4NR1A

Factor inhibiting hif-1 alpha in complex with consensus ankyrin repeat domain-(d)allyl-gly peptide
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
335
structure length
335
Chain Sequence
b'EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
publication title Structure of an oxygenase in complex with substrate
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 106
structure length 335
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2013-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4nr1A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4nr1A01
2WA3A 4QU2A 1MZEA 1H2LA 2YC0A 1H2NA 3KCXA 1H2KA 5JWPA 4BIOA 4Z2WA 3D8CA 2YDEA 2XUMA 1H2MA 4NR1A 4JAAA 1MZFA 1YCIA 3P3PA 4B7EA 2Y0IA 4Z1VA 1IZ3A 2CGNA 4AI8A 3OD4A 2CGOA 2W0XA 4B7KA 2WA4A 2ILMA 3P3NA 3KCYA
chains in the Genus database with same CATH superfamily
4NHLA 5FZ4A 3CJXA 4X1KB 1PMIA 1FS0G 1UPIA 4TV9B 3N9NA 3RYFA 3HPLC 3WG4A 3EQEA 3SH4A 1NAEA 4MHRA 3CCJV 1N33O 2VCBA 4GXLA 5C9AC 1FJGO 1CAWB 1IURA 1F4NA 4A6OA 4QQOA 3CRAA 4Y1ZA 1VARA 4RA0A 4TYSA 3I59A 1GM9A 4LKEA 2XDVA 4OUSA 2VBBA 2YV8A 1Q43A 1MS1A 1Z7S2 3GBGA 3SLIA 2IBZH 2VUCA 3WNOA 5FY8A 5B1NA 3F2ZA 4UV8A 4MGZE 3WF1A 5HCFA 3KVAA 5JSPA 1MA1A 1BMV2 4GX0A 2BYVE 2RR13 3IIIA 4C8DA 1RHI3 1W9WA 1YSCA 3K08A 2PYLA 2DWEC 2WZR1 4YW7A 1XE0A 2XJTA 1PMHX 5DPNA 3GWKC 3CCEV 1QKQA 4XC9A 2YI8A 1YLLA 1H2KA 4EN6B 1X7NA 3B93A 1XE8A 1OT5A 3E35A 5L3BA 3OB8A 1SERA 1JYNA 3LGRA 4G3YC 3LDDA 3B2EE 4NPMA 2YU2A 2Q5ZA 5LZ6A 1ZZ7A 2W0XA 2R72A 4NROA 4B3SB 1MVQA 2VW0A 2WL1A 4RHV3 4YZ5A 4OZXA 1IVSA 4W65A 3AP5A 4JKMA 3ZOIA 4LXLA 4JI5O 1U12A 1DGWX 2ZZQA 1ZL8B 3WCSA 3P5BA 1JHNA 3SEEA 4AFCA 4YZ4A 2VJXA 2YHJA 2C6SA 1W2AX 2W94A 4FFGA 2ZDIC 1QH6A 2LS6A 3KT7A 4XBLA 1XC6A 5KHGA 2OIGA 1O91A 4QPGC 2HKOA 4J42A 4KG8A 4AEDB 2GU9A 5HCAA 2ADEA 5T3NA 4NN0A 4LPLA 4EKWA 2ZEYA 2E75B 4YVSA 5BNPC 1GMGA 4ARXA 1N36O 3OSDA 1X82A 2JEUA 3LPGA 3GZTB 5T52A 1WAZA 3T08A 5CG9A 4FM2A 2BNNA 1W0KG 4IDZA 3O12A 2IH3C 3KV5A 2VZTA 4D8MA 1MPXA 3JYCA 2WO1A 4HSJA 3BAAA 4EQVA 1UPSA 3CKHA 3I97A 4XAAA 5ACA2 3N7KA 1Q56A 1YTFD 3UCSC 4ZZ8A 4DQAA 3HVDA 5KLVH 1EM1A 4TV8B 2P7TC 1CR7A 2WQZC 1AR5A 1I9RA 1H8TC 1Y7BA 1BHAA 1UZ0A 2D7FA 2BUKA 4UFKA 1G9FA 2HJDA 2DUQA 1F31A 3J7MA 4Y1UA 3MLJA 4PQQA 1VB4A 3IAPA 1M93A 2J42A 4Y33A 3O7OA 4MSVA 1KFXL 3B5LB 1RL3A 2X5IB 1M57B 2D6MA 5ACA3 4DR5B 4P9IA 4XE9A 2UURA 4GX1A 5A3WA 3AYEA 2D6NA 4LNVA 5A1LA 4TSVA 1UOFA 2C9AA 2IXLA 4JTNA 2VQTA 4DUXA 4UVAA 1W2BU 1V54B 3EMRA 1S3JA 3FZ3A 3M1HA 4XXPA 2KSDA 3N7LA 5SV5A 2JWPA 4TQFA 3RZLA 1VIBA 3GHMA 2A9HA 2WAAA 1OXCA 1S72V 4LO8A 4TLGA 2BVBA 3KQ4B 5IK4A 5LK5A 4XF1A 1GANA 4BM8A 4DRXA 3ZSMA 1XI1A 4D7YA 5CNAA 5LA6A 1S0JA 1OI6A 1OCRC 2I45A 5T5JA 3MDSA 1QLEB 2ZE7A 1X36A 4B29A 4KU8A 4FFIA 3LSUA 2DJVA 3IT8A 1FV2A 4CDUA 2Y64A 3GVMA 1QDCA 4PI2A 2WT1A 2OXBA 1TEIA 4Z2WA 4XILA 3GJBA 1VIWB 5A33B 1VB2A 3A0NA 1EN6A 2YI9A 3DKWA 3AX4A 2XOKG 2Z4FA 2LALA 3ZRVA 3J7LA 5FK7A 5JZGB 1UYXA 2EIMB 4QM8A 2K1EA 1L8DA 4YHHB 3P32A 3O65A 1URXA 1ZLZA 3R66A 4NTXA 1NX9A 4BXFA 1I94B 2JDYA 1NCQB 3WDWA 5FZKA 1W8UA 3OYWA 2ARAA 4BQ5A 2AUYA 1GNHA 2RR11 1WLCA 4LBMA 1RHI1 4DK0A 3M3CA 2VNRA 3K03A 1KXGA 1OF4A 1I5ZA 1YJLA 3FLTA 1SG3A 2LUWA 4CUCA 1YJ9V 1NXMA 2ZR2A 1IBMO 3OY8B 5EYXA 3ZN5A 5KAIZ 4AEDC 4CUBA 1QJZA 4YXWG 1BKZA 5EIYB 3JQWA 4QB6A 3RFRA 4BWAA 1ULCA 3NJXA 3JAKA 4LC1A 4LF5O 1U0AA 2HLDG 1JI6A 4QE7A 3AKQA 4A7KA 1SQVH 3RN4A 1HP8A 4RHV1 3E8HA 2E33A 3CMEV 1YRZA 1JZ8A 1L0LH 2P2KA 3GGLA 3DN7A 3RYHA 2JB8A 1P49A 5EXOA 4AF9A 2E74B 1LR5A 2UWCA 5EWSA 3W5NA 4JDMA 1K9MW 2QWPB 2Y38A 2YSUB 3WW1A 2YIDA 1COV2 3F95A 1K5MB 1WUVA 3M70A 2FCTA 4AVVA 4AHXA 1LR1A 2DFBA 1DHKB 4XF4A 3GB7C 5DABA 4QX7A 5A80A 1UCXA 3QOPA 2GP3A 2HWB3 3MW2A 3RWNA 1M57C 1XBFA 4UFIA 2D44A 2ZE5A 5LA2A 5IATA 1XNQO 4OI2A 1ST8A 4NAMA 1CEZA 5HCHA 1C8M3 4DO2A 1V54C 4NUBA 3ZMSA 4YSFA 4CDUB 2UY9A 4L9BA 4ISRA 3DGEA 1H2MA 5IWAB 4M3CE 4HZ3A 3EBRA 3NW4A 1OOPB 2EXKA 4DRVA 3FE5A 3ILFA 2RDRA 4YZ3A 2QWNB 4HXCA 1BHGA 4XUPA 1H0BA 4DR5O 3G4SV 3MICA 4N43A 3N9MA 4PQ9A 1UQXA 4GWIA 1SQXH 1QLEC 1UOBA 3D3QA 1YFYA 5ACA1 4CDWB 2R042 3PVOA 4Q8LA 2UUBB 1NS1A 4QQPA 5IT9N 5FYYA 4XJUA 5FZ0A 3HMYA 5JI9A 3CL1A 5LCWL 3OGIB 2EXHA 3K5OA 1QU7A 5EFUA 4AI3A 1A8DA 3E6DA 1QY4A 1NTMH 2VE1A 3T0DA 2ET7A 5CBGA 1EP0A 5JZGC 2EIMC 4A42A 2WBKA 3HQXA 1D0GA 4NR1A 4YVSC 5B1AB 1NCQC 1V9U2 4FPJA 2VBPA 5LHHA 2R043 1IQDC 3KG2A 4XEZA 4HN1A 2HJIA 2Q1FA 3FHQA 3ZHSA 2FDHA 2P6JA 1QNMA 2VTXA 1PO12 1PNKA 1R3JC 5FZ6A 4LQRA 2XXZA 4YARA 1Q8IA 1VBB2 3NSTA 1WP7A 2WIIB 3I2FA 4LIVA 5JXHA 1Y66A 1B35A 2W1QA 3T09A 1I94O 5FL7G 5LGTA 5FZ9A 1HKDA 2XAFA 1OQEA 1W6QB 1BVVA 4LH7A 1KMIZ 2YICA 2EF6A 2ZNJA 3DXRA 5HFLA 4JVAA 3KMHA 2QKDA 3E83A 4S2FA 5F5IA 1DYOA 3OGRA 5SV8A 5H5NA 1M90W 1PO13 1XNDA 2EIDA 3HN1A 3MV01 3K0DA 2PHFA 3AXEA 2ZR3A 1SF9A 1H1MA 4V2VA 2VD7A 2Y6KA 4IV1A 1XMQB 4L87A 1QQP2 4YZ2A 2HFEC 2VQFB 1X8EA 4GH4A 3SC7X 3VHPA 2GSYA 4R6ZA 1K5MC 2DVFA 2Y34A 1G4YB 5C93A 3ZFEA 1VBA2 2PHWA 3OOXA 1US6A 2QE3A 3I4IA 1HRV2 3L74H 4MHUA 4LIUA 4QGPA 2GC0A 1QF3A 2VZVA 2F66C 4FVMA 4P9GA 1IG3A 2YBKA 1V6IA 5C3QA 