3CCQV

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 25
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ccqV00
3G6EV 3CXCU 1W2BU 4WFAV 1VQ8V 1YJNV 1K9MW 3CCMV 3CD6V 3CCRV 3CMAV 1KD1W 1R73A 1JJ2U 1NJIW 3I56V 1VQ9V 1YJ9V 1VQ5V 5DM6V 1N8RW 1VQPV 1M1KW 1VQLV 1VQOV 1K73W 1M90W 3CC2V 1VQNV 1YI2V 1Q81W 3CCQV 1YITV 3CC7V 3CCJV 3CCSV 1QVFU 1VQ6V 3G71V 3OW2U 3CMEV 1Q86W 3CCEV 1Q7YW 1YHQV 1VQMV 2QA4V 3CC4V 2OTJV 4WCEV 3CPWU 1K8AW 1S72V 4WF9V 1YJWV 1YIJV 1Q82W 3CCUV 1KC8W 4WFBV 3CCLV 2D3OW 1KQSU 1VQKV 3CCVV 2QEXV 3G4SV 3I55V 2OTLV 1QVGU 1VQ7V 1VQ4V
chains in the Genus database with same CATH superfamily
4NTYA 1F7YA 3CE2A 4LFBO 3E22A 1KD1W 1V54B 1NKDA 1WP8A 3IC9A 5J9PC 4I9WA 1VQPV 3F7VC 3CX5F 1N36O 3ZRWA 1NH2D 4FM2A 3RYCB 1UPGA 2ZXWB 5C8YB 2FTKA 1AR1B 3K3WA 4J7KA 4X1YB 2W0XA 2A0LA 4X20B 2UU9O 4PA7A 2WA3A 2OIGA 5B3SB 4TSFG 1JOYA 3CRQA 4F6RA 2Y69B 4BW5A 1SQQH 4OX9O 3GB7C 4JAVA 1NTMH 1EN5A 3BVOA 2JGUA 3CRCA 2ILMA 3ABTA 4JI5O 2UUBO 2CK3G 1YCIA 3CCRV 4IL6Z 2UU9B 4IHJA 3Q4HA 2EIMB 4X1IB 1QR8A 2WLMA 1VQOV 3OFNG 1BHBA 1GM8A 1YEWA 4FFKA 3JASB 5H6RA 4PA3A 5B1OA 3K03A 2AW9A 2YSUB 1SRYA 2XOKG 5BY1A 1CPYA 1QU7A 1R3IC 3CCVV 1TGOA 4FLXA 4I55B 1G8MA 3STLC 5DN6G 4X1IA 2CGNA 4DR7B 2Y4UA 2OCCB 2YIAA 4X66O 5GW7A 3JASA 4QNHB 3MHSC 3UCSC 3S3XA 4FM1A 2P4KA 3IJ4A 1DK1A 3TJTA 1FD9A 4DV4O 2DW4A 2UUCO 2B5UA 1XMOO 4BW9A 3OTOB 4O2AB 1X59A 4JPRA 1FJGO 5IYDO 4FLYA 4LWSB 4YJ2B 5B1BB 2GUZA 1BCCH 1DLBA 3CCSV 3RYCA 3QVNA 4UUJC 1THZA 5GTHZ 2MK3A 4YIPA 3ZRWB 5FL7G 4WFHA 1I94B 2VRZA 2CAZC 3H1HH 4J10A 4DXWA 3R65A 1OCOC 2CE4A 2GDSA 4IT5A 3SJCC 3J7AU 5LMNB 4J42A 2ATKC 2CUGA 4UXNA 3RGBA 3E8BA 1DF4A 1VF7A 3AK1A 3HB3B 4WFEA 5A9GA 1XHZA 4D7TA 4JI1O 1MZFA 2QM4A 1I5YA 1WP7A 2GSMB 3W7SA 2PGGA 2OWOA 3WB1A 2ZT9B 2BTQA 4I5SA 2PTMA 2UXXA 2YUAA 4MVZA 3C3SA 4LF7O 1KC8W 1U96A 1J95A 2QEXV 2HG5C 2VWKA 4PI2A 2CTRA 1BL8A 2R9RB 1R3LC 1KUQA 1JPXA 4DRXA 3ABUA 3CCQV 4U3JB 3ABMC 2H8PC 2P67A 2M6YA 2IJIA 3MDSA 1DF5A 1Y74A 4H37A 2OT5A 1RFYA 4FLZA 2EILC 2XAHA 3E8FA 3VQWA 3JD0A 4LNUA 3WU2Z 3SJBC 3ZBHA 2K9PA 2LGQA 4X64B 3A2FA 1GKFA 1I7FA 1QLNA 3AG3C 4I0XB 2HEPA 1ORQC 2P06A 4X65O 1SKVA 4ZI7B 5CBGA 4TT3G 5LXTA 3CC4V 1L1FA 4MVOA 1TVKB 1XILA 4FPPA 3CCUV 5KHIA 2P7TC 5KX5A 2UUBB 3ML0A 4ABMA 1FAFA 3HPLC 5E79Z 3D36A 3MAQA 3ICXA 1OJHA 1ZWIC 3JATB 1FFXB 2XAQA 4W4KA 1KU9A 2BTOA 3I5DA 4X1KB 4YJ3A 2ZNJA 3FYEB 1EZVH 1SA0A 2DYSC 2WWWA 3FFQA 3JYCA 4DR1B 4DR7O 3N2GB 4K8ZA 2Q4PA 1M56B 3E8GA 3RVZA 3D3IA 3K06A 1BSMA 2YXLA 3QG5A 1YJ9V 2RCVA 1WA8B 1PD3A 2JEXA 4DW1A 1S5HC 4BWAA 1YTFD 4J7ZA 4J41A 2EIKB 2Q7GA 2JGDA 2FB5A 3QF7A 4ZBMA 3GVMA 5EIBC 2YS8A 1JMKC 4JTDB 2QTOA 1Q82W 4TV8B 5J2TB 1WPBA 3MHHC 1JJ2U 1BS3A 5LGUA 2DWDC 2HJFC 3K5LA 2ARHA 1B06A 4O2AA 3LDDA 2QTSA 3X2QC 4E4EA 3H01A 4JYBA 3JD2A 2RQ6A 5JWPA 4RQEA 2QJ1A 2IJJA 3ZHRA 1R1BA 1AP6A 4YJ3B 4I50A 3OTFA 5LOVA 3K5MA 3CB2A 4GKKB 3OGIB 1HNXB 5LMNO 3GWOA 3EFFK 4QPKA 5CA1A 2O57A 1GAXA 2WLNA 5KUMA 1M56C 4JF3A 1QQCA 3LSSA 4DV1B 2ZIOA 1Q43A 2BOCC 5CA0B 2CTQA 2WLLB 1QLEC 4H0LB 5FNVB 3QO5A 1UJWB 3CYOA 5KUKA 4PJ0Z 5IY5B 3ABLB 2LJ2A 3DSQA 1GM9A 3K57A 4KUMA 5ITZA 3RYIB 2IH1C 3E83A 3BPZA 4I4TB 4DV1O 1VF5B 3LUTB 1P4RA 4XDLA 4P30A 2B1IA 2ZE6A 4D7SA 2ZNIA 1WJZA 4MW8A 1KKCA 2R72A 5IYZA 1WB7A 3JAWA 4X1YA 1IDSA 4FFBB 4CH5A 4B08A 1NR1A 5BR8O 3K08A 2AZ0A 1SQVH 2R70A 2EZPA 2HR3A 4Z2WA 2GV9A 2L6LA 1PNLA 1GM7A 5KLVH 2MW2B 1SESA 3KCXA 1HWYA 2X0LA 4LFCB 1HW7A 2A7WA 3T1HB 4X64O 4HNAA 2Q5ZA 3SYOA 4JYCA 3SYQA 5EK0A 2FMLA 3ASNB 4CS2A 4TQDA 1SS3A 1U97A 3T1CA 1IX9A 4CC5A 3AG2C 2WLIA 4UV9A 3K5NA 1KQSU 5LXTB 2QWNB 2ZKOA 3ZMZA 3T1HO 4H33A 1KP3A 4UVAA 1R73A 4QGPA 4FLTA 3O65A 1NS1A 2EJ7A 3W7UA 2XUMA 3D8CA 4AQYB 3M7MX 4UFZA 1ENVA 5IDJA 4JI8B 3HKEB 4JI4O 5LGNA 3CPWU 1RPRA 3OMIB 1H2SB 3RFRA 3RYHB 1Y74B 3ZRSA 3G4SV 4DV0O 4LF5B 4L8JA 5JH7A 1DTOA 4K8XA 3BEHA 5CA0A 4FZ1A 3KZIZ 4TOIA 2Q67A 2ZINA 5LYJB 4MVUA 4FVMA 5EBMC 5IYBO 4JGSA 1GN2A 5KHHA 5BMVB 2HVKC 1MZEA 4O4IA 1L8DA 2QA4V 3DGEA 3ZX6A 1YJWV 5L3FA 1VIBA 3CCLV 1E1QG 4DV0B 4MTGA 5CBFA 1G4YB 3IFXA 3FB5C 4WBNA 1V55B 1PNMA 5LMUB 2F43G 1NH2B 1PL0A 1XOUA 1NU1H 1K33A 4CH3A 4LF6B 4TWKA 4EKWA 4LR3A 1IXBA 2FL4A 5KMGA 1K5QA 3TETA 2LW1A 1OCCB 3CRAA 2PI4A 1SF9A 3ZIAG 3ZMSA 1VMGA 3E35A 5LMUO 1OCRB 1HNXO 4K0KB 3Q4HB 4UB6Z 1I08A 1AJQA 4LWSA 4RUEA 2DQ0A 1A32A 3N2KB 3HKDB 5GONA 2XAGA 2UXBB 1L0NH 1VQ8V 4W4LA 2NN4A 2ODMA 1N4CA 5CB4A 4DV3B 1BT8A 3W7XA 5GONB 5EC2C 2OYQA 2P4VA 4X1KA 1AJNA 1VQ6V 2ETNA 3JATA 2N04A 3OT7A 1EBOA 3BY6A 3AG3B 3OUFA 3X2QB 2PYLA 2A79B 4WFFA 2UXDB 3LSUA 3QO7A 4X62O 2EIMC 2ZDIC 4MTOA 4ASUG 1HR0B 4KP4A 3WB2A 2XHBA 1Y4MA 1SC5B 3JAKA 4LC1A 3CJHB 1FXKC 1K4DC 4NVPA 4JZGA 4FLVA 2UXDO 4LH6A 4X8AA 5LOVB 4LNUB 3K5OA 3AG4C 2QWOB 2XAFA 5JQGB 2Q68A 4MTFA 1YSCA 3NR7A 2E5LO 1OCCC 1TUBA 4HYOA 1FPOA 1GRJA 4IHJB 5L3DA 1JCHA 1JA8A 1Q3EA 5DECA 4DR4B 2DOSA 3OW2U 4B3SO 4B3RO 2CGOA 5BMVA 5ITZB 3AK3A 5EZYB 5LA6A 5JVDA 4G2KA 1W0JG 2X6BA 4AHCA 5JH7B 1H8HG 1HP8A 1M4UA 2QR4A 3CMAV 4O4HB 1MMMA 2E5LB 5JQGA 3CP1A 2Z5UA 3RVYA 4DV7O 2IH3C 4NXMO 4JI0O 3UM7A 4U3FH 3U10A 4AILC 1F4MA 3W7WA 3BA8A 2JS3A 4RO2A 5FNVA 2EZOA 1YF2A 1SZTA 3JD1A 4EFBA 1RPOA 1XREA 3A0RA 5LP6B 4KXRA 4I50B 3K58A 3CWBH 1OCOB 4DV7B 1I0HA 3L73H 1DGSA 4NYKA 3BCCH 3SPJA 1VQMV 1LUWA 4UVBA 5IE9A 1K8AW 4JYAO 4JI2O 1N33O 3HKCA 4JAUA 