1QVGU

Structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1qvgU00
1Q86W 1N8RW 1K73W 3OW2U 1K8AW 4WFBV 4WF9V 3CCRV 1YI2V 4WCEV 3CPWU 1YJWV 1Q82W 3CMEV 1KC8W 2OTJV 3CCLV 3CMAV 1YHQV 2D3OW 1VQ7V 1VQ6V 3I56V 3CCUV 1Q81W 3CD6V 4WFAV 1VQMV 1QVGU 1VQ8V 1VQPV 1YITV 3CCQV 3CCSV 1QVFU 1VQNV 5DM6V 3CC7V 1YJNV 3G6EV 1Q7YW 3I55V 3CCJV 3CCMV 3CCVV 2QA4V 1W2BU 1M1KW 1KD1W 2OTLV 1K9MW 1R73A 3G71V 1VQOV 3CC4V 1YJ9V 3CXCU 1VQ9V 1NJIW 1VQ5V 3CC2V 1S72V 1VQKV 1YIJV 1KQSU 1M90W 1VQ4V 1VQLV 3G4SV 3CCEV 1JJ2U 2QEXV
chains in the Genus database with same CATH superfamily
4CH5A 2VS0A 1XQ8A 1R3JC 1H2SB 4O4LB 1F4MA 5L3EA 4JI4B 4OX9B 2F93B 3CCLV 5IYCO 1FAFA 3PN1A 4C7UA 1XMOO 3A8TA 1W0JG 2F95B 1Z5WA 4YHHB 3L70H 3HKEB 4JI7B 1DLBA 1R6TA 3LUTB 1EBOA 5L3DA 2F43G 2BE3A 4WFFA 3ZN1A 5JQGB 3LDEA 4PI2A 3BRCA 2QDOA 4LF7B 3H1HH 5EIBD 4BW9A 4CS2A 1H2KA 3CC7V 2Y0IA 3K5NA 3KCYA 1Q90D 1WP8A 2HKOA 4JASA 5BXZA 1IXMA 2YUAA 4UUJC 5H9CA 4MTGA 4NB5A 2QEXV 2DN9A 5J2TB 1RPOA 1K73W 1PP9H 4K35A 3O65A 1BSMA 3CX5F 3OGIB 2WLMA 1YTFB 2YXLA 1KYOF 3T1HB 4MW8A 1N4CA 2P7TC 2QGNA 3K59A 2WA3A 5FNVA 4A5UB 2OYQA 3OT7A 3A0RA 1JJ2U 5B1AC 2BTQA 2B1IA 1AJNA 3ZJZA 3ETEA 1TGOA 2H94A 1BMFG 2IJIA 2LGQA 2QTOA 3OFNG 4JI5B 3ZHTA 2Y4UA 4JF3A 3ASNB 5KX5A 3SDLA 5IWAO 4JZGA 1LUWA 3M7MX 3RBZA 4DR3O 3WG7B 5JJNB 3CSXA 5IDJA 2R9RB 4LNUA 3G6EV 1XEQA 2OCHA 3G71V 4GKKO 4X89A 5CMUA 2P90A 4FLTA 1MZFA 2BOBC 2ZCEA 4B7EA 3P32A 4TWKA 4LR3A 5FNVB 2HHHB 2UUBB 1MOFA 2Z5UA 1OCOC 3ICXA 2QR4A 2W0XA 4LBEC 3OTOB 3X2QB 3SYOA 3ZMZA 1K9MW 3ZHQA 1K97A 2ZINA 2BTQB 1EM1A 2XTAA 2QSAA 3T1YO 1VQ4V 1BHAA 5GW7A 3C3SA 2JVDA 2JIZG 1J95A 2DQ0A 4H33A 4JTAB 2Q7HA 2F4VB 2XUMA 3TXSA 3ABMB 4XDJA 5KX5B 4P30A 2YIBA 4N21A 3G6BA 1ZL8B 1SKVA 1VQOV 1WAZA 4TSFG 3JATB 1GH6A 2XAJA 3BPZA 4UCUA 1D5AA 2UXDO 2FTKA 2QWRB 5H2FZ 1SQGA 4LNUB 2KB1A 4I0XA 4Q20A 4P9OA 3OE7G 4K8XA 1YITV 4R50A 3HKCA 2Q7GA 3AG4C 4J7JA 2RJZA 3WB2A 3FYIB 2UXCB 3TJTA 1KP3A 2KG7A 2CE4A 1LR1A 1G8MA 2A7WA 3ABKC 1M93A 2OIGA 1OCOB 1T5EA 3D8CA 1I7FA 4DV2O 2A0LA 4JV5B 2FKXA 2CTPA 2KSDA 2VQFB 2E5LB 3ZHRA 2GHYA 1VF6C 1NZ6A 4JAVA 1OCZC 3AG2C 4GX0A 4PD4F 1SESA 3I56V 1Q5OA 2P06A 1I5XA 4GX2A 3JCUZ 1N32O 2WLIA 1TAEA 3RT3C 3PJSK 3ETQA 1QU7A 1VARA 1K5SA 2EULA 5GTIZ 3HKCB 3L73H 5CA0A 3NXSA 4PA3A 1EN4A 1NI8A 3CHXA 4W4KA 2KG7B 2YXHA 1Y6XA 4LFBO 2ZIOA 3K79A 2DMXA 2JEXA 1SQPH 4MVMA 2RMKB 2ITCC 4JI4O 4OX9O 3K9SA 5BY1A 5B3SC 4PDVA 2ZQMA 3M8AA 3UKMA 1OCCC 4YHHO 1AP5A 2YC0A 3FB6C 2PY5A 1BZKA 4JI7O 4FMTA 1KKDA 1S5JA 1SQFA 2EX3A 1I5YA 1S72V 1U96A 1XILA 2YEVA 3CYOA 3CE2A 4UVCA 4PDMA 4OXSA 3F7YC 2WLIB 2HFEC 2QWQB 4LF7O 3K57A 1HP8A 4CS4A 2UXXA 2EINC 4NTXA 1MMMA 5LHGA 5D5QA 2EILB 4QPJA 1GM9A 1GTOA 1CEZA 2JGUA 2AZ2A 3LDCA 1G6UA 3K0GA 2PI5A 1YZBA 3TXQA 1JX9A 4I50B 3D3IA 1FKAO 3ZMUA 4ZI7A 4DXWA 3T1HO 4DR7B 5A9GA 3A0BZ 4DV0B 1K92A 4H37A 2ZE7A 3T4DA 1AP6A 2QM4A 4LFAB 3BEHA 1M57B 1XL4A 3AG1C 2ZXWC 2F66C 2QTSA 2UXNA 1QHTA 4R6ZA 2ZDIA 2DYRC 4WFAV 3MHSC 2EZOA 2Y69B 2Q73A 2XOKG 2ADPA 4JI5O 4JGSA 5IYZA 4CH3A 2G38A 4J80A 1H8EG 4J41A 3C3TA 3B8MA 2R72A 1WB7A 1L8DA 4LF8B 3D36C 2Y48A 1LUVA 1HDJA 5C93A 4JTCB 1ZLZA 5IY5C 1R6NA 2RCVA 5LP6A 1P84F 4ZI7B 2YDEA 1P4RA 1BHBA 4BW5A 2QKAA 5CN0A 3DGEA 5JJEB 3K3WA 2ETNA 2HHHO 2UUBO 2PI4A 3IAYA 1M56B 3JYCA 4NXMB 1H38A 3OTOO 4K0KO 3CRAA 5F2VO 3ZHUA 2GSMB 1N8RW 4UCSA 1NTKH 5AG2A 1RM1B 2IBZH 4X9QA 3JAWA 2CH7A 3WFVA 5IYZB 2F4VO 3U11A 1QNMA 3DXRA 4RO2A 4UV8A 1MSWD 2K1EA 4JYAB 1QVFU 2ADQB 1QR9A 4NVPA 1V55C 3CCJV 4IYHA 1M9NA 1AB3A 4G27B 3CC2V 2JDIG 2XT9A 2CTRA 4UVAA 1IVSA 3JCZA 3T2MA 1Q86W 5FLXN 3VQYA 4L87A 3E8FA 5LHHA 2CUGA 1SRYA 5IY5B 5LP6B 1K7DA 2YI8A 5D5PA 1F23A 1JJOA 2JRIA 4UCTA 4MVSA 3DSQA 4KL1A 2YSUB 4MSWC 1L0LH 2UXCO 2BOCC 5KHHA 4LF9B 3RYFA 4ZKIA 4IT5A 2EIKC 2IJJA 4NTWA 3FB5C 5LYJA 4JV5O 5J2UA 2AXTZ 5H6RA 4IYIA 1G1XB 4JI3B 2GTAA 4MTXA 1SC5B 2ZR3A 1HNWB 1DF4A 2VQFO 2E5LO 3JAWB 3N27A 5KHIA 2UU9B 3CRQA 1XI1A 2CH7B 1TUEB 3IJ4A 4DV5B 4BIUA 2NR5A 2ZNJA 3CPWU 1K3EA 4JI8B 1AVMA 1V55B 1Q81W 2JS3A 2P5OA 3SJQC 5EK0A 4ABMA 3ABLB 1NVPB 2Y0PA 2RN9A 4B08A 1AI6A 2CGOA 2W6IG 3LNNA 4GZRB 3LSSA 1NQTA 2OIEA 3CP1A 1R3LC 3BCCH 3C90A 3A0HZ 1H8HG 2UUCB 5BR8B 1YTFD 2N04A 3ML0A 2EIJC 4J9YB 2P22C 1XMQB 4WFGA 4FLVA 1SQBH 4TUYA 3NR7A 4FLYA 3RYFB 4X62B 4MVRA 1THZA 4JAAA 5LGNA 3BHPA 4JAUA 5LYJB 5J2UB 4B3SB 4IHJA 1AR1B 3HB3B 1XHXA 4CBCA 4CC6A 2Q0OC 1SA0A 5EIBC 1FJGB 2HR3A 3H1LH 3CCSV 3ETGA 3K5MA 2IW5A 4PA6A 5IJ9A 4JYBA 5IYDO 3QO7A 5JCOC 1NH2B 1M5IA 3WU2Z 3CRCA 1FXVA 3DC6A 3K58A 3SPIA 1MSDA 1H2NA 1PM9A 2ZNIA 1JMKC 3AK2A 2AHYA 2VQEB 2DYSC 3CB2A 1FFXA 5EYPA 2QWOB 1M4UA 1GM7A 4QE7A 4FM0A 1SS3A 4HAMA 1DK1A 5HFLA 3IGAC 3I5DA 2DWDC 4JYCA 3RWRD 1VIBA 4MW3A 4TUYB 3SYAA 4I4TA 1WLEA 4MT8A 4DR7O 2H3OA 4FK5C 5LMUB 3SPGA 1KD1W 2HJDA 4ZHQA 3CXCU 4IHJB 4DV0O 1E1QG 1Q43A 1SA0B 4LFAO 4W4LA 5JH7A 4UV9A 3RYCA 3CMAV 2WPDG 5IJ9B 1YXBA 2VWKA 3E22A 1Q7YW 1FXKC 4YY3B 1ZSPA 4JTDB 1P7BA 5KHGA 1ZWIC 1IX9A 3LNMB 1QLNA 1Q6HA 1P7GA 3ZRWA 1K33A 4TOIA 4O2BA 4WFBV 5LGUA 4PDLA 1BQZA 1FFXB 1DTOA 5EYPB 1S5LZ 4MVUA 4LF8O 5FPRA 4R7CA 3DTUB 1S5HC 2MK3A 1F51A 2OTLV 4K8ZA 1DGSA 4K0KB 4YIPA 1NJIW 2EZPA 5B1NA 3JSNA 2L6LA 4I4TB 5B1AB 1KUQA 1N34B 1Y74A 2ZR2A 2PTMA 1SQXH 2W6JG 2IJKA 4X1IA 1NBMG 4ZHQB 4JI0B 4F4LA 4UFZA 4IL6Z 4NXMO 1JCHA 1ZUQA 2CTQA 3L74H 5JH7B 4RUFA 