3CCQV

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ccqV00
1QVFU 1JJ2U 1YIJV 3CMAV 1YI2V 1K9MW 3G71V 1N8RW 1VQ9V 3CCMV 3CCVV 3G4SV 1S72V 3CD6V 1VQNV 1W2BU 4WF9V 1KD1W 3I56V 3CCJV 1VQKV 1Q7YW 5DM6V 1QVGU 3OW2U 1VQ8V 2OTLV 1VQMV 4WFAV 1KQSU 4WCEV 1Q81W 3CCSV 4WFBV 1VQOV 2OTJV 3CC2V 3CPWU 3CCLV 3G6EV 1VQ4V 1VQ6V 2QA4V 1KC8W 1YITV 3CXCU 1YJ9V 3I55V 3CCEV 3CCRV 1Q86W 1YJWV 3CMEV 1M1KW 3CCQV 3CCUV 1K73W 1YJNV 3CC7V 1R73A 2D3OW 1NJIW 1VQPV 1VQ7V 1Q82W 1YHQV 1K8AW 1VQLV 1M90W 2QEXV 3CC4V 1VQ5V
chains in the Genus database with same CATH superfamily
4IHJA 1MNGA 3BA9A 1OJHA 3E22B 3JARA 1WA8B 1UPGA 1VF7A 2W0FC 1AR5A 1SQBH 4JI5O 4DR4O 4DW0A 1KECA 2F93B 2F66C 4X1KB 1TA8A 4RUFA 1VQLV 4PA4A 4O4IA 2A06H 5LHIA 5CBFA 4H37A 3G67A 1I0HA 1AROP 3FYIB 2WLNA 3CEIA 2BOBC 4JAAA 5JJNB 3CCUV 1EM1A 1VQPV 1XI1A 4PELA 2G38A 2CTWA 2EIMB 1SQGA 3T4ZA 1N36O 1OV9A 4IT5A 5IWAB 2C2AA 4ZIBA 4U7OA 5IJ9B 5JH7A 1DK1A 1K4DC 3OE7G 4JASA 1BZKA 4L87A 1JR9A 4B3MO 5J2UA 3OMIB 4JYAB 2JGDA 5CB4B 1L0LH 3OM3B 4YJ3B 2K1EA 4UCUA 3ZEDA 2PGGA 4GKJO 1Y76B 4B7EA 3OR7C 1D5AA 2M6YA 1VQMV 4FZ0A 3ETDA 4TSFG 2EBOA 4BW5A 2EZOA 1FFXA 3IC7A 4DV5B 1YTFB 1M93A 1FJGO 1S77D 4DK1A 4QE7A 1EZJA 2YIDA 4I5SA 4HNAB 3E35A 3CCVV 1JFFA 3ABKB 1IBLO 4I55A 4J9ZB 1KBHA 1WLEA 4RAIA 3AK2A 4UUJC 5FNVB 5K1XA 5KHKA 5CA0B 3CX5F 3ZS8C 5E79Z 3C90A 4KHPB 3E86A 5L3GA 4UCTA 5L3BA 1Q7YW 1GN4A 3OGCC 2MW2B 4WFAV 3RYCA 4X1YA 1OCRB 2F1MA 3AG2B 1FKAO 3GWKC 2FKXA 2JVDA 3F5WC 3O9OA 1DF5A 4YIPA 1FXKB 4RQFA 4UFZA 2CUGA 4EB6A 1VEWA 3R66A 1W2BU 4NTYA 4GX0A 4YHHO 2P4VA 4HZ3A 1N32B 4TOIA 3SYPA 3IAYA 3X2QB 5KA5A 2Q6AA 4PHZA 2B1GA 3APOA 2JJ2G 3NXSA 4YJ2A 3CE2A 4JI6O 2XUMA 3ABMB 5LXTA 3BABA 3FB5C 1FAFA 3HKDA 1KQSU 4DV2O 3MHSC 3WB1A 1I08A 4G2KA 5LGTA 3JASB 4ZI7B 3T1YB 4DR5B 2DWEC 4I7ZB 3ZRWB 1FFTB 5IYDO 2W6JG 4XDKA 2P7TC 4PDVA 1MSDA 3ZBHA 2D3OW 5BXZA 2AZ2A 2LFSA 1GM9A 5KAFZ 3ASOC 2JDIG 1WP7A 4Z2WA 5FPRA 4MTFA 3H1HH 1BGYH 2UUBB 5KHJA 4TQDA 2LP7A 4FMTA 5CBHA 3B2EE 4AHCA 2ZNJA 3BPZA 3LUTB 2IU0A 4KUMA 3HKEA 2UXNA 3MD0A 4I0XA 4MTGA 3K57A 2PF4E 3ML0A 5LOVA 1ZSPA 4FFBA 1RFYA 4C7UA 1WB8A 2CGNA 4GKKB 3N2GA 3ZHQA 4UCOA 1NH2B 3G6EV 2ZCEA 1QHTA 1Y74A 1JVMA 4GCZA 4BIZA 3QO7A 3ZMSA 1N4CA 4JV5B 1QVFU 4JI3B 4F6RA 3ZRSA 1W0JG 3OGIB 4IIJA 1NVPD 4PDLA 2BSKA 4BW9A 3G80A 1PNMA 1K33A 2JS5A 4FLTA 5EBWC 1G4YB 2ADQB 3PN1A 4JYAO 2EIKC 1R3IC 2NR5A 1AR4A 5F2VO 2BE3A 2A7WA 1K3EA 4HAMA 4R8CA 1K73W 2XOKG 1H2SB 1VQ5V 3RN4A 3C3TA 4DV5O 3RYFB 5FL7G 1VF5B 2ZE6A 2Y69B 4JTAB 2XHBA 4DYLA 2JEUA 1GM8A 2Q0OC 3H1KH 4X66B 4MVQA 2WPDG 5JQGB 5LMUB 3AG1C 1COWG 2D2CB 2E75B 1AP5A 3W7UA 5CA1B 4R50A 5BMVB 3W7XA 2P22C 5B3SB 4U3FH 1M57C 4CH5A 3TXQA 4X65B 3OD4A 3A8TA 1L1FA 3EHBB 2EIJC 3QF7A 1YZBA 4J41A 4KHPO 3B8MA 3BY6A 4J9YB 1BSMA 4JI2O 4TWKA 2MK3A 2QA4V 1R3KC 3W7TA 1BT8A 4MVOA 2RQ6A 1WPBA 2RDCA 1P84F 4EKWA 3CCQV 1AI4A 1TVKB 4FFKA 4Q6GA 1H2LA 4PI2A 2XASA 2ZKOA 4ASUG 1UJWB 1J95A 1H2GA 3QG5A 2DOSA 2EINB 4OXSA 2RMKB 3FFQA 4O4LA 1HNXO 1PNLA 1S5HC 5ITZB 3L74H 1N32O 1V55B 2XAQA 2Y0IA 2IJKA 4ZKIA 2JS3A 3LDDA 3BHPA 5H9CA 1R3JC 1VF6A 1WJZA 5B1AB 5C8YA 3LDEA 4D6TH 5J2TA 1EFRG 1XMQB 1VF6C 3AK3A 4BWAA 2BCCH 4X20B 4WFEA 1R6NA 2DJVA 4DR3B 2WAMA 4P9PA 4LFAO 3T1YO 4DR5O 1GRJA 2GTSA 4X1IA 4K0KB 4K35A 4LNUA 1TAEA 2F23A 3AK1A 4NYKA 2QWRB 2R70A 3S3XA 5EIBC 1V9PA 1IVSA 1O9GA 2UU9B 1M1KW 2UUBO 1BQ0A 1KP2A 4H0LB 5IY5C 4RQEA 1VARA 2QWOB 1K92A 4P30A 1JJOA 1BMFG 3CMAV 3UT5A 2ZXWB 2PY5A 4NB5A 3ZN0A 1F51A 1XHXA 1Q6UA 4FVMA 1BQZA 3B4SA 1MMMA 5HFMA 1B6QA 2YIBA 4KP4A 4TV8B 2WLMA 1PL0A 2FYUH 4GKKO 2AGAA 1NJIW 3M8AA 1LR1A 2DE0X 4JYCA 2Q7EA 4UCSA 3KKYA 2CK3G 4GZRB 4JV5O 2VRZA 4JI3O 4LF9B 4GT1A 5EIBD 1FXVA 2Q68A 1K34A 1LNQA 1ZAUA 4DR2B 1HR0B 2B5UA 3ABLC 2VQFB 1Q82W 2QEXV 3OTFA 1P7GA 1XQ8A 2QGNA 1BHBA 3CYOA 5D5PA 1GN2A 3IFXA 1YVWA 4YIOA 3B09A 1H2NA 1K7DA 1V54B 4O4JA 5LA6B 1XBLA 2B1IA 2YIBD 4X66O 2E76B 2Q8VA 4E4EA 3CC4V 4QIWF 1XOUA 4JTCB 2R72A 2KSDA 3P3PA 3JAKB 3HB3B 1SQFA 5EYPB 1PV0A 2YC0A 3WB0A 4X65O 3SGIA 1YJ9V 3L75H 2OIGA 2HLDG 4DR7B 3BCCH 2YSUB 3K06A 4FIPC 3K5MA 5KX5B 1VMGA 3RVZA 1N0JA 4E2LA 5LYJA 1SKVA 2Q69A 4O2BA 3SJQC 3JATA 2ILMA 1HNWB 3ZMVA 4JGSA 3K9SA 3JSLA 3CP1A 3LNMB 4J7KA 2X7RB 5GTHZ 1AJNA 2ETNA 5DEDA 3T1CA 1ENVA 4JYBA 4CS4A 1OCZC 2LFRA 3AG3C 2GHYA 1ZL8B 4DUZB 3RBZA 2AXTZ 3UM7A 3HKBB 4ZHQB 5LP6A 1N0NA 2R9IA 1D5NA 1WAZA 4UVCA 1FYJA 3ZHSA 1XMQO 1IBMO 4DR3O 5KMGB 4X9QA 1G8MA 2AHYA 4NTXA 3ZIAG 5LMNO 3CXHF 3ASNC 3OW2U 3M7MX 4K0KO 2WLIB 1KMIZ 1RPRA 3CS5A 1Y67A 2OYQA 5GONB 2ZM6O 4WFGA 3ZMTA 5EBLC 1JJ2U 2UU9O 1SQQH 3OUSA 1THZA 3TK1A 3UO3A 1SC5B 4N21A 4MW8A 1X59A 2DN9A 4QE9A 3OEEG 2ZE5A 2LQTA 2GBOA 2Q4PA 3MHHC 2KG7B 3E22A 5KHGA 1B04A 3IC9A 3RGBA 1WA8A 5BY1A 1ROPA 1S76D 1AI7A 1XREA 1OCCB 5FPOA 3SPIA 1SERA 2OIEA 4X1KA 4LFCB 4DV6B 3E2EA 1VP7A 1JX9A 4H44B 2EILB 4LF9O 4LR3A 5IE9A 3CC7V 4FK5C 4PA7A 4DV0B 3IGAC 4JAVA 2F4VB 5LBQA 4DR2O 3L70H 1HR0O 1QQCA 1ZUQA 4LF7B 1I5YA 1F7YA 2VQFO 3Q4HB 2QTOA 4PV1B 2UXCB 3FYEB 3E89A 3GB7C 3VQXA 4IYHA 4JZGA 2EIMC 5IJ9A 3L9DA 4LC1A 1WP8A 2HVJC 2Q9LA 2YDEA 3STLC 4FLWA 3UO2A 3LNNA 4JI2B 3DTUB 2WLLB 1XL4A 2EULA 3K58A 3C3SA 4DO2A 5CB4A 4YJ3A 2E3CA 3VOUA 2Q7GA 5KUMA 2IM9A 3RYIB 3AG4B 5A2QN 4PDMA 3TCUA 1Y76A 2HEPA 4LH6A 1SRYA 4DXWA 3JYCA 2UXDO 1TUBB 2OCCB 1PNKA 1NTMH 2Z5UA 4DR7O 3LSSA 5LHGA 