4RWUA

J-domain of sis1 protein, hsp40 co-chaperone from saccharomyces cerevisiae
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
81
structure length
81
Chain Sequence
MVKETKLYDLLGVSPSANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQKREIYDQYGLEAARSGGPSFGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Roles of intramolecular and intermolecular interactions in functional regulation of the Hsp70 J-protein co-chaperone Sis1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Chaperone
molecule keywords Protein SIS1
total genus 30
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2014-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 4rwuA00
2PF4E 2CTPA 3AG7A 2Y4UA 1XBLA 2QWNB 1HDJA 1BQZA 4J7ZA 2N05A 2GUZB 1WJZA 2QWRB 1BQ0A 2QWQB 1N4CA 2CUGA 1FPOA 2QWPB 2YS8A 1GH6A 3APOA 2QWOB 2DN9A 2EJ7A 2CTQA 2Y4TA 4J80A 3UO2A 2LO1A 1IURA 1NZ6A 2M6YA 4IT5A 2DMXA 3BVOA 4RWUA 2CTWA 3APQA 2N04A 3UO3A 2GUZA 2KQXA 2CTRA 3UCSC 2L6LA 1FAFA 2YUAA 2QSAA 2LGWA 2OCHA
chains in the Genus database with same CATH superfamily
2WWWA 1YJNV 3K5OA 3CPWU 5JCOC 1ZWIC 4H13B 2X6AA 3ZRVA 5D5PA 4TWKA 3D8CA 2Z0AA 1S77D 1SQFA 1H2SB 3S3XA 3JALB 2XNDG 2GUZA 1R3KC 2D2CB 4H44B 4DR3O 3OMAB 3RYHB 3L73H 3JAKB 4K35A 1Y66A 4MTXA 2Y48A 3TXQA 4TV8B 3JASB 4X64B 2MK3A 1OCOC 1YHQV 3H1IH 3C3SA 2EILC 1LUWA 2YUAA 4DUZO 4I9QA 2Q67A 5IJ0B 3JD0A 3LSSA 4BW5A 1K3EA 1IDSA 1MG1A 4FLZA 4OGQB 1QU7A 4DYLA 4GX2A 4WBNB 2NN4A 5FL7G 4DR6B 2JEUA 1KC8W 2Q8VA 2F95B 2EIKC 2ITCC 4DR1B 5KHHA 3OEHG 1BSMA 1AR4A 3OR7C 4X20A 1N36B 2DW4A 1Q43A 4GX5A 1LNQA 4FJCC 5C8YB 5LHGA 4IYHA 4GCZA 3ZRWA 3SYOA 3VQYA 4YHHB 3TXSA 3EFFK 4DR2B 3K0DA 2R70A 1L0LH 4ZBMA 4FLYA 4LBEC 4NB5A 3HKEB 2QWPB 2XOKG 3IFXA 4FLXA 4DO2A 4ZHQA 4JYAB 1DGSA 4B3TO 4PDLA 4ZI7B 2DE0X 1I94O 3FYEB 4LF7O 2XAJA 5IYDO 1X59A 1V55B 2Q73A 3ABKC 4UVBA 4JI6O 4YIOA 4CS3A 1PL0A 4H0LB 2Q6AA 4OX9B 2WSSG 2B1GA 4MTOA 4K8XA 2M6YA 2OIGA 2FB5A 1S5LZ 3ZEDA 2EULA 4UFZA 2LFRA 5EIBC 3EHBB 1H2LA 3CEIA 1Y67A 1P7BA 4DR7O 1QBZA 3CCUV 3AK1A 1RSOB 4J10A 3L72H 3JAWA 4QE9A 3JD1A 4C7UA 3CWBH 2ADPA 3G4SV 2G38A 2BSKA 4ZIBA 3KCXA 2JGDA 4FPPA 4OXSA 2ILMA 4NVPA 1GM8A 4JI4B 1VF5B 4KFMA 2UU9O 3CRCA 3CYOA 3FFQA 2Q0OC 1N0JA 1VQKV 4GKJB 4O4JB 5LXTA 4TV9B 3SGIA 4B3SO 4EEQA 2GDSA 3B8MA 2PTMA 2Z3YA 1GRJA 4JI0B 1SQPH 4DUYB 1GK9A 2ATKC 3G80A 1BMFG 1H2KA 2KG7A 4DV6O 2UUBO 3ABLC 2LGQA 1V9PA 2KB1A 2XASA 2VWJA 2WAMA 4PHZA 1KECA 3ETEA 4RWUA 4MVQA 4P9OA 2F43G 2RNBA 2WLJA 1PD3A 1SZXA 3DC6A 4FM1A 1M4UA 2R72A 3FB6C 2LQTA 1OZ0A 4IHJA 2WLHA 3G6BA 4WFFA 1H8HG 2Y0IA 3QNEA 4X1YA 2B1IA 1AVMA 2P6JA 4DV2O 4RQFA 2DYSC 3H1LH 1SRYA 2UXDO 4NXNB 2AZ0A 2H8PC 2PI4A 3APQA 2UXDB 3D3IA 5A9GA 4CH3A 5IWAO 1XOUA 1M57B 2LGWA 2W6IG 3BEHA 1TUBB 2W0XA 2VWKA 1A32A 4W4LA 3KCYA 5EIBD 4EKWA 4O4LB 4DV5B 5H6QA 4YJ2B 5BMVA 3IJ4A 3B8NA 2ZKOA 3E2EA 1JA8A 1UPGA 2YIBD 4U3JA 3ZMSA 3ABUA 3LSQA 4JI3B 4LF9O 1Y76B 5L3CA 4ZOLB 1Y6XA 4LR3A 1S72V 1EZVH 3OEEG 3K5MA 3JD4A 4LF7B 1VQNV 1BHBA 2QTOA 1AR1B 5GONB 3JYCA 1JJOA 1N32O 3HKDB 5B1OA 1K7DA 3UQ8A 4EB6B 1AR5A 5EYPA 1HNZB 4R7CA 4MW8A 1AI5A 1JCHA 2Y69C 4ICGA 1P49A 1EZJA 4WFGA 4X8AA 3T4DA 4O4LA 2E74B 3OTFA 3RWRD 4KHPO 2PI5A 2RN9A 1VQ9V 1SC5B 3HKEA 4D7TA 5J2UB 3BRCA 1HR0B 1FFXB 1J95A 2DWEC 3OD4A 2UUBB 1R73A 4W4KA 2YIBA 5H5NA 3N2KA 4Z1VA 1HR0O 3RYFA 2GTAA 4JF3A 1NTZH 2QWRB 2DQ0A 4HNAB 3B4SA 1MNGA 5LBQA 1TVKA 3ZMZA 4DXWA 2ODMA 2EINB 3HKBA 2YS8A 3E8BA 2Q7EA 1CP9A 3OGIB 4JI4O 4P30A 1L0NH 1FS0G 1VMGA 2Q9LA 4NR1A 4TT3G 1VQOV 4AILC 1XMQO 3JAWB 1KU9A 4BIOA 4RUEA 2YIDA 3ZHRA 4LF4B 4MTFA 3G6EV 2LP7A 3K9SA 2Q7HA 5IYZA 1JVMA 1JFFB 2YEVB 5L3EA 2OTJV 4J7JA 4K0KB 1R6NA 3T1HO 3CD6V 5TISZ 4GKKO 1FJGO 2QM7A 2XAFA 3H9VA 1U97A 3FAVB 5IY5C 3UCSC 3OGCC 2OCCC 3IC7A 2EIJB 2ZIOA 1R3JC 4R50A 1PKXA 3ZMVA 4GX1A 1NU1H 4PV1B 3AG3B 3M99B 3QG5A 2OIEA 1HNXB 3ETQA 2PGGA 4UCVA 5B1BB 1LR1A 3ZN0A 4JASA 1Q90D 1CXZB 3JD2A 5LYJA 3K3WA 4H37A 4N23A 3WFVA 3SDLA 1FXKC 1G8MA 4ASUG 4A5UB 3A8TA 