2DOSA 1VQ5V 2LW7A 4U7OA 4DR5B 1VQLV 2NN4A 4DR6B 2EJRA 1IURA 3E22B 2YIBD 4O4JA 4UVBA 2OTJV 5LBQA 1ZTEA 2AZ0A 1HNXB 1BL8A 3ZRWB 2B1GA 3BAAA 1S76D 4JYAO 3OMIB 3ASOC 4O2BB 1GAXA 4JYYA 2HVKC 2Q0AA 4LFCB 4FLZA 2GV9A 1VQ9V 1URFA 2ARHA 3ZIAG 2XHBA 4G2KA 3T4ZA 1SERA 4U3JA 4BIOA 3FX7A 1GN6A 1RPRA 1GKFA 3VQVA 4O4HA 4GKJO 1SZXA 1Y74B 4U3FH 4DV7B 3FYEB 4CH6A 1QBZA 4X1IB 4D6TH 3G4SV 2BTOA 3B4SA 1VF6A 3H01A 3HKBA 4LF9O 4DV1B 5B1BC 5L3GA 3RVZA 1HNZB 2ZT9B 1SZTA 2HP8A 3P3PA 1AI5A 4HBNA 4O2AA 5CB4A 3R65A 3SR2C 2ATKC 2KQXA 1Z2GA 3STZC 4JI3O 1YVWA 2OT5A 1HNWO 4UB6Z 4O4JB 2AGAA 2UU9O 2DW4A 4I0XB 5JJJB 3L75H 4DV5O 1YJWV 4Z1MG 3UQ8A 4JI8O 2Q4PA 1KECA 1RFYA 2Q6AA 3KZIZ 3AG7A 2UUAB 3AG4B 1US6A 4DUZB 3H9VA 2B9ZA 4P2ZA 4FLWA 4U3JB 1W0KG 2QKCA 3QVNA 3ABKB 4WBNA 1O9GA 4FFBA 3TGUH 4H0LB 4O4HB 1YCIA 1KP2A 2UUCO 5BR8O 2YI9A 4QNHB 1EFRG 1YSCA 3B77A 4GLXA 1XMQO 2A9HA 5DM6V 2CK3G 3JAMN 5KAFZ 4X1YA 1EN5A 1Y4MA 3HKBB 4X62O 1EZVH 3W7WA 1OCZB 3ZBHA 3AG2B 3EVKA 1U97A 3ZMVA 2QM8A 4O2AB 5CB4B 2PYJA 3F5WC 3FB7C 3ETDA 4B3SO 3ZMTA 2YIAA 3BA9A 1N33B 1HW7A 1N36B 1FJGO 5KHJA 1BE3H 4B3MB 4RQFA 5EZYA 1IBMB 4K3AA 1PL4A 3ZHSA 5CA0B 4QJFB 4LF4B 2LGWA 2GUZA 2DQ3A 4I9QA 1XBLA 2WSSG 1AJPA 3TK1A 3W7XA 1GMGA 1YDXA 1GM8A 5LL6Y 1WP7A 3OEEG 4IGGA 2VQEO 4AILC 4WBNB 4D7TA 3K0DA 4FFBB 1AILA 1JVMA 1BGYH 1MG1A 1SETA 4J7ZA 1OCRC 3H1KH 2PUSA 5B3SB 1ROPA 1OCCB 1ENVA 4X1YB 3FB8C 3BABA 5LXTA 1QVGU 4WFHA 1CP9A 4ASUG 2R9IA 2YEVB 2YICA 5LMUO 4QPKA 2HVJC 1R1BA 1G4YB 4GYCB 1FPOA 3ABUA 1QLEC 2GBOA 3RYHA 5E79Z 1AR5A 4WF9V 2P4VA 2JS5A 2FB5A 3QO8A 3BFRA 1GN3A 5IYBO 4O4IA 2EINB 1HWYA 1OV9A 5EZYB 2Q67A 3AG3C 4GX1A 2PYLA 3CCQV 2DE0X 4YY3O 2EIMC 1OZ0A 2GUZB 2V4DA 2YIDA 3D36A 2B5UA 3IC7A 1R3IC 1KQSU 4I5SA 2VRZA 2GDSA 2RQ6A 2QKSA 4MTOA 3EHBB 5EC2C 2IU0A 3QF7A 5IJ0A 2FL4A 2XAFA 3FKSG 4X66B 4MVOA 4DR1B 1VQ8V 2AW9A 2HJFC 1XL6A 3N2KA 3CCMV 3LSUA 3ZS8C 3L9DA 1L0NH 2ZKOA 1JFFA 5B1OA 5LXTB 2X6BA 3AG1B 2ZXWB 4EEQA 2Q7EA 4DV3O 1N34O 4WFEA 1AI7A 3CCRV 2NLJC 2DYRB 3K04A 1EN6A 4Q6GA 1PKXA 5CBFA 4JI0O 4B3RB 4ZOLA 1AR4A 2ZE5A 3RYHB 2LO1A 4GUNA 4YIOA 4JI1B 5DEDA 3OMAB 1S0VA 3RN4A 4XBFA 3OTFA 1XNQB 4DR5O 3IFXA 2RNBA 3BA8A 4E4EA 1PNMA 3ZRVA 4DR6O 1F7YA 2O57A 1B6QA 1V9PA 2WWWA 5LMNB 5C8YA 4J11A 4DV6B 3J7AU 2QE7G 1E79G 3QG5A 3DC5A 4ICGA 1B04A 3JD1A 1HNXO 2RDCA 3AK1A 2JGDA 5KA6A 4GKJB 4LFCO 1NVPD 3QTCA 3SPJA 1V54C 2V7QG 1J5EB 3APQA 5IJ0B 4HZ3A 2WAMA 4QE9A 4NTYA 4U7NA 3F7VC 2FYUH 3N2KB 2X0LA 3VOUA 4ZBMA 3L71H 3GVMA 3TETA 1X59A 1JFFB 1WB8A 2K9PA 4UCRA 1XHZA 3MHHC 1BCCH 4NR1A 1GK9A 3E35A 4DV7O 4J42A 2PF4E 3ZEDA 2E75B 3DXRB 4ZOLB 2AHZA 5EBWC 2OWOA 2PGGA 1Q82W 4DV1O 5JVDA 5KUKA 4EFEA 4PV1B 1HNZO 2Q69A 4X65B 3I55V 3W7UA 4DW0A 1ZX3A 3G67A 4JI6B 5C8YB 3JAKA 3LDDA 3B2EE 1NH2D 5GONA 2ZIMA 5CBHA 2JGDB 3WB1A 3A2FA 1K34A 1FD9A 4RUEA 4AQYB 5KHKA 2UUAO 4OPHA 4DUZO 2LQTA 1XUQA 1Y76A 4PA4A 4PI0A 4JI2B 3SPHA 3KG2A 2WLHA 4J9ZB 3ZRXA 1MA1A 1FXHA 3QO5A 1XREA 3S3WA 4FJCC 1EZJA 3EFFK 2BSKA 3LSQA 5E1AC 2EIKB 3WB0A 2W0FC 2QWNB 4DV4B 4KFMA 5CA1A 2ZM6O 2UXBB 1NKDA 2A79B 5J9PC 3MAQA 1YJNV 4X1KA 4BAYA 4PJ0Z 5DECA 3VQXA 4OGQB 5KUMA 2CTWA 5JVDB 3MD0A 4YXWG 4EKWA 3M99B 4BR6A 3OR6C 3ASNC 5JCOA 3B40A 2F23A 4XDLA 1RSOA 3JAKB 1N33O 3WG7C 2N05A 1UFIA 4KUMA 5GONB 1N36O 1E1RG 1H2GA 5B5EZ 2GTSA 1LNQA 3T1CA 1I0HA 4B3MO 4H13B 1IBMO 1RP3B 4QGPA 1IBKB 4FLUA 2WA4A 1S77D 4DO2A 2H8PC 4LF4O 3CRRA 2DWEC 1IBLB 4NYKA 1Y76B 2EIJB 2BCCH 2QWPB 4B3TB 4NXNB 3JALA 4I55A 3GB7C 2EBOA 2QM7A 2BSKB 1PPJH 4KHPB 4BIZA 3X2QC 4LF6B 2X7RB 4QIWF 5H5NA 5CA1B 1JPXA 1YI2V 4X1KB 3G80A 3JASA 5LA6A 5KMGA 5BMVA 4DK1A 3CS5A 3ABMC 5LGTA 2FMLA 1TUBA 1UJWB 2CGNA 1FXKA 5L3BA 1ZL8A 1RSOB 4H44B 2E3CA 1JOYA 5JWPA 3JATA 3RFRA 1KB9F 2DYSB 3OUSA 2JK5C 1ZAUA 4PDRA 4FM2A 3RVYA 1AI4A 1HR0B 4LH6A 1UPGA 3CCVV 3HKDA 3IC9A 1NTMH 5EC1C 1YJ9V 5IT9N 3GWOA 4TT3G 1MABG 4UCVA 3JALB 4I55B 4DV3B 1S3JA 3CD6V 1YEWA 3JSLA 1K5QA 1I94B 4X66O 3U10A 4DR1O 1VQPV 1VQNV 3BVOA 3SYPA 4DR4B 1PL0A 5EBLC 2XAQA 2OCCC 3SJCC 4I9WA 5HFMA 3RYCB 4RAIA 4YJ2A 3P30A 3JASB 5LA6B 3E8GA 5KMGB 5BMVB 3E8BA 3ZX6A 3JD2A 1TUBB 2CAZC 2Y4TA 3CXHF 1FXKB 2IU3A 4B3RO 5LOVA 4JI1O 1Y66A 3W7TA 1W2BU 1Q8IA 4TV9A 2ZE6A 3BY6A 5K1PA 3UO3A 1XNQO 1P49A 2WLJA 4BWAA 1TA8A 2LW1A 1W59A 1WNSA 2P67A 1SF9A 5LMNO 4DV6O 3HKDB 3VBBA 4TV8A 4JPRA 3W7SA 3L72H 2IH3C 1OJHA 1NR7A 4AHCA 1J5EO 3U0ZA 2Q5ZA 1VQ6V 3UM7A 4DUYB 3JD3A 5FL7G 3E2EA 3OAAG 4ZIBA 1BS3A 4GT1A 1CPYA 4FVMA 4X64B 3Q4HA 3RYIA 5L3FA 4YJ2B 2OCCB 2IJHA 4B7KA 2ZE8A 1WN7A 3CRMA 2VWJA 4DR2B 1M90W 1KKCA 2A3QA 4LH7A 4F6RA 1VP7A 3OGCC 1SQVH 1VEWA 1K8AW 4LF5B 5K1XA 1XNRB 5LOVB 4IIJA 2DJVA 4TV9B 2ILMA 3CCUV 3ASOB 2KKWA 3F5TA 4FM1A 1IXBA 1JQ0A 3KCXA 2C2AA 4X65O 3OUFA 1R3KC 4AI8A 3FAVA 4HNAA 4JI6O 5GTHZ 3ZRSA 4D7SA 2EILC 4UXNA 3CCEV 4DRXA 4TV8B 2E76B 2E74B 3N2GA 4XDKA 1B06A 3CEIA 1A32A 1F4NA 3CMEV 2WLKA 1XMOB 2D3OW 1TVKA 3ZN0A 1VQ7V 4AQYO 3ZCCA 3SJBC 4PA9A 3E83A 1AJQA 4FFKA 3UCSC 2ZM6B 4YJ3A 3SGIA 3FD9A 2X6AA 3E8HA 4I50A 3SPCA 4MVZA 2QA4V 4JI2O 3K5LA 2QJ1A 4MTFA 1MZEA 2M6YA 3HPLC 3OMNB 2YS8A 3Q4HB 3RYIB 5B1BB 3SYCA 3R66A 4GX5A 4F6EA 3UO2A 5BZBA 1M57C 3K5OA 4DV4O 1KU9A 5IE9A 3UT5A 1BT8A 1VQMV 2Z3YA 1FFTB 2Q8VA 2UXBO 4F6RB 1Q3EA 3THOA 4X20A 2Y69C 1K4CC 1KMIZ 3O9OA 4IIJB 4JZ2A 4RQEA 1D2DA 3P3NA 4J10A 3TCUA 2NNUA 1NTZH 1NR1A 1QCEA 4HYOA 