4RWUA

J-domain of sis1 protein, hsp40 co-chaperone from saccharomyces cerevisiae
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
81
structure length
81
Chain Sequence
MVKETKLYDLLGVSPSANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQKREIYDQYGLEAARSGGPSFGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Protein SIS1
publication title Roles of intramolecular and intermolecular interactions in functional regulation of the Hsp70 J-protein co-chaperone Sis1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
total genus 30
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2014-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 4rwuA00
2QWNB 4J80A 1FPOA 1N4CA 2L6LA 2LGWA 2LO1A 1HDJA 2PF4E 4J7ZA 1GH6A 1XBLA 4IT5A 2CTQA 2CTRA 2GUZA 3UO3A 2M6YA 2OCHA 2QWRB 3AG7A 3APQA 3APOA 2CTPA 2QSAA 2YUAA 2QWQB 2DMXA 2Y4TA 2CUGA 2KQXA 2Y4UA 3UO2A 2GUZB 2EJ7A 2DN9A 1BQZA 2CTWA 2QWPB 3BVOA 1NZ6A 4RWUA 1BQ0A 2N05A 2N04A 2YS8A 2QWOB 1IURA 3UCSC 1FAFA 1WJZA
chains in the Genus database with same CATH superfamily
2QTSA 4PA7A 3IFXA 5LP6A 1V55C 1ZSPA 5LMNB 1TUBB 3BAAA 3F7VC 1PL0A 5GW7A 4WFGA 1VQ4V 1AP6A 3RW0A 4LH6A 4PDVA 4LF8B 2YIAA 2OCCB 3E8HA 1Q90D 3ASOC 2R70A 4X88A 1FJGO 3IC9A 2LJ2A 4YIPA 2UXCO 2QM8A 1QU7A 3OM3B 1SA0A 3KZIZ 3BRCA 1WA8A 1ROPA 3C3TA 1OCOB 3AG1B 4QPJA 3WG7B 3FAVA 4FFBB 5GONA 2LFRA 2ZD9A 3B40A 1B06A 1G1XB 4MTXA 3I56V 2EZPA 2DJVA 2OCHA 4WFFA 4X65O 5FPOA 3EFFK 3CE2A 3S3WA 3H1JH 5J2UA 4DV5B 3RYFB 1XMQO 2JS3A 4NR1A 3HKDB 2HFEC 2ADQB 3G67A 2KB1A 2YSUB 3SYQA 2AZ2A 2UUBO 3ASNB 4F6RA 4X1IB 2KG7A 3BEHA 1N32O 2HJFC 4JI5O 1OCZB 4OXSA 4RAIA 5L3CA 5IWAO 4LCUC 1NQTA 4DXWA 1SESA 4W4LA 1H8EG 3P3NA 2UXBB 2WLIB 2XAHA 3A2FA 4J80A 3CCUV 1SQQH 3ZHRA 4AQYO 4FZ1A 3CHXA 3TCUA 4XDLA 1DTOA 1BT8A 5KAFZ 2DWEC 3ZIAG 3ABMC 1Q81W 4TQDA 1JFFB 4B7KA 4P9OA 4DV4O 3CXHF 1F51A 2XOKG 1KUQA 2H8PC 1FKAO 4LF7O 1KP3A 5CBGA 4YJ2A 2DQ0A 1N36O 4O4LB 1NJIW 3G6EV 4OX9B 3SPJA 3WB0A 4DYLA 3K3WA 3DXRA 3ZRVA 3ZMUA 2F93B 4DW0A 3CJHB 3G6BA 2EIMB 2ITCC 5H2FZ 2L35A 4B3RO 1M56B 1MNGA 3JYCA 4JI1B 1ZL8B 3E22A 4DRXA 4J41A 1NR7A 1FFXB 3K04A 1H2SB 5LBQA 1GN4A 4PD4F 4R50A 3OTOB 4DR3B 2ZR2A 1XQ8A 4X1YA 2BE3A 1GK9A 4JI0O 2V7QG 4J7JA 2EBOA 1JX9A 2Z3YA 5LMNO 2BOCC 2N04A 3G80A 5KMGB 1MA1A 3BPZA 4U3FH 2L6LA 2LO1A 3P32A 4IHJA 1RSOA 3K5NA 4LF8O 4X20A 1M1KW 3B2EE 3FYEB 5CA1B 3RT3C 4JI3O 1WB7A 2R72A 1OCCB 2FKXA 1AI4A 2V1DA 1K7DA 1KKCA 1V54C 1R3JC 4UUJC 1OCRB 4H13B 1R6NA 4O4IA 3E2EA 5LGUA 1MABG 2E5LB 3K57A 4I0XA 1CXZB 5IE9A 5K1PA 2IU0A 2Q0AA 4TUYB 4J9ZB 2QSAA 3QO7A 3RVZA 3CCJV 1ENVA 5KHJA 2W0XA 5E79Z 3ETGA 2ZE7A 4K8XA 4JASA 5CB4B 2HHHO 3RFRA 1GM9A 1NTZH 2YC0A 4I7ZB 5B1NA 1HNZO 4FZ0A 3L72H 3ABTA 4C7UA 1P4RA 3L70H 1IBMB 2WPDG 4UCSA 4F4LA 3DC5A 1SZXA 4JF3A 4LF5O 2JEXA 5EBLC 4LFBB 1VF5B 2EJRA 1YZBA 1K73W 2GHYA 5EC2C 2A06H 1TVKB 3TGUH 1VIBA 2EIJC 2WAMA 2PF4E 2YXLA 4IT5A 1YI2V 1V55B 2F1MA 1UFIA 5IT9N 5H9CA 5LGNA 3F5TA 3RYCA 1W59A 4JYAB 1E79G 1GM8A 3ASOB 1S5JA 4FJCC 3JSNA 1FYJA 2JGDA 2XUMA 4MTGA 3UO3A 3TXSA 1W0KG 1F4NA 1ZX3A 3SGIA 3TETA 4NXMO 2RJZA 3Q4HA 2KQXA 4JAVA 4NKGB 2XAFA 1I94B 3ZEDA 3QTCA 1K8AW 4O2AB 2B1GA 5DEDA 4ZI7A 3H9VA 3BCCH 5DN6G 4JI8O 1P49A 5LHGA 1WNSA 5IYZA 1LUWA 4D7TA 3HKBA 2CK3G 3K5OA 2ZNIA 5LOVA 4E4EA 4B3SB 4XDKA 2X7RB 2YICA 4B08A 3UO2A 2OIGA 3M7MX 2EJ7A 2IBZH 3ZMVA 1HP8A 4JI4O 2IH3C 4MT8A 4NVPA 4D7SA 1VQNV 1S5HC 1K9MW 1VQPV 1A32A 2OT5A 2Y69C 3B4SA 3BA9A 1Q6UA 4DR3O 4FFKA 3E8GA 1GH6A 5EK0A 2AHYA 2HR3A 3BY6A 3VQXA 3LDDA 4G2KA 5JVDB 2A3QA 4EB6B 4JZ2A 5E1AC 1JMKC 2BSKB 2WLLB 5IDJA 1L8DA 2R9AA 1P7GA 3FFQA 2ZDIA 5EYPB 3THOA 5LL6Y 4XBFA 4YHHB 4KHPO 1Y6XA 4R8CA 1YITV 1HR0B 2QE7G 4HAMA 1Q6IA 3DSQA 5B1BC 4BW9A 2FYUH 3W7SA 5LXTA 4B7EA 3STZC 1PP9H 3I5DA 4I4TB 4DR7O 2YIBD 3CEIA 4JAUA 5B1OA 1XI1A 2QWPB 3CCLV 2XAJA 4HNAB 4IYHA 4JGSA 1ZLZA 2ZE6A 3JAWA 2NNUA 4JI7O 1SQPH 2CTRA 1L1FA 5L3FA 2F4VO 1YDXA 2HVJC 1VQ8V 2BOBC 1DF4A 3MHHC 4DR2O 1VF7A 4N21A 2PI5A 2P4VA 