1QVGU

Structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1qvgU00
4WCEV 1NJIW 3CCUV 2OTLV 1YJ9V 1QVGU 1N8RW 1VQ5V 1VQ7V 3I55V 1JJ2U 4WF9V 3CC2V 1K9MW 3OW2U 5DM6V 2QA4V 1VQ6V 1VQKV 2D3OW 3CD6V 1Q81W 3G71V 1YITV 1YI2V 2OTJV 3CCRV 1KQSU 1VQ4V 1S72V 3CCJV 3CC4V 3CMEV 1R73A 3CMAV 4WFBV 1Q7YW 1KC8W 4WFAV 1YJNV 1YJWV 1Q86W 3CCVV 3G4SV 3CPWU 1VQNV 1VQMV 1M90W 1YIJV 1M1KW 1VQOV 1K8AW 1VQ9V 3G6EV 1K73W 3CCEV 3CCQV 3CCMV 2QEXV 3CCLV 1Q82W 1KD1W 1VQ8V 3CXCU 3CCSV 1W2BU 3CC7V 1QVFU 1YHQV 1VQPV 1VQLV 3I56V
chains in the Genus database with same CATH superfamily
1AP5A 3OMAB 1IVSA 4H0LB 4CS2A 4P9PA 1Q3EA 1WP8A 3ABMB 4JI5O 5DEDA 4FLZA 3IFXA 4LF8B 4R8CA 4CH5A 1YVWA 2Z0AA 3T4ZA 3S3XA 2KQXA 3JALB 3E2EA 1Y74B 5LA6B 2Y69B 3FX7A 2ZINA 1BQ0A 1IX9A 4JGSA 4DRXA 4A5UB 4FLWA 2WA3A 2D3OW 1P84F 4CC5A 2LW1A 4D6TH 1QLEB 4ZHQA 3U11A 1MG1A 4B3SO 1HWYA 1QR8A 1KB9F 3JSLA 4LF7O 3ZRWB 3D3IA 3SYAA 4FFBB 3NR7A 3A0BZ 4KUMA 4RO2A 4C7UA 2HJDA 1P7BA 3ZMZA 3B8MA 4DR3O 3SYPA 2LO1A 1R73A 3QO7A 4Z1MG 4MVZA 4W4KA 3AG7A 1H2MA 2LQTA 2Q8VA 5EZYA 2QWNB 1XBLA 2RJZA 3HKBB 3JAWB 3T2MA 1YHQV 1QLNA 3BA9A 2CTQA 4DR6O 2DOSA 3APQA 4ABMA 4TV9B 4RAIA 1F7YA 3CRAA 5IYDO 2B1GA 5LXTA 3S3WA 5FPOA 3ZN1A 4DV7O 4WFHA 4X1IB 4ZOLB 3G71V 4JYCA 2UXNA 3APOA 3QVNA 4X1KA 2GDSA 1ZSPA 1B06A 1THZA 3T1CA 3P3NA 2UUCO 4J42A 4J9ZB 3HKEA 4NKGB 4PA4A 4CH3A 4LFBO 2A9HA 3ASNB 2RMKB 1H8EG 4GKKB 5GONA 1OCRC 4HZ3A 2LFSA 4QNHB 4WF9V 3P30A 1UJWB 1ZL8A 1I94O 2L35A 2ZE5A 3F5TA 4DK1A 4L8JA 1RP3B 3CCVV 4AI8A 3JASB 3AG2C 5E1AC 1VF7A 2JS5A 4GX2A 3OT7A 1JCHA 4JYYA 2PUSA 1NQTA 4P2ZA 4DUZO 5EK0A 4IYIA 1BCCH 3BRCA 5BXZA 2P5OA 1XNQO 2QGNA 1FAFA 3RYFB 3D8CA 5CA1A 2QEXV 3A2FA 1HP8A 3CCSV 2BE3A 1AR1B 3DC5A 2VWJA 2AHZA 5LMNO 2ZM6B 3B8NA 2LJ2A 4DV1O 1K4DC 2XAJA 1GMGA 1NBMG 4LF5B 4UCTA 5B1BC 3VOUA 2IH3C 4PA9A 1GM7A 4BIUA 1SA0B 2O57A 5KHHA 2F1MA 2H94A 3HKDA 2JVDA 3GVMA 4EB6A 4ZIBA 1RFYA 2CTWA 5LL6Y 1G8MA 2B9ZA 3ETGA 2Q4PA 3ZCCA 4X66O 1MNGA 3ASOB 3I56V 3ZN0A 2UXCO 4MVUA 1EFRG 4UCRA 4UCSA 3X2QC 1PD3A 2OTJV 3T1YB 1N33B 4HNAB 2EJ7A 1DF4A 2PYJA 1AP6A 5CMUA 3JALA 2VQFB 4I55A 1Y74A 3VQWA 4E2LA 2H3OA 1DF5A 5EIBC 4WBNA 4K35A 3O9OA 5B3SB 4FM0A 2UU9O 5BR8O 4NXMO 4TUYB 2XNDG 2IJIA 2AXTZ 1UFIA 1FXKB 5IWAB 1VQ6V 3M7MX 3ZRWA 1QVGU 1NU1H 4FFBA 5H2FZ 3WU2Z 3N27A 3F7VC 2BSKB 2HHHO 4QE9A 3AG4B 1AILA 2H8PC 3OGIB 2WAMA 1HNWB 4LF4O 3BHPA 1AI6A 3OGCC 2JDIG 3JARA 4FLUA 2VQEO 1QVFU 1VQPV 3HKBA 3MHHC 5BZBA 2KKWA 3AG3C 4MW8A 1ZWIC 1D5AA 2ARHA 2XAHA 1WPXA 1K9MW 4PDMA 1X4TA 2W0FC 1TAEA 5ITZA 4TQFA 1NT2B 4X1IA 4JTCB 1E79G 4AQYB 4X88A 2F43G 4LF6B 5B66Z 1SKVA 4DUYO 1JR9A 2QWPB 2DWEC 4LH6A 2UUAO 1VEWA 1VQ5V 1SQBH 2QM8A 3B09A 5LBQA 3RN4A 1IBLO 4O4JB 1YDXA 2EJRA 4MTGA 1XHXA 3CWBH 2ODMA 3HKCB 2OIGA 3VBBA 4LCUC 3H1LH 3J81N 4FMTA 3IJ4A 2EIMB 3PJSK 1NS1A 1Z5VA 3CCMV 2Q0OC 1VQ8V 2JGUA 1A32A 2FTKA 3JASA 4JAUA 5JJEB 1XMOB 4H44B 5GTHZ 1R3IC 2IJKA 1VIBA 5IJ9A 3CEIA 1GO3F 1OV9A 2YS8A 4JI4O 1JFFA 2A79B 1KKCA 4D7TA 2QKSA 2V4DA 5JVDB 4YXWG 1FS0G 3K58A 1DLBA 1BSMA 4ZKIA 2A3QA 4MTFA 2CGNA 3OEHG 4U3JA 2M6YA 1GM8A 4RUFA 2AHYA 5JCOA 3RYFA 4TV8B 2R9IA 4TQDA 3H1HH 1I0HA 2QTSA 2FMLA 1N32B 2DYRB 3HB3B 3E22B 2A06H 5FPRA 3CRRA 3KKYA 4DK0A 1SA0A 3OMIB 5KHJA 5GW7A 4BIZA 1VQOV 3OUFA 1OZ0A 1AJPA 2F4VO 2YI9A 3CXCU 3CD6V 1YF2A 4BW9A 3ABKC 3M8AA 4G2KA 4F6EA 1VQ7V 4GCZA 3RFRA 4HAMA 2N05A 2PGGA 3SPJA 5DM6V 2QA4V 4PI0A 4AHCA 2ZQMA 3K57A 4B3MO 1BQZA 2BTQA 4JV5B 1N4CA 5JJJB 4X1YA 1QHTA 5C8YB 4HNAA 2CTPA 3KG2A 4X9QA 4BWAA 4JI3B 1HNZO 2E5LB 1V54B 4QGPA 4X62B 2HLDG 2KG7A 1R3KC 5FNVB 4FLXA 3K79A 1Z5WA 2E76B 3FAVB 1U97A 3RBZA 4KXRA 2ZT9B 1RM1C 4DW1A 2EX3A 1YIJV 2R9AA 1KYOF 3O65A 1TA8A 2QDOA 5H6RA 3K9SA 3LDCA 3H9VA 4JI6B 1BE3H 1XNRO 4XDLA 1FXKA 2NNUA 4OX9B 3E83A 1EBOA 2ZXWB 4JAAA 4PV1B 4W4LA 2BSKA 4DR4B 4CS3A 3GB7C 1GK9A 4TWKA 2OIEA 2ADPA 1XOUA 4FFKA 2YXYA 4QJFB 3JD3A 3ZHVA 4QIWF 1MZFA 3R65A 3K5NA 4LC1A 1YITV 1FYJA 2WWWA 1QQCA 4DR2O 4X20A 3DSQA 1G1XB 2F93B 4G27B 1K34A 2ATKC 1VMGA 3QTCA 3L9DA 4DO2A 4CH6A 2ZE8A 1FPOA 5CB4B 1HNXO 4N23A 1GN4A 1IBKB 4DV2O 3FB5C 4JPRA 5LMUB 1XMQB 4DV0B 2B5UA 4DW0A 3CCRV 3CC4V 2QKCA 3JD0A 1GTOA 3HKCA 1E1RG 1IZ3A 1O9HA 1IBMB 3H1JH 4GYCB 4DXWA 4I4TB 1K3EA 4ASUG 4NYKA 3F5WC 1LR1A 4JTAB 3L70H 4GKJO 1F4NA 1N34O 1OCRB 4JYAO 2GUZA 4CS4A 1COWG 4IHJB 3Q4HA 2IJHA 4YHHB 4DR5B 4YIOA 1TUBB 2ILMA 2FL4A 3ZHSA 3TETA 1KD1W 1P49A 1FJGO 3AG2B 5JQGB 1XDCA 1N36O 2OTLV 1NI8A 4JI2O 2QM7A 4TV8A 3C3SA 4FLYA 4YY3B 1SF9A 4R50A 2K1EA 3CSXA 2EILC 3BVOA 1AI4A 3E22A 3RYHB 4DV6B 1K4CC 3VQVA 4JI7B 3P3PA 2XHBA 1U96A 4LR3A 3A8TA 3RWRD 1IDSA 3K5OA 2OCCB 1FXHA 4NVPA 3IAYA 2F66C 5EIBD 2JJ2G 4WFFA 5CN0A 2QWQB 3K04A 5EC1C 1KQSU 3OUSA 4I9QA 4R6ZA 3MAQA 1AR5A 4IIJA 2W0XA 4TOIA 5JH7B 3T4DA 4DV5O 5J9PC 1KBHA 4QPKA 2YEVB 5C8YA 1OCZC 3ETEA 3GWOA 4R7CA 2Q6AA 5F2VO 4J41A 4PI2A 2HKOA 3E89A 2QWRB 3ABLC 4LF9O 1B04A 4J9YB 3JCUZ 3KZIZ 1P4RA 2JGDB 2ZR3A 1FFTB 3AEIA 4BIOA 3B77A 1AJNA 1Y4MA 2ZDIA 4B7EA 1JA8A 4JI1O 3SJBC 4ZBMA 2HG5C 4DV3O 2IU0A 4B3TB 4O4IB 1L0NH 1RSOA 1QU7A 1NJIW 5B1AC 4GUNA 4H33A 4JI8B 2WLIA 4JAVA 4MTXA 4P9OA 4X64O 4K0KB 4ZI7B 4L87A 2DWDC 3CRCA 3RT3C 3ZHTA 1KP2A 5BMVA 2UUBB 4F6RB 1HR0B 3OTOB 1GN6A 3IC7A 1Q6HA 3ZS8C 4UV9A 1VARA 2NN4A 4FLVA 1W2BU 1S76D 3CXHF 3ZIAG 1F51A 3LSUA 2BTOA 1XNQB 4XDKA 1F23A 1Z2GA 1IXMA 4LFAB 