4RWUA

J-domain of sis1 protein, hsp40 co-chaperone from saccharomyces cerevisiae
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
81
structure length
81
Chain Sequence
MVKETKLYDLLGVSPSANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQKREIYDQYGLEAARSGGPSFGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Roles of intramolecular and intermolecular interactions in functional regulation of the Hsp70 J-protein co-chaperone Sis1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Chaperone
molecule keywords Protein SIS1
total genus 30
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2014-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 4rwuA00
1BQZA 2N05A 2QWOB 1IURA 1N4CA 2LGWA 2CTQA 2CTRA 2L6LA 3AG7A 3APOA 3UCSC 1BQ0A 2Y4TA 2GUZA 2CTPA 2PF4E 2OCHA 2CUGA 2QWPB 2QWQB 2DMXA 1GH6A 2QSAA 2N04A 2YS8A 3UO2A 3UO3A 4J80A 2KQXA 1WJZA 1FAFA 1FPOA 1NZ6A 2GUZB 3APQA 2QWRB 2CTWA 2EJ7A 4IT5A 4RWUA 2M6YA 1HDJA 3BVOA 2YUAA 2LO1A 2QWNB 4J7ZA 2Y4UA 2DN9A 1XBLA
chains in the Genus database with same CATH superfamily
4XBFA 3UT5A 4X65O 2IBZH 3ABKC 2V4DA 2ZE5A 5IT9N 1VQ5V 1JX9A 2QM4A 1J95A 3SYOA 5CA3A 1VMGA 1VQ8V 4N23A 1XILA 2GUZB 5C8YB 3ZMVA 4JZGA 1KP2A 1N32B 4EEQA 3AG4C 4X88A 2F93B 3K59A 1KKDA 2HJFC 1YZBA 1VQNV 4LNUA 2OTJV 5IJ9B 3NR7A 2AGAA 3QF7A 1OCZB 1AI6A 1EZVH 1VQ7V 5KA5A 1V54B 3IGAC 1UFIA 2QKCA 1CXZB 1RFYA 4IT5A 3E8FA 1VF7A 3CCMV 4FPPA 4G2KA 4O2BA 4RUFA 1TA8A 1YIJV 1N32O 3ZHRA 1S76D 4B3MO 1CEZA 3AG7A 2EINC 4JAUA 3JAMN 1CP9A 5IYBO 4FFBB 4UVAA 2NN4A 1WPXA 4H44B 2Z5UA 4ZI7B 2A79B 2P90A 3SPIA 3RYCA 1M9NA 1VQOV 4GX5A 4CC5A 3HR0A 1VQ9V 4DUZB 1N8RW 1YI2V 1ZSPA 2WA4A 2Z0AA 3HKBA 4DV7B 2YXLA 3E86A 1W0JG 4PHZA 3SJQC 3ABUA 4RQFA 1X59A 1G1XB 2XAQA 2ZR2A 1NH2B 5C93A 2RN9A 2R9AA 4DK1A 1N0JA 1W2BU 1U97A 2E3CA 1N34O 1NTMH 2R72A 1SQBH 1OZ0A 3AK2A 1HR0O 3FB7C 1IBLO 4TV9A 4JI0O 1NU1H 3ZHUA 1PNKA 3CC2V 1Y4MA 3ABLC 1NKDA 2VQEB 2ETNA 4DV0O 1LR1A 4Z2WA 3T4ZA 2B5UA 4YJ3A 1LNQA 3APOA 2IU0A 1S5HC 2UU9O 2ITDC 4DUYB 4R6ZA 2BSKA 3B4SA 2Q9LA 1YXBA 3HKDB 4DV1B 5IYDO 1AR5A 3SYCA 3SYAA 1V55C 3JD3A 4MTOA 1M93A 3LSQA 2UUBB 2ZCEA 2PZSA 1XHXA 1D5NA 3TXQA 5IY5B 2F4VO 1Z5VA 1WJZA 1B04A 1ZWIC 4AQYB 1CPYA 1M57B 3ZS8C 4BWAA 1QLNA 3K57A 3C3TA 2JDIG 3QO5A 1GRJA 1QR9A 4QIWF 3CCVV 2Q68A 4DR2B 4OPAA 2ZNJA 4DV3O 4PA9A 4QNHB 1YTFD 3JD0A 2GHYA 5JCOC 1GAXA 2UXCO 1MZEA 5GONB 3AEIA 2WLMA 1R6KA 4YJ2B 1XI1A 4DV2B 1KQSU 2F43G 4MVMA 5B1NA 3K9AA 4MW8A 3VOUA 4EFEA 3T1YB 1BQZA 1Y66A 4TWKA 3F5WC 4NKGB 5HFMA 5FPOA 1FFTB 2EINB 1Q6HA 1R3JC 2P6JA 1KKCA 3JSLA 2OCCB 2FMLA 3ZIAG 3SDLA 4O4LB 1TVKA 3A0BZ 4PA3A 2WLNA 4DV5O 5JJEB 5B1AC 5B1OA 4J7ZA 4J7JA 1QVFU 4ICGA 5A2QN 1OHHG 1YSCA 1EN5A 4I0XB 3MHHC 3ETEA 5IJ0A 1KC8W 1RP3B 1V54C 3UT5B 1RM1B 1OCCB 3W7WA 1IURA 1SETA 3B8NA 5KAIZ 3P3PA 1NBMG 1JJ2U 3VBBA 4JI5O 3JD4A 4AILC 2DYRB 1P49A 4UFZA 2EIMB 3ZN1A 4RO2A 3CMEV 5JH7A 1WB7A 4UCTA 1XL4A 1H2GA 3T1YO 3I55V 3CS5A 3BFRA 3JALA 4B7KA 3RYFA 1NT2B 1QVGU 2M7WA 1R3KC 1AJNA 4FLWA 4LF4O 2Q5ZA 3DXRB 4MTXA 2UXCB 2Q69A 5EIBD 4DV3B 2OCCC 4ZHQA 4HNAA 3AG2B 5EBMC 1Q7YW 2A06H 2QA4V 4KFMA 2W6IG 2DW4A 4DO2A 3RVYA 4IIJB 3W7UA 2ZDIA 1H2NA 4E2LA 4LFAO 2YDEA 2D3OW 3CCJV 4WCEV 2Y0PA 4J11A 3CXHF 3DSQA 1HW7A 1XOUA 2K1EA 5FLXN 3RYIB 3MDSA 3FYEB 1US6A 1AJPA 2Y69C 4DUYO 1NTKH 1BZKA 2JVDA 4MVSA 4B3RB 2GBOA 3SGIA 2GTAA 1F4NA 2DQ3A 1R3IC 1QCEA 3O9OA 2VQFB 4JF3A 2YIBA 5BR8O 1IBKB 1E1RG 1ZAUA 3OUFA 1I94B 2GUZA 2HG5C 3L72H 2QWQB 3EFFK 2QSAA 4FLYA 5DN6G 2XTAA 4LF8O 4UVBA 2AW9A 2EIJB 2R9IA 3ZEDA 3ETDA 4E4EA 2UXDB 1N34B 2R9RB 4UB8Z 2P7TC 2IJHA 2AHYA 2G38A 2XAHA 3FAVB 1BQ0A 2JRIA 1NS1A 1GN4A 3I56V 1WA8A 2R70A 3AK3A 3K0DA 3X2QC 5B3SB 1SRYA 3AG3B 4WFFA 5FNVB 3CCUV 1JFFA 2Q73A 4IL6Z 5IYZB 3DC6A 2CH7A 3N2KA 4DUZO 4X20B 4NTYA 4JGSA 3DC5A 3CSXA 1VQ6V 1BT8A 4EB6A 5EC2C 5KHJA 4B3SO 5H6RA 4JYCA 4H13B 3H1JH 1XQ8A 3K0GA 2FYUH 4CZZA 4R7CA 5L3DA 4GKJB 2UXNA 3MD0A 1K34A 3BRCA 1LUVA 4FLVA 4NXNO 2IJIA 1DGSA 1SQVH 4B3MB 