3CCQV

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
molecule tags Ribosome
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 25
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ccqV00
3CC4V 1K73W 1NJIW 3I55V 3G71V 1M1KW 1YITV 3CCVV 1JJ2U 1R73A 3CCLV 1QVGU 4WFAV 3CCUV 1YJ9V 4WFBV 1KD1W 1VQPV 1QVFU 1S72V 3CCEV 4WF9V 3CMAV 1KQSU 3G6EV 1Q86W 1VQLV 1VQ9V 3I56V 1VQ4V 2D3OW 3CXCU 3CPWU 3CMEV 1YHQV 2QEXV 1M90W 1K8AW 3CCQV 1YJNV 1VQMV 5DM6V 1VQ5V 3OW2U 3CCJV 3CC7V 1VQKV 1YJWV 1VQ8V 3CC2V 1Q7YW 1Q82W 1VQ7V 2OTJV 1VQ6V 3CD6V 1YI2V 1KC8W 1Q81W 3G4SV 3CCRV 2QA4V 1N8RW 1VQOV 3CCMV 1YIJV 1VQNV 4WCEV 3CCSV 1W2BU 2OTLV 1K9MW
chains in the Genus database with same CATH superfamily
1BHAA 1ZUQA 4JI8O 4DV1O 5L3FA 4DV5B 1XMQB 2VWJA 4DV7B 2ZD9A 1Z5WA 2AHYA 3LSUA 3W7WA 3O9OA 1Y6XA 2CE4A 5DM6V 4B3MB 3CCJV 3W7SA 1OJHA 3HKEA 1XDCA 2ZINA 3ABLC 4K8XA 1XBLA 2B5UA 1S77D 1B6QA 2XASA 2XAQA 3JD2A 5KMGB 4KFMA 1JMKC 4UVCA 4GLXA 3FB6C 1KP2A 2HP8A 4MVUA 2UUBO 3RVYA 3OW2U 1IDSA 3OMAB 3ZHRA 2DN9A 4I50B 3F7VC 3UKMA 4ZOLB 1L1FA 1TUBB 4FM1A 3X2QB 3ZHSA 1HP8A 1JVMA 2Y0IA 3ICXA 3E35A 3QO7A 1QVFU 5CBGA 4PDVA 3AK1A 1ZTEA 2WLIA 3SPGA 4QIWF 1S0VA 2F4VO 4X88A 3OTFA 1N33O 5L3GA 4YJ3A 3JALA 3HKEB 3CXHF 1OZ0A 2CDYA 4LF5B 2CTQA 1IBLB 2DYSB 2Q67A 5KHIA 3AG7A 2LQTA 5IY5B 2QE7G 3MHSC 5CA0B 5IJ9B 3AK2A 4FLWA 1SERA 4X1YA 4I9WA 4JI8B 2DYRC 4P9PA 3ZMUA 4J9YB 1RFYA 3H1HH 3RYIA 4PA7A 3ZHUA 4UXNA 2EIKB 3P30A 4P2ZA 4YHHB 1TUBA 1XHXA 1MSDA 2F23A 3ZN0A 1RPRA 4LFCB 2Q7GA 1F7YA 3A0RA 1FPOA 1JR9A 1JCHA 4G2KA 2ADPA 2JIZG 2BTQB 1XI1A 3LDDA 4X64O 3UO3A 2IJIA 4YJ3B 2VQFB 4TV8A 3BRCA 2ZE5A 1EZVH 2DJVA 2AHZA 2OWOA 4B3SO 1M4UA 4W4LA 1VARA 5EBLC 5LBQA 2RJZA 2HEPA 2AXTZ 4NVPA 1FXKB 2GUZB 4ICGA 2E5LB 3CCMV 2QJ1A 3IGAC 4JZ2A 3JAWB 4J80A 5H6QA 1OCOC 2VWKA 2DW4A 2Z3YA 3OFNG 4HNAB 1A32A 1K4CC 3BEHA 5KAIZ 4JI0B 5FL7G 4U7OA 2H8PC 4AHCA 4JV5B 2LJ2A 4PA6A 4IGGA 4BIUA 1F51A 1JJ2U 2F66C 3WG7C 1S72V 1FXVA 2UU9B 3ZEDA 4Z1VA 3B09A 3TETA 2D3OW 3F7YC 5LYJA 4DO2A 1MABG 3E8HA 1PPJH 1CPYA 4UCRA 1FFXA 2L35A 2XAGA 1BQ0A 1VQKV 4GX5A 3QTCA 2R72A 4B3RB 1SZTA 2XHBA 4LFCO 4BIZA 1H2KA 5HFMA 1E1QG 3T1YB 1GH6A 3RT3C 4LF9O 2Q7HA 3S3WA 3AG4B 4AI8A 3SYPA 3ZMSA 3E89A 1YJNV 1Y67A 4J10A 2YIBD 4FK5C 4DYLA 3MDSA 2OCHA 3UT5B 1JQ0A 4EB6B 2BSKB 4TV8B 1SRYA 1F4MA 2R9RB 4MVOA 3D3IA 2Y69C 5JCOA 3ZCCA 3B8NA 2AZ2A 1MMMA 4XDLA 3CE2A 4PHZA 3ZBHA 4UV8A 2ZR3A 2GTSA 3UCSC 1UPGA 1S5LZ 4CH6A 2Q4PA 2JDIG 1AI4A 4JTDB 5JJEB 4ZKIA 1SQFA 5HFLA 3CD6V 4X1IA 1WPXA 1N0NA 4PD4F 3OUSA 1Q6UA 3G71V 1N36B 3BABA 5ITZA 3UM7A 4X89A 1XMOB 2B9ZA 1RSOB 1L0NH 4OX9B 1QHTA 4JV5O 3DXRA 5L3BA 1OCZC 1IBMB 3UO2A 2YIDA 3K03A 3RW0A 1QCEA 3OR6C 1J5EO 1PL0A 4IYHA 3PN1A 2YDEA 4WFEA 4QPKA 1ZAUA 4DR5O 4EKWA 4FIPC 1IURA 4IL6Z 1PD3A 2PI4A 4BR6A 2DWEC 3ZHQA 3C90A 1RM1B 1DF4A 4UUJC 3JD3A 5L3EA 2A0LA 3BVOA 2QTSA 5D5QA 4X1YB 5JVDB 4Q20A 3CMAV 1MA1A 2WLKA 1XHZA 3ZN1A 1LR1A 2E74B 1Y66A 3OTOO 2WA4A 5F2VO 2EZOA 2VQEO 1EN5A 4FJCC 2QWQB 3FAVB 1GMGA 1FS0G 2A7WA 1YTFD 5EBWC 4JGSA 1H8EG 3JASA 3APOA 4X1KB 2QWPB 4R8CA 2LW7A 5LHGA 3TJTA 2A79B 3ZRXA 3UQ8A 3LDCA 2UXCO 4F6EA 3N2GB 3LDEA 5CB4A 2X6BA 2YI9A 4NXNO 4GT1A 4DV6B 2QEXV 2N74A 4DRXA 1K33A 3OGCC 1KBHA 4L87A 5BMVB 4K3AA 5B5EZ 3WB0A 3T1HB 1Q81W 3E8GA 4UCVA 1P4RA 4KHPB 3JAKB 4UB6Z 5AG2A 2P90A 3AG4C 1QLNA 1R1BA 1ZSPA 2CH7A 1N32O 3FFQA 2CTPA 4XDJA 1PNLA 4X62O 2Q68A 5JCOC 3KCXA 5C8YA 4X66B 3ABMB 4GCZA 3P3PA 1VQ5V 2CUGA 1HWYA 2Y4UA 3CC7V 3ML0A 1KC8W 4MS2A 4GKKO 2E76B 2UUBB 4HNAA 1I08A 5BMVA 1SA0B 2A3QA 2XAJA 3KKYA 2OIGA 1YTFB 2WSSG 2XNDG 1FFXB 4BW9A 1P7GA 5B3SB 1YHQV 2D2CB 2YXYA 3GVMA 3L70H 5KHGA 4B08A 4J7ZA 1PM9A 3M7MX 1IX9A 2FYUH 4H0LB 4UV9A 4PA3A 2F4VB 3QF7A 3F5WC 1NR7A 4OPAA 1IVSA 3L71H 5IT9N 4RQFA 2X0LA 2EIMB 1YF2A 4LF5O 1IBLO 3KG2A 2ZE8A 4PELA 2IU0A 4F4LA 4YJ2A 4X8AA 3CB2A 3TXSA 2RMKB 5B3SC 1NH2D 1R6NA 1YSCA 4LH7A 1KKCA 3I55V 1V55C 3K58A 3U0ZA 5IYBO 3FB5C 1GM7A 5EC2C 2AW9A 3BPZA 3T1HO 3BCCH 2P6JA 4I55B 1K34A 4C7UA 4O4IB 2GSMB 5FNVB 4KHPO 1HW7A 1JPXA 3FD9A 5LP6A 2WLJA 4HAMA 3HPLC 4FM2A 2EJ7A 4TWKA 2GV9A 5JH7B 1V54B 4DUZO 2ZKOA 2DQ3A 2OCCC 1WNSA 2VRZA 1YJ9V 1EZJA 2YEVA 2WAMA 1G8MA 1LUVA 2CH7B 1FYJA 4DV0B 3AG2B 2RNBA 3JD1A 3JYCA 4K0KB 2YIBA 1YIJV 4W4KA 1GO3F 1W59A 3UT5A 4EB6A 2ZCEA 4DK1A 1OHHG 5J2TA 2B1IA 1ZLZA 1NZ6A 3NXSA 1ORQC 3ETQA 2YXHA 4OGQB 3K57A 1P84F 1Q7YW 1I94B 2HJFC 5EZYA 1NBMG 5TISZ 1RSOA 4FLXA 1H2NA 2NLJC 4O4HB 4JAUA 2HVKC 5LXTB 4LF8O 2OCCB 3GB7C 3VQVA 2VQFO 4D7TA 5IDJA 1V54C 4JI6O 1AR5A 3CSXA 5D5PA 4YXWG 1VQ8V 4LCUC 1U97A 3EXAA 2XAFA 1QLEC 2EILC 4LFAO 3K0DA 4UVAA 1JX9A 4FLZA 3HKDB 4RWUA 3K5LA 3L72H 1GRJA 3G80A 4PI2A 2UUCO 2UXXA 3T1YO 2IJKA 4GX0A 5IYCO 3SGIA 2DOSA 4X65B 4I55A 3CX5F 4FFBA 4UB8Z 5IWAO 1BZKA 1NTMH 4JTCB 1TUEB 3FX7A 3S3XA 3VBBA 4DR7B 3DC5A 1Q6HA 4DUYB 4TV9B 2Q9LA 3T2MA 1WP7A 2Y0PA 2LFSA 2HR3A 2EINB 2Y69B 4TUYB 5B1BB 2LP7A 4MVRA 3ETDA 4E4EA 4FLVA 4Z2WA 1JFFA 2P06A 5KX5A 3ZRWA 5CN0A 3L74H 3T1CA 5BZBA 4NXMB 1TVKB 3E2EA 1K7DA 1R3LC 5JQGA 1BGYH 1H2MA 1AJPA 1HNXB 4X1IB 3ZS8C 5KMGA 1IXMA 1V9PA 4JF3A 5LMUO 2ITDC 1URFA 5EZYB 3CJHB 1RP3B 3RBZA 3HB3B 2QDOA 5C8YB 3RN4A 1JFFB 5H5NA 3DXRB 2WWWA 3CEIA 3Q4HB 4MTGA 1SQGA 2UUCB 4WBNA 4JI5O 3K9SA 2PTMA 5BR8B 1WA8A 2UXDB 3H1KH 4FLYA 2JEXA 4GKJB 1KD1W 1M5IA 3J81N 4DR6B 3OE7G 1FXKA 5IWAB 4PDRA 1DK1A 