4QGPA

Crystal structure of a pyrophosphatase (af1178) from archaeoglobus fulgidus dsm 4304 at 1.80 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
108
structure length
108
Chain Sequence
KIHHHHHHMEELLDILREFRDSRGWLKYHTPKNLAVSISIEVAELLEIFQWTRSSDEEFEVLERRKGEVEEEIADVLIYLLFLCDVAEINPIEAVKRKMEKNERKYPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords pyrophosphatase
publication title Crystal structure of a pyrophosphatase (AF1178) from Archaeoglobus fulgidus DSM 4304 at 1.80 A resolution
rcsb
source organism Archaeoglobus fulgidus
total genus 40
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12643 MazG-like MazG-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 4qgpA00
1YXBA 1YVWA 3CRAA 2Q4PA 2P06A 5IE9A 4QGPA 1VMGA 3CRCA 2YXHA 2GTAA 3C90A 2Q9LA 2OIEA 2A3QA 2Q73A 1Y6XA 2Q5ZA 2A7WA 2OIGA
chains in the Genus database with same CATH superfamily
4I55B 1Y4MA 4UVAA 3R66A 3P3NA 2BOBC 2NNUA 2IBZH 5JJEB 1AP5A 1EN4A 3CX5F 1KBHA 4YHHB 3WB0A 4FFBB 4MVZA 2KQXA 1SZTA 4OX9O 3K57A 1HNXB 3L72H 5LMUO 3T1HB 3F5TA 4JI8B 5KUMA 5DM6V 4HBNA 3CRMA 4UCRA 4H37A 1TGOA 4J9ZB 2X7RB 4LNUA 4R6ZA 3JASB 1US6A 1SQQH 2GV9A 5IY5C 4GKKO 4DV5B 4EB6A 4LR3A 5FPRA 1H38A 4UVCA 3SYPA 4DUZB 3AG2B 3E8GA 1TA8A 4FLZA 5JH7B 3AK3A 1YEWA 4G27B 2EJRA 3D36A 4D6TH 1XHZA 1VARA 1Y76A 3L9DA 3JD1A 5C8YB 3D36C 4X1IA 1B6QA 4GX1A 4YIOA 3G71V 4IL6Z 2EIJB 3K9AA 5IDJA 4PA4A 4TV9A 2PZSA 4KXRA 3IC9A 1W0KG 3ZHRA 2A3QA 1JFFB 4LWSB 2N05A 4X64B 3MD0A 4EFBA 4L87A 1W2BU 1YJWV 2CTWA 3LUTB 1FXVA 4YJ3A 2GHYA 1V54B 1CP9A 1AR4A 2L6LA 3GVMA 5E79Z 4JI3O 1GO3F 5IJ9A 3CJHA 1XNRO 4ZBMA 4HNAB 4MTGA 2QM4A 4QPJA 5LA6A 4Q6GA 4JF3A 1DF4A 1FXHA 1NI8A 3B8MA 4I50B 4I4TA 1RSOB 4MS2A 3PJSK 1XI1A 2NN4A 1MABG 3DXRA 2EILB 3AG4C 4FVMA 3I56V 3ABLC 3SJCC 3CCSV 1SRYA 5EC2C 3LSSA 4YJ2A 1IDSA 1E1RG 4DW1A 4TQDA 1WPXA 1GM9A 2IM9A 3L75H 4ZI7A 4NKGB 2QDOA 3CCRV 1SQVH 2XT9A 2YIBA 2HEPA 1JMKC 2B1IA 2CGNA 4JI5B 1EN6A 1OCZC 4JYYA 1VQKV 3ASNB 4LFAO 2HR3A 3D3QA 2GUZB 4FLYA 1M90W 1WPBA 4PA3A 1CXZB 4JI1B 2WA4A 1RM1B 2B5UA 1Y67A 2Y48A 2UXBO 4HAMA 3AG7A 1XEQA 3I5DA 2A06H 2DQ3A 2ZIOA 4YIPA 2JGDA 2XUMA 4DV2O 5B1BB 3FYIB 2PGGA 4W4KA 4P9PA 4LF9O 4JI0O 5TISZ 5IWAB 3SPCA 1AI5A 4TQFA 3ZBHA 2YI8A 3HKDA 4IIJB 4O4IA 3G67A 3JALA 1P49A 4UCSA 5IE9A 1YDXA 1MOFA 2K1EA 3K59A 3OD4A 4GKJO 2VS0A 3RYHA 3CRQA 3JCZA 5L3DA 1VQOV 3CRRA 4DR5O 1Y6XA 1BZKA 2GTSA 4BW5A 5IY5B 3K3WA 4J9YB 4WFHA 1IBKB 5KMGB 4O4HA 2QWPB 4PELA 1S77D 4BAYA 3M7MX 3CC4V 3E35A 2HVJC 3HR0A 1XL4A 2E76B 4DV0B 5B1NA 3P3PA 2JIZG 3H01A 3B40A 3OUFA 1TVKA 2JK5C 4UCUA 1K4CC 1QVGU 1I0HA 4K8XA 2OIGA 4X1IB 2AXTZ 4RQEA 1H8EG 1WB7A 1BCCH 1O9GA 1ROPA 4MVOA 1SKVA 2HHHO 5EC1C 3JD2A 2Q8VA 2ZE5A 4QPKA 2IH1C 2E3CA 2HP8A 5CA1B 4X8AA 1NQTA 1DK1A 4YJ3B 2RJZA 3ZRWA 2XHBA 4DRXA 3FFQA 4GLXA 3W7TA 3D3IA 3J7AU 4FLVA 1YI2V 2C2AA 2EIMC 5HFMA 4B3TB 1JA8A 4JAAA 1ZSPA 5IJ9B 2CGOA 2WLLA 1OV9A 1WLEA 3AG3C 1K92A 3K5MA 5LA6B 2UXCB 4DV1O 1WB8A 2P6JA 4WFFA 3CCJV 4X65O 1G6UA 2X6AA 4B3SO 4O4LA 4I4TB 1Q90D 3RYIA 4LF6B 4U7OA 3DC6A 5KUKA 1KKCA 2PI5A 2YXYA 3ABLB 3UT5A 5CA3A 1SQFA 3DXRB 3OEEG 5JVDA 3B8NA 5JCOA 3T4DA 5JWPA 3ML0A 4J42A 4UVBA 4JI4O 5JCOC 1VQ8V 2YC0A 4NB5A 4DR6O 1GN6A 2VQEO 1AP6A 1HNZO 4JI7O 4ZI7B 2EZPA 1EBOA 5K1PA 1QVFU 2QTOA 1VQ5V 4DR7B 3QTCA 2JS5A 2X6BA 3G4SV 5EK0A 4FPPA 3TJTA 1L0NH 2PYLA 1R3IC 2ZKOA 4LCUC 2W0XA 2UUBB 2OYQA 2IJKA 1SERA 1NKDA 3M99B 2QR4A 2V4DA 2EBOA 1F4NA 1K9MW 1HWYA 1GTOA 4JGSA 3SR2C 2QE7G 4JAUA 2W0FC 1WJZA 3BFRA 5JQGA 1VQNV 3T4ZA 1N0NA 3BEHA 3IFXA 3HKEA 3O65A 1AILA 2R9IA 1XDCA 2QKSA 5J2UA 4GX2A 2WLKA 4J41A 2UUCO 2JGDB 4UXNA 1XMQO 3DC5A 4Q20A 2EJ7A 2GTAA 1Y66A 2R70A 2YIAA 3CC2V 3HKDB 4CC5A 3CYOA 4O4IB 2XOKG 3BRCA 4OPAA 4EKWA 5AG2A 1VF5B 3QO5A 4P9OA 1NTMH 4TUYA 4LFCB 3RVZA 1MNGA 2XAJA 2CTPA 3CSXA 4DK0A 1SF9A 1ZUQA 4BR6A 4CH3A 3U10A 4PD4F 2XTAA 