3ETQA 4J7KA 3PJSK 1V9PA 4UCUA 3WB2A 4MVRA 3J81N 2OYQA 3E83A 3B40A 3AG2C 5IE9A 1ZL8B 3JAKB 5GONA 4RQEA 2P4VA 3QO8A 1G4YB 1N36O 4U7NA 2N04A 3JSNA 1N36B 1IXBA 1SZXA 3KCYA 1P7BA 2BOCC 3SPHA 1EFRG 4KUMA 1I0HA 4TUYB 2BE3A 4QPJA 4NYKA 2HP8A 4CH3A 1DK1A 1R3LC 1LUWA 3IAYA 4DR3B 5BXZA 3BABA 2IU3A 4DR1O 4TQFA 3GB7C 1I5YA 4GKJO 2XNDG 4X1IA 1BE3H 4JI6B 4K8ZA 3SPJA 5BMVB 5DECA 4X65B 4A5UB 3K5NA 1SQQH 1SKVA 2GTSA 1MOFA 5JJJB 1OCZC 2LQTA 4CBCA 2E5LB 3N27A 1K9MW 3CD6V 4FM2A 4UB6Z 1VARA 4OPHA 2KQXA 4ASUG 5LXTB 1N33O 3AG3C 1KU9A 3W7XA 4U3FH 1HNZB 2ZXWC 5LOVA 3D3IA 2EIJC 4NTXA 1TUBA 5FL7G 2HHHB 1XNRB 3J80N 2VWKA 4FVMA 3CCEV 1S0VA 2ZM6B 4P2ZA 4N21A 4F4LA 1IBMO 5K1PA 1GMGA 2ZXWB 3FB8C 2NLJC 5BR8B 1L0NH 1IBKO 1QLEC 2QEXV 4JI7O 2VQFO 3OFNG 1B3QA 1VP7A 3ZHQA 1JPXA 2B9ZA 1M56C 3JARB 4Q20A 1N4CA 1PNLA 3HKCA 3N2KB 4K0KO 1SC5B 4OGQB 3VQYA 1PNMA 5LYJB 2YSUB 4KL1A 4HNAB 4PJ0Z 1NI8A 2UUCO 3BVOA 3WU2Z 4OX9B 4O2BB 1YDXA 3OMNB 5KUKA 2Y48A 4LFAB 1XL6A 3CB2A 1GM9A 2RMKB 1Z5WA 5IJ9A 5KHKA 3FYIB 4O4IA 1FFXB 5KLVH 5IY5C 4DR5O 2WWWA 2VRZA 3ZX6A 3GWOA 1VQMV 1RSOB 2DN9A 5LMNB 5LHHA 1PV0A 5HFLA 2DJVA 1RSOA 2WLJA 3STLC 2QTOA 5LYJA 4O4HB 2IJKA 1XNQO 1TVKB 1GN3A 2ZQMA 3CRQA 1N0NA 1K3EA 3H1LH 1WPBA 1FXHA 2YUAA 4BAYA 3FD9A 2EZOA 3JCZA 4YIPA 4YY3O 4MT8A 4TV8A 2QWOB 2Q7EA 4DV6O 4CH5A 5KHGA 2LW1A 1GM7A 3ZMUA 3E8HA 1G8MA 3FFQA 5GW7A 2MW2B 4DRXA 4DW1A 5CA0B 5JJNB 5IWAB 3LDCA 4XDLA 2WAMA 4XDJA 3E35A 1WP7A 1AI5A 1OCCC 3ZRWA 3LDEA 1SQPH 1GH6A 2DMXA 2XT9A 3L73H 5GTIZ 2N74A 1H2KA 3H9VA 4HAMA 4TQDA 4I50B 2B1IA 4DV5B 2XAJA 1DLBA 5IWAO 5KHIA 1EZJA 1ORQC 5LP6A 2E74B 4I7ZB 4LF6B 1YEWA 4W4KA 3OUSA 4DRXB 2XOKG 5LXTA 4FK5C 4LH7A 4JAVA 1EN4A 1ZLZA 3SPGA 3SYQA 2KG7B 4YY3B 3CJHB 4PA6A 1TUBB 3SR2C 4ZI7A 5E79Z 4DV2O 5BZBA 2IM9A 5EZYB 3JCUZ 5LMUO 2V1DA 3ASNB 3IFXA 2ZIMA 4NVPA 1XHZA 4BW5A 3SYPA 1XUQA 4ZKIA 3K5LA 4I50A 1PP9H 2OTLV 5LMNO 3R65A 3D8CA 1Q86W 4JI3B 4TUYA 5LA6B 2F4VB 2ZIOA 5CB4B 4JPRA 2WLKA 3FB5C 4J80A 3UO3A 4JYAO 3ZRVA 3N2GB 4PD4F 5IDJA 4X64O 2Q67A 1VF6C 1BSMA 1XREA 5EZYA 1Y76B 5D5PA 5CA0A 5KA6A 3L74H 1BL8A 5DEDA 1KP3A 4JI1O 1FKAO 1T5EA 2L6LA 3L75H 1JA8A 4O2AA 3A0HZ 1JOYA 3T4DA 2Y0IA 3H1KH 3RFRA 3U10A 4ZIBA 1AJQA 4FLUA 4DR6B 1O9GA 3K08A 5B3SC 3AG1B 4K35A 3ZHSA 5KMGB 3B2EE 1O9HA 4TSFG 5IJ0B 3B8MA 1XBLA 3A8TA 1IXMA 2P22C 2DYRC 1QQCA 2XAGA 5KHHA 4TT3G 1IBLB 1IBMB 1SF9A 2DYSB 2WLLB 4NXMO 1AI7A 2P4KA 4D6TH 1GN2A 4H33A 2A3QA 1Q8IA 4CS3A 3ABLB 3W7TA 5JVDA 4GX1A 3BA8A 2ZE8A 2EULA 1QR8A 5LBQA 2RCVA 2EIMC 4QE7A 1OCRC 4I55A 1COWG 4NB5A 4I55B 3RYHB 2X6AA 2PYLA 1N33B 3TCUA 5EC1C 4DR4B 1K5SA 4LH6A 2RQ6A 4UUJC 3OGIB 2F1MA 2F23A 4ZOLB 2JGUA 5B1AB 4WFEA 4JZ2A 3RYCB 4GX0A 3K3WA 1L8DA 4QJFB 3G6BA 4O4JB 3BA9A 1HNWO 3CE2A 4DK0A 1FFXA 2EILB 3ASOB 1L1FA 3BHPA 2YEVB 4JI6O 5L3EA 4JI8B 4RUEA 4DR1B 4JYBA 2YIAA 4PDLA 5J2UB 1XMOO 3SJCC 3OM3B 4FJCC 4GX2A 4DR3O 1MG1A 3G80A 4IHJA 1M1KW 3K9SA 2ZT9B 2PYJA 1J5EB 2P67A 2E76B 3BCCH 1Q3EA 1H2MA 3HB3B 4FFBA 1WLEA 4BIOA 2FTKA 1Y6XA 3G71V 3B77A 3VQXA 1I08A 4LR3A 1SQXH 4FFKA 4CS4A 1OV9A 2ZE7A 3FB6C 4P30A 1AB3A 3F5TA 2JJ2G 2DQ0A 1Y76A 2ITCC 1JMKC 5IYZA 2Y4TA 4TV9B 1XMOB 4F6RB 2A9HA 2ADQB 4JASA 4YJ3B 4JI8O 2JK5C 4WBNA 1K7DA 1DTOA 3OGCC 3CP1A 3BAAA 2JIZG 4B3SB 2FKXA 1ENVA 3ABKB 3CCSV 3CCQV 5CA1B 1KBHA 4PV1B 2PI5A 1RPOA 2IH3C 3CRAA 3LDDA 2UXBB 4J9ZB 1BCCH 1W0KG 4JV5B 4H37A 4QPKA 4DR4O 1K8AW 3ZRWB 5FNVA 1FXKB 2EIKB 4X1YA 4YXWG 1SA0A 1GN6A 1AILA 2YXHA 4RWUA 2Q7GA 1GK9A 4JTCB 4LWSB 3L71H 2K9PA 2W0FC 1HP8A 2Z3YA 2UXDO 2N05A 3CPWU 2DWEC 4JI2O 4PI0A 3M8AA 1YVWA 3KZIZ 2ARHA 5TISZ 2JJ1G 4UVCA 2D2CB 4NXMB 4IGGA 3G6EV 1KD1W 3SJAC 1AR1B 1K97A 3K06A 4JI4O 1P7GA 2BTQA 3P32A 3CRRA 3WG7C 3G4SV 2EX3A 3JASA 4QGPA 2JEUA 2QM8A 4XDKA 1K33A 1Q43A 5CBGA 4CS2A 1Y74B 3JAKA 2QGNA 3CMAV 3L9DA 4GKKB 1WN7A 3ABTA 1BS3A 3DGEA 4JI1B 1Q81W 4B3TO 1URFA 1AI4A 2UUAO 3H1IH 4LFBB 4J42A 3JAWB 2LW7A 4X64B 1D5AA 3D36A 1M56B 1H8EG 5KX5B 1XMQO 4DR7O 3WB1A 1FAFA 1ZL8A 3OR6C 4G27B 1ZUQA 4JI3O 