4NR1A

Factor inhibiting hif-1 alpha in complex with consensus ankyrin repeat domain-(d)allyl-gly peptide
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
335
structure length
335
Chain Sequence
EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
publication title Structure of an oxygenase in complex with substrate
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 106
structure length 335
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2013-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4nr1A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4nr1A01
4Z1VA 4QU2A 1H2LA 4B7KA 3OD4A 1YCIA 2Y0IA 2W0XA 2WA4A 2XUMA 4BIOA 4NR1A 1MZEA 1H2KA 1IZ3A 4Z2WA 2WA3A 1H2MA 4B7EA 3P3PA 1H2NA 2YC0A 2ILMA 2CGNA 5JWPA 2YDEA 3P3NA 3D8CA 4AI8A 3KCYA 1MZFA 4JAAA 2CGOA 3KCXA
chains in the Genus database with same CATH superfamily
1WBLA 4DINB 4JV5B 1M9NA 4FLYA 4JQRA 4UFLA 5H9QA 3STZC 1JH5A 1LULA 1PNKA 2F4VO 1PZ7A 4COUA 4DV1O 1UZZA 3CC2V 4G2KA 2P90A 4QX0A 5JR7B 3OMAB 3O1TA 3MD0A 1H8EG 1ZA4A 3CJIA 4AL9A 4K0KB 3AG1B 4M3CB 5F3IA 4RUEA 2Y69B 1AR92 4CS4A 1AR72 4PDWA 2BOIA 3VBSB 4DUWA 1W59A 1J3RA 1XOUA 2E75B 4XACA 3WQ1A 4OPHA 2IC1A 4CRQA 1XMQO 3M99B 1AYM3 1ZBE1 3BU0A 5KC5A 2ZX1A 1UY3A 4FQ4A 1GN3A 4I4TA 4X8AA 4O4IB 3WEZA 5F5IA 4YJ3A 4DMIA 4LWSA 4IGOA 1OCRB 4YHHO 1VBB3 1JU4A 3VQVA 1LOCA 1OQEA 1IKPA 4IE6A 1RUNA 1FOD3 3A0BZ 3AMQA 4JYYA 1XL6A 4O7XA 1FT9A 2ZJCA 5A7OA 1I5YA 5B1BC 4OLLA 4PQQA 5LOVA 2SBAA 4BR6A 4DR1O 4AGRA 5CFDA 4X20A 3FHIB 4XZUG 5F39A 4G3YC 2KB1A 4PLOA 3TNQA 1N1SA 4AEMA 3MYXA 4B4PA 1SCRA 2E74B 2BRTA 4GKXA 3TBDA 1GQGA 3N9PA 3EXAA 1DQ5A 1V6LA 1UN1A 5A3MA 5B1AB 4X65B 5C4WC 3ORJA 3ZN6A 2KKWA 4IEPA 1CPYA 3F7YC 5JAXA 3N9MA 5LY2A 1JZ7A 3JAKA 2RM21 4FP2A 5LA6A 5JJJB 3ZM8A 4JX0A 1YYNA 4LF8B 4DXZA 2DYRB 1RJ7A 1FNYA 5FZ0A 2VZSA 2WABA 4OMDA 5BNPC 1O3TA 1SFPA 3MF6A 4MG2A 1SDDB 4MVZA 1S0VA 1XPWA 4P9PA 2V1DA 5D2AA 4IEOA 3JAWB 5IWAB 1REDA 1ZM1A 4DR7B 4FCAA 4CUCA 4YW6A 4MUVA 3SH3A 1AB3A 2ADEA 3D6EA 2YXHA 5GLWA 1QJX1 4DR5B 4Y1YA 3BOPA 1OHHG 3D36A 3JD0A 3U14A 3H9AA 1HB3A 3AMMA 3VBUC 3ETPA 3AKQA 1QCEA 4LNUA 5EK0A 1DQ0A 2ORZA 1W04A 4FTEA 4NIHA 5T5JA 1L1FA 3QNEA 1N3QA 1STMA 1RINA 3J81N 1BK1A 3RJ2X 1NA1B 1C57A 2LJ2A 5DUWA 4XAAA 1US6A 5CAZA 1ASJ3 2HBTA 3WDYA 1QU7A 2CH7A 1GNYA 3CIHA 3OGCC 1J3PA 4GAZA 1PX4A 2D6LX 4QM9A 1GP4A 4AF9A 1S0JA 4E2GA 4B4RA 3C90A 2IXHA 1RVF1 4Y4RA 3MV11 4CDXB 2Q30A 2ZGUA 1W2BU 2QE7G 1R64A 5DXDA 2VAUA 3F5TA 1WMXA 4LR4A 2VBPA 3ZYIB 4Q0UA 4JI2B 1MS8A 5FPAA 5CZKA 3R65A 2N04A 4QU2A 4EYUA 1YIJV 3DV8A 3OUIA 2ZNJA 1PX3A 1FOD1 3BTAA 4H7MA 3TJTA 1Q7YW 2ITCC 2EAAA 5LP6C 1YEWA 4YZ4A 3GALA 2PHXA 3HKDB 3A23A 1B3QA 2F43G 4JI0B 4YGBA 5JIAA 2DU1A 4MSWC 2EX3A 1PMJX 4DRXA 3BU7A 1NLRA 2VQ0A 5LBCA 2VPVA 3HR0A 3AG2B 2I2SA 2L9LA 2QDNA 5D8AA 1WLCA 1VBC3 3ZFEA 3UK9A 4A2UA 3M70A 2ZKOA 1DTOA 2KA3A 4FO9A 1W6MA 2XLFA 2Z69A 2FTKA 5JIUA 4QPIB 1UKGA 2P2KA 3BY6A 3WF1A 4P5HA 4MH0E 4E8DA 2XHBA 3NW4A 1PVC2 1UY0A 3O1UA 1OH3A 4D3WA 1K7DA 1P84F 3UESA 3LWCA 4OZXA 3BAAA 3NL1A 5I0DA 5L7OB 1XBLA 4P30A 4IEWA 4B29A 4EE2A 1AI4A 4FM2A 4XDPA 1KDMA 4IL7A 4QX8A 3FLRA 2LP7A 4Y1VA 4GWJA 4SBVA 3VD7A 5CA3A 1CAXB 4EN0A 4ZZ5A 1CAVB 1FPN3 2O8QA 1UOGA 2B46X 4OUEA 2RNBA 3LA2A 