2N04A 5GW7A 3VQYA 4JI8B 4RWUA 1HNXB 2WA3A 1Q81W 3P32A 1P49A 4HNAA 1ZLZA 2AW9A 1YDXA 3K03A 2P90A 1J5EO 1YITV 4B3SB 5EC2C 1U97A 3A0BZ 3I5DA 3K59A 3CCEV 4PJ0Z 3FB8C 2E5LB 2ITCC 1HNWO 2HHHB 3ABKC 4J7JA 4OPHA 1HW7A 4K8ZA 1K9MW 1HP8A 2QWPB 4A5UB 3EFFK 1S72V 3A0RA 5FNVA 1VIBA 3DC6A 3FKSG 3JAWB 1KUQA 1Z2GA 5CA0A 3F7YC 2RN9A 3BVOA 3TXSA 1NT2B 5DECA 4EFBA 2V7QG 2PI4A 2WA4A 4LFAB 4DUZO 4BR6A 5JVDB 3L71H 1WNSA 4GYCB 4O4HB 4ZOLB 4MVMA 4LFBB 3G4SV 4LWSB 1DF4A 1OCRC 1GAXA 2WLHA 1YTFD 1Q5OA 3AG2C 1OHHG 1FXKA 5EBMC 1ZTEA 1XILA 4I4TB 4DV3O 2YS8A 4ABMA 1P7BA 3ZMUA 1FD9A 4D7SA 1K5SA 3T1HO 3KZIZ 1URFA 2BTQB 2WWWA 1FPOA 1RSOB 2X0LA 2RNBA 1P4RA 3JD0A 5CMUA 1HNZO 2CAZC 5GTIZ 3T2MA 5HFLA 1QLEC 2AHZA 4U7NA 2PI5A 3ZMZA 4UCVA 4O2AB 1XMOB 3UQ8A 3AG1B 4QPJA 3ABMC 3JASA 4ZI7A 5KHHA 4YXWG 2ZE7A 4F6EA 3ZRWA 2H8PC 3ETGA 3CRAA 4K3AA 1Y6XA 4U3JB 3NR7A 1M57B 2HJFC 2QM4A 2ZIMA 2BTOA 4D7TA 2Q0AA 1E79G 2W0XA 4IL6Z 3T4DA 1ZWIC 5EZYB 5IYZB 4X64B 4LFCO 4DV6O 2PYJA 3OTOB 1NS1A 3L72H 1QCEA 4Z1VA 2UUCB 2F43G 1RM1B 1Y66A 3FB6C 3P30A 5K1PA 4MVRA 2CH7B 4DV0O 1K5QA 3WG7C 1SS3A 2F4VO 4CC5A 4JF3A 2EJ7A 4LF7O 1IDSA 3QTCA 3M99B 3VBBA 2YI9A 5B1BB 5CA3A 3HR0A 3D3QA 3S3WA 5C93A 4NKGB 2L35A 4WBNB 2UXCO 4MT8A 3FX7A 1M56C 4MTXA 4CS3A 3K08A 3KCXA 1AILA 1XL6A 1HWYA 2QKSA 3E83A 3CJHB 4JYYA 3K9AA 1Z5VA 2HVKC 3CRRA 1AJQA 1GH6A 2P06A 3UCSC 5IJ0B 3D8CA 3SPCA 1ORQC 2IJHA 3ZCCA 1XUQA 2YXHA 3JSNA 3FB7C 2IH3C 2HG5C 4CC6A 2XAHA 5EK0A 3H01A 3JALB 1KKDA 1I94B 3RYFA 3ZHTA 2PZSA 4JI8O 1Q8IA 1PM9A 3ZHVA 4WFFA 1MG1A 2Y69C 3RFRA 3HKCB 3BAAA 5JQGA 4KL1A 1XNQO 4B3SO 4TV9B 1NH2D 4TUYB 1JMKC 5CA1A 1SA0B 5BMVA 3OEHG 2E5LO 4F4LA 2HHHO 1PL4A 2V4DA 1CPYA 1QR8A 2Z0AA 2PUSA 3QO8A 4UV8A 3K5NA 1OCOB 3HPLC 3CWBH 5B3SC 1H2KA 3RWRD 1IBMB 1KKCA 2IJJA 2HP8A 5LMNB 3SPHA 1N8RW 3N2KB 3SYOA 1EN4A 5AG2A 2DYRB 3TGUH 1VQ8V 1TVKA 1SQVH 3J7AU 3W7WA 4LFBO 3RYHB 3SR2C 2X6BA 2RCVA 2ZM6B 4AILC 3U0ZA 1TGOA 3A2FA 2XAGA 4I9QA 1SQXH 3ABLB 4JI7B 2ZIOA 3OMNB 5ITZA 4I50B 2EINC 1EN6A 2VWKA 2CTQA 2DYSB 5IYBO 4FLYA 3CCLV 4CZZA 5CN0A 1V55C 3H1JH 2Q7HA 3E8HA 4UV9A 1PPJH 2GUZB 3OT7A 4X20A 1MZEA 1DGSA 4HYOA 4DRXB 1MA1A 5B1AC 4PD4F 4J80A 1IXBA 1XMOO 3MDSA 4L8JA 4CS2A 4UCRA 4LF4B 2LW7A 1VQOV 2JRIA 3FAVA 2CTRA 2ZR2A 1WB7A 4JZ2A 4JI1B 5DN6G 2XNDG 1MSWD 3CSXA 2KKWA 1YHQV 2FMLA 3WU2Z 3B77A 4CBCA 3CRMA 4QPKA 4MW3A 4X64O 3H1LH 2GV9A 3OTOO 2WLKA 1AJPA 5D5QA 4OX9O 2XAJA 3ICXA 4NXNB 2HR3A 4XDJA 2JEXA 2UUCO 5H5NA 2YEVA 1B3QA 4X89A 2Q5ZA 3K0GA 2DMXA 3DXRB 2B9ZA 2ZXWC 2QTSA 1US6A 3SJCC 1HDJA 2Y4TA 2QKCA 4TV8A 4DR6B 1YIJV 5H2FZ 1YEWA 5TISZ 2JIZG 4OGQB 2YXYA 2VS0A 1OCZB 2ZNIA 3B8NA 4RO2A 1H2MA 2UXDB 4EFEA 3ZX6A 3UKMA 1VQ4V 1JA8A 4GUNA 4IHJB 4JTDB 1NR1A 3P3NA 4BIOA 4ICGA 2Y48A 4UVAA 3JARB 2XT9A 2YUAA 2N74A 2KB1A 1QLNA 3OFNG 3BFRA 1J5EB 1JOYA 1KU9A 2A0LA 2LGQA 1I7FA 4MSWC 1KC8W 4O4IB 1I94O 2H3OA 3CMEV 3CRQA 2A3QA 4FLUA 1Q6HA 4ZBMA 1NBMG 4EEQA 3F5TA 2H94A 4X8AA 5LA6A 1JQ0A 1V54C 2BOCC 1GMGA 2L6LA 2IBZH 4AI8A 1Y4MA 2F95B 4DV4B 4CH3A 1DLBA 1NTZH 1OZ0A 3SPGA 1YJWV 1Q43A 3JAKA 1MOFA 5IYCO 1ZX3A 5EYPA 1PP9H 5LP6C 1DTOA 5JH7B 3ZHRA 4MVZA 4DV3B 2P4KA 5KX5A 2QR4A 3CCSV 1S3JA 3ETQA 1AB3A 5J2UB 5BZBA 3T1HB 2JGDB 1SZTA 2CTPA 3CXCU 1I5XA 5KLVH 2Q73A 3K0DA 3H1IH 3N27A 3ZRVA 5B1OA 1VQ7V 1M90W 1HNZB 3QVNA 3E8GA 3LSQA 1Q3EA 2JGUA 1EN5A 3TETA 3OUFA 1FFXB 1WPXA 3LSUA 2V1DA 1QVGU 3B40A 4NXMO 3RT3C 5E1AC 3JCUZ 2LO1A 4JI7O 1ZL8A 3DGEA 1JFFB 1R6KA 4I55B 3HKBA 1Z5WA 3BA8A 4ZHQA 1XHZA 3SYCA 4FLXA 3ETEA 4GX1A 2X6CA 3BEHA 1GM7A 4B7KA 5KMGA 3K5LA 2NN4A 1AVMA 5KUKA 2YXLA 4LF4O 3LDCA 2WLIA 1IURA 4LP8A 3RYCB 4X1YB 1RP3B 4UXNA 2P67A 3JCZA 4JI1O 2LGWA 5B1NA 2GDSA 5GONA 4PDRA 4MVSA 4IGGA 1JPXA 4EB6B 1IBKB 4P9OA 3SPJA 1BHAA 5JJEB 4NXNO 4MS2A 2K9PA 4IYIA 2KG7A 3DSQA 1VQ9V 4X62O 2OT5A 3CD6V 5L3CA 1GN6A 4KFMA 5JCOA 1SESA 1S0VA 2IJIA 5LGUA 4DR6O 4YJ2B 5J9PC 5JCOC 4X88A 3ABTA 5FLXN 3D3IA 2CDYA 3EXAA 1IX9A 3WFVA 1OCCC 5LXTB 2ZD9A 1PD3A 1R6TA 3HKDB 4DUYB 3E8BA 2QM7A 3EVKA 3H9VA 1AI5A 4CH4A 2EILC 3ASOB 2IW5A 1N34O 1H38A 1NVPB 1BE3H 1XNQB 4WFHA 3Q4HA 1GN3A 2VQEB 3RW0A 3OR6C 1XDCA 1M4UA 1N33B 2UUAB 5EC1C 3HKEB 4I0XB 1GTOA 2OWOA 3R65A 1CEZA 2WLLA 3OAAG 2UXXA 5H6QA 2FTKA 1S5JA 5LOVB 2EX3A 1NU1H 5JJJB 2DQ3A 1QLEB 4FFBB 3RYIA 4DV4O 2Y4UA 1NI8A 3QO5A 5KAIZ 4K8XA 2XTAA 2LJ2A 3N2GB 2HJDA 4J7ZA 4B3RO 2W6IG 1TUBA 3AG4C 1BCCH 1Y74B 3L73H 4GX2A 2JK5C 3CC2V 1F4MA 2OCCC 1RPOA 4F6RB 1A32A 4TQFA 3O65A 2LW1A 4IIJB 2EIKB 1FXKC 4G27B 2BSKB 4GLXA 4KXRA 3PJSK 1UFIA 1YI2V 5BR8B 1KD1W 3VQVA 4UVBA 4FM2A 1TUEB 3SJBC 4PA6A 3CPWU 4XBFA 3X2QC 3SYAA 3JAWA 3WG7B 4DK0A 2QSAA 3IJ4A 2CGOA 3RVYA 1BS3A 3J81N 1E1QG 1YCIA 2GTAA 2OTLV 5JVDA 3F7VC 2ATKC 1H8HG 1M56B 4O4HA 4ZOLA 4LWSA 1NKDA 2EIJB 5IWAO 4HBNA 3J80N 1SZXA 2ITDC 4PA9A 4H13B 1K97A 2QKAA 1L8DA 4I4TA 4OX9B 1Q90D 2DWDC 3THOA 2DW4A 2UXBB 2BTQA 3JAMN 1RSOA 1G6UA 4W4KA 4DV7B 4DR1B 1IXMA 3E8FA 5LHHA 4N23A 1SETA 3CHXA 5B5EZ 4JI0B 2CE4A 1GK9A 1NR7A 2P5OA 1JCHA 3CB2A 1IBKO 1QR9A 1VQNV 4FLVA 4O2AA 1EZVH 4O4LB 2QJ1A 3ZRXA 1X4TA 2DQ0A 4AQYB 5L3FA 4B3TB 4U3JA 3D36A 3SDLA 4LF5B 2JJ1G 1M5IA 2AZ0A 3D36C 3KCYA 1IZ3A 4R7CA 1LUVA 5EZYA 4R6ZA 5C8YB 5IYZA 5J2TB 4FJCC 4BAYA 4LF6B 3AG7A 1NQTA 4DUYO 4B08A 4QJFB 2ARHA 4YY3B 2R9RB 5LL6Y 2IH1C 4X1IB 4LNUB 2CH7A 3JD3A 4CH6A 2XAFA 4DV1B 3SYQA 1FXHA 2YI8A 4LF8B 