2MK3A 5FPRA 3ZHVA 4J41A 1HNXO 4TV8B 1AR4A 4CH6A 4Z1MG 5LHGA 3RBZA 5F2VO 3B09A 4FM1A 4C7UA 2WPDG 4WBNB 3C3SA 4LF4B 4H0LB 5LOVB 3CX5F 4YHHB 1IDSA 4FLXA 1X4TA 5CN0A 5ITZA 2CGOA 2VS0A 4LF9B 3OD4A 2AHZA 1W59A 1XDCA 1YHQV 2WLHA 1S3JA 4MVQA 3G67A 3SJBC 4P9OA 2JS3A 3S3WA 2LGQA 4IYHA 4WF9V 2PUSA 5JQGA 1QBZA 1QHTA 4LC1A 4JI5B 1K92A 2XAFA 3LUTB 2HEPA 3CRCA 1WA8B 1RM1C 3ABMC 1MABG 4UCSA 1HDJA 2QDOA 3JD2A 4YJ2A 3CCRV 1BHBA 4WFGA 3ZHTA 4HBNA 2Q8VA 1S5LZ 1FXKA 4X1YB 3EHBB 4LF7B 3E22B 2PGGA 2F66C 4LF7O 1H8HG 3AK1A 3E8BA 3W7SA 1KYOF 1SQFA 2YI8A 3D36C 4DXWA 3A0RA 1NH2D 1R6TA 3ZMZA 3D3QA 4WFAV 1OJHA 4JYYA 3KKYA 2QJ1A 4U7OA 3K04A 5H5NA 3N2GA 3VQVA 4I5SA 5E1AC 1ROPA 5B66Z 3MHSC 2LFRA 2BTOA 4MS2A 3TK1A 2EJRA 4ZHQB 4K8XA 5B5EZ 4LF9O 4LFCB 1YCIA 1NTZH 1BMFG 4EFBA 1JQ0A 1PKXA 3HPLC 1QNMA 4U3JB 3UCSC 3RN4A 2CTPA 2DOSA 3ZMTA 5H9CA 2P06A 5JVDB 1I5XA 3MAQA 2ATKC 1KECA 1AP5A 2GSMB 3RGBA 4CC6A 4ABMA 3ETGA 3T1HO 1L0LH 1S5JA 1B6QA 2A7WA 3OEEG 2VWJA 5LGTA 2YICA 5A9GA 1I7FA 4LBEC 1Q82W 2PTMA 2QKSA 4X1KB 3Q4HA 4CH4A 3HKDA 4AQYO 4UCRA 2KSDA 1XMQB 4DR7B 1GTOA 2WLIA 4HYOA 1QLEB 3DXRA 5KUMA 1WP8A 3TJTA 1GM8A 2JEXA 5J2TB 4EKWA 1TGOA 3ML0A 3JAWA 4OX9O 4LFBO 3LSSA 5B1BC 4BR6A 3ZMSA 1MNGA 4FMTA 2UUCB 2UUAB 4MVOA 2CE4A 2LP7A 3M7MX 3ZRSA 4B3TB 1JFFB 5JQGB 5EIBC 1A32A 4DV1O 3C90A 3CEIA 4K0KB 1R1BA 3EVKA 3JYCA 3UO2A 2QR4A 3HKCB 4NR1A 3HKEA 4YIOA 5ITZB 1E1QG 4IIJA 1MSDA 3OT7A 2FL4A 3RYFB 2HKOA 3RYHA 1K4DC 2VQEO 3OEHG 2F95B 5KMGA 4JI4B 2LJ2A 5DM6V 2LGWA 3OAAG 3T1CA 4JTAB 2EZPA 3RYIA 1SZTA 1HR0B 3ZCCA 1PD3A 2H94A 3OTFA 3E8GA 4PDMA 1Y74A 3NXSA 4JI2B 1JCHA 4GCZA 3QNEA 3UM7A 5D5QA 4DV4B 1XNRO 4B08A 3K79A 1VIBA 1SS3A 4D7SA 2XASA 1K73W 3I5DA 1HWYA 2HLDG 4MTFA 3K58A 4PI2A 4WFBV 4GZRB 4GT1A 4JV5O 4KHPB 4O4HA 1S77D 2CTWA 1YJWV 1P84F 2DE0X 2KB1A 4FZ0A 2AZ2A 1F23A 1R73A 2BSKB 5IYCO 3WG7B 2QWPB 3P30A 3ICXA 2HVJC 2ODMA 2YI9A 3E2EA 3CC4V 4MVUA 5LHIA 5J2TA 2RNBA 4IHJB 3J7AU 2L35A 3X2QB 3LSUA 1IVSA 2EILC 1EBOA 2YIDA 4NTWA 3TETA 2JGDB 4X89A 5KX5A 4G28B 2EJ7A 1IZ3A 2BTQB 1JR9A 2M6YA 4X1KA 1J5EO 4D7TA 3JARA 3F7VC 2QWNB 2CH7B 4FM0A 4BW9A 2CTQA 2X0LA 4ZOLA 4NXNB 5C8YA 3QG5A 1AROP 2W6JG 3FAVA 3OMIB 4W4LA 1GO3F 1OCRB 3S3XA 1Z2GA 2WA3A 3K5OA 3WFVA 1PL0A 1OCOB 3JALB 1HNWB 2PY5A 4X20A 1VQPV 2BCCH 2ZR3A 4PA4A 2CDYA 1H2SB 1E79G 1WB8A 2ZD9A 2LFSA 4KHPO 3AG1C 3WB0A 2QWRB 3OTOB 4ZBMA 1UPGA 2OIEA 2GDSA 4X62B 4MSWC 2NR5A 4K3AA 1IX9A 4P9PA 2YS8A 4DV4O 4LWSA 2ZDIC 1YITV 1M5IA 3F7YC 3E89A 3CCLV 5L3GA 4LF8B 3ASOC 5H2FZ 2O57A 1FXVA 2QKAA 4X66O 2XUMA 1DF5A 2ADPA 3IC7A 3A2FA 3E22A 3THOA 4HZ3A 1I94O 4FZ1A 2OT5A 1Q6IA 2LO1A 3RW0A 1RPRA 5BMVA 1MA1A 1MMMA 5EBWC 3BY6A 4B3RO 4KXRA 1F51A 3CXCU 3L70H 4AI8A 4DR6O 3LNMB 2YIBD 2UXXA 1V55B 2CUGA 3OE7G 2KKWA 3GVMA 3Q4HB 5LA6A 2X6CA 2P5OA 1YF2A 3HKBB 1DF4A 3H01A 1FXKC 2EIKC 1ZTEA 3SPCA 1U96A 5EYPA 1F7YA 1FYJA 3R66A 3H1HH 4MW3A 5CBHA 2DYSC 4LF5B 2JGDA 5LGUA 2YC0A 1YJ9V 5J9PC 2CAZC 2OCHA 4JYAB 5H6QA 3QO7A 2AXTZ 4IYIA 1FD9A 1VEWA 3UQ8A 1WNSA 4I4TA 1QU7A 2QM7A 3CJHA 3IJ4A 3P3NA 3T1HB 1MSWD 5LL6Y 5BY1A 1FJGO 1H2LA 2W0XA 5L3CA 2HJDA 1FS0G 2YXYA 1UJWB 3RWRD 5LMUB 2Y69B 2RDCA 1EN6A 4OXSA 1VQKV 1BGYH 2B1GA 3KG2A 3QVNA 2E75B 4PA7A 3ASNC 2X6BA 4LFCO 2ZE6A 2KG7A 3VQWA 4PDVA 4PDRA 3CHXA 4WFHA 1VF6A 4X9QA 3O65A 5LGNA 4B7EA 5EBLC 1S72V 4JAAA 4UV8A 5CMUA 1PM9A 4LF6O 2ZKOA 2XHBA 2Q6AA 4BIZA 1NR1A 1AP6A 5LP6B 3JASB 2HVKC 1JVMA 4GLXA 1GKFA 2Q0AA 1SA0B 3OMAB 3JATB 4O4JA 2EBOA 1Q5OA 4FLTA 4O2AB 3U11A 1H38A 1VQ4V 2H8PC 4LP8A 5LP6C 3DTUB 4GYCB 1NVPD 2RJZA 2IJJA 4U3JA 1P4RA 4J10A 1M57C 4MVZA 4QE9A 2CK3G 4O4LA 4MTGA 3K03A 1KMIZ 4UV9A 4X8AA 2WSSG 5CBFA 1D2DA 1PL4A 4X1IB 3KCXA 3CWBH 4F6RA 3BEHA 2A0LA 3LNNA 3ABMB 4DV6B 1K4CC 1PPJH 4DW0A 3OW2U 3BPZA 5CA1A 1NJIW 3CRMA 3IC9A 1MZFA 1R6NA 4YHHO 2BOBC 1M90W 3M99B 1YJNV 2WLIB 5L3FA 4UCOA 3ZN0A 5KAFZ 2Q0OC 4GUNA 2ZNIA 1G6UA 2JS5A 3ZRXA 1XNQB 4LNUB 3ZJZA 3PN1A 3ZBHA 1FJGB 5K1XA 4R50A 4UXNA 4EB6B 4DR2O 3TGUH 1Y67A 1HNXB 2Y4UA 