3JD1A 1VQ4V 2Q67A 4GLXA 2X6BA 4LF8O 2Y48A 1NH2D 3ZRXA 1AVMA 4PA6A 3TGUH 4O4HB 3CCLV 3ZJZA 4OPHA 4GX5A 4NTYA 2QKAA 2EBOA 4BW5A 5IYBO 2XAQA 2ZNJA 5CB4A 1JX9A 3CRQA 4I50B 4KHPB 1MABG 1YI2V 3WB2A 3K5MA 4WFBV 1MMMA 3QF7A 4PA7A 1TGOA 2YIBA 4IL6Z 1M90W 4FJCC 1K8AW 5FL7G 3G6EV 4Z2WA 3LSSA 2XAFA 1ZLZA 5L3GA 5IE9A 1M57B 4I4TA 1V55C 2C2AA 3NXSA 2A0LA 1H2KA 1B6QA 2EIKC 3ZHRA 3K0DA 2CK3G 1TVKB 2DYSC 4IHJA 1JMKC 1NH2B 3CE2A 3UKMA 1TUBA 2QM4A 1XI1A 1PM9A 3AK1A 1ZAUA 2Q7HA 2RDCA 5IJ0B 4I9WA 1SERA 4YIPA 5B1OA 2Q7EA 2ZR2A 4UVBA 3CRMA 3WG7C 1NR1A 2ADQB 4J10A 2E74B 4WFGA 3RYHA 2EIJC 5KAIZ 1SQGA 4NB5A 2X6CA 4LWSB 4DV4B 3ABMC 2WLHA 4FVMA 1MOFA 1GN2A 4LF4B 2Y4TA 2G38A 4JI0B 1YTFD 1XL4A 4GKKO 3SJQC 1NTKH 2E3CA 1HW7A 1Q5OA 3D3QA 1WAZA 4IT5A 1S77D 4PELA 5JH7A 1Y6XA 3JAMN 1GM9A 1M4UA 3B4SA 4UV8A 2GTSA 2YEVA 5LA6A 4K8XA 3DGEA 3TCUA 4DYLA 1PL0A 3ABKB 2Q69A 4U7NA 1CEZA 4PDRA 3THOA 1N0JA 2V7QG 1KC8W 5KA5A 3HR0A 3DTUB 3RVYA 5KLVH 4PJ0Z 4CH4A 2BCCH 2PF4E 2GTAA 4MVQA 2OYQA 5LP6B 1EN5A 2EZOA 3ETDA 3ML0A 2XTAA 4UVCA 3W7XA 4JZ2A 3UO3A 2ZM6O 1E1QG 4ZI7A 3B2EE 3VQXA 4LF5O 4UCUA 2XAGA 4O2BB 3CPWU 2CDYA 1Q90D 3QO5A 3KCYA 1M9NA 5L3EA 2B1IA 4I7ZB 4H13B 3QNEA 3ZRVA 4WCEV 2Y0PA 3JAWA 3I55V 3B40A 1IURA 1AJQA 4JYBA 4TV9A 1JJOA 2IU3A 4DR1B 3J7AU 4ZOLA 2LW7A 1PKXA 3T1YO 1N33O 1AROP 2DN9A 2Z5UA 3DC6A 1J95A 1W59A 5J2TB 2WLKA 2VQFO 1OCOB 2ZKOA 1ROPA 2PZSA 2PI4A 1EZVH 3CYOA 4UFZA 2R72A 1AI7A 4O2AB 3JD4A 2DW4A 3JYCA 4MW3A 1R6NA 4JASA 1I08A 1WA8B 5HFLA 1ZTEA 4CZZA 5K1PA 3ZMTA 3U0ZA 3L73H 3C90A 2ZNIA 5IWAO 3GWKC 4DR7B 3K08A 5JCOC 3CMAV 5A9GA 1BL8A 4XBFA 1R1BA 4EKWA 1TVKA 2GV9A 1HNWO 1MA1A 3OTFA 3G80A 3TXQA 3UO2A 3ICXA 2P90A 3BA8A 3ZEDA 1H2NA 1GH6A 2YSUB 1BT8A 3U10A 3ABUA 2Q73A 4D7SA 1YJNV 1I7FA 4J7JA 2YI8A 2NR5A 4O4LB 4AQYO 1S5HC 1KUQA 1M56C 3OR6C 1O9GA 5LOVB 3FKSG 4LF6O 2UXDB 4LWSA 2VRZA 5EYPB 3JSNA 4X65B 1GN3A 3EFFK 5LYJB 3WB0A 1FFXB 1SQQH 1XILA 3ETQA 1J5EB 1WB7A 2DQ0A 3D36A 2UXBB 5LHIA 2CGOA 1WP7A 4WFEA 5IY5C 1QR9A 3BEHA 2EINC 4UVAA 2XT9A 3BPZA 2ZIMA 1Q43A 1CP9A 5B3SC 1CXZB 1WB8A 1XMOO 4X89A 1T5EA 3OR7C 1KP3A 5KHIA 3L71H 4NXNB 5K1XA 1IXBA 3UM7A 4LNUB 3ABTA 2LGWA 4GZRB 1FXKC 1CPYA 1BMFG 2M7WA 2RN9A 3IC9A 5DECA 1OCZB 1JOYA 4BR6A 4MVSA 4TUYA 3ZMUA 5LP6A 2DMXA 3AG4C 3SGIA 1VF5B 2IJJA 1XREA 3QG5A 4FM1A 1OJHA 4PDLA 1Q7YW 2AZ2A 2FB5A 4FK5C 3BABA 2W6IG 3E8FA 3JAKB 2BOBC 4B3RB 4FLTA 3EXAA 5KX5B 5CBFA 2R70A 4LFCB 3N2KB 5EZYB 1TUEB 2EZPA 1FJGB 2WLLB 3MHSC 1N36B 2IH1C 4JV5O 1BHBA 4RUEA 5EBWC 2P06A 5L3FA 3CCEV 4JI2B 2WPDG 5H9CA 4Z1VA 5LXTB 2CUGA 2AGAA 1OHHG 5J2TA 4JI3O 4BAYA 3LUTB 4JTDB 2E5LO 2JK5C 4X62O 4FZ1A 1NTMH 2JEUA 4TSFG 4H37A 5L3BA 4UUJC 1SESA 1VF6A 1S5LZ 4O4JA 5CA3A 1K97A 4O2AA 1MSWD 3HKEB 2ZCEA 3T1HB 3SYCA 1WJZA 2MW2B 2ITCC 4JI5B 5DN6G 5KUKA 4FIPC 4JI6O 1GKFA 3FB7C 1DGSA 1LUVA 4OX9O 1YCIA 1GAXA 1FKAO 1PV0A 2LFRA 5JVDA 1H38A 2YIDA 4MVRA 4DR4O 1BS3A 3LDEA 3G67A 1H2SB 1Q6UA 2DYRC 4LP8A 3PN1A 4EEQA 4TT3G 3DXRB 5IYCO 3OE7G 4B3SB 1DK1A 2WLNA 4DV3B 4J7ZA 4LF7B 5CA1B 1XL6A 3F7YC 3K06A 2D2CB 5GTIZ 5KAFZ 3ZMVA 2DYSB 4I0XB 4DR3B 4YJ3B 3L72H 5LOVA 3JD2A 1ENVA 1OCCC 5D5PA 1VQKV 3HKDB 4PD4F 1IBKO 4KL1A 5LYJA 5LMUO 5B1BB 1XMQO 1FFXA 4DV0O 1W0JG 1H2LA 1YZBA 2QE7G 5IYZB 3WG7B 4DR6B 3RYCB 1NTZH 2CE4A 3W7WA 1EN4A 3ZHUA 1V9PA 1IBMO 2EIJB 5EBLC 4DV7B 2ZDIC 3E8HA 2AW9A 4MVOA 5FNVA 5CA0B 3W7UA 3OFNG 3JATB 4FPPA 3FAVA 3X2QB 3P32A 2UUCB 4I55B 4LFBB 3M99B 4LNUA 3SJCC 2Q5ZA 1G4YB 4YHHO 4DR5O 1S5JA 2WLJA 1SS3A 4EFEA 1WLEA 4I5SA 4WBNB 4HYOA 2ZXWC 1I94B 3FD9A 3UCSC 2PTMA 4FM2A 1NKDA 3G6BA 4QE7A 3IGAC 4YY3O 1EN6A 1AI5A 5A2QN 5KMGB 4DV6O 4JI7O 3JAKA 4DUZB 4CBCA 2MK3A 3E35A 3H1IH 1HDJA 2DJVA 5C93A 1Y76B 4J80A 1Q81W 5KX5A 1KMIZ 2FYUH 4J11A 3JARB 1FD9A 4FZ0A 3FYIB 2Q68A 5CBHA 2X7RB 3N2KA 1SQXH 3SYOA 5LMNB 1YSCA 1KU9A 1R6KA 4DV1B 2WLLA 3JCZA 2GSMB 2IM9A 3AG1C 4IGGA 3FYEB 1EM1A 5ITZB 2HEPA 3RYIB 2X0LA 2FKXA 3E8BA 3AG3B 3CX5F 3ZRSA 2JS3A 4X66B 3RW0A 3K3WA 1I5YA 2JRIA 3LNMB 2YXLA 1VQ9V 2P67A 1XQ8A 1NR7A 3VQYA 2UXCB 2LP7A 1N0NA 2LGQA 3LDDA 2X6AA 3BFRA 4B3TO 1GRJA 3N2GB 1S3JA 2K9PA 5L3CA 1S0VA 4JI8O 2R9RB 1G6UA 1BHAA 1UPGA 5JWPA 4K0KO 2JIZG 3FB8C 3RVZA 2JEXA 4RWUA 2UUBO 3RGBA 4Q6GA 3OTOO 1HR0O 5IJ9B 4YJ2B 1F4MA 5IDJA 2ZE7A 1US6A 1JFFB 1WNSA 1L1FA 3TK1A 2YICA 5JQGA 2OWOA 5B5EZ 2UU9B 4LBEC 5BR8B 4NXMB 3DXRA 1BGYH 4U3JB 4IYHA 4LFAO 1DTOA 1KECA 2Z3YA 1PNLA 2OCCC 1XUQA 4F4LA 1PNKA 3CS5A 3STZC 4U3FH 4QPJA 1Q8IA 2HHHB 4I0XA 1H8HG 3J80N 4G28B 4YJ3A 1KKDA 1PNMA 5KHKA 3OM3B 5EC2C 1L0LH 2VQEB 5LHGA 4KHPO 2Y69C 4CC6A 5IYZA 1W0KG 5EBMC 3RYCA 1M56B 2EULA 4Q20A 2BTQB 1QLEC 4X1YB 4B08A 2WA4A 1Y66A 2KSDA 2Q7GA 2JGDA 1URFA 3W7TA 3SPIA 5HFMA 5CA0A 4DUYB 3JATA 2AZ0A 2ZIOA 3E86A 3QO8A 2UUAB 1VQNV 2KG7B 3C3TA 3CB2A 1Y67A 1IBLB 4GT1A 5IY5B 4O4IA 2EINB 1RPOA 2P4KA 2A7WA 3ZHQA 1D2DA 2N04A 1YTFB 2KB1A 1SRYA 3SR2C 4F6RA 4MT8A 1RM1B 3EHBB 4JI4B 5KMGA 2DQ3A 1RPRA 3OAAG 3SYQA 1JVMA 4DV4O 1YXBA 5E79Z 2HFEC 1LUWA 4ICGA 1Y76A 4JI0O 4PDVA 3K5LA 1K33A 3CJHB 1VQMV 5B1NA 3ASNC 4O4HA 1AB3A 1VQLV 1YEWA 1N8RW 2RCVA 3UT5B 1ZUQA 4GX1A 2VWKA 3W7SA 4X20B 3MDSA 3CP1A 1QBZA 4KFMA 3RYIA 3CMEV 2XOKG 1YJWV 1Q86W 4I50A 2F4VB 1R3JC 2JJ1G 4UB6Z 1X59A 1M57C 2BOCC 3CCQV 2PYLA 1Q82W 1FXVA 2OT5A 1SZXA 4HBNA 2HVJC 4B3MB 1YJ9V 3WFVA 1SC5B 3SPCA 5TISZ 5L3DA 4UXNA 4UCVA 1SQVH 