1G4YB 3IAYA 3ZN1A 1XDCA 3ZHUA 1VARA 3H1HH 3ZRWB 3ZMTA 3MDSA 5KHGA 1VQ5V 4LWSB 4DV0B 4LFBO 1AROP 5BZBA 4O4JB 3U10A 1Y74A 1R3LC 3U11A 1YXBA 3CCSV 1QCEA 4I50B 5BMVA 5FL7G 1SKVA 3OW2U 2D2CB 4H0LB 4DV6B 2XNDG 3ETDA 2RCVA 1VQ7V 3WU2Z 3FB8C 4I55A 4JTAB 4TV9B 1I08A 1XBLA 2LFSA 1HNWB 5KHKA 4DV7B 3ZCCA 3SPGA 3OT7A 3WB2A 4UVBA 4LF9O 2DN9A 1GRJA 2B9ZA 1NBMG 2WA3A 5KA5A 3OAAG 4X66B 4CS4A 2QR4A 5LYJA 1CEZA 4JI6O 1KC8W 4O4HA 3K58A 1FPOA 3AG2C 3L9DA 4FLTA 2A0LA 3RYHA 4PA9A 1NS1A 1I94O 1JQ0A 1MZFA 5IJ9B 3D36C 2JS5A 2DYSC 3JAKA 1TA8A 5B3SC 3HR0A 4MS2A 2VQEB 5JJNB 4LBEC 2YI9A 3BA8A 1URFA 1Y67A 3ZHVA 2Q8VA 4LF6B 4FM2A 2QWQB 2NLJC 4FPPA 1SQBH 4DUZB 4LNUA 4DR5B 5LHIA 3TJTA 3ZN0A 2GDSA 4G27B 1GAXA 3QO8A 3B8MA 4NXNO 5FNVB 4TV8B 5EZYA 3NR7A 1EFRG 1VP7A 2IU3A 3K5LA 3E86A 3JCUZ 4GYCB 3CRAA 3K9SA 1P7BA 3SDLA 4WFAV 3OMIB 1NT2B 2CAZC 1BE3H 5B66Z 4CZZA 5L3GA 1HR0O 1G8MA 5JH7A 1TUBA 1PKXA 1UPGA 4TSFG 1THZA 3UT5B 2N74A 1OZ0A 3W7XA 1S0VA 1MMMA 3OUSA 4UV8A 2QDOA 3AEIA 1R73A 1Q6HA 2HEPA 3AK1A 4X89A 4BIOA 2JDIG 3A8TA 2ZE8A 1WB8A 2OTLV 2HG5C 3E35A 1KP2A 3W7TA 2ZE5A 2ZM6B 2AHZA 2WLMA 2UXNA 1US6A 1PNKA 1WP8A 2JK5C 3EHBB 2F66C 1K33A 2QKSA 2Q7HA 1XNQO 3QG5A 3CMEV 2AGAA 1R3IC 4RWUA 1VQ9V 2K9PA 2ZXWC 4LP8A 2Y69B 5TISZ 3RYFA 2UU9O 4BW5A 2UXXA 3JARB 5DECA 1L0LH 4FLUA 4X64O 4K3AA 4UCOA 1XHZA 1BGYH 1S76D 3T1YB 1MSWD 4Z1MG 1GMGA 3FAVB 4DR1O 2YXYA 1ZTEA 1M4UA 4UVCA 1NI8A 4DR6B 4PI2A 5IJ0A 3KCXA 2P22C 4JV5B 5IY5C 1NTKH 1BS3A 4DV1B 1FXKA 1JVMA 2EX3A 2MW2B 1BQZA 2P06A 2WLIA 4B3MO 1B3QA 4ZBMA 1B04A 3HKCB 3JALB 5J2UB 2X6CA 2D3OW 3L74H 1BHBA 4UVAA 3KKYA 2IW5A 2W0FC 3OEEG 1AI7A 2PI4A 4LF4O 1HW7A 1EM1A 5H6RA 4MVQA 1JFFA 2UUAB 1JPXA 1Y76A 2VQEO 4GX2A 4UFZA 1K34A 2HVKC 1Q8IA 4YY3B 1N0JA 4F6EA 1H8HG 4LF6O 1CP9A 1IDSA 4DV3O 4ASUG 4CH4A 4H33A 2CTQA 3FX7A 3ML0A 2CDYA 5ITZB 2CTPA 4DR5O 2DQ3A 1M5IA 4QJFB 4DK0A 3L71H 2WLHA 3ABKC 4KUMA 2P4KA 2JVDA 3CPWU 4ZOLA 3UM7A 1FFXA 4CH5A 4OPAA 5JCOC 1KD1W 2GV9A 3T1HO 4CC6A 1KMIZ 2GUZA 4LFAO 1TAEA 2BTOA 1NVPB 4EFEA 1WPBA 3RWRD 2GSMB 5KMGA 3LUTB 1WAZA 1D5AA 1BMFG 5H5NA 4BAYA 1R1BA 3D3QA 1IBLB 3JASA 3OUFA 3CC4V 5CA1A 5KX5B 3AG2B 5JJJB 4EKWA 3LDEA 1NVPD 4GCZA 2ILMA 2DYSB 4JTCB 2Y48A 2CH7B 3SR2C 5B3SB 5LHHA 4OPHA 4AI8A 2ZM6O 2QWNB 3JD4A 1N4CA 1OV9A 3QF7A 2X0LA 1V9PA 1F4MA 3B8NA 2Q4PA 1BCCH 1XOUA 4X62B 1M93A 5CB4A 1N34B 4IHJB 3BFRA 4NTYA 1H2NA 1K5SA 1DGSA 4TWKA 3TK1A 3H1LH 5LA6B 1I5YA 1M57C 4ZHQB 1H2KA 3CRRA 3M8AA 5J2TB 4IL6Z 4I0XB 2YEVB 4DV5O 2B5UA 3K03A 2RN9A 2WSSG 3ICXA 1EZJA 1YJ9V 1N33B 2ATKC 1TVKA 4K0KB 1YTFB 3R66A 4DR6O 1NH2B 5KAIZ 1YCIA 2N05A 4JAAA 1EZVH 1Y4MA 1S72V 3S3XA 1KBHA 1HNXB 4BR6A 2M7WA 3CRQA 5HFLA 4Q20A 5C8YA 4WF9V 1AI5A 5KLVH 1IX9A 1NKDA 4DR4B 2IJIA 2YDEA 3K59A 1S3JA 4IGGA 2LP7A 4GKJB 2UXBO 1L0NH 4P9PA 1YTFD 4EEQA 1QVFU 4MVUA 4U3JB 1NH2D 3SPIA 3OFNG 3K9AA 3G4SV 2Z5UA 5JQGA 1G6UA 4PDMA 4QIWF 2XHBA 4RQFA 3J7AU 3SYCA 3UQ8A 2NN4A 5EC1C 2EIKC 2DMXA 1AP5A 4UB8Z 1PPJH 2XAQA 4X9QA 1D2DA 1FFTB 1VF6C 1OJHA 2P6JA 1Q43A 4PDRA 1E1QG 4CH6A 4GKKB 3LSQA 4OX9O 3CX5F 1KB9F 1F7YA 2XT9A 2PGGA 2Z0AA 4R7CA 3JATB 5BR8B 5LP6C 4TQFA 2JGDB 3MD0A 1AB3A 4RUFA 2DOSA 1XL6A 1IBKB 1RP3B 1XREA 4FM0A 3SYPA 1BSMA 4B3TB 1JR9A 1VMGA 5GTHZ 3E89A 3IJ4A 3Q4HB 4JI1O 3K79A 2UUCB 4MW3A 2FTKA 5JVDA 4EB6A 1JOYA 3JD2A 2H3OA 3OTOO 2YIBA 4GX0A 2JGUA 5IYBO 4A5UB 1OCOC 4EFBA 2BSKA 5IY5B 3L75H 2QM4A 2DE0X 1AJNA 3H1KH 4H37A 5C93A 1IBLO 4FVMA 1SZTA 2ZINA 3BVOA 5L3DA 2V4DA 2OYQA 4FLXA 1WJZA 2PZSA 4RQEA 1QBZA 4FIPC 4LFCB 3VQWA 1MOFA 3ZRSA 2YUAA 1JJOA 3K06A 3SJQC 2QJ1A 3LNMB 4IIJB 1IVSA 1EN5A 4O2BA 2E5LO 1XNRB 3ABMB 2QWOB 4I9WA 4NTXA 1N34O 1XUQA 1WP7A 4QE9A 3OTFA 2QWRB 2Q0OC 4UCRA 1GN6A 1X59A 5CA0B 1FXKC 2H94A 2P90A 3JCZA 4BWAA 1W2BU 4LWSA 1GKFA 5EBWC 1CPYA 1FS0G 1PL4A 3ABKB 3CC2V 3ZMSA 3SJCC 3HKEB 1IBMO 3T4DA 3JAMN 1FJGB 2PY5A 2NR5A 1Q3EA 1VEWA 3OEHG 2UXCB 1F23A 2EULA 5CA3A 5IYCO 1N33O 4K0KO 1Q5OA 3JD1A 4BIZA 4G28B 1U96A 2RNBA 3IGAC 2JJ2G 1OHHG 4TV9A 3T1CA 1HNXO 