4RWUA

J-domain of sis1 protein, hsp40 co-chaperone from saccharomyces cerevisiae
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
81
structure length
81
Chain Sequence
MVKETKLYDLLGVSPSANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQKREIYDQYGLEAARSGGPSFGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein SIS1
publication title Roles of intramolecular and intermolecular interactions in functional regulation of the Hsp70 J-protein co-chaperone Sis1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Chaperone
total genus 30
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2014-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 4rwuA00
2CTQA 2QWOB 4J7ZA 1IURA 2LGWA 3UO3A 2Y4TA 2L6LA 2M6YA 2QWPB 2CTRA 2DMXA 1BQ0A 2CTPA 1FPOA 2QWNB 2CTWA 1WJZA 2YS8A 3BVOA 2N04A 2QWQB 2N05A 2OCHA 1XBLA 1FAFA 1HDJA 2GUZA 3APOA 2GUZB 1NZ6A 3UO2A 2PF4E 2LO1A 2DN9A 4J80A 2YUAA 1BQZA 3AG7A 4RWUA 3APQA 2CUGA 2QWRB 3UCSC 1N4CA 2EJ7A 2Y4UA 4IT5A 2QSAA 1GH6A 2KQXA
chains in the Genus database with same CATH superfamily
4O2AB 4AQYO 3MDSA 2BCCH 1NH2D 3ZRWA 3E8GA 4DV5O 2LW7A 4RUEA 1KECA 1OCRB 5J2TB 3H1LH 4RQEA 4JI4B 4YIOA 4JYAB 1AI7A 1OCZC 1SESA 5DEDA 1ZX3A 5L3DA 4OPHA 1BL8A 5CA1A 1FXKC 3FYIB 1VQ5V 1IBKB 3RYCB 1IZ3A 3OD4A 3OEEG 3E8BA 4DV7B 1G8MA 2K9PA 3GWOA 4XDJA 3JAKA 4X9QA 1KMIZ 4KXRA 1YIJV 1W0KG 4KUMA 5KHKA 1QLEC 3ZBHA 3DSQA 4LF9O 4JI5O 4CC5A 4JI6B 3CCJV 1B04A 1WP7A 2DYSC 4D7SA 5IT9N 4JI2O 2GBOA 4RWUA 3I55V 5LMNB 3JD0A 2B5UA 3BRCA 3QVNA 3ABLB 1BT8A 4X8AA 4I50B 2GHYA 4X1YB 3OT7A 3CRRA 3SPGA 3ZJZA 3ZRXA 2V7QG 4GKJB 1T5EA 1SKVA 2Y69C 3Q4HB 3U10A 3A0HZ 1BS3A 4UCRA 4BIOA 2Y0IA 4MTFA 2JGUA 1TUEB 1TVKB 2NN4A 1OCRC 1SA0A 3OAAG 3K58A 2F23A 1JJOA 1S0VA 1GN4A 2CAZC 3ZEDA 1WB8A 2QR4A 2A06H 3APOA 2YDEA 5C8YA 2HLDG 2W6IG 2KG7A 4X1IA 3AG7A 1L0NH 4PHZA 5L3BA 5EBMC 4FJCC 1AI4A 4XDLA 5IJ0A 3CHXA 4B3MO 4O2AA 3CCMV 4FLZA 1OZ0A 4QIWF 4CH6A 1XL4A 2CK3G 2UUBB 5J2TA 2PGGA 1KP2A 1JQ0A 2GUZA 4ZI7B 4YJ3B 2ZM6O 1MSDA 1BMFG 4TUYB 3ABLC 3B4SA 1X4TA 3UCSC 3RYCA 1MZEA 2LFRA 2WPDG 2Y0PA 1SERA 1HWYA 3K04A 4JI2B 1D5AA 1NTZH 4JTAB 3SR2C 3B09A 2ZNJA 1Y76B 3D36C 3A0RA 4HZ3A 3WFVA 1N34B 4FLTA 4F4LA 1I08A 2DWEC 3CP1A 4GLXA 2F66C 1XMQO 2QWRB 3LSUA 1XL6A 5FPRA 1WPXA 2IM9A 5H6RA 4I50A 3SDLA 4X1YA 4H33A 3BFRA 2DMXA 3EVKA 2O57A 3G6EV 4BAYA 3ZHRA 2YIBD 1TAEA 4JYYA 3Q4HA 1SC5B 2WAMA 3FAVB 2B1IA 4JI0B 3ZRVA 2HHHO 1LR1A 3L70H 3X2QB 4UCOA 1TVKA 3J7AU 4XDKA 3E2EA 3M7MX 1XNQO 4I9QA 3T4DA 2P5OA 4JASA 3EFFK 4OGQB 3OW2U 3UQ8A 3RYFA 3LNMB 3RBZA 1SQBH 2UUAO 1R1BA 5L3FA 3WB0A 2ZINA 5AG2A 4WFEA 3VOUA 4MVRA 3RT3C 1NTKH 4TOIA 5KHGA 5K1PA 4MTGA 1FJGB 1HNZB 4DV6B 3T1HO 3T1CA 4XBFA 3HKBA 1B6QA 5KAIZ 5LOVB 5B1BC 2A79B 1K9MW 2V4DA 1WAZA 2AGAA 4YJ3A 4TUYA 3ZMVA 3H9VA 5EC1C 4KP4A 1M4UA 3JYCA 3IAYA 3K9SA 1SRYA 3G4SV 1XMQB 3RN4A 4UCUA 5LBQA 4J7KA 4NXMB 2Z3YA 5EIBD 3KCYA 1N36O 4JGSA 4DV1B 2RCVA 1Y6XA 4R50A 2JDIG 3X2QC 2BTQB 4JTDB 3L72H 5L3GA 2P6JA 1GN2A 1AB3A 1HNXO 2ETNA 2Q7HA 3ZHTA 4LWSA 1Q8IA 2PTMA 4WFGA 1AROP 3ZCCA 2NNUA 1P7GA 3OMAB 2YUAA 2FMLA 2YEVB 1XMOB 4K3AA 3K03A 1HP8A 4MVUA 1KQSU 3RYIB 2CTQA 3R66A 4ZKIA 1AR4A 1AI5A 5CBHA 1HR0O 3L71H 2GV9A 3H1KH 2WSSG 3D8CA 4O4HB 4Z1VA 1ZWIC 2DE0X 2UU9B 2R70A 1FS0G 1FFXA 3VQXA 2VWJA 1J5EB 3OTOB 2F1MA 3N2KA 1BHBA 2RNBA 3CXCU 2QWOB 3K79A 1IBLO 2Q0AA 2DWDC 3FB6C 2HVKC 3SYOA 2WLMA 5BY1A 1JJ2U 4LF7B 1K97A 3M99B 1Q6HA 2X6AA 4CS4A 1XUQA 4U3JA 5LOVA 4DR3O 3R65A 2ZE6A 2JVDA 4X66O 2AHZA 1FD9A 1EFRG 1YI2V 5D5PA 2HJDA 3K5LA 3ETGA 1VQPV 4BW5A 2WLKA 2UXCB 5FNVB 3ZHVA 4H37A 2ZT9B 2Y4TA 2YI9A 3N27A 4PA6A 3IFXA 2UXDB 4P9PA 2JEXA 3OR6C 1ORQC 4DR4O 2QKSA 4OX9O 4QPKA 1M1KW 2HP8A 2WA3A 3W7TA 4DV3B 1WA8A 3N2GA 4DR1B 3E8FA 5LP6A 3ABKB 3C3SA 5H9CA 4FLVA 1VQKV 1ROPA 4GX1A 2HG5C 3CCLV 1VQ7V 1DLBA 1HR0B 3BA8A 3FB8C 1HNWO 1Y4MA 2A0LA 2KB1A 4DK1A 1KBHA 3OUFA 5JH7A 4NYKA 1S5HC 1NR7A 4JAVA 3RYIA 5HFMA 1Q81W 4FMTA 4I9WA 3SYCA 1JFFB 3W7UA 4P9OA 5B1AB 3VQWA 