1K5QA 2F95B 1R3LC 2YIAA 3N2GA 2YDEA 2N74A 1L8DA 4NTWA 1D5NA 2W6JG 3G4SV 1HNZB 2QJ1A 3K0GA 2ZD9A 4N21A 5J2UB 2GHYA 4YJ2A 3MD0A 5JJNB 2GUZB 3SPGA 2ETNA 5AG2A 4K8ZA 3Q4HB 2OCHA 2Q0AA 4LH7A 5IJ0A 3CCJV 2CH7B 4WFAV 3UQ8A 4U7OA 2PI5A 3EVKA 4JZGA 4XDJA 3ASOC 4OXSA 4DR1O 1XNRB 2ZE6A 3SPHA 3ZBHA 2XUMA 2L6LA 2QSAA 3OMNB 5KUMA 1WPBA 3D36C 4MTOA 2GBOA 3OW2U 1XHZA 2HP8A 2IBZH 1H2GA 2WSSG 3L74H 3K59A 1M5IA 3H01A 4PHZA 1NZ6A 2HR3A 4B7KA 1ZX3A 2EILB 1K73W 2HJFC 3L75H 3BCCH 5CBGA 3CC2V 4DR2B 1PPJH 5LHHA 2VS0A 5H5NA 4IIJB 4AILC 1OCCB 1S72V 3ZX6A 4JF3A 3SDLA 4UB8Z 4RQEA 4DR7O 2P22C 1SQPH 3CHXA 3AK2A 2P4VA 5LP6C 3TXSA 1HNXB 4UCOA 3ZMSA 3CC7V 3FB6C 4DRXB 4DV2B 3A0RA 3CCUV 3BY6A 1I5XA 3K03A 3STLC 3ABLB 4ZHQB 1MSDA 5D5QA 2F23A 1B3QA 3E8GA 2Q9LA 1N32O 1AR4A 1RSOB 2QTOA 1XEQA 4O2BA 2WLIB 2E75B 4GKJB 2RNBA 5KHGA 1EZJA 1N34B 2PY5A 1QCEA 4JYAB 5BMVB 2YIBD 5B1AB 2UXDO 1SQFA 1QNMA 4X65O 1JPXA 3WB1A 1J5EO 4E4EA 2UXBO 3CJHA 1OCOC 4J7KA 3OD4A 3LSQA 3A0HZ 1VF6C 3H1KH 4X8AA 5BY1A 3LNNA 5IT9N 1K92A 4X1KB 4P30A 3UT5A 5LGNA 2YC0A 2QWOB 2EIMC 1WN7A 4NXNO 3R66A 4KP4A 1BZKA 5GONB 4PA3A 4GX0A 1WA8A 1P7GA 2Y4UA 1PL4A 1ZL8B 1ORQC 4RQFA 2DE0X 1JJ2U 3AG1B 1R6TA 4EFBA 4DV5B 1NVPD 2IW5A 3I5DA 5KA6A 3FFQA 1M93A 4LF9B 2QR4A 1K7DA 2P6JA 4MSWC 5J2UA 3BAAA 5FLXN 2YXHA 4B3RO 2CTRA 1V55B 2WLMA 1MZEA 2RQ6A 2XASA 4NTXA 4MVMA 4JI1B 4K3AA 4NR1A 2Y0IA 2EIKB 2UXXA 4OGQB 2CH7A 5LGUA 3OEEG 3SJAC 4OPAA 4LFCO 2YUAA 5LGTA 1SZTA 3AK3A 4X64B 1M1KW 3KCXA 1VP7A 2CAZC 1SETA 5H6QA 1JQ0A 4O4LA 1Q6IA 3K9AA 4MS2A 2P7TC 2V1DA 5EYPA 4EB6B 3TJTA 2HVKC 3HPLC 2ITDC 1LNQA 1PP9H 2NLJC 1NVPB 1K5SA 1V54C 3T1HO
chains in the Genus database with same CATH topology
1L1FA 3TK1A 3OMAB 4XDLA 2WLKA 4P9PA 1OCOB 1FXKA 2NNUA 1ROPA 3ABMB 3E83A 1EBOA 2ZXWB 3IFXA 4R8CA 2PI4A 3CYOA 1AI7A 4LBEC 3JD4A 2DW4A 3JYCA 1DTOA 4MW3A 1R6NA 3T4ZA 3GB7C 1GK9A 1KECA 2Z3YA 4JASA 4TWKA 3E2EA 1PNLA 2OCCC 4F4LA 1PNKA 2Y69B 3STZC 5HFLA 4CZZA 4QJFB 4QPJA 3JD3A 4JGSA 4QIWF 3ZMTA 1H8HG 3R65A 4G28B 1KKDA 2D3OW 1PNMA 4LC1A 1YITV 3K08A 1QLEB 2WWWA 3OM3B 3CMAV 5EC2C 1MG1A 5LHGA 1BL8A 4XBFA 2Y69C 1HWYA 4EKWA 1QR8A 4G27B 1K34A 1W0KG 2ATKC 3ZRWB 5EBMC 3D3IA 4DO2A 3SYAA 4N23A 4KUMA 1M56B 2P90A 4RO2A 4Q20A 1P7BA 1QLEC 3FB5C 4JPRA 3ZMZA 2YSUB 3B8MA 2B5UA 1Y66A 3CCRV 3CC4V 3SYPA 3W7TA 3ABUA 1R73A 3SPIA 3QO7A 4Z1MG 3JD0A 1GTOA 5HFMA 1YJNV 4MVZA 1E1RG 3E86A 3QO8A 1VQNV 4DXWA 3T2MA 1S5HC 1K3EA 4ASUG 1YHQV 1M56C 3OR6C 3F5WC 1QLNA 3FKSG 4JTAB 4GT1A 5IY5B 4RAIA 2EINB 5IYDO 2B1GA 1F4NA 1RPOA 3ZN1A 4WFHA 3EFFK 1OCRB 3G71V 4JYCA 2UXNA 1COWG 2DQ0A 2IJHA 2KB1A 1YTFB 3D36A 1SRYA 5LHIA 1THZA 3T1CA 1RM1B 4MT8A 4WFEA 3EHBB 3TETA 4J9ZB 1KD1W 4PA4A 5IY5C 1QR9A 3BEHA 2DQ3A 3AG2B 2EINC 4UVAA 2A9HA 3ASNB 1H8EG 2OTLV 1RPRA 3OAAG 1CP9A 2QM7A 1OCRC 4HZ3A 2LFSA 3SYQA 4QNHB 5B3SC 1JVMA 3P30A 1UJWB 4WF9V 4X89A 3OR7C 1KP3A 4R50A 2HFEC 2K1EA 2EILC 1AI4A 3UM7A 4PDVA 3ABTA 3CCVV 1K33A 1K4CC 1VQMV 1FXKC 3AG2C 1CPYA 5E1AC 5B1NA 3ASNC 1BMFG 2M7WA 2OCCB 4GX2A 1OCZB 1VQLV 1JOYA 4MVSA 3ZMUA 1FXHA 1N8RW 1JCHA 3AG4C 2JJ2G 4GX1A 1NQTA 3W7SA 4P2ZA 4WFFA 5CN0A 2IJJA 5EK0A 3CP1A 3K04A 5EC1C 1KQSU 4PDLA 3OUSA 1QBZA 4KFMA 3CMEV 1Q7YW 2XOKG 4R6ZA 1YJWV 1Q86W 4FK5C 2W6IG 1R3JC 2JJ1G 3T4DA 5J9PC 4QPKA 2YEVB 3E8FA 2BOBC 1M57C 2BOCC 1OCZC 3ETEA 3GWOA 4R7CA 2Q6AA 3CCQV 2QEXV 1Q82W 3CCSV 1FXVA 2OT5A 1AR1B 2HKOA 2AHZA 3E89A 2HVJC 3ABLC 1YJ9V 3WFVA 3B8NA 4J9YB 3SPCA 1P4RA 1K4DC 2XAJA 1GMGA 5L3DA 1NBMG 4UXNA 2ZR3A 1K5QA 1FFTB 1R3LC 5B1BC 3AEIA 3VOUA 2IH3C 4PA9A 1GM7A 4BIUA 5CBFA 3B77A 1AJNA 1Y4MA 2H94A 2ZDIA 1TUEB 2W6JG 2EZPA 3G4SV 2WLLB 3MHSC 1G8MA 2IH1C 1BHBA 4RUEA 3K0GA 5EBWC 2ZD9A 3ETGA 4ZBMA 3ZCCA 5L3FA 3CCEV 2HG5C 2IU0A 2WPDG 5H9CA 4N21A 2GHYA 3ASOB 3I56V 1NJIW 5B1AC 4H33A 3MD0A 3ZN0A 4MVUA 1OHHG 2WLIA 4JAVA 1EFRG 4MTXA 4P9OA 4BAYA 3LUTB 4JTDB 3SPGA 2JK5C 4L87A 3X2QC 1PD3A 2JEUA 2DWDC 2OTJV 4TSFG 4H37A 1KP2A 4UUJC 5L3BA 1SESA 3CCJV 4WFAV 3IC7A 5CA3A 1K97A 1MSWD 4U7OA 1DF4A 4UV9A 2PI5A 5CMUA 3SYCA 4XDJA 3ASOC 4OXSA 1W2BU 3SPHA 2ITCC 1S76D 5DN6G 5KUKA 3ZIAG 3OMNB 5KUMA 1F51A 4E2LA 1DF5A 4FIPC 4MTOA 4XDKA 1F23A 3OW2U 1GKFA 1IXMA 3FB7C 3JD1A 5B3SB 1VQ4V 1H2GA 2Q67A 2WSSG 2X6BA 2Y48A 1NH2D 3ZRXA 4PA6A 2LFRA 3H01A 2HR3A 1H38A 2EILB 4MVRA 1K73W 2XNDG 3CCLV 3ZJZA 2IJIA 4GX5A 3LDEA 1FXKB 1VQ6V 2DYRC 3ZRWA 2EBOA 2HJFC 1QVGU 4BW5A 5IYBO 2XAQA 4LP8A 5CBGA 3CC2V 1JX9A 4TT3G 5IYCO 3F7VC 5LHHA 3OE7G 1MABG 1YI2V 4QE9A 1OCCB 1S72V 3AG4B 4JF3A 2WLNA 4WFBV 4RQEA 2H8PC 2WAMA 4PA7A 1AI6A 3OGCC 1XL6A 2JDIG 1M90W 3F7YC 3K06A 4FJCC 5FL7G 3G6EV 3ZMVA 1K8AW 2DYSB 3LSSA 3ZMSA 2XAFA 3CC7V 3FB6C 1QVFU 1VQPV 5L3GA 1M57B 3A0RA 1V55C 2C2AA 3MHHC 5BZBA 3NXSA 3CCUV 2A0LA 3AG3C 3BY6A 1I5XA 4MW8A 1ZWIC 1B6QA 3JD2A 3K03A 1ENVA 2XAHA 1WPXA 1OCCC 1K9MW 2EIKC 3STLC 3ABLB 4PDMA 1VQKV 2W0FC 3K0DA 2CK3G 3E8GA 4JTCB 5B1BB 1E79G 1W0JG 4X88A 2QE7G 2DYSC 3WG7B 1NH2B 2F43G 3UKMA 2QTOA 2WLIB 3W7WA 2DWEC 2EIJB 5EBLC 1EZJA 1QCEA 2ZDIC 1VQ5V 2QM8A 3E8HA 4I9WA 5LBQA 1SERA 5B1AB 5B1OA 4MVOA 2EJRA 4MTGA 3W7UA 3OFNG 2ZR2A 4UVBA 4FPPA 3VBBA 3X2QB 3P32A 3WG7C 1NR1A 4LCUC 1JPXA 4FMTA 4WFGA 3PJSK 2EIMB 3M99B 2EIJC 1G4YB 3CCMV 1VQ8V 1OCOC 2WLJA 2X6CA 2FTKA 4JAUA 1WLEA 3ABMC 3LSQA 2WLHA 4I5SA 1R3IC 2IJKA 4HYOA 2ZXWC 4X8AA 1GO3F 1MOFA 2A79B 1NKDA 1K92A 1YTFD 