4PI0A 5EYPA 4CS3A 1VQ4V 1B6QA 4HBNA 4QE7A 3RYFB 3CRRA 1Y67A 4B3TO 3B2EE 1CEZA 4LF6O 2ITDC 4PHZA 3G71V 1K3EA 2X7RB 1FKAO 4X9QA 3T4DA 3UT5B 4GKJO 2F1MA 1MG1A 4GLXA 3FB7C 5EZYA 3JAWB 3J80N 1ZX3A 4JAAA 1IBMO 3F5WC 5CMUA 3UQ8A 2PF4E 3ZRXA 1JR9A 3K59A 3VQYA 2W0FC 4K0KO 4I9QA 1AILA 3DXRA 2GTAA 5IY5C 4TUYA 4LF4O 4BIOA 4EB6A 1NR7A 1AJPA 3RYIA 3APQA 1Q5OA 2JVDA 1P49A 3A0HZ 1BHAA 1R6TA 4B3MB 2HJDA 2UXBO 3OMNB 1NVPD 2CDYA 1TUBB 2WLJA 1E79G 1WPXA 1AI7A 4DV3O 2E76B 1KKDA 3U11A 4MW3A 1S5JA 1K34A 3SPCA 4YY3O 4UCOA 1TUEB 3P3NA 3UO2A 1FFXA 2RN9A 4LFAO 1IXMA 3AG4B 3DC5A 1XL4A 5IWAB 1H2MA 5KX5B 4LF8O 2QM8A 2D2CB 2OTLV 4X62B 1COWG 1XEQA 1ZAUA 3L75H 3RBZA 4CBCA 1N8RW 4DR3B 1BZKA 4XDKA 1O9HA 4EB6B 4TV9A 1V55C 1Z2GA 2AHYA 1QNMA 1YHQV 2QKCA 5LA6B 3H1KH 4BR6A 3CS5A 2ZE7A 3ASNC 1GK9A 5GTIZ 1HNWB 2YIDA 5LL6Y 3JAMN 3BA9A 2FYUH 3L72H 1N34O 4LF8B 1KB9F 3TXSA 5CB4B 2QKSA 1MSDA 1NJIW 3NXSA 4J7JA 4DR4O 3ABKC 3CMEV 4IYIA 3STZC 1JFFB 4OX9B 4H13B 1HNZO 3JAKB 1Q6HA 1BQ0A 3C3TA 1VEWA 2Q7EA 5C93A 4YHHB 3T1YO 4ZIBA 2C2AA 3UKMA 3ZHUA 3J81N 4O4LA 4NXMB 3RT3C 1MSWD 3HKBA 1R6KA 1E1RG 2GTSA 1YDXA 1WNSA 4WCEV 4I7ZB 2M7WA 4J9YB 2A9HA 4GCZA 1QCEA 1GTOA 2ZM6B 3T1YB 3K0DA 4HZ3A 3WG7B 3TGUH 5K1XA 1Y76A 1SQXH 2OCHA 2QWQB 2KG7A 3VQXA 1FXKB 1UFIA 3N2KA 1H38A 2PI5A 2VQEB 1NZ6A 5JVDB 2F23A 3AG1B 3ETEA 2ZM6O 1XMOB 3MD0A 1FJGB 3F5TA 1RSOB 3CEIA 4R6ZA 1IVSA 4LBEC 4BIUA 2IBZH 3FAVA 1NT2B 1QR9A 1ZL8A 2DJVA 5EBLC 1ROPA 5KMGB 2RMKB 3JALA 2CH7A 1I94O 2JJ2G 4JI6B 4DV6O 1ZUQA 4GX1A 3B8NA 1SERA 2A06H 2YXHA 4DK1A 4X66B 2A3QA 4LF4B 4XBFA 3CC2V 2LO1A 4PDVA 4UCSA 2IJKA 4DV4B 4JTAB 5BZBA 2QWPB 1TAEA 1VQKV 2N05A 4WF9V 3KG2A 3PN1A 1P7BA 5L3CA 2AHZA 4LFBB 5DEDA 4FLUA 2ZD9A 2YI8A 2YXYA 1Q8IA 4YY3B 1Q81W 4GT1A 3CC7V 4LF9O 5IJ9A 4YXWG 4LFAB 1K4CC 5HFMA 1XNQB 3QNEA 4GX5A 3LDCA 5IJ9B 2D3OW 3H1JH 4MTXA 4ZHQA 4P9PA 3ABLC 1T5EA 3TK1A 5HFLA 5E1AC 3L9DA 2Y48A 3RWRD 3SJAC 1QHTA 1SQPH 2Y0PA 3ZCCA 5CBHA 4MSWC 2NLJC 4NXNB 1M57C 2YEVB 4JZ2A 4E2LA 3BABA 1MOFA 1SQGA 5H5NA 4RUFA 1KMIZ 2F66C 2XNDG 1F23A 1S72V 3OM3B 2UXCB 1Q6IA 3CXHF 3VQVA 4MS2A 3HKDA 2ZR2A 2LGWA 3E22B 3ZHSA 3F7YC 4MVRA 3CCMV 2EINB 4NXNO 2EILB 3RYFA 2QM7A 1YITV 4X65B 5JJNB 3DTUB 1PM9A 2OTJV 1XI1A 1AP5A 5LP6A 2IU3A 2QDOA 3B4SA 5EBWC 4YHHO 1Q6UA 3ETGA 3VOUA 3W7TA 1SQBH 1NI8A 1WB8A 3I56V 4PV1B 4G28B 5LGTA 4WBNB 4UCVA 2LQTA 4JI7B 5EIBD 1QVFU 1NTZH 5A2QN 1VF6C 5L3BA 1K5SA 2LFSA 4DYLA 4PA6A 3KCYA 3SPIA 1P7GA 4U3JA 3OGCC 4JI5B 2UUCB 3DC6A 2E74B 3HR0A 4DR6O 4PA4A 1S0VA 1GH6A 4MVMA 4DK0A 4EFEA 5KHGA 3ZN1A 4BIZA 2DQ3A 1M90W 5IYCO 1JQ0A 4O4HA 2DYRC 4JI7O 2WPDG 3H1IH 3D36C 1S77D 4NB5A 2CTWA 1V54C 4ICGA 1RM1B 1NVPB 2E3CA 3RYHA 3JSLA 3K9AA 1FYJA 5FLXN 4DR6B 3G6BA 3P3PA 3ABMB 5KAIZ 4ZHQB 3T2MA 3CHXA 2WLKA 5JCOA 4IIJA 1KYOF 1Q86W 3S3WA 2ZXWC 3SGIA 2Q0AA 1IURA 3GWKC 2XAJA 1B04A 3A8TA 4JI1B 4DR1O 3LSQA 3CJHA 4CZZA 3OTOO 4EEQA 3AG7A 1G6UA 2GHYA 1XMQB 1AR5A 3FX7A 2ADQB 3TCUA 3EHBB 3THOA 4G27B 4CS4A 1NQTA 1JFFA 4AI8A 1TVKA 2QGNA 1ZL8B 4PA9A 3CSXA 4PDLA 4OGQB 5B1NA 1I5XA 4CC6A 4D6TH 4RQFA 1LUVA 1XBLA 2AXTZ 1RP3B 1OV9A 3BAAA 4LF9B 2DE0X 1FFTB 4Z1VA 1H2KA 5F2VO 2QKAA 2Z0AA 1BQZA 2DYRB 3ABKB 1Z5VA 2F93B 4MT8A 4F4LA 2Q8VA 5JJEB 2DN9A 3C90A 2KQXA 3B77A 1EN6A 1Q7YW 1M57B 2B1GA 2WLLA 2W6JG 1N0NA 2P5OA 2NNUA 2AGAA 3JD3A 3SPGA 4DV2O 4JV5O 1G1XB 4ZI7A 3ASOC 3TXQA 1GMGA 3UO3A 5B1BC 5BXZA 2B9ZA 2LP7A 1H2GA 3JSNA 1M1KW 1AI6A 3OR6C 2JEUA 3JD4A 3RW0A 1B3QA 3OR7C 1S3JA 1TA8A 4CH4A 2XASA 3SYAA 4O2BB 4DV2B 4JV5B 4WFBV 2PUSA 3M99B 1D2DA 1IBLO 2XT9A 1IZ3A 1BMFG 4DO2A 2ZIMA 1LNQA 5BR8B 3A0BZ 1YI2V 5K1PA 5J2TA 4MVSA 3T4ZA 3E8HA 4JI4B 1M5IA 4O2BA 4LFCO 3HKBB 2L35A 1VARA 1IBLB 5TISZ 3G6EV 1R3JC 3BHPA 4PELA 1K9MW 1EFRG 1WA8A 5DM6V 5J2UB 1WN7A 1VQLV 1VQNV 1ZLZA 1JVMA 2H94A 4KHPO 3APOA 2BCCH 2WA4A 4YIOA 4BAYA 3G67A 1K7DA 4JYYA 2WLIB 1YZBA 2ZQMA 3AK2A 2BE3A 2YC0A 1AROP 2Q73A 1K97A 2HFEC 1YTFB 3FB6C 3QTCA 1K73W 1F51A 4KHPB 3JALB 3EXAA 3JCUZ 4TQFA 1EZJA 5LHGA 1W59A 2Y69C 1Q90D 4ZKIA 1OCZC 5LBQA 3U0ZA 3AEIA 4PD4F 5B66Z 4PDRA 3ZEDA 1M9NA 4F6RB 4YJ2A 1XMQO 4KL1A 2VWJA 4DRXB 3R66A 3ZMTA 5KA6A 2Y4TA 2OCCC 1YVWA 1KECA 2P6JA 2HLDG 1KBHA 4QPJA 5C8YA 4IGGA 3FB8C 3LNMB 2UXNA 4U7NA 3QO8A 3ETQA 4I4TA 5KHJA 1VQ7V 4GKKO 4X20A 1CXZB 5L3EA 1Z5WA 4IIJB 5H2FZ 3OEHG 1XL6A 2YI9A 3PJSK 1QBZA 1WLEA 1YXBA 1NBMG 2YICA 1PPJH 3LDEA 2PZSA 2JDIG 4H44B 2CTPA 3SR2C 1VQ9V 4FJCC 2ITCC 2ZE8A 3SJQC 2DMXA 2N74A 5J2UA 4J11A 4K3AA 1PV0A 3ZHTA 5AG2A 3UT5A 2RJZA 5D5PA 2E75B 4L87A 4P9OA 3ZMUA 1IBKB 2XTAA 4OPHA 4FZ0A 1GN6A 2GBOA 2GUZB 3ZN0A 4Z1MG 4DR5B 2JK5C 1XQ8A 1NTKH 2PY5A 1L0LH 2ZDIA 2IW5A 2VQFO 4B3SB 2K1EA 4JI8O 5KAFZ 2YIBD 1N32B 3OAAG 3KKYA 2Q9LA 1VF6A 1D5NA 5IT9N 1RM1C 4UV8A 4DR5O 2V4DA 5FPRA 1FXVA 1QLEB 3B40A 2JIZG 4NKGB 2IU0A 2VQFB 4TV9B 5B5EZ 3WB0A 3OMAB 1XUQA 4HAMA 1CP9A 4B7KA 5LHIA 3K9SA 5B3SC 4WFAV 2ZCEA 3JARB 2DYSB 3WFVA 4Q20A 3K04A 4AQYO 3B09A 3ZJZA 4DV5O 1O9GA 4I55A 5JCOC 2CH7B 2LFRA 1XHXA 4JYAB 1YIJV 3L74H 4UVCA 3O9OA 2EIJC 4LF5O 1XNRB 1OZ0A 1R6NA 2DWEC 3K0GA 4TUYB 3WG7C 1M93A 2JGDB 1HDJA 2IJHA 3SYCA 3CCJV 5B1AB 2HVJC 1PL4A 4UCUA 3OUSA 4DV5B 4O4JB 4XDJA 1SQFA 1Y66A 3N2GA 3OE7G 3BRCA 1XNRO 1QVGU 2IM9A 1W2BU 5CN0A 4OXSA 2Q69A 2P22C 4FMTA 1J5EO 2X6AA 2F95B 3ZHQA 1WAZA 4K35A 4FLWA 1Y76B 4X89A 4OPAA 5KA5A 1JX9A 3IGAC 1N0JA 2V1DA 2FKXA 4JI3O 