1G9FA 3ZRWA 5A6ZA 1M56B 4E2LA 4GJZA 4K35A 4X1KA 1Y9GA 1V6NA 1F4MA 2Y48A 2R16A 1DYPA 4NWWA 1ZBA1 2ZGNA 3WNMA 2PLV2 1VQOV 2OUJA 1UY4A 3RZGA 5IVEA 5KR7A 3O1MA 2CDOA 3GDBA 3U4SA 1NCQC 2XBO1 3ZR5A 1URFA 2ARCA 2F4LA 4AI2A 4LH7A 3APQA 3HWJA 5CFCB 4BOWA 3L70H 2BSKA 4AQ6A 1MSDA 2VMDA 3OM3B 5BNOB 2R073 3S30A 1KS4A 4BQXA 5KMGA 3ZSMA 1S4CA 2FDKA 2XHKA 2YMZA 2BU9A 4LF5B 5CB4B 3ABMB 4AILC 3JARB 1ZL8A 5DDJ3 1X8MA 1DYKA 1BMFG 4AQSA 4FPOB 1XBFA 4OUMA 2XAFA 2KQXA 5FUIA 3PDQA 3AMNA 1XYOA 1RUH3 3WV6A 4RHV3 2YI9A 4XE9A 1GH6A 5HXVA 3QH7A 4B3NA 5EC1C 4LFCO 1KKDA 3HNYM 4E4HA 2JE8A 5JPMB 2AC1A 1UMIA 4B3RB 4UXNA 2VOXA 2I07B 1ZWIC 1RMU1 1J95A 4XDLA 4GA9A 1CEZA 2IH3C 5DAWA 2WYSA 3WCRA 2Q4PA 1WGPA 3L75H 2CNAA 1U12A 4OMCA 1LHNA 2WWWA 2VQAA 4R9BA 2VW1A 3OW2U 1VBC1 3K75B 2E5LB 2CDYA 3ZN5A 2F23A 5FNVB 2QJVA 1UIJA 3THPA 2V5YA 4X66O 1EYBA 3WINE 4FMTA 4GH4A 4AI8A 4IV3B 1OKOA 4Y4YA 4ATEA 2ZKLA 4YARA 3JAMN 1XXNA 5B2GB 3JCIA 1C1LA 3WX5A 2LROA 3GZUC 4MGSA 5FZAA 5FZ1A 1ZZ9A 2RCVA 1THZA 4AI3A 3ZBHA 1H9PA 4RSUA 2BBAA 2ZABA 4YVWA 1LODA 5H9PA 4LLOA 1S77D 2PFWA 4QHBA 3T2TA 1KJRA 3VL9A 1OA3A 4Q4X2 2RS53 3Q8CA 1WA8B 2R0HA 3ETQA 1NQDA 3DUIA 4E4ZA 4LBQA 1WZXA 3M3EA 5KHHA 4LF9B 2VVEA 2XOKG 2H0BA 3C8XA 2DQ3A 1PL0A 1K5JA 3E89A 5JZGB 5F5QA 4BK5A 5LHIA 1TUEB 5JI7A 4JI5O 3VQWA 5FPOA 1C1FA 1JZ6A 3O9OA 1V6KA 4RFT0 1OA2A 3V0BA 4E2SA 3ASOC 1UF2C 2QM8A 1AJOA 4I3PA 3N7LA 3I56V 4NHYA 1CJDA 5IY5B 4U3FH 1NUKA 4PA6A 4MT8A 1MS0A 1CPMA 2R071 4Q4W3 4ET7A 1NT0A 4O2AB 3IMNA 1ZZBA 4A44A 5J3UA 3ZR6A 3WB0A 4QWNA 1DF0A 4P00B 5E1AC 1XHZA 1C8M3 5CIRA 4MO3M 4JTDB 3S3XA 1LOFC 4MVMA 1UY2A 4JVAA 4XZPA 5L9VA 3WU2Z 4WFHA 2BJSA 4NJ4A 2YSUB 2BYVE 1UJWB 5JCTA 1EUTA 5FZOB 4NROA 3RVYA 2P37A 2P6JA 4XJWA 3O1PA 1V0AA 3JU9A 3HOBA 5A3PA 4D69A 4IDZA 4IHJA 1PO12 4Y20B 3E8HA 4P2ZA 5EJ1B 4K20A 3AZVA 3JQWA 2AR6A 4JTOA 4O4JA 4X64B 3O5SA 3T4VA 3VHPA 1G8WA 2GAUA 2A7WA 3RZMA 1BEV3 4HANA 1JUIA 1XRUA 2FDHA 4QKFA 2EJRA 4BIZA 3VBOA 1SG3A 4MGTA 1OOPC 1XMOB 4QJFB 1MNGA 3ZSLA 5D1IA 4HOOA 3WW4A 2NLRA 3ML0A 4GXLA 4LULA 2Y6KA 1PVXA 4R4XA 3ZMUA 4YWAA 5LK7B 5FRAA 3FKSG 5LA0A 4NIAA 3OD0A 1PO23 1G4YB 5KA5A 2ZGTA 3CCVV 5JOZA 4NTYA 1N33B 1KMIZ 1AR83 1HRV3 3I3BA 3SC7X 4MTGA 3ZMTA 5IT6A 2RDRA 4GCZA 1GMGA 3KHCA 5B4XA 2BTQB 4DO0A 3N2KB 4CEWA 4QKDA 4WV8A 2HLEA 2XJQA 3T09A 3A0KA 1KP3A 5B1BB 2XPJA 3OGIB 2XJRA 1GKBA 4MHUA 3GB7C 4NVPA 4LBJA 4R52A 3PTRB 1NKGA 2W08A 3VKMA 4C1WA 3CCEV 5C70A 3E1F1 3JD73 4PI0A 1YIFA 5FLHA 4RAIA 4L9BA 1RHI1 5C4WB 2JJ2G 4JAAA 4LBMA 4PA7A 4Q4V1 2XONA 1TUBB 4O2BA 1F7YA 4Q4W1 3UGGA 3L9DA 1COWG 3JD4A 3AP7A 3QACA 3F7VC 2F4PA 5FZ7A 5BNPB 2DWRA 3JQXA 1C8M1 3V0AA 4CUGA 2JD9A 4HKLA 4Y3OA 2LTNA 1JFFA 4KL1A 3TEWA 4RR3C 3POYA 3LCPA 4J7JA 5CFCA 3FHQA 3EJKA 4NOTA 5JLVA 1TME3 5FJKA 3O1OA 1OVSA 5FZCA 3CX5F 2YI8A 1QDOA 1MACA 3WP3A 2FKXA 3FX3A 4I01A 4FLWA 2EIDA 3ZMSA 3RYCA 3LSEA 3K5MA 1FJGB 1M93A 5J37A 4DV6O 3CRMA 3BPZA 1FYJA 3CQOA 4MXWB 3VBUB 1JVMA 3KZIZ 5CB4A 3U37A 4AHCA 3SYCA 2R30A 1BEV1 4YSFA 2WLJA 4CP9B 4IE0A 5FAXA 3JALB 2GNBA 4L87A 2VG9A 5GTIZ 2BFUL 1AUYA 2W68A 2VTXA 1AX2A 1DQ4A 4DR3O 1W6PB 3K04A 1N0JA 5K1XA 2XG3A 3WG7C 2TUNA 1LRHA 1PO21 2EJ7A 2EVXA 4YGCA 5FBJA 1LOEA 4A3ZA 1O5UA 2HWE3 4UFJA 3ZVXA 3ES1A 1VPHA 3OCPA 1R091 1IBKO 3SYAA 