5C8CA 2C26A 3W7WA 3HKCA 2GN7A 3ZM8A 3RNSA 2ZD9A 1LUVA 2JKBA 1QQP3 1S2BA 1W8TA 3ZFFA 4CCJA 4XETA 2WR9A 1XSRA 1YO8A 4CDUC 2K0GA 3T1YO 1VBA3 1P8JA 4PIZA 1OOPC 3AMPA 1W2TA 3RI9A 2J1UA 4PLOA 4LF6B 1VE0A 2ERFA 5M0TA 4MH0E 1AYM3 1EPZA 3RRDA 2ES3A 4K1YA 2LGWA 4UCUA 3NV3A 1J3RA 4M3CF 2HWB1 5H9RA 1O9GA 3TB0A 1Q8OA 4GKKO 4PBPA 2XKOA 1K97A 4CSWA 4TXWA 4AI9A 4CDXA 1D7PM 5FNVA 2V1DA 3UM7A 2E31A 3WF4A 1C8M1 2AHZA 4DW0A 3N27A 3PJSK 2WS93 2AZ0A 2HVJC 2WINB 2JE8A 3K46A 5JMCA 1O7FA 1E57A 1A8MA 1N8RW 1W28A 3AKSA 2WFF2 2ZX2A 4MLOA 3D0JA 1B35B 2WLKA 1TQ5A 2VQ0A 5B1AC 1VMFA 1RFYA 5L36A 5IYDO 5LYJA 3R4UA 5KBFA 2FZ2A 5JVDA 2YYOA 3WUDA 2EIKB 3R0RA 4HKLA 3RMXA 1SMVA 4INDA 2EA7A 3L73H 2CTWA 4DEQA 3ZN1A 2W87A 5A7PA 3OGVA 2X6BA 1RUG2 2WLIB 3CRCA 3GWOA 4I3PA 4Q4W2 1UZWA 2R30A 4DV4O 2GALA 2Q0OC 3NQHA 3RZZA 1W2NA 4X8PA 2MW2B 2GV9A 4FM0A 3ZYBA 4CXXA 1YFXA 4P5YA 5CA3A 5F6LB 2XGXA 4B7KA 2HKXA 2ZS6B 1WP8A 3I54A 3LA3A 1OQ1A 4GKJB 1GH6A 4J10A 3T2PA 5KMGA 2R041 4Q0PA 1SBEA 3R05A 5JR7B 1JYTA 2YXYA 4AQSA 4BW9A 2X10A 5A1AA 4AK3A 5BNNA 3VBHB 1IXBA 2EXJA 3WB2A 4E2SA 1D5NA 1LOFA 3TBDA 2VZ3A 2ZMLA 1VR3A 3HKCB 5FMDA 3H8RA 4WVZA 1WGPA 4O2BA 2G9GA 2VCAA 4LF7B 4Q27A 3KV6A 5EHDA 2A3XA 3ZFFB 4B08A 1WW4A 3USSA 4QU2A 5F2WA 2DCTA 1MVEA 4XHXA 1WLEA 2XJPA 1Q82W 3U14A 2OT7A 1OCZB 2VM9A 2HEVF 4Q8KA 3JB8A 1PO11 3C8XA 1KITA 1WLDA 1K34A 1OA3A 1US3A 4F7ZA 1HN1A 3BN6A 3POGA 5KXCA 2HLEA 4HFSA 1VRH2 4FFFA 4CDXB 3K06A 4DV0O 5EC1C 2XBO3 3WSOA 4N21A 2ATFA 2R70A 2WWSA 1SQPH 4NIDA 4QAWA 4I55A 4RGAA 4O7XA 3VD5A 3PDQA 2IJIA 4IEWA 4OPHA 2DCZA 4XJ8A 3L72H 1OQDA 5ITZA 2RDQA 1H2SB 1XXNA 5FZLA 3W20A 3S3WA 4RR3A 4XAEA 2WO3A 2OQ6A 1DQ6A 3VKLA 2GBOA 5D1IA 4LBKA 4YPJA 1N34O 3AK1A 5HBAA 4KWUA 4L92A 3HKDA 3JAMN 1QQP1 4QX0A 3FFQA 5K9YA 5A7NA 5ANNA 1WMFA 4CCMA 3NV2A 2YC2A 1ZBE2 2BZDA 1EPWA 4OUEA 1VBA1 1QH7A 5C4WA 4AQ2A 3OMIB 3N7MA 5IJ9A 1GICA 1X59A 4WVMB 5LOVA 2IJKA 1AYM1 1B35C 1FAYA 3DSQA 1AJPA 4CZSA 2TBVA 3K2OA 3VGIA 2MEV2 2EIKC 2C5DA 3WINE 2OKXA 4OLLA 5JOXA 4NMIA 2FBEA 2A7WA 1PX3A 2A7AA 4XFAA 4QXHA 1KJLA 3ZN4A 4QPIB 4J1WA 4UVCA 1S55A 1U5IA 5LY1A 3MHSC 1N1VA 3U0ZA 1LECA 1TUEB 4YVWB 5L9RA 3TNQA 1U5YA 5FZ3A 1PPJH 4HPKA 1YC61 1FT9A 4DXSA 3BTYA 4B1MA 1NZ6A 1YHFA 1A34A 3N35A 1G7YA 3MHHC 1MMMA 1LOCA 5FZAA 4UW6A 2WS91 4OUMA 4XUOA 1ODMA 5F7UA 1BCCH 1MZFA 3KHCA 3EYPA 4ZHQA 1NVPD 2MEV3 3I2HA 2OYQA 2QCSB 3H1JH 3PUIA 2FDGA 3A21A 3ENRA 2BNMA 2YZ4A 1NT2B 1JYXA 1KB9F 3T30A 1SFYA 3ZYIB 1ULDA 5DAWA 1I5XA 5EJ3A 2YXHA 4HL0A 3CLPA 1GZCA 2CAZC 3E5QA 3VBHC 4LO4B 4UW3A 1E5RA 1IX9A 3ZO0B 3A0BZ 5AVAA 3WQBA 4GKJO 2X7RB 4COZA 1S5HC 3ZFFC 4ASLA 1CD3G 3A2FA 1JTZX 3JSLA 1HNZO 3UL2A 2JIZG 1RUI2 2ARCA 5FWEA 4IL7A 1TME3 3C7OA 1NKDA 2P67A 5C3RA 4L11A 5FP8A 4J80A 5J2TA 3VD3A 1G8MA 5LGUA 4RD7A 2ITDC 4YZ1A 5J96B 5LA9A 1PNMA 4LF7O 3VZJA 2X29A 2ZGTA 2ZJCA 1OD5A 2QBXA 1GTOA 1KGYA 4CDXC 3T1CA 1HNXB 4U3FH 3SPHA 2I07B 4NHMA 2W6JG 4O4JA 2XB6C 4E4EA 1W03A 3AZZA 5BUVA 3ASNB 2GUZA 4LKFA 4AR2A 1OKQA 2DVAA 3H1LH 3SKJE 2JDMA 4G28B 2F4PA 5FXWA 3PMSA 1IPJA 4WVVA 1K3EA 3E22B 5A6YA 5IVBA 5IK7A 4IIJB 2ODMA 3BTXA 1V9PA 4E4DX 3JCZA 4NHXA 4N7UA 4MYEA 2GNMA 4IEQA 4AFDA 3Q8AA 4WM8A 4MXVA 4M00A 3AG2B 4BYYA 2WSVA 1OVPA 1S0EA 1AP5A 2IXIA 5DQ0A 4DRRA 1VBD3 2XBO1 4QGMA 3VUOA 1OMIA 2MNGA 1CZTA 3LPFA 2VS0A 4IERA 3ACGA 4FLXA 1LGBA 5LHIA 2VWKA 5J2UA 3M7AA 1M5IA 1ZM1A 1CGPA 4WFBV 1SESA 1GN2A 1NYWA 3IM0A 4EWEA 3IFXA 4CDQA 4QPIC 4LBLA 2AGAA 1MZ5A 2BRTA 5J9PC 2FB5A 1RITA 4YVWC 5C3PA 5BXZA 4AGRA 1T6BX 2OWOA 3VQWA 2D6LX 4JI3B 2HWC2 4GULA 2JJ6A 3ZYGA 2PHDA 5C5TA 5FWJA 3NV1A 2CSGA 4FQZA 5CN0A 2VTFA 1AR82 5GW7A 4Z2AA 1DGLA 1IS5A 4A45A 1BLZA 1YQ5A 3THDA 4JI6B 1L0NH 1U96A 5BNOA 2FCVA 1DQ2A 3DYMA 4NTYA 1TMF2 2PMWB 5A3OA 1QOSA 3ABKB 4WM7A 2UXCB 2Q7EA 5FLHA 1Q6HA 4IV3B 2QM4A 4Z8BA 4XMAA 1CJPA 4DYLA 1K12A 3LUTB 2GHYA 1WA8B 4MGSA 3W9AA 1LCLA 4ZZ5A 4LF8B 3VQXA 1FMD2 4G9SB 1H1IA 1GQPA 5KC5A 3PURA 4O9EA 2OUHA 2J1AA 4Y22B 4ZU7A 1W05A 3OAAG 2N7GA 1JW6A 2MEV1 4LOTA 5F9TA 3RWRD 1PX4A 1DQ1A 4NHYA 2GUZB 4WBNB 4JAVA 2R062 4FPFA 1REFA 3ACLA 5FQ0A 3E89A 2F43G 1UW8A 4Z82A 4H7LA 4MGIE 1OA2A 5E88A 5B5EZ 1XNBA 4PDWA 3ZVXA 4RUFA 1Q6IA 1UZZA 1Q3EA 4AVBA 2P3JA 1OLME 2DURA 2DQ0A 3KF3A 1GWLA 1ZZ8A 1FMD3 2V72A 1VALA 4QPJA 4Z1MG 4HANA 3JASA 5LP6A 2AC1A 3NR7A 1GZTA 4IUGA 4QXBA 2WO2A 3J4UH 1P7GA 1VP7A 1IZ3A 1HB3A 1JS9A 2R063 4DXZA 1TME1 2KQXA 3S0MA 3UYJA 3MZHA 1NQTA 5KA6A 3RT3C 4HVRA 2VCCA 5IWFA 5DAQA 1EN4A 5D2AA 2Q8VA 4JI4B 5JH7A 5J2UB 1AI5A 3OTOO 1XHZA 2HEPA 2EICA 1ZRFA 3VHNA 1W8ZA 3L75H 3AG2C 3MBWA 2WAMA 2VL4A 1OLQA 3L2YA 4CDQB 2UU9B 3SCHA 1LRHA 2XOMA 1I0HA 4FPOB 4KFMA 5DEDA 3CRMA 3K3OA 3L70H 4O4LB 1VAMA 4DR2B 1ORQC 1PV0A 3MIBA 1FOD3 5F5QA 2WPDG 3A4UA 2WUHA 5L3GA 2GZWA 1Y76A 3O1PA 1KFUL 2H6CA 2X09A 3D0SA 4QKBA 1DLBA 1NBMG 2E3CA 3BALA 4ARYA 5FV3A 1AX1A 3NL1A 4IHJA 5FAXA 2BE3A 2JIGA 3DL3A 4AQTA 3CC2V 2AHYA 3AB0A 2NLJC 5BNOB 2BOBC 2DBNA 4PF5A 5HCBA 1KECA 1O3QA 4MTGA 4O4HB 4JI8B 1GNZA 1O6UA 4DK1A 2PHTA 2BNOA 4DB5A 4CH5A 1VBD1 1RUD2 4GKYA 1K8AW 1MS0A 1OUXA 3BA9A 1HJFA 4NIHA 3FL7A 3H9AA 1V6NA 2QEXV 4UUJC 3RPQA 5TSWA 2GNBA 4Y26A 1C5IA 