3CCQV

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 25
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ccqV00
3I55V 1KC8W 1Q81W 1VQNV 1VQOV 3CPWU 1YJWV 3G4SV 3CC7V 1YJ9V 1N8RW 1VQ6V 1KD1W 4WCEV 1KQSU 3CCUV 1W2BU 3CCRV 3CCJV 1M1KW 1VQ4V 1VQ5V 3OW2U 1S72V 1YJNV 1VQKV 1JJ2U 1VQ8V 3G71V 1K73W 1YIJV 1YITV 5DM6V 1K9MW 1QVGU 3CCEV 3CCQV 4WFAV 1VQMV 3CMEV 1YHQV 1VQ9V 1Q86W 3G6EV 2OTLV 2OTJV 3CCVV 2QA4V 1K8AW 4WFBV 1VQ7V 2D3OW 3CC4V 1R73A 3CC2V 1QVFU 3I56V 3CCSV 3CMAV 3CXCU 1Q82W 4WF9V 3CCMV 1VQPV 3CD6V 3CCLV 1Q7YW 1YI2V 1M90W 2QEXV 1VQLV 1NJIW
chains in the Genus database with same CATH superfamily
1H8EG 3JALA 1X59A 3QNEA 3LDDA 3C3TA 1FKAO 1K4DC 4YHHB 4B3MB 5IJ0B 1KKDA 3OW2U 2JK5C 3E8BA 3WG7C 1O9GA 5LXTB 2UXNA 1SKVA 4LWSB 1QBZA 4B7EA 1EZVH 1IBKO 2XAQA 5B1BB 3LDEA 1D5NA 4GYCB 4GKJB 4GKJO 3EHBB 5CA3A 1Q81W 4K8ZA 4B3SB 2LQTA 1RSOA 3AG2C 1T5EA 3MD0A 4J42A 3OMIB 5LBQA 3N2KA 2CGNA 2DYRB 1PKXA 1NVPD 1B3QA 4PD4F 1Z2GA 4K8XA 1LR1A 4DYLA 1WB7A 1DLBA 2HFEC 4WFGA 1S72V 2FB5A 4X8AA 4I9QA 3OE7G 3AG4B 2YXHA 4LH7A 2ZNJA 4GLXA 1COWG 3RVYA 2Q7EA 4DV1O 2EIJB 4XDJA 5B3SC 3JARB 1I5YA 3J7AU 4LFBB 5BMVB 1F4MA 2BTQA 5LHHA 1YTFB 3VQVA 1Y74A 3CCRV 1H2MA 2WSSG 3JAWB 4FLVA 1KKCA 2A7WA 4EB6A 2WLKA 3DC6A 2OIEA 4U3FH 3K5LA 3K5MA 3CCQV 1NZ6A 1PNLA 4UCSA 4O2AA 4JI4B 1F23A 3JD1A 4UB6Z 4JI8B 1WNSA 2B1GA 2F43G 5KHKA 1V9PA 2B5UA 3L71H 1AJQA 2Q68A 4LF7B 1VIBA 1KYOF 1R6NA 1QU7A 4DK0A 5C93A 2WLHA 4JGSA 2YXLA 3QO5A 3WG7B 3CMAV 2F23A 2UU9B 4U3JB 4O4LA 2HP8A 1AP6A 4CH6A 4UV9A 1JCHA 3K06A 1YF2A 3M8AA 2WLMA 3CCJV 1SERA 3IJ4A 4FFBA 1MMMA 1DGSA 5CB4B 4UUJC 3A0RA 2PZSA 3JD0A 3G80A 3FB8C 5H2FZ 4XDLA 2ZCEA 3AG2B 1MNGA 2AZ0A 1KC8W 1XI1A 2FMLA 4JI6B 4JI6O 3CC7V 5LHGA 2YSUB 3SJQC 3ZEDA 4GX1A 1R3IC 4YIPA 1RP3B 2AHZA 4ZOLA 3RYIA 3UO3A 4K0KB 4G27B 1KECA 5GONA 2E5LB 2IH1C 3K0GA 4OPAA 4H37A 1BQZA 1NBMG 1P4RA 2XAHA 1QCEA 2YC0A 3J81N 1BSMA 3FD9A 2BOCC 5B3SB 1NR7A 1QNMA 1F51A 2R9AA 4CS3A 4DV6B 1Z5WA 2UXDB 2UXDO 1RFYA 2OTJV 3P3PA 3E22B 5LA6A 1KMIZ 2LO1A 1N33B 1N33O 3CHXA 3VQWA 2E74B 4W4LA 2AGAA 1H38A 4MVMA 3AG3C 4YJ3B 3ZHTA 1GM7A 3QG5A 3F5TA 5EZYA 4TUYA 3TJTA 4YY3B 4YY3O 2X6AA 4FK5C 4DRXB 4JI3B 2H8PC 3JAKB 4KHPO 3I56V 4WBNA 4FLUA 1OCZC 3AK2A 2PY5A 1Y6XA 1XMOB 3ZHVA 4J41A 1S0VA 2XAJA 3ICXA 3L70H 2HR3A 2X0LA 4LNUA 1DK1A 1QLNA 3L74H 3W7TA 3FX7A 5K1PA 1R1BA 3OUFA 1FYJA 1Q3EA 4EEQA 3RYFB 4HNAA 1S77D 4MT8A 3R65A 3CXHF 2WAMA 1YJWV 3HKCB 1YJ9V 3RYCA 4LP8A 4IHJB 2YIBA 3LNMB 1IBMB 3JD3A 2P67A 1D5AA 5BY1A 2DYSC 1W59A 5KHGA 3D36A 5FNVA 4DO2A 3PJSK 3CCMV 1WA8B 3CEIA 3CSXA 5IDJA 3JYCA 3SPCA 2D2CB 4JAAA 5B5EZ 3K3WA 2IM9A 3RT3C 1QHTA 2UXBB 2UXBO 1E1RG 4AILC 1KP3A 1N32B 2Z0AA 2P06A 4W4KA 2GUZB 3I5DA 3E8HA 1VF6A 3W7XA 2Q69A 3SJCC 3ZIAG 1ZL8B 2RDCA 3CCUV 4DV7B 1H8HG 5JH7B 1IVSA 1L8DA 5JCOC 1K5QA 2YI8A 4B08A 2X6CA 1KP2A 3OR6C 4X62B 4TQFA 1CEZA 1PPJH 5TISZ 4QPKA 5KHHA 2M7WA 2Q0OC 1U96A 4JZ2A 2AW9A 3B4SA 5BXZA 1K5SA 1M93A 2B9ZA 1L0NH 3T4ZA 5IYZB 1EN4A 1B6QA 4FVMA 4H13B 4GX0A 1OCZB 4HAMA 3SYQA 3JCZA 5JJNB 2DW4A 3ZN1A 2EZOA 4X9QA 3JARA 3RN4A 4NXMO 4KP4A 2ZNIA 4LF4B 3AG7A 4MW3A 4JAUA 3DGEA 3E35A 1JPXA 1WB8A 3JAWA 2UUBB 1O9HA 2Z3YA 4GCZA 3HKDA 1BE3H 3ZRWB 5JJJB 1IBLB 1JJOA 5KA5A 1TA8A 3ZMUA 2Q8VA 1VQNV 2DYSB 1S3JA 4ASUG 3N2GA 4JV5O 1WN7A 3FYEB 4BAYA 4ZI7B 2UXXA 4MVUA 5IYBO 2EJ7A 2YEVB 2KB1A 3H1JH 4MVZA 4O2BB 2Z5UA 1R3LC 4WFFA 4U3JA 2JJ2G 5HFMA 4DV5B 4F6RA 2ZE6A 3MDSA 5CBHA 1FXVA 1GAXA 2DWEC 2LW7A 5CB4A 5KHJA 5J2UB 4AI8A 3OGIB 2XT9A 3GB7C 2EILC 5LOVB 3CS5A 3QO8A 1XEQA 1S5HC 2QKCA 3CRRA 1DTOA 1E79G 3ZHRA 2DJVA 3B8NA 1Q7YW 2YIDA 3OD4A 4DR5B 1MZEA 4DR5O 4GKKO 4NKGB 2X7RB 5L3GA 2HKOA 1I94B 1AR4A 4J80A 4TOIA 3STLC 3OTOB 1IXMA 4JYCA 3IAYA 1AI7A 1ROPA 4JI0O 1M56C 4UFZA 2YS8A 1IURA 3ZRSA 4DR4O 2VRZA 4UCVA 4JTDB 1MG1A 2OCCC 3LNNA 3UKMA 4B3TO 4DV0B 3RGBA 1KB9F 4MTOA 3MAQA 4TV9B 2ZINA 3OMNB 2B1IA 1HR0B 3E22A 2R9RB 1AP5A 2ITDC 4XBFA 3ABMC 1UJWB 1BMFG 2O57A 4YJ3A 1KUQA 4UCUA 5EK0A 3L73H 3RYHB 2WWWA 2WA4A 1XBLA 4DRXA 4FLWA 2X6BA 4JTCB 2ATKC 4WFBV 3SR2C 1RPOA 4J7KA 3UM7A 1U97A 2VQEB 2RNBA 3T2MA 3SPGA 4DV4B 4DV4O 4MVOA 2ZR3A 1KQSU 3CRAA 4IYIA 4I50B 1PP9H 1GTOA 1FS0G 3OT7A 5IWAB 5IWAO 2R72A 3ABTA 1BHAA 2WLIB 2JS3A 4X1YB 1AJNA 1I08A 2GTAA 3LDCA 1B06A 2GBOA 2QWQB 2YIAA 5D5QA 3QF7A 1R3KC 1XL6A 3RYFA 2CTWA 1K4CC 2Y0PA 2EILB 4LFAB 1SQFA 3HKCA 1XL4A 2XASA 3CWBH 1QQCA 2RCVA 5L3DA 5CA0B 4YHHO 1SF9A 3IFXA 4IHJA 4B3MO 1VQKV 1BS3A 3AK1A 5B1AC 3B2EE 1SESA 4IIJB 5E79Z 4NB5A 3CX5F 3TXSA 1HW7A 4UV8A 4X88A 4JTAB 1SQBH 4LF6B 4JI5B 4JI5O 1H2NA 5GW7A 1WA8A 3B77A 4I4TB 4B3SO 1HNZB 5LMUB 1HNZO 1ZWIC 4RAIA 1M56B 1M57C 2H94A 4X1KA 3SJAC 1XUQA 1XNQB 1XNQO 2OCCB 1HDJA 4BW5A 2ZIOA 5K1XA 4OGQB 2RMKB 4O4HA 1TUEB 1Q5OA 4OPHA 2EX3A 3AG1C 4R6ZA 3SYCA 2G38A 4CH4A 5L3BA 4LF9B 4LF9O 4GZRB 4NTXA 5ITZB 5JH7A 2ARHA 3HKEB 3ABMB 1K9MW 3VBBA 4K35A 3ZMSA 3H9VA 2C2AA 2P4VA 1H2LA 1S76D 1GN6A 3SGIA 5H6RA 2ZDIC 5IE9A 3QO7A 2JJ1G 2E3CA 1Y76B 4NR1A 2QJ1A 2CK3G 5D5PA 2Q7HA 3T1YB 1GM9A 1Q8IA 4LFBO 1IZ3A 3T4DA 4Z1VA 5A9GA 5KMGB 4BR6A 3G71V 5LHIA 5L3CA 5DM6V 4X65B 5B1OA 4X65O 4FIPC 2A9HA 1OCOC 3ABKC 4DUYB 3ZHSA 5EBWC 3SPHA 2HVJC 4JI4O 4J7ZA 4JI8O 4GUNA 3F5WC 2H3OA 1GH6A 4X89A 3ZMZA 3L72H 1VQOV 3FB6C 4J9YB 4FLXA 4YJ2B 2OYQA 5E1AC 4LF7O 4LFCB 4LFCO 1F7YA 2QWOB 3SYOA 1YHQV 2IJIA 