3H1WA 3KV4A 4GKKB 4LNVA 1VQ4V 3ZKUA 4QHZA 1W6NB 2ZGRA 5BPXA 3I2HA 2JDNA 4TSFG 3D3IA 4BIFA 1GK9A 4TUYB 2OIIA 4CEYB 2VMHA 3VL8A 1HRI1 4FOWA 5C33A 5FNVA 1XHXA 4JZRA 1XYPA 3B8NA 2GC2A 2W52A 1P8JA 4BXSV 1X9PA 5C8YA 3BA9A 4DV5B 1B35C 1U0AA 1GBGA 4XJ9A 1VQLV 5LP6B 4K1ZA 3KKYA 2QUOA 1AR93 1AR73 2Q5ZA 1V9PA 1TNFA 1N34O 1NZCA 2ID4A 3R4SA 3O0VA 4OQ9A 5BUVA 2HHHB 1QDCA 3FBMA 4QX1A 5EIBC 4KH9A 1LHOA 2WFF1 3K59A 3FAVA 3OPWA 3FL7A 3KG2A 3JD71 1DGSA 3RYHB 1X36A 3KD4A 4DUZO 4W6YA 1H2GA 1EAH2 1WA8A 1UFIA 5DZGA 3S7EA 3AP5A 1QR8A 3RI8A 3RQ0A 2E3CA 2LO1A 2RHPA 5CG8A 4FOQA 1UYPA 5FZ3A 1MQTA 4BQWA 3HT2A 4XJ8A 5TSWA 1KBHA 1Y9QA 4NHXA 2W95A 2E7TA 5CEHA 1BS3A 2R49A 2GC0A 3OE7G 1UZ0A 4LMFA 3SNMA 2Y4UA 2QQMA 5T5LA 1K4CC 1URXA 3TGUH 1RYYA 4YXWG 4HFSA 1DF4A 2OTLV 4MGKE 1TME1 1XU2A 4YPJA 1AP5A 2JIZG 2ZMNA 1Y67A 1JPXA 5FUPA 2HWD1 3HVDA 1V6OA 3OG2A 4CU9A 4XTPA 3BPSA 4OCTA 5BY1A 1N3OA 2FBEA 1YXWA 4UB8Z 4J9YB 2K9PA 3LSUA 4ORFA 5GLVA 1QLNA 1O9GA 4R9CA 1IVSA 4XFIA 2VXJA 3PUQA 4NXMO 1NCQB 2HJFC 3X29B 1UL9A 2DBIA 3DXTA 1BXHA 3K0DA 1BL8A 2ARXA 2BCCH 3BABA 3AZZA 3G4SV 2DYCA 1BYHA 4FFHA 1RXFA 4O65A 3HQRA 1CX4A 2VMGA 2UUCO 1UW8A 2G9GA 1RUE2 2VC9A 1JOBA 3ZYHA 1NQJA 3V56A 4Y22A 4LK7A 4DEVA 1FAYA 5HCAA 3U10A 5E8AA 2JG8C 2A0LA 4WVMB 4X1IB 2UUBB 4LEJA 4Q0VA 4Q1RA 5LCWL 2Z4FA 3K46A 1H2KA 4COYA 4DV2O 4LA2A 2H0VA 2VQUA 1SKVA 3KCCA 5FYBA 4FQZA 4JV5O 4AEDA 1JZ5A 3G67A 3MPPG 1PGL2 3E6CC 4UUJC 5H9CA 1NBMG 4B3SB 3WNNA 2JEXA 1AR71 1W3XA 5IVYA 4DR4O 4YYOA 1CXZB 3POWA 3B01A 1OV9A 3IAQA 2WZR2 4GLXA 3T08A 2R062 4JGYC 2K46A 1EPWA 3DKQA 1FFXB 3PU3A 3I54A 2W39A 4FLTA 2ZM6B 3BIWE 2RR13 4LFBO 4DY3A 4LITA 3LEKA 1J5EO 2YIBA 4N7IA 3N2KA 3ABUA 4QD2A 1GTOA 4J41A 5LRRA 5L9BA 4EN8B 1JYWA 4I0BA 2WLIA 2VWKA 3I2OA 1LOAA 1YLLA 1MS5A 2VNVA 2ODMA 2YBKA 3OJBA 1GANA 1UX6A 2EINC 3BN6A 4JDOA 5KAFZ 4LF4O 1UZVA 1I94O 3H8UA 4BQ3A 5G05L 3ZMNA 2UU9B 4BU2A 3MIDA 2W9XA 4JCKA 4QMAA 4CDWA 5BMVB 4JKLA 1F5FA 4YVSB 5LB6A 2VZOA 2F1MA 2ZHMA 3DN7A 3KM5A 1JHJA 5J36A 1DQ6A 3MGUA 4KWJA 5BV6A 2JDZA 2J42A 3GYDA 2X7RB 2IZWA 2HLDG 2VMIA 1QXRA 1IXMA 4FSJA 5FP7A 3JATA 1PVC3 4Y26A 1QEXA 4KGQA 1RSOA 3IPVB 4LUMA 4K7JA 5D21A 1W8WA 4NTXA 1QVGU 2ARHA 4Z1MG 4LF6B 4PIXA 4MGZE 1NCRA 5JQGA 1AJPA 1W0KG 1TEIA 1TVKB 1MPXA 3JCUZ 4B3TO 2A5ZA 3ASOB 1N3PA 4UFHA 1W8NA 3GBGA 2CL2A 1N1VA 4DRRA 3AC0A 5K0UC 3FZ3A 4BMEA 1PK6C 4JAVA 2PY5A 4CH3A 1GM7A 1K4DC 1VQNV 3WLUA 4I9QA 3MUY1 4BWOA 2PLV3 4WFAV 1F2NA 4LOSA 5JJEB 4JI1B 5KHIA 4R9DA 1ZVFA 4RQPC 2J1AA 3C3SA 1W8HA 1L7QA 3OGGA 4N8MA 4JAUA 3JALA 2QDRA 2VQTA 4LO7A 3JYCA 1W99A 4EB6A 3HKCB 1MA1A 1PIV2 1QQP1 5C93A 5IATA 5H6RA 1LAJA 3VZNA 4A7YA 2Q1MA 1NS1A 1JMUB 1EV11 1HW7A 4DV0O 2VM9A 4UFZA 4ATFA 1JN2P 1Q8SA 3H3UA 1SS3A 4LK6A 3I4IA 5A1AA 5FLJA 4WM8A 1FXKA 3RN4A 1POV3 4CDUC 4GMP1 2X05A 1CIYA 4W8JA 1W6NA 2QWOB 2RV9A 2Q1FA 4CH5A 2V72A 4KWUA 4CEYA 4H44B 2XAHA 3SKJE 3RT3C 3URFA 2A6XA 1OOPB 1F9KA 2D5HA 3EYPA 1VP7A 3LF7A 4N53B 4Q8LA 3RVHA 1I7FA 3HN1A 3KVAA 2H6BA 1R3LC 3RYIB 1OF3A 1VAVA 1YJ9V 3AG4C 2GV9A 1CAWB 1AR1B 5FQ0B 1ORQC 3EQEA 4NO4A 1DLCA 5DAVA 1RUF2 1D0GA 1AJKA 1WCDJ 2HFEC 3T1YO 2E51A 3K77A 1CZVA 5EXOA 3ZYRA 1NLQA 5B1NA 3NSTA 4KGGA 5FYHA 3PN1A 5FXZA 2WNOA 4O4HA 2NM1A 1J1TA 4GX2A 5KWRA 5EBWC 3ITQA 2I45A 