4P30A 1XL4A 5LGNA 2QKSA 3SJQC 4YXWG 1FS0G 4QE7A 1DLBA 3IGAC 4ZKIA 2EIMC 4MTFA 1AI5A 3OEHG 1S77D 1GM8A 4PELA 4RUFA 2AHYA 1GM9A 4KP4A 4UV8A 2YEVA 4PA3A 2R9IA 4GX0A 4CBCA 1ORQC 3DGEA 2MK3A 3TCUA 4RQFA 1PL0A 3E35A 3ABKB 3AG1B 1JJ2U 2Q69A 4U7NA 2DYRB 1CEZA 5C93A 4PDRA 3HB3B 1Q81W 2V7QG 1KC8W 5KA5A 1NVPD 2IW5A 3DTUB 3FYIB 3RVYA 2Q68A 5CBHA 5KA6A 2X7RB 3OMIB 5GW7A 3SYOA 4BIZA 1VQOV 3OUFA 1YSCA 1OZ0A 4MVQA 1AJPA 1R6KA 1K7DA 2P6JA 2WLLA 3JCZA 2GSMB 3CXCU 3CD6V 3ABKC 3AG1C 2EZOA 4G2KA 3FYEB 3ETDA 4MSWC 3ML0A 4GCZA 1VQ7V 4UVCA 4HAMA 3W7XA 3SPJA 1V55B 5DM6V 2QA4V 2WLMA 2ZQMA 2X0LA 3E8BA 2XASA 3AG3B 4MVMA 3ZRSA 1E1QG 2EIKB 2UXXA 2XAGA 3RW0A 3K3WA 1I5YA 5LGUA 3CPWU 3LNMB 3OEEG 1VQ9V 2P67A 3QO5A 1NR7A 1M9NA 5L3EA 3KG2A 5LGTA 1SZTA 2B1IA 2LP7A 1M1KW 1V54B 3QNEA 3LDDA 2HLDG 3ZRVA 4WCEV 2X6AA 1SETA 1R3KC 5H6QA 1JQ0A 3K79A 3I55V 1S3JA 3K9AA 1AJQA 5L3CA 4JYBA 4MS2A 1S0VA 2R9RB 2P7TC 2V1DA 1BHAA 2IU3A 3RBZA 2JIZG 1RM1C 3FB8C 3RVZA 1PKXA 2JEXA 2HVKC 3HPLC 2ITDC 1LNQA 2NLJC 1NVPB 1YIJV 1K5SA 1AROP 1V54C 2Z5UA 1F4MA 1J95A 5IDJA 5H6RA 3LDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WCE V;  1NJI W;  3CCU V;  2OTL V;  1YJ9 V;  1QVG U;  1N8R W;  1VQ5 V;  1VQ7 V;  3I55 V;  1JJ2 U;  4WF9 V;  3CC2 V;  1K9M W;  3OW2 U;  5DM6 V;  2QA4 V;  1VQ6 V;  1VQK V;  2D3O W;  3CD6 V;  1Q81 W;  3G71 V;  1YIT V;  1YI2 V;  2OTJ V;  3CCR V;  1KQS U;  1VQ4 V;  1S72 V;  3CCJ V;  3CC4 V;  3CME V;  1R73 A;  3CMA V;  4WFB V;  1Q7Y W;  1KC8 W;  4WFA V;  1YJN V;  1YJW V;  1Q86 W;  3CCV V;  3G4S V;  3CPW U;  1VQN V;  1VQM V;  1M90 W;  1YIJ V;  1M1K W;  1VQO V;  1K8A W;  1VQ9 V;  3G6E V;  1K73 W;  3CCE V;  3CCQ V;  3CCM V;  2QEX V;  3CCL V;  1Q82 W;  1KD1 W;  1VQ8 V;  3CXC U;  3CCS V;  1W2B U;  3CC7 V;  1QVF U;  1YHQ V;  1VQP V;  1VQL V;  3I56 V; 
#chains in the Genus database with same CATH topology
 1AP5 A;  3OMA B;  1IVS A;  4H0L B;  4CS2 A;  4P9P A;  1Q3E A;  1WP8 A;  3ABM B;  4JI5 O;  5DED A;  4FLZ A;  3IFX A;  4LF8 B;  4R8C A;  4CH5 A;  1YVW A;  2Z0A A;  3T4Z A;  3S3X A;  2KQX A;  3JAL B;  3E2E A;  1Y74 B;  5LA6 B;  2Y69 B;  3FX7 A;  2ZIN A;  1BQ0 A;  1IX9 A;  4JGS A;  4DRX A;  4A5U B;  4FLW A;  2WA3 A;  2D3O W;  1P84 F;  4CC5 A;  2LW1 A;  4D6T H;  1QLE B;  4ZHQ A;  3U11 A;  1MG1 A;  4B3S O;  1HWY A;  1QR8 A;  1KB9 F;  3JSL A;  4LF7 O;  3ZRW B;  3D3I A;  3SYA A;  4FFB B;  3NR7 A;  3A0B Z;  4KUM A;  4RO2 A;  4C7U A;  2HJD A;  1P7B A;  3ZMZ A;  3B8M A;  4DR3 O;  3SYP A;  2LO1 A;  1R73 A;  3QO7 A;  4Z1M G;  4MVZ A;  4W4K A;  3AG7 A;  1H2M A;  2LQT A;  2Q8V A;  5EZY A;  2QWN B;  1XBL A;  2RJZ A;  3HKB B;  3JAW B;  3T2M A;  1YHQ V;  1QLN A;  3BA9 A;  2CTQ A;  4DR6 O;  2DOS A;  3APQ A;  4ABM A;  4TV9 B;  4RAI A;  1F7Y A;  3CRA A;  5IYD O;  2B1G A;  5LXT A;  3S3W A;  5FPO A;  3ZN1 A;  4DV7 O;  4WFH A;  4X1I B;  4ZOL B;  3G71 V;  4JYC A;  2UXN A;  3APO A;  3QVN A;  4X1K A;  2GDS A;  1ZSP A;  1B06 A;  1THZ A;  3T1C A;  3P3N A;  2UUC O;  4J42 A;  4J9Z B;  3HKE A;  4NKG B;  4PA4 A;  4CH3 A;  4LFB O;  2A9H A;  3ASN B;  2RMK B;  1H8E G;  4GKK B;  5GON A;  1OCR C;  4HZ3 A;  2LFS A;  4QNH B;  4WF9 V;  3P30 A;  1UJW B;  1ZL8 A;  1I94 O;  2L35 A;  2ZE5 A;  3F5T A;  4DK1 A;  4L8J A;  1RP3 B;  3CCV V;  4AI8 A;  3JAS B;  3AG2 C;  5E1A C;  1VF7 A;  2JS5 A;  4GX2 A;  3OT7 A;  1JCH A;  4JYY A;  2PUS A;  1NQT A;  4P2Z A;  4DUZ O;  5EK0 A;  4IYI A;  1BCC H;  3BRC A;  5BXZ A;  2P5O A;  1XNQ O;  2QGN A;  1FAF A;  3RYF B;  3D8C A;  5CA1 A;  2QEX V;  3A2F A;  1HP8 A;  3CCS V;  2BE3 A;  1AR1 B;  3DC5 A;  2VWJ A;  2AHZ A;  5LMN O;  2ZM6 B;  3B8N A;  2LJ2 A;  4DV1 O;  1K4D C;  2XAJ A;  1GMG A;  1NBM G;  4LF5 B;  4UCT A;  5B1B C;  3VOU A;  2IH3 C;  4PA9 A;  1GM7 A;  4BIU A;  1SA0 B;  2O57 A;  5KHH A;  2F1M A;  2H94 A;  3HKD A;  2JVD A;  3GVM A;  4EB6 A;  4ZIB A;  1RFY A;  2CTW A;  5LL6 Y;  1G8M A;  2B9Z A;  3ETG A;  2Q4P A;  3ZCC A;  4X66 O;  1MNG A;  3ASO B;  3I56 V;  3ZN0 A;  2UXC O;  4MVU A;  1EFR G;  4UCR A;  4UCS A;  3X2Q C;  1PD3 A;  2OTJ V;  3T1Y B;  1N33 B;  4HNA B;  2EJ7 A;  1DF4 A;  2PYJ A;  1AP6 A;  5CMU A;  3JAL A;  2VQF B;  4I55 A;  1Y74 A;  3VQW A;  4E2L A;  2H3O A;  1DF5 A;  5EIB C;  4WBN A;  4K35 A;  3O9O A;  5B3S B;  4FM0 A;  2UU9 O;  5BR8 O;  4NXM O;  4TUY B;  2XND G;  2IJI A;  2AXT Z;  1UFI A;  1FXK B;  5IWA B;  1VQ6 V;  3M7M X;  3ZRW A;  1QVG U;  1NU1 H;  4FFB A;  5H2F Z;  3WU2 Z;  3N27 A;  3F7V C;  2BSK B;  2HHH O;  4QE9 A;  3AG4 B;  1AIL A;  2H8P C;  3OGI B;  2WAM A;  1HNW B;  4LF4 O;  3BHP A;  1AI6 A;  3OGC C;  2JDI G;  3JAR A;  4FLU A;  2VQE O;  1QVF U;  1VQP V;  3HKB A;  3MHH C;  5BZB A;  2KKW A;  3AG3 C;  4MW8 A;  1ZWI C;  1D5A A;  2ARH A;  2XAH A;  1WPX A;  1K9M W;  4PDM A;  1X4T A;  2W0F C;  1TAE A;  5ITZ A;  4TQF A;  1NT2 B;  4X1I A;  4JTC B;  1E79 G;  4AQY B;  4X88 A;  2F43 G;  4LF6 B;  5B66 Z;  1SKV A;  4DUY O;  1JR9 A;  2QWP B;  2DWE C;  4LH6 A;  2UUA O;  1VEW A;  1VQ5 V;  1SQB H;  2QM8 A;  3B09 A;  5LBQ A;  3RN4 A;  1IBL O;  4O4J B;  1YDX A;  2EJR A;  4MTG A;  1XHX A;  3CWB H;  2ODM A;  3HKC B;  2OIG A;  3VBB A;  4LCU C;  3H1L H;  3J81 N;  4FMT A;  3IJ4 A;  2EIM B;  3PJS K;  1NS1 A;  1Z5V A;  3CCM V;  2Q0O C;  1VQ8 V;  2JGU A;  1A32 A;  2FTK A;  3JAS A;  4JAU A;  5JJE