3UT5B 4MSWC 4WFHA 3ZRWA 2AXTZ 4P9OA 4IGGA 1OHHG 4ZHQB 3Q4HB 3CCSV 5B1AB 1J95A 5IJ9A 5B66Z 2UU9O 2KQXA 5KLVH 4R50A 1Y67A 1NU1H 5KX5B 3OEEG 2R9IA 2CH7B 5JQGA 2IH3C 3K04A 1WP7A 4PDVA 3UO2A 5LYJB 2K1EA 1SS3A 3K57A 4B3RB 1FJGB 5JJEB 1M57B 4ZI7A 1VF5B 3E86A 2YEVA 1G4YB 3ETGA 1AILA 3ZHQA 2WA3A 3HKBB 4O2BA 4N23A 1TVKB 1WJZA 2Q6AA 3EXAA 3G4SV 1R6TA 2XTAA 4QGPA 5LGUA 3AG1B 1JX9A 3BCCH 3ZHUA 2GTSA 1IXBA 5EYPB 3D3QA 5CMUA 1QVGU 4K0KO 2F66C 4G28B 2ZD9A 2PI5A 5J2UA 3E2EA 4O4IB 1VP7A 3HPLC 2Y4TA 1MSWD 2E5LO 5JCOA 1I5XA 3U10A 4DR1B 5DECA 1QLEC 3VQYA 5EIBD 4FZ1A 2IU3A 2ILMA 1NH2B 1XHZA 1DF4A 3U0ZA 4MW8A 1I0HA 3PN1A 5EC2C 1RM1C 3APOA 4TQDA 4DV6O 1Q86W 2QKSA 4CS2A 1N4CA 4FMTA 4GT1A 4FLYA 2XAGA 2YI9A 4H33A 1QVFU 1ZSPA 1VQPV 4PDLA 5H6QA 4NXNB 4NXNO 1VARA 1OCOB 3ABKB 1MA1A 1EZJA 2ZE5A 4I55B 1XDCA 2LGWA 2XAFA 2N74A 4FLZA 2WLLB 4IYHA 1ZUQA 4JI3O 2HHHB 3BVOA 4ICGA 2QA4V 3K5OA 4TV9A 4O4JA 4X1IB 1JQ0A 3E8GA 4QIWF 2F95B 2QKAA 1GRJA 2JGDB 1XMOO 3CRMA 4Z2WA 3ZJZA 3A0HZ 3OGCC 1JVMA 1FPOA 2DWDC 3RYHA 4FFKA 1MZFA 2DQ0A 2JEXA 4DK1A 1HNXB 1K8AW 4FM0A 2QM4A 1SA0A 2LJ2A 3OAAG 5LL6Y 1N34B 3CXCU 3KCXA 2PYJA 1K92A 5KA6A 2P7TC 1W2BU 4RQEA 2F4VB 2F4VO 3MHSC 2CTPA 3H1HH 1GN4A 3APQA 1AJPA 1SQGA 1IBMO 2Q0AA 2WLIA 3JCUZ 4X1YA 3X2QC 3RVZA 1NTMH 1QR8A 5J9PC 5CA1B 1NQTA 4I5SA 3E89A 3IGAC 4I0XB 4PDMA 5F2VO 1NTZH 1WPBA 3ETQA 5CA0A 5IJ0A 1QLEB 5DN6G 5BZBA 3QVNA 1NVPB 4PA3A 2N05A 5LXTA 2YIBD 4NTWA 3K79A 2EULA 4LWSA 1S5LZ 2NLJC 3IC7A 2WPDG 1N32O 4RWUA 1NTKH 5LGTA 2QDOA 4LBEC 4DR2B 4DR2O 1RSOB 3ZRVA 2W0XA 4I4TA 1TUBB 4DV7O 1OCRC 4FPPA 3N2KB 5HFLA 4G2KA 4X62O 4PA9A 3AG3B 3E8FA 3O65A 4J7JA 1XQ8A 4WF9V 1H2GA 1AR5A 2VWJA 1AI6A 1XMQB 1AVMA 4OX9B 3ZMVA 4JI1B 2F93B 3JD2A 4I7ZB 2W6IG 4U7OA 4JYYA 3ABUA 3LSQA 1NS1A 1YIJV 3HKEA 2QE7G 4QPJA 1SZXA 3K58A 4Q6GA 3BEHA 4NTYA 2D3OW 2KG7B 2RN9A 2V7QG 2Q4PA 2XNDG 1GKFA 4OXSA 4L87A 2BTQB 1Y74B 3C90A 4JI7B 1N8RW 5BMVA 4LF4O 1MSDA 2IJJA 1M1KW 4EFBA 3THOA 4EB6B 1VQ8V 2JIZG 2UUBO 1ZX3A 4KXRA 4O2AB 1PV0A 4UCRA 2OTLV 1IBLO 3FKSG 4NVPA 2QTOA 4NYKA 3FAVB 3FB7C 2K9PA 1YI2V 1XOUA 4UCOA 3X2QB 5IYDO 4YJ2A 1FXKC 1P7BA 1XREA 5LP6C 1YTFD 4RO2A 2MW2B 4R8CA 1VF7A 2CDYA 2WLJA 3R66A 4O4LB 4ZHQA 3G67A 3Q4HA 2Y4UA 4CBCA 1L0LH 3JSNA 2HEPA 5KX5A 3RBZA 2CH7A 4DV5O 2EINC 4FLTA 1EBOA 1EM1A 5EBLC 5JVDB 4FZ0A 1XILA 3BAAA 1OCRB 1EN5A 2VS0A 2JVDA 3WU2Z 3W7WA 2Y0IA 3GWKC 1V55C 2V4DA 3HKBA 3ABLC 1TVKA 1ZAUA 1BQ0A 1BZKA 3AK3A 1H2SB 4LR3A 3D36C 5FPOA 3RYIB 2LFSA 4IT5A 1KBHA 1I94O 4D6TH 2NN4A 5EYPA 5KUMA 5GONB 1PL0A 4JYBA 3OTOO 3NXSA 1GN3A 4O4IA 3SPIA 1VQ7V 3CP1A 4JF3A 1AI5A 2ZM6B 2QWRB 3WFVA 2JEUA 3CE2A 2BSKB 1JOYA 1GMGA 2ZDIA 2EJRA 1Q6UA 2WLNA 4D7TA 1VF6C 1CP9A 3U11A 4DV0O 5LA6B 2FYUH 3S3XA 4CH3A 1LUWA 3HR0A 1HR0O 3CC2V 1I7FA 4TSFG 3CB2A 2JGUA 1Y66A 5EZYB 2UUCB 2UUCO 2DQ3A 3H1LH 1JJ2U 4PHZA 2R70A 2GSMB 4JYAB 2KKWA 1N0JA 2ITCC 4WBNB 1FXKB 3DSQA 3JAKA 4X1IA 3T1CA 3W7SA 2PI4A 5LP6B 2VQEO 1S5JA 3EFFK 1LNQA 3JD4A 3ASOC 1WLEA 1KD1W 2JGDA 4N21A 1BL8A 1SZTA 4ZIBA 3OEHG 5CN0A 1OCCC 3STZC 3ZS8C 1Q90D 2EINB 3CJHB 4HNAB 4CZZA 3I55V 1N36B 2ZQMA 2ZXWC 1M9NA 1KU9A 4LFAO 1ENVA 3SYAA 3B40A 4U7NA 1V55B 3KG2A 5CBGA 3ABLB 3H01A 3QTCA 5A2QN 2XOKG 4TV8B 4PA4A 5FNVB 3HB3B 3CD6V 1SQPH 4LF6O 2HJDA 3M7MX 4MVQA 2QM8A 1SRYA 3OFNG 2PF4E 1GM8A 4I0XA 1Z5VA 5LMUO 4HBNA 1EN6A 4DUZB 4DUZO 2OWOA 3K5NA 1IBKB 4AQYB 2LW1A 4AQYO 3F7YC 4FM2A 3JATB 4E2LA 1K34A 1XNRB 1XNRO 4RUEA 1YDXA 2GUZA 1VQ6V 2W0FC 3B8MA 1TUBA 5FL7G 1ZL8A 3OR7C 1VQ4V 3FFQA 3M99B 4A5UB 3SPJA 4MVRA 3SDLA 3G6EV 3A2FA 5CBFA 1YVWA 1P49A 4MTFA 2Q67A 1FFTB 2V1DA 3T1YO 5AG2A 1PNMA 5IYZA 4J11A 4MTGA 1YJNV 3OUSA 1JMKC 2L35A 3ASOB 2DOSA 2GDSA 1W0KG 1M5IA 2A0LA 4DV1B 3ZX6A 1XHXA 4DUYO 2Q9LA 3ASNC 2KG7A 3P30A 3CCLV 1G6UA 1OCCB 2ZR2A 3DXRB 4PA7A 3K0DA 3WB1A 4YXWG 3TK1A 5KUKA 3ML0A 5FLXN 4LC1A 1G8MA 4JPRA 1VQ5V 3HKDB 4F4LA 1VQ9V 2ZXWB 4H0LB 1AI4A 1ZLZA 4D7SA 4I9WA 3ZCCA 2RJZA 1FFXB 3FAVA 1M90W 4HYOA 1P7GA 1FXHA 2DE0X 4MTXA 4PI2A 3RW0A 5L3FA 3N2GB 3UCSC 5BR8B 5BR8O 3G6BA 4JI2B 4JI2O 2RQ6A 4CC5A 4B3RO 3WB2A 1V54C 1FJGO 2LGQA 1TGOA 1Q43A 2IU0A 4H44B 2OT5A 3K59A 3RWRD 2ZE8A 5IYCO 3CPWU 1R6KA 4F6RB 2HVKC 3W7UA 2DN9A 1SQXH 2EIMC 4L8JA 2PTMA 4WFEA 2M6YA 5GTIZ 1ORQC 3A0BZ 5KHIA 3CMEV 5JVDA 3CCVV 5H5NA 5LOVA 1UPGA 1Q82W 2YUAA 2L6LA 4DR1O 4F6EA 2Y48A 5DEDA 4YIOA 1VMGA 4DR7B 4DR7O 4RQFA 3FYIB 4C7UA 2YICA 2N04A 3LUTB 3C3SA 4X20B 4DR3B 4DR3O 1YSCA 3T1HB 2NNUA 3T1HO 4GX5A 2ADPA 3LSUA 4QE7A 3BFRA 2BSKA 4KFMA 3ASNB 2P4KA 3ZRXA 3B09A 2OIGA 4XDKA 1YITV 1W0JG 1L1FA 3TGUH 1A32A 3JASB 2CGOA 5J2TB 2EZPA 2P5OA 4JAVA 1WPXA 2HHHO 3CC4V 2HJFC 1OZ0A 4QJFB 2GV9A 3TXQA 1GK9A 2IJKA 1YXBA 2Y69C 4BIZA 2FL4A 4EFEA 4FM1A 2YDEA 4J9ZB 2HLDG 1N0NA 4UVAA 3NR7A 1CXZB 3L9DA 3ETEA 2CAZC 4BIUA 1HP8A 2A79B 1HNXO 4KHPB 2UUAB 2UUAO 1FXKA 2ZE7A 1Y4MA 4DR6B 1N34O 4DR6O 5LP6A 1MABG 4LCUC 5LGNA 1V54B 1LUVA 5C8YB 3BA9A 1JFFB 5JWPA 1YCIA 2XUMA 4I50A 2QGNA 1AROP 4PJ0Z 1FD9A 3N27A 2EIMB 1F4NA 1PM9A 3H1IH 2A06H 4JASA 2IW5A 3CJHA 3F7VC 4MS2A 2Q5ZA 1E1QG 3JALB 3UQ8A 3GWOA 3DC5A 1K3EA 1GN2A 4IL6Z 4CC6A 2CUGA 4CS4A 3K9SA 3BHPA 2E75B 4DV3B 4DV3O 1SQQH 4IIJA 4TV8A 1SQVH 4P30A 2IJHA 5GTHZ 1RM1B 4DXWA 3CRQA 2IBZH 4PI0A 2JS5A 4TT3G 4BW9A 1RPRA 2AZ2A 4X1KB 4J10A 5EIBC 4AHCA 1UFIA 4X66B 4X66O 1JA8A 5L3EA 5EBMC 4WFAV 1PL4A 4O4HB 3TCUA 2F1MA 