5KUKA 2WLJA 2LGQA 1QLNA 4CC5A 5F2VO 3TXQA 4U7OA 2P7TC 2X6AA 3H1IH 1Z5VA 3O65A 3QO5A 4MTFA 4WFEA 2P67A 4JYAO 1IXMA 3X2QC 4GKJO 2G38A 2KSDA 1KYOF 1MZEA 4X65B 4J9YB 3OGIB 1V54B 4YIOA 2KKWA 5BMVB 3F5WC 1XMQB 4TOIA 5IJ9A 2EINC 2UUBB 3H01A 2FMLA 3SYOA 3MHSC 4QE7A 4JZGA 4Q6GA 3W7UA 4JI5B 2E74B 3OMAB 1RM1C 5IWAB 3N2KB 2Q7EA 3STLC 1BQ0A 4UCUA 1EN6A 2ETNA 5AG2A 1WN7A 2ZKOA 3N27A 2XAGA 4XDJA 3CSXA 4B3SO 5LYJB 1IBKO 4B3TO 1LR1A 4O4HB 4AQYB 4RO2A 4WBNB 1SC5B 3AK2A 1JJ2U 4X1KB 1XMOB 3SPHA 2IM9A 3RYIA 2XTAA 2QA4V 2Q68A 3JSLA 4TV8A 4JPRA 2RDCA 4QNHB 5FLXN 1HWYA 4YJ3B 1T5EA 2BTQB 4LF7B 1AJQA 3QNEA 2EIJB 4FLZA 3APQA 3ABLC 1N36B 1TGOA 4KXRA 1QHTA 4ZIBA 2CGOA 3ETEA 1FXHA 4YHHO 1VQKV 4LNUB 3ZX6A 2VRZA 1FAFA 1N0NA 1SQFA 2YIDA 1Q7YW 2PUSA 3CCEV 4NTWA 1DF5A 3GB7C 2OTJV 2EZOA 3PN1A 5IYDO 5BY1A 1DK1A 3ZMZA 2FL4A 1XNRO 4FLVA 2EIKB 4UXNA 3I55V 3HPLC 1NTMH 1M90W 4JI0B 3GVMA 1NR1A 5CN0A 1IURA 2QGNA 3AK3A 1LUVA 2DYRC 3N2GB 2DW4A 5GTIZ 5JH7B 1YF2A 3UKMA 3APOA 4FFBA 1SQVH 5LP6B 1N8RW 1ZWIC 1K4CC 3EVKA 1EBOA 2QM7A 4PA4A 3ZJZA 4JI3B 4W4KA 1VQ6V 3OR7C 4DV0O 1KKDA 3JARA 1GN2A 2Q6AA 2ZR3A 1QLEC 2IJKA 3CP1A 4FLYA 3MAQA 5D5QA 2QEXV 2W6IG 3HKDA 4DV6O 4GX1A 5KHIA 3E8BA 3C90A 5KHHA 1SA0B 3CYOA 3VOUA 1WA8B 4QPKA 1I0HA 1SQXH 2AZ0A 4X1IA 2HHHB 2AXTZ 5GONB 2WLKA 1HNWO 1HDJA 3C3SA 4DV7O 1HNZB 4P2ZA 3T2MA 1AR4A 3OMNB 5B1BB 3HKCA 3JALA 3FB6C 2ZQMA 2Y4TA 4X66O 4LF5B 1MG1A 1Q82W 3K0GA 2CTWA 2FB5A 3B77A 4GZRB 4PHZA 3NXSA 5L3EA 2VWKA 3LDCA 3FD9A 3K0DA 1K97A 3A0RA 5IJ0B 4PI0A 2E76B 2WLNA 4CBCA 4F6RB 3JD0A 2VQFB 1P84F 2KG7B 4U7NA 3E8FA 1FXKB 2GBOA 4MVZA 4NB5A 4O4LA 1K5QA 3RBZA 3CCVV 3SPCA 5ITZA 2ZDIC 2RQ6A 1RPOA 2LQTA 2Q7GA 3SJAC 1PD3A 4OGQB 1XMOO 4FLWA 4L87A 1AVMA 3CJHA 4DUZO 4LR3A 3LSSA 3CS5A 1SF9A 3DC6A 3K08A 1XHXA 4NXMB 1K4DC 1Y76B 4PA3A 4ICGA 2EILC 1ZL8A 1BL8A 5BXZA 4LH7A 3AG4C 2AW9A 4JI8B 4JTDB 4YJ2B 3P3PA 4UV9A 3AG3C 3X2QB 1J5EB 3ZS8C 4CH3A 4KFMA 4ABMA 4MVSA 5KX5A 5EIBC 1H38A 4DV2B 2ZCEA 3DXRB 3QVNA 3ZBHA 4JI4B 2LGWA 3W7WA 4ZOLB 3B09A 1K3EA 4MVOA 3D36A 2EINB 4UCTA 4FM1A 4GX5A 5CBFA 1QNMA 3E22B 4I5SA 2CH7A 3P30A 4DRXB 3CXCU 2CUGA 2GUZB 1KQSU 1GO3F 2MK3A 2O57A 4X1YB 1RM1B 3ZHTA 3VQYA 2HJDA 1NU1H 4TUYA 3JASB 2F95B 3J80N 4LC1A 4KHPB 1B6QA 4WCEV 5LA6A 4HYOA 1RSOB 3CCRV 4X20B 4ZHQA 4DR7B 2F43G 5B1AC 3U0ZA 5J2TA 4JYCA 1R6TA 1S77D 1BHAA 4K8ZA 2YEVA 3R65A 2ODMA 2RMKB 4O4IB 3F7YC 2VWJA 1YEWA 4JI7B 1Z5WA 3ABLB 4DO2A 3T1YO 2F4VB 4K35A 2HKOA 3VBBA 1EN4A 2W6JG 4DR2B 1FXVA 3ETQA 2QTOA 3WB1A 4J10A 1H2LA 2PYJA 1W0JG 1R3KC 4FK5C 2GTAA 5HFMA 4JV5O 3WFVA 4QGPA 4DV1O 3CD6V 3SYAA 2CGNA 2OWOA 2ZT9B 4DK1A 2QKCA 2JRIA 3RVYA 4U3JA 1PM9A 5A9GA 1I7FA 1H2GA 3E83A 2HP8A 1IZ3A 3SJBC 4GUNA 3DTUB 2UUAO 3M99B 2DYRB 2DWDC 2VQFO 3OD4A 2Q67A 1R6KA 3CRCA 4O2AA 1PV0A 5C8YB 4YY3O 3CWBH 5JWPA 3JD3A 5LMUB 1SETA 4LF9B 3ABUA 3RYCB 4MVMA 3JATA 2B1IA 1JCHA 2Q5ZA 1Z2GA 2IH1C 4PELA 5LGTA 4JI6B 2JJ1G 2ZXWB 3IC7A 1QLEB 5JQGB 3FYIB 4JYYA 3A0BZ 1K92A 2OCCC 1DLBA 3RN4A 3CMAV 2OIEA 4PV1B 3L73H 5KA6A 3O9OA 4ZI7B 3ZRXA 2YI8A 2E75B 1J5EO 1SS3A 3LSUA 2PTMA 2IJHA 3CCQV 3GWKC 2WLLA 3AG1C 3WG7C 5IYZB 2ZNJA 5H6QA 3HKBB 5EYPA 4PJ0Z 5L3BA 4DV2O 2ADPA 4D6TH 5LOVB 4MSWC 4DUYB 3HB3B 4JI2B 1YSCA 1AILA 3FKSG 1VQOV 2JIZG 4NXNB 5CBHA 3D3IA 4IIJA 4I4TA 3CC7V 2M6YA 1O9HA 2JEUA 1KECA 1Y66A 1YIJV 2IJJA 4YXWG 4BIUA 4HNAA 2ARHA 4Z1VA 3OR6C 2UXDB 2CE4A 2YS8A 2LW7A 3ASNC 1Q86W 1I5XA 4UB6Z 1GTOA 4J11A 1FD9A 5CA0A 4ZKIA 4X62O 2F23A 1COWG 4L8JA 2XASA 2VS0A 1OCZC 4P30A 1U97A 2X6BA 1SQGA 1D5NA 1SERA 3BABA 2GTSA 2Q9LA 5EBMC 4CS2A 1YJWV 3OE7G 3KCYA 4X8AA 1PNLA 3HKEA 2A7WA 3ZRWA 5LXTB 1MSDA 3LNNA 5JCOA 3KG2A 4MW8A 4MVRA 4O2BB 2EILB 4O4JA 4MTOA 1YHQV 1M9NA 1GN3A 1X4TA 3FB5C 2LW1A 3AG4B 4GT1A 4I50A 2A9HA 3JAWB 4N23A 5CMUA 5D5PA 2WA4A 3AG3B 1WLEA 2Y4UA 1XNQB 4DW1A 2ZIMA 1S5LZ 3GWOA 1AR5A 1J95A 4DR4O 1H2MA 5JJEB 1JA8A 4HZ3A 5A2QN 1ORQC 1QR8A 2UU9B 1TUEB 2EIMC 2Q69A 3OGCC 4X64B 4RUEA 1Y74B 2C2AA 4CS3A 1M56C 4I9QA 1ZAUA 1IXBA 