3MHHC 1Q90D 2N04A 2Q0OC 5CBFA 4MW3A 1SC5B 2HFEC 3U11A 2ZT9B 2HG5C 4CS3A 2YEVB 5JWPA 1OCOB 5B1OA 4FPPA 1OCCC 4Q6GA 4WFAV 2XAHA 5LOVB 1ENVA 3CRQA 1FKAO 2JGDB 2QR4A 1M90W 3D36C 2FKXA 2P67A 1RPOA 2ITCC 3SYCA 3B4SA 2YIAA 4YY3B 4YIPA 2JJ2G 3BA8A 1VQOV 1OCCB 4TV9A 3H1LH 4XDKA 4NXMO 2QGNA 3M99B 4WFBV 2Q8VA 4JYAO 1QLEB 2EILB 2XT9A 3MAQA 4JI7O 4TT3G 3G6EV 2PF4E 4J42A 4EFBA 2NN4A 1ZWIC 1THZA 3THOA 1VMGA 4JAVA 2LGWA 2KQXA 4FVMA 3HKBB 2P4VA 1OCZB 2R9IA 1GN2A 3VQXA 5JQGB 2R70A 4X66O 3CCVV 4ZOLA 4ABMA 4HBNA 2Q5ZA 3OTOB 4DW1A 4LF7O 1R6TA 3SJQC 1DGSA 3AG2C 4DW0A 5E79Z 4CZZA 5EYPB 4X20B 2BSKA 1HNWO 4PV1B 3BHPA 4WFFA 3JARB 4GUNA 3HKCA 2Y4TA 4P9OA 2IW5A 1SZXA 5J2UB 3E83A 2P7TC 4DV6O 2KKWA 5FPOA 3H01A 3CCUV 4B7KA 2GDSA 5L3CA 2GTAA 1VP7A 3ZJZA 1DF5A 2BTOA 2PUSA 1PNMA 4YHHO 1Z2GA 1XOUA 1MNGA 1GKFA 2ADQB 1CP9A 3WG7B 1V55B 1YVWA 4DR2O 2OTJV 2BOBC 3APQA 1N32B 1W2BU 3J7AU 4JI4O 1SQBH 4GX1A 1TGOA 2JS5A 3X2QC 3OEEG 4BAYA 1NT2B 2JS3A 4YY3O 4OPHA 3OAAG 4JYCA 1H38A 4LBEC 3N27A 2JGDA 2ILMA 1XL6A 3CCRV 3SJAC 1VQNV 3O65A 2CGOA 3H9VA 5B1NA 4QGPA 3ZHTA 4DR3O 1AP6A 4JI3B 1XNRB 3LNNA 3K9AA 4ASUG 2QM7A 1QQCA 2L6LA 1GM9A 4R7CA 3RVZA 4CC6A 1L0LH 2RCVA 3H1IH 3U10A 4JASA 2LW1A 1EN4A 3CC2V 4UVBA 3B2EE 1D5AA 2PY5A 2IH1C 2GUZA 4WCEV 4JAAA 2WLLA 2EIMC 2OT5A 2UUAB 1FAFA 3RWRD 4JI0O 1YITV 1TVKA 1CEZA 4F6RA 2YSUB 4TSFG 2O57A 3D8CA 1K3EA 1E79G 2LGQA 1WN7A 3ABTA 5LHIA 1N34B 2FB5A 3IC7A 5IJ9A 2UU9O 4LWSB 2QTOA 4YIOA 1QNMA 4J9ZB 3FAVA 4OXSA 2ZM6B 4DR2B 4UFZA 1S76D 3ZHVA 2W0FC 3IJ4A 4GX2A 1HDJA 3JAKA 1K8AW 3ABMC 1U96A 2YC0A 1YJWV 2RDCA 1GN4A 4TOIA 1NR1A 4L8JA 2XTAA 1KMIZ 1H2LA 1NJIW 2PGGA 2ETNA 1N0JA 2K9PA 3LSSA 4UCUA 4JI2B 3STLC 2WPDG 3KZIZ 1AJNA 1Q86W 3JCZA 3OMNB 2F95B 2ZE7A 2JJ1G 1BE3H 4DR3B 1XNRO 1R3KC 5FPRA 4NKGB 2MK3A 4H13B 3T4ZA 1WAZA 4H44B 3RYCA 1RM1C 4X65O 2HLDG 3BAAA 1VF6A 3RYIB 1Q8IA 1N36O 3I56V 2QWNB 2RN9A 1KUQA 2Q6AA 3SR2C 3SPIA 4CS2A 2ZXWB 2KSDA 3MD0A 2KG7A 2ZQMA 3WB1A 4PJ0Z 1KYOF 3T4DA 2Q73A 4QNHB 4DUYO 3BFRA 3ABKC 5H6RA 5KUMA 1COWG 2BOCC 3JATB 4LNUA 4MVQA 2AGAA 1WPBA 2YI8A 3QO5A 2VS0A 2E75B 1Q82W 3IFXA 4G28B 2WLMA 3SYAA 3WFVA 4ZI7A 2ZM6O 1SS3A 3W7TA 1F4NA 1X59A 4EFEA 1HNXO 4D6TH 5IYDO 2R9AA 5DECA 1KECA 4WF9V 3DC6A 3HKDA 4PA4A 3K79A 1M9NA 4MVZA 4RUFA 5JH7A 1WLEA 1YZBA 1DLBA 1MG1A 2JK5C 4FMTA 5FNVA 3N2KB 4N23A 5JVDA 5A2QN 2CK3G 5EYPA 1Z5VA 3SYQA 1WB8A 3ASOB 1XNQB 2UXCB 4DV7O 1P7BA 4AQYB 3K0GA 1NTKH 1R3IC 4RAIA 3HR0A 5LA6A 1YEWA 1XREA 1VF7A 4TUYA 4LF4B 5BY1A 2BTQA 1VQ4V 3JARA 3CYOA 3JCUZ 1K5QA 4I0XB 4R6ZA 4U3FH 4B3TB 5J2UA 3NR7A 2WLLB 4ZIBA 5LMUB 5EIBD 5IYZA 2A9HA 5EBMC 1N8RW 3AK3A 4LP8A 1G1XB 1LNQA 4BWAA 5LYJB 2UXNA 2IH3C 2EIJC 1SQVH 2QM4A 3OM3B 3CP1A 4IHJA 1AILA 1BT8A 3D36A 1IBKO 1FJGO 1FFTB 4KP4A 3KCYA 4JYAB 4H37A 4NTYA 5KHKA 1I5XA 1NQTA 3CCSV 5KHJA 5K1PA 1AI6A 1Y76A 1TA8A 4U3JA 1R73A 2FTKA 1SQQH 4XBFA 4WBNB 1IXBA 3STZC 1AJQA 5ITZB 1LUWA 4I0XA 1BS3A 2IJHA 4IHJB 1GAXA 4PDMA 1Q5OA 4QJFB 3OR7C 1JOYA 1M56C 2ZIOA 1YXBA 3ZRVA 2K1EA 3CC4V 3C3TA 3RFRA 1HNWB 1KKDA 3CCLV 2IM9A 3JASB 4JI1B 1SETA 1VQ9V 3JD4A 5LOVA 3A0HZ 3CXCU 4ZHQB 2G38A 1WB7A 1AR4A 3AG1B 3B40A 1HNZB 1UFIA 5EIBC 4A5UB 2QA4V 2XUMA 2PYJA 4JI7B 1O9GA 2F1MA 1FD9A 1AP5A 1NKDA 2JEUA 1XEQA 1QVGU 1SF9A 1Y74A 5JJJB 1D2DA 2IJJA 1B04A 3LNMB 3K5NA 1H2GA 4DUZB 4J7KA 1R6KA 1CXZB 1SQXH 2EJRA 1HR0B 4CBCA 2H3OA 2HJDA 4MVMA 4LF7B 3TK1A 3CJHA 1YCIA 4FM0A 4DV4O 4B3SB 4U7NA 3L75H 3H1JH 4K0KO 5B66Z 1BQZA 4FFBB 3E22A 2E5LO 3PJSK 3CPWU 3CMEV 5KAFZ 4LC1A 1VIBA 1JA8A 4X20A 2QKAA 3JATA 4LNUB 1D5NA 1F23A 1K97A 1M57C 2OTLV 3E8FA 5IY5C 4MTOA 3K08A 1PP9H 4DRXB 2B1GA 1VF5B 5EK0A 4DXWA 3A0BZ 1I94O 2LFRA 2ARHA 3TCUA 1KQSU 1NH2B 2QWOB 2Y48A 2X6AA 3W7UA 3JD0A 4MSWC 3SYOA 3P32A 4JI1O 3ABLB 3RYFB 3N2KA 4JI6B 1N34O 1PNKA 3L9DA 1S5JA 1KP3A 1GN3A 4IT5A 2ZDIA 1HNZO 1AROP 2YXLA 4LF6O 4B3RO 4LFAB 2EX3A 3W7XA 5KHHA 2Q0AA 2CTRA 5L3DA 4NYKA 4JYBA 4JI3O 1PL4A 3E8BA 4DR4O 5IE9A 4LF9B 1Q6IA 2H94A 3EHBB 1AI7A 2Z5UA 3JALB 4WFGA 5FLXN 4DR7O 1Y74B 4ZI7B 5IYZB 1W0KG 3R65A 4GYCB 4IIJA 1NTZH 4KL1A 5CA0A 2ZNIA 3G67A 1PV0A 5DN6G 2P5OA 4B7EA 3C3SA 2OIEA 1T5EA 5CA1B 3OMIB 4DK0A 4MT8A 2RQ6A 2P22C 1O9HA 5CMUA 2V4DA 3HKBA 5DEDA 2QKSA 2CTWA 3SJCC 4E2LA 1KU9A 1IZ3A 3K59A 4DV1B 3CHXA 4DV5O 1XMQO 2DWDC 2F93B 1MOFA 3ASNB 3WB2A 3A2FA 1SQPH 4P30A 3FYIB 1Q3EA 4QPJA 1L8DA 1WJZA 4IIJB 2HHHO 2EIKC 1M1KW 4LR3A 2WA3A 3DTUB 4CH5A 2WLNA 4MW8A 1IBMO 1AB3A 4K35A 2QWRB 4DV2O 1SESA 3R66A 5EC1C 4O4HA 2MW2B 4U3JB 4JI2O 2ODMA 3QG5A 1H2SB 4QE7A 4BW5A 1K9MW 4LF6B 3B77A 2WLHA 5LP6C 4O4IA 3QNEA 1KB9F 4UCOA 4O4LA 1TAEA 2N05A 1VF6C 3TXQA 3ABKB 3AG3B 2UXBO 1VQLV 5BR8O 1Q43A 2UXDO 1QBZA 3ZIAG 4GKJO 4DR6O 2AZ0A 2ZIMA 2ZXWC 4J11A 3GWOA 5C93A 2BCCH 4FZ0A 4O2AA 4LH6A 2CGNA 4HZ3A 4JZGA 3JSNA 1PKXA 5B1AC 1WA8B 1N33B 3CRCA 4ZBMA 1UJWB 1MZFA 3RYCB 5KUKA 2VQEB 4B3MO 1ROPA 1BHBA 3ZMZA 2YUAA 1B3QA 3K3WA 3GWKC 1M57B 4I4TB 5GONB 4O2BA 3OEHG 5CA3A 3F5TA 1Y76B 2ZE6A 4PA9A 1VQ6V 2ZDIC 1XNQO 4NXNB 1GK9A 4O2AB 4AQYO 4I5SA 2IBZH 3DGEA 2EBOA 4R50A 5LP6B 3CRAA 2F43G 5H9CA 2P4KA 4Z1MG 1B06A 2ZNJA 1BMFG 4FZ1A 3JAMN 1YI2V 1XQ8A 2XOKG 5CBHA 1BL8A 1SA0A 2HKOA 4B3TO 4X62B 5LA6B 2BE3A 4CH3A 3ETEA 3SDLA 5LGTA 1W0JG 1ZL8B 1OCRB 1N4CA 4O2BB 2X6CA 4X9QA 5LGUA 1YDXA 2JRIA 3L73H 2JGUA 2UXBB 2A06H 1BCCH 3M8AA 3CCEV 2ZR2A 1NVPD 5JJNB 3CWBH 1M56B 4O4JA 