3CCQV

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ccqV00
3CCSV 1JJ2U 3CCMV 1VQMV 2D3OW 1VQ5V 2OTLV 3CXCU 3CD6V 1Q86W 2OTJV 4WCEV 2QA4V 3OW2U 1YITV 1YJ9V 1KD1W 1YJNV 3CCQV 3CCRV 1VQNV 1R73A 3I55V 1VQLV 3CC7V 3G4SV 3CCLV 1YI2V 1KC8W 1NJIW 3G71V 1N8RW 3CPWU 1QVGU 5DM6V 1VQ7V 1Q7YW 1QVFU 4WFBV 3CCJV 1K9MW 3CC2V 1K8AW 1VQ4V 1VQPV 4WFAV 3G6EV 1Q81W 3CCUV 1Q82W 1VQOV 1VQKV 1M1KW 1YJWV 1M90W 3CCVV 1K73W 1KQSU 2QEXV 1VQ6V 1W2BU 3CMEV 4WF9V 3CMAV 1VQ9V 1S72V 3CC4V 1YHQV 3CCEV 1YIJV 3I56V 1VQ8V
chains in the Genus database with same CATH superfamily
1YDXA 3RBZA 5J2UA 1R3JC 3L70H 4K3AA 2JDIG 2JEUA 5KA5A 3TXSA 1QBZA 5CB4A 2IBZH 5L3EA 4FZ1A 1N34B 1EN6A 3ZRWA 1IBLO 4UV8A 3S3WA 4JYAO 1KBHA 2HR3A 4F6EA 3E83A 3ABLC 1XBLA 4RWUA 2WA3A 5EBLC 1WN7A 3L73H 3OFNG 1NQTA 1EN4A 1TUBB 2IJIA 3APOA 1ZSPA 4DW1A 3FB8C 1ZTEA 4B7KA 4MVQA 5GONA 2EIMC 4X9QA 1I0HA 4U3JA 1R6KA 2WSSG 4ZHQB 1ROPA 4UCTA 3T1HB 3BHPA 1GM7A 1E79G 2UXDB 3MD0A 3APQA 2QWQB 1YJ9V 4PELA 3M99B 4TT3G 5EC1C 4CBCA 1HNWO 2ZNJA 4JI5B 4PDRA 2DYRB 1ZL8A 4UCRA 3D3QA 4LNUA 1AVMA 2A3QA 4DV7O 2IH1C 1F23A 4IHJA 3RFRA 3ZMZA 2JGDA 1HNXB 3K5LA 1K33A 4QJFB 4YIOA 2QWRB 1NTKH 1XHZA 3BPZA 1RFYA 2ZDIC 2EZPA 2KG7A 4GX2A 2WLIA 4W4KA 2Y4TA 4EFEA 4YJ2A 5JH7B 4AILC 1I5YA 4JV5B 1FFTB 3CHXA 2RMKB 1OCZC 3CJHA 3CCVV 4ICGA 1S72V 4R7CA 3P30A 1ZAUA 2XUMA 3MHSC 3JD2A 2Y48A 1KMIZ 1MNGA 4O4LB 2VQEO 2Q69A 4B3SB 4YXWG 3SPHA 3JSNA 3ZHUA 3R65A 2CK3G 4DR5B 1FXKB 2JIZG 1R3IC 4GKKO 3AK1A 2Q7EA 1VQ6V 3CMAV 4JI0B 2ILMA 1NI8A 1TUEB 1VQ5V 1Q86W 4OPHA 2QM8A 4X66B 4LF6O 4LFBB 2Q6AA 3ASNB 3H1HH 4MVUA 1VF7A 3C3SA 2CH7B 5EYPB 4PA3A 4A5UB 4FLTA 3L71H 1UPGA 3A8TA 2WLNA 1BCCH 2F93B 4PA7A 2YDEA 4B3TB 4QPJA 4HYOA 1N4CA 3IGAC 4B3MB 1KU9A 1THZA 1TUBA 5CA0B 3J81N 3KCXA 2QE7G 5FL7G 4DUYB 2DN9A 2C2AA 1ORQC 4ZHQA 5LGUA 2G38A 2XNDG 3K03A 2GTAA 3OMIB 5CN0A 2D2CB 1SQFA 1Q8IA 5DN6G 3JATA 4JI6O 4FPPA 3HKEB 2ZQMA 3UM7A 4PDLA 2NN4A 1H2GA 4LC1A 2CDYA 4P30A 1NJIW 1KYOF 3ZS8C 4JAVA 1Q5OA 4WFAV 4O4HB 1Q82W 3OGCC 4QE9A 4DR6B 3ZX6A 1CPYA 2V7QG 1VF6A 2MW2B 4UCOA 2BCCH 5H2FZ 2HLDG 1BHAA 3RYIB 5KHGA 2EINC 1YITV 2F1MA 1Q6HA 2XASA 1PPJH 3LDEA 1KKDA 5JH7A 2QR4A 3HKCB 3K5MA 5C8YB 3ZHRA 1YJWV 2ZE5A 2YI8A 1UJWB 2UXBO 1JJ2U 4B08A 4TOIA 2P90A 1ZX3A 4O4LA 2VS0A 5LBQA 4I4TB 1XHXA 2EILC 2F66C 2W0FC 3CC7V 1H2NA 3B8NA 2XAQA 4J11A 4WFBV 5B3SC 1FXKA 4ZI7B 4H33A 4O2BB 2QTSA 2XTAA 4ZOLB 2PGGA 3CRCA 2AZ0A 5JJJB 1JR9A 1S5JA 4MVSA 5KUKA 4K8XA 4NKGB 3ZHQA 2R9IA 1Y6XA 4J9YB 2AZ2A 1GRJA 2PZSA 4HAMA 4EKWA 2CH7A 3F7VC 5EYPA 4NXMB 4U7NA 4DR7B 3AG1C 4LCUC 3WB0A 1SERA 3LUTB 3W7WA 3ASOC 3JCUZ 4RO2A 4YHHB 3JAKB 2VQFO 1VQ9V 1YIJV 1Y66A 5CA0A 2CGNA 3J80N 1NR1A 1SC5B 2FB5A 4JI4B 2LGQA 3OTFA 3G4SV 4TQDA 4DR3B 4DV6B 1MA1A 4C7UA 4DK1A 2OWOA 4OX9O 2EIMB 3SYAA 1IZ3A 1SKVA 2UUCO 2JRIA 2HHHO 5LHIA 3AEIA 1S0VA 4FLUA 3JALB 3ZN0A 3UO3A 3CCSV 3HKEA 4X65B 2OCCB 4PA6A 1XQ8A 5EZYB 5LHHA 1BE3H 3E8HA 5BMVB 1BL8A 1JVMA 5EK0A 3T2MA 1N32B 4J80A 3JAMN 4MTGA 4O4HA 1SZXA 1BZKA 1SQPH 4XDJA 4LF4O 1X59A 3I56V 4MTOA 2OTLV 2CE4A 3RYIA 1P7BA 2XAJA 5IYCO 3RVYA 4OGQB 5IY5B 1ZLZA 5CBHA 3WB2A 3HKCA 4KL1A 5C8YA 1WNSA 3D36A 1V54B 2DYRC 2Q0OC 3ZRVA 3SJBC 4BW9A 3K79A 3RYFB 3T4ZA 5CBFA 5LMUB 3STZC 1VF6C 2X6CA 2OT5A 4I4TA 4GT1A 1GN2A 4JTDB 2QGNA 1N8RW 3JD1A 5K1XA 3ABKB 4WFFA 4DO2A 4ZI7A 2R9RB 4F6RB 4O2BA 1MSWD 2LQTA 1IURA 1U97A 1G4YB 4LF7B 4X62B 2F95B 1GM8A 3CP1A 2W6IG 4KHPO 5GTHZ 2JGUA 1MOFA 3O9OA 1V9PA 5CMUA 3KKYA 1TVKB 1I7FA 3UT5B 2UUAO 2F4VB 3DXRB 1GO3F 2HKOA 2XOKG 1OV9A 1FXKC 1SESA 4ABMA 2KKWA 3JAKA 2PY5A 5L3GA 1EM1A 2H94A 4J41A 3D3IA 4FVMA 5J2UB 1N33B 3VQYA 4LWSB 1I94B 5KMGB 3ASNC 2JEXA 1CEZA 2ETNA 5JVDB 1AP5A 1ZUQA 5KLVH 2O57A 1L0NH 2A79B 3D8CA 3OTOB 1CP9A 2GV9A 4AQYB 1YVWA 3JALA 3F7YC 2WPDG 1K7DA 4YY3O 4CH4A 1H2MA 1XL6A 5EIBD 1XMOB 2DJVA 3DSQA 5EZYA 1B6QA 3SDLA 1X4TA 4DV4B 1QQCA 4IYHA 5BMVA 4RUFA 4GX0A 2NLJC 4FMTA 1M5IA 4J7ZA 1Q43A 1AI4A 3QNEA 3U10A 4GKJB 4FFBB 1VQOV 4DV3B 1Q3EA 4D7SA 3CYOA 2ZE7A 1I08A 3ZHVA 1Z2GA 2YICA 3OW2U 2QM7A 4J10A 2RCVA 1TGOA 3HR0A 3AG3B 1K9MW 2DMXA 5H5NA 4DR1B 1ZL8B 2IU3A 3RYFA 3M7MX 3SPGA 4DRXB 2EIJB 3LSSA 2XAFA 2ZT9B 3NXSA 4PI2A 4RUEA 3JAWB 1GH6A 2EILB 1RSOB 3K06A 4LH7A 4JI1O 4JI2O 3K58A 5JQGB 1AP6A 4F6RA 3D36C 2JJ1G 1NH2D 3G6EV 4QPKA 4NR1A 1XEQA 2HVKC 3VOUA 4GYCB 3RGBA 2Q8VA 1JCHA 3KG2A 1HNXO 2KB1A 2QA4V 1TVKA 5KHJA 3UT5A 4YIPA 4JI7O 1R73A 1M9NA 3DXRA 3E2EA 1OCCB 4DV0B 2Y69B 5BZBA 2B5UA 4PHZA 2ZKOA 2E75B 4NTYA 5LXTB 3W7XA 3ASOB 4PDMA 1JPXA 1M93A 1KP3A 4O2AB 3H1JH 3C90A 1BSMA 2GSMB 2ZM6O 4CH3A 1YEWA 4BAYA 2AHYA 1YCIA 5LMNO 4X8AA 4LF9O 1VQMV 2K9PA 3CXCU 2B9ZA 4X20B 4JYBA 1M57B 4LWSA 3HKDB 5KMGA 1GAXA 4FLYA 4ZKIA 5JVDA 3FKSG 3SPJA 5HFLA 5BXZA 4J42A 4N21A 3SJCC 5D5PA 2QKSA 3HKBB 5F2VO 4LH6A 2EZOA 5KA6A 2P5OA 3K3WA 1HNZO 1QNMA 2BSKB 3S3XA 1EZJA 2UXNA 5JJNB 1WP8A 3JD0A 3M8AA 1JFFB 2YEVB 4LF8B 2PTMA 2GTSA 3K9AA 3OT7A 5B1BB 1PNLA 4I9QA 4X88A 2CTPA 1XUQA 4FFBA 1E1QG 1RPOA 3JCZA 1WPBA 3E86A 4J7KA 2DWDC 3SR2C 1G1XB 1HR0B 3JATB 3SPIA 3ZHTA 2OCCC 3H1IH 3E8BA 5KX5B 4NXNO 1MABG 1KUQA 2H3OA 5DM6V 4MW3A 4GZRB 3E89A 1RP3B 4DUZO 5L3DA 3IAYA 1IXMA 2R70A 5B66Z 4DRXA 4FM0A 4F4LA 2N04A 2UUBO 2Q73A 2YIBD 3JAWA 3BA8A 3L9DA 5LP6A 1RSOA 3G80A 5DECA 4DV5B 5IY5C 5IWAB 1WB8A 3QF7A 4LBEC 1K97A 1QCEA 5JQGA 1V54C 3T1YO 1V55B 