1XDCA 3FAVB 4P9PA 4HNAB 2Z0AA 2LP7A 2HG5C 1PV0A 4DRXB 5L3CA 3N2GB 4N23A 4FZ1A 4E2LA 4EB6A 5ITZA 3ABTA 3AK3A 2P4KA 1IBKO 2R70A 1TVKB 3OW2U 1JR9A 4YJ3B 1NT2B 3RW0A 1IBLO 1CXZB 1FS0G 1KC8W 4PELA 3JARA 1Z5VA 3QNEA 2N74A 4B3TO 4NXNO 1GO3F 5KA5A 1MNGA 4Z2WA 5B66Z 4CZZA 2WLLA 2XAGA 1M1KW 1M56C 2V1DA 4KHPO 1X4TA 2WLNA 1VQKV 4CS3A 4LF6O 3UT5B 3JD0A 5IWAB 1Q6IA 2ZDIC 4NKGB 2LFRA 4DK0A 4DR3B 3E86A 4WCEV 2PZSA 2JEUA 4X20B 1RM1C 5CBGA 4L8JA 4LC1A 2LFSA 3GWKC 2A06H 4Z1VA 2Q9LA 2CDYA 1GRJA 3KKYA 4CC5A 4GKKB 1B3QA 1IDSA 1I08A 3RGBA 3MDSA 4PA7A 1VMGA 2F1MA 3ZHVA 5A2QN 1XOUA 2IH1C 3CWBH 1WA8A 4EB6B 4X8AA 5ITZB 3OEHG 1HR0O 4X88A 1IZ3A 2L35A 5LP6C 3T1YB 4DYLA 1Y67A 3B09A 3JARB 1OCRB 2R9AA 4MVQA 1JA8A 1NS1A 5LHIA 2WLLB 1SQQH 2XNDG 1R6KA 5FPOA 1QQCA 1I94O 1K4DC 3AEIA 2Q68A 2ZD9A 4DR4O 4MS2A 3FFQA 1QLEB 3SYQA 1KBHA 4EFBA 1PNKA 1FYJA 4R8CA 3H1IH 1H2LA 4CH4A 4O4IB 1PD3A 4J7KA 2UXDB 1L1FA 1YF2A 2YXYA 1O9HA 3AG3B 2M7WA 4I7ZB 2HEPA 3CJHA 1GN4A 2EIMB 3K03A 3S3XA 2IM9A 3J81N 1WPBA 2XAHA 5DN6G 2HLDG 3K06A 3JD4A 4DW1A 3ABLC 1QR8A 3B8NA 1NU1H 4FIPC 4KXRA 3HR0A 1N0JA 1WA8B 2MW2B 4LWSA 1PNLA 1VF5B 2JJ1G 1VF7A 3SJAC 3EXAA 1H2MA 4UCOA 4DV2B 4OPAA 3ZMSA 4FLXA 3D3QA 4O4LA 3VQWA 1N0NA 1D5NA 1WJZA 2ITDC 3STLC 1YIJV 1BQ0A 4LCUC 3H1JH 3HKEA 4FPPA 4FZ0A 4DUYO 1WPXA 1YHQV 1ORQC 2P6JA 2EJ7A 3OM3B 2X6CA 5JQGA 2ODMA 4X64O 4UB8Z 1N32B 4KP4A 3OR7C 2JJ2G 1Q6UA 5H6QA 3OD4A 3CC4V 4PHZA 5KAIZ 4DR2O 3E89A 4TQDA 3CJHB 5EBMC 1DF5A 4LF5O 1COWG 4RWUA 1XNRO 3K08A 2D2CB 4GCZA 5J2TA 2LJ2A 5CA3A 1AROP 5KLVH 4LWSB 3J80N 4TQFA 2XASA 1V54B 1R73A 4LP8A 4G28B 1GN2A 4LFBB 3APOA 5TISZ 1OHHG 3K9AA
chains in the Genus database with same CATH topology
1P4RA 1BHBA 1R3JC 4BW5A 5CN0A 3DGEA 1KP2A 1S3JA 1F4MA 5L3EA 3K3WA 3CCLV 5IYCO 4QNHB 3CD6V 1EFRG 2PI4A 1YSCA 3B77A 1K5QA 1W0JG 1VQPV 1M56B 3JYCA 1VQNV 2A9HA 5DM6V 2CK3G 1H38A 3SYPA 1DLBA 1PL0A 5EBLC 1Y4MA 2XAQA 2OCCC 3LUTB 4I9WA 5HFMA 1EBOA 2GSMB 4RAIA 3W7WA 1OCZB 3AG2B 3P30A 5L3DA 2F43G 4WFFA 3ZN1A 1N8RW 3ZMVA 3E8GA 2QM8A 3LDEA 1RM1B 3F5WC 3FB7C 3ETDA 3E8BA 3ZMTA 3JD2A 3WFVA 1FXKB 4RO2A 4UV8A 1MSWD 2K1EA 2IU3A 1QVFU 3CC7V 1QR9A 1V55C 3CCJV 1Y66A 3W7TA 1W2BU 1M9NA 4RQFA 4G27B 3BY6A 4JASA 2HKOA 3CC2V 1IXMA 2JDIG 4UUJC 5H9CA 4MTGA 2WLJA 2QEXV 4UVAA 4QJFB 1RPOA 3JCZA 3T2MA 1Q86W 1K73W 2DQ3A 2P67A 2WSSG 1AJPA 3TK1A 3W7XA 4L87A 2WLMA 1YTFB 3E8FA 1GMGA 3VBBA 1GM8A 5LHHA 4MW8A 3OEEG 4JPRA 1SRYA 5IY5B 2P7TC 3W7SA 1K7DA 3K0DA 2IH3C 1F23A 1NR7A 3A0RA 1JVMA 4MVSA 2YSUB 4MSWC 1JJ2U 1VQ6V 3UM7A 1MG1A 1SETA 2BOCC 3JD3A 1OCRC 5B1AC 4ZKIA 5FL7G 3E2EA 2B1IA 3OAAG 1AJNA 5B3SB 3ZJZA 1ROPA 3ETEA 1OCCB 1ENVA 4GT1A 2H94A 3FB8C 2EIKC 1BMFG 1CPYA 2IJIA 1QVGU 2IJJA 2QTOA 3OFNG 3FB5C 5H6RA 5L3FA 4WFHA 2OCCB 1CP9A 4ASUG 2R9IA 2IJHA 2YEVB 4MTXA 2ZR3A 4QPKA 1DF4A 4JF3A 2HVJC 3ASNB 1G4YB 1M90W 3ABUA 1QLEC 1TUEB 3OGCC 1K8AW 4WF9V 4BIUA 3QO8A 3RBZA 5IYBO 3CPWU 1K3EA 3WG7B 2EINB 1HWYA 3CCUV 1V55B 1Q81W 3ASOB 2Q67A 3AG3C 4GX1A 3SJQC 3CCQV 5EK0A 1JQ0A 3ABLB 2C2AA 5IDJA 2R9RB 3G6EV 3OUFA 1R3KC 2EIMC 1OZ0A 3D36A 1NVPB 3G71V 1AI6A 4X89A 5CMUA 2B5UA 3IC7A 2P90A 2W6IG 3ZRSA 1R3IC 1KQSU 2EILC 4I5SA 4UXNA 2BOBC 3CCEV 3LSSA 2QKSA 4MTOA 3EHBB 1NQTA 3CP1A 1R3LC 5EC2C 4XDKA 2IU0A 3P32A 1F4NA 4TWKA 1H8HG 3CMEV 2WLKA 1YTFD 2D3OW 3ZN0A 1VQ7V 3ML0A 2EIJC 4J9YB 2XAFA 1MOFA 2Z5UA 3FKSG 3ZCCA 4MVOA 1OCOC 4PA9A 2HJFC 1AJQA 3E83A 1VQ8V 4WFGA 1XL6A 2X6AA 3E8HA 4LBEC 3SPCA 4MVZA 3X2QB 3CCMV 3SYOA 2QA4V 3ZMZA 1K9MW 1K97A 4MTFA 4MVRA 1THZA 1BHAA 1VQ4V 5GW7A 3HPLC 5B1OA 3OMNB 2X6BA 3AG1B 5LGNA 2ZXWB 4JAUA 2JIZG 5B1BB 1J95A 2DQ0A 1AI7A 4WFEA 3SYCA 3CCRV 2NLJC 2DYRB 4H33A 3HB3B 4JTAB 1AR1B 4GX5A 3K04A 5BZBA 1M57C 4CBCA 1PKXA 5CBFA 3ABMB 4XDJA 1VQMV 2Z3YA 4P30A 2HR3A 3CCSV 1FFTB 1S0VA 4N21A 3ETGA 2IW5A 3OMAB 4PA6A 2Y69C 1VQOV 4JYBA 5IYDO 4XBFA 3QO7A 1K4CC 4TSFG 1NH2B 2XAJA 3IFXA 1PNMA 3ZRVA 1FXVA 3SPIA 4RQEA 2FTKA 1B6QA 2WWWA 3TCUA 2NNUA 1NR1A 2QE7G 1E79G 1QCEA 2KB1A 4Q20A 4HYOA 4P9PA 4P9OA 3OE7G 3JD1A 2AHYA 2DYSC 1YITV 2LP7A 2HG5C 4R50A 5KA6A 5L3CA 3AG4C 1GM7A 4N23A 4E2LA 1NVPD 4QE7A 3FYIB 3SPJA 1V54C 2V7QG 3ABTA 4HAMA 4HZ3A 2WAMA 5HFLA 3IGAC 1KP3A 4QE9A 3OW2U 1G8MA 3RW0A 3ABKC 4U7NA 3F7VC 1FS0G 2DWDC 1OCOB 4JYCA 1KC8W 4PELA 4MW3A 2X0LA 3VOUA 4ZBMA 3SYAA 3QNEA 1WLEA 2A0LA 1GO3F 5KA5A 3TETA 4MT8A 4CZZA 4FK5C 2WLLA 2XAGA 3MHHC 1M1KW 1KD1W 3SPGA 1M56C 2V1DA 1GK9A 3E35A 3CXCU 2GHYA 1E1QG 2WLNA 1VQKV 3JD0A 2ZDIC 4JAVA 1OCZC 2LFRA 3AG2C 2AHZA 5EBWC 3E86A 4UV9A 4WCEV 1Q82W 2JEUA 4GX0A 5KUKA 3CMAV 5CBGA 1RM1C 2WPDG 1SESA 3I56V 4LC1A 2LFSA 1I5XA 2Q69A 4GX2A 1Q7YW 1FXKC 3I55V 4JTDB 1P7BA 2WLIA 3W7UA 1ZWIC 3LNMB 1QLNA 3LDDA 3PJSK 3ZRWA 1NH2D 1K33A 4PA7A 5CBHA 4WFBV 5LGUA 4PDLA 1K5SA 2IH1C 1DTOA 1K34A 4MVUA 4RUEA 3NXSA 4PA3A 4X8AA 3OEHG 3DTUB 4R7CA 4PA4A 1S5HC 2MK3A 1F51A 4X88A 2OTLV 3SPHA 3KG2A 2WLHA 4J9ZB 1NJIW 2EZPA 3ZRXA 3K79A 5B1NA 1FXHA 3QO5A 1OCRB 5B1AB 2JEXA 4FJCC 4MVMA 4MVQA 1EZJA 3EFFK 5LHIA 2ZR2A 3LSQA 5E1AC 2WLLB 2EIKB 2IJKA 2W6JG 1NBMG 2ITCC 2W0FC 4KFMA 5B3SC 2XNDG 1R6KA 4PDVA 4F4LA 2ZQMA 3UKMA 1OCCC 1NKDA 1K4DC 2A79B 3AEIA 2Q68A 5J9PC 1YJNV 1JCHA 3FB6C 2ZD9A 4BAYA 4FMTA 4MS2A 1QLEB 4RUFA 1KKDA 3SYQA 1VQ5V 1I5YA 5KUMA 4U7OA 1S72V 1PNKA 3MD0A 4R8CA 4YXWG 3M99B 4EKWA 1VQLV 3OR6C 2YEVA 2EJRA 3ASNC 1PD3A 1L1FA 