4QGPA

Crystal structure of a pyrophosphatase (af1178) from archaeoglobus fulgidus dsm 4304 at 1.80 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
108
structure length
108
Chain Sequence
KIHHHHHHMEELLDILREFRDSRGWLKYHTPKNLAVSISIEVAELLEIFQWTRSSDEEFEVLERRKGEVEEEIADVLIYLLFLCDVAEINPIEAVKRKMEKNERKYPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pyrophosphatase
publication title Crystal structure of a pyrophosphatase (AF1178) from Archaeoglobus fulgidus DSM 4304 at 1.80 A resolution
rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 40
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12643 MazG-like MazG-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 4qgpA00
2Q73A 1YXBA 2GTAA 2OIGA 4QGPA 2P06A 2Q5ZA 3C90A 3CRAA 2OIEA 3CRCA 2Q9LA 1VMGA 2A3QA 2A7WA 2YXHA 5IE9A 2Q4PA 1Y6XA 1YVWA
chains in the Genus database with same CATH superfamily
2WA4A 4X66B 1W0KG 2YICA 3JAMN 1HDJA 3IFXA 2ATKC 3N2GB 3IC9A 5H2FZ 3OGIB 1KUQA 1M57C 2H94A 4UVBA 2EINC 4JI2O 4KP4A 1BHAA 2RJZA 4RQEA 1IBKB 4X64O 4ZHQB 2HFEC 1FJGB 2WLNA 3ZRSA 3AG1C 3RBZA 5FPRA 3HB3B 1TUEB 4TQFA 4E2LA 5L3FA 1I08A 3CWBH 2YXLA 4DR4B 5CBHA 4EEQA 5DM6V 1VEWA 4H13B 1S5HC 4JYBA 4DUYB 4DR7O 5GTIZ 5L3EA 2VQFO 3CCRV 4BR6A 3E22A 3G4SV 1I5YA 1RPOA 2G38A 4WF9V 4U3JA 2UUAO 3A0RA 3T1CA 1RFYA 3AG3C 1LNQA 1HNXB 5DN6G 4LF7B 5FNVA 3P30A 1YI2V 2RMKB 4FPPA 1EM1A 1ROPA 1N32B 2CAZC 1KECA 5EBMC 2L6LA 2PUSA 3FX7A 2KQXA 3K9AA 4G28B 3ASNB 2WLLA 1QU7A 1N36B 4YJ3B 4FFBA 3HR0A 4WFEA 3CCJV 1HR0B 4X66O 2OT5A 5B66Z 1K4DC 3CX5F 2MW2B 2W6IG 1EZVH 2CK3G 3OW2U 5B1OA 4KXRA 2ZE8A 4O4IB 1ZTEA 2X6CA 1IBKO 2DMXA 3AK1A 2Z3YA 2GTSA 5BMVB 1YXBA 3L70H 4RAIA 5KX5B 2GBOA 2BOBC 3M8AA 4JTDB 5DECA 4BIZA 3N2KA 3OGCC 1OCZB 3WG7B 4DUZO 1B3QA 4DR4O 2IJJA 1QLNA 3BA8A 5J9PC 5B1BB 4DUYO 1H2GA 1N0JA 3X2QC 1R3IC 5LBQA 2WA3A 3JD3A 4H37A 2Q69A 4X62B 4IIJB 1HNZB 3JARB 1OCCC 1S0VA 4LFAB 5JCOC 2KG7B 3BA9A 3S3XA 4AI8A 4BIOA 5DEDA 4C7UA 3SPCA 1FXKC 4QPKA 4GX0A 4JASA 4DW1A 2Q7EA 1OV9A 1HNXO 1AILA 5EC2C 4LF7O 4I4TB 2UUBB 4FLWA 1YJNV 4PA3A 1YEWA 1N32O 4CC5A 3TJTA 4PI0A 3SPIA 2KKWA 3OMAB 1M1KW 2AZ2A 2P6JA 2E3CA 3IAYA 1QHTA 3J80N 4X1IB 3HKEB 3KKYA 1HR0O 3CC4V 2N74A 3S3WA 2ZM6B 2RDCA 3SPHA 1N33B 5CA3A 5HFLA 1AROP 5AG2A 3W7SA 3K57A 3QG5A 1CPYA 5IJ9A 3B2EE 2JDIG 2AZ0A 2UXNA 2PI4A 1JVMA 2P22C 1DGSA 3L72H 2XHBA 1RM1C 3MD0A 4GX1A 4LF8B 1NH2B 3KG2A 4XBFA 1SZTA 1E1RG 3NR7A 3ZHTA 4PJ0Z 1F23A 1Y4MA 4JI3B 1PP9H 3TGUH 5CB4A 3ZMVA 4U3JB 3ZCCA 1YF2A 2Y0PA 2IH3C 2ADPA 4KUMA 4O4JA 3ZHRA 2DYRC 1IVSA 3TETA 1GK9A 4DYLA 3U0ZA 1Y76A 1HNZO 2UXBB 5FNVB 1DF4A 4LFAO 1S5JA 3VOUA 1VARA 3H1JH 4NXMB 2X6AA 3DXRB 4U7OA 4PELA 4DV4B 1AB3A 1K5QA 4UCOA 3EXAA 4XDLA 2Z5UA 3VQXA 2WLLB 2ITCC 4FFBB 2UUBO 2XASA 4UCRA 2MK3A 3L75H 2QA4V 2WLIA 5KAIZ 4X1YA 2A7WA 2H8PC 5J2TA 2N05A 5KMGB 3MAQA 4NB5A 1IZ3A 4IYIA 2ZM6O 3B8NA 1TA8A 1N33O 3FAVA 1EN5A 1MSDA 2QM8A 3N2KB 3UKMA 1JMKC 3PJSK 1N34B 5J2UA 1R6TA 4WFHA 2C2AA 3ASNC 2YEVB 4HYOA 4DV3B 1K9MW 4YIPA 5C8YA 4J41A 2VRZA 2F93B 3QVNA 1H8HG 4X9QA 4I55A 2PI5A 1NS1A 1I7FA 4JI3O 1Q90D 4AHCA 3KCXA 3L9DA 1G4YB 1I94B 2HEPA 5L3DA 2HR3A 1F4NA 1PL4A 5H6QA 1SS3A 4WBNA 1AI4A 2ZR3A 1XMQB 5CN0A 1CEZA 4Z2WA 3I5DA 3ZS8C 2BTQA 4NXMO 1OCZC 3F5WC 1XL6A 4DV4O 3WFVA 2CGNA 5B1BC 3L71H 1B6QA 3ZJZA 5IYZA 3RWRD 5KAFZ 1SA0B 5CBFA 3EHBB 2Q9LA 5LMUB 4LWSA 1ZLZA 3MHHC 3OD4A 1QVGU 4TQDA 4UVAA 4F6RA 4G27B 1A32A 3F5TA 3CCSV 2EIKC 2EJRA 3CCVV 1J5EB 3ABMB 1K5SA 4DV5B 4OXSA 1Y74A 1GMGA 4MT8A 1EZJA 2LP7A 4PDMA 2XAJA 4JI1B 4JAVA 1ZL8A 2UU9B 1M57B 2EINB 4JI6B 1BS3A 4MVSA 1X4TA 4ICGA 4DV3O 1SZXA 2ZR2A 1ZSPA 4O4JB 3OMNB 1O9HA 3OTOB 3AG1B 4TT3G 1L0LH 2Y0IA 5IJ0A 2NR5A 4DV6B 1SERA 1TUBB 1I94O 3R66A 1AP6A 2JJ1G 3K5OA 2R72A 3ZHVA 1Y6XA 3IJ4A 4P9PA 1XMQO 5E1AC 2YS8A 3JASA 4EFEA 2IH1C 3FB7C 2OIEA 4X1YB 1PM9A 3ZMTA 3CJHB 4IL6Z 1D5AA 3W7WA 