1RM1C 5LGNA 4JI4B 4DW1A 5IY5B 5IT9N 2X6AA 1SQPH 2VQEO 4WBNA 3ZN1A 1XNRB 5IDJA 4QNHB 3K5OA 5B1BC 1N33O 1KP3A 2ZQMA 1G1XB 3ZHUA 4J10A 2HKOA 3UT5B 2UUAO 3ZJZA 3CJHA 4QGPA 5B66Z 3ABUA 3WB2A 1EBOA 3DC5A 3K3WA 5IJ0A 3OMAB 1YSCA 2NLJC 4JI5B 4DR4B 3A0HZ 3CRCA 4MVUA 1B06A 1Q6IA 1E1RG 1QBZA 1BL8A 3JALA 2ZDIA 2WSSG 1QU7A 3U11A 2EJRA 2HFEC 2ZDIC 4MTOA 1K8AW 4NXMB 2R9AA 3QNEA 3FAVB 1K4CC 1AP6A 2ZR3A 4Z1MG 2A9HA 3U10A 3I56V 2FL4A 3HKCA 2M7WA 1MZFA 4NVPA 3K04A 1YXBA 2ZE8A 4TV9A 4TUYA 5BR8O 1SA0A 2Y0PA 3APQA 3CCRV 1CXZB 1N36B 2QWNB 1H8EG 2E74B 4OPAA 1YJNV 1XEQA 1PKXA 2Z3YA 3G71V 2YEVB 3G6BA 4JPRA 1LUWA 1FS0G 1OCOC 4O4JB 2QWQB 3GWOA 1R3LC 5JWPA 4WFBV 4B3MB 2IU3A 2OTJV 3N2KA 4UB6Z 2ZINA 4RUEA 3AEIA 3GVMA 4W4LA 3VQWA 4GKJB 2QE7G 3RYHA 3KG2A 2DYRC 2GSMB 1L0NH 4PI0A 2ADPA 1F4NA 4WF9V 2KQXA 1W59A 5L3EA 3SJAC 5DM6V 1KYOF 3BRCA 1FJGB 4FPPA 5CBGA 3JD2A 1VQ6V 4NTWA 4GX5A 3JD1A 1SF9A 4I50A 2N05A 2UXBO 5LYJB 4X62B 1YF2A 4O2BB 3JATB 2O57A 1IBLB 1AI6A 4I9WA 1R73A 4DV7O 4DR1O 2PYLA 1D2DA 1NZ6A 2VWJA 1NTKH 3CCMV 2DYSC 4TT3G 4JAUA 4LBEC 3W7SA 5KA6A 4FM0A 1M9NA 2NNUA 1CP9A 4JI0O 2GUZA 2QM8A 3AG3B 4WCEV 1GO3F 4DRXA 2Q67A 2YIAA 2A79B 1Q86W 2YICA 4J42A 4J11A 4AQYO 1GKFA 4B3TO 5LMUO 2EZPA 4LF5O 4NR1A 1N34B 4G28B 4FLZA 1F23A 4LH7A 5LP6B 4Q20A 3CCJV 5L3DA 4UB8Z 1U96A 1O9HA 2OCHA 1T5EA 2QDOA 5A9GA 4H33A 3FD9A 2PTMA 3TJTA 1MABG 3ASNB 2ODMA 4FZ1A 1QNMA 4LF6O 4BIUA 4YY3O 4YHHB 1WN7A 1R1BA 1AR1B 4XDLA 3JD4A 2ZT9B 3DXRA 3STZC 4LCUC 4FM1A 4DV1O 1VQKV 1S5LZ 4LF8O 2FB5A 4JI4O 1W0KG 3MAQA 4JI6B 5H6RA 3I55V 2RJZA 1XNRO 2WLJA 4B3RB 4PA3A 2P6JA 3K79A 1KB9F 4P2ZA 4DV2B 5KHIA
chains in the Genus database with same CATH topology
4P30A 1BMFG 3E8BA 2QM7A 3CMAV 2ZXWB 3ZN0A 1F51A 2F43G 1AI5A 1RM1B 1Y66A 3FB6C 3P30A 4MVRA 2EILC 5HFMA 3ASOB 1K5QA 2IW5A 3WG7C 1H38A 1NVPB 1B6QA 2W0FC 4JF3A 4KP4A 4WFHA 2WLMA 3M99B 3VBBA 1KECA 1PL0A 5B1BB 5CA3A 5C93A 1NJIW 3RW0A 3OR6C 4MT8A 4RUFA 1VQLV 1M56C 4MTXA 3K08A 4JYCA 4PA4A 2CK3G 1XL6A 5LHIA 1HWYA 5CBFA 5EC1C 4H37A 2QKSA 3E83A 1GTOA 4GT1A 3K9AA 2HVKC 3R65A 1AROP 1FXVA 2Q68A 1AJQA 2WLNA 1K34A 3FYIB 1LNQA 2WLLA 1CEZA 3OAAG 2UXXA 5H6QA 2FTKA 3SPCA 1ORQC 2BOBC 2IJHA 3ZCCA 2B5UA 2DQ3A 3ABLC 1QLEB 3CCUV 3FB7C 2IH3C 3QO5A 2HG5C 1VQPV 1Q82W 2QEXV 4PELA 2XAHA 5EK0A 1BHBA 3CYOA 3H01A 2EIMB 1KKDA 3T4ZA 2W6IG 3AG4C 3IFXA 4GX2A 2C2AA 2JK5C 4U7OA 3CC2V 1F4MA 1K7DA 1K4DC 1V54B 1RPOA 2OCCC 3OE7G 4JASA 4WFFA 2EIKB 1FXKC 4G27B 2B1IA 1MG1A 2Y69C 4L87A 3PJSK 3OMIB 3CC4V 4QIWF 3OM3B 1YI2V 2K1EA 1NH2D 4JTCB 1KD1W 3OEHG 3OR7C 4F4LA 4UVBA 1VQMV 1CPYA 1QR8A 1TUEB 3ETDA 4TSFG 2EBOA 3QO8A 4PA6A 4UV8A 4BW5A 4XBFA 3CPWU 2EZOA 3HB3B 3X2QC 1OCOB 3HPLC 3SYAA 5B3SC 3IC7A 1YJ9V 2HLDG 3WG7B 1YTFB 1S77D 2IJJA 2YSUB 3K06A 4QE7A 3RVYA 1E1QG 4FIPC 1EZJA 3SPHA 2OTLV 4I5SA 3RVZA 1N8RW 4E2LA 3E35A 3F7VC 3CCVV 2ATKC 1H8HG 2Q69A 3SJQC 3SYOA 3ABKB 2DYRB 1M56B 1VQ8V 3W7WA 4J9ZB 3ZMVA 4JGSA 1NKDA 2EIJB 2X6BA 1WLEA 4RAIA 3CP1A 2ITDC 3LNMB 4UUJC 4PA9A 2XAGA 1K97A 2X7RB 1AJNA 3T1CA 1ENVA 4JYBA 3E86A 5L3GA 1OCZC 2LFRA 3ABLB 3AG3C 2GHYA 2DWDC 3OMNB 5L3BA 2DW4A 2EINC 1Q7YW 3RBZA 3OGCC 4WFAV 2DYSB 5IYBO 1OCRB 3UM7A 3CCLV 4CZZA 5CN0A 1IXMA 1V55C 3AG2B 3E8FA 5LHHA 4N23A 3E8HA 2R9IA 4UV9A 1SETA 3F5WC 4UVCA 1DF5A 1GK9A 1FXKB 4RQFA 1NR7A 4HYOA 5B1AC 1JCHA 3ZIAG 1G8MA 1QR9A 2AHYA 1W2BU 1VQNV 4GX0A 3ASNC 3ZRXA 3OW2U 2DQ0A 4HZ3A 1VQOV 5L3FA 2WLIB 3D36A 3SYPA 2ZR2A 2JJ1G 1RPRA 3X2QB 5KA5A 2Q6AA 5DN6G 2B1GA 2XNDG 1MSWD 4R7CA 1YHQV 2JJ2G 3NXSA 4WFGA 3ZMTA 3B77A 5EBLC 1JJ2U 4R6ZA 4CBCA 4QPKA 4FJCC 4BAYA 4MW3A 3OUSA 1THZA 3ABMB 3TK1A 2WLKA 3FB5C 1NQTA 4N21A 1KQSU 4MW8A 1AJPA 4QE9A 3MHSC 2XAJA 4QJFB 2HR3A 3OEEG 4XDJA 2JEXA 2R9RB 2YEVA 4G2KA 5LGTA 2IH1C 4X89A 3MHHC 2DWEC 3ZRWB 3K0GA 1FFTB 3JD3A 5IYDO 2W6JG 4XDKA 2XAFA 2ZXWC 2P7TC 4PDVA 1FXHA 3SYQA 1RM1C 2D3OW 5LGNA 2LFSA 1GM9A 1YIJV 1ROPA 1S76D 1AI7A 3ASOC 1OCCB 2JIZG 5IY5B 2JDIG 2X6AA 3SPIA 1SERA 1OCZB 3ZN1A 5IDJA 4MTFA 4QNHB 3B8NA 4RO2A 5B1BC 3E2EA 2LP7A 1KP3A 2ZQMA 4FMTA 1JX9A 3UKMA 5CBHA 1VQ4V 3LUTB 2EILB 2HKOA 2IU0A 4KUMA 3ZJZA 2UXNA 4JTDB 1NR1A 3MD0A 4MTGA 2Y48A 3ABUA 4UVAA 1EBOA 4FK5C 4PA7A 3CC7V 3IGAC 3K3WA 4JAVA 3ML0A 5LBQA 3OMAB 2KB1A 1YSCA 2NLJC 1QLNA 3OFNG 1I5YA 1JOYA 2QTOA 2A0LA 4MVUA 1E1RG 1QBZA 1NH2B 1BL8A 3G6EV 2ZDIA 4MSWC 2WSSG 1KC8W 3FYEB 1JVMA 3E89A 3GB7C 4GCZA 2EJRA 4BIZA 3QO7A 2HFEC 3CMEV 3ZMSA 2EIMC 2ZDIC 4MTOA 4ZBMA 1NBMG 4LC1A 1K8AW 2HVJC 1QVFU 3ZRSA 3QNEA 3STLC 1W0JG 2H94A 1K4CC 4X8AA 1NVPD 4PDLA 2ZR3A 4Z1MG 3DTUB 1PNMA 1JQ0A 1K33A 2A9HA 2WLLB 3I56V 1V54C 1XL4A 5EBWC 1G4YB 2BOCC 1GMGA 2M7WA 4DO2A 3K04A 1Y4MA 2EIKC 3VOUA 5KUMA 1R3IC 1DLBA 3AG4B 4PDMA 3TCUA 1SRYA 4DXWA 1OZ0A 3JYCA 3SPGA 3CCRV 1YJWV 2OCCB 1MOFA 1H8EG 5IYCO 1PNKA 1K3EA 4HAMA 4R8CA 1YJNV 1K73W 2XOKG 1VQ5V 1DTOA 1PKXA 2Z3YA 2Z5UA 5FL7G 3G71V 2YEVB 2Y69B 3LSSA 5LHGA 4MVZA 4JPRA 5GW7A 1FS0G 1OCOC 4JTAB 2JEUA 1GM8A 1Q81W 3GWOA 3CCSV 1R3LC 1S3JA 3P32A 4WFBV 2IU3A 2OTJV 5BZBA 4MVQA 3K03A 2P90A 2WPDG 1YITV 1SZTA 3CXCU 3AG1C 5EC2C 1COWG 1I5XA 4RUEA 3CCEV 3W7UA 3AEIA 3FB8C 4R50A 2QE7G 3K0DA 2ITCC 5B3SB 3W7XA 3ZRVA 3KG2A 3ABKC 5B1OA 2DYRC 1VQ7V 1M90W 1M57C 2GSMB 1K9MW 3E8GA 3LSQA 3EFFK 3TETA 3A0RA 3OUFA 1S72V 1F4NA 1WPXA 4WF9V 2V1DA 1L1FA 3FKSG 5L3EA 3EHBB 5DM6V 2EIJC 3F7YC 1QVGU 4FPPA 