3N7JA 1VQ9V 5F9TA 4DUYO 4HG6B 4Z92B 3K3NA 3IFXA 4TWTA 4XUQA 3ZHRA 5GZGA 2GN3A 3T2OA 4M4PA 4PT6A 5B3SB 4QDQA 5KAIZ 3CJIC 4LTAA 2WA3A 4FPYA 3DXUA 3NNFA 4W4KA 2QQLA 3CXCU 1JZ8A 4D6QA 4P9YA 3LOIA 4LHNA 1YJKA 4PDWC 4ARYA 2GDSA 1EN5A 3SJBC 2ZMLA 1VBD1 3ZIXA 5EC2C 1MS3A 1UU4A 1WW5A 2A73B 3U0ZA 3S6PA 3AEIA 2FMLA 4KHPB 3CZJA 4FPFA 3SJQC 3CD6V 2BW8A 5DECA 5IYCO 4YW2A 3TK1A 3O0XA 4YM2A 2YC4A 1I08A 1V00A 2BVBA 4A41A 4N9IA 5A3NA 3A0HZ 4FZ0A 1IS4A 1W2UA 3ZXJA 1QJEA 3VKFC 4RGAA 4RR3B 2YBPA 3OMNB 5CFDC 1K9MW 2EIMC 3M4FA 3ACGA 4HN1A 1IS6A 2XJPA 4M01A 1OCZC 3T1HB 3MHSC 1RIRA 4AVTA 4K9SA 3JB8A 3MLJA 4A5UB 1D7PM 1SCSA 3HNMA 4OHXA 1PGW2 1OMIA 1QMJA 3UT5A 2JVDA 4ASLA 1WMFA 1QJZA 4YW7A 3UL2A 2VMEA 4CBCA 1YF2A 2O1QA 1YTFB 2TEPA 2EIBA 5F6LB 2NN4A 3AVSA 2WNEA 4QM8A 5IJ0B 2BWCA 1W0NA 3QO8A 1YQ2A 5K9YA 3WDTA 3ZN4A 1QNWA 4UI9L 1NY72 1KFXL 2ZEWA 4J7ZA 3N9NA 1TG7A 1PO13 3WG7B 3AZXA 3OYWB 2ZCEA 1Q3EA 4FT8A 2BQPA 2WINB 1G9AA 5CA1A 2HWB2 2YEVB 1UNBA 1VQMV 2ILMA 4MW3A 1VBA2 4I55B 1QJX2 2A71A 3D36C 2D97A 5KXDA 4IEVA 4MADA 1PGSA 5A33A 3FMGA 3ZPOA 5I8TA 2BWAA 2EIKC 2X09A 5C3RA 1XNQO 4JI6O 3H8RA 2VECA 1DQ1A 4JYAO 2Q7GA 3IN9A 3LDEA 2XKOA 3SH5A 5BZBA 1B35B 2Y8KA 2EBOA 4HSLA 2D5FA 1BVVA 2BPA2 1EY2A 5JUVA 3I2KA 1W6OB 4GKYA 5E79Z 3KLSA 5A80A 4PHZA 5JXHA 1VBE3 3GJAA 1JOJA 1W8OA 4Q29A 1J58A 4ZKIA 3EVKA 2C6SA 4YVSA 1YITV 3LIHA 3UM7A 4Q4X1 4TN7A 4UCTA 4FBFA 4URAA 4EN6B 4O4LB 2ZZQA 1UQXA 2OT5A 3U11A 1RVF2 2X10A 2ZR3A 2VUCA 4LFAO 1HR0O 4DW1A 1NTKH 5FYVA 5LA2A 4D7TA 1R1A2 4GWNA 2TBVA 5KHGA 2ZX3A 1O8PA 4YW4A 2WZEA 1RUD1 3MFCA 1PZ8A 2C26A 3CEIA 3GVMA 4CPBD 4UV9A 4EFBA 5IJ9B 1KUQA 1OPMA 4IERA 5KA6A 4RS5A 2UXNA 3MI8A 2FYUH 2QBXA 2ZPXA 1QXPA 4TT3G 2IXIA 3CJHB 3FFQA 3FX7A 4PLNA 5D8AC 3M7MX 3ES4A 1HNWO 3ZFEC 2A9HA 5C3OA 4UXAA 4P08A 1MZEA 5JSPA 5A2QN 4ZHNA 3AFKA 4PIZA 5F3EA 1H0BA 2VULA 2W5FA 2ADPA 3TEZA 3AK0A 4E4EA 1RUG3 2J1SA 4DOUA 4UCUA 3L74H 1IG0A 3ZHVA 4LJHA 5AFBA 1OVPA 4TV8A 3U4XA 1SDWA 3MBWA 1E1RG 5F7UA 1F15A 1SACA 5A7WB 1SESA 2ZXWB 3N2GB 4BCUA 2WLKA 1D5NA 1VQPV 1ZRDA 2BV4A 4DR2O 2QM4A 5CVRA 2WSSG 3JB4C 4XILA 1A78A 4BWAA 2OW4A 5JWPA 3PUIA 2JG8B 3PVBB 1UX7A 4HLTA 2VH9A 4LF7B 2VQEO 2VZUA 3GM8A 2Q6AA 5J2TB 4AVSA 3RGBA 5FYTA 1MVEA 2YS8A 2DTWA 3HPNA 3VD9A 1L7RA 1MZ6A 3CU7A 2VJXA 2LW8A 2Y38A 2R0FA 2Y6GA 4N53A 2PHUA 3T4HB 4AI1A 4OI2A 3U75A 5LYJA 5KUMA 5E1RA 2XBO2 2OYZA 2P67A 5FQ0A 2NP0A 4MVSA 3USUB 5DEDA 1UYYA 2OQ7A 2VMCA 2WL1A 1F31A 4DV4O 3ZYPA 4HPKB 4GKJB 2G9FA 3L2YA 4JGYB 3BOWA 3D3QA 1VMFA 1GP5A 3K48A 3FYEB 4P9GA 1RTVA 1BHBA 1WW7A 3AG7A 1BBT2 1BLZA 5FV3A 4CCDA 5DMYA 5K4LA 1KU9A 1S76D 4BW9A 1CPNA 5GJ6A 3WR0A 1ULGA 1NTZH 3JASA 3LDDA 4NRQA 3QVNA 4UBHA 3TNPB 3TOJA 3MO4A 4R9AA 1GR3A 1WLWA 2ZHKA 1SZBA 2EINB 1XUQA 1BE3H 2X6AA 3M1HA 4CCOA 4JI7O 5IVJA 1LU1A 2QWNB 2E76B 1EBOA 4J1WA 4YM3A 1EM1A 5DM6V 4U7OA 1XNKA 1H2NA 2VZ3A 2ZACA 5A3OA 1EAH3 4IE7A 1X8EA 2V5DA 3JUUA 4YG3A 2IFRA 3ZXFA 2QTSA 4Z1VA 1JOPA 3VHRA 1BJQA 1HNZB 1LHWA 4JI8B 1Y66A 1YVWA 3ATGA 1OCRC 4IIJB 1RM1C 2ZGLA 4GH4C 1GU3A 1IKQA 3DYOA 1CQ9A 5DZEA 4QX7A 2AZ2A 3W7TA 3OEBA 1G9CA 2DCYA 2XDVA 3CCSV 2LS6A 4R8HA 3ZXAC 1FYUA 1UYXA 4FXKB 1SLTA 4XPVA 3T0DA 1XREA 2FB5A 4U3JB 1S5LZ 2ZGMA 5LGUA 2LRPA 4UF0A 1REEA 1R3KC 3M2MA 3K4AA 5C7GA 2ATFA 