4Q6GA 2RJZA 1GN4A 5CA1B 4B7EA 3J7AU 4JI8O 1R6NA 1IBKB 4CC5A 2UXCB 2A9HA 2B1IA 2KQXA 1NH2B 2YXYA 1DGSA 1IXBA 2QJ1A 4MT8A 4JZGA 1J5EO 3AK3A 3ABKC 4NTWA 5E1AC 1DK1A 4PA4A 2CAZC 5LXTA 2LW7A 2ZD9A 4O2AA 5A9GA 5FPOA 2XHBA 4QNHB 2YSUB 1K92A 2JVDA 4X20A 2FL4A 3HKDA 1KB9F 2X6BA 1IBLB 1KC8W 4TV8B 1DF5A 2IJHA 3FB7C 3HKBA 1WA8B 4E2LA 3CX5F 2BSKA 3CRAA 4W4LA 4HZ3A 2Q7HA 2UU9O 3TJTA 2QSAA 1JFFA 2YEVA 1XILA 3W7TA 3I5DA 4NB5A 1D5NA 3PJSK 1BHBA 2H8PC 2ZXWB 2QEXV 5TISZ 1EZVH 2WWWA 3OEEG 3UQ8A 3F5TA 4R8CA 4IGGA 1PL0A 1HNWB 5KX5A 1YJNV 3AG4B 1I5XA 5LHGA 4DR2O 3O65A 3FB5C 3OMNB 1FXHA 4JYYA 4DV7B 1OCOB 3N27A 3ZMUA 4NYKA 2HVJC 1PKXA 4GX5A 1VP7A 3BA9A 1F51A 2GBOA 1XMQO 1H2SB 1WPXA 1QLNA 4DR4B 3DC6A 2Q5ZA 1GM9A 5JWPA 1Z5WA 4X65O 2OIEA 3LSUA 1WP7A 3AG3C 4DYLA 2P6JA 4GCZA 4MVRA 5CA1A 2WAMA 1AJQA 2LO1A 4YJ3A 2VQEB 2EIJC 2P67A 1F4NA 1FPOA 1BMFG 1H2KA 3JD4A 2X6AA 4NTXA 2KSDA 4H44B 4ZBMA 5J2TB 3EVKA 4P9OA 5LP6C 2E5LO 2E3CA 3EXAA 3ZJZA 2QM4A 4GKKB 3K0DA 4IYIA 3WB1A 3ZMTA 1VQPV 1PNMA 2Q67A 2OIGA 1K4CC 1KQSU 2Q4PA 3RT3C 4GUNA 3MHHC 4LF6B 2LP7A 1LUWA 2RNBA 3ICXA 4DXWA 5LMUO 4B3RO 1H8EG 4WCEV 2ZE8A 2QDOA 1OCCC 4TV8A 3BVOA 2Y69C 2DOSA 2LW1A 2GDSA 1XDCA 2Q9LA 1M90W 4DV2O 1WA8A 1HW7A 4GLXA 2ZIMA 2YUAA 4JTAB 4PDVA 3U11A 3G67A 1M57C 5JCOA 4FM1A 3N2KB 2EIKB 3IJ4A 4JI3O 3KZIZ 2Y4UA 2QWOB 1G8MA 4X64B 2AHZA 1BQ0A 3X2QB 1S77D 1UFIA 1CXZB 4TSFG 5IDJA 2ZR2A 1DF4A 1IVSA 1N0NA 4JI6B 4I5SA 1GMGA 2EJRA 4FK5C 3DTUB 5IYZB 3CD6V 2M6YA 4D6TH 2X0LA 4X1KB 2ADPA 2MK3A 1GKFA 2Q0AA 2HFEC 5CBGA 1I94O 1P7GA 3PN1A 3G71V 5IJ9B 5B1BC 4XBFA 1H38A 1YSCA 2ZE6A 2WLJA 5EIBC 2PYJA 2E74B 1FAFA 1JQ0A 1YHQV 1YXBA 1K5SA 5KAIZ 2HEPA 3BABA 3QTCA 3JD3A 4K35A 3FAVA 3K9SA 1KD1W 4LF5O 3OUSA 3BRCA 1AR1B 3Q4HB 1QR8A 4H13B 1YTFD 4GKJO 2YIBA 2UXBB 1VMGA 3L75H 4N23A 1W2BU 1XNRB 4LFCO 2GUZB 1VF5B 2EULA 3A0HZ 2OTJV 5J2TA 3LSQA 4DV1O 5LOVB 2AGAA 4PV1B 1N36B 1RM1B 5BR8O 2FMLA 5EC2C 1V55C 2IW5A 4KUMA 3OD4A 3BAAA 2M7WA 4JASA 4PD4F 5KHKA 1O9HA 2OCHA 1SA0B 4TWKA 5EBWC 5KAFZ 3W7UA 2Y0IA 3SJAC 4UUJC 3C3TA 2VQFB 5H6QA 1URFA 3HB3B 2DQ3A 3EFFK 1FJGO 2WLMA 3RN4A 3SYCA 4ASUG 4K0KO 1OCRB 1SQQH 2QKAA 2JJ2G 3N2KA 3IFXA 1AJPA 4AHCA 4CC6A 3CCLV 3U0ZA 5AG2A 4OX9B 4DV0O 3SGIA 2UUCB 2IJJA 2HHHB 1AILA 1IBMO 5LGTA 4I50B 5L3FA 4BIOA 1XNQB 1SF9A 4BR6A 5IYZA 1AI5A 3CRQA 3OR7C 1PD3A 4X1KA 2ITDC 5JCOC 1K3EA 1VQLV 5IJ9A 1W0JG 4KP4A 4LF4B 1N34O 2ATKC 3K57A 2ZXWC 4JAUA 3K5NA 1SETA 3H01A 3P3PA 5A2QN 4GX1A 4MVMA 1NTZH 1R1BA 3RYHB 1JX9A 3AG4C 3CCQV 4H37A 4L87A 5L3BA 3Q4HA 4PI0A 3CE2A 1K34A 1OCOC 4BIZA 1TA8A 1WB7A 2JK5C 1L1FA 5LL6Y 4P9PA 4IIJB 1AROP 1PNKA 4EFBA 1S5LZ 2L35A 2GUZA 3CCEV 1Y67A 3T1HO 3IC9A 2UXDO 1B06A 1FKAO 1AR5A 1BQZA 5LOVA 1IDSA 4CS4A 1YTFB 1XL4A 4MW8A 5LP6B 4JZ2A 1PP9H 2VRZA 4JI5O 3DGEA 3ZEDA 4KHPB 3T4DA 3ABUA 2NR5A 1SA0A 2YS8A 2UUAB 2A06H 1SQVH 1WAZA 4G28B 4MVZA 1SQGA 2WLLB 3JASB 3THOA 1NT2B 3K5OA 2FKXA 4LFAB 4BW5A 1P4RA 4E4EA 2W0XA 2YIDA 4KXRA 4JV5O 3OE7G 4FZ0A 2RN9A 2EX3A 2QWPB 1RPRA 2NNUA 4UVAA 1NKDA 3TGUH 3A0BZ 3VQXA 4CZZA 5GW7A 4FFKA 2CUGA 3OEHG 1Q7YW 1JMKC 3CCJV 4B3SO 2LJ2A 2A7WA 5EBMC 4WFGA 3MAQA 4DR5O 3GVMA 1AB3A 1NZ6A 4I50A 4YY3B 1NTMH 1EBOA 1NR7A 2HJFC 3GWOA 1M56B 2D3OW 1ZWIC 4JI0O 2CTQA 2CGOA 1FS0G 3EHBB 3NR7A 1S5HC 2EIKC 5L3CA 3JSLA 1KECA 2DYSB 4X66O 5B1NA 4LFBO 4MVOA 2IU0A 4Z1MG 1TAEA 2Q7GA 3X2QC 1SQBH 4JF3A 2IJKA 4AI8A 3CMEV 4B3TO 1NBMG 1WLEA 5H6RA 3RYHA 2WLHA 4B3MO 3SPCA 4QIWF 2ZCEA 4CH6A 2K1EA 1IX9A 3FFQA 2BOBC 1XOUA 3TXQA 1D5AA 1A32A 1FYJA 3LNMB 2ARHA 1MSDA 4DUYO 1Y4MA 1HDJA 1JOYA 1R3LC 4IIJA 3KCYA 1DLBA 3FB6C 1VQ8V 2PF4E 3DC5A 3B4SA 1MZFA 3CWBH 4G2KA 4JI1B 4IT5A 5DEDA 5FNVB 1HWYA 4JI2B 4XDKA 1LUVA 3TETA 2AW9A 3QVNA 4PA9A 4FLVA 2P06A 5LGNA 1LNQA 3E8GA 1M4UA 2AXTZ 4G27B 4JTCB 4DR6O 4OXSA 2ZR3A 4YJ3B 3K59A 3SYOA 4JI7B 2V4DA 1B3QA 4NVPA 2XAHA 1E1RG 3OUFA 4DR4O 2WLLA 5GTIZ 3JASA 3WFVA 3K04A 5ITZB 4O4JB 4CS2A 1RM1C 3MDSA 1FXVA 2LFRA 1MG1A 4K8ZA 2ZM6B 1NVPD 3QO5A 3AG2B 2XAGA 2CTRA 4MSWC 5LMNB 1VIBA 4LF9B 3STLC 3E8FA 5KHIA 4RQEA 2DW4A 1Y74A 1T5EA 2ITCC 1QR9A 3I55V 3SYQA 3CPWU 3ZCCA 2FTKA 4JYAB 1COWG 5IT9N 3ETGA 1N0JA 4U3FH 2YIAA 1HNZB 4FM2A 1QHTA 4PJ0Z 3CRRA 4OPAA 4U7OA 3ABTA 3ETDA 1OCRC 2P4VA 3WU2Z 4L8JA 3TCUA 4WFHA 1OJHA 4MS2A 3ZN1A 5LYJB 4NXMO 2DQ0A 4DR7O 2YC0A 5B1AB 3JYCA 3W7SA 4JAAA 5BY1A 3H1KH 1PL4A 1JJOA 2F43G 4YHHO 2PI5A 1H2LA 1EN5A 2R72A 4NXNB 1QLEB 3OR6C 3N2GB 3FYEB 4I55B 1YI2V 1GN6A 1DTOA 1XI1A 4JI4O 2ZNIA 4I7ZB 4DUZB 2RDCA 4O4IB 4DR3O 4DV6O 4X64O 2JS5A 3E35A 2UUBB 1L8DA 4UV9A 3LDDA 2QWNB 3ABMB 4I9WA 3QO8A 1VEWA 3TK1A 3VBBA 1Q6IA 5FNVA 5IYBO 3FAVB 1KP2A 3QO7A 3ZMSA 3T1YB 4XDLA 3HPLC 2WLKA 2BOCC 3UKMA 4FLXA 4JI8B 1GN3A 3CRMA 1JA8A 2B1GA 3P32A 1N32O 3FD9A 4Z2WA 3VQWA 3OMAB 2PI4A 5K1PA 3B77A 3FX7A 1J5EB 3JARB 1K4DC 5ITZA 1OHHG 4O4JA 3WG7B 2Y0PA 1QVGU 3A0RA 1Q90D 4UFZA 1R6TA 4R6ZA 1K8AW 4LR3A 3SJQC 2Z3YA 3ZRXA 5LA6B 4QE7A 4LP8A 3AG7A 4J7JA 4WBNB 2IH3C 4Z1VA 1L0LH 3OGIB 1F7YA 5IJ0B 1XNRO 3RYCB 2N74A 3ZBHA 2HG5C 3LNNA 5J9PC 1NVPB 5HFMA 2L6LA 2VWJA 3BCCH 4CS3A 1N36O 3RW0A 1SQXH 4UCUA 1P49A 1XREA 3UCSC 1PM9A 1MMMA 4EEQA 2UU9B 4X62O 4LF7O 4FLZA 4QGPA 4MTFA 2EJ7A 1OZ0A 1ENVA 3E22B 5FLXN 3H1LH 2GHYA 3ETEA 5LYJA 2F4VO 5JJEB 2ADQB 2LFSA 4WFEA 3BY6A 3ABLB 4WF9V 4X1YB 4JPRA 3CXHF 1M56C 4TV9B 1S76D 4DR2B 3N2GA 4I55A 3GB7C 