5GTHZ 4QPKA 4LF4O 1NI8A 3E22B 2NR5A 2HKOA 2OT5A 2FL4A 4DUZB 1WAZA 4DK1A 5HFMA 3E8GA 2CH7B 4PDRA 2CAZC 2P22C 2QKSA 1HP8A 1YJ9V 1TUBA 3OE7G 2ZQMA 4N21A 2Q68A 1G1XB 2A0LA 2PF4E 1VQMV 1FFTB 4LNUB 2N05A 2JEXA 1GAXA 1E1QG 2XTAA 4I0XB 4J42A 5JJJB 4MSWC 4GKKB 4X66O 3WB2A 5IJ0A 1KD1W 3E8FA 5GONA 3J7AU 1IBLO 1BS3A 1ZUQA 4NXMO 1R3LC 1VQLV 4YHHO 4DV7O 3AG4B 3H1HH 3TJTA 5KHKA 1X4TA 1I5YA 1GM7A 5JQGB 4D7SA 1XUQA 5IJ9A 2UUCO 3OT7A 1FD9A 3JCUZ 1O9GA 3D36A 2DYRB 4EFBA 1Q5OA 3WB1A 4B7EA 1VF6A 4J7KA 5KHIA 3CCSV 1AI4A 1KUQA 3K03A 4UCRA 2JRIA 3UT5A 1K97A 3FYIB 3G67A 2B9ZA 1GN2A 2E3CA 2WA4A 4Q20A 5JJEB 5KX5A 1DLBA 3CC4V 2KKWA 4B3MO 2QEXV 4JZ2A 1OCRC 4X89A 4JI3O 4YXWG 1XL6A 1W2BU 1MOFA 1RPRA 1H2GA 2ZXWC 4UB6Z 1JX9A 4IYIA 5JCOA 1IBMO 4XDKA 5IDJA 1KBHA 1XNRB 3W7WA 3LSUA 5KA6A 3LNNA 1G4YB 2X6CA 4X65O 2F4VB 4CH6A 3K58A 4DV4O 1L1FA 3CC7V 3ZN1A 5CBGA 4DR5B 5JVDA 1AJNA 2QM4A 2H3OA 1N4CA 4YJ3A 1QVGU 1Z5VA 5EK0A 1KMIZ 3O65A 2WLIB 1UJWB 4P2ZA 2E5LB 2LO1A 3ZMTA 3N2GB 4GX0A 1M56C 3T1CA 4F6RB 1HNWO 4D6TH 3O9OA 1W0JG 3H1JH 2P67A 1QCEA 1SA0B 4I50B 1K33A 4BIUA 5IYCO 4K0KO 2BTOA 3U11A 2ZE6A 2EIMC 1XNRO 2ZNJA 2EJ7A 1K8AW 3DXRB 3AEIA 1R1BA 4O4HA 1TUEB 2KQXA 3LNMB 2OWOA 2WLLB 3D3QA 3F7YC 3SR2C 1KKDA 2OCHA 3JSLA 3AK3A 4DR4B 5BXZA 3T1YB 4BIZA 1N36O 4LFCO 1JQ0A 1ZLZA 4DR1O 2DWDC 1P84F 4J80A 5A2QN 2K9PA 1Z5WA 3L71H 2N74A 2DOSA 2YI9A 1MSWD 3Q4HA 3Q4HB 3ML0A 1AI7A 4O2BA 3ASOB 4X1YB 5KAIZ 1SZTA 2A7WA 3GB7C 3VOUA 4FFBB 4FIPC 4JI1O 3ASNB 4TV8A 3MAQA 3MHHC 3VQWA 2KSDA 2LJ2A 2YXHA 4F4LA 2Y0PA 1M57C 3QO5A 4LF9B 4I4TB 3ZS8C 3CB2A 1XREA 4JTCB 1COWG 3JARA 3JD3A 3ZHTA 3ZRWB 3X2QC 1NR1A 2F66C 4RAIA 1GN3A 4MVZA 2JK5C 1N32B 4PDMA 2GBOA 2AW9A 1EM1A 1OCZC 5DECA 1PL4A 1ZL8B 2DN9A 4ZKIA 3A0HZ 5B3SC 2IU0A 2K1EA 4X1KA 4JYAO 1Z2GA 3N2KB 1KP3A 4O4IB 2V7QG 4FZ0A 3GVMA 4X62B 4FVMA 4JI8B 5LMNB 3I56V 1F4NA 4MVSA 1V54C 4LCUC 1DF5A 5CMUA 3U10A 3CCVV 1N34O 4O2BB 3QF7A 1AI6A 1FJGB 2WPDG 4DV4B 1NVPD 2YXYA 3CC2V 2GUZB 1WJZA 4I5SA 3AG1C 2NNUA 1O9HA 1P7GA 3SYPA 4QGPA 3HKDA 4AI8A 2A9HA 3APOA 5DEDA 4P9PA 3RYCB 1URFA 4HYOA 4KUMA 3C90A 5K1XA 1DTOA 2HVJC 1OCOB 1RM1B 4MVMA 2Q0AA 3GWKC 4FLTA 1IXBA 1BHAA 2UUAO 2DQ3A 2BTQA 3J80N 2UU9B 3RVZA 2QGNA 3ZHUA 4GT1A 4FZ1A 2PUSA 5LYJB 1FPOA 5BMVB 1ZL8A 4ZHQB 2BOCC 2VQFB 5J2TB 2ZE8A 3QVNA 3RN4A 2IH1C 3THOA 3W7UA 4TUYB 4B3SB 2GHYA 3W7XA 2Z5UA 2UXXA 3ABMB 1NT2B 4PDVA 4UCTA 2FKXA 4I55B 4DK0A 3OW2U 1H8EG 2X6BA 4R8CA 3HB3B 3HPLC 1FXHA 4JZGA 5E1AC 2VS0A 4J9YB 1W0KG 1Y74A 4DV6B 2CTPA 4LFAB 5L3BA 1IBLB 3QO8A 4LP8A 4LF8O 3ZJZA 3CCMV 1KB9F 5JJNB 4BAYA 3K08A 4JI2O 2CGNA 4B3TB 3BFRA 2F23A 3K57A 4IIJA 4E2LA 1QHTA 4G28B 4NTYA 4RO2A 2HHHB 4GLXA 5B1AB 2JS5A 1XHZA 4BR6A 5KX5B 1QLEB 2CGOA 1PM9A 2PZSA 2O57A 1BQ0A 2UXNA 3CXHF 3K5LA 3RFRA 4O4JA 5LXTB 2Y69B 4WF9V 3E89A 1AP5A 4X1IB 3ICXA 4X62O 2CTQA 1H2MA 5LOVB 4B3RO 4MVUA 1ZAUA 3JATB 1KKCA 4B7KA 1Y4MA 1YVWA 3H01A 3RYIA 2X7RB 3K79A 2EILB 1GN4A 1M1KW 3K9AA 1TGOA 5EZYA 1WN7A 3RYFB 1D5AA 3SPHA 3FB5C 1N34B 1NVPB 5B66Z 4DV3B 2EBOA 1NZ6A 1QNMA 5KHJA 1RM1C 2JJ1G 4OPAA 4FLVA 1WLEA 2ZM6O 5KAFZ 2YIAA 1NKDA 4QE7A 1VF6C 5CBHA 3L74H 3HKCA 1YITV 3M7MX 3OTOB 5CA0A 2HR3A 4NXNO 3D36C 1K9MW 1VIBA 1MSDA 5KLVH 1FKAO 4I7ZB 5B5EZ 3KZIZ 1WA8B 4DV1O 2YXLA 4JV5B 3JALA 5C93A 4JPRA 1K5QA 2PYLA 5L3DA 2FMLA 4MW3A 1P4RA 2A06H 3BPZA 2HLDG 4CH5A 4YY3B 4HNAA 4UXNA 5FLXN 1AJPA 5EBWC 5LHHA 1YEWA 4X64O 5HFLA 5LGUA 2ZIMA 4G2KA 3B40A 2BTQB 5H2FZ 4TV9A 1F51A 4X1KB 1F4MA 2ZXWB 3E86A 4DV7B 3OUFA 1VQ5V 2UXBO 2RCVA 1N8RW 4UV9A 3E83A 3AG7A 1ROPA 4I50A 3LDEA 4JV5O 3ASNC 1H2NA 5GW7A 4J9ZB 3LUTB 3CCRV 2AHYA 5JH7B 1IURA 4F6RA 2L35A 1PV0A 1Q3EA 1ZSPA 5B1AC 4HAMA 3X2QB 3ZBHA 1YDXA 4WCEV 4WFHA 2JGUA 2P4KA 1I7FA 4CH4A 3K59A 1ENVA 4TQFA 3WG7C 2UXCO 1FXKA 3SYQA 2BE3A 3CRMA 3WB0A 2H94A 2V1DA 1XNQO 1Q82W 1PPJH 4JI2B 2XUMA 3P32A 4CC5A 3N27A 3P3PA 3RYIB 1FXVA 1N0NA 2KG7B 2AGAA 1VEWA 2RQ6A 4WFBV 3OMIB 3HKBB 3STLC 1Q7YW 2HP8A 3CCJV 1GH6A 2ZD9A 3B2EE 4JI8O 1I0HA 3L70H 3W7SA 