V;  1Q86 W;  3CC4 V;  1K9M W;  3CCV V;  3G71 V;  1YIJ V;  2QA4 V;  3CCQ V;  1M1K W;  3CCR V;  3CPW U;  1NJI W;  1W2B U;  1QVG U;  1JJ2 U;  1R73 A;  2OTJ V;  3CCJ V;  1YHQ V;  4WF9 V;  3G6E V;  3CME V;  1YI2 V;  1YJN V;  2D3O W;  2OTL V;  3CD6 V; 
#chains in the Genus database with same CATH topology
 3AK2 A;  5B1B C;  4IIJ A;  3DC5 A;  3GB7 C;  5IJ9 A;  5LXT A;  3CSX A;  3FYI B;  2UUC O;  2IJK A;  5TIS Z;  4AHC A;  1JOY A;  2HLD G;  2P90 A;  3HB3 B;  3ABM C;  2QKS A;  3FB6 C;  4NKG B;  2R9A A;  3ABU A;  3WG7 B;  1OCZ C;  2PYL A;  3C3S A;  3K9S A;  4H13 B;  1MG1 A;  3VQV A;  3CC2 V;  3DXR B;  3CMA V;  3GWK C;  3B8N A;  4IIJ B;  4G28 B;  4LFA B;  1GM9 A;  1DF4 A;  5HFM A;  3D36 A;  5A2Q N;  5DEC A;  3K0G A;  4NTX A;  3RW0 A;  4JI2 B;  4PA6 A;  3TK1 A;  3W7W A;  1D5A A;  2A0L A;  2FML A;  3B8M A;  4EB6 B;  4KHP B;  2QWR B;  4JI0 B;  2QKC A;  3H1J H;  2BOB C;  1I08 A;  1MNG A;  3H9V A;  1GK9 A;  4DV1 O;  4MTF A;  1ZL8 A;  5FNV A;  4MVO A;  1K5S A;  1BGY H;  3JD2 A;  3RWR D;  1URF A;  3JAK A;  5GTI Z;  2F66 C;  2HHH B;  4FM0 A;  1PNK A;  5KA5 A;  2QWN B;  1M4U A;  4GX5 A;  4P30 A;  4UVB A;  2OWO A;  4NB5 A;  4RWU A;  5FL7 G;  1QLE B;  4RQE A;  1K3E A;  2F4V B;  3FKS G;  4J11 A;  1VQM V;  2UUB O;  1YF2 A;  2UXN A;  3E2E A;  1PNL A;  1WP8 A;  1FAF A;  1WA8 A;  1Q86 W;  2XAG A;  2YS8 A;  4DYL A;  1XQ8 A;  1QVG U;  3CE2 A;  1B3Q A;  4FLW A;  2GBO A;  5KHI A;  2DYS C;  3U11 A;  1FYJ A;  4AIL C;  1ZL8 B;  2UXX A;  3OUF A;  4LF4 O;  2AZ0 A;  4YIP A;  2ZNI A;  3JAK B;  1BMF G;  2RMK B;  2EX3 A;  1BE3 H;  3IC7 A;  4B3T O;  3ASO B;  2EIJ B;  2YID A;  3OT7 A;  4I55 A;  4RO2 A;  3H01 A;  2NNU A;  1KUQ A;  4BR6 A;  3HKE A;  1EFR G;  2Y0I A;  1M56 B;  4CC6 A;  1NTK H;  1XMQ O;  1S5H C;  3BHP A;  1QBZ A;  3CRQ A;  4X88 A;  1HW7 A;  1O9G A;  3T1C A;  1IBM O;  4TWK A;  4UVC A;  4ABM A;  1R6N A;  3W7T A;  4B3M O;  2QTS A;  5KX5 A;  2WLJ A;  5EBM C;  1P49 A;  4O2A A;  5HFL A;  1D2D A;  5GON B;  1XEQ A;  4NXM B;  2IH1 C;  4UV9 A;  3LDC A;  3W7X A;  2UXD B;  1EN4 A;  2EUL A;  1NH2 B;  2WAM A;  1KMI Z;  5LP6 C;  4H37 A;  4I55 B;  3GWO A;  2BTQ A;  2XOK G;  3TJT A;  3JAR B;  4OXS A;  1ENV A;  3HKE B;  1LUV A;  1WN7 A;  4LF6 O;  4P2Z A;  4X64 O;  2K9P A;  3JAS A;  1QQC A;  1GN3 A;  1UJW B;  4GKK B;  1COW G;  1AP6 A;  2LGW A;  3ZN0 A;  1S3J A;  1TAE A;  1V55 B;  2YIB A;  4IGG A;  1GRJ A;  2DWD C;  2P5O A;  5KX5 B;  2CGO A;  4O2A B;  1Y74 A;  2Y4T A;  1Q5O A;  5H6Q A;  3ZRW B;  5KHH A;  3HR0 A;  5EYP B;  2ZIN A;  2UUC B;  2XUM A;  3L74 H;  4PA7 A;  1VQL V;  1ZUQ A;  4Z1M G;  2E74 B;  2BTQ B;  1OHH G;  4WFH A;  1K92 A;  2LFR A;  3N2K A;  5LGN A;  1N4C A;  5J2T A;  3JAS B;  1NR1 A;  2ZDI A;  4ZBM A;  4MTO A;  2ZT9 B;  3LSS A;  5LGU A;  2EIL C;  2WLK A;  1ZAU A;  4Q20 A;  2BE3 A;  4UV8 A;  4UFZ A;  1SQB H;  3EFF K;  3IJ4 A;  5CBG A;  5IT9 N;  2ILM A;  3SYO A;  1F4M A;  2KKW A;  4FVM A;  4GX2 A;  3E8F A;  3WFV A;  1FFX B;  3BRC A;  1PNM A;  1S0V A;  4X1K A;  4CZZ A;  5KA6 A;  2ITC C;  4RUE A;  4MT8 A;  2XAF A;  3JAL B;  3LSU A;  2A7W