4G4FA 1YQ2A 3CYOA 4KGQA 3VBFA 1VF6A 1GQGA 3VQYA 4FT8A 1KP3A 3ABKC 1V0AA 3CC7V 2WLNA 3OGCC 3ETPA 3RWKX 3LKJA 4LF4B 2YBSA 2RMU3 3LSQA 1CWPA 5CYYA 1EY2A 4I30A 1QJX3 2UUCO 4NWVA 5A6ZA 2RM22 1G6NA 4X8NA 1Q6UA 4XACA 5LASA 3E5XA 2VNVA 4B3MB 1ZVFA 5LRRA 1NZIA 2IXJA 3JASB 2UXCO 4E2GA 3WT3A 1NTZH 3ZYRA 5EBLC 2QQMA 4I0WB 1IXMA 2E6VA 3H3LA 4XUNA 1QXRA 1HWYA 3AZVA 2JGUA 2ZOEB 4EN9B 1KC8W 3LAGA 5I0DA 2JG9A 1BBT3 4QDSA 1R1BA 5DUWA 3KF5A 1AR1B 5EZYB 5JH7B 4NXNO 3DPRA 4TUYB 1NUKA 1HRI3 3P1IA 2HWF2 4I01A 5JCOA 2CY6A 4EJRA 4F6EA 3V0BB 4X9QA 5L7OB 3D3IA 3X2QC 1UMIA 2WA3A 4LUMA 3FFZA 2F4VO 4S2HA 3IB3A 1FD9A 3BA8A 3C7EA 4O4IB 3ASIA 1SETA 1BSMA 3M8AA 4YLZA 4IL6Z 2HYXA 4YYOA 3T0AA 1UXXX 3KGLA 5HI0A 4CDQC 3DC6A 1FMD1 4BIOA 4IE7A 2HWF3 5JLVA 1ZUQA 4G2KA 1ZRRA 1KU9A 4J11A 1XSQA 4JYAO 2B5UA 2EZOA 4DUWA 1DQ0A 5IYCO 1RYYA 2LP7A 2C9KA 2R061 2QSAA 4DV1O 1POV0 1UXZA 4I0AA 3JD2A 2BBAA 1SZBA 4GX2A 5BR8B 1EBOA 2Y60A 4LULA 4X66O 4I50A 5I0SA 2FDJA 2GDSA 4DR7O 2WLLA 1D0HA 4DY3A 1LEMA 4IGOA 5BNOC 1UU5A 5B66Z 4XTMA 5FLXN 3O1RA 1S0BA 4RQPA 3W21A 4W8JA 2A71A 2ZGPA 4PA9A 2YBPA 3HQUA 3L2HA 3VZKA 3W7XA 4HBNA 3NNGA 1FOD1 5FZOB 4P02B 1AJKA 1CPNA 5KAFZ 1W8WA 3MGUA 4M0HA 1ULOA 2QQOA 3N2KA 1QQCA 4GX5A 2O14A 2D93A 4JV5B 4B4PA 1W9SA 4CBCA 4YW3A 1GNYA 2Z69A 3B77A 3NRUA 2PHUA 3BRCA 2BP6A 3C7FA 5DAPA 5JOZA 1G9CA 3JCIA 1YVWA 2P37A 3FMGA 4HVQA 5C8WA 4QQLA 4I09A 3ZFGB 2DFCA 1IGOA 2SBAA 5EYPA 4PDWC 1Y43B 3OUIA 4JGYB 4FXGB 2JDAA 2R073 3ZIXA 2FDFA 1URFA 4PLMA 5E89A 2WKKA 4P9LA 4X64O 4IEZA 5T54A 4QXKA 4Q4Y2 1SZTA 1DZTA 1DGRN 3TEZA 5JMOA 2BEOA 1COWG 3TETA 2MK3A 4JDNA 4XQDA 1X9PA 1SFNA 1QU0A 3ZX7A 1MABG 1HN0A 3ZHTA 3G71V 2CV6A 4IE6A 2HWD3 5IYYA 5JXIA 1LHNA 2XLFA 1RP3B 1JH5A 3O9OA 2FDIA 2HBUA 1R092 4ZONA 4XZPA 3NJYA 4JCKA 2XJQA 2RMU1 3E6BA 3W58A 1KRIA 4DINB 4L0PA 5FO8B 1W2UA 4PF1A 1QJX1 1LHUA 3K9SA 1VQNV 4Q4Y3 5CA0A 3EB7A 1A6CA 1JHJA 3MLLA 4NIGA 4D7SA 3CX5F 4IT5A 1WCKA 5L7OC 4DV5O 2N05A 1ZRDA 3OBRA 2AXTZ 1CX1A 4URAA 4TTGA 4XDJA 4MGTA 1GBGA 4CEWA 3AKRA 3E5UA 4P9WA 5FO9B 1UYYA 1O8SA 1N1TA 1BBT1 4LLFA 1H30A 1GYKA 4AAXA 1EN5A 3EJKA 1UN1A 2O0OA 2JRIA 4F3JA 3Q8EA 1LU1A 3WDUA 3BODA 5FYIA 4I50B 3ZJZA 2BVVA 1JZ6A 2HJFC 3IC9A 1HRI1 2W9XA 5L19A 3U4XA 2ZTNA 5GLVA 2XNDG 4IEVA 1JOYA 1S2EA 4N53A 3S3XA 1KKCA 2VOKA 4HNAA 1M1KW 4E4HA 3E2EA 4MVOA 3HWJA 1NZCA 2XUEA 4FFHA 4S2GA 2QTSA 4U7NA 3NKGA 2DWRA 4HKOA 1LULA 5FJHA 3O0VA 2AH2A 4EEQA 2DDUA 3SDLA 4ITCA 4BAYA 2Y0OA 1N1SA 3OBAA 5LRSA 3N2KB 2J1VA 1W6NA 2O8OA 3UO2A 4YJ3A 2LJ2A 1MQTA 5LEKA 1VF6C 3G6JB 3M8LA 2UXBO 2A5ZA 4BE3A 3LEMA 3MEPA 2HWF1 4XBQA 4RFRB 2CAVA 1BXHA 4DXTA 4JKKA 1Y9MA 3RGBA 1E5HA 2JS5A 1LOGA 1XOYA 2VO5A 3ZLIA 1W0NA 4ZS2A 4YWAA 3ACHA 3WDVA 5TISZ 2PZSA 2BW8A 2UWAA 3APBA 4R4ZA 1UAIA 4XFGA 3ZRWB 2XHBA 3ABTA 2DYSB 3PUAA 2A3WA 3ZFGC 1QR8A 3LIGA 1WPXA 2ILMA 4AFAA 4IEPA 3DGTA 3CMAV 1DIWA 4JGYC 3ZS8C 1XJAA 1GWKA 1UY1A 3AMQA 5I8YA 3GHNA 3OGJA 5FYTA 5F8PA 4FFBB 3CCVV 3ZX6A 4OX9B 2VECA 1D2QA 1V6MA 1VBE3 1CN1A 2IVJA 4QU1A 2JEMA 1IBLB 4LK7A 3SYCA 4AI1A 3VBRB 4KXRA 4HAMA 1CONA 1KD1W 3JATA 1UMHA 2XG3A 3ZXEA 4IW3A 4LWSA 2VMCA 3WEZA 2Y4UA 1YXWA 3DV8A 1I1EA 2FDKA 3HT2A 5KUMA 2Y0PA 4D6SA 5L3EA 2WQ4A 2R071 4XF9A 5CEHA 3KVBA 1YHQV 3OUFA 3BUCA 1UWWA 3UGGA 2BSKB 4B8EA 4EZ4A 5FUNA 5T5LA 3ZN6B 2B1GA 3NJVA 1EV12 4B3RO 2BFUS 3H01A 5DM6V 5D8AA 3KHBA 2HWD1 4FK5C 2VMFA 2ZHKA 2JX9A 5C8YB 3TEYA 2VOVA 4EN0A 1UY4A 3LWCA 4KBBA 3BIWE 5FP7A 5FBZA 3WR0A 5CBFA 4O65A 5GLTA 5A3NA 2DV9A 4BH9A 1W6NB 1GO3F 4Q4Y1 3C3SA 4KGGA 2AGSA 3HR9A 4K8RB 2A6VA 4NAOA 4AZZA 4ZHNA 5L3DA 2WN2A 4XDLA 4UBHA 3GZUC 2YPDA 1RXGA 3AK3A 1PK6A 3Q8FA 3CU7A 2K46A 5E1RA 2WNUA 3LEKA 2WLMA 1GV9A 4LITA 3DECA 2BCCH 3AK0A 3O1UA 2IXHA 4CPBD 2WLJA 3K5NA 3VZNA 1Y74B 3D8CA 3OW2U 4B4RA 4UI9L 3LIHA 1I08A 1JN2P 4PDVA 5A7OA 4PBOA 5A32B 2ZKOA 1U5ZA 4BISA 4MGQA 3MFCA 4JZ2A 5K0UB 5BY1A 1DBNA 1HXS3 1OPOA 3CCQV 1HW5A 3VOUA 3JD3A 1FATA 2YEVB 4Z1VA 2JVDA 2NP0A 4R9CA 1R3KC 4X62B 3IAYA 2CTRA 1RSOA 1XE7A 1K7DA 3ZYJB 3TK1A 2IXKA 2J1EA 3WZ1A 5F39A 1NT0A 1B04A 1RB8G 2DYSC 3GCWA 4DR1O 2W52A 1TZOA 2GC3A 3SEPA 4W4LA 3RZKA 5FZ8A 4YIPA 4GB33 1Y4WA 3RYIB 3CZJA 5I0UA 3WNNA 3WQ7A 1HNWO 1HW7A 1LOAA 4BIUA 3KGZA 2ZGSA 4LWSB 3ECQA 1V70A 3MLKA 5A7QA 1JYIA 1MEC3 2YY1A 1M9NA 3VBOB 2XAQA 3CF6E 3TRSB 3JSNA 3K58A 3UK9A 1LESA 3VBRC 2F1MA 3KT1A 2WYSA 3BU7A 1VBC2 1RC6A 2G38A 2GC1A 5BYNA 2FHRA 4IGGA 2ZHMA 3GNEA 1GP6A 3HEIA 4MXWB 2YMZA 2XVGA 4AG4A 1TVKA 4LF9B 4BK5A 4QX5A 1G86A 2W0FC 1AXKA 1L7RA 3KS7A 2FQPA 4UVBA 1KBHA 4JTCB 3E6CC 1QHTA 3KB5A 4QQHA 3NV4A 4BOWA 2R7EB 2WABA 5FREA 4J7JA 2EZPA 4COVA 1VBE1 1PM7A 5FY7A 5H9CA 3H1MA 1Q8VA 3WNXA 1VBC3 2FZ1A 1GZ9A 2R0FA 2EULA 3KV4A 4XIOA 3L9DA 4FOVA 5CFCB 4K35A 4KMQA 3VBBA 3VHOA 2ARHA 3JBG3 3U11A 1AB3A 4UWDA 5KHHA 4ZI7B 4TQDA 5AG2A 5DDJ2 3P6BA 1LOEA 5K7PA 3K79A 1WZXA 2ZM6B 4I0XA 3BCWA 1SDWA 3G6BA 3STZC 3AYDA 1OKOA 4JI7O 5KX5B 2EINB 5GZEA 2CTPA 4OZOA 2XWJB 5JPMB 1AL22 1Z0HA 2OPKA 3LSEA 2A06H 4XDPA 5K1PA 3RMYA 2ZX3A 1FV3A 4LO7A 4XQWA 1ZBA3 1BEV3 5K0UC 2ZGRA 5HXVA 2FMDA 4CEYB 4RGKA 2RE9A 2AREA 4XZUG 4QQ2A 2AW9A 4FPPA 1SCRA 5BMVA 2C4XA 1JZ5A 