4NR1A

Factor inhibiting hif-1 alpha in complex with consensus ankyrin repeat domain-(d)allyl-gly peptide
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
335
structure length
335
Chain Sequence
EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
publication title Structure of an oxygenase in complex with substrate
rcsb
source organism Homo sapiens
total genus 106
structure length 335
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2013-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4nr1A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4nr1A01
3P3NA 4B7EA 2WA4A 4AI8A 3KCXA 4Z2WA 2CGNA 2ILMA 1MZFA 3P3PA 2XUMA 2YC0A 1H2KA 1MZEA 2W0XA 2WA3A 4BIOA 4NR1A 2Y0IA 2YDEA 1YCIA 1H2MA 2CGOA 4JAAA 3D8CA 3OD4A 4Z1VA 1IZ3A 4B7KA 3KCYA 1H2NA 1H2LA 4QU2A 5JWPA
chains in the Genus database with same CATH superfamily
4YW7A 2CE4A 5KHKA 2W95A 5KA5A 3RZZA 3AYEA 1JW6A 3A21A 4LHNA 4JHTA 2VQ0A 4G2KA 4Y33A 3TWIA 4MVTA 1GTOA 4LKSA 4WFEA 4PA6A 1JH5A 2F4LA 4B3RO 1NA1C 4LK6A 4FT8A 3CO2A 2CSGA 4AEDB 4XUNA 4QE7A 4KL1A 1Y9GA 1AVMA 4GKXA 3W21A 5A6QA 4OI2A 4AGGA 3WW2A 3ZX7A 2VECA 4Q0VA 4PBOA 5CISA 3AKPA 4LPLA 2EIMC 1WWYA 5DN2A 1NAEA 1S3JA 1XYNA 2OIIA 2Z79A 4QGLA 4JYBA 5HCAA 2YYOA 1M56C 4CXXA 4EN9B 2ZKNA 2QTWB 3RGBA 2VNOA 4LNVA 1H2GA 4XF0A 3KCCA 4B4QA 2KSDA 1O9GA 4WVVA 2Y33A 1IS5A 4OI1A 1HRI3 1UMIA 1NCQA 4LP8A 5C8CB 4B1MA 2FDJA 3CCEV 2RMU2 1WPXA 1MVEA 2WLNA 4FP2A 3QOPA 3JCIA 5C5UA 2OCCB 4Y4RA 1UY3A 4Z1MG 2R49A 2XKPA 2B1GA 4CYDA 5JXHA 3NV4A 5B1NA 3I3EA 4Z2AA 3OJBA 1BEV3 1M1KW 1VQ4V 2B46X 1PZ7A 3FJSA 4RS5A 3PL0A 5DAWA 4TXWA 3SPIA 2E7TA 4JDOA 3M3OA 2P5BA 2RDSA 3FB5C 1NXD1 4CRQA 4CS2A 2VVFA 4DR4O 1VRH3 3HNYM 1FMD1 4I7ZB 4R9BA 1R1A1 5DUXA 3HNMA 1SA0B 3H42B 3LE0A 4V2WA 1KS5A 3AG3B 1CX1A 1POV3 3ABZA 2BWAA 2GNDA 2QNKA 3WW1A 3KB5A 2QTOA 1IG0A 1S5HC 3N9QA 4XDPA 3IAQA 3GZUC 2SLIA 5DG2A 3H8UA 1OI6A 5C4WA 4GJZA 4L92A 5FPBA 2R062 3RS6A 1GZTA 1OOPB 3L2YA 1PNFA 3T4HB 3W7XA 2A70A 1NQDA 4YWAA 5A3WA 3POIA 1GMMA 3MGUA 3JD72 4AEJA 4CDWC 4ZXKA 2KXLA 3CCRV 1IBLB 2LM3A 3F7VC 4BR6A 3MW4A 3NV1A 5FZLA 1IXBA 3WZ1A 1TMF2 4FFFA 4UBHA 5FZGA 2P2KA 3WF0A 2ZNIA 1KD1W 3LDCA 2RS11 3WSOA 4UB8Z 4LF4B 2P6CA 4YRDA 2A73B 4QKNA 2VMEA 4XAAA 2XVKA 4ZONA 1U12A 2A3YA 3URFA 1EZVH 3C3SA 4GX1A 1AR1B 1HQWA 1KQRA 3L73H 3ZM8A 3SGIA 3P3NA 1VBE3 3WB0A 2A75A 4DR1B 4FTSA 3K9SA 5ERLA 1VQOV 2ZA9A 1TUBA 4HBNA 5BNNA 4JYAO 2AR6A 1AYN1 3T0BA 3WX5A 2EXIA 5LXTB 1R3LC 4CXYA 1OA4A 1THZA 1GP5A 4O7XA 3KQ4B 5DDJ1 2DE0X 2UURA 1E57A 4LC1A 3O14A 1WN7A 4X64O 1FYJA 1Y7BA 1Y6XA 1JR9A 4A44A 5DUWA 4A4AA 3Q8FA 4R9CA 1AR91 3HB3B 3A0KA 2IJJA 4OULA 1J3PA 2JJ2G 4WBBA 4O9GA 4IERA 5F2VO 2BVVA 3VD7A 1CAXA 1XE0A 5FK8A 1KYOF 2JDIG 1XL6A 1VMGA 4FZ0A 3MV11 5K8SA 3BOWA 1WMDA 1AI6A 2DYRB 3VBOB 1ZX3A 2BZDA 3ON7A 3NAPC 3CMEV 4IV3B 4NIIA 4PDWB 4NRMA 3CC2V 5A32A 1EN6A 2FDFA 1OLMA 4BW5A 4AYUA 4UF0A 5A7WA 3CXCU 2EVXA 4W6XA 4MOAA 1BZKA 3USUB 2P4VA 3L75H 2R70A 2GAUA 3SQOA 3ZSKA 4D6SA 4RQPA 3ZKYA 2RR13 1IHMA 2UYBA 3FB6C 3QO5A 2DW4A 1DF4A 2VULA 3H3LA 4JRLA 5EJ1B 3ABMB 1N1VA 2WKKA 3Q4HA 2ET7A 4I55A 3EMRA 3DPRB 4F6RB 1YJ9V 4QQHA 1UCXA 1YIJV 3I3BA 2ATFA 1A3KA 4J7JA 1MQTA 4LTAA 1I5YA 1M57B 5LMNO 2ZEYA 2B39A 1MZ6A 1QXRA 3B8NA 3BIWE 4MGSA 4J9ZB 2EAAA 3GWOA 5CG9A 3PMSA 4Q4Y1 4DV5O 3N7MA 1D7PM 1UO9A 2H0VA 4BWOA 2PLV2 1B35C 1CZVA 3AMMA 1JYCA 2NP0A 4FLXA 4KBZA 5IYBO 1IQDC 3SISA 5B66Z 5AVPA 4Y1YA 3ZDSA 4NXNO 1FXKA 5L3DA 4R4ZA 1MS1A 3THCA 1D0HA 4CE8A 3OPZA 1AROP 4G4FA 3BTZA 4J42A 4O65A 2FDGA 4CDQC 1COV1 3FB7C 5JZGC 4HETA 2BERA 1DU3D 4RGKA 1KFXL 2FCTA 3OUSA 4LA3A 4FPGA 4MZUA 3BTXA 2GUZA 3IAYA 5JIAA 3IC9A 3CEIA 5JJNB 4KXRA 4M00A 3ZHVA 1BGYH 4UW3A 5BY1A 2RE9A 2W6IG 3J7MA 4J9YB 5FZ7A 4Q4W2 4Q4V3 1DQ1A 1XOYA 1PMIA 4CSWA 1C1LA 4BQ2A 4NXMO 1QLNA 1NKDA 3APBA 4I9WA 1BSMA 4XMIA 5KBFA 1QJX3 2C4XA 2OPKA 1NOVA 3N9LA 4DR7B 4AL9A 3J4UH 2W39A 1DGLA 1MOFA 4IESA 3ABTA 2Y34A 4DV3O 2C9KA 4F7ZA 4SBVA 3SH3A 1I7FA 2GH8A 3PVOA 3ECQA 1OHFA 1OCZC 1VQ8V 1OLME 3UT0A 4RFRB 1Q82W 2KG7A 3ES1A 4AVBA 3PIJA 1S0DA 4JX0A 1PGL2 1SDDB 3HR0A 3T2OA 2WLMA 5FR3A 4X65O 5F3GA 4HPKA 4GWJA 4BIFA 2UXDB 3BU7A 4Q0PA 4XJUA 2QFEA 2K46A 3K03A 4JGSA 1R1ZA 3V56A 1JZ2A 4Z8BA 2EILC 1GN6A 3AYDA 1XHZA 4P5YA 4BM8A 4FPOB 3JAMN 4MW3A 2HJDA 2R7EB 5B1AC 1HXS2 1BQPA 3CJHB 1CN1A 1C57A 4O2BA 3JAWB 4GJYA 3WEZA 4KWKA 1G4YB 3OGCC 3CJIA 4ARYA 3H3UA 1NI8A 1YQ5A 4GMP1 4UW5A 1BL8A 1NCQC 5FREA 1JYVA 1BXHA 2PHRA 2YB7A 5GLUA 2D3RA 3ZSLA 4JTOA 2RJZA 3PURA 3JZVA 1FPOA 2BCCH 2ORXA 2NYYA 3UKTA 3VD3A 5I93A 2NMOA 1WCQA 1M4UA 3K5LA 1H2LA 1H4GA 4NIDA 4ARXA 5KHGA 4MGYE 2EIJB 1H6XA 3HKEA 3Q8CA 2A6WA 1CAWA 2FMYA 2YPJA 4DR5B 4A45A 3BVOA 3S5QA 1ZRDA 1BT8A 2JIGA 4O4IA 1J3QA 2EXHA 3PU3A 5I0DA 5IATA 5F32A 4FSJA 3NSTA 2Q69A 5IYZA 3CDZB 3K2OA 4V2VA 5GONB 4F8AA 4E2GA 4DY5A 4JI6O 1S0GA 4XAEA 1ZUQA 2Z3YA 5ANNA 2W6JG 5H9QA 4TV8A 1AR62 2P4KA 2FDKA 3J7NA 3MUY1 2VC9A 1FMD3 4XOGA 4X89A 1LHOA 1R1A3 3CE2A 1UKRA 5FZ3A 1M5IA 2JVDA 1UOFA 1ZZBA 2XONA 1H1MA 4KMQA 5IK5A 4NHYA 2ADQB 1WCKA 2EIGA 3AZYA 2LGQA 2Y0OA 4XABA 3CYOA 1GAXA 2IH1C 4PLMA 1R64A 3ACIA 4QM8A 5C4WC 1WKYA 