A;  2UXB O;  2R9I A;  1KC8 W;  3N2K B;  3BFR A;  3R66 A;  4WFA V;  1BQZ A;  3ASN B;  1JPX A;  4DV1 B;  2W6I G;  4QE7 A;  2EIK C;  5JVD A;  4LP8 A;  3ZMU A;  1WB7 A;  1SC5 B;  1VF7 A;  2V7Q G;  4UB6 Z;  2JGU A;  4I7Z B;  2WA3 A;  3P3P A;  3DSQ A;  1G6U A;  4X1K B;  5B1A B;  1T5E A;  4I5S A;  3G6B A;  5IYZ B;  2UUB B;  1G1X B;  2B1G A;  1YZB A;  1Q6H A;  5JJE B;  3A0H Z;  4BIZ A;  4YXW G;  2Q67 A;  3JD3 A;  1R3K C;  2DJV A;  4LFB B;  5CN0 A;  3F7V C;  5KAF Z;  1NT2 B;  4GYC B;  1CXZ B;  2F93 B;  1ZLZ A;  5JH7 A;  1MSW D;  4FLV A;  4ZHQ A;  4CS4 A;  5DN6 G;  3NXS A;  4J7J A;  4B3T B;  4QGP A;  2GHY A;  4K0K B;  4WF9 V;  2ZR2 A;  3SYC A;  4X65 O;  1ARO P;  4EFB A;  5IYD O;  3UT5 B;  1OCR C;  2EIM B;  5CA3 A;  2JJ1 G;  4DV7 O;  2XAH A;  3J7A U;  4TOI A;  3SYQ A;  4GCZ A;  1SF9 A;  1IBM B;  3RFR A;  1IZ3 A;  4JI3 O;  2UXC O;  5LHG A;  1SQV H;  1QLE C;  4B3M B;  4F6R B;  1E1Q G;  1XMO O;  2N05 A;  3B2E E;  1SS3 A;  2VWK A;  4DXW A;  5C8Y B;  1YJW V;  2Q73 A;  1WPX A;  3TGU H;  2GSM B;  1KU9 A;  3GVM A;  4KL1 A;  1IBK O;  2QA4 V;  1R3I C;  1TA8 A;  2CTQ A;  1YJN V;  2V1D A;  3SYA A;  1DGS A;  3ZIA G;  3ASO C;  4LCU C;  3ETQ A;  4JYY A;  4RUF A;  3CCL V;  3ETG A;  2Q6A A;  5AG2 A;  1N32 O;  3OE7 G;  1TGO A;  4X20 A;  1M56 C;  4TV9 A;  2LQT A;  1S76 D;  4ZI7 A;  1RSO B;  5J2U A;  1AI5 A;  4LFC O;  4PDM A;  1YHQ V;  1GMG A;  4YIO A;  1U96 A;  4DV6 O;  4UB8 Z;  4XBF A;  3IFX A;  2X6C A;  1P7B A;  2P7T C;  2IW5 A;  4Z2W A;  3L72 H;  4LFA O;  1WPB A;  1SA0 A;  3H1L H;  4UCR A;  1R6K A;  3CPW U;  3A0R A;  4JI2 O;  4X20 B;  4TV9 B;  2QEX V;  2N74 A;  2UU9 O;  4KHP O;  3UCS C;  4JI0 O;  4ZI7 B;  5J2U B;  1JA8 A;  1HNZ O;  4J7K A;  4YJ3 A;  1I0H A;  1S5L Z;  2ZNJ A;  3MHH C;  3P30 A;  4YJ2 B;  2HHH O;  2AHZ A;  2CK3 G;  3CME V;  2AHY A;  5JQG B;  2P06 A;  1XHZ A;  4DV2 O;  2WLI A;  4JAV A;  1ZX3 A;  1SA0 B;  4KXR A;  2UUA O;  1FXK A;  2VRZ A;  2ADQ B;  3E89 A;  3OM3 B;  3L73 H;  4FLT A;  4TQD A;  1TVK B;  4TQF A;  3STL C;  2OYQ A;  3RYH B;  2DOS A;  3CWB H;  4YJ3 B;  4UCS A;  2OIG A;  1GTO A;  5IJ0 A;  2Y0P A;  4I50 A;  3QNE A;  4JV5 B;  3ML0 A;  4G27 B;  4I9W A;  3OAA G;  4PEL A;  3WB2 A;  1BL8 A;  3A2F A;  1FXK B;  1JR9 A;  2YUA A;  1N34 O;  2HKO A;  1V54 B;  1HNX O;  2ZXW B;  2ZDI C;  4PD4 F;  3BAA A;  4NTW A;  4JI4 O;  5H6R A;  2FTK A;  4P9O A;  5L3D A;  1L0N H;  3JAW A;  4UCO A;  1PKX A;  1MZF A;  1Z5W A;  4DV7 B;  5IJ0 B;  4DV0 O;  2OIE A;  2RDC A;  2O57 A;  4D6T H;  3CC4 V;  3K5M A;  4I50 B;  2ZKO A;  1FD9 A;  2YSU B;  4JI3 B;  2UXC B;  3CCE V;  1XNR O;  3E22 B;  1MAB G;  1OCC B;  1Q6I A;  1YVW A;  1XMO B;  3VQW A;  3OR6 C;  1GM7 A;  3ZHR A;  1QU7 A;  4IL6 Z;  2EBO A;  2HVK C;  2K1E A;  3MDS A;  2BSK B;  3JAW B;  4OGQ B;  2JK5 C;  2JJ2 G;  2ZR3 A;  1SQQ H;  2N04 A;  2PTM A;  4WBN A;  1IBK B;  5B3S B;  5LGT A;  1OZ0 A;  2PI5 A;  1SQX H;  3JAM N;  3RGB A;  4X62 O;  5EBL C;  2AZ2 A;  5EZY A;  2DYR B;  1N32 B;  1D5N A;  1I5Y A;  3D3I A;  3M7M X;  3AG4 C;  4EB6 A;  3LUT B;  4JAS A;  1E1R G;  2WPD G;  4PHZ A;  