5E1AC 5CBGA 3B8MA 3BY6A 4J9YB 3JD2A 4TWKA 2MK3A 1VQ6V 2V7QG 2QA4V 2PI4A 4GX5A 3JD1A 1R3KC 3DGEA 3W7TA 4MVOA 1R6KA 1AI6A 4EKWA 3CCQV 1AI4A 4I9WA 1R73A 3SYCA 4MVMA 3CCMV 2DYSC 4TT3G 3G4SV 4JAUA 4LBEC 3W7SA 1DF4A 1OCRC 5KA6A 1M9NA 2WLHA 2NNUA 1CP9A 2XASA 4ASUG 1UJWB 1YTFD 1J95A 1H2GA 3AG2C 1OHHG 1FXKA 2QM8A 3AG3B 4WCEV 3ETEA 4GX1A 2X6CA 3BEHA 1GO3F 5EBMC 1GM7A 2EINB 4OXSA 5KUKA 2Q67A 1P7BA 3ZMUA 1PNLA 2A79B 1Q86W 1S5HC 3LDCA 1GKFA 1K5SA 2WLIA 1V55B 4LP8A 2WWWA 2XAQA 2EZPA 2X0LA 2IJKA 4ZKIA 1P4RA 2P67A 3JCZA 1F23A 3LDDA 4G28B 4UXNA 5B1NA 4Q20A 5H9CA 1R3JC 3CCJV 3JD0A 5CMUA 5L3DA 4PDRA 4MVSA 4H33A 5B1AB 3LDEA 1EFRG 1MABG 3T2MA 5HFLA 3ASNB 1JPXA 1QLEC 4WFEA 2AHZA 1R6NA 4U7NA 2PI5A 3ZMZA 4P9OA 3SPJA 2WAMA 1BHAA 4BIUA 4P9PA 3AG1B 4QPJA 3ABMC 4MS2A 1AR1B 4XDLA 4YXWG 3ZRWA 1VQ9V 2H8PC 3JD4A 3ETGA 2OT5A 3STZC 3CD6V 4LCUC 5L3CA 1M57B 2HJFC 1VQKV 4KFMA 1SESA 1S0VA 2IJIA 5LGUA 1E79G 1W0KG 3T4DA 5J9PC 1ZWIC 4X88A 3ABTA 5H6RA 3I55V 3D3IA 3WFVA 1M1KW 2WLJA 4PA3A 1OCCC 1KP2A 2P6JA 2ZD9A 3K79A 5IY5C 1PD3A 4RQEA 4P2ZA 1QCEA 1K92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVF U;  1JJ2 U;  1YIJ V;  3CMA V;  1YI2 V;  1K9M W;  3G71 V;  1N8R W;  1VQ9 V;  3CCM V;  3CCV V;  3G4S V;  1S72 V;  3CD6 V;  1VQN V;  1W2B U;  4WF9 V;  1KD1 W;  3I56 V;  3CCJ V;  1VQK V;  1Q7Y W;  5DM6 V;  1QVG U;  3OW2 U;  1VQ8 V;  2OTL V;  1VQM V;  4WFA V;  1KQS U;  4WCE V;  1Q81 W;  3CCS V;  4WFB V;  1VQO V;  2OTJ V;  3CC2 V;  3CPW U;  3CCL V;  3G6E V;  1VQ4 V;  1VQ6 V;  2QA4 V;  1KC8 W;  1YIT V;  3CXC U;  1YJ9 V;  3I55 V;  3CCE V;  3CCR V;  1Q86 W;  1YJW V;  3CME V;  1M1K W;  3CCQ V;  3CCU V;  1K73 W;  1YJN V;  3CC7 V;  1R73 A;  2D3O W;  1NJI W;  1VQP V;  1VQ7 V;  1Q82 W;  1YHQ V;  1K8A W;  1VQL V;  1M90 W;  2QEX V;  3CC4 V;  1VQ5 V; 
#chains in the Genus database with same CATH topology
 4IHJ A;  1MNG A;  3BA9 A;  1OJH A;  3E22 B;  3JAR A;  1WA8 B;  1UPG A;  1VF7 A;  2W0F C;  1AR5 A;  1SQB H;  4JI5 O;  4DR4 O;  4DW0 A;  1KEC A;  2F93 B;  2F66 C;  4X1K B;  1TA8 A;  4RUF A;  1VQL V;  4PA4 A;  4O4I A;  2A06 H;  5LHI A;  5CBF A;  4H37 A;  3G67 A;  1I0H A;  1ARO P;  3FYI B;  2WLN A;  3CEI A;  2BOB C;  4JAA A;  5JJN B;  3CCU V;  1EM1 A;  1VQP V;  1XI1 A;  4PEL A;  2G38 A;  2CTW A;  2EIM B;  1SQG A;  3T4Z A;  1N36 O;  1OV9 A;  4IT5 A;  5IWA B;  2C2A A;  4ZIB A;  4U7O A;  5IJ9 B;  5JH7 A;  1DK1 A;  1K4D C;  3OE7 G;  4JAS A;  1BZK A;  4L87 A;  1JR9 A;  4B3M O;  5J2U A;  3OMI B;  4JYA B;  2JGD A;  5CB4 B;  1L0L H;  3OM3 B;  4YJ3 B;  2K1E A;  4UCU A;  3ZED A;  2PGG A;  4GKJ O;  1Y76 B;  4B7E A;  3OR7 C;  1D5A A;  2M6Y A;  1VQM V;  4FZ0 A;  3ETD A;  4TSF G;  2EBO A;  4BW5 A;  2EZO A;  1FFX A;  3IC7 A;  4DV5 B;  1YTF B;  1M93 A;  1FJG O;  1S77 D;  4DK1 A;  4QE7 A;  1EZJ A;  2YID A;  4I5S A;  4HNA B;  3E35 A;  3CCV V;  1JFF A;  3ABK B;  1IBL O;  4I55 A;  4J9Z B;  1KBH A;  1WLE A;  4RAI A;  3AK2 A;  4UUJ C;  5FNV B;  5K1X A;  5KHK A;  5CA0 B;  3CX5 F;  3ZS8 C;  5E79 Z;  3C90 A;  4KHP B;  3E86 A;  5L3G A;  4UCT A;  5L3B A;  1Q7Y W;  1GN4 A;  3OGC C;  2MW2 B;  4WFA V;  3RYC A;  4X1Y A;  1OCR B;  2F1M A;  3AG2 B;  1FKA O;  3GWK C;  2FKX A;  2JVD A;  3F5W C;  3O9O A;  1DF5 A;  4YIP A;  1FXK B;  4RQF A;  4UFZ A;  2CUG A;  4EB6 A;  1VEW A;  3R66 A;  1W2B U;  4NTY A;  4GX0 A;  4YHH O;  2P4V A;  4HZ3 A;  1N32 B;  4TOI A;  3SYP A;  3IAY A;  3X2Q B;  5KA5 A;  2Q6A A;  4PHZ A;  2B1G A;  3APO A;  2JJ2 G;  3NXS A;  4YJ2 A;  3CE2 A;  4JI6 O;  2XUM A;  3ABM B;  5LXT A;  3BAB A;  3FB5 C;  1FAF A;  3HKD A;  1KQS U;  4DV2 O;  3MHS C;  3WB1 A;  1I08 A;  4G2K A;  5LGT A;  3JAS B;  4ZI7 B;  3T1Y B;  4DR5 B;  2DWE C;  4I7Z B;  3ZRW B;  1FFT B;  5IYD O;  2W6J G;  4XDK A;  2P7T C;  4PDV A;  1MSD A;  3ZBH A;  2D3O W;  5BXZ A;  2AZ2 A;  2LFS A;  1GM9 A;  5KAF Z;  3ASO C;  2JDI G;  1WP7 A;  4Z2W A;  5FPR A;  4MTF A;  3H1H H;  1BGY H;  2UUB B;  5KHJ A;  4TQD A;  2LP7 A;  4FMT A;  5CBH A;  3B2E E;  4AHC A;  2ZNJ A;  3BPZ A;  3LUT B;  2IU0 A;  4KUM A;  3HKE A;  2UXN A;  3MD0 A;  4I0X A;  4MTG A;  3K57 A;  2PF4 E;  3ML0 A;  5LOV A;  1ZSP A;  4FFB A;  1RFY A;  4C7U A;  1WB8 A;  2CGN A;  4GKK B;  3N2G A;  3ZHQ A;  4UCO A;  1NH2 B;  3G6E V;  2ZCE A;  1QHT A;  1Y74 A;  1JVM A;  4GCZ A;  4BIZ A;  3QO7 A;  3ZMS A;  1N4C A;  4JV5 B;  1QVF U;  4JI3 B;  4F6R A;  3ZRS A;  1W0J G;  3OGI B;  4IIJ A;  1NVP D;  4PDL A;  2BSK A;  4BW9 A;  3G80 A;  1PNM A;  1K33 A;  2JS5 A;  4FLT A;  5EBW C;  1G4Y B;  2ADQ B;  3PN1 A;  4JYA O;  2EIK C;  1R3I C;  2NR5 A;  1AR4 A;  5F2V O;  2BE3 A;  2A7W A;  1K3E A;  4HAM A;  4R8C A;  1K73 W;  2XOK G;  1H2S B;  1VQ5 V;  3RN4 A;  3C3T A;  4DV5 O;  3RYF B;  5FL7 G;  1VF5 B;  2ZE6 A;  2Y69 B;  4JTA B;  2XHB A;  4DYL A;  2JEU A;  1GM8 A;  2Q0O C;  3H1K H;  4X66 B;  4MVQ A;  2WPD G;  5JQG B;  5LMU B;  3AG1 C;  1COW G;  2D2C B;  2E75 B;  1AP5 A;  3W7U A;  5CA1 B;  4R50 A;  5BMV B;  3W7X A;  2P22 C;  5B3S B;  4U3F H;  1M57 C;  4CH5 A;  3TXQ A;  4X65 B;  3OD4 A;  3A8T A;  1L1F A;  3EHB B;  2EIJ C;  3QF7 A;  1YZB A;  4J41 A;  4KHP O;  3B8M A;  3BY6 A;  4J9Y B;  1BSM A;  4JI2 O;  4TWK A;  2MK3 A;  2QA4 V;  1R3K C;  3W7T A;  1BT8 A;  4MVO A;  2RQ6 A;  1WPB A;  2RDC A;  1P84 F;  4EKW A;  3CCQ V;  1AI4 A;  