2PFWA 4JTOA 3VQVA 3OPWA 5A9GA 2ZHLA 5IDJA 3FAVA 3CSXA 1JZ4A 1JYCA 4K8ZA 2HR3A 5C9AB 1DZRA 2WAOA 3G80A 4XYXA 1BYHA 3OR7C 1C28A 1B09A 5DZFA 4I9WA 4SBVA 4JV4A 2X05A 1NA1B 2WSSG 3BY6A 4JPRA 1O3RA 1DQ4A 2Y33A 3MHZA 3S5AA 3D36A 3CEWA 1K92A 4BK4A 1TNRA 3WF2A 1Q5OA 1FNZA 1HXS1 1SRYA 3JD72 3ETGA 2QTWB 1IBKO 2IXCA 1H2NA 3VBOC 1W9YA 4FMTA 5BV6A 2PAKA 3K77A 4ZY9A 2O1QA 2Z3YA 2TNFA 3ASOB 4JYBA 4I7ZB 2DN9A 4JHTA 3ZXGA 3B3QE 3JQXA 4K0KO 2HBTA 2DVGA 4AAPA 5KC6A 1NE6A 2VULA 1BHBA 1YFUA 3I3DA 5B3SB 4DUYB 4CZZA 3FD9A 2PA7A 1ZRIA 3FB7C 4GB31 4UFMA 1W6PA 1W06A 4IGPA 4R50A 4LE3A 2W68A 1MR5A 1PM4A 4DFSA 1VQ9V 1YUDA 3JARA 4PA3A 2XHKA 3OF1A 4YGEA 3POFA 4B1LA 3I2KA 4O2AA 1MEC1 4AE2A 4UYBA 2A3QA 3K5LA 5FBJA 4JTDB 2KXLA 2DCKA 3RJ2X 3ZHQA 1RMU2 3I55V 2BGOA 1J5EB 4LBQB 4I0XB 4LF9O 3HNMA 1PK6C 2DVDA 3ZMVA 1W8FA 4CE8A 1TUBA 5CFCC 1SACA 2PTMA 4FJCC 2Q7GA 2CUGA 2GNDA 4K8FA 2N04A 3HKBA 1UY3A 2H6BA 1UZYA 4EE2A 5FTTC 1S5JA 4YW6A 4BQWA 4BQYA 1O4YA 3H9VA 3HNYM 5E8AA 3S30A 2RS32 2QWQB 2P4KA 2KG7A 2VVEA 1LNQA 1ZA7A 4LHNA 3MF6A 3AYAA 1FXVA 1N1YA 5JJEB 3A0KA 2DU0A 4CVUA 4BJ0A 5F5CA 2CGOA 2Q69A 4U3JA 2ZX1A 2P6HA 1NH2B 1VF5B 2EINC 1VBC1 1R1A2 3M4FA 2RMKB 5A2QN 3LDRA 3O1VA 5J3UA 3ZN0A 2OCCB 1W99A 4CXWA 4L2NA 2VH9A 1NY72 4LHSA 1OJHA 2HEWF 5G04L 4NB5A 5FK8A 3RI8A 2ZM6O 1C1FA 3NAPA 5DMYA 3ATGA 4X1YA 4QHOA 3CQOA 4LBNA 2OYZA 2IFWA 4CEYC 2XQXA 3IPVB 1DK1A 1ASJ3 4QX2A 4UFHA 2XAJA 4GQ7A 1NVPB 3BGAA 3LFIA 3GJAA 4DUZB 3ZDSA 3EO6A 3HBZA 3VBUA 3BOPA 4GMP0 1UX7A 2QQPA 1JFFA 2Q30A 2Y48A 1B3QA 5LL6Y 2L9LA 3AG4B 3FHAA 1PP9H 4HK9A 1Y3TA 5C70A 2C2AA 4PA7A 5DAXA 3SPCA 3USUA 3OMAB 3IAQA 3IDBB 1NA1C 2Q1MA 3MPPG 1CAUB 5FPZA 1G8WA 1ZBA1 2VG9A 2IWGB 1BEV1 2EIJB 4A41A 4X20A 2IU0A 1PMJX 1CXZB 3UKTA 5DAVA 4DO0A 4NJ4A 4HONA 1F9KA 1QDOA 1OCRB 1XREA 4JI1B 4XTPA 1X50A 2B42B 3CJHA 5LMNO 1QNYA 1EUTA 3OUHA 3ASOC 3TNPB 3THTA 2V09A 3UJOA 3OT7A 4O2AB 5IYZA 1TG7A 1I5YA 5JOWA 2PI5A 1SLCA 5B3SC 4NXMB 2JE7A 2QKAA 1EUUA 3UKVA 3WNLA 1Z7S3 2A3YA 4L8JA 3NNFA 3NXSA 1N32O 2WZEA 2OW4A 4AXOA 3O1MA 4HMZA 1O5LA 3NNMA 1DGRA 4RS5A 2B39A 4WCEV 5ABJA 3ALQA 3J7HA 4FPCA 3ZEDA 3RZGA 4OI0A 3QACA 5E79Z 1Y9GA 3AMHA 3E8GA 3RYCA 1WW6A 3FYIB 1S76D 1PGW1 4JZRA 1WB8A 2CE4A 1OUSA 3VDDB 3RW0A 4P14A 2P6CA 2DE0X 4PDLA 3BVOA 2J1RA 4U3JB 4LR4A 1HQLA 1SLLA 1F5FA 4GYCB 1OV9A 3DCQA 2LM3A 1THZA 4MUVA 3V56A 3RYKA 3ZIWA 2IW5A 3CJIB 2EBOA 5I91A 2FCUA 2RJ2A 3LQCA 3OUJA 4FFKA 1ENQA 3Q8CA 4FVVA 5IFPA 2HWE2 2UXDO 3E1F1 4AILC 2WNVA 2IU3A 1N0JA 1MS8A 1SQFA 4IEXA 5CBLA 4OQ9A 3WX5A 4DV3B 1PKXA 4DIQA 1PZ7A 2OCCC 1HQWA 3VBUB 3OFNG 4KHPB 1AJOA 4C90A 4HSLA 4A3ZA 2XJUA 1JFFB 2QJVA 2Q6AA 1ENSA 5FZIA 1IPSA 5L9VA 4EWDA 3RYFB 2YFUA 1UY2A 4DUVA 2ORXA 4R4XA 2YUEA 2ZA9A 2RQ6A 1RPRA 3AL5A 4B3TO 4ZXEA 1ZA4A 2BOCC 2HWE3 3I59B 4FPLA 4CP0A 3PVBB 5GTIZ 3TWIA 2VR4A 5JQGA 3D36C 1DP0A 4X20B 1YJNV 4MVMA 2F23A 3SQOA 2QQUA 4H13B 1MACA 4LHLA 5AFBA 3TXSA 3ZBHA 3SJAC 2R9RB 1ENVA 3AG4C 5DXDA 2Q67A 4LA2A 4M4PA 3HJRA 2PF4E 4CU8A 3STLC 3CJHB 3TXQA 4IE0A 3S7EA 5A70A 4AVSA 3DTUB 3TJTA 2E5LB 2O57A 3PLQA 3SCGA 4DV7O 3WF0A 4H37A 4UXAA 3UT5A 2EIJC 2IZWA 4DOUA 4MS2A 5J36A 4QMAA 5CVRA 1ASJ1 4N9HA 1XU1A 4UCTA 2OIEA 4ZOLA 1CAXA 2BWCA 3D82A 1C4RA 1SA0A 4GAZA 4AFBA 3WP6A 2B1IA 4XCBA 4OULA 3JD1A 5JSRA 3WW3A 4GJYA 3T0BA 2A6XA 3WW2A 2ZGOA 1M06G 2Y6GA 4S2DA 3FB5C 3MFAA 4AEJA 1EAH2 2QQJA 4MVTA 3TN92 4E27A 4F6RA 1SQGA 3HB3B 4PA4A 3BTAA 1S0VA 1J58A 4A3XA 3Q4HA 1PNLA 4MW3A 1IKQA 2YC4A 4YVSB 3GXUA 1K45A 3E8BA 2BTOA 4FLTA 2QKSA 3B00A 2FMYA 4E8CA 4ZIBA 1PHMA 1RUE2 2QDNA 1TE1B 4QX3A 1GK9A 1FX5A 5DG2A 5KHIA 1L7QA 4LHKA 3UQ8A 3VDDC 2CDPA 5LW9A 2XH6A 3VKNA 4EN7B 1R3IC 4FLWA 4CYDA 2DWDC 1C1LA 4B3SO 5AFEA 1R6TA 2VVFA 2JENA 4H7MA 3JALA 1F51A 1QVGU 3QVNA 4XPVA 1K5JA 3TN93 1Z7S1 5LY2A 4UF0A 2VUAA 1BK0A 3CJIC 5JAXA 1ROPA 1N47A 5FPBA 3NNLA 1KD7A 4MV2A 2D5HA 3SXWA 1J95A 4FSJA 5FZHA 1EZVH 3LSDA 3NAPC 3HOBA 1BMV1 4FPKA 3N2GA 4A4AA 4QWNA 4AQ6A 1H8EG 3U75A 2ZABA 3EFFK 5H9QA 2XJSA 3K3NA 3DC5A 5F3GA 3VBUC 1SBFA 4QKNA 5FZDA 5JIAA 1PO22 1K4DC 3EHBB 1XL6A 1SLIA 4OYUA 2DW4A 1HR0B 4YG0A 1T2XA 2BTQA 3QG5A 5LA1A 3POEA 2RS52 2VGDA 4BU2A 4W6YA 5IK8A 3O0XA 1XNRB 1JBCA 1VJ2A 1WW7A 1WCUA 2Y6LA 3ZPOA 4LA3A 5G05L 4KHPO 4BW5A 3HN3A 5GONA 1Q81W 1RJ7A 1UOGA 1GOGA 4DRXB 3T1HB 5LA6B 5LMUB 5A7WA 1XL4A 5CA1A 1XMOB 1PO23 2JS3A 1COV3 1JPXA 2OVUA 2UYBA 5FMOL 2VMIA 1S77D 2RJLA 2V4VA 2QKCA 2PI4A 2WDBA 2VUJA 5FZCA 4RGGA 3B4SA 2Z2SB 5APAA 1ENXA 2Y6FA 2GH8A 1NCRA 1S0GA 4KUMA 4MVRA 3FX3A 2C0ZA 4YY3B 4N7IA 2HWE1 1O5UA 1DDLA 5EQUA 4DR6B 4M0NA 3IN9A 4BMBA 2WJSA 3SH3A 1SPPA 3OJBA 1P7BA 3T2OA 4FTBA 4RO2A 3RS6A 4UFLA 2RDSA 3OYWB 2VOXA 2D97A 5BZBA 1IPKA 2XR4A 4FPHA 3ZKYA 3BABA 1XOUA 3QNEA 1UD1A 2XAHA 2P06A 1RTVA 4CUGA 2P17A 5LBEA 1TA8A 3VHRA 5FUIA 4EV0A 4BQXA 3K57A 1NQJA 5FYHA 4QX1A 3JAKB 2CGNA 5HV4A 4LP8A 3IZOA 3M3IA 2AYHA 5CADA 2VY0A 5LXTA 3ZXJA 3RYHB 2ARXA 2WNEA 5FDBA 2KD7A 2K9PA 3PTYA 1CPMA 4Q4V2 2XVKA 4YHHO 5KXBA 3A22A 1OC1A 3RDIA 4A2UA 4DV2B 1GAXA 5I8SA 4PJ0Z 1V9U3 2JICA 3R6SA 5K4LA 2OTLV 3MUY1 4OFGA 3AXDA 4OHWA 4GA9A 1CVNA 2RVAA 2VZRA 5BPXA 2E7TA 2A75A 1ZX3A 2UUAB 5FXXA 