4N21 A;  4LFC B;  1VQ9 V;  3THO A;  5LMN O;  1GKF A;  4OPA A;  4JAA A;  3SGI A;  2ZE7 A;  3DTU B;  4UCV A;  4DV6 B;  4B7K A;  4MVR A;  4WBN B;  1H2M A;  2GUZ B;  4B3S O;  4U3F H;  1I5X A;  5GW7 A;  3ZRV A;  4FLX A;  1F23 A;  2Q8V A;  1N36 B;  3TXS A;  2QM7 A;  2ZE8 A;  1L1F A;  2W0F C;  1BS3 A;  5EZY B;  3K59 A;  3H1I H;  1P84 F;  1VQP V;  2UU9 B;  4DR3 O;  5E79 Z;  2CTR A;  3LNM B;  2VWJ A;  5LHI A;  3QO7 A;  1HNZ B;  1KD1 W;  3WB1 A;  2WLL B;  1H2K A;  3ZHV A;  2Q7E A;  3X2Q B;  3PJS K;  2Q0O C;  1YI2 V;  4IYI A;  1L8D A;  1UFI A;  4LH7 A;  4PDV A;  4DV2 B;  2HFE C;  1Y66 A;  2L35 A;  3QF7 A;  4NYK A;  4K8X A;  2UUA B;  2Z5U A;  1GAX A;  4IHJ B;  3SJB C;  5B1N A;  4PI2 A;  2M7W A;  1CP9 A;  3FB5 C;  3CRA A;  1K9M W;  3OEH G;  3CCV V;  4ASU G;  2H8P C;  2ITD C;  1W59 A;  3E8B A;  2QGN A;  1BHB A;  4BW5 A;  1THZ A;  4LFB O;  2RJZ A;  1N0J A;  1KP2 A;  2QWP B;  4FZ0 A;  1BZK A;  1PL4 A;  5GON A;  2JVD A;  4WFE A;  2QDO A;  2EZO A;  1LR1 A;  4RAI A;  4K0K O;  4GT1 A;  3JAR A;  3ZMV A;  1N34 B;  3QVN A;  3L70 H;  1YEW A;  2QTO A;  1KQS U;  1VQ5 V;  1HNX B;  4N23 A;  4YHH O;  1MSD A;  5EIB C;  3B4S A;  4MW8 A;  1V9P A;  2Q0A A;  1H8E G;  4JI4 B;  5JWP A;  3K79 A;  4MVU A;  1YTF D;  1Q43 A;  1SZX A;  3G71 V;  4XDJ A;  4DV0 B;  3ZRW A;  3ZX6 A;  3CD6 V;  3IC9 A;  4AI8 A;  5EYP A;  3JD4 A;  4I0X B;  2Q7G A;  4J42 A;  1LUW A;  2R9R B;  1XNR B;  4JF3 A;  1R6T A;  3K5L A;  4DK1 A;  1TUB A;  3B09 A;  3E35 A;  5FLX N;  1J5E O;  4MVM A;  1I94 O;  2BCC H;  1U97 A;  4ZKI A;  4MSW C;  4NTY A;  1BSM A;  2VQE O;  3OFN G;  3AG3 B;  4J9Y B;  4R6Z A;  2ZM6 O;  1FXK C;  5IDJ A;  3S3X A;  2C2A A;  2QM8 A;  4WFB V;  1EBO A;  1V54 C;  2Z3Y A;  2ZXW C;  1QLN A;  1FFX A;  1PL0 A;  4F4L A;  1PD3 A;  4X62 B;  1DTO A;  1FXH A;  2EIN B;  3JAL A;  3JSL A;  1TUB B;  4FM1 A;  4HYO A;  3RBZ A;  3A8T A;  3QG5 A;  2PF4 E;  1VIB A;  2RCV A;  4GX1 A;  4W4K A;  1Q7Y W;  2CGN A;  1H38 A;  2IBZ H;  5CBF A;  1SER A;  3CCS V;  4FMT A;  2FYU H;  3T4Z A;  2CTP A;  5LMN B;  4XDK A;  3FAV A;  3MAQ A;  2DQ3 A;  1OCC C;  1M5I A;  5FPR A;  2LW1 A;  1QCE A;  2NR5 A;  5LA6 B;  4B3S B;  4CH3 A;  3CB2 A;  5KHJ A;  2YI8 A;  3FB7 C;  2OCC C;  3DGE A;  1IXM A;  1WP7 A;  3K3W A;  2B9Z A;  4I9Q A;  5IYZ A;  4I4T A;  5BXZ A;  4MVZ A;  5B3S C;  4DR3 B;  4PA4 A;  1VEW A;  3RYC A;  4AQY B;  3RVZ A;  2QWO B;  3RYF B;  3FAV B;  2ZIM A;  2DYR C;  2XAJ A;  3B77 A;  1OV9 A;  2ATK C;  3AG7 A;  1RFY A;  4JYA O;  1W0K G;  3I55 V;  1AP5 A;  5J9P C;  5LYJ B;  3BVO A;  3ABK B;  4U3J B;  3O9O A;  3WG7 C;  3NR7 A;  2NLJ C;  3K57 A;  2YXL A;  1Y4M A;  4TSF G;  4F6E A;  1A32 A;  1SRY A;  1NBM G;  5H5N A;  4I4T B;  4K8Z A;  3UT5 A;  2ODM A;  3E86 A;  3ZS8 C;  5H2F Z;  3RYC B;  1M93 A;  2ETN A;  4W4L A;  1S72 V;  2ZE5 A;  4JV5 O;  3JYC A;  4HNA B;  2H94 A;  2WLM A;  4QJF B;  4F6R A;  1I7F A;  2CAZ C;  4X8A A;  4LWS A;  4DK0 A;  1K73 W;  1O9H A;  2Y4U A;  4FM2 A;  4H33 A;  2HP8 A;  1SZT A;  4BWA A;  2W6J G;  4MTG A;  1NJI W;  5C8Y A;  1NQT A;  1NTZ H;  2JGD B;  5GTH Z;  2CUG A;  