1OCCC 1EN5A 2QM8A 3RYHB 5LHGA 4PA6A 2YI9A 1CPYA 3H1IH 2Q0OC 3ABKC 4DUYB 1I5XA 4WFAV 1PL0A 3RBZA 5H2FZ 3LDDA 3OMAB 4O4HB 4X20A 4CBCA 2WLJA 2YICA 2EIKB 3RYCA 3CRAA 5GW7A 4QIWF 1HDJA 3K04A 1SQXH 4YY3B 2P7TC 5E1AC 4LF5O 3G6BA 1N34O 4LFBO 4J80A 1B06A 1TVKB 3K08A 1K33A 3C3SA 5LGNA 2UUAO 3T1CA 4AILC 3ETDA 4J11A 1R6TA 4DR2B 1TUBB 3T2MA 3BHPA 2OCCC 4FM1A 2DYRC 1YJ9V 3E8BA 5EIBD 4X66O 1OCRB 3JAWA 4BW9A 1W0JG 3FD9A 4X62O 2CH7A 2ZQMA 1M5IA 3ZRWB 2QWOB 3JAMN 1IURA 2EIMB 4DRXB 4PDMA 3Q4HA 4AQYO 2CTRA 4H33A 4EFEA 3ZMUA 3ZJZA 4WFBV 1KC8W 2WLLB 2FYUH 1M1KW 1YVWA 1G8MA 1KMIZ 1PNMA 2W6IG 2LO1A 1OZ0A 2QWRB 4ZKIA 2N74A 3ABTA 2LW7A 1R6NA 4DR1B 1HNWB 1BQZA 4AHCA 5KX5A 1Q82W 3BVOA 2BSKA 4O4LB 1FAFA 1FFXA 5EBMC 2JGUA 3CCMV 2Q68A 2KG7A 1XREA 3FKSG 3T1YB 5CBHA 4OX9B 4X1KB 5CA0A 3TK1A 1FKAO 5JVDB 5LMUB 3FB8C 4U3JA 2XNDG 1WNSA 1N4CA 4ZOLA 1XILA 1VQ9V 4QE9A 5IJ0A 1LR1A 4GKKB 5BY1A 1GN3A 3BA9A 4C7UA 3CP1A 1K5QA 2F4VO 3NR7A 4J7KA 4GX0A 2GBOA 1BT8A 4FLXA 2IJIA 2ZR2A 4TV8A 1WN7A 1XNQB 2FMLA 4NXNO 3W7UA 4K0KO 1NVPD 3UKMA 1VQ6V 2XAGA 2LGQA 1JR9A 4KUMA 2QEXV 2ZNJA 1QLNA 4H0LB 3J81N 4R7CA 1K73W 2M6YA 1K4DC 3X2QB 2YXLA 4LF7O 3HKBB 1GK9A 3B09A 2JS3A 5J2UB 2IJJA 3QO8A 2FL4A 4GYCB 2ITDC 4OPHA 4RO2A 3SYQA 5CMUA 1XNRB 2K9PA 4DK1A 3EVKA 5B66Z 1SZXA 1KYOF 1V55B 5GTIZ 1L0LH 4LF4O 2Z0AA 2VQFO 3CCEV 3JYCA 1M56C 2H8PC 5EBLC 2E74B 2UXDO 1NR7A 4CZZA 1X59A 4PI2A 1U97A 5CN0A 1GRJA 1Q7YW 1NJIW 1QNMA 1OCCB 4YHHO 2WA3A 5JJJB 2RNBA 5H6RA 4JYAB 3ABKB 5FPOA 2F1MA 4O2BA 3ZRSA 5IYZA 3ZHQA 3BY6A 1HNXO 3IC7A 3LDEA 4JI8O 2DWDC 4IYHA 3RWRD 4X20B 5A2QN 3K5OA 3IAYA 2ZXWC 1PKXA 1VF6A 3CPWU 3ZRVA 1N32B 1VF6C 3K03A 1Q81W 4ZHQA 1DF5A 1NT2B 2IH3C 4LFAB 4WCEV 1WP8A 1SQBH 3CRCA 3N2GA 2NLJC 2YS8A 2YEVA 4Z1MG 3JARA 2YIBD 3SYOA 2JDIG 2JJ2G 4HZ3A 4KHPO 1N33O 5EZYB 4PHZA 1KU9A 4BIZA 2PYJA 4MVUA 1JQ0A 3JAWB 3RYFA 1K8AW 2BTQA 2UXBB 5ITZA 1PP9H 3PN1A 4RUEA 1N8RW 2R72A 4X64O 2QA4V 1I94B 2V7QG 4R50A 3JATA 2F95B 4LF8B 1IX9A 2ZM6O 1GKFA 2QKAA 1O9HA 4DV2B 2HFEC 2ZE7A 1YHQV 5CBFA 4P2ZA 3L73H 5LMNB 1Q86W 4NXMO 4MSWC 2Y4TA 2F23A 4TOIA 1AROP 1ENVA 1JPXA 1ZL8A 2P06A 3MDSA 1S0VA 1XMOB 1H2KA 1Y74A 2MW2B 4YXWG 3UCSC 2OIEA 2N04A 5FNVA 3H9VA 2KG7B 3K0GA 3A0HZ 4IYIA 4I0XB 4GKJB 3LSUA 1B3QA 2Y69C 4U3JB 1IBMO 4ICGA 4DV6O 2DW4A 3WG7C 3ZN1A 4CH6A 3HKCA 4JAVA 4ZOLB 3WU2Z 4DR5B 1MSDA 1AR5A 2AHZA 4JTAB 4CS2A 3U11A 5CBGA 4NYKA 1JVMA 1BL8A 1MSWD 3IGAC 1FJGB 4JZ2A 5KHGA 1P7BA 4UB6Z 4F6RA 3ZMZA 2L35A 3H1JH 1EM1A 3STLC 1GM7A 1VQMV 4JI5O 2R9RB 1XHXA 3C90A 5A9GA 3UO2A 4E2LA 5BMVA 1NR1A 3E22A 1K7DA 3VQYA 3OAAG 4DV3B 2IJHA 1D5NA 4OXSA 1MMMA 3UQ8A 4LNUB 4RWUA 1VQ4V 3CXCU 3ETQA 1THZA 2XASA 1OJHA 3ASOC 1YCIA 4EB6B 4PA9A 2BCCH 1AVMA 2IU0A 1NVPB 3OFNG 3MHSC 4F4LA 4FMTA 4UB8Z 3SDLA 1GN2A 2VRZA 1Y76B 2XAFA 4DV1B 4GX5A 1M56B 5EBWC 4X65B 5BR8B 1QBZA 3SGIA 1AJNA 5LHHA 3CS5A 5LL6Y 4B3SB 4QE7A 4QGPA 4TV9B 5B1AC 5IWAO 3G6EV 2RQ6A 3EHBB 1SQGA 2P90A 5J9PC 1NZ6A 3D8CA 3GWOA 3B2EE 3CCQV 4UV8A 3A8TA 1IXMA 4O2BB 5IYZB 1S72V 1MG1A 2LW1A 4JI4B 1J95A 1ZLZA 5H9CA 4PI0A 2VQEB 1H2GA 1L8DA 4N21A 2ZXWB 2QWQB 2RMKB 3CJHB 3CWBH 3SPGA 4FM0A 1TUEB 1KKDA 4B3MO 1KP3A 4U7NA 1N36O 3W7XA 3P30A 1GH6A 2P4KA 5BZBA 3RGBA 4ZHQB 1F51A 3OGCC 2B1GA 4UUJC 1NH2D 3N2GB 4NVPA 4I9WA 1HW7A 3ABMC 4DV0O 3AG4B 4JASA 4DR4O 4CC6A 2XAHA 2Q67A 1VEWA 4JI2B 3FB7C 3JSNA 4YJ2B 2OTJV 4O4JA 1WP7A 2PUSA 1MA1A 5KLVH 1L1FA 1Z5VA 5ITZB 1WA8A 2KKWA 1ZWIC 5HFLA 5LXTA 2AW9A 3M8AA 3AG1C 1SA0A 1PV0A 2LP7A 4BWAA 1R3JC 3ZS8C 3ZMSA 1XQ8A 2QWNB 1P4RA 1OCZB 1XMQB 5L3BA 2X0LA 1IBLB 2PF4E 1QCEA 1IZ3A 2HJDA 1YJNV 3OW2U 3OTFA 1VF7A 3JD0A 2UXCO 1Y74B 3ETEA 2Q4PA 4I55A 1S5LZ 2PI4A 3KKYA 5FNVB 4GUNA 2Y69B 4DV4O 1GAXA 3SPJA 5JJNB 4H13B 1CEZA 1H2LA 3WG7B 1Q5OA 3RFRA 5LBQA 1F4MA 5KHKA 4MVQA 4RQFA 4B3RO 2HKOA 4K8ZA 1QU7A 2DMXA 1YTFD 1YF2A 2M7WA 5DECA 5LYJA 1P84F 1K97A 1Q8IA 2BOCC 