3CYOA 4UVCA 4PDMA 4UVBA 3AG3B 4OXSA 2OTJV 3F7YC 5LBQA 4XDLA 2M7WA 2WLIB 2HFEC 1BL8A 2EIMB 3K03A 3WG7C 2B1GA 2EINC 2UXXA 4KUMA 2XAHA 3ZRWB 3OMIB 3ASOC 1E1RG 1S76D 1H2GA 5DN6G 2HVKC 2HLDG 3K06A 5LHGA 3JD4A 1LNQA 2EILB 1QR8A 3ABLC 3B8NA 4QPJA 1GM9A 4FIPC 3T1CA 1GTOA 1VQ9V 1CEZA 3LDCA 3K0GA 1S77D 2PI5A 4DO2A 3ZIAG 1PNLA 2H8PC 2JJ1G 2DWEC 4G2KA 1JX9A 3T4ZA 2EIJB 1SERA 3D3IA 3ZMUA 1RPRA 4DXWA 3ZMSA 1GKFA 3GB7C 2EBOA 2QM7A 3FYEB 4BIZA 3X2QC 2ITDC 1K92A 1QBZA 4H37A 3STLC 3T4DA 1YIJV 2X7RB 3G4SV 4LCUC 4FPPA 4QIWF 3BEHA 1JPXA 1M57B 3H01A 1YI2V 1XL4A 3AG1C 2ZXWC 1WPXA 2UXNA 4R6ZA 5B1BC 5L3GA 2ZDIA 1YHQV 1ORQC 2P6JA 2DYRC 3OM3B 4WFAV 2X6CA 3MHSC 3RVZA 2EZOA 1SZTA 1AI5A 2Y69B 3R65A 2XOKG 3ABMC 5LGTA 2ATKC 4KP4A 3OR7C 3STZC 2JJ2G 4JGSA 1UJWB 5H6QA 2OT5A 3CC4V 1FXKA 5L3BA 3E89A 2DW4A 1H8EG 5EBMC 1DF5A 1JOYA 3B8MA 1COWG 1YJWV 3K08A 4Z1MG 2DYSB 1KECA 3OUSA 2JK5C 2Q6AA 4GCZA 4PDRA 5CA3A 3RVYA 3AG4B 1AI4A 1AROP 2Y48A 2XASA 5C93A 1V54B 3CCVV 4JTCB 1R73A 4LP8A 4G28B 4P2ZA 5IY5C 5EC1C 1YJ9V 1R6NA 1W0KG 3GWOA 4TT3G 3ABKB 1OHHG 1MABG 3K9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q86 W;  1N8R W;  1K73 W;  3OW2 U;  1K8A W;  4WFB V;  4WF9 V;  3CCR V;  1YI2 V;  4WCE V;  3CPW U;  1YJW V;  1Q82 W;  3CME V;  1KC8 W;  2OTJ V;  3CCL V;  3CMA V;  1YHQ V;  2D3O W;  1VQ7 V;  1VQ6 V;  3I56 V;  3CCU V;  1Q81 W;  3CD6 V;  4WFA V;  1VQM V;  1QVG U;  1VQ8 V;  1VQP V;  1YIT V;  3CCQ V;  3CCS V;  1QVF U;  1VQN V;  5DM6 V;  3CC7 V;  1YJN V;  3G6E V;  1Q7Y W;  3I55 V;  3CCJ V;  3CCM V;  3CCV V;  2QA4 V;  1W2B U;  1M1K W;  1KD1 W;  2OTL V;  1K9M W;  1R73 A;  3G71 V;  1VQO V;  3CC4 V;  1YJ9 V;  3CXC U;  1VQ9 V;  1NJI W;  1VQ5 V;  3CC2 V;  1S72 V;  1VQK V;  1YIJ V;  1KQS U;  1M90 W;  1VQ4 V;  1VQL V;  3G4S V;  3CCE V;  1JJ2 U;  2QEX V; 
#chains in the Genus database with same CATH topology
 4CH5 A;  2VS0 A;  1XQ8 A;  1R3J C;  1H2S B;  4O4L B;  1F4M A;  5L3E A;  4JI4 B;  4OX9 B;  2F93 B;  3CCL V;  5IYC O;  1FAF A;  3PN1 A;  4C7U A;  1XMO O;  3A8T A;  1W0J G;  2F95 B;  1Z5W A;  4YHH B;  3L70 H;  3HKE B;  4JI7 B;  1DLB A;  1R6T A;  3LUT B;  1EBO A;  5L3D A;  2F43 G;  2BE3 A;  4WFF A;  3ZN1 A;  5JQG B;  3LDE A;  4PI2 A;  3BRC A;  2QDO A;  4LF7 B;  3H1H H;  5EIB D;  4BW9 A;  4CS2 A;  1H2K A;  3CC7 V;  2Y0I A;  3K5N A;  3KCY A;  1Q90 D;  1WP8 A;  2HKO A;  4JAS A;  5BXZ A;  1IXM A;  2YUA A;  4UUJ C;  5H9C A;  4MTG A;  4NB5 A;  2QEX V;  2DN9 A;  5J2T B;  1RPO A;  1K73 W;  1PP9 H;  4K35 A;  3O65 A;  1BSM A;  3CX5 F;  3OGI B;  2WLM A;  1YTF B;  2YXL A;  1KYO F;  3T1H B;  4MW8 A;  1N4C A;  2P7T C;  2QGN A;  3K59 A;  2WA3 A;  5FNV A;  4A5U B;  2OYQ A;  3OT7 A;  3A0R A;  1JJ2 U;  5B1A C;  2BTQ A;  2B1I A;  1AJN A;  3ZJZ A;  3ETE A;  1TGO A;  2H94 A;  1BMF G;  2IJI A;  2LGQ A;  2QTO A;  3OFN G;  4JI5 B;  3ZHT A;  2Y4U A;  4JF3 A;  3ASN B;  5KX5 A;  3SDL A;  5IWA O;  4JZG A;  1LUW A;  3M7M X;  3RBZ A;  4DR3 O;  3WG7 B;  5JJN B;  3CSX A;  5IDJ A;  2R9R B;  4LNU A;  3G6E V;  1XEQ A;  2OCH A;  3G71 V;  4GKK O;  4X89 A;  5CMU A;  2P90 A;  4FLT A;  1MZF A;  2BOB C;  2ZCE A;  4B7E A;  3P32 A;  4TWK A;  4LR3 A;  5FNV B;  2HHH B;  2UUB B;  1MOF A;  2Z5U A;  1OCO C;  3ICX A;  2QR4 A;  2W0X A;  4LBE C;  3OTO B;  3X2Q B;  3SYO A;  3ZMZ A;  1K9M W;  3ZHQ A;  1K97 A;  2ZIN A;  2BTQ B;  1EM1 A;  2XTA A;  2QSA A;  3T1Y O;  1VQ4 V;  1BHA A;  5GW7 A;  3C3S A;  2JVD A;  2JIZ G;  1J95 A;  2DQ0 A;  4H33 A;  4JTA B;  2Q7H A;  2F4V B;  2XUM A;  3TXS A;  3ABM B;  4XDJ A;  5KX5 B;  4P30 A;  2YIB A;  4N21 A;  3G6B A;  1ZL8 B;  1SKV A;  1VQO V;  1WAZ A;  4TSF G;  3JAT B;  1GH6 A;  2XAJ A;  3BPZ A;  4UCU A;  1D5A A;  2UXD O;  2FTK A;  2QWR B;  5H2F Z;  1SQG A;  4LNU B;  2KB1 A;  4I0X A;  4Q20 A;  4P9O A;  3OE7 G;  4K8X A;  1YIT V;  4R50 A;  3HKC A;  2Q7G A;  3AG4 C;  4J7J A;  2RJZ A;  3WB2 A;  3FYI B;  2UXC B;  3TJT A;  1KP3 A;  2KG7 A;  2CE4 A;  1LR1 A;  1G8M A;  2A7W A;  3ABK C;  1M93 A;  2OIG A;  1OCO B;  1T5E A;  3D8C A;  1I7F A;  4DV2 O;  2A0L A;  4JV5 B;  2FKX A;  2CTP A;  2KSD A;  2VQF B;  2E5L B;  3ZHR A;  2GHY A;  1VF6 C;  1NZ6 A;  4JAV A;  1OCZ C;  3AG2 C;  4GX0 A;  4PD4 F;  1SES A;  3I56 V;  1Q5O A;  2P06 A;  1I5X A;  4GX2 A;  3JCU Z;  1N32 O;  2WLI A;  1TAE A;  3RT3 C;  3PJS K;  3ETQ A;  1QU7 A;  1VAR A;  1K5S A;  2EUL A;  5GTI Z;  3HKC B;  3L73 H;  5CA0 A;  3NXS A;  4PA3 A;  1EN4 A;  1NI8 A;  3CHX A;  4W4K A;  2KG7 B;  2YXH A;  1Y6X A;  4LFB O;  2ZIO A;  3K79 A;  2DMX A;  2JEX A;  1SQP H;  4MVM A;  2RMK B;  2ITC C;  4JI4 O;  4OX9 O;  3K9S A;  5BY1 A;  5B3S C;  4PDV A;  2ZQM A;  3M8A A;  3UKM A;  1OCC C;  4YHH O;  1AP5 A;  2YC0 A;  3FB6 C;  2PY5 A;  1BZK A;  4JI7 O;  4FMT A;  1KKD A;  1S5J A;  1SQF A;  2EX3 A;  1I5Y A;  1S72 V;  1U96 A;  1XIL A;  2YEV A;  3CYO A;  3CE2 A;  4UVC A;  4PDM A;  4OXS A;  3F7Y C;  2WLI B;  2HFE C;  2QWQ B;  4LF7 O;  3K57 A;  1HP8 A;  4CS4 A;  2UXX A;  2EIN C;  4NTX A;  1MMM A;  5LHG A;  5D5Q A;  2EIL B;  4QPJ A;  1GM9 A;  1GTO A;  1CEZ A;  2JGU A;  2AZ2 A;  3LDC A;  1G6U A;  3K0G A;  2PI5 A;  1YZB A;  3TXQ A;  1JX9 A;  4I50 B;  3D3I A;  1FKA O;  3ZMU A;  4ZI7 A;  4DXW A;  3T1H O;  4DR7 B;  5A9G A;  3A0B Z;  4DV0 B;  1K92 A;  4H37 A;  2ZE7 A;  3T4D A;  1AP6 A;  2QM4 