4BIUA 4DR5B 2AZ0A 4L87A 4PELA 4KP4A 5B1BB 4I4TB 4FIPC 1TUEB 3HKEB 1B06A 2YEVA 2H3OA 2PI4A 2OIGA 4JTDB 2UUBO 4TOIA 2IH1C 3UKMA 4LF5O 1SESA 1YTFB 4I9WA 5JH7B 2CGNA 2QTSA 4UCVA 4Z1VA 3JD1A 4RAIA 2GV9A 3OR7C 2Q4PA 1TAEA 4GKKO 2PF4E 1SQGA 5J2UA 2UU9B 4I9QA 1NZ6A 3APQA 3RVZA 3CC7V 2OWOA 1THZA 5CB4A 3FX7A 4R8CA 1EM1A 1ZX3A 1K5QA 4DV0B 3EXAA 3U0ZA 3RT3C 5EK0A 3FKSG 4JI7B 2NNUA 4AHCA 4JI0B 1KB9F 1F4MA 1M4UA 3QTCA 1Q6UA 1BHAA 2ILMA 2ZM6O 4X66B 1NR7A 2QE7G 1WAZA 3GWKC 1SERA 2ZINA 4FLZA 3JATA 1KUQA 4LCUC 4DYLA 2HHHO 3K5MA 1Q90D 5JCOA 4O4IB 3STZC 1NQTA 2HR3A 3T2MA 4L8JA 4X62O 1HNZO 5GTHZ 1XEQA 1JJOA 1VF5B 2CTRA 2FB5A 4F6EA 4I0XA 3OTOO 2IW5A 1VQLV 2X7RB 5JWPA 1AVMA 2HFEC 2C2AA 5L3BA 3CYOA 4DV7O 2UXBO 1OCOC 2DWDC 1FPOA 2V7QG 2WLLA 5EYPB 3TXSA 3AG4B 2Q7HA 2E5LO 1NVPB 4J9YB 5AG2A 4Q6GA
chains in the Genus database with same CATH topology
1BQZA 2N05A 2QWOB 1IURA 1N4CA 2LGWA 2CTQA 2CTRA 2L6LA 3AG7A 3APOA 3UCSC 1BQ0A 2Y4TA 2GUZA 2CTPA 2PF4E 2OCHA 2CUGA 2QWPB 2QWQB 2DMXA 1GH6A 2QSAA 2N04A 2YS8A 3UO2A 3UO3A 4J80A 2KQXA 1WJZA 1FAFA 1FPOA 1NZ6A 2GUZB 3APQA 2QWRB 2CTWA 2EJ7A 4IT5A 4RWUA 2M6YA 1HDJA 3BVOA 2YUAA 2LO1A 2QWNB 4J7ZA 2Y4UA 2DN9A 1XBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BQZ A;  2N05 A;  2QWO B;  1IUR A;  1N4C A;  2LGW A;  2CTQ A;  2CTR A;  2L6L A;  3AG7 A;  3APO A;  3UCS C;  1BQ0 A;  2Y4T A;  2GUZ A;  2CTP A;  2PF4 E;  2OCH A;  2CUG A;  2QWP B;  2QWQ B;  2DMX A;  1GH6 A;  2QSA A;  2N04 A;  2YS8 A;  3UO2 A;  3UO3 A;  4J80 A;  2KQX A;  1WJZ A;  1FAF A;  1FPO A;  1NZ6 A;  2GUZ B;  3APQ A;  2QWR B;  2CTW A;  2EJ7 A;  4IT5 A;  4RWU A;  2M6Y A;  1HDJ A;  3BVO A;  2YUA A;  2LO1 A;  2QWN B;  4J7Z A;  2Y4U A;  2DN9 A;  1XBL A; 
#chains in the Genus database with same CATH topology
 4XBF A;  3UT5 A;  4X65 O;  2IBZ H;  3ABK C;  2V4D A;  2ZE5 A;  5IT9 N;  1VQ5 V;  1JX9 A;  2QM4 A;  1J95 A;  3SYO A;  5CA3 A;  1VMG A;  1VQ8 V;  4N23 A;  1XIL A;  2GUZ B;  5C8Y B;  3ZMV A;  4JZG A;  1KP2 A;  1N32 B;  4EEQ A;  3AG4 C;  4X88 A;  2F93 B;  3K59 A;  1KKD A;  2HJF C;  1YZB A;  1VQN V;  4LNU A;  2OTJ V;  5IJ9 B;  3NR7 A;  2AGA A;  3QF7 A;  1OCZ B;  1AI6 A;  1EZV H;  1VQ7 V;  5KA5 A;  1V54 B;  3IGA C;  1UFI A;  2QKC A;  1CXZ B;  1RFY A;  4IT5 A;  3E8F A;  1VF7 A;  3CCM V;  4FPP A;  4G2K A;  4O2B A;  4RUF A;  1TA8 A;  1YIJ V;  1N32 O;  3ZHR A;  1S76 D;  4B3M O;  1CEZ A;  3AG7 A;  2EIN C;  4JAU A;  3JAM N;  1CP9 A;  5IYB O;  4FFB B;  4UVA A;  2NN4 A;  1WPX A;  4H44 B;  2Z5U A;  4ZI7 B;  2A79 B;  2P90 A;  3SPI A;  3RYC A;  1M9N A;  1VQO V;  4GX5 A;  4CC5 A;  3HR0 A;  1VQ9 V;  4DUZ B;  1N8R W;  1YI2 V;  1ZSP A;  2WA4 A;  2Z0A A;  3HKB A;  4DV7 B;  2YXL A;  3E86 A;  1W0J G;  4PHZ A;  3SJQ C;  3ABU A;  4RQF A;  1X59 A;  1G1X B;  2XAQ A;  2ZR2 A;  1NH2 B;  5C93 A;  2RN9 A;  2R9A A;  4DK1 A;  1N0J A;  1W2B U;  1U97 A;  2E3C A;  1N34 O;  1NTM H;  2R72 A;  1SQB H;  1OZ0 A;  3AK2 A;  1HR0 O;  3FB7 C;  1IBL O;  4TV9 A;  4JI0 O;  1NU1 H;  3ZHU A;  1PNK A;  3CC2 V;  1Y4M A;  3ABL C;  1NKD A;  2VQE B;  2ETN A;  4DV0 O;  1LR1 A;  4Z2W A;  3T4Z A;  2B5U A;  4YJ3 A;  1LNQ A;  3APO A;  2IU0 A;  1S5H C;  2UU9 O;  2ITD C;  4DUY B;  4R6Z A;  2BSK A;  3B4S A;  2Q9L A;  1YXB A;  3HKD B;  4DV1 B;  5IYD O;  1AR5 A;  3SYC A;  3SYA A;  1V55 C;  3JD3 A;  4MTO A;  1M93 A;  3LSQ A;  2UUB B;  2ZCE A;  2PZS A;  1XHX A;  1D5N A;  3TXQ A;  5IY5 B;  2F4V O;  1Z5V A;  1WJZ A;  1B04 A;  1ZWI C;  4AQY B;  1CPY A;  1M57 B;  3ZS8 C;  4BWA A;  1QLN A;  3K57 A;  3C3T A;  2JDI G;  3QO5 A;  1GRJ A;  1QR9 A;  4QIW F;  3CCV V;  2Q68 A;  4DR2 B;  4OPA A;  2ZNJ A;  4DV3 O;  4PA9 A;  4QNH B;  1YTF D;  3JD0 A;  2GHY A;  5JCO C;  1GAX A;  2UXC O;  1MZE A;  5GON B;  3AEI A;  2WLM A;  1R6K A;  4YJ2 B;  1XI1 A;  4DV2 B;  1KQS U;  2F43 G;  4MVM A;  5B1N A;  3K9A A;  4MW8 A;  3VOU A;  4EFE A;  3T1Y B;  1BQZ A;  1Y66 A;  4TWK A;  3F5W C;  4NKG B;  5HFM A;  5FPO A;  1FFT B;  