1BGYH 4PDMA 4GX0A 1PNKA 3HKCB 1MABG 2F4VB 3AG2B 4B3MO 1GN4A 3LNNA 3CXCU 3SPHA 4R50A 2EULA 1LR1A 1FXHA 4WFGA 1H2NA 5IYZB 2WLHA 4GUNA 2EIJB 2ZR3A 5H6QA 5IJ0A 2H3OA 4CH6A 1H2LA 1FS0G 2EX3A 4GX2A 1MNGA 1URFA 2OIEA 4R8CA 5JJJB 4NR1A 2JRIA 2Q6AA 1FXKA 1EN4A 1OHHG 3OD4A 1RSOA 1AB3A 1PKXA 1Y6XA 4P2ZA 4O4IB 1ZTEA 3SDLA 2QE7G 3D3QA 3FD9A 1F4NA 4Q6GA 4RAIA 4QJFB 1IBKO 4A5UB 3P30A 4B7EA 1HR0O 3JARA 3N27A 2BTQB 2Q7HA 2G38A 1N36B 5IJ0B 1D5AA 2KB1A 3L71H 1N32O 1GO3F 3H1LH 4NTWA 1HNZB 4ZOLB 2YDEA 2EIKC 3P32A 2RNBA 2R9AA 2VS0A 4DUYB 2JJ1G 2RDCA 4JTCB 3FKSG 1OCRC 2W6IG 5LYJA 1SZXA 4N21A 4DR3O 3JCZA 2EJRA 2YIBA 3ASOB 4C7UA 3K79A 4B3RB 3L70H 5LHHA 3BFRA 4DW0A 2QSAA 2AZ2A 3FYIB 2ZE5A 1AVMA 1HNWO 3SYPA 1AI5A 1N34B 4DUYO 4HNAB 2HKOA 1ZSPA 4TV8A 4FFBA 3EVKA 2X6CA 4J80A 3ETDA 2YEVA 2BOBC 2QWRB 3E86A 4B3TB 1PP9H 4UB8Z 4JI0B 5D5QA 4O4JA 1W0KG 5KHKA 3G80A 4J9ZB 1KP2A 1S5LZ 4UCRA 2VQEO 4FIPC 3ZRVA 1VP7A 1SA0B 5LP6C 1VQ5V 4JASA 1AI4A 2HHHO 2Y0IA 4IYHA 4LP8A 4GZRB 4JI2B 1N33B 2Q0OC 4LCUC 5CA3A 4ZOLA 2V7QG 3E2EA 4MVQA 2Z3YA 2KSDA 3CRMA 3I55V 4I0XA 3IAYA 4JI6O 2WAMA 1J5EB 3OEEG 1XDCA 5FPOA 4DUZB 4FK5C 1AR4A 3M8AA 4LH7A 1P84F 3FAVB 3ZS8C 3AG1C 4R7CA 4UCTA 1US6A 2JS5A 2HHHB 3ZHVA 1V9PA 1MA1A 3DXRB 2BSKB 3CCEV 4GKJB 3VBBA 4JI3B 2ADPA 1X4TA 2UUAO 2F4VO 2NR5A 2EBOA 2KKWA 1IBMB 4DUZO 3CD6V 1GN3A 4GYCB 4QE9A 1H8EG 3H9VA 4RWUA 1R3KC 3IC7A 4FM0A 2EINC 5EC1C 2R9IA 3HKEA 4KFMA 2KG7B 1BE3H 4X88A 4F6EA 1XNQO 4DR2B 1S76D 2UUAB 2HP8A 3B8MA 5EYPB 4DV6B 1OCZB 1YJNV 5H9CA 2P90A 2BSKA 2LW7A 4NTXA 4QIWF 4O4LB 1JJOA 5L3GA 2WSSG 5CA1B 1EM1A 4DR2O 3RN4A 1SETA 4N23A 5B1AC 5IWAO 4LF7B 1K92A 3E89A 2UXCO 2PYJA 3ZMVA 4U7OA
chains in the Genus database with same CATH topology
3ZMZA 4H33A 1KD1W 1KP3A 4UVAA 1R73A 1V54B 1NKDA 5L3EA 4R6ZA 5J9PC 3W7UA 4I9WA 1VQPV 3F7VC 4LBEC 3OEHG 4BIUA 1XL6A 3ZRWA 1ENVA 1QR9A 3PJSK 1QBZA 1WLEA 5EBLC 5IDJA 1NBMG 1ROPA 1NH2D 5LGNA 3CPWU 1RPRA 3OMIB 2ZXWB 2FTKA 2JJ2G 3ZRSA 3LDEA 3G4SV 2JDIG 1AR1B 3K3WA 1DTOA 4GX1A 3BEHA 3B8NA 1SERA 2A0LA 4PA7A 1VQ9V 4FJCC 2Q67A 5B3SB 4MVUA 4TSFG 4XBFA 2ITCC 5EBMC 5IYBO 4JGSA 3CC2V 1JOYA 2Y69B 4BW5A 4PDVA 2HVKC 3SJQC 3GB7C 2IJKA 4JAVA 2QA4V 3DGEA 4JTAB 1YJWV 5L3FA 5BZBA 3CCLV 4L87A 1VQKV 1E1QG 3ABTA 4P9OA 3ZMUA 4WF9V 4MTGA 2CK3G 3KG2A 1G4YB 1P7BA 5CBFA 5L3CA 3IFXA 2AHZA 3CCRV 3ZN0A 3FB5C 4Z1MG 1V55B 1PNMA 2F43G 2ZD9A 2EIMB 1NH2B 1PL0A 2JK5C 1QR8A 2WLMA 1VQOV 1K33A 3OFNG 1Q81W 4GT1A 1BHBA 3CC7V 4TWKA 1GM8A 4EKWA 2ZDIA 2IW5A 4YXWG 2K1EA 1K4CC 5HFMA 5H6RA 4PA3A 5B1OA 1K5QA 3K03A 3QNEA 3TETA 4GX5A 3LDCA 3OAAG 2YSUB 1SRYA 2XOKG 1CPYA 2D3OW 1OCCB 1R3IC 4MTXA 3CCVV 4P9PA 2PI4A 3ABLC 1G8MA 3STLC 5DN6G 3TK1A 5HFLA 3ZIAG 3ZMSA 5E1AC 2OCCB 3E35A 2Y48A 1RM1C 4UV8A 5GW7A 1OCRB 4QNHB 3ZCCA 5CBHA 4MSWC 3MHSC 2NLJC 1FXVA 1QLEB 1M57C 2JIZG 2YEVB 2IU0A 4E2LA 1MOFA 1AJQA 4RUEA 2DQ0A 4RUFA 2XNDG 1F23A 3OMAB 1S72V 3OM3B 2DW4A 4HAMA 1CP9A 2XAGA 4MS2A 2B5UA 2ZR2A 5LHIA 3F7YC 5B3SC 4MVRA 4WFAV 1VQ8V 3CCMV 4JPRA 2DYSB 3WFVA 5IYDO 2EINB 4Q20A 5B1BB 3K04A 3W7XA 5EC2C 2EILB 2QM7A 1YITV 1AJNA 1DLBA 3ZJZA 3CCSV 1VQ6V 3DTUB 2OTJV 1EBOA 3BY6A 4UUJC 3AG3B 1THZA 2LFRA 3OUFA 1YIJV 2MK3A 3X2QB 3ZRWB 5FL7G 2IU3A 4WFHA 4UVCA 2EIJC 2A79B 5EBWC 4DXWA 4WFFA 3R65A 1OCOC 3ETGA 3QO7A 3VOUA 3W7TA 1OZ0A 2EIMC 2ZDIC 1R6NA 2DWEC 4MTOA 4ASUG 3K0GA 3I56V 4KP4A 3WG7C 4G28B 5LGTA 2IJHA 1Y4MA 2ATKC 3SYCA 3CCJV 5B1AB 2HVJC 1QVFU 5L3BA 3OUSA 4UXNA 1K5SA 2LFSA 3E8BA 4LC1A 1DF4A 4PA6A 4XDJA 3HB3B 1FXKC 4WFEA 3SPIA 1K4DC 1Y66A 3OGCC 3OE7G 1I5YA 1QVGU 2GSMB 3W7SA 4X8AA 1W2BU 5CN0A 4OXSA 2Q69A 4PA4A 3AG4C 4FMTA 2XAFA 4MVMA 1S0VA 2X6AA 2Q68A 4MTFA 1YSCA 1OCCC 3ZN1A 4HYOA 4BIZA 2DQ3A 1M90W 5L3DA 1JCHA 5IYCO 1JQ0A 4I5SA 2DYRC 4X89A 2WPDG 2UXXA 3OW2U 5KA5A 1S77D 1V54C 1JX9A 3IGAC 2V1DA 1RM1B 4MVZA 4G2KA 4GX0A 1PNKA 1W0JG 4PDMA 1NVPB 1KC8W 2X6BA 1J95A 1MABG 2QEXV 3AG2B 3K9AA 2HG5C 3CXCU 1H8HG 3SPHA 4R50A 3ABMB 3CMAV 1FXHA 4WFGA 3T2MA 1BL8A 3CP1A 2R9RB 2WLHA 2WLKA 1R3LC 2Z5UA 1JPXA 3RVYA 3ABUA 2IH3C 2EIJB 3CCQV 3UM7A 2ZR3A 3ABMC 1Q86W 2H8PC 2P67A 2ZXWC 5H6QA 2IJIA 1F4MA 1DF5A 4H37A 3W7WA 2OT5A 2XAJA 4RO2A 1FS0G 2EILC 4GX2A 2XAHA 3E8FA 2EZOA 3LSQA 4CZZA 1SZTA 3JD1A 4R8CA 1RPOA 3A0RA 3JD0A 2GHYA 1GKFA 1OCOB 2Q6AA 1FXKA 1OHHG 3TCUA 3AG3C 1QLNA 3EHBB 4G27B 1PKXA 1NQTA 4P2ZA 1ORQC 5CBGA 4TT3G 3SPJA 1VQMV 4UVBA 3CC4V 2QE7G 1K8AW 4PA9A 1L1FA 4MVOA 4FPPA 3CCUV 4JAUA 4PDLA 1F4NA 5B1NA 1I5XA 2P7TC 4RAIA 4QJFB 3ML0A 1VQ4V 3HPLC 1B6QA 4RQFA 3D36A 3P30A 4QE7A 1ZWIC 2XAQA 1CEZA 2ITDC 3G71V 1FFTB 1K3EA 2X7RB 3T4DA 2KB1A 1GO3F 1MG1A 3FYEB 2EIKC 3P32A 2DYRB 2DYSC 2WWWA 2JJ1G 3ABKB 3FB7C 4JTCB 3JYCA 3FKSG 1OCRC 2W6IG 3F5WC 5CMUA 1M56B 3E8GA 3RVZA 3D3IA 3K06A 3ZRXA 2W0FC 1YJ9V 4MT8A 4N21A 4F4LA 2EJRA 3JCZA 3ASOB 1PD3A 2JEXA 5IY5C 1S5HC 1YTFD 2EIKB 3B77A 1NR7A 3K79A 4ZBMA 1AJPA 5LHHA 1Q7YW 1M57B 3FYIB 2B1GA 2WLLA 4JTDB 2W6JG 2QTOA 1Q82W 2NNUA 3SPGA 3JD3A 1BHAA 3SYPA 1AI5A 3MHHC 3ASOC 3OMNB 1NVPD 1JJ2U 1GMGA 2HKOA 2WLJA 5LGUA 2DWDC 2X6CA 5B1BC 2HJFC 1E79G 2LP7A 1WPXA 1AI7A 1KKDA 1H2GA 1M1KW 3ETDA 1AI6A 2JEUA 2YEVA 3LDDA 3OR6C 2BOBC 3E86A 4MW3A 3JD4A 1K34A 3X2QC 3H01A 3RW0A 1VQ7V 3SPCA 1TUEB 3OR7C 1S3JA 4JYBA 1W0KG 3JD2A 4RQEA 1IXMA 4J9ZB 3AG4B 2XASA 3SYAA 2IJJA 1XL4A 1KP2A 4WFBV 3M99B 2QM8A 2OTLV 4FIPC 1COWG 3ZRVA 