1YRZA 4YVWC 2H8PC 5K0UB 1G9DA 3WQ7A 1PK6B 4I0XA 2CE4A 4BHPA 3B94A 2DYSC 3ZN0A 3L73H 4Y1UA 5C71A 5FZ6A 2B1IA 3B5LB 4J42A 2C1FA 1VP6A 2W47A 3HKBB 3BHPA 5FP4A 1U97A 3S57A 1H1IA 4NIDA 4RQPB 2D98A 3SCFA 2DYRC 2VBDA 4FLUA 1FXZA 3JD2A 2E9QA 3B93A 1U5XA 1MEC2 3E86A 5D5QA 1A34A 1F23A 3B9CA 5J98B 3WG3A 5FYMA 2DCZA 5FMOL 3CMAV 1AYN1 4PJYA 3W7WA 2P17A 3OUSA 3P32A 2DDUA 2JDUA 4FTBA 1S5JA 4XFFA 3E5XA 2ADQB 4CDUB 4DR6B 1GO3F 2OCHA 2O57A 2JGDA 3POJA 1CX1A 4DZGA 1KD7A 1RUOA 4A7KA 2GUZB 1W9SA 2B39A 3FLTA 3CRQA 4IESA 2PELA 3WW2A 5C8CC 5AC91 2DE0X 1ZAUA 1JXNA 1SA0B 3POBA 3BTXA 1DZQA 1LU2A 2WS91 1H30A 4CTEA 2Q8DA 1GZCA 1IBLB 5EZYA 4PCRA 1UXXX 2WBKA 1ZRIA 2UXDB 4N9HA 5JCOA 3AG4B 3D82A 3O1SA 2RS11 4KI5M 4QX2A 2X6CA 2D6OX 1NR7A 2WZR3 4UW4A 1BZWA 2R063 2R72A 1YDXA 1WAZA 3CXHF 3K03A 2F66C 1GNHA 5FY4A 5JVVA 1HDKA 3VD3A 5J9PC 2YIDA 3WF2A 2QWPB 2W6JG 5JVDB 1C3HA 2DFBA 2ZS6B 4XF3A 4ZS3A 2QR4A 1VE0A 2WNVC 1WCQA 1ODMA 3A21A 5KBFA 5I91A 3CYOA 4OYUA 3ZMVA 3J8F2 3SMHA 2OA2A 1GSLA 3VBOC 4QGPA 2AYHA 1RUC2 2D3RA 3WD5A 2EIEA 4XIKA 3CJIB 2C9KA 4AHYA 4UOJA 2HBUA 4BJ0A 5IJ9A 5FK7A 4NKGB 2BNMA 5EWSA 1J3QA 3FHAA 1LHUA 1HQLA 4PDWB 2WJSA 1H8HG 1R6TA 4FPEA 3NNMA 2BUKA 1NH2B 4XUOA 3OPTA 3SITA 3CJHA 1SQGA 3J26N 2FHRA 1FXVA 2KSDA 4LR3A 2VZTA 4I4TB 5HPOA 4CEWC 4YJ3B 1O4YA 1OI6A 1QNYA 3D0JA 2JE9A 2QE3A 3ASIA 2D3PA 1V9U2 1H8TA 3PMEA 2WAMA 1IBMO 1SZTA 4E27A 2ZINA 2VOWA 2HYXA 1UAIA 2J22A 4IXLA 4EWAA 4PF1A 4LBOA 3CLPA 5CBLA 1XNAA 1YI2V 1DBNA 1KJLA 3RZHA 5CFDB 4X20B 2EIMB 4DV3O 1O3SA 3RWRD 4EWEA 3DXRA 1NQTA 2DWDC 5LA9A 1RPRA 3N7MA 3P3PA 1NXMA 3FE5A 1OCZB 3TWIA 1RUE1 1D5AA 2R9IA 3ZN6B 1UOBA 2D6MA 2C5DA 1RHI2 1HNXO 4RYDA 4O9GA 4Q4V2 3JAKB 2VUAA 5LBQA 5FP8A 3WUDA 5LA6B 1W2AX 1NE4A 3KSCA 1PNFA 1YXBA 1DLBA 3VB9A 1RFYA 1PIV3 1QLEC 2GC1A 4UW3A 1YZBA 1REFA 4CC5A 3HAGA 1JZ2A 3UKTA 2WO1A 2ZQMA 1M06G 3SQOA 2IW5A 1K73W 4G9SB 2VVFA 1VAMA 5IFTA 3AB0A 1RPOA 4ZI7A 4DS0A 4GB32 4JGYA 5FOBB 1CESA 4D7YA 2QJ1A 1W0PA 4FPCA 1NOVA 5FKCA 5LMNB 5EQUA 2RDQA 3ME2A 2V4DA 2J1TA 2Q8EA 4LNUB 3CJXA 3ZSJA 4UFIA 1U5YA 4V2VA 2IJIA 4PDLA 1JODA 2ZM6O 4IGGA 3IBMA 3W7UA 1ZX5A 2W92A 1O59A 2R9RB 1MVQA 3HQUA 2VE1A 4DPNA 3ZHUA 3OPZA 1MMMA 2CH7B 1RUF3 3WF4A 5APAA 4GULA 4PELA 2YIAA 3VN4A 2I74A 3OBZA 4XFCA 3VHOA 4J7KA 2P3JA 3OAAG 3SPHA 1JW6A 5FL7G 1D2DA 3P6BA 5JSRA 2QDOA 1YI9A 4B3MO 1SQVH 1SLLA 5LZ6A 4PV1B 3KS7A 1XNRB 2P5OA 1LR1A 3OBAA 4LIVA 2VTXJ 5IVCA 3VZKA 4LC1A 3I49A 4QB2A 2ZEXA 2IJKA 1HRI2 1Y76A 4UCVA 3UO2A 3RZKA 4YGEA 3MIEA 4CVUA 1S0EA 2YDEA 2WKKA 4KXRA 3FLPA 1ENRA 2VUJA 4D6SA 3AK1A 1MS9A 5GW7A 5IYDO 3ZFGA 3UGHA 5I93A 1LOBA 1L0NH 2RDCA 4DRXB 4JRLA 1F4HA 5D5PA 1GQHA 2CWSA 1NKDA 2A6WA 2WFF2 5IHRA 1Q81W 5D8AB 5F3CA 4PIYA 5C8WA 4TQFA 3ZFEB 2MHFA 5A7NA 1W6QA 3ZHSA 4J10A 3IC7A 5FPZA 2F4VB 5C9AA 4DV1B 4WFFA 3E22B 1O3RA 1AXYA 2QEXV 1J84A 3ETGA 1YIPA 2XL9A 1MQTC 5JR2A 3JSLA 4YJ2A 1A8DA 2AACA 1JR9A 1Y4MA 3ON7A 1AVMA 5IK8A 4M00A 2W94A 1PIV1 4FTSA 2ZT9B 4UWDA 4Y5SA 1K12A 4AVVA 4OX9O 2GMPA 1UWWA 1XMQB 1HB1A 1OT5A 2RMU2 2XASA 1LHVA 5T50A 3HKEA 4XCBA 3Q4HA 1M4UA 3ZRWB 1N8RW 2QKSA 4Q4Y1 1Z5WA 2XAGA 2P6HA 2F17A 4X1KB 2RM23 2HWD2 4YHHB 2AH2A 2E32A 3MIGA 2JK5C 4MTXA 1OLMA 4RA0A 1P49A 3EMRA 5B5EZ 1CIWA 3ZIWA 3SDLA 1OD5A 1A32A 4DR1B 