2KSD A;  4EKW A;  4FJC C;  1X4T A;  2LW7 A;  4YHH B;  3AG2 B;  2WLH A;  1AJQ A;  1N33 B;  3VOU A;  5BR8 O;  1JQ0 A;  4LWS B;  1GM8 A;  2F95 B;  3SDL A;  1DLB A;  5FPO A;  4J41 A;  1R3L C;  3ABL B;  5EK0 A;  1RSO A;  3D3Q A;  5DED A;  4CS2 A;  5E1A C;  3QTC A;  2DMX A;  3KKY A;  3KZI Z;  3OW2 U;  4E4E A;  1B6Q A;  1AJP A;  2PUS A;  1J5E B;  2XTA A;  1I94 B;  3C90 A;  3HPL C;  4PDR A;  3CYO A;  5L3B A;  5KMG A;  4DR7 O;  1PPJ H;  2VQE B;  1YJ9 V;  2GV9 A;  2EIJ C;  2KG7 A;  2AW9 A;  3RVY A;  2ZM6 B;  4DR4 B;  5F2V O;  3H1K H;  2ADP A;  1CPY A;  2DWE C;  2YC0 A;  3TET A;  1MZE A;  4FIP C;  1Z2G A;  4JTA B;  4JI6 O;  3CCR V;  4DV5 O;  4HAM A;  3STZ C;  4U7O A;  3SJC C;  1IXB A;  4O2B A;  2ZD9 A;  1MA1 A;  4YJ2 A;  2WWW A;  3OEE G;  1JFF B;  1Q8I A;  5KMG B;  2F1M A;  5JQG A;  1N36 O;  2KG7 B;  3T2M A;  4LF5 O;  3ZMZ A;  2YIB D;  3CP1 A;  2ZCE A;  5D5P A;  3P32 A;  2EJ7 A;  4LC1 A;  3N2G A;  1H2L A;  2A06 H;  1TVK A;  1K33 A;  1VQK V;  2X7R B;  3RYH A;  4K3A A;  2PYJ A;  4JYC A;  3AG3 C;  1V55 C;  1GN4 A;  3CC7 V;  4DUY O;  4CH4 A;  2HEP A;  4O2B B;  2P4K A;  1IX9 A;  3JCU Z;  1SES A;  4TUY B;  1HWY A;  3M99 B;  1MMM A;  2EIN C;  2HJF C;  3OUS A;  1L0L H;  4Q6G A;  4FFK A;  2E76 B;  4H0L B;  4JYA B;  2GTA A;  3N2G B;  2LJ2 A;  5DM6 V;  4O4I B;  1N0N A;  4PA9 A;  3FX7 A;  2LFS A;  5L3E A;  4LH6 A;  3ZMS A;  1OCO B;  2P67 A;  1Q3E A;  4DR2 B;  3Q4H B;  2ARH A;  3UQ8 A;  1IVS A;  3K9A A;  4DRX A;  1Z5V A;  3B40 A;  4MVQ A;  2VQF B;  3DC6 A;  3ZMT A;  4KFM A;  4JZ2 A;  3IGA C;  2CE4 A;  1H2N A;  3E22 A;  3ZED A;  2Q4P A;  2WA4 A;  3CRR A;  3ETE A;  1XUQ A;  2YIC A;  2OTL V;  2A3Q A;  1HNW O;  2Q9L A;  4DV3 O;  4A5U B;  4O4H B;  1GH6 A;  3ASN C;  4JZG A;  2B1I A;  2BSK A;  5IY5 B;  4WCE V;  1QR8 A;  4ZOL B;  1NZ6 A;  1R1B A;  4WFG A;  4DRX B;  4FLU A;  1YXB A;  3JCZ A;  1SQG A;  3C3T A;  1WJZ A;  1W2B U;  1R73 A;  1W0J G;  1YTF B;  4LF9 O;  5B1A C;  5B5E Z;  1M57 B;  4H44 B;  5BR8 B;  3L71 H;  1QNM A;  2IU3 A;  1S77 D;  3K58 A;  4NXN O;  4LF7 B;  1JMK C;  3E8H A;  4JPR A;  4J9Z B;  3G80 A;  4JI7 O;  5LOV A;  2F43 G;  1FFT B;  4GUN A;  1WAZ A;  4JTC B;  4X1I B;  5KAI Z;  2GUZ A;  1WNS A;  1DF5 A;  1KP3 A;  1Q90 D;  4ICG A;  3EVK A;  3CHX A;  4PV1 B;  2PZS A;  1EN5 A;  4DR7 B;  2JS3 A;  4O4J A;  1K4C C;  2EIM C;  3F5W C;  3H1H H;  3UO3 A;  3IAY A;  2CDY A;  4CC5 A;  1NI8 A;  1Y6X A;  4KUM A;  4L8J A;  4PDL A;  4JI6 B;  5C93 A;  4DV5 B;  4U7N A;  4DR1 O;  3ETD A;  2QR4 A;  3I5D A;  1VAR A;  2XT9 A;  5LOV B;  2WLL A;  5CA1 B;  2Y69 B;  3RYI A;  5LL6 Y;  2EIK B;  2KB1 A;  3WU2 Z;  1HR0 O;  3CXH F;  4OX9 O;  2JEX A;  2DE0 X;  3FFQ A;  2JIZ G;  1Q81 W;  4UUJ C;  3ABL C;  1JVM A;  3T4D A;  1JJ2 U;  5D5Q A;  4O4J B;  1FJG O;  4LF5 B;  1VQN V;  5LBQ A;  3SPG A;  5CMU A;  2DN9 A;  3CRM A;  4TV8 A;  4IHJ A;  2BTO A;  2X6B A;  3HKD B;  1J95 A;  3APO A;  4AQY O;  2F23 A;  3K5N A;  5IJ9 B;  5LXT B;  4DR5 O;  4DUY B;  3WB0 A;  4B08 A;  3RYI B;  2E5L O;  4WFF A;  2YI9 A;  2Q7H A;  2QE7 G;  1DK1 A;  1FXV A;  3ABT A;  1XOU A;  