4I7ZB 4PDLA 3K5MA 3CRMA 3FYEB 1G4YB 2DQ0A 4DV3O 1US6A 5KX5B 1QR8A 4FLTA 4LF4O 4TQFA 2CAZC 2NR5A 3K06A 3JSLA 5E1AC 2LO1A 1AR1B 1AI5A 3SJBC 1SKVA 2Q7EA 5IJ0B 5LGNA 3ZMTA 4X64B 3ZRSA 4JI4B 2KB1A 1BSMA 4NTXA 2E3CA 4QE9A 2EZPA 3AEIA 4O4JB 3ZRWB 4I9QA 1EBOA 4FFKA 2HVJC 1P49A 3JAWA 4NR1A 3WU2Z 4EEQA 1IBKB 1FJGB 5LHHA 1XL4A 4X1KA 1M93A 3BA9A 4GZRB 1MZEA 2V1DA 4UCSA 1OV9A 4DR1B 3VQYA 3N2GA 5CB4B 4HYOA 2JVDA 3IC9A 4LFBO 3A8TA 4H33A 1QU7A 1FXKC 1HR0O 4J41A 4DV0O 1E1RG 3OUFA 5H2FZ 3EFFK 2NNUA 2M6YA 4JYYA 1R3JC 1EM1A 3Q4HA 1Y4MA 2UUAO 3LSQA 4DV4B 5LL6Y 3QVNA 1ZL8A 3SPCA 1FXHA 3ABUA 3E86A 2FL4A 4YJ2B 1X4TA 2PZSA 1K92A 5LMNO 4CH4A 4J7JA 3OT7A 5KA5A 1VQPV 3AG1C 4DV3B 1XMOO 1XILA 1VQMV 5CA1A 3B8MA 4OX9O 1OCRC 1GTOA 4JTAB 3G4SV 1NI8A 2Z0AA 4LF8B 4UCTA 2DYRB 3CS5A 2W6IG 1I7FA 2Q69A 2QSAA 1J5EB 3J80N 2ATKC 5IJ0A 2W6JG 4TQDA 1J95A 3VOUA 3ETGA 2QM8A 1ZX3A 3FKSG 5A9GA 5B1AB 2DYSC 4KXRA 3G6BA 3TGUH 1K4DC 1NVPB 3SPHA 4I4TA 5GONA 1K5SA 4O4LB 2PI5A 2GBOA 3RGBA 5K1XA 1I5YA 5GTHZ 4DR4B 3HKCB 4DR1O 4KUMA 5GTIZ 1VEWA 5J2TB 3AG3C 1G6UA 4NB5A 4LFBB 1S5HC 1GN6A 4BIOA 2DMXA 2YS8A 4N21A 5KLVH 3E22B 4MTXA 4D7SA 1VQ7V 2EIJB 4RQEA 4MTFA 5KA6A 4MVSA 3OGIB 1GM8A 3RYHA 4FLUA 4AILC 3IAYA 2PYLA 1NU1H 4WFHA 2X7RB 2FMLA 1EFRG 3BY6A 3CCQV 2OYQA 4I50A 5LMNB 5GW7A 3LUTB 4G27B 5LXTA 3QO8A 1JJOA 4DR5B 1I0HA 2KG7B 2V7QG 2C2AA 3ZX6A 3FB7C 1K73W 4CC5A 3D3QA 4ZHQA 4CS4A 3RYFA 2WLIB 3P3NA 4LWSA 2IU3A 4JPRA 2HHHB 5BXZA 4K8ZA 1MSWD 3FB8C 3VQWA 3EVKA 1WP8A 1NS1A 1S3JA 4DV2B 4NTWA 3K5OA 2EULA 3OD4A 2M7WA 1XUQA 1H8HG 3K04A 2GHYA 4IYIA 4GKKB 3DSQA 3SPJA 3RYHB 4PI0A 5B1BC 3CRRA 1QR9A 2EINC 2YICA 3ZMVA 4RUEA 2DE0X 4JI5B 3ASNC 4F6RB 5J9PC 1DTOA 2W0XA 4RO2A 1EN6A 3ASOC 1AVMA 2QKCA 3I5DA
chains in the Genus database with same CATH topology
2OT5A 3OMIB 4UV9A 1YITV 4PA3A 1BHAA 1CEZA 4MT8A 5L3FA 2YSUB 3F5WC 1NR7A 4TSFG 5CMUA 2ZD9A 4RQFA 2AHYA 2X0LA 1K3EA 2EIMB 2QKSA 4E2LA 3KG2A 1E79G 3W7WA 3ABTA 2DWDC 2IU0A 4PELA 4F4LA 5LHIA 5DM6V 3CCJV 1MOFA 3ASNB 4X8AA 3W7SA 3IC7A 4P30A 3FYIB 5B3SC 4QPJA 1NH2D 3ABLC 1R6NA 1YSCA 2EIKC 2QTOA 3I55V 2B5UA 1M1KW 3DTUB 1V55C 1S77D 1B6QA 2XASA 2WLNA 2XAQA 5IYBO 4MW8A 3FB5C 3JD2A 1GM7A 5EC2C 4KFMA 4J9ZB 4OXSA 4UVCA 2P6JA 1S76D 3FB6C 1K34A 1SESA 2W0FC 4GX2A 1KP2A 5EC1C 1K8AW 2GSMB 4MVUA 3ABMC 3RVYA 3OW2U 1YJWV 1JPXA 3OMAB 2WLJA 4HAMA 3HPLC 4TWKA 1NR1A 3F7VC 3UKMA 4QE7A 4BW5A 1K9MW 1V54B 1NJIW 3B77A 2WLHA 1L1FA 2DQ3A 2OCCC 3LSSA 3QNEA 3X2QB 3STLC 1JVMA 1YJ9V 1EZJA 2YEVA 3E35A 2WPDG 3QO7A 1QVFU 2WAMA 5CBGA 3ABKB 1AJNA 1G8MA 3AG3B 4PDVA 1Q86W 3JCZA 1VQLV 2WLIA 3OMNB 3AG2B 1QBZA 3SPGA 3ZIAG 4QIWF 2JJ1G 3JD1A 1S0VA 4X88A 3JYCA 2ZXWC 5L3GA 1R3KC 3GWOA 5C93A 2MK3A 3T4ZA 1YIJV 1OZ0A 4HZ3A 1GO3F 1RM1C 2DYSB 1OHHG 1PKXA 2Q67A 5B1AC 2HLDG 2B1IA 4ZBMA 1UJWB 5KUKA 5IY5B 1ROPA 3NXSA 1BHBA 2QE7G 3ZMZA 3MHSC 1ORQC 3I56V 3K3WA 1M57B 3OEHG 5CA3A 1SERA 2Q6AA 4I9WA 2DYRC 3SPIA 1Q7YW 2ZXWB 3MD0A 4PA9A 4P9PA 1VQ6V 2ZQMA 3ZMUA 4J9YB 4PA7A 2HJFC 3T4DA 4UXNA 2ZDIC 2EIKB 1NBMG 4QNHB 3P30A 4P2ZA 1GK9A 3ABKC 5H6RA 2NLJC 5KUMA 1COWG 3DGEA 4I5SA 2EBOA 2BOCC 4JAUA 3ZN0A 1RPRA 4R50A 2HVKC 3A0RA 2OCCB 3GB7C 4MVQA 5IDJA 1V54C 1JCHA 3QO5A 2F43G 4G2KA 5H9CA 4Z1MG 4YXWG 1VQ8V 2JIZG 1BMFG 1Q82W 3IFXA 4G28B 2WLMA 3LDDA 4LCUC 3SYAA 3WFVA 1YI2V 2IJIA 2XOKG 5CBHA 3W7TA 1BL8A 1F4NA 2XAFA 2HKOA 1QLEC 2EILC 3K0DA 4UVAA 1JX9A 3ETEA 5LGTA 5IYDO 1KECA 4WF9V 2UXXA 2AHZA 1W0JG 1OCRB 2IJKA 4GX0A 5IYCO 5EBLC 4PA4A 5LBQA 3K79A 2X6CA 1M9NA 4MVZA 4RUFA 1WLEA 5LGUA 1FXKB 4JTCB 1DLBA 1MG1A 3CCMV 1TUEB 2JK5C 3IGAC 4FMTA 3VBBA 5H6QA 4N23A 1OCOC 2DW4A 2Z3YA 2CK3G 3CCEV 2ZR2A 1NVPD 3OFNG 1M56B 4PDLA 1K4CC 3SYQA 3BEHA 3ASOB 3FYEB 1G4YB 5FL7G 2DQ0A 1P7BA 4U7OA 1QR8A 3T2MA 2H8PC 4PA6A 3K0GA 1R3IC 4RAIA 2LFSA 2HR3A 2EINB 2Y69B 1F51A 4BIUA 1JJ2U 3K06A 5B1BB 2LP7A 4MVRA 3ETDA 5E1AC 1AR1B 1AI5A 3WG7C 3ZRWA 5LGNA 1S72V 1FXVA 5CN0A 3ZMTA 3TETA 3T1CA 3ZRSA 1VQ4V 5BZBA 2D3OW 2KB1A 3F7YC 4DO2A 1MABG 3E8HA 3CYOA 1K5QA 3E2EA 1K7DA 1R3LC 1CPYA 4R6ZA 2XAGA 1VQKV 4GX5A 2WLLB 4QE9A 2EZPA 3AEIA 2A9HA 1AJPA 3ZRWB 5EBMC 1N8RW 1SZTA 4LP8A 4BIZA 1LNQA 1EBOA 5HFMA 1IXMA 1E1QG 2HVJC 4JF3A 2UXNA 2IH3C 2EIJC 2ITDC 5LHHA 3OM3B 3AG4B 3CP1A 3RBZA 3HB3B 1XL4A 3D36A 3SYPA 1FFTB 3ZMSA 4KP4A 3E89A 2V1DA 1YJNV 2WWWA 4H37A 4MTGA 4HYOA 1I5XA 1NQTA 4FK5C 3CCSV 4H33A 1FXKC 1AI6A 1E1RG 1JQ0A 3OUFA 2JEXA 1R73A 2FTKA 1SRYA 1F4MA 2R9RB 4MVOA 4XBFA 1KD1W 3EFFK 2NNUA 1R3JC 2Y69C 3D3IA 3OE7G 1FXKA 3ZCCA 1Y4MA 3B8NA 4PDRA 3STZC 3LSQA 4XDLA 1AJQA 4UV8A 2ZR3A 3MHHC 5CBFA 2JDIG 4MW3A 1AI4A 2IJHA 4JTDB 2HFEC 4ZKIA 4PDMA 5HFLA 3SPCA 4QJFB 3OR7C 3CD6V 1JOYA 2HG5C 1M56C 1FXHA 1WPXA 3ABUA 3E86A 3ZRVA 2K1EA 2YEVB 3OUSA 3CC4V 3G71V 1OCOB 5B1OA 4FPPA 1K92A 1OCCC 3UM7A 1KKDA 4X89A 3CCLV 4WFAV 2XAHA 1ENVA 5KA5A 1VQPV 3AG1C 1SETA 1VQ9V 3JD4A 3CXCU 1M90W 2P67A 1VQMV 5L3BA 1OCZC 1RPOA 3AG1B 2ITCC 3SYCA 3B8MA 2JJ2G 3K03A 1OCRC 1GTOA 4JTAB 3RW0A 3G4SV 2QA4V 1VQOV 1OCCB 1QCEA 3OR6C 1NKDA 1PL0A 2JEUA 4XDKA 2DYRB 1QVGU 2W6IG 3M99B 4WFBV 2IJJA 4WFEA 4QPKA 4EKWA 1QLEB 2EILB 3LNMB 2Q69A 4FIPC 4TT3G 3G6EV 1H2GA 2ATKC 2W6JG 1ZWIC 1J95A 3VOUA 1PD3A 1R6KA 1THZA 3ETGA 2PI4A 2EJRA 2QM8A 4JAVA 4CBCA 3FKSG 2DWEC 5B1AB 2DYSC 4MVMA 3TK1A 1RM1B 1OCZB 1DF4A 2R9IA 4UUJC 1K4DC 3JD3A 5L3EA 2A0LA 1NVPB 3SPHA 3CCVV 1K5SA 4U7NA 