1TVK B;  4FFK A;  4Q6G A;  1H2L A;  4PI2 A;  2XAS A;  2ZKO A;  4ASU G;  1UJW B;  1J95 A;  1H2G A;  3QG5 A;  2DOS A;  2EIN B;  4OXS A;  2RMK B;  3FFQ A;  4O4L A;  1HNX O;  1PNL A;  1S5H C;  5ITZ B;  3L74 H;  1N32 O;  1V55 B;  2XAQ A;  2Y0I A;  2IJK A;  4ZKI A;  2JS3 A;  3LDD A;  3BHP A;  5H9C A;  1R3J C;  1VF6 A;  1WJZ A;  5B1A B;  5C8Y A;  3LDE A;  4D6T H;  5J2T A;  1EFR G;  1XMQ B;  1VF6 C;  3AK3 A;  4BWA A;  2BCC H;  4X20 B;  4WFE A;  1R6N A;  2DJV A;  4DR3 B;  2WAM A;  4P9P A;  4LFA O;  3T1Y O;  4DR5 O;  1GRJ A;  2GTS A;  4X1I A;  4K0K B;  4K35 A;  4LNU A;  1TAE A;  2F23 A;  3AK1 A;  4NYK A;  2QWR B;  2R70 A;  3S3X A;  5EIB C;  1V9P A;  1IVS A;  1O9G A;  2UU9 B;  1M1K W;  2UUB O;  1BQ0 A;  1KP2 A;  4H0L B;  5IY5 C;  4RQE A;  1VAR A;  2QWO B;  1K92 A;  4P30 A;  1JJO A;  1BMF G;  3CMA V;  3UT5 A;  2ZXW B;  2PY5 A;  4NB5 A;  3ZN0 A;  1F51 A;  1XHX A;  1Q6U A;  4FVM A;  1BQZ A;  3B4S A;  1MMM A;  5HFM A;  1B6Q A;  2YIB A;  4KP4 A;  4TV8 B;  2WLM A;  1PL0 A;  2FYU H;  4GKK O;  2AGA A;  1NJI W;  3M8A A;  1LR1 A;  2DE0 X;  4JYC A;  2Q7E A;  4UCS A;  3KKY A;  2CK3 G;  4GZR B;  4JV5 O;  2VRZ A;  4JI3 O;  4LF9 B;  4GT1 A;  5EIB D;  1FXV A;  2Q68 A;  1K34 A;  1LNQ A;  1ZAU A;  4DR2 B;  1HR0 B;  2B5U A;  3ABL C;  2VQF B;  1Q82 W;  2QEX V;  3OTF A;  1P7G A;  1XQ8 A;  2QGN A;  1BHB A;  3CYO A;  5D5P A;  1GN2 A;  3IFX A;  1YVW A;  4YIO A;  3B09 A;  1H2N A;  1K7D A;  1V54 B;  4O4J A;  5LA6 B;  1XBL A;  2B1I A;  2YIB D;  4X66 O;  2E76 B;  2Q8V A;  4E4E A;  3CC4 V;  4QIW F;  1XOU A;  4JTC B;  2R72 A;  2KSD A;  3P3P A;  3JAK B;  3HB3 B;  1SQF A;  5EYP B;  1PV0 A;  2YC0 A;  3WB0 A;  4X65 O;  3SGI A;  1YJ9 V;  3L75 H;  2OIG A;  2HLD G;  4DR7 B;  3BCC H;  2YSU B;  3K06 A;  4FIP C;  3K5M A;  5KX5 B;  1VMG A;  3RVZ A;  1N0J A;  4E2L A;  5LYJ A;  1SKV A;  2Q69 A;  4O2B A;  3SJQ C;  3JAT A;  2ILM A;  1HNW B;  3ZMV A;  4JGS A;  3K9S A;  3JSL A;  3CP1 A;  3LNM B;  4J7K A;  2X7R B;  5GTH Z;  1AJN A;  2ETN A;  5DED A;  3T1C A;  1ENV A;  4JYB A;  4CS4 A;  1OCZ C;  2LFR A;  3AG3 C;  2GHY A;  1ZL8 B;  4DUZ B;  3RBZ A;  2AXT Z;  3UM7 A;  3HKB B;  4ZHQ B;  5LP6 A;  1N0N A;  2R9I A;  1D5N A;  1WAZ A;  4UVC A;  1FYJ A;  3ZHS A;  1XMQ O;  1IBM O;  4DR3 O;  5KMG B;  4X9Q A;  1G8M A;  2AHY A;  4NTX A;  3ZIA G;  5LMN O;  3CXH F;  3ASN C;  3OW2 U;  3M7M X;  4K0K O;  2WLI B;  1KMI Z;  1RPR A;  3CS5 A;  1Y67 A;  2OYQ A;  5GON B;  2ZM6 O;  4WFG A;  3ZMT A;  5EBL C;  1JJ2 U;  2UU9 O;  1SQQ H;  3OUS A;  1THZ A;  3TK1 A;  3UO3 A;  1SC5 B;  4N21 A;  4MW8 A;  1X59 A;  2DN9 A;  4QE9 A;  3OEE G;  2ZE5 A;  2LQT A;  2GBO A;  2Q4P A;  3MHH C;  2KG7 B;  3E22 A;  5KHG A;  1B04 A;  3IC9 A;  3RGB A;  1WA8 A;  5BY1 A;  1ROP A;  1S76 D;  1AI7 A;  1XRE A;  1OCC B;  5FPO A;  3SPI A;  1SER A;  2OIE A;  4X1K A;  4LFC B;  4DV6 B;  3E2E A;  1VP7 A;  1JX9 A;  4H44 B;  2EIL B;  4LF9 O;  4LR3 A;  5IE9 A;  3CC7 V;  4FK5 C;  4PA7 A;  4DV0 B;  3IGA C;  4JAV A;  2F4V B;  5LBQ A;  4DR2 O;  3L70 H;  1HR0 O;  1QQC A;  1ZUQ A;  4LF7 B;  1I5Y A;  1F7Y A;  2VQF O;  3Q4H B;  2QTO A;  4PV1 B;  2UXC B;  3FYE B;  3E89 A;  3GB7 C;  3VQX A;  4IYH A;  4JZG A;  2EIM C;  5IJ9 A;  3L9D A;  4LC1 A;  1WP8 A;  2HVJ C;  2Q9L A;  2YDE A;  3STL C;  4FLW A;  3UO2 A;  3LNN A;  4JI2 B;  3DTU B;  2WLL B;  1XL4 A;  2EUL A;  3K58 A;  3C3S A;  4DO2 A;  5CB4 A;  4YJ3 A;  2E3C A;  3VOU A;  2Q7G A;  5KUM A;  2IM9 A;  3RYI B;  3AG4 B;  5A2Q N;  4PDM A;  3TCU A;  1Y76 A;  2HEP A;  4LH6 A;  1SRY A;  4DXW A;  3JYC A;  2UXD O;  1TUB B;  2OCC B;  1PNK A;  1NTM H;  2Z5U A;  4DR7 O;  3LSS A;  5LHG A;  2N04 A;  5GW7 A;  3VQY A;  4JI8 B;  4RWU A;  1HNX B;  2WA3 A;  1Q81 W;  3P32 A;  1P49 A;  4HNA A;  1ZLZ A;  2AW9 A;  1YDX A;  3K03 A;  2P90 A;  1J5E O;  1YIT V;  4B3S B;  5EC2 C;  1U97 A;  3A0B Z;  3I5D A;  3K59 A;  3CCE V;  4PJ0 Z;  3FB8 C;  2E5L B;  2ITC C;  1HNW O;  2HHH B;  3ABK C;  4J7J A;  4OPH A;  1HW7 A;  4K8Z A;  1K9M W;  1HP8 A;  2QWP B;  4A5U B;  3EFF K;  1S72 V;  3A0R A;  5FNV A;  1VIB A;  3DC6 A;  3FKS G;  3JAW B;  1KUQ A;  1Z2G A;  5CA0 A;  3F7Y C;  2RN9 A;  3BVO A;  3TXS A;  1NT2 B;  5DEC A;  4EFB A;  2V7Q G;  2PI4 A;  2WA4 A;  4LFA B;  4DUZ O;  4BR6 A;  5JVD B;  3L71 H;  1WNS A;  4GYC B;  4O4H B;  4ZOL B;  4MVM A;  4LFB B;  3G4S V;  4LWS B;  1DF4 A;  1OCR C;  1GAX A;  2WLH A;  1YTF D;  1Q5O A;  3AG2 C;  1OHH G;  1FXK A;  5EBM C;  1ZTE A;  1XIL A;  4I4T B;  4DV3 O;  2YS8 A;  4ABM A;  1P7B A;  3ZMU A;  1FD9 A;  4D7S A;  1K5S A;  3T1H O;  3KZI Z;  1URF A;  2BTQ B;  2WWW A;  1FPO A;  1RSO B;  2X0L A;  2RNB A;  1P4R A;  3JD0 A;  5CMU A;  1HNZ O;  2CAZ C;  5GTI Z;  3T2M A;  5HFL A;  1QLE C;  2AHZ A;  4U7N A;  2PI5 A;  3ZMZ A;  4UCV A;  4O2A B;  1XMO B;  3UQ8 A;  3AG1 B;  4QPJ A;  3ABM C;  3JAS A;  4ZI7 A;  5KHH A;  4YXW G;  2ZE7 A;  4F6E A;  3ZRW A;  2H8P C;  3ETG A;  3CRA A;  4K3A A;  1Y6X A;  4U3J B;  3NR7 A;  1M57 B;  2HJF C;  2QM4 A;  2ZIM A;  2BTO A;  4D7T A;  2Q0A A;  1E79 G;  2W0X A;  4IL6 Z;  3T4D A;  1ZWI C;  5EZY B;  5IYZ B;  4X64 B;  4LFC O;  4DV6 O;  2PYJ A;  3OTO B;  1NS1 A;  3L72 H;  1QCE A;  4Z1V A;  2UUC B;  2F43 G;  1RM1 B;  1Y66 A;  3FB6 C;  3P30 A;  5K1P A;  4MVR A;  2CH7 B;  4DV0 O;  1K5Q A;  3WG7 C;  1SS3 