1VBB3 4NVPA 5FUPA 4FZ0A 1HJGA 1MS5A 1GU3A 2BERA 1UKGA 4NPLA 4JQRA 5FZBA 5EIBC 3N9OA 5GONB 3TN91 4DW1A 1J3QA 5JJJB 3I56V 4H44B 2GNTA 2PAMA 4LNUA 4LORA 2CHHA 2D2CB 1M4WA 4RWUA 4HOOA 3OD0A 4PIXA 2RS12 3HKEA 5IVFA 2DCYA 2PHXA 4CTEA 5IYBO 1AR92 2JDPA 1ODNA 2VZUA 4ATEA 3ZMOA 4N43B 1UMZA 1AI4A 2H3OA 4M3CA 1YWKA 1H9PA 4EB6A 3THOA 1AZDA 2B46X 3CXHF 4F8AA 3N4MA 4KG0A 3W59A 1BL8A 3TYJA 1ZX5A 1F23A 3WHUA 3K48A 1UL9A 4JI2B 2VMEA 3OBTA 4XOGA 4DV6B 1PL4A 5J09A 1HRV3 3SPGA 4LFBB 2Y26A 2QE7G 3W7UA 2KR2A 3BPSA 3GBFA 4JTAB 3D5OA 2JD9A 3AK2A 2WC2A 2HP8A 4BHPA 3QF7A 1VLNA 3ZSKA 2QQLA 3QH6A 2CGPA 2Z42A 2B4KA 5IWAO 3KWVA 1W90A 4JI0B 4KU7A 2ZXWB 3PIJA 3QO7A 1OBNA 1PO21 1FFXA 3J81N 3AZWA 1OZ0A 4U2AA 3ZMTA 3DXUA 1COV1 2ZDIA 4LFAB 4CCLA 5KA5A 5JXGA 3M7MX 4QPGA 4AQYB 3IDAA 3WG3A 3JAWA 3A23A 4Q1RA 1YF2A 5DUUA 1W6MA 1XHXA 2ZPXA 2PY5A 5IVEA 2KA3A 5J37A 5BNPA 2XUMA 1PZ9A 3E8FA 1VP6A 2UUBO 4ZBMA 4CXYA 3CMGA 1XQNA 1H4HA 2NQYA 1QJFA 4YJ2A 5EBWC 4GWNA 1GM8A 3DXRB 3H1IH 1N3OA 3RVYA 1FJGB 2VQUA 2ZGKA 3U78A 2JGDA 3EHKA 2WO7A 4BLJA 4IXLA 1UPGA 1W6OA 4MVZA 3H3UA 3OEAA 4AVAA 4GWJA 2AZ2A 1H8TA 5F1RA 5FPAA 2WFF3 4IV1B 4PLNA 1JZ3A 4XW3A 1MS4A 2OCHA 4GH4B 1CP9A 4V2WA 1C57A 2DBIA 1NG0A 4ES9A 1I6XA 3ZFEB 3RZMA 1TGOA 3BKZA 1RUG3 3I5DA 5A6XA 4P9PA 4Q4W3 2R32A 4KL1A 2WYFA 3WP5A 2OIIA 4TV9A 4F4LA 1AX0A 5C8CB 2OS2A 1R73A 3SJQC 4YNIA 2YS8A 1PVXA 5FLIA 4EB6B 5GJ6A 4BWOA 2ETNA 1NTKH 1BK1A 3D4KA 4P2ZA 4JI5B 5K1XA 4AHZA 5KXEA 1V9U1 3H0OA 4FLYA 1MSDA 3VL8A 1YI7A 1LAJA 2DVBA 3ZR6A 3E86A 4CPBA 4MTFA 1OFSA 1B06A 4QGLA 4K1ZA 2D3RA 2WT0A 1GP5A 1XMQO 1YI9A 2VOWA 3PHMA 1MOFA 5F32A 4N43C 5DUXA 2VQFO 1OLRA 1XRUA 3AFKA 1D2DA 4D6RA 1VBB1 3URFA 4CU7A 1XBLA 2LRPA 4KNCA 1JZ7A 4MG2A 1IS6A 2K2SA 3AZYA 3RG0A 2ITCC 1DF5A 5T5PA 5FNVB 3MIEA 5HXMA 2J1SA 3ZHVA 4BZ4A 3PN1A 2QFEA 5EV7A 5IJ0A 4FTEA 2Z0AA 1GFF2 3DKQA 4YGBA 3OCPA 1SLBA 2NM1A 4HETA 2EIGA 1AR62 1W3XA 1PIV2 3PUQA 1VQ5V 1ZL8A 2P90A 2ZXWC 2R16A 5LYJB 2G9ZA 2GTSA 3NMBA 5JVDB 4JI2O 5ISLA 3W7SA 4DV6O 1VRH3 4QKDA 4LF6O 2JDIG 1PL0A 2VC9A 5DG1A 1VQ8V 1ULFA 5H2FZ 2GSMB 1W0PA 1HB2A 1RPOA 2JJ2G 1S0CA 1WMEA 1HRV1 4MGYE 1PNGA 5H9PA 4AI0A 2W47A 1AR72 4MOAA 4COWA 1M56C 4JI0O 3CC4V 1AR63 3T2TA 1PIV3 3FN9A 4W4KA 5A7SA 1K4CC 1QCEA 2O8QA 5CZKA 1UY0A 1WD4A 1DTOA 3ZKUA 1ZRCA 4JGSA 3OGSA 3F7YC 4XDQA 5KMGB 1AJQA 1UU4A 1ZBE3 1JJ2U 4DPNA 5A3LA 3ZRXA 2XONA 1Q8PA 1ULPA 2VQEB 2PXJA 4JKLA 3SNMA 1H2GA 1Z5WA 4TV8A 5BNNB 2XL9A 3O5SA 2QDRA 4IV1C 1AR73 1HDKA 2RR12 1RHI2 4GH4C 5LK7B 3R65A 1Q8SA 4O2BB 2J7MA 3ZIAG 1SCSA 1W3VA 3ZFEC 2JDZA 3V65A 2P4EA 3H8XA 1KDKA 2R6QA 2X5IA 2L6LA 3G6EV 1YYNA 1WMXA 1OSGA 1T6GC 3VD7A 3VBSA 3AC0A 1REDA 3JXSA 4RHV2 5C8CC 5JOYA 1FNYA 1FPOA 3K59A 5FMOS 5L3FA 1NR7A 2QTOA 4XURA 4OI1A 4Y4YA 4D6QA 5FY9A 2UWBA 1RINA 2J1TA 2WFF1 3WXPA 1VQMV 3DYOA 4ISQA 5FYVA 4NRPA 4Z92B 3LB9A 3CD6V 4YW1A 4I55B 5F3CA 2CL2A 1RUG1 1IBMB 5IJ0B 5ITZB 1AROP 4Q4W1 5L9BA 1BZWA 1I3HA 2PQSA 2AEZA 4MTOA 1GP4A 3W5MA 3NJZA 2YB7A 2ZIOA 4RR3B 1OVSA 5LGNA 1PGSA 2IVIB 4LF5B 1N0NA 1AJNA 2NZ9A 3B01A 4FAHA 3HKDB 3SYAA 4MADA 5A33A 1YZBA 1RUI3 2JXAA 4ZU4A 5CFDA 5A3PA 1GN6A 1POV3 3H1WA 1S1AA 5C4WB 4ABMA 2LW8A 5JZGA 5JUVA 4WFGA 3S5QA 5IJ9B 4D6TH 4CCCA 1SBDA 4XDOA 5LOVB 1NCQA 1GWMA 4KH9A 1CZSA 2HH9A 2RDNA 3QTCA 4QB2A 1DU3D 3I3BA 3WW4A 3FUOA 5GLZA 4IEOA 3OY8A 4Z07A 2ZE6A 1NOVA 2RJKA 2LTNA 4O61A 4HPKB 2RN9A 4LR3A 1W0OA 2BQPA 4OHVA 5HFMA 3VDCA 3SITA 1VF7A 5FYSA 1YNAA 5A3UA 1RUOA 3WG7C 1ZZBA 3NKTA 4IQPA 4ZHQB 2ZX0A 1XNQB 1NXD1 1X8MA 4RQFA 3IMNA 3MW4A 3WNKA 2P3YA 2JDNA 3FLRA 4JAUA 3I2IA 4CCKA 2JEXA 3PVNA 1VRH1 5F2SA 4R9BA 4HN0A 2VW1A 3LDKA 5BNNC 2MHFA 3VBSB 5EPAA 4NYKA 1JMUB 5JPNB 4LE4A 2Z5WA 1LOFC 1K5MA 3I3MA 1APNA 2P4VA 4YRDA 4ZS3A 2BGPA 2GC2A 3TGUH 3VD9A 4R7CA 3PUHA 1AR61 4X1IA 1PIV1 1QR9A 2ZGNA 4HKWA 2ET1A 4YG6A 2VQEO 4K9SA 5BY5A 4LH6A 1U97A 1A32A 1J83A 5J2TB 5FY4A 1JUIA 1W8NA 2HWC3 1ZBE1 4FLVA 5JXJA 2BWAA 5KXDA 1AR83 4IESA 4YGCA 2LW7A 3TCUA 4LKSA 2B8MA 1IKPA 1RUH2 1AR71 1OOPA 3VZOA 4CH3A 2H8PC 3O1OA 3K0GA 4O4JB 4OMCA 1K5SA 4UFJA 3P30A 1UFIA 5KUKA 5JIUA 3KSCA 1GSLA 3ILNA 4BB3A 1TMF3 1H1AA 5CFDB 1YQ6A 4XFCA 1WA6X 3KCXA 4WFHA 4P9JA 4ASMB 4YM1A 3SJBC 4CDWA 1ND2A 2QZ3A 3G7DA 4BPZA 2G19A 4RR3C 1Q7YW 1ALYA 1JZ2A 4L8QA 3FBYA 1X33A 1RUH3 2XLAA 1LB2A 1FI2A 4WM8B 3THCA 5CB7A 5DUVA 2Y8KA 5LHGA 5D21A 2IC1A 1JUHA 2DQ3A 3X2QB 5C4WC 4PDRA 2Q0AA 3SPIA 1UF2C 3MPBA 1AL0G 3GYDA 3CIHA 3N7JA 1V00A 4Q0UA 5FPLA 2QQIA 4MT8A 1HNXO 4QPWA 4FOYA 1D5AA 5HV0A 3WVJA 4CU9A 5JJNB 4J9YB 1WPBA 3WV6A 1KP2A 4W4ZA 1Q86W 3SR2C 2PHRA 3K3WA 1VMGA 4Q0QA 3EXAA 3S7IA 4N9IA 2HWB2 1WWYA 5LATA 2W46A 4J1XA 1RUI1 4AEKA 1E5SA 5C6CA 3ICXA 5EC2C 5B2GB 1O3SA 1POV1 1W6QA 1C8M2 2VPVA 3RVHA 2ADQB 2BFUL 3IWZA 2B9ZA 4Y20A 4P00B 1W0JG 4X1IB 3NO8A 1DF4A 3AP7A 3T1YB 4GD4A 3NWKA 2NPIA 4GLXA 4B4QA 2NMOA 2X5IC 4WM7B 4XBNA 2TUNA 3TOJA 3ZYHA 2CH7A 1YCIA 3WNMA 4I5SA 4WBBA 3VBSC 4EN8B 2XT9A 3I2OA 1MZEA 4RAIA 3T2MA 4D7TA 2PAEA 1MSWD 1QXJA 4GKKB 1DGWA 5CG8A 2B9VA 1JYVA 1UZVA 4LOSA 1JU3A 3OPZA 3RBZA 2ZKNA 3WF3A 1OURA 5FPRA 4JI3O 5C33A 4RL7A 2PQQA 2OQ7A 4QDRA 5FIXA 3RSJA 2Q4PA 3V0AA 4GT1A 