1VMG A;  2X6A A;  5EIB D;  3OTO O;  1AR4 A;  1UPG A;  5B1O A;  1EN6 A;  1M90 W;  5IWA O;  3MHS C;  2R72 A;  1H2G A;  2AGA A;  1B06 A;  1BHA A;  4TV8 B;  3CRC A;  1OCR B;  5KHK A;  3CCQ V;  1NVP D;  4D7T A;  2IJH A;  2YDE A;  1NR7 A;  4L87 A;  1XBL A;  4J80 A;  2V4D A;  2VS0 A;  3TCU A;  2JDI G;  4NVP A;  1BQ0 A;  4QPJ A;  5JJN B;  1NTM H;  4QE9 A;  1HDJ A;  2HVJ C;  4I0X A;  4UVA A;  2G38 A;  3O65 A;  4GKJ B;  1XDC A;  1US6 A;  2YEV A;  3P3N A;  3F7Y C;  2EZP A;  1PV0 A;  5FNV B;  3S3W A;  3BAB A;  2CH7 A;  3LDD A;  4IT5 A;  1HNW B;  4DV3 B;  2RN9 A;  3CCU V;  2LP7 A;  1VQO V;  1Y67 A;  4GX0 A;  3W7S A;  5BY1 A;  1KBH A;  1N33 O;  1XIL A;  2PGG A;  4JYB A;  3VQX A;  3CX5 F;  4UCT A;  3HKC A;  2IM9 A;  4RQF A;  4FFB A;  4JTD B;  3D8C A;  5LHH A;  2OTJ V;  1KYO F;  3T1H O;  4DV4 B;  1IBL O;  3KCX A;  3SPI A;  1EZJ A;  1WA8 B;  1OCO C;  1K8A W;  4DW0 A;  1LNQ A;  4LF9 B;  4B7E A;  1AJN A;  2YEV B;  4NXN B;  4LF8 O;  2CH7 B;  3J80 N;  2IJI A;  2JEU A;  4JI7 B;  4DUZ O;  1JCH A;  4PA3 A;  4DR4 O;  3OTF A;  4PI0 A;  5JCO A;  2QJ1 A;  3HKC B;  1AVM A;  5LA6 A;  4BAY A;  4FFB B;  3A0B Z;  4CS3 A;  1H2S B;  1HP8 A;  3RN4 A;  3T1Y O;  1VF6 A;  2LGQ A;  3APQ A;  5L3C A;  2Q5Z A;  4DR6 O;  4G2K A;  1YIT V;  1XL4 A;  3U10 A;  1G4Y B;  3E8G A;  5IY5 C;  2BOC C;  1RM1 B;  1KEC A;  3K08 A;  4LR3 A;  1E79 G;  2YXH A;  2ZIO A;  2A79 B;  3SR2 C;  4DR1 B;  5H9C A;  3G4S V;  3PN1 A;  5KUM A;  1VQ8 V;  3RYF A;  1M57 C;  3K04 A;  4CH5 A;  4UCU A;  1HR0 B;  4OX9 B;  1RP3 B;  5K1X A;  3ZHS A;  2OT5 A;  5LYJ A;  4U3J A;  5CBH A;  2W0X A;  1F7Y A;  1FJG B;  4XDL A;  5K1P A;  2XND G;  1KB9 F;  1XL6 A;  1IUR A;  2QKA A;  4FPP A;  1Y74 B;  2YIA A;  2DW4 A;  1XHX A;  2NN4 A;  4DR5 B;  4HNA A;  2CTW A;  4ZIB A;  1QVF U;  1ORQ C;  1X59 A;  5LMU O;  2E5L B;  3L9D A;  2IU0 A;  5L3G A;  1TUE B;  4YY3 O;  3OMA B;  1VQ7 V;  3OMI B;  5JJJ B;  5J2T B;  3OTO B;  3MD0 A;  3CJH A;  2JGD A;  5IWA B;  1B04 A;  3UM7 A;  4DR2 O;  3BCC H;  2Y69 C;  1ZWI C;  3UO2 A;  1M1K W;  4X1Y A;  2RQ6 A;  3BY6 A;  3CEI A;  4OPH A;  4JI5 O;  2QSA A;  3G6E V;  4DW1 A;  1YDX A;  1VP7 A;  4O4L A;  2VQF O;  1SKV A;  4BIU A;  3CS5 A;  4P9P A;  3RT3 C;  1NKD A;  3SPH A;  4C7U A;  1VF5 B;  2ZE6 A;  3ZBH A;  5ITZ A;  3FB8 C;  1WLE A;  1Y76 A;  3AG1 B;  3U0Z A;  4Z1V A;  1XNQ O;  1KKD A;  1QHT A;  1YCI A;  4R7C A;  4R8C A;  4B3R O;  1NS1 A;  2MW2 B;  3CJH B;  5KUK A;  3K06 A;  1NU1 H;  1GO3 F;  2FL4 A;  3KCY A;  4LF4 B;  3X2Q C;  4X1Y B;  5JVD B;  2YXY A;  3VBB A;  3FD9 A;  4FZ1 A;  1Q82 W;  4O4L B;  3JD0 A;  5B1B B;  4EEQ A;  2EJR A;  2XAS A;  3ZHQ A;  5ITZ B;  2X0L A;  4FLZ A;  3ABM B;  1Y76 B;  3T1H B;  1IBL B;  4LF7 O;  4JI8 O;  4X9Q A;  3AG4 B;  1BT8 A;  3OMN B;  1XMQ B;  1SQP H;  5IYB O;  3ZN1 A;  1KKC A;  3D36 C;  3LSQ A;  1FPO A;  1WB8 A;  2M6Y A;  2HJD A;  4MS2 A;  1NH2 D;  1OCZ B;  5CB4 A;  4LF8 B;  4X66 O;  1YSC A;  1CEZ A;  5JH7 B;  1JFF A;  1OJH A;  4JI1 O;  4ZHQ B;  4DUZ B;  4GLX A;  3K5O A;  2D2C B;  3AK3 A;  3UKM A;  4E2L A;  3BPZ A;  5IYC O;  4LF6 B;  