2EIN B;  1Q6H A;  1R3J C;  2P6J A;  1KKC A;  3JSL A;  2OCC B;  2FML A;  3ZIA G;  3SDL A;  4O4L B;  1TVK A;  3A0B Z;  4PA3 A;  2WLN A;  4DV5 O;  5JJE B;  5B1A C;  5B1O A;  4J7Z A;  4J7J A;  1QVF U;  4ICG A;  5A2Q N;  1OHH G;  1YSC A;  1EN5 A;  4I0X B;  3MHH C;  3ETE A;  5IJ0 A;  1KC8 W;  1RP3 B;  1V54 C;  3UT5 B;  1RM1 B;  1OCC B;  3W7W A;  1IUR A;  1SET A;  3B8N A;  5KAI Z;  3P3P A;  1NBM G;  1JJ2 U;  3VBB A;  4JI5 O;  3JD4 A;  4AIL C;  2DYR B;  1P49 A;  4UFZ A;  2EIM B;  3ZN1 A;  4RO2 A;  3CME V;  5JH7 A;  1WB7 A;  4UCT A;  1XL4 A;  1H2G A;  3T1Y O;  3I55 V;  3CS5 A;  3BFR A;  3JAL A;  4B7K A;  3RYF A;  1NT2 B;  1QVG U;  2M7W A;  1R3K C;  1AJN A;  4FLW A;  4LF4 O;  2Q5Z A;  3DXR B;  4MTX A;  2UXC B;  2Q69 A;  5EIB D;  4DV3 B;  2OCC C;  4ZHQ A;  4HNA A;  3AG2 B;  5EBM C;  1Q7Y W;  2A06 H;  2QA4 V;  4KFM A;  2W6I G;  2DW4 A;  4DO2 A;  3RVY A;  4IIJ B;  3W7U A;  2ZDI A;  1H2N A;  4E2L A;  4LFA O;  2YDE A;  2D3O W;  3CCJ V;  4WCE V;  2Y0P A;  4J11 A;  3CXH F;  3DSQ A;  1HW7 A;  1XOU A;  2K1E A;  5FLX N;  3RYI B;  3MDS A;  3FYE B;  1US6 A;  1AJP A;  2Y69 C;  4DUY O;  1NTK H;  1BZK A;  2JVD A;  4MVS A;  4B3R B;  2GBO A;  3SGI A;  2GTA A;  1F4N A;  2DQ3 A;  1R3I C;  1QCE A;  3O9O A;  2VQF B;  4JF3 A;  2YIB A;  5BR8 O;  1IBK B;  1E1R G;  1ZAU A;  3OUF A;  1I94 B;  2GUZ A;  2HG5 C;  3L72 H;  2QWQ B;  3EFF K;  2QSA A;  4FLY A;  5DN6 G;  2XTA A;  4LF8 O;  4UVB A;  2AW9 A;  2EIJ B;  2R9I A;  3ZED A;  3ETD A;  4E4E A;  2UXD B;  1N34 B;  2R9R B;  4UB8 Z;  2P7T C;  2IJH A;  2AHY A;  2G38 A;  2XAH A;  3FAV B;  1BQ0 A;  2JRI A;  1NS1 A;  1GN4 A;  3I56 V;  1WA8 A;  2R70 A;  3AK3 A;  3K0D A;  3X2Q C;  5B3S B;  1SRY A;  3AG3 B;  4WFF A;  5FNV B;  3CCU V;  1JFF A;  2Q73 A;  4IL6 Z;  5IYZ B;  3DC6 A;  2CH7 A;  3N2K A;  4DUZ O;  4X20 B;  4NTY A;  4JGS A;  3DC5 A;  3CSX A;  1VQ6 V;  1BT8 A;  4EB6 A;  5EC2 C;  5KHJ A;  4B3S O;  5H6R A;  4JYC A;  4H13 B;  3H1J H;  1XQ8 A;  3K0G A;  2FYU H;  4CZZ A;  4R7C A;  5L3D A;  4GKJ B;  2UXN A;  3MD0 A;  1K34 A;  3BRC A;  1LUV A;  4FLV A;  4NXN O;  2IJI A;  1DGS A;  1SQV H;  4B3M B;  3ETQ A;  4J7K A;  3PJS K;  1V9P A;  4UCU A;  3WB2 A;  4MVR A;  3J81 N;  2OYQ A;  3E83 A;  3B40 A;  3AG2 C;  5IE9 A;  1ZL8 B;  3JAK B;  5GON A;  4RQE A;  2P4V A;  3QO8 A;  1G4Y B;  1N36 O;  4U7N A;  2N04 A;  3JSN A;  1N36 B;  1IXB A;  1SZX A;  3KCY A;  1P7B A;  2BOC C;  3SPH A;  1EFR G;  4KUM A;  1I0H A;  4TUY B;  2BE3 A;  4QPJ A;  4NYK A;  2HP8 A;  4CH3 A;  1DK1 A;  1R3L C;  1LUW A;  3IAY A;  4DR3 B;  5BXZ A;  3BAB A;  2IU3 A;  4DR1 O;  4TQF A;  3GB7 C;  1I5Y A;  4GKJ O;  2XND G;  4X1I A;  1BE3 H;  4JI6 B;  4K8Z A;  3SPJ A;  5BMV B;  5DEC A;  4X65 B;  4A5U B;  3K5N A;  1SQQ H;  1SKV A;  2GTS A;  1MOF A;  5JJJ B;  1OCZ C;  2LQT A;  4CBC A;  2E5L B;  3N27 A;  1K9M W;  3CD6 V;  4FM2 A;  4UB6 Z;  1VAR A;  4OPH A;  2KQX A;  4ASU G;  5LXT B;  1N33 O;  3AG3 C;  1KU9 A;  3W7X A;  4U3F H;  1HNZ B;  2ZXW C;  5LOV A;  3D3I A;  2EIJ C;  4NTX A;  1TUB A;  5FL7 G;  2HHH B;  1XNR B;  3J80 N;  2VWK A;  4FVM A;  3CCE V;  1S0V A;  2ZM6 B;  4P2Z A;  4N21 A;  4F4L A;  1IBM O;  5K1P A;  1GMG A;  2ZXW B;  3FB8 C;  2NLJ C;  5BR8 B;  1L0N H;  1IBK O;  1QLE C;  2QEX V;  4JI7 O;  2VQF O;  3OFN G;  1B3Q A;  1VP7 A;  3ZHQ A;  1JPX A;  2B9Z A;  1M56 C;  3JAR B;  4Q20 A;  1N4C A;  1PNL A;  3HKC A;  3N2K B;  4K0K O;  1SC5 B;  4OGQ B;  3VQY A;  1PNM A;  5LYJ B;  2YSU B;  4KL1 A;  4HNA B;  4PJ0 Z;  1NI8 A;  2UUC O;  3BVO A;  3WU2 Z;  4OX9 B;  4O2B B;  1YDX A;  3OMN B;  5KUK A;  2Y48 A;  4LFA B;  1XL6 A;  3CB2 A;  1GM9 A;  2RMK B;  1Z5W A;  5IJ9 A;  5KHK A;  3FYI B;  4O4I A;  1FFX B;  5KLV H;  5IY5 C;  4DR5 O;  2WWW A;  2VRZ A;  3ZX6 A;  3GWO A;  1VQM V;  1RSO B;  2DN9 A;  5LMN B;  5LHH A;  1PV0 A;  5HFL A;  2DJV A;  1RSO A;  2WLJ A;  3STL C;  2QTO A;  5LYJ A;  4O4H B;  2IJK A;  1XNQ O;  1TVK B;  1GN3 A;  2ZQM A;  3CRQ A;  1N0N A;  