3BY6A 2W6JG 2YXYA 1BHBA 4LF8B 4LF8O 2QR4A 3K08A 2BE3A 1YZBA 3JATA 1XMQO 3O9OA 3H1KH 3E83A 4OX9O 4JI1O 2QWNB 3SYPA 5ITZA 3BABA 2Y69B 1Q6IA 5EC1C 2QWPB 1US6A 1JR9A 1BT8A 3GVMA 4CH5A 4PDRA 2VWKA 3JSLA 1THZA 1Y76A 4UVCA 3J80N 4JI7O 4JZGA 1EFRG 4WCEV 2EIKC 1IDSA 5B1NA 4B7KA 5KMGA 2CTRA 4TWKA 1VQMV 1NR1A 3KZIZ 4R7CA 3IC9A 5IY5C 1VQLV 4NXMB 3DXRA 3AEIA 4PV1B 4DW0A 1SETA 4GX2A 1K33A 4HZ3A 1M4UA 3UT5A 4RUFA 5IJ9B 3BA8A 2JDIG 4FJCC 3FB5C 2QSAA 1FFXA 3SJBC 1PNKA 2EBOA 5JQGB 2P90A 3WB0A 2BTOA 2QTSA 4FFBB 2PUSA 1DF5A 1HNWB 1HNWO 2Q73A 4JV5B 5LYJA 2JRIA 3CCEV 4KL1A 2A3QA 4P9PA 1PD3A 4KUMA 2P6JA 3K9AA 4E4EA 5H9CA 1CPYA 2FTKA 4BIOA 4DW1A 1G1XB 2ZT9B 2VQFB 4PA6A 1BCCH 2VQFO 4ZBMA 4MVSA 2LFRA 2GHYA 1OJHA 2DMXA 4ZOLB 5LMNB 5LMNO 1K73W 2ODMA 4BWAA 1AR1B 3ZBHA 1WP8A 1K97A 1R73A 1K7DA 2ZKOA 3BRCA 2Q7GA 4X64B 4X64O 4DV2O 4DV2B 2QEXV 4GKKB 1URFA 2FKXA 2ZM6O 3OTFA 3OMAB 1H2KA 3DTUB 3P3NA 3MHHC 5B1BC 3D3IA 2NR5A 1HWYA 3ZN0A 4UXNA 3JAMN 3L75H 1ZTEA 2EIKB 4JI0B 4X20A 2CTQA 2QM7A 3TETA 2BCCH 4Z1MG 3S3WA 4DR4B 5KAFZ 1WAZA 3BPZA 3VQXA 1IX9A 4B3TB 4QNHB 2HG5C 2DYRC 2CE4A 4TUYB 2E76B 5IY5B 5IT9N 4I55A 2P22C 2ZIMA 2OCHA 3ZMTA 1Q6HA 1NH2D 4JYAO 3VOUA 5J2TA 2WLLA 3JASA 4LH6A 4O4JB 5KAIZ 2PYLA 1QR9A 4LF5B 3A8TA 4EKWA 4LF5O 4UB8Z 2AHYA 1OV9A 3LSSA 4Q20A 1B04A 1NT2B 3RFRA 2PGGA 4UVBA 3AG4C 1R3JC 4P2ZA 3K03A 2ETNA 3EVKA 1VEWA 1FAFA 1BGYH 2EIJC 1AB3A 5FPRA 4UCTA 1NI8A 1SC5B 4LNUB 1GO3F 4ZKIA 4QE9A 1SA0B 2BOBC 2ADQB 1MOFA 2LP7A 4K3AA 3RYCB 1D2DA 2XHBA 1N36O 1X4TA 3KKYA 5C8YA 1P84F 3P32A 1JFFA 1NKDA 3OM3B 2MK3A 3CRCA 3ETDA 1TAEA 3CYOA 4PELA 3D8CA 1YEWA 1J5EB 1J5EO 2UXCB 2UXCO 4ABMA 5CA1A 3KCYA 2KSDA 1NJIW
chains in the Genus database with same CATH topology
1H8EG 3E89A 3IGAC 1R6KA 2JJ2G 4PDMA 5IYCO 3CPWU 3QNEA 2HVKC 3LDDA 5HFMA 3W7UA 1K4DC 2EIMC 5CBHA 1KKDA 4WFEA 3OW2U 1FXVA 2JK5C 3E8BA 3WG7C 1QLEB 2DWEC 5DN6G 1ORQC 5BZBA 2UXNA 1NVPB 1QBZA 3CMEV 4PA3A 3K79A 3GB7C 2EILC 3CCVV 2XAQA 5B1BB 3QO8A 3LDEA 2NLJC 1S5HC 3IC7A 2WPDG 1DTOA 1E79G 1Q82W 3B8NA 1Q7YW 5LGTA 3EHBB 5CA3A 1Q81W 4LBEC 2Y48A 3ZRVA 2X7RB 5L3GA 4RQFA 2HKOA 1OCRC 4FPPA 3AG2C 3FYIB 3MD0A 3LUTB 3OMIB 5LBQA 5HFLA 4G2KA 3STLC 4PA9A 3AG3B 1IXMA 3E8FA 4JYCA 2DYRB 1PKXA 1AI7A 1ROPA 1NVPD 1YSCA 1M56C 2NNUA 4GX5A 4WF9V 1H2GA 1AI6A 3ZRSA 1DLBA 2HFEC 3ZMVA 4JTDB 4WFGA 4QE7A 1MG1A 2OCCC 3JD2A 4KFMA 3ASNB 3UKMA 2W6IG 4U7OA 3ZRXA 1S72V 3ABUA 3LSQA 4X8AA 4XDKA 1YIJV 1YITV 2QE7G 1W0JG 1L1FA 3OE7G 4QPJA 3AG4B 2EZPA 4MTOA 4JAVA 3BEHA 1COWG 1WPXA 2B1IA 3OMNB 2D3OW 3CC4V 3RVYA 2R9RB 2HJFC 2V7QG 2ITDC 2EIJB 1OZ0A 2XNDG 4XDJA 4XBFA 4QJFB 1GK9A 5B3SC 1GKFA 4OXSA 1I5YA 2IJKA 4L87A 3ABMC 2Y69C 4BIZA 1F4MA 1UJWB 1N8RW 4J9ZB 1BMFG 2HLDG 5LHHA 1YTFB 3CCRV 2IJJA 2WSSG 1M1KW 5EK0A 4UVAA 1VQ8V 2JIZG 3ETEA 2WLKA 2WWWA 3CCQV 4BIUA 1PNLA 2OTLV 2X6BA 4JTCB 2ATKC 4WFBV 3FKSG 2A79B 1RPOA 2QTOA 1F23A 3JD1A 3UM7A 1FXKA 3FB7C 1Y4MA 2F43G 2B1GA 1YI2V 3T2MA 1MABG 4LCUC 5LGNA 3SPGA 1V54B 2B5UA 3X2QB 1AJQA 2Q68A 4MVOA 2ZR3A 5IYDO 1KQSU 1FXKC 1GTOA 1FS0G 1R6NA 1P7BA 1YTFD 3ABTA 1AROP 1BHAA 2WLIB 4RO2A 1AJNA 4R8CA 3LDCA 5C93A 2EIMB 1F4NA 2WLJA 2WLHA 4JGSA 3QO5A 4JASA 2IW5A 3F7VC 3WG7B 3CMAV 4MS2A 1R3KC 4CBCA 1XL6A 1E1QG 3GWOA 1K4CC 2EILB 1K3EA 4UV9A 1JCHA 3K06A 3RBZA 1XL4A 2WLMA 2XASA 5L3DA 3CCJV 1SERA 3IFXA 2EINC 1EBOA 1VQKV 5B1AC 4UUJC 1SESA 3A0RA 5EBLC 3JD0A 3FB8C 4UV8A 4XDLA 4X88A 4JTAB 1OCRB 3AG2B 4P30A 2IJHA 5GW7A 1RM1B 4DXWA 3W7WA 1V55C 1KC8W 3B77A 3ABLC 3CC7V 4TT3G 5LHGA 1RPRA 1ZWIC 4RAIA 2YSUB 3SJQC 1M56B 1M57C 2H94A 4GX1A 1R3IC 2LFSA 2AHZA 4G27B 5L3EA 5EBMC 4WFAV 5KUMA 2OCCB 1PL0A 4JYBA 4BW5A 1KECA 3NXSA 3TCUA 3BY6A 2W6JG 1VQ7V 3SPIA 1BHBA 2IH1C 1TUEB 3K0GA 3CP1A 4H37A 3AG1C 1NBMG 1P4RA 2XAHA 1QCEA 4JF3A 1AI5A 3K08A 4R6ZA 3SYCA 3WFVA 3E83A 5L3BA 2JEUA 2BOCC 1JOYA 1GMGA 2ZDIA 2EJRA 5B3SB 3SYPA 1NR7A 3ABMB 1F51A 2Y69B 5EC1C 3VBBA 1K9MW 2WLNA 3ZMSA 1CP9A 2C2AA 1S76D 2OTJV 5H6RA 2ZDIC 3QO7A 3CC2V 4PDRA 2JJ1G 1THZA 2CK3G 4TSFG 1GM9A 4UVCA 1H38A 4MVMA 3AG3C 1Y66A 1EFRG 3T4DA 4WCEV 1GM7A 2EIKC 5B1NA 2DQ3A 1JJ2U 3G71V 5LHIA 2GSMB 2X6AA 5L3CA 5DM6V 4FK5C 5B1OA 4TWKA 1VQMV 1NR1A 4FIPC 2A9HA 1OCOC 2H8PC 3ABKC 2ITCC 5EBWC 4R7CA 3SPHA 1FXKB 2HVJC 3I56V 5IY5C 3T1CA 3W7SA 2PI4A 3F5WC 1OCZC 1LNQA 3EFFK 4X89A 3JD4A 1VQLV 3ASOC 3ZMZA 1WLEA 1VQOV 3FB6C 4J9YB 1KD1W 4N21A 3AEIA 5E1AC 1S0VA 1BL8A 1SZTA 2XAJA 3SYOA 1SETA 3OEHG 2HR3A 4GX2A 2X0LA 5CN0A 1OCCC 1YHQV 2IJIA 3STZC 1K33A 1QLNA 3W7TA 4MSWC 4WFHA 3ZRWA 4HZ3A 4P9OA 2EINB 4RUFA 1OHHG 2JDIG 4FJCC 3FB5C 3OUFA 3CCSV 5B1AB 1J95A 4CZZA 1S77D 4R50A 3I55V 1PNKA 2EBOA 4MT8A 3OEEG 3R65A 2R9IA 2ZQMA 2WAMA 2P90A 1M9NA 2ZXWC 1YJ9V 1YJWV 4LP8A 1ENVA 2IH3C 3K04A 1DF5A 3SYAA 4PDVA 4U7NA 2K1EA 1V55B 3LNMB 3KG2A 5CBGA 3JD3A 3CCEV 3ABLB 3H01A 4P9PA 2P67A 1PD3A 4KUMA 2XOKG 4PA4A 2P6JA 3K9AA 1M57B 2DYSC 3E86A 2YEVA 1G4YB 3D36A 3HB3B 3CD6V 3ETGA 5H9CA 4DO2A 3PJSK 3CCMV 1CPYA 2FTKA 4MVQA 2QM8A 1SRYA 4N23A 3OFNG 1GM8A 2Q6AA 3G4SV 4PA6A 5IDJA 4ZBMA 3JYCA 4MVSA 3SPCA 2LFRA 2GHYA 5LGUA 3AG1B 1JX9A 1K73W 1AR1B 5CMUA 1QVGU 4G28B 3K3WA 2ZD9A 2PI5A 3E2EA 1K97A 3HPLC 1MSWD 1E1RG 1R73A 3F7YC 1KP3A 1I5XA 1K7DA 4E2LA 2QEXV 1QLEC 1K34A 3E8HA 3W7XA 2Q69A 4RUEA 3OMAB 2IU3A 3ZIAG 1VQ6V 3DTUB 2W0FC 3CCUV 3B8MA 1NH2B 1H8HG 3MHHC 5FL7G 1DF4A 5B1BC 3OR7C 