2UWBA 3C2UA 4TTGA 1VQNV 3CP1A 4AEDA 3JALB 1PIV1 1JYWA 2XASA 5JPNB 1RL3A 1WLCA 2V72A 1RVF2 4AW7A 5T54A 3RSJA 1Q8IA 4RWUA 1GNZA 1XUQA 4TLFA 3KWVA 3I2OA 1N47A 4LO8A 5I0TA 5HPOA 3NKTA 1IQAA 4PI0A 5FBJA 3WOGA 1ZRCA 1VQ9V 2W47A 1MEC1 3W7SA 2JJ6A 3E6DA 3ZYPA 3K79A 3M3CA 4JI0B 1RUNA 4OHVA 1UYXA 4M4PA 5C5TA 1N36O 2TNFA 2YC2A 1HV0A 2E26A 4RD7A 3BABA 1RMU2 4QPIB 5F2SA 2WAMA 4FLWA 4JI2B 5BNNC 3IPVB 4X66O 1OKOA 3AVRA 5TSWA 1AYN3 2TEPA 2VO5A 1JODA 4YW5A 1ZBA1 2QUOA 1ZREA 1XSRA 2IXLA 4IGGA 2ILMA 1N0NA 5DDJ3 4QPYA 1DG6A 2A0LA 4QXHA 4QQLA 3SHRA 5FTTC 1Y4MA 1AR93 4CU8A 4HSJA 2V1DA 1FKAO 3OAAG 4PI2A 1SA0A 2XTAA 2ZGSA 4AVSA 4TYSA 3K3OA 1AX0A 4N8MA 1Q6IA 3VKNA 1X8EA 2F1MA 4JI5B 2BTVC 3WF4A 2XKOA 5A3OA 3K48A 4P9WA 5FUNA 3M8AA 1LRHA 3DXTA 2LFRA 5B4NA 2YU2A 1OSGA 2VQUA 4XHBA 1FJGB 1OOPA 4YY3B 1Z78A 1GFF2 1GRJA 2YXSA 4KP4A 4CP9B 2Z0AA 4GKJB 3INAA 3K08A 3W5NA 2AENA 3IBMA 3TBDA 3ZX6A 2M7WA 1KP3A 4YIPA 4IHJB 5GW7A 4LFBO 3L2HA 1SLLA 3SC7X 4QB1A 1MZFA 4FCAA 1YJNV 1VBC3 2YG0A 2WS92 1MS3A 3VBSA 1NYWA 1ENVA 1YQ2A 2QQUA 3LD8A 2PI4A 4ES8A 4P9OA 2WO7A 4IYIA 1MQTC 1JFFB 4XUPA 1G6UA 1LB2A 1GQPA 1ZZCA 1LECA 3SCHA 1Z5WA 1AR71 1SQXH 3NNFA 4Y22B 3BB6A 1CZTA 3SH4A 4AFDA 5CZKA 2Y6FA 2ZD9A 3WINE 1RB8G 1W8OA 2HEVF 5LHHA 3MW3A 1R3KC 1UZZA 3VKMA 2D6OX 4Q4Y3 2XLGA 1SRYA 3SYAA 3HKBB 2PHLA 2JECA 2XL7A 4LHKA 4NHXA 1JXNA 1H1IA 1OLRA 4PA7A 1HB1A 1Y4WA 1FXKC 2K9PA 5F3CA 5IK7A 2Q5ZA 2YS8A 5CYYA 1TUEB 5IAXA 5DAPA 2DYSB 1TEIA 1TE1B 4JAAA 4XUTA 1XEQA 3CCVV 2XB6C 3BA9A 1COV3 1QLEB 4FOVA 5T5PA 1OH3A 4QHZA 4JCKA 3SCFA 3FLPA 3U4SA 5I8YA 4UUJC 2A79B 2ZS6B 2X10A 4J10A 4C1XA 1LULA 2V73A 4DEVA 1GP6A 2WFF2 3H1JH 2X29A 1VBA1 4PDWA 2EBOA 4DXSA 2YFZA 1E5RA 4XF4A 4NPLA 1SS3A 5IVYA 2OUJA 3VZJA 2IU3A 3AB0A 4Q1PA 1WCSA 1GV9A 4CS4A 3DGTA 3RZLA 3USUA 1W28A 2ZZQA 4XCBA 3RYIB 3O1PA 5L7OB 4KWJA 4OHXA 1YHQV 2EIDA 4QM9A 2VQEB 3AP9A 5JI7A 2CY6A 1W6MB 4JQRA 3DPRA 4F6RA 1DTOA 5FXZA 2Q1ZB 1LHNA 4UFKA 1WUVA 3LZZA 4FK5C 1EV13 3WDXA 1UIJA 2P06A 3ACGA 3N7KA 4GX2A 1YEWA 1TA8A 2FMLA 4JV5B 4LWSA 1K8AW 2X0LA 1VBB2 4NPMA 1LODA 5DEDA 2QVSB 4QDRA 2YFUA 5LGUA 1RSOB 1IG3A 2WLQA 1RUD3 4CH5A 3ZJZA 4KWLA 2QE7G 2DU1A 3GF6A 3ILFA 4N9IA 3K46A 4YJ3B 2OWOA 2QKAA 2R72A 5K0UB 1H8HG 3O9OA 3CJIC 3CKHA 5GKAC 4RUFA 4DV6O 3UKNA 2VUCA 2VOXA 2E76B 3W7UA 1AXYA 4FPCA 2OXBA 4XW3A 2MHFA 3FHQA 2WYFA 1IDSA 4LOSA 5J98B 2OTLV 2C5DA 3GALA 4X1KB 5EQUA 1PGW1 3MIGA 1KD7A 2WWSA 4GH4C 1FV2A 1G9BA 3PVNA 1W99A 1LENA 3AG4C 1ZA4A 4CCMA 1HDJA 1EP0A 2P5OA 2ZX1A 1O5UA 2F17A 3TGUH 4XE9A 5LEJA 1GOHA 4R8HA 3BRCA 4IDZA 3C7HA 1WB8A 4YARA 5FPVA 2Q1FA 3I3QA 3ILRA 5C3QA 1W0KG 2YEVB 1YO8A 4JI0O 2MEV2 3K3NA 3MIBA 2LFSA 3GBFA 5E88A 5KAIZ 5LA0A 2VD7A 1JYXA 2RV9A 1RJ7A 4YHHB 1Y3TA 1DYKA 2ZGQA 3J7AU 1SFNA 5D5QA 3KSCA 5IY5B 3CL1A 1ZNPA 4JI2O 3GHMA 4JGYB 1FXHA 4UCTA 3A23A 4XUOA 4LJHA 5B4XA 5F2WA 4UOJA 2CTRA 3MLJA 3RZHA 1ZBE2 1HW5A 4AEDC 1PO22 2RDQA 3D82A 1PIV3 4X6RB 2Q9LA 3NL1A 1YTFD 4JI8B 1XMOB 4NE9A 4FPJA 3VL8A 4DPNA 2Y6GA 1R73A 2E75B 4PDMA 4JDNA 3CRMA 3MUZ1 4H37A 1N0JA 3CJHA 5HV4A 4U3JB 3JAWA 4QXKA 3ZXAC 4ZKIA 3DSQA 3T0AA 3OBZA 4HVOA 3B09A 3RQ0A 4Y1ZA 3K0DA 1QR9A 2ZABA 2QKCA 1KDMA 1DYOA 1BMV2 5FKBA 4YLZA 2ZHKA 1FJGO 3BALA 4WM8B 3RJRA 4YY3O 1SLCA 4BK4A 2BSKB 3ZKUA 1MG1A 1BQ0A 4YM1A 1YJWV 3B4SA 1Q43A 4AQTA 4FFBB 4EFEA 1TVGA 1U97A 2PY5A 1LHVA 2GH2A 1W90A 3VUOA 4DO0A 2LO1A 2JD4A 1SLAA 2C26A 4MH0E 2IXKA 5GONA 2G38A 3MYXA 3OMIB 1C8NA 1XNTA 3RWRD 1JJOA 2QWOB 2KB1A 4LLOA 2LS6A 2C24A 5FMOS 3FBYA 1RGSA 4ITCA 4BXFA 3ZVXA 3AG3C 4BIOA 3HBZA 2HWE2 4AEKA 3QG5A 1LESA 1V6JA 4NJ4A 4META 4YZ2A 1X9PA 1N33O 5IJRA 1TZOA 1EAH2 2G1MA 5FY7A 1YUDA 2Y60A 1KC8W 1WW6A 2DN9A 1NQTA 4EWAA 5CN0A 3JALA 1C8M1 1OOPC 4XVHA 1K7DA 2X6CA 4ZU5A 1IBKB 3N9NA 2LW7A 1SFPA 2IJIA 2ARXA 1KP2A 2QQPA 4LULA 1EUTA 1PVC1 1QY4A 5FBZA 1ORQC 3VL9A 3J80N 2JWPA 2WN3A 3VBSC 3WNXA 2N04A 1F5FA 2YPDA 4CCCA 2XWJB 5KWRA 4HNAA 3OTFA 4O4LB 4EROA 3CZUA 5IWAB 1ZTEA 4NB5A 4E27A 3ZMZA 1RHI2 4CH3A 4LE4A 3IDEA 1B04A 4H7LA 3BCWA 1V6MA 1HNWB 1SACA 1S0BA 1OD3A 4IE6A 2HWD2 5EIYB 5BR8O 1MSDA 1JUIA 3TB0A 4HANA 1QNWA 4GLXA 2FBEA 1R1BA 4AQYB 3LQCA 1H8TB 3UETA 4QX3A 2QQMA 4OFGA 2AW9A 1W9YA 4QXBA 3KCYA 4NYKA 3IPVA 4CH6A 1K3IA 1SG3A 1IXMA 2XWBB 2BEOA 5IK8A 5ACA3 2VBDA 1IS3A 4IE0A 4MXVA 2A3QA 3ZRXA 1AB3A 3BYWA 4B3MO 4FI9A 2WFPA 1NE4A 2R6QA 3CX5F 1GKBA 1C5IA 4WBNB 3C8XA 1JZ4A 4FTEA 3M1HA 1UW8A 2VMHA 3BA8A 1OCCB 4PDWC 3VHRA 2AZ2A 1VBA3 1VQLV 3HJRA 2PAEA 1DF5A 5E1RA 4IIJB 4FLVA 4OX9O 3LSDA 2RDCA 3RWKX 3X2QB 2YU1A 1UKGA 4IHJA 4FQ4A 5LWBA 4IT5A 3K4AA 1WJZA 3OB8A 1D4M1 1AJQA 3ABMC 2NPIA 4KG0A 1V00A 5JOZA 2ODMA 3DPRC 4CP0A 2NNUA 3ZYBA 3I2DA 5J2TB 2E33A 1M57C 5I91A 4BIZA 3AP7A 4W8JA 3ZXGA 3T08A 1AJPA 4N43A 4XF3A 1FOD2 4P5HA 1X33A 1CAVB 4Y22A 1H1AA 1UNBA 4HSLA 2IZWA 2ZXQA 4DV1B 2VCCA 4JHZA 1R092 4I50B 4E9KA 2V4VA 2BUKA 1EY2A 1Q90D 1H9PA 4XJZA 5CB4B 5BMVB 5FFOC 4F4LA 4YHHO 4HL0A 1J59A 1HJFA 4XFAA 1BZWA 3PUSA 1RUC2 3OTOB 1SEFA 3E35A 4CZZA 1YWKA 5C93A 3M99B 1W03A 2OS2A 1TME3 2HBTA 3U4XA 2WT0A 4JZGA 4JZRA 4FZ1A 4URAA 2W5FA 3UT5B 1MZEA 2C1FA 3O65A 4H14A 5IVBA 2WSSG 2E3CA 3PVBB 