1BMFG 3RBZA 1VQ5V 4CBCA 4JASA 4DO2A 1N8RW 1LNQA 4XDKA 1AI4A 3GWOA 1V55C 3EFFK 4QPKA 1YI2V 2WLNA 4MVSA 4LP8A 3T4ZA 2AHYA 3E8HA 5KUMA 1YHQV 1M56C 4JF3A 4LCUC 3LSSA 5CA3A 2V7QG 3ASNC 3E2EA 4MVQA 1GK9A 2Z3YA 2BOCC 3I55V 2WLLB 1QLEC 1UJWB 3QO5A 1R3JC 3G6EV 4PELA 2QKSA 3CYOA 2WAMA 5KUKA 1EFRG 1K9MW 3OEEG 5IY5B 1NJIW 4FK5C 3ABLB 3NXSA 5DM6V 3AG1C 4R7CA 1VQLV 1VQNV 1GM9A 4KUMA 3ABKC 1JVMA 2H94A 3CMEV 2IH1C 3E83A 3CCEV 3STZC 3VBBA 4BAYA 3LUTB 4XDLA 1P4RA 4P30A 1K7DA 2WLIB 2B1IA 2ZQMA 2EBOA 4U7OA 1AROP 4MW8A 5C93A 1K97A 3CD6V 2C2AA 2HFEC 3UKMA 4QE9A 1YTFB 1H8EG 3FB6C 1R3KC 1K73W 1NR1A 1F51A 1MSWD 3K08A 3IC7A 1R6KA 2EZPA 2HR3A 2EINC 1EZJA 5EC1C 1E1RG 1PNLA 5LHGA 2R9IA 4WCEV 2Y69C 1GM7A 4KFMA 4X88A 2M7WA 1SESA 1S76D 4ZKIA 1HWYA 1OCZC 2X0LA 3B8MA 4J9YB 5LBQA 2A9HA 4GCZA 1QCEA 1GTOA 3AEIA 3K0DA 4HZ3A 4PDRA 1OCZB 3WG7B 1YJNV 1M9NA 5H9CA 3SYOA 4JYCA 2P90A 3ZMTA 4QIWF 5KA6A 3SYQA 5L3GA 2OCCC 1FXKB 5EK0A 3ASNB 2WSSG 1KECA 3T1CA 2P6JA 1SETA 2HLDG 3AG2C 4N23A 4QPJA 5B1AC 2WLIA 4UV9A 3FB8C 1H38A 1K92A 3LNMB 3E89A 2PI5A 1KQSU 2UXNA 4U7NA 3AG1B 3ETEA 3QO8A 3ZMVA 3MD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E V;  3CXC U;  1W2B U;  4WFA V;  1VQ8 V;  1YJN V;  1K9M W;  3CCM V;  3CD6 V;  3CCR V;  3CMA V;  1KD1 W;  1R73 A;  1JJ2 U;  1NJI W;  3I56 V;  1VQ9 V;  1YJ9 V;  1VQ5 V;  5DM6 V;  1N8R W;  1VQP V;  1M1K W;  1VQL V;  1VQO V;  1K73 W;  1M90 W;  3CC2 V;  1VQN V;  1YI2 V;  1Q81 W;  3CCQ V;  1YIT V;  3CC7 V;  3CCJ V;  3CCS V;  1QVF U;  1VQ6 V;  3G71 V;  3OW2 U;  3CME V;  1Q86 W;  3CCE V;  1Q7Y W;  1YHQ V;  1VQM V;  2QA4 V;  3CC4 V;  2OTJ V;  4WCE V;  3CPW U;  1K8A W;  1S72 V;  4WF9 V;  1YJW V;  1YIJ V;  1Q82 W;  3CCU V;  1KC8 W;  4WFB V;  3CCL V;  2D3O W;  1KQS U;  1VQK V;  3CCV V;  2QEX V;  3G4S V;  3I55 V;  2OTL V;  1QVG U;  1VQ7 V;  1VQ4 V; 
#chains in the Genus database with same CATH topology
 4NTY A;  1F7Y A;  3CE2 A;  4LFB O;  3E22 A;  1KD1 W;  1V54 B;  1NKD A;  1WP8 A;  3IC9 A;  5J9P C;  4I9W A;  1VQP V;  3F7V C;  3CX5 F;  1N36 O;  3ZRW A;  1NH2 D;  4FM2 A;  3RYC B;  1UPG A;  2ZXW B;  5C8Y B;  2FTK A;  1AR1 B;  3K3W A;  4J7K A;  4X1Y B;  2W0X A;  2A0L A;  4X20 B;  2UU9 O;  4PA7 A;  2WA3 A;  2OIG A;  5B3S B;  4TSF G;  1JOY A;  3CRQ A;  4F6R A;  2Y69 B;  4BW5 A;  1SQQ H;  4OX9 O;  3GB7 C;  4JAV A;  1NTM H;  1EN5 A;  3BVO A;  2JGU A;  3CRC A;  2ILM A;  3ABT A;  4JI5 O;  2UUB O;  2CK3 G;  1YCI A;  3CCR V;  4IL6 Z;  2UU9 B;  4IHJ A;  3Q4H A;  2EIM B;  4X1I B;  1QR8 A;  2WLM A;  1VQO V;  3OFN G;  1BHB A;  1GM8 A;  1YEW A;  4FFK A;  3JAS B;  5H6R A;  4PA3 A;  5B1O A;  3K03 A;  2AW9 A;  2YSU B;  1SRY A;  2XOK G;  5BY1 A;  1CPY A;  1QU7 A;  1R3I C;  3CCV V;  1TGO A;  4FLX A;  4I55 B;  1G8M A;  3STL C;  5DN6 G;  4X1I A;  2CGN A;  4DR7 B;  2Y4U A;  2OCC B;  2YIA A;  4X66 O;  5GW7 A;  3JAS A;  4QNH B;  3MHS C;  3UCS C;  3S3X A;  4FM1 A;  2P4K A;  3IJ4 A;  1DK1 A;  3TJT A;  1FD9 A;  4DV4 O;  2DW4 A;  2UUC O;  2B5U A;  1XMO O;  4BW9 A;  3OTO B;  4O2A B;  1X59 A;  4JPR A;  1FJG O;  5IYD O;  4FLY A;  4LWS B;  4YJ2 B;  5B1B B;  2GUZ A;  1BCC H;  1DLB A;  3CCS V;  3RYC A;  3QVN A;  4UUJ C;  1THZ A;  5GTH Z;  2MK3 A;  4YIP A;  3ZRW B;  5FL7 G;  4WFH A;  1I94 B;  2VRZ A;  2CAZ C;  3H1H H;  4J10 A;  4DXW A;  3R65 A;  1OCO C;  2CE4 A;  2GDS A;  4IT5 A;  3SJC C;  3J7A U;  5LMN B;  4J42 A;  2ATK C;  2CUG A;  4UXN A;  3RGB A;  3E8B A;  1DF4 A;  1VF7 A;  3AK1 A;  3HB3 B;  4WFE A;  5A9G A;  1XHZ A;  4D7T A;  4JI1 O;  1MZF A;  2QM4 A;  1I5Y A;  1WP7 A;  2GSM B;  3W7S A;  2PGG A;  2OWO A;  3WB1 A;  2ZT9 B;  2BTQ A;  4I5S A;  2PTM A;  2UXX A;  2YUA A;  4MVZ A;  3C3S A;  4LF7 O;  1KC8 W;  1U96 A;  1J95 A;  2QEX V;  2HG5 C;  2VWK A;  4PI2 A;  2CTR A;  1BL8 A;  2R9R B;  1R3L C;  1KUQ A;  1JPX A;  4DRX A;  3ABU A;  3CCQ V;  4U3J B;  3ABM C;  2H8P C;  2P67 A;  2M6Y A;  2IJI A;  3MDS A;  1DF5 A;  1Y74 A;  4H37 A;  2OT5 A;  1RFY A;  4FLZ A;  2EIL C;  2XAH A;  3E8F A;  3VQW A;  3JD0 A;  4LNU A;  3WU2 Z;  3SJB C;  3ZBH A;  2K9P A;  2LGQ A;  4X64 B;  3A2F A;  1GKF A;  1I7F A;  1QLN A;  3AG3 C;  4I0X B;  2HEP A;  1ORQ C;  2P06 A;  4X65 O;  1SKV A;  4ZI7 B;  5CBG A;  4TT3 G;  5LXT A;  3CC4 V;  1L1F A;  4MVO A;  1TVK B;  1XIL A;  4FPP A;  3CCU V;  5KHI A;  2P7T C;  5KX5 A;  2UUB B;  3ML0 A;  4ABM A;  1FAF A;  3HPL C;  5E79 Z;  3D36 A;  3MAQ A;  3ICX A;  1OJH A;  1ZWI C;  3JAT B;  1FFX B;  2XAQ A;  4W4K A;  1KU9 A;  2BTO A;  3I5D A;  4X1K B;  4YJ3 A;  2ZNJ A;  3FYE B;  1EZV H;  1SA0 A;  2DYS C;  2WWW A;  3FFQ A;  3JYC A;  4DR1 B;  4DR7 O;  3N2G B;  4K8Z A;  2Q4P A;  1M56 B;  3E8G A;  3RVZ A;  3D3I A;  3K06 A;  1BSM A;  2YXL A;  3QG5 A;  1YJ9 V;  2RCV A;  1WA8 B;  1PD3 A;  2JEX A;  4DW1 A;  1S5H C;  4BWA A;  1YTF D;  4J7Z A;  4J41 A;  2EIK B;  2Q7G A;  2JGD A;  2FB5 A;  3QF7 A;  4ZBM A;  3GVM A;  5EIB C;  2YS8 A;  1JMK C;  4JTD B;  2QTO A;  1Q82 W;  4TV8 B;  5J2T B;  1WPB A;  3MHH C;  1JJ2 U;  1BS3 A;  5LGU A;  2DWD C;  2HJF C;  3K5L A;  2ARH A;  1B06 A;  4O2A A;  3LDD A;  2QTS A;  3X2Q C;  4E4E A;  3H01 A;  4JYB A;  3JD2 A;  2RQ6 A;  5JWP A;  4RQE A;  2QJ1 A;  2IJJ A;  3ZHR A;  1R1B A;  1AP6 A;  4YJ3 B;  4I50 A;  3OTF A;  5LOV A;  3K5M A;  3CB2 A;  4GKK B;  3OGI B;  1HNX B;  5LMN O;  