2A79B 5B5EZ 2WWWA 4PDLA 5EIBD 1NZ6A 4KL1A 4AHCA 4DR1B 4Z2WA 4GLXA 3D8CA 1RPRA 1AR1B 3FB7C 3N2KA 4I55B 5LMUO 4UCVA 1N32B 3CCMV 2PYLA 1YVWA 1SRYA 4GKKO 1KU9A 1QVGU 2BCCH 1GM7A 4HBNA 5J9PC 1RFYA 4E2LA 5B1AB 4B3MB 3RGBA 3UCSC 4WBNA 5BR8O 4J7ZA 4X1KA 3EXAA 1M57B 1PNMA 1VQMV 2HLDG 1XL4A 5KUMA 4LF4B 3CB2A 1OCCC 4FMTA 3RYHB 2E3CA 2Q73A 3CRMA 1E1RG 4JYBA 5FNVA 1QQCA 1OCRC 4YJ3A 2UUCO 2BTQA 2R9RB 4AILC 1VQLV 3PJSK 2ITDC 3BHPA 5DM6V 3JAKB 2K1EA 4DV4B 4NYKA 3T4ZA 1YJNV 3J81N 4R6ZA 4TT3G 5K1XA 2P5OA 1ZUQA 4DV3B 3AG7A 4PA6A 1AI6A 5FPRA 1XILA 2ZIOA 2QKAA 4DUYO 1O9GA 4WFBV 4JI2O 3UT5A 3RYIB 3VQVA 4KP4A 1WPXA 4WFHA 4LFCO 2R9IA 1UJWB 2Y0PA 4B3RB 1AJPA 3G71V 1VF6A 1XEQA 3T1HB 5EZYB 3A0HZ 3ZHSA 2UXDO 3DGEA 4LFAB 4J7KA 1BZKA 2Y0IA 4IYIA 1QR9A 3N2GA 2YXHA 1LNQA 3ZHQA 4J42A 4H44B 3K5MA
chains in the Genus database with same CATH topology
2QWNB 4J80A 1FPOA 1N4CA 2L6LA 2LGWA 2LO1A 1HDJA 2PF4E 4J7ZA 1GH6A 1XBLA 4IT5A 2CTQA 2CTRA 2GUZA 3UO3A 2M6YA 2OCHA 2QWRB 3AG7A 3APQA 3APOA 2CTPA 2QSAA 2YUAA 2QWQB 2DMXA 2Y4TA 2CUGA 2KQXA 2Y4UA 3UO2A 2GUZB 2EJ7A 2DN9A 1BQZA 2CTWA 2QWPB 3BVOA 1NZ6A 4RWUA 1BQ0A 2N05A 2N04A 2YS8A 2QWOB 1IURA 3UCSC 1FAFA 1WJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QWN B;  4J80 A;  1FPO A;  1N4C A;  2L6L A;  2LGW A;  2LO1 A;  1HDJ A;  2PF4 E;  4J7Z A;  1GH6 A;  1XBL A;  4IT5 A;  2CTQ A;  2CTR A;  2GUZ A;  3UO3 A;  2M6Y A;  2OCH A;  2QWR B;  3AG7 A;  3APQ A;  3APO A;  2CTP A;  2QSA A;  2YUA A;  2QWQ B;  2DMX A;  2Y4T A;  2CUG A;  2KQX A;  2Y4U A;  3UO2 A;  2GUZ B;  2EJ7 A;  2DN9 A;  1BQZ A;  2CTW A;  2QWP B;  3BVO A;  1NZ6 A;  4RWU A;  1BQ0 A;  2N05 A;  2N04 A;  2YS8 A;  2QWO B;  1IUR A;  3UCS C;  1FAF A;  1WJZ A; 
#chains in the Genus database with same CATH topology
 2QTS A;  4PA7 A;  3IFX A;  5LP6 A;  1V55 C;  1ZSP A;  5LMN B;  1TUB B;  3BAA A;  3F7V C;  1PL0 A;  5GW7 A;  4WFG A;  1VQ4 V;  1AP6 A;  3RW0 A;  4LH6 A;  4PDV A;  4LF8 B;  2YIA A;  2OCC B;  3E8H A;  1Q90 D;  3ASO C;  2R70 A;  4X88 A;  1FJG O;  3IC9 A;  2LJ2 A;  4YIP A;  2UXC O;  2QM8 A;  1QU7 A;  3OM3 B;  1SA0 A;  3KZI Z;  3BRC A;  1WA8 A;  1ROP A;  3C3T A;  1OCO B;  3AG1 B;  4QPJ A;  3WG7 B;  3FAV A;  4FFB B;  5GON A;  2LFR A;  2ZD9 A;  3B40 A;  1B06 A;  1G1X B;  4MTX A;  3I56 V;  2EZP A;  2DJV A;  2OCH A;  4WFF A;  4X65 O;  5FPO A;  3EFF K;  3CE2 A;  3S3W A;  3H1J H;  5J2U A;  4DV5 B;  3RYF B;  1XMQ O;  2JS3 A;  4NR1 A;  3HKD B;  2HFE C;  2ADQ B;  3G67 A;  2KB1 A;  2YSU B;  3SYQ A;  2AZ2 A;  2UUB O;  3ASN B;  4F6R A;  4X1I B;  2KG7 A;  3BEH A;  1N32 O;  2HJF C;  4JI5 O;  1OCZ B;  4OXS A;  4RAI A;  5L3C A;  5IWA O;  4LCU C;  1NQT A;  4DXW A;  1SES A;  4W4L A;  1H8E G;  3P3N A;  2UXB B;  2WLI B;  2XAH A;  3A2F A;  4J80 A;  3CCU V;  1SQQ H;  3ZHR A;  4AQY O;  4FZ1 A;  3CHX A;  3TCU A;  4XDL A;  1DTO A;  1BT8 A;  5KAF Z;  2DWE C;  3ZIA G;  3ABM C;  1Q81 W;  4TQD A;  1JFF B;  4B7K A;  4P9O A;  4DV4 O;  3CXH F;  1F51 A;  2XOK G;  1KUQ A;  2H8P C;  1FKA O;  4LF7 O;  1KP3 A;  5CBG A;  4YJ2 A;  2DQ0 A;  1N36 O;  4O4L B;  1NJI W;  3G6E V;  4OX9 B;  3SPJ A;  3WB0 A;  4DYL A;  3K3W A;  3DXR A;  3ZRV A;  3ZMU A;  2F93 B;  4DW0 A;  3CJH B;  3G6B A;  2EIM B;  2ITC C;  5H2F Z;  2L35 A;  4B3R O;  1M56 B;  1MNG A;  3JYC A;  4JI1 B;  1ZL8 B;  3E22 A;  4DRX A;  4J41 A;  1NR7 A;  1FFX B;  3K04 A;  1H2S B;  5LBQ A;  1GN4 A;  4PD4 F;  4R50 A;  3OTO B;  4DR3 B;  2ZR2 A;  1XQ8 A;  4X1Y A;  2BE3 A;  1GK9 A;  4JI0 O;  2V7Q G;  4J7J A;  2EBO A;  1JX9 A;  2Z3Y A;  5LMN O;  2BOC C;  2N04 A;  3G80 A;  5KMG B;  1MA1 A;  3BPZ A;  4U3F H;  2L6L A;  2LO1 A;  3P32 A;  4IHJ A;  1RSO A;  3K5N A;  4LF8 O;  4X20 A;  1M1K W;  3B2E E;  3FYE B;  5CA1 B;  3RT3 C;  4JI3 O;  1WB7 A;  2R72 A;  1OCC B;  2FKX A;  1AI4 A;  2V1D A;  1K7D A;  1KKC A;  1V54 C;  1R3J C;  4UUJ C;  1OCR B;  4H13 B;  1R6N A;  4O4I A;  3E2E A;  5LGU A;  1MAB G;  2E5L B;  3K57 A;  4I0X A;  1CXZ B;  5IE9 