4M01A 2PGGA 2J1EA 1OHHG 3OMAB 4E4DX 4CS3A 4X1IB 2VZTA 4R4XA 1RUJ1 4B08A 3H1IH 2ZKLA 1HV1A 2JK5C 2DBNA 1RM1B 3FYEB 2DUPA 4BOWA 1Q3EA 4K8RB 2WLHA 5IW0A 4MGKE 1OUXA 3OD4A 3WQ1A 1CIYA 5J36A 2DYCA 4KI5M 2QZ3A 4BAYA 4MXWA 4AILC 2UU9O 3RYIA 3PJQA 5L7OA 5C9AB 3HT2A 1RP3B 2HWC2 2HEYF 1AL22 4FXGB 1O4ZA 4CDUB 3KQRA 1DF0A 1FNZA 3MPBA 2BOBC 3ZXJA 3ZRVA 1QXPA 3FAVB 4TQDA 3ZRSA 2RNBA 2WAAA 5K7PA 3OD0A 4KNCA 4CH4A 3N7LA 3OGRA 4Q4V2 1PO11 2QQVA 2AYHA 3UK9A 5D1IA 4LKFA 4K3AA 1PMJX 1FFTB 4YW1A 2ZM6O 3WQBA 1GN4A 4HONA 3ZN5A 3Q9OA 5AC92 2WQ8A 1US3A 3WCSA 5FY4A 4LFAB 1VLNA 4IEQA 1RSOA 3AKQA 4P9XA 4UV8A 4X62O 4Q29A 3H8RA 4HKLA 3K4DA 4E4EA 5JOYA 3EXAA 1CP9A 4YJ3A 4WCEV 3N2KB 5K0UA 5FZAA 1S0IA 2WWWA 2XVLA 1DCSA 3GCWA 3VBFB 3QF7A 4RUEA 4NO4A 4G27B 3ZN6B 3NQHA 3JYCA 3POBA 4Z07A 3P5BA 5B3SB 3D3IA 3BCCH 2ET1A 1WB7A 1NQJA 2EIJC 4X1KA 3JAKB 3EHKA 1RINA 3E5QA 1QH6A 4NVPA 4D6TH 2DTWA 3NNLA 1LOCA 3AK0A 2VNVA 1SKVA 4FVVA 1V54C 2NN8A 4DV2O 4FAGA 4HLTA 1AILA 2OW4A 2WRAA 1O7FA 3FX7A 1ASJ1 3LIGA 4JYCA 2VGDA 3CCSV 3HQRA 2WINB 1QJZA 4GA9A 4P9IA 2DCTA 4GALA 1NCRB 1UAIA 1PNLA 1O8PA 4WVWA 2D93A 4QQOA 2GC2A 1YJKA 2YEVA 1HNWO 1NZCA 4XQDA 4J7KA 1KECA 4A2UA 5LP6B 4KGGA 1RITA 1JJ2U 1NY72 1Y43B 2BU9A 1H2NA 3VKLA 2V4AA 5FYVA 4XJAA 2UUCB 1OJHA 2XQXA 1BHAA 4BB3A 4GXLA 1XDCA 5JXGA 4JGYA 4CC6A 2LP7A 1SLTA 2ZE8A 4A7ZA 1NS1A 4ABMA 1ALYA 4LHLA 1C8M3 4Y1VA 3CCLV 3GM8A 4J25A 4ATFA 5GLZA 5LEKA 3E5UA 2YI8A 2Y0IA 2VOTA 2VZ1A 2ZEXA 3KT1A 3TYJA 1UJWB 2JS3A 3OGSA 3J7HA 4U3JA 2QKDA 2Q6AA 4GWMA 1JOPA 3W5MA 3P3PA 2UYAA 3TEWA 2GALA 3KHBA 4BYYA 1O3RA 2GC3A 1YXBA 3W59A 3EHBB 2VMDA 5A70A 3N36A 2HHHB 2D2CB 5IJ9B 3N2GA 2GV9A 2F6BA 2XAHA 3FHAA 1W9TA 5FP3A 1YYNA 2BSKA 5LBCA 3KV4A 1V55B 2ENRA 5LRRA 3UKMA 2PHUA 3A0HZ 3ZFGB 4J41A 3AP5A 4OQ8A 5BXZA 4GB33 4DR6B 1LEMA 2RM23 2EINB 4FFBA 1OA2A 4XEZA 3FKSG 4WM7B 2LQTA 1JZ6A 3CRQA 4LF5B 2RS12 2YBPA 1AI7A 4X1YA 1NZ6A 1GM8A 3D6EA 2CAUA 2WLIB 1O4TA 3UV9A 1JVMA 1Z0HA 4HFSA 4D0QA 2Z42A 4PQ9A 1BE3H 1ZX5A 3L9JT 3NJVA 2BW8A 3NJXA 1ZZ9A 4IE5A 2B7YA 3AP4A 4C0BA 3VHOA 4CCJA 4YIOA 5DABA 5FV3A 1JI6A 2CU5A 4XBLA 3KHCA 2J1UA 4C90A 3ST7A 5LY2A 3QCWA 1F4HA 3POEA 2CUGA 2GNTA 5A3TA 3WDTA 4P2ZA 2IC1A 2O57A 1GLHA 4LH6A 1CX4A 4OHWA 1NU1H 4Y26A 3AKRA 1ZRRA 1F5JA 2IVIB 2E5LO 3OTOO 2P67A 4YG6A 2XQRA 3JD0A 4QQPA 1HB4A 4HK8A 3R05A 1SFYA 4QHOA 1RUE1 3OGJA 3RVHA 5HXVA 4BQYA 1SQFA 1EZJA 4IEUA 2EJ7A 1BHGA 4DW1A 1COWG 4AQ6A 3NR7A 1D4M3 4MLOA 4CEWB 4FXKB 4LO6B 3HWJA 1E1QG 2J22A 3RT3C 3ZN4A 1IVSA 1MS9A 3S7EA 4O4LA 5EK0A 4CBCA 3KGLA 1XPWA 2WO3A 2VS0A 5B1BB 3UKVA 1A8DA 1FXZA 1Y67A 3ACLA 5L3CA 4L99A 2CAVA 4HAMA 4K8ZA 2VXRA 3VKFC 4MVUA 1UPGA 1LJ7A 5FYSA 3JBG1 1JU4A 2XJTA 4JKLA 3OGIB 1VIBA 1W05A 3KF3A 1B06A 2QGNA 1H8TA 4QAWA 1VRBA 5FPOA 4XYXA 3QH6A 3VDAA 1XREA 2K2SA 5L3FA 5JAXA 4UVAA 1W8FA 5K1PA 3EQEA 1DGSA 3N9PA 4LE3A 3HN3A 4FOYA 5LYJB 3M3IA 5CA1B 1TNRA 3Q8EA 1KUQA 4YM0A 1IBMO 1EUUA 2RMU1 2DYSC 2DVGA 1SPPA 5GLTA 1NTZH 5CBLA 4AE2A 5T3NA 1QLEC 5F37A 1YFWA 4WBNA 2DMXA 5KXBA 5HFLA 4IEWA 4S2FA 4JI4B 4LT5A 3F5TA 4H33A 4YFWA 2L9LA 4WFGA 2WL1A 2V7QG 2O8QA 2QQKA 2Z69A 3A8TA 1LOGA 1RUJ3 3B2EE 1LOFC 2DVDA 2F95B 4Y3OA 3ZMOA 1UX7A 2GZWA 1HRV1 4OZOA 4IIJA 1W39A 3R6SA 2OYZA 3KMHA 2DCYA 1AYM2 3SEPA 5L7OC 4TWKA 2XGXA 5F7UA 5KHJA 5HXMA 2EIEA 4V1PA 4W65A 3WDVA 1OC1A 1ZL8B 3CCMV 4BPZA 3DECA 1G9CA 3VBUA 2FDHA 4R6ZA 5FYMA 3ORJA 4EE2A 1IOAA 2YGLA 2R061 5J2TA 2J42A 2GDSA 1PO13 2R043 1DGRN 2XLFA 1QXJA 1CAVA 2RHPA 2EIBA 3WF3A 2ZHLA 1H30A 3CHXA 1JQ0A 2C9AA 3FUQA 2WZEA 3DN7A 3VKOA 2DFBA 2DWEC 2AGSA 4L2NA 4DZGA 1P49A 4I50A 3BVCA 1E5IA 1GP4A 3ZMSA 1SMVA 2RDRA 1T6BX 2VZ3A 4NIHA 4LQRA 2XT9A 1IS4A 3WVJA 5K0UC 3LKJA 4NR1A 3B00A 1HRI1 2QM7A 2IXCA 2D7FA 1IPJA 3F7YC 4I4TA 1YFYA 1GZCA 5F5CA 4XC9A 2C2AA 4MSWC 2YC4A 4AQSA 1JN2P 3GHNA 2X05A 1HNZB 5F9TA 3N9MA 1ND2B 2ZPXA 2IBZH 4LNUB 3OEBA 3UT5A 3T1HO 1XNKA 3PIGA 2Y4UA 3AC0A 4BLIA 3N7JA 4ZPIA 3KCXA 2NZ9A 4ZZ8A 5H6QA 1RC6A 1IKQA 4AI9A 2P7TC 4IW3A 4X1IA 1IS6A 2ORZA 1Y76B 2P3YA 1EPZA 1I9RA 5G05L 3UESA 4KH9A 3EO6A 1ASJ3 2QDOA 3L74H 1K33A 4CCEA 1XNRO 3I7DA 1VRH1 2X09A 4COYA 1EFRG 4U7OA 1A34A 1QNMA 5FZCA 3FUOA 5C9AA 5LL6Y 3AVSA 3OE7G 4BQ4A 5KMGB 3K5NA 4CDUA 1O59A 2DU0A 5A7QA 1AX1A 5CU1A 2PELA 5KHHA 5BZBA 3IIAA 3FAVA 1UYZA 3K06A 5IY5C 3U0ZA 3ZLIA 3WR0A 5A1AA 3ASNB 4JGYC 3CZJA 4DR6O 1QDOA 3VDBA 4LK7A 4ES9A 1US6A 4BQ3A 4LF5O 2FB5A 3ZFFB 3R4SA 4P00B 1L1FA 3AG7A 1NTMH 1MS5A 2CH7B 4YJ2B 4I0WB 3D4KA 3WNOA 1EPWA 4RHV1 1G86A 2PAMA 4GWNA 5GM0A 2XMLA 1FPN2 3LEMA 3T09A 3VBRB 4JRAA 3OUIA 1VE0A 2CDOA 2ZEZA 4BK5A 5SV5A 3EFFK 2A1XA 4FLZA 4UFMA 2XUMA 3VN4A 3RW0A 1XSQA 1N3QA 3AG2B 4GCZA 3QO7A 3O7OA 3OPWA 2XJVA 3ZSMA 2VMCA 2G4IA 3ZN6A 2LRPA 3MHZA 1T2XA 1RPRA 1SCRA 1W0PA 3QACA 4WM8C 1OKQA 4XTMA 4CUGA 2VZPA 5E79Z 2ZT9B 4I9QA 5J37A 4I02A 2R9RB 2YXHA 5EYPB 4L87A 5DZGA 1JHNA 2EIKB 1H2SB 3JAKA 1AI4A 1MSWD 4O2AA 2Q8VA 5IUQA 1KFUL 2PLV1 1V6IA 5J7MA 4ZI7B 3JU9A 5SV8A 2PI5A 4K7JA 4EB6A 1DP0A 3SLIA 4ISRA 1BBT2 3ZMUA 4LF9O 1HB2A 2BOCC 3JATA 4QNHB 3CSXA 4B3SO 4XJ8A 2ES3A 2A9HA 3E89A 1MEC2 4I0AA 2R16A 5BNOA 3GB7C 4DRRA 5LOVB 3KD4A 3DGEA 