1QVFU 3AG3B 3HKCA 1Q6UA 2F43G 5LMUO 4UV8A 1VQPV 3L73H 2Q67A 5K1XA 3T1HB 3OM3B 2HG5C 4BIUA 1JJ2U 4BW9A 5IDJA 3GVMA 2F23A 5GONA 1JPXA 1SKVA 2ZDIA 3OE7G 4JI0O 3JYCA 4OPHA 4DV5O 3STLC 3SYCA 1SQPH 4BAYA 2QM4A 2OCCB 1OCRB 5JQGA 4UB8Z 4K8ZA 3CE2A 1UJWB 4DR1O 3D3IA 4I55B 4GCZA 2XAGA 4DR5O 4O4LB 4YY3O 2QSAA 4QIWF 4JI6O 5IYCO 2FYUH 2ZKOA 3ABUA 1ZX3A 4UCVA 3CMAV 4ZBMA 2PYJA 1NBMG 2QE7G 2YIBD 3OTOO 4WBNB 1VQ7V 4LR3A 1KBHA 1QLEC 2IU3A 4DV6O 2UXCB 4LP8A 3JD2A 2E76B 1XHZA 4JI2B 2IJHA 5LL6Y 1S77D 3W7TA 2LJ2A 2VWKA 5IYZB 3ZHUA 2XT9A 4LWSB 4MS2A 2N04A 3CHXA 5LGUA 4F6RB 1BE3H 3OT7A 4GX2A 4YJ2A 4UV9A 1FXKB 1GRJA 3B40A 2K9PA 1T5EA 1R3KC 2GV9A 4U7NA 1BQZA 4J7JA 5EZYA 1NQTA 1F51A 1Y74B 1SETA 2VQFB 4GYCB 3HPLC 3UQ8A 3JSNA 3CMEV 5H6RA 4CBCA 4RQFA 2QKCA 2EZOA 4ZI7B 3LSQA 3I56V 4FLTA 3JAKA 3UCSC 5FPOA 1THZA 1P7GA 1M4UA 1B04A 2ETNA 4LF5B 1AJQA 1QR8A 5HFMA 3LSSA 4QE7A 2Q68A 5TISZ 1SQVH 3FKSG 1WLEA 1ENVA 3QNEA 1PPJH 1MA1A 1S3JA 1K73W 3B4SA 1XDCA 2CTPA 5IJ0B 2P5OA 4B7EA 3ZMUA 4L87A 1ZUQA 2Y69C 2ZQMA 4DR6O 3GB7C 5LMNO 4UXNA 5LYJA 4JPRA 1BGYH 3K04A 2HJDA 1RM1B 4HNAA 3DC5A 2XNDG 3A2FA 4DV0O 4J42A 2UXCO 2QWQB 4L8JA 5LGTA 4NTXA 1M56C 3B77A 3BRCA 3JALA 4P9OA 1H8EG 1OZ0A 2DYRB 3HKCB 4DRXB 4JYAO 1WB8A 2GUZA 2HVKC 5IT9N 1AI7A 1SC5B 5LHGA 3MDSA 3THOA 1D2DA 3CXHF 3CS5A 2YDEA 4DUZB 4PI2A 4X65O 4JAUA 2CTQA 3BVOA 3AG4B 4GKKO 2XAFA 1VMGA 3K0GA 4MTOA 1OCOB 2IW5A 4J9YB 2FKXA 5JQGB 3CCMV 1Q6IA 4ABMA 1WP8A 5IE9A 3QO7A 1WAZA 2V7QG 2Q0OC 3H1IH 1R6KA 3PN1A 1AVMA 4LF5O 4ZKIA 4JZGA 3W7UA 4LF9B 1SQBH 2XUMA 3ZHQA 4E4EA 3HKDA 1K97A 5B1NA 4QJFB 4TUYA 2Q73A 5EK0A 4O4HA 5LOVA 1G8MA 2JVDA 1HW7A 3G67A 3H01A 4J9ZB 1NTKH 2OCCC 1OCRC 1P84F 2EZPA 1AR5A 4J80A 3I55V 2QJ1A 3QTCA 4YJ2B 5LXTA 2R9RB 4UUJC 3QF7A 1RSOB 1XEQA 2WLMA 4EFBA 4OGQB 5L3BA 3CRQA 1UFIA 3WB0A 3G6BA 2ZIOA 2RNBA 3WB1A 3SJAC 4CH5A 1KD1W 2F4VB 4FVMA 2EILB 2ZE5A 1HP8A 3JCZA 2PY5A 4PDRA 4NR1A 1GTOA 1Y66A 2YIBA 1JR9A 2LFSA 3JAWB 2EIKB 4LF9O 4FFKA 1JJOA 1P7BA 2Q7HA 4X1KA 4CH3A 3JD1A 2UUCO 1FFXA 3AEIA 5LA6A 1WP7A 1R3JC 3ASOB 2YI8A 1F4MA 4JF3A 1V9PA 1WPXA 1BT8A 4X20A 1IDSA 3K08A 3SJBC 3JALB 3OUFA 1O9GA 2QEXV 5IWAB 5ITZA 1M5IA 2GUZB 1MOFA 1JOYA 1R6NA 1YITV 3OAAG 4QPJA 4JI5B 2F1MA 3K3WA 5B1AC 1FXVA 3H9VA 4FMTA 2CTRA 3BHPA 1ORQC 4FLZA 1JCHA 3STZC 2ITDC 3RYFA 2QWRB 2E75B 1MABG 3E22B 4PDVA 4HBNA 4G2KA 1GH6A 1BSMA 1QCEA 1FPOA 3CYOA 3Q4HA 2BE3A 2Y48A 1WN7A 4GUNA 3TK1A 4PA4A 3WB2A 2CGOA 2F4VO 5JVDA 1YSCA 1Z5VA 2D3OW 2P06A 1XNQO 3VBBA 3FD9A 1F7YA 1V55C 1PNLA 3R65A 5LHIA 4CC6A 3HKDB 1Q81W 2B1IA 3RYHA 2ZDIC 1DTOA 2YSUB 3BPZA 3SPJA 3AG4C 1OCOC 5LP6C 3FYEB 4DV7O 1IXMA 5H5NA 1FD9A 3RVZA 1NU1H 4J11A 2D2CB 5IWAO 2ZIMA 1HNWO 1SQXH 4Z1MG 4EB6A 3E2EA 2FB5A 3LDDA 3DTUB 3FB8C 1QLEB 3K58A 1MNGA 4NVPA 4GLXA 1XNRB 4RUEA 4D7TA 4K3AA 3CRRA 4JI5O 1N0NA 1EBOA 3CP1A 5KHHA 3CCEV 1XI1A 1Q8IA 1KP2A 2YXHA 4U3FH 3WU2Z 3ZHSA 4IT5A 4AQYB 1B06A 3RYIA 4JTAB 3C3SA 1M93A 3CRAA 4LC1A 1VQ5V 3D3QA 3IGAC 4X1KB 1FFXB 1KP3A 3E89A 2CH7A 5LA6B 1WJZA 2M6YA 2ZNJA 4TV8A 5D5PA 4JTCB 1PV0A 1R1BA 4I50A 3LDCA 3A0HZ 4DXWA 1SESA 1GO3F 3OEHG 5A2QN 2DE0X 5ITZB 1GKFA 3RYCA 4RO2A 1R73A 2EILC 1TVKA 2WWWA 2R9IA 1IBLO 2E5LO 2KB1A 1P4RA 2FL4A 2YXYA 3E35A 5IJ9B 2Y69B 2JEXA 4UB6Z 2WPDG 2JJ2G 1PNKA 3LSUA 1HWYA 4JI0B 4TWKA 1Q7YW 4P2ZA 3SYPA 1H2LA 1DF5A 4YHHO 3ASOC 3ZRVA 2DWDC 4DR2O 4DR1B 5IY5C 1XNRO 1M56B 4DR5B 2RCVA 4JGSA 3RT3C 4YY3B 2AXTZ 5CB4B 2YIAA 3RFRA 1GN2A 3E8GA 2HLDG 1NI8A 1PL0A 3BABA 3ETGA 2JRIA 4O2BA 3P3PA 1BMFG 2M7WA 1Y76B 4AQYO 4IGGA 1DK1A 3ETDA 1WB7A 1H2KA 1EN4A 4CS3A 5KUKA 2QGNA 1K3EA 2DOSA 4B3SO 2OCHA 2PTMA 3MHSC 5CBGA 2QTSA 4I0XA 3TXQA 4KHPB 2Q0AA 4FM0A 4LFCB 1GM8A 5EBWC 2WAMA 1N8RW 4JI8B 1URFA 1GN3A 1BCCH 3CC2V 2EJ7A 2P67A 2WLHA 1QBZA 1IXBA 2F66C 2WLIB 3G6EV 4CS2A 4BWAA 2LO1A 2X7RB 4PA9A 2XAQA 4TSFG 1JQ0A 5J2TB 4EB6B 2EIJC 3BCCH 3GWOA 1VQ4V 