B;  1XMO B;  4H44 B;  5GTH Z;  1R3I C;  2IJK A;  1VIB A;  5IJ9 A;  3CEI A;  1GO3 F;  1OV9 A;  2YS8 A;  4JI4 O;  1JFF A;  2A79 B;  1KKC A;  4D7T A;  2QKS A;  2V4D A;  5JVD B;  4YXW G;  1FS0 G;  3K58 A;  1DLB A;  1BSM A;  4ZKI A;  2A3Q A;  4MTF A;  2CGN A;  3OEH G;  4U3J A;  2M6Y A;  1GM8 A;  4RUF A;  2AHY A;  5JCO A;  3RYF A;  4TV8 B;  2R9I A;  4TQD A;  3H1H H;  1I0H A;  2QTS A;  2FML A;  1N32 B;  2DYR B;  3HB3 B;  3E22 B;  2A06 H;  5FPR A;  3CRR A;  3KKY A;  4DK0 A;  1SA0 A;  3OMI B;  5KHJ A;  5GW7 A;  4BIZ A;  1VQO V;  3OUF A;  1OZ0 A;  1AJP A;  2F4V O;  2YI9 A;  3CXC U;  3CD6 V;  1YF2 A;  4BW9 A;  3ABK C;  3M8A A;  4G2K A;  4F6E A;  1VQ7 V;  4GCZ A;  3RFR A;  4HAM A;  2N05 A;  2PGG A;  3SPJ A;  5DM6 V;  2QA4 V;  4PI0 A;  4AHC A;  2ZQM A;  3K57 A;  4B3M O;  1BQZ A;  2BTQ A;  4JV5 B;  1N4C A;  5JJJ B;  4X1Y A;  1QHT A;  5C8Y B;  4HNA A;  2CTP A;  3KG2 A;  4X9Q A;  4BWA A;  4JI3 B;  1HNZ O;  2E5L B;  1V54 B;  4QGP A;  4X62 B;  2HLD G;  2KG7 A;  1R3K C;  5FNV B;  4FLX A;  3K79 A;  1Z5W A;  2E76 B;  3FAV B;  1U97 A;  3RBZ A;  4KXR A;  2ZT9 B;  1RM1 C;  4DW1 A;  2EX3 A;  1YIJ V;  2R9A A;  1KYO F;  3O65 A;  1TA8 A;  2QDO A;  5H6R A;  3K9S A;  3LDC A;  3H9V A;  4JI6 B;  1BE3 H;  1XNR O;  4XDL A;  1FXK A;  2NNU A;  4OX9 B;  3E83 A;  1EBO A;  2ZXW B;  4JAA A;  4PV1 B;  4W4L A;  2BSK A;  4DR4 B;  4CS3 A;  3GB7 C;  1GK9 A;  4TWK A;  2OIE A;  2ADP A;  1XOU A;  4FFK A;  2YXY A;  4QJF B;  3JD3 A;  3ZHV A;  4QIW F;  1MZF A;  3R65 A;  3K5N A;  4LC1 A;  1YIT V;  1FYJ A;  2WWW A;  1QQC A;  4DR2 O;  4X20 A;  3DSQ A;  1G1X B;  2F93 B;  4G27 B;  1K34 A;  2ATK C;  1VMG A;  3QTC A;  3L9D A;  4DO2 A;  4CH6 A;  2ZE8 A;  1FPO A;  5CB4 B;  1HNX O;  4N23 A;  1GN4 A;  1IBK B;  4DV2 O;  3FB5 C;  4JPR A;  5LMU B;  1XMQ B;  4DV0 B;  2B5U A;  4DW0 A;  3CCR V;  3CC4 V;  2QKC A;  3JD0 A;  1GTO A;  3HKC A;  1E1R G;  1IZ3 A;  1O9H A;  1IBM B;  3H1J H;  4GYC B;  4DXW A;  4I4T B;  1K3E A;  4ASU G;  4NYK A;  3F5W C;  1LR1 A;  4JTA B;  3L70 H;  4GKJ O;  1F4N A;  1N34 O;  1OCR B;  4JYA O;  2GUZ A;  4CS4 A;  1COW G;  4IHJ B;  3Q4H A;  2IJH A;  4YHH B;  4DR5 B;  4YIO A;  1TUB B;  2ILM A;  2FL4 A;  3ZHS A;  3TET A;  1KD1 W;  1P49 A;  1FJG O;  3AG2 B;  5JQG B;  1XDC A;  1N36 O;  2OTL V;  1NI8 A;  4JI2 O;  2QM7 A;  4TV8 A;  3C3S A;  4FLY A;  4YY3 B;  1SF9 A;  4R50 A;  2K1E A;  3CSX A;  2EIL C;  3BVO A;  1AI4 A;  3E22 A;  3RYH B;  4DV6 B;  1K4C C;  3VQV A;  4JI7 B;  3P3P A;  2XHB A;  1U96 A;  4LR3 A;  3A8T A;  3RWR D;  1IDS A;  3K5O A;  2OCC B;  1FXH A;  4NVP A;  3IAY A;  2F66 C;  5EIB D;  2JJ2 G;  4WFF A;  5CN0 A;  2QWQ B;  3K04 A;  5EC1 C;  1KQS U;  3OUS A;  4I9Q A;  4R6Z A;  3MAQ A;  1AR5 A;  4IIJ A;  2W0X A;  4TOI A;  5JH7 B;  3T4D A;  4DV5 O;  5J9P C;  1KBH A;  4QPK A;  2YEV B;  5C8Y A;  1OCZ C;  3ETE A;  3GWO A;  4R7C A;  2Q6A A;  5F2V O;  4J41 A;  4PI2 A;  2HKO A;  3E89 A;  2QWR B;  3ABL C;  4LF9 O;  1B04 A;  4J9Y B;  3JCU Z;  3KZI Z;  1P4R A;  2JGD B;  2ZR3 A;  1FFT B;  3AEI A;  4BIO A;  3B77 A;  1AJN A;  1Y4M A;  2ZDI A;  4B7E A;  1JA8 A;  4JI1 O;  3SJB C;  4ZBM A;  2HG5 C;  4DV3 O;  2IU0 A;  4B3T B;  4O4I B;  1L0N H;  1RSO A;  1QU7 A;  1NJI W;  5B1A C;  4GUN A;  4H33 A;  4JI8 B;  2WLI A;  4JAV A;  4MTX A;  4P9O A;  4X64 O;  4K0K B;  4ZI7 B;  4L87 A;  2DWD C;  3CRC A;  3RT3 C;  3ZHT A;  1KP2 A;  5BMV A;  2UUB B;  4F6R B;  1HR0 B;  3OTO B;  1GN6 A;  3IC7 A;  1Q6H A;  3ZS8 C;  4UV9 A;  1VAR A;  2NN4 A;  4FLV A;  1W2B U;  1S76 D;  3CXH F;  3ZIA G;  1F51 A;  3LSU A;  2BTO A;  1XNQ B;  4XDK A;  1F23 A;  1Z2G A;  1IXM A;  4LFA B;  3JD1 A;  1VQ4 V;  2Q67 A;  4GLX A;  2X6B A;  4LF8 O;  2Y48 A;  1NH2 D;  3ZRX A;  1AVM A;  4PA6 A;  3TGU H;  4O4H B;  3CCL V;  3ZJZ A;  4OPH A;  4GX5 A;  4NTY A;  2QKA A;  2EBO A;  4BW5 A;  5IYB O;  2XAQ A;  2ZNJ A;  5CB4 A;  1JX9 A;  3CRQ A;  4I50 B;  4KHP B;  1MAB G;  1YI2 V;  3WB2 A;  3K5M A;  4WFB V;  1MMM A;  3QF7 A;  4PA7 A;  1TGO A;  2YIB A;  4IL6 Z;  1M90 W;  4FJC C;  1K8A W;  5FL7 G;  3G6E V;  4Z2W A;  3LSS A;  2XAF A;  1ZLZ A;  5L3G A;  5IE9 A;  1M57 B;  4I4T A;  1V55 C;  2C2A A;  3NXS A;  2A0L A;  1H2K A;  1B6Q A;  2EIK C;  3ZHR A;  3K0D A;  2CK3 G;  1TVK B;  2DYS C;  4IHJ A;  1JMK C;  1NH2 B;  3CE2 A;  3UKM A;  1TUB A;  2QM4 A;  1XI1 A;  1PM9 A;  3AK1 A;  1ZAU A;  2Q7H A;  2RDC A;  5IJ0 B;  4I9W A;  1SER A;  4YIP A;  5B1O A;  2Q7E A;  2ZR2 A;  4UVB A;  3CRM A;  3WG7 C;  1NR1 A;  2ADQ B;  4J10 A;  2E74 B;  4WFG A;  3RYH A;  2EIJ C;  5KAI Z;  1SQG A;  4NB5 A;  2X6C A;  4LWS B;  4DV4 B;  3ABM C;  2WLH A;  4FVM A;  1MOF A;  1GN2 A;  4LF4 B;  2Y4T A;  2G38 A;  4JI0 B;  1YTF D;  1XL4 A;  4GKK O;  3SJQ C;  1NTK H;  2E3C A;  1HW7 A;  1Q5O A;  3D3Q A;  1WAZ A;  4IT5 A;  1S77 D;  4PEL A;  5JH7 A;  1Y6X A;  3JAM N;  1GM9 A;  1M4U A;  3B4S A;  4UV8 A;  2GTS A;  2YEV A;  5LA6 A;  4K8X A;  3DGE A;  3TCU A;  4DYL A;  1PL0 A;  3ABK B;  2Q69 A;  4U7N A;  1CEZ A;  4PDR A;  3THO A;  1N0J A;  2V7Q G;  1KC8 W;  5KA5 A;  3HR0 A;  3DTU B;  3RVY A;  5KLV H;  4PJ0 Z;  4CH4 A;  2BCC H;  2PF4 E;  2GTA A;  4MVQ A;  2OYQ A;  5LP6 B;  1EN5 A;  2EZO A;  3ETD A;  3ML0 A;  2XTA A;  4UVC A;  3W7X A;  4JZ2 A;  3UO3 A;  2ZM6 O;  1E1Q G;  4ZI7 A;  3B2E E;  3VQX A;  