4GMP0 3K9AA 3ASOC 1XNDA 4DFSA 2Q30A 1NCRA 2FD8A 4IE4A 4MX3A 1UWWA 3EXUA 1DGWX 5FZ6A 3VDDB 5A7SA 1S0VA 4JQTA 4FOWA 1N1YA 3PMEA 5LP6A 5C8WA 3SITA 1SQVH 4DUZB 2GP3A 2BNOA 1ULEA 4QDQA 4QHBA 2D3SA 1ZBA2 2R9IA 5T5LA 4Q4W1 3HNBM 4IE7A 1N32O 4PF1A 3H1WA 1GMGA 5FZ4A 3IT8A 5B5EZ 2HR3A 1F8VA 4HMZA 2GMPA 4D7SA 4IV1B 4MVMA 3IMNA 4QT6A 2WWUA 4KHPO 4ZIBA 3ZYFA 3KS7A 2JEUA 4YW6A 3W58A 2RR11 3PUQA 2ADEA 1XI1A 3KGZA 3RRDA 3WG1A 4YZ4A 4AR2A 1QGLA 1C28A 4XJ9A 5FCCA 1G8WA 2QBXA 5HCHA 3AEIA 4JI4O 4LH7A 3ZDVA 2OZJA 5IYYA 5HFMA 1FT9A 4XIKA 4X64B 3LA2A 3USSA 2JE8A 3APOA 3S3XA 2ZACA 2DVAA 4Z92B 1RUOA 1HR0O 1QIQA 5EYYA 1YIFA 4CU7A 5CEHA 2VOWA 2ZX0A 2ZCWA 3M7AA 3OBTA 2W3JA 3JBG3 5IYDO 4LCUC 1QJFA 4M3CB 1NVPB 1HXS1 4A3ZA 3G4SV 1H8TC 5LHIA 3ZFGA 4Y4YA 3HQXA 1AZDA 2VCAA 2QJVA 4MVZA 3JD2A 4IL7A 4BMEA 3SCGA 3HBKA 5IYCO 3ZO0B 3GBWA 3WB2A 1CGPA 1YCIA 4PIYA 1PZ9A 3WQ7A 4DXTA 3ZHUA 3LEIA 1AR72 2WLIA 4Z2WA 2W87A 4QPWA 2LTNA 2RMU3 2P17A 2W08A 3W20A 5IWFA 3MDSA 3QNEA 1J95A 1QOSA 1VQKV 4PT6A 5JPMB 3O5SA 2ZMNA 4IQPA 3WCRA 1R6KA 3SYQA 2PHDA 4Q6GA 2Y6JA 2JG9B 3LSEA 1LU2A 4ZXEA 4LO5B 4FVMA 1AHSA 3UCSC 3SEEA 3MO4A 1FATA 3SPGA 1HP8A 1OCCC 2BTQB 4MTXA 1JOYA 4AGVA 4P14A 2LALA 4BH9A 5LMNB 2FZ2A 5GALA 5J2UA 4IEVA 2ZMLA 2ZGTA 3JCZA 1JHJA 1UY4A 2X8KA 4EEQA 4FP3A 1BJQA 2HBUA 1XE8A 1AR61 3H3ZA 1OCRB 2AUYA 4GYCB 4DV5B 1UMZA 4DK0A 1F31A 4A5UB 3U07A 3X2QC 3M3EA 3KVBA 3AMQA 5A9GA 1VPHA 2JXAA 4E4SA 1QJY1 1SLBA 4CEWA 3VBUC 2IUWA 4NXNB 3OT7A 5JJJB 4E2SA 4AFAA 1RUI2 1AI5A 2R063 4XF1A 2I2SA 2VUJA 1BVVA 4A42A 5HCFA 1RVF1 3T30A 1N8RW 4MO3M 4F3JA 2HEWF 3THOA 3IZOA 1F23A 3JD73 2P1BA 2JDYA 1WBFA 4PJYA 1UOGA 2R071 5FO7B 4UFZA 4O9EA 3LSQA 4XDJA 1WCDJ 1N3PA 3S3WA 1LGCA 3LDEA 1K45A 2UXBB 1TMF3 1KKCA 3WG3A 4COUA 5H5NA 4DUVA 3T2QA 1ULOA 4KG8A 4YW4A 3TRSB 1AJNA 4XXPA 1WGPA 3OGGA 1XQNA 4WF9V 1M90W 4NXMB 5FY9A 3RMXA 1BVP1 4LKDA 3ZPOA 1AUYA 2DWRA 2EA7A 2HLEA 4R8CA 5FY8A 4D69A 3BKZA 1PX3A 2Y6LA 2BDRA 4DV3B 2GMMA 2I45A 4KQ7A 3VLBB 5BNQA 3DYMA 1D5AA 4M3CF 1NTKH 5EZWA 2WLPA 2D5FA 3WG7B 4N53B 4EYUA 3JASB 2OT7A 2ZX2A 4FFKA 2YDEA 1SBDA 1GM9A 5BNPA 1RM1C 3ZYIB 2ZE6A 2HLDG 4X65B 4JAVA 4LF8B 1ROPA 4ZOLB 1QVFU 3E8BA 4WVMA 1S2BA 3FC0A 2E31A 3AYAA 3T1LA 1S77D 4QGNA 2DDUA 1VBD2 1XMQO 4FPLA 4EN8B 4BE3A 1AR82 3WNMA 5C9AC 4OHYA 1PGW2 3BODA 3ETGA 4MSVA 5F6KA 4CDUC 2A6YA 1ZL8A 3E6CC 2GU9A 1RUH2 1X36A 4XTPA 2VBPA 1W2TA 3IFXA 2VVDA 2XUEA 2ITDC 1KRIA 1PL4A 4BDVB 1HB3A 2EZPA 2VWJA 5F5AA 2JDZA 4NROA 3ETPA 3LOIA 4CCDA 1GO3F 1UPSA 4K8XA 2YXLA 2ARBA 3KV6A 3K0GA 5IT9N 3NNMA 1JA8A 3LEGA 1JS9A 2VQTA 5KR7A 4LF6B 4PF5A 1OUSA 1W6PB 1D2SA 4L8JA 2Q5TA 4RHV3 5A1LA 4B7KA 4IETA 4MW8A 4CCNA 2OZ6A 4HYOA 4HG6B 4MADA 1W3XA 3DCQA 2VJXA 4PV1B 4D6QA 1R082 4DUZO 3A2FA 5C71A 4XZUG 3TXQA 1DQ2A 1EN5A 1JYTA 4I0XB 1QOOA 2ZOEB 1F4MA 4U3FH 3VBFC 2GNBA 4XACA 4JI6B 4BQ1A 4B3TO 1W2NA 3MLKA 4CUAA 4R9AA 4WZFA 2PXJA 3W9AA 3LGRA 2AACA 3DUIA 5B3SC 4IGQA 5JCOC 1LU1A 1B09A 2LUWA 1N1TA 3IIIA 4GKKO 4LNUA 2M6YA 4EKWA 4LF7O 5FZFA 3ML0A 2PLV3 5F1RA 1NLRA 1JMUB 4OYUA 1NLSA 2XBO2 2ZGOA 5LZ6A 4ORFA 3ZRWB 1Q86W 2PMWB 1FI2A 1AF9A 3UNPA 1ULGA 4QX7A 1QH7A 1Q81W 2K9ZA 1LR1A 2Y69B 4TSVA 4IGOA 3B01A 1Y76A 4A3XA 5BNOC 3IKWA 2OUHA 5FZHA 1DLCA 1X59A 3UQ8A 1NCRC 1Q8OA 4FFGA 1VF6C 2Z4FA 3O1TA 2ZNJA 2XJQA 1AXZA 3CB2A 5LP6C 3CCQV 3K4ZA 5KMGA 3AZXA 2AEZA 1NLQA 4BU2A 4MVRA 1UU5A 3M8LA 2FKXA 1XNBA 3WF1A 1DLLA 4XMAA 3FFQA 1W6OB 3WT3A 4Q4W3 2PN5A 4Q5OA 2WN2A 2Y8KA 1XILA 4KU8A 2A7WA 5EIBC 1N36B 2XJRA 2CH7A 4YJ2A 1QHTA 4LO4B 3ZHSA 4UXNA 3VBRA 5CFDB 1VBC1 1K73W 2DURA 2X53S 1K5QA 1HIXA 2LROA 5CIRA 4P08A 3QVNA 4GIQA 1GSLA 1S1AA 1U5YA 5AVAA 1OPMA 4X66B 5CMUA 4H55A 1YTFB 2L35A 2PHXA 2IXHA 4KFMA 1N4CA 3U75A 2VTXA 4Y5TA 4DEQA 2Y48A 1ODNA 4W6YA 5LRSA 1HW7A 2WQ4A 3W7TA 1N34B 5BXXA 5E1AC 2WYSA 4I2OA 2BOIA 2JS5A 2HWB2 3C7FA 3Q8BA 3LNNA 4I3PA 1V9U2 5EYPA 1V55C 5FZKA 1PVC2 1HXS3 3ZFGC 1X7NA 5FJKA 1BMFG 5KC5A 1K12A 4ZI7A 5C8YB 3ZHTA 3WD5A 1OCZB 5EXOA 2EINC 3D8CA 3CJXA 2MW2B 4DUYB 1PP9H 1REEA 1IZ3A 4CPBA 3RJ2X 4PDRA 1GZ9A 3CCJV 1SQBH 2DCZA 3SH5A 1X4TA 4J80A 1MR5A 1DDLA 2I07B 3TNPB 2VMFA 3RYHB 4P30A 1PM4A 5LOVA 5CADA 3ETEA 1AL0G 2EILB 3LCPA 1L7LA 4COZA 2UWCA 2GC1A 4LFBB 2FMDA 4WV8A 3VDDA 1Z7S2 4BWAA 4XBFA 3ACHA 2VW2A 2ZIMA 3BGAA 1WLTA 4AG4A 3CRAA 1CPMA 1W8WA 5EPAA 3E86A 4ZS3A 3B77A 5JQGB 1QJEA 1C3HA 4QIWF 2QR4A 4CA9A 5CB7A 4AWDA 4H7MA 5FY5A 3CMGA 5T5JA 3PUIA 1VAMA 4MV2A 2UXBO 5EFUA 1K92A 5ISLA 1VQPV 1NCQB 2DV9A 1FX5A 2ZGMA 1UPIA 4XDKA 4GULA 4NHLA 4R50A 4LOTA 1ZRFA 5HCBA 5A33B 3H7YA 4PDVA 3NV3A 4IV1A 5FWEA 1AR63 4RN5A 2X6BA 5LA6B 1PX4A 4MHRA 3IDAA 5EBLC 4A6OA 5LK5A 5FP8A 5A6ZA 4H2AA 2DOSA 3DC5A 4AI0A 4CEWC 1H38A 5JUVA 1QJY3 5FZEA 3WP5A 4RS5B 1KQSU 2RJ2A 2XAFA 2WC2A 1W0NA 2CTPA 4BHPA 1ZBE1 4PA9A 2XJUA 2Y6KA 1EV11 1PO21 5B1BC 5C7GA 1F51A 3G6BA 3H1YA 4W4LA 4LF8O 1RVF3 2QWRB 4PCRA 3SDLA 1Q5OA 2RJLA 4CCLA 2VW0A 2JICA 2J1VA 2WQZC 4RL7A 3H1MA 2ZAHA 2XOKG 4M3CA 3TAYA 1RUD1 3A0RA 3HIFA 2R073 1S72V 3LEKA 3ENRA 2Q4SA 4DY3A 1O4YA 4UFJA 5CA0B 4I30A 2B5UA 2IM9A 2VZRA 4G3YC 2DCKA 2Y26A 5JH7B 1UOBA 3LSUA 4XUQA 4OUSA 2G9GA 1UXZA 2W91A 3CQOA 