3FAVB 1KQSU 1FS0G 1IBMO 5J2UB 2JS5A 1VQ6V 3K06A 4EKWA 4B3TB 2LW1A 4ZIBA 4WFFA 3AK2A 4FK5C 5BXZA 5EBLC 4DK0A 1JX9A 4ZHQA 3FYIB 2XTAA 5C8YB 2LFRA 3LNMB 4W4KA 1XHXA 3ZRXA 5LP6A 1Q82W 3RYIB 4H0LB 2GSMB 1VQNV 4UCUA 4J7ZA 2GHYA 1L1FA 4DR6B 1SRYA 2CDYA 3P32A 5LMNB 1M9NA 4FLYA 1BZKA 2HP8A 3DGEA 3G80A 4FJCC 3E83A 1AR4A 3UO3A 2CH7B 2A0LA 1J95A 1COWG 1XMOB 3ABLB 2ZINA 4DV0B 2DYSB 3ZBHA 2Q6AA 3D36A 2BTQB 3RVYA 1YVWA 1VF5B 2B1GA 4ZOLA 3FB5C 3EVKA 4KHPO 3RYCB 3FB6C 4UCTA 4LFCO 4JYAB 1GM9A 2P7TC 4YXWG 3G71V 2AGAA 4JI8O 1I5XA 4WFAV 4QE9A 2JEUA 4GT1A 1FAFA 3CCUV 1KC8W 1NR1A 1K4CC 2HHHB 2OTJV 4J7KA 3M7MX 4X88A 1BL8A 4X65B 4JI4B 1TGOA 2OIGA 4DO2A 4GKKB 4PHZA 2O57A 3OEEG 1NTMH 2VWJA 3C90A 4LF4B 5KUMA 3JSLA 3CD6V 3OUSA 2EBOA 3RGBA 1ZL8B 5IYBO 4R6ZA 4LFBB 4B3TO 1H38A 3CCQV 4F4LA 4BW5A 4CH6A 4GKJB 3ICXA 4D6TH 2YIDA 1G1XB 3LDEA 2LGWA 2A79B 5KHJA 1AJPA 2WLJA 4MW8A 4PD4F 3LUTB 1LUWA 5B1AB 4Q6GA 4I0XB 3OR7C 1QR9A 3O65A 4IIJA 4CS4A 1XMOO 4NYKA 3JARA 2WSSG 2KG7A 4TOIA 1XBLA 4JV5B 3JASB 3NXSA 1XOUA 3U10A 3CC7V 4CH4A 4UFZA 3SGIA 5B5EZ 5CA0A 5CMUA 4B3RB 1XUQA 4I4TA 1V55B 1Q43A 2KSDA 2HHHO 1W2BU 2CTWA 2Z0AA 2IJIA 5GONB 1SQFA 3IC7A 4MW3A 3K5MA 4JI4O 1KKDA 1L8DA 4FLXA 4X1IA 3HKEA 1NJIW 1UPGA 3BEHA 4LF4O 5LP6B 3UM7A 2BOCC 2AHZA 2JS3A 1NKDA 4LFBO 1LUVA 3CEIA 2GTAA 3B8MA 1SF9A 4GKJO 1H2MA 1CXZB 4GX5A 4K8XA 1AI5A 2UUCB 1L0NH 2JK5C 4PA7A 1EN6A 4DV2B 2RN9A 1QNMA 3K79A 1FXHA 4NXNB 1YTFD 1OJHA 1V54C 3AG2B 4ZOLB 4IYHA 4MTGA 2DQ0A 2UXDO 4O2AA 3AG7A 4ASUG 3T4ZA 3H1HH 1KYOF 3SYQA 2VQEB 1AR1B 4JV5O 4PA6A 1KMIZ 3BAAA 4DR3B 3E8HA 2Y4TA 3DXRA 4HAMA 3SYAA 2ZT9B 3VQYA 3ZN1A 2ODMA 1G6UA 2EX3A 5KHIA 2K1EA 1VQOV 4B3RO 1NVPD 4A5UB 5BZBA 5EZYB 1CP9A 2ZE7A 2XAHA 3JD4A 2EIMC 5K1PA 4OPAA 3F7VC 3ABLC 2B5UA 2DYSC 4W4LA 3CRCA 2XOKG 3JAKB 1SQQH 1YDXA 1RPRA 1WA8A 3E86A 1VF6A 2LGQA 3SJQC 2JGDA 3E8FA 5KMGA 1FJGO 1S5LZ 2QDOA 1XNQB 4MVRA 1VP7A 5H9CA 4Q20A 5CA1A 1MZEA 1Z5WA 3OR6C 1XL4A 1H2SB 4PV1B 3CSXA 2YEVA 1VQLV 1SQGA 1W0JG 5LYJB 2OTLV 1RP3B 1AJNA 3H1KH 2BTOA 4HNAB 1MZFA 4LCUC 4DV2O 5IY5B 4NTYA 4DV7B 4NXNO 3D8CA 1XQ8A 4MSWC 1LR1A 4LF6B 3UT5A 4F6EA 4LNUA 5CA0B 1HNWB 4H33A 3J7AU 3BY6A 4I9WA 3SYOA 1NT2B 1YJ9V 1QQCA 3J81N 2VQEO 4RWUA 4DR3O 5L3CA 1VQ9V 2IBZH 4NTWA 3CB2A 5JJEB 4DK1A 2QKSA 1PNMA 2W0FC 3LNNA 1Q3EA 3K59A 1DLBA 1N36O 1SA0A 4KFMA 1IX9A 1AP5A 5GW7A 5C93A 5GTHZ 1Y67A 5JWPA 1E1QG 3N27A 3K9SA 4JI7B 3ABTA 2ARHA 3F7YC 2V4DA 1KU9A 4LH6A 3OMIB 2Q5ZA 3ML0A 2EIJB 2Y4UA 1M90W 4P30A 2A3QA 2QTOA 4MVQA 2DQ3A 4K35A 1BQ0A 4AILC 4TUYB 4O4HB 5LOVB 4X62O 3T4DA 5EIBD 1AI6A 4O2AB 3UO2A 1GAXA 4RUFA 1VQMV 5LGNA 1US6A 4N21A 1IBLB 2E5LB 4I7ZB 1BHBA 1TUBA 1K33A 1Q86W 3VQVA 5LXTB 1H2NA 4LF6O 3OTFA 2FTKA 1MSWD 2LW7A 3C3TA 4X8AA 1YCIA 2ZXWB 2DN9A 3P3NA 4YHHB 4DR2B 3D36C 2P4VA 5D5QA 3ZRWA 1VF7A 5EIBC 4QNHB 3CJHA 3AG2C 2V1DA 1WA8B 5EC1C 2QWOB 4PDLA 3HKBA 2JGDB 1JFFA 2PGGA 2QM7A 3SJCC 5JJJB 5LHHA 1XREA 5A9GA 2R9AA 1IURA 5CA1B 4JI7O 3W7XA 3DSQA 4B3SB 2X6BA 2P4KA 4GZRB 4KL1A 3ZN0A 5KLVH 3ZEDA 2DW4A 4LF8O 4IHJA 3T1YB 3CCLV 2ILMA 4FM1A 1S72V 4WFBV 4O4LA 2Q7GA 3KCYA 4X20B 3EFFK 2BCCH 3UT5B 1MMMA 4LNUB 3ETQA 2UXBO 2WLKA 4B3MB 4JZ2A 2NN4A 5B3SB 4FZ0A 2YI9A 1W59A 4HZ3A 5KHKA 1KB9F 3WG7C 2H3OA 4JYYA 1IBMB 3CRMA 2NNUA 5FLXN 4MVZA 2CUGA 2DWEC 3ABKB 2X0LA 3QO8A 4R50A 4WCEV 4TV9A 3RYFB 2BSKA 5JCOA 1WNSA 4JAAA 5KA5A 2OYQA 4XDKA 1YIJV 3Q4HB 4OX9B 1JA8A 1FXKA 1FKAO 3L74H 4MVMA 2DJVA 3TCUA 5JVDB 5BY1A 5F2VO 2AW9A 2P90A 1N4CA 3ZMZA 1VQKV 1N34O 4ZI7A 1FYJA 1NH2D 5JH7A 3RYHB 2QKAA 4JYCA 2YC0A 3JATA 2ZD9A 4FLUA 3K5NA 2HVJC 2RQ6A 3A0BZ 3T1YO 2L35A 5KHGA 1NTZH 2JGUA 3ZMSA 2W0XA 3KZIZ 2IM9A 4CZZA 1VQ8V 1S76D 4WFGA 4LH7A 5IYDO 4MVOA 4DV1B 1VIBA 3T2MA 2ZNIA 2CE4A 4K0KB 2A9HA 1K34A 1P49A 4B3MO 3K0DA 5EYPA 3SPGA 3OFNG 4XDJA 4R7CA 3N2GA 2QWNB 3ZRWB 2QWPB 2AHYA 1K7DA 1V54B 5BR8B 4UCSA 3HKBB 2JIZG 