1XMOO 5JQGA 3PJSK 2PY5A 2LW7A 2ITDC 1IX9A 1E79G 3T4ZA 2HG5C 3SYCA 4RQEA 4DR6O 4JI1B 4FK5C 2QJ1A 1VQ6V 5CA1B 1IBKO 4MTGA 3CRQA 2QDOA 1GN6A 1PP9H 1YI2V 1YTFD 1K5SA 3AG4C 1U96A 1T5EA 4WFEA 4GYCB 1PNLA 1Q6IA 3BA8A 3EVKA 4L8JA 1Q8IA 5H9CA 3DTUB 4LWSB 3H1KH 2ZCEA 3NR7A 4IT5A 3UM7A 3SPJA 2IJJA 3FB7C 3CE2A 1CPYA 3I55V 5LP6C 2ZINA 2VQFO 1SQGA 5JWPA 3RYHA 3K06A 1D2DA 1B06A 3ABMC 1MZEA 3ZCCA 3M8AA 4CBCA 2EIJC 4XDLA 4PD4F 2HVKC 4R6ZA 3CP1A 1XMOB 5L3GA 4JAUA 1OJHA 4PI2A 3B77A 2QR4A 2ZE7A 5CB4A 2ADQB 4PA4A 5FNVB 5IYBO 1IBKB 2JIZG 5KHGA 4LF5O 4X66B 2QKCA 2F93B 2QKAA 1AB3A 2QTSA 3C3TA 1YSCA 4NKGB 1WA8A 2DJVA 2EIMB 4LF5B 4ABMA 2XAHA 4YIPA 1EFRG 1AJQA 4NTXA 2Q69A 2QSAA 1R6TA 2VRZA 4O2AA 4TOIA 1Q6UA 2QWQB 4JAAA 2Q4PA 2IBZH 3UKMA 1HNZO 3CS5A 1IXMA 5KMGB 2HEPA 1XDCA 2JVDA 4JTAB 1US6A 1BCCH 4Z2WA 2XHBA 4Q6GA 5E79Z 1BQZA 4Z1MG 2A79B 4DV2B 1VF7A 3OUSA 4X65B 1QR9A 1I08A 1JPXA 3CXCU 3AG2B 3SJBC 2YC0A 3RBZA 3SJCC 3CSXA 2JS3A 4DV5O 4K3AA 2BSKB 5FPRA 5IY5B 1GMGA 1GO3F 2CH7A 5KMGA 1WNSA 2OCCB 1S5JA 3F7VC 4UB8Z 1YF2A 2JDIG 1NH2B 4E4EA 3U0ZA 4JI7O 1FFXA 1VQPV 3ZHVA 2AHZA 1FXKB 3UO3A 1CEZA 4JI0O 5BR8O 3ZRXA 1FAFA 3I5DA 4DUYO 2V4DA 4MS2A 3VQVA 3IGAC 2IJHA 3RW0A 5BZBA 5CN0A 2LFSA 4J7ZA 5BY1A 3B09A 2AXTZ 3JAKA 3NXSA 2WLIA 1NJIW 3VBBA 5FPOA 3ZRSA 4GKJO 2QA4V 1XI1A 4IL6Z 4LNUA 1K73W 1SQXH 3BCCH 2XAGA 2IU3A 5CB4B 1S76D 3BVOA 4LH6A 1VQ8V 2OTLV 4LWSA 2P90A 1F7YA 1SETA 5LHIA 3TGUH 2CE4A 2QWNB 1IZ3A 2VQEB 3STZC 3OMNB 3JAMN 3N2GA 1XL4A 3DGEA 5LA6A 3CRAA 1N33B 1ZTEA 4UCSA 1E1RG 5K1PA 4YJ3B 3WG7B 1BE3H 1SQVH 2R9AA 1NR7A 2WLKA 3QO7A 1MA1A 1S3JA 4X1IA 5EC2C 2XT9A 4CS4A 4IHJB 3HR0A 2IJIA 4XDJA 4MT8A 2YI8A 2DYSB 5LMUB 4FLUA 1BGYH 2EIKB 1IBMB 1ZX3A 4FFBA 4I9WA 4B3RB 1JJ2U 3ZIAG 3ABTA 2R9IA 3BY6A 1NTMH 1NH2D 2UXCB 1VQ4V 4O2AB 2PYJA 3FX7A 4HBNA 4QPJA 3ETDA 2E76B 3SJQC 2D3OW 3RT3C 3ZMUA 3CX5F 1YJWV 5LL6Y 4DW1A 2EZPA 4AHCA 4L87A 2IH3C 4FMTA 5LGTA 4O4IA 3WU2Z 1J5EO 2W0FC 1NBMG 2WLNA 4TSFG 4FM2A 2JJ2G 1FYJA 4K8ZA 1B3QA 3OFNG 3UT5B 4CS2A 3DXRA 3P30A 1J5EB 5ITZA 1NQTA 1PNMA 4DR2O 1JMKC 4I4TA 2WA3A 1YZBA 1R6KA 2OYQA 3ETGA 4X20B 2JGDB 1JOYA 3BAAA 3CMEV 2ZM6B 2Y4TA 2LW1A 3UO2A 2EJRA 1BL8A 5KUMA 4PA7A 5B1BC 1PNKA 4DW0A 4UCOA 3SPCA 5F2VO 4NXMB 1QLNA 3ZX6A 3KG2A 5EYPB 2M7WA 1EN5A 3DC5A 5LMUO 3SPIA 3FAVA 4KP4A 1M93A 2C2AA 2W6JG 1SF9A 3RGBA 3OTOO 3DSQA 1GTOA 4KHPB 1QR8A 2E75B 1MABG 2IW5A 2DMXA 3JSNA 2ZDIC 2ZNIA 1D5NA 4X88A 4DR4O 4TQDA 2YSUB 2EINC 1EBOA 5KA5A 3K5NA 3TCUA 1VQ7V 5DM6V 4U7OA 4KXRA 1BZKA 4YJ2A 5B1NA 1JFFA 2YEVA 4JI5O 4JI6B 1MZFA 4JYBA 3A2FA 3MHSC 5H6RA 3ZHQA 4DR7B 1QQCA 1K34A 3JATA 2CTWA 2ZT9B 3E22A 2NLJC 1Q6HA 1XHXA 4WBNA 1NTKH 1OV9A 1EN6A 1GKFA 3CCQV 4XBFA 2R9RB 4UVCA 4FLWA 4DRXB 4MVRA 1WP8A 1KP2A 2HHHO 1DK1A 2FTKA 4AQYB 4IGGA 1RPOA 1XILA 5IYZB 2IJKA 5IJ9B 3SPGA 1QVFU 5IWAB 3A0BZ 3SJAC 3TK1A 3FB8C 1B6QA 1WB8A 4PJ0Z 5IE9A 2VQEO 3AG2C 1SESA 1EN4A 3ABKB 5D5QA 5B3SB 1Y74B 3L9DA 1DF4A 1HNXO 4EFEA 4H33A 1XMQB 5DN6G 3MD0A 3KKYA 3CCEV 3OM3B 3IC9A 4GUNA 4PELA 4JGSA 2GSMB 1OCCB 1F23A 2ARHA 3W7TA 4OPHA 4I55A 1YTFB 1BT8A 5LOVA 1K92A 4LFCB 1Y76A 5EZYB 2UUAB 3T1YO 1UFIA 5CA3A 4HZ3A 5AG2A 2MW2B 2Q7GA 2IM9A 3OAAG 1S0VA 1V54B 2X0LA 3T1HB 4ZI7A 3K04A 2GV9A 1VP7A 1ORQC 3CRRA 2B5UA 2ZE5A 4NYKA 3PN1A 4LFAO 1G6UA 3AG1B 5BR8B 2UXBB 3RVYA 5LA6B 2Y4UA 1XBLA 2RMKB 4TUYA 5CBFA 1XEQA 4UVAA 3SYAA 4U3FH 4JI7B 1AILA 1SKVA 5L3FA 1SS3A 2HJFC 2EZOA 2UUCB 2CDYA 1YXBA 3TETA 4IIJB 3AK2A 1M56B 2E5LO 4MVOA 4YY3O 5GTIZ 4QNHB 1M9NA 3VQXA 1XQ8A 4DR5O 1M5IA 2WLMA 4NTWA 2CUGA 4I0XA 4QIWF 1SQQH 3T2MA 2AZ2A 2F4VO 1W59A 4LF6B 2HJDA 3E35A 4O4HB 2RJZA 4DV0B 1GM9A 3FD9A 5LMNO 3F5WC 1B04A 1OCRB 5ITZB 5EC1C 4LH7A 3CCLV 4DV0O 2QM8A 5J9PC 3LDDA 4J11A 4JYCA 1AP6A 3ASOC 2Q5ZA 4KL1A 2EX3A 3S3WA 1WPXA 4LFBB 3A0RA 4LF6O 3GWOA 3JCZA 1WPBA 2HFEC 4LFBO 1LUVA 3CJHB 3ZHSA 3BABA 3BHPA 4JI5B 1RSOA 3MDSA 1OHHG 2P5OA 3JARB 1OCCC 1KQSU 5KUKA 4X9QA 1QLEC 2F1MA 3AG3C 1N33O 2P06A 4QJFB 4FFKA 4FM0A 3IAYA 1THZA 