2GDSA 4O4HA 3JD3A 4JI1B 2H8PC 4IHJA 5H2FZ 1M90W 2QDOA 1KD1W 4QE7A 4JV5O 2YSUB 2LGWA 1S77D 3DTUB 2X7RB 2JGDB 3TCUA 5BZBA 2VQEO 3M8AA 2QE7G 3OR7C 1JR9A 4LF4O 1SQFA 2QGNA 3HB3B 3DGEA 2OCCB 4R6ZA 3DXRA 1UFIA 1AJQA 2ZDIA 2LJ2A 1R6TA 2YIBA 2XT9A 4DR4B 4OX9B 5D5QA 2IJHA 4J41A 2ADPA 1MSWD 3LSSA 3SYQA 4ASUG 5IYBO 2FTKA 1E1RG 4B3SO 4LF5B 1O9GA 3ICXA 2ILMA 2F4VO 2DN9A 4J11A 3HKEB 4JI3O 5JVDA 3T1YO 1N0NA 2P4VA 2ZR2A 1AVMA 3P32A 3AG3C 4EKWA 4DUYB 1VP7A 1QR9A 5B1AC 2Z5UA 2M6YA 3JAKB 2EIJC 4JI4O 2ZQMA 5CN0A 3CRAA 2IU3A 4I5SA 1J95A 1H2KA 2RQ6A 1VEWA 4MVZA 1ENVA 3KKYA 5LGTA 1IBKO 4WBNB 1PM9A 4DV7O 2E74B 3G80A 2VS0A 4IIJB 2EIKC 3C3TA 2EJ7A 1M9NA 1AR5A 4PD4F 1BCCH 3JD1A 1YDXA 2QKAA 2R9AA 5LXTA 2LP7A 3WU2Z 4JI6O 2CDYA 1MABG 3K9AA 2OCCC 1YTFD 4N21A 3ZMUA 4LBEC 5LMNO 2L35A 3ASNB 5KX5B 1NTMH 4Q6GA 5JQGB 3RW0A 3F7VC 2XAQA 1NBMG 2WA4A 1SQQH 2HEPA 3CC2V 4CS3A 4GKJO 1SA0B 5J2UB 5L3EA 4FM2A 2JGDA 1GMGA 2QWQB 5LGUA 5IYDO 3ZMZA 3L73H 2ZE7A 3EHBB 3ML0A 2R72A 3ABTA 4X1IB 2XHBA 4LFBB 2H3OA 1I5XA 1NVPB 5BXZA 4LNUB 1ZTEA 5IJ0B 1GK9A 2ZD9A 1F51A 2Q7EA 4FFKA 4E4EA 5KA6A 5JJNB 2A9HA 3E86A 2ZR3A 5IYZB 2N04A 5B1OA 3JCZA 4CZZA 2GUZB 1H2SB 1KB9F 2ZIOA 3SYAA 3HKEA 4DR7B 1M56B 1F7YA 3ZX6A 3TGUH 1GM8A 2QTOA 2EIMB 3E8HA 4YY3B 2UUBO 4QGPA 3SPHA 4JAAA 4MSWC 3ASNC 5IE9A 4O2BB 1D5NA 2X6CA 3CRCA 4WBNA 1F4NA 1RP3B 5IY5C 4U7OA 1XI1A 1M57C 1N4CA 4IIJA 2ITCC 4UVAA 3ZRSA 2ZIMA 2Y48A 1N32B 3K5OA 4GX0A 2CTWA 1N34O 2YICA 1E1QG 2JRIA 1Q7YW 3U0ZA 5KX5A 4B3TB 3LDCA 5A2QN 4ICGA 5JQGA 2W6JG 3H1JH 1SQGA 4O4JA 4E2LA 1A32A 1XEQA 5J2UA 2EX3A 3JD2A 4PI2A 1Z5VA 1WNSA 2EIMC 4ZBMA 3RYFB 3CXHF 4JI0O 2C2AA 4TV9B 4TQFA 3AG2B 2BOCC 1ZSPA 4MVQA 2E75B 3JASB 3LSQA 3VQYA 4LNUA 4GCZA 3CC4V 3MAQA 1R6KA 3OMNB 5GONB 4P2ZA 4GUNA 3D3QA 5IYZA 3JALA 2D2CB 1CXZB 4U3FH 3HKBB 3SJAC 4MW8A 1GM7A 1FXVA 4TT3G 1FJGO 5FPOA 1HNZO 4DV6O 3APQA 2CUGA 3QG5A 2IU0A 2DJVA 3PJSK 2F43G 4HYOA 4IT5A 5B66Z 2P22C 1SQPH 1V55B 3J80N 3FX7A 3JSNA 1B06A 3B8NA 3UKMA 1SS3A 4FFBA 5F2VO 3UT5A 1X59A 1VARA 4O2BA 4NTYA 2A7WA 3T2MA 4DV0B 4UCVA 4LP8A 4DUZB 3ABMB 1SQVH 2YXYA 2V1DA 4WFAV 4FM1A 5KHIA 1OCCB 3DC5A 2WLIB 4X1KB 4J7ZA 1CP9A 4NXMO 5KLVH 1P7BA 3K08A 4WFHA 5CA0A 4DV1O 4LWSB 5B1NA 2XTAA 2F93B 3AG2C 3FKSG 2EZOA 1SF9A 1IXMA 2Q68A 1NKDA 3ETEA 2IJJA 1GKFA 5IWAB 1MG1A 4JYCA 1N33B 1H2MA 1NH2B 3FB7C 1YXBA 1LUWA 3ETDA 3CJHA 4NTWA 3KCXA 1GO3F 4K0KB 2ZKOA 3B2EE 1GM9A 2OT5A 5K1XA 4I4TA 5IYCO 2NR5A 4DYLA 3K0GA 3E83A 4DV2B 3KZIZ 5IJ9B 1XMOO 2XAHA 3JAWA 4G2KA 3STZC 4J9YB 4X62B 4TV9A 1FFXB 4AILC 2E3CA 5KHJA 1KKDA 1V55C 1Y74A 4W4KA 3N2KB 3JASA 3SPJA 2R9IA 1S3JA 2P4KA 2EINB 4LH7A 5A9GA 5GONA 2L6LA 1MZFA 2UU9O 5EBLC 1XNRB 1QR8A 2BOBC 3E22A 2PY5A 3H1IH 1J5EO 4U3JB 2FYUH 3AG1B 3OTOO 5EK0A 1AP6A 2ITDC 3IC7A 4DR5O 4ZOLA 1QVGU 1YCIA 1V54B 1DF5A 4EEQA 4DV4B 4LF7O 3RVYA 1VQMV 4X20B 1NS1A 4G27B 3RVZA 2YI8A 1WJZA 2PI4A 1VMGA 3JATB 1TGOA 1VF6A 4GX5A 5LA6A 2E5LB 1F4MA 1PNKA 1KC8W 1IX9A 4HAMA 1KP3A 1R3KC 1YEWA 4KHPO 2UXCO 1JMKC 2WLJA 2Q0OC 4UFZA 4DRXA 2FL4A 2WLIA 4X1KA 3K0DA 1WA8B 1AP5A 3N2GB 5LP6B 2UXDO 1JA8A 4ZHQA 2QM8A 4X65B 2AZ2A 1VQNV 4JI7B 4GKKO 3O9OA 5GTHZ 4DV3O 4DR1O 5JH7B 2Y4UA 2WLLB 2AXTZ 2QEXV 2JJ2G 3VBBA 4LFAB 3BHPA 2Q73A 4IL6Z 5IJ9A 3LUTB 4K8XA 4CH3A 4IHJB 4LC1A 2XNDG 2UXXA 1IXBA 2AZ0A 2X0LA 4DR5B 3CRMA 4QNHB 2G38A 1I94B 3HR0A 3QNEA 4JI1O 2JEUA 2B9ZA 5CBFA 1NU1H 3W7WA 3CCQV 1XBLA 5BMVB 1THZA 1XDCA 3ASOB 3K3WA 4F6EA 3K59A 4WCEV 3FD9A 4L8JA 3JCUZ 5FL7G 3DXRB 5LP6C 1US6A 1OCOB 2QSAA 1R3LC 2JJ1G 4X20A 4KHPB 1BQ0A 1TA8A 2QWPB 2UXBO 4X64B 4JI8B 3JATA 1GN6A 3CMAV 5BR8O 2RJZA 1HW7A 1L8DA 4OPAA 5JVDB 2BSKB 4NKGB 4GKKB 4UB6Z 3ZN1A 4LF5O 1YSCA 2YS8A 3U11A 4N23A 4PDVA 2DW4A 1K8AW 4DUYO 3AK2A 4D6TH 1GTOA 1H8EG 1NR1A 1NQTA 2ARHA 1QU7A 2WLLA 4EFEA 4YXWG 1BSMA 5LXTB 4UCSA 3MHSC 4I55B 4F6RA 1IVSA 1IBMB 3H1HH 3P3NA 5GW7A 2B1GA 3CB2A 1OCOC 3F5TA 1EZJA 4UXNA 2ZDIC 3STLC 2RDCA 2LFSA 2EULA 2BE3A 1YJWV 3RYHB 4HNAB 4PDMA 2RMKB 4BR6A 2EBOA 5B3SB 4ABMA 