4DRXA 1JFFB 1D5NA 1Q6HA 4YIOA 4DW0A 2FMLA 3SDLA 3A8TA 2YUAA 1MG1A 2B9ZA 3RN4A 3QO5A 4OX9O 2UXXA 1U97A 1K92A 4FZ1A 1NZ6A 1J5EO 2IU0A 3ZX6A 2LQTA 2PF4E 4B08A 4IHJB 2ZXWC 4FLVA 1YTFB 2EIMB 4JI1O 3TXSA 4TV8B 1XILA 4MTXA 2VS0A 1KKCA 2UU9O 2PYLA 4I50B 4B7KA 3APOA 1YJWV 1I0HA 3JCUZ 1GN6A 2F95B 1GM7A 4QGPA 1ZWIC 1VF6C 1YZBA 3VQWA 1TVKB 3CPWU 2EULA 3ZIAG 2HKOA 1X59A 2OWOA 4MVUA 3FFQA 3U11A 1NVPB 5FL7G 2Q4PA 1OHHG 4DV1O 4MTFA 3O9OA 4X89A 2NLJC 3ETEA 4K0KO 3X2QB 1WPBA 1R3LC 4YJ3A 4X64B 2E74B 3SR2C 4TV9B 2GDSA 4FIPC 2BSKB 1OCCB 4UVCA 4FM2A 2A06H 2ZE6A 4H44B 2IJKA 3AK3A 3CXCU 3APQA 2QR4A 1ZAUA 5BR8O 4I5SA 1PD3A 4O4IA 4D7SA 3DC6A 1RSOA 4O2BB 4LBEC 4NKGB 4DR7B 3JD0A 5BMVA 1FFTB 3T1HO 3B09A 4R8CA 1U96A 5E79Z 5B3SC 1EFRG 5KX5A 4I9QA 3E8BA 5JJNB 3GWKC 3BFRA 5JH7B 1Z2GA 2W6JG 1TAEA 3ABKC 3JATB 4Z1VA 2UUAB 1PKXA 1K8AW 2UXDB 1E79G 3M99B 1NR7A 1GN4A 5L3GA 3K03A 2ADQB 1YHQV 1Q5OA 3RW0A 2Q8VA 4J10A 2HJFC 4N23A 2PZSA 3JAWA 2R70A 5KA6A 3ABMC 3K5LA 3H1LH 5EYPB 2ZCEA
chains in the Genus database with same CATH topology
2Q73A 1YXBA 2GTAA 2OIGA 4QGPA 2P06A 2Q5ZA 3C90A 3CRAA 2OIEA 3CRCA 2Q9LA 1VMGA 2A3QA 2A7WA 2YXHA 5IE9A 2Q4PA 1Y6XA 1YVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q73 A;  1YXB A;  2GTA A;  2OIG A;  4QGP A;  2P06 A;  2Q5Z A;  3C90 A;  3CRA A;  2OIE A;  3CRC A;  2Q9L A;  1VMG A;  2A3Q A;  2A7W A;  2YXH A;  5IE9 A;  2Q4P A;  1Y6X A;  1YVW A; 
#chains in the Genus database with same CATH topology
 2WA4 A;  4X66 B;  1W0K G;  2YIC A;  3JAM N;  1HDJ A;  3IFX A;  2ATK C;  3N2G B;  3IC9 A;  5H2F Z;  3OGI B;  1KUQ A;  1M57 C;  2H94 A;  4UVB A;  2EIN C;  4JI2 O;  4KP4 A;  1BHA A;  2RJZ A;  4RQE A;  1IBK B;  4X64 O;  4ZHQ B;  2HFE C;  1FJG B;  2WLN A;  3ZRS A;  3AG1 C;  3RBZ A;  5FPR A;  3HB3 B;  1TUE B;  4TQF A;  4E2L A;  5L3F A;  1I08 A;  3CWB H;  2YXL A;  4DR4 B;  5CBH A;  4EEQ A;  5DM6 V;  1VEW A;  4H13 B;  1S5H C;  4JYB A;  4DUY B;  4DR7 O;  5GTI Z;  5L3E A;  2VQF O;  3CCR V;  4BR6 A;  3E22 A;  3G4S V;  1I5Y A;  1RPO A;  2G38 A;  4WF9 V;  4U3J A;  2UUA O;  3A0R A;  3T1C A;  1RFY A;  3AG3 C;  1LNQ A;  1HNX B;  5DN6 G;  4LF7 B;  5FNV A;  3P30 A;  1YI2 V;  2RMK B;  4FPP A;  1EM1 A;  1ROP A;  1N32 B;  2CAZ C;  1KEC A;  5EBM C;  2L6L A;  2PUS A;  3FX7 A;  2KQX A;  3K9A A;  4G28 B;  3ASN B;  2WLL A;  1QU7 A;  1N36 B;  4YJ3 B;  4FFB A;  3HR0 A;  4WFE A;  3CCJ V;  1HR0 B;  4X66 O;  2OT5 A;  5B66 Z;  1K4D C;  3CX5 F;  2MW2 B;  2W6I G;  1EZV H;  2CK3 G;  3OW2 U;  5B1O A;  4KXR A;  2ZE8 A;  4O4I B;  1ZTE A;  2X6C A;  1IBK O;  2DMX A;  3AK1 A;  2Z3Y A;  2GTS A;  5BMV B;  1YXB A;  3L70 H;  4RAI A;  5KX5 B;  2GBO A;  2BOB C;  3M8A A;  4JTD B;  5DEC A;  4BIZ A;  3N2K A;  3OGC C;  1OCZ B;  3WG7 B;  4DUZ O;  1B3Q A;  4DR4 O;  2IJJ A;  1QLN A;  3BA8 A;  5J9P C;  5B1B B;  4DUY O;  1H2G A;  1N0J A;  3X2Q C;  1R3I C;  5LBQ A;  2WA3 A;  3JD3 A;  4H37 A;  2Q69 A;  4X62 B;  4IIJ B;  1HNZ B;  3JAR B;  1OCC C;  1S0V A;  4LFA B;  5JCO C;  2KG7 B;  3BA9 A;  3S3X A;  4AI8 A;  4BIO A;  5DED A;  4C7U A;  3SPC A;  1FXK C;  4QPK A;  4GX0 A;  4JAS A;  4DW1 A;  2Q7E A;  1OV9 A;  1HNX O;  1AIL A;  5EC2 C;  4LF7 O;  4I4T B;  2UUB B;  4FLW A;  1YJN V;  4PA3 A;  1YEW A;  1N32 O;  4CC5 A;  3TJT A;  4PI0 A;  3SPI A;  2KKW A;  3OMA B;  1M1K W;  2AZ2 A;  2P6J A;  2E3C A;  3IAY A;  1QHT A;  3J80 N;  4X1I B;  3HKE B;  3KKY A;  1HR0 O;  3CC4 V;  2N74 A;  3S3W A;  2ZM6 B;  2RDC A;  3SPH A;  1N33 B;  5CA3 A;  5HFL A;  1ARO P;  5AG2 A;  3W7S A;  3K57 A;  3QG5 A;  1CPY A;  5IJ9 A;  3B2E E;  2JDI G;  2AZ0 A;  2UXN A;  2PI4 A;  1JVM A;  2P22 C;  1DGS A;  3L72 H;  2XHB A;  1RM1 C;  3MD0 A;  4GX1 A;  4LF8 B;  1NH2 B;  3KG2 A;  4XBF A;  1SZT A;  1E1R G;  3NR7 A;  3ZHT A;  4PJ0 Z;  1F23 A;  1Y4M A;  4JI3 B;  1PP9 H;  3TGU H;  5CB4 A;  3ZMV A;  4U3J