3GWO A;  3EFF K;  4QPK A;  5CA1 A;  2O57 A;  1GAX A;  2WLN A;  5KUM A;  1M56 C;  4JF3 A;  1QQC A;  3LSS A;  4DV1 B;  2ZIO A;  1Q43 A;  2BOC C;  5CA0 B;  2CTQ A;  2WLL B;  1QLE C;  4H0L B;  5FNV B;  3QO5 A;  1UJW B;  3CYO A;  5KUK A;  4PJ0 Z;  5IY5 B;  3ABL B;  2LJ2 A;  3DSQ A;  1GM9 A;  3K57 A;  4KUM A;  5ITZ A;  3RYI B;  2IH1 C;  3E83 A;  3BPZ A;  4I4T B;  4DV1 O;  1VF5 B;  3LUT B;  1P4R A;  4XDL A;  4P30 A;  2B1I A;  2ZE6 A;  4D7S A;  2ZNI A;  1WJZ A;  4MW8 A;  1KKC A;  2R72 A;  5IYZ A;  1WB7 A;  3JAW A;  4X1Y A;  1IDS A;  4FFB B;  4CH5 A;  4B08 A;  1NR1 A;  5BR8 O;  3K08 A;  2AZ0 A;  1SQV H;  2R70 A;  2EZP A;  2HR3 A;  4Z2W A;  2GV9 A;  2L6L A;  1PNL A;  1GM7 A;  5KLV H;  2MW2 B;  1SES A;  3KCX A;  1HWY A;  2X0L A;  4LFC B;  1HW7 A;  2A7W A;  3T1H B;  4X64 O;  4HNA A;  2Q5Z A;  3SYO A;  4JYC A;  3SYQ A;  5EK0 A;  2FML A;  3ASN B;  4CS2 A;  4TQD A;  1SS3 A;  1U97 A;  3T1C A;  1IX9 A;  4CC5 A;  3AG2 C;  2WLI A;  4UV9 A;  3K5N A;  1KQS U;  5LXT B;  2QWN B;  2ZKO A;  3ZMZ A;  3T1H O;  4H33 A;  1KP3 A;  4UVA A;  1R73 A;  4QGP A;  4FLT A;  3O65 A;  1NS1 A;  2EJ7 A;  3W7U A;  2XUM A;  3D8C A;  4AQY B;  3M7M X;  4UFZ A;  1ENV A;  5IDJ A;  4JI8 B;  3HKE B;  4JI4 O;  5LGN A;  3CPW U;  1RPR A;  3OMI B;  1H2S B;  3RFR A;  3RYH B;  1Y74 B;  3ZRS A;  3G4S V;  4DV0 O;  4LF5 B;  4L8J A;  5JH7 A;  1DTO A;  4K8X A;  3BEH A;  5CA0 A;  4FZ1 A;  3KZI Z;  4TOI A;  2Q67 A;  2ZIN A;  5LYJ B;  4MVU A;  4FVM A;  5EBM C;  5IYB O;  4JGS A;  1GN2 A;  5KHH A;  5BMV B;  2HVK C;  1MZE A;  4O4I A;  1L8D A;  2QA4 V;  3DGE A;  3ZX6 A;  1YJW V;  5L3F A;  1VIB A;  3CCL V;  1E1Q G;  4DV0 B;  4MTG A;  5CBF A;  1G4Y B;  3IFX A;  3FB5 C;  4WBN A;  1V55 B;  1PNM A;  5LMU B;  2F43 G;  1NH2 B;  1PL0 A;  1XOU A;  1NU1 H;  1K33 A;  4CH3 A;  4LF6 B;  4TWK A;  4EKW A;  4LR3 A;  1IXB A;  2FL4 A;  5KMG A;  1K5Q A;  3TET A;  2LW1 A;  1OCC B;  3CRA A;  2PI4 A;  1SF9 A;  3ZIA G;  3ZMS A;  1VMG A;  3E35 A;  5LMU O;  1OCR B;  1HNX O;  4K0K B;  3Q4H B;  4UB6 Z;  1I08 A;  1AJQ A;  4LWS A;  4RUE A;  2DQ0 A;  1A32 A;  3N2K B;  3HKD B;  5GON A;  2XAG A;  2UXB B;  1L0N H;  1VQ8 V;  4W4L A;  2NN4 A;  2ODM A;  1N4C A;  5CB4 A;  4DV3 B;  1BT8 A;  3W7X A;  5GON B;  5EC2 C;  2OYQ A;  2P4V A;  4X1K A;  1AJN A;  1VQ6 V;  2ETN A;  3JAT A;  2N04 A;  3OT7 A;  1EBO A;  3BY6 A;  3AG3 B;  3OUF A;  3X2Q B;  2PYL A;  2A79 B;  4WFF A;  2UXD B;  3LSU A;  3QO7 A;  4X62 O;  2EIM C;  2ZDI C;  4MTO A;  4ASU G;  1HR0 B;  4KP4 A;  3WB2 A;  2XHB A;  1Y4M A;  1SC5 B;  3JAK A;  4LC1 A;  3CJH B;  1FXK C;  1K4D C;  4NVP A;  4JZG A;  4FLV A;  2UXD O;  4LH6 A;  4X8A A;  5LOV B;  4LNU B;  3K5O A;  3AG4 C;  2QWO B;  2XAF A;  5JQG B;  2Q68 A;  4MTF A;  1YSC A;  3NR7 A;  2E5L O;  1OCC C;  1TUB A;  4HYO A;  1FPO A;  1GRJ A;  4IHJ B;  5L3D A;  1JCH A;  1JA8 A;  1Q3E A;  5DEC A;  4DR4 B;  2DOS A;  3OW2 U;  4B3S O;  4B3R O;  2CGO A;  5BMV A;  5ITZ B;  3AK3 A;  5EZY B;  5LA6 A;  5JVD A;  4G2K A;  1W0J G;  2X6B A;  4AHC A;  5JH7 B;  1H8H G;  1HP8 A;  1M4U A;  2QR4 A;  3CMA V;  4O4H B;  1MMM A;  2E5L B;  5JQG A;  3CP1 A;  2Z5U A;  3RVY A;  4DV7 O;  2IH3 C;  4NXM O;  4JI0 O;  3UM7 A;  4U3F H;  3U10 A;  4AIL C;  1F4M A;  3W7W A;  3BA8 A;  2JS3 A;  4RO2 A;  5FNV A;  2EZO A;  1YF2 A;  1SZT A;  3JD1 A;  4EFB A;  1RPO A;  1XRE A;  3A0R A;  5LP6 B;  4KXR A;  4I50 B;  3K58 A;  3CWB H;  1OCO B;  4DV7 B;  1I0H A;  3L73 H;  1DGS A;  4NYK A;  3BCC H;  3SPJ A;  1VQM V;  1LUW A;  4UVB A;  5IE9 A;  1K8A W;  4JYA O;  4JI2 O;  1N33 O;  3HKC A;  4JAU A;  4PI0 A;  5EYP A;  4CS3 A;  1VQ4 V;  1B6Q A;  4HBN A;  4QE7 A;  3RYF B;  3CRR A;  1Y67 A;  4B3T O;  3B2E E;  1CEZ A;  4LF6 O;  2ITD C;  4PHZ A;  3G71 V;  1K3E A;  2X7R B;  1FKA O;  4X9Q A;  3T4D A;  3UT5 B;  4GKJ O;  2F1M A;  1MG1 A;  4GLX A;  3FB7 C;  5EZY A;  3JAW B;  3J80 N;  1ZX3 A;  4JAA A;  1IBM O;  3F5W C;  5CMU A;  3UQ8 A;  2PF4 E;  3ZRX A;  1JR9 A;  3K59 A;  3VQY A;  2W0F C;  4K0K O;  4I9Q A;  1AIL A;  3DXR A;  2GTA A;  5IY5 C;  4TUY A;  4LF4 O;  4BIO A;  4EB6 A;  1NR7 A;  1AJP A;  3RYI A;  3APQ A;  1Q5O A;  2JVD A;  1P49 A;  3A0H Z;  1BHA A;  1R6T A;  4B3M B;  2HJD A;  2UXB O;  3OMN B;  1NVP D;  2CDY A;  1TUB B;  2WLJ A;  1E79 G;  1WPX A;  1AI7 A;  4DV3 O;  2E76 B;  1KKD A;  3U11 A;  4MW3 A;  1S5J A;  1K34 A;  3SPC A;  4YY3 O;  4UCO A;  1TUE B;  3P3N A;  3UO2 A;  1FFX A;  2RN9 A;  4LFA O;  1IXM A;  3AG4 B;  3DC5 A;  1XL4 A;  5IWA B;  1H2M A;  5KX5 B;  4LF8 O;  2QM8 A;  2D2C B;  2OTL V;  4X62 B;  1COW G;  1XEQ A;  1ZAU A;  3L75 H;  3RBZ A;  4CBC A;  1N8R W;  4DR3 B;  1BZK A;  4XDK A;  1O9H A;  4EB6 B;  4TV9 A;  1V55 C;  1Z2G A;  2AHY A;  1QNM A;  1YHQ V;  2QKC A;  5LA6 B;  3H1K H;  4BR6 A;  3CS5 A;  2ZE7 A;  3ASN C;  1GK9 A;  5GTI Z;  1HNW B;  2YID A;  5LL6 Y;  3JAM N;  3BA9 A;  2FYU H;  3L72 H;  1N34 O;  4LF8 B;  1KB9 F;  3TXS A;  5CB4 B;  2QKS A;  1MSD A;  1NJI W;  3NXS A;  4J7J A;  4DR4 O;  3ABK C;  3CME V;  4IYI A;  3STZ C;  1JFF B;  4OX9 B;  4H13 B;  1HNZ O;  3JAK B;  1Q6H A;  1BQ0 A;  3C3T A;  1VEW A;  2Q7E A;  5C93 A;  4YHH B;  3T1Y O;  4ZIB A;  2C2A A;  3UKM A;  3ZHU A;  3J81 N;  4O4L A;  4NXM B;  3RT3 C;  1MSW D;  3HKB A;  1R6K A;  1E1R G;  2GTS A;  1YDX A;  1WNS A;  4WCE V;  