2A3WA 2IU0A 1O3TA 2ZGUA 1UX6A 3FL7A 4E4HA 5GZEA 2WIIB 3ZMVA 4DR3O 3SYPA 4QQ2A 3ZIXA 1QBZA 4LF6O 4MGIE 5IFTA 3RWNA 2AGAA 1RMU3 4H3WA 1ZWIC 5IVEA 4GH4A 3BI3A 3VD9A 3I3MA 4O4HB 2Y0PA 2JG9A 5L9RA 3DEMA 1KITA 2RS52 5C70A 4LBEC 1BCCH 2BTQA 5BNPC 3N35A 4LBJA 1UOJA 5JIUA 2HKOA 1TQ5A 1W04A 4QU1A 1WMEA 2XVGA 3K77A 2ZHNA 5FMBA 2QKSA 3OEAA 4L9BA 1FD9A 1GH6A 4UCVA 2B5HA 1WNSA 5LW9A 1SLIA 3O1OA 4NKGB 1YQ8A 1TUBB 2ZCEA 5B1OA 4JI3B 3H1LH 5FJHA 5BNNB 4HOOA 1UYYA 3NW4A 3POWA 2KQXA 3K58A 4QX0A 4DV6B 1EAH1 1CESA 3TEZA 1WW5A 4OQ9A 2F23A 4LIVA 1YZBA 4I3GA 5LGNA 1XYPA 2JE7A 2XAGA 3WUDA 2D6PA 2UY9A 4KU7A 3SNMA 2F4VB 3ICXA 1LCLA 1PM9A 1GICA 1U96A 2XL9A 1RIRA 2UUBO 1YNAA 3CU7A 2VTXJ 2RCVA 4RYDA 2ETEA 2PYJA 4HKWA 4JGZB 5CKNA 1O3QA 2WS93 1GANA 4OMCA 2YICA 3WW3A 4HN0A 4A7YA 3ATGA 1RHI1 4YM3A 4CVUA 1QJU2 3R4UA 3E8FA 3E8GA 4YVSB 4N90A 5I0UA 2BJSA 5IT6A 2HFEC 5C8CA 3ZR5A 4RQPB 5FZ8A 1VR3A 2Q0AA 4E8CA 1F7YA 3K5OA 3VDCA 4AF9A 2I74A 3RG0A 3SPHA 2VOKA 3HT1A 2E51A 2B4KA 2QDRA 4AFBA 4DUWA 5C3SA 4N53A 1H9WA 2FHRA 5E16A 3JASA 2XHKA 3KV9A 1HJGA 3CC4V 3ZBHA 3GBGA 3PTRB 2AC1A 1GNHA 4TLGA 1JOBA 4O61A 3D3AA 1JOJA 3TN92 3NO8A 3I2IA 4OZXA 4UXAA 1N34O 2XXZA 4X88A 1Q8SA 4W6WA 2BFUL 3CEWA 3PJYA 5A80A 5AFEA 4QD2A 4ICGA 4QX2A 4K40A 1NUKA 3D36A 2WFF3 4D6RA 3R65A 1G9AA 3WDUA 2KR2A 1GK9A 3B9CA 3BUCA 4M0HA 1DBNA 3AG1C 3D0JA 4Q0SA 4MTOA 4DUYO 4AAPA 1BLZA 4Q26A 3THDA 1WA4A 1V6KA 1DQ4A 2PHFA 5FUIA 1VAVA 3AJZA 4Q0UA 2RN9A 1W6PA 4QKFA 2WNVB 3VBRC 4CCKA 4D8MA 2XH6A 1A78A 3OOXA 3VHPA 3O1SA 3J26N 3K51A 4C8DA 1LUVA 1ZM1A 1ULCA 1WD4A 3NMBA 4UT5A 3B3QE 3VD4A 4NIAA 4XQ4A 4A6SA 3AG2C 3R4DB 4I0XA 3KLSA 3E1F1 1W2BU 2JGUA 4LBLA 2ARCA 3ABKB 3L71H 3J9SA 5FY1A 3P6BA 5L73A 2V09A 4HN1A 4GUNA 2E6VA 4FLYA 1R091 2RVAA 2EIKC 1DQ6A 4SLIA 5FLJA 3RZMA 1N33B 2EX3A 3LUTB 1DFQA 1AJKA 5JSPA 4H13B 4XJWA 1OH4A 3ZRWA 5M0TA 4MUVA 2WO2A 5GTIZ 5LXTA 1GUIA 2KG7B 4AHWA 1XJAA 4Q4X2 2DF7A 5ACA1 2ETNA 1WLDA 3CXHF 3LA3A 1SQ4A 1H8EG 3U11A 1O3SA 3VZNA 4TSFG 1VF7A 3VDDC 1CJPA 3G80A 4QMAA 3H1KH 4O2BB 2H94A 3MEPA 2JRIA 3CJIB 1V0AA 1TAEA 4DNYA 3VBOA 3WNPA 5JWPA 4IV3A 2JKXA 1D2QA 3VV1A 3WNNA 4YFZA 2F4PA 2D6LX 2C0ZA 2ZGKA 1I94B 1AR4A 4TV9B 2AXTZ 1CEZA 3IWZA 4IV1C 4E4ZA 5FO9B 5BR8B 2W1QA 1AVBA 4ONUA 2D97A 3ZSEA 3HKEB 2HWC1 1AL21 1Y9QA 4EFBA 1CAWB 2MEV3 1W8UA 1Q6UA 5BV6A 1J84A 4RR3B 3ZN1A 1DYPA 4KUMA 5CFDA 1PK6B 2VQFO 5CAZA 2UXCO 3ZXFA 1SCSA 3ZPYA 5ITZB 2RDNA 4DQAA 5L9VA 3NNGA 4HZFA 5KLVH 2OKXA 5IYZB 3OM3B 3WNLA 1RTVA 1NT2B 3I2KA 1ZBE3 1GN3A 2JG8B 1PO23 1GWKA 4JI7B 1WMXA 4B3MB 2QSAA 3ZSJA 4TV8B 5FPZA 2XDVA 4DMIA 4FM0A 3LF7A 4B8EA 1RUE2 1QCEA 3MBWA 4OUMA 3GDBA 2WZR2 1A32A 2XAJA 1V6NA 4YNIA 2F43G 3BEHA 1CVNA 3PJSK 2TBVA 1H2KA 3WV6A 5EIBD 1HQLA 4JI3O 1WZXA 3AJYA 1GN2A 2BWCA 4D3WA 5C8YA 3OF1A 4GWIA 3T2MA 1TVKB 1X50A 4L97A 1NH2D 4JKMA 3RYHA 3H01A 1ZLZA 4OX9B 1SC5B 3ABLB 1OBNA 1RUF2 2A71A 1PPJH 1TME1 2F4VO 1JZ8A 3JBG2 3J8F2 3AMNA 4YGEA 1M4WA 1DQ0A 2WLJA 3MFAA 4GAZA 2HWF2 2Z2SB 5JQGA 1G1XB 2JDUA 2JG9C 4QJFB 4C1WA 3M70A 3CF6E 2OX0A 4AAXA 4LORA 2ZXWB 3SR2C 4DW0A 1LOAA 4IEYA 3U10A 2WZ8A 5FZDA 1OCOB 1PL0A 5FPUA 3FB8C 4G9SB 4QWNA 5A33A 4H0LB 2CNAA 4PIXA 1K42A 4AK3A 2QQNA 4YGDA 4AI1A 1OCRC 2X5IB 2B8MA 2GDFA 1WW7A 1XNQO 4UFHA 5LA6A 5LBQA 1CAUB 1NY71 5EC2C 2HWE3 2TUNA 3JSNA 3B9IA 2A6ZA 5A3LA 4BQWA 4QDSA 3N27A 2BQPA 1F4NA 1MA1A 2O14A 4OPAA 1QQP2 5IVFA 1EAH3 2BGPA 3RYFB 2LW1A 2E63A 3GCXA 4DV4B 2Y6HA 4QXCA 4IGPA 4JAUA 1AXKA 1HRV2 4IYHA 1RUG2 4CDXB 2NLRA 2VCBA 3P30A 4A7KA 2CL2A 4EN6B 4Z1VA 3FLRA 2V5DA 4LKEA 4DRVA 3CNAA 1SHWB 3FWEA 4QPGB 4P9YA 3G67A 2J1RA 2QCSB 3SPCA 3HKDB 2F66C 4D7TA 4B3NA 5IVVA 5CA0A 1UU4A 5CFCB 5GLWA 1I6XA 1NKGA 2WR9A 2WLKA 1LNSA 1RHI3 3RZGA 4XDQA 5C3PA 2ZGPA 3F95A 2WPDG 5JH7A 1RFYA 2CAZC 2H0BA 1XRUA 4UFLA 3FBMA 2O8OA 3MIDA 5DXDA 5C8CC 2UU9B 2HWD3 5LCWL 1Q8PA 4BISA 3A22A 5LBBA 2OCCC 3VBSB 2GTAA 4PA4A 3OGVA 1D0GA 1VP7A 5LMUO 1WP8A 1RJ8A 3BOPA 2W1WA 4O4HA 4NTYA 3FHIB 5GJ6A 3WG7C 1QEXA 4N53C 3KT7A 1SBEA 4A41A 3JCUZ 4YYOA 1W0OA 2VG9A 4IEPA 2ZM6B 3SXWA 4AQ2A 1HRI2 1ENRA 1HLCA 2C6SA 4PDLA 2JEXA 2VZQA 2RS31 2ZDIA 1S76D 4TT3G 2E53A 5DQ0A 3GXUA 2K1EA 2P22C 5LA2A 4X62B 5FPAA 4CEYB 1UZVA 3BHPA 3QTCA 4HZ3A 4FM1A 2QM8A 4EV0A 1CONA 4K1YA 1H8VA 4RQEA 3D36C 2OPWA 4DV0B 1BEV2 2KKWA 4UV9A 4AVAA 4FM2A 3DKQA 2BRTA 3MDPA 4RGAA 4JYYA 5D5PA 1VRH2 4B7EA 2CWSA 2X7RB 3AYCA 2ADPA 1RXGA 2IH3C 3FZ3A 1LUWA 4P9JA 4JGZA 3STZC 2ATKC 4DV2B 4MVQA 2QA4V 5LASA 5FYHA 3W7WA 1GWLA 1XXNA 2PTMA 5KX5B 4EZ4A 4JTDB 1QU7A 1GZWB 4TQFA 4YVSA 1B3QA 2CV6A 3CRCA 1FOD3 2P37A 4DXZA 1I94O 1OQEA 2GN3A 4XETA 2VNRA 2VU9A 4YG3A 4HKOA 3T1YB 1QOTA 4RHV2 2AHYA 4PLOA 3U37A 1XBFA 3JB8A 1R093 2AZ5A 3OUFA 4QPIA 1EYBA 2PUSA 1PHMA 3LAGA 5F6LB 4GB31 3PU8A 2Q7GA 1YVWA 2RM21 4EN7B 4B4RA 1YHFA 4X20B 2R9AA 2LGWA 2ZZJA 2Y69C 2VM9A 2VZUA 4UCUA 3IN9A 3UL2A 1RUC3 3H0OA 2VNGA 4LWSB 1JMKC 2XPJA 5CA6A 1W2OA 4AVVA 5ANQA 4JI7O 4QKDA 4AI2A 4PIZA 3RYKA 2BBVA 4LEJA 1ZYBA 1VBE2 5LA1A 2B1IA 3PLQA 2BGOA 4B4PA 4FLUA 4XFHA 4OHZA 2JDKA 2K0GA 2DYRC 2R30A 3VBOC 1BQZA 4IV3C 3HMYA 1KU9A 5T50A 4N21A 3QBQA 3N9OA 5LBEA 1C5HA 3H8XA 4ET7A 