4LF5 O;  4UCU A;  2XAG A;  4O2B B;  3CPW U;  2CDY A;  1Q90 D;  3QO5 A;  3KCY A;  1M9N A;  5L3E A;  2B1I A;  4I7Z B;  4H13 B;  3QNE A;  3ZRV A;  4WCE V;  2Y0P A;  3JAW A;  3I55 V;  3B40 A;  1IUR A;  1AJQ A;  4JYB A;  4TV9 A;  1JJO A;  2IU3 A;  4DR1 B;  3J7A U;  4ZOL A;  2LW7 A;  1PKX A;  3T1Y O;  1N33 O;  1ARO P;  2DN9 A;  2Z5U A;  3DC6 A;  1J95 A;  1W59 A;  5J2T B;  2WLK A;  2VQF O;  1OCO B;  2ZKO A;  1ROP A;  2PZS A;  2PI4 A;  1EZV H;  3CYO A;  4UFZ A;  2R72 A;  1AI7 A;  4O2A B;  3JD4 A;  2DW4 A;  3JYC A;  4MW3 A;  1R6N A;  4JAS A;  1I08 A;  1WA8 B;  5HFL A;  1ZTE A;  4CZZ A;  5K1P A;  3ZMT A;  3U0Z A;  3L73 H;  3C90 A;  2ZNI A;  5IWA O;  3GWK C;  4DR7 B;  3K08 A;  5JCO C;  3CMA V;  5A9G A;  1BL8 A;  4XBF A;  1R1B A;  4EKW A;  1TVK A;  2GV9 A;  1HNW O;  1MA1 A;  3OTF A;  3G80 A;  3TXQ A;  3UO2 A;  3ICX A;  2P90 A;  3BA8 A;  3ZED A;  1H2N A;  1GH6 A;  2YSU B;  1BT8 A;  3U10 A;  3ABU A;  2Q73 A;  4D7S A;  1YJN V;  1I7F A;  4J7J A;  2YI8 A;  2NR5 A;  4O4L B;  4AQY O;  1S5H C;  1KUQ A;  1M56 C;  3OR6 C;  1O9G A;  5LOV B;  3FKS G;  4LF6 O;  2UXD B;  4LWS A;  2VRZ A;  5EYP B;  3JSN A;  4X65 B;  1GN3 A;  3EFF K;  5LYJ B;  3WB0 A;  1FFX B;  1SQQ H;  1XIL A;  3ETQ A;  1J5E B;  1WB7 A;  2DQ0 A;  3D36 A;  2UXB B;  5LHI A;  2CGO A;  1WP7 A;  4WFE A;  5IY5 C;  1QR9 A;  3BEH A;  2EIN C;  4UVA A;  2XT9 A;  3BPZ A;  2ZIM A;  1Q43 A;  1CP9 A;  5B3S C;  1CXZ B;  1WB8 A;  1XMO O;  4X89 A;  1T5E A;  3OR7 C;  1KP3 A;  5KHI A;  3L71 H;  4NXN B;  5K1X A;  1IXB A;  3UM7 A;  4LNU B;  3ABT A;  2LGW A;  4GZR B;  1FXK C;  1CPY A;  1BMF G;  2M7W A;  2RN9 A;  3IC9 A;  5DEC A;  1OCZ B;  1JOY A;  4BR6 A;  4MVS A;  4TUY A;  3ZMU A;  5LP6 A;  2DMX A;  3AG4 C;  3SGI A;  1VF5 B;  2IJJ A;  1XRE A;  3QG5 A;  4FM1 A;  1OJH A;  4PDL A;  1Q7Y W;  2AZ2 A;  2FB5 A;  4FK5 C;  3BAB A;  2W6I G;  3E8F A;  3JAK B;  2BOB C;  4B3R B;  4FLT A;  3EXA A;  5KX5 B;  5CBF A;  2R70 A;  4LFC B;  3N2K B;  5EZY B;  1TUE B;  2EZP A;  1FJG B;  2WLL B;  3MHS C;  1N36 B;  2IH1 C;  4JV5 O;  1BHB A;  4RUE A;  5EBW C;  2P06 A;  5L3F A;  3CCE V;  4JI2 B;  2WPD G;  5H9C A;  4Z1V A;  5LXT B;  2CUG A;  2AGA A;  1OHH G;  5J2T A;  4JI3 O;  4BAY A;  3LUT B;  4JTD B;  2E5L O;  2JK5 C;  4X62 O;  4FZ1 A;  1NTM H;  2JEU A;  4TSF G;  4H37 A;  5L3B A;  4UUJ C;  1SES A;  1VF6 A;  1S5L Z;  4O4J A;  5CA3 A;  1K97 A;  4O2A A;  1MSW D;  3HKE B;  2ZCE A;  3T1H B;  3SYC A;  1WJZ A;  2MW2 B;  2ITC C;  4JI5 B;  5DN6 G;  5KUK A;  4FIP C;  4JI6 O;  1GKF A;  3FB7 C;  1DGS A;  1LUV A;  4OX9 O;  1YCI A;  1GAX A;  1FKA O;  1PV0 A;  2LFR A;  5JVD A;  1H38 A;  2YID A;  4MVR A;  4DR4 O;  1BS3 A;  3LDE A;  3G67 A;  1H2S B;  1Q6U A;  2DYR C;  4LP8 A;  3PN1 A;  4EEQ A;  4TT3 G;  3DXR B;  5IYC O;  3OE7 G;  4B3S B;  1DK1 A;  2WLN A;  4DV3 B;  4J7Z A;  4LF7 B;  5CA1 B;  1XL6 A;  3F7Y C;  3K06 A;  2D2C B;  5GTI Z;  5KAF Z;  3ZMV A;  2DYS B;  4I0X B;  4DR3 B;  4YJ3 B;  3L72 H;  5LOV A;  3JD2 A;  1ENV A;  1OCC C;  5D5P A;  1VQK V;  3HKD B;  4PD4 F;  1IBK O;  4KL1 A;  5LYJ A;  5LMU O;  5B1B B;  1XMQ O;  1FFX A;  4DV0 O;  1W0J G;  1H2L A;  1YZB A;  2QE7 G;  5IYZ B;  3WG7 B;  4DR6 B;  3RYC B;  1NTZ H;  2CE4 A;  3W7W A;  1EN4 A;  3ZHU A;  1V9P A;  1IBM O;  2EIJ B;  5EBL C;  4DV7 B;  2ZDI C;  3E8H A;  2AW9 A;  4MVO A;  5FNV A;  5CA0 B;  3W7U A;  3OFN G;  3JAT B;  4FPP A;  3FAV A;  3X2Q B;  3P32 A;  2UUC B;  4I55 B;  4LFB B;  3M99 B;  4LNU A;  3SJC C;  2Q5Z A;  1G4Y B;  4YHH O;  4DR5 O;  1S5J A;  2WLJ A;  1SS3 A;  4EFE A;  1WLE A;  4I5S A;  4WBN B;  4HYO A;  2ZXW C;  1I94 B;  3FD9 A;  3UCS C;  2PTM A;  4FM2 A;  1NKD A;  3G6B A;  4QE7 A;  3IGA C;  4YY3 O;  1EN6 A;  1AI5 A;  5A2Q N;  5KMG B;  4DV6 O;  4JI7 O;  3JAK A;  4DUZ B;  4CBC A;  2MK3 A;  3E35 A;  3H1I H;  1HDJ A;  2DJV A;  5C93 A;  1Y76 B;  4J80 A;  1Q81 W;  5KX5 A;  1KMI Z;  2FYU H;  4J11 A;  3JAR B;  1FD9 A;  4FZ0 A;  3FYI B;  2Q68 A;  5CBH A;  2X7R B;  3N2K A;  1SQX H;  3SYO A;  5LMN B;  1YSC A;  1KU9 A;  1R6K A;  4DV1 B;  2WLL A;  3JCZ A;  2GSM B;  2IM9 A;  3AG1 C;  4IGG A;  3FYE B;  1EM1 A;  5ITZ B;  2HEP A;  3RYI B;  2X0L A;  2FKX A;  3E8B A;  3AG3 B;  3CX5 F;  3ZRS A;  2JS3 A;  4X66 B;  3RW0 A;  3K3W A;  1I5Y A;  2JRI A;  3LNM B;  2YXL A;  1VQ9 V;  2P67 A;  1XQ8 A;  1NR7 A;  3VQY A;  2UXC B;  2LP7 A;  1N0N A;  2LGQ A;  3LDD A;  2X6A A;  3BFR A;  4B3T O;  1GRJ A;  3N2G B;  1S3J A;  2K9P A;  5L3C A;  1S0V A;  4JI8 O;  2R9R B;  1G6U A;  1BHA A;  1UPG A;  5JWP A;  4K0K O;  2JIZ G;  3FB8 C;  3RVZ A;  2JEX A;  4RWU A;  2UUB O;  3RGB A;  4Q6G A;  3OTO O;  1HR0 O;  5IJ9 B;  4YJ2 B;  1F4M A;  5IDJ A;  2ZE7 A;  1US6 A;  1JFF B;  1WNS A;  1L1F A;  3TK1 A;  2YIC A;  5JQG A;  2OWO A;  5B5E Z;  2UU9 B;  4LBE C;  5BR8 B;  4NXM B;  3DXR A;  1BGY H;  4U3J B;  4IYH A;  4LFA O;  1DTO A;  1KEC A;  2Z3Y A;  1PNL A;  2OCC C;  1XUQ A;  4F4L A;  1PNK A;  3CS5 A;  3STZ C;  4U3F H;  4QPJ A;  1Q8I A;  2HHH B;  4I0X A;  1H8H G;  3J80 N;  4G28 B;  4YJ3 A;  1KKD A;  1PNM A;  5KHK A;  3OM3 B;  5EC2 C;  1L0L H;  2VQE B;  5LHG A;  4KHP O;  2Y69 C;  4CC6 A;  5IYZ A;  1W0K G;  5EBM C;  3RYC A;  1M56 B;  2EUL A;  4Q20 A;  2BTQ B;  1QLE C;  4X1Y B;  4B08 A;  2WA4 A;  1Y66 A;  2KSD A;  2Q7G A;  2JGD A;  1URF