1K3E A;  3H1L H;  1WPB A;  1FXH A;  2YUA A;  4BAY A;  3FD9 A;  2EZO A;  3JCZ A;  4YIP A;  4YY3 O;  4MT8 A;  4TV8 A;  2QWO B;  2Q7E A;  4DV6 O;  4CH5 A;  5KHG A;  2LW1 A;  1GM7 A;  3ZMU A;  3E8H A;  1G8M A;  3FFQ A;  5GW7 A;  2MW2 B;  4DRX A;  4DW1 A;  5CA0 B;  5JJN B;  5IWA B;  3LDC A;  4XDL A;  2WAM A;  4XDJ A;  3E35 A;  1WP7 A;  1AI5 A;  1OCC C;  3ZRW A;  3LDE A;  1SQP H;  1GH6 A;  2DMX A;  2XT9 A;  3L73 H;  5GTI Z;  2N74 A;  1H2K A;  3H9V A;  4HAM A;  4TQD A;  4I50 B;  2B1I A;  4DV5 B;  2XAJ A;  1DLB A;  5IWA O;  5KHI A;  1EZJ A;  1ORQ C;  5LP6 A;  2E74 B;  4I7Z B;  4LF6 B;  1YEW A;  4W4K A;  3OUS A;  4DRX B;  2XOK G;  5LXT A;  4FK5 C;  4LH7 A;  4JAV A;  1EN4 A;  1ZLZ A;  3SPG A;  3SYQ A;  2KG7 B;  4YY3 B;  3CJH B;  4PA6 A;  1TUB B;  3SR2 C;  4ZI7 A;  5E79 Z;  4DV2 O;  5BZB A;  2IM9 A;  5EZY B;  3JCU Z;  5LMU O;  2V1D A;  3ASN B;  3IFX A;  2ZIM A;  4NVP A;  1XHZ A;  4BW5 A;  3SYP A;  1XUQ A;  4ZKI A;  3K5L A;  4I50 A;  1PP9 H;  2OTL V;  5LMN O;  3R65 A;  3D8C A;  1Q86 W;  4JI3 B;  4TUY A;  5LA6 B;  2F4V B;  2ZIO A;  5CB4 B;  4JPR A;  2WLK A;  3FB5 C;  4J80 A;  3UO3 A;  4JYA O;  3ZRV A;  3N2G B;  4PD4 F;  5IDJ A;  4X64 O;  2Q67 A;  1VF6 C;  1BSM A;  1XRE A;  5EZY A;  1Y76 B;  5D5P A;  5CA0 A;  5KA6 A;  3L74 H;  1BL8 A;  5DED A;  1KP3 A;  4JI1 O;  1FKA O;  1T5E A;  2L6L A;  3L75 H;  1JA8 A;  4O2A A;  3A0H Z;  1JOY A;  3T4D A;  2Y0I A;  3H1K H;  3RFR A;  3U10 A;  4ZIB A;  1AJQ A;  4FLU A;  4DR6 B;  1O9G A;  3K08 A;  5B3S C;  3AG1 B;  4K35 A;  3ZHS A;  5KMG B;  3B2E E;  1O9H A;  4TSF G;  5IJ0 B;  3B8M A;  1XBL A;  3A8T A;  1IXM A;  2P22 C;  2DYR C;  1QQC A;  2XAG A;  5KHH A;  4TT3 G;  1IBL B;  1IBM B;  1SF9 A;  2DYS B;  2WLL B;  4NXM O;  1AI7 A;  2P4K A;  4D6T H;  1GN2 A;  4H33 A;  2A3Q A;  1Q8I A;  4CS3 A;  3ABL B;  3W7T A;  5JVD A;  4GX1 A;  3BA8 A;  2ZE8 A;  2EUL A;  1QR8 A;  5LBQ A;  2RCV A;  2EIM C;  4QE7 A;  1OCR C;  4I55 A;  1COW G;  4NB5 A;  4I55 B;  3RYH B;  2X6A A;  2PYL A;  1N33 B;  3TCU A;  5EC1 C;  4DR4 B;  1K5S A;  4LH6 A;  2RQ6 A;  4UUJ C;  3OGI B;  2F1M A;  2F23 A;  4ZOL B;  2JGU A;  5B1A B;  4WFE A;  4JZ2 A;  3RYC B;  4GX0 A;  3K3W A;  1L8D A;  4QJF B;  3G6B A;  4O4J B;  3BA9 A;  1HNW O;  3CE2 A;  4DK0 A;  1FFX A;  2EIL B;  3ASO B;  1L1F A;  3BHP A;  2YEV B;  4JI6 O;  5L3E A;  4JI8 B;  4RUE A;  4DR1 B;  4JYB A;  2YIA A;  4PDL A;  5J2U B;  1XMO O;  3SJC C;  3OM3 B;  4FJC C;  4GX2 A;  4DR3 O;  1MG1 A;  3G80 A;  4IHJ A;  1M1K W;  3K9S A;  2ZT9 B;  2PYJ A;  1J5E B;  2P67 A;  2E76 B;  3BCC H;  1Q3E A;  1H2M A;  3HB3 B;  4FFB A;  1WLE A;  4BIO A;  2FTK A;  1Y6X A;  3G71 V;  3B77 A;  3VQX A;  1I08 A;  4LR3 A;  1SQX H;  4FFK A;  4CS4 A;  1OV9 A;  2ZE7 A;  3FB6 C;  4P30 A;  1AB3 A;  3F5T A;  2JJ2 G;  2DQ0 A;  1Y76 A;  2ITC C;  1JMK C;  5IYZ A;  2Y4T A;  4TV9 B;  1XMO B;  4F6R B;  2A9H A;  2ADQ B;  4JAS A;  4YJ3 B;  4JI8 O;  2JK5 C;  4WBN A;  1K7D A;  1DTO A;  3OGC C;  3CP1 A;  3BAA A;  2JIZ G;  4B3S B;  2FKX A;  1ENV A;  3ABK B;  3CCS V;  3CCQ V;  5CA1 B;  1KBH A;  4PV1 B;  2PI5 A;  1RPO A;  2IH3 C;  3CRA A;  3LDD A;  2UXB B;  4J9Z B;  1BCC H;  1W0K G;  4JV5 B;  4H37 A;  4QPK A;  4DR4 O;  1K8A W;  3ZRW B;  5FNV A;  1FXK B;  2EIK B;  4X1Y A;  4YXW G;  1SA0 A;  1GN6 A;  1AIL A;  2YXH A;  4RWU A;  2Q7G A;  1GK9 A;  4JTC B;  4LWS B;  3L71 H;  2K9P A;  2W0F C;  1HP8 A;  2Z3Y A;  2UXD O;  2N05 A;  3CPW U;  2DWE C;  4JI2 O;  4PI0 A;  3M8A A;  1YVW A;  3KZI Z;  2ARH A;  5TIS Z;  2JJ1 G;  4UVC A;  2D2C B;  4NXM B;  4IGG A;  3G6E V;  1KD1 W;  3SJA C;  1AR1 B;  1K97 A;  3K06 A;  4JI4 O;  1P7G A;  2BTQ A;  3P32 A;  3CRR A;  3WG7 C;  3G4S V;  2EX3 A;  3JAS A;  4QGP A;  2JEU A;  2QM8 A;  4XDK A;  1K33 A;  1Q43 A;  5CBG A;  4CS2 A;  1Y74 B;  3JAK A;  2QGN A;  3CMA V;  3L9D A;  4GKK B;  1WN7 A;  3ABT A;  1BS3 A;  3DGE A;  4JI1 B;  1Q81 W;  4B3T O;  1URF A;  1AI4 A;  2UUA O;  3H1I H;  4LFB B;  4J42 A;  