3QO5 A;  4X64 B;  3BEH A;  2RNB A;  3T1Y B;  4K35 A;  1PP9 H;  1ROP A;  1YIJ V;  1RPO A;  4JAU A;  4UXN A;  4QNH B;  4DR6 B;  2JRI A;  1QR9 A;  3K03 A;  4QPK A;  5A9G A;  2QM4 A;  1N8R W;  3FYE B;  2E75 B;  5KLV H;  2Q68 A;  3JAT A;  5CB4 B;  1P7G A;  3KG2 A;  4TUY A;  3OD4 A;  3I56 V;  2Z0A A;  1PM9 A;  1VQ4 V;  3ZJZ A;  5BMV A;  1SQF A;  1FS0 G;  3ZRX A;  3BA8 A;  2IJJ A;  4FLY A;  1AR5 A;  1GN2 A;  2Y48 A;  4KP4 A;  1G8M A;  1K7D A;  2OCH A;  3OR7 C;  3OGI B;  3L75 H;  2DQ0 A;  2JS5 A;  4O4I A;  1S5J A;  1EZV H;  3HKB A;  1ZSP A;  2XAQ A;  3AEI A;  3G67 A;  3J81 N;  3ZHT A;  3SPC A;  4DO2 A;  3SJA C;  3Q4H A;  4CH6 A;  2IH3 C;  2DYS B;  2AXT Z;  3JAT B;  3OGC C;  4TT3 G;  1K4D C;  1R3J C;  3BA9 A;  3CCJ V;  3SYP A;  5BMV B;  2Q69 A;  1K97 A;  3EXA A;  4MVS A;  2GDS A;  2QWQ B;  2FB5 A;  3N27 A;  3W7U A;  4GZR B;  5LMU B;  2WLN A;  1RM1 C;  5LP6 A;  3K0D A;  4HBN A;  4YY3 B;  2UXB B;  3JSN A;  1AB3 A;  2E3C A;  3E83 A;  3JD1 A;  1F51 A;  3HKB B;  4BIO A;  4O4H A;  4X89 A;  1IDS A;  1F4N A;  2H3O A;  3VQY A;  2ZQM A;  3AK1 A;  5JCO C;  4ZOL A;  2XHB A;  4JI5 B;  3R65 A;  1Q6U A;  2F4V O;  2WSS G;  5B66 Z;  1NVP B;  1GN6 A;  3F5T A;  2L6L A;  1AI4 A;  1VF6 C;  2KQX A;  4LNU A;  3SJQ C;  4GKJ O;  1BCC H;  3TXQ A;  1K5Q A;  5LP6 B;  3ICX A;  4NR1 A;  2GTS A;  4J10 A;  4HZ3 A;  2R70 A;  1AI6 A;  1MOF A;  4EFE A;  4LBE C;  3M8A A;  1AI7 A;  1XNQ B;  3LDE A;  5BZB A;  3SPJ A;  4B3R B;  3LNN A;  4FK5 C;  1AR1 B;  3ZHU A;  2WLI B;  5KHG A;  1P4R A;  4X1I A;  2MK3 A;  3CCM V;  5EC2 C;  2B5U A;  1H8H G;  4DV4 O;  1M9N A;  1RPR A;  3ABK C;  5EBW C;  4LNU B;  2P22 C;  4BW9 A;  5CA0 A;  1JJO A;  4X65 B;  2HR3 A;  4IYH A;  4JGS A;  4CBC A;  1SET A;  1JX9 A;  1ZTE A;  4JI8 B;  1XRE A;  4MTX A;  1K34 A;  5IE9 A;  5EC1 C;  2PY5 A;  1VQ6 V;  3CXC U;  4NXM O;  4MW3 A;  2FKX A;  2EIL B;  2UXD O;  2LO1 A;  4PJ0 Z;  5CA1 A;  3EHB B;  4D7S A;  3ZRS A;  4X66 B;  3AG1 C;  2P4V A;  1XI1 A;  1AIL A;  4JI1 B;  2A9H A;  2PI4 A;  4R50 A;  4GKK O;  2HG5 C;  1FKA O;  3QO8 A;  5L3F A;  1EM1 A;  2P6J A;  2OCC B;  4QIW F;  5CA0 B;  3HKD A;  3ZCC A;  2D3O W;  4J7Z A;  3DXR A;  3AG2 C; 
#chains in the Genus database with same CATH homology
 1EZJ A;  5B1B C;  3GB7 C;  1OCO C;  3FYI B;  1S72 V;  1K8A W;  1LNQ A;  3JYC A;  2IJK A;  2H94 A;  1JOY A;  2WLM A;  2HLD G;  4QJF B;  2P90 A;  1AJN A;  3HB3 B;  2YEV B;  4X8A A;  1K73 W;  3ABM C;  2QKS A;  4H33 A;  1SZT A;  2IJI A;  2W6J G;  4MTG A;  3MHH C;  3P30 A;  3FB6 C;  2AHZ A;  2CK3 G;  1NJI W;  1NQT A;  2JEU A;  3CME V;  1JCH A;  2AHY A;  4PA3 A;  2WLI A;  3ABU A;  4JAV A;  3WG7 B;  1OCZ C;  1FXK A;  4EKW A;  4FJC C;  4BAY A;  3E89 A;  1MG1 A;  3OM3 B;  3CC2 V;  3CMA V;  3B8N A;  3AG2 B;  2WLH A;  4G28 B;  3STL C;  5L3C A;  1AJQ A;  1GM9 A;  1DF4 A;  4G2K A;  5HFM A;  3D36 A;  1YIT V;  1XL4 A;  3K0G A;  1G4Y B;  3E8G A;  3VOU A;  5IY5 C;  2BOC C;  1JQ0 A;  1RM1 B;  1KEC A;  3RW0 A;  1GM8 A;  3K08 A;  1GTO A;  1E79 G;  1DLB A;  4PA6 A;  3TK1 A;  3W7W A;  2A0L A;  1R3L C;  3B8M A;  3ABL B;  