2PI5A 1I5YA 3SJQC 4Q20A 3AG2C 3CMAV 2WLKA 4KUMA 4CZZA 3AG3C 3ZN1A 3PJSK 1Y66A 3CMEV 3CPWU 1S5HC 4LC1A 2EZOA 4N21A 4MTXA 1VQ7V 4FJCC 4WFFA 1GMGA 1FS0G 2EIJB 1YTFD 1M57C 1F23A 1K97A 5EBWC 4RQEA 4P9OA 4JGSA 2OTLV 2IW5A 3E8FA 1H8EG 4MTFA 5IY5C 4MTOA 3E83A 2P7TC 3K08A 5KA6A 2B1GA 4R8CA 4MVSA 5EK0A 4DXWA 3H01A 3CCUV 5LHGA 3ZRXA 2A79B 5L3CA 1GM8A 2LFRA 3LDCA 3LDEA 3TCUA 2X6BA 1KQSU 3ZJZA 1DF5A 1NH2B 4GT1A 1PNMA 4WFHA 2X7RB 2QEXV 2Y48A 2X6AA 3W7UA 1EFRG 3BY6A 3CCQV 1GKFA 3JD0A 1K33A 3OGCC 1CP9A 5GW7A 3LUTB 3WG7B 1V55B 4G27B 3QO8A 4L87A 4MSWC 3SYOA 2OTJV 3P32A 2BOBC 1Q81W 3E8GA 1P4RA 2V7QG 3ABLB 2C2AA 1W2BU 3FB7C 1K73W 1PNKA 1KP3A 2P90A 3AG4C 4GX1A 1QLNA 2WLIB 3X2QC 3OEEG 2IU3A 2ZDIA 4BAYA 1AROP 4JPRA 4XDJA 1PNLA 1MSWD 3OAAG 2Q68A 3FB8C 4JYCA 1H38A 3W7XA 4LBEC 3ABMB 4GCZA 5L3DA 1VQ5V 1HWYA 3CC7V 4JYBA 1S3JA 3ML0A 1KC8W 3E8BA 1XL6A 4MS2A 3CCRV 1VQNV 2H94A 5B1NA 3EHBB 1AI7A 2XAJA 2Z5UA 2M7WA 1H8HG 3K04A 3K9AA 4ASUG 1YTFB 2QM7A 2GHYA 4WFGA 2WSSG 2XNDG 3SPJA 5B1BC 1GM9A 5B3SB 1QR9A 2EINC 4R7CA 3RVZA 3ZMVA 1YHQV 1W0KG 4RUEA 3R65A 3ASNC 4JASA 5J9PC 1DTOA 3CC2V 4UVBA 4RO2A 5DN6G 3ASOC 2IH1C 4WCEV 2WLLA 2EIMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC4 V;  1K73 W;  1NJI W;  3I55 V;  3G71 V;  1M1K W;  1YIT V;  3CCV V;  1JJ2 U;  1R73 A;  3CCL V;  1QVG U;  4WFA V;  3CCU V;  1YJ9 V;  4WFB V;  1KD1 W;  1VQP V;  1QVF U;  1S72 V;  3CCE V;  4WF9 V;  3CMA V;  1KQS U;  3G6E V;  1Q86 W;  1VQL V;  1VQ9 V;  3I56 V;  1VQ4 V;  2D3O W;  3CXC U;  3CPW U;  3CME V;  1YHQ V;  2QEX V;  1M90 W;  1K8A W;  3CCQ V;  1YJN V;  1VQM V;  5DM6 V;  1VQ5 V;  3OW2 U;  3CCJ V;  3CC7 V;  1VQK V;  1YJW V;  1VQ8 V;  3CC2 V;  1Q7Y W;  1Q82 W;  1VQ7 V;  2OTJ V;  1VQ6 V;  3CD6 V;  1YI2 V;  1KC8 W;  1Q81 W;  3G4S V;  3CCR V;  2QA4 V;  1N8R W;  1VQO V;  3CCM V;  1YIJ V;  1VQN V;  4WCE V;  3CCS V;  1W2B U;  2OTL V;  1K9M W; 
#chains in the Genus database with same CATH topology
 1BHA A;  1ZUQ A;  4JI8 O;  4DV1 O;  5L3F A;  4DV5 B;  1XMQ B;  2VWJ A;  4DV7 B;  2ZD9 A;  1Z5W A;  2AHY A;  3LSU A;  3W7W A;  3O9O A;  1Y6X A;  2CE4 A;  5DM6 V;  4B3M B;  3CCJ V;  3W7S A;  1OJH A;  3HKE A;  1XDC A;  2ZIN A;  3ABL C;  4K8X A;  1XBL A;  2B5U A;  1S77 D;  1B6Q A;  2XAS A;  2XAQ A;  3JD2 A;  5KMG B;  4KFM A;  1JMK C;  4UVC A;  4GLX A;  3FB6 C;  1KP2 A;  2HP8 A;  4MVU A;  2UUB O;  3RVY A;  3OW2 U;  1IDS A;  3OMA B;  3ZHR A;  2DN9 A;  4I50 B;  3F7V C;  3UKM A;  4ZOL B;  1L1F A;  1TUB B;  4FM1 A;  3X2Q B;  3ZHS A;  1HP8 A;  1JVM A;  2Y0I A;  3ICX A;  3E35 A;  3QO7 A;  1QVF U;  5CBG A;  4PDV A;  3AK1 A;  1ZTE A;  2WLI A;  3SPG A;  4QIW F;  1S0V A;  2F4V O;  4X88 A;  3OTF A;  1N33 O;  5L3G A;  4YJ3 A;  3JAL A;  3HKE B;  3CXH F;  1OZ0 A;  2CDY A;  4LF5 B;  2CTQ A;  1IBL B;  2DYS B;  2Q67 A;  5KHI A;  3AG7 A;  2LQT A;  5IY5 B;  2QE7 G;  3MHS C;  5CA0 B;  5IJ9 B;  3AK2 A;  4FLW A;  1SER A;  4X1Y A;  4I9W A;  4JI8 B;  2DYR C;  4P9P A;  3ZMU A;  4J9Y B;  1RFY A;  3H1H H;  3RYI A;  4PA7 A;  3ZHU A;  4UXN A;  2EIK B;  3P30 A;  4P2Z A;  4YHH B;  1TUB A;  1XHX A;  1MSD A;  2F23 A;  3ZN0 A;  1RPR A;  4LFC B;  2Q7G A;  1F7Y A;  3A0R A;  1FPO A;  1JR9 A;  1JCH A;  4G2K A;  2ADP A;  2JIZ G;  2BTQ B;  1XI1 A;  3LDD A;  4X64 O;  3UO3 A;  2IJI A;  4YJ3 B;  2VQF B;  4TV8 A;  3BRC A;  2ZE5 A;  1EZV H;  2DJV A;  2AHZ A;  2OWO A;  4B3S O;  1M4U A;  4W4L A;  1VAR A;  5EBL C;  5LBQ A;  2RJZ A;  2HEP A;  2AXT Z;  4NVP A;  1FXK B;  2GUZ B;  4ICG A;  2E5L B;  3CCM V;  2QJ1 A;  3IGA C;  4JZ2 A;  3JAW B;  4J80 A;  5H6Q A;  1OCO C;  2VWK A;  2DW4 A;  2Z3Y A;  3OFN G;  4HNA B;  1A32 A;  1K4C C;  3BEH A;  5KAI Z;  4JI0 B;  5FL7 G;  4U7O A;  2H8P C;  4AHC A;  4JV5 B;  2LJ2 A;  4PA6 A;  4IGG A;  4BIU A;  1F51 A;  1JJ2 U;  2F66 C;  3WG7 C;  1S72 V;  1FXV A;  2UU9 B;  3ZED A;  4Z1V A;  3B09 A;  3TET A;  2D3O W;  3F7Y C;  5LYJ A;  4DO2 A;  1MAB G;  3E8H A;  1PPJ H;  1CPY A;  4UCR A;  1FFX A;  2L35 A;  2XAG A;  1BQ0 A;  1VQK V;  4GX5 A;  3QTC A;  2R72 A;  4B3R B;  1SZT A;  2XHB A;  4LFC O;  4BIZ A;  1H2K A;  5HFM A;  1E1Q G;  3T1Y B;  1GH6 A;  3RT3 C;  4LF9 O;  2Q7H A;  3S3W A;  3AG4 B;  4AI8 A;  3SYP A;  3ZMS A;  3E89 A;  1YJN V;  1Y67 A;  4J10 A;  2YIB D;  4FK5 C;  4DYL A;  3MDS A;  2OCH A;  3UT5 B;  1JQ0 A;  4EB6 B;  2BSK B;  4TV8 B;  1SRY A;  1F4M A;  2R9R B;  4MVO A;  3D3I A;  2Y69 C;  5JCO A;  3ZCC A;  3B8N A;  2AZ2 A;  1MMM A;  4XDL A;  3CE2 A;  4PHZ A;  3ZBH A;  4UV8 A;  2ZR3 A;  2GTS A;  3UCS C;  1UPG A;  1S5L Z;  4CH6 A;  2Q4P A;  2JDI G;  1AI4 A;  4JTD B;  5JJE B;  4ZKI A;  1SQF A;  5HFL A;  3CD6 V;  4X1I A;  1WPX A;  1N0N A;  4PD4 F;  3OUS A;  1Q6U A;  3G71 V;  1N36 B;  3BAB A;  5ITZ A;  3UM7 A;  4X89 A;  1XMO B;  2B9Z A;  1RSO B;  1L0N H;  4OX9 B;  1QHT A;  4JV5 O;  3DXR A;  5L3B A;  1OCZ C;  1IBM B;  3UO2 A;  2YID A;  3K03 A;  3RW0 A;  1QCE A;  3OR6 C;  1J5E O;  1PL0 A;  4IYH A;  3PN1 A;  2YDE A;  4WFE A;  4QPK A;  1ZAU A;  4DR5 O;  4EKW A;  4FIP C;  1IUR A;  4IL6 Z;  1PD3 A;  2PI4 A;  4BR6 A;  2DWE C;  3ZHQ A;  3C90 A;  1RM1 B;  1DF4 A;  4UUJ C;  3JD3 A;  5L3E A;  2A0L A;  3BVO A;  2QTS A;  5D5Q A;  4X1Y B;  5JVD B;  4Q20 A;  3CMA V;  1MA1 A;  2WLK A;  1XHZ A;  3ZN1 A;  1LR1 A;  2E74 B;  1Y66 A;  3OTO O;  2WA4 A;  5F2V O;  2EZO