1VQ4V 4MW8A 3D3IA 1K5QA 3M99B 5EC2C 1RM1C 1HWYA 2X6CA 3ZN0A 1KP2A 3OR6C 4UXNA 3SPJA 1CEZA 4MVRA 1Q86W 3G6EV 2QKSA 4QPKA 2EIKB 4FMTA 2M7WA 4GT1A 5CBFA 2QM7A 2XAGA 4H33A 1QVFU 3TETA 1K5SA 1VQPV 4PDLA 4Z1MG 4MTFA 2Q67A 5H6QA 1FFTB 3T4ZA 2V1DA 1OCOB 1B6QA 1PNMA 3ABKB 1EZJA 4QNHB 2HG5C 4MTGA 2DYRC 5IY5B 1YJNV 4GX0A 1OCZB 4HAMA 3OUSA 3ZMTA 2XAFA 3ASOB 2WLLB 1NH2D 3VOUA 3SYQA 3JCZA 1W0KG 2WLLA 2QA4V 2A0LA 2DW4A 3ZN1A 1QR9A 3ASNC 1JQ0A 4EKWA 3E8GA 2AHYA 2EZOA 3P30A 3CCLV 4QIWF 3LSSA 1OCCB 2ZR2A 4PA7A 4Q20A 3K0DA 4KP4A 4UVBA 3AG4C 1R3JC 4MW3A 4P2ZA 4YXWG 3TK1A 5KUKA 3ML0A 3K03A 4LC1A 4JAUA 3DGEA 3E35A 1G8MA 3ZJZA 1JPXA 4JPRA 1VQ5V 3OGCC 2EIJC 4F4LA 1JVMA 2Z3YA 2DWDC 4GCZA 1GO3F 2ZXWB 4ZKIA 1VQ9V 2DQ0A 2JEXA 3ZRWB 4QE9A 1AI4A 5KA5A 1K8AW 2BOBC 4I9WA 3ZCCA 3ZMUA 1MOFA 3OAAG 3CXCU 2LP7A 1M90W 4HYOA 1VQNV 1FXHA 1K92A 5KA6A 2P7TC 4MTXA 2DYSB 3RW0A 1W2BU 3P32A 4RQEA 1S3JA 5L3FA 3MHSC 4ASUG 1NKDA 3OM3B 2MK3A 3ETDA 3CYOA 1AJPA 3FYEB 4PELA 2WLIA 4BAYA 1V54C 2UXXA 4MVUA 3RVZA 3X2QC 5IYBO 2YEVB 1QR8A 5J9PC 2KB1A 2IU0A 4MVZA 1NQTA 2OT5A 2Z5UA 1R3LC 4I5SA 4WFFA 1NJIW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 V;  1KC8 W;  1Q81 W;  1VQN V;  1VQO V;  3CPW U;  1YJW V;  3G4S V;  3CC7 V;  1YJ9 V;  1N8R W;  1VQ6 V;  1KD1 W;  4WCE V;  1KQS U;  3CCU V;  1W2B U;  3CCR V;  3CCJ V;  1M1K W;  1VQ4 V;  1VQ5 V;  3OW2 U;  1S72 V;  1YJN V;  1VQK V;  1JJ2 U;  1VQ8 V;  3G71 V;  1K73 W;  1YIJ V;  1YIT V;  5DM6 V;  1K9M W;  1QVG U;  3CCE V;  3CCQ V;  4WFA V;  1VQM V;  3CME V;  1YHQ V;  1VQ9 V;  1Q86 W;  3G6E V;  2OTL V;  2OTJ V;  3CCV V;  2QA4 V;  1K8A W;  4WFB V;  1VQ7 V;  2D3O W;  3CC4 V;  1R73 A;  3CC2 V;  1QVF U;  3I56 V;  3CCS V;  3CMA V;  3CXC U;  1Q82 W;  4WF9 V;  3CCM V;  1VQP V;  3CD6 V;  3CCL V;  1Q7Y W;  1YI2 V;  1M90 W;  2QEX V;  1VQL V;  1NJI W; 
#chains in the Genus database with same CATH topology
 1H8E G;  3JAL A;  1X59 A;  3QNE A;  3LDD A;  3C3T A;  1FKA O;  1K4D C;  4YHH B;  4B3M B;  5IJ0 B;  1KKD A;  3OW2 U;  2JK5 C;  3E8B A;  3WG7 C;  1O9G A;  5LXT B;  2UXN A;  1SKV A;  4LWS B;  1QBZ A;  4B7E A;  1EZV H;  1IBK O;  2XAQ A;  5B1B B;  3LDE A;  1D5N A;  4GYC B;  4GKJ B;  4GKJ O;  3EHB B;  5CA3 A;  1Q81 W;  4K8Z A;  4B3S B;  2LQT A;  1RSO A;  3AG2 C;  1T5E A;  3MD0 A;  4J42 A;  3OMI B;  5LBQ A;  3N2K A;  2CGN A;  2DYR B;  1PKX A;  1NVP D;  1B3Q A;  4PD4 F;  1Z2G A;  4K8X A;  1LR1 A;  4DYL A;  1WB7 A;  1DLB A;  2HFE C;  4WFG A;  1S72 V;  2FB5 A;  4X8A A;  4I9Q A;  3OE7 G;  3AG4 B;  2YXH A;  4LH7 A;  2ZNJ A;  4GLX A;  1COW G;  3RVY A;  2Q7E A;  4DV1 O;  2EIJ B;  4XDJ A;  5B3S C;  3JAR B;  1I5Y A;  3J7A U;  4LFB B;  5BMV B;  1F4M A;  2BTQ A;  5LHH A;  1YTF B;  3VQV A;  1Y74 A;  3CCR V;  1H2M A;  2WSS G;  3JAW B;  4FLV A;  1KKC A;  2A7W A;  4EB6 A;  2WLK A;  3DC6 A;  2OIE A;  4U3F H;  3K5L A;  3K5M A;  3CCQ V;  1NZ6 A;  1PNL A;  4UCS A;  4O2A A;  4JI4 B;  1F23 A;  3JD1 A;  4UB6 Z;  4JI8 B;  1WNS A;  2B1G A;  2F43 G;  5KHK A;  1V9P A;  2B5U A;  3L71 H;  1AJQ A;  2Q68 A;  4LF7 B;  1VIB A;  1KYO F;  1R6N A;  1QU7 A;  4DK0 A;  5C93 A;  2WLH A;  4JGS A;  2YXL A;  3QO5 A;  3WG7 B;  3CMA V;  2F23 A;  2UU9 B;  4U3J B;  4O4L A;  2HP8 A;  1AP6 A;  4CH6 A;  4UV9 A;  1JCH A;  3K06 A;  1YF2 A;  3M8A A;  2WLM A;  3CCJ V;  1SER A;  3IJ4 A;  4FFB A;  1MMM A;  1DGS A;  5CB4 B;  4UUJ C;  3A0R A;  2PZS A;  3JD0 A;  3G80 A;  3FB8 C;  5H2F Z;  4XDL A;  2ZCE A;  3AG2 B;  1MNG A;  2AZ0 A;  1KC8 W;  1XI1 A;  2FML A;  4JI6 B;  4JI6 O;  3CC7 V;  5LHG A;  2YSU B;  3SJQ C;  3ZED A;  4GX1 A;  1R3I C;  4YIP A;  1RP3 B;  2AHZ A;  4ZOL A;  3RYI A;  3UO3 A;  4K0K B;  4G27 B;  1KEC A;  5GON A;  2E5L B;  2IH1 C;  3K0G A;  4OPA A;  4H37 A;  1BQZ A;  1NBM G;  1P4R A;  2XAH A;  1QCE A;  2YC0 A;  3J81 N;  1BSM A;  3FD9 A;  2BOC C;  5B3S B;  1NR7 A;  1QNM A;  1F51 A;  2R9A A;  4CS3 A;  4DV6 B;  1Z5W A;  2UXD B;  2UXD O;  1RFY A;  2OTJ V;  3P3P A;  3E22 B;  5LA6 A;  1KMI Z;  2LO1 A;  1N33 B;  1N33 O;  3CHX A;  3VQW A;  2E74 B;  4W4L A;  2AGA A;  1H38 A;  4MVM A;  3AG3 C;  4YJ3 B;  3ZHT A;  1GM7 A;  3QG5 A;  3F5T A;  5EZY A;  4TUY A;  3TJT A;  4YY3 B;  4YY3 O;  2X6A A;  4FK5 C;  4DRX B;  4JI3 B;  2H8P C;  3JAK B;  4KHP O;  3I56 V;  4WBN A;  4FLU A;  1OCZ C;  3AK2 A;  2PY5 A;  1Y6X A;  1XMO B;  3ZHV A;  4J41 A;  1S0V A;  2XAJ A;  3ICX A;  3L70 H;  2HR3 A;  2X0L A;  4LNU A;  1DK1 A;  1QLN A;  3L74 H;  3W7T A;  3FX7 A;  5K1P A;  1R1B A;  3OUF A;  1FYJ A;  1Q3E A;  4EEQ A;  3RYF B;  4HNA A;  1S77 D;  4MT8 A;  3R65 A;  3CXH F;  2WAM A;  1YJW V;  3HKC B;  1YJ9 V;  3RYC A;  4LP8 A;  4IHJ B;  2YIB A;  3LNM B;  1IBM B;  3JD3 A;  2P67 A;  1D5A A;  5BY1 A;  2DYS C;  1W59 A;  5KHG A;  3D36 A;  5FNV A;  4DO2 A;  3PJS K;  3CCM V;  1WA8 B;  3CEI A;  3CSX A;  5IDJ A;  3JYC A;  3SPC A;  2D2C B;  4JAA A;  5B5E Z;  3K3W A;  2IM9 A;  3RT3 C;  1QHT A;  2UXB B;  2UXB O;  1E1R G;  4AIL C;  1KP3 A;  1N32 B;  2Z0A A;  2P06 A;  4W4K A;  2GUZ B;  3I5D A;  3E8H A;  1VF6 A;  3W7X A;  2Q69 A;  3SJC C;  3ZIA G;  1ZL8 B;  2RDC A;  3CCU V;  4DV7 B;  1H8H G;  5JH7 B;  1IVS A;  1L8D A;  5JCO C;  1K5Q A;  2YI8 A;  4B08 A;  2X6C A;  1KP2 A;  3OR6 C;  4X62 B;  4TQF A;  1CEZ A;  1PPJ H;  5TIS Z;  4QPK A;  5KHH A;  2M7W A;  2Q0O C;  