4EB6B 1FFXB 3ETQA 2DE0X 2DYSC 1N33O 2BTQB 2A0LA 4O4IA 3G6BA 3RWRD 3CS5A 1GK9A 1Q6UA 3ZMVA 1XMQB 1J95A 3OTOO 4R50A 1B04A 4AQYO 3F5WC 1XNQO 1BGYH 2IM9A 1XMOO 1Y76B 2PUSA 3UO2A 4DV4O 1VQ4V 2DWEC 1W59A 1M1KW 3B8MA 2YXLA 3K0GA 4DV3O 2Q68A 1NU1H 5D5QA 1P84F 5KHHA 5H9CA 3JARA 2E5LB 2RQ6A 3GWKC 5FPRA 3ZHSA 3ZRSA 3K08A 4I0XB 4X89A 5LA6A 2OYQA 1OCZB 4WBNA 1K73W 4DR1O 5IJ0A 1G6UA 4B3RB 4J9ZB 3CC2V 4H0LB 3RYCA 2LGWA 1Z5VA 4TUYB 2CTWA 2ODMA 4HNAB 3SYPA 1H8HG 1BS3A 4BWAA 1LR1A 1AR4A 3P3NA 5B5EZ 5KUMA 3B40A 1BT8A 4ZOLA 4UVBA 4DV2B 3ZIAG 3IC7A 4UCSA 1U96A 3AG2C 4ZIBA 4DW0A 5E79Z 2Z0AA 1PV0A 1WJZA 4JI3B 2VWKA 1NS1A 4UB8Z 3E22A 2YXHA 1FD9A 2BTOA 2Z5UA 4RQFA 4LFAO 1KKCA 1F4MA 4RAIA 3B09A 3CCUV 5IYDO 2PYLA 3ML0A 4X1YA 4X1IB 3QG5A 4JYCA 4TV9A 2JS3A 2EBOA 4P2ZA 4IL6Z 4DK0A 1EFRG 4JGSA 4EB6A 1FFXA 1SZTA 2X7RB 2BTQA 2P7TC 5CB4B 2V1DA 3ZRWB 2WA4A 2BE3A 1SRYA 1Q81W 1VQKV 5B1AC 1D2DA 3CC4V 3BEHA 4FIPC 4LF5B 1YF2A 2HP8A 1QLEC 2F23A 4UB6Z 3OAAG 2ZINA 1GTOA 1Y76A 2ZIOA 1VQ7V 1QVFU 1W0KG 1AI6A 5CA3A 4FLWA 5B1OA 5GONB 4LF8O 5C93A 2UXXA 4LFCB 4U3JB 3R66A 3L74H 1AJNA 5IE9A 4DV1B 2EINB 2ZDIA 3ABMC 3FYIB 3CCRV 1HR0O 1VQNV 2E76B 4UXNA 5BR8B 4MTXA 4Q20A 4I0XA 3AK2A 2XT9A 3BFRA 4UCVA 4LNUB 4KFMA 1O9GA 3CB2A 2W6JG 4IHJB 2JGDB 4HBNA 1R3KC 1US6A 4TUYA 3RVZA 3CCMV 3T1CA 3OM3B 4HNAA 1MZEA 2P22C 2KG7B 3WG7C 3B2EE 2WLIB 1AI7A 1QU7A 3CEIA 4YJ2B 4CH5A 4DV5O 5IWAO 4TQFA 2P4KA 5B3SB 2QTOA 3VQVA 1FJGB 3LDCA 1K5QA 3CJHB 1S3JA 4K0KB 2N05A 1HP8A 2R9AA 4BIUA 1IBKO 3H9VA 3L72H 1Y74B 2UXCO 3A2FA 3AG1B 1SS3A 2FYUH 1IBMB 1YZBA 4D7TA 2HJDA 4X1IA 2YI9A 3CSXA 1VARA 4UVCA 4FJCC 2QKCA
chains in the Genus database with same CATH topology
4U7OA 4JTAB 4PDVA 3ABTA 3RBZA 1R3JC 3ETDA 1OCRC 3D3IA 2JDIG 2JEUA 5KA5A 1M57C 3TCUA 2EIKB 4WFHA 3ASNC 1QBZA 2JEXA 4MS2A 1CEZA 5L3EA 3ZRWA 4UV8A 3ZN1A 1G8MA 2AHZA 2DQ0A 3X2QB 1S77D 2A79B 2HR3A 5IDJA 4TSFG 3E83A 3ABLC 5B1AB 3JYCA 2ZR2A 1CP9A 3W7SA 1DF4A 3F7YC 4I5SA 5EBLC 1GMGA 2F43G 2WPDG 2EJRA 2PI5A 1K7DA 3OFNG 4FK5C 3DTUB 1NQTA 3CD6V 1XL6A 1QLEB 2IJIA 2X0LA 3OR6C 2MK3A 3FYEB 3FB8C 1GKFA 2HFEC 1B6QA 5CBGA 1YI2V 1DTOA 3G71V 4RUFA 4MVQA 4GX0A 5B1BC 2NLJC 4FMTA 4XBFA 1AI4A 3QNEA 2EIMC 1H38A 1YSCA 1R6KA 2WSSG 1VQOV 2WLJA 1ROPA 3E35A 4UV9A 1GM7A 1E79G 1JQ0A 3CYOA 1YHQV 1K5SA 3LDDA 3MD0A 3JD3A 3ABMB 4I9WA 3OW2U 3QO8A 1YJ9V 4PELA 2QM7A 3M99B 3TK1A 3VBBA 1KD1W 3OUSA 4TT3G 5IYBO 3QO7A 1KP2A 5EC1C 3ZMSA 4CBCA 1AR1B 4XDLA 3AG3B 3HPLC 4PDRA 1K9MW 2DYRB 1QR8A 2WLKA 2BOCC 3UKMA 1YTFD 3P32A 2IU3A 2B1GA 2IH1C 1F23A 1W2BU 4N23A 3ZMZA 3OMAB 3SPGA 2PI4A 1K33A 4QJFB 2EIJB 3LSSA 2XAFA 2OTJV 3NXSA 2ZDIC 3B77A 2EZPA 4RUEA 1K4DC 1OHHG 3LSQA 4GX2A 2WLIA 2EILB 3WG7B 3K06A 1QVGU 1RM1B 3A0RA 1I5YA 5EC2C 4R6ZA 1K8AW 1V55C 3SJQC 2JJ1G 2Z3YA 2IW5A 1FFTB 3ZRXA 4QE7A 4KUMA 1NH2D 3G6EV 4LP8A 1OCZC 4QPKA 3CCVV 2HVKC 2IH3C 3VOUA 1S72V 4R7CA 3P30A 2M7WA 4JASA 1JCHA 3KG2A 3MHSC 3JD2A 2Y48A 4TWKA 2KB1A 5EBWC 2QA4V 2HG5C 3W7UA 5J9PC 1R73A 1NVPB 1M9NA 2Q69A 4YXWG 5HFMA 3SPHA 3E2EA 1OCCB 2Y69B 5BZBA 2B5UA 3R65A 2CK3G 4UUJC 3RW0A 1FXKB 2JIZG 3W7XA 1R3IC 3ASOB 5H6QA 4PDMA 1JPXA 1KP3A 3HB3B 2DQ3A 3EFFK 1VQ6V 2GSMB 2WLMA 3CMAV 3SYCA 4ASUG 4BAYA 2AHYA 4X8AA 1TUEB 1VQMV 1VQ5V 1OCRB 3CXCU 1Q86W 2JJ2G 2QM8A 1M57B 4JYBA 4MTFA 2Q6AA 3ASNB 1OZ0A 1ENVA 3IFXA 1AJPA 4MVUA 4ZKIA 3CCLV 2GHYA 3FKSG 3SPJA 5HFLA 3ETEA 4PA3A 2WLNA 4PA7A 4N21A 2LFSA 2IJJA 4WFEA 3BY6A 2QKSA 4QPJA 4HYOA 3ABLB 5LGTA 3IGAC 5L3FA 4WF9V 4JPRA 5KA6A 2EZOA 1M56C 1THZA 1AI5A 3K3WA 3OR7C 1S76D 1PD3A 2ITDC 3GB7C 1EZJA 2UXNA 1K3EA 1VQLV 2DYSC 2QE7G 3JD0A 2A0LA 5FL7G 1W0JG 2YEVB 3K9AA 2C2AA 5B1BB 1PNLA 4KP4A 4X88A 1ORQC 2ATKC 5LGUA 1GK9A 2ZXWC 4JAUA 3ZMVA 2XNDG 1SETA 1E1QG 3K03A 1J95A 1RPOA 3H01A 3JCZA 3OMIB 3E86A 4GX1A 4R50A 5CN0A 4MVMA 2DWDC 5DN6G 3F5WC 4FPPA 2ZQMA 3UM7A 1JX9A 4PDLA 3SPIA 2OCCC 3AG4C 3CCQV 3E8BA 4H37A 1H2GA 4LC1A 1MABG 4L87A 4P30A 5L3BA 1NJIW 4JAVA 5DM6V 4MW3A 3E89A 1K34A 1OCOC 4BIZA 2JK5C 1VQ4V 2DWEC 5L3DA 4WFAV 1L1FA 1Q82W 4P9PA 1IXMA 3OGCC 1M1KW 4QE9A 1AROP 3B8MA 1CPYA 2V7QG 1PNKA 3K0GA 2Q68A 4F4LA 3CCEV 2HLDG 1BHAA 2EINC 5H9CA 1YITV 1YTFB 2XASA 1XL4A 3LDEA 4MW8A 5IY5C 1KKDA 3ZRSA 4LBEC 1K97A 1QCEA 3K08A 1V54C 4X89A 1V55B 1OCZB 3DGEA 1YJWV 1K73W 3T4DA 3ABUA 1UJWB 4J9ZB 1R6NA 3CC2V 1JJ2U 2P90A 2A9HA 2B1IA 4G28B 4MVZA 5LBQA 3SYPA 2WLLB 1NH2B 2EILC 1H8HG 2W0FC 3CC7V 4MT8A 3B8NA 2XAQA 4WFBV 3ABKC 5KUMA 5E1AC 5B3SC 1FXKA 4PA4A 4BW5A 4UVBA 1P4RA 2ZD9A 4H33A 3ZIAG 3IC7A 3AG2C 3OE7G 4QNHB 4MVSA 1RPRA 2NNUA 5KUKA 4UVAA 1NKDA 2YSUB 1K92A 2R9IA 4J9YB 4CZZA 4HAMA 5GW7A 2X6BA 4EKWA 3F7VC 1KC8W 3OEHG 1Q7YW 4U7NA 1DF5A 3CCJV 2Z5UA 4RQFA 3AG1C 4LCUC 5EBMC 1SERA 3LUTB 4WFGA 3ASOC 3W7WA 1F4MA 4RAIA 3CCUV 4RO2A 2IJHA 5IYDO 3FB7C 3ML0A 1EBOA 4E2LA 1VQ9V 1NR7A 2HJFC 4JYCA 3GWOA 1YIJV 1M56B 1Y66A 2EBOA 2D3OW 4P2ZA 1ZWIC 4HZ3A 1NR1A 1EFRG 1FS0G 3EHBB 4JGSA 1S5HC 1SZTA 2EIKC 2X7RB 5L3CA 1KECA 3G4SV 2DYSB 5B1NA 2P7TC 2YEVA 2V1DA 4MVOA 3W7TA 3ZRWB 2IU0A 4Z1MG 3X2QC 1SRYA 1Q81W 2EIMB 3PJSK 4JF3A 3SYAA 1BHBA 2H8PC 2IJKA 2ZXWB 1VQKV 2QEXV 5B1AC 3CMEV 5LHIA 2WWWA 3AEIA 3CC4V 1S0VA 1NBMG 3OEEG 1WLEA 5H6RA 3BEHA 4FIPC 3ZN0A 3CCSV 4R8CA 2WLHA 3SPCA 4QIWF 1QLEC 1PL0A 1YJNV 2OCCB 3AG4B 1I5XA 4PA6A 5LHGA 2K1EA 3OAAG 1GTOA 2BOBC 3FB5C 1VQ7V 1QVFU 5LHHA 3OMNB 