1AI6A 3S3WA 2QSAA 1NTKH 1LNQA 5KHHA 1DTOA 5J2TA 4LF5B 4LFBB 1TAEA 3F5WC 3MHHC 1LUWA 2CUGA 4NTYA 4DR7O 3JALB 2UUAB 1UFIA 3AG2C 3KCYA 1VQLV 1COWG 2UUBO 2YXHA 4IGGA 3SPHA 4WBNA 4X66B 3ZX6A 2GDSA 2QTSA 1HR0O 2EIJC 4L8JA 5FL7G 2UU9B 1JFFA 3E83A 2OCHA 2ZT9B 2Q6AA 4QJFB 3K06A 4AQYB 2XAQA 1VQ7V 1W59A 3JD3A 2D2CB 3K79A 3CE2A 5L3CA 5GTHZ 1H2MA 1V54C 4E4EA 2ILMA 4WFGA 3OTOO 4K3AA 2A7WA 2JEUA 3APOA 4I5SA 4X9QA 4B7KA 3TCUA 4J10A 4DR3O 1BHAA 4D7TA 3FYEB 1J5EB 4I50A 3ZHVA 2F66C 1KECA 2ZD9A 4LC1A 3WB1A 3CMEV 4TT3G 3TETA 2D3OW 3OT7A 1GMGA 3TXQA 1S5JA 5EYPA 2B9ZA 1NS1A 3FB5C 2CK3G 3AG3B 4QNHB 2CE4A 3RT3C 3ICXA 4CH4A 3KG2A 1PNKA 3A0BZ 4MVMA 3L70H 4GCZA 2ADQB 5K1XA 3KCXA 2H3OA 1JJ2U 3LDCA 3ABMB 3RYIB 4NXNB 1NBMG 2WWWA 2EINC 3UT5B 1FPOA 5KA5A 4O4JB 3SJBC 3STZC 4DR2O 1GM8A 2RDCA 1Z5WA 4G2KA 4X88A 3RN4A 5LOVA 1WA8B 3AG1B 3ZIAG 1IVSA 1F7YA 5LXTB 1NH2B 4JV5O 3O9OA 1AJPA 2WPDG 5H5NA 4JYCA 1RM1C 4AI8A 5LGUA 2Q69A 3EFFK 3QF7A 3TGUH 1VQPV 4DXWA 1Q43A 3BPZA 1VP7A 3ZHSA 4LF4B 2VQFB 1YIJV 1Z2GA 2DYSC 2UXDB 4FJCC 1H2SB 2E5LO 4LP8A 3NXSA 4DR1O 1HNWO 4OGQB 4IIJA 1BS3A 1WAZA 5LP6A 1SESA 4PV1B 3JAKA 5CB4A 5JQGB 3K0DA 3QVNA 3FB6C 1R73A 5LP6C 2GSMB 3C3TA 1ORQC 1R3LC 3RVYA 1UJWB 3HKEB 2DQ0A 4CH5A 3F7VC 4EEQA 3T1YO 1PL4A 3RW0A 1E1QG 2Q73A 2YIDA 4JI3B 4DV7O 1BQ0A 2HJFC 1BE3H 2Q7HA 5C93A 4UCOA 4JI6O 5LYJB 1YXBA 2YSUB 3ZCCA 4O2AA 2LGWA 1V9PA 2OTLV 3ZMTA 4MVSA 2IU3A 4PDVA 5KMGA 5J2TB 1AB3A 1G1XB 2QGNA 4JTCB 3OUSA 4P30A 4MTOA 2ATKC 2X6CA 4TUYB 4RUFA 1ZAUA 5DEDA 3A0RA 4RAIA 3E8FA 5BXZA 2E75B 1YTFB 3VOUA 1FXKA 5LHIA 1XNQO 1SC5B 4KHPB 1FXKC 4ASUG 3JCUZ 3TXSA 1N33B 4WBNB 1F23A 5B3SC 4DW0A 4HYOA 5FLXN 3T1HO 1Q6IA 2AHYA 4PA7A 3LSQA 5KHJA 1I7FA 3SYAA 4TSFG 3RYCB 2EULA 1EFRG 5CA1A 2ZM6B 1QLEC 4UCTA 1HP8A 1M4UA 4DV5O 4JTDB 2BTOA 3SPIA 4DUZO 5KAFZ 4NXMB 1QR9A 2CTQA 1YITV 1D2DA 3OR7C 2FKXA 2OCCB 2DYRB 1KUQA 4IT5A 5L3GA 4FM2A 4FIPC 2CAZC 2ETNA 5IYDO 4IHJA 1T5EA 3UO3A 1S5HC 2CH7B 1IBMB 5KAIZ 4DV6B 2ZR3A 3ABUA 5F2VO 3E8HA 3Q4HB 5EYPB 3QO7A 4DO2A 1BSMA 3QG5A 4KFMA 5GONA 2ITCC 1XL6A 3OR6C 4JYAO 1FS0G 4MW8A 3THOA 2IW5A 4LF9B 4JI0B 3OMIB 2QM7A 2KSDA 3BABA 2OWOA 3B77A 1DLBA 5KX5B 2YUAA 2BSKB 4WFEA 1FFXB 1JCHA 2LFRA 2P22C 3E86A 4PJ0Z 4CS4A 1N32O 2EINB 2WSSG 2WLIA 1B04A 2RCVA 3H1HH 4FLUA 1K34A 4U3FH 5CA0B 3L71H 3BA8A 4B08A 1Q3EA 1XUQA 1E79G 3CCLV 3BAAA 5LOVB 1K5SA 5IJ0B 2DN9A 3GB7C 1LUVA 4FZ0A 3F7YC 3VQXA 2Q5ZA 4ABMA 5L3FA 1BGYH 1I94O 1SQPH 1Q6UA 4TV8B 4LF8O 1KQSU 3GWKC 2DYSB 2WLHA 5KA6A 1PD3A 2ZE8A 4UCVA 5L3EA 1R6KA 5LMNO 1JJOA 2HHHB 2P5OA 2Q7GA 3VQVA 2A79B 3HB3B 5LP6B 3JAKB 5CB4B 1P7GA 1XMOO 1M57C 4XDKA 1EZVH 3CCUV 4X1YA 5DN6G 4JI1O 4WF9V 1R1BA 1KB9F 2Q9LA 1RFYA 3W7SA 1FD9A 4UV9A 2JRIA 4B3MB 2ARHA 4O2AB 1N36B 3OE7G 2Z3YA 5IT9N 2AZ0A 3IJ4A 2ODMA 4F6EA 4PDRA 3CC7V 3CMAV 4FZ1A 3P32A 1OCOC 3ETGA 4G28B 1FJGO 1PPJH 2EIKC 4A5UB 4ZIBA 4Z1VA 4DR4B 1FXKB 1M93A 2HG5C 4I7ZB 3VQWA 5B3SB 1XBLA 1DGSA 4MW3A 4Z2WA 1MZFA 4LBEC 3OGIB 4MTFA 3SJQC 2AZ2A 4JPRA 1TUBA 1QR8A 3SYCA 4DR6B 1HNZB 4JI7B 2JEXA 1KP2A 4I9QA 4DV3O 2KB1A 3BCCH 1PNLA 1QLEB 3K5NA 1OCRC 4XDJA 1IBKO 2WLMA 4KP4A 1K3EA 4UFZA 1NTZH 1RP3B 1PM9A 1S3JA 1M9NA 3U0ZA 2YEVB 4NR1A 5D5QA 3JARB 2V1DA 3FAVA 4NTWA 3R65A 3DGEA 5BR8O 2ADPA 3N2KA 3QNEA 3K9SA 4IHJB 4DV4B 3RYFB 3OMNB 4FFKA 2BTQB 3DTUB 2PY5A 1AI7A 1X4TA 2EZOA 2ZINA 3WB2A 4KL1A 3AK1A 4X1KA 4B3RB 2OT5A 3JATB 5GONB 2UUCB 2HVKC 4K35A 4N23A 3OM3B 2QJ1A 3CEIA 2JJ1G 4B3TO 3L74H 1URFA 1ZL8B 2WLNA 3CD6V 2O57A 1I08A 1VMGA 2WLIB 3B4SA 3DSQA 2F43G 3VBBA 2Q0AA 1BMFG 4FFBA 4LF6O 4PDLA 4JZGA 3ZRXA 2ZCEA 3HKCB 2NR5A 3WFVA 1UPGA 1HR0B 3H1LH 4JI2O 3CCVV 1D5AA 5B1OA 2RN9A 1QHTA 4XDLA 4J7JA 5IYBO 3LNNA 2G38A 3JSLA 3JASA 2VWJA 2DJVA 4GT1A 3H1KH 3HKBA 1Q6HA 1RPRA 3X2QC 2P4VA 1YZBA 4MT8A 4F6RB 1N34B 1XOUA 2PTMA 1QQCA 4BIOA 5JH7A 3OTOB 3N27A 3E2EA 1RPOA 3S3XA 1MZEA 5C8YA 5BMVB 