1U96 A;  4JZ2 A;  2AW9 A;  3B4S A;  5BXZ A;  1K5S A;  1M93 A;  2B9Z A;  1L0N H;  3T4Z A;  5IYZ B;  1EN4 A;  1B6Q A;  4FVM A;  4H13 B;  4GX0 A;  1OCZ B;  4HAM A;  3SYQ A;  3JCZ A;  5JJN B;  2DW4 A;  3ZN1 A;  2EZO A;  4X9Q A;  3JAR A;  3RN4 A;  4NXM O;  4KP4 A;  2ZNI A;  4LF4 B;  3AG7 A;  4MW3 A;  4JAU A;  3DGE A;  3E35 A;  1JPX A;  1WB8 A;  3JAW A;  2UUB B;  1O9H A;  2Z3Y A;  4GCZ A;  3HKD A;  1BE3 H;  3ZRW B;  5JJJ B;  1IBL B;  1JJO A;  5KA5 A;  1TA8 A;  3ZMU A;  2Q8V A;  1VQN V;  2DYS B;  1S3J A;  4ASU G;  3N2G A;  4JV5 O;  1WN7 A;  3FYE B;  4BAY A;  4ZI7 B;  2UXX A;  4MVU A;  5IYB O;  2EJ7 A;  2YEV B;  2KB1 A;  3H1J H;  4MVZ A;  4O2B B;  2Z5U A;  1R3L C;  4WFF A;  4U3J A;  2JJ2 G;  5HFM A;  4DV5 B;  4F6R A;  2ZE6 A;  3MDS A;  5CBH A;  1FXV A;  1GAX A;  2DWE C;  2LW7 A;  5CB4 A;  5KHJ A;  5J2U B;  4AI8 A;  3OGI B;  2XT9 A;  3GB7 C;  2EIL C;  5LOV B;  3CS5 A;  3QO8 A;  1XEQ A;  1S5H C;  2QKC A;  3CRR A;  1DTO A;  1E79 G;  3ZHR A;  2DJV A;  3B8N A;  1Q7Y W;  2YID A;  3OD4 A;  4DR5 B;  1MZE A;  4DR5 O;  4GKK O;  4NKG B;  2X7R B;  5L3G A;  2HKO A;  1I94 B;  1AR4 A;  4J80 A;  4TOI A;  3STL C;  3OTO B;  1IXM A;  4JYC A;  3IAY A;  1AI7 A;  1ROP A;  4JI0 O;  1M56 C;  4UFZ A;  2YS8 A;  1IUR A;  3ZRS A;  4DR4 O;  2VRZ A;  4UCV A;  4JTD B;  1MG1 A;  2OCC C;  3LNN A;  3UKM A;  4B3T O;  4DV0 B;  3RGB A;  1KB9 F;  4MTO A;  3MAQ A;  4TV9 B;  2ZIN A;  3OMN B;  2B1I A;  1HR0 B;  3E22 A;  2R9R B;  1AP5 A;  2ITD C;  4XBF A;  3ABM C;  1UJW B;  1BMF G;  2O57 A;  4YJ3 A;  1KUQ A;  4UCU A;  5EK0 A;  3L73 H;  3RYH B;  2WWW A;  2WA4 A;  1XBL A;  4DRX A;  4FLW A;  2X6B A;  4JTC B;  2ATK C;  4WFB V;  3SR2 C;  1RPO A;  4J7K A;  3UM7 A;  1U97 A;  2VQE B;  2RNB A;  3T2M A;  3SPG A;  4DV4 B;  4DV4 O;  4MVO A;  2ZR3 A;  1KQS U;  3CRA A;  4IYI A;  4I50 B;  1PP9 H;  1GTO A;  1FS0 G;  3OT7 A;  5IWA B;  5IWA O;  2R72 A;  3ABT A;  1BHA A;  2WLI B;  2JS3 A;  4X1Y B;  1AJN A;  1I08 A;  2GTA A;  3LDC A;  1B06 A;  2GBO A;  2QWQ B;  2YIA A;  5D5Q A;  3QF7 A;  1R3K C;  1XL6 A;  3RYF A;  2CTW A;  1K4C C;  2Y0P A;  2EIL B;  4LFA B;  1SQF A;  3HKC A;  1XL4 A;  2XAS A;  3CWB H;  1QQC A;  2RCV A;  5L3D A;  5CA0 B;  4YHH O;  1SF9 A;  3IFX A;  4IHJ A;  4B3M O;  1VQK V;  1BS3 A;  3AK1 A;  5B1A C;  3B2E E;  1SES A;  4IIJ B;  5E79 Z;  4NB5 A;  3CX5 F;  3TXS A;  1HW7 A;  4UV8 A;  4X88 A;  4JTA B;  1SQB H;  4LF6 B;  4JI5 B;  4JI5 O;  1H2N A;  5GW7 A;  1WA8 A;  3B77 A;  4I4T B;  4B3S O;  1HNZ B;  5LMU B;  1HNZ O;  1ZWI C;  4RAI A;  1M56 B;  1M57 C;  2H94 A;  4X1K A;  3SJA C;  1XUQ A;  1XNQ B;  1XNQ O;  2OCC B;  1HDJ A;  4BW5 A;  2ZIO A;  5K1X A;  4OGQ B;  2RMK B;  4O4H A;  1TUE B;  1Q5O A;  4OPH A;  2EX3 A;  3AG1 C;  4R6Z A;  3SYC A;  2G38 A;  4CH4 A;  5L3B A;  4LF9 B;  4LF9 O;  4GZR B;  4NTX A;  5ITZ B;  5JH7 A;  2ARH A;  3HKE B;  3ABM B;  1K9M W;  3VBB A;  4K35 A;  3ZMS A;  3H9V A;  2C2A A;  2P4V A;  1H2L A;  1S76 D;  1GN6 A;  3SGI A;  5H6R A;  2ZDI C;  5IE9 A;  3QO7 A;  2JJ1 G;  2E3C A;  1Y76 B;  4NR1 A;  2QJ1 A;  2CK3 G;  5D5P A;  2Q7H A;  3T1Y B;  1GM9 A;  1Q8I A;  4LFB O;  1IZ3 A;  3T4D A;  4Z1V A;  5A9G A;  5KMG B;  4BR6 A;  3G71 V;  5LHI A;  5L3C A;  5DM6 V;  4X65 B;  5B1O A;  4X65 O;  4FIP C;  2A9H A;  1OCO C;  3ABK C;  4DUY B;  3ZHS A;  5EBW C;  3SPH A;  2HVJ C;  4JI4 O;  4J7Z A;  4JI8 O;  4GUN A;  3F5W C;  2H3O A;  1GH6 A;  4X89 A;  3ZMZ A;  3L72 H;  1VQO V;  3FB6 C;  4J9Y B;  4FLX A;  4YJ2 B;  2OYQ A;  5E1A C;  4LF7 O;  4LFC B;  4LFC O;  1F7Y A;  2QWO B;  3SYO A;  1YHQ V;  2IJI A;  3UT5 B;  4MSW C;  4WFH A;  3ZRW A;  2AXT Z;  4P9O A;  4IGG A;  1OHH G;  4ZHQ B;  3Q4H B;  3CCS V;  5B1A B;  1J95 A;  5IJ9 A;  5B66 Z;  2UU9 O;  2KQX A;  5KLV H;  4R50 A;  1Y67 A;  1NU1 H;  5KX5 B;  3OEE G;  2R9I A;  2CH7 B;  5JQG A;  2IH3 C;  3K04 A;  1WP7 A;  4PDV A;  3UO2 A;  5LYJ B;  2K1E A;  1SS3 A;  3K57 A;  4B3R B;  1FJG B;  5JJE B;  1M57 B;  4ZI7 A;  1VF5 B;  3E86 A;  2YEV A;  1G4Y B;  3ETG A;  1AIL A;  3ZHQ A;  2WA3 A;  3HKB B;  4O2B A;  4N23 A;  1TVK B;  1WJZ A;  2Q6A A;  3EXA A;  3G4S V;  1R6T A;  2XTA A;  4QGP A;  5LGU A;  3AG1 B;  1JX9 A;  3BCC H;  3ZHU A;  2GTS A;  1IXB A;  5EYP B;  3D3Q A;  5CMU A;  1QVG U;  4K0K O;  2F66 C;  4G28 B;  2ZD9 A;  2PI5 A;  5J2U A;  3E2E A;  4O4I B;  1VP7 A;  3HPL C;  2Y4T A;  1MSW D;  2E5L O;  5JCO A;  1I5X A;  3U10 A;  4DR1 B;  5DEC A;  1QLE C;  3VQY A;  5EIB D;  4FZ1 A;  2IU3 A;  2ILM A;  1NH2 B;  1XHZ A;  1DF4 A;  3U0Z A;  4MW8 A;  1I0H A;  3PN1 A;  5EC2 C;  1RM1 C;  3APO A;  4TQD A;  4DV6 O;  1Q86 W;  2QKS A;  4CS2 A;  1N4C A;  4FMT A;  4GT1 A;  4FLY A;  2XAG A;  2YI9 A;  4H33 A;  1QVF U;  1ZSP A;  1VQP V;  4PDL A;  5H6Q A;  4NXN B;  4NXN O;  1VAR A;  1OCO B;  3ABK B;  1MA1 A;  1EZJ A;  2ZE5 A;  4I55 B;  1XDC A;  2LGW A;  2XAF A;  2N74 A;  4FLZ A;  2WLL B;  4IYH A;  1ZUQ A;  4JI3 O;  2HHH B;  3BVO A;  4ICG A;  2QA4 V;  3K5O A;  4TV9 A;  4O4J A;  4X1I B;  1JQ0 A;  3E8G A;  4QIW F;  2F95 B;  2QKA A;  1GRJ A;  2JGD B;  1XMO O;  3CRM A;  4Z2W A;  3ZJZ A;  3A0H Z;  3OGC C;  1JVM A;  1FPO A;  2DWD C;  3RYH A;  4FFK A;  1MZF A;  2DQ0 A;  2JEX A;  4DK1 A;  1HNX B;  1K8A W;  4FM0 A;  2QM4 A;  1SA0 A;  2LJ2 A;  3OAA G;  5LL6 Y;  1N34 B;  3CXC U;  3KCX A;  