5LP6B 2XAQA 1SQBH 2ZR3A 2P4VA 5EBMC 2N04A 4CC6A 4DV1B 4GZRB 4JYYA 2CTRA 3E8HA 3CJHA 1RP3B 2YDEA 5JH7A 4EB6A 5CA1A 5EBLC 3J81N 4BWAA 3K0GA 1R3IC 1TVKB 1VARA 3ABLB 5IT9N 3R66A 3CMAV 2A3QA 4U7NA 3LDCA 3CHXA 1AROP 3QTCA 4DR3B 1TAEA 1WP7A 4U3JB 2BOBC 4PA6A 2P7TC 2DYRC 4LC1A 5J2UA 4OX9O 1YCIA 4PI0A 1WB7A 1HWYA 4PA3A 4G27B 4RUFA 1YIJV 3G71V 1NS1A 4J41A 1I94B 4JTDB 1Q81W 1JR9A 1Q86W 1XNQB 1K4CC 3P3NA 1KYOF 1MMMA 4AQYO 4BW9A 5LGNA 1HNWB 2QE7G 3HKCB 1HW7A 1IVSA 1TA8A 3OR6C 1SERA 5CA0B 3RYCA 4B08A 2RDCA 1SA0A 4DV3O 2QWOB 2GTSA 1M90W 4B3MB 4F6EA 3F5TA 4ZOLA 4PA9A 5LP6A 3EXAA 5JVDB 2ZDIA 1V55C 3L75H 1OCZB 4LF8B 1HDJA 4UV8A 5J2TA 5C8YA 2YICA 3JASA 2ZR2A 4JAVA 3FKSG 2BCCH 1S5HC 2WLLA 1K4DC 4UCUA 4DRXA 3R65A 2FYUH 1RFYA 1L8DA 5FNVA 3BA9A 4WFAV 2CK3G 2L6LA 1I5XA 1H38A 4CZZA 2ETNA 4UUJC
chains in the Genus database with same CATH topology
2PF4E 2CTPA 3AG7A 2Y4UA 1XBLA 2QWNB 1HDJA 1BQZA 4J7ZA 2N05A 2GUZB 1WJZA 2QWRB 1BQ0A 2QWQB 1N4CA 2CUGA 1FPOA 2QWPB 2YS8A 1GH6A 3APOA 2QWOB 2DN9A 2EJ7A 2CTQA 2Y4TA 4J80A 3UO2A 2LO1A 1IURA 1NZ6A 2M6YA 4IT5A 2DMXA 3BVOA 4RWUA 2CTWA 3APQA 2N04A 3UO3A 2GUZA 2KQXA 2CTRA 3UCSC 2L6LA 1FAFA 2YUAA 2QSAA 2LGWA 2OCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PF4 E;  2CTP A;  3AG7 A;  2Y4U A;  1XBL A;  2QWN B;  1HDJ A;  1BQZ A;  4J7Z A;  2N05 A;  2GUZ B;  1WJZ A;  2QWR B;  1BQ0 A;  2QWQ B;  1N4C A;  2CUG A;  1FPO A;  2QWP B;  2YS8 A;  1GH6 A;  3APO A;  2QWO B;  2DN9 A;  2EJ7 A;  2CTQ A;  2Y4T A;  4J80 A;  3UO2 A;  2LO1 A;  1IUR A;  1NZ6 A;  2M6Y A;  4IT5 A;  2DMX A;  3BVO A;  4RWU A;  2CTW A;  3APQ A;  2N04 A;  3UO3 A;  2GUZ A;  2KQX A;  2CTR A;  3UCS C;  2L6L A;  1FAF A;  2YUA A;  2QSA A;  2LGW A;  2OCH A; 
#chains in the Genus database with same CATH topology
 2WWW A;  1YJN V;  3K5O A;  3CPW U;  5JCO C;  1ZWI C;  4H13 B;  2X6A A;  3ZRV A;  5D5P A;  4TWK A;  3D8C A;  2Z0A A;  1S77 D;  1SQF A;  1H2S B;  3S3X A;  3JAL B;  2XND G;  2GUZ A;  1R3K C;  2D2C B;  4H44 B;  4DR3 O;  3OMA B;  3RYH B;  3L73 H;  3JAK B;  4K35 A;  1Y66 A;  4MTX A;  2Y48 A;  3TXQ A;  4TV8 B;  3JAS B;  4X64 B;  2MK3 A;  1OCO C;  1YHQ V;  3H1I H;  3C3S A;  2EIL C;  1LUW A;  2YUA A;  4DUZ O;  4I9Q A;  2Q67 A;  5IJ0 B;  3JD0 A;  3LSS A;  4BW5 A;  1K3E A;  1IDS A;  1MG1 A;  4FLZ A;  4OGQ B;  1QU7 A;  4DYL A;  4GX2 A;  4WBN B;  2NN4 A;  5FL7 G;  4DR6 B;  2JEU A;  1KC8 W;  2Q8V A;  2F95 B;  2EIK C;  2ITC C;  4DR1 B;  5KHH A;  3OEH G;  1BSM A;  1AR4 A;  3OR7 C;  4X20 A;  1N36 B;  2DW4 A;  1Q43 A;  4GX5 A;  1LNQ A;  4FJC C;  5C8Y B;  5LHG A;  4IYH A;  4GCZ A;  3ZRW A;  3SYO A;  3VQY A;  4YHH B;  3TXS A;  3EFF K;  4DR2 B;  3K0D A;  2R70 A;  1L0L H;  4ZBM A;  4FLY A;  4LBE C;  4NB5 A;  3HKE B;  2QWP B;  2XOK G;  3IFX A;  4FLX A;  4DO2 A;  4ZHQ A;  4JYA B;  1DGS A;  4B3T O;  4PDL A;  4ZI7 B;  2DE0 X;  1I94 O;  3FYE B;  4LF7 O;  2XAJ A;  5IYD O;  1X59 A;  1V55 B;  2Q73 A;  3ABK C;  4UVB A;  4JI6 O;  4YIO A;  4CS3 A;  1PL0 A;  4H0L B;  2Q6A A;  4OX9 B;  2WSS G;  2B1G A;  4MTO A;  4K8X A;  2M6Y A;  2OIG A;  2FB5 A;  1S5L Z;  3ZED A;  2EUL A;  4UFZ A;  2LFR A;  5EIB C;  3EHB B;  1H2L A;  3CEI A;  1Y67 A;  1P7B A;  4DR7 O;  1QBZ A;  3CCU V;  3AK1 A;  1RSO B;  4J10 A;  3L72 H;  3JAW A;  4QE9 A;  3JD1 A;  4C7U A;  3CWB H;  2ADP A;  3G4S V;  2G38 A;  2BSK A;  4ZIB A;  3KCX A;  2JGD A;  4FPP A;  4OXS A;  2ILM A;  4NVP A;  1GM8 A;  4JI4 B;  1VF5 B;  4KFM A;  2UU9 O;  3CRC A;  3CYO A;  3FFQ A;  2Q0O C;  1N0J A;  1VQK V;  4GKJ B;  4O4J B;  5LXT A;  4TV9 B;  3SGI A;  4B3S O;  4EEQ A;  2GDS A;  3B8M A;  2PTM A;  2Z3Y A;  1GRJ A;  4JI0 B;  1SQP H;  4DUY B;  1GK9 A;  2ATK C;  3G80 A;  1BMF G;  1H2K A;  2KG7 A;  4DV6 O;  2UUB O;  3ABL C;  2LGQ A;  1V9P A;  2KB1 A;  2XAS A;  2VWJ A;  2WAM A;  4PHZ A;  1KEC A;  3ETE A;  4RWU A;  4MVQ A;  4P9O A;  2F43 G;  2RNB A;  2WLJ A;  1PD3 A;  1SZX A;  3DC6 A;  4FM1 A;  1M4U A;  2R72 A;  3FB6 C;  2LQT A;  