1IBLO 3E22B 2Z5UA 1V55C 2DE0X 1M57B 2R9AA 4X89A 4DR3B 2DWEC 2UXXA 3W7WA 4TWKA 4GZRB 1S76D 4X62B 2FTKA 2F93B 3AK2A 4X1YB 3ASOB 1AI4A 4LWSA 3K5LA 4W4LA 1GN4A 3CHXA 4D7SA 2P67A 2YDEA 2Y4UA 5H6QA 4LH6A 2MK3A 1R3KC 1OHHG 5KHIA 1KD1W 1JOYA 3SJAC 2ZNIA 4DYLA 1OCOB 4FK5C 5B1AB 4HNAA 2AGAA 3FX7A 1BHBA 1N0JA 2Q7EA 3I55V 1NU1H 2ZIMA 1I5YA 3J80N 2H94A 3APQA 3JD4A 3MAQA 2LQTA 2A0LA 1RSOA 3G80A 3K58A 1IXBA 4FLWA 4LFCO 5LGTA 3KZIZ 4B7EA 1AR1B 4FLTA 3EXAA 5IYCO 4CS3A 3UM7A 2Y0PA 1SETA 1ZTEA 3A2FA 2FB5A 5EZYA 2EILC 2WAMA 4JV5B 1YSCA 3ZEDA 1A32A 2VWKA 4DUYO 1H2NA 2EX3A 4BIUA 3E89A 2F4VB 1ZX3A 2UU9O 2LFSA 2ZE6A 4R8CA 4JYBA 1G4YB 3CXHF 3AEIA 1AJQA 3LNMB 2UXNA 4MTXA 4XBFA 4YY3O 4K0KB 2ZDIA 3FAVB 2A9HA 2LJ2A 2DOSA 2HLDG 4MVRA 2W6JG 3ZMVA 2ZDIC 2GUZA 3OEHG 1U96A 2E5LB 5D5PA 3ASNC 5EIBC 3HPLC 3ZHUA 3N2KB 3ZHTA 4LH7A 4LF7B 2BE3A 1EZJA 4J7ZA 4I0XA 1JX9A 1SA0B 2JVDA 1J5EO 4H44B 4DV7B 2CDYA 4JI6B 1FYJA 5B5EZ 1H8HG 4NTXA 3ZN0A 5B1BC 2Y0IA 1FFTB 3CB2A 2QKCA 1VIBA 1SS3A
chains in the Genus database with same CATH topology
1YXBA 1YVWA 3CRAA 2Q4PA 2P06A 5IE9A 4QGPA 1VMGA 3CRCA 2YXHA 2GTAA 3C90A 2Q9LA 2OIEA 2A3QA 2Q73A 1Y6XA 2Q5ZA 2A7WA 2OIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YXB A;  1YVW A;  3CRA A;  2Q4P A;  2P06 A;  5IE9 A;  4QGP A;  1VMG A;  3CRC A;  2YXH A;  2GTA A;  3C90 A;  2Q9L A;  2OIE A;  2A3Q A;  2Q73 A;  1Y6X A;  2Q5Z A;  2A7W A;  2OIG A; 
#chains in the Genus database with same CATH topology
 4I55 B;  1Y4M A;  4UVA A;  3R66 A;  3P3N A;  2BOB C;  2NNU A;  2IBZ H;  5JJE B;  1AP5 A;  1EN4 A;  3CX5 F;  1KBH A;  4YHH B;  3WB0 A;  4FFB B;  4MVZ A;  2KQX A;  1SZT A;  4OX9 O;  3K57 A;  1HNX B;  3L72 H;  5LMU O;  3T1H B;  3F5T A;  4JI8 B;  5KUM A;  5DM6 V;  4HBN A;  3CRM A;  4UCR A;  4H37 A;  1TGO A;  4J9Z B;  2X7R B;  4LNU A;  4R6Z A;  3JAS B;  1US6 A;  1SQQ H;  2GV9 A;  5IY5 C;  4GKK O;  4DV5 B;  4EB6 A;  4LR3 A;  5FPR A;  1H38 A;  4UVC A;  3SYP A;  4DUZ B;  3AG2 B;  3E8G A;  1TA8 A;  4FLZ A;  5JH7 B;  3AK3 A;  1YEW A;  4G27 B;  2EJR A;  3D36 A;  4D6T H;  1XHZ A;  1VAR A;  1Y76 A;  3L9D A;  3JD1 A;  5C8Y B;  3D36 C;  4X1I A;  1B6Q A;  4GX1 A;  4YIO A;  3G71 V;  4IL6 Z;  2EIJ B;  3K9A A;  5IDJ A;  4PA4 A;  4TV9 A;  2PZS A;  4KXR A;  3IC9 A;  1W0K G;  3ZHR A;  2A3Q A;  1JFF B;  4LWS B;  2N05 A;  4X64 B;  3MD0 A;  4EFB A;  4L87 A;  1W2B U;  1YJW V;  2CTW A;  3LUT B;  1FXV A;  4YJ3 A;  2GHY A;  1V54 B;  1CP9 A;  1AR4 A;  2L6L A;  3GVM A;  5E79 Z;  4JI3 O;  1GO3 F;  5IJ9 A;  3CJH A;  1XNR O;  4ZBM A;  4HNA B;  4MTG A;  2QM4 A;  4QPJ A;  5LA6 A;  4Q6G A;  4JF3 A;  1DF4 A;  1FXH A;  1NI8 A;  3B8M A;  4I50 B;  4I4T A;  1RSO B;  4MS2 A;  3PJS K;  1XI1 A;  2NN4 A;  1MAB G;  3DXR A;  2EIL B;  3AG4 C;  4FVM A;  3I56 V;  3ABL C;  3SJC C;  3CCS V;  1SRY A;  5EC2 C;  3LSS A;  4YJ2 A;  1IDS A;  1E1R G;  4DW1 A;  4TQD A;  1WPX A;  1GM9 A;  2IM9 A;  3L75 H;  4ZI7 A;  4NKG B;  2QDO A;  3CCR V;  1SQV H;  2XT9 A;  2YIB A;  2HEP A;  1JMK C;  2B1I A;  2CGN A;  4JI5 B;  1EN6 A;  1OCZ C;  4JYY A;  1VQK V;  3ASN B;  4LFA O;  2HR3 A;  3D3Q A;  2GUZ B;  4FLY A;  1M90 W;  1WPB A;  4PA3 A;  1CXZ B;  4JI1 B;  2WA4 A;  1RM1 B;  2B5U A;  1Y67 A;  2Y48 A;  2UXB O;  4HAM A;  3AG7 A;  1XEQ A;  3I5D A;  2A06 H;  2DQ3 A;  2ZIO A;  4YIP A;  2JGD A;  2XUM A;  4DV2 O;  5B1B B;  3FYI B;  2PGG A;  4W4K A;  4P9P A;  4LF9 O;  4JI0 O;  5TIS Z;  5IWA B;  3SPC A;  1AI5 A;  4TQF A;  3ZBH A;  2YI8 A;  3HKD A;  4IIJ B;  4O4I A;  3G67 A;  3JAL A;  1P49 A;  4UCS A;  5IE9 A;  1YDX A;  1MOF A;  2K1E A;  3K59 A;  3OD4 A;  4GKJ O;  2VS0 A;  3RYH A;  3CRQ A;  3JCZ A;  5L3D A;  1VQO V;  3CRR A;  4DR5 O;  1Y6X A;  1BZK A;  2GTS A;  4BW5 A;  5IY5 B;  3K3W A;  4J9Y B;  4WFH A;  1IBK B;  5KMG B;  4O4H A;  2QWP B;  4PEL A;  1S77 D;  4BAY A;  3M7M X;  3CC4 