3E8HA 1W0KG 3LNMB 1AI6A 1FXHA 5CA3A 1BL8A 1OCOB 1JVMA 5EK0A 3T2MA 5B1OA 3ZMUA 4MTGA 2HVJC 1Y4MA 1PKXA 1JOYA 4GX5A 2UXXA 1R3LC 1F51A 4XDJA 5C93A 1DLBA 3FB6C 1WPXA 3I56V 1QLNA 1VQ8V 4MTOA 2OTLV 1P7BA 1AJNA 2XAJA 2EINB 1GM9A 2ZDIA 3ABMC 3FYIB 5IYCO 3CCRV 1VQNV 3RVYA 4G2KA 4UXNA 4MTXA 1HWYA 5IY5B 4Q20A 4XDKA 5CBHA 3AG3C 3TETA 3D36A 1V54B 2DYRC 4PA9A 2P6JA 4GCZA 4MVRA 4KFMA 3ZRVA 5LGNA 2W6JG 2WAMA 1LNQA 3E8GA 3K79A 1AJQA 3T4ZA 4G27B 5CBFA 4JTCB 3STZC 4OXSA 1R3KC 2ZR3A 3RVZA 3CCMV 2X6CA 3SYOA 2EIJC 2XAHA 3T1CA 2OT5A 1F4NA 1E1RG 2P67A 3OM3B 1BMFG 3OUFA 4GT1A 2WLLA 3JD4A 2X6AA 4ZBMA 3WFVA 3K04A 4JTDB 4P9OA 3WG7C 2WLIB 1AI7A 1N8RW 1RM1C 3JD1A 1FXVA 3ABKB 3ZJZA 4WFFA 2LFRA 1MG1A 4DO2A 3K0DA 5B3SB 2QTOA 3ZMTA 2R9RB 1MSWD 1VQPV 1PNMA 2Q67A 3LDCA 1K4CC 3QO5A 1NVPD 1K5QA 1KQSU 3AG2B 2XAGA 4MSWC 1G4YB 1S3JA 3STLC 1GM8A 3E8FA 3CP1A 2W6IG 3MHHC 2LP7A 1MOFA 4RQEA 4DXWA 2DW4A 1H8EG 4BIUA 4WCEV 5CMUA 2ITCC 1QR9A 3I55V 3SYQA 1OCCC 3CPWU 1GO3F 3ZCCA 2FTKA 2HKOA 2XOKG 2Y69C 1COWG 3AG1B 1FXKC 1SESA 3ETGA 1M90W 5L3GA 2H94A 4UVCA 4FJCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS V;  1JJ2 U;  3CCM V;  1VQM V;  2D3O W;  1VQ5 V;  2OTL V;  3CXC U;  3CD6 V;  1Q86 W;  2OTJ V;  4WCE V;  2QA4 V;  3OW2 U;  1YIT V;  1YJ9 V;  1KD1 W;  1YJN V;  3CCQ V;  3CCR V;  1VQN V;  1R73 A;  3I55 V;  1VQL V;  3CC7 V;  3G4S V;  3CCL V;  1YI2 V;  1KC8 W;  1NJI W;  3G71 V;  1N8R W;  3CPW U;  1QVG U;  5DM6 V;  1VQ7 V;  1Q7Y W;  1QVF U;  4WFB V;  3CCJ V;  1K9M W;  3CC2 V;  1K8A W;  1VQ4 V;  1VQP V;  4WFA V;  3G6E V;  1Q81 W;  3CCU V;  1Q82 W;  1VQO V;  1VQK V;  1M1K W;  1YJW V;  1M90 W;  3CCV V;  1K73 W;  1KQS U;  2QEX V;  1VQ6 V;  1W2B U;  3CME V;  4WF9 V;  3CMA V;  1VQ9 V;  1S72 V;  3CC4 V;  1YHQ V;  3CCE V;  1YIJ V;  3I56 V;  1VQ8 V; 
#chains in the Genus database with same CATH topology
 1YDX A;  3RBZ A;  5J2U A;  1R3J C;  3L70 H;  4K3A A;  2JDI G;  2JEU A;  5KA5 A;  3TXS A;  1QBZ A;  5CB4 A;  2IBZ H;  5L3E A;  4FZ1 A;  1N34 B;  1EN6 A;  3ZRW A;  1IBL O;  4UV8 A;  3S3W A;  4JYA O;  1KBH A;  2HR3 A;  4F6E A;  3E83 A;  3ABL C;  1XBL A;  4RWU A;  2WA3 A;  5EBL C;  1WN7 A;  3L73 H;  3OFN G;  1NQT A;  1EN4 A;  1TUB B;  2IJI A;  3APO A;  1ZSP A;  4DW1 A;  3FB8 C;  1ZTE A;  4B7K A;  4MVQ A;  5GON A;  2EIM C;  4X9Q A;  1I0H A;  4U3J A;  1R6K A;  2WSS G;  4ZHQ B;  1ROP A;  4UCT A;  3T1H B;  3BHP A;  1GM7 A;  1E79 G;  2UXD B;  3MD0 A;  3APQ A;  2QWQ B;  1YJ9 V;  4PEL A;  3M99 B;  4TT3 G;  5EC1 C;  4CBC A;  1HNW O;  2ZNJ A;  4JI5 B;  4PDR A;  2DYR B;  1ZL8 A;  4UCR A;  3D3Q A;  4LNU A;  1AVM A;  2A3Q A;  4DV7 O;  2IH1 C;  1F23 A;  4IHJ A;  3RFR A;  3ZMZ A;  2JGD A;  1HNX B;  3K5L A;  1K33 A;  4QJF B;  4YIO A;  2QWR B;  1NTK H;  1XHZ A;  3BPZ A;  1RFY A;  2ZDI C;  2EZP A;  2KG7 A;  4GX2 A;  2WLI A;  4W4K A;  2Y4T A;  4EFE A;  4YJ2 A;  5JH7 B;  4AIL C;  1I5Y A;  4JV5 B;  1FFT B;  3CHX A;  2RMK B;  1OCZ C;  3CJH A;  3CCV V;  4ICG A;  1S72 V;  4R7C A;  3P30 A;  1ZAU A;  2XUM A;  3MHS C;  3JD2 A;  2Y48 A;  1KMI Z;  1MNG A;  4O4L B;  2VQE O;  2Q69 A;  4B3S B;  4YXW G;  3SPH A;  3JSN A;  3ZHU A;  3R65 A;  2CK3 G;  4DR5 B;  1FXK B;  2JIZ G;  1R3I C;  4GKK O;  3AK1 A;  2Q7E A;  1VQ6 V;  3CMA V;  4JI0 B;  2ILM A;  1NI8 A;  1TUE B;  1VQ5 V;  1Q86 W;  4OPH A;  2QM8 A;  4X66 B;  4LF6 O;  4LFB B;  2Q6A A;  3ASN B;  3H1H H;  4MVU A;  1VF7 A;  3C3S A;  2CH7 B;  5EYP B;  4PA3 A;  4A5U B;  4FLT A;  3L71 H;  1UPG A;  3A8T A;  2WLN A;  1BCC H;  2F93 B;  4PA7 A;  2YDE A;  4B3T B;  4QPJ A;  4HYO A;  1N4C A;  3IGA C;  4B3M B;  1KU9 A;  1THZ A;  1TUB A;  5CA0 B;  3J81 N;  3KCX A;  2QE7 G;  5FL7 G;  4DUY B;  2DN9 A;  2C2A A;  1ORQ C;  4ZHQ A;  5LGU A;  2G38 A;  2XND G;  3K03 A;  2GTA A;  3OMI B;  5CN0 A;  2D2C B;  1SQF A;  1Q8I A;  5DN6 G;  3JAT A;  4JI6 O;  4FPP A;  3HKE B;  2ZQM A;  3UM7 A;  4PDL A;  2NN4 A;  1H2G A;  4LC1 A;  2CDY A;  4P30 A;  1NJI W;  1KYO F;  3ZS8 C;  4JAV A;  1Q5O A;  4WFA V;  4O4H B;  1Q82 W;  3OGC C;  4QE9 A;  4DR6 B;  3ZX6 A;  1CPY A;  2V7Q G;  1VF6 A;  2MW2 B;  4UCO A;  2BCC H;  5H2F Z;  2HLD G;  1BHA A;  3RYI B;  5KHG A;  2EIN C;  1YIT V;  2F1M A;  1Q6H A;  2XAS A;  1PPJ H;  3LDE A;  1KKD A;  5JH7 A;  2QR4 A;  3HKC B;  3K5M A;  5C8Y B;  3ZHR A;  1YJW V;  2ZE5 A;  2YI8 A;  1UJW B;  2UXB O;  1JJ2 U;  4B08 A;  4TOI A;  2P90 A;  1ZX3 A;  4O4L A;  2VS0 A;  5LBQ A;  4I4T B;  1XHX A;  2EIL C;  2F66 C;  2W0F C;  3CC7 V;  1H2N A;  3B8N A;  2XAQ A;  4J11 A;  4WFB V;  5B3S C;  1FXK A;  4ZI7 B;  4H33 A;  4O2B B;  2QTS A;  2XTA A;  4ZOL B;  2PGG A;  3CRC A;  2AZ0 A;  5JJJ B;  1JR9 A;  1S5J A;  4MVS A;  5KUK A;  4K8X A;  4NKG B;  3ZHQ A;  2R9I A;  1Y6X A;  4J9Y B;  2AZ2 A;  1GRJ A;  2PZS A;  4HAM A;  4EKW A;  2CH7 A;  3F7V C;  5EYP A;  4NXM B;  4U7N A;  4DR7 B;  3AG1 C;  4LCU C;  3WB0 A;  1SER A;  3LUT B;  3W7W A;  3ASO C;  3JCU Z;  4RO2 A;  4YHH B;  3JAK B;  2VQF O;  1VQ9 V;  1YIJ V;  1Y66 A;  5CA0 A;  2CGN A;  3J80 N;  1NR1 A;  1SC5 B;  2FB5 A;  4JI4 B;  2LGQ A;  3OTF A;  3G4S V;  4TQD A;  4DR3 B;  4DV6 B;  1MA1 A;  4C7U A;  4DK1 A;  2OWO A;  4OX9 O;  2EIM B;  3SYA A;  1IZ3 A;  1SKV A;  2UUC O;  2JRI A;  2HHH O;  5LHI A;  3AEI A;  1S0V A;  4FLU A;  3JAL B;  3ZN0 A;  3UO3 A;  3CCS V;  