1OZ0 A;  4IHJ A;  2WLH A;  3G6B A;  4WFF A;  1H8H G;  2Y0I A;  3QNE A;  4X1Y A;  2B1I A;  1AVM A;  2P6J A;  4DV2 O;  4RQF A;  2DYS C;  3H1L H;  1SRY A;  2UXD O;  4NXN B;  2AZ0 A;  2H8P C;  2PI4 A;  3APQ A;  2UXD B;  3D3I A;  5A9G A;  4CH3 A;  5IWA O;  1XOU A;  1M57 B;  2LGW A;  2W6I G;  3BEH A;  1TUB B;  2W0X A;  2VWK A;  1A32 A;  4W4L A;  3KCY A;  5EIB D;  4EKW A;  4O4L B;  4DV5 B;  5H6Q A;  4YJ2 B;  5BMV A;  3IJ4 A;  3B8N A;  2ZKO A;  3E2E A;  1JA8 A;  1UPG A;  2YIB D;  4U3J A;  3ZMS A;  3ABU A;  3LSQ A;  4JI3 B;  4LF9 O;  1Y76 B;  5L3C A;  4ZOL B;  1Y6X A;  4LR3 A;  1S72 V;  1EZV H;  3OEE G;  3K5M A;  3JD4 A;  4LF7 B;  1VQN V;  1BHB A;  2QTO A;  1AR1 B;  5GON B;  3JYC A;  1JJO A;  1N32 O;  3HKD B;  5B1O A;  1K7D A;  3UQ8 A;  4EB6 B;  1AR5 A;  5EYP A;  1HNZ B;  4R7C A;  4MW8 A;  1AI5 A;  1JCH A;  2Y69 C;  4ICG A;  1P49 A;  1EZJ A;  4WFG A;  4X8A A;  3T4D A;  4O4L A;  2E74 B;  3OTF A;  3RWR D;  4KHP O;  2PI5 A;  2RN9 A;  1VQ9 V;  1SC5 B;  3HKE A;  4D7T A;  5J2U B;  3BRC A;  1HR0 B;  1FFX B;  1J95 A;  2DWE C;  3OD4 A;  2UUB B;  1R73 A;  4W4K A;  2YIB A;  5H5N A;  3N2K A;  4Z1V A;  1HR0 O;  3RYF A;  2GTA A;  4JF3 A;  1NTZ H;  2QWR B;  2DQ0 A;  4HNA B;  3B4S A;  1MNG A;  5LBQ A;  1TVK A;  3ZMZ A;  4DXW A;  2ODM A;  2EIN B;  3HKB A;  2YS8 A;  3E8B A;  2Q7E A;  1CP9 A;  3OGI B;  4JI4 O;  4P30 A;  1L0N H;  1FS0 G;  1VMG A;  2Q9L A;  4NR1 A;  4TT3 G;  1VQO V;  4AIL C;  1XMQ O;  3JAW B;  1KU9 A;  4BIO A;  4RUE A;  2YID A;  3ZHR A;  4LF4 B;  4MTF A;  3G6E V;  2LP7 A;  3K9S A;  2Q7H A;  5IYZ A;  1JVM A;  1JFF B;  2YEV B;  5L3E A;  2OTJ V;  4J7J A;  4K0K B;  1R6N A;  3T1H O;  3CD6 V;  5TIS Z;  4GKK O;  1FJG O;  2QM7 A;  2XAF A;  3H9V A;  1U97 A;  3FAV B;  5IY5 C;  3UCS C;  3OGC C;  2OCC C;  3IC7 A;  2EIJ B;  2ZIO A;  1R3J C;  4R50 A;  1PKX A;  3ZMV A;  4GX1 A;  1NU1 H;  4PV1 B;  3AG3 B;  3M99 B;  3QG5 A;  2OIE A;  1HNX B;  3ETQ A;  2PGG A;  4UCV A;  5B1B B;  1LR1 A;  3ZN0 A;  4JAS A;  1Q90 D;  1CXZ B;  3JD2 A;  5LYJ A;  3K3W A;  4H37 A;  4N23 A;  3WFV A;  3SDL A;  1FXK C;  1G8M A;  4ASU G;  4A5U B;  3A8T A;  5GTH Z;  4QPK A;  4LF4 O;  1NI8 A;  3E22 B;  2NR5 A;  2HKO A;  2OT5 A;  2FL4 A;  4DUZ B;  1WAZ A;  4DK1 A;  5HFM A;  3E8G A;  2CH7 B;  4PDR A;  2CAZ C;  2P22 C;  2QKS A;  1HP8 A;  1YJ9 V;  1TUB A;  3OE7 G;  2ZQM A;  4N21 A;  2Q68 A;  1G1X B;  2A0L A;  2PF4 E;  1VQM V;  1FFT B;  4LNU B;  2N05 A;  2JEX A;  1GAX A;  1E1Q G;  2XTA A;  4I0X B;  4J42 A;  5JJJ B;  4MSW C;  4GKK B;  4X66 O;  3WB2 A;  5IJ0 A;  1KD1 W;  3E8F A;  5GON A;  3J7A U;  1IBL O;  1BS3 A;  1ZUQ A;  4NXM O;  1R3L C;  1VQL V;  4YHH O;  4DV7 O;  3AG4 B;  3H1H H;  3TJT A;  5KHK A;  1X4T A;  1I5Y A;  1GM7 A;  5JQG B;  4D7S A;  1XUQ A;  5IJ9 A;  2UUC O;  3OT7 A;  1FD9 A;  3JCU Z;  1O9G A;  3D36 A;  2DYR B;  4EFB A;  1Q5O A;  3WB1 A;  4B7E A;  1VF6 A;  4J7K A;  5KHI A;  3CCS V;  1AI4 A;  1KUQ A;  3K03 A;  4UCR A;  2JRI A;  3UT5 A;  1K97 A;  3FYI B;  3G67 A;  2B9Z A;  1GN2 A;  2E3C A;  2WA4 A;  4Q20 A;  5JJE B;  5KX5 A;  1DLB A;  3CC4 V;  2KKW A;  4B3M O;  2QEX V;  4JZ2 A;  1OCR C;  4X89 A;  4JI3 O;  4YXW G;  1XL6 A;  1W2B U;  1MOF A;  1RPR A;  1H2G A;  2ZXW C;  4UB6 Z;  1JX9 A;  4IYI A;  5JCO A;  1IBM O;  4XDK A;  5IDJ A;  1KBH A;  1XNR B;  3W7W A;  3LSU A;  5KA6 A;  3LNN A;  1G4Y B;  2X6C A;  4X65 O;  2F4V B;  4CH6 A;  3K58 A;  4DV4 O;  1L1F A;  3CC7 V;  3ZN1 A;  5CBG A;  4DR5 B;  5JVD A;  1AJN A;  2QM4 A;  2H3O A;  1N4C A;  4YJ3 A;  1QVG U;  1Z5V A;  5EK0 A;  1KMI Z;  3O65 A;  2WLI B;  1UJW B;  4P2Z A;  2E5L B;  2LO1 A;  3ZMT A;  3N2G B;  4GX0 A;  1M56 C;  3T1C A;  4F6R B;  1HNW O;  4D6T H;  3O9O A;  1W0J G;  3H1J H;  2P67 A;  1QCE A;  1SA0 B;  4I50 B;  1K33 A;  4BIU A;  5IYC O;  4K0K O;  2BTO A;  3U11 A;  2ZE6 A;  2EIM C;  1XNR O;  2ZNJ A;  2EJ7 A;  1K8A W;  3DXR B;  3AEI A;  1R1B A;  4O4H A;  1TUE B;  2KQX A;  3LNM B;  2OWO A;  2WLL B;  