3IAPA 3GCXA 4X6QB 5L3GA 1UD1A 3VHNA 1IQAA 2WT1A 2OUHA 5GONA 4ZIBA 4TV9A 4I09A 4WFEA 1VBA3 3SJAC 2XH6A 2BSKB 1QJX3 4PDRA 4MVQA 2ET7A 5FZ8A 3POIA 1ROPA 1YQ5A 3M7AA 1QOSA 5KMGB 2DUQA 4P5YA 1E79G 3B4SA 5GM0A 3E83A 3H8OA 3UCSC 3GZAA 2D7FA 4X89A 2HR3A 1ZL8B 4HONA 3LSQA 5A9GA 1LGBA 3CCJV 1GNZA 3FB5C 3ZX6A 2JIJA 1PP9H 5L36A 2CGOA 4AEDC 1KQSU 2RE9A 3MLLA 1AI7A 3IIAA 1CGPA 1EUUA 2DF7A 1R082 4R50A 3SEEA 3G6EV 3VBFA 3SCHA 2BOCC 5DPNA 4RUFA 3SPJA 4LBEC 2AGAA 4JI4O 3WW1A 4FFBA 5JXIA 2XT9A 1RVF3 4XXAA 4GUNA 2WLMA 3CNAA 1O6UA 1VF6A 3CC4V 1IG3A 4QPGA 1QJY1 2Z0AA 5KX5A 3ZYGA 2XLGA 4NXNO 2XVGA 4YFWA 3AFGA 2YUAA 3W5MA 2JG9A 4HT1T 2CTWA 4BIOA 4DY5A 1OHFA 2ES3A 4P9IA 1RM1B 2JDKA 2ZGQA 4GH4B 5IFPA 2BGCA 1ONAA 2DV9A 4CCEA 4W6XA 5C5TA 1OXCA 4MV2A 3B9IA 3RYKA 4NB5A 4KBBA 3SYQA 3ACFA 2UUAO 2N74A 3DCQA 3VDBA 5L3FA 1TE1B 2E6VA 4COWA 1ULEA 2ORXA 4P9OA 5HFMA 4CDWC 5L3CA 4LHLA 1LNSA 4N43A 1JYNA 2K0GA 1RUJ2 3CB2A 4NPMA 2DWEC 3B7MA 4YVWB 4IE5A 3ZFFA 2A79B 4DUXA 1VMJA 2DYSB 4B08A 3NMBA 2PAMA 1PGW1 3O12A 4XBNA 2YY1A 2QQNA 3ZXEA 4LBQB 1UU5A 2AW9A 1CJPA 4M3CF 3CPWU 2VZPA 4PQ9A 5FO9B 2O0OA 2OX0A 3PIJA 2BEOA 2OTJV 2Q8OA 1NI8A 2W1SA 3VDDA 4CUBA 2Z3YA 1Q86W 1VMHA 4M0NA 4DXWA 1NY71 1NCRC 3IIIA 5FOJB 1VQ6V 1COV1 4HNAA 2PXJA 3C2UA 4QPKA 1FKAO 5T52A 4DUVA 3V0BB 4KU8A 1NT2B 1W2TA 2HWB1 4LP8A 1G1XB 1VBA1 4CCJA 5J48A 1JZ3A 5CKMA 2WN2A 3WNXA 1YFXA 5F2SA 4Q6GA 1GFF2 5EBMC 1ZBA3 1LB2A 3HN3A 3IM0A 2VCCA 5HI0A 2QFEA 3AXEA 2XUMA 4W65A 1KD1W 3QD6A 5C8CB 2XJTA 5C6CA 4MVUA 3PIGA 2LW7A 2L35A 4WBNA 2JKBA 4CDQA 2FCVA 3WNPA 2V7QG 4WFBV 3I3DA 2XBO3 1CAUA 1MS4A 5IAXA 4QQLA 3KT4A 4JPRA 5CNAA 3I3EA 2HP8A 4ASKA 1QQP2 4KNCA 5T5OA 2X6BA 4XUTA 4QX5A 1I5ZA 3EHKA 1EV12 1JHNA 3DKWA 2LALA 1SQPH 3VKNA 3PJYA 1BBT3 4IHJB 4LBLA 2IXKA 4WM8C 2D6NA 5JMCA 1FI2A 1FXKC 3UT0A 3PJQA 4K8ZA 1LUWA 5HXMA 2PUSA 4I02A 4HSJA 3E35A 4O4JB 5AFEA 2X5IA 2WNVB 2QKDA 4QU1A 3TEXA 4CEYC 1KKCA 1W8ZA 1R1A1 3PLQA 2QWRB 2XNDG 4XDQA 3VBOB 1HN1A 1BZKA 2CGPA 4XC9A 1S1AA 3UKNA 4V1PA 4EZHA 2CDPA 2CTVA 4X62O 5FXWA 3G71V 1W28A 1QHTA 1WCSA 3CRCA 1O9HA 4LORA 3I8TA 1RMU3 3UJQA 4NMIA 1HV0A 3H1HH 1PM4A 3RG0A 1K42A 4X1YA 4LLFA 2WRAA 1E57A 3NNJA 3K3OA 2HJIA 1POV0 3RRDA 2AXTZ 1I5PA 2G4IA 2DVBA 4FLZA 1Q82W 4CEWB 1ZUQA 3K79A 3E22A 2Q0AA 2HVJC 2ZIMA 4LUKA 4OHWA 1VRH1 4MX3A 2Y6LA 1X33A 4ZXKA 1JQ0A 3VOUA 2N05A 2C0ZA 4LFCB 2PHRA 3LNNA 2ZR2A 1HIXA 2HYKA 4LQRA 1HXS2 4B1MA 4AI0A 4XAEA 1OLME 1WA6X 3APBA 4KMQA 3KMHA 1AXZA 4TZDA 4ZHQA 1VBD2 2FDGA 3H9VA 3OTOO 3KB5A 1ALYA 4KQ7A 1C4RA 1F51A 1XNCA 2P4EA 3B09A 1SBEA 4X66B 4O2BB 2K9ZA 2WNUB 1V70A 1OUXA 1K97A 1MEC3 4X6RB 1VB4A 2WSUA 2R1BA 3NJVA 1QLEB 4FPKA 4LF7O 4BMBA 1UO9A 3V0AB 3T2PA 4J9ZB 2IBZH 3GGLA 3WF0A 4XF4A 4BAYA 1JFFB 4P14A 4EQVA 5K1PA 1HN0A 3RZJA 3WT3A 2WLHA 2QA4V 2UWCA 4TQDA 5T54A 5CYYA 5LMUO 2Z2SB 4QB6A 2QQPA 3GF6A 5FPLA 1R6KA 4HVRA 2N7GA 1ENQA 5DG1A 1BBT1 4GZ9A 1Q5OA 4H7LA 3RYCB 2EICA 5F6KA 4K21A 2DN9A 1VAKA 3J4UH 4LPLA 2ZX4A 1WKYA 2V73A 5A3UA 3LDBA 4NAMA 1DGRA 1KC8W 5F2WA 3RSJA 3G6BA 1M57C 4HXCA 1L3JA 1WNSA 4A6SA 1WW6A 4JI5B 1RL3A 5EYXA 1K45A 4BH9A 4FOVA 2ZD9A 1BCCH 4XMAA 3AZYA 4CE8A 2WN3A 1YJLA 5LGTA 5JXJA 1W39A 5B4NA 2IWGB 3R4DB 1AHSA 4DK1A 3FJSA 1DP0A 4B4QA 4NAOA 1SRYA 3MZHA 3DSQA 1OQ1A 1JI6A 