1OCCB 5FOJB 5FQ0B 1W8OA 3T1MA 4Q20A 1RUD3 4PDWB 2ZXQA 4JI6O 3VL9A 2IUWA 1ND2B 1AILA 3OPTA 3KZIZ 2Q8DA 4EWAA 4DXRA 2KM2A 4CH6A 2OZ6A 4BMEA 2WLPA 3IKWA 1VAKA 1AI7A 2F93B 5LB6A 2DU1A 5LP6B 1RJ8A 1XUQA 1KYOF 3VZLA 3UJQA 3SGIA 5CFDC 1XNAA 2IJHA 1OLMA 5I0TA 3OEHG 1FFTB 4UW4A 4LF8O 3N9QA 3CB2A 4EZHA 3ST7A 4DV4B 1AYN2 1VQ6V 1F35A 2HWC1 2PN5A 1L7LA 1E1QG 3D6EA 5L73A 4PI0A 2RM23 2ZT9B 4K8XA 2EAAA 1QVFU 1AR81 3CWBH 4E2QA 4WM8C 1RUJ2 4UCSA 3TAYA 3CO2A 4CUAA 1WKYA 1AXYA 2E51A 2FMLA 2QR4A 1WCDJ 1S5LZ 2LGQA 3IGAC 5DN6G 1TMF1 4LBOA 1Z78A 5LEJA 2ZEWA 1GMMA 1FKAO 3T4HB 1AYN3 1H38A 2EJ7A 1Y76B 3H8OA 4OXSA 4RQEA 5GZCA 1LGCA 1IS4A 3ZMNA 3CE2A 4Y20B 2WLIA 2BJSA 4WVWA 2E9QA 3VKFC 1RUJ3 4IHJB 5DECA 1RUH1 3F5TA 3FX7A 1L1FA 2XPJA 3CXCU 3K51A 5FY1A 2WNOA 1SC5B 4Y5Z0 4DS0A 4IGQA 4NWWA 1G1XB 3APOA 1S2KA 4H3WA 1N3PA 4JI4O 2CH7B 1ZWIC 1PGL2 3AMMA 1TNFA 2VZQA 1CAVA 4J6GA 3OEEG 3BHPA 2UU9O 4PDMA 1E1RG 4LMFA 4P30A 4NHKA 2XQRA 2D3SA 1I7FA 3WP3A 4XVHA 4DR2O 4DV0B 1AYM2 5F3IA 3VBFB 3VBHA 5JCTA 4E2LA 1Y67A 4WFEA 3B02A 1HB1A 2W91A 1VQOV 4WM7C 3ZSLA 1NE4A 3HQRA 5D5PA 3V0AB 4QXCA 3ZDVA 2Q73A 4L99A 1GQHA 2E76B 1HIXA 3FKSG 1J59A 3SJCC 4FXKB 1SQBH 3GZAA 2KKWA 1N34B 4DR3B 2PUSA 5DZEA 3A8TA 3WG2A 4JI8O 4XUQA 2WS92 4ZKTB 5LBBA 1YTFB 1OCCC 2RCVA 1BZKA 2E7QA 2JDKA 2ZZJA 1X9TA 5FP4A 4CDWC 2A6YA 2JG9B 1ND2C 1S0DA 1G9AA 1F4AA 1PD3A 1RIRA 5C71A 1YJWV 5H6RA 3OMNB 4W6WA 3DPRB 4C1WA 1SQQH 2X6AA 5LP6C 1ENRA 4YFZA 3AL6A 3OE7G 4LF4O 4OHXA 4X88A 2P34A 3EVKA 4HVOA 5A1FA 3WHTA 4OHYA 2DCJA 4JGZA 2ZEZA 4Q0SA 4XF0A 4CS4A 1QJEA 4PA6A 4QX8A 2J22A 4BQ2A 2YXSA 3I8TA 3U07A 4AVTA 4B3MO 1RUD1 4JASA 2X8KA 1LHOA 5CU1A 2Q8EA 3LEGA 2ZGLA 3ABMB 5CKMA 3POSA 4IE5A 4UB6Z 1AUYA 3LA7A 1UIJA 1KDMA 1WCQA 4WVMA 4N8MA 2DYCA 2ZBJA 2ZHNA 4RYDA 2M6YA 2XLGA 4CU6A 1A78A 2A6WA 2RDCA 4W6XA 1R093 2XWBB 1LHWA 1TAEA 3LCPA 2E53A 4E9KA 1SLAA 4QPIA 1CAVB 4QGNA 2BPA2 1AI6A 2V73A 1AX2A 1M4UA 4YVWA 4QPYA 1CIWA 3PU3A 2RM21 2Y6JA 3B09A 2QQNA 2WLLB 1HNZB 3DUIA 2D6PA 4CP2A 1OH4A 4JC1A 2YIBD 4RQPB 1QIQA 3M99B 3QO8A 1V6JA 1Q90D 4K40A 4ONUA 2VXJA 5LBCA 3RYRA 1YXBA 1N4CA 1MNGA 4NOTA 4EYUA 3CS5A 1V6KA 2HG5C 1R1ZA 4I2OA 1V55B 3AM2A 4LKDA 2CTQA 1AYN1 3IDCB 3KCYA 2XBO2 2Q1ZB 4NIAA 3POWA 4G27B 2VBDA 2D40A 4XJAA 4WFAV 3LDCA 3DEMA 2XVLA 3VBFC 3U4SA 2Y0IA 1G9DA 5IY5B 1RUJ1 2YGLA 4TOIA 1NI8A 1NQDA 3O14A 1LODA 2EVXA 5FKBA 4PJYA 4I0BA 1KEXA 5BR8O 5EYPB 4Q1PA 1F7YA 1EYBA 2HVKC 4JHZA 3UKNA 2V5DA 1R6NA 3RZJA 1HLCA 2XMLA 4DR4B 4PV1B 4AYUA 1A3KA 4PD4F 1OD3A 4Y1XA 4UCVA 2WRAA 2QNKA 2FL4A 4CCEA 2GH2A 4BDVB 3PTRB 3OD4A 1H6XA 5CB4A 1JXNA 3BIEA 4KWJA 2IM9A 4JGZB 3ON7A 4PHZA 5LBQA 3ZXFA 2JG9C 1QEXA 4LBQD 2VXRA 2ZCEA 4JV5O 4K21A 4DR3O 4UV9A 2CWMA 2I2SA 4H33A 2W1UA 3KD4A 2ZGMA 1PGL1 2XHNA 3ACIA 3DPRC 1XPWA 2ZAHA 1K3IA 5CA0B 5JCOC 5FZGA 2X0LA 3E22A 2V4AA 2EIEA 4FOWA 4IIJA 2GN3A 3I7DA 2FD8A 2LW1A 2NNUA 2DOSA 5FYZA 3C7HA 4XFBA 2ZIMA 4IEUA 4CEWB 5FZ1A 1BQ0A 3M3OA 3QO5A 1NH2D 3JD4A 1ZREA 3ABMC 5I93A 3GF6A 4F83A 1UU6A 3POYA 4FQ4A 2PGGA 3WFVA 3X29B 1RM1B 2BBVA 5CAZA 2WN3A 3M3QA 4N53B 3AYCA 4QJFB 1SZXA 2Y6HA 3CEIA 4HNAB 1VQ7V 1K5QA 4C7UA 5FZ7A 2DF7A 2DUPA 3T4DA 1E5IA 1DYPA 3I49A 2AR6A 3WCRA 2WSUA 3INAA 2BU9A 4BCUA 1TME2 3KM5A 3MIDA 4UBGA 5FKCA 4CA9A 4JYYA 4HK8A 5F3EA 4YJ3B 2W2IA 5GTHZ 1MQTB 4RQPC 3B8NA 5IAVA 3SHRA 4AVCA 1J84A 2CWSA 4GMP3 1EV13 5F2VO 2XJRA 1GM7A 4XHBA 5J7MA 4UT5A 2ENRA 3ETQA 4FLZA 4FI9A 4TN7A 4D0QA 3K5MA 3ES4A 1O8PA 1G6UA 1V55C 2QGNA 2V4DA 4QNHB 1R091 4QKFA 2VNGA 3GALA 3T3YA 5T5OA 4A5UB 3QH7A 1VRBA 2ADPA 4RSUA 4LLOA 1R082 2QA4V 2DMXA 3WDTA 4IV3A 1OCZC 2PYJA 2ZMNA 4CP9A 3PIGA 5IY5C 5T55A 2VMHA 1WA8A 1LHVA 1H6YA 1VPHA 2OPWA 2FYUH 2YDEA 3QD6A 5CB4B 1DCSA 3VKMA 4A6SA 4Y22A 2X6CA 4BQ4A 2OT5A 3T1LA 5ERLA 3OTOB 5FPXA 4X8AA 3WB1A 3IJ4A 2RJZA 1R083 4WBNA 2VZ1A 4NIIA 3BU0A 1VBD2 4Y5TA 4I4TA 1K42A 1IS3A 4JX0A 4KWLA 3WNPA 5EJZB 2FTKA 1W9FA 3C3VA 4JGZC 1YFWA 2W39A 2DYRB 4GWMA 3UESA 4JDOA 3JATB 1UYZA 2ZGQA 2Q7HA 2VRZA 4LUKA 5EP9A 3A0HZ 3VZMA 4DR4O 1GKFA 3FHIB 3NVCA 3BTZA 2N74A 2ZGUA 1PNFA 2LO1A 1XNKA 4JF3A 1YDXA 2SLIA 4K3AA 3ZSEA 3MO4A 2QQKA 1BQPA 2VQAA 2ZAAA 1Y4MA 2QQWA 1MS9A 2IFRA 5GM0A 5H9SA 5IUQA 4XQ4A 3LFMA 4CEWC 3HT1A 2GMMA 4FOQA 4R52A 5D8AB 4OX9O 2Y4TA 1W04A 4LK6A 5B1BB 3S57A 3K9AA 5FJKA 2ZINA 3POJA 1IBLO 4JRAA 4MVQA 3ZRSA 2CDOA 2BDRA 4O4LA 1RM1C 4NTWA 1XB9A 4XUTA 4D69A 4V1PA 5L3CA 1ZZ9A 4N53C 3UKMA 4HG6B 1JR9A 1AXZA 3RQ0A 1XYNA 1PK6B 5F37A 1YIFA 5IW0A 1CZVA 2UUCB 3ZYPA 2WNUB 4UCRA 3THPA 4MVSA 3W7TA 3AEIA 2H94A 2CTVA 1J1TA 4O4HA 3LDEA 2WFPA 1IQAA 4AEMA 1MQTC 4Y5SA 1EZJA 4OPAA 3MAQA 3GDBA 1DQ5A 3AG7A 1VQ4V 3ZHRA 4META 1PVC2 4XXAA 4CP9B 2XJVA 4A7YA 2OUJA 2JJ1G 3ML0A 1DLCA 3ETDA 3MIFA 3WP4A 1JU4A 4HZFA 3ETEA 4QB1A 2VMGA 3J26N 4X6RB 2E7AA 5FMCA 4UB8Z 5C3OA 4NXNB 1RSOB 3AP9A 2H0VA 1N3QA 1WLWA 4CRQA 2ADDA 2VWJA 2CU5A 3FB8C 3H7JA 5DDJ3 1EFRG 4I4TB 2Q9LA 3KQRA 3AFGA 1PVC3 4WV8A 1O59A 4J25A 2VU9A 3BYWA 1JJOA 1X4TA 4GCZA 5ANQA 5EZWA 1W8HA 3RZHA 4OHZA 3C90A 3MDPA 5H6QA 2F4VB 4NRMA 2GP5A 3B9CA 4QHBA 4GMP1 1EV11 3I2DA 3AG3B 4AHCA 1ACCA 2QWRB 1K73W 2NN4A 3ASNC 4UFZA 1AL23 5J1XA 