4I7Z B;  2M7W A;  4J9Y B;  2A9H A;  4GCZ A;  1QCE A;  1GTO A;  2ZM6 B;  3T1Y B;  3K0D A;  4HZ3 A;  3WG7 B;  3TGU H;  5K1X A;  1Y76 A;  1SQX H;  2OCH A;  2QWQ B;  2KG7 A;  3VQX A;  1FXK B;  1UFI A;  3N2K A;  1H38 A;  2PI5 A;  2VQE B;  1NZ6 A;  5JVD B;  2F23 A;  3AG1 B;  3ETE A;  2ZM6 O;  1XMO B;  3MD0 A;  1FJG B;  3F5T A;  1RSO B;  3CEI A;  4R6Z A;  1IVS A;  4LBE C;  4BIU A;  2IBZ H;  3FAV A;  1NT2 B;  1QR9 A;  1ZL8 A;  2DJV A;  5EBL C;  1ROP A;  5KMG B;  2RMK B;  3JAL A;  2CH7 A;  1I94 O;  2JJ2 G;  4JI6 B;  4DV6 O;  1ZUQ A;  4GX1 A;  3B8N A;  1SER A;  2A06 H;  2YXH A;  4DK1 A;  4X66 B;  2A3Q A;  4LF4 B;  4XBF A;  3CC2 V;  2LO1 A;  4PDV A;  4UCS A;  2IJK A;  4DV4 B;  4JTA B;  5BZB A;  2QWP B;  1TAE A;  1VQK V;  2N05 A;  4WF9 V;  3KG2 A;  3PN1 A;  1P7B A;  5L3C A;  2AHZ A;  4LFB B;  5DED A;  4FLU A;  2ZD9 A;  2YI8 A;  2YXY A;  1Q8I A;  4YY3 B;  1Q81 W;  4GT1 A;  3CC7 V;  4LF9 O;  5IJ9 A;  4YXW G;  4LFA B;  1K4C C;  5HFM A;  1XNQ B;  3QNE A;  4GX5 A;  3LDC A;  5IJ9 B;  2D3O W;  3H1J H;  4MTX A;  4ZHQ A;  4P9P A;  3ABL C;  1T5E A;  3TK1 A;  5HFL A;  5E1A C;  3L9D A;  2Y48 A;  3RWR D;  3SJA C;  1QHT A;  1SQP H;  2Y0P A;  3ZCC A;  5CBH A;  4MSW C;  2NLJ C;  4NXN B;  1M57 C;  2YEV B;  4JZ2 A;  4E2L A;  3BAB A;  1MOF A;  1SQG A;  5H5N A;  4RUF A;  1KMI Z;  2F66 C;  2XND G;  1F23 A;  1S72 V;  3OM3 B;  2UXC B;  1Q6I A;  3CXH F;  3VQV A;  4MS2 A;  3HKD A;  2ZR2 A;  2LGW A;  3E22 B;  3ZHS A;  3F7Y C;  4MVR A;  3CCM V;  2EIN B;  4NXN O;  2EIL B;  3RYF A;  2QM7 A;  1YIT V;  4X65 B;  5JJN B;  3DTU B;  1PM9 A;  2OTJ V;  1XI1 A;  1AP5 A;  5LP6 A;  2IU3 A;  2QDO A;  3B4S A;  5EBW C;  4YHH O;  1Q6U A;  3ETG A;  3VOU A;  3W7T A;  1SQB H;  1NI8 A;  1WB8 A;  3I56 V;  4PV1 B;  4G28 B;  5LGT A;  4WBN B;  4UCV A;  2LQT A;  4JI7 B;  5EIB D;  1QVF U;  1NTZ H;  5A2Q N;  1VF6 C;  5L3B A;  1K5S A;  2LFS A;  4DYL A;  4PA6 A;  3KCY A;  3SPI A;  1P7G A;  4U3J A;  3OGC C;  4JI5 B;  2UUC B;  3DC6 A;  2E74 B;  3HR0 A;  4DR6 O;  4PA4 A;  1S0V A;  1GH6 A;  4MVM A;  4DK0 A;  4EFE A;  5KHG A;  3ZN1 A;  4BIZ A;  2DQ3 A;  1M90 W;  5IYC O;  1JQ0 A;  4O4H A;  2DYR C;  4JI7 O;  2WPD G;  3H1I H;  3D36 C;  1S77 D;  4NB5 A;  2CTW A;  1V54 C;  4ICG A;  1RM1 B;  1NVP B;  2E3C A;  3RYH A;  3JSL A;  3K9A A;  1FYJ A;  5FLX N;  4DR6 B;  3G6B A;  3P3P A;  3ABM B;  5KAI Z;  4ZHQ B;  3T2M A;  3CHX A;  2WLK A;  5JCO A;  4IIJ A;  1KYO F;  1Q86 W;  3S3W A;  2ZXW C;  3SGI A;  2Q0A A;  1IUR A;  3GWK C;  2XAJ A;  1B04 A;  3A8T A;  4JI1 B;  4DR1 O;  3LSQ A;  3CJH A;  4CZZ A;  3OTO O;  4EEQ A;  3AG7 A;  1G6U A;  2GHY A;  1XMQ B;  1AR5 A;  3FX7 A;  2ADQ B;  3TCU A;  3EHB B;  3THO A;  4G27 B;  4CS4 A;  1NQT A;  1JFF A;  4AI8 A;  1TVK A;  2QGN A;  1ZL8 B;  4PA9 A;  3CSX A;  4PDL A;  4OGQ B;  5B1N A;  1I5X A;  4CC6 A;  4D6T H;  4RQF A;  1LUV A;  1XBL A;  2AXT Z;  1RP3 B;  1OV9 A;  3BAA A;  4LF9 B;  2DE0 X;  1FFT B;  4Z1V A;  1H2K A;  5F2V O;  2QKA A;  2Z0A A;  1BQZ A;  2DYR B;  3ABK B;  1Z5V A;  2F93 B;  4MT8 A;  4F4L A;  2Q8V A;  5JJE B;  2DN9 A;  3C90 A;  2KQX A;  3B77 A;  1EN6 A;  1Q7Y W;  1M57 B;  2B1G A;  2WLL A;  2W6J G;  1N0N A;  2P5O A;  2NNU A;  2AGA A;  3JD3 A;  3SPG A;  4DV2 O;  4JV5 O;  1G1X B;  4ZI7 A;  3ASO C;  3TXQ A;  1GMG A;  3UO3 A;  5B1B C;  5BXZ A;  2B9Z A;  2LP7 A;  1H2G A;  3JSN A;  1M1K W;  1AI6 A;  3OR6 C;  2JEU A;  3JD4 A;  3RW0 A;  1B3Q A;  3OR7 C;  1S3J A;  1TA8 A;  4CH4 A;  2XAS A;  3SYA A;  4O2B B;  4DV2 B;  4JV5 B;  4WFB V;  2PUS A;  3M99 B;  1D2D A;  1IBL O;  2XT9 A;  1IZ3 A;  1BMF G;  4DO2 A;  2ZIM A;  1LNQ A;  5BR8 B;  3A0B Z;  1YI2 V;  5K1P A;  5J2T A;  4MVS A;  3T4Z A;  3E8H A;  4JI4 B;  1M5I A;  4O2B A;  4LFC O;  3HKB B;  2L35 A;  1VAR A;  1IBL B;  5TIS Z;  3G6E V;  1R3J C;  3BHP A;  4PEL A;  1K9M W;  1EFR G;  1WA8 A;  5DM6 V;  5J2U B;  1WN7 A;  1VQL V;  1VQN V;  1ZLZ A;  1JVM A;  2H94 A;  4KHP O;  3APO A;  2BCC H;  2WA4 A;  4YIO A;  4BAY A;  3G67 A;  1K7D A;  4JYY A;  2WLI B;  1YZB A;  2ZQM A;  3AK2 A;  2BE3 A;  2YC0 A;  1ARO P;  2Q73 A;  1K97 A;  2HFE C;  1YTF B;  3FB6 C;  3QTC A;  1K73 W;  1F51 A;  4KHP B;  3JAL B;  3EXA A;  3JCU Z;  4TQF A;  1EZJ A;  5LHG A;  1W59 A;  2Y69 C;  1Q90 D;  4ZKI A;  1OCZ C;  5LBQ A;  3U0Z A;  3AEI A;  4PD4 F;  5B66 Z;  4PDR A;  3ZED A;  1M9N A;  4F6R B;  4YJ2 A;  1XMQ O;  4KL1 A;  2VWJ A;  4DRX B;  3R66 A;  3ZMT A;  5KA6 A;  2Y4T A;  2OCC C;  1YVW A;  1KEC A;  2P6J A;  2HLD G;  1KBH A;  4QPJ A;  5C8Y A;  4IGG A;  3FB8 C;  3LNM B;  2UXN A;  4U7N A;  3QO8 A;  3ETQ A;  4I4T A;  5KHJ A;  1VQ7 V;  4GKK O;  4X20 A;  1CXZ B;  5L3E A;  1Z5W A;  4IIJ B;  5H2F Z;  3OEH G;  1XL6 A;  2YI9 A;  3PJS K;  1QBZ A;  1WLE A;  1YXB A;  1NBM G;  2YIC A;  1PPJ H;  3LDE A;  2PZS A;  2JDI G;  4H44 B;  2CTP A;  3SR2 C;  1VQ9 V;  4FJC C;  2ITC C;  2ZE8 A;  3SJQ C;  2DMX A;  2N74 A;  5J2U A;  4J11 A;  4K3A A;  1PV0 A;  3ZHT A;  5AG2 A;  3UT5 A;  2RJZ A;  5D5P A;  2E75 B;  4L87 A;  4P9O A;  3ZMU A;  1IBK B;  2XTA A;  4OPH A;  4FZ0 A;  1GN6 A;  2GBO A;  2GUZ B;  3ZN0 A;  4Z1M G;  4DR5 B;  2JK5 C;  1XQ8 A;  1NTK H;  2PY5 A;  1L0L H;  2ZDI A;  2IW5 A;  2VQF O;  4B3S B;  2K1E A;  4JI8 O;  5KAF Z;  2YIB D;  1N32 B;  3OAA G;  3KKY A;  2Q9L A;  1VF6 A;  1D5N A;  