3JAW B;  2LW7 A;  4X64 B;  1D5A A;  3D36 A;  1M56 B;  1H8E G;  5KX5 B;  1XMQ O;  4DR7 O;  3WB1 A;  1FAF A;  1ZL8 A;  3OR6 C;  4G27 B;  1ZUQ A;  4JI3 O;  2MK3 A;  5FPR A;  3ZHV A;  4J41 A;  1HNX O;  4TV8 B;  1AR4 A;  4CH6 A;  4Z1M G;  5LHG A;  3RBZ A;  5F2V O;  3B09 A;  4FM1 A;  4C7U A;  2WPD G;  4WBN B;  3C3S A;  4LF4 B;  4H0L B;  5LOV B;  3CX5 F;  4YHH B;  1IDS A;  4FLX A;  1X4T A;  5CN0 A;  5ITZ A;  2CGO A;  2VS0 A;  4LF9 B;  3OD4 A;  2AHZ A;  1W59 A;  1XDC A;  1YHQ V;  2WLH A;  1S3J A;  4MVQ A;  3G67 A;  3SJB C;  4P9O A;  2JS3 A;  3S3W A;  2LGQ A;  4IYH A;  4WF9 V;  2PUS A;  5JQG A;  1QBZ A;  1QHT A;  4LC1 A;  4JI5 B;  1K92 A;  2XAF A;  3LUT B;  2HEP A;  3CRC A;  1WA8 B;  1RM1 C;  3ABM C;  1MAB G;  4UCS A;  1HDJ A;  2QDO A;  3JD2 A;  4YJ2 A;  3CCR V;  1BHB A;  4WFG A;  3ZHT A;  4HBN A;  2Q8V A;  1S5L Z;  1FXK A;  4X1Y B;  3EHB B;  4LF7 B;  3E22 B;  2PGG A;  2F66 C;  4LF7 O;  1H8H G;  3AK1 A;  3E8B A;  3W7S A;  1KYO F;  1SQF A;  2YI8 A;  3D36 C;  4DXW A;  3A0R A;  1NH2 D;  1R6T A;  3ZMZ A;  3D3Q A;  4WFA V;  1OJH A;  4JYY A;  3KKY A;  2QJ1 A;  4U7O A;  3K04 A;  5H5N A;  3N2G A;  3VQV A;  4I5S A;  5E1A C;  1ROP A;  5B66 Z;  3MHS C;  2LFR A;  2BTO A;  4MS2 A;  3TK1 A;  2EJR A;  4ZHQ B;  4K8X A;  5B5E Z;  4LF9 O;  4LFC B;  1YCI A;  1NTZ H;  1BMF G;  4EFB A;  1JQ0 A;  1PKX A;  3HPL C;  1QNM A;  4U3J B;  3UCS C;  3RN4 A;  2CTP A;  2DOS A;  3ZMT A;  5H9C A;  2P06 A;  5JVD B;  1I5X A;  3MAQ A;  2ATK C;  1KEC A;  1AP5 A;  2GSM B;  3RGB A;  4CC6 A;  4ABM A;  3ETG A;  3T1H O;  1L0L H;  1S5J A;  1B6Q A;  2A7W A;  3OEE G;  2VWJ A;  5LGT A;  2YIC A;  5A9G A;  1I7F A;  4LBE C;  1Q82 W;  2PTM A;  2QKS A;  4X1K B;  3Q4H A;  4CH4 A;  3HKD A;  4AQY O;  4UCR A;  2KSD A;  1XMQ B;  4DR7 B;  1GTO A;  2WLI A;  4HYO A;  1QLE B;  3DXR A;  5KUM A;  1WP8 A;  3TJT A;  1GM8 A;  2JEX A;  5J2T B;  4EKW A;  1TGO A;  3ML0 A;  3JAW A;  4OX9 O;  4LFB O;  3LSS A;  5B1B C;  4BR6 A;  3ZMS A;  1MNG A;  4FMT A;  2UUC B;  2UUA B;  4MVO A;  2CE4 A;  2LP7 A;  3M7M X;  3ZRS A;  4B3T B;  1JFF B;  5JQG B;  5EIB C;  1A32 A;  4DV1 O;  3C90 A;  3CEI A;  4K0K B;  1R1B A;  3EVK A;  3JYC A;  3UO2 A;  2QR4 A;  3HKC B;  4NR1 A;  3HKE A;  4YIO A;  5ITZ B;  1E1Q G;  4IIJ A;  1MSD A;  3OT7 A;  2FL4 A;  3RYF B;  2HKO A;  3RYH A;  1K4D C;  2VQE O;  3OEH G;  2F95 B;  5KMG A;  4JI4 B;  2LJ2 A;  5DM6 V;  2LGW A;  3OAA G;  3T1C A;  4JTA B;  2EZP A;  3RYI A;  1SZT A;  1HR0 B;  3ZCC A;  1PD3 A;  2H94 A;  3OTF A;  3E8G A;  4PDM A;  1Y74 A;  3NXS A;  4JI2 B;  1JCH A;  4GCZ A;  3QNE A;  3UM7 A;  5D5Q A;  4DV4 B;  1XNR O;  4B08 A;  3K79 A;  1VIB A;  1SS3 A;  4D7S A;  2XAS A;  1K73 W;  3I5D A;  1HWY A;  2HLD G;  4MTF A;  3K58 A;  4PI2 A;  4WFB V;  4GZR B;  4GT1 A;  4JV5 O;  4KHP B;  4O4H A;  1S77 D;  2CTW A;  1YJW V;  1P84 F;  2DE0 X;  2KB1 A;  4FZ0 A;  2AZ2 A;  1F23 A;  1R73 A;  2BSK B;  5IYC O;  3WG7 B;  2QWP B;  3P30 A;  3ICX A;  2HVJ C;  2ODM A;  2YI9 A;  3E2E A;  3CC4 V;  4MVU A;  5LHI A;  5J2T A;  2RNB A;  4IHJ B;  3J7A U;  2L35 A;  3X2Q B;  3LSU A;  1IVS A;  2EIL C;  1EBO A;  2YID A;  4NTW A;  3TET A;  2JGD B;  4X89 A;  5KX5 A;  4G28 B;  2EJ7 A;  1IZ3 A;  2BTQ B;  1JR9 A;  2M6Y A;  4X1K A;  1J5E O;  4D7T A;  3JAR A;  3F7V C;  2QWN B;  2CH7 B;  4FM0 A;  4BW9 A;  2CTQ A;  2X0L A;  4ZOL A;  4NXN B;  5C8Y A;  3QG5 A;  1ARO P;  2W6J G;  3FAV A;  3OMI B;  4W4L A;  1GO3 F;  1OCR B;  3S3X A;  1Z2G A;  2WA3 A;  3K5O A;  3WFV A;  1PL0 A;  1OCO B;  3JAL B;  1HNW B;  2PY5 A;  4X20 A;  1VQP V;  2BCC H;  2ZR3 A;  4PA4 A;  2CDY A;  1H2S B;  1E79 G;  1WB8 A;  2ZD9 A;  2LFS A;  4KHP O;  3AG1 C;  3WB0 A;  2QWR B;  3OTO B;  4ZBM A;  1UPG A;  2OIE A;  2GDS A;  4X62 B;  4MSW C;  2NR5 A;  4K3A A;  1IX9 A;  4P9P A;  2YS8 A;  4DV4 O;  4LWS A;  2ZDI C;  1YIT V;  1M5I A;  3F7Y C;  3E89 A;  3CCL V;  5L3G A;  4LF8 B;  3ASO C;  5H2F Z;  2O57 A;  1FXV A;  2QKA A;  4X66 O;  2XUM