A;  3W7T A;  3SPI A;  5HFM A;  5CA0 A;  4DUY B;  3JAT A;  2AZ0 A;  2ZIO A;  3E86 A;  3QO8 A;  2UUA B;  1VQN V;  2KG7 B;  3C3T A;  3CB2 A;  1Y67 A;  1IBL B;  4GT1 A;  5IY5 B;  4O4I A;  2EIN B;  1RPO A;  2P4K A;  2A7W A;  3ZHQ A;  1D2D A;  2N04 A;  1YTF B;  2KB1 A;  1SRY A;  3SR2 C;  4F6R A;  4MT8 A;  1RM1 B;  3EHB B;  4JI4 B;  5KMG A;  2DQ3 A;  1RPR A;  3OAA G;  3SYQ A;  1JVM A;  4DV4 O;  1YXB A;  5E79 Z;  2HFE C;  1LUW A;  4ICG A;  1Y76 A;  4JI0 O;  4PDV A;  3K5L A;  1K33 A;  3CJH B;  1VQM V;  5B1N A;  3ASN C;  4O4H A;  1AB3 A;  1VQL V;  1YEW A;  1N8R W;  2RCV A;  3UT5 B;  1ZUQ A;  4GX1 A;  2VWK A;  3W7S A;  4X20 B;  3MDS A;  3CP1 A;  1QBZ A;  4KFM A;  3RYI A;  3CME V;  2XOK G;  1YJW V;  1Q86 W;  4I50 A;  2F4V B;  1R3J C;  2JJ1 G;  4UB6 Z;  1X59 A;  1M57 C;  2BOC C;  3CCQ V;  2PYL A;  1Q82 W;  1FXV A;  2OT5 A;  1SZX A;  4HBN A;  2HVJ C;  4B3M B;  1YJ9 V;  3WFV A;  1SC5 B;  3SPC A;  5TIS Z;  5L3D A;  4UXN A;  4UCV A;  1SQV H;  1K5Q A;  2F95 B;  1R3L C;  2YIA A;  3N2G A;  2YDE A;  2N74 A;  1L8D A;  4NTW A;  1D5N A;  2W6J G;  3G4S V;  1HNZ B;  2QJ1 A;  3K0G A;  2ZD9 A;  4N21 A;  5J2U B;  2GHY A;  4YJ2 A;  3MD0 A;  5JJN B;  2GUZ B;  3SPG A;  2ETN A;  5AG2 A;  4K8Z A;  3Q4H B;  2OCH A;  2Q0A A;  4LH7 A;  5IJ0 A;  3CCJ V;  2CH7 B;  4WFA V;  3UQ8 A;  4U7O A;  2PI5 A;  3EVK A;  4JZG A;  4XDJ A;  3ASO C;  4OXS A;  4DR1 O;  1XNR B;  2ZE6 A;  3SPH A;  3ZBH A;  2XUM A;  2L6L A;  2QSA A;  3OMN B;  5KUM A;  1WPB A;  3D36 C;  4MTO A;  2GBO A;  3OW2 U;  1XHZ A;  2HP8 A;  2IBZ H;  1H2G A;  2WSS G;  3L74 H;  3K59 A;  1M5I A;  3H01 A;  4PHZ A;  1NZ6 A;  2HR3 A;  4B7K A;  1ZX3 A;  2EIL B;  1K73 W;  2HJF C;  3L75 H;  3BCC H;  5CBG A;  3CC2 V;  4DR2 B;  1PPJ H;  5LHH A;  2VS0 A;  5H5N A;  4IIJ B;  4AIL C;  1OCC B;  1S72 V;  3ZX6 A;  4JF3 A;  3SDL A;  4UB8 Z;  4RQE A;  4DR7 O;  2P22 C;  1SQP H;  3CHX A;  3AK2 A;  2P4V A;  5LP6 C;  3TXS A;  1HNX B;  4UCO A;  3ZMS A;  3CC7 V;  3FB6 C;  4DRX B;  4DV2 B;  3A0R A;  3CCU V;  3BY6 A;  1I5X A;  3K03 A;  3STL C;  3ABL B;  4ZHQ B;  1MSD A;  5D5Q A;  2F23 A;  1B3Q A;  3E8G A;  2Q9L A;  1N32 O;  1AR4 A;  1RSO B;  2QTO A;  1XEQ A;  4O2B A;  2WLI B;  2E75 B;  4GKJ B;  2RNB A;  5KHG A;  1EZJ A;  1N34 B;  2PY5 A;  1QCE A;  4JYA B;  5BMV B;  2YIB D;  5B1A B;  2UXD O;  1SQF A;  1QNM A;  4X65 O;  1JPX A;  3WB1 A;  1J5E O;  4E4E A;  2UXB O;  3CJH A;  1OCO C;  4J7K A;  3OD4 A;  3LSQ A;  3A0H Z;  1VF6 C;  3H1K H;  4X8A A;  5BY1 A;  3LNN A;  5IT9 N;  1K92 A;  4X1K B;  4P30 A;  3UT5 A;  5LGN A;  2YC0 A;  2QWO B;  2EIM C;  1WN7 A;  4NXN O;  3R66 A;  4KP4 A;  1BZK A;  5GON B;  4PA3 A;  4GX0 A;  1WA8 A;  1P7G A;  2Y4U A;  1PL4 A;  1ZL8 B;  1ORQ C;  4RQF A;  2DE0 X;  1JJ2 U;  3AG1 B;  1R6T A;  4EFB A;  4DV5 B;  1NVP D;  2IW5 A;  3I5D A;  5KA6 A;  3FFQ A;  1M93 A;  4LF9 B;  2QR4 A;  1K7D A;  2P6J A;  4MSW C;  5J2U A;  3BAA A;  5FLX N;  2YXH A;  4B3R O;  2CTR A;  1V55 B;  2WLM A;  1MZE A;  2RQ6 A;  2XAS A;  4NTX A;  4MVM A;  4JI1 B;  4K3A A;  4NR1 A;  2Y0I A;  2EIK B;  2UXX A;  4OGQ B;  2CH7 A;  5LGU A;  3OEE G;  3SJA C;  4OPA A;  4LFC O;  2YUA A;  5LGT A;  1SZT A;  3AK3 A;  4X64 B;  1M1K W;  3KCX A;  1VP7 A;  2CAZ C;  1SET A;  5H6Q A;  1JQ0 A;  4O4L A;  1Q6I A;  3K9A A;  4MS2 A;  2P7T C;  2V1D A;  5EYP A;  4EB6 B;  3TJT A;  2HVK C;  3HPL C;  2ITD C;  1LNQ A;  1PP9 H;  2NLJ C;  1NVP B;  1K5S A;  1V54 C;  3T1H O; 
#chains in the Genus database with same CATH homology
 1L1F A;  3TK1 A;  3OMA B;  4XDL A;  2WLK A;  4P9P A;  1OCO B;  1FXK A;  2NNU A;  1ROP A;  3ABM B;  3E83 A;  1EBO A;  2ZXW B;  3IFX A;  4R8C A;  2PI4 A;  3CYO A;  1AI7 A;  4LBE C;  3JD4 A;  2DW4 A;  3JYC A;  1DTO A;  4MW3 A;  1R6N A;  3T4Z A;  3GB7 C;  1GK9 A;  1KEC A;  2Z3Y A;  4JAS A;  4TWK A;  3E2E A;  1PNL A;  2OCC C;  4F4L A;  1PNK A;  2Y69 B;  3STZ C;  5HFL A;  4CZZ A;  4QJF B;  4QPJ A;  3JD3 A;  4JGS A;  4QIW F;  3ZMT A;  1H8H G;  3R65 A;  4G28 B;  1KKD A;  2D3O W;  1PNM A;  4LC1 A;  1YIT V;  3K08 A;  1QLE B;  2WWW A;  3OM3 B;  3CMA V;  5EC2 C;  1MG1 A;  5LHG A;  1BL8 A;  4XBF A;  2Y69 C;  1HWY A;  4EKW A;  1QR8 A;  4G27 B;  1K34 A;  1W0K G;  2ATK C;  3ZRW B;  5EBM C;  3D3I A;  4DO2 A;  3SYA A;  4N23 A;  4KUM A;  1M56 B;  2P90 A;  4RO2 A;  4Q20 A;  1P7B A;  1QLE C;  3FB5 C;  4JPR A;  3ZMZ A;  2YSU B;  3B8M A;  2B5U A;  1Y66 A;  3CCR V;  3CC4 V;  3SYP A;  3W7T A;  3ABU A;  1R73 A;  3SPI A;  3QO7 A;  4Z1M G;  3JD0 A;  1GTO A;  5HFM A;  1YJN V;  4MVZ A;  1E1R G;  3E86 A;  3QO8 A;  1VQN V;  4DXW A;  3T2M A;  1S5H C;  1K3E A;  4ASU G;  1YHQ V;  1M56 C;  3OR6 C;  3F5W C;  1QLN A;  3FKS G;  4JTA B;  4GT1 A;  5IY5 B;  4RAI A;  2EIN B;  5IYD O;  2B1G A;  1F4N A;  1RPO A;  3ZN1 A;  4WFH A;  3EFF K;  1OCR B;  3G71 V;  4JYC A;  2UXN A;  1COW G;  2DQ0 A;  2IJH A;  2KB1 A;  1YTF B;  3D36 A;  1SRY A;  5LHI A;  1THZ A;  3T1C A;  1RM1 B;  4MT8 A;  4WFE A;  3EHB B;  3TET A;  4J9Z B;  1KD1 W;  4PA4 A;  5IY5 C;  1QR9 A;  3BEH A;  2DQ3 A;  3AG2 B;  2EIN C;  4UVA A;  2A9H A;  3ASN B;  1H8E G;  2OTL V;  1RPR A;  3OAA G;  1CP9 A;  2QM7 A;  1OCR C;  4HZ3 A;  2LFS A;  3SYQ A;  4QNH B;  5B3S C;  1JVM A;  3P30 A;  1UJW B;  4WF9 V;  4X89 A;  3OR7 C;  1KP3 A;  4R50 A;  2HFE C;  2K1E A;  