5IT9 N;  1RM1 C;  4UV8 A;  4DR5 O;  2V4D A;  5FPR A;  1FXV A;  1QLE B;  3B40 A;  2JIZ G;  4NKG B;  2IU0 A;  2VQF B;  4TV9 B;  5B5E Z;  3WB0 A;  3OMA B;  1XUQ A;  4HAM A;  1CP9 A;  4B7K A;  5LHI A;  3K9S A;  5B3S C;  4WFA V;  2ZCE A;  3JAR B;  2DYS B;  3WFV A;  4Q20 A;  3K04 A;  4AQY O;  3B09 A;  3ZJZ A;  4DV5 O;  1O9G A;  4I55 A;  5JCO C;  2CH7 B;  2LFR A;  1XHX A;  4JYA B;  1YIJ V;  3L74 H;  4UVC A;  3O9O A;  2EIJ C;  4LF5 O;  1XNR B;  1OZ0 A;  1R6N A;  2DWE C;  3K0G A;  4TUY B;  3WG7 C;  1M93 A;  2JGD B;  1HDJ A;  2IJH A;  3SYC A;  3CCJ V;  5B1A B;  2HVJ C;  1PL4 A;  4UCU A;  3OUS A;  4DV5 B;  4O4J B;  4XDJ A;  1SQF A;  1Y66 A;  3N2G A;  3OE7 G;  3BRC A;  1XNR O;  1QVG U;  2IM9 A;  1W2B U;  5CN0 A;  4OXS A;  2Q69 A;  2P22 C;  4FMT A;  1J5E O;  2X6A A;  2F95 B;  3ZHQ A;  1WAZ A;  4K35 A;  4FLW A;  1Y76 B;  4X89 A;  4OPA A;  5KA5 A;  1JX9 A;  3IGA C;  1N0J A;  2V1D A;  2FKX A;  4JI3 O;  1BGY H;  4PDM A;  4GX0 A;  1PNK A;  3HKC B;  1MAB G;  2F4V B;  3AG2 B;  4B3M O;  1GN4 A;  3LNN A;  3CXC U;  3SPH A;  4R50 A;  2EUL A;  1LR1 A;  1FXH A;  4WFG A;  1H2N A;  5IYZ B;  2WLH A;  4GUN A;  2EIJ B;  2ZR3 A;  5H6Q A;  5IJ0 A;  2H3O A;  4CH6 A;  1H2L A;  1FS0 G;  2EX3 A;  4GX2 A;  1MNG A;  1URF A;  2OIE A;  4R8C A;  5JJJ B;  4NR1 A;  2JRI A;  2Q6A A;  1FXK A;  1EN4 A;  1OHH G;  3OD4 A;  1RSO A;  1AB3 A;  1PKX A;  1Y6X A;  4P2Z A;  4O4I B;  1ZTE A;  3SDL A;  2QE7 G;  3D3Q A;  3FD9 A;  1F4N A;  4Q6G A;  4RAI A;  4QJF B;  1IBK O;  4A5U B;  3P30 A;  4B7E A;  1HR0 O;  3JAR A;  3N27 A;  2BTQ B;  2Q7H A;  2G38 A;  1N36 B;  5IJ0 B;  1D5A A;  2KB1 A;  3L71 H;  1N32 O;  1GO3 F;  3H1L H;  4NTW A;  1HNZ B;  4ZOL B;  2YDE A;  2EIK C;  3P32 A;  2RNB A;  2R9A A;  2VS0 A;  4DUY B;  2JJ1 G;  2RDC A;  4JTC B;  3FKS G;  1OCR C;  2W6I G;  5LYJ A;  1SZX A;  4N21 A;  4DR3 O;  3JCZ A;  2EJR A;  2YIB A;  3ASO B;  4C7U A;  3K79 A;  4B3R B;  3L70 H;  5LHH A;  3BFR A;  4DW0 A;  2QSA A;  2AZ2 A;  3FYI B;  2ZE5 A;  1AVM A;  1HNW O;  3SYP A;  1AI5 A;  1N34 B;  4DUY O;  4HNA B;  2HKO A;  1ZSP A;  4TV8 A;  4FFB A;  3EVK A;  2X6C A;  4J80 A;  3ETD A;  2YEV A;  2BOB C;  2QWR B;  3E86 A;  4B3T B;  1PP9 H;  4UB8 Z;  4JI0 B;  5D5Q A;  4O4J A;  1W0K G;  5KHK A;  3G80 A;  4J9Z B;  1KP2 A;  1S5L Z;  4UCR A;  2VQE O;  4FIP C;  3ZRV A;  1VP7 A;  1SA0 B;  5LP6 C;  1VQ5 V;  4JAS A;  1AI4 A;  2HHH O;  2Y0I A;  4IYH A;  4LP8 A;  4GZR B;  4JI2 B;  1N33 B;  2Q0O C;  4LCU C;  5CA3 A;  4ZOL A;  2V7Q G;  3E2E A;  4MVQ A;  2Z3Y A;  2KSD A;  3CRM A;  3I55 V;  4I0X A;  3IAY A;  4JI6 O;  2WAM A;  1J5E B;  3OEE G;  1XDC A;  5FPO A;  4DUZ B;  4FK5 C;  1AR4 A;  3M8A A;  4LH7 A;  1P84 F;  3FAV B;  3ZS8 C;  3AG1 C;  4R7C A;  4UCT A;  1US6 A;  2JS5 A;  2HHH B;  3ZHV A;  1V9P A;  1MA1 A;  3DXR B;  2BSK B;  3CCE V;  4GKJ B;  3VBB A;  4JI3 B;  2ADP A;  1X4T A;  2UUA O;  2F4V O;  2NR5 A;  2EBO A;  2KKW A;  1IBM B;  4DUZ O;  3CD6 V;  1GN3 A;  4GYC B;  4QE9 A;  1H8E G;  3H9V A;  4RWU A;  1R3K C;  3IC7 A;  4FM0 A;  2EIN C;  5EC1 C;  2R9I A;  3HKE A;  4KFM A;  2KG7 B;  1BE3 H;  4X88 A;  4F6E A;  1XNQ O;  4DR2 B;  1S76 D;  2UUA B;  2HP8 A;  3B8M A;  5EYP B;  4DV6 B;  1OCZ B;  1YJN V;  5H9C A;  2P90 A;  2BSK A;  2LW7 A;  4NTX A;  4QIW F;  4O4L B;  1JJO A;  5L3G A;  2WSS G;  5CA1 B;  1EM1 A;  4DR2 O;  3RN4 A;  1SET A;  4N23 A;  5B1A C;  5IWA O;  4LF7 B;  1K92 A;  3E89 A;  2UXC O;  2PYJ A;  3ZMV A;  4U7O A; 
#chains in the Genus database with same CATH homology
 3ZMZ A;  4H33 A;  1KD1 W;  1KP3 A;  4UVA A;  1R73 A;  1V54 B;  1NKD A;  5L3E A;  4R6Z A;  5J9P C;  3W7U A;  4I9W A;  1VQP V;  3F7V C;  4LBE C;  3OEH G;  4BIU A;  1XL6 A;  3ZRW A;  1ENV A;  1QR9 A;  3PJS K;  1QBZ A;  1WLE A;  5EBL C;  5IDJ A;  1NBM G;  1ROP A;  1NH2 D;  5LGN A;  3CPW U;  1RPR A;  3OMI B;  2ZXW B;  2FTK A;  2JJ2 G;  3ZRS A;  3LDE A;  3G4S V;  2JDI G;  1AR1 B;  3K3W A;  1DTO A;  4GX1 A;  3BEH A;  3B8N A;  1SER A;  2A0L A;  4PA7 A;  1VQ9 V;  4FJC C;  2Q67 A;  5B3S B;  4MVU A;  4TSF G;  4XBF A;  2ITC C;  5EBM C;  5IYB O;  4JGS A;  3CC2 V;  1JOY A;  2Y69 B;  4BW5 A;  4PDV A;  2HVK C;  3SJQ C;  3GB7 C;  2IJK A;  4JAV A;  2QA4 V;  3DGE A;  4JTA B;  1YJW V;  5L3F A;  5BZB A;  3CCL V;  4L87 A;  1VQK V;  1E1Q G;  3ABT A;  4P9O A;  3ZMU A;  4WF9 V;  4MTG A;  2CK3 G;  3KG2 A;  1G4Y B;  1P7B A;  5CBF A;  5L3C A;  3IFX A;  2AHZ A;  3CCR V;  3ZN0 A;  3FB5 C;  4Z1M G;  1V55 B;  1PNM A;  2F43 G;  2ZD9 A;  2EIM B;  1NH2 B;  1PL0 A;  2JK5 C;  1QR8 A;  2WLM A;  1VQO V;  1K33 A;  3OFN G;  1Q81 W;  4GT1 A;  1BHB A;  3CC7 V;  4TWK A;  1GM8 A;  4EKW A;  2ZDI A;  2IW5 A;  4YXW G;  2K1E A;  1K4C C;  5HFM A;  5H6R A;  4PA3 A;  5B1O A;  1K5Q A;  3K03 A;  3QNE A;  3TET A;  4GX5 A;  3LDC A;  3OAA G;  2YSU B;  1SRY A;  2XOK G;  1CPY A;  2D3O W;  1OCC B;  1R3I C;  4MTX A;  3CCV V;  4P9P A;  2PI4 A;  3ABL C;  1G8M A;  3STL C;  5DN6 G;  3TK1 A;  5HFL A;  3ZIA G;  3ZMS A;  5E1A C;  2OCC B;  3E35 A;  2Y48 A;  1RM1 C;  4UV8 A;  5GW7 A;  1OCR B;  4QNH B;  3ZCC A;  5CBH A;  4MSW C;  3MHS C;  2NLJ C;  1FXV A;  1QLE B;  1M57 C;  2JIZ G;  2YEV B;  2IU0 A;  4E2L A;  1MOF A;  1AJQ A;  4RUE A;  2DQ0 A;  4RUF A;  2XND G;  1F23 A;  3OMA B;  1S72 V;  3OM3 B;  2DW4 A;  4HAM A;  1CP9 A;  2XAG