A;  5K1P A;  2IU0 A;  2Q0A A;  4TUY B;  4J9Z B;  2QSA A;  3QO7 A;  3RVZ A;  3CCJ V;  1ENV A;  5KHJ A;  2W0X A;  5E79 Z;  3ETG A;  2ZE7 A;  4K8X A;  4JAS A;  5CB4 B;  2HHH O;  3RFR A;  1GM9 A;  1NTZ H;  2YC0 A;  4I7Z B;  5B1N A;  1HNZ O;  4FZ0 A;  3L72 H;  3ABT A;  4C7U A;  1P4R A;  3L70 H;  1IBM B;  2WPD G;  4UCS A;  4F4L A;  3DC5 A;  1SZX A;  4JF3 A;  4LF5 O;  2JEX A;  5EBL C;  4LFB B;  1VF5 B;  2EJR A;  1YZB A;  1K73 W;  2GHY A;  5EC2 C;  2A06 H;  1TVK B;  3TGU H;  1VIB A;  2EIJ C;  2WAM A;  2PF4 E;  2YXL A;  4IT5 A;  1YI2 V;  1V55 B;  2F1M A;  1UFI A;  5IT9 N;  5H9C A;  5LGN A;  3F5T A;  3RYC A;  1W59 A;  4JYA B;  1E79 G;  1GM8 A;  3ASO B;  1S5J A;  4FJC C;  3JSN A;  1FYJ A;  2JGD A;  2XUM A;  4MTG A;  3UO3 A;  3TXS A;  1W0K G;  1F4N A;  1ZX3 A;  3SGI A;  3TET A;  4NXM O;  2RJZ A;  3Q4H A;  2KQX A;  4JAV A;  4NKG B;  2XAF A;  1I94 B;  3ZED A;  3QTC A;  1K8A W;  4O2A B;  2B1G A;  5DED A;  4ZI7 A;  3H9V A;  3BCC H;  5DN6 G;  4JI8 O;  1P49 A;  5LHG A;  1WNS A;  5IYZ A;  1LUW A;  4D7T A;  3HKB A;  2CK3 G;  3K5O A;  2ZNI A;  5LOV A;  4E4E A;  4B3S B;  4XDK A;  2X7R B;  2YIC A;  4B08 A;  3UO2 A;  2OIG A;  3M7M X;  2EJ7 A;  2IBZ H;  3ZMV A;  1HP8 A;  4JI4 O;  2IH3 C;  4MT8 A;  4NVP A;  4D7S A;  1VQN V;  1S5H C;  1K9M W;  1VQP V;  1A32 A;  2OT5 A;  2Y69 C;  3B4S A;  3BA9 A;  1Q6U A;  4DR3 O;  4FFK A;  3E8G A;  1GH6 A;  5EK0 A;  2AHY A;  2HR3 A;  3BY6 A;  3VQX A;  3LDD A;  4G2K A;  5JVD B;  2A3Q A;  4EB6 B;  4JZ2 A;  5E1A C;  1JMK C;  2BSK B;  2WLL B;  5IDJ A;  1L8D A;  2R9A A;  1P7G A;  3FFQ A;  2ZDI A;  5EYP B;  3THO A;  5LL6 Y;  4XBF A;  4YHH B;  4KHP O;  1Y6X A;  4R8C A;  1YIT V;  1HR0 B;  2QE7 G;  4HAM A;  1Q6I A;  3DSQ A;  5B1B C;  4BW9 A;  2FYU H;  3W7S A;  5LXT A;  4B7E A;  3STZ C;  1PP9 H;  3I5D A;  4I4T B;  4DR7 O;  2YIB D;  3CEI A;  4JAU A;  5B1O A;  1XI1 A;  2QWP B;  3CCL V;  2XAJ A;  4HNA B;  4IYH A;  4JGS A;  1ZLZ A;  2ZE6 A;  3JAW A;  2NNU A;  4JI7 O;  1SQP H;  2CTR A;  1L1F A;  5L3F A;  2F4V O;  1YDX A;  2HVJ C;  1VQ8 V;  2BOB C;  1DF4 A;  3MHH C;  4DR2 O;  1VF7 A;  4N21 A;  2PI5 A;  2P4V A;  1G4Y B;  3IAY A;  3ZN1 A;  1XDC A;  3ZHU A;  1VAR A;  3H1H H;  3ZRW B;  3ZMT A;  3MDS A;  5KHG A;  1VQ5 V;  4LWS B;  4DV0 B;  4LFB O;  1ARO P;  5BZB A;  4O4J B;  3U10 A;  1Y74 A;  1R3L C;  3U11 A;  1YXB A;  3CCS V;  1QCE A;  4I50 B;  5BMV A;  5FL7 G;  1SKV A;  3OW2 U;  2D2C B;  4H0L B;  4DV6 B;  2XND G;  3ETD A;  2RCV A;  1VQ7 V;  3WU2 Z;  3FB8 C;  4I55 A;  4JTA B;  4TV9 B;  1I08 A;  1XBL A;  2LFS A;  1HNW B;  5KHK A;  4DV7 B;  3ZCC A;  3SPG A;  3OT7 A;  3WB2 A;  4UVB A;  4LF9 O;  2DN9 A;  1GRJ A;  2B9Z A;  1NBM G;  2WA3 A;  5KA5 A;  3OAA G;  4X66 B;  4CS4 A;  2QR4 A;  5LYJ A;  1CEZ A;  4JI6 O;  1KC8 W;  4O4H A;  3K58 A;  1FPO A;  3AG2 C;  3L9D A;  4FLT A;  2A0L A;  3RYH A;  4PA9 A;  1NS1 A;  1I94 O;  1JQ0 A;  1MZF A;  5IJ9 B;  3D36 C;  2JS5 A;  2DYS C;  3JAK A;  1TA8 A;  5B3S C;  3HR0 A;  4MS2 A;  2VQE B;  5JJN B;  4LBE C;  2YI9 A;  3BA8 A;  1URF A;  1Y67 A;  3ZHV A;  2Q8V A;  4LF6 B;  4FM2 A;  2QWQ B;  2NLJ C;  4FPP A;  1SQB H;  4DUZ B;  4LNU A;  4DR5 B;  5LHI A;  3TJT A;  3ZN0 A;  2GDS A;  4G27 B;  1GAX A;  3QO8 A;  3B8M A;  4NXN O;  5FNV B;  4TV8 B;  5EZY A;  3NR7 A;  1EFR G;  1VP7 A;  2IU3 A;  3K5L A;  3E86 A;  3JCU Z;  4GYC B;  3CRA A;  3K9S A;  1P7B A;  3SDL A;  4WFA V;  3OMI B;  1NT2 B;  2CAZ C;  1BE3 H;  5B66 Z;  4CZZ A;  5L3G A;  1HR0 O;  1G8M A;  5JH7 A;  1TUB A;  1PKX A;  1UPG A;  4TSF G;  1THZ A;  3UT5 B;  2N74 A;  1OZ0 A;  3W7X A;  1S0V A;  1MMM A;  3OUS A;  4UV8 A;  2QDO A;  3AEI A;  1R73 A;  1Q6H A;  2HEP A;  3AK1 A;  4X89 A;  4BIO A;  2JDI G;  3A8T A;  2ZE8 A;  1WB8 A;  2OTL V;  2HG5 C;  3E35 A;  1KP2 A;  3W7T A;  2ZE5 A;  2ZM6 B;  2AHZ A;  2WLM A;  2UXN A;  1US6 A;  1PNK A;  1WP8 A;  2JK5 C;  3EHB B;  2F66 C;  1K33 A;  2QKS A;  2Q7H A;  1XNQ O;  3QG5 A;  3CME V;  2AGA A;  1R3I