B;  3ZCC A;  1YF2 A;  2Y0P A;  2IH3 C;  2ADP A;  4KUM A;  4O4J A;  3ZHR A;  2DYR C;  1IVS A;  3TET A;  1GK9 A;  4DYL A;  3U0Z A;  1Y76 A;  1HNZ O;  2UXB B;  5FNV B;  1DF4 A;  4LFA O;  1S5J A;  3VOU A;  1VAR A;  3H1J H;  4NXM B;  2X6A A;  3DXR B;  4U7O A;  4PEL A;  4DV4 B;  1AB3 A;  1K5Q A;  4UCO A;  3EXA A;  4XDL A;  2Z5U A;  3VQX A;  2WLL B;  2ITC C;  4FFB B;  2UUB O;  2XAS A;  4UCR A;  2MK3 A;  3L75 H;  2QA4 V;  2WLI A;  5KAI Z;  4X1Y A;  2A7W A;  2H8P C;  5J2T A;  2N05 A;  5KMG B;  3MAQ A;  4NB5 A;  1IZ3 A;  4IYI A;  2ZM6 O;  3B8N A;  1TA8 A;  1N33 O;  3FAV A;  1EN5 A;  1MSD A;  2QM8 A;  3N2K B;  3UKM A;  1JMK C;  3PJS K;  1N34 B;  5J2U A;  1R6T A;  4WFH A;  2C2A A;  3ASN C;  2YEV B;  4HYO A;  4DV3 B;  1K9M W;  4YIP A;  5C8Y A;  4J41 A;  2VRZ A;  2F93 B;  3QVN A;  1H8H G;  4X9Q A;  4I55 A;  2PI5 A;  1NS1 A;  1I7F A;  4JI3 O;  1Q90 D;  4AHC A;  3KCX A;  3L9D A;  1G4Y B;  1I94 B;  2HEP A;  5L3D A;  2HR3 A;  1F4N A;  1PL4 A;  5H6Q A;  1SS3 A;  4WBN A;  1AI4 A;  2ZR3 A;  1XMQ B;  5CN0 A;  1CEZ A;  4Z2W A;  3I5D A;  3ZS8 C;  2BTQ A;  4NXM O;  1OCZ C;  3F5W C;  1XL6 A;  4DV4 O;  3WFV A;  2CGN A;  5B1B C;  3L71 H;  1B6Q A;  3ZJZ A;  5IYZ A;  3RWR D;  5KAF Z;  1SA0 B;  5CBF A;  3EHB B;  2Q9L A;  5LMU B;  4LWS A;  1ZLZ A;  3MHH C;  3OD4 A;  1QVG U;  4TQD A;  4UVA A;  4F6R A;  4G27 B;  1A32 A;  3F5T A;  3CCS V;  2EIK C;  2EJR A;  3CCV V;  1J5E B;  3ABM B;  1K5S A;  4DV5 B;  4OXS A;  1Y74 A;  1GMG A;  4MT8 A;  1EZJ A;  2LP7 A;  4PDM A;  2XAJ A;  4JI1 B;  4JAV A;  1ZL8 A;  2UU9 B;  1M57 B;  2EIN B;  4JI6 B;  1BS3 A;  4MVS A;  1X4T A;  4ICG A;  4DV3 O;  1SZX A;  2ZR2 A;  1ZSP A;  4O4J B;  3OMN B;  1O9H A;  3OTO B;  3AG1 B;  4TT3 G;  1L0L H;  2Y0I A;  5IJ0 A;  2NR5 A;  4DV6 B;  1SER A;  1TUB B;  1I94 O;  3R66 A;  1AP6 A;  2JJ1 G;  3K5O A;  2R72 A;  3ZHV A;  1Y6X A;  3IJ4 A;  4P9P A;  1XMQ O;  5E1A C;  2YS8 A;  3JAS A;  4EFE A;  2IH1 C;  3FB7 C;  2OIE A;  4X1Y B;  1PM9 A;  3ZMT A;  3CJH B;  4IL6 Z;  1D5A A;  3W7W A;  1QVF U;  3AG3 B;  3HKC A;  1Q6U A;  2F43 G;  5LMU O;  4UV8 A;  1VQP V;  3L73 H;  2Q67 A;  5K1X A;  3T1H B;  3OM3 B;  2HG5 C;  4BIU A;  1JJ2 U;  4BW9 A;  5IDJ A;  3GVM A;  2F23 A;  5GON A;  1JPX A;  1SKV A;  2ZDI A;  3OE7 G;  4JI0 O;  3JYC A;  4OPH A;  4DV5 O;  3STL C;  3SYC A;  1SQP H;  4BAY A;  2QM4 A;  2OCC B;  1OCR B;  5JQG A;  4UB8 Z;  4K8Z A;  3CE2 A;  1UJW B;  4DR1 O;  3D3I A;  4I55 B;  4GCZ A;  2XAG A;  4DR5 O;  4O4L B;  4YY3 O;  2QSA A;  4QIW F;  4JI6 O;  5IYC O;  2FYU H;  2ZKO A;  3ABU A;  1ZX3 A;  4UCV A;  3CMA V;  4ZBM A;  2PYJ A;  1NBM G;  2QE7 G;  2YIB D;  3OTO O;  4WBN B;  1VQ7 V;  4LR3 A;  1KBH A;  1QLE C;  2IU3 A;  4DV6 O;  2UXC B;  4LP8 A;  3JD2 A;  2E76 B;  1XHZ A;  4JI2 B;  2IJH A;  5LL6 Y;  1S77 D;  3W7T A;  2LJ2 A;  2VWK A;  5IYZ B;  3ZHU A;  2XT9 A;  4LWS B;  4MS2 A;  2N04 A;  3CHX A;  5LGU A;  4F6R B;  1BE3 H;  3OT7 A;  4GX2 A;  4YJ2 A;  4UV9 A;  1FXK B;  1GRJ A;  3B40 A;  2K9P A;  1T5E A;  1R3K C;  2GV9 A;  4U7N A;  1BQZ A;  4J7J A;  5EZY A;  1NQT A;  1F51 A;  1Y74 B;  1SET A;  2VQF B;  4GYC B;  3HPL C;  3UQ8 A;  3JSN A;  3CME V;  5H6R A;  4CBC A;  4RQF A;  2QKC A;  2EZO A;  4ZI7 B;  3LSQ A;  3I56 V;  4FLT A;  3JAK A;  3UCS C;  5FPO A;  1THZ A;  1P7G A;  1M4U A;  1B04 A;  2ETN A;  4LF5 B;  1AJQ A;  1QR8 A;  5HFM A;  3LSS A;  4QE7 A;  2Q68 A;  5TIS Z;  1SQV H;  3FKS G;  1WLE A;  1ENV A;  3QNE A;  1PPJ H;  1MA1 A;  1S3J A;  1K73 W;  3B4S A;  1XDC A;  2CTP A;  5IJ0 B;  2P5O A;  4B7E A;  3ZMU A;  4L87 A;  1ZUQ A;  2Y69 C;  2ZQM A;  4DR6 O;  3GB7 C;  5LMN O;  4UXN A;  5LYJ A;  4JPR A;  1BGY H;  3K04 A;  2HJD A;  1RM1 B;  4HNA A;  3DC5 A;  2XND G;  3A2F A;  4DV0 O;  4J42 A;  2UXC O;  2QWQ B;  4L8J A;  5LGT A;  4NTX A;  1M56 C;  3B77 A;  3BRC A;  3JAL A;  4P9O A;  