1YJ9V 2ZXWB 1NZ6A 2PF4E 5BMVA 2UXBB 4DW1A 1VQ6V 1TUBB 5BR8B 4JTCB 2W0FC 4R7CA 3ABKC 5H5NA 3JSLA 5LYJB 4Z1MG 4MVSA 5JJJB 1N8RW 1VQ9V 4X89A 1FFTB 4NVPA 2CH7B 1B3QA 3O65A 4LFBO 4JYBA 4UV8A 4J80A 3CCVV 4LF8B 3CMEV 2OYQA 2BSKA 4DXWA 1P84F 1DGSA 1GH6A 2VQFB 2PUSA 2CE4A 3OEHG 3TETA 4UB8Z 2LQTA 4DR7O 1XILA 4B3RB 1VQOV 3ZHQA 1PL4A 2ATKC 3OGCC 4MS2A 5JCOA 2XOKG 4BW9A 1PL0A 4YY3O 1D2DA 5J9PC 5EIBC 3CRQA 2Q6AA 1NT2B 1FXHA 3A8TA 3CE2A 1QLNA 1RPOA 3TXQA 5KAFZ 4CS2A 1PPJH 1IURA 5LMUB 2ZXWC 1P4RA 4MVOA 4GT1A 2ADQB 4I55A 1ZL8A 5CMUA 1EN5A 5L3CA 4PA4A 3GVMA 3UO2A 3THOA 4PDLA 1SQXH 2GTAA 4NXNB 1OCZB 1N32O 2QA4V 2RN9A 3K5MA 3RYHA 4HNAA 5KMGA 4O4JB 4J9ZB 2LGQA 3CPWU 2P7TC 1G6UA 4FLXA 4JZ2A 4B3TO 3SGIA 1K34A 2K1EA 3H01A 3WG7B 3K06A 3QO5A 2YIDA 1TUBA 3WB2A 3JAMN 4LFCB 3BABA 2PYJA 2UUCO 5LYJA 3AEIA 2CH7A 3JALB 2Q4PA 4O4LB 4U7NA 3ETQA 2D3OW 3CC7V 3SJCC 4TV8A 2Y69B 2FB5A 4R8CA 1RM1B 3OFNG 3CCRV 3JARA 4JZGA 4LR3A 2P90A 2Q8VA 1RSOB 2YIAA 4FFBB 3UT5B 2JS5A 3LDDA 4YHHB 4AI8A 4DR6O 5H6QA 1R3IC 3OM3B 1EBOA 2OIGA 1BE3H 5EC2C 3DC6A 4RAIA 1ZUQA 4DR2O 3SPIA 2HFEC 5TISZ 3WG7C 2IW5A 2ZNIA 5CA0B 4IGGA 2DQ0A 4DV0O 1I7FA 3SJBC 4DUZO 3BVOA 3TJTA 5ITZB 2P67A 1ZLZA 3ZN0A 3J81N 2DYRB 1MOFA 3P30A 3CJHB 1EM1A 1FXKA 4LCUC 4I4TB 2Q69A 1K73W 5IWAO 2UUCB 4Z2WA 2IBZH 1N33O 1M56C 2ZE8A 3JAWB 3B40A 4FLWA 2Z0AA 2F95B 1RM1C 3LDEA 4HBNA 1Y74B 4K0KO 4PDRA 3CD6V 3BPZA 1I0HA 2GTSA 1Y66A 2QJ1A 3B8MA 4DV2O 2YC0A 2CTRA 4IYIA 2QWNB 4UV9A 4B7KA 4X62O 1U97A 2HJFC 4AQYB 1ZAUA 1Q82W 3E22B 3QF7A 2GSMB 4MTXA 2OWOA 4O4LA 1VQLV 4DV5B 4I7ZB 1VQ8V 1G4YB 4EB6A 4ZOLB 5CB4B 5CBGA 2E76B 4DR6B 3FYEB 1XNRO 1YTFB 3E35A 3UM7A 1QVFU 1RSOA 1LNQA 1V9PA 4JF3A 4TWKA 2DYRC 3CS5A 1BZKA 4DR2B 4PI0A 2OTJV 1WP8A 3CSXA 2R9RB 5LA6B 3G6BA 5GTIZ 5EZYB 3OTFA 4DV4O 4LF9B 1OV9A 4JI5B 2VWKA 4DRXB 1QCEA 4PV1B 2KQXA 3BA9A 4I0XB 4EFBA 3F5WC 3W7SA 2DQ3A 1MMMA 1R6NA 2E5LO 1QHTA 4ZHQB 1HDJA 5ITZA 5B1BB 3CEIA 3K57A 1I5YA 1VF7A 1Z5WA 1YVWA 2IH3C 1H38A 3GWKC 1BHAA 2N74A 1KU9A 2CGOA 3UO3A 4X65O 3CYOA 2P06A 4JI7O 4QJFB 1XHXA 1DF4A 1SETA 1S5JA 2LO1A 4A5UB 4DK0A 1JX9A 1FKAO 1BQZA 1QNMA 5HFLA 3CCEV 3D36A 3L75H 4LFAO 1S76D 3BEHA 4FLYA 3ZMSA 1K5QA 1VF6C 4H44B 1E79G 4GYCB 4UUJC 1WLEA 3AG4B 3W7XA 2EJRA 3B77A 4B3MB 2JK5C 1UJWB 2Q67A 3KG2A 3ABMC 3OUSA 1XQ8A 1PP9H 3IGAC 3SPCA 1L0LH 1OCCC 2X6BA 2YXLA 4BIUA 5CB4A 2QM7A 4Q20A 1I94O 2ZM6B 3QO8A 2PYLA 1MNGA 2W0XA 4KL1A 4FM0A 2H94A 1JCHA 5KUMA 1K92A 3PN1A 2PI5A 2FKXA 4PELA 3OGIB 1W59A 1FAFA 4ZI7A 4JPRA 1LUVA 5EZYA 1H2NA 3GB7C 1M93A 1CEZA 5E1AC 5DECA 5LHHA 3G71V 4O4IB 4PA3A 4RUFA 4X64O 4JI8O 4I0XA 1GAXA 4K35A 4NB5A 2Q5ZA 1PNLA 1S5LZ 1PNMA 1VQ4V 3JD4A 1H2GA 1DK1A 1PV0A 1Y76A 1XOUA 3FB5C 4UVCA 2QM4A 3IC9A 3HPLC 5C93A 2M7WA 1YZBA 2EINC 4B08A 3AG4C 4K8ZA 3HKCB 3BCCH 5JWPA 1MA1A 1K5SA 2PZSA 4WF9V 1K7DA 5E79Z 2VRZA 2HHHB 1N0JA 4GZRB 3AG1C 4F6RB 1QQCA 2JS3A 2KSDA 4PJ0Z 2MW2B 3L74H 1XNQB 1K33A 1V54C 1URFA 3FAVA 4FVMA 3I5DA 4UCTA 3F7YC 4OXSA 1RFYA 4BIZA 3EXAA 3S3XA 2UUAB 1IBMO 4DO2A 1AR1B 3CCSV 1W0JG 5B5EZ 2CTPA 1W2BU 2QKCA 5DN6G 2N05A 3T4ZA 3T1HB 3HKDB 4TQDA 4RQFA 1Z2GA 2HR3A 1JVMA 2IH1C 3MHHC 4P30A 3L9DA 1COWG 1Q6IA 2HKOA 1YITV 4CBCA 1VF5B 1KUQA 3QTCA 3QO7A 3OMIB 3CWBH 5LHIA 4LF6O 4B7EA 4JAUA 3SJQC 2KKWA 1IDSA 1GRJA 2Q7GA 1KYOF 1M5IA 1NI8A 3OE7G 1N36B 1F23A 4MVMA 4O4IA 3RGBA 3BAAA 2LW1A 3ZS8C 4X88A 4LH6A 1BGYH 1K3EA 1QBZA 1FPOA 3ZIAG 1Y67A 2JIZG 4LF8O 1HNXB 5EBWC 1S72V 4CC6A 1AI6A 1EZVH 1YHQV 2BTQA 2VQFO 2XUMA 4UVBA 3TK1A 2WLHA 4YIPA 3HKCA 3AK1A 2HVJC 5LL6Y 5FLXN 4B3RO 4RO2A 2EILB 1SZXA 1G1XB 4W4LA 1O9HA 1NVPD 3ASOC 1ZL8B 4L87A 4MTOA 2ZCEA 1K4DC 2WLNA 4CH5A 2XAGA 2OCHA 4PA7A 4GX2A 4H0LB 2YEVA 3D3IA 3VQVA 1UPGA 2AW9A 5LMUO 5KMGB 1Q86W 3LNNA 3CCUV 4NTXA 3AG3B 5KA5A 4J7JA 1IBLB 1NJIW 2EIJB 4LF6B 4NXNO 1PKXA 2MK3A 3HKDA 4TSFG 2IJKA 3E89A 4DR3B 1KKCA 3ZHUA 2DOSA 3S3WA 4CH4A 4X66B 2IJIA 1FYJA 1P49A 2EIKB 5EYPB 2AHYA 2BTOA 4FK5C 2ZE5A 5KHHA 3K5NA 5JCOC 1AJPA 3P3PA 4C7UA 2EZPA 2OIEA 