C;  4RWU A;  1VQ9 V;  2K9P A;  2ZXW C;  4LP8 A;  2Y69 B;  5TIS Z;  3RYF A;  2UU9 O;  4BW5 A;  2UXX A;  3JAR B;  5DEC A;  1L0L H;  4FLU A;  4X64 O;  4K3A A;  4UCO A;  1XHZ A;  1BGY H;  1S76 D;  3T1Y B;  1MSW D;  4Z1M G;  1GMG A;  3FAV B;  4DR1 O;  2YXY A;  1ZTE A;  1M4U A;  4UVC A;  1NI8 A;  4DR6 B;  4PI2 A;  5IJ0 A;  3KCX A;  2P22 C;  4JV5 B;  5IY5 C;  1NTK H;  1BS3 A;  4DV1 B;  1FXK A;  1JVM A;  2EX3 A;  2MW2 B;  1BQZ A;  2P06 A;  2WLI A;  4B3M O;  1B3Q A;  4ZBM A;  1B04 A;  3HKC B;  3JAL B;  5J2U B;  2X6C A;  2D3O W;  3L74 H;  1BHB A;  4UVA A;  3KKY A;  2IW5 A;  2W0F C;  3OEE G;  1AI7 A;  2PI4 A;  4LF4 O;  1HW7 A;  1EM1 A;  5H6R A;  4MVQ A;  1JFF A;  2UUA B;  1JPX A;  1Y76 A;  2VQE O;  4GX2 A;  4UFZ A;  1K34 A;  2HVK C;  1Q8I A;  4YY3 B;  1N0J A;  4F6E A;  1H8H G;  4LF6 O;  1CP9 A;  1IDS A;  4DV3 O;  4ASU G;  4CH4 A;  4H33 A;  2CTQ A;  3FX7 A;  3ML0 A;  2CDY A;  5ITZ B;  2CTP A;  4DR5 O;  2DQ3 A;  1M5I A;  4QJF B;  4DK0 A;  3L71 H;  2WLH A;  3ABK C;  4KUM A;  2P4K A;  2JVD A;  3CPW U;  4ZOL A;  3UM7 A;  1FFX A;  4CH5 A;  4OPA A;  5JCO C;  1KD1 W;  2GV9 A;  3T1H O;  4CC6 A;  1KMI Z;  2GUZ A;  4LFA O;  1TAE A;  2BTO A;  1NVP B;  4EFE A;  1WPB A;  3RWR D;  2GSM B;  5KMG A;  3LUT B;  1WAZ A;  1D5A A;  1BMF G;  5H5N A;  4BAY A;  1R1B A;  3D3Q A;  1IBL B;  3JAS A;  3OUF A;  3CC4 V;  5CA1 A;  5KX5 B;  3AG2 B;  5JJJ B;  4EKW A;  3LDE A;  1NVP D;  4GCZ A;  2ILM A;  2DYS B;  4JTC B;  2Y48 A;  2CH7 B;  3SR2 C;  5B3S B;  5LHH A;  4OPH A;  4AI8 A;  2ZM6 O;  2QWN B;  3JD4 A;  1N4C A;  1OV9 A;  3QF7 A;  2X0L A;  1V9P A;  1F4M A;  3B8N A;  2Q4P A;  1BCC H;  1XOU A;  4X62 B;  1M93 A;  5CB4 A;  1N34 B;  4IHJ B;  3BFR A;  4NTY A;  1H2N A;  1K5S A;  1DGS A;  4TWK A;  3TK1 A;  3H1L H;  5LA6 B;  1I5Y A;  1M57 C;  4ZHQ B;  1H2K A;  3CRR A;  3M8A A;  5J2T B;  4IL6 Z;  4I0X B;  2YEV B;  4DV5 O;  2B5U A;  3K03 A;  2RN9 A;  2WSS G;  3ICX A;  1EZJ A;  1YJ9 V;  1N33 B;  2ATK C;  1TVK A;  4K0K B;  1YTF B;  3R66 A;  4DR6 O;  1NH2 B;  5KAI Z;  1YCI A;  2N05 A;  4JAA A;  1EZV H;  1Y4M A;  1S72 V;  3S3X A;  1KBH A;  1HNX B;  4BR6 A;  2M7W A;  3CRQ A;  5HFL A;  4Q20 A;  5C8Y A;  4WF9 V;  1AI5 A;  5KLV H;  1IX9 A;  1NKD A;  4DR4 B;  2IJI A;  2YDE A;  3K59 A;  1S3J A;  4IGG A;  2LP7 A;  4GKJ B;  2UXB O;  1L0N H;  4P9P A;  1YTF D;  4EEQ A;  1QVF U;  4MVU A;  4U3J B;  1NH2 D;  3SPI A;  3OFN G;  3K9A A;  3G4S V;  2Z5U A;  5JQG A;  1G6U A;  4PDM A;  4QIW F;  2XHB A;  4RQF A;  3J7A U;  3SYC A;  3UQ8 A;  2NN4 A;  5EC1 C;  2EIK C;  2DMX A;  1AP5 A;  4UB8 Z;  1PPJ H;  2XAQ A;  4X9Q A;  1D2D A;  1FFT B;  1VF6 C;  1OJH A;  2P6J A;  1Q43 A;  4PDR A;  1E1Q G;  4CH6 A;  4GKK B;  3LSQ A;  4OX9 O;  3CX5 F;  1KB9 F;  1F7Y A;  2XT9 A;  2PGG A;  2Z0A A;  4R7C A;  3JAT B;  5BR8 B;  5LP6 C;  4TQF A;  2JGD B;  3MD0 A;  1AB3 A;  4RUF A;  2DOS A;  1XL6 A;  1IBK B;  1RP3 B;  1XRE A;  4FM0 A;  3SYP A;  1BSM A;  4B3T B;  1JR9 A;  1VMG A;  5GTH Z;  3E89 A;  3IJ4 A;  3Q4H B;  4JI1 O;  3K79 A;  2UUC B;  4MW3 A;  2FTK A;  5JVD A;  4EB6 A;  1JOY A;  3JD2 A;  2H3O A;  3OTO O;  2YIB A;  4GX0 A;  2JGU A;  5IYB O;  4A5U B;  1OCO C;  4EFB A;  2BSK A;  5IY5 B;  3L75 H;  2QM4 A;  2DE0 X;  1AJN A;  3H1K H;  4H37 A;  5C93 A;  1IBL O;  4FVM A;  1SZT A;  2ZIN A;  3BVO A;  5L3D A;  2V4D A;  2OYQ A;  4FLX A;  1WJZ A;  2PZS A;  4RQE A;  1QBZ A;  4FIP C;  4LFC B;  3VQW A;  1MOF A;  3ZRS A;  2YUA A;  1JJO A;  3K06 A;  3SJQ C;  2QJ1 A;  3LNM B;  4IIJ B;  1IVS A;  1EN5 A;  4O2B A;  2E5L O;  1XNR B;  3ABM B;  2QWO B;  4I9W A;  4NTX A;  1N34 O;  1XUQ A;  1WP7 A;  4QE9 A;  3OTF A;  2QWR B;  2Q0O C;  4UCR A;  1GN6 A;  1X59 A;  5CA0 B;  1FXK C;  2H94 A;  2P90 A;  3JCZ A;  4BWA A;  1W2B U;  4LWS A;  1GKF A;  5EBW C;  1CPY A;  1FS0 G;  1PL4 A;  3ABK B;  3CC2 V;  3ZMS A;  3SJC C;  3HKE B;  1IBM O;  3T4D A;  3JAM N;  1FJG B;  2PY5 A;  2NR5 A;  1Q3E A;  1VEW A;  3OEH G;  2UXC B;  