V;  3E35 A;  2HVJ C;  3HR0 A;  1XL4 A;  2E76 B;  4DV0 B;  5B1N A;  3P3P A;  2JIZ G;  3H01 A;  3B40 A;  3OUF A;  1TVK A;  2JK5 C;  4UCU A;  1K4C C;  1QVG U;  1I0H A;  4K8X A;  2OIG A;  4X1I B;  2AXT Z;  4RQE A;  1H8E G;  1WB7 A;  1BCC H;  1O9G A;  1ROP A;  4MVO A;  1SKV A;  2HHH O;  5EC1 C;  3JD2 A;  2Q8V A;  2ZE5 A;  4QPK A;  2IH1 C;  2E3C A;  2HP8 A;  5CA1 B;  4X8A A;  1NQT A;  1DK1 A;  4YJ3 B;  2RJZ A;  3ZRW A;  2XHB A;  4DRX A;  3FFQ A;  4GLX A;  3W7T A;  3D3I A;  3J7A U;  4FLV A;  1YI2 V;  2C2A A;  2EIM C;  5HFM A;  4B3T B;  1JA8 A;  4JAA A;  1ZSP A;  5IJ9 B;  2CGO A;  2WLL A;  1OV9 A;  1WLE A;  3AG3 C;  1K92 A;  3K5M A;  5LA6 B;  2UXC B;  4DV1 O;  1WB8 A;  2P6J A;  4WFF A;  3CCJ V;  4X65 O;  1G6U A;  2X6A A;  4B3S O;  4O4L A;  4I4T B;  1Q90 D;  3RYI A;  4LF6 B;  4U7O A;  3DC6 A;  5KUK A;  1KKC A;  2PI5 A;  2YXY A;  3ABL B;  3UT5 A;  5CA3 A;  1SQF A;  3DXR B;  3OEE G;  5JVD A;  3B8N A;  5JCO A;  3T4D A;  5JWP A;  3ML0 A;  4J42 A;  4UVB A;  4JI4 O;  5JCO C;  1VQ8 V;  2YC0 A;  4NB5 A;  4DR6 O;  1GN6 A;  2VQE O;  1AP6 A;  1HNZ O;  4JI7 O;  4ZI7 B;  2EZP A;  1EBO A;  5K1P A;  1QVF U;  2QTO A;  1VQ5 V;  4DR7 B;  3QTC A;  2JS5 A;  2X6B A;  3G4S V;  5EK0 A;  4FPP A;  3TJT A;  1L0N H;  2PYL A;  1R3I C;  2ZKO A;  4LCU C;  2W0X A;  2UUB B;  2OYQ A;  2IJK A;  1SER A;  1NKD A;  3M99 B;  2QR4 A;  2V4D A;  2EBO A;  1F4N A;  1K9M W;  1HWY A;  1GTO A;  4JGS A;  3SR2 C;  2QE7 G;  4JAU A;  2W0F C;  1WJZ A;  3BFR A;  5JQG A;  1VQN V;  3T4Z A;  1N0N A;  3BEH A;  3IFX A;  3HKE A;  3O65 A;  1AIL A;  2R9I A;  1XDC A;  2QKS A;  5J2U A;  4GX2 A;  2WLK A;  4J41 A;  2UUC O;  2JGD B;  4UXN A;  1XMQ O;  3DC5 A;  4Q20 A;  2EJ7 A;  2GTA A;  1Y66 A;  2R70 A;  2YIA A;  3CC2 V;  3HKD B;  4CC5 A;  3CYO A;  4O4I B;  2XOK G;  3BRC A;  4OPA A;  4EKW A;  5AG2 A;  1VF5 B;  3QO5 A;  4P9O A;  1NTM H;  4TUY A;  4LFC B;  3RVZ A;  1MNG A;  2XAJ A;  2CTP A;  3CSX A;  4DK0 A;  1SF9 A;  1ZUQ A;  4BR6 A;  4CH3 A;  3U10 A;  4PD4 F;  2XTA A;  1OCC C;  1EN5 A;  2QM8 A;  3RYH B;  5LHG A;  4PA6 A;  2YI9 A;  1CPY A;  3H1I H;  2Q0O C;  3ABK C;  4DUY B;  1I5X A;  4WFA V;  1PL0 A;  3RBZ A;  5H2F Z;  3LDD A;  3OMA B;  4O4H B;  4X20 A;  4CBC A;  2WLJ A;  2YIC A;  2EIK B;  3RYC A;  3CRA A;  5GW7 A;  4QIW F;  1HDJ A;  3K04 A;  1SQX H;  4YY3 B;  2P7T C;  5E1A C;  4LF5 O;  3G6B A;  1N34 O;  4LFB O;  4J80 A;  1B06 A;  1TVK B;  3K08 A;  1K33 A;  3C3S A;  5LGN A;  2UUA O;  3T1C A;  4AIL C;  3ETD A;  4J11 A;  1R6T A;  4DR2 B;  1TUB B;  3T2M A;  3BHP A;  2OCC C;  4FM1 A;  2DYR C;  1YJ9 V;  3E8B A;  5EIB D;  4X66 O;  1OCR B;  3JAW A;  4BW9 A;  1W0J G;  3FD9 A;  4X62 O;  2CH7 A;  2ZQM A;  1M5I A;  3ZRW B;  2QWO B;  3JAM N;  1IUR A;  2EIM B;  4DRX B;  4PDM A;  3Q4H A;  4AQY O;  2CTR A;  4H33 A;  4EFE A;  3ZMU A;  3ZJZ A;  4WFB V;  1KC8 W;  2WLL B;  2FYU H;  1M1K W;  1YVW A;  1G8M A;  1KMI Z;  1PNM A;  2W6I G;  2LO1 A;  1OZ0 A;  2QWR B;  4ZKI A;  2N74 A;  3ABT A;  2LW7 A;  1R6N A;  4DR1 B;  1HNW B;  1BQZ A;  4AHC A;  5KX5 A;  1Q82 W;  3BVO A;  2BSK A;  4O4L B;  1FAF A;  1FFX A;  5EBM C;  2JGU A;  3CCM V;  2Q68 A;  2KG7 A;  1XRE A;  3FKS G;  3T1Y B;  5CBH A;  4OX9 B;  4X1K B;  5CA0 A;  3TK1 A;  1FKA O;  5JVD B;  5LMU B;  3FB8 C;  4U3J A;  2XND G;  1WNS A;  1N4C A;  4ZOL A;  1XIL A;  1VQ9 V;  4QE9 A;  5IJ0 A;  1LR1 A;  4GKK B;  5BY1 A;  1GN3 A;  3BA9 A;  4C7U A;  3CP1 A;  1K5Q A;  2F4V O;  3NR7 A;  4J7K A;  4GX0 A;  2GBO A;  1BT8 A;  4FLX A;  2IJI A;  2ZR2 A;  4TV8 A;  1WN7 A;  1XNQ B;  2FML A;  4NXN O;  3W7U A;  4K0K O;  1NVP D;  3UKM A;  1VQ6 V;  2XAG A;  2LGQ A;  1JR9 A;  4KUM A;  2QEX V;  2ZNJ A;  1QLN A;  4H0L B;  3J81 N;  4R7C A;  1K73 W;  2M6Y A;  1K4D C;  3X2Q B;  2YXL A;  4LF7 O;  3HKB B;  1GK9 A;  3B09 A;  2JS3 A;  5J2U B;  2IJJ A;  3QO8 