2EIL C;  1AI4 A;  3UM7 A;  4PDV A;  3ABT A;  3CCV V;  1K33 A;  1K4C C;  1VQM V;  1FXK C;  3AG2 C;  1CPY A;  5E1A C;  5B1N A;  3ASN C;  1BMF G;  2M7W A;  2OCC B;  4GX2 A;  1OCZ B;  1VQL V;  1JOY A;  4MVS A;  3ZMU A;  1FXH A;  1N8R W;  1JCH A;  3AG4 C;  2JJ2 G;  4GX1 A;  1NQT A;  3W7S A;  4P2Z A;  4WFF A;  5CN0 A;  2IJJ A;  5EK0 A;  3CP1 A;  3K04 A;  5EC1 C;  1KQS U;  4PDL A;  3OUS A;  1QBZ A;  4KFM A;  3CME V;  1Q7Y W;  2XOK G;  4R6Z A;  1YJW V;  1Q86 W;  4FK5 C;  2W6I G;  1R3J C;  2JJ1 G;  3T4D A;  5J9P C;  4QPK A;  2YEV B;  3E8F A;  2BOB C;  1M57 C;  2BOC C;  1OCZ C;  3ETE A;  3GWO A;  4R7C A;  2Q6A A;  3CCQ V;  2QEX V;  1Q82 W;  3CCS V;  1FXV A;  2OT5 A;  1AR1 B;  2HKO A;  2AHZ A;  3E89 A;  2HVJ C;  3ABL C;  1YJ9 V;  3WFV A;  3B8N A;  4J9Y B;  3SPC A;  1P4R A;  1K4D C;  2XAJ A;  1GMG A;  5L3D A;  1NBM G;  4UXN A;  2ZR3 A;  1K5Q A;  1FFT B;  1R3L C;  5B1B C;  3AEI A;  3VOU A;  2IH3 C;  4PA9 A;  1GM7 A;  4BIU A;  5CBF A;  3B77 A;  1AJN A;  1Y4M A;  2H94 A;  2ZDI A;  1TUE B;  2W6J G;  2EZP A;  3G4S V;  2WLL B;  3MHS C;  1G8M A;  2IH1 C;  1BHB A;  4RUE A;  3K0G A;  5EBW C;  2ZD9 A;  3ETG A;  4ZBM A;  3ZCC A;  5L3F A;  3CCE V;  2HG5 C;  2IU0 A;  2WPD G;  5H9C A;  4N21 A;  2GHY A;  3ASO B;  3I56 V;  1NJI W;  5B1A C;  4H33 A;  3MD0 A;  3ZN0 A;  4MVU A;  1OHH G;  2WLI A;  4JAV A;  1EFR G;  4MTX A;  4P9O A;  4BAY A;  3LUT B;  4JTD B;  3SPG A;  2JK5 C;  4L87 A;  3X2Q C;  1PD3 A;  2JEU A;  2DWD C;  2OTJ V;  4TSF G;  4H37 A;  1KP2 A;  4UUJ C;  5L3B A;  1SES A;  3CCJ V;  4WFA V;  3IC7 A;  5CA3 A;  1K97 A;  1MSW D;  4U7O A;  1DF4 A;  4UV9 A;  2PI5 A;  5CMU A;  3SYC A;  4XDJ A;  3ASO C;  4OXS A;  1W2B U;  3SPH A;  2ITC C;  1S76 D;  5DN6 G;  5KUK A;  3ZIA G;  3OMN B;  5KUM A;  1F51 A;  4E2L A;  1DF5 A;  4FIP C;  4MTO A;  4XDK A;  1F23 A;  3OW2 U;  1GKF A;  1IXM A;  3FB7 C;  3JD1 A;  5B3S B;  1VQ4 V;  1H2G A;  2Q67 A;  2WSS G;  2X6B A;  2Y48 A;  1NH2 D;  3ZRX A;  4PA6 A;  2LFR A;  3H01 A;  2HR3 A;  1H38 A;  2EIL B;  4MVR A;  1K73 W;  2XND G;  3CCL V;  3ZJZ A;  2IJI A;  4GX5 A;  3LDE A;  1FXK B;  1VQ6 V;  2DYR C;  3ZRW A;  2EBO A;  2HJF C;  1QVG U;  4BW5 A;  5IYB O;  2XAQ A;  4LP8 A;  5CBG A;  3CC2 V;  1JX9 A;  4TT3 G;  5IYC O;  3F7V C;  5LHH A;  3OE7 G;  1MAB G;  1YI2 V;  4QE9 A;  1OCC B;  1S72 V;  3AG4 B;  4JF3 A;  2WLN A;  4WFB V;  4RQE A;  2H8P C;  2WAM A;  4PA7 A;  1AI6 A;  3OGC C;  1XL6 A;  2JDI G;  1M90 W;  3F7Y C;  3K06 A;  4FJC C;  5FL7 G;  3G6E V;  3ZMV A;  1K8A W;  2DYS B;  3LSS A;  3ZMS A;  2XAF A;  3CC7 V;  3FB6 C;  1QVF U;  1VQP V;  5L3G A;  1M57 B;  3A0R A;  1V55 C;  2C2A A;  3MHH C;  5BZB A;  3NXS A;  3CCU V;  2A0L A;  3AG3 C;  3BY6 A;  1I5X A;  4MW8 A;  1ZWI C;  1B6Q A;  3JD2 A;  3K03 A;  1ENV A;  2XAH A;  1WPX A;  1OCC C;  1K9M W;  2EIK C;  3STL C;  3ABL B;  4PDM A;  1VQK V;  2W0F C;  3K0D A;  2CK3 G;  3E8G A;  4JTC B;  5B1B B;  1E79 G;  1W0J G;  4X88 A;  2QE7 G;  2DYS C;  3WG7 B;  1NH2 B;  2F43 G;  3UKM A;  2QTO A;  2WLI B;  3W7W A;  2DWE C;  2EIJ B;  5EBL C;  1EZJ A;  1QCE A;  2ZDI C;  1VQ5 V;  2QM8 A;  3E8H A;  4I9W A;  5LBQ A;  1SER A;  5B1A B;  5B1O A;  4MVO A;  2EJR A;  4MTG A;  3W7U A;  3OFN G;  2ZR2 A;  4UVB A;  4FPP A;  3VBB A;  3X2Q B;  3P32 A;  3WG7 C;  1NR1 A;  4LCU C;  1JPX A;  4FMT A;  4WFG A;  3PJS K;  2EIM B;  3M99 B;  2EIJ C;  1G4Y B;  3CCM V;  1VQ8 V;  1OCO C;  2WLJ A;  2X6C A;  2FTK A;  4JAU A;  1WLE A;  3ABM C;  3LSQ A;  2WLH A;  4I5S A;  1R3I C;  2IJK A;  4HYO A;  2ZXW C;  4X8A A;  1GO3 F;  1MOF A;  2A79 B;  1NKD A;  1K92 A;  1YTF D;  4P30 A;  1XL4 A;  5LGN A;  2QKS A;  3SJQ C;  4YXW G;  1FS0 G;  4QE7 A;  1DLB A;  3IGA C;  4ZKI A;  2EIM C;  4MTF A;  1AI5 A;  3OEH G;  1S77 D;  1GM8 A;  4PEL A;  4RUF A;  2AHY A;  1GM9 A;  4KP4 A;  4UV8 A;  2YEV A;  4PA3 A;  2R9I A;  4GX0 A;  4CBC A;  1ORQ C;  3DGE A;  2MK3 A;  3TCU A;  4RQF A;  1PL0 A;  3E35 A;  3ABK B;  3AG1 B;  1JJ2 U;  2Q69 A;  4U7N A;  2DYR B;  1CEZ A;  5C93 A;  4PDR A;  3HB3 B;  1Q81 W;  2V7Q G;  1KC8 W;  5KA5 A;  1NVP D;  2IW5 A;  3DTU B;  3FYI B;  3RVY A;  2Q68 A;  5CBH A;  5KA6 A;  2X7R B;  3OMI B;  5GW7 A;  3SYO A;  4BIZ A;  1VQO V;  3OUF A;  1YSC A;  1OZ0 A;  4MVQ A;  1AJP A;  1R6K A;  1K7D A;  2P6J A;  2WLL A;  3JCZ A;  2GSM B;  3CXC U;  3CD6 V;  3ABK C;  3AG1 C;  2EZO A;  4G2K A;  3FYE B;  3ETD A;  4MSW C;  3ML0 A;  4GCZ A;  1VQ7 V;  4UVC A;  4HAM A;  3W7X A;  3SPJ A;  1V55 B;  5DM6 V;  2QA4 V;  2WLM A;  2ZQM A;  2X0L A;  3E8B A;  2XAS A;  3AG3 B;  4MVM A;  3ZRS A;  1E1Q G;  2EIK B;  2UXX A;  2XAG A;  3RW0 A;  3K3W A;  1I5Y A;  5LGU A;  3CPW U;  3LNM B;  3OEE G;  1VQ9 V;  2P67 A;  3QO5 A;  1NR7 A;  1M9N A;  5L3E A;  3KG2 A;  5LGT A;  1SZT A;  2B1I A;  2LP7 A;  1M1K W;  1V54 B;  3QNE A;  3LDD A;  2HLD G;  3ZRV A;  4WCE V;  2X6A A;  1SET A;  1R3K C;  5H6Q A;  1JQ0 A;  3K79 A;  3I55 V;  1S3J A;  3K9A A;  1AJQ A;  5L3C A;  4JYB A;  4MS2 A;  1S0V A;  2R9R B;  2P7T C;  2V1D A;  1BHA A;  2IU3 A;  3RBZ A;  2JIZ G;  1RM1 C;  3FB8 C;  3RVZ A;  1PKX A;  2JEX A;  2HVK C;  3HPL C;  2ITD C;  1LNQ A;  2NLJ C;  1NVP B;  1YIJ V;  1K5S A;  1ARO P;  1V54 C;  2Z5U A;  1F4M A;  1J95 A;  5IDJ A;  5H6R A;  3LDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...