A;  2F4V O;  4CC5 A;  4JF3 A;  2EJ7 A;  4LF7 O;  1IDS A;  3QTC A;  3M99 B;  3VBB A;  2YI9 A;  5B1B B;  5CA3 A;  3HR0 A;  3D3Q A;  3S3W A;  5C93 A;  4NKG B;  2L35 A;  4WBN B;  2UXC O;  4MT8 A;  3FX7 A;  1M56 C;  4MTX A;  4CS3 A;  3K08 A;  3KCX A;  1AIL A;  1XL6 A;  1HWY A;  2QKS A;  3E83 A;  3CJH B;  4JYY A;  3K9A A;  1Z5V A;  2HVK C;  3CRR A;  1AJQ A;  1GH6 A;  2P06 A;  3UCS C;  5IJ0 B;  3D8C A;  3SPC A;  1ORQ C;  2IJH A;  3ZCC A;  1XUQ A;  2YXH A;  3JSN A;  3FB7 C;  2IH3 C;  2HG5 C;  4CC6 A;  2XAH A;  5EK0 A;  3H01 A;  3JAL B;  1KKD A;  1I94 B;  3RYF A;  3ZHT A;  2PZS A;  4JI8 O;  1Q8I A;  1PM9 A;  3ZHV A;  4WFF A;  1MG1 A;  2Y69 C;  3RFR A;  3HKC B;  3BAA A;  5JQG A;  4KL1 A;  1XNQ O;  4B3S O;  4TV9 B;  1NH2 D;  4TUY B;  1JMK C;  5CA1 A;  1SA0 B;  5BMV A;  3OEH G;  2E5L O;  4F4L A;  2HHH O;  1PL4 A;  2V4D A;  1CPY A;  1QR8 A;  2Z0A A;  2PUS A;  3QO8 A;  4UV8 A;  3K5N A;  1OCO B;  3HPL C;  3CWB H;  5B3S C;  1H2K A;  3RWR D;  1IBM B;  1KKC A;  2IJJ A;  2HP8 A;  5LMN B;  3SPH A;  1N8R W;  3N2K B;  3SYO A;  1EN4 A;  5AG2 A;  2DYR B;  3TGU H;  1VQ8 V;  1TVK A;  1SQV H;  3J7A U;  3W7W A;  4LFB O;  3RYH B;  3SR2 C;  2X6B A;  2RCV A;  2ZM6 B;  4AIL C;  3U0Z A;  1TGO A;  3A2F A;  2XAG A;  4I9Q A;  1SQX H;  3ABL B;  4JI7 B;  2ZIO A;  3OMN B;  5ITZ A;  4I50 B;  2EIN C;  1EN6 A;  2VWK A;  2CTQ A;  2DYS B;  5IYB O;  4FLY A;  3CCL V;  4CZZ A;  5CN0 A;  1V55 C;  3H1J H;  2Q7H A;  3E8H A;  4UV9 A;  1PPJ H;  2GUZ B;  3OT7 A;  4X20 A;  1MZE A;  1DGS A;  4HYO A;  4DRX B;  1MA1 A;  5B1A C;  4PD4 F;  4J80 A;  1IXB A;  1XMO O;  3MDS A;  4L8J A;  4CS2 A;  4UCR A;  4LF4 B;  2LW7 A;  1VQO V;  2JRI A;  3FAV A;  2CTR A;  2ZR2 A;  1WB7 A;  4JZ2 A;  4JI1 B;  5DN6 G;  2XND G;  1MSW D;  3CSX A;  2KKW A;  1YHQ V;  2FML A;  3WU2 Z;  3B77 A;  4CBC A;  3CRM A;  4QPK A;  4MW3 A;  4X64 O;  3H1L H;  2GV9 A;  3OTO O;  2WLK A;  1AJP A;  5D5Q A;  4OX9 O;  2XAJ A;  3ICX A;  4NXN B;  2HR3 A;  4XDJ A;  2JEX A;  2UUC O;  5H5N A;  2YEV A;  1B3Q A;  4X89 A;  2Q5Z A;  3K0G A;  2DMX A;  3DXR B;  2B9Z A;  2ZXW C;  2QTS A;  1US6 A;  3SJC C;  1HDJ A;  2Y4T A;  2QKC A;  4TV8 A;  4DR6 B;  1YIJ V;  5H2F Z;  1YEW A;  5TIS Z;  2JIZ G;  4OGQ B;  2YXY A;  2VS0 A;  1OCZ B;  2ZNI A;  3B8N A;  4RO2 A;  1H2M A;  2UXD B;  4EFE A;  3ZX6 A;  3UKM A;  1VQ4 V;  1JA8 A;  4GUN A;  4IHJ B;  4JTD B;  1NR1 A;  3P3N A;  4BIO A;  4ICG A;  2Y48 A;  4UVA A;  3JAR B;  2XT9 A;  2YUA A;  2N74 A;  2KB1 A;  1QLN A;  3OFN G;  3BFR A;  1J5E B;  1JOY A;  1KU9 A;  2A0L A;  2LGQ A;  1I7F A;  4MSW C;  1KC8 W;  4O4I B;  1I94 O;  2H3O A;  3CME V;  3CRQ A;  2A3Q A;  4FLU A;  1Q6H A;  4ZBM A;  1NBM G;  4EEQ A;  3F5T A;  2H94 A;  4X8A A;  5LA6 A;  1JQ0 A;  1V54 C;  2BOC C;  1GMG A;  2L6L A;  2IBZ H;  4AI8 A;  1Y4M A;  2F95 B;  4DV4 B;  4CH3 A;  1DLB A;  1NTZ H;  1OZ0 A;  3SPG A;  1YJW V;  1Q43 A;  3JAK A;  1MOF A;  5IYC O;  1ZX3 A;  5EYP A;  1PP9 H;  5LP6 C;  1DTO A;  5JH7 B;  3ZHR A;  4MVZ A;  4DV3 B;  2P4K A;  5KX5 A;  2QR4 A;  3CCS V;  1S3J A;  3ETQ A;  1AB3 A;  5J2U B;  5BZB A;  3T1H B;  2JGD B;  1SZT A;  2CTP A;  3CXC U;  1I5X A;  5KLV H;  2Q73 A;  3K0D A;  3H1I H;  3N27 A;  3ZRV A;  5B1O A;  1VQ7 V;  1M90 W;  1HNZ B;  3QVN A;  3E8G A;  3LSQ A;  1Q3E A;  2JGU A;  1EN5 A;  3TET A;  3OUF A;  1FFX B;  1WPX A;  3LSU A;  2V1D A;  1QVG U;  3B40 A;  4NXM O;  3RT3 C;  5E1A C;  3JCU Z;  2LO1 A;  4JI7 O;  1ZL8 A;  3DGE A;  1JFF B;  1R6K A;  4I55 B;  3HKB A;  1Z5W A;  3BA8 A;  4ZHQ A;  1XHZ A;  3SYC A;  4FLX A;  3ETE A;  4GX1 A;  2X6C A;  3BEH A;  1GM7 A;  4B7K A;  5KMG A;  3K5L A;  2NN4 A;  1AVM A;  5KUK A;  2YXL A;  4LF4 O;  3LDC A;  2WLI A;  1IUR A;  4LP8 A;  3RYC B;  4X1Y B;  1RP3 B;  4UXN A;  2P67 A;  3JCZ A;  4JI1 O;  2LGW A;  5B1N A;  2GDS A;  5GON A;  4PDR A;  4MVS A;  4IGG A;  1JPX A;  4EB6 B;  1IBK B;  4P9O A;  3SPJ A;  1BHA A;  5JJE B;  4NXN O;  4MS2 A;  2K9P A;  4IYI A;  2KG7 A;  3DSQ A;  1VQ9 V;  4X62 O;  2OT5 A;  3CD6 V;  5L3C A;  1GN6 A;  4KFM A;  5JCO A;  1SES A;  1S0V A;  2IJI A;  5LGU A;  4DR6 O;  4YJ2 B;  5J9P C;  5JCO C;  4X88 A;  3ABT A;  5FLX N;  3D3I A;  2CDY A;  3EXA A;  1IX9 A;  3WFV A;  1OCC C;  5LXT B;  2ZD9 A;  1PD3 A;  1R6T A;  3HKD B;  4DUY B;  3E8B A;  2QM7 A;  3EVK A;  3H9V A;  1AI5 A;  4CH4 A;  2EIL C;  3ASO B;  2IW5 A;  1N34 O;  1H38 A;  1NVP B;  1BE3 H;  1XNQ B;  4WFH A;  3Q4H A;  1GN3 A;  2VQE B;  3RW0 A;  3OR6 C;  1XDC A;  1M4U A;  1N33 B;  2UUA B;  5EC1 C;  3HKE B;  4I0X B;  1GTO A;  2OWO A;  3R65 A;  1CEZ A;  2WLL A;  3OAA G;  2UXX A;  5H6Q A;  2FTK A;  1S5J A;  5LOV B;  2EX3 A;  1NU1 H;  5JJJ B;  2DQ3 A;  1QLE B;  4FFB B;  3RYI A;  4DV4 O;  2Y4U A;  1NI8 A;  3QO5 A;  5KAI Z;  4K8X A;  2XTA A;  2LJ2 A;  3N2G B;  2HJD A;  4J7Z A;  4B3R O;  2W6I G;  1TUB A;  3AG4 C;  1BCC H;  1Y74 B;  3L73 H;  4GX2 A;  2JK5 C;  3CC2 V;  1F4M A;  2OCC C;  1RPO A;  4F6R B;  1A32 A;  4TQF A;  3O65 A;  2LW1 A;  4IIJ B;  2EIK B;  1FXK C;  4G27 B;  2BSK B;  4GLX A;  4KXR A;  3PJS K;  1UFI A;  1YI2 V;  5BR8 B;  1KD1 W;  3VQV A;  4UVB A;  4FM2 A;  1TUE B;  3SJB C;  4PA6 A;  3CPW U;  4XBF A;  3X2Q C;  3SYA A;  3JAW A;  3WG7 B;  4DK0 A;  2QSA A;  3IJ4 A;  2CGO A;  3RVY A;  1BS3 A;  3J81 N;  1E1Q G;  1YCI A;  