A;  2FL4 A;  4GYC B;  2ITD C;  4OPH A;  4RO2 A;  3SYQ A;  5CMU A;  1XNR B;  2K9P A;  4DK1 A;  3EVK A;  5B66 Z;  1SZX A;  1KYO F;  1V55 B;  5GTI Z;  1L0L H;  4LF4 O;  2Z0A A;  2VQF O;  3CCE V;  3JYC A;  1M56 C;  2H8P C;  5EBL C;  2E74 B;  2UXD O;  1NR7 A;  4CZZ A;  1X59 A;  4PI2 A;  1U97 A;  5CN0 A;  1GRJ A;  1Q7Y W;  1NJI W;  1QNM A;  1OCC B;  4YHH O;  2WA3 A;  5JJJ B;  2RNB A;  5H6R A;  4JYA B;  3ABK B;  5FPO A;  2F1M A;  4O2B A;  3ZRS A;  5IYZ A;  3ZHQ A;  3BY6 A;  1HNX O;  3IC7 A;  3LDE A;  4JI8 O;  2DWD C;  4IYH A;  3RWR D;  4X20 B;  5A2Q N;  3K5O A;  3IAY A;  2ZXW C;  1PKX A;  1VF6 A;  3CPW U;  3ZRV A;  1N32 B;  1VF6 C;  3K03 A;  1Q81 W;  4ZHQ A;  1DF5 A;  1NT2 B;  2IH3 C;  4LFA B;  4WCE V;  1WP8 A;  1SQB H;  3CRC A;  3N2G A;  2NLJ C;  2YS8 A;  2YEV A;  4Z1M G;  3JAR A;  2YIB D;  3SYO A;  2JDI G;  2JJ2 G;  4HZ3 A;  4KHP O;  1N33 O;  5EZY B;  4PHZ A;  1KU9 A;  4BIZ A;  2PYJ A;  4MVU A;  1JQ0 A;  3JAW B;  3RYF A;  1K8A W;  2BTQ A;  2UXB B;  5ITZ A;  1PP9 H;  3PN1 A;  4RUE A;  1N8R W;  2R72 A;  4X64 O;  2QA4 V;  1I94 B;  2V7Q G;  4R50 A;  3JAT A;  2F95 B;  4LF8 B;  1IX9 A;  2ZM6 O;  1GKF A;  2QKA A;  1O9H A;  4DV2 B;  2HFE C;  2ZE7 A;  1YHQ V;  5CBF A;  4P2Z A;  3L73 H;  5LMN B;  1Q86 W;  4NXM O;  4MSW C;  2Y4T A;  2F23 A;  4TOI A;  1ARO P;  1ENV A;  1JPX A;  1ZL8 A;  2P06 A;  3MDS A;  1S0V A;  1XMO B;  1H2K A;  1Y74 A;  2MW2 B;  4YXW G;  3UCS C;  2OIE A;  2N04 A;  5FNV A;  3H9V A;  2KG7 B;  3K0G A;  3A0H Z;  4IYI A;  4I0X B;  4GKJ B;  3LSU A;  1B3Q A;  2Y69 C;  4U3J B;  1IBM O;  4ICG A;  4DV6 O;  2DW4 A;  3WG7 C;  3ZN1 A;  4CH6 A;  3HKC A;  4JAV A;  4ZOL B;  3WU2 Z;  4DR5 B;  1MSD A;  1AR5 A;  2AHZ A;  4JTA B;  4CS2 A;  3U11 A;  5CBG A;  4NYK A;  1JVM A;  1BL8 A;  1MSW D;  3IGA C;  1FJG B;  4JZ2 A;  5KHG A;  1P7B A;  4UB6 Z;  4F6R A;  3ZMZ A;  2L35 A;  3H1J H;  1EM1 A;  3STL C;  1GM7 A;  1VQM V;  4JI5 O;  2R9R B;  1XHX A;  3C90 A;  5A9G A;  3UO2 A;  4E2L A;  5BMV A;  1NR1 A;  3E22 A;  1K7D A;  3VQY A;  3OAA G;  4DV3 B;  2IJH A;  1D5N A;  4OXS A;  1MMM A;  3UQ8 A;  4LNU B;  4RWU A;  1VQ4 V;  3CXC U;  3ETQ A;  1THZ A;  2XAS A;  1OJH A;  3ASO C;  1YCI A;  4EB6 B;  4PA9 A;  2BCC H;  1AVM A;  2IU0 A;  1NVP B;  3OFN G;  3MHS C;  4F4L A;  4FMT A;  4UB8 Z;  3SDL A;  1GN2 A;  2VRZ A;  1Y76 B;  2XAF A;  4DV1 B;  4GX5 A;  1M56 B;  5EBW C;  4X65 B;  5BR8 B;  1QBZ A;  3SGI A;  1AJN A;  5LHH A;  3CS5 A;  5LL6 Y;  4B3S B;  4QE7 A;  4QGP A;  4TV9 B;  5B1A C;  5IWA O;  3G6E V;  2RQ6 A;  3EHB B;  1SQG A;  2P90 A;  5J9P C;  1NZ6 A;  3D8C A;  3GWO A;  3B2E E;  3CCQ V;  4UV8 A;  3A8T A;  1IXM A;  4O2B B;  5IYZ B;  1S72 V;  1MG1 A;  2LW1 A;  4JI4 B;  1J95 A;  1ZLZ A;  5H9C A;  4PI0 A;  2VQE B;  1H2G A;  1L8D A;  4N21 A;  2ZXW B;  2QWQ B;  2RMK B;  3CJH B;  3CWB H;  3SPG A;  4FM0 A;  1TUE B;  1KKD A;  4B3M O;  1KP3 A;  4U7N A;  1N36 O;  3W7X A;  3P30 A;  1GH6 A;  2P4K A;  5BZB A;  3RGB A;  4ZHQ B;  1F51 A;  3OGC C;  2B1G A;  4UUJ C;  1NH2 D;  3N2G B;  4NVP A;  4I9W A;  1HW7 A;  3ABM C;  4DV0 O;  3AG4 B;  4JAS A;  4DR4 O;  4CC6 A;  2XAH A;  2Q67 A;  1VEW A;  4JI2 B;  3FB7 C;  3JSN A;  4YJ2 B;  2OTJ V;  4O4J A;  1WP7 A;  2PUS A;  1MA1 A;  5KLV H;  1L1F A;  1Z5V A;  5ITZ B;  1WA8 A;  2KKW A;  1ZWI C;  5HFL A;  5LXT A;  2AW9 A;  3M8A A;  3AG1 C;  1SA0 A;  1PV0 A;  2LP7 A;  4BWA A;  1R3J C;  3ZS8 C;  3ZMS A;  1XQ8 A;  2QWN B;  1P4R A;  1OCZ B;  1XMQ B;  5L3B A;  2X0L A;  1IBL B;  2PF4 E;  1QCE A;  1IZ3 A;  2HJD A;  1YJN V;  3OW2 U;  3OTF A;  1VF7 A;  3JD0 A;  2UXC O;  1Y74 B;  3ETE A;  2Q4P A;  4I55 A;  1S5L Z;  2PI4 A;  3KKY A;  5FNV B;  4GUN A;  2Y69 B;  4DV4 O;  1GAX A;  3SPJ A;  5JJN B;  4H13 B;  1CEZ A;  1H2L A;  3WG7 B;  1Q5O A;  3RFR A;  5LBQ A;  1F4M A;  5KHK A;  4MVQ A;  4RQF A;  4B3R O;  2HKO A;  