5EK0 A;  2A79 B;  3QNE A;  5H9C A;  3G4S V;  3ML0 A;  4G27 B;  5KUM A;  5E1A C;  1VQ8 V;  2BOB C;  1M57 C;  3OAA G;  4I9W A;  4PEL A;  1GK9 A;  3K04 A;  4MTF A;  1BL8 A;  1FXK B;  3OW2 U;  4MVO A;  1K5S A;  3JD2 A;  1B6Q A;  1AJP A;  2HKO A;  1V54 B;  2ZXW B;  3HPL C;  2OT5 A;  4PDR A;  2ZDI C;  3CYO A;  5L3B A;  1PNK A;  5KA5 A;  5CBH A;  1YJ9 V;  5H6R A;  2FTK A;  4P9O A;  2EIJ C;  4XDL A;  5L3D A;  3RVY A;  4GX5 A;  4P30 A;  1PKX A;  4UVB A;  2XND G;  1XL6 A;  5FL7 G;  1QLE B;  4RQE A;  1K3E A;  3FKS G;  1VQM V;  1CPY A;  2DWE C;  2UXN A;  4FPP A;  3E2E A;  3TET A;  1PNL A;  2DW4 A;  4FIP C;  1Q86 W;  2XAG A;  3CC4 V;  4JTA B;  3CCR V;  4HAM A;  3STZ C;  1QVG U;  2YSU B;  4U7O A;  2DYS C;  3CCE V;  1QVF U;  1ORQ C;  2UXX A;  1MAB G;  1OCC B;  3OUF A;  2ZD9 A;  2IU0 A;  5L3G A;  1TUE B;  3OMA B;  1VQ7 V;  3OMI B;  3OR6 C;  1BMF G;  1GM7 A;  2WWW A;  3OEE G;  2EBO A;  3MD0 A;  2HVK C;  2K1E A;  3IC7 A;  3ASO B;  3T2M A;  3UM7 A;  2EIJ B;  2Y69 C;  1ZWI C;  4RO2 A;  3H01 A;  2JK5 C;  2JJ2 G;  2NNU A;  3ZMZ A;  1M1K W;  2ZR3 A;  3CP1 A;  3BY6 A;  3G6E V;  1EFR G;  3P32 A;  1M56 B;  4LC1 A;  5B3S B;  5LGT A;  1OZ0 A;  2PI5 A;  1K33 A;  4BIU A;  1VQK V;  2X7R B;  1S5H C;  4JYC A;  1QBZ A;  4P9P A;  3AG3 C;  1NKD A;  1V55 C;  4X88 A;  3SPH A;  3T1C A;  3CC7 V;  4TWK A;  5EBL C;  4UVC A;  1R6N A;  2DYR B;  3W7T A;  1I5Y A;  3FB8 C;  1WLE A;  3D3I A;  2WLJ A;  5EBM C;  1SES A;  3AG1 B;  1HWY A;  3AG4 C;  3M99 B;  5HFL A;  1KKD A;  3LUT B;  2IH1 C;  4UV9 A;  3LDC A;  4JAS A;  4R7C A;  3W7X A;  4R8C A;  1E1R G;  2WPD G;  4N21 A;  5KUK A;  1VQ9 V;  3K06 A;  2EIN C;  1NH2 B;  2WAM A;  1GKF A;  1GO3 F;  4H37 A;  2HJF C;  3DTU B;  3GWO A;  3OUS A;  2XOK G;  3X2Q C;  4OXS A;  1ENV A;  4MVR A;  3VBB A;  4P2Z A;  5GW7 A;  1I5X A;  5DM6 V;  1Q82 W;  3ZRV A;  3JD0 A;  4PA9 A;  5B1B B;  1UJW B;  1COW G;  2LFS A;  5L3E A;  1F23 A;  3ZMS A;  1OCO B;  2EJR A;  2P67 A;  3ZN0 A;  1S3J A;  2XAS A;  1V55 B;  2QM7 A;  1L1F A;  2W0F C;  3K9A A;  2DWD C;  2X0L A;  3ABM B;  4MVQ A;  1VQP V;  3AG4 B;  3OMN B;  5H6Q A;  3ZRW B;  3LNM B;  5IYB O;  5LHI A;  3ZN1 A;  3QO7 A;  3LSQ A;  1KD1 W;  4PA7 A;  3ZMT A;  4KFM A;  3IGA C;  1VQL V;  4Z1M G;  2WLL B;  4MS2 A;  1NH2 D;  1OCZ B;  3X2Q B;  3PJS K;  1OHH G;  4WFH A;  3ETE A;  1K92 A;  2LFR A;  1YSC A;  5LGN A;  1YI2 V;  2OTL V;  1CEZ A;  1NR1 A;  2ZDI A;  4ZBM A;  4MTO A;  3LSS A;  4PDV A;  2EIL C;  5LGU A;  2WLK A;  3ASN C;  2HFE C;  1Y66 A;  2B1I A;  4Q20 A;  4UV8 A;  2Z5U A;  5IY5 B;  3UKM A;  4WCE V;  1QR8 A;  3EFF K;  5CBG A;  4E2L A;  4WFG A;  5IYC O;  5B1N A;  2M7W A;  1CP9 A;  3FB5 C;  3QO5 A;  3JCZ A;  3BEH A;  3SYO A;  1F4M A;  4GX2 A;  1K9M W;  3OEH G;  1ROP A;  3CCV V;  4ASU G;  2H8P C;  2ITD C;  3E8F A;  1YIJ V;  1RPO A;  4JAU A;  3E8B A;  4UXN A;  3WFV A;  1W2B U;  4QNH B;  1R73 A;  1PNM A;  4BW5 A;  1BHB A;  1S0V A;  1W0J G;  4CZZ A;  1QR9 A;  3K03 A;  4QPK A;  1THZ A;  1YTF B;  5KA6 A;  5B1A C;  1N8R W;  1M57 B;  2ITC C;  3FYE B;  4RUE A;  4MT8 A;  2XAF A;  1KP2 