3E8GA 2ZBJA 3OGRA 3J8F3 2JX9A 1ZZCA 1S0GA 5HV4A 1RUC3 3UYJA 2MPFA 1IZ3A 1TA8A 1HB4A 1LEMA 2YC0A 1KRIA 3AK2A 1GZWB 5C8YB 1UMZA 4I30A 4KG8A 3OGVA 4C0BA 3CCLV 1VEWA 3SPGA 3RZZA 1E5SA 4Y5Z0 1GOHA 4R8CA 4ZOLA 2ZAHA 4OQ8A 3BGAA 2WC2A 3PNAA 3APOA 3ZMOA 4Q26A 1ND2A 3ILRA 4YVSC 3FAVB 3G6JB 4RHV2 2VCMA 1U5IA 1XQ8A 5ACA2 3D5OA 1Q8OA 3POSA 5CB7A 1Y9MA 3RWNA 4XDKA 4RN5A 2XUEA 3CRAA 1J1LA 3LSSA 5LBFA 2QM7A 4XDJA 1QNMA 3PJSK 4KG0A 4C7UA 5BR8O 2QQIA 1Y4WA 2W0XA 1MQTB 2ZDIA 3CHXA 5DUXA 4NHKA 5J2UA 1XB9A 3RYRA 1N32O 1S0IA 1MEC1 5BYNA 1RUD2 5GZEA 3CO2A 4QKNA 3VQYA 2E31A 4YY3O 3M8LA 4NUBA 2B9VA 5K8SA 2DU0A 2IFWA 5ERLA 4RS5C 2L6LA 1DYOA 2YICA 2PTMA 4LE4A 1RHI3 5M0TA 1UPGA 2G38A 4Q4V3 1HQNA 5FZMA 5H6QA 3VLBB 4BIUA 4H13B 1O7FA 1M1KW 2D93A 1NX9A 1BMV2 2WLPA 2QQUA 5C8CA 4GT1A 4UAPA 3IZOA 2GN7A 2RS52 1K33A 3T1CA 3ABLC 3T4ZA 1N47A 5JMOA 1D2QA 3H8XA 4MGIE 4OHZA 1WCUA 2WT2A 3D3AA 2VZRA 5A32A 3AYDA 1SLIA 2XJUA 5JDBA 4GB33 3RWKX 3KZ4C 3C7FA 4Q27A 1QJU2 4RFRB 1VB2A 1T6GC 2VTFA 5A3LA 1IPKA 1BCXA 2JE7A 1W9TA 3DGTA 5BXZA 2XMLA 4Y22B 3T1LA 4YZ2A 4H2AA 1US3A 3WCSA 3PTYA 1MS1A 3E5UA 2WLLA 2WNVA 2CYFA 3J8F1 3ZO0B 4DV7O 2JDPA 1OLRA 1RUC1 4JDMA 1LGNA 4AW7A 3TYJA 4AEDB 2UXBB 4N53C 2BOJA 5FR3A 4JI3O 5A70A 2VOKA 3OUHA 2XQXA 3DEMA 1D0HA 1SF9A 2ZE6A 4UVBA 2RDNA 1S2BA 3E6BA 2FZ2A 1R093 2XTAA 3NKGA 1KDKA 4OI1A 3VZMA 2YXYA 5J96B 5FZ4A 1ZZ7A 4NHLA 4DV6B 3CWBH 4EFEA 4YW3A 1ULCA 5E16A 4YG6A 3IDCB 3ZXDA 1HRI3 1PMIA 1M5IA 4P9WA 5DN6G 1G6UA 2Q8CA 2ERFA 3AMHA 2FDFA 2W1QA 1QBZA 1V9U1 2WLIB 3MIFA 3RYFA 1GOGA 2Z79A 4R7CA 2YXLA 2A70A 1FMD1 3H42B 3S7IA 3PUSA 4FZ1A 1ZNPA 4HKOA 5B3SC 4DR3B 2ADDA 2X53S 4EWDA 5GLUA 1TAEA 3B00A 1S5HC 3NJXA 4QPWA 2OVUA 5EBLC 4FI9A 4NTWA 2WFF3 2KD7A 1IBKB 4INDA 4CDWB 3ROUA 2XB6C 1Y74A 2JJ6A 2HWC1 3O1VA 4XDOA 2BVVA 1HX6A 3ABTA 4XABA 2IJHA 2R32A 3WNKA 2GNMA 2JS3A 5LXTA 2J1EA 1LESA 4C8DA 4CC6A 2DUPA 1TQ5A 1Y3TA 5E89A 4QXHA 4XTMA 4L99A 3JATB 2WNUA 3WDUA 3DPRA 5IYBO 5J09A 3H0OA 1RSOB 1JUHA 2QQOA 3LAGA 1OPOA 3A4UA 3A0RA 4ISQA 5DAQA 4JGZA 1N34B 1NCRB 3CCUV 1GWMA 2VVDA 5JQGB 3J80N 1KITA 2PMWB 3K06A 2RMU3 5FLIA 3PVEA 4OVEA 1DF5A 4PBOA 4GB31 5FZHA 2A3QA 3F5WC 1QWRA 4DUZB 4HK9A 5JJNB 3TCUA 3MV01 1WP7A 2HWD3 5GTHZ 1DGWA 4JRAA 3G7DA 3WG1A 2DVDA 4XQWA 2WZPP 1JYTA 2OT7A 2B4KA 2JEMA 2VCBA 2Q69A 2WO3A 2Y0OA 3RBZA 2HWF2 2E7AA 5FJHA 2EZOA 4IV1A 1T2XA 4EB6B 3LKJA 2YU2A 5FYCA 1BSMA 4FAGA 4R4ZA 1ACCA 4QT6A 1LGCA 1XJAA 5ABJA 2EAKA 4OHYA 4MHRA 5JOWA 1NJIW 4MVTA 5GZDA 1I3HA 4QIWF 4AFBA 1AYN2 2Z5UA 1NZIA 4P9LA 3ELNA 4WM8B 2G9ZA 1FXKB 3ICXA 2PGGA 4ABMA 1WB7A 2Y6HA 1YFYA 2RN9A 3CMGA 1HB2A 1OFSA 3T2QA 1RJ8A 2IJJA 2NLJC 5I0SA 3E97A 2JWPA 1LTEA 2P06A 5A1LA 5IJRA 1MABG 3ZYJB 5AC92 4LKEA 4NXMB 1GZWA 1BKZA 5C3QA 3ZJZA 3DECA 1GOFA 4B7KA 4ZS2A 2ZXQA 3I2GA 2WLNA 2WS92 3ZYFA 2P7TC 1WBFA 3AJYA 1R083 1CZTA 1EZJA 3LOBA 5JCOC 3WVJA 1ZTEA 3DYPA 4YM1A 3NAPA 4Z07A 3AZWA 3N27A 1IPJA 5FBZA 4XHXA 2RS12 1UOJA 2UUCB 1S3JA 5FXXA 3B69A 2D43A 5FZGA 1VMGA 1H8VA 1UU6A 4YZ1A 1DK1A 4JKKA 1WP8A 2SLIA 2LGQA 4DV2B 4O4HB 4MGQA 1SETA 2HWE2 3GZEA 2EXIA 1NVPD 1OURA 2G19A 4AAXA 3MICA 5JSOA 3B02A 1JTZX 4PA9A 2YV8A 4GX1A 3K51A 1NH2D 3PURA 1WLTA 2P4VA 2BZDA 5A6QA 4DR4B 1VQKV 1LJ7A 2LM3A 4J1XA 1RUJ3 4AQYO 2GP5A 3MW4A 