4K8Z A;  1QU7 A;  2DMX A;  1YTF D;  1YF2 A;  2M7W A;  5DEC A;  5LYJ A;  1P84 F;  1K97 A;  1Q8I A;  2BOC C;  1AI6 A;  3S3W A;  2QSA A;  1NTK H;  1LNQ A;  5KHH A;  1DTO A;  5J2T A;  4LF5 B;  4LFB B;  1TAE A;  3F5W C;  3MHH C;  1LUW A;  2CUG A;  4NTY A;  4DR7 O;  3JAL B;  2UUA B;  1UFI A;  3AG2 C;  3KCY A;  1VQL V;  1COW G;  2UUB O;  2YXH A;  4IGG A;  3SPH A;  4WBN A;  4X66 B;  3ZX6 A;  2GDS A;  2QTS A;  1HR0 O;  2EIJ C;  4L8J A;  5FL7 G;  2UU9 B;  1JFF A;  3E83 A;  2OCH A;  2ZT9 B;  2Q6A A;  4QJF B;  3K06 A;  4AQY B;  2XAQ A;  1VQ7 V;  1W59 A;  3JD3 A;  2D2C B;  3K79 A;  3CE2 A;  5L3C A;  5GTH Z;  1H2M A;  1V54 C;  4E4E A;  2ILM A;  4WFG A;  3OTO O;  4K3A A;  2A7W A;  2JEU A;  3APO A;  4I5S A;  4X9Q A;  4B7K A;  3TCU A;  4J10 A;  4DR3 O;  1BHA A;  4D7T A;  3FYE B;  1J5E B;  4I50 A;  3ZHV A;  2F66 C;  1KEC A;  2ZD9 A;  4LC1 A;  3WB1 A;  3CME V;  4TT3 G;  3TET A;  2D3O W;  3OT7 A;  1GMG A;  3TXQ A;  1S5J A;  5EYP A;  2B9Z A;  1NS1 A;  3FB5 C;  2CK3 G;  3AG3 B;  4QNH B;  2CE4 A;  3RT3 C;  3ICX A;  4CH4 A;  3KG2 A;  1PNK A;  3A0B Z;  4MVM A;  3L70 H;  4GCZ A;  2ADQ B;  5K1X A;  3KCX A;  2H3O A;  1JJ2 U;  3LDC A;  3ABM B;  3RYI B;  4NXN B;  1NBM G;  2WWW A;  2EIN C;  3UT5 B;  1FPO A;  5KA5 A;  4O4J B;  3SJB C;  3STZ C;  4DR2 O;  1GM8 A;  2RDC A;  1Z5W A;  4G2K A;  4X88 A;  3RN4 A;  5LOV A;  1WA8 B;  3AG1 B;  3ZIA G;  1IVS A;  1F7Y A;  5LXT B;  1NH2 B;  4JV5 O;  3O9O A;  1AJP A;  2WPD G;  5H5N A;  4JYC A;  1RM1 C;  4AI8 A;  5LGU A;  2Q69 A;  3EFF K;  3QF7 A;  3TGU H;  1VQP V;  4DXW A;  1Q43 A;  3BPZ A;  1VP7 A;  3ZHS A;  4LF4 B;  2VQF B;  1YIJ V;  1Z2G A;  2DYS C;  2UXD B;  4FJC C;  1H2S B;  2E5L O;  4LP8 A;  3NXS A;  4DR1 O;  1HNW O;  4OGQ B;  4IIJ A;  1BS3 A;  1WAZ A;  5LP6 A;  1SES A;  4PV1 B;  3JAK A;  5CB4 A;  5JQG B;  3K0D A;  3QVN A;  3FB6 C;  1R73 A;  5LP6 C;  2GSM B;  3C3T A;  1ORQ C;  1R3L C;  3RVY A;  1UJW B;  3HKE B;  2DQ0 A;  4CH5 A;  3F7V C;  4EEQ A;  3T1Y O;  1PL4 A;  3RW0 A;  1E1Q G;  2Q73 A;  2YID A;  4JI3 B;  4DV7 O;  1BQ0 A;  2HJF C;  1BE3 H;  2Q7H A;  5C93 A;  4UCO A;  4JI6 O;  5LYJ B;  1YXB A;  2YSU B;  3ZCC A;  4O2A A;  2LGW A;  1V9P A;  2OTL V;  3ZMT A;  4MVS A;  2IU3 A;  4PDV A;  5KMG A;  5J2T B;  1AB3 A;  1G1X B;  2QGN A;  4JTC B;  3OUS A;  4P30 A;  4MTO A;  2ATK C;  2X6C A;  4TUY B;  4RUF A;  1ZAU A;  5DED A;  3A0R A;  4RAI A;  3E8F A;  5BXZ A;  2E75 B;  1YTF B;  3VOU A;  1FXK A;  5LHI A;  1XNQ O;  1SC5 B;  4KHP B;  1FXK C;  4ASU G;  3JCU Z;  3TXS A;  1N33 B;  4WBN B;  1F23 A;  5B3S C;  4DW0 A;  4HYO A;  5FLX N;  3T1H O;  1Q6I A;  2AHY A;  4PA7 A;  3LSQ A;  5KHJ A;  1I7F A;  3SYA A;  4TSF G;  3RYC B;  2EUL A;  1EFR G;  5CA1 A;  2ZM6 B;  1QLE C;  4UCT A;  1HP8 A;  1M4U A;  4DV5 O;  4JTD B;  2BTO A;  3SPI A;  4DUZ O;  5KAF Z;  4NXM B;  1QR9 A;  2CTQ A;  1YIT V;  1D2D A;  3OR7 C;  2FKX A;  2OCC B;  2DYR B;  1KUQ A;  4IT5 A;  5L3G A;  4FM2 A;  4FIP C;  2CAZ C;  2ETN A;  5IYD O;  4IHJ A;  1T5E A;  3UO3 A;  1S5H C;  2CH7 B;  1IBM B;  5KAI Z;  4DV6 B;  2ZR3 A;  3ABU A;  5F2V O;  3E8H A;  3Q4H B;  5EYP B;  3QO7 A;  4DO2 A;  1BSM A;  3QG5 A;  4KFM A;  5GON A;  2ITC C;  1XL6 A;  3OR6 C;  4JYA O;  1FS0 G;  4MW8 A;  3THO A;  2IW5 A;  4LF9 B;  4JI0 B;  3OMI B;  2QM7 A;  2KSD A;  3BAB A;  2OWO A;  3B77 A;  1DLB A;  5KX5 B;  2YUA A;  2BSK B;  4WFE A;  1FFX B;  1JCH A;  2LFR A;  2P22 C;  3E86 A;  4PJ0 Z;  4CS4 A;  1N32 O;  2EIN B;  2WSS G;  2WLI A;  1B04 A;  2RCV A;  3H1H H;  4FLU A;  1K34 A;  4U3F H;  5CA0 B;  3L71 H;  3BA8 A;  4B08 A;  1Q3E A;  1XUQ A;  1E79 G;  3CCL V;  3BAA A;  5LOV B;  1K5S A;  5IJ0 B;  2DN9 A;  3GB7 C;  1LUV A;  4FZ0 A;  3F7Y C;  3VQX A;  2Q5Z A;  4ABM A;  5L3F A;  1BGY H;  1I94 O;  1SQP H;  1Q6U A;  4TV8 B;  4LF8 O;  1KQS U;  3GWK C;  2DYS B;  2WLH A;  5KA6 