A;  4MS2 A;  2B5U A;  2ZR2 A;  5LHI A;  3F7Y C;  5B3S C;  4MVR A;  4WFA V;  1VQ8 V;  3CCM V;  4JPR A;  2DYS B;  3WFV A;  5IYD O;  2EIN B;  4Q20 A;  5B1B B;  3K04 A;  3W7X A;  5EC2 C;  2EIL B;  2QM7 A;  1YIT V;  1AJN A;  1DLB A;  3ZJZ A;  3CCS V;  1VQ6 V;  3DTU B;  2OTJ V;  1EBO A;  3BY6 A;  4UUJ C;  3AG3 B;  1THZ A;  2LFR A;  3OUF A;  1YIJ V;  2MK3 A;  3X2Q B;  3ZRW B;  5FL7 G;  2IU3 A;  4WFH A;  4UVC A;  2EIJ C;  2A79 B;  5EBW C;  4DXW A;  4WFF A;  3R65 A;  1OCO C;  3ETG A;  3QO7 A;  3VOU A;  3W7T A;  1OZ0 A;  2EIM C;  2ZDI C;  1R6N A;  2DWE C;  4MTO A;  4ASU G;  3K0G A;  3I56 V;  4KP4 A;  3WG7 C;  4G28 B;  5LGT A;  2IJH A;  1Y4M A;  2ATK C;  3SYC A;  3CCJ V;  5B1A B;  2HVJ C;  1QVF U;  5L3B A;  3OUS A;  4UXN A;  1K5S A;  2LFS A;  3E8B A;  4LC1 A;  1DF4 A;  4PA6 A;  4XDJ A;  3HB3 B;  1FXK C;  4WFE A;  3SPI A;  1K4D C;  1Y66 A;  3OGC C;  3OE7 G;  1I5Y A;  1QVG U;  2GSM B;  3W7S A;  4X8A A;  1W2B U;  5CN0 A;  4OXS A;  2Q69 A;  4PA4 A;  3AG4 C;  4FMT A;  2XAF A;  4MVM A;  1S0V A;  2X6A A;  2Q68 A;  4MTF A;  1YSC A;  1OCC C;  3ZN1 A;  4HYO A;  4BIZ A;  2DQ3 A;  1M90 W;  5L3D A;  1JCH A;  5IYC O;  1JQ0 A;  4I5S A;  2DYR C;  4X89 A;  2WPD G;  2UXX A;  3OW2 U;  5KA5 A;  1S77 D;  1V54 C;  1JX9 A;  3IGA C;  2V1D A;  1RM1 B;  4MVZ A;  4G2K A;  4GX0 A;  1PNK A;  1W0J G;  4PDM A;  1NVP B;  1KC8 W;  2X6B A;  1J95 A;  1MAB G;  2QEX V;  3AG2 B;  3K9A A;  2HG5 C;  3CXC U;  1H8H G;  3SPH A;  4R50 A;  3ABM B;  3CMA V;  1FXH A;  4WFG A;  3T2M A;  1BL8 A;  3CP1 A;  2R9R B;  2WLH A;  2WLK A;  1R3L C;  2Z5U A;  1JPX A;  3RVY A;  3ABU A;  2IH3 C;  2EIJ B;  3CCQ V;  3UM7 A;  2ZR3 A;  3ABM C;  1Q86 W;  2H8P C;  2P67 A;  2ZXW C;  5H6Q A;  2IJI A;  1F4M A;  1DF5 A;  4H37 A;  3W7W A;  2OT5 A;  2XAJ A;  4RO2 A;  1FS0 G;  2EIL C;  4GX2 A;  2XAH A;  3E8F A;  2EZO A;  3LSQ A;  4CZZ A;  1SZT A;  3JD1 A;  4R8C A;  1RPO A;  3A0R A;  3JD0 A;  2GHY A;  1GKF A;  1OCO B;  2Q6A A;  1FXK A;  1OHH G;  3TCU A;  3AG3 C;  1QLN A;  3EHB B;  4G27 B;  1PKX A;  1NQT A;  4P2Z A;  1ORQ C;  5CBG A;  4TT3 G;  3SPJ A;  1VQM V;  4UVB A;  3CC4 V;  2QE7 G;  1K8A W;  4PA9 A;  1L1F A;  4MVO A;  4FPP A;  3CCU V;  4JAU A;  4PDL A;  1F4N A;  5B1N A;  1I5X A;  2P7T C;  4RAI A;  4QJF B;  3ML0 A;  1VQ4 V;  3HPL C;  1B6Q A;  4RQF A;  3D36 A;  3P30 A;  4QE7 A;  1ZWI C;  2XAQ A;  1CEZ A;  2ITD C;  3G71 V;  1FFT B;  1K3E A;  2X7R B;  3T4D A;  2KB1 A;  1GO3 F;  1MG1 A;  3FYE B;  2EIK C;  3P32 A;  2DYR B;  2DYS C;  2WWW A;  2JJ1 G;  3ABK B;  3FB7 C;  4JTC B;  3JYC A;  3FKS G;  1OCR C;  2W6I G;  3F5W C;  5CMU A;  1M56 B;  3E8G A;  3RVZ A;  3D3I A;  3K06 A;  3ZRX A;  2W0F C;  1YJ9 V;  4MT8 A;  4N21 A;  4F4L A;  2EJR A;  3JCZ A;  3ASO B;  1PD3 A;  2JEX A;  5IY5 C;  1S5H C;  1YTF D;  2EIK B;  3B77 A;  1NR7 A;  3K79 A;  4ZBM A;  1AJP A;  5LHH A;  1Q7Y W;  1M57 B;  3FYI B;  2B1G A;  2WLL A;  4JTD B;  2W6J G;  2QTO A;  1Q82 W;  2NNU A;  3SPG A;  3JD3 A;  1BHA A;  3SYP A;  1AI5 A;  3MHH C;  3ASO C;  3OMN B;  1NVP D;  1JJ2 U;  1GMG A;  2HKO A;  2WLJ A;  5LGU A;  2DWD C;  2X6C A;  5B1B C;  2HJF C;  1E79 G;  2LP7 A;  1WPX A;  1AI7 A;  1KKD A;  1H2G A;  1M1K W;  3ETD A;  1AI6 A;  2JEU A;  2YEV A;  3LDD A;  3OR6 C;  2BOB C;  3E86 A;  4MW3 A;  3JD4 A;  1K34 A;  3X2Q C;  3H01 A;  3RW0 A;  1VQ7 V;  3SPC A;  1TUE B;  3OR7 C;  1S3J A;  4JYB A;  1W0K G;  3JD2 A;  4RQE A;  1IXM A;  4J9Z B;  3AG4 B;  2XAS A;  3SYA A;  2IJJ A;  1XL4 A;  1KP2 A;  4WFB V;  3M99 B;  2QM8 A;  2OTL V;  4FIP C;  1COW G;  3ZRV A;  1BMF G;  3RBZ A;  1VQ5 V;  4CBC A;  4JAS A;  4DO2 A;  1N8R W;  1LNQ A;  4XDK A;  1AI4 A;  3GWO A;  1V55 C;  3EFF K;  4QPK A;  1YI2 V;  2WLN A;  4MVS A;  4LP8 A;  3T4Z A;  2AHY A;  3E8H A;  5KUM A;  1YHQ V;  1M56 C;  4JF3 A;  4LCU C;  3LSS A;  5CA3 A;  2V7Q G;  3ASN C;  3E2E A;  4MVQ A;  1GK9 A;  2Z3Y A;  2BOC C;  3I55 V;  2WLL B;  1QLE C;  1UJW B;  3QO5 A;  1R3J C;  3G6E V;  4PEL A;  2QKS A;  3CYO A;  2WAM A;  5KUK A;  1EFR G;  1K9M W;  3OEE G;  5IY5 B;  1NJI W;  4FK5 C;  3ABL B;  3NXS A;  5DM6 V;  3AG1 C;  4R7C A;  1VQL V;  1VQN V;  1GM9 A;  4KUM A;  3ABK C;  1JVM A;  2H94 A;  3CME V;  2IH1 C;  3E83 A;  3CCE V;  3STZ C;  3VBB A;  4BAY A;  3LUT B;  4XDL A;  1P4R A;  4P30 A;  1K7D A;  2WLI B;  2B1I A;  2ZQM A;  2EBO A;  4U7O A;  1ARO P;  4MW8 A;  5C93 A;  1K97 A;  3CD6 V;  2C2A A;  2HFE C;  3UKM A;  4QE9 A;  1YTF B;  1H8E G;  3FB6 C;  1R3K C;  1K73 W;  1NR1 A;  1F51 A;  1MSW D;  3K08 A;  3IC7 A;  1R6K A;  2EZP A;  2HR3 A;  2EIN C;  1EZJ A;  5EC1 C;  1E1R G;  1PNL A;  5LHG A;  2R9I A;  4WCE V;  2Y69 C;  1GM7 A;  4KFM A;  4X88 A;  2M7W A;  1SES A;  1S76 D;  4ZKI A;  1HWY A;  1OCZ C;  2X0L A;  3B8M A;  4J9Y B;  5LBQ A;  2A9H A;  4GCZ A;  1QCE A;  1GTO A;  3AEI A;  3K0D A;  4HZ3 A;  4PDR A;  1OCZ B;  3WG7 B;  1YJN V;  1M9N A;  5H9C A;  3SYO A;  4JYC A;  2P90 A;  3ZMT A;  4QIW F;  5KA6 A;  3SYQ A;  5L3G A;  2OCC C;  1FXK B;  5EK0 A;  3ASN B;  2WSS G;  1KEC A;  3T1C A;  2P6J A;  1SET A;  2HLD G;  3AG2 C;  4N23 A;  4QPJ A;  5B1A C;  2WLI A;  4UV9 A;  3FB8 C;  1H38 A;  1K92 A;  3LNM B;  3E89 A;  2PI5 A;  1KQS U;  2UXN A;  4U7N A;  3AG1 B;  3ETE A;  3QO8 A;  3ZMV A;  3MD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...