1H8E G;  1OZ0 A;  2DYR B;  3HKC B;  4DRX B;  4JYA O;  1WB8 A;  2GUZ A;  2HVK C;  5IT9 N;  1AI7 A;  1SC5 B;  5LHG A;  3MDS A;  3THO A;  1D2D A;  3CXH F;  3CS5 A;  2YDE A;  4DUZ B;  4PI2 A;  4X65 O;  4JAU A;  2CTQ A;  3BVO A;  3AG4 B;  4GKK O;  2XAF A;  1VMG A;  3K0G A;  4MTO A;  1OCO B;  2IW5 A;  4J9Y B;  2FKX A;  5JQG B;  3CCM V;  1Q6I A;  4ABM A;  1WP8 A;  5IE9 A;  3QO7 A;  1WAZ A;  2V7Q G;  2Q0O C;  3H1I H;  1R6K A;  3PN1 A;  1AVM A;  4LF5 O;  4ZKI A;  4JZG A;  3W7U A;  4LF9 B;  1SQB H;  2XUM A;  3ZHQ A;  4E4E A;  3HKD A;  1K97 A;  5B1N A;  4QJF B;  4TUY A;  2Q73 A;  5EK0 A;  4O4H A;  5LOV A;  1G8M A;  2JVD A;  1HW7 A;  3G67 A;  3H01 A;  4J9Z B;  1NTK H;  2OCC C;  1OCR C;  1P84 F;  2EZP A;  1AR5 A;  4J80 A;  3I55 V;  2QJ1 A;  3QTC A;  4YJ2 B;  5LXT A;  2R9R B;  4UUJ C;  3QF7 A;  1RSO B;  1XEQ A;  2WLM A;  4EFB A;  4OGQ B;  5L3B A;  3CRQ A;  1UFI A;  3WB0 A;  3G6B A;  2ZIO A;  2RNB A;  3WB1 A;  3SJA C;  4CH5 A;  1KD1 W;  2F4V B;  4FVM A;  2EIL B;  2ZE5 A;  1HP8 A;  3JCZ A;  2PY5 A;  4PDR A;  4NR1 A;  1GTO A;  1Y66 A;  2YIB A;  1JR9 A;  2LFS A;  3JAW B;  2EIK B;  4LF9 O;  4FFK A;  1JJO A;  1P7B A;  2Q7H A;  4X1K A;  4CH3 A;  3JD1 A;  2UUC O;  1FFX A;  3AEI A;  5LA6 A;  1WP7 A;  1R3J C;  3ASO B;  2YI8 A;  1F4M A;  4JF3 A;  1V9P A;  1WPX A;  1BT8 A;  4X20 A;  1IDS A;  3K08 A;  3SJB C;  3JAL B;  3OUF A;  1O9G A;  2QEX V;  5IWA B;  5ITZ A;  1M5I A;  2GUZ B;  1MOF A;  1JOY A;  1R6N A;  1YIT V;  3OAA G;  4QPJ A;  4JI5 B;  2F1M A;  3K3W A;  5B1A C;  1FXV A;  3H9V A;  4FMT A;  2CTR A;  3BHP A;  1ORQ C;  4FLZ A;  1JCH A;  3STZ C;  2ITD C;  3RYF A;  2QWR B;  2E75 B;  1MAB G;  3E22 B;  4PDV A;  4HBN A;  4G2K A;  1GH6 A;  1BSM A;  1QCE A;  1FPO A;  3CYO A;  3Q4H A;  2BE3 A;  2Y48 A;  1WN7 A;  4GUN A;  3TK1 A;  4PA4 A;  3WB2 A;  2CGO A;  2F4V O;  5JVD A;  1YSC A;  1Z5V A;  2D3O W;  2P06 A;  1XNQ O;  3VBB A;  3FD9 A;  1F7Y A;  1V55 C;  1PNL A;  3R65 A;  5LHI A;  4CC6 A;  3HKD B;  1Q81 W;  2B1I A;  3RYH A;  2ZDI C;  1DTO A;  2YSU B;  3BPZ A;  3SPJ A;  3AG4 C;  1OCO C;  5LP6 C;  3FYE B;  4DV7 O;  1IXM A;  5H5N A;  1FD9 A;  3RVZ A;  1NU1 H;  4J11 A;  2D2C B;  5IWA O;  2ZIM A;  1HNW O;  1SQX H;  4Z1M G;  4EB6 A;  3E2E A;  2FB5 A;  3LDD A;  3DTU B;  3FB8 C;  1QLE B;  3K58 A;  1MNG A;  4NVP A;  4GLX A;  1XNR B;  4RUE A;  4D7T A;  4K3A A;  3CRR A;  4JI5 O;  1N0N A;  1EBO A;  3CP1 A;  5KHH A;  3CCE V;  1XI1 A;  1Q8I A;  1KP2 A;  2YXH A;  4U3F H;  3WU2 Z;  3ZHS A;  4IT5 A;  4AQY B;  1B06 A;  3RYI A;  4JTA B;  3C3S A;  1M93 A;  3CRA A;  4LC1 A;  1VQ5 V;  3D3Q A;  3IGA C;  4X1K B;  1FFX B;  1KP3 A;  3E89 A;  2CH7 A;  5LA6 B;  1WJZ A;  2M6Y A;  2ZNJ A;  4TV8 A;  5D5P A;  4JTC B;  1PV0 A;  1R1B A;  4I50 A;  3LDC A;  3A0H Z;  4DXW A;  1SES A;  1GO3 F;  3OEH G;  5A2Q N;  2DE0 X;  5ITZ B;  1GKF A;  3RYC A;  4RO2 A;  1R73 A;  2EIL C;  1TVK A;  2WWW A;  2R9I A;  1IBL O;  2E5L O;  2KB1 A;  1P4R A;  2FL4 A;  2YXY A;  3E35 A;  5IJ9 B;  2Y69 B;  2JEX A;  4UB6 Z;  2WPD G;  2JJ2 G;  1PNK A;  3LSU A;  1HWY A;  4JI0 B;  4TWK A;  1Q7Y W;  4P2Z A;  3SYP A;  1H2L A;  1DF5 A;  4YHH O;  3ASO C;  3ZRV A;  2DWD C;  4DR2 O;  4DR1 B;  5IY5 C;  1XNR O;  1M56 B;  4DR5 B;  2RCV A;  4JGS A;  3RT3 C;  4YY3 B;  2AXT Z;  5CB4 B;  2YIA A;  3RFR A;  1GN2 A;  3E8G A;  2HLD G;  1NI8 A;  1PL0 A;  3BAB A;  3ETG A;  2JRI A;  4O2B A;  3P3P A;  1BMF G;  2M7W A;  1Y76 B;  4AQY O;  4IGG A;  1DK1 A;  3ETD A;  1WB7 A;  1H2K A;  1EN4 A;  4CS3 A;  5KUK A;  2QGN A;  1K3E A;  2DOS A;  4B3S O;  2OCH A;  2PTM A;  3MHS C;  5CBG A;  2QTS A;  4I0X A;  3TXQ A;  4KHP B;  2Q0A A;  4FM0 A;  4LFC B;  1GM8 A;  5EBW C;  2WAM A;  1N8R W;  4JI8 B;  1URF A;  1GN3 A;  1BCC H;  3CC2 V;  2EJ7 A;  2P67 A;  2WLH A;  1QBZ A;  1IXB A;  2F66 C;  2WLI B;  3G6E V;  4CS2 A;  