4LFCO 3G67A 1R3JC 3CX5F 3ABUA 3BY6A 4TV8B 3NR7A 2EILC 4FZ0A 4YJ2B 3WB1A 1YF2A 3JARB 5FNVA 2XAFA 3RFRA 3ZRWB 4FIPC 3FFQA 2ODMA 1XREA 3SYPA 5IDJA 3IJ4A 1AJNA 1EN4A 1R73A 1RPRA 3A2FA 3RWRD 4H13B 1EN6A 1PD3A 3TXSA 5CA1B 1XHZA 3MD0A 5LGNA 1Q90D 1WPBA 5JJEB 5B3SC 1HNWB 4FZ1A 4AHCA 3A0BZ 1Q3EA 4J10A 4YHHO 1SZTA 4JYAO 1DTOA 1U96A 1VIBA 4PA9A 2XASA 4WFFA 1H8HG 1OHHG 3AK3A 1Q5OA 2OTLV 1WN7A 4J42A 5KUKA 1YJNV 1FXKB 2UXNA 2A3QA 1L1FA 1JFFA 4WFBV 4JV5B 1H2LA 4MW3A 4KFMA 3C90A 5DM6V 1AILA 3ZMTA 1GN3A 5LHGA 4FLUA 1JPXA 2VQEB 2QTSA 4D7TA 2Q9LA 1QLEB 4NR1A 4BWAA 4DW0A 4LF4B 2DYSB 4G28B 2XAJA 4QPJA 5IY5B 3ZHSA 4ZIBA 1M57B 2CGNA 5EYPA 3I56V 1CPYA 1K4CC 1Q43A 4MT8A 4QE9A 2WWWA 1OJHA 5C8YB 4FPPA 2KG7B 5CA3A 4IYHA 4B3SB 2NLJC 4EB6B 1WB7A 3NXSA 1Q6UA 1JOYA 2F4VB 2YXHA 4YJ2A 4JI3B 3T1YB
chains in the Genus database with same CATH topology
2CTQA 2QWOB 4J7ZA 1IURA 2LGWA 3UO3A 2Y4TA 2L6LA 2M6YA 2QWPB 2CTRA 2DMXA 1BQ0A 2CTPA 1FPOA 2QWNB 2CTWA 1WJZA 2YS8A 3BVOA 2N04A 2QWQB 2N05A 2OCHA 1XBLA 1FAFA 1HDJA 2GUZA 3APOA 2GUZB 1NZ6A 3UO2A 2PF4E 2LO1A 2DN9A 4J80A 2YUAA 1BQZA 3AG7A 4RWUA 3APQA 2CUGA 2QWRB 3UCSC 1N4CA 2EJ7A 2Y4UA 4IT5A 2QSAA 1GH6A 2KQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTQ A;  2QWO B;  4J7Z A;  1IUR A;  2LGW A;  3UO3 A;  2Y4T A;  2L6L A;  2M6Y A;  2QWP B;  2CTR A;  2DMX A;  1BQ0 A;  2CTP A;  1FPO A;  2QWN B;  2CTW A;  1WJZ A;  2YS8 A;  3BVO A;  2N04 A;  2QWQ B;  2N05 A;  2OCH A;  1XBL A;  1FAF A;  1HDJ A;  2GUZ A;  3APO A;  2GUZ B;  1NZ6 A;  3UO2 A;  2PF4 E;  2LO1 A;  2DN9 A;  4J80 A;  2YUA A;  1BQZ A;  3AG7 A;  4RWU A;  3APQ A;  2CUG A;  2QWR B;  3UCS C;  1N4C A;  2EJ7 A;  2Y4U A;  4IT5 A;  2QSA A;  1GH6 A;  2KQX A; 
#chains in the Genus database with same CATH topology
 4O2A B;  4AQY O;  3MDS A;  2BCC H;  1NH2 D;  3ZRW A;  3E8G A;  4DV5 O;  2LW7 A;  4RUE A;  1KEC A;  1OCR B;  5J2T B;  3H1L H;  4RQE A;  4JI4 B;  4YIO A;  4JYA B;  1AI7 A;  1OCZ C;  1SES A;  5DED A;  1ZX3 A;  5L3D A;  4OPH A;  1BL8 A;  5CA1 A;  1FXK C;  3FYI B;  1VQ5 V;  1IBK B;  3RYC B;  1IZ3 A;  3OD4 A;  3OEE G;  3E8B A;  4DV7 B;  1G8M A;  2K9P A;  3GWO A;  4XDJ A;  3JAK A;  4X9Q A;  1KMI Z;  4KXR A;  1YIJ V;  1W0K G;  4KUM A;  5KHK A;  1QLE C;  3ZBH A;  3DSQ A;  4LF9 O;  4JI5 O;  4CC5 A;  4JI6 B;  3CCJ V;  1B04 A;  1WP7 A;  2DYS C;  4D7S A;  5IT9 N;  4JI2 O;  2GBO A;  4RWU A;  3I55 V;  5LMN B;  3JD0 A;  2B5U A;  3BRC A;  3QVN A;  3ABL B;  1BT8 A;  4X8A A;  4I50 B;  2GHY A;  4X1Y B;  3OT7 A;  3CRR A;  3SPG A;  3ZJZ A;  3ZRX A;  2V7Q G;  4GKJ B;  1T5E A;  1SKV A;  2Y69 C;  3Q4H B;  3U10 A;  3A0H Z;  1BS3 A;  4UCR A;  4BIO A;  2Y0I A;  4MTF A;  2JGU A;  1TUE B;  1TVK B;  2NN4 A;  1OCR C;  1SA0 A;  3OAA G;  3K58 A;  2F23 A;  1JJO A;  1S0V A;  1GN4 A;  2CAZ C;  3ZED A;  1WB8 A;  2QR4 A;  2A06 H;  3APO A;  2YDE A;  5C8Y A;  2HLD G;  2W6I G;  2KG7 A;  4X1I A;  3AG7 A;  1L0N H;  4PHZ A;  5L3B A;  5EBM C;  4FJC C;  1AI4 A;  4XDL A;  5IJ0 A;  3CHX A;  4B3M O;  4O2A A;  3CCM V;  4FLZ A;  1OZ0 A;  4QIW F;  4CH6 A;  1XL4 A;  2CK3 G;  2UUB B;  5J2T A;  2PGG A;  1KP2 A;  1JQ0 A;  2GUZ A;  4ZI7 B;  4YJ3 B;  2ZM6 O;  1MSD A;  1BMF G;  4TUY B;  3ABL C;  3B4S A;  1X4T A;  3UCS C;  3RYC A;  1MZE A;  2LFR A;  2WPD G;  2Y0P A;  1SER A;  1HWY A;  3K04 A;  4JI2 B;  1D5A A;  1NTZ H;  4JTA B;  3SR2 C;  3B09 A;  2ZNJ A;  1Y76 B;  3D36 C;  3A0R A;  4HZ3 A;  3WFV A;  1N34 B;  4FLT A;  4F4L A;  1I08 A;  2DWE C;  3CP1 A;  4GLX A;  2F66 C;  1XMQ O;  2QWR B;  3LSU A;  1XL6 A;  5FPR A;  1WPX A;  2IM9 A;  5H6R A;  4I50 A;  3SDL A;  4X1Y A;  4H33 A;  3BFR A;  2DMX A;  3EVK A;  2O57 A;  3G6E V;  4BAY A;  3ZHR A;  2YIB D;  1TAE A;  4JYY A;  3Q4H A;  1SC5 B;  2WAM A;  3FAV B;  2B1I A;  4JI0 B;  3ZRV A;  2HHH O;  1LR1 A;  3L70 H;  3X2Q B;  4UCO A;  1TVK A;  3J7A U;  4XDK A;  3E2E A;  3M7M X;  1XNQ O;  4I9Q A;  3T4D A;  2P5O A;  4JAS A;  3EFF K;  4OGQ B;  3OW2 U;  3UQ8 