3D3Q A;  3F7Y C;  3SR2 C;  1KKD A;  2OCH A;  3JSL A;  3AK3 A;  4DR4 B;  5BXZ A;  3T1Y B;  4BIZ A;  1N36 O;  4LFC O;  1JQ0 A;  1ZLZ A;  4DR1 O;  2DWD C;  1P84 F;  4J80 A;  5A2Q N;  2K9P A;  1Z5W A;  3L71 H;  2N74 A;  2DOS A;  2YI9 A;  1MSW D;  3Q4H A;  3Q4H B;  3ML0 A;  1AI7 A;  4O2B A;  3ASO B;  4X1Y B;  5KAI Z;  1SZT A;  2A7W A;  3GB7 C;  3VOU A;  4FFB B;  4FIP C;  4JI1 O;  3ASN B;  4TV8 A;  3MAQ A;  3MHH C;  3VQW A;  2KSD A;  2LJ2 A;  2YXH A;  4F4L A;  2Y0P A;  1M57 C;  3QO5 A;  4LF9 B;  4I4T B;  3ZS8 C;  3CB2 A;  1XRE A;  4JTC B;  1COW G;  3JAR A;  3JD3 A;  3ZHT A;  3ZRW B;  3X2Q C;  1NR1 A;  2F66 C;  4RAI A;  1GN3 A;  4MVZ A;  2JK5 C;  1N32 B;  4PDM A;  2GBO A;  2AW9 A;  1EM1 A;  1OCZ C;  5DEC A;  1PL4 A;  1ZL8 B;  2DN9 A;  4ZKI A;  3A0H Z;  5B3S C;  2IU0 A;  2K1E A;  4X1K A;  4JYA O;  1Z2G A;  3N2K B;  1KP3 A;  4O4I B;  2V7Q G;  4FZ0 A;  3GVM A;  4X62 B;  4FVM A;  4JI8 B;  5LMN B;  3I56 V;  1F4N A;  4MVS A;  1V54 C;  4LCU C;  1DF5 A;  5CMU A;  3U10 A;  3CCV V;  1N34 O;  4O2B B;  3QF7 A;  1AI6 A;  1FJG B;  2WPD G;  4DV4 B;  1NVP D;  2YXY A;  3CC2 V;  2GUZ B;  1WJZ A;  4I5S A;  3AG1 C;  2NNU A;  1O9H A;  1P7G A;  3SYP A;  4QGP A;  3HKD A;  4AI8 A;  2A9H A;  3APO A;  5DED A;  4P9P A;  3RYC B;  1URF A;  4HYO A;  4KUM A;  3C90 A;  5K1X A;  1DTO A;  2HVJ C;  1OCO B;  1RM1 B;  4MVM A;  2Q0A A;  3GWK C;  4FLT A;  1IXB A;  1BHA A;  2UUA O;  2DQ3 A;  2BTQ A;  3J80 N;  2UU9 B;  3RVZ A;  2QGN A;  3ZHU A;  4GT1 A;  4FZ1 A;  2PUS A;  5LYJ B;  1FPO A;  5BMV B;  1ZL8 A;  4ZHQ B;  2BOC C;  2VQF B;  5J2T B;  2ZE8 A;  3QVN A;  3RN4 A;  2IH1 C;  3THO A;  3W7U A;  4TUY B;  4B3S B;  2GHY A;  3W7X A;  2Z5U A;  2UXX A;  3ABM B;  1NT2 B;  4PDV A;  4UCT A;  2FKX A;  4I55 B;  4DK0 A;  3OW2 U;  1H8E G;  2X6B A;  4R8C A;  3HB3 B;  3HPL C;  1FXH A;  4JZG A;  5E1A C;  2VS0 A;  4J9Y B;  1W0K G;  1Y74 A;  4DV6 B;  2CTP A;  4LFA B;  5L3B A;  1IBL B;  3QO8 A;  4LP8 A;  4LF8 O;  3ZJZ A;  3CCM V;  1KB9 F;  5JJN B;  4BAY A;  3K08 A;  4JI2 O;  2CGN A;  4B3T B;  3BFR A;  2F23 A;  3K57 A;  4IIJ A;  4E2L A;  1QHT A;  4G28 B;  4NTY A;  4RO2 A;  2HHH B;  4GLX A;  5B1A B;  2JS5 A;  1XHZ A;  4BR6 A;  5KX5 B;  1QLE B;  2CGO A;  1PM9 A;  2PZS A;  2O57 A;  1BQ0 A;  2UXN A;  3CXH F;  3K5L A;  3RFR A;  4O4J A;  5LXT B;  2Y69 B;  4WF9 V;  3E89 A;  1AP5 A;  4X1I B;  3ICX A;  4X62 O;  2CTQ A;  1H2M A;  5LOV B;  4B3R O;  4MVU A;  1ZAU A;  3JAT B;  1KKC A;  4B7K A;  1Y4M A;  1YVW A;  3H01 A;  3RYI A;  2X7R B;  3K79 A;  2EIL B;  1GN4 A;  1M1K W;  3K9A A;  1TGO A;  5EZY A;  1WN7 A;  3RYF B;  1D5A A;  3SPH A;  3FB5 C;  1N34 B;  1NVP B;  5B66 Z;  4DV3 B;  2EBO A;  1NZ6 A;  1QNM A;  5KHJ A;  1RM1 C;  2JJ1 G;  4OPA A;  4FLV A;  1WLE A;  2ZM6 O;  5KAF Z;  2YIA A;  1NKD A;  4QE7 A;  1VF6 C;  5CBH A;  3L74 H;  3HKC A;  1YIT V;  3M7M X;  3OTO B;  5CA0 A;  2HR3 A;  4NXN O;  3D36 C;  1K9M W;  1VIB A;  1MSD A;  5KLV H;  1FKA O;  4I7Z B;  5B5E Z;  3KZI Z;  1WA8 B;  4DV1 O;  2YXL A;  4JV5 B;  3JAL A;  5C93 A;  4JPR A;  1K5Q A;  2PYL A;  5L3D A;  2FML A;  4MW3 A;  1P4R A;  2A06 H;  3BPZ A;  2HLD G;  4CH5 A;  4YY3 B;  4HNA A;  4UXN A;  5FLX N;  1AJP A;  5EBW C;  5LHH A;  1YEW A;  4X64 O;  5HFL A;  5LGU A;  2ZIM A;  4G2K A;  3B40 A;  2BTQ B;  5H2F Z;  4TV9 A;  1F51 A;  4X1K B;  1F4M A;  2ZXW B;  3E86 A;  4DV7 B;  3OUF A;  1VQ5 V;  2UXB O;  2RCV A;  1N8R W;  4UV9 A;  3E83 A;  3AG7 A;  1ROP A;  4I50 A;  3LDE A;  4JV5 O;  3ASN C;  1H2N A;  5GW7 A;  4J9Z B;  3LUT B;  3CCR V;  2AHY A;  5JH7 B;  1IUR A;  4F6R A;  2L35 A;  1PV0 A;  1Q3E A;  1ZSP A;  5B1A C;  4HAM A;  3X2Q B;  3ZBH A;  1YDX A;  4WCE V;  4WFH A;  2JGU A;  2P4K A;  1I7F A;  4CH4 A;  3K59 A;  1ENV A;  4TQF A;  3WG7 C;  2UXC O;  1FXK A;  3SYQ A;  2BE3 A;  3CRM A;  3WB0 A;  2H94 A;  2V1D A;  1XNQ O;  1Q82 W;  1PPJ H;  4JI2 B;  2XUM A;  3P32 A;  4CC5 A;  3N27 A;  3P3P A;  3RYI B;  1FXV A;  1N0N A;  2KG7 B;  