2AEYA 2DTYA 4WF9V 4J41A 4MW8A 4AW7A 1FOD2 2QM8A 5FLJA 4RN5A 3N3HA 2FKXA 3AVRA 2DYRC 4JYAB 4XJWA 5JWPA 4U7OA 2W5FA 3SH5A 4N23A 4X62O 3WQ0A 4B3NA 2ARBA 5EZYA 3AP4A 4TUYA 4DV1B 1TVKB 4Q4X2 3J80N 1XYOA 2KB1A 2VZOA 5JVVA 1VMJA 5GZGA 5K8SA 5IE9A 1JOBA 2C1FA 3HR0A 4KBZA 1WMDA 3V0BA 1FXKA 2ZACA 4X89A 4X66B 5L7OA 1F5JA 3DF0A 4WZCA 5FMBA 5FP9A 4DR7B 3SYOA 3SYPA 3WUCA 1LENA 2ID4A 1R081 3OBZA 1IDSA 3K75B 3QCWA 5IK5A 4DY5A 5C5UA 2VZPA 4UOJA 1SS3A 4BIZA 2CDYA 4O4IA 3OTFA 3LNNA 1FAFA 1W59A 5D8AC 2BTVC 2UXNA 1P4RA 3VB9A 5EBMC 4H0LB 2NMNA 1GLHA 2XASA 5B1BC 4Q4X3 4AI8A 1YQCA 1GN3A 3JD73 1KQSU 3A7QA 2VTXJ 3FB6C 4AWDA 5A3TA 2HEYF 4LTAA 5EIBD 4MVUA 4Q6GA 2AZ5A 2RMU2 4PCRA 4LT5A 3CRRA 4Q29A 3GBWA 1GKBA 1QJX2 4MSWC 3R4SA 3AJZA 4YW4A 2JB4A 2WNUC 2W95A 4MX3A 3AZXA 2RV9A 4XF3A 4X64B 4A44A 2K9ZA 3CPWU 4TZDA 3EXUA 3VV1A 2HHHB 5F5AA 4IV3C 3OM3B 4P08A 4GKXA 2YXLA 4UAPA 2GMEA 4AI2A 3IBMA 1BBT2 1RMU3 5FR3A 3SMHA 3IDEA 4KP4A 5FZOA 4E4SA 4BXSV 4CCDA 3F5WC 5FZFA 2LFSA 5CBHA 4YIOA 4GZRB 4MO3M 4XJZA 3U37A 5BMVB 1HRI2 4P5HA 3CCSV 1AP6A 3NNJA 3POIA 4BIFA 3K4AA 5FYUA 4E8DA 3FBMA 3V64A 1BGYH 1VEWA 4ASUG 5CKQA 3J8F2 4QD2A 4QHZA 2W1SA 3FAVB 1QHDA 5DZGA 3ZFGA 2RS33 2CNAA 3CP1A 3U10A 4P9YA 4XDKA 2VMDA 4DV5B 1R6KA 1IG0A 5EYYA 4JGYA 1F2NA 2D3OW 4K20A 1QWRA 2JG8A 4O9GA 4C1XA 3LA2A 3AG3C 1R1A3 3UNPA 4I3GA 1LJ7A 3Q8BA 2VCMA 5AVPA 1SQ4A 4LO6B 2B45X 2W3JA 2WWWA 1FXKB 3J8F3 4Q26A 3FYEB 2TEPA 2F17A 1O4ZA 4XBFA 2P3IA 2GMPA 1HV1A 1ND3A 4FLUA 1VAVA 3IMMA 4FP2A 5DDJ1 3ZYFA 1SLTA 3JB4C 5FZMA 4SLIA 1PVC1 4P9XA 3PU8A 3UV9A 3ES1A 2QJ1A 2R9IA 1JVMA 2EILB 1W6PB 4K6BA 5DN2A 3FWEA 4OVEA 5IAXA 2PLV2 4ES8A 1SHWB 3JARB 1JA8A 5KHKA 5J98B 2OA2A 1CIYA 1UNBA 1H8HG 2EX3A 1AL21 1VQKV 2V5YA 3WU2Z 1Y9QA 5E6HA 2A70A 3BI3A 4PIYA 1FXHA 2UXBB 2YU1A 4BQ3A 1NLRA 1YI2V 3O1TA 2Y69B 1UO9A 1US2A 4UXNA 1JX9A 1TUBB 3UO3A 4JYCA 4LFCB 2ZQMA 1AVMA 1DG6A 3HKBB 3GZEA 5FYCA 2PLV3 3UT0A 4CC5A 3N36A 2Q68A 1ONAA 3SKVA 1BT8A 3DXTA 4DUYO 2KG7B 4HT1T 4YM0A 1J1LA 1LGNA 1OA4A 2R072 1BVP1 4CS2A 2BOIA 2C24A 1F8VA 2Z79A 1UOJA 3ZR5A 1GOHA 4D94A 1V6OA 2Q5TA 5AC92 3RVZA 1SKVA 2BV4A 5IVCA 4Q4X1 5EJ1B 3JD71 1NR1A 4PT6A 1YJKA 1J5EO 2HWD2 3O0WA 4DZGA 3B8MA 3NAPB 3ELNA 5LWBA 4X1YB 3POBA 3I2JA 3LNMB 2F95B 3BB6A 5KR7A 3AG1B 4ASKA 1DYKA 2QM7A 3CZUA 4XFHA 2P5BA 2D5FA 3MYXA 3LZZA 3FUQA 4J9ZB 2JG8B 1S0IA 1RUC2 3CCLV 4XFIA 5KHJA 1NLQA 3HIFA 4URTA 2XL7A 2GTAA 3FJSA 3WQ1A 1SFPA 3ZRWA 2HHHO 5AC93 3JU9A 2NR5A 2W08A 2IJJA 4X65B 4TT3G 2WWUA 4MZUA 1BS3A 1S4CA 3USUB 1STMA 5B4XA 1L3JA 1FXZA 1NLSA 1TVGA 3ZXDA 3ITQA 1C3HA 1ND3B 2R1BA 4ICGA 1BE3H 4B3RB 1RMU1 3B9IA 2XKPA 4FFBA 4ZU5A 2RNBA 2JECA 3B94A 2ORZA 4Y1VA 1RUC3 4OMDA 4M01A 2JD4A 2VVDA 1DFQA 1WW5A 3GM8A 1FXKC 3K4ZA 3O1SA 3VBRA 3BCCH 1LU2A 2WLQA 4COUA 2LFRA 3WY6A 1OHFA 3Q9OA 4RFT0 4DUZO 2UXXA 1WA4A 3ZMZA 1NJIW 1IOAA 5IYZB 3KCCA 3MF9A 4FO9A 1LOBA 5FP3A 2RS31 2YGMA 3H1HH 2ATKC 1H2LA 2E63A 1QJU2 2QQVA 2EILC 1YEWA 2UU8A 1XYPA 2Q8OA 2BSKA 4AL9A 1R1A1 1MZ6A 3FLPA 4RS5B 5BXXA 4Y1YA 4I9QA 1UX6A 2F4LA 5F6KA 5ABJB 3VD4A 3ZN6A 5D5QA 1NY71 1NU1H 1JOJA 4Y24A 2ZCWA 2QDOA 3K4DA 3J8F1 5B4NA 2JE9A 1XILA 4OGQB 3RYCB 1UJWB 5FOBB 2Y69C 5C8YA 3SPJA 3ILRA 1LUWA 2ETEA 1WBFA 1XNTA 2JK5C 1K33A 3KZ4C 4JI1O 3APQA 3CBNA 2ZMKA 1HB4A 2PELA 2OTJV 4GJZA 1QJU3 4NPRA 1U5XA 5BNQA 4C0HA 4YM3A 4LBJA 1KS5A 4NXMO 4ET7A 3OG2A 4IEYA 3UETA 3B40A 1R3LC 2DTWA 4UCOA 4DR1B 1G9BA 1HV0A 4X6QB 4CCNA 2WNVB 1WD3A 4EFBA 4OCTA 4LFCO 1LTEA 1EAH3 3C2UA 1ZYBA 1FYUA 4XJ9A 4BR6A 1Y74A 1HNWB 3HPNA 3HNBM 4FP3A 1VBE2 4WZFA 3RJRA 4HYOA 4HLTA 4Q0VA 1KJRA 5A32A 1JOPA 1OCOB 1XQ8A 5GALA 5K0UA 2XAGA 2YPJA 4PELA 2QZ2A 4B7EA 1H9WA 1RUE3 1JMKC 2PLV1 2WA4A 2QWOB 2YEVA 4XIKA 4ATFA 4NE9A 2ZNIA 4A7ZA 3AG1C 2ZE8A 1KQRA 1H8VA 3JCUZ 1FPN2 2JG8C 1GRJA 5JQGB 3ZPYA 5GZFA 1O4TA 3KV9A 4TSFG 2IH1C 1C8NA 3N9LA 2YG0A 4COYA 2EIBA 4UW5A 2BOJA 2OX0A 3LF7A 4FPGA 4TWTA 2P1BA 4CC6A 5CIRA 1CPYA 3VKOA 1F4MA 1P84F 2H0BA 1KUQA 2HYKA 3B69A 2B7YA 4YW5A 2ZKLA 4C91A 1NKGA 1XU2A 2BGCA 3R4DB 4DV3O 3PL0A 3RYIA 1ND3C 1GN4A 3MW3A 1ULEA 3I3QA 5JR2A 4Y4RA 3UT5B 3I2GA 3JUUA 1I5PA 4IYHA 5IJRA 5FPOA 3C3TA 1ZZ6A 3T2QA 4QIWF 1FPN3 1ZTEA 3WB0A 3H42B 4ORFA 3H1KH 3VBOA 1D4M2 4QT6A 4ZOLB 1VQPV 1CAXB 4X65O 4WFFA 2WT2A 1GR3A 3L9JT 4CP1A 3ACFA 3E97A 3F7VC 2ZX4A 1SA0B 4R8CA 4RUEA 3H3ZA 2VAUA 3AKTA 4W50A 4P9OA 3PJYA 1ULGA 5AC91 2AACA 2W1WA 1WB7A 4MXWA 2RS53 2VNOA 4TLFA 2YROA 1HX6A 2YFZA 5LBFA 3LOBA 2YIAA 4JI7B 3MIHA 4F6RB 1O9HA 4LJHA 1KKDA 1WCSA 3TEXA 1PM9A 1VQLV 1D4M3 3PNAA 4RS5C 3Q4HB 2E5LO 1RUC1 3IIAA 5ABJC 5FPUA 4MGKE 1BMFG 4TWKA 5B1OA 3U1XA 5I0RA 2UY8A 1LEDA 5CKNA 2JDUA 2OZJA 3KKYA 1HXS2 1QOTA 1AVBA 2LROA 2VZSA 2D3PA 5CFCA 2G4IA 4AGGA 1QOOA 4DEVA 1CESA 1B6QA 3JALB 1RUF2 3LDBA 1JODA 2D43A 4FTSA 1QJY2 1C5HA 5T50A 4ZI7A 4XABA 4UF0B 4J7ZA 4I02A 3UGHA 3WDXA 3J9SA 3PUSA 5C7GA 1XNCA 4GB32 1LNSA 3ABLB 2P22C 4FCAA 3N2GB 5KX5A 1Q8QA 1DGSA 2WNVC 4QDQA 1OFNA 3PMEA 2WZPP 1MEC2 4BLIA 1RUF3 1QJY3 1ZZCA 1UYPA 2R1DA 2EAKA 1DLLA 1OCOC 1HQNA 2VW2A 1IBKB 1QJU1 2R9AA 2X53S 1GZWA 3H1YA 3TEWA 3B7MA 2Q4SA 3S6PA 4CEYA 1RUNA 3OUSA 4GIQA 5FO7B 2BTQB 3CCUV 