A;  4LFA B;  3BEH A;  1M57 B;  1XL4 A;  3AG1 C;  2ZXW C;  2F66 C;  2QTS A;  2UXN A;  1QHT A;  4R6Z A;  2ZDI A;  2DYR C;  4WFA V;  3MHS C;  2EZO A;  2Y69 B;  2Q73 A;  2XOK G;  2ADP A;  4JI5 O;  4JGS A;  5IYZ A;  4CH3 A;  2G38 A;  4J80 A;  1H8E G;  4J41 A;  3C3T A;  3B8M A;  2R72 A;  1WB7 A;  1L8D A;  4LF8 B;  3D36 C;  2Y48 A;  1LUV A;  1HDJ A;  5C93 A;  4JTC B;  1ZLZ A;  5IY5 C;  1R6N A;  2RCV A;  5LP6 A;  1P84 F;  4ZI7 B;  2YDE A;  1P4R A;  1BHB A;  4BW5 A;  2QKA A;  5CN0 A;  3DGE A;  5JJE B;  3K3W A;  2ETN A;  2HHH O;  2UUB O;  2PI4 A;  3IAY A;  1M56 B;  3JYC A;  4NXM B;  1H38 A;  3OTO O;  4K0K O;  3CRA A;  5F2V O;  3ZHU A;  2GSM B;  1N8R W;  4UCS A;  1NTK H;  5AG2 A;  1RM1 B;  2IBZ H;  4X9Q A;  3JAW A;  2CH7 A;  3WFV A;  5IYZ B;  2F4V O;  3U11 A;  1QNM A;  3DXR A;  4RO2 A;  4UV8 A;  1MSW D;  2K1E A;  4JYA B;  1QVF U;  2ADQ B;  1QR9 A;  4NVP A;  1V55 C;  3CCJ V;  4IYH A;  1M9N A;  1AB3 A;  4G27 B;  3CC2 V;  2JDI G;  2XT9 A;  2CTR A;  4UVA A;  1IVS A;  3JCZ A;  3T2M A;  1Q86 W;  5FLX N;  3VQY A;  4L87 A;  3E8F A;  5LHH A;  2CUG A;  1SRY A;  5IY5 B;  5LP6 B;  1K7D A;  2YI8 A;  5D5P A;  1F23 A;  1JJO A;  2JRI A;  4UCT A;  4MVS A;  3DSQ A;  4KL1 A;  2YSU B;  4MSW C;  1L0L H;  2UXC O;  2BOC C;  5KHH A;  4LF9 B;  3RYF A;  4ZKI A;  4IT5 A;  2EIK C;  2IJJ A;  4NTW A;  3FB5 C;  5LYJ A;  4JV5 O;  5J2U A;  2AXT Z;  5H6R A;  4IYI A;  1G1X B;  4JI3 B;  2GTA A;  4MTX A;  1SC5 B;  2ZR3 A;  1HNW B;  1DF4 A;  2VQF O;  2E5L O;  3JAW B;  3N27 A;  5KHI A;  2UU9 B;  3CRQ A;  1XI1 A;  2CH7 B;  1TUE B;  3IJ4 A;  4DV5 B;  4BIU A;  2NR5 A;  2ZNJ A;  3CPW U;  1K3E A;  4JI8 B;  1AVM A;  1V55 B;  1Q81 W;  2JS3 A;  2P5O A;  3SJQ C;  5EK0 A;  4ABM A;  3ABL B;  1NVP B;  2Y0P A;  2RN9 A;  4B08 A;  1AI6 A;  2CGO A;  2W6I G;  3LNN A;  4GZR B;  3LSS A;  1NQT A;  2OIE A;  3CP1 A;  1R3L C;  3BCC H;  3C90 A;  3A0H Z;  1H8H G;  2UUC B;  5BR8 B;  1YTF D;  2N04 A;  3ML0 A;  2EIJ C;  4J9Y B;  2P22 C;  1XMQ B;  4WFG A;  4FLV A;  1SQB H;  4TUY A;  3NR7 A;  4FLY A;  3RYF B;  4X62 B;  4MVR A;  1THZ A;  4JAA A;  5LGN A;  3BHP A;  4JAU A;  5LYJ B;  5J2U B;  4B3S B;  4IHJ A;  1AR1 B;  3HB3 B;  1XHX A;  4CBC A;  4CC6 A;  2Q0O C;  1SA0 A;  5EIB C;  1FJG B;  2HR3 A;  3H1L H;  3CCS V;  3ETG A;  3K5M A;  2IW5 A;  4PA6 A;  5IJ9 A;  4JYB A;  5IYD O;  3QO7 A;  5JCO C;  1NH2 B;  1M5I A;  3WU2 Z;  3CRC A;  1FXV A;  3DC6 A;  3K58 A;  3SPI A;  1MSD A;  1H2N A;  1PM9 A;  2ZNI A;  1JMK C;  3AK2 A;  2AHY A;  2VQE B;  2DYS C;  3CB2 A;  1FFX A;  5EYP A;  2QWO B;  1M4U A;  1GM7 A;  4QE7 A;  4FM0 A;  1SS3 A;  4HAM A;  1DK1 A;  5HFL A;  3IGA C;  3I5D A;  2DWD C;  4JYC A;  3RWR D;  1VIB A;  4MW3 A;  4TUY B;  3SYA A;  4I4T A;  1WLE A;  4MT8 A;  4DR7 O;  2H3O A;  4FK5 C;  5LMU B;  3SPG A;  1KD1 W;  2HJD A;  4ZHQ A;  3CXC U;  4IHJ B;  4DV0 O;  1E1Q G;  1Q43 A;  1SA0 B;  4LFA O;  4W4L A;  5JH7 A;  4UV9 A;  3RYC A;  3CMA V;  2WPD G;  5IJ9 B;  1YXB A;  2VWK A;  3E22 A;  1Q7Y W;  1FXK C;  4YY3 B;  1ZSP A;  4JTD B;  1P7B A;  5KHG A;  1ZWI C;  1IX9 A;  3LNM B;  1QLN A;  1Q6H A;  1P7G A;  3ZRW A;  1K33 A;  4TOI A;  4O2B A;  4WFB V;  5LGU A;  4PDL A;  1BQZ A;  1FFX B;  1DTO A;  5EYP B;  1S5L Z;  4MVU A;  4LF8 O;  5FPR A;  4R7C A;  3DTU B;  1S5H C;  2MK3 A;  1F51 A;  2OTL V;  4K8Z A;  1DGS A;  4K0K B;  4YIP A;  1NJI W;  2EZP A;  5B1N A;  3JSN A;  2L6L A;  4I4T B;  5B1A B;  1KUQ A;  1N34 B;  1Y74 A;  2ZR2 A;  2PTM A;  1SQX H;  2W6J G;  2IJK A;  4X1I A;  1NBM G;  4ZHQ B;  4JI0 B;  4F4L A;  4UFZ A;  4IL6 Z;  4NXM O;  1JCH A;  1ZUQ A;  2CTQ A;  3L74 H;  5JH7 B;  4RUF A;  2DOS A;  1VQ5 V;  2LW7 A;  4U7O A;  4DR5 B;  1VQL V;  2NN4 A;  4DR6 B;  2EJR A;  1IUR A;  3E22 B;  2YIB D;  4O4J A;  4UVB A;  2OTJ V;  5LBQ A;  1ZTE A;  2AZ0 A;  1HNX B;  1BL8 A;  3ZRW B;  2B1G A;  3BAA A;  1S76 D;  4JYA O;  3OMI B;  3ASO C;  4O2B B;  1GAX A;  4JYY A;  2HVK C;  2Q0A A;  4LFC B;  4FLZ A;  2GV9 A;  1VQ9 V;  1URF A;  2ARH A;  3ZIA G;  2XHB A;  4G2K A;  3T4Z A;  1SER A;  4U3J A;  4BIO A;  3FX7 A;  1GN6 A;  1RPR A;  1GKF A;  3VQV A;  4O4H A;  4GKJ O;  1SZX A;  1Y74 B;  4U3F H;  4DV7 B;  3FYE B;  4CH6 A;  1QBZ A;  4X1I B;  4D6T H;  3G4S V;  2BTO A;  3B4S A;  1VF6 A;  3H01 A;  3HKB A;  4LF9 O;  4DV1 B;  5B1B C;  5L3G A;  3RVZ A;  1HNZ B;  2ZT9 B;  1SZT A;  2HP8 A;  3P3P A;  1AI5 A;  4HBN A;  4O2A A;  5CB4 A;  3R65 A;  3SR2 C;  2ATK C;  2KQX A;  1Z2G A;  3STZ C;  4JI3 O;  1YVW A;  2OT5 A;  1HNW O;  4UB6 Z;  4O4J B;  2AGA A;  2UU9 O;  2DW4 A;  4I0X B;  5JJJ B;  3L75 H;  4DV5 O;  1YJW V;  4Z1M G;  3UQ8 A;  4JI8 O;  2Q4P A;  1KEC A;  1RFY A;  2Q6A A;  3KZI Z;  3AG7 A;  2UUA B;  3AG4 B;  1US6 A;  4DUZ B;  3H9V A;  2B9Z A;  4P2Z A;  4FLW A;  4U3J B;  1W0K G;  2QKC A;  3QVN A;  3ABK B;  4WBN A;  1O9G A;  4FFB A;  3TGU H;  4H0L B;  4O4H B;  1YCI A;  1KP2 A;  2UUC O;  5BR8 O;  2YI9 A;  4QNH B;  1EFR G;  1YSC A;  3B77 A;  4GLX A;  1XMQ O;  2A9H A;  5DM6 V;  2CK3 G;  3JAM N;  5KAF Z;  4X1Y A;  1EN5 A;  1Y4M A;  3HKB B;  4X62 O;  1EZV H;  3W7W A;  1OCZ B;  3ZBH A;  3AG2 B;  3EVK A;  1U97 A;  3ZMV A;  2QM8 A;  4O2A B;  5CB4 B;  2PYJ A;  3F5W C;  3FB7 C;  3ETD A;  4B3S O;  3ZMT A;  2YIA A;  3BA9 A;  1N33 B;  1HW7 A;  1N36 B;  1FJG O;  5KHJ A;  