5K4LA 3B02A 4HK9A 3ZXEA 4UI9L 3HPLC 1AYM1 4CP9A 2EXKA 5JXIA 3WG2A 2JDNA 5JSOA 4PA3A 2OT5A 2D98A 2HWC3 1AL23 3I2GA 2WNVA 4FAHA 5FP4A 2R1BA 5CFDC 4L8QA 1KB9F 3MF9A 3E5XA 1POV0 4NUBA 2PA7A 3IDBB 1JFFA 4N23A 2X6AA 1GKFA 4PBPA 1FYUA 5C3RA 2B42B 2VZSA 3E8HA 3ZMNA 5EWSA 2BTOA 3WLUA 1DK1A 3A0NA 3IM0A 5AC93 4Z82A 1BS3A 2RR12 1P7BA 2PHWA 3HKBA 5KUKA 3GJBA 5IE9A 3BIEA 4QB6A 1W9WA 2H6CA 1J83A 1NR7A 1ST8A 3CWBH 4NTXA 3MICA 4KWUA 2YIBA 3DC6A 5JVVA 1PKXA 2XNDG 1KJLA 4DV4O 2E5LB 1MNGA 5D21A 5DZFA 5FZ9A 3VQYA 3AXDA 5FOBB 1I0HA 2UWAA 3OCPA 4DRXB 1PNMA 3U78A 2VAUA 3WHTA 4ASUG 4NIGA 5LBFA 1WA6X 3PUAA 4LBQB 3UGGA 4NN0A 1CPNA 4X8NA 4C91A 4CUCA 4LXLA 4X6QB 5AFBA 1F35A 1LOFA 2VPVA 4O4JB 1P84F 3Q8AA 4TV9A 4FFHA 5IFPA 4LHSA 5JR2A 2WNOA 4CPBD 3ILNA 2KM2A 5JOXA 2V4DA 4PQQA 4D7YA 1S2KA 1UZWA 3LPGA 4RR3A 1YJLA 1Q8QA 1PK6A 4R7CA 1IBLO 3ZN0A 1V54B 1Z2GA 1W8HA 4IUGA 1W6MA 5ITZA 1A8MA 1F9KA 4RS5C 4LR4A 3ITQA 2MPFA 4LBNA 3FE5A 4WVZA 3MIFA 1IBMB 2B9ZA 2JG8A 2R041 4LF4O 1LGNA 4WFBV 2PQQA 4ASLA 3K04A 2ZEWA 3V65A 2H3OA 2QE3A 4PJ0Z 1GBGA 2Q8DA 4BZ4A 4P02B 3O0XA 4BJ0A 1FPN1 1QJX2 4XIOA 1UY1A 5DUVA 4AVTA 3LWCA 1WLEA 5LB6A 4BCUA 4DR1O 1IPSA 3R66A 4OCTA 5FZIA 1QF3A 1QJY2 1OV9A 1FAFA 3UJOA 5F5QA 3U14A 2ZTNA 2GSMB 3CPWU 1UMHA 1KJRA 5HV0A 4YW3A 2JDMA 2JE9A 4YG0A 3EB7A 3O1UA 4DV0O 1TVKA 1NXMA 4BIUA 1L8DA 2IWGB 1AX2A 2VMGA 2QQLA 4GZRB 1E5HA 1HNXB 4I09A 2R1DA 4TUYB 4LFCB 2JD9A 2R072 3DKWA 4XDOA 1HN0A 2VW1A 1WA8B 3G71V 4MGTA 1BBT1 1L3JA 3AMHA 2VRZA 2Y4TA 3ZXDA 4IXLA 1Q6HA 4HNAB 3K75B 4UFIA 2GMEA 2GN7A 4UAPA 4JTAB 3I4IA 2RS13 2VR4A 5FKCA 2W2IA 1NVPD 2WA3A 2BVBA 2QWNB 4E2LA 3I8TA 4XURA 2ZDIC 3ZS8C 2FL4A 4H44B 2EAKA 3SYCA 2RS33 5FXWA 2ZQMA 2X5IA 5E89A 3STLC 1XYOA 2ZIOA 3T1YO 1CAUA 4EN0A 1ODMA 3OUHA 1C1FA 1PVXA 1G9DA 1US2A 2P3KA 3PDQA 2ZMKA 3RYFA 2CK3G 3CMAV 1GYKA 3S30A 3AZWA 3CD6V 3KT4A 4TWTA 1YC61 4NAOA 3OEEG 4BW9A 4DOUA 1VP6A 1W8ZA 4CDXA 1LOEA 3I5DA 3T1HB 4CU9A 1FMD2 3TOJA 1PD3A 4AFCA 1R1A2 2D3PA 1ZRIA 4AZZA 4QPGA 4QX8A 1OURA 1M9NA 2P6JA 2UUAB 3V0BB 4JGZC 3I2JA 2P6HA 2Q8EA 5FYBA 1J58A 3HKDA 3I2HA 3LSSA 4UVBA 4KGQA 1FFXB 2H6BA 4LBOA 2NN4A 5CFCA 5LATA 3HD8B 1K34A 4YVSC 2Q67A 1ND3B 1XNRB 5DMYA 1S0CA 3IC7A 2NQYA 1TGOA 2ZINA 4IEOA 2VE1A 3SKJE 4RQPC 2QQOA 2AREA 4WM8A 3O1MA 2Z5UA 3UGHA 1QQCA 2DCJA 4QB2A 4YZ3A 4X8AA 4F83A 3C7OA 1LKNA 1XC6A 4UCSA 4QPIC 5JXJA 5CG8A 1QDCA 1IGOA 3LIHA 1VQMV 3G7DA 3RNSA 1JCHA 3MPPG 2CGNA 5KAFZ 4P9LA 4Q0QA 4AI3A 1W8TA 1OLQA 4N43B 2WDBA 5GLVA 3WP3A 3HR9A 1BK1A 1BK0A 4WFHA 1U0AA 4ZKTB 2Q7HA 5FRAA 3ZFEB 1KGYA 4XFFA 3RYCB 1Q8VA 1SQPH 4YPJA 4CEYA 4YM2A 4FO9A 4DR7O 5CKMA 1GNYA 3DF0A 3E83A 2E9QA 1ULPA 1IURA 1WBLA 2NM1A 2ZKOA 4COWA 2CDPA 5B2GB 3WHUA 1AYN2 5KUMA 4CTEA 3OUJA 1VF5B 5DDJ2 2FCVA 3ZYGA 3WP6A 1NZIA 3H1HH 2UXDO 1AR92 3VQVA 1VB2A 2DUQA 1AYM3 2L6LA 2WNVC 3VZKA 4ZS2A 1E79G 1K5MB 1CPYA 1H0BA 1OPOA 5FUPA 1PGSA 2GBOA 4LF9B 4S2GA 5KHIA 2V5YA 1W9SA 3POJA 1S2EA 1PNGA 3FLTA 4MHUA 5FNVB 3OR6C 4B3SB 2OQ7A 3JARB 3LB9A 1I5ZA 1OXCA 5IVJA 2DQ0A 1RUI1 2EALA 4DV7B 5KX5A 5F5IA 4OPHA 2W0XA 5JLVA 1GZWA 3DXRB 1T6GC 5A1FA 4UWDA 4N7UA 4MXWB 1O9HA 1QHDA 5EYXA 3NWKA 3ABKC 3ALQA 5IK4A 2YIAA 1T5EA 2GTSA 3NXSA 4OLLA 1M06G 1VIWB 4K20A 5I0SA 5J9PC 4XPVA 1VBC2 1VALA 2WABA 2HVJC 5J96B 4DR5O 5FLIA 1PV0A 1H6YA 2XAQA 1N32B 3T1CA 3KV5A 4X20A 3OYWB 3MW2A 4NRPA 1VEWA 3JQWA 3H8OA 5JVDB 1DQ5A 5BY5A 3H7JA 2ITCC 2BE3A 3T0DA 4URTA 4KHPB 2WT1A 1N1SA 2JB4A 4LO7A 3P1IA 2AHZA 3WU2Z 1R3IC 3AL6A 5K1XA 1U5XA 1IX9A 4Q4Y2 3ZCCA 1QVGU 5T52A 3G6JB 5E8AA 3JXSA 5EZYB 4JKKA 2ERFA 2YSUB 2QDNA 3AXEA 2ID4A 5FZOB 2QQJA 1SQQH 2WLLB 1W06A 3NJYA 4FTBA 3V0AB 2WNUB 5H2FZ 1WW4A 2OA2A 2VOVA 4GMP3 1SETA 3ZYJB 3B94A 3ABUA 2W9XA 4Q8KA 1YI2V 5L19A 1HR0B 3D0SA 1I3HA 3FX3A 2XHNA 1VBD1 4Y5Z0 1COV2 4UW6A 1AR81 1YI7A 5FOJB 5GZCA 1HNXO 3OPTA 4AEMA 4RR3C 1RUH1 4LFCO 1MZ5A 3ZMTA 1PK6C 4AFMA 4JVAA 5JJEB 1W8NA 3AZVA 4AHZA 4Q20A 3KKYA 3CIHA 1F2NA 2JKBA 5LY1A 4QGPA 2OYQA 4K35A 3I97A 1ZSPA 3A7QA 2YGMA 2JG8C 3GWKC 3THTA 3I59B 4L0PA 2AH2A 3IDCB 2JDHA 4XFCA 2WWJA 2QWQB 3ZHRA 3GZTB 3JD71 1FPN3 2EXJA 1VMFA 3OY8B 3DYOA 2WSVA 1OF4A 2G19A 1R081 5C33A 4CXWA 1TMF1 2J1AA 5EHDA 5CB4A 4JV4A 5BMVA 1VB4A 5EV7A 5LHGA 4QKBA 3LFMA 2LW8A 1CD3G 1V70A 1LEDA 1EV12 1VMHA 2JIJA 1UZ0A 5BPXA 1XHXA 5FMOL 1SQGA 3POFA 3X29B 2ZE5A 3ABLC 1JYNA 3H9VA 3JUUA 3LDRA 4DRXA 3DV8A 5FYZA 4YVWB 4J1WA 3MZHA 1ENQA 1RXFA 2RQ6A 1UY2A 2BGCA 4AOCA 1ULFA 1XOUA 3NVCA 4DK1A 3LFIA 1RUD2 2XBO1 5DN6G 1Y66A 2OQ6A 2D43A 2UUAO 2XOMA 1P8JA 1BBT3 1W2UA 4JI5O 4MGQA 2WAOA 2ZXWC 4LBQA 3B40A 3ZIWA 3APQA 5AG2A 3I49A 4OI0A 1MEC3 2PF4E 5LGTA 1OCOC 5FXXA 5L3GA 4O4JA 3BFRA 3N2GB 2GSYA 2DWDC 2JGDB 4GKJO 3E22B 3FD9A 2X5IC 5JCTA 4DIQA 4GT1A 4J6GA 5G04L 1URXA 3S6PA 4P9PA 2Q73A 3L9DA 1OF3A 5FMCA 1JZ3A 2W0FC 1I08A 2A7AA 1ZBA3 2HYKA 1S0FA 4X1YB 4DR2B 3RBZA 1F15A 3ZHQA 5CA3A 2A3XA 3ASOB 2QTSA 1WCUA 3ELNA 4MS2A 4CDXC 3OMNB 1MACA 1FS0G 3VGIA 3AZZA 1YI9A 4QPGC 1OT5A 2N05A 1FXVA 3RVZA 3TNQA 3ZXKA 4XDLA 4N7IA 4Y24A 5A3MA 2A06H 3VBHB 5J3UA 5I0RA 5A6XA 5FYCA 5CFCC 2Q7EA 3N2KA 4BQXA 4DS0A 1K5JA 2NLJC 2WBKA 4G28B 1Q7YW 4GQ7A 3RZKA 4PHZA 