1F23 A;  2EUL A;  5CA3 A;  5IYC O;  1N33 O;  4K0K O;  1Q5O A;  3JD1 A;  4BIZ A;  4G28 B;  1U96 A;  2RNB A;  3IGA C;  2JJ2 G;  1OHH G;  4TV9 A;  3T1C A;  1HNX O;  5KUK A;  2WLJ A;  2LGQ A;  1QLN A;  4CC5 A;  5F2V O;  3TXQ A;  4U7O A;  2P7T C;  2X6A A;  3H1I H;  1Z5V A;  3O65 A;  3QO5 A;  4MTF A;  4WFE A;  2P67 A;  4JYA O;  1IXM A;  3X2Q C;  4GKJ O;  2G38 A;  2KSD A;  1KYO F;  1MZE A;  4X65 B;  4J9Y B;  3OGI B;  1V54 B;  4YIO A;  2KKW A;  5BMV B;  3F5W C;  1XMQ B;  4TOI A;  5IJ9 A;  2EIN C;  2UUB B;  3H01 A;  2FML A;  3SYO A;  3MHS C;  4QE7 A;  4JZG A;  4Q6G A;  3W7U A;  4JI5 B;  2E74 B;  3OMA B;  1RM1 C;  5IWA B;  3N2K B;  2Q7E A;  3STL C;  1BQ0 A;  4UCU A;  1EN6 A;  2ETN A;  5AG2 A;  1WN7 A;  2ZKO A;  3N27 A;  2XAG A;  4XDJ A;  3CSX A;  4B3S O;  5LYJ B;  1IBK O;  4B3T O;  1LR1 A;  4O4H B;  4AQY B;  4RO2 A;  4WBN B;  1SC5 B;  3AK2 A;  1JJ2 U;  4X1K B;  1XMO B;  3SPH A;  2IM9 A;  3RYI A;  2XTA A;  2QA4 V;  2Q68 A;  3JSL A;  4TV8 A;  4JPR A;  2RDC A;  4QNH B;  5FLX N;  1HWY A;  4YJ3 B;  1T5E A;  2BTQ B;  4LF7 B;  1AJQ A;  3QNE A;  2EIJ B;  4FLZ A;  3APQ A;  3ABL C;  1N36 B;  1TGO A;  4KXR A;  1QHT A;  4ZIB A;  2CGO A;  3ETE A;  1FXH A;  4YHH O;  1VQK V;  4LNU B;  3ZX6 A;  2VRZ A;  1FAF A;  1N0N A;  1SQF A;  2YID A;  1Q7Y W;  2PUS A;  3CCE V;  4NTW A;  1DF5 A;  3GB7 C;  2OTJ V;  2EZO A;  3PN1 A;  5IYD O;  5BY1 A;  1DK1 A;  3ZMZ A;  2FL4 A;  1XNR O;  4FLV A;  2EIK B;  4UXN A;  3I55 V;  3HPL C;  1NTM H;  1M90 W;  4JI0 B;  3GVM A;  1NR1 A;  5CN0 A;  1IUR A;  2QGN A;  3AK3 A;  1LUV A;  2DYR C;  3N2G B;  2DW4 A;  5GTI Z;  5JH7 B;  1YF2 A;  3UKM A;  3APO A;  4FFB A;  1SQV H;  5LP6 B;  1N8R W;  1ZWI C;  1K4C C;  3EVK A;  1EBO A;  2QM7 A;  4PA4 A;  3ZJZ A;  4JI3 B;  4W4K A;  1VQ6 V;  3OR7 C;  4DV0 O;  1KKD A;  3JAR A;  1GN2 A;  2Q6A A;  2ZR3 A;  1QLE C;  2IJK A;  3CP1 A;  4FLY A;  3MAQ A;  5D5Q A;  2QEX V;  2W6I G;  3HKD A;  4DV6 O;  4GX1 A;  5KHI A;  3E8B A;  3C90 A;  5KHH A;  1SA0 B;  3CYO A;  3VOU A;  1WA8 B;  4QPK A;  1I0H A;  1SQX H;  2AZ0 A;  4X1I A;  2HHH B;  2AXT Z;  5GON B;  2WLK A;  1HNW O;  1HDJ A;  3C3S A;  4DV7 O;  1HNZ B;  4P2Z A;  3T2M A;  1AR4 A;  3OMN B;  5B1B B;  3HKC A;  3JAL A;  3FB6 C;  2ZQM A;  2Y4T A;  4X66 O;  4LF5 B;  1MG1 A;  1Q82 W;  3K0G A;  2CTW A;  2FB5 A;  3B77 A;  4GZR B;  4PHZ A;  3NXS A;  5L3E A;  2VWK A;  3LDC A;  3FD9 A;  3K0D A;  1K97 A;  3A0R A;  5IJ0 B;  4PI0 A;  2E76 B;  2WLN A;  4CBC A;  4F6R B;  3JD0 A;  2VQF B;  1P84 F;  2KG7 B;  4U7N A;  3E8F A;  1FXK B;  2GBO A;  4MVZ A;  4NB5 A;  4O4L A;  1K5Q A;  3RBZ A;  3CCV V;  3SPC A;  5ITZ A;  2ZDI C;  2RQ6 A;  1RPO A;  2LQT A;  2Q7G A;  3SJA C;  1PD3 A;  4OGQ B;  1XMO O;  4FLW A;  4L87 A;  1AVM A;  3CJH A;  4DUZ O;  4LR3 A;  3LSS A;  3CS5 A;  1SF9 A;  3DC6 A;  3K08 A;  1XHX A;  4NXM B;  1K4D C;  1Y76 B;  4PA3 A;  4ICG A;  2EIL C;  1ZL8 A;  1BL8 A;  5BXZ A;  4LH7 A;  3AG4 C;  2AW9 A;  4JI8 B;  4JTD B;  4YJ2 B;  3P3P A;  4UV9 A;  3AG3 C;  3X2Q B;  1J5E B;  3ZS8 C;  4CH3 A;  4KFM A;  4ABM A;  4MVS A;  5KX5 A;  5EIB C;  1H38 A;  4DV2 B;  2ZCE A;  3DXR B;  3QVN A;  3ZBH A;  4JI4 B;  2LGW A;  3W7W A;  4ZOL B;  3B09 A;  1K3E A;  4MVO A;  3D36 A;  2EIN B;  4UCT A;  4FM1 A;  4GX5 A;  5CBF A;  1QNM A;  3E22 B;  4I5S A;  2CH7 A;  3P30 A;  4DRX B;  3CXC U;  2CUG A;  2GUZ B;  1KQS U;  1GO3 F;  2MK3 A;  2O57 A;  4X1Y B;  1RM1 B;  3ZHT A;  3VQY A;  2HJD A;  1NU1 H;  4TUY A;  3JAS B;  2F95 B;  3J80 N;  4LC1 A;  4KHP B;  1B6Q A;  4WCE V;  5LA6 A;  4HYO A;  1RSO B;  3CCR V;  4X20 B;  4ZHQ A;  4DR7 B;  2F43 G;  5B1A C;  3U0Z A;  5J2T A;  4JYC A;  1R6T A;  1S77 D;  1BHA A;  4K8Z A;  2YEV A;  3R65 A;  2ODM A;  2RMK B;  4O4I B;  3F7Y C;  2VWJ A;  1YEW A;  4JI7 B;  1Z5W A;  3ABL B;  4DO2 A;  3T1Y O;  2F4V B;  4K35 A;  2HKO A;  3VBB A;  1EN4 A;  2W6J G;  4DR2 B;  1FXV A;  3ETQ A;  2QTO A;  3WB1 A;  4J10 A;  1H2L A;  2PYJ A;  1W0J G;  1R3K C;  