1BE3 H;  4B3M B;  4RQF A;  5EZY A;  1IBM B;  4K3A A;  1PL4 A;  3ZHS A;  5CA0 B;  4QJF B;  4LF4 B;  2LGW A;  2GUZ A;  2DQ3 A;  4I9Q A;  1XBL A;  2WSS G;  1AJP A;  3TK1 A;  3W7X A;  1GMG A;  1YDX A;  1GM8 A;  5LL6 Y;  1WP7 A;  3OEE G;  4IGG A;  2VQE O;  4AIL C;  4WBN B;  4D7T A;  3K0D A;  4FFB B;  1AIL A;  1JVM A;  1BGY H;  1MG1 A;  1SET A;  4J7Z A;  1OCR C;  3H1K H;  2PUS A;  5B3S B;  1ROP A;  1OCC B;  1ENV A;  4X1Y B;  3FB8 C;  3BAB A;  5LXT A;  1QVG U;  4WFH A;  1CP9 A;  4ASU G;  2R9I A;  2YEV B;  2YIC A;  5LMU O;  4QPK A;  2HVJ C;  1R1B A;  1G4Y B;  4GYC B;  1FPO A;  3ABU A;  1QLE C;  2GBO A;  3RYH A;  5E79 Z;  1AR5 A;  4WF9 V;  2P4V A;  2JS5 A;  2FB5 A;  3QO8 A;  3BFR A;  1GN3 A;  5IYB O;  4O4I A;  2EIN B;  1HWY A;  1OV9 A;  5EZY B;  2Q67 A;  3AG3 C;  4GX1 A;  2PYL A;  3CCQ V;  2DE0 X;  4YY3 O;  2EIM C;  1OZ0 A;  2GUZ B;  2V4D A;  2YID A;  3D36 A;  2B5U A;  3IC7 A;  1R3I C;  1KQS U;  4I5S A;  2VRZ A;  2GDS A;  2RQ6 A;  2QKS A;  4MTO A;  3EHB B;  5EC2 C;  2IU0 A;  3QF7 A;  5IJ0 A;  2FL4 A;  2XAF A;  3FKS G;  4X66 B;  4MVO A;  4DR1 B;  1VQ8 V;  2AW9 A;  2HJF C;  1XL6 A;  3N2K A;  3CCM V;  3LSU A;  3ZS8 C;  3L9D A;  1L0N H;  2ZKO A;  1JFF A;  5B1O A;  5LXT B;  2X6B A;  3AG1 B;  2ZXW B;  4EEQ A;  2Q7E A;  4DV3 O;  1N34 O;  4WFE A;  1AI7 A;  3CCR V;  2NLJ C;  2DYR B;  3K04 A;  1EN6 A;  4Q6G A;  1PKX A;  5CBF A;  4JI0 O;  4B3R B;  4ZOL A;  1AR4 A;  2ZE5 A;  3RYH B;  2LO1 A;  4GUN A;  4YIO A;  4JI1 B;  5DED A;  3OMA B;  1S0V A;  3RN4 A;  4XBF A;  3OTF A;  1XNQ B;  4DR5 O;  3IFX A;  2RNB A;  3BA8 A;  4E4E A;  1PNM A;  3ZRV A;  4DR6 O;  1F7Y A;  2O57 A;  1B6Q A;  1V9P A;  2WWW A;  5LMN B;  5C8Y A;  4J11 A;  4DV6 B;  3J7A U;  2QE7 G;  1E79 G;  3QG5 A;  3DC5 A;  4ICG A;  1B04 A;  3JD1 A;  1HNX O;  2RDC A;  3AK1 A;  2JGD A;  5KA6 A;  4GKJ B;  4LFC O;  1NVP D;  3QTC A;  3SPJ A;  1V54 C;  2V7Q G;  1J5E B;  3APQ A;  5IJ0 B;  4HZ3 A;  2WAM A;  4QE9 A;  4NTY A;  4U7N A;  3F7V C;  2FYU H;  3N2K B;  2X0L A;  3VOU A;  4ZBM A;  3L71 H;  3GVM A;  3TET A;  1X59 A;  1JFF B;  1WB8 A;  2K9P A;  4UCR A;  1XHZ A;  3MHH C;  1BCC H;  4NR1 A;  1GK9 A;  3E35 A;  4DV7 O;  4J42 A;  2PF4 E;  3ZED A;  2E75 B;  3DXR B;  4ZOL B;  2AHZ A;  5EBW C;  2OWO A;  2PGG A;  1Q82 W;  4DV1 O;  5JVD A;  5KUK A;  4EFE A;  4PV1 B;  1HNZ O;  2Q69 A;  4X65 B;  3I55 V;  3W7U A;  4DW0 A;  1ZX3 A;  3G67 A;  4JI6 B;  5C8Y B;  3JAK A;  3LDD A;  3B2E E;  1NH2 D;  5GON A;  2ZIM A;  5CBH A;  2JGD B;  3WB1 A;  3A2F A;  1K34 A;  1FD9 A;  4RUE A;  4AQY B;  5KHK A;  2UUA O;  4OPH A;  4DUZ O;  2LQT A;  1XUQ A;  1Y76 A;  4PA4 A;  4PI0 A;  4JI2 B;  3SPH A;  3KG2 A;  2WLH A;  4J9Z B;  3ZRX A;  1MA1 A;  1FXH A;  3QO5 A;  1XRE A;  3S3W A;  4FJC C;  1EZJ A;  3EFF K;  2BSK A;  3LSQ A;  5E1A C;  2EIK B;  3WB0 A;  2W0F C;  2QWN B;  4DV4 B;  4KFM A;  5CA1 A;  2ZM6 O;  2UXB B;  1NKD A;  2A79 B;  5J9P C;  3MAQ A;  1YJN V;  4X1K A;  4BAY A;  4PJ0 Z;  5DEC A;  3VQX A;  4OGQ B;  5KUM A;  2CTW A;  5JVD B;  3MD0 A;  4YXW G;  4EKW A;  3M99 B;  4BR6 A;  3OR6 C;  3ASN C;  5JCO A;  3B40 A;  2F23 A;  4XDL A;  1RSO A;  3JAK B;  1N33 O;  3WG7 C;  2N05 A;  1UFI A;  4KUM A;  5GON B;  1N36 O;  1E1R G;  1H2G A;  5B5E Z;  2GTS A;  1LNQ A;  3T1C A;  1I0H A;  4B3M O;  4H13 B;  1IBM O;  1RP3 B;  4QGP A;  1IBK B;  4FLU A;  2WA4 A;  1S77 D;  4DO2 A;  2H8P C;  4LF4 O;  3CRR A;  2DWE C;  1IBL B;  4NYK A;  1Y76 B;  2EIJ B;  2BCC H;  2QWP B;  4B3T B;  4NXN B;  3JAL A;  4I55 A;  3GB7 C;  2EBO A;  2QM7 A;  2BSK B;  1PPJ H;  4KHP B;  4BIZ A;  3X2Q C;  4LF6 B;  2X7R B;  4QIW F;  5H5N A;  5CA1 B;  1JPX A;  1YI2 V;  4X1K B;  3G80 A;  3JAS A;  5LA6 A;  5KMG A;  5BMV A;  4DK1 A;  3CS5 A;  3ABM C;  5LGT A;  2FML A;  1TUB A;  1UJW B;  2CGN A;  1FXK A;  5L3B A;  1ZL8 A;  1RSO B;  4H44 B;  2E3C A;  1JOY A;  5JWP A;  3JAT A;  3RFR A;  1KB9 F;  2DYS B;  3OUS A;  2JK5 C;  1ZAU A;  4PDR A;  4FM2 A;  3RVY A;  1AI4 A;  1HR0 B;  4LH6 A;  1UPG A;  3CCV V;  3HKD A;  3IC9 A;  1NTM H;  5EC1 C;  1YJ9 V;  5IT9 N;  3GWO A;  4TT3 G;  1MAB G;  4UCV A;  3JAL B;  4I55 B;  4DV3 B;  1S3J A;  3CD6 V;  1YEW A;  3JSL A;  1K5Q A;  1I94 B;  4X66 O;  3U10 A;  4DR1 O;  1VQP V;  1VQN V;  3BVO A;  3SYP A;  4DR4 B;  1PL0 A;  5EBL C;  2XAQ A;  2OCC C;  3SJC C;  4I9W A;  5HFM A;  3RYC B;  4RAI A;  4YJ2 A;  3P30 A;  3JAS B;  5LA6 B;  3E8G A;  5KMG B;  5BMV B;  3E8B A;  3ZX6 A;  3JD2 A;  1TUB B;  2CAZ C;  2Y4T A;  3CXH F;  1FXK B;  2IU3 A;  4B3R O;  5LOV A;  4JI1 O;  1Y66 A;  3W7T A;  1W2B U;  1Q8I A;  4TV9 A;  2ZE6 A;  3BY6 A;  5K1P A;  3UO3 A;  1XNQ O;  1P49 A;  2WLJ A;  4BWA A;  1TA8 A;  2LW1 A;  1W59 A;  1WNS A;  2P67 A;  1SF9 A;  5LMN O;  4DV6 O;  3HKD B;  3VBB A;  4TV8 A;  4JPR A;  3W7S A;  3L72 H;  2IH3 C;  1OJH A;  1NR7 A;  4AHC A;  1J5E O;  3U0Z A;  2Q5Z A;  1VQ6 V;  3UM7 A;  4DUY B;  3JD3 A;  5FL7 G;  3E2E A;  3OAA G;  4ZIB A;  1BS3 A;  4GT1 A;  1CPY A;  4FVM A;  4X64 B;  3Q4H A;  3RYI A;  5L3F A;  4YJ2 B;  2OCC B;  2IJH A;  4B7K A;  2ZE8 A;  1WN7 A;  3CRM A;  2VWJ A;  4DR2 B;  1M90 W;  1KKC A;  2A3Q A;  4LH7 A;  4F6R A;  1VP7 A;  3OGC C;  1SQV H;  1VEW A;  1K8A W;  4LF5 B;  5K1X A;  1XNR B;  5LOV B;  4IIJ A;  2DJV A;  4TV9 B;  2ILM A;  3CCU V;  3ASO B;  2KKW