A;  2VQE O;  1EN5 A;  4FJC C;  2QWQ B;  3FAV B;  1GMG A;  1FS0 G;  2A7W A;  1YTF D;  5EBW C;  4JGS A;  1H8E G;  3JAS A;  3APO A;  4X1K B;  2QWP B;  4R8C A;  2LW7 A;  5LHG A;  3TJT A;  2A79 B;  3ZRX A;  3UQ8 A;  3LDC A;  2UXC O;  4F6E A;  3N2G B;  3LDE A;  5CB4 A;  2X6B A;  2YI9 A;  4NXN O;  4GT1 A;  4DV6 B;  2QEX V;  2N74 A;  4DRX A;  1K33 A;  3OGC C;  1KBH A;  4L87 A;  5BMV B;  4K3A A;  5B5E Z;  3WB0 A;  3T1H B;  1Q81 W;  3E8G A;  4UCV A;  1P4R A;  4KHP B;  3JAK B;  4UB6 Z;  5AG2 A;  2P90 A;  3AG4 C;  1QLN A;  1R1B A;  1ZSP A;  2CH7 A;  1N32 O;  3FFQ A;  2CTP A;  4XDJ A;  1PNL A;  4X62 O;  2Q68 A;  5JCO C;  3KCX A;  5C8Y A;  4X66 B;  3ABM B;  4GCZ A;  3P3P A;  1VQ5 V;  2CUG A;  1HWY A;  2Y4U A;  3CC7 V;  3ML0 A;  1KC8 W;  4MS2 A;  4GKK O;  2E76 B;  2UUB B;  4HNA A;  1I08 A;  5BMV A;  1SA0 B;  2A3Q A;  2XAJ A;  3KKY A;  2OIG A;  1YTF B;  2WSS G;  2XND G;  1FFX B;  4BW9 A;  1P7G A;  5B3S B;  1YHQ V;  2D2C B;  2YXY A;  3GVM A;  3L70 H;  5KHG A;  4B08 A;  4J7Z A;  1PM9 A;  3M7M X;  1IX9 A;  2FYU H;  4H0L B;  4UV9 A;  4PA3 A;  2F4V B;  3QF7 A;  3F5W C;  1NR7 A;  4OPA A;  1IVS A;  3L71 H;  5IT9 N;  4RQF A;  2X0L A;  2EIM B;  1YF2 A;  4LF5 O;  1IBL O;  3KG2 A;  2ZE8 A;  4PEL A;  2IU0 A;  4F4L A;  4YJ2 A;  4X8A A;  3CB2 A;  3TXS A;  2RMK B;  5B3S C;  1NH2 D;  1R6N A;  1YSC A;  4LH7 A;  1KKC A;  3I55 V;  1V55 C;  3K58 A;  3U0Z A;  5IYB O;  3FB5 C;  1GM7 A;  5EC2 C;  2AW9 A;  3BPZ A;  3T1H O;  3BCC H;  2P6J A;  4I55 B;  1K34 A;  4C7U A;  4O4I B;  2GSM B;  5FNV B;  4KHP O;  1HW7 A;  1JPX A;  3FD9 A;  5LP6 A;  2WLJ A;  4HAM A;  3HPL C;  4FM2 A;  2EJ7 A;  4TWK A;  2GV9 A;  5JH7 B;  1V54 B;  4DUZ O;  2ZKO A;  2DQ3 A;  2OCC C;  1WNS A;  2VRZ A;  1YJ9 V;  1EZJ A;  2YEV A;  2WAM A;  1G8M A;  1LUV A;  2CH7 B;  1FYJ A;  4DV0 B;  3AG2 B;  2RNB A;  3JD1 A;  3JYC A;  4K0K B;  2YIB A;  1YIJ V;  4W4K A;  1GO3 F;  1W59 A;  3UT5 A;  4EB6 A;  2ZCE A;  4DK1 A;  1OHH G;  5J2T A;  2B1I A;  1ZLZ A;  1NZ6 A;  3NXS A;  1ORQ C;  3ETQ A;  2YXH A;  4OGQ B;  3K57 A;  1P84 F;  1Q7Y W;  1I94 B;  2HJF C;  5EZY A;  1NBM G;  5TIS Z;  1RSO A;  4FLX A;  1H2N A;  2NLJ C;  4O4H B;  4JAU A;  2HVK C;  5LXT B;  4LF8 O;  2OCC B;  3GB7 C;  3VQV A;  2VQF O;  4D7T A;  5IDJ A;  1V54 C;  4JI6 O;  1AR5 A;  3CSX A;  5D5P A;  4YXW G;  1VQ8 V;  4LCU C;  1U97 A;  3EXA A;  2XAF A;  1QLE C;  2EIL C;  4LFA O;  3K0D A;  4UVA A;  1JX9 A;  4FLZ A;  3HKD B;  4RWU A;  3K5L A;  3L72 H;  1GRJ A;  3G80 A;  4PI2 A;  2UUC O;  2UXX A;  3T1Y O;  2IJK A;  4GX0 A;  5IYC O;  3SGI A;  2DOS A;  4X65 B;  4I55 A;  3CX5 F;  4FFB A;  4UB8 Z;  5IWA O;  1BZK A;  1NTM H;  4JTC B;  1TUE B;  3FX7 A;  3S3X A;  3VBB A;  4DR7 B;  3DC5 A;  1Q6H A;  4DUY B;  4TV9 B;  2Q9L A;  3T2M A;  1WP7 A;  2Y0P A;  2LFS A;  2HR3 A;  2EIN B;  2Y69 B;  4TUY B;  5B1B B;  2LP7 A;  4MVR A;  3ETD A;  4E4E A;  4FLV A;  4Z2W A;  1JFF A;  2P06 A;  5KX5 A;  3ZRW A;  5CN0 A;  3L74 H;  3T1C A;  5BZB A;  4NXM B;  1TVK B;  3E2E A;  1K7D A;  1R3L C;  5JQG A;  1BGY H;  1H2M A;  1AJP A;  1HNX B;  4X1I B;  3ZS8 C;  5KMG A;  1IXM A;  1V9P A;  4JF3 A;  5LMU O;  2ITD C;  1URF A;  5EZY B;  3CJH B;  1RP3 B;  3RBZ A;  3HB3 B;  2QDO A;  5C8Y B;  3RN4 A;  1JFF B;  5H5N A;  3DXR B;  2WWW A;  3CEI A;  3Q4H B;  4MTG A;  1SQG A;  2UUC B;  4WBN A;  4JI5 O;  3K9S A;  2PTM A;  5BR8 B;  1WA8 A;  2UXD B;  3H1K H;  4FLY A;  2JEX A;  4GKJ B;  1KD1 W;  1M5I A;  3J81 N;  4DR6 B;  3OE7 G;  1FXK A;  5IWA B;  4PDR A;  1DK1 A;  3MHH C;  1Q90 D;  2N04 A;  2Q0O C;  5CBF A;  4MW3 A;  1SC5 B;  2HFE C;  3U11 A;  2ZT9 B;  2HG5 C;  4CS3 A;  2YEV B;  5JWP A;  1OCO B;  5B1O A;  4FPP A;  1OCC C;  4Q6G A;  4WFA V;  2XAH A;  5LOV B;  1ENV A;  3CRQ A;  1FKA O;  2JGD B;  2QR4 A;  1M90 W;  3D36 C;  2FKX A;  2P67 A;  1RPO A;  2ITC C;  3SYC A;  3B4S A;  2YIA A;  4YY3 B;  4YIP A;  2JJ2 G;  3BA8 A;  1VQO V;  1OCC B;  4TV9 A;  3H1L H;  4XDK A;  4NXM O;  2QGN A;  3M99 B;  4WFB V;  2Q8V A;  4JYA O;  1QLE B;  2EIL B;  2XT9 A;  3MAQ A;  4JI7 O;  4TT3 G;  3G6E V;  2PF4 E;  4J42 A;  4EFB A;  2NN4 A;  1ZWI C;  1THZ A;  3THO A;  1VMG A;  4JAV A;  2LGW A;  2KQX A;  4FVM A;  3HKB B;  2P4V A;  1OCZ B;  2R9I A;  1GN2 A;  3VQX A;  5JQG B;  2R70 A;  4X66 O;  3CCV V;  4ZOL A;  4ABM A;  4HBN A;  2Q5Z A;  3OTO B;  4DW1 A;  4LF7 O;  1R6T A;  3SJQ C;  1DGS A;  3AG2 C;  4DW0 A;  5E79 Z;  4CZZ A;  5EYP B;  4X20 B;  2BSK A;  1HNW O;  4PV1 B;  3BHP A;  4WFF A;  3JAR B;  4GUN A;  3HKC A;  2Y4T A;  4P9O A;  2IW5 A;  1SZX A;  5J2U B;  3E83 A;  2P7T C;  4DV6 O;  2KKW A;  5FPO A;  3H01 A;  3CCU V;  4B7K A;  2GDS A;  5L3C A;  2GTA A;  1VP7 A;  3ZJZ A;  1DF5 A;  2BTO A;  2PUS A;  1PNM A;  4YHH O;  1Z2G A;  1XOU A;  1MNG A;  1GKF A;  2ADQ B;  1CP9 A;  3WG7 B;  1V55 B;  1YVW A;  4DR2 O;  2OTJ V;  2BOB C;  3APQ A;  1N32 B;  1W2B U;  3J7A U;  4JI4 O;  1SQB H;  4GX1 A;  1TGO A;  2JS5 A;  3X2Q C;  3OEE G;  4BAY A;  1NT2 B;  2JS3 A;  4YY3 O;  4OPH A;  3OAA G;  4JYC A;  1H38 A;  4LBE C;  3N27 A;  2JGD A;  2ILM A;  1XL6 A;  3CCR V;  3SJA C;  1VQN V;  3O65 A;  2CGO A;  3H9V A;  5B1N A;  4QGP A;  3ZHT A;  4DR3 O;  1AP6 A;  4JI3 B;  1XNR B;  3LNN A;  3K9A A;  4ASU G;  2QM7 A;  1QQC A;  2L6L A;  1GM9 A;  4R7C A;  3RVZ A;  4CC6 A;  1L0L H;  2RCV A;  