A;  3RYF A;  3LNM B;  3RBZ A;  1SQB H;  2UUA O;  1R1B A;  5L3F A;  3WB0 A;  2ZIN A;  5AG2 A;  4WFE A;  3VOU A;  4MVR A;  3RT3 C;  1NTK H;  4TOI A;  5KHG A;  5K1P A;  4MTG A;  1FJG B;  1HNZ B;  4DV6 B;  3T1H O;  3T1C A;  4XBF A;  3HKB A;  1B6Q A;  5KAI Z;  5LOV B;  5B1B C;  2A79 B;  1K9M W;  2V4D A;  1WAZ A;  2AGA A;  4YJ3 A;  4TUY A;  3ZMV A;  3H9V A;  5EC1 C;  4KP4 A;  1M4U A;  3JYC A;  3IAY A;  3K9S A;  1SRY A;  3G4S V;  1XMQ B;  3RN4 A;  4UCU A;  5LBQ A;  4J7K A;  4NXM B;  2Z3Y A;  5EIB D;  3KCY A;  1N36 O;  4JGS A;  4DV1 B;  2RCV A;  1Y6X A;  4R50 A;  2JDI G;  3X2Q C;  2BTQ B;  4JTD B;  3L72 H;  5L3G A;  2P6J A;  1GN2 A;  1AB3 A;  1HNX O;  2ETN A;  2Q7H A;  3ZHT A;  4LWS A;  1Q8I A;  2PTM A;  4WFG A;  1ARO P;  3ZCC A;  2NNU A;  1P7G A;  3OMA B;  2YUA A;  2FML A;  2YEV B;  1XMO B;  4K3A A;  3K03 A;  1HP8 A;  4MVU A;  1KQS U;  3RYI B;  2CTQ A;  3R66 A;  4ZKI A;  1AR4 A;  1AI5 A;  5CBH A;  1HR0 O;  3L71 H;  2GV9 A;  3H1K H;  2WSS G;  3D8C A;  4O4H B;  4Z1V A;  1ZWI C;  2DE0 X;  2UU9 B;  2R70 A;  1FS0 G;  1FFX A;  3VQX A;  2VWJ A;  1J5E B;  3OTO B;  2F1M A;  3N2K A;  1BHB A;  2RNB A;  3CXC U;  2QWO B;  3K79 A;  1IBL O;  2Q0A A;  2DWD C;  3FB6 C;  2HVK C;  3SYO A;  2WLM A;  5BY1 A;  1JJ2 U;  4LF7 B;  1K97 A;  3M99 B;  1Q6H A;  2X6A A;  4CS4 A;  1XUQ A;  4U3J A;  5LOV A;  4DR3 O;  3R65 A;  2ZE6 A;  2JVD A;  4X66 O;  2AHZ A;  1FD9 A;  1EFR G;  1YI2 V;  5D5P A;  2HJD A;  3K5L A;  3ETG A;  1VQP V;  4BW5 A;  2WLK A;  2UXC B;  5FNV B;  3ZHV A;  4H37 A;  2ZT9 B;  2Y4T A;  2YI9 A;  3N27 A;  4PA6 A;  3IFX A;  2UXD B;  4P9P A;  2JEX A;  3OR6 C;  1ORQ C;  4DR4 O;  2QKS A;  4OX9 O;  4QPK A;  1M1K W;  2HP8 A;  2WA3 A;  3W7T A;  4DV3 B;  1WA8 A;  3N2G A;  4DR1 B;  3E8F A;  5LP6 A;  3ABK B;  3C3S A;  5H9C A;  4FLV A;  1VQK V;  1ROP A;  4GX1 A;  2HG5 C;  3CCL V;  1VQ7 V;  1DLB A;  1HR0 B;  3BA8 A;  3FB8 C;  1HNW O;  1Y4M A;  2A0L A;  2KB1 A;  4DK1 A;  1KBH A;  3OUF A;  5JH7 A;  4NYK A;  1S5H C;  1NR7 A;  4JAV A;  3RYI A;  5HFM A;  1Q81 W;  4FMT A;  4I9W A;  3SYC A;  1JFF B;  3W7U A;  4P9O A;  5B1A B;  3VQW A;  2GDS A;  4O4H A;  3JD3 A;  4JI1 B;  2H8P C;  4IHJ A;  5H2F Z;  1M90 W;  2QDO A;  1KD1 W;  4QE7 A;  4JV5 O;  2YSU B;  2LGW A;  1S77 D;  3DTU B;  2X7R B;  2JGD B;  3TCU A;  5BZB A;  2VQE O;  3M8A A;  2QE7 G;  3OR7 C;  1JR9 A;  4LF4 O;  1SQF A;  2QGN A;  3HB3 B;  3DGE A;  2OCC B;  4R6Z A;  3DXR A;  1UFI A;  1AJQ A;  2ZDI A;  2LJ2 A;  1R6T A;  2YIB A;  2XT9 A;  4DR4 B;  4OX9 B;  5D5Q A;  2IJH A;  4J41 A;  2ADP A;  1MSW D;  3LSS A;  3SYQ A;  4ASU G;  5IYB O;  2FTK A;  1E1R G;  4B3S O;  4LF5 B;  1O9G A;  3ICX A;  2ILM A;  2F4V O;  2DN9 A;  4J11 A;  3HKE B;  4JI3 O;  5JVD A;  3T1Y O;  1N0N A;  2P4V A;  2ZR2 A;  1AVM A;  3P32 A;  3AG3 C;  4EKW A;  4DUY B;  1VP7 A;  1QR9 A;  5B1A C;  2Z5U A;  2M6Y A;  3JAK B;  2EIJ C;  4JI4 O;  2ZQM A;  5CN0 A;  3CRA A;  2IU3 A;  4I5S A;  1J95 A;  1H2K A;  2RQ6 A;  1VEW A;  4MVZ A;  1ENV A;  3KKY A;  5LGT A;  1IBK O;  4WBN B;  1PM9 A;  4DV7 O;  2E74 B;  3G80 A;  2VS0 A;  4IIJ B;  2EIK C;  3C3T A;  2EJ7 A;  1M9N A;  1AR5 A;  4PD4 F;  1BCC H;  3JD1 A;  1YDX A;  2QKA A;  2R9A A;  5LXT A;  2LP7 A;  3WU2 Z;  4JI6 O;  2CDY A;  1MAB G;  3K9A A;  2OCC C;  1YTF D;  4N21 A;  3ZMU A;  4LBE C;  5LMN O;  2L35 A;  3ASN B;  5KX5 B;  1NTM H;  4Q6G A;  5JQG B;  3RW0 A;  3F7V C;  2XAQ A;  1NBM G;  2WA4 A;  1SQQ H;  2HEP A;  3CC2 V;  4CS3 A;  4GKJ O;  1SA0 B;  5J2U B;  5L3E A;  4FM2 A;  2JGD A;  1GMG A;  2QWQ B;  5LGU A;  5IYD O;  3ZMZ A;  3L73 H;  2ZE7 A;  3EHB B;  3ML0 A;  2R72 A;  3ABT A;  4X1I B;  2XHB A;  4LFB B;  2H3O A;  1I5X A;  1NVP B;  5BXZ A;  4LNU B;  1ZTE A;  5IJ0 B;  1GK9 A;  2ZD9 A;  1F51 A;  2Q7E A;  4FFK A;  4E4E A;  5KA6 A;  5JJN B;  2A9H A;  3E86 A;  2ZR3 A;  5IYZ B;  2N04 A;  5B1O A;  3JCZ A;  4CZZ A;  2GUZ B;  1H2S B;  1KB9 F;  2ZIO A;  3SYA A;  3HKE A;  4DR7 B;  1M56 B;  