2GTA A;  2OTL V;  5JVD A;  3F7V C;  2ATK C;  1H8H G;  1M56 B;  4O4H A;  4ZOL A;  4LWS A;  1NKD A;  2EIJ B;  5IWA O;  4HBN A;  3J80 N;  1SZX A;  2ITD C;  4PA9 A;  4H13 B;  1K97 A;  2QKA A;  1L8D A;  4I4T A;  4OX9 B;  1Q90 D;  2DWD C;  3THO A;  2DW4 A;  2UXB B;  2BTQ A;  3JAM N;  1RSO A;  1G6U A;  4W4K A;  4DV7 B;  4DR1 B;  1IXM A;  3E8F A;  5LHH A;  4N23 A;  1SET A;  3CHX A;  5B5E Z;  4JI0 B;  2CE4 A;  1GK9 A;  1NR7 A;  2P5O A;  1JCH A;  3CB2 A;  1IBK O;  1QR9 A;  1VQN V;  4FLV A;  4O2A A;  1EZV H;  4O4L B;  2QJ1 A;  3ZRX A;  1X4T A;  2DQ0 A;  4AQY B;  5L3F A;  4B3T B;  4U3J A;  3D36 A;  3SDL A;  4LF5 B;  2JJ1 G;  1M5I A;  2AZ0 A;  3D36 C;  3KCY A;  1IZ3 A;  4R7C A;  1LUV A;  5EZY A;  4R6Z A;  5C8Y B;  5IYZ A;  5J2T B;  4FJC C;  4BAY A;  4LF6 B;  3AG7 A;  1NQT A;  4DUY O;  4B08 A;  4QJF B;  2ARH A;  4YY3 B;  2R9R B;  5LL6 Y;  2IH1 C;  4X1I B;  4LNU B;  2CH7 A;  3JD3 A;  4CH6 A;  2XAF A;  4DV1 B;  3SYQ A;  1FXH A;  2YI8 A;  4LF8 B;  1RM1 C;  5LGN A;  4JI4 B;  4DW1 A;  5IY5 B;  5IT9 N;  2X6A A;  1SQP H;  2VQE O;  4WBN A;  3ZN1 A;  1XNR B;  5IDJ A;  4QNH B;  3K5O A;  5B1B C;  1N33 O;  1KP3 A;  2ZQM A;  1G1X B;  3ZHU A;  4J10 A;  2HKO A;  3UT5 B;  2UUA O;  3ZJZ A;  3CJH A;  4QGP A;  5B66 Z;  3ABU A;  3WB2 A;  1EBO A;  3DC5 A;  3K3W A;  5IJ0 A;  3OMA B;  1YSC A;  2NLJ C;  4JI5 B;  4DR4 B;  3A0H Z;  3CRC A;  4MVU A;  1B06 A;  1Q6I A;  1E1R G;  1QBZ A;  1BL8 A;  3JAL A;  2ZDI A;  2WSS G;  1QU7 A;  3U11 A;  2EJR A;  2HFE C;  2ZDI C;  4MTO A;  1K8A W;  4NXM B;  2R9A A;  3QNE A;  3FAV B;  1K4C C;  1AP6 A;  2ZR3 A;  4Z1M G;  2A9H A;  3U10 A;  3I56 V;  2FL4 A;  3HKC A;  2M7W A;  1MZF A;  4NVP A;  3K04 A;  1YXB A;  2ZE8 A;  4TV9 A;  4TUY A;  5BR8 O;  1SA0 A;  2Y0P A;  3APQ A;  3CCR V;  1CXZ B;  1N36 B;  2QWN B;  1H8E G;  2E74 B;  4OPA A;  1YJN V;  1XEQ A;  1PKX A;  2Z3Y A;  3G71 V;  2YEV B;  3G6B A;  4JPR A;  1LUW A;  1FS0 G;  1OCO C;  4O4J B;  2QWQ B;  3GWO A;  1R3L C;  5JWP A;  4WFB V;  4B3M B;  2IU3 A;  2OTJ V;  3N2K A;  4UB6 Z;  2ZIN A;  4RUE A;  3AEI A;  3GVM A;  4W4L A;  3VQW A;  4GKJ B;  2QE7 G;  3RYH A;  3KG2 A;  2DYR C;  2GSM B;  1L0N H;  4PI0 A;  2ADP A;  1F4N A;  4WF9 V;  2KQX A;  1W59 A;  5L3E A;  3SJA C;  5DM6 V;  1KYO F;  3BRC A;  1FJG B;  4FPP A;  5CBG A;  3JD2 A;  1VQ6 V;  4NTW A;  4GX5 A;  3JD1 A;  1SF9 A;  4I50 A;  2N05 A;  2UXB O;  5LYJ B;  4X62 B;  1YF2 A;  4O2B B;  3JAT B;  2O57 A;  1IBL B;  1AI6 A;  4I9W A;  1R73 A;  4DV7 O;  4DR1 O;  2PYL A;  1D2D A;  1NZ6 A;  2VWJ A;  1NTK H;  3CCM V;  2DYS C;  4TT3 G;  4JAU A;  4LBE C;  3W7S A;  5KA6 A;  4FM0 A;  1M9N A;  2NNU A;  1CP9 A;  4JI0 O;  2GUZ A;  2QM8 A;  3AG3 B;  4WCE V;  1GO3 F;  4DRX A;  2Q67 A;  2YIA A;  2A79 B;  1Q86 W;  2YIC A;  4J42 A;  4J11 A;  4AQY O;  1GKF A;  4B3T O;  5LMU O;  2EZP A;  4LF5 O;  4NR1 A;  1N34 B;  4G28 B;  4FLZ A;  1F23 A;  4LH7 A;  5LP6 B;  4Q20 A;  3CCJ V;  5L3D A;  4UB8 Z;  1U96 A;  1O9H A;  2OCH A;  1T5E A;  2QDO A;  5A9G A;  4H33 A;  3FD9 A;  2PTM A;  3TJT A;  1MAB G;  3ASN B;  2ODM A;  4FZ1 A;  1QNM A;  4LF6 O;  4BIU A;  4YY3 O;  4YHH B;  1WN7 A;  1R1B A;  1AR1 B;  4XDL A;  3JD4 A;  2ZT9 B;  3DXR A;  3STZ C;  4LCU C;  4FM1 A;  4DV1 O;  1VQK V;  1S5L Z;  4LF8 O;  2FB5 A;  4JI4 O;  1W0K G;  3MAQ A;  4JI6 B;  5H6R A;  3I55 V;  2RJZ A;  1XNR O;  2WLJ A;  4B3R B;  4PA3 A;  2P6J A;  3K79 A;  1KB9 F;  4P2Z A;  4DV2 B;  5KHI A; 
#chains in the Genus database with same CATH homology
 4P30 A;  1BMF G;  3E8B A;  2QM7 A;  3CMA V;  2ZXW B;  3ZN0 A;  1F51 A;  2F43 G;  1AI5 A;  1RM1 B;  1Y66 A;  3FB6 C;  3P30 A;  4MVR A;  2EIL C;  5HFM A;  3ASO B;  1K5Q A;  2IW5 A;  3WG7 C;  1H38 A;  1NVP B;  1B6Q A;  2W0F C;  4JF3 A;  4KP4 A;  4WFH A;  2WLM A;  3M99 B;  3VBB A;  1KEC A;  1PL0 A;  5B1B B;  5CA3 A;  5C93 A;  1NJI W;  3RW0 A;  3OR6 C;  4MT8 A;  4RUF A;  1VQL V;  1M56 C;  4MTX A;  3K08 A;  4JYC A;  4PA4 A;  2CK3 G;  1XL6 A;  5LHI A;  1HWY A;  5CBF A;  5EC1 C;  4H37 A;  2QKS A;  3E83 A;  1GTO A;  4GT1 A;  3K9A A;  2HVK C;  3R65 A;  1ARO P;  1FXV A;  2Q68 A;  1AJQ A;  2WLN A;  1K34 A;  3FYI B;  1LNQ A;  2WLL A;  1CEZ A;  3OAA G;  2UXX A;  5H6Q A;  2FTK A;  3SPC A;  1ORQ C;  2BOB C;  2IJH A;  3ZCC A;  2B5U A;  2DQ3 A;  3ABL C;  1QLE B;  3CCU V;  3FB7 C;  2IH3 C;  3QO5 A;  2HG5 C;  1VQP V;  1Q82 W;  2QEX V;  4PEL A;  2XAH A;  5EK0 A;  1BHB A;  3CYO A;  3H01 A;  2EIM B;  1KKD A;  3T4Z A;  2W6I G;  3AG4 C;  3IFX A;  4GX2 A;  2C2A A;  2JK5 C;  4U7O A;  3CC2 V;  1F4M A;  1K7D A;  1K4D C;  1V54 B;  1RPO A;  2OCC C;  3OE7 G;  4JAS A;  4WFF A;  2EIK B;  1FXK C;  4G27 B;  2B1I A;  1MG1 A;  2Y69 C;  4L87 A;  3PJS K;  3OMI B;  3CC4 V;  4QIW F;  3OM3 B;  1YI2 V;  2K1E A;  1NH2 D;  4JTC B;  1KD1 W;  3OEH G;  3OR7 C;  4F4L A;  4UVB A;  1VQM V;  1CPY A;  1QR8 A;  1TUE B;  3ETD A;  4TSF G;  2EBO A;  3QO8 A;  4PA6 A;  4UV8 A;  4BW5 A;  4XBF A;  3CPW U;  2EZO A;  3HB3 B;  3X2Q C;  1OCO B;  3HPL C;  3SYA A;  5B3S C;  3IC7 A;  1YJ9 V;  2HLD G;  3WG7 B;  1YTF B;  1S77 D;  2IJJ A;  2YSU B;  3K06 A;  4QE7 A;  3RVY A;  1E1Q G;  4FIP C;  1EZJ A;  3SPH A;  2OTL V;  4I5S A;  3RVZ A;  1N8R W;  4E2L A;  3E35 A;  3F7V C;  3CCV V;  2ATK C;  1H8H G;  2Q69 A;  3SJQ C;  3SYO A;  3ABK B;  