3H1I H;  3U10 A;  4JAS A;  2LW1 A;  1EN4 A;  3CC2 V;  4UVB A;  3B2E E;  1D5A A;  2PY5 A;  2IH1 C;  2GUZ A;  4WCE V;  4JAA A;  2WLL A;  2EIM C;  2OT5 A;  2UUA B;  1FAF A;  3RWR D;  4JI0 O;  1YIT V;  1TVK A;  1CEZ A;  4F6R A;  2YSU B;  4TSF G;  2O57 A;  3D8C A;  1K3E A;  1E79 G;  2LGQ A;  1WN7 A;  3ABT A;  5LHI A;  1N34 B;  2FB5 A;  3IC7 A;  5IJ9 A;  2UU9 O;  4LWS B;  2QTO A;  4YIO A;  1QNM A;  4J9Z B;  3FAV A;  4OXS A;  2ZM6 B;  4DR2 B;  4UFZ A;  1S76 D;  3ZHV A;  2W0F C;  3IJ4 A;  4GX2 A;  1HDJ A;  3JAK A;  1K8A W;  3ABM C;  1U96 A;  2YC0 A;  1YJW V;  2RDC A;  1GN4 A;  4TOI A;  1NR1 A;  4L8J A;  2XTA A;  1KMI Z;  1H2L A;  1NJI W;  2PGG A;  2ETN A;  1N0J A;  2K9P A;  3LSS A;  4UCU A;  4JI2 B;  3STL C;  2WPD G;  3KZI Z;  1AJN A;  1Q86 W;  3JCZ A;  3OMN B;  2F95 B;  2ZE7 A;  2JJ1 G;  1BE3 H;  4DR3 B;  1XNR O;  1R3K C;  5FPR A;  4NKG B;  2MK3 A;  4H13 B;  3T4Z A;  1WAZ A;  4H44 B;  3RYC A;  1RM1 C;  4X65 O;  2HLD G;  3BAA A;  1VF6 A;  3RYI B;  1Q8I A;  1N36 O;  3I56 V;  2QWN B;  2RN9 A;  1KUQ A;  2Q6A A;  3SR2 C;  3SPI A;  4CS2 A;  2ZXW B;  2KSD A;  3MD0 A;  2KG7 A;  2ZQM A;  3WB1 A;  4PJ0 Z;  1KYO F;  3T4D A;  2Q73 A;  4QNH B;  4DUY O;  3BFR A;  3ABK C;  5H6R A;  5KUM A;  1COW G;  2BOC C;  3JAT B;  4LNU A;  4MVQ A;  2AGA A;  1WPB A;  2YI8 A;  3QO5 A;  2VS0 A;  2E75 B;  1Q82 W;  3IFX A;  4G28 B;  2WLM A;  3SYA A;  3WFV A;  4ZI7 A;  2ZM6 O;  1SS3 A;  3W7T A;  1F4N A;  1X59 A;  4EFE A;  1HNX O;  4D6T H;  5IYD O;  2R9A A;  5DEC A;  1KEC A;  4WF9 V;  3DC6 A;  3HKD A;  4PA4 A;  3K79 A;  1M9N A;  4MVZ A;  4RUF A;  5JH7 A;  1WLE A;  1YZB A;  1DLB A;  1MG1 A;  2JK5 C;  4FMT A;  5FNV A;  3N2K B;  4N23 A;  5JVD A;  5A2Q N;  2CK3 G;  5EYP A;  1Z5V A;  3SYQ A;  1WB8 A;  3ASO B;  1XNQ B;  2UXC B;  4DV7 O;  1P7B A;  4AQY B;  3K0G A;  1NTK H;  1R3I C;  4RAI A;  3HR0 A;  5LA6 A;  1YEW A;  1XRE A;  1VF7 A;  4TUY A;  4LF4 B;  5BY1 A;  2BTQ A;  1VQ4 V;  3JAR A;  3CYO A;  3JCU Z;  1K5Q A;  4I0X B;  4R6Z A;  4U3F H;  4B3T B;  5J2U A;  3NR7 A;  2WLL B;  4ZIB A;  5LMU B;  5EIB D;  5IYZ A;  2A9H A;  5EBM C;  1N8R W;  3AK3 A;  4LP8 A;  1G1X B;  1LNQ A;  4BWA A;  5LYJ B;  2UXN A;  2IH3 C;  2EIJ C;  1SQV H;  2QM4 A;  3OM3 B;  3CP1 A;  4IHJ A;  1AIL A;  1BT8 A;  3D36 A;  1IBK O;  1FJG O;  1FFT B;  4KP4 A;  3KCY A;  4JYA B;  4H37 A;  4NTY A;  5KHK A;  1I5X A;  1NQT A;  3CCS V;  5KHJ A;  5K1P A;  1AI6 A;  1Y76 A;  1TA8 A;  4U3J A;  1R73 A;  2FTK A;  1SQQ H;  4XBF A;  4WBN B;  1IXB A;  3STZ C;  1AJQ A;  5ITZ B;  1LUW A;  4I0X A;  1BS3 A;  2IJH A;  4IHJ B;  1GAX A;  4PDM A;  1Q5O A;  4QJF B;  3OR7 C;  1JOY A;  1M56 C;  2ZIO A;  1YXB A;  3ZRV A;  2K1E A;  3CC4 V;  3C3T A;  3RFR A;  1HNW B;  1KKD A;  3CCL V;  2IM9 A;  3JAS B;  4JI1 B;  1SET A;  1VQ9 V;  3JD4 A;  5LOV A;  3A0H Z;  3CXC U;  4ZHQ B;  2G38 A;  1WB7 A;  1AR4 A;  3AG1 B;  3B40 A;  1HNZ B;  1UFI A;  5EIB C;  4A5U B;  2QA4 V;  2XUM A;  2PYJ A;  4JI7 B;  1O9G A;  2F1M A;  1FD9 A;  1AP5 A;  1NKD A;  2JEU A;  1XEQ A;  1QVG U;  1SF9 A;  1Y74 A;  5JJJ B;  1D2D A;  2IJJ A;  1B04 A;  3LNM B;  3K5N A;  1H2G A;  4DUZ B;  4J7K A;  1R6K A;  1CXZ B;  1SQX H;  2EJR A;  1HR0 B;  4CBC A;  2H3O A;  2HJD A;  4MVM A;  4LF7 B;  3TK1 A;  3CJH A;  1YCI A;  4FM0 A;  4DV4 O;  4B3S B;  4U7N A;  3L75 H;  3H1J H;  4K0K O;  5B66 Z;  1BQZ A;  4FFB B;  3E22 A;  2E5L O;  3PJS K;  3CPW U;  3CME V;  5KAF Z;  4LC1 A;  1VIB A;  1JA8 A;  4X20 A;  2QKA A;  3JAT A;  4LNU B;  1D5N A;  1F23 A;  1K97 A;  1M57 C;  2OTL V;  3E8F A;  5IY5 C;  4MTO A;  3K08 A;  1PP9 H;  4DRX B;  2B1G A;  1VF5 B;  5EK0 A;  4DXW A;  3A0B Z;  1I94 O;  2LFR A;  2ARH A;  3TCU A;  1KQS U;  1NH2 B;  2QWO B;  2Y48 A;  2X6A A;  3W7U A;  3JD0 A;  4MSW C;  3SYO A;  3P32 A;  4JI1 O;  3ABL B;  3RYF B;  3N2K A;  4JI6 B;  1N34 O;  1PNK A;  3L9D A;  1S5J A;  1KP3 A;  1GN3 A;  4IT5 A;  2ZDI A;  1HNZ O;  1ARO P;  2YXL A;  4LF6 O;  4B3R O;  4LFA B;  2EX3 A;  3W7X A;  5KHH A;  2Q0A A;  2CTR A;  5L3D A;  4NYK A;  4JYB A;  4JI3 O;  1PL4 A;  3E8B A;  4DR4 O;  5IE9 A;  4LF9 B;  1Q6I A;  2H94 A;  3EHB B;  1AI7 A;  2Z5U A;  3JAL B;  4WFG A;  5FLX N;  4DR7 O;  1Y74 B;  4ZI7 B;  5IYZ B;  1W0K G;  3R65 A;  4GYC B;  4IIJ A;  1NTZ H;  4KL1 A;  5CA0 A;  2ZNI A;  3G67 A;  1PV0 A;  5DN6 G;  2P5O A;  4B7E A;  3C3S A;  2OIE A;  1T5E A;  5CA1 B;  3OMI B;  4DK0 A;  4MT8 A;  2RQ6 A;  2P22 C;  1O9H A;  5CMU A;  2V4D A;  3HKB A;  5DED A;  2QKS A;  2CTW A;  3SJC C;  4E2L A;  1KU9 A;  1IZ3 A;  3K59 A;  4DV1 B;  3CHX A;  4DV5 O;  1XMQ O;  2DWD C;  2F93 B;  1MOF A;  3ASN B;  3WB2 A;  3A2F A;  1SQP H;  4P30 A;  3FYI B;  1Q3E A;  4QPJ A;  1L8D A;  1WJZ A;  4IIJ B;  2HHH O;  2EIK C;  1M1K W;  4LR3 A;  2WA3 A;  3DTU B;  4CH5 A;  2WLN A;  4MW8 A;  1IBM O;  1AB3 A;  4K35 A;  2QWR B;  4DV2 O;  1SES A;  3R66 A;  5EC1 C;  4O4H A;  2MW2 B;  4U3J B;  4JI2 O;  2ODM A;  3QG5 A;  1H2S B;  4QE7 A;  4BW5 A;  1K9M W;  4LF6 B;  3B77 A;  2WLH A;  5LP6 C;  4O4I A;  3QNE A;  1KB9 F;  4UCO A;  4O4L A;  1TAE A;  2N05 A;  1VF6 C;  3TXQ A;  3ABK B;  3AG3 B;  2UXB O;  1VQL V;  5BR8 O;  1Q43 A;  2UXD O;  1QBZ A;  3ZIA G;  4GKJ O;  4DR6 O;  2AZ0 A;  2ZIM A;  2ZXW C;  4J11 A;  3GWO A;  5C93 A;  2BCC H;  4FZ0 A;  4O2A A;  4LH6 A;  2CGN A;  4HZ3 A;  