A;  1DF5 A;  2ADP A;  3IC7 A;  3A2F A;  3E22 A;  3THO A;  4HZ3 A;  1I94 O;  4FZ1 A;  2OT5 A;  1Q6I A;  2LO1 A;  3RW0 A;  1RPR A;  5BMV A;  1MA1 A;  1MMM A;  5EBW C;  3BY6 A;  4B3R O;  4KXR A;  1F51 A;  3CXC U;  3L70 H;  4AI8 A;  4DR6 O;  3LNM B;  2YIB D;  2UXX A;  1V55 B;  2CUG A;  3OE7 G;  2KKW A;  3GVM A;  3Q4H B;  5LA6 A;  2X6C A;  2P5O A;  1YF2 A;  3HKB B;  1DF4 A;  3H01 A;  1FXK C;  2EIK C;  1ZTE A;  3SPC A;  1U96 A;  5EYP A;  1F7Y A;  1FYJ A;  3R66 A;  3H1H H;  4MW3 A;  5CBH A;  2DYS C;  4LF5 B;  2JGD A;  5LGU A;  2YC0 A;  1YJ9 V;  5J9P C;  2CAZ C;  2OCH A;  4JYA B;  5H6Q A;  3QO7 A;  2AXT Z;  4IYI A;  1FD9 A;  1VEW A;  3UQ8 A;  1WNS A;  4I4T A;  1QU7 A;  2QM7 A;  3CJH A;  3IJ4 A;  3P3N A;  3T1H B;  1MSW D;  5LL6 Y;  5BY1 A;  1FJG O;  1H2L A;  2W0X A;  5L3C A;  2HJD A;  1FS0 G;  2YXY A;  1UJW B;  3RWR D;  5LMU B;  2Y69 B;  2RDC A;  1EN6 A;  4OXS A;  1VQK V;  1BGY H;  2B1G A;  3KG2 A;  3QVN A;  2E75 B;  4PA7 A;  3ASN C;  2X6B A;  4LFC O;  2ZE6 A;  2KG7 A;  3VQW A;  4PDV A;  4PDR A;  3CHX A;  4WFH A;  1VF6 A;  4X9Q A;  3O65 A;  5LGN A;  4B7E A;  5EBL C;  1S72 V;  4JAA A;  4UV8 A;  5CMU A;  1PM9 A;  4LF6 O;  2ZKO A;  2XHB A;  2Q6A A;  4BIZ A;  1NR1 A;  1AP6 A;  5LP6 B;  3JAS B;  2HVK C;  1JVM A;  4GLX A;  1GKF A;  2Q0A A;  1SA0 B;  3OMA B;  3JAT B;  4O4J A;  2EBO A;  1Q5O A;  4FLT A;  4O2A B;  3U11 A;  1H38 A;  1VQ4 V;  2H8P C;  4LP8 A;  5LP6 C;  3DTU B;  4GYC B;  1NVP D;  2RJZ A;  2IJJ A;  4U3J A;  1P4R A;  4J10 A;  1M57 C;  4MVZ A;  4QE9 A;  2CK3 G;  4O4L A;  4MTG A;  3K03 A;  1KMI Z;  4UV9 A;  4X8A A;  2WSS G;  5CBF A;  1D2D A;  1PL4 A;  4X1I B;  3KCX A;  3CWB H;  4F6R A;  3BEH A;  2A0L A;  3LNN A;  3ABM B;  4DV6 B;  1K4C C;  1PPJ H;  4DW0 A;  3OW2 U;  3BPZ A;  5CA1 A;  1NJI W;  3CRM A;  3IC9 A;  1MZF A;  1R6N A;  4YHH O;  2BOB C;  1M90 W;  3M99 B;  1YJN V;  2WLI B;  5L3F A;  4UCO A;  3ZN0 A;  5KAF Z;  2Q0O C;  4GUN A;  2ZNI A;  1G6U A;  2JS5 A;  3ZRX A;  1XNQ B;  4LNU B;  3ZJZ A;  3PN1 A;  3ZBH A;  1FJG B;  5K1X A;  4R50 A;  4UXN A;  4EB6 B;  4DR2 O;  3TGU H;  1Y67 A;  1HNX B;  2Y4U A;  4BIU A;  4DR5 B;  2AZ0 A;  4L87 A;  4PEL A;  4KP4 A;  5B1B B;  4I4T B;  4FIP C;  1TUE B;  3HKE B;  1B06 A;  2YEV A;  2H3O A;  2PI4 A;  2OIG A;  4JTD B;  2UUB O;  4TOI A;  2IH1 C;  3UKM A;  4LF5 O;  1SES A;  1YTF B;  4I9W A;  5JH7 B;  2CGN A;  2QTS A;  4UCV A;  4Z1V A;  3JD1 A;  4RAI A;  2GV9 A;  3OR7 C;  2Q4P A;  1TAE A;  4GKK O;  2PF4 E;  1SQG A;  5J2U A;  2UU9 B;  4I9Q A;  1NZ6 A;  3APQ A;  3RVZ A;  3CC7 V;  2OWO A;  1THZ A;  5CB4 A;  3FX7 A;  4R8C A;  1EM1 A;  1ZX3 A;  1K5Q A;  4DV0 B;  3EXA A;  3U0Z A;  3RT3 C;  5EK0 A;  3FKS G;  4JI7 B;  2NNU A;  4AHC A;  4JI0 B;  1KB9 F;  1F4M A;  1M4U A;  3QTC A;  1Q6U A;  1BHA A;  2ILM A;  2ZM6 O;  4X66 B;  1NR7 A;  2QE7 G;  1WAZ A;  3GWK C;  1SER A;  2ZIN A;  4FLZ A;  3JAT A;  1KUQ A;  4LCU C;  4DYL A;  2HHH O;  3K5M A;  1Q90 D;  5JCO A;  4O4I B;  3STZ C;  1NQT A;  2HR3 A;  3T2M A;  4L8J A;  4X62 O;  1HNZ O;  5GTH Z;  1XEQ A;  1JJO A;  1VF5 B;  2CTR A;  2FB5 A;  4F6E A;  4I0X A;  3OTO O;  2IW5 A;  1VQL V;  2X7R B;  5JWP A;  1AVM A;  2HFE C;  2C2A A;  5L3B A;  3CYO A;  4DV7 O;  2UXB O;  1OCO C;  2DWD C;  1FPO A;  2V7Q G;  2WLL A;  5EYP B;  3TXS A;  3AG4 B;  2Q7H A;  2E5L O;  1NVP B;  4J9Y B;  5AG2 A;  4Q6G A; 
#chains in the Genus database with same CATH homology
 1BQZ A;  2N05 A;  2QWO B;  1IUR A;  1N4C A;  2LGW A;  2CTQ A;  2CTR A;  2L6L A;  3AG7 A;  3APO A;  3UCS C;  1BQ0 A;  2Y4T A;  2GUZ A;  2CTP A;  2PF4 E;  2OCH A;  2CUG A;  2QWP B;  2QWQ B;  2DMX A;  1GH6 A;  2QSA A;  2N04 A;  2YS8 A;  3UO2 A;  3UO3 A;  4J80 A;  2KQX A;  1WJZ A;  1FAF A;  1FPO A;  1NZ6 A;  2GUZ B;  3APQ A;  2QWR B;  2CTW A;  2EJ7 A;  4IT5 A;  4RWU A;  2M6Y A;  1HDJ A;  3BVO A;  2YUA A;  2LO1 A;  2QWN B;  4J7Z A;  2Y4U A;  2DN9 A;  1XBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...