3HKE A;  4X65 B;  2OCC B;  4PA6 A;  1XQ8 A;  5EZY B;  5LHH A;  1BE3 H;  3E8H A;  5BMV B;  1BL8 A;  1JVM A;  5EK0 A;  3T2M A;  1N32 B;  4J80 A;  3JAM N;  4MTG A;  4O4H A;  1SZX A;  1BZK A;  1SQP H;  4XDJ A;  4LF4 O;  1X59 A;  3I56 V;  4MTO A;  2OTL V;  2CE4 A;  3RYI A;  1P7B A;  2XAJ A;  5IYC O;  3RVY A;  4OGQ B;  5IY5 B;  1ZLZ A;  5CBH A;  3WB2 A;  3HKC A;  4KL1 A;  5C8Y A;  1WNS A;  3D36 A;  1V54 B;  2DYR C;  2Q0O C;  3ZRV A;  3SJB C;  4BW9 A;  3K79 A;  3RYF B;  3T4Z A;  5CBF A;  5LMU B;  3STZ C;  1VF6 C;  2X6C A;  2OT5 A;  4I4T A;  4GT1 A;  1GN2 A;  4JTD B;  2QGN A;  1N8R W;  3JD1 A;  5K1X A;  3ABK B;  4WFF A;  4DO2 A;  4ZI7 A;  2R9R B;  4F6R B;  4O2B A;  1MSW D;  2LQT A;  1IUR A;  1U97 A;  1G4Y B;  4LF7 B;  4X62 B;  2F95 B;  1GM8 A;  3CP1 A;  2W6I G;  4KHP O;  5GTH Z;  2JGU A;  1MOF A;  3O9O A;  1V9P A;  5CMU A;  3KKY A;  1TVK B;  1I7F A;  3UT5 B;  2UUA O;  2F4V B;  3DXR B;  1GO3 F;  2HKO A;  2XOK G;  1OV9 A;  1FXK C;  1SES A;  4ABM A;  2KKW A;  3JAK A;  2PY5 A;  5L3G A;  1EM1 A;  2H94 A;  4J41 A;  3D3I A;  4FVM A;  5J2U B;  1N33 B;  3VQY A;  4LWS B;  1I94 B;  5KMG B;  3ASN C;  2JEX A;  1CEZ A;  2ETN A;  5JVD B;  1AP5 A;  1ZUQ A;  5KLV H;  2O57 A;  1L0N H;  2A79 B;  3D8C A;  3OTO B;  1CP9 A;  2GV9 A;  4AQY B;  1YVW A;  3JAL A;  3F7Y C;  2WPD G;  1K7D A;  4YY3 O;  4CH4 A;  1H2M A;  1XL6 A;  5EIB D;  1XMO B;  2DJV A;  3DSQ A;  5EZY A;  1B6Q A;  3SDL A;  1X4T A;  4DV4 B;  1QQC A;  4IYH A;  5BMV A;  4RUF A;  4GX0 A;  2NLJ C;  4FMT A;  1M5I A;  4J7Z A;  1Q43 A;  1AI4 A;  3QNE A;  3U10 A;  4GKJ B;  4FFB B;  1VQO V;  4DV3 B;  1Q3E A;  4D7S A;  3CYO A;  2ZE7 A;  1I08 A;  3ZHV A;  1Z2G A;  2YIC A;  3OW2 U;  2QM7 A;  4J10 A;  2RCV A;  1TGO A;  3HR0 A;  3AG3 B;  1K9M W;  2DMX A;  5H5N A;  4DR1 B;  1ZL8 B;  2IU3 A;  3RYF A;  3M7M X;  3SPG A;  4DRX B;  2EIJ B;  3LSS A;  2XAF A;  2ZT9 B;  3NXS A;  4PI2 A;  4RUE A;  3JAW B;  1GH6 A;  2EIL B;  1RSO B;  3K06 A;  4LH7 A;  4JI1 O;  4JI2 O;  3K58 A;  5JQG B;  1AP6 A;  4F6R A;  3D36 C;  2JJ1 G;  1NH2 D;  3G6E V;  4QPK A;  4NR1 A;  1XEQ A;  2HVK C;  3VOU A;  4GYC B;  3RGB A;  2Q8V A;  1JCH A;  3KG2 A;  1HNX O;  2KB1 A;  2QA4 V;  1TVK A;  5KHJ A;  3UT5 A;  4YIP A;  4JI7 O;  1R73 A;  1M9N A;  3DXR A;  3E2E A;  1OCC B;  4DV0 B;  2Y69 B;  5BZB A;  2B5U A;  4PHZ A;  2ZKO A;  2E75 B;  4NTY A;  5LXT B;  3W7X A;  3ASO B;  4PDM A;  1JPX A;  1M93 A;  1KP3 A;  4O2A B;  3H1J H;  3C90 A;  1BSM A;  2GSM B;  2ZM6 O;  4CH3 A;  1YEW A;  4BAY A;  2AHY A;  1YCI A;  5LMN O;  4X8A A;  4LF9 O;  1VQM V;  2K9P A;  3CXC U;  2B9Z A;  4X20 B;  4JYB A;  1M57 B;  4LWS A;  3HKD B;  5KMG A;  1GAX A;  4FLY A;  4ZKI A;  5JVD A;  3FKS G;  3SPJ A;  5HFL A;  5BXZ A;  4J42 A;  4N21 A;  3SJC C;  5D5P A;  2QKS A;  3HKB B;  5F2V O;  4LH6 A;  2EZO A;  5KA6 A;  2P5O A;  3K3W A;  1HNZ O;  1QNM A;  2BSK B;  3S3X A;  1EZJ A;  2UXN A;  5JJN B;  1WP8 A;  3JD0 A;  3M8A A;  1JFF B;  2YEV B;  4LF8 B;  2PTM A;  2GTS A;  3K9A A;  3OT7 A;  5B1B B;  1PNL A;  4I9Q A;  4X88 A;  2CTP A;  1XUQ A;  4FFB A;  1E1Q G;  1RPO A;  3JCZ A;  1WPB A;  3E86 A;  4J7K A;  2DWD C;  3SR2 C;  1G1X B;  1HR0 B;  3JAT B;  3SPI A;  3ZHT A;  2OCC C;  3H1I H;  3E8B A;  5KX5 B;  4NXN O;  1MAB G;  1KUQ A;  2H3O A;  5DM6 V;  4MW3 A;  4GZR B;  3E89 A;  1RP3 B;  4DUZ O;  5L3D A;  3IAY A;  1IXM A;  2R70 A;  5B66 Z;  4DRX A;  4FM0 A;  4F4L A;  2N04 A;  2UUB O;  2Q73 A;  2YIB D;  3JAW A;  3BA8 A;  3L9D A;  5LP6 A;  1RSO A;  3G80 A;  5DEC A;  4DV5 B;  5IY5 C;  5IWA B;  1WB8 A;  3QF7 A;  4LBE C;  1K97 A;  1QCE A;  5JQG A;  1V54 C;  3T1Y O;  1V55 B;  4Q6G A;  2RJZ A;  1GN4 A;  5CA1 B;  4B7E A;  3J7A U;  4JI8 O;  1R6N A;  1IBK B;  4CC5 A;  2UXC B;  2A9H A;  2B1I A;  2KQX A;  1NH2 B;  2YXY A;  1DGS A;  1IXB A;  2QJ1 A;  4MT8 A;  4JZG A;  1J5E O;  3AK3 A;  3ABK C;  4NTW A;  5E1A C;  1DK1 A;  4PA4 A;  2CAZ C;  5LXT A;  2LW7 A;  2ZD9 A;  4O2A A;  5A9G A;  5FPO A;  2XHB A;  4QNH B;  2YSU B;  1K92 A;  2JVD A;  4X20 A;  2FL4 A;  3HKD A;  1KB9 F;  2X6B A;  1IBL B;  1KC8 W;  4TV8 B;  1DF5 A;  2IJH A;  3FB7 C;  3HKB A;  1WA8 B;  4E2L A;  3CX5 F;  2BSK A;  3CRA A;  4W4L A;  4HZ3 A;  2Q7H A;  2UU9 O;  3TJT A;  2QSA A;  1JFF A;  2YEV A;  1XIL A;  3W7T A;  3I5D A;  4NB5 A;  1D5N A;  3PJS K;  1BHB A;  2H8P C;  2ZXW B;  2QEX V;  5TIS Z;  1EZV H;  2WWW A;  3OEE G;  3UQ8 A;  3F5T A;  4R8C A;  4IGG A;  1PL0 A;  1HNW B;  5KX5 A;  1YJN V;  3AG4 B;  1I5X A;  5LHG A;  4DR2 O;  3O65 A;  3FB5 C;  3OMN B;  1FXH A;  4JYY A;  4DV7 B;  1OCO B;  3N27 A;  3ZMU A;  4NYK A;  2HVJ C;  1PKX A;  4GX5 A;  1VP7 A;  3BA9 A;  1F51 A;  2GBO A;  1XMQ O;  1H2S B;  1WPX A;  1QLN A;  4DR4 B;  3DC6 A;  2Q5Z A;  1GM9 A;  5JWP A;  1Z5W A;  4X65 O;  2OIE A;  3LSU A;  1WP7 A;  3AG3 C;  4DYL A;  2P6J A;  4GCZ A;  4MVR A;  5CA1 A;  2WAM A;  1AJQ A;  2LO1 A;  4YJ3 A;  2VQE B;  2EIJ C;  2P67 A;  1F4N A;  1FPO A;  1BMF G;  1H2K A;  3JD4 A;  2X6A A;  4NTX A;  2KSD A;  4H44 B;  4ZBM A;  5J2T B;  3EVK A;  4P9O A;  5LP6 C;  2E5L O;  2E3C A;  3EXA A;  3ZJZ A;  2QM4 A;  4GKK B;  3K0D A;  4IYI A;  3WB1 A;  3ZMT A;  1VQP V;  1PNM A;  2Q67 A;  2OIG A;  1K4C C;  1KQS U;  2Q4P A;  3RT3 C;  4GUN A;  3MHH C;  4LF6 B;  2LP7 A;  1LUW A;  2RNB A;  3ICX