4JZG A;  3JSN A;  1PKX A;  5B1A C;  1WA8 B;  1N33 B;  3CRC A;  4ZBM A;  1UJW B;  1MZF A;  3RYC B;  5KUK A;  2VQE B;  4B3M O;  1ROP A;  1BHB A;  3ZMZ A;  2YUA A;  1B3Q A;  3K3W A;  3GWK C;  1M57 B;  4I4T B;  5GON B;  4O2B A;  3OEH G;  5CA3 A;  3F5T A;  1Y76 B;  2ZE6 A;  4PA9 A;  1VQ6 V;  2ZDI C;  1XNQ O;  4NXN B;  1GK9 A;  4O2A B;  4AQY O;  4I5S A;  2IBZ H;  3DGE A;  2EBO A;  4R50 A;  5LP6 B;  3CRA A;  2F43 G;  5H9C A;  2P4K A;  4Z1M G;  1B06 A;  2ZNJ A;  1BMF G;  4FZ1 A;  3JAM N;  1YI2 V;  1XQ8 A;  2XOK G;  5CBH A;  1BL8 A;  1SA0 A;  2HKO A;  4B3T O;  4X62 B;  5LA6 B;  2BE3 A;  4CH3 A;  3ETE A;  3SDL A;  5LGT A;  1W0J G;  1ZL8 B;  1OCR B;  1N4C A;  4O2B B;  2X6C A;  4X9Q A;  5LGU A;  1YDX A;  2JRI A;  3L73 H;  2JGU A;  2UXB B;  2A06 H;  1BCC H;  3M8A A;  3CCE V;  2ZR2 A;  1NVP D;  5JJN B;  3CWB H;  1M56 B;  4O4J A;  4I7Z B;  4PDL A;  3K5M A;  3CRM A;  3FYE B;  1G4Y B;  2DQ0 A;  4DV3 O;  1US6 A;  5KX5 B;  1QR8 A;  4FLT A;  4LF4 O;  4TQF A;  2CAZ C;  2NR5 A;  3K06 A;  3JSL A;  5E1A C;  2LO1 A;  1AR1 B;  1AI5 A;  3SJB C;  1SKV A;  2Q7E A;  5IJ0 B;  5LGN A;  3ZMT A;  4X64 B;  3ZRS A;  4JI4 B;  2KB1 A;  1BSM A;  4NTX A;  2E3C A;  4QE9 A;  2EZP A;  3AEI A;  4O4J B;  3ZRW B;  4I9Q A;  1EBO A;  4FFK A;  2HVJ C;  1P49 A;  3JAW A;  4NR1 A;  3WU2 Z;  4EEQ A;  1IBK B;  1FJG B;  5LHH A;  1XL4 A;  4X1K A;  1M93 A;  3BA9 A;  4GZR B;  1MZE A;  2V1D A;  4UCS A;  1OV9 A;  4DR1 B;  3VQY A;  3N2G A;  5CB4 B;  4HYO A;  2JVD A;  3IC9 A;  4LFB O;  3A8T A;  4H33 A;  1QU7 A;  1FXK C;  1HR0 O;  4J41 A;  4DV0 O;  1E1R G;  3OUF A;  5H2F Z;  3EFF K;  2NNU A;  2M6Y A;  4JYY A;  1R3J C;  1EM1 A;  3Q4H A;  1Y4M A;  2UUA O;  3LSQ A;  4DV4 B;  5LL6 Y;  3QVN A;  1ZL8 A;  3SPC A;  1FXH A;  3ABU A;  3E86 A;  2FL4 A;  4YJ2 B;  1X4T A;  2PZS A;  1K92 A;  5LMN O;  4CH4 A;  4J7J A;  3OT7 A;  5KA5 A;  1VQP V;  3AG1 C;  4DV3 B;  1XMO O;  1XIL A;  1VQM V;  5CA1 A;  3B8M A;  4OX9 O;  1OCR C;  1GTO A;  4JTA B;  3G4S V;  1NI8 A;  2Z0A A;  4LF8 B;  4UCT A;  2DYR B;  3CS5 A;  2W6I G;  1I7F A;  2Q69 A;  2QSA A;  1J5E B;  3J80 N;  2ATK C;  5IJ0 A;  2W6J G;  4TQD A;  1J95 A;  3VOU A;  3ETG A;  2QM8 A;  1ZX3 A;  3FKS G;  5A9G A;  5B1A B;  2DYS C;  4KXR A;  3G6B A;  3TGU H;  1K4D C;  1NVP B;  3SPH A;  4I4T A;  5GON A;  1K5S A;  4O4L B;  2PI5 A;  2GBO A;  3RGB A;  5K1X A;  1I5Y A;  5GTH Z;  4DR4 B;  3HKC B;  4DR1 O;  4KUM A;  5GTI Z;  1VEW A;  5J2T B;  3AG3 C;  1G6U A;  4NB5 A;  4LFB B;  1S5H C;  1GN6 A;  4BIO A;  2DMX A;  2YS8 A;  4N21 A;  5KLV H;  3E22 B;  4MTX A;  4D7S A;  1VQ7 V;  2EIJ B;  4RQE A;  4MTF A;  5KA6 A;  4MVS A;  3OGI B;  1GM8 A;  3RYH A;  4FLU A;  4AIL C;  3IAY A;  2PYL A;  1NU1 H;  4WFH A;  2X7R B;  2FML A;  1EFR G;  3BY6 A;  3CCQ V;  2OYQ A;  4I50 A;  5LMN B;  5GW7 A;  3LUT B;  4G27 B;  5LXT A;  3QO8 A;  1JJO A;  4DR5 B;  1I0H A;  2KG7 B;  2V7Q G;  2C2A A;  3ZX6 A;  3FB7 C;  1K73 W;  4CC5 A;  3D3Q A;  4ZHQ A;  4CS4 A;  3RYF A;  2WLI B;  3P3N A;  4LWS A;  2IU3 A;  4JPR A;  2HHH B;  5BXZ A;  4K8Z A;  1MSW D;  3FB8 C;  3VQW A;  3EVK A;  1WP8 A;  1NS1 A;  1S3J A;  4DV2 B;  4NTW A;  3K5O A;  2EUL A;  3OD4 A;  2M7W A;  1XUQ A;  1H8H G;  3K04 A;  2GHY A;  4IYI A;  4GKK B;  3DSQ A;  3SPJ A;  3RYH B;  4PI0 A;  5B1B C;  3CRR A;  1QR9 A;  2EIN C;  2YIC A;  3ZMV A;  4RUE A;  2DE0 X;  4JI5 B;  3ASN C;  4F6R B;  5J9P C;  1DTO A;  2W0X A;  4RO2 A;  1EN6 A;  3ASO C;  1AVM A;  2QKC A;  3I5D A; 
#chains in the Genus database with same CATH homology
 2OT5 A;  3OMI B;  4UV9 A;  1YIT V;  4PA3 A;  1BHA A;  1CEZ A;  4MT8 A;  5L3F A;  2YSU B;  3F5W C;  1NR7 A;  4TSF G;  5CMU A;  2ZD9 A;  4RQF A;  2AHY A;  2X0L A;  1K3E A;  2EIM B;  2QKS A;  4E2L A;  3KG2 A;  1E79 G;  3W7W A;  3ABT A;  2DWD C;  2IU0 A;  4PEL A;  4F4L A;  5LHI A;  5DM6 V;  3CCJ V;  1MOF A;  3ASN B;  4X8A A;  3W7S A;  3IC7 A;  4P30 A;  3FYI B;  5B3S C;  4QPJ A;  1NH2 D;  3ABL C;  1R6N A;  1YSC A;  2EIK C;  2QTO A;  3I55 V;  2B5U A;  1M1K W;  3DTU B;  1V55 C;  1S77 D;  1B6Q A;  2XAS A;  2WLN A;  2XAQ A;  5IYB O;  4MW8 A;  3FB5 C;  3JD2 A;  1GM7 A;  5EC2 C;  4KFM A;  4J9Z B;  4OXS A;  4UVC A;  2P6J A;  1S76 D;  3FB6 C;  1K34 A;  1SES A;  2W0F C;  4GX2 A;  1KP2 A;  5EC1 C;  1K8A W;  2GSM B;  4MVU A;  3ABM C;  3RVY A;  3OW2 U;  1YJW V;  1JPX A;  3OMA B;  2WLJ A;  4HAM A;  3HPL C;  4TWK A;  1NR1 A;  3F7V C;  3UKM A;  4QE7 A;  4BW5 A;  1K9M W;  1V54 B;  1NJI W;  3B77 A;  2WLH A;  1L1F A;  2DQ3 A;  2OCC C;  3LSS A;  3QNE A;  3X2Q B;  3STL C;  1JVM A;  1YJ9 V;  1EZJ A;  2YEV A;  3E35 A;  2WPD G;  3QO7 A;  1QVF U;  2WAM A;  5CBG A;  3ABK B;  1AJN A;  1G8M A;  3AG3 B;  4PDV A;  1Q86 W;  3JCZ A;  1VQL V;  2WLI A;  3OMN B;  3AG2 B;  1QBZ A;  3SPG A;  3ZIA G;  4QIW F;  2JJ1 G;  3JD1 A;  1S0V A;  4X88 A;  3JYC A;  2ZXW C;  5L3G A;  1R3K C;  3GWO A;  5C93 A;  2MK3 A;  3T4Z A;  1YIJ V;  1OZ0 A;  4HZ3 A;  1GO3 F;  1RM1 C;  2DYS B;  1OHH G;  1PKX A;  2Q67 A;  5B1A C;  2HLD G;  2B1I A;  4ZBM A;  1UJW B;  5KUK A;  5IY5 B;  1ROP A;  3NXS A;  1BHB A;  2QE7 G;  3ZMZ A;  3MHS C;  1ORQ C;  3I56 V;  3K3W A;  1M57 B;  3OEH G;  5CA3 A;  1SER A;  2Q6A A;  4I9W A;  2DYR C;  3SPI A;  1Q7Y W;  2ZXW B;  3MD0 A;  4PA9 A;  4P9P A;  1VQ6 V;  2ZQM A;  3ZMU A;  4J9Y B;  4PA7 