A;  2Q68 A;  3KG2 A;  2IU3 A;  1S77 D;  2R9I A;  3I56 V;  1KC8 W;  1VQ4 V;  4WFA V;  3ZJZ A;  1FS0 G;  3ZRX A;  3E8H A;  2IJJ A;  4WFE A;  2EZO A;  4JPR A;  4RAI A;  4J9Z B;  2F43 G;  3ASN B;  2Y48 A;  1FFT B;  1JPX A;  4KP4 A;  2W6I G;  1G8M A;  1K7D A;  4GT1 A;  4QE7 A;  4JTC B;  3ZMV A;  2EIK C;  3OR7 C;  4LP8 A;  2QTO A;  3ZMU A;  2DQ0 A;  1KQS U;  1DF5 A;  1KP3 A;  1VQ5 V;  4N23 A;  2V7Q G;  4MW8 A;  2XAQ A;  3AEI A;  1H8E G;  3SPC A;  4DO2 A;  3K79 A;  1K4C C;  4MVU A;  1YTF D;  2IH3 C;  5B1A B;  4I5S A;  2DYS B;  2B1G A;  3OGC C;  4TT3 G;  2EIM C;  3G71 V;  1K4D C;  4XDJ A;  3F5W C;  1R3J C;  4BIZ A;  4YXW G;  3ZRW A;  3CCJ V;  3CD6 V;  2Q67 A;  3SYP A;  2Q69 A;  1K97 A;  4KUM A;  4PDL A;  3JD4 A;  5C93 A;  4MVS A;  3JD3 A;  4U7N A;  1R3K C;  3ETD A;  5CN0 A;  3W7U A;  2WLL A;  2R9R B;  3F7V C;  2WLN A;  4JF3 A;  1RM1 C;  2Y69 B;  3K0D A;  3E35 A;  2EIK B;  2KB1 A;  4MVM A;  2JEX A;  3E83 A;  2JIZ G;  3JD1 A;  4UUJ C;  1F51 A;  1Q81 W;  3ABL C;  1MSW D;  1JVM A;  3T4D A;  4ZKI A;  4MSW C;  4X89 A;  5DN6 G;  3NXS A;  1JJ2 U;  1F4N A;  2GHY A;  3AG3 B;  3OFN G;  4J9Y B;  4WF9 V;  1VQN V;  5LBQ A;  4R6Z A;  2ZQM A;  5CMU A;  3SPG A;  1FXK C;  2ZR2 A;  5IDJ A;  3SYC A;  1ARO P;  2X6B A;  2C2A A;  2QM8 A;  5IYD O;  4WFB V;  1EBO A;  3R65 A;  1OCR C;  1V54 C;  2EIM B;  2WSS G;  5CA3 A;  2Z3Y A;  2JJ1 G;  1J95 A;  2ZXW C;  1NVP B;  1QLN A;  1PL0 A;  1AI4 A;  2XAH A;  4F4L A;  1PD3 A;  3SJQ C;  3SYQ A;  1DTO A;  4GCZ A;  1FXH A;  5LHG A;  2EIN B;  1K5Q A;  1QLE C;  1E1Q G;  4HYO A;  4HZ3 A;  1AI6 A;  1MOF A;  3RBZ A;  4WFF A;  4LBE C;  1AI7 A;  2QE7 G;  1FXV A;  3ABT A;  4GX1 A;  3LDE A;  1Q7Y W;  5BZB A;  1H38 A;  5CBF A;  2X6A A;  3SPJ A;  1SER A;  4DXW A;  3CCS V;  4FMT A;  4FK5 C;  5B1O A;  1YJW V;  1AR1 B;  3T4Z A;  1M90 W;  3MHS C;  4XDK A;  1WPX A;  1H2G A;  2WLI B;  2GSM B;  1P4R A;  2DQ3 A;  1OCC C;  1BHA A;  2MK3 A;  3CCM V;  5EC2 C;  2B5U A;  1QCE A;  1H8H G;  2QA4 V;  1OCR B;  1R3I C;  3CCQ V;  1M9N A;  1NVP D;  1YJN V;  2V1D A;  3SYA A;  1RPR A;  3ABK C;  5EBW C;  2IJH A;  3ZIA G;  3FB7 C;  2OCC C;  3ASO C;  1NR7 A;  4LCU C;  4L87 A;  3DGE A;  1IXM A;  3K3W A;  4RUF A;  3CCL V;  3ETG A;  2HR3 A;  2Q6A A;  3TCU A;  4JGS A;  4CBC A;  1SET A;  3OE7 G;  2JDI G;  1JX9 A;  1M56 C;  4MVZ A;  4QPJ A;  5B3S C;  4MTX A;  1K34 A;  4PA4 A;  4QE9 A;  1S76 D;  2HVJ C;  5EC1 C;  1VQ6 V;  3CXC U;  3RVZ A;  4UVA A;  4MW3 A;  2EIL B;  1AI5 A;  4PDM A;  1YHQ V;  3EHB B;  1GMG A;  2DYR C;  2XAJ A;  2YEV A;  3B77 A;  3F7Y C;  2EZP A;  3ZRS A;  3AG1 C;  3LDD A;  2ATK C;  1W0K G;  3I55 V;  3CCU V;  4XBF A;  3IFX A;  2A9H A;  2X6C A;  5J9P C;  2LP7 A;  1VQO V;  2PI4 A;  1P7B A;  2P7T C;  2IW5 A;  4R50 A;  3ABK B;  2HG5 C;  4GX0 A;  3W7S A;  3QO8 A;  3WG7 C;  5L3F A;  2P6J A;  2OCC B;  2NLJ C;  4QIW F;  4JYB A;  1Y4M A;  4TSF G;  1SRY A;  1NBM G;  1R6K A;  4RQF A;  3CPW U;  3A0R A;  3ZCC A;  4JTD B;  5LHH A;  2OTJ V;  2D3O W;  3E86 A;  2QEX V;  3SPI A;  3AG2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...