1F7Y A;  3ZX6 A;  3TGU H;  1GM8 A;  2QTO A;  2EIM B;  3E8H A;  4YY3 B;  2UUB O;  4QGP A;  3SPH A;  4JAA A;  4MSW C;  3ASN C;  5IE9 A;  4O2B B;  1D5N A;  2X6C A;  3CRC A;  4WBN A;  1F4N A;  1RP3 B;  5IY5 C;  4U7O A;  1XI1 A;  1M57 C;  1N4C A;  4IIJ A;  2ITC C;  4UVA A;  3ZRS A;  2ZIM A;  2Y48 A;  1N32 B;  3K5O A;  4GX0 A;  2CTW A;  1N34 O;  2YIC A;  1E1Q G;  2JRI A;  1Q7Y W;  3U0Z A;  5KX5 A;  4B3T B;  3LDC A;  5A2Q N;  4ICG A;  5JQG A;  2W6J G;  3H1J H;  1SQG A;  4O4J A;  4E2L A;  1A32 A;  1XEQ A;  5J2U A;  2EX3 A;  3JD2 A;  4PI2 A;  1Z5V A;  1WNS A;  2EIM C;  4ZBM A;  3RYF B;  3CXH F;  4JI0 O;  2C2A A;  4TV9 B;  4TQF A;  3AG2 B;  2BOC C;  1ZSP A;  4MVQ A;  2E75 B;  3JAS B;  3LSQ A;  3VQY A;  4LNU A;  4GCZ A;  3CC4 V;  3MAQ A;  1R6K A;  3OMN B;  5GON B;  4P2Z A;  4GUN A;  3D3Q A;  5IYZ A;  3JAL A;  2D2C B;  1CXZ B;  4U3F H;  3HKB B;  3SJA C;  4MW8 A;  1GM7 A;  1FXV A;  4TT3 G;  1FJG O;  5FPO A;  1HNZ O;  4DV6 O;  3APQ A;  2CUG A;  3QG5 A;  2IU0 A;  2DJV A;  3PJS K;  2F43 G;  4HYO A;  4IT5 A;  5B66 Z;  2P22 C;  1SQP H;  1V55 B;  3J80 N;  3FX7 A;  3JSN A;  1B06 A;  3B8N A;  3UKM A;  1SS3 A;  4FFB A;  5F2V O;  3UT5 A;  1X59 A;  1VAR A;  4O2B A;  4NTY A;  2A7W A;  3T2M A;  4DV0 B;  4UCV A;  4LP8 A;  4DUZ B;  3ABM B;  1SQV H;  2YXY A;  2V1D A;  4WFA V;  4FM1 A;  5KHI A;  1OCC B;  3DC5 A;  2WLI B;  4X1K B;  4J7Z A;  1CP9 A;  4NXM O;  5KLV H;  1P7B A;  3K08 A;  4WFH A;  5CA0 A;  4DV1 O;  4LWS B;  5B1N A;  2XTA A;  2F93 B;  3AG2 C;  3FKS G;  2EZO A;  1SF9 A;  1IXM A;  2Q68 A;  1NKD A;  3ETE A;  2IJJ A;  1GKF A;  5IWA B;  1MG1 A;  4JYC A;  1N33 B;  1H2M A;  1NH2 B;  3FB7 C;  1YXB A;  1LUW A;  3ETD A;  3CJH A;  4NTW A;  3KCX A;  1GO3 F;  4K0K B;  2ZKO A;  3B2E E;  1GM9 A;  2OT5 A;  5K1X A;  4I4T A;  5IYC O;  2NR5 A;  4DYL A;  3K0G A;  3E83 A;  4DV2 B;  3KZI Z;  5IJ9 B;  1XMO O;  2XAH A;  3JAW A;  4G2K A;  3STZ C;  4J9Y B;  4X62 B;  4TV9 A;  1FFX B;  4AIL C;  2E3C A;  5KHJ A;  1KKD A;  1V55 C;  1Y74 A;  4W4K A;  3N2K B;  3JAS A;  3SPJ A;  2R9I A;  1S3J A;  2P4K A;  2EIN B;  4LH7 A;  5A9G A;  5GON A;  2L6L A;  1MZF A;  2UU9 O;  5EBL C;  1XNR B;  1QR8 A;  2BOB C;  3E22 A;  2PY5 A;  3H1I H;  1J5E O;  4U3J B;  2FYU H;  3AG1 B;  3OTO O;  5EK0 A;  1AP6 A;  2ITD C;  3IC7 A;  4DR5 O;  4ZOL A;  1QVG U;  1YCI A;  1V54 B;  1DF5 A;  4EEQ A;  4DV4 B;  4LF7 O;  3RVY A;  1VQM V;  4X20 B;  1NS1 A;  4G27 B;  3RVZ A;  2YI8 A;  1WJZ A;  2PI4 A;  1VMG A;  3JAT B;  1TGO A;  1VF6 A;  4GX5 A;  5LA6 A;  2E5L B;  1F4M A;  1PNK A;  1KC8 W;  1IX9 A;  4HAM A;  1KP3 A;  1R3K C;  1YEW A;  4KHP O;  2UXC O;  1JMK C;  2WLJ A;  2Q0O C;  4UFZ A;  4DRX A;  2FL4 A;  2WLI A;  4X1K A;  3K0D A;  1WA8 B;  1AP5 A;  3N2G B;  5LP6 B;  2UXD O;  1JA8 A;  4ZHQ A;  2QM8 A;  4X65 B;  2AZ2 A;  1VQN V;  4JI7 B;  4GKK O;  3O9O A;  5GTH Z;  4DV3 O;  4DR1 O;  5JH7 B;  2Y4U A;  2WLL B;  2AXT Z;  2QEX V;  2JJ2 G;  3VBB A;  4LFA B;  3BHP A;  2Q73 A;  4IL6 Z;  5IJ9 A;  3LUT B;  4K8X A;  4CH3 A;  4IHJ B;  4LC1 A;  2XND G;  2UXX A;  1IXB A;  2AZ0 A;  2X0L A;  4DR5 B;  3CRM A;  4QNH B;  2G38 A;  1I94 B;  3HR0 A;  3QNE A;  4JI1 O;  2JEU A;  2B9Z A;  5CBF A;  1NU1 H;  3W7W A;  3CCQ V;  1XBL A;  5BMV B;  1THZ A;  1XDC A;  3ASO B;  3K3W A;  4F6E A;  3K59 A;  4WCE V;  3FD9 A;  4L8J A;  3JCU Z;  5FL7 G;  3DXR B;  5LP6 C;  1US6 A;  1OCO B;  2QSA A;  1R3L C;  2JJ1 G;  4X20 A;  4KHP B;  1BQ0 A;  1TA8 A;  2QWP B;  2UXB O;  4X64 B;  4JI8 B;  3JAT A;  1GN6 A;  3CMA V;  5BR8 O;  2RJZ A;  1HW7 A;  1L8D A;  4OPA A;  5JVD B;  2BSK B;  4NKG B;  4GKK B;  4UB6 Z;  3ZN1 A;  4LF5 O;  1YSC A;  2YS8 A;  3U11 A;  4N23 A;  4PDV A;  2DW4 A;  1K8A W;  4DUY O;  3AK2 A;  4D6T H;  1GTO A;  1H8E G;  1NR1 A;  1NQT A;  2ARH A;  1QU7 A;  2WLL A;  4EFE A;  4YXW G;  1BSM A;  5LXT B;  4UCS A;  3MHS C;  4I55 B;  4F6R A;  1IVS A;  1IBM B;  3H1H H;  3P3N A;  5GW7 A;  2B1G A;  3CB2 A;  1OCO C;  3F5T A;  