4BWA A;  2LO1 A;  2X7R B;  4PA9 A;  2XAQ A;  4TSF G;  1JQ0 A;  5J2T B;  4EB6 B;  2EIJ C;  3BCC H;  3GWO A;  1VQ4 V;  3FAV B;  1KQS U;  1FS0 G;  1IBM O;  5J2U B;  2JS5 A;  1VQ6 V;  3K06 A;  4EKW A;  4B3T B;  2LW1 A;  4ZIB A;  4WFF A;  3AK2 A;  4FK5 C;  5BXZ A;  5EBL C;  4DK0 A;  1JX9 A;  4ZHQ A;  3FYI B;  2XTA A;  5C8Y B;  2LFR A;  3LNM B;  4W4K A;  1XHX A;  3ZRX A;  5LP6 A;  1Q82 W;  3RYI B;  4H0L B;  2GSM B;  1VQN V;  4UCU A;  4J7Z A;  2GHY A;  1L1F A;  4DR6 B;  1SRY A;  2CDY A;  3P32 A;  5LMN B;  1M9N A;  4FLY A;  1BZK A;  2HP8 A;  3DGE A;  3G80 A;  4FJC C;  3E83 A;  1AR4 A;  3UO3 A;  2CH7 B;  2A0L A;  1J95 A;  1COW G;  1XMO B;  3ABL B;  2ZIN A;  4DV0 B;  2DYS B;  3ZBH A;  2Q6A A;  3D36 A;  2BTQ B;  3RVY A;  1YVW A;  1VF5 B;  2B1G A;  4ZOL A;  3FB5 C;  3EVK A;  4KHP O;  3RYC B;  3FB6 C;  4UCT A;  4LFC O;  4JYA B;  1GM9 A;  2P7T C;  4YXW G;  3G71 V;  2AGA A;  4JI8 O;  1I5X A;  4WFA V;  4QE9 A;  2JEU A;  4GT1 A;  1FAF A;  3CCU V;  1KC8 W;  1NR1 A;  1K4C C;  2HHH B;  2OTJ V;  4J7K A;  3M7M X;  4X88 A;  1BL8 A;  4X65 B;  4JI4 B;  1TGO A;  2OIG A;  4DO2 A;  4GKK B;  4PHZ A;  2O57 A;  3OEE G;  1NTM H;  2VWJ A;  3C90 A;  4LF4 B;  5KUM A;  3JSL A;  3CD6 V;  3OUS A;  2EBO A;  3RGB A;  1ZL8 B;  5IYB O;  4R6Z A;  4LFB B;  4B3T O;  1H38 A;  3CCQ V;  4F4L A;  4BW5 A;  4CH6 A;  4GKJ B;  3ICX A;  4D6T H;  2YID A;  1G1X B;  3LDE A;  2LGW A;  2A79 B;  5KHJ A;  1AJP A;  2WLJ A;  4MW8 A;  4PD4 F;  3LUT B;  1LUW A;  5B1A B;  4Q6G A;  4I0X B;  3OR7 C;  1QR9 A;  3O65 A;  4IIJ A;  4CS4 A;  1XMO O;  4NYK A;  3JAR A;  2WSS G;  2KG7 A;  4TOI A;  1XBL A;  4JV5 B;  3JAS B;  3NXS A;  1XOU A;  3U10 A;  3CC7 V;  4CH4 A;  4UFZ A;  3SGI A;  5B5E Z;  5CA0 A;  5CMU A;  4B3R B;  1XUQ A;  4I4T A;  1V55 B;  1Q43 A;  2KSD A;  2HHH O;  1W2B U;  2CTW A;  2Z0A A;  2IJI A;  5GON B;  1SQF A;  3IC7 A;  4MW3 A;  3K5M A;  4JI4 O;  1KKD A;  1L8D A;  4FLX A;  4X1I A;  3HKE A;  1NJI W;  1UPG A;  3BEH A;  4LF4 O;  5LP6 B;  3UM7 A;  2BOC C;  2AHZ A;  2JS3 A;  1NKD A;  4LFB O;  1LUV A;  3CEI A;  2GTA A;  3B8M A;  1SF9 A;  4GKJ O;  1H2M A;  1CXZ B;  4GX5 A;  4K8X A;  1AI5 A;  2UUC B;  1L0N H;  2JK5 C;  4PA7 A;  1EN6 A;  4DV2 B;  2RN9 A;  1QNM A;  3K79 A;  1FXH A;  4NXN B;  1YTF D;  1OJH A;  1V54 C;  3AG2 B;  4ZOL B;  4IYH A;  4MTG A;  2DQ0 A;  2UXD O;  4O2A A;  3AG7 A;  4ASU G;  3T4Z A;  3H1H H;  1KYO F;  3SYQ A;  2VQE B;  1AR1 B;  4JV5 O;  4PA6 A;  1KMI Z;  3BAA A;  4DR3 B;  3E8H A;  2Y4T A;  3DXR A;  4HAM A;  3SYA A;  2ZT9 B;  3VQY A;  3ZN1 A;  2ODM A;  1G6U A;  2EX3 A;  5KHI A;  2K1E A;  1VQO V;  4B3R O;  1NVP D;  4A5U B;  5BZB A;  5EZY B;  1CP9 A;  2ZE7 A;  2XAH A;  3JD4 A;  2EIM C;  5K1P A;  4OPA A;  3F7V C;  3ABL C;  2B5U A;  2DYS C;  4W4L A;  3CRC A;  2XOK G;  3JAK B;  1SQQ H;  1YDX A;  1RPR A;  1WA8 A;  3E86 A;  1VF6 A;  2LGQ A;  3SJQ C;  2JGD A;  3E8F A;  5KMG A;  1FJG O;  1S5L Z;  2QDO A;  1XNQ B;  4MVR A;  1VP7 A;  5H9C A;  4Q20 A;  5CA1 A;  1MZE A;  1Z5W A;  3OR6 C;  1XL4 A;  1H2S B;  4PV1 B;  3CSX A;  2YEV A;  1VQL V;  1SQG A;  1W0J G;  5LYJ B;  2OTL V;  1RP3 B;  1AJN A;  3H1K H;  2BTO A;  4HNA B;  1MZF A;  4LCU C;  4DV2 O;  5IY5 B;  4NTY A;  4DV7 B;  4NXN O;  3D8C A;  1XQ8 A;  4MSW C;  1LR1 A;  4LF6 B;  3UT5 A;  4F6E A;  4LNU A;  5CA0 B;  1HNW B;  4H33 A;  3J7A U;  3BY6 A;  4I9W A;  3SYO A;  1NT2 B;  1YJ9 V;  1QQC A;  3J81 N;  2VQE O;  4RWU A;  4DR3 O;  5L3C A;  1VQ9 V;  2IBZ H;  4NTW A;  3CB2 A;  5JJE B;  4DK1 A;  2QKS A;  1PNM A;  2W0F C;  3LNN A;  1Q3E A;  3K59 A;  1DLB A;  1N36 O;  1SA0 A;  4KFM A;  1IX9 A;  1AP5 A;  5GW7 A;  5C93 A;  5GTH Z;  1Y67 A;  5JWP A;  1E1Q G;  3N27 A;  3K9S A;  4JI7 B;  3ABT A;  2ARH A;  3F7Y C;  2V4D A;  1KU9 A;  4LH6 A;  3OMI B;  2Q5Z A;  3ML0 A;  2EIJ B;  2Y4U A;  1M90 W;  4P30 A;  2A3Q