A;  3F5T A;  4FM1 A;  1IXB A;  1JQ0 A;  3KCX A;  2C2A A;  4X65 O;  3OUF A;  1R3K C;  4AI8 A;  3FAV A;  4HNA A;  4JI6 O;  5GTH Z;  3ZRS A;  4D7S A;  2EIL C;  4UXN A;  3CCE V;  4DRX A;  4TV8 B;  2E76 B;  2E74 B;  3N2G A;  4XDK A;  1B06 A;  3CEI A;  1A32 A;  1F4N A;  3CME V;  2WLK A;  1XMO B;  2D3O W;  1TVK A;  3ZN0 A;  1VQ7 V;  4AQY O;  3ZCC A;  3SJB C;  4PA9 A;  3E83 A;  1AJQ A;  4FFK A;  3UCS C;  2ZM6 B;  4YJ3 A;  3SGI A;  3FD9 A;  2X6A A;  3E8H A;  4I50 A;  3SPC A;  4MVZ A;  2QA4 V;  4JI2 O;  3K5L A;  2QJ1 A;  4MTF A;  1MZE A;  2M6Y A;  3HPL C;  3OMN B;  2YS8 A;  3Q4H B;  3RYI B;  5B1B B;  3SYC A;  3R66 A;  4GX5 A;  4F6E A;  3UO2 A;  5BZB A;  1M57 C;  3K5O A;  4DV4 O;  1KU9 A;  5IE9 A;  3UT5 A;  1BT8 A;  1VQM V;  2Z3Y A;  1FFT B;  2Q8V A;  2UXB O;  4F6R B;  1Q3E A;  3THO A;  4X20 A;  2Y69 C;  1K4C C;  1KMI Z;  3O9O A;  4IIJ B;  4JZ2 A;  4RQE A;  1D2D A;  3P3N A;  4J10 A;  3TCU A;  2NNU A;  1NTZ H;  1NR1 A;  1QCE A;  4HYO A;  1XDC A;  3FAV B;  4P9P A;  4HNA B;  2Z0A A;  2LP7 A;  2HG5 C;  1PV0 A;  4DRX B;  5L3C A;  3N2G B;  4N23 A;  4FZ1 A;  4E2L A;  4EB6 A;  5ITZ A;  3ABT A;  3AK3 A;  2P4K A;  1IBK O;  2R70 A;  1TVK B;  3OW2 U;  1JR9 A;  4YJ3 B;  1NT2 B;  3RW0 A;  1IBL O;  1CXZ B;  1FS0 G;  1KC8 W;  4PEL A;  3JAR A;  1Z5V A;  3QNE A;  2N74 A;  4B3T O;  4NXN O;  1GO3 F;  5KA5 A;  1MNG A;  4Z2W A;  5B66 Z;  4CZZ A;  2WLL A;  2XAG A;  1M1K W;  1M56 C;  2V1D A;  4KHP O;  1X4T A;  2WLN A;  1VQK V;  4CS3 A;  4LF6 O;  3UT5 B;  3JD0 A;  5IWA B;  1Q6I A;  2ZDI C;  4NKG B;  2LFR A;  4DK0 A;  4DR3 B;  3E86 A;  4WCE V;  2PZS A;  2JEU A;  4X20 B;  1RM1 C;  5CBG A;  4L8J A;  4LC1 A;  2LFS A;  3GWK C;  2A06 H;  4Z1V A;  2Q9L A;  2CDY A;  1GRJ A;  3KKY A;  4CC5 A;  4GKK B;  1B3Q A;  1IDS A;  1I08 A;  3RGB A;  3MDS A;  4PA7 A;  1VMG A;  2F1M A;  3ZHV A;  5A2Q N;  1XOU A;  2IH1 C;  3CWB H;  1WA8 A;  4EB6 B;  4X8A A;  5ITZ B;  3OEH G;  1HR0 O;  4X88 A;  1IZ3 A;  2L35 A;  5LP6 C;  3T1Y B;  4DYL A;  1Y67 A;  3B09 A;  3JAR B;  1OCR B;  2R9A A;  4MVQ A;  1JA8 A;  1NS1 A;  5LHI A;  2WLL B;  1SQQ H;  2XND G;  1R6K A;  5FPO A;  1QQC A;  1I94 O;  1K4D C;  3AEI A;  2Q68 A;  2ZD9 A;  4DR4 O;  4MS2 A;  3FFQ A;  1QLE B;  3SYQ A;  1KBH A;  4EFB A;  1PNK A;  1FYJ A;  4R8C A;  3H1I H;  1H2L A;  4CH4 A;  4O4I B;  1PD3 A;  4J7K A;  2UXD B;  1L1F A;  1YF2 A;  2YXY A;  1O9H A;  3AG3 B;  2M7W A;  4I7Z B;  2HEP A;  3CJH A;  1GN4 A;  2EIM B;  3K03 A;  3S3X A;  2IM9 A;  3J81 N;  1WPB A;  2XAH A;  5DN6 G;  2HLD G;  3K06 A;  3JD4 A;  4DW1 A;  3ABL C;  1QR8 A;  3B8N A;  1NU1 H;  4FIP C;  4KXR A;  3HR0 A;  1N0J A;  1WA8 B;  2MW2 B;  4LWS A;  1PNL A;  1VF5 B;  2JJ1 G;  1VF7 A;  3SJA C;  3EXA A;  1H2M A;  4UCO A;  4DV2 B;  4OPA A;  3ZMS A;  4FLX A;  3D3Q A;  4O4L A;  3VQW A;  1N0N A;  1D5N A;  1WJZ A;  2ITD C;  3STL C;  1YIJ V;  1BQ0 A;  4LCU C;  3H1J H;  3HKE A;  4FPP A;  4FZ0 A;  4DUY O;  1WPX A;  1YHQ V;  1ORQ C;  2P6J A;  2EJ7 A;  3OM3 B;  2X6C A;  5JQG A;  2ODM A;  4X64 O;  4UB8 Z;  1N32 B;  4KP4 A;  3OR7 C;  2JJ2 G;  1Q6U A;  5H6Q A;  3OD4 A;  3CC4 V;  4PHZ A;  5KAI Z;  4DR2 O;  3E89 A;  4TQD A;  3CJH B;  5EBM C;  1DF5 A;  4LF5 O;  1COW G;  4RWU A;  1XNR O;  3K08 A;  2D2C B;  4GCZ A;  5J2T A;  2LJ2 A;  5CA3 A;  1ARO P;  5KLV H;  4LWS B;  3J80 N;  4TQF A;  2XAS A;  1V54 B;  1R73 A;  4LP8 A;  4G28 B;  1GN2 A;  4LFB B;  3APO A;  5TIS Z;  1OHH G;  3K9A A; 
#chains in the Genus database with same CATH homology
 1P4R A;  1BHB A;  1R3J C;  4BW5 A;  5CN0 A;  3DGE A;  1KP2 A;  1S3J A;  1F4M A;  5L3E A;  3K3W A;  3CCL V;  5IYC O;  4QNH B;  3CD6 V;  1EFR G;  2PI4 A;  1YSC A;  3B77 A;  1K5Q A;  1W0J G;  1VQP V;  1M56 B;  3JYC A;  1VQN V;  2A9H A;  5DM6 V;  2CK3 G;  1H38 A;  3SYP A;  1DLB A;  1PL0 A;  5EBL C;  1Y4M A;  2XAQ A;  2OCC C;  3LUT B;  4I9W A;  5HFM A;  1EBO A;  2GSM B;  4RAI A;  3W7W A;  1OCZ B;  3AG2 B;  3P30 A;  5L3D A;  2F43 G;  4WFF A;  3ZN1 A;  1N8R W;  3ZMV A;  3E8G A;  2QM8 A;  3LDE A;  1RM1 B;  3F5W C;  3FB7 C;  3ETD A;  3E8B A;  3ZMT A;  3JD2 A;  3WFV A;  1FXK B;  4RO2 A;  4UV8 A;  1MSW D;  2K1E A;  2IU3 A;  1QVF U;  3CC7 V;  1QR9 A;  1V55 C;  3CCJ V;  1Y66 A;  3W7T A;  1W2B U;  1M9N A;  4RQF A;  4G27 B;  3BY6 A;  4JAS A;  2HKO A;  3CC2 V;  1IXM A;  2JDI G;  4UUJ C;  5H9C A;  4MTG A;  2WLJ A;  2QEX V;  4UVA A;  4QJF B;  1RPO A;  3JCZ A;  3T2M A;  1Q86 W;  1K73 W;  2DQ3 A;  2P67 A;  2WSS G;  1AJP A;  3TK1 A;  3W7X A;  4L87 A;  2WLM A;  1YTF B;  3E8F A;  1GMG A;  3VBB A;  1GM8 A;  5LHH A;  4MW8 A;  3OEE G;  4JPR A;  1SRY A;  5IY5 B;  2P7T C;  3W7S A;  1K7D A;  3K0D A;  2IH3 C;  1F23 A;  1NR7 A;  3A0R A;  1JVM A;  4MVS A;  2YSU B;  4MSW C;  1JJ2 U;  1VQ6 V;  3UM7 A;  1MG1 A;  1SET A;  2BOC C;  3JD3 A;  1OCR C;  5B1A C;  4ZKI A;  5FL7 G;  3E2E A;  2B1I A;  3OAA G;  1AJN A;  5B3S B;  3ZJZ A;  1ROP A;  3ETE A;  1OCC B;  1ENV A;  4GT1 A;  2H94 A;  3FB8 C;  2EIK C;  1BMF G;  1CPY A;  2IJI A;  1QVG U;  2IJJ A;  2QTO A;  3OFN G;  3FB5 C;  5H6R A;  5L3F A;  4WFH A;  2OCC B;  1CP9 A;  4ASU G;  2R9I A;  2IJH A;  2YEV B;  4MTX A;  2ZR3 A;  4QPK A;  1DF4 A;  4JF3 A;  2HVJ C;  3ASN B;  1G4Y B;  1M90 W;  3ABU A;  1QLE C;  1TUE B;  3OGC C;  1K8A W;  4WF9 V;  4BIU A;  3QO8 A;  