2DYR B;  1M56 B;  1VQ8 V;  3W7W A;  4J9Z B;  3ZMV A;  4JGS A;  1NKD A;  2EIJ B;  2X6B A;  1WLE A;  4RAI A;  3CP1 A;  2ITD C;  3LNM B;  4UUJ C;  4PA9 A;  2XAG A;  1K97 A;  2X7R B;  1AJN A;  3T1C A;  1ENV A;  4JYB A;  3E86 A;  5L3G A;  1OCZ C;  2LFR A;  3ABL B;  3AG3 C;  2GHY A;  2DWD C;  3OMN B;  5L3B A;  2DW4 A;  2EIN C;  1Q7Y W;  3RBZ A;  3OGC C;  4WFA V;  2DYS B;  5IYB O;  1OCR B;  3UM7 A;  3CCL V;  4CZZ A;  5CN0 A;  1IXM A;  1V55 C;  3AG2 B;  3E8F A;  5LHH A;  4N23 A;  3E8H A;  2R9I A;  4UV9 A;  1SET A;  3F5W C;  4UVC A;  1DF5 A;  1GK9 A;  1FXK B;  4RQF A;  1NR7 A;  4HYO A;  5B1A C;  1JCH A;  3ZIA G;  1G8M A;  1QR9 A;  2AHY A;  1W2B U;  1VQN V;  4GX0 A;  3ASN C;  3ZRX A;  3OW2 U;  2DQ0 A;  4HZ3 A;  1VQO V;  5L3F A;  2WLI B;  3D36 A;  3SYP A;  2ZR2 A;  2JJ1 G;  1RPR A;  3X2Q B;  5KA5 A;  2Q6A A;  5DN6 G;  2B1G A;  2XND G;  1MSW D;  4R7C A;  1YHQ V;  2JJ2 G;  3NXS A;  4WFG A;  3ZMT A;  3B77 A;  5EBL C;  1JJ2 U;  4R6Z A;  4CBC A;  4QPK A;  4FJC C;  4BAY A;  4MW3 A;  3OUS A;  1THZ A;  3ABM B;  3TK1 A;  2WLK A;  3FB5 C;  1NQT A;  4N21 A;  1KQS U;  4MW8 A;  1AJP A;  4QE9 A;  3MHS C;  2XAJ A;  4QJF B;  2HR3 A;  3OEE G;  4XDJ A;  2JEX A;  2R9R B;  2YEV A;  4G2K A;  5LGT A;  2IH1 C;  4X89 A;  3MHH C;  2DWE C;  3ZRW B;  3K0G A;  1FFT B;  3JD3 A;  5IYD O;  2W6J G;  4XDK A;  2XAF A;  2ZXW C;  2P7T C;  4PDV A;  1FXH A;  3SYQ A;  1RM1 C;  2D3O W;  5LGN A;  2LFS A;  1GM9 A;  1YIJ V;  1ROP A;  1S76 D;  1AI7 A;  3ASO C;  1OCC B;  2JIZ G;  5IY5 B;  2JDI G;  2X6A A;  3SPI A;  1SER A;  1OCZ B;  3ZN1 A;  5IDJ A;  4MTF A;  4QNH B;  3B8N A;  4RO2 A;  5B1B C;  3E2E A;  2LP7 A;  1KP3 A;  2ZQM A;  4FMT A;  1JX9 A;  3UKM A;  5CBH A;  1VQ4 V;  3LUT B;  2EIL B;  2HKO A;  2IU0 A;  4KUM A;  3ZJZ A;  2UXN A;  4JTD B;  1NR1 A;  3MD0 A;  4MTG A;  2Y48 A;  3ABU A;  4UVA A;  1EBO A;  4FK5 C;  4PA7 A;  3CC7 V;  3IGA C;  3K3W A;  4JAV A;  3ML0 A;  5LBQ A;  3OMA B;  2KB1 A;  1YSC A;  2NLJ C;  1QLN A;  3OFN G;  1I5Y A;  1JOY A;  2QTO A;  2A0L A;  4MVU A;  1E1R G;  1QBZ A;  1NH2 B;  1BL8 A;  3G6E V;  2ZDI A;  4MSW C;  2WSS G;  1KC8 W;  3FYE B;  1JVM A;  3E89 A;  3GB7 C;  4GCZ A;  2EJR A;  4BIZ A;  3QO7 A;  2HFE C;  3CME V;  3ZMS A;  2EIM C;  2ZDI C;  4MTO A;  4ZBM A;  1NBM G;  4LC1 A;  1K8A W;  2HVJ C;  1QVF U;  3ZRS A;  3QNE A;  3STL C;  1W0J G;  2H94 A;  1K4C C;  4X8A A;  1NVP D;  4PDL A;  2ZR3 A;  4Z1M G;  3DTU B;  1PNM A;  1JQ0 A;  1K33 A;  2A9H A;  2WLL B;  3I56 V;  1V54 C;  1XL4 A;  5EBW C;  1G4Y B;  2BOC C;  1GMG A;  2M7W A;  4DO2 A;  3K04 A;  1Y4M A;  2EIK C;  3VOU A;  5KUM A;  1R3I C;  1DLB A;  3AG4 B;  4PDM A;  3TCU A;  1SRY A;  4DXW A;  1OZ0 A;  3JYC A;  3SPG A;  3CCR V;  1YJW V;  2OCC B;  1MOF A;  1H8E G;  5IYC O;  1PNK A;  1K3E A;  4HAM A;  4R8C A;  1YJN V;  1K73 W;  2XOK G;  1VQ5 V;  1DTO A;  1PKX A;  2Z3Y A;  2Z5U A;  5FL7 G;  3G71 V;  2YEV B;  2Y69 B;  3LSS A;  5LHG A;  4MVZ A;  4JPR A;  5GW7 A;  1FS0 G;  1OCO C;  4JTA B;  2JEU A;  1GM8 A;  1Q81 W;  3GWO A;  3CCS V;  1R3L C;  1S3J A;  3P32 A;  4WFB V;  2IU3 A;  2OTJ V;  5BZB A;  4MVQ A;  3K03 A;  2P90 A;  2WPD G;  1YIT V;  1SZT A;  3CXC U;  3AG1 C;  5EC2 C;  1COW G;  1I5X A;  4RUE A;  3CCE V;  3W7U A;  3AEI A;  3FB8 C;  4R50 A;  2QE7 G;  3K0D A;  2ITC C;  5B3S B;  3W7X A;  3ZRV A;  3KG2 A;  3ABK C;  5B1O A;  2DYR C;  1VQ7 V;  1M90 W;  1M57 C;  2GSM B;  1K9M W;  3E8G A;  3LSQ A;  3EFF K;  3TET A;  3A0R A;  3OUF A;  1S72 V;  1F4N A;  1WPX A;  4WF9 V;  2V1D A;  1L1F A;  3FKS G;  5L3E A;  3EHB B;  5DM6 V;  2EIJ C;  3F7Y C;  1QVG U;  4FPP A;  5E1A C;  5CBG A;  3B8M A;  3BY6 A;  4J9Y B;  3JD2 A;  4TWK A;  2MK3 A;  1VQ6 V;  2V7Q G;  2QA4 V;  2PI4 A;  4GX5 A;  3JD1 A;  1R3K C;  3DGE A;  3W7T A;  4MVO A;  1R6K A;  1AI6 A;  4EKW A;  3CCQ V;  1AI4 A;  4I9W A;  1R73 A;  3SYC A;  4MVM A;  3CCM V;  2DYS C;  4TT3 G;  3G4S V;  4JAU A;  4LBE C;  3W7S A;  1DF4 A;  1OCR C;  5KA6 A;  1M9N A;  2WLH A;  2NNU A;  1CP9 A;  2XAS A;  4ASU G;  1UJW B;  1YTF D;  1J95 A;  1H2G A;  3AG2 C;  1OHH G;  1FXK A;  2QM8 A;  3AG3 B;  4WCE V;  3ETE A;  4GX1 A;  2X6C A;  3BEH A;  1GO3 F;  5EBM C;  1GM7 A;  2EIN B;  4OXS A;  5KUK A;  2Q67 A;  1P7B A;  3ZMU A;  1PNL A;  2A79 B;  1Q86 W;  1S5H C;  3LDC A;  1GKF A;  1K5S A;  2WLI A;  1V55 B;  4LP8 A;  2WWW A;  2XAQ A;  2EZP A;  2X0L A;  2IJK A;  4ZKI A;  1P4R A;  2P67 A;  3JCZ A;  1F23 A;  3LDD A;  4G28 B;  4UXN A;  5B1N A;  4Q20 A;  5H9C A;  1R3J C;  3CCJ V;  3JD0 A;  5CMU A;  5L3D A;  4PDR A;  4MVS A;  4H33 A;  5B1A B;  3LDE A;  1EFR G;  1MAB G;  3T2M A;  5HFL A;  3ASN B;  1JPX A;  1QLE C;  4WFE A;  2AHZ A;  1R6N A;  4U7N A;  2PI5 A;  3ZMZ A;  4P9O A;  3SPJ A;  2WAM A;  1BHA A;  4BIU A;  4P9P A;  3AG1 B;  4QPJ A;  3ABM C;  4MS2 A;  1AR1 B;  4XDL A;  4YXW G;  3ZRW A;  1VQ9 V;  2H8P C;  3JD4 A;  3ETG A;  2OT5 A;  3STZ C;  3CD6 V;  4LCU C;  5L3C A;  1M57 B;  2HJF C;  1VQK V;  4KFM A;  1SES A;  1S0V A;  2IJI A;  5LGU A;  1E79 G;  1W0K G;  3T4D A;  5J9P C;  1ZWI C;  4X88 A;  3ABT A;  5H6R A;  3I55 V;  3D3I A;  3WFV A;  1M1K W;  2WLJ A;  4PA3 A;  1OCC C;  1KP2 A;  2P6J A;  2ZD9 A;  3K79 A;  5IY5 C;  1PD3 A;  4RQE A;  4P2Z A;  1QCE A;  1K92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...