A;  4DXW A;  5LMU O;  4B3R O;  1H8E G;  4WCE V;  2ZE8 A;  2QDO A;  1OCC C;  4TV8 A;  3BVO A;  2Y69 C;  2DOS A;  2LW1 A;  2GDS A;  1XDC A;  2Q9L A;  1M90 W;  4DV2 O;  1WA8 A;  1HW7 A;  4GLX A;  2ZIM A;  2YUA A;  4JTA B;  4PDV A;  3U11 A;  3G67 A;  1M57 C;  5JCO A;  4FM1 A;  3N2K B;  2EIK B;  3IJ4 A;  4JI3 O;  3KZI Z;  2Y4U A;  2QWO B;  1G8M A;  4X64 B;  2AHZ A;  1BQ0 A;  3X2Q B;  1S77 D;  1UFI A;  1CXZ B;  4TSF G;  5IDJ A;  2ZR2 A;  1DF4 A;  1IVS A;  1N0N A;  4JI6 B;  4I5S A;  1GMG A;  2EJR A;  4FK5 C;  3DTU B;  5IYZ B;  3CD6 V;  2M6Y A;  4D6T H;  2X0L A;  4X1K B;  2ADP A;  2MK3 A;  1GKF A;  2Q0A A;  2HFE C;  5CBG A;  1I94 O;  1P7G A;  3PN1 A;  3G71 V;  5IJ9 B;  5B1B C;  4XBF A;  1H38 A;  1YSC A;  2ZE6 A;  2WLJ A;  5EIB C;  2PYJ A;  2E74 B;  1FAF A;  1JQ0 A;  1YHQ V;  1YXB A;  1K5S A;  5KAI Z;  2HEP A;  3BAB A;  3QTC A;  3JD3 A;  4K35 A;  3FAV A;  3K9S A;  1KD1 W;  4LF5 O;  3OUS A;  3BRC A;  1AR1 B;  3Q4H B;  1QR8 A;  4H13 B;  1YTF D;  4GKJ O;  2YIB A;  2UXB B;  1VMG A;  3L75 H;  4N23 A;  1W2B U;  1XNR B;  4LFC O;  2GUZ B;  1VF5 B;  2EUL A;  3A0H Z;  2OTJ V;  5J2T A;  3LSQ A;  4DV1 O;  5LOV B;  2AGA A;  4PV1 B;  1N36 B;  1RM1 B;  5BR8 O;  2FML A;  5EC2 C;  1V55 C;  2IW5 A;  4KUM A;  3OD4 A;  3BAA A;  2M7W A;  4JAS A;  4PD4 F;  5KHK A;  1O9H A;  2OCH A;  1SA0 B;  4TWK A;  5EBW C;  5KAF Z;  3W7U A;  2Y0I A;  3SJA C;  4UUJ C;  3C3T A;  2VQF B;  5H6Q A;  1URF A;  3HB3 B;  2DQ3 A;  3EFF K;  1FJG O;  2WLM A;  3RN4 A;  3SYC A;  4ASU G;  4K0K O;  1OCR B;  1SQQ H;  2QKA A;  2JJ2 G;  3N2K A;  3IFX A;  1AJP A;  4AHC A;  4CC6 A;  3CCL V;  3U0Z A;  5AG2 A;  4OX9 B;  4DV0 O;  3SGI A;  2UUC B;  2IJJ A;  2HHH B;  1AIL A;  1IBM O;  5LGT A;  4I50 B;  5L3F A;  4BIO A;  1XNQ B;  1SF9 A;  4BR6 A;  5IYZ A;  1AI5 A;  3CRQ A;  3OR7 C;  1PD3 A;  4X1K A;  2ITD C;  5JCO C;  1K3E A;  1VQL V;  5IJ9 A;  1W0J G;  4KP4 A;  4LF4 B;  1N34 O;  2ATK C;  3K57 A;  2ZXW C;  4JAU A;  3K5N A;  1SET A;  3H01 A;  3P3P A;  5A2Q N;  4GX1 A;  4MVM A;  1NTZ H;  1R1B A;  3RYH B;  1JX9 A;  3AG4 C;  3CCQ V;  4H37 A;  4L87 A;  5L3B A;  3Q4H A;  4PI0 A;  3CE2 A;  1K34 A;  1OCO C;  4BIZ A;  1TA8 A;  1WB7 A;  2JK5 C;  1L1F A;  5LL6 Y;  4P9P A;  4IIJ B;  1ARO P;  1PNK A;  4EFB A;  1S5L Z;  2L35 A;  2GUZ A;  3CCE V;  1Y67 A;  3T1H O;  3IC9 A;  2UXD O;  1B06 A;  1FKA O;  1AR5 A;  1BQZ A;  5LOV A;  1IDS A;  4CS4 A;  1YTF B;  1XL4 A;  4MW8 A;  5LP6 B;  4JZ2 A;  1PP9 H;  2VRZ A;  4JI5 O;  3DGE A;  3ZED A;  4KHP B;  3T4D A;  3ABU A;  2NR5 A;  1SA0 A;  2YS8 A;  2UUA B;  2A06 H;  1SQV H;  1WAZ A;  4G28 B;  4MVZ A;  1SQG A;  2WLL B;  3JAS B;  3THO A;  1NT2 B;  3K5O A;  2FKX A;  4LFA B;  4BW5 A;  1P4R A;  4E4E A;  2W0X A;  2YID A;  4KXR A;  4JV5 O;  3OE7 G;  4FZ0 A;  2RN9 A;  2EX3 A;  2QWP B;  1RPR A;  2NNU A;  4UVA A;  1NKD A;  3TGU H;  3A0B Z;  3VQX A;  4CZZ A;  5GW7 A;  4FFK A;  2CUG A;  3OEH G;  1Q7Y W;  1JMK C;  3CCJ V;  4B3S O;  2LJ2 A;  2A7W A;  5EBM C;  4WFG A;  3MAQ A;  4DR5 O;  3GVM A;  1AB3 A;  1NZ6 A;  4I50 A;  4YY3 B;  1NTM H;  1EBO A;  1NR7 A;  2HJF C;  3GWO A;  1M56 B;  2D3O W;  1ZWI C;  4JI0 O;  2CTQ A;  2CGO A;  1FS0 G;  3EHB B;  3NR7 A;  1S5H C;  2EIK C;  5L3C A;  3JSL A;  1KEC A;  2DYS B;  4X66 O;  5B1N A;  4LFB O;  4MVO A;  2IU0 A;  4Z1M G;  1TAE A;  2Q7G A;  3X2Q C;  1SQB H;  4JF3 A;  2IJK A;  4AI8 A;  3CME V;  4B3T O;  1NBM G;  1WLE A;  5H6R A;  3RYH A;  2WLH A;  4B3M O;  3SPC A;  4QIW F;  2ZCE A;  4CH6 A;  2K1E A;  1IX9 A;  3FFQ A;  2BOB C;  1XOU A;  3TXQ A;  1D5A A;  1A32 A;  1FYJ A;  3LNM B;  2ARH A;  1MSD A;  4DUY O;  1Y4M A;  1HDJ A;  1JOY A;  1R3L C;  4IIJ A;  3KCY A;  1DLB A;  3FB6 C;  1VQ8 V;  2PF4 E;  3DC5 A;  3B4S A;  1MZF A;  3CWB H;  4G2K A;  4JI1 B;  4IT5 A;  5DED A;  5FNV B;  1HWY A;  4JI2 B;  4XDK A;  1LUV A;  3TET A;  2AW9 A;  3QVN A;  4PA9 A;  4FLV A;  2P06 A;  5LGN A;  1LNQ A;  3E8G A;  1M4U A;  2AXT Z;  4G27 B;  4JTC B;  4DR6 O;  4OXS A;  2ZR3 A;  4YJ3 B;  3K59 A;  3SYO A;  4JI7 B;  2V4D A;  1B3Q A;  4NVP A;  2XAH A;  1E1R G;  3OUF A;  4DR4 O;  2WLL A;  5GTI Z;  3JAS A;  3WFV A;  3K04 A;  5ITZ B;  4O4J B;  4CS2 A;  1RM1 C;  3MDS A;  1FXV A;  2LFR A;  1MG1 A;  4K8Z A;  2ZM6 B;  1NVP D;  3QO5 A;  3AG2 B;  2XAG A;  2CTR A;  4MSW C;  5LMN B;  1VIB A;  4LF9 B;  3STL C;  3E8F A;  5KHI A;  4RQE A;  2DW4 A;  1Y74 A;  1T5E A;  2ITC C;  1QR9 A;  3I55 V;  3SYQ A;  3CPW U;  3ZCC A;  2FTK A;  4JYA B;  1COW G;  5IT9 N;  3ETG A;  1N0J A;  4U3F H;  2YIA A;  1HNZ B;  4FM2 A;  1QHT A;  4PJ0 Z;  3CRR A;  4OPA A;  4U7O A;  3ABT A;  3ETD A;  1OCR C;  2P4V A;  3WU2 Z;  4L8J A;  3TCU A;  4WFH A;  1OJH A;  4MS2 A;  3ZN1 A;  5LYJ B;  4NXM O;  2DQ0 A;  4DR7 O;  2YC0 A;  5B1A B;  3JYC A;  3W7S A;  4JAA A;  5BY1 A;  3H1K H;  1PL4 A;  1JJO A;  2F43 G;  4YHH O;  2PI5 A;  1H2L A;  1EN5 A;  2R72 A;  4NXN B;  1QLE B;  3OR6 C;  3N2G B;  3FYE B;  4I55 B;  1YI2 V;  1GN6 A;  1DTO A;  1XI1 A;  4JI4 O;  2ZNI A;  4I7Z B;  4DUZ B;  2RDC A;  4O4I B;  4DR3 O;  4DV6 O;  4X64 O;  2JS5 A;  3E35 A;  2UUB B;  1L8D A;  4UV9 A;  3LDD A;  2QWN B;  3ABM B;  4I9W A;  3QO8 A;  1VEW A;  3TK1 A;  3VBB A;  1Q6I A;  5FNV A;  5IYB O;  3FAV B;  1KP2 A;  3QO7 A;  3ZMS A;  3T1Y B;  4XDL A;  3HPL C;  2WLK A;  