3RBZ A;  5IYB O;  3CPW U;  1K3E A;  3WG7 B;  2EIN B;  1HWY A;  3CCU V;  1V55 B;  1Q81 W;  3ASO B;  2Q67 A;  3AG3 C;  4GX1 A;  3SJQ C;  3CCQ V;  5EK0 A;  1JQ0 A;  3ABL B;  2C2A A;  5IDJ A;  2R9R B;  3G6E V;  3OUF A;  1R3K C;  2EIM C;  1OZ0 A;  3D36 A;  1NVP B;  3G71 V;  1AI6 A;  4X89 A;  5CMU A;  2B5U A;  3IC7 A;  2P90 A;  2W6I G;  3ZRS A;  1R3I C;  1KQS U;  2EIL C;  4I5S A;  4UXN A;  2BOB C;  3CCE V;  3LSS A;  2QKS A;  4MTO A;  3EHB B;  1NQT A;  3CP1 A;  1R3L C;  5EC2 C;  4XDK A;  2IU0 A;  3P32 A;  1F4N A;  4TWK A;  1H8H G;  3CME V;  2WLK A;  1YTF D;  2D3O W;  3ZN0 A;  1VQ7 V;  3ML0 A;  2EIJ C;  4J9Y B;  2XAF A;  1MOF A;  2Z5U A;  3FKS G;  3ZCC A;  4MVO A;  1OCO C;  4PA9 A;  2HJF C;  1AJQ A;  3E83 A;  1VQ8 V;  4WFG A;  1XL6 A;  2X6A A;  3E8H A;  4LBE C;  3SPC A;  4MVZ A;  3X2Q B;  3CCM V;  3SYO A;  2QA4 V;  3ZMZ A;  1K9M W;  1K97 A;  4MTF A;  4MVR A;  1THZ A;  1BHA A;  1VQ4 V;  5GW7 A;  3HPL C;  5B1O A;  3OMN B;  2X6B A;  3AG1 B;  5LGN A;  2ZXW B;  4JAU A;  2JIZ G;  5B1B B;  1J95 A;  2DQ0 A;  1AI7 A;  4WFE A;  3SYC A;  3CCR V;  2NLJ C;  2DYR B;  4H33 A;  3HB3 B;  4JTA B;  1AR1 B;  4GX5 A;  3K04 A;  5BZB A;  1M57 C;  4CBC A;  1PKX A;  5CBF A;  3ABM B;  4XDJ A;  1VQM V;  2Z3Y A;  4P30 A;  2HR3 A;  3CCS V;  1FFT B;  1S0V A;  4N21 A;  3ETG A;  2IW5 A;  3OMA B;  4PA6 A;  2Y69 C;  1VQO V;  4JYB A;  5IYD O;  4XBF A;  3QO7 A;  1K4C C;  4TSF G;  1NH2 B;  2XAJ A;  3IFX A;  1PNM A;  3ZRV A;  1FXV A;  3SPI A;  4RQE A;  2FTK A;  1B6Q A;  2WWW A;  3TCU A;  2NNU A;  1NR1 A;  2QE7 G;  1E79 G;  1QCE A;  2KB1 A;  4Q20 A;  4HYO A;  4P9P A;  4P9O A;  3OE7 G;  3JD1 A;  2AHY A;  2DYS C;  1YIT V;  2LP7 A;  2HG5 C;  4R50 A;  5KA6 A;  5L3C A;  3AG4 C;  1GM7 A;  4N23 A;  4E2L A;  1NVP D;  4QE7 A;  3FYI B;  3SPJ A;  1V54 C;  2V7Q G;  3ABT A;  4HAM A;  4HZ3 A;  2WAM A;  5HFL A;  3IGA C;  1KP3 A;  4QE9 A;  3OW2 U;  1G8M A;  3RW0 A;  3ABK C;  4U7N A;  3F7V C;  1FS0 G;  2DWD C;  1OCO B;  4JYC A;  1KC8 W;  4PEL A;  4MW3 A;  2X0L A;  3VOU A;  4ZBM A;  3SYA A;  3QNE A;  1WLE A;  2A0L A;  1GO3 F;  5KA5 A;  3TET A;  4MT8 A;  4CZZ A;  4FK5 C;  2WLL A;  2XAG A;  3MHH C;  1M1K W;  1KD1 W;  3SPG A;  1M56 C;  2V1D A;  1GK9 A;  3E35 A;  3CXC U;  2GHY A;  1E1Q G;  2WLN A;  1VQK V;  3JD0 A;  2ZDI C;  4JAV A;  1OCZ C;  2LFR A;  3AG2 C;  2AHZ A;  5EBW C;  3E86 A;  4UV9 A;  4WCE V;  1Q82 W;  2JEU A;  4GX0 A;  5KUK A;  3CMA V;  5CBG A;  1RM1 C;  2WPD G;  1SES A;  3I56 V;  4LC1 A;  2LFS A;  1I5X A;  2Q69 A;  4GX2 A;  1Q7Y W;  1FXK C;  3I55 V;  4JTD B;  1P7B A;  2WLI A;  3W7U A;  1ZWI C;  3LNM B;  1QLN A;  3LDD A;  3PJS K;  3ZRW A;  1NH2 D;  1K33 A;  4PA7 A;  5CBH A;  4WFB V;  5LGU A;  4PDL A;  1K5S A;  2IH1 C;  1DTO A;  1K34 A;  4MVU A;  4RUE A;  3NXS A;  4PA3 A;  4X8A A;  3OEH G;  3DTU B;  4R7C A;  4PA4 A;  1S5H C;  2MK3 A;  1F51 A;  4X88 A;  2OTL V;  3SPH A;  3KG2 A;  2WLH A;  4J9Z B;  1NJI W;  2EZP A;  3ZRX A;  3K79 A;  5B1N A;  1FXH A;  3QO5 A;  1OCR B;  5B1A B;  2JEX A;  4FJC C;  4MVM A;  4MVQ A;  1EZJ A;  3EFF K;  5LHI A;  2ZR2 A;  3LSQ A;  5E1A C;  2WLL B;  2EIK B;  2IJK A;  2W6J G;  1NBM G;  2ITC C;  2W0F C;  4KFM A;  5B3S C;  2XND G;  1R6K A;  4PDV A;  4F4L A;  2ZQM A;  3UKM A;  1OCC C;  1NKD A;  1K4D C;  2A79 B;  3AEI A;  2Q68 A;  5J9P C;  1YJN V;  1JCH A;  3FB6 C;  2ZD9 A;  4BAY A;  4FMT A;  4MS2 A;  1QLE B;  4RUF A;  1KKD A;  3SYQ A;  1VQ5 V;  1I5Y A;  5KUM A;  4U7O A;  1S72 V;  1PNK A;  3MD0 A;  4R8C A;  4YXW G;  3M99 B;  4EKW A;  1VQL V;  3OR6 C;  2YEV A;  2EJR A;  3ASN C;  1PD3 A;  1L1F A;  3CYO A;  4UVC A;  4PDM A;  4UVB A;  3AG3 B;  4OXS A;  2OTJ V;  3F7Y C;  5LBQ A;  4XDL A;  2M7W A;  2WLI B;  2HFE C;  1BL8 A;  2EIM B;  3K03 A;  3WG7 C;  2B1G A;  2EIN C;  2UXX A;  4KUM A;  2XAH A;  3ZRW B;  3OMI B;  3ASO C;  1E1R G;  1S76 D;  1H2G A;  5DN6 G;  2HVK C;  2HLD G;  3K06 A;  5LHG A;  3JD4 A;  1LNQ A;  2EIL B;  1QR8 A;  3ABL C;  3B8N A;  4QPJ A;  1GM9 A;  4FIP C;  3T1C A;  1GTO A;  1VQ9 V;  1CEZ A;  3LDC A;  3K0G A;  1S77 D;  2PI5 A;  4DO2 A;  3ZIA G;  1PNL A;  2H8P C;  2JJ1 G;  2DWE C;  4G2K A;  1JX9 A;  3T4Z A;  2EIJ B;  1SER A;  3D3I A;  3ZMU A;  1RPR A;  4DXW A;  3ZMS A;  1GKF A;  3GB7 C;  2EBO A;  2QM7 A;  3FYE B;  4BIZ A;  3X2Q C;  2ITD C;  1K92 A;  1QBZ A;  4H37 A;  3STL C;  3T4D A;  1YIJ V;  2X7R B;  3G4S V;  4LCU C;  4FPP A;  4QIW F;  3BEH A;  1JPX A;  1M57 B;  3H01 A;  1YI2 V;  1XL4 A;  3AG1 C;  2ZXW C;  1WPX A;  2UXN A;  4R6Z A;  5B1B C;  5L3G A;  2ZDI A;  1YHQ V;  1ORQ C;  2P6J A;  2DYR C;  3OM3 B;  4WFA V;  2X6C A;  3MHS C;  3RVZ A;  2EZO A;  1SZT A;  1AI5 A;  2Y69 B;  3R65 A;  2XOK G;  3ABM C;  5LGT A;  2ATK C;  4KP4 A;  3OR7 C;  3STZ C;  2JJ2 G;  4JGS A;  1UJW B;  5H6Q A;  2OT5 A;  3CC4 V;  1FXK A;  5L3B A;  3E89 A;  2DW4 A;  1H8E G;  5EBM C;  1DF5 A;  1JOY A;  3B8M A;  1COW G;  1YJW V;  3K08 A;  4Z1M G;  2DYS B;  1KEC A;  3OUS A;  2JK5 C;  2Q6A A;  4GCZ A;  4PDR A;  5CA3 A;  3RVY A;  3AG4 B;  1AI4 A;  1ARO P;  2Y48 A;  2XAS A;  5C93 A;  1V54 B;  3CCV V;  4JTC B;  1R73 A;  4LP8 A;  4G28 B;  4P2Z A;  5IY5 C;  5EC1 C;  1YJ9 V;  1R6N A;  1W0K G;  3GWO A;  4TT3 G;  3ABK B;  1OHH G;  1MAB G;  3K9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...