A;  2HJF C;  3T4D A;  4UXN A;  2ZDI C;  2EIK B;  1NBM G;  4QNH B;  3P30 A;  4P2Z A;  1GK9 A;  3ABK C;  5H6R A;  2NLJ C;  5KUM A;  1COW G;  3DGE A;  4I5S A;  2EBO A;  2BOC C;  4JAU A;  3ZN0 A;  1RPR A;  4R50 A;  2HVK C;  3A0R A;  2OCC B;  3GB7 C;  4MVQ A;  5IDJ A;  1V54 C;  1JCH A;  3QO5 A;  2F43 G;  4G2K A;  5H9C A;  4Z1M G;  4YXW G;  1VQ8 V;  2JIZ G;  1BMF G;  1Q82 W;  3IFX A;  4G28 B;  2WLM A;  3LDD A;  4LCU C;  3SYA A;  3WFV A;  1YI2 V;  2IJI A;  2XOK G;  5CBH A;  3W7T A;  1BL8 A;  1F4N A;  2XAF A;  2HKO A;  1QLE C;  2EIL C;  3K0D A;  4UVA A;  1JX9 A;  3ETE A;  5LGT A;  5IYD O;  1KEC A;  4WF9 V;  2UXX A;  2AHZ A;  1W0J G;  1OCR B;  2IJK A;  4GX0 A;  5IYC O;  5EBL C;  4PA4 A;  5LBQ A;  3K79 A;  2X6C A;  1M9N A;  4MVZ A;  4RUF A;  1WLE A;  5LGU A;  1FXK B;  4JTC B;  1DLB A;  1MG1 A;  3CCM V;  1TUE B;  2JK5 C;  3IGA C;  4FMT A;  3VBB A;  5H6Q A;  4N23 A;  1OCO C;  2DW4 A;  2Z3Y A;  2CK3 G;  3CCE V;  2ZR2 A;  1NVP D;  3OFN G;  1M56 B;  4PDL A;  1K4C C;  3SYQ A;  3BEH A;  3ASO B;  3FYE B;  1G4Y B;  5FL7 G;  2DQ0 A;  1P7B A;  4U7O A;  1QR8 A;  3T2M A;  2H8P C;  4PA6 A;  3K0G A;  1R3I C;  4RAI A;  2LFS A;  2HR3 A;  2EIN B;  2Y69 B;  1F51 A;  4BIU A;  1JJ2 U;  3K06 A;  5B1B B;  2LP7 A;  4MVR A;  3ETD A;  5E1A C;  1AR1 B;  1AI5 A;  3WG7 C;  3ZRW A;  5LGN A;  1S72 V;  1FXV A;  5CN0 A;  3ZMT A;  3TET A;  3T1C A;  3ZRS A;  1VQ4 V;  5BZB A;  2D3O W;  2KB1 A;  3F7Y C;  4DO2 A;  1MAB G;  3E8H A;  3CYO A;  1K5Q A;  3E2E A;  1K7D A;  1R3L C;  1CPY A;  4R6Z A;  2XAG A;  1VQK V;  4GX5 A;  2WLL B;  4QE9 A;  2EZP A;  3AEI A;  2A9H A;  1AJP A;  3ZRW B;  5EBM C;  1N8R W;  1SZT A;  4LP8 A;  4BIZ A;  1LNQ A;  1EBO A;  5HFM A;  1IXM A;  1E1Q G;  2HVJ C;  4JF3 A;  2UXN A;  2IH3 C;  2EIJ C;  2ITD C;  5LHH A;  3OM3 B;  3AG4 B;  3CP1 A;  3RBZ A;  3HB3 B;  1XL4 A;  3D36 A;  3SYP A;  1FFT B;  3ZMS A;  4KP4 A;  3E89 A;  2V1D A;  1YJN V;  2WWW A;  4H37 A;  4MTG A;  4HYO A;  1I5X A;  1NQT A;  4FK5 C;  3CCS V;  4H33 A;  1FXK C;  1AI6 A;  1E1R G;  1JQ0 A;  3OUF A;  2JEX A;  1R73 A;  2FTK A;  1SRY A;  1F4M A;  2R9R B;  4MVO A;  4XBF A;  1KD1 W;  3EFF K;  2NNU A;  1R3J C;  2Y69 C;  3D3I A;  3OE7 G;  1FXK A;  3ZCC A;  1Y4M A;  3B8N A;  4PDR A;  3STZ C;  3LSQ A;  4XDL A;  1AJQ A;  4UV8 A;  2ZR3 A;  3MHH C;  5CBF A;  2JDI G;  4MW3 A;  1AI4 A;  2IJH A;  4JTD B;  2HFE C;  4ZKI A;  4PDM A;  5HFL A;  3SPC A;  4QJF B;  3OR7 C;  3CD6 V;  1JOY A;  2HG5 C;  1M56 C;  1FXH A;  1WPX A;  3ABU A;  3E86 A;  3ZRV A;  2K1E A;  2YEV B;  3OUS A;  3CC4 V;  3G71 V;  1OCO B;  5B1O A;  4FPP A;  1K92 A;  1OCC C;  3UM7 A;  1KKD A;  4X89 A;  3CCL V;  4WFA V;  2XAH A;  1ENV A;  5KA5 A;  1VQP V;  3AG1 C;  1SET A;  1VQ9 V;  3JD4 A;  3CXC U;  1M90 W;  2P67 A;  1VQM V;  5L3B A;  1OCZ C;  1RPO A;  3AG1 B;  2ITC C;  3SYC A;  3B8M A;  2JJ2 G;  3K03 A;  1OCR C;  1GTO A;  4JTA B;  3RW0 A;  3G4S V;  2QA4 V;  1VQO V;  1OCC B;  1QCE A;  3OR6 C;  1NKD A;  1PL0 A;  2JEU A;  4XDK A;  2DYR B;  1QVG U;  2W6I G;  3M99 B;  4WFB V;  2IJJ A;  4WFE A;  4QPK A;  4EKW A;  1QLE B;  2EIL B;  3LNM B;  2Q69 A;  4FIP C;  4TT3 G;  3G6E V;  1H2G A;  2ATK C;  2W6J G;  1ZWI C;  1J95 A;  3VOU A;  1PD3 A;  1R6K A;  1THZ A;  3ETG A;  2PI4 A;  2EJR A;  2QM8 A;  4JAV A;  4CBC A;  3FKS G;  2DWE C;  5B1A B;  2DYS C;  4MVM A;  3TK1 A;  1RM1 B;  1OCZ B;  1DF4 A;  2R9I A;  4UUJ C;  1K4D C;  3JD3 A;  5L3E A;  2A0L A;  1NVP B;  3SPH A;  3CCV V;  1K5S A;  4U7N A;  2PI5 A;  1I5Y A;  3SJQ C;  4Q20 A;  3AG2 C;  3CMA V;  2WLK A;  4KUM A;  4CZZ A;  3AG3 C;  3ZN1 A;  3PJS K;  1Y66 A;  3CME V;  3CPW U;  1S5H C;  4LC1 A;  2EZO A;  4N21 A;  4MTX A;  1VQ7 V;  4FJC C;  4WFF A;  1GMG A;  1FS0 G;  2EIJ B;  1YTF D;  1M57 C;  1F23 A;  1K97 A;  5EBW C;  4RQE A;  4P9O A;  4JGS A;  2OTL V;  2IW5 A;  3E8F A;  1H8E G;  4MTF A;  5IY5 C;  4MTO A;  3E83 A;  2P7T C;  3K08 A;  5KA6 A;  2B1G A;  4R8C A;  4MVS A;  5EK0 A;  4DXW A;  3H01 A;  3CCU V;  5LHG A;  3ZRX A;  2A79 B;  5L3C A;  1GM8 A;  2LFR A;  3LDC A;  3LDE A;  3TCU A;  2X6B A;  1KQS U;  3ZJZ A;  1DF5 A;  1NH2 B;  4GT1 A;  1PNM A;  4WFH A;  2X7R B;  2QEX V;  2Y48 A;  2X6A A;  3W7U A;  1EFR G;  3BY6 A;  3CCQ V;  1GKF A;  3JD0 A;  1K33 A;  3OGC C;  1CP9 A;  5GW7 A;  3LUT B;  3WG7 B;  1V55 B;  4G27 B;  3QO8 A;  4L87 A;  4MSW C;  3SYO A;  2OTJ V;  3P32 A;  2BOB C;  1Q81 W;  3E8G A;  1P4R A;  2V7Q G;  3ABL B;  2C2A A;  1W2B U;  3FB7 C;  1K73 W;  1PNK A;  1KP3 A;  2P90 A;  3AG4 C;  4GX1 A;  1QLN A;  2WLI B;  3X2Q C;  3OEE G;  2IU3 A;  2ZDI A;  4BAY A;  1ARO P;  4JPR A;  4XDJ A;  1PNL A;  1MSW D;  3OAA G;  2Q68 A;  3FB8 C;  4JYC A;  1H38 A;  3W7X A;  4LBE C;  3ABM B;  4GCZ A;  5L3D A;  1VQ5 V;  1HWY A;  3CC7 V;  4JYB A;  1S3J A;  3ML0 A;  1KC8 W;  3E8B A;  1XL6 A;  4MS2 A;  3CCR V;  1VQN V;  2H94 A;  5B1N A;  3EHB B;  1AI7 A;  2XAJ A;  2Z5U A;  2M7W A;  1H8H G;  3K04 A;  3K9A A;  4ASU G;  1YTF B;  2QM7 A;  2GHY A;  4WFG A;  2WSS G;  2XND G;  3SPJ A;  5B1B C;  1GM9 A;  5B3S B;  1QR9 A;  2EIN C;  4R7C A;  3RVZ A;  3ZMV A;  1YHQ V;  1W0K G;  4RUE A;  3R65 A;  3ASN C;  4JAS A;  5J9P C;  1DTO A;  3CC2 V;  4UVB A;  4RO2 A;  5DN6 G;  3ASO C;  2IH1 C;  4WCE V;  2WLL A;  2EIM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...