1K97A 3VBFA 5FLXN 3ZR6A 2JIZG 1QWRA 3S5AA 1PIV2 1XMQB 2D40A 1XU2A 5EJ3A 4NWVA 2HWB1 4LLFA 1UXXX 1HQNA 3SJQC 4COVA 3NKGA 5KC6A 2KA3A 3MD0A 2HJIA 1V9U1 5JCOA 3CC7V 2YBSA 4TUYA 3K5MA 3I55V 3A4UA 2XR4A 2MNGA 3RVYA 1GOFA 3VQXA 1O91A 3M7MX 1WA8A 4XHXA 4IL6Z 1DZQA 5KXEA 1UU6A 5ABJB 4P9GA 1UL9A 5D8AB 1E5SA 1AP6A 1H4HA 1GR3A 2B45X 4CCOA 4DV7O 1AR73 1W6NB 3TEYA 1WD3A 1ZVFA 1Z7S1 4NOTA 3AFGA 1VF6A 2YC0A 3H9AA 2YIDA 4CEYC 4NTWA 4XILA 1A6CA 2YY1A 5IDJA 2CTQA 4ZY9A 5T5OA 3J7LA 2FDIA 2VQEO 2P90A 1SZBA 3U1XA 3VOUA 3C90A 1BCXA 4B3TB 1BHBA 4GKYA 4B29A 1SPPB 4QU2A 1R6NA 3BAAA 4LBKA 3BTAA 4RA0A 5FPXA 5HI0A 1ONAA 3HKCB 1UFIA 4JV5O 1UIKA 4JASA 4YGBA 3BPSA 5FMDA 2YV8A 4GKKB 2N7GA 5IJ0B 2NR5A 4LF7B 4FPEA 1HN1A 3V0BA 4TN7A 5H9RA 2JEMA 4ZU4A 3C3TA 2GHYA 2D44A 5APAA 2XHBA 1FFXA 1QR8A 3GYDA 4MTFA 3F2ZA 3TJTA 1RUI3 1PGL1 1C4RA 3O1RA 1O8SA 3DYPA 1YF2A 1JZ7A 1ND3A 4QGMA 2VVEA 5FQ0B 1OZ0A 3B93A 5IJ9A 2PYTA 1CZSA 1N3OA 3WNKA 2DUOA 1QNYA 1H2MA 2G9FA 5C6CA 2ZJCA 5H9SA 5L3BA 4DINB 3VBUB 5JR7B 3MV01 4AHXA 3QO8A 3S7IA 2Q0OC 1X8MA 4XFGA 1NA1B 3VHNA 2VUDA 2XJSA 4WM7A 5H9PA 3OBAA 2IW5A 2J1TA 2E74B 3RYPA 3KZIZ 1OD5A 3MFCA 1REFA 3OW2U 1SESA 5H9CA 4GZ9A 3DL3A 5EBWC 4E2QA 2EIMB 3ZFEA 2BPA2 4GX5A 3RYCA 2W92A 4RFT0 4J1XA 2YMZA 1M56B 1S5JA 1L0NH 5FP7A 5BYNA 3POSA 1KDKA 2UU8A 3AK1A 2RS51 2VCMA 3FYIB 4JF3A 5F8PA 2O0OA 3TCUA 3I2FA 4I0BA 2YZ4A 3ZYRA 3ZIAG 2HJFC 4I4TB 4CP2A 5ACA2 2XLAA 1JZ5A 3CLPA 4FJCC 1VMJA 3B69A 2EULA 1VBD3 3MHSC 2ZGRA 1IPKA 1LOBA 4JI8O 3NJZA 4FLTA 1XBLA 2ZE7A 1XMOO 1AR83 2WZPP 3ROUA 3LDBA 3T2TA 3V64A 4RO2A 4OVEA 1K5MA 1RUH3 4UVCA 3I54A 2Q8OA 1JPXA 2P4EA 1VQ7V 2VMIA 1J3RA 5FNVA 4YSFA 1VBA2 2OIGA 2YUAA 3JARA 3PTYA 4EQVA 3EJKA 3DXRA 3D5OA 3BPZA 4KBBA 4CUBA 3K3WA 4OUEA 5J1XA 3ZOIA 1WMFA 3B8MA 1NT0A 4NAMA 3AP6A 2KD7A 1R083 2UXNA 2A5ZA 3POYA 4XXAA 4Y5SA 3VZMA 3CS5A 2VUAA 4HT1T 1QJU1 3M4FA 2FQPA 1SBFA 3IMMA 3OYWA 5GZDA 4Y20B 1JTZX 4DR2O 2XG3A 1MS8A 1DHKB 5F39A 4YGCA 5JVDA 5LYJA 5TISZ 5CA1A 1OQDA 1RYYA 1WAZA 1SF9A 2SBAA 3NNJA 1JYIA 3C3VA 1KS4A 3P32A 4K21A 1UF2C 1XNAA 3LDKA 3MI8A 3POGA 4FOQA 4CDWB 1RMU1 1S5LZ 2RG4A 5EZYA 3FFZA 4AXOA 4J11A 5LK7B 5DZEA 1R6TA 4DO2A 2XBO3 4EZHA 1OFNA 5FZOA 1EN4A 4JTNA 4K0KB 2WLLA 3IB3A 1ULDA 5A6YA 3V0AA 2WNUA 3E2EA 1YQ6A 3VD5A 2LJ2A 4FPPA 2CGOA 4I01A 3RFRA 3KM5A 1AR5A 1P4RA 1ZZ7A 3OBRA 4QX1A 4N9HA 3TN91 1V6OA 4U2AA 4LBMA 1SZTA 1JU3A 3N3HA 2YBKA 3T2PA 2PHTA 4Q2FA 3AX4A 4LIUA 3CBNA 2A6XA 1IBKO 1EM1A 1TME2 2YIBD 2PZSA 4PD4F 5DAQA 4O2AB 1W6QB 1ZAUA 3C7GA 3L72H 1VQ6V 4AGRA 2Q4PA 4EB6B 3JSLA 5DG1A 3ZEDA 3LDDA 4CU6A 5KXCA 4DYLA 4XFIA 3ZXLA 1PNKA 1D5NA 3JATB 1AJOA 5FLHA 2PYLA 4JDMA 1LTEA 5BNOB 1Q56A 2ZGNA 3EVKA 1CQ9A 5IWAO 1KKDA 2DTYA 3I59A 4XF9A 3OSDA 4DR3B 1TNFA 5J09A 1O6UA 2EZOA 2YI9A 2BNNA 2H8PC 2EF6A 3O12A 2WS91 4NRQA 3OY8A 2QQIA 1SDWA 2DVFA 4AQYO 4M0NA 4XZPA 2Q8CA 3EYPA 2DJVA 3HOBA 3NAPB 5FY0A 3RI8A 5IAVA 4DUXA 2UY8A 3BN6A 3E97A 1YITV 2D5HA 5JSRA 5DAVA 4BMBA 2W46A 1EBOA 5EC1C 1Y74B 4YZ5A 2HP8A 2Z5WA 4QE9A 3PNAA 3G6EV 5FYYA 5CKQA 3WDYA 3VQWA 1YRZA 2HWB3 3RMYA 4EWDA 4YVWA 1V9U3 1ND2A 1I1EA 1PVC3 4NWWA 4NPRA 1NH2B 1OVSA 4YW2A 4DXRA 3JB4C 3VB9A 2W1SA 3HQUA 2IJHA 3I3DA 3AFKA 1U5ZA 3CCUV 4WFFA 4RSUA 3O0VA 4Q4X1 1W59A 3TK1A 5FXVA 3B7MA 3IJ4A 3MIHA 5FIXA 2UUBB 2EICA 1K9MW 5JMOA 1I5XA 4ATEA 2JGDA 1O5LA 4TOIA 4LUKA 3E22A 1Z7S3 1D2DA 2VZVA 2D3OW 2ZX4A 4JPRA 5F3IA 1B35B 4FPKA 1DZTA 2WFF1 3PUHA 3JD1A 2ZAAA 2BV4A 2F93B 2VQAA 3BTYA 5JOWA 1L7RA 1URFA 4RQFA 2HYXA 4ZHQB 2D6NA 1DZRA 1DGWA 2VTFA 4CDQB 3ZFFA 2CYFA 5JZGB 5KXDA 2BNMA 3VZLA 3KG2A 2RS32 2E32A 3PVEA 3JD3A 2VL4A 1UY0A 3UJQA 4DV1O 4IEXA 4Q1RA 2QWPB 2E7AA 3WFVA 3NRUA 3RDIA 5FYIA 3RYRA 3VBHA 5A3UA 5CVRA 1LNQA 1OA3A 5J2UB 3MHHC 2IXJA 1ND3C 3WDWA 1C8M2 1DIWA 4GD4A 4ASMB 4WZCA 5FPRA 2DFCA 2ZR3A 2ARHA 1VBB1 1U5IA 1M93A 3AMPA 3O0WA 5K9YA 2WZR1 2W68A 2JB8A 2HG5C 5CNAA 3TEXA 3VBBA 5I8SA 2GC0A 1OVPA 4UYBA 1FV3A 5FZMA 4PLNA 4BLJA 4INDA 1YSCA 3WXPA 4GX0A 3O1VA 1S0JA 3TETA 5GZFA 1UD1A 1HWYA 5ABJA 4WM7C 3UYJA 1S55A 5D8AA 4N43C 2BOJA 5GZGA 5E6HA 2WO1A 1RUF1 2DQ3A 1YXWA 1W6NA 5H6RA 4EJRA 2WSUA 3M2MA 3J8F1 3QD6A 2G9ZA 4QX5A 1W3VA 2FZ1A 5A3NA 2HKXA 3ZFEC 4Y1UA 2HWF1 5B1AB 4UBGA 3T4VA 2QEXV 1XQ8A 4C7UA 4U7NA 1J1TA 4ASKA 1GWMA 4LR3A 3UGFA 3AKSA 3RZJA 4GB32 2WJSA 1NJIW 4XCAA 3GJAA 3AKTA 2RM22 1BKZA 3HPNA 2RS53 4HVQA 2XJPA 4I5SA 5A7PA 3GVMA 2VY0A 2CTVA 2BYVE 3GZEA 5L36A 5JDBA 5DAXA 4X8PA 1LHUA 3JD4A 4R52A 4JI1B 1NE6A 3T3YA 5CBFA 2Q68A 3HKCA 2W52A 3SMHA 2R0HA 2MEV1 4MVOA 3WQ0A 3AM2A 5IJ0A 4LFAO 3ASIA 1K5MC 4C0HA 2GP5A 1WLWA 3K59A 1TG7A 3E6BA 3ETDA 1QQP1 5FK7A 3OEHG 1SZXA 1NR1A 1ZA7A 5BNPB 4K0KO 2QJ1A 1MS4A 5EBMC 4WVMB 1YLLA 4R9DA 2DBIA 4E8DA 1RUG1 1MVQA 2ZBJA 1OFSA 3AK2A 5FQ0A 5L9BA 5EJZB 4B1LA 4QPKA 2PQSA 3T4DA 2RMKB 2CHHA 1K4CC 3LOBA 2VBBA 3VZOA 1WP7A 1UZYA 4LITA 4IEZA 2WUHA 5CBGA 1D4M2 1W9FA 1XB9A 4BQ5A 3FN9A 3C7EA 5FPLA 4MG2A 4XFBA 1NA1A 3WW4A 1QJU3 5C4WB 4XBQA 2CDYA 4CZSA 2EJRA 2WT2A 2Q1MA 4XQWA 1REDA 1BMV1 2D6KA 4AHYA 3RN4A 3OG2A 2A6VA 5FZBA 3LNMB 5C3OA 4FPFA 3WP4A 1FNYA 1PMHX 2VQFB 2ZX3A 2JENA 3T4ZA 2UXCB 3DXUA 2YUEA 1J5EB 