2AGA A;  1VEW A;  2RQ6 A;  4WFB V;  3OMI B;  3HKB B;  3STL C;  1Q7Y W;  2HP8 A;  3CCJ V;  1GH6 A;  2ZD9 A;  3B2E E;  4JI8 O;  1I0H A;  3L70 H;  3W7S A;  1XMO O;  5JQG A;  3PJS K;  2PY5 A;  2LW7 A;  2ITD C;  1IX9 A;  1E79 G;  3T4Z A;  2HG5 C;  3SYC A;  4RQE A;  4DR6 O;  4JI1 B;  4FK5 C;  2QJ1 A;  1VQ6 V;  5CA1 B;  1IBK O;  4MTG A;  3CRQ A;  2QDO A;  1GN6 A;  1PP9 H;  1YI2 V;  1YTF D;  1K5S A;  3AG4 C;  1U96 A;  1T5E A;  4WFE A;  4GYC B;  1PNL A;  1Q6I A;  3BA8 A;  3EVK A;  4L8J A;  1Q8I A;  5H9C A;  3DTU B;  4LWS B;  3H1K H;  2ZCE A;  3NR7 A;  4IT5 A;  3UM7 A;  3SPJ A;  2IJJ A;  3FB7 C;  3CE2 A;  1CPY A;  3I55 V;  5LP6 C;  2ZIN A;  2VQF O;  1SQG A;  5JWP A;  3RYH A;  3K06 A;  1D2D A;  1B06 A;  3ABM C;  1MZE A;  3ZCC A;  3M8A A;  4CBC A;  2EIJ C;  4XDL A;  4PD4 F;  2HVK C;  4R6Z A;  3CP1 A;  1XMO B;  5L3G A;  4JAU A;  1OJH A;  4PI2 A;  3B77 A;  2QR4 A;  2ZE7 A;  5CB4 A;  2ADQ B;  4PA4 A;  5FNV B;  5IYB O;  1IBK B;  2JIZ G;  5KHG A;  4LF5 O;  4X66 B;  2QKC A;  2F93 B;  2QKA A;  1AB3 A;  2QTS A;  3C3T A;  1YSC A;  4NKG B;  1WA8 A;  2DJV A;  2EIM B;  4LF5 B;  4ABM A;  2XAH A;  4YIP A;  1EFR G;  1AJQ A;  4NTX A;  2Q69 A;  2QSA A;  1R6T A;  2VRZ A;  4O2A A;  4TOI A;  1Q6U A;  2QWQ B;  4JAA A;  2Q4P A;  2IBZ H;  3UKM A;  1HNZ O;  3CS5 A;  1IXM A;  5KMG B;  2HEP A;  1XDC A;  2JVD A;  4JTA B;  1US6 A;  1BCC H;  4Z2W A;  2XHB A;  4Q6G A;  5E79 Z;  1BQZ A;  4Z1M G;  2A79 B;  4DV2 B;  1VF7 A;  3OUS A;  4X65 B;  1QR9 A;  1I08 A;  1JPX A;  3CXC U;  3AG2 B;  3SJB C;  2YC0 A;  3RBZ A;  3SJC C;  3CSX A;  2JS3 A;  4DV5 O;  4K3A A;  2BSK B;  5FPR A;  5IY5 B;  1GMG A;  1GO3 F;  2CH7 A;  5KMG A;  1WNS A;  2OCC B;  1S5J A;  3F7V C;  4UB8 Z;  1YF2 A;  2JDI G;  1NH2 B;  4E4E A;  3U0Z A;  4JI7 O;  1FFX A;  1VQP V;  3ZHV A;  2AHZ A;  1FXK B;  3UO3 A;  1CEZ A;  4JI0 O;  5BR8 O;  3ZRX A;  1FAF A;  3I5D A;  4DUY O;  2V4D A;  4MS2 A;  3VQV A;  3IGA C;  2IJH A;  3RW0 A;  5BZB A;  5CN0 A;  2LFS A;  4J7Z A;  5BY1 A;  3B09 A;  2AXT Z;  3JAK A;  3NXS A;  2WLI A;  1NJI W;  3VBB A;  5FPO A;  3ZRS A;  4GKJ O;  2QA4 V;  1XI1 A;  4IL6 Z;  4LNU A;  1K73 W;  1SQX H;  3BCC H;  2XAG A;  2IU3 A;  5CB4 B;  1S76 D;  3BVO A;  4LH6 A;  1VQ8 V;  2OTL V;  4LWS A;  2P90 A;  1F7Y A;  1SET A;  5LHI A;  3TGU H;  2CE4 A;  2QWN B;  1IZ3 A;  2VQE B;  3STZ C;  3OMN B;  3JAM N;  3N2G A;  1XL4 A;  3DGE A;  5LA6 A;  3CRA A;  1N33 B;  1ZTE A;  4UCS A;  1E1R G;  5K1P A;  4YJ3 B;  3WG7 B;  1BE3 H;  1SQV H;  2R9A A;  1NR7 A;  2WLK A;  3QO7 A;  1MA1 A;  1S3J A;  4X1I A;  5EC2 C;  2XT9 A;  4CS4 A;  4IHJ B;  3HR0 A;  2IJI A;  4XDJ A;  4MT8 A;  2YI8 A;  2DYS B;  5LMU B;  4FLU A;  1BGY H;  2EIK B;  1IBM B;  1ZX3 A;  4FFB A;  4I9W A;  4B3R B;  1JJ2 U;  3ZIA G;  3ABT A;  2R9I A;  3BY6 A;  1NTM H;  1NH2 D;  2UXC B;  1VQ4 V;  4O2A B;  2PYJ A;  3FX7 A;  4HBN A;  4QPJ A;  3ETD A;  2E76 B;  3SJQ C;  2D3O W;  3RT3 C;  3ZMU A;  3CX5 F;  1YJW V;  5LL6 Y;  4DW1 A;  2EZP A;  4AHC A;  4L87 A;  2IH3 C;  4FMT A;  5LGT A;  4O4I A;  3WU2 Z;  1J5E O;  2W0F C;  1NBM G;  2WLN A;  4TSF G;  4FM2 A;  2JJ2 G;  1FYJ A;  4K8Z A;  1B3Q A;  3OFN G;  3UT5 B;  4CS2 A;  3DXR A;  3P30 A;  1J5E B;  5ITZ A;  1NQT A;  1PNM A;  4DR2 O;  1JMK C;  4I4T A;  2WA3 A;  1YZB A;  1R6K A;  2OYQ A;  3ETG A;  4X20 B;  2JGD B;  1JOY A;  3BAA A;  3CME V;  2ZM6 B;  2Y4T A;  2LW1 A;  3UO2 A;  2EJR A;  1BL8 A;  5KUM A;  4PA7 A;  5B1B C;  1PNK A;  4DW0 A;  4UCO A;  3SPC A;  5F2V O;  4NXM B;  1QLN A;  3ZX6 A;  3KG2 A;  5EYP B;  2M7W A;  1EN5 A;  3DC5 A;  5LMU O;  3SPI A;  3FAV A;  4KP4 A;  1M93 A;  2C2A A;  2W6J G;  1SF9 A;  3RGB A;  3OTO O;  3DSQ A;  1GTO A;  4KHP B;  1QR8 A;  2E75 B;  1MAB G;  2IW5 A;  2DMX A;  3JSN A;  2ZDI C;  2ZNI A;  1D5N A;  4X88 A;  4DR4 O;  4TQD A;  2YSU B;  2EIN C;  1EBO A;  5KA5 A;  3K5N A;  3TCU A;  1VQ7 V;  5DM6 V;  4U7O A;  4KXR A;  1BZK A;  4YJ2 A;  5B1N A;  1JFF A;  2YEV A;  4JI5 