2PYJ A;  1K92 A;  5KA6 A;  2P7T C;  1W2B U;  4RQE A;  2F4V B;  2F4V O;  3MHS C;  2CTP A;  3H1H H;  1GN4 A;  3APQ A;  1AJP A;  1SQG A;  1IBM O;  2Q0A A;  2WLI A;  3JCU Z;  4X1Y A;  3X2Q C;  3RVZ A;  1NTM H;  1QR8 A;  5J9P C;  5CA1 B;  1NQT A;  4I5S A;  3E89 A;  3IGA C;  4I0X B;  4PDM A;  5F2V O;  1NTZ H;  1WPB A;  3ETQ A;  5CA0 A;  5IJ0 A;  1QLE B;  5DN6 G;  5BZB A;  3QVN A;  1NVP B;  4PA3 A;  2N05 A;  5LXT A;  2YIB D;  4NTW A;  3K79 A;  2EUL A;  4LWS A;  1S5L Z;  2NLJ C;  3IC7 A;  2WPD G;  1N32 O;  4RWU A;  1NTK H;  5LGT A;  2QDO A;  4LBE C;  4DR2 B;  4DR2 O;  1RSO B;  3ZRV A;  2W0X A;  4I4T A;  1TUB B;  4DV7 O;  1OCR C;  4FPP A;  3N2K B;  5HFL A;  4G2K A;  4X62 O;  4PA9 A;  3AG3 B;  3E8F A;  3O65 A;  4J7J A;  1XQ8 A;  4WF9 V;  1H2G A;  1AR5 A;  2VWJ A;  1AI6 A;  1XMQ B;  1AVM A;  4OX9 B;  3ZMV A;  4JI1 B;  2F93 B;  3JD2 A;  4I7Z B;  2W6I G;  4U7O A;  4JYY A;  3ABU A;  3LSQ A;  1NS1 A;  1YIJ V;  3HKE A;  2QE7 G;  4QPJ A;  1SZX A;  3K58 A;  4Q6G A;  3BEH A;  4NTY A;  2D3O W;  2KG7 B;  2RN9 A;  2V7Q G;  2Q4P A;  2XND G;  1GKF A;  4OXS A;  4L87 A;  2BTQ B;  1Y74 B;  3C90 A;  4JI7 B;  1N8R W;  5BMV A;  4LF4 O;  1MSD A;  2IJJ A;  1M1K W;  4EFB A;  3THO A;  4EB6 B;  1VQ8 V;  2JIZ G;  2UUB O;  1ZX3 A;  4KXR A;  4O2A B;  1PV0 A;  4UCR A;  2OTL V;  1IBL O;  3FKS G;  4NVP A;  2QTO A;  4NYK A;  3FAV B;  3FB7 C;  2K9P A;  1YI2 V;  1XOU A;  4UCO A;  3X2Q B;  5IYD O;  4YJ2 A;  1FXK C;  1P7B A;  1XRE A;  5LP6 C;  1YTF D;  4RO2 A;  2MW2 B;  4R8C A;  1VF7 A;  2CDY A;  2WLJ A;  3R66 A;  4O4L B;  4ZHQ A;  3G67 A;  3Q4H A;  2Y4U A;  4CBC A;  1L0L H;  3JSN A;  2HEP A;  5KX5 A;  3RBZ A;  2CH7 A;  4DV5 O;  2EIN C;  4FLT A;  1EBO A;  1EM1 A;  5EBL C;  5JVD B;  4FZ0 A;  1XIL A;  3BAA A;  1OCR B;  1EN5 A;  2VS0 A;  2JVD A;  3WU2 Z;  3W7W A;  2Y0I A;  3GWK C;  1V55 C;  2V4D A;  3HKB A;  3ABL C;  1TVK A;  1ZAU A;  1BQ0 A;  1BZK A;  3AK3 A;  1H2S B;  4LR3 A;  3D36 C;  5FPO A;  3RYI B;  2LFS A;  4IT5 A;  1KBH A;  1I94 O;  4D6T H;  2NN4 A;  5EYP A;  5KUM A;  5GON B;  1PL0 A;  4JYB A;  3OTO O;  3NXS A;  1GN3 A;  4O4I A;  3SPI A;  1VQ7 V;  3CP1 A;  4JF3 A;  1AI5 A;  2ZM6 B;  2QWR B;  3WFV A;  2JEU A;  3CE2 A;  2BSK B;  1JOY A;  1GMG A;  2ZDI A;  2EJR A;  1Q6U A;  2WLN A;  4D7T A;  1VF6 C;  1CP9 A;  3U11 A;  4DV0 O;  5LA6 B;  2FYU H;  3S3X A;  4CH3 A;  1LUW A;  3HR0 A;  1HR0 O;  3CC2 V;  1I7F A;  4TSF G;  3CB2 A;  2JGU A;  1Y66 A;  5EZY B;  2UUC B;  2UUC O;  2DQ3 A;  3H1L H;  1JJ2 U;  4PHZ A;  2R70 A;  2GSM B;  4JYA B;  2KKW A;  1N0J A;  2ITC C;  4WBN B;  1FXK B;  3DSQ A;  3JAK A;  4X1I A;  3T1C A;  3W7S A;  2PI4 A;  5LP6 B;  2VQE O;  1S5J A;  3EFF K;  1LNQ A;  3JD4 A;  3ASO C;  1WLE A;  1KD1 W;  2JGD A;  4N21 A;  1BL8 A;  1SZT A;  4ZIB A;  3OEH G;  5CN0 A;  1OCC C;  3STZ C;  3ZS8 C;  1Q90 D;  2EIN B;  3CJH B;  4HNA B;  4CZZ A;  3I55 V;  1N36 B;  2ZQM A;  2ZXW C;  1M9N A;  1KU9 A;  4LFA O;  1ENV A;  3SYA A;  3B40 A;  4U7N A;  1V55 B;  3KG2 A;  5CBG A;  3ABL B;  3H01 A;  3QTC A;  5A2Q N;  2XOK G;  4TV8 B;  4PA4 A;  5FNV B;  3HB3 B;  3CD6 V;  1SQP H;  4LF6 O;  2HJD A;  3M7M X;  4MVQ A;  2QM8 A;  1SRY A;  3OFN G;  2PF4 E;  1GM8 A;  4I0X A;  1Z5V A;  5LMU O;  4HBN A;  1EN6 A;  4DUZ B;  4DUZ O;  2OWO A;  3K5N A;  1IBK B;  4AQY B;  2LW1 A;  4AQY O;  3F7Y C;  4FM2 A;  3JAT B;  4E2L A;  1K34 A;  1XNR B;  1XNR O;  4RUE A;  1YDX A;  2GUZ A;  1VQ6 V;  2W0F C;  3B8M A;  1TUB A;  5FL7 G;  1ZL8 A;  3OR7 C;  1VQ4 V;  3FFQ A;  3M99 B;  4A5U B;  3SPJ A;  4MVR A;  3SDL A;  3G6E V;  3A2F A;  5CBF A;  1YVW A;  1P49 A;  4MTF A;  2Q67 A;  1FFT B;  2V1D A;  3T1Y O;  5AG2 A;  1PNM A;  5IYZ A;  4J11 A;  4MTG A;  1YJN V;  3OUS A;  1JMK C;  2L35 A;  3ASO B;  2DOS A;  2GDS A;  1W0K G;  1M5I A;  2A0L A;  4DV1 B;  3ZX6 A;  1XHX A;  4DUY O;  2Q9L A;  3ASN C;  2KG7 A;  3P30 A;  3CCL V;  1G6U A;  1OCC B;  2ZR2 A;  3DXR B;  4PA7 A;  3K0D A;  3WB1 A;  4YXW G;  3TK1 A;  5KUK A;  3ML0 A;  5FLX N;  4LC1 A;  1G8M A;  4JPR A;  1VQ5 V;  3HKD B;  4F4L A;  1VQ9 V;  2ZXW B;  4H0L B;  1AI4 A;  1ZLZ A;  4D7S A;  4I9W A;  3ZCC A;  2RJZ A;  1FFX B;  3FAV A;  1M90 W;  4HYO A;  1P7G A;  1FXH A;  2DE0 X;  4MTX A;  4PI2 A;  3RW0 A;  5L3F A;  3N2G B;  3UCS C;  5BR8 B;  5BR8 O;  3G6B A;  4JI2 B;  4JI2 O;  2RQ6 A;  4CC5 A;  4B3R O;  3WB2 A;  1V54 C;  1FJG O;  2LGQ A;  1TGO A;  1Q43 A;  2IU0 A;  4H44 B;  2OT5 A;  3K59 A;  3RWR D;  2ZE8 A;  5IYC O;  3CPW U;  1R6K A;  4F6R B;  2HVK C;  3W7U A;  2DN9 A;  1SQX H;  2EIM C;  4L8J A;  2PTM A;  4WFE A;  2M6Y A;  5GTI Z;  1ORQ C;  3A0B Z;  5KHI A;  3CME V;  5JVD A;  3CCV V;  5H5N A;  5LOV A;  1UPG A;  1Q82 W;  2YUA A;  2L6L A;  4DR1 O;  4F6E A;  2Y48 A;  5DED A;  4YIO A;  1VMG A;  4DR7 B;  4DR7 O;  4RQF A;  3FYI B;  4C7U A;  2YIC A;  2N04 A;  3LUT B;  3C3S A;  4X20 B;  4DR3 B;  4DR3 O;  1YSC A;  3T1H B;  2NNU A;  3T1H O;  4GX5 A;  2ADP A;  3LSU A;  4QE7 A;  3BFR A;  2BSK A;  4KFM A;  3ASN B;  2P4K A;  3ZRX A;  3B09 A;  2OIG A;  4XDK A;  1YIT V;  1W0J G;  1L1F A;  3TGU H;  1A32 A;  3JAS B;  2CGO A;  5J2T B;  2EZP A;  2P5O A;  4JAV A;  1WPX A;  2HHH O;  3CC4 V;  2HJF C;  1OZ0 A;  4QJF B;  2GV9 A;  3TXQ A;  1GK9 A;  2IJK A;  1YXB A;  2Y69 C;  4BIZ A;  2FL4 A;  4EFE A;  4FM1 A;  2YDE