5A3MA 3ZXAC 4C0BA 4IETA 4ZXKA 4K0KB 4K3UA 4CCOA 4FIPC 3L71H 1QMJA 2YUAA 4J7KA 3HBKA 4Q4V3 3BEHA 3ROUA 2WZ8A 2D98A 4GUNA 1EAH1 1RVF2 2YIBA 5C9AA 5A7WB 5CA1B 5E16A 3AVSA 3MD0A 4CH4A 5J48A 4FPEA 4YW2A 1YIPA 2GDFA 5FRAA 1NA1A 2R0HA 3OR6C 1R64A 4R9DA 3HAGA 1OHHG 3CRQA 2M7WA 4M4RA 2B5HA 1JQ0A 3LSSA 3WLUA 2WQ8A 2JKXA 4QM9A 1RUE1 1WN7A 3M2MA 1NCRB 2V7QG 3CHXA 1JYWA 3LE0A 1AR4A 2VOTA 4LEJA 3GCXA 3JBG2 1WNSA 4R8HA 2CYFA 3P3NA 1HR0O 1RVF3 4KI5M 2A0LA 3H7YA 1SPPB 3ABZA 1BQZA 3BVCA 2QUOA 1SEFA 3KT4A 3WDYA 3WOGA 1XNRO 1DZQA 1UIKA 4LO5B 5E1AC 3AMNA 4JRLA 5GZDA 1HDJA 3SCFA 5IVJA 4L97A 2RS13 3T1HO 1POQA 5LMUO 2F6BA 1XMOO 4YG3A 1AR93 4FAGA 4KQ7A 2I74A 3LD8A 4EFEA 4XMIA 4FPYA 1FPN1 5JI7A 3LEIA 1ZBA2 1BEV2 3ZHUA 4Y3OA 3ORJA 4LBQA 5CA6A 4Q2FA 2RG4A 4YY3O 2PHLA 1QGLA 1V6LA 4DR6O 3G67A 5LXTB 3VN4A 4BQ1A 2RS51 5FYBA 2P5OA 2B9UA 5I8TA 3MI8A 1F4HA 1KS4A 1MS3A 1MG1A 2Z5UA 2WZR2 4JAAA 4AHYA 1M56B 2JIJA 4FZ1A 3QLQA 3K04A 3VDBA 4IE4A 2W6IG 3UGFA 2MPFA 4LCUC 1D4M1 3D3AA 4E4ZA 1GZWB 1N33B 2W92A 1RXFA 3ABLC 1YQ8A 3J7AU 1AHSA 3OEBA 4K7JA 5IFTA 3DYPA 1IHMA 3CNAA 2RHPA 1BCXA 3AKPA 3AJYA 3H50A 2G9FA 1CQ9A 4NRQA 4YGDA 3RYPA 2GAUA 5FZEA 2CK3G 2YC0A 4CS3A 3BPZA 2EXIA 4JZGA 2ZEXA 4BA6A 1FYJA 3BOWA 1ZSPA 3JZVA 3LOIA 1YITV 2EJRA 3PVEA 2WZR3 4LBEC 1PGW2 3M3EA 5FXZA 5FY0A 5LMNB 5JSOA 1OH3A 4D3WA 3IPVA 4LNUB 3AP6A 2A79B 1Y6XA 3ABUA 4YM2A 1REEA 2E26A 2E32A 5C3SA 3MIGA 3P3PA 5HPOA 4X1KA 3OGGA 1E79G 3HKEB 4NO4A 4H2AA 4DV2O 4QE9A 1D4VB 4AFMA 4XCAA 1J3PA 3MUZ1 1GUIA 4DXWA 1N32B 1DF0A 4OQ8A 2XTAA 4M3CB 1CAWA 2L35A 2NLRA 1RUF1 4AOCA 5KWRA 1QJY1 2D6KA 4OI4A 1CAUA 2A1XA 5CISA 3MV11 3ZCCA 4AHWA 2UUAO 5LA0A 3J7NA 2A73B 4ZPIA 4MTXA 1QBZA 2AENA 1XEQA 1NCRC 2JDHA 4H55A 3ZMUA 4YFWA 1XDCA 1F15A 4KWKA 1Z5VA 1QLNA 5GLWA 5IVYA 5FXVA 1CJDA 4H14A 4DNYA 3HD8B 2A6ZA 1LKNA 3CCRV 4Q4V1 5IT6A 4JQTA 3JD0A 1W2OA 1W39A 2D6OX 4EROA 1BJQA 2CAUA 1WBLA 3WD5A 3A0RA 1N36B 1OPMA 2QVSB 3KLSA 3VDAA 2NN8A 3N9PA 5IVVA 3VLBB 1FFXB 1S0FA 4GALA 3PJQA 3FC0A 5JDBA 4AGVA 1AF9A 1WJZA 2UXDB 4XFFA 5FFOC 4QPGB 3ZSJA 3JAWB 3I3EA 4FM1A 3CCMV 3ZXLA 1O3TA 1W6MB 1W9TA 5BNPB 3SYQA 1YIJV 2Q8CA 3T4ZA 5GKAC 5EK0A 2R49A 4U36A 4FBFA 4YJ2B 1RVF1 2PYTA 5A6QA 4LFBO 1OF3A 1T5EA 1ASJ2 2DUOA 1D2SA 3VDDA 3BFRA 1GOFA 4Q5OA 4R9AA 1QXPA 1SDDB 5IHRA 3H8UA 2G1MA 5FPVA 2NYYA 1VMHA 4B3TB 4NKGB 2WWJA 1JCHA 4AEDA 1WLTA 4IYIA 4QPKA 2LQTA 1PZ8A 5FCCA 2JGDB 1RGSA 2UYAA 2WLHA 5CMUA 3C7GA 2EALA 3ME2A 1W6OB 2RS11 3CJIA 5GLUA 4ZKIA 1AR91 1Z2GA 1H8TB 4N90A 1H4GA 2VUDA 5FY5A 3WG7B 1CX4A 4LFAO 5FYMA 3CDZB 1ZAUA 3IC7A 3SISA 1ZNPA 3JBG1 3WG1A 1QNWA 3T4VA 3QBQA 4GZ9A 4AQYO 4DMIA 4DV7B 3ZXKA 1UKRA 2P3KA
chains in the Genus database with same CATH topology
1DYPA 4NHLA 2AR6A 3WCRA 2WSUA 1QXRA 3CJXA 3RS6A 3AZVA 3INAA 2ZOEB 1PMIA 3OYWB 4EN9B 2VOXA 1UPIA 2D97A 3LAGA 4BCUA 1TME2 2JG9A 1BBT3 1IPKA 3KM5A 3MIDA 3WG4A 4UBGA 3EQEA 4FPHA 3SH4A 4HK8A 4GXLA 5C9AC 1UD1A 1CAWB 1MQTB 5DUWA 4QQOA 4RQPC 1OIJB 1RTVA 4Y1ZA 3SHRA 2P17A 3DPRA 4RA0A 4TYSA 3VHRA 3I59A 1HRI3 4AVCA 4EV0A 2CWSA 4GMP3 1EV13 2HWF2 4I01A 4OUSA 2CY6A 2XJRA 1NQJA 2YV8A 4EJRA 1Q43A 1MS1A 1Z7S2 3GBGA 4XHBA 2ENRA 3ETQA 5J7MA 3SLIA 3V0BB 3ES4A 2CGNA 5L7OB 1R091 2WA3A 2VNGA 4LUMA 3M3IA 3FFZA 3GALA 4MGZE 5T5OA 2AYHA 3QH7A 4RSUA 4LLOA 5CADA 4S2HA 5HCFA 2VY0A 1R082 5JSPA 1BMV2 2BYVE 3WDTA 2RR13 1RHI3 3ASIA 3ZXJA 2ARXA 4IV3A 2WNEA 5FDBA 2ZMNA 4YLZA 3PTYA 1CPMA 4Q4V2 2XVKA 5T55A 2VMHA 2WZR1 4YYOA 2XJTA 5KXBA 1LHVA 3KGLA 1QKQA 5HI0A 4CDQC 1YLLA 4EN6B 1H2KA 1FMD1 3RDIA 4BIOA 4A2UA 1X7NA 2YDEA 2HWF3 3B93A 5JLVA 1XE8A 3QD6A 3VKMA 1GQWA 3LGRA 5I8SA 1ZRRA 1V9U3 4Y22A 2JICA 4G3YC 3R6SA 4OFGA 3T1LA 1ZZ7A 2W0XA 3AXDA 1MVQA 4OHWA 4GA9A 2VW0A 5FPXA 2WL1A 4RHV3 1CVNA 1DQ0A 4YZ5A 2WBOA 5BPXA 2R061 2E7TA 4OZXA 1R083 4W65A 1POV0 3AP5A 2A75A 1VBD2 4I0AA 1U12A 1DGWX 2ZZQA 1VBB3 4NVPA 3WCSA 1IS3A 1JHNA 4AFCA 1MS5A 4YZ4A 2YHJA 1UKGA 4LULA 4KWLA 4JQRA 5I0SA 3C3VA 4JGZC 1QH6A 1YFWA 2W39A 4GWMA 1D0HA 4JDOA 3TN91 3KT7A 4DY3A 4XBLA 1LEMA 1J3QA 5BNOC 1UU5A 4XTMA 5KHGA 1S0BA 4RQPA 1O91A 2ZGQA 2GNTA 4LUKA 4QPGC 2PAMA 2A71A 2ZGPA 4KG8A 4AEDB 2GU9A 1OTJA 3VZMA 5HCAA 3FHIB 3NVCA 5T3NA 4NN0A 2ZGUA 1M4WA 1PNFA 3L2HA 4YVSA 3VZKA 5BNPC 1XNKA 4HBNA 3OD0A 1FOD1 4PIXA 1AJKA 1CPNA 1X82A 2RS12 3MGUA 3GZTB 5T52A 2DCYA 2PHXA 4M0HA 4CTEA 2SLIA 5CG9A 1AR92 3ZSEA 2BNNA 4ATEA 3O12A 1NX4A 3ZMOA 1BQPA 2VQAA 4N43B 1UMZA 2D93A 2ZAAA 4B4PA 1MS9A 2IFRA 1YWKA 4M3CA 5GM0A 1H9PA 5H9SA 5IUQA 4XQ4A 4YW3A 2Z69A 4CEWC 3HT1A 1AZDA 2B46X 4HSJA 4F8AA 2GMMA 4FOQA 4R52A 3N4MA 5D8AB 1UPSA 2PHUA 4KG0A 5JOZA 1G9CA 4M2FA 3JCIA 3W59A 2P37A 3FMGA 1Q56A 3N7KA 3TYJA 4HVQA 1ZX5A 5ACA2 3WHUA 5C8WA 4QQLA 4I09A 4DQAA 3ZFGB 2DFCA 1IGOA 3K48A 1UL9A 2SBAA 3OBTA 4XOGA 4JRAA 4PDWC 1CR7A 2WQZC 5J09A 1HRV3 1I9RA 1Y43B 1H8TC 1Y7BA 4FXGB 4JGYB 2Y26A 2R073 4D69A 3R1JA 4CWDA 3ZIXA 2D7FA 3GBFA 2BUKA 1G9FA 4PLMA 2DUQA 4V1PA 1F31A 5E89A 2WKKA 4P9LA 4C5WA 4IEZA 4Y1UA 5T54A 4QXKA 3MLJA 4Q4Y2 1DZTA 1ZZ9A 1DGRN 3D5OA 4N53C 2WC2A 1VB4A 4BHPA 2BEOA 1VLNA 3ZSKA 3QH6A 2CGPA 4JDNA 1AXZA 4XQDA 3RQ0A 2Z42A 1XYNA 1SFNA 1QU0A 3O7OA