A;  1PD3 A;  2ZE8 A;  4UCV A;  5L3E A;  1R6K A;  5LMN O;  1JJO A;  2HHH B;  2P5O A;  2Q7G A;  3VQV A;  2A79 B;  3HB3 B;  5LP6 B;  3JAK B;  5CB4 B;  1P7G A;  1XMO O;  1M57 C;  4XDK A;  1EZV H;  3CCU V;  4X1Y A;  5DN6 G;  4JI1 O;  4WF9 V;  1R1B A;  1KB9 F;  2Q9L A;  1RFY A;  3W7S A;  1FD9 A;  4UV9 A;  2JRI A;  4B3M B;  2ARH A;  4O2A B;  1N36 B;  3OE7 G;  2Z3Y A;  5IT9 N;  2AZ0 A;  3IJ4 A;  2ODM A;  4F6E A;  4PDR A;  3CC7 V;  3CMA V;  4FZ1 A;  3P32 A;  1OCO C;  3ETG A;  4G28 B;  1FJG O;  1PPJ H;  2EIK C;  4A5U B;  4ZIB A;  4Z1V A;  4DR4 B;  1FXK B;  1M93 A;  2HG5 C;  4I7Z B;  3VQW A;  5B3S B;  1XBL A;  1DGS A;  4MW3 A;  4Z2W A;  1MZF A;  4LBE C;  3OGI B;  4MTF A;  3SJQ C;  2AZ2 A;  4JPR A;  1TUB A;  1QR8 A;  3SYC A;  4DR6 B;  1HNZ B;  4JI7 B;  2JEX A;  1KP2 A;  4I9Q A;  4DV3 O;  2KB1 A;  3BCC H;  1PNL A;  1QLE B;  3K5N A;  1OCR C;  4XDJ A;  1IBK O;  2WLM A;  4KP4 A;  1K3E A;  4UFZ A;  1NTZ H;  1RP3 B;  1PM9 A;  1S3J A;  1M9N A;  3U0Z A;  2YEV B;  4NR1 A;  5D5Q A;  3JAR B;  2V1D A;  3FAV A;  4NTW A;  3R65 A;  3DGE A;  5BR8 O;  2ADP A;  3N2K A;  3QNE A;  3K9S A;  4IHJ B;  4DV4 B;  3RYF B;  3OMN B;  4FFK A;  2BTQ B;  3DTU B;  2PY5 A;  1AI7 A;  1X4T A;  2EZO A;  2ZIN A;  3WB2 A;  4KL1 A;  3AK1 A;  4X1K A;  4B3R B;  2OT5 A;  3JAT B;  5GON B;  2UUC B;  2HVK C;  4K35 A;  4N23 A;  3OM3 B;  2QJ1 A;  3CEI A;  2JJ1 G;  4B3T O;  3L74 H;  1URF A;  1ZL8 B;  2WLN A;  3CD6 V;  2O57 A;  1I08 A;  1VMG A;  2WLI B;  3B4S A;  3DSQ A;  2F43 G;  3VBB A;  2Q0A A;  1BMF G;  4FFB A;  4LF6 O;  4PDL A;  4JZG A;  3ZRX A;  2ZCE A;  3HKC B;  2NR5 A;  3WFV A;  1UPG A;  1HR0 B;  3H1L H;  4JI2 O;  3CCV V;  1D5A A;  5B1O A;  2RN9 A;  1QHT A;  4XDL A;  4J7J A;  5IYB O;  3LNN A;  2G38 A;  3JSL A;  3JAS A;  2VWJ A;  2DJV A;  4GT1 A;  3H1K H;  3HKB A;  1Q6H A;  1RPR A;  3X2Q C;  2P4V A;  1YZB A;  4MT8 A;  4F6R B;  1N34 B;  1XOU A;  2PTM A;  1QQC A;  4BIO A;  5JH7 A;  3OTO B;  3N27 A;  3E2E A;  1RPO A;  3S3X A;  1MZE A;  5C8Y A;  5BMV B;  1IBL O;  3E22 B;  2Z5U A;  1V55 C;  2DE0 X;  1M57 B;  2R9A A;  4X89 A;  4DR3 B;  2DWE C;  2UXX A;  3W7W A;  4TWK A;  4GZR B;  1S76 D;  4X62 B;  2FTK A;  2F93 B;  3AK2 A;  4X1Y B;  3ASO B;  1AI4 A;  4LWS A;  3K5L A;  4W4L A;  1GN4 A;  3CHX A;  4D7S A;  2P67 A;  2YDE A;  2Y4U A;  5H6Q A;  4LH6 A;  2MK3 A;  1R3K C;  1OHH G;  5KHI A;  1KD1 W;  1JOY A;  3SJA C;  2ZNI A;  4DYL A;  1OCO B;  4FK5 C;  5B1A B;  4HNA A;  2AGA A;  3FX7 A;  1BHB A;  1N0J A;  2Q7E A;  3I55 V;  1NU1 H;  2ZIM A;  1I5Y A;  3J80 N;  2H94 A;  3APQ A;  3JD4 A;  3MAQ A;  2LQT A;  2A0L A;  1RSO A;  3G80 A;  3K58 A;  1IXB A;  4FLW A;  4LFC O;  5LGT A;  3KZI Z;  4B7E A;  1AR1 B;  4FLT A;  3EXA A;  5IYC O;  4CS3 A;  3UM7 A;  2Y0P A;  1SET A;  1ZTE A;  3A2F A;  2FB5 A;  5EZY A;  2EIL C;  2WAM A;  4JV5 B;  1YSC A;  3ZED A;  1A32 A;  2VWK A;  4DUY O;  1H2N A;  2EX3 A;  4BIU A;  3E89 A;  2F4V B;  1ZX3 A;  2UU9 O;  2LFS A;  2ZE6 A;  4R8C A;  4JYB A;  1G4Y B;  3CXH F;  3AEI A;  1AJQ A;  3LNM B;  2UXN A;  4MTX A;  4XBF A;  4YY3 O;  4K0K B;  2ZDI A;  3FAV B;  2A9H A;  2LJ2 A;  2DOS A;  2HLD G;  4MVR A;  2W6J G;  3ZMV A;  2ZDI C;  2GUZ A;  3OEH G;  1U96 A;  2E5L B;  5D5P A;  3ASN C;  5EIB C;  3HPL C;  3ZHU A;  3N2K B;  3ZHT A;  4LH7 A;  4LF7 B;  2BE3 A;  1EZJ A;  4J7Z A;  4I0X A;  1JX9 A;  1SA0 B;  2JVD A;  1J5E O;  4H44 B;  4DV7 B;  2CDY A;  4JI6 B;  1FYJ A;  5B5E Z;  1H8H G;  4NTX A;  3ZN0 A;  5B1B C;  2Y0I A;  1FFT B;  3CB2 A;  2QKC A;  1VIB A;  1SS3 A; 
#chains in the Genus database with same CATH homology
 1YXB A;  1YVW A;  3CRA A;  2Q4P A;  2P06 A;  5IE9 A;  4QGP A;  1VMG A;  3CRC A;  2YXH A;  2GTA A;  3C90 A;  2Q9L A;  2OIE A;  2A3Q A;  2Q73 A;  1Y6X A;  2Q5Z A;  2A7W A;  2OIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...