A;  4J9Z B;  2HLD G;  1N0N A;  4UVA A;  3NR7 A;  1CXZ B;  3L9D A;  3ETE A;  2CAZ C;  4BIU A;  1HP8 A;  2A79 B;  1HNX O;  4KHP B;  2UUA B;  2UUA O;  1FXK A;  2ZE7 A;  1Y4M A;  4DR6 B;  1N34 O;  4DR6 O;  5LP6 A;  1MAB G;  4LCU C;  5LGN A;  1V54 B;  1LUV A;  5C8Y B;  3BA9 A;  1JFF B;  5JWP A;  1YCI A;  2XUM A;  4I50 A;  2QGN A;  1ARO P;  4PJ0 Z;  1FD9 A;  3N27 A;  2EIM B;  1F4N A;  1PM9 A;  3H1I H;  2A06 H;  4JAS A;  2IW5 A;  3CJH A;  3F7V C;  4MS2 A;  2Q5Z A;  1E1Q G;  3JAL B;  3UQ8 A;  3GWO A;  3DC5 A;  1K3E A;  1GN2 A;  4IL6 Z;  4CC6 A;  2CUG A;  4CS4 A;  3K9S A;  3BHP A;  2E75 B;  4DV3 B;  4DV3 O;  1SQQ H;  4IIJ A;  4TV8 A;  1SQV H;  4P30 A;  2IJH A;  5GTH Z;  1RM1 B;  4DXW A;  3CRQ A;  2IBZ H;  4PI0 A;  2JS5 A;  4TT3 G;  4BW9 A;  1RPR A;  2AZ2 A;  4X1K B;  4J10 A;  5EIB C;  4AHC A;  1UFI A;  4X66 B;  4X66 O;  1JA8 A;  5L3E A;  5EBM C;  4WFA V;  1PL4 A;  4O4H B;  3TCU A;  2F1M A;  3BY6 A;  2W6J G;  2YXY A;  1BHB A;  4LF8 B;  4LF8 O;  2QR4 A;  3K08 A;  2BE3 A;  1YZB A;  3JAT A;  1XMQ O;  3O9O A;  3H1K H;  3E83 A;  4OX9 O;  4JI1 O;  2QWN B;  3SYP A;  5ITZ A;  3BAB A;  2Y69 B;  1Q6I A;  5EC1 C;  2QWP B;  1US6 A;  1JR9 A;  1BT8 A;  3GVM A;  4CH5 A;  4PDR A;  2VWK A;  3JSL A;  1THZ A;  1Y76 A;  4UVC A;  3J80 N;  4JI7 O;  4JZG A;  1EFR G;  4WCE V;  2EIK C;  1IDS A;  5B1N A;  4B7K A;  5KMG A;  2CTR A;  4TWK A;  1VQM V;  1NR1 A;  3KZI Z;  4R7C A;  3IC9 A;  5IY5 C;  1VQL V;  4NXM B;  3DXR A;  3AEI A;  4PV1 B;  4DW0 A;  1SET A;  4GX2 A;  1K33 A;  4HZ3 A;  1M4U A;  3UT5 A;  4RUF A;  5IJ9 B;  3BA8 A;  2JDI G;  4FJC C;  3FB5 C;  2QSA A;  1FFX A;  3SJB C;  1PNK A;  2EBO A;  5JQG B;  2P90 A;  3WB0 A;  2BTO A;  2QTS A;  4FFB B;  2PUS A;  1DF5 A;  1HNW B;  1HNW O;  2Q73 A;  4JV5 B;  5LYJ A;  2JRI A;  3CCE V;  4KL1 A;  2A3Q A;  4P9P A;  1PD3 A;  4KUM A;  2P6J A;  3K9A A;  4E4E A;  5H9C A;  1CPY A;  2FTK A;  4BIO A;  4DW1 A;  1G1X B;  2ZT9 B;  2VQF B;  4PA6 A;  1BCC H;  2VQF O;  4ZBM A;  4MVS A;  2LFR A;  2GHY A;  1OJH A;  2DMX A;  4ZOL B;  5LMN B;  5LMN O;  1K73 W;  2ODM A;  4BWA A;  1AR1 B;  3ZBH A;  1WP8 A;  1K97 A;  1R73 A;  1K7D A;  2ZKO A;  3BRC A;  2Q7G A;  4X64 B;  4X64 O;  4DV2 O;  4DV2 B;  2QEX V;  4GKK B;  1URF A;  2FKX A;  2ZM6 O;  3OTF A;  3OMA B;  1H2K A;  3DTU B;  3P3N A;  3MHH C;  5B1B C;  3D3I A;  2NR5 A;  1HWY A;  3ZN0 A;  4UXN A;  3JAM N;  3L75 H;  1ZTE A;  2EIK B;  4JI0 B;  4X20 A;  2CTQ A;  2QM7 A;  3TET A;  2BCC H;  4Z1M G;  3S3W A;  4DR4 B;  5KAF Z;  1WAZ A;  3BPZ A;  3VQX A;  1IX9 A;  4B3T B;  4QNH B;  2HG5 C;  2DYR C;  2CE4 A;  4TUY B;  2E76 B;  5IY5 B;  5IT9 N;  4I55 A;  2P22 C;  2ZIM A;  2OCH A;  3ZMT A;  1Q6H A;  1NH2 D;  4JYA O;  3VOU A;  5J2T A;  2WLL A;  3JAS A;  4LH6 A;  4O4J B;  5KAI Z;  2PYL A;  1QR9 A;  4LF5 B;  3A8T A;  4EKW A;  4LF5 O;  4UB8 Z;  2AHY A;  1OV9 A;  3LSS A;  4Q20 A;  1B04 A;  1NT2 B;  3RFR A;  2PGG A;  4UVB A;  3AG4 C;  1R3J C;  4P2Z A;  3K03 A;  2ETN A;  3EVK A;  1VEW A;  1FAF A;  1BGY H;  2EIJ C;  1AB3 A;  5FPR A;  4UCT A;  1NI8 A;  1SC5 B;  4LNU B;  1GO3 F;  4ZKI A;  4QE9 A;  1SA0 B;  2BOB C;  2ADQ B;  1MOF A;  2LP7 A;  4K3A A;  3RYC B;  1D2D A;  2XHB A;  1N36 O;  1X4T A;  3KKY A;  5C8Y A;  1P84 F;  3P32 A;  1JFF A;  1NKD A;  3OM3 B;  2MK3 A;  3CRC A;  3ETD A;  1TAE A;  3CYO A;  4PEL A;  3D8C A;  1YEW A;  1J5E B;  1J5E O;  2UXC B;  2UXC O;  4ABM A;  5CA1 A;  3KCY A;  2KSD A;  1NJI W; 
#chains in the Genus database with same CATH homology
 1H8E G;  3E89 A;  3IGA C;  1R6K A;  2JJ2 G;  4PDM A;  5IYC O;  3CPW U;  3QNE A;  2HVK C;  3LDD A;  5HFM A;  3W7U A;  1K4D C;  2EIM C;  5CBH A;  1KKD A;  4WFE A;  3OW2 U;  1FXV A;  2JK5 C;  3E8B A;  3WG7 C;  1QLE B;  2DWE C;  5DN6 G;  1ORQ C;  5BZB A;  2UXN A;  1NVP B;  1QBZ A;  3CME V;  4PA3 A;  3K79 A;  3GB7 C;  2EIL C;  3CCV V;  2XAQ A;  5B1B B;  3QO8 A;  3LDE A;  2NLJ C;  1S5H C;  3IC7 A;  2WPD G;  1DTO A;  1E79 G;  1Q82 W;  3B8N A;  1Q7Y W;  5LGT A;  3EHB B;  5CA3 A;  1Q81 W;  4LBE C;  2Y48 A;  3ZRV A;  2X7R B;  5L3G A;  4RQF A;  2HKO A;  1OCR C;  4FPP A;  3AG2 C;  3FYI B;  3MD0 A;  3LUT B;  3OMI B;  5LBQ A;  5HFL A;  4G2K A;  3STL C;  4PA9 A;  3AG3 B;  1IXM A;  3E8F A;  4JYC A;  2DYR B;  1PKX A;  1AI7 A;  1ROP A;  1NVP D;  1YSC A;  1M56 C;  2NNU A;  4GX5 A;  4WF9 V;  1H2G A;  1AI6 A;  3ZRS A;  1DLB A;  2HFE C;  3ZMV A;  4JTD B;  4WFG A;  4QE7 A;  1MG1 A;  2OCC C;  3JD2 A;  4KFM A;  3ASN B;  3UKM A;  2W6I G;  4U7O A;  3ZRX A;  1S72 V;  3ABU A;  3LSQ A;  4X8A A;  4XDK A;  1YIJ V;  1YIT V;  2QE7 G;  1W0J G;  1L1F A;  3OE7 G;  4QPJ A;  3AG4 B;  2EZP A;  4MTO A;  4JAV A;  3BEH A;  1COW G;  1WPX A;  2B1I A;  3OMN B;  2D3O W;  3CC4 V;  3RVY A;  2R9R B;  2HJF C;  2V7Q G;  2ITD C;  2EIJ B;  1OZ0 A;  2XND G;  4XDJ A;  4XBF A;  4QJF B;  1GK9 A;  5B3S C;  1GKF A;  4OXS A;  1I5Y A;  2IJK A;  4L87 A;  3ABM C;  2Y69 C;  4BIZ A;  1F4M A;  1UJW B;  1N8R W;  4J9Z B;  1BMF G;  2HLD G;  5LHH A;  1YTF B;  3CCR V;  2IJJ A;  2WSS G;  1M1K W;  5EK0 A;  4UVA A;  1VQ8 V;  2JIZ G;  3ETE A;  2WLK A;  2WWW A;  3CCQ V;  4BIU A;  1PNL A;  2OTL V;  2X6B A;  4JTC B;  2ATK C;  4WFB V;  3FKS G;  2A79 B;  1RPO A;  2QTO A;  1F23 A;  3JD1 A;  3UM7 A;  1FXK A;  3FB7 C;  1Y4M A;  2F43 G;  2B1G