2BOC C;  3UKM A;  4FLX A;  4JI8 B;  1GN3 A;  3CRM A;  1JA8 A;  2B1G A;  3P32 A;  1N32 O;  3FD9 A;  4Z2W A;  3VQW A;  3OMA B;  2PI4 A;  5K1P A;  3B77 A;  3FX7 A;  1J5E B;  3JAR B;  1K4D C;  5ITZ A;  1OHH G;  4O4J A;  3WG7 B;  2Y0P A;  1QVG U;  3A0R A;  1Q90 D;  4UFZ A;  1R6T A;  4R6Z A;  1K8A W;  4LR3 A;  3SJQ C;  2Z3Y A;  3ZRX A;  5LA6 B;  4QE7 A;  4LP8 A;  3AG7 A;  4J7J A;  4WBN B;  2IH3 C;  4Z1V A;  1L0L H;  3OGI B;  1F7Y A;  5IJ0 B;  1XNR O;  3RYC B;  2N74 A;  3ZBH A;  2HG5 C;  3LNN A;  5J9P C;  1NVP B;  5HFM A;  2L6L A;  2VWJ A;  3BCC H;  4CS3 A;  1N36 O;  3RW0 A;  1SQX H;  4UCU A;  1P49 A;  1XRE A;  3UCS C;  1PM9 A;  1MMM A;  4EEQ A;  2UU9 B;  4X62 O;  4LF7 O;  4FLZ A;  4QGP A;  4MTF A;  2EJ7 A;  1OZ0 A;  1ENV A;  3E22 B;  5FLX N;  3H1L H;  2GHY A;  3ETE A;  5LYJ A;  2F4V O;  5JJE B;  2ADQ B;  2LFS A;  4WFE A;  3BY6 A;  3ABL B;  4WF9 V;  4X1Y B;  4JPR A;  3CXH F;  1M56 C;  4TV9 B;  1S76 D;  4DR2 B;  3N2G A;  4I55 A;  3GB7 C;  4EB6 B;  1FFX B;  3ETQ A;  2DE0 X;  2DYS C;  1N33 O;  2BTQ B;  2A0L A;  4O4I A;  3G6B A;  3RWR D;  3CS5 A;  1GK9 A;  1Q6U A;  3ZMV A;  1XMQ B;  1J95 A;  3OTO O;  4R50 A;  1B04 A;  4AQY O;  3F5W C;  1XNQ O;  1BGY H;  2IM9 A;  1XMO O;  1Y76 B;  2PUS A;  3UO2 A;  4DV4 O;  1VQ4 V;  2DWE C;  1W59 A;  1M1K W;  3B8M A;  2YXL A;  3K0G A;  4DV3 O;  2Q68 A;  1NU1 H;  5D5Q A;  1P84 F;  5KHH A;  5H9C A;  3JAR A;  2E5L B;  2RQ6 A;  3GWK C;  5FPR A;  3ZHS A;  3ZRS A;  3K08 A;  4I0X B;  4X89 A;  5LA6 A;  2OYQ A;  1OCZ B;  4WBN A;  1K73 W;  4DR1 O;  5IJ0 A;  1G6U A;  4B3R B;  4J9Z B;  3CC2 V;  4H0L B;  3RYC A;  2LGW A;  1Z5V A;  4TUY B;  2CTW A;  2ODM A;  4HNA B;  3SYP A;  1H8H G;  1BS3 A;  4BWA A;  1LR1 A;  1AR4 A;  3P3N A;  5B5E Z;  5KUM A;  3B40 A;  1BT8 A;  4ZOL A;  4UVB A;  4DV2 B;  3ZIA G;  3IC7 A;  4UCS A;  1U96 A;  3AG2 C;  4ZIB A;  4DW0 A;  5E79 Z;  2Z0A A;  1PV0 A;  1WJZ A;  4JI3 B;  2VWK A;  1NS1 A;  4UB8 Z;  3E22 A;  2YXH A;  1FD9 A;  2BTO A;  2Z5U A;  4RQF A;  4LFA O;  1KKC A;  1F4M A;  4RAI A;  3B09 A;  3CCU V;  5IYD O;  2PYL A;  3ML0 A;  4X1Y A;  4X1I B;  3QG5 A;  4JYC A;  4TV9 A;  2JS3 A;  2EBO A;  4P2Z A;  4IL6 Z;  4DK0 A;  1EFR G;  4JGS A;  4EB6 A;  1FFX A;  1SZT A;  2X7R B;  2BTQ A;  2P7T C;  5CB4 B;  2V1D A;  3ZRW B;  2WA4 A;  2BE3 A;  1SRY A;  1Q81 W;  1VQK V;  5B1A C;  1D2D A;  3CC4 V;  3BEH A;  4FIP C;  4LF5 B;  1YF2 A;  2HP8 A;  1QLE C;  2F23 A;  4UB6 Z;  3OAA G;  2ZIN A;  1GTO A;  1Y76 A;  2ZIO A;  1VQ7 V;  1QVF U;  1W0K G;  1AI6 A;  5CA3 A;  4FLW A;  5B1O A;  5GON B;  4LF8 O;  5C93 A;  2UXX A;  4LFC B;  4U3J B;  3R66 A;  3L74 H;  1AJN A;  5IE9 A;  4DV1 B;  2EIN B;  2ZDI A;  3ABM C;  3FYI B;  3CCR V;  1HR0 O;  1VQN V;  2E76 B;  4UXN A;  5BR8 B;  4MTX A;  4Q20 A;  4I0X A;  3AK2 A;  2XT9 A;  3BFR A;  4UCV A;  4LNU B;  4KFM A;  1O9G A;  3CB2 A;  2W6J G;  4IHJ B;  2JGD B;  4HBN A;  1R3K C;  1US6 A;  4TUY A;  3RVZ A;  3CCM V;  3T1C A;  3OM3 B;  4HNA A;  1MZE A;  2P22 C;  2KG7 B;  3WG7 C;  3B2E E;  2WLI B;  1AI7 A;  1QU7 A;  3CEI A;  4YJ2 B;  4CH5 A;  4DV5 O;  5IWA O;  4TQF A;  2P4K A;  5B3S B;  2QTO A;  3VQV A;  1FJG B;  3LDC A;  1K5Q A;  3CJH B;  1S3J A;  4K0K B;  2N05 A;  1HP8 A;  2R9A A;  4BIU A;  1IBK O;  3H9V A;  3L72 H;  1Y74 B;  2UXC O;  3A2F A;  3AG1 B;  1SS3 A;  2FYU H;  1IBM B;  1YZB A;  4D7T A;  2HJD A;  4X1I A;  2YI9 A;  3CSX A;  1VAR A;  4UVC A;  4FJC C;  2QKC A; 
#chains in the Genus database with same CATH homology
 4U7O A;  4JTA B;  4PDV A;  3ABT A;  3RBZ A;  1R3J C;  3ETD A;  1OCR C;  3D3I A;  2JDI G;  2JEU A;  5KA5 A;  1M57 C;  3TCU A;  2EIK B;  4WFH A;  3ASN C;  1QBZ A;  2JEX A;  4MS2 A;  1CEZ A;  5L3E A;  3ZRW A;  4UV8 A;  3ZN1 A;  1G8M A;  2AHZ A;  2DQ0 A;  3X2Q B;  1S77 D;  2A79 B;  2HR3 A;  5IDJ A;  4TSF G;  3E83 A;  3ABL C;  5B1A B;  3JYC A;  2ZR2 A;  1CP9 A;  3W7S A;  1DF4 A;  3F7Y C;  4I5S A;  5EBL C;  1GMG A;  2F43 G;  2WPD G;  2EJR A;  2PI5 A;  1K7D A;  3OFN G;  4FK5 C;  3DTU B;  1NQT A;  3CD6 V;  1XL6 A;  1QLE B;  2IJI A;  2X0L A;  3OR6 C;  2MK3 A;  3FYE B;  3FB8 C;  1GKF A;  2HFE C;  1B6Q A;  5CBG A;  1YI2 V;  1DTO A;  3G71 V;  4RUF A;  4MVQ A;  4GX0 A;  5B1B C;  2NLJ C;  4FMT A;  4XBF A;  1AI4 A;  3QNE A;  2EIM C;  1H38 A;  1YSC A;  1R6K A;  2WSS G;  1VQO V;  2WLJ A;  1ROP A;  3E35 A;  4UV9 A;  1GM7 A;  1E79 G;  1JQ0 A;  3CYO A;  1YHQ V;  1K5S A;  3LDD A;  3MD0 A;  3JD3 A;  3ABM B;  4I9W A;  3OW2 U;  3QO8 A;  1YJ9 V;  4PEL A;  2QM7 A;  3M99 B;  3TK1 A;  3VBB A;  1KD1 W;  3OUS A;  4TT3 G;  5IYB O;  3QO7 A;  1KP2 A;  5EC1 C;  3ZMS A;  4CBC A;  1AR1 B;  4XDL A;  3AG3 B;  3HPL C;  4PDR A;  1K9M W;  2DYR B;  1QR8 A;  2WLK A;  2BOC C;  3UKM A;  1YTF D;  3P32 A;  2IU3 A;  2B1G A;  2IH1 C;  1F23 A;  1W2B U;  4N23 A;  3ZMZ A;  3OMA B;  3SPG A;  2PI4 A;  1K33 A;  4QJF B;  2EIJ B;  3LSS A;  2XAF A;  2OTJ V;  3NXS A;  2ZDI C;  3B77 A;  2EZP A;  4RUE A;  1K4D C;  1OHH G;  3LSQ A;  4GX2 A;  2WLI A;  2EIL B;  3WG7 B;  3K06 A;  1QVG U;  1RM1 B;  3A0R A;  1I5Y A;  5EC2 C;  4R6Z A;  1K8A W;  1V55 C;  3SJQ C;  2JJ1 G;  2Z3Y A;  2IW5 A;  1FFT B;  3ZRX A;  4QE7 A;  4KUM A;  1NH2 D;  3G6E V;  4LP8 A;  1OCZ C;  4QPK A;  3CCV V;  2HVK C;  2IH3 C;  3VOU A;  1S72 V;  4R7C A;  3P30 A;  