1EZJ A;  4UXN A;  2ZDI C;  3STL C;  2RDC A;  2LFS A;  2EUL A;  2BE3 A;  1YJW V;  3RYH B;  4HNA B;  4PDM A;  2RMK B;  4BR6 A;  2EBO A;  5B3S B;  4ABM A;  1YJ9 V;  2ZXW B;  1NZ6 A;  2PF4 E;  5BMV A;  2UXB B;  4DW1 A;  1VQ6 V;  1TUB B;  5BR8 B;  4JTC B;  2W0F C;  4R7C A;  3ABK C;  5H5N A;  3JSL A;  5LYJ B;  4Z1M G;  4MVS A;  5JJJ B;  1N8R W;  1VQ9 V;  4X89 A;  1FFT B;  4NVP A;  2CH7 B;  1B3Q A;  3O65 A;  4LFB O;  4JYB A;  4UV8 A;  4J80 A;  3CCV V;  4LF8 B;  3CME V;  2OYQ A;  2BSK A;  4DXW A;  1P84 F;  1DGS A;  1GH6 A;  2VQF B;  2PUS A;  2CE4 A;  3OEH G;  3TET A;  4UB8 Z;  2LQT A;  4DR7 O;  1XIL A;  4B3R B;  1VQO V;  3ZHQ A;  1PL4 A;  2ATK C;  3OGC C;  4MS2 A;  5JCO A;  2XOK G;  4BW9 A;  1PL0 A;  4YY3 O;  1D2D A;  5J9P C;  5EIB C;  3CRQ A;  2Q6A A;  1NT2 B;  1FXH A;  3A8T A;  3CE2 A;  1QLN A;  1RPO A;  3TXQ A;  5KAF Z;  4CS2 A;  1PPJ H;  1IUR A;  5LMU B;  2ZXW C;  1P4R A;  4MVO A;  4GT1 A;  2ADQ B;  4I55 A;  1ZL8 A;  5CMU A;  1EN5 A;  5L3C A;  4PA4 A;  3GVM A;  3UO2 A;  3THO A;  4PDL A;  1SQX H;  2GTA A;  4NXN B;  1OCZ B;  1N32 O;  2QA4 V;  2RN9 A;  3K5M A;  3RYH A;  4HNA A;  5KMG A;  4O4J B;  4J9Z B;  2LGQ A;  3CPW U;  2P7T C;  1G6U A;  4FLX A;  4JZ2 A;  4B3T O;  3SGI A;  1K34 A;  2K1E A;  3H01 A;  3WG7 B;  3K06 A;  3QO5 A;  2YID A;  1TUB A;  3WB2 A;  3JAM N;  4LFC B;  3BAB A;  2PYJ A;  2UUC O;  5LYJ A;  3AEI A;  2CH7 A;  3JAL B;  2Q4P A;  4O4L B;  4U7N A;  3ETQ A;  2D3O W;  3CC7 V;  3SJC C;  4TV8 A;  2Y69 B;  2FB5 A;  4R8C A;  1RM1 B;  3OFN G;  3CCR V;  3JAR A;  4JZG A;  4LR3 A;  2P90 A;  2Q8V A;  1RSO B;  2YIA A;  4FFB B;  3UT5 B;  2JS5 A;  3LDD A;  4YHH B;  4AI8 A;  4DR6 O;  5H6Q A;  1R3I C;  3OM3 B;  1EBO A;  2OIG A;  1BE3 H;  5EC2 C;  3DC6 A;  4RAI A;  1ZUQ A;  4DR2 O;  3SPI A;  2HFE C;  5TIS Z;  3WG7 C;  2IW5 A;  2ZNI A;  5CA0 B;  4IGG A;  2DQ0 A;  4DV0 O;  1I7F A;  3SJB C;  4DUZ O;  3BVO A;  3TJT A;  5ITZ B;  2P67 A;  1ZLZ A;  3ZN0 A;  3J81 N;  2DYR B;  1MOF A;  3P30 A;  3CJH B;  1EM1 A;  1FXK A;  4LCU C;  4I4T B;  2Q69 A;  1K73 W;  5IWA O;  2UUC B;  4Z2W A;  2IBZ H;  1N33 O;  1M56 C;  2ZE8 A;  3JAW B;  3B40 A;  4FLW A;  2Z0A A;  2F95 B;  1RM1 C;  3LDE A;  4HBN A;  1Y74 B;  4K0K O;  4PDR A;  3CD6 V;  3BPZ A;  1I0H A;  2GTS A;  1Y66 A;  2QJ1 A;  3B8M A;  4DV2 O;  2YC0 A;  2CTR A;  4IYI A;  2QWN B;  4UV9 A;  4B7K A;  4X62 O;  1U97 A;  2HJF C;  4AQY B;  1ZAU A;  1Q82 W;  3E22 B;  3QF7 A;  2GSM B;  4MTX A;  2OWO A;  4O4L A;  1VQL V;  4DV5 B;  4I7Z B;  1VQ8 V;  1G4Y B;  4EB6 A;  4ZOL B;  5CB4 B;  5CBG A;  2E76 B;  4DR6 B;  3FYE B;  1XNR O;  1YTF B;  3E35 A;  3UM7 A;  1QVF U;  1RSO A;  1LNQ A;  1V9P A;  4JF3 A;  4TWK A;  2DYR C;  3CS5 A;  1BZK A;  4DR2 B;  4PI0 A;  2OTJ V;  1WP8 A;  3CSX A;  2R9R B;  5LA6 B;  3G6B A;  5GTI Z;  5EZY B;  3OTF A;  4DV4 O;  4LF9 B;  1OV9 A;  4JI5 B;  2VWK A;  4DRX B;  1QCE A;  4PV1 B;  2KQX A;  3BA9 A;  4I0X B;  4EFB A;  3F5W C;  3W7S A;  2DQ3 A;  1MMM A;  1R6N A;  2E5L O;  1QHT A;  4ZHQ B;  1HDJ A;  5ITZ A;  5B1B B;  3CEI A;  3K57 A;  1I5Y A;  1VF7 A;  1Z5W A;  1YVW A;  2IH3 C;  1H38 A;  3GWK C;  1BHA A;  2N74 A;  1KU9 A;  2CGO A;  3UO3 A;  4X65 O;  3CYO A;  2P06 A;  4JI7 O;  4QJF B;  1XHX A;  1DF4 A;  1SET A;  1S5J A;  2LO1 A;  4A5U B;  4DK0 A;  1JX9 A;  1FKA O;  1BQZ A;  1QNM A;  5HFL A;  3CCE V;  3D36 A;  3L75 H;  4LFA O;  1S76 D;  3BEH A;  4FLY A;  3ZMS A;  1K5Q A;  1VF6 C;  4H44 B;  1E79 G;  4GYC B;  4UUJ C;  1WLE A;  3AG4 B;  3W7X A;  2EJR A;  3B77 A;  4B3M B;  2JK5 C;  1UJW B;  2Q67 A;  3KG2 A;  3ABM C;  3OUS A;  1XQ8 A;  1PP9 H;  3IGA C;  3SPC A;  1L0L H;  1OCC C;  2X6B A;  2YXL A;  4BIU A;  5CB4 A;  2QM7 A;  4Q20 A;  1I94 O;  2ZM6 B;  3QO8 A;  2PYL A;  1MNG A;  2W0X A;  4KL1 A;  4FM0 A;  2H94 A;  1JCH A;  5KUM A;  1K92 A;  3PN1 A;  2PI5 A;  2FKX A;  4PEL A;  3OGI B;  1W59 A;  1FAF A;  4ZI7 A;  4JPR A;  1LUV A;  5EZY A;  1H2N A;  3GB7 C;  1M93 A;  1CEZ A;  