A;  2QTO A;  4MVQ A;  2DQ3 A;  4K35 A;  1BQ0 A;  4AIL C;  4TUY B;  4O4H B;  5LOV B;  4X62 O;  3T4D A;  5EIB D;  1AI6 A;  4O2A B;  3UO2 A;  1GAX A;  4RUF A;  1VQM V;  5LGN A;  1US6 A;  4N21 A;  1IBL B;  2E5L B;  4I7Z B;  1BHB A;  1TUB A;  1K33 A;  1Q86 W;  3VQV A;  5LXT B;  1H2N A;  4LF6 O;  3OTF A;  2FTK A;  1MSW D;  2LW7 A;  3C3T A;  4X8A A;  1YCI A;  2ZXW B;  2DN9 A;  3P3N A;  4YHH B;  4DR2 B;  3D36 C;  2P4V A;  5D5Q A;  3ZRW A;  1VF7 A;  5EIB C;  4QNH B;  3CJH A;  3AG2 C;  2V1D A;  1WA8 B;  5EC1 C;  2QWO B;  4PDL A;  3HKB A;  2JGD B;  1JFF A;  2PGG A;  2QM7 A;  3SJC C;  5JJJ B;  5LHH A;  1XRE A;  5A9G A;  2R9A A;  1IUR A;  5CA1 B;  4JI7 O;  3W7X A;  3DSQ A;  4B3S B;  2X6B A;  2P4K A;  4GZR B;  4KL1 A;  3ZN0 A;  5KLV H;  3ZED A;  2DW4 A;  4LF8 O;  4IHJ A;  3T1Y B;  3CCL V;  2ILM A;  4FM1 A;  1S72 V;  4WFB V;  4O4L A;  2Q7G A;  3KCY A;  4X20 B;  3EFF K;  2BCC H;  3UT5 B;  1MMM A;  4LNU B;  3ETQ A;  2UXB O;  2WLK A;  4B3M B;  4JZ2 A;  2NN4 A;  5B3S B;  4FZ0 A;  2YI9 A;  1W59 A;  4HZ3 A;  5KHK A;  1KB9 F;  3WG7 C;  2H3O A;  4JYY A;  1IBM B;  3CRM A;  2NNU A;  5FLX N;  4MVZ A;  2CUG A;  2DWE C;  3ABK B;  2X0L A;  3QO8 A;  4R50 A;  4WCE V;  4TV9 A;  3RYF B;  2BSK A;  5JCO A;  1WNS A;  4JAA A;  5KA5 A;  2OYQ A;  4XDK A;  1YIJ V;  3Q4H B;  4OX9 B;  1JA8 A;  1FXK A;  1FKA O;  3L74 H;  4MVM A;  2DJV A;  3TCU A;  5JVD B;  5BY1 A;  5F2V O;  2AW9 A;  2P90 A;  1N4C A;  3ZMZ A;  1VQK V;  1N34 O;  4ZI7 A;  1FYJ A;  1NH2 D;  5JH7 A;  3RYH B;  2QKA A;  4JYC A;  2YC0 A;  3JAT A;  2ZD9 A;  4FLU A;  3K5N A;  2HVJ C;  2RQ6 A;  3A0B Z;  3T1Y O;  2L35 A;  5KHG A;  1NTZ H;  2JGU A;  3ZMS A;  2W0X A;  3KZI Z;  2IM9 A;  4CZZ A;  1VQ8 V;  1S76 D;  4WFG A;  4LH7 A;  5IYD O;  4MVO A;  4DV1 B;  1VIB A;  3T2M A;  2ZNI A;  2CE4 A;  4K0K B;  2A9H A;  1K34 A;  1P49 A;  4B3M O;  3K0D A;  5EYP A;  3SPG A;  3OFN G;  4XDJ A;  4R7C A;  3N2G A;  2QWN B;  3ZRW B;  2QWP B;  2AHY A;  1K7D A;  1V54 B;  5BR8 B;  4UCS A;  3HKB B;  2JIZ G;  4DRX A;  1JFF B;  1D5N A;  1Q6H A;  4YIO A;  4DW0 A;  2FML A;  3SDL A;  3A8T A;  2YUA A;  1MG1 A;  2B9Z A;  3RN4 A;  3QO5 A;  4OX9 O;  2UXX A;  1U97 A;  1K92 A;  4FZ1 A;  1NZ6 A;  1J5E O;  2IU0 A;  3ZX6 A;  2LQT A;  2PF4 E;  4B08 A;  4IHJ B;  2ZXW C;  4FLV A;  1YTF B;  2EIM B;  4JI1 O;  3TXS A;  4TV8 B;  1XIL A;  4MTX A;  2VS0 A;  1KKC A;  2UU9 O;  2PYL A;  4I50 B;  4B7K A;  3APO A;  1YJW V;  1I0H A;  3JCU Z;  1GN6 A;  2F95 B;  1GM7 A;  4QGP A;  1ZWI C;  1VF6 C;  1YZB A;  3VQW A;  1TVK B;  3CPW U;  2EUL A;  3ZIA G;  2HKO A;  1X59 A;  2OWO A;  4MVU A;  3FFQ A;  3U11 A;  1NVP B;  5FL7 G;  2Q4P A;  1OHH G;  4DV1 O;  4MTF A;  3O9O A;  4X89 A;  2NLJ C;  3ETE A;  4K0K O;  3X2Q B;  1WPB A;  1R3L C;  4YJ3 A;  4X64 B;  2E74 B;  3SR2 C;  4TV9 B;  2GDS A;  4FIP C;  2BSK B;  1OCC B;  4UVC A;  4FM2 A;  2A06 H;  2ZE6 A;  4H44 B;  2IJK A;  3AK3 A;  3CXC U;  3APQ A;  2QR4 A;  1ZAU A;  5BR8 O;  4I5S A;  1PD3 A;  4O4I A;  4D7S A;  3DC6 A;  1RSO A;  4O2B B;  4LBE C;  4NKG B;  4DR7 B;  3JD0 A;  5BMV A;  1FFT B;  3T1H O;  3B09 A;  4R8C A;  1U96 A;  5E79 Z;  5B3S C;  1EFR G;  5KX5 A;  4I9Q A;  3E8B A;  5JJN B;  3GWK C;  3BFR A;  5JH7 B;  1Z2G A;  2W6J G;  1TAE A;  3ABK C;  3JAT B;  4Z1V A;  2UUA B;  1PKX A;  1K8A W;  2UXD B;  1E79 G;  3M99 B;  1NR7 A;  1GN4 A;  5L3G A;  3K03 A;  2ADQ B;  1YHQ V;  1Q5O A;  3RW0 A;  2Q8V A;  4J10 A;  2HJF C;  4N23 A;  2PZS A;  3JAW A;  2R70 A;  5KA6 A;  3ABM C;  3K5L A;  3H1L H;  5EYP B;  2ZCE A; 
#chains in the Genus database with same CATH homology
 2Q73 A;  1YXB A;  2GTA A;  2OIG A;  4QGP A;  2P06 A;  2Q5Z A;  3C90 A;  3CRA A;  2OIE A;  3CRC A;  2Q9L A;  1VMG A;  2A3Q A;  2A7W A;  2YXH A;  5IE9 A;  2Q4P A;  1Y6X A;  1YVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...