A;  1YI2 V;  3T2M A;  1MAB G;  4LCU C;  5LGN A;  3SPG A;  1V54 B;  2B5U A;  3X2Q B;  1AJQ A;  2Q68 A;  4MVO A;  2ZR3 A;  5IYD O;  1KQS U;  1FXK C;  1GTO A;  1FS0 G;  1R6N A;  1P7B A;  1YTF D;  3ABT A;  1ARO P;  1BHA A;  2WLI B;  4RO2 A;  1AJN A;  4R8C A;  3LDC A;  5C93 A;  2EIM B;  1F4N A;  2WLJ A;  2WLH A;  4JGS A;  3QO5 A;  4JAS A;  2IW5 A;  3F7V C;  3WG7 B;  3CMA V;  4MS2 A;  1R3K C;  4CBC A;  1XL6 A;  1E1Q G;  3GWO A;  1K4C C;  2EIL B;  1K3E A;  4UV9 A;  1JCH A;  3K06 A;  3RBZ A;  1XL4 A;  2WLM A;  2XAS A;  5L3D A;  3CCJ V;  1SER A;  3IFX A;  2EIN C;  1EBO A;  1VQK V;  5B1A C;  4UUJ C;  1SES A;  3A0R A;  5EBL C;  3JD0 A;  3FB8 C;  4UV8 A;  4XDL A;  4X88 A;  4JTA B;  1OCR B;  3AG2 B;  4P30 A;  2IJH A;  5GW7 A;  1RM1 B;  4DXW A;  3W7W A;  1V55 C;  1KC8 W;  3B77 A;  3ABL C;  3CC7 V;  4TT3 G;  5LHG A;  1RPR A;  1ZWI C;  4RAI A;  2YSU B;  3SJQ C;  1M56 B;  1M57 C;  2H94 A;  4GX1 A;  1R3I C;  2LFS A;  2AHZ A;  4G27 B;  5L3E A;  5EBM C;  4WFA V;  5KUM A;  2OCC B;  1PL0 A;  4JYB A;  4BW5 A;  1KEC A;  3NXS A;  3TCU A;  3BY6 A;  2W6J G;  1VQ7 V;  3SPI A;  1BHB A;  2IH1 C;  1TUE B;  3K0G A;  3CP1 A;  4H37 A;  3AG1 C;  1NBM G;  1P4R A;  2XAH A;  1QCE A;  4JF3 A;  1AI5 A;  3K08 A;  4R6Z A;  3SYC A;  3WFV A;  3E83 A;  5L3B A;  2JEU A;  2BOC C;  1JOY A;  1GMG A;  2ZDI A;  2EJR A;  5B3S B;  3SYP A;  1NR7 A;  3ABM B;  1F51 A;  2Y69 B;  5EC1 C;  3VBB A;  1K9M W;  2WLN A;  3ZMS A;  1CP9 A;  2C2A A;  1S76 D;  2OTJ V;  5H6R A;  2ZDI C;  3QO7 A;  3CC2 V;  4PDR A;  2JJ1 G;  1THZ A;  2CK3 G;  4TSF G;  1GM9 A;  4UVC A;  1H38 A;  4MVM A;  3AG3 C;  1Y66 A;  1EFR G;  3T4D A;  4WCE V;  1GM7 A;  2EIK C;  5B1N A;  2DQ3 A;  1JJ2 U;  3G71 V;  5LHI A;  2GSM B;  2X6A A;  5L3C A;  5DM6 V;  4FK5 C;  5B1O A;  4TWK A;  1VQM V;  1NR1 A;  4FIP C;  2A9H A;  1OCO C;  2H8P C;  3ABK C;  2ITC C;  5EBW C;  4R7C A;  3SPH A;  1FXK B;  2HVJ C;  3I56 V;  5IY5 C;  3T1C A;  3W7S A;  2PI4 A;  3F5W C;  1OCZ C;  1LNQ A;  3EFF K;  4X89 A;  3JD4 A;  1VQL V;  3ASO C;  3ZMZ A;  1WLE A;  1VQO V;  3FB6 C;  4J9Y B;  1KD1 W;  4N21 A;  3AEI A;  5E1A C;  1S0V A;  1BL8 A;  1SZT A;  2XAJ A;  3SYO A;  1SET A;  3OEH G;  2HR3 A;  4GX2 A;  2X0L A;  5CN0 A;  1OCC C;  1YHQ V;  2IJI A;  3STZ C;  1K33 A;  1QLN A;  3W7T A;  4MSW C;  4WFH A;  3ZRW A;  4HZ3 A;  4P9O A;  2EIN B;  4RUF A;  1OHH G;  2JDI G;  4FJC C;  3FB5 C;  3OUF A;  3CCS V;  5B1A B;  1J95 A;  4CZZ A;  1S77 D;  4R50 A;  3I55 V;  1PNK A;  2EBO A;  4MT8 A;  3OEE G;  3R65 A;  2R9I A;  2ZQM A;  2WAM A;  2P90 A;  1M9N A;  2ZXW C;  1YJ9 V;  1YJW V;  4LP8 A;  1ENV A;  2IH3 C;  3K04 A;  1DF5 A;  3SYA A;  4PDV A;  4U7N A;  2K1E A;  1V55 B;  3LNM B;  3KG2 A;  5CBG A;  3JD3 A;  3CCE V;  3ABL B;  3H01 A;  4P9P A;  2P67 A;  1PD3 A;  4KUM A;  2XOK G;  4PA4 A;  2P6J A;  3K9A A;  1M57 B;  2DYS C;  3E86 A;  2YEV A;  1G4Y B;  3D36 A;  3HB3 B;  3CD6 V;  3ETG A;  5H9C A;  4DO2 A;  3PJS K;  3CCM V;  1CPY A;  2FTK A;  4MVQ A;  2QM8 A;  1SRY A;  4N23 A;  3OFN G;  1GM8 A;  2Q6A A;  3G4S V;  4PA6 A;  5IDJ A;  4ZBM A;  3JYC A;  4MVS A;  3SPC A;  2LFR A;  2GHY A;  5LGU A;  3AG1 B;  1JX9 A;  1K73 W;  1AR1 B;  5CMU A;  1QVG U;  4G28 B;  3K3W A;  2ZD9 A;  2PI5 A;  3E2E A;  1K97 A;  3HPL C;  1MSW D;  1E1R G;  1R73 A;  3F7Y C;  1KP3 A;  1I5X A;  1K7D A;  4E2L A;  2QEX V;  1QLE C;  1K34 A;  3E8H A;  3W7X A;  2Q69 A;  4RUE A;  3OMA B;  2IU3 A;  3ZIA G;  1VQ6 V;  3DTU B;  2W0F C;  3CCU V;  3B8M A;  1NH2 B;  1H8H G;  3MHH C;  5FL7 G;  1DF4 A;  5B1B C;  3OR7 C;  1VQ4 V;  4MW8 A;  3D3I A;  1K5Q A;  3M99 B;  5EC2 C;  1RM1 C;  1HWY A;  2X6C A;  3ZN0 A;  1KP2 A;  3OR6 C;  4UXN A;  3SPJ A;  1CEZ A;  4MVR A;  1Q86 W;  3G6E V;  2QKS A;  4QPK A;  2EIK B;  4FMT A;  2M7W A;  4GT1 A;  5CBF A;  2QM7 A;  2XAG A;  4H33 A;  1QVF U;  3TET A;  1K5S A;  1VQP V;  4PDL A;  4Z1M G;  4MTF A;  2Q67 A;  5H6Q A;  1FFT B;  3T4Z A;  2V1D A;  1OCO B;  1B6Q A;  1PNM A;  3ABK B;  1EZJ A;  4QNH B;  2HG5 C;  4MTG A;  2DYR C;  5IY5 B;  1YJN V;  4GX0 A;  1OCZ B;  4HAM A;  3OUS A;  3ZMT A;  2XAF A;  3ASO B;  2WLL B;  1NH2 D;  3VOU A;  3SYQ A;  3JCZ A;  1W0K G;  2WLL A;  2QA4 V;  2A0L A;  2DW4 A;  3ZN1 A;  1QR9 A;  3ASN C;  1JQ0 A;  4EKW A;  3E8G A;  2AHY A;  2EZO A;  3P30 A;  3CCL V;  4QIW F;  3LSS A;  1OCC B;  2ZR2 A;  4PA7 A;  4Q20 A;  3K0D A;  4KP4 A;  4UVB A;  3AG4 C;  1R3J C;  4MW3 A;  4P2Z A;  4YXW G;  3TK1 A;  5KUK A;  3ML0 A;  3K03 A;  4LC1 A;  4JAU A;  3DGE A;  3E35 A;  1G8M A;  3ZJZ A;  1JPX A;  4JPR A;  1VQ5 V;  3OGC C;  2EIJ C;  4F4L A;  1JVM A;  2Z3Y A;  2DWD C;  4GCZ A;  1GO3 F;  2ZXW B;  4ZKI A;  1VQ9 V;  2DQ0 A;  2JEX A;  3ZRW B;  4QE9 A;  1AI4 A;  5KA5 A;  1K8A W;  2BOB C;  4I9W A;  3ZCC A;  3ZMU A;  1MOF A;  3OAA G;  3CXC U;  2LP7 A;  1M90 W;  4HYO A;  1VQN V;  1FXH A;  1K92 A;  5KA6 A;  2P7T C;  4MTX A;  2DYS B;  3RW0 A;  1W2B U;  3P32 A;  4RQE A;  1S3J A;  5L3F A;  3MHS C;  4ASU G;  1NKD A;  3OM3 B;  2MK3 A;  3ETD A;  3CYO A;  1AJP A;  3FYE B;  4PEL A;  2WLI A;  4BAY A;  1V54 C;  2UXX A;  4MVU A;  3RVZ A;  3X2Q C;  5IYB O;  2YEV B;  1QR8 A;  5J9P C;  2KB1 A;  2IU0 A;  4MVZ A;  1NQT A;  2OT5 A;  2Z5U A;  1R3L C;  4I5S A;  4WFF A;  1NJI W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...