4FK5 C;  2GTA A;  5HFM A;  4JV5 O;  3WFV A;  4QGP A;  4DV1 O;  3CD6 V;  3SYA A;  2CGN A;  2OWO A;  2ZT9 B;  4DK1 A;  2QKC A;  2JRI A;  3RVY A;  4U3J A;  1PM9 A;  5A9G A;  1I7F A;  1H2G A;  3E83 A;  2HP8 A;  1IZ3 A;  3SJB C;  4GUN A;  3DTU B;  2UUA O;  3M99 B;  2DYR B;  2DWD C;  2VQF O;  3OD4 A;  2Q67 A;  1R6K A;  3CRC A;  4O2A A;  1PV0 A;  5C8Y B;  4YY3 O;  3CWB H;  5JWP A;  3JD3 A;  5LMU B;  1SET A;  4LF9 B;  3ABU A;  3RYC B;  4MVM A;  3JAT A;  2B1I A;  1JCH A;  2Q5Z A;  1Z2G A;  2IH1 C;  4PEL A;  5LGT A;  4JI6 B;  2JJ1 G;  2ZXW B;  3IC7 A;  1QLE B;  5JQG B;  3FYI B;  4JYY A;  3A0B Z;  1K92 A;  2OCC C;  1DLB A;  3RN4 A;  3CMA V;  2OIE A;  4PV1 B;  3L73 H;  5KA6 A;  3O9O A;  4ZI7 B;  3ZRX A;  2YI8 A;  2E75 B;  1J5E O;  1SS3 A;  3LSU A;  2PTM A;  2IJH A;  3CCQ V;  3GWK C;  2WLL A;  3AG1 C;  3WG7 C;  5IYZ B;  2ZNJ A;  5H6Q A;  3HKB B;  5EYP A;  4PJ0 Z;  5L3B A;  4DV2 O;  2ADP A;  4D6T H;  5LOV B;  4MSW C;  4DUY B;  3HB3 B;  4JI2 B;  1YSC A;  1AIL A;  3FKS G;  1VQO V;  2JIZ G;  4NXN B;  5CBH A;  3D3I A;  4IIJ A;  4I4T A;  3CC7 V;  2M6Y A;  1O9H A;  2JEU A;  1KEC A;  1Y66 A;  1YIJ V;  2IJJ A;  4YXW G;  4BIU A;  4HNA A;  2ARH A;  4Z1V A;  3OR6 C;  2UXD B;  2CE4 A;  2YS8 A;  2LW7 A;  3ASN C;  1Q86 W;  1I5X A;  4UB6 Z;  1GTO A;  4J11 A;  1FD9 A;  5CA0 A;  4ZKI A;  4X62 O;  2F23 A;  1COW G;  4L8J A;  2XAS A;  2VS0 A;  1OCZ C;  4P30 A;  1U97 A;  2X6B A;  1SQG A;  1D5N A;  1SER A;  3BAB A;  2GTS A;  2Q9L A;  5EBM C;  4CS2 A;  1YJW V;  3OE7 G;  3KCY A;  4X8A A;  1PNL A;  3HKE A;  2A7W A;  3ZRW A;  5LXT B;  1MSD A;  3LNN A;  5JCO A;  3KG2 A;  4MW8 A;  4MVR A;  4O2B B;  2EIL B;  4O4J A;  4MTO A;  1YHQ V;  1M9N A;  1GN3 A;  1X4T A;  3FB5 C;  2LW1 A;  3AG4 B;  4GT1 A;  4I50 A;  2A9H A;  3JAW B;  4N23 A;  5CMU A;  5D5P A;  2WA4 A;  3AG3 B;  1WLE A;  2Y4U A;  1XNQ B;  4DW1 A;  2ZIM A;  1S5L Z;  3GWO A;  1AR5 A;  1J95 A;  4DR4 O;  1H2M A;  5JJE B;  1JA8 A;  4HZ3 A;  5A2Q N;  1ORQ C;  1QR8 A;  2UU9 B;  1TUE B;  2EIM C;  2Q69 A;  3OGC C;  4X64 B;  4RUE A;  1Y74 B;  2C2A A;  4CS3 A;  1M56 C;  4I9Q A;  1ZAU A;  1IXB A;  2A79 B;  5B5E Z;  2WWW A;  4PDL A;  5EIB D;  1NZ6 A;  4KL1 A;  4AHC A;  4DR1 B;  4Z2W A;  4GLX A;  3D8C A;  1RPR A;  1AR1 B;  3FB7 C;  3N2K A;  4I55 B;  5LMU O;  4UCV A;  1N32 B;  3CCM V;  2PYL A;  1YVW A;  1SRY A;  4GKK O;  1KU9 A;  1QVG U;  2BCC H;  1GM7 A;  4HBN A;  5J9P C;  1RFY A;  4E2L A;  5B1A B;  4B3M B;  3RGB A;  3UCS C;  4WBN A;  5BR8 O;  4J7Z A;  4X1K A;  3EXA A;  1M57 B;  1PNM A;  1VQM V;  2HLD G;  1XL4 A;  5KUM A;  4LF4 B;  3CB2 A;  1OCC C;  4FMT A;  3RYH B;  2E3C A;  2Q73 A;  3CRM A;  1E1R G;  4JYB A;  5FNV A;  1QQC A;  1OCR C;  4YJ3 A;  2UUC O;  2BTQ A;  2R9R B;  4AIL C;  1VQL V;  3PJS K;  2ITD C;  3BHP A;  5DM6 V;  3JAK B;  2K1E A;  4DV4 B;  4NYK A;  3T4Z A;  1YJN V;  3J81 N;  4R6Z A;  4TT3 G;  5K1X A;  2P5O A;  1ZUQ A;  4DV3 B;  3AG7 A;  4PA6 A;  1AI6 A;  5FPR A;  1XIL A;  2ZIO A;  2QKA A;  4DUY O;  1O9G A;  4WFB V;  4JI2 O;  3UT5 A;  3RYI B;  3VQV A;  4KP4 A;  1WPX A;  4WFH A;  4LFC O;  2R9I A;  1UJW B;  2Y0P A;  4B3R B;  1AJP A;  3G71 V;  1VF6 A;  1XEQ A;  3T1H B;  5EZY B;  3A0H Z;  3ZHS A;  2UXD O;  3DGE A;  4LFA B;  4J7K A;  1BZK A;  2Y0I A;  4IYI A;  1QR9 A;  3N2G A;  2YXH A;  1LNQ A;  3ZHQ A;  4J42 A;  4H44 B;  3K5M A; 
#chains in the Genus database with same CATH homology
 2QWN B;  4J80 A;  1FPO A;  1N4C A;  2L6L A;  2LGW A;  2LO1 A;  1HDJ A;  2PF4 E;  4J7Z A;  1GH6 A;  1XBL A;  4IT5 A;  2CTQ A;  2CTR A;  2GUZ A;  3UO3 A;  2M6Y A;  2OCH A;  2QWR B;  3AG7 A;  3APQ A;  3APO A;  2CTP A;  2QSA A;  2YUA A;  2QWQ B;  2DMX A;  2Y4T A;  2CUG A;  2KQX A;  2Y4U A;  3UO2 A;  2GUZ B;  2EJ7 A;  2DN9 A;  1BQZ A;  2CTW A;  2QWP B;  3BVO A;  1NZ6 A;  4RWU A;  1BQ0 A;  2N05 A;  2N04 A;  2YS8 A;  2QWO B;  1IUR A;  3UCS C;  1FAF A;  1WJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...