4U36A 4FQZA 2UUCO 2WNUC 4ZBMA 2BBAA 2JX9A 4DXWA 3WUCA 3SJCC 5A2QN 2E7QA 3ACFA 2CGPA 3MAQA 3RPQA 1FAYA 1V6LA 3TN93 3F5WC 3A0BZ 1HKDA 2BP6A 1G6NA 5KA6A 4DB5A 4J7ZA 4S2DA 4MT8A 5FL7G 5FAXA 1B6QA 4JTCB 3MIEA 3T1MA 1KBHA 1ZZ8A 4FFIA 3B5LB 1YQCA 4CP1A 2HH9A 2DVBA 3HVDA 2HWE1 1W0JG 4TZDA 1POQA 1LHWA 3WY6A 4UW4A 1PZ8A 4LMFA 5FZ1A 2W1UA 1BYHA 3N4MA 4LA2A 1BEV1 4B3RB 5FYTA 1RUJ2 3UO2A 2ADDA 3AL5A 2QZ2A 1APNA 3DTUB 3UM7A 3KZ4C 2R32A 2CWMA 1X9TA 3NV2A 2HHHO 2VH9A 3IGAC 1JX9A 1KXGA 1CAXB 4MGZE 3WG4A 4ZZ5A 1SERA 1Y9MA 4NMIA 4UCOA 1POV1 4K6BA 4QPJA 1P7GA 1GQHA 3BY6A 5I8TA 4FIPC 4AHCA 2JDPA 3ETQA 2D6MA 4OGQB 5A32B 2Y64A 3AG1B 3ME2A 5DECA 4UF0B 2R0FA 3R0RA 1KMIZ 5A7WB 2YHJA 1PO12 4Y20A 5GTHZ 1NX9A 2R042 2GNMA 1GM7A 2QQWA 1OMIA 3FMGA 4S2HA 2VXJA 3JQXA 2HWD1 1XNQB 1HDKA 2Y38A 3KVAA 3SYOA 2IJKA 4YVWC 1ND2C 2ARAA 5BUVA 5IHRA 4CDWA 4M3CE 2OTJV 2WA4A 2OVUA 4NHMA 1YFUA 3Q4HB 4I55B 3GGLA 3CRRA 1UQXA 2IFRA 4YZ1A 1RPOA 2O1QA 3SPJA 3K57A 1MQTB 1OQ1A 5F3EA 2N74A 1D4VB 2PFWA 4XBNA 4Q4X3 4FBFA 5LA9A 1ENXA 1MABG 1UN1A 5FZ0A 4DR4B 4K8FA 2JDAA 4ZOLA 3S0MA 2ZGLA 1ACCA 1STMA 4AVCA 4HVRA 4UB6Z 2WNEA 1VBE1 4HXCA 4MTGA 1HX6A 1DLBA 2B9UA 3THPA 1WPBA 2CTWA 1W6QA 4X9QA 4WFAV 1LAJA 2B9VA 5A7NA 1NBMG 1G7YA 1FXKB 2ZR2A 3ASNC 4OMDA 4JC1A 2P3JA 3SJBC 2RJKA 1GQGA 5JI9A 2IXIA 3AK3A 4JZ2A 2P34A 1VQ5V 4Q8LA 1ASJ2 3ZFFC 1XE7A 3HEIA 5FYUA 1K4DC 1ZZ6A 4F6EA 4LBQD 2QM4A 1JUHA 3GZAA 2IFWA 3HN1A 2ZHMA 3TXSA 4ZU7A 3OR7C 5LMUB 3L70H 1G8MA 2AZ0A 2GUZB 2VZOA 5T55A 4FPYA 3LPFA 1V9PA 4W4ZA 2W94A 4LUMA 1L7QA 5A7OA 3VBHC 1XNCA 3NAPA 1I5PA 5JMCA 1CR7A 2FYUH 1MPXA 2JJ1G 2YROA 2HEPA 4YXWG 4RGGA 1FOD1 1AP5A 1Y74A 3PN1A 3MLLA 3SKVA 4ZHNA 4D94A 4EWEA 4JI1O 1ENSA 1VBB3 5D2AA 1R3JC 2UXXA 1RUE3 2MK3A 2WZR3 5FO8B 4M4RA 3PHMA 3KF5A 4JYAB 1GU3A 3RI9A 1YDXA 3ZYHA 1W2AX 1MS0A 4L11A 3EBRA 3H50A 2BFUS 2AEYA 1K5SA 1DGRA 1K3EA 2P3IA 1KEXA 5ABJC 4ISQA 3UO3A 4CC5A 5D8AC 1RUC1 4HPKB 1CWPA 1IKPA 4OI4A 5HBAA 2IVJA 1RUF3 3S57A 5DPNA 1Z5VA 2YXYA 1E1RG 1J1LA 3J8F3 5FWJA 2J1SA 1S4CA 3MF6A 1NG0A 1XU1A 3GNEA 3IAPA 2HWF3 1B35A 1G9FA 4MYEA 1YIPA 4Y1XA 2J7MA 4FMTA 5FP9A 1QU0A 4BA6A 4MVSA 3OFNG 5CBHA 3I56V 2FTKA 2VWKA 1W6OA 4UCRA 4RAIA 1VAKA 5J48A 1VJ2A 5DM6V 1PM7A 1CXZB 4ZHQA 1CIWA 1QMJA 2HVKC 1L0LH 3J81N 4PELA 4K9SA 4CDQA 2OCHA 2NMNA 3SJAC 5JZGA 1XL4A 4NHKA 1UYPA 1QKQA 1VARA 2FCUA 1JBCA 1LGBA 4AI8A 4GH4B 4W4KA 3HAGA 5A3PA 3WB1A 4K3UA 2OIEA 3AG4B 1LR5A 4Q27A 4W50A 4O4IB 3M3QA 1QQP3 5EP9A 3ES4A 5IVCA 1J5EO 4Q4V1 5FDBA 3D3QA 1S0EA 1CJDA 4OXSA 3QLQA 5DUUA 4FPHA 1F4AA 1HRV3 1RUG3 3BU0A 5L3EA 3LA7A 1MMMA 4BXSV 2PAKA 5AC91 1QJX1 3QH7A 1X82A 1YFXA 3WF2A 1GOGA 1HNZO 4K1ZA
chains in the Genus database with same CATH topology
2XJUA 1YWKA 5KHKA 1EV11 1PO21 4FTBA 3V0AB 2WNUB 1TME3 3U4XA 1WW4A 2OA2A 2WT0A 3H1YA 2VOVA 4GMP3 3RZZA 3AYEA 3ZYJB 1JW6A 4LHNA 3B94A 1MZEA 2C1FA 1RVF3 4Q8KA 4H14A 5L19A 2Q4AA 4PCRA 2VQ0A 3TWIA 1Q5OA 4MVTA 3D0SA 2RJLA 3PVBB 1JH5A 2WBOA 1I3HA 3FX3A 4M01A 2VW0A 1NA1C 2JICA 1VBD1 4Y5Z0 2WQZC 4FT8A 4RL7A 3CO2A 4AEDB 3H1MA 1COV2 2ZAHA 4M3CA 3TAYA 1RUD1 3HIFA 4UW6A 4E4DX 4R4XA 2R073 1RUJ1 1AR81 4KL1A 1YI7A 2ZKLA 1HV1A 5FOJB 5GZCA 3ENRA 4GKXA 2Q4SA 4BHGA 1O4YA 4DY3A 2DUPA 4BOWA 1Q3EA 4OI2A 4AEMA 4AGGA 3WW2A 3ZX7A 4RR3C 2VECA 1RUH1 4MGKE 4Q0VA 4I30A 4PBOA 1MZ5A 1PK6C 3OD4A 3WQ1A 4G3YC 4AFMA 4JVAA 3AKPA 2DCKA 2DYCA 5J36A 3AZVA 2Y26A 2QZ3A 4AHZA 4MXWA 1XYNA 2OIIA 2Z79A 4QGLA 1F2NA 5HCAA 2YYOA 2JKBA 3PJQA 5L7OA 5C9AB 4OUSA 3HT2A 2G9GA 2HEYF 2HWC2 1AL22 4EN9B 4FXGB 2ZKNA 2R6SA 2A3WA 1O4ZA 4CDUB 1O3TA 3KQRA 1DF0A 2VNOA 1UX6A 2YGMA 2ZGUA 4LNVA 2JG8C 4XF0A 1FNZA 3THTA 3KCCA 3MPBA 5GZEA 2WIIB 3ZXJA 1QXPA 4B4QA 3I59B 2AH2A 4QQ2A 4WVVA 3ZIXA 3IDCB 4XFCA 4MGIE 3RWNA 1RMU3 4H3WA 1IS5A 4OI1A 1HRI3 5K7PA 1NCQA 3OD0A 4GH4A 4KNCA 5C8CB 3GZTB 3N7LA 2JG9A 3JD71 4Q4V2 1FPN3 2RMU2 1PO11 2AYHA 1MVEA 2EXJA 3UK9A 3OY8B 5D1IA 1KITA 2RS52 2WSVA 4FP2A 4YW1A 1R081 3QOPA 5C33A 3JCIA 5BNPC 3N35A 1TMF1 3ZN5A 4LBJA 3Q9OA 2R49A 5JIUA 2XKPA 5AC92 1TQ5A 4JV4A 4CYDA 1VB4A 5EV7A 1WMEA 2XVGA 3NV4A 3WCSA 2ZHNA 1CD3G 1V70A 1LEDA 1VLNA 4L9BA 4IEQA 1EV12 3AKQA 3OJBA 4P9XA 1BEV3 2B5HA 5BPXA 5FMOL 4Q29A 2B46X 1PZ7A 1SLIA 3FJSA 4HKLA 4RS5A 3X29B 5JOYA 2E7TA 4JDOA 3M3OA 3JUUA 5K0UA 1S0IA 2XVLA 5BNNB 3DV8A 1NXD1 4YVWB 4J1WA 3MZHA 1ENQA 4CRQA 3NW4A 3POWA 3VBFB 1EAH1 2BGCA 1CESA 2VVFA 4NO4A 1ULFA 1VRH3 3NVCA 1RUD2 1FMD1 2XBO1 4R9BA 1WW5A 1R1A1 5DUXA 3ZN6B 2D43A 1KS5A 4I3GA 4Z07A 1BBT3 1W2UA 1XYPA 1POV3 2JE7A 2BWAA 2GNDA 2QNKA 3WUDA 3KB5A 3WW1A 2ET1A 4LBQA 2D6PA 2UY9A 4KU7A 3ZIWA 3SNMA 1NQJA 4OI0A 1MEC3 3EHKA 1RINA 3E5QA 1QH6A 1LCLA 1GICA 4NVPA 2XL9A 1RIRA 2DTWA 3GZUC 1LOCA 1YNAA 3AK0A 2GSYA 3CU7A 2SLIA 1OIHA 5DG2A 3H8UA 1OI6A 2ETEA 4FVVA 5C4WA 4HKWA 4L92A 2R062 2NN8A 4JGZB 3RS6A 1O3QA 2WS93 1GANA 1OOPB 3L2YA 4FAGA 2X5IC 4HLTA 5JCTA 2OW4A 1PNFA 3WW3A 1O7FA 2A70A 4HN0A 4A7YA 1NQDA 1ASJ1 4J6GA 2VGDA 1URXA 3S6PA 2WINB 1QJZA 4GA9A 3ATGA 4P9IA 1RHI1 2DCTA 3MGUA 4GALA 4YM3A 3JD72 1NCRB 1QJU2 4AEJA 1UAIA 3R4UA 4CDWC 4ZXKA 4YVSB 4WVWA 2KXLA 2D93A 4QQOA 2GC2A 1YJKA 2LM3A 2A7AA 1ZBA3 3MW4A