2M7W A;  4JAS A;  1JCH A;  3KG2 A;  3MHS C;  3JD2 A;  2Y48 A;  4TWK A;  2KB1 A;  5EBW C;  2QA4 V;  2HG5 C;  3W7U A;  5J9P C;  1R73 A;  1NVP B;  1M9N A;  2Q69 A;  4YXW G;  5HFM A;  3SPH A;  3E2E A;  1OCC B;  2Y69 B;  5BZB A;  2B5U A;  3R65 A;  2CK3 G;  4UUJ C;  3RW0 A;  1FXK B;  2JIZ G;  3W7X A;  1R3I C;  3ASO B;  5H6Q A;  4PDM A;  1JPX A;  1KP3 A;  3HB3 B;  2DQ3 A;  3EFF K;  1VQ6 V;  2GSM B;  2WLM A;  3CMA V;  3SYC A;  4ASU G;  4BAY A;  2AHY A;  4X8A A;  1TUE B;  1VQM V;  1VQ5 V;  1OCR B;  3CXC U;  1Q86 W;  2JJ2 G;  2QM8 A;  1M57 B;  4JYB A;  4MTF A;  2Q6A A;  3ASN B;  1OZ0 A;  1ENV A;  3IFX A;  1AJP A;  4MVU A;  4ZKI A;  3CCL V;  2GHY A;  3FKS G;  3SPJ A;  5HFL A;  3ETE A;  4PA3 A;  2WLN A;  4PA7 A;  4N21 A;  2LFS A;  2IJJ A;  4WFE A;  3BY6 A;  2QKS A;  4QPJ A;  4HYO A;  3ABL B;  5LGT A;  3IGA C;  5L3F A;  4WF9 V;  4JPR A;  5KA6 A;  2EZO A;  1M56 C;  1THZ A;  1AI5 A;  3K3W A;  3OR7 C;  1S76 D;  1PD3 A;  2ITD C;  3GB7 C;  1EZJ A;  2UXN A;  1K3E A;  1VQL V;  2DYS C;  2QE7 G;  3JD0 A;  2A0L A;  5FL7 G;  1W0J G;  2YEV B;  3K9A A;  2C2A A;  5B1B B;  1PNL A;  4KP4 A;  4X88 A;  1ORQ C;  2ATK C;  5LGU A;  1GK9 A;  2ZXW C;  4JAU A;  3ZMV A;  2XND G;  1SET A;  1E1Q G;  3K03 A;  1J95 A;  1RPO A;  3H01 A;  3JCZ A;  3OMI B;  3E86 A;  4GX1 A;  4R50 A;  5CN0 A;  4MVM A;  2DWD C;  5DN6 G;  3F5W C;  4FPP A;  2ZQM A;  3UM7 A;  1JX9 A;  4PDL A;  3SPI A;  2OCC C;  3AG4 C;  3CCQ V;  3E8B A;  4H37 A;  1H2G A;  4LC1 A;  1MAB G;  4L87 A;  4P30 A;  5L3B A;  1NJI W;  4JAV A;  5DM6 V;  4MW3 A;  3E89 A;  1K34 A;  1OCO C;  4BIZ A;  2JK5 C;  1VQ4 V;  2DWE C;  5L3D A;  4WFA V;  1L1F A;  1Q82 W;  4P9P A;  1IXM A;  3OGC C;  1M1K W;  4QE9 A;  1ARO P;  3B8M A;  1CPY A;  2V7Q G;  1PNK A;  3K0G A;  2Q68 A;  4F4L A;  3CCE V;  2HLD G;  1BHA A;  2EIN C;  5H9C A;  1YIT V;  1YTF B;  2XAS A;  1XL4 A;  3LDE A;  4MW8 A;  5IY5 C;  1KKD A;  3ZRS A;  4LBE C;  1K97 A;  1QCE A;  3K08 A;  1V54 C;  4X89 A;  1V55 B;  1OCZ B;  3DGE A;  1YJW V;  1K73 W;  3T4D A;  3ABU A;  1UJW B;  4J9Z B;  1R6N A;  3CC2 V;  1JJ2 U;  2P90 A;  2A9H A;  2B1I A;  4G28 B;  4MVZ A;  5LBQ A;  3SYP A;  2WLL B;  1NH2 B;  2EIL C;  1H8H G;  2W0F C;  3CC7 V;  4MT8 A;  3B8N A;  2XAQ A;  4WFB V;  3ABK C;  5KUM A;  5E1A C;  5B3S C;  1FXK A;  4PA4 A;  4BW5 A;  4UVB A;  1P4R A;  2ZD9 A;  4H33 A;  3ZIA G;  3IC7 A;  3AG2 C;  3OE7 G;  4QNH B;  4MVS A;  1RPR A;  2NNU A;  5KUK A;  4UVA A;  1NKD A;  2YSU B;  1K92 A;  2R9I A;  4J9Y B;  4CZZ A;  4HAM A;  5GW7 A;  2X6B A;  4EKW A;  3F7V C;  1KC8 W;  3OEH G;  1Q7Y W;  4U7N A;  1DF5 A;  3CCJ V;  2Z5U A;  4RQF A;  3AG1 C;  4LCU C;  5EBM C;  1SER A;  3LUT B;  4WFG A;  3ASO C;  3W7W A;  1F4M A;  4RAI A;  3CCU V;  4RO2 A;  2IJH A;  5IYD O;  3FB7 C;  3ML0 A;  1EBO A;  4E2L A;  1VQ9 V;  1NR7 A;  2HJF C;  4JYC A;  3GWO A;  1YIJ V;  1M56 B;  1Y66 A;  2EBO A;  2D3O W;  4P2Z A;  1ZWI C;  4HZ3 A;  1NR1 A;  1EFR G;  1FS0 G;  3EHB B;  4JGS A;  1S5H C;  1SZT A;  2EIK C;  2X7R B;  5L3C A;  1KEC A;  3G4S V;  2DYS B;  5B1N A;  2P7T C;  2YEV A;  2V1D A;  4MVO A;  3W7T A;  3ZRW B;  2IU0 A;  4Z1M G;  3X2Q C;  1SRY A;  1Q81 W;  2EIM B;  3PJS K;  4JF3 A;  3SYA A;  1BHB A;  2H8P C;  2IJK A;  2ZXW B;  1VQK V;  2QEX V;  5B1A C;  3CME V;  5LHI A;  2WWW A;  3AEI A;  3CC4 V;  1S0V A;  1NBM G;  3OEE G;  1WLE A;  5H6R A;  3BEH A;  4FIP C;  3ZN0 A;  3CCS V;  4R8C A;  2WLH A;  3SPC A;  4QIW F;  1QLE C;  1PL0 A;  1YJN V;  2OCC B;  3AG4 B;  1I5X A;  4PA6 A;  5LHG A;  2K1E A;  3OAA G;  1GTO A;  2BOB C;  3FB5 C;  1VQ7 V;  1QVF U;  5LHH A;  3OMN B;  3E8H A;  1W0K G;  3LNM B;  1AI6 A;  1FXH A;  5CA3 A;  1BL8 A;  1OCO B;  1JVM A;  5EK0 A;  3T2M A;  5B1O A;  3ZMU A;  4MTG A;  2HVJ C;  1Y4M A;  1PKX A;  1JOY A;  4GX5 A;  2UXX A;  1R3L C;  1F51 A;  4XDJ A;  5C93 A;  1DLB A;  3FB6 C;  1WPX A;  3I56 V;  1QLN A;  1VQ8 V;  4MTO A;  2OTL V;  1P7B A;  1AJN A;  2XAJ A;  2EIN B;  1GM9 A;  2ZDI A;  3ABM C;  3FYI B;  5IYC O;  3CCR V;  1VQN V;  3RVY A;  4G2K A;  4UXN A;  4MTX A;  1HWY A;  5IY5 B;  4Q20 A;  4XDK A;  5CBH A;  3AG3 C;  3TET A;  3D36 A;  1V54 B;  2DYR C;  4PA9 A;  2P6J A;  4GCZ A;  4MVR A;  4KFM A;  3ZRV A;  5LGN A;  2W6J G;  2WAM A;  1LNQ A;  3E8G A;  3K79 A;  1AJQ A;  3T4Z A;  4G27 B;  5CBF A;  4JTC B;  3STZ C;  4OXS A;  1R3K C;  2ZR3 A;  3RVZ A;  3CCM V;  2X6C A;  3SYO A;  2EIJ C;  2XAH A;  3T1C A;  2OT5 A;  1F4N A;  1E1R G;  2P67 A;  3OM3 B;  1BMF G;  3OUF A;  4GT1 A;  2WLL A;  3JD4 A;  2X6A A;  4ZBM A;  3WFV A;  3K04 A;  4JTD B;  4P9O A;  3WG7 C;  2WLI B;  1AI7 A;  1N8R W;  1RM1 C;  3JD1 A;  1FXV A;  3ABK B;  3ZJZ A;  4WFF A;  2LFR A;  1MG1 A;  4DO2 A;  3K0D A;  5B3S B;  2QTO A;  3ZMT A;  2R9R B;  1MSW D;  1VQP V;  1PNM A;  2Q67 A;  3LDC A;  1K4C C;  3QO5 A;  1NVP D;  1K5Q A;  1KQS U;  3AG2 B;  2XAG A;  4MSW C;  1G4Y B;  1S3J A;  3STL C;  1GM8 A;  3E8F A;  3CP1 A;  2W6I G;  3MHH C;  2LP7 A;  1MOF A;  4RQE A;  4DXW A;  2DW4 A;  1H8E G;  4BIU A;  4WCE V;  5CMU A;  2ITC C;  1QR9 A;  3I55 V;  3SYQ A;  1OCC C;  3CPW U;  1GO3 F;  3ZCC A;  2FTK A;  2HKO A;  2XOK G;  2Y69 C;  1COW G;  3AG1 B;  1FXK C;  1SES A;  3ETG A;  1M90 W;  5L3G A;  2H94 A;  4UVC A;  4FJC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...