5E1A C;  5DEC A;  5LHH A;  3G71 V;  4O4I B;  4PA3 A;  4RUF A;  4X64 O;  4JI8 O;  4I0X A;  1GAX A;  4K35 A;  4NB5 A;  2Q5Z A;  1PNL A;  1S5L Z;  1PNM A;  1VQ4 V;  3JD4 A;  1H2G A;  1DK1 A;  1PV0 A;  1Y76 A;  1XOU A;  3FB5 C;  4UVC A;  2QM4 A;  3IC9 A;  3HPL C;  5C93 A;  2M7W A;  1YZB A;  2EIN C;  4B08 A;  3AG4 C;  4K8Z A;  3HKC B;  3BCC H;  5JWP A;  1MA1 A;  1K5S A;  2PZS A;  4WF9 V;  1K7D A;  5E79 Z;  2VRZ A;  2HHH B;  1N0J A;  4GZR B;  3AG1 C;  4F6R B;  1QQC A;  2JS3 A;  2KSD A;  4PJ0 Z;  2MW2 B;  3L74 H;  1XNQ B;  1K33 A;  1V54 C;  1URF A;  3FAV A;  4FVM A;  3I5D A;  4UCT A;  3F7Y C;  4OXS A;  1RFY A;  4BIZ A;  3EXA A;  3S3X A;  2UUA B;  1IBM O;  4DO2 A;  1AR1 B;  3CCS V;  1W0J G;  5B5E Z;  2CTP A;  1W2B U;  2QKC A;  5DN6 G;  2N05 A;  3T4Z A;  3T1H B;  3HKD B;  4TQD A;  4RQF A;  1Z2G A;  2HR3 A;  1JVM A;  2IH1 C;  3MHH C;  4P30 A;  3L9D A;  1COW G;  1Q6I A;  2HKO A;  1YIT V;  4CBC A;  1VF5 B;  1KUQ A;  3QTC A;  3QO7 A;  3OMI B;  3CWB H;  5LHI A;  4LF6 O;  4B7E A;  4JAU A;  3SJQ C;  2KKW A;  1IDS A;  1GRJ A;  2Q7G A;  1KYO F;  1M5I A;  1NI8 A;  3OE7 G;  1N36 B;  1F23 A;  4MVM A;  4O4I A;  3RGB A;  3BAA A;  2LW1 A;  3ZS8 C;  4X88 A;  4LH6 A;  1BGY H;  1K3E A;  1QBZ A;  1FPO A;  3ZIA G;  1Y67 A;  2JIZ G;  4LF8 O;  1HNX B;  5EBW C;  1S72 V;  4CC6 A;  1AI6 A;  1EZV H;  1YHQ V;  2BTQ A;  2VQF O;  2XUM A;  4UVB A;  3TK1 A;  2WLH A;  4YIP A;  3HKC A;  3AK1 A;  2HVJ C;  5LL6 Y;  5FLX N;  4B3R O;  4RO2 A;  2EIL B;  1SZX A;  1G1X B;  4W4L A;  1O9H A;  1NVP D;  3ASO C;  1ZL8 B;  4L87 A;  4MTO A;  2ZCE A;  1K4D C;  2WLN A;  4CH5 A;  2XAG A;  2OCH A;  4PA7 A;  4GX2 A;  4H0L B;  2YEV A;  3D3I A;  3VQV A;  1UPG A;  2AW9 A;  5LMU O;  5KMG B;  1Q86 W;  3LNN A;  3CCU V;  4NTX A;  3AG3 B;  5KA5 A;  4J7J A;  1IBL B;  1NJI W;  2EIJ B;  4LF6 B;  4NXN O;  1PKX A;  2MK3 A;  3HKD A;  4TSF G;  2IJK A;  3E89 A;  4DR3 B;  1KKC A;  3ZHU A;  2DOS A;  3S3W A;  4CH4 A;  4X66 B;  2IJI A;  1FYJ A;  1P49 A;  2EIK B;  5EYP B;  2AHY A;  2BTO A;  4FK5 C;  2ZE5 A;  5KHH A;  3K5N A;  5JCO C;  1AJP A;  3P3P A;  4C7U A;  2EZP A;  2OIE A;  4LFC O;  3G67 A;  1R3J C;  3CX5 F;  3ABU A;  3BY6 A;  4TV8 B;  3NR7 A;  2EIL C;  4FZ0 A;  4YJ2 B;  3WB1 A;  1YF2 A;  3JAR B;  5FNV A;  2XAF A;  3RFR A;  3ZRW B;  4FIP C;  3FFQ A;  2ODM A;  1XRE A;  3SYP A;  5IDJ A;  3IJ4 A;  1AJN A;  1EN4 A;  1R73 A;  1RPR A;  3A2F A;  3RWR D;  4H13 B;  1EN6 A;  1PD3 A;  3TXS A;  5CA1 B;  1XHZ A;  3MD0 A;  5LGN A;  1Q90 D;  1WPB A;  5JJE B;  5B3S C;  1HNW B;  4FZ1 A;  4AHC A;  3A0B Z;  1Q3E A;  4J10 A;  4YHH O;  1SZT A;  4JYA O;  1DTO A;  1U96 A;  1VIB A;  4PA9 A;  2XAS A;  4WFF A;  1H8H G;  1OHH G;  3AK3 A;  1Q5O A;  2OTL V;  1WN7 A;  4J42 A;  5KUK A;  1YJN V;  1FXK B;  2UXN A;  2A3Q A;  1L1F A;  1JFF A;  4WFB V;  4JV5 B;  1H2L A;  4MW3 A;  4KFM A;  3C90 A;  5DM6 V;  1AIL A;  3ZMT A;  1GN3 A;  5LHG A;  4FLU A;  1JPX A;  2VQE B;  2QTS A;  4D7T A;  2Q9L A;  1QLE B;  4NR1 A;  4BWA A;  4DW0 A;  4LF4 B;  2DYS B;  4G28 B;  2XAJ A;  4QPJ A;  5IY5 B;  3ZHS A;  4ZIB A;  1M57 B;  2CGN A;  5EYP A;  3I56 V;  1CPY A;  1K4C C;  1Q43 A;  4MT8 A;  4QE9 A;  2WWW A;  1OJH A;  5C8Y B;  4FPP A;  2KG7 B;  5CA3 A;  4IYH A;  4B3S B;  2NLJ C;  4EB6 B;  1WB7 A;  3NXS A;  1Q6U A;  1JOY A;  2F4V B;  2YXH A;  4YJ2 A;  4JI3 B;  3T1Y B; 
#chains in the Genus database with same CATH homology
 2CTQ A;  2QWO B;  4J7Z A;  1IUR A;  2LGW A;  3UO3 A;  2Y4T A;  2L6L A;  2M6Y A;  2QWP B;  2CTR A;  2DMX A;  1BQ0 A;  2CTP A;  1FPO A;  2QWN B;  2CTW A;  1WJZ A;  2YS8 A;  3BVO A;  2N04 A;  2QWQ B;  2N05 A;  2OCH A;  1XBL A;  1FAF A;  1HDJ A;  2GUZ A;  3APO A;  2GUZ B;  1NZ6 A;  3UO2 A;  2PF4 E;  2LO1 A;  2DN9 A;  4J80 A;  2YUA A;  1BQZ A;  3AG7 A;  4RWU A;  3APQ A;  2CUG A;  2QWR B;  3UCS C;  1N4C A;  2EJ7 A;  2Y4U A;  4IT5 A;  2QSA A;  1GH6 A;  2KQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...