O;  4JI6 B;  1MZF A;  4JYB A;  3A2F A;  3MHS C;  5H6R A;  3ZHQ A;  4DR7 B;  1QQC A;  1K34 A;  3JAT A;  2CTW A;  2ZT9 B;  3E22 A;  2NLJ C;  1Q6H A;  1XHX A;  4WBN A;  1NTK H;  1OV9 A;  1EN6 A;  1GKF A;  3CCQ V;  4XBF A;  2R9R B;  4UVC A;  4FLW A;  4DRX B;  4MVR A;  1WP8 A;  1KP2 A;  2HHH O;  1DK1 A;  2FTK A;  4AQY B;  4IGG A;  1RPO A;  1XIL A;  5IYZ B;  2IJK A;  5IJ9 B;  3SPG A;  1QVF U;  5IWA B;  3A0B Z;  3SJA C;  3TK1 A;  3FB8 C;  1B6Q A;  1WB8 A;  4PJ0 Z;  5IE9 A;  2VQE O;  3AG2 C;  1SES A;  1EN4 A;  3ABK B;  5D5Q A;  5B3S B;  1Y74 B;  3L9D A;  1DF4 A;  1HNX O;  4EFE A;  4H33 A;  1XMQ B;  5DN6 G;  3MD0 A;  3KKY A;  3CCE V;  3OM3 B;  3IC9 A;  4GUN A;  4PEL A;  4JGS A;  2GSM B;  1OCC B;  1F23 A;  2ARH A;  3W7T A;  4OPH A;  4I55 A;  1YTF B;  1BT8 A;  5LOV A;  1K92 A;  4LFC B;  1Y76 A;  5EZY B;  2UUA B;  3T1Y O;  1UFI A;  5CA3 A;  4HZ3 A;  5AG2 A;  2MW2 B;  2Q7G A;  2IM9 A;  3OAA G;  1S0V A;  1V54 B;  2X0L A;  3T1H B;  4ZI7 A;  3K04 A;  2GV9 A;  1VP7 A;  1ORQ C;  3CRR A;  2B5U A;  2ZE5 A;  4NYK A;  3PN1 A;  4LFA O;  1G6U A;  3AG1 B;  5BR8 B;  2UXB B;  3RVY A;  5LA6 B;  2Y4U A;  1XBL A;  2RMK B;  4TUY A;  5CBF A;  1XEQ A;  4UVA A;  3SYA A;  4U3F H;  4JI7 B;  1AIL A;  1SKV A;  5L3F A;  1SS3 A;  2HJF C;  2EZO A;  2UUC B;  2CDY A;  1YXB A;  3TET A;  4IIJ B;  3AK2 A;  1M56 B;  2E5L O;  4MVO A;  4YY3 O;  5GTI Z;  4QNH B;  1M9N A;  3VQX A;  1XQ8 A;  4DR5 O;  1M5I A;  2WLM A;  4NTW A;  2CUG A;  4I0X A;  4QIW F;  1SQQ H;  3T2M A;  2AZ2 A;  2F4V O;  1W59 A;  4LF6 B;  2HJD A;  3E35 A;  4O4H B;  2RJZ A;  4DV0 B;  1GM9 A;  3FD9 A;  5LMN O;  3F5W C;  1B04 A;  1OCR B;  5ITZ B;  5EC1 C;  4LH7 A;  3CCL V;  4DV0 O;  2QM8 A;  5J9P C;  3LDD A;  4J11 A;  4JYC A;  1AP6 A;  3ASO C;  2Q5Z A;  4KL1 A;  2EX3 A;  3S3W A;  1WPX A;  4LFB B;  3A0R A;  4LF6 O;  3GWO A;  3JCZ A;  1WPB A;  2HFE C;  4LFB O;  1LUV A;  3CJH B;  3ZHS A;  3BAB A;  3BHP A;  4JI5 B;  1RSO A;  3MDS A;  1OHH G;  2P5O A;  3JAR B;  1OCC C;  1KQS U;  5KUK A;  4X9Q A;  1QLE C;  2F1M A;  3AG3 C;  1N33 O;  2P06 A;  4QJF B;  4FFK A;  4FM0 A;  3IAY A;  1THZ A;  5LP6 B;  2XAQ A;  1SQB H;  2ZR3 A;  2P4V A;  5EBM C;  2N04 A;  4CC6 A;  4DV1 B;  4GZR B;  4JYY A;  2CTR A;  3E8H A;  3CJH A;  1RP3 B;  2YDE A;  5JH7 A;  4EB6 A;  5CA1 A;  5EBL C;  3J81 N;  4BWA A;  3K0G A;  1R3I C;  1TVK B;  1VAR A;  3ABL B;  5IT9 N;  3R66 A;  3CMA V;  2A3Q A;  4U7N A;  3LDC A;  3CHX A;  1ARO P;  3QTC A;  4DR3 B;  1TAE A;  1WP7 A;  4U3J B;  2BOB C;  4PA6 A;  2P7T C;  2DYR C;  4LC1 A;  5J2U A;  4OX9 O;  1YCI A;  4PI0 A;  1WB7 A;  1HWY A;  4PA3 A;  4G27 B;  4RUF A;  1YIJ V;  3G71 V;  1NS1 A;  4J41 A;  1I94 B;  4JTD B;  1Q81 W;  1JR9 A;  1Q86 W;  1XNQ B;  1K4C C;  3P3N A;  1KYO F;  1MMM A;  4AQY O;  4BW9 A;  5LGN A;  1HNW B;  2QE7 G;  3HKC B;  1HW7 A;  1IVS A;  1TA8 A;  3OR6 C;  1SER A;  5CA0 B;  3RYC A;  4B08 A;  2RDC A;  1SA0 A;  4DV3 O;  2QWO B;  2GTS A;  1M90 W;  4B3M B;  4F6E A;  3F5T A;  4ZOL A;  4PA9 A;  5LP6 A;  3EXA A;  5JVD B;  2ZDI A;  1V55 C;  3L75 H;  1OCZ B;  4LF8 B;  1HDJ A;  4UV8 A;  5J2T A;  5C8Y A;  2YIC A;  3JAS A;  2ZR2 A;  4JAV A;  3FKS G;  2BCC H;  1S5H C;  2WLL A;  1K4D C;  4UCU A;  4DRX A;  3R65 A;  2FYU H;  1RFY A;  1L8D A;  5FNV A;  3BA9 A;  4WFA V;  2CK3 G;  2L6L A;  1I5X A;  1H38 A;  4CZZ A;  2ETN A;  4UUJ C; 
#chains in the Genus database with same CATH homology
 2PF4 E;  2CTP A;  3AG7 A;  2Y4U A;  1XBL A;  2QWN B;  1HDJ A;  1BQZ A;  4J7Z A;  2N05 A;  2GUZ B;  1WJZ A;  2QWR B;  1BQ0 A;  2QWQ B;  1N4C A;  2CUG A;  1FPO A;  2QWP B;  2YS8 A;  1GH6 A;  3APO A;  2QWO B;  2DN9 A;  2EJ7 A;  2CTQ A;  2Y4T A;  4J80 A;  3UO2 A;  2LO1 A;  1IUR A;  1NZ6 A;  2M6Y A;  4IT5 A;  2DMX A;  3BVO A;  4RWU A;  2CTW A;  3APQ A;  2N04 A;  3UO3 A;  2GUZ A;  2KQX A;  2CTR A;  3UCS C;  2L6L A;  1FAF A;  2YUA A;  2QSA A;  2LGW A;  2OCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...