4J80A 2RMU1 2O8OA 3ZLIA 3CL1A 3PL0A 4I2OA 3B2EE 1K34A 4Q1PA 3JD3A 3K5NA 2VQFO 4LFBB 3FB6C 1J5EB 1N1TA 1C5IA 3J7NA 4WVZA 3VUOA 1K5QA 1BHGA 2VO5A 2JJ1G 2VNOA 1MZ5A 2XJSA 2A3WA 3IWZA 4XF1A 4U2AA 1YWKA 2LGWA 4WM7A 4EZ4A 3VBRA 4RQEA 3CRRA 1H8TC 1R6NA 2QCSB 4QPYA 4BQ4A 4JQTA 1JYXA 4LF4B 1I94B 1HV1A 3PVNA 3UKVA 1XQNA 2CV6A 3LSDA 1Q90D 4J25A 1KEXA 2VXRA 3TAYA 2QTOA 1AR61 1L8DA 1XILA 4U36A 4K6BA 3Q8FA 1H6YA 1AVBA 5EHDA 2PI4A 3VZJA 2ZXWC 1QOOA 3WY6A 2W46A 4WZFA 2UY8A 3ZSEA 5FZ9A 1BHAA 3GZTB 3VDAA 4JZ2A 1FATA 5CMUA 3K4DA 2FDIA 3NO8A 3TEYA 4D0QA 4CP0A 1G6NA 3UT5B 4XUNA 4D7SA 2OCCC 2M6YA 4S2DA 4XIOA 3B77A 4AAPA 4I50A 2D2CB 2OKXA 1OH4A 1M57B 1PHMA 1XC6A 3OBRA 4IE4A 1LEDA 3HBZA 1QIQA 5BNNC 4UB6Z 3ZDSA 3LE0A 4XHBA 3QO5A 1CP9A 2WQ8A 1H2LA 1QQP3 2BTVC 1H1MA 3NV4A 4B3TB 3QF7A 2YB7A 3K5OA 2PHFA 1R081 4FVVA 1EV13 4AFDA 4GALA 5LEJA 4S2GA 3FB8C 1SQBH 2A75A 3O7OA 1GYKA 1Y43B 1WB8A 5CA1B 4K0KO 2WQZC 4GMP3 2LUWA 5DAPA 2B9ZA 4N7UA 2UY9A 1SQFA 2KG7B 3BI3A 3VD4A 4ES8A 4H14A 3HIFA 1QHDA 2VW2A 3ZRXA 5ITZA 4X8NA 3ST7A 2OYQA 5A33B 2VW0A 1WA4A 2Y33A 4EV0A 1ENSA 3S5AA 2Y26A 1FPOA 5EV7A 4XF0A 2TNFA 1IHMA 4FK5C 1LCLA 5EYPA 3N7KA 2P4KA 3KGZA 3RZLA 4HL0A 1H38A 3UQ8A 1HDJA 3K5LA 3IGAC 2JICA 1SEFA 4PA4A 1S72V 5FDBA 2IU3A 2B5HA 4XQDA 1DQ2A 2WUHA 4DV0B 3Q8AA 4XETA 1HQWA 4LIUA 4Z2WA 3J7HA 1OA4A 4GX5A 1GZTA 1RUJ1 1W9YA 5FY1A 2RDSA 3SPCA 3VGIA 1QF3A 1YSCA 2ZX0A 3ZXLA 1H4HA 1NZ6A 4U7NA 4XBLA 1Q43A 5F32A 2UU8A 1X59A 4CCKA 5FK8A 4N90A 4UCRA 4XFAA 1D2SA 1QQCA 4LHSA 4GX0A 1S0BA 5FIXA 1ENVA 1P4RA 2E63A 1K5MA 2RJKA 3GBFA 1H1AA 5C3SA 5CBFA 5I0RA 3IKWA 1AYM1 4LKFA 3FFZA 2W91A 2YROA 1AR4A 4WBBA 3LDKA 1SPPA 4A42A 4X65O 5EJZB 3WFVA 4YGDA 4RL7A 2RR12 3EB7A 2PHTA 5IVBA 2WAOA 4H0LB 4QQOA 2ZGPA 1VBB1 1W0OA 1ND3C 3MLKA 3MDSA 2Y64A 1VLNA 4LF8O 1HXS3 2HH9A 3WQ0A 1FFTB 1MZFA 4RS5B 2W1UA 4BQ5A 3T1YB 3ZFGC 3OEHG 2A1XA 3CKHA 5A1FA 1VBD3 5DUUA 3O0WA 4LE3A 5DAXA 1UYZA 4MTOA 3T2MA 2AENA 1H2SB 3J7MA 1M90W 1GAXA 4LKDA 1EZVH 2A7AA 2VMFA 5IWAO 4CS3A 4DR7O 3HB3B 3M3CA 4DUYB 5C9AC 3I5DA 1B06A 2Y0IA 4FFGA 3J9SA 4DR5O 4NE9A 4JGSA 1F4AA 2ITDC 3ABLB 2QQKA 3LUTB 1SFYA 3P5BA 4M4RA 1JOYA 1UXZA 5FKBA 4LO8A 3JBG2 5AVPA 2UXXA 2W2IA 4TV8B 1ZRCA 4FM0A 4F8AA 1S2KA 1OSGA 2JD4A 2VNGA 1DIWA 2GMEA 2GNDA 5I0TA 3C7OA 2HKOA 1GICA 2XKPA 2PAEA 1NU1H 2ZIOA 4AVAA 4Y5TA 4MVOA 4QAWA 4BW5A 4WCEV 4Q4Y2 5CA6A 4I5SA 1WMEA 2ZX2A 1O4ZA 2BFUS 3ZSKA 1PNLA 5ISLA 1EN6A 4JTAB 2CHHA 4MZUA 3T0BA 2FCUA 4Y1XA 3GBWA 4JI2O 2BNNA 4IEYA 2D3OW 5LYJB 5FPVA 2E7QA 1RXGA 2YXSA 1PL4A 3AJZA 1UPIA 3I59A 2ZGSA 3LEMA 4YLZA 4HKWA 4IT5A 4DXSA 1OCOC 2LW1A 2QZ3A 1TMF2 4A6OA 5FZEA 1DGLA 1ASJ1 2WPDG 1WCKA 1SFNA 1XU1A 1P7BA 4W6WA 3OGSA 4FLVA 1POQA 2EXJA 4JI0O 3LEGA 5FZLA 4L11A 2ATKC 2PYJA 3ABKC 1XSRA 4TSVA 4K8RB 4QGNA 2Y60A 4KP4A 3I3MA 2B8MA 4Q20A 3JASB 3RMYA 3WZ1A 3ACLA 2ET1A 4DO2A 3E5QA 4XURA 1GN4A 3FUQA 3ZMZA 2D6KA 5LY1A 4LXLA 5LASA 2DFCA 5LATA 3EO6A 3ECQA 1YQ6A 2FL4A 3DL3A 2WIIB 3C7EA 2WT0A 3K08A 1HXS1 3VBFC 2PAKA 1AX1A 4M3CA 3P30A 3EXUA 5ACA3 3K0GA 4Q4X3 1SMVA 1AL22 2JKXA 2VGDA 1XNBA 3VBSA 2UYAA 1VF6C 2AZ0A 4QPGC 2PI5A 4CP2A 4IL6Z 3A7QA 3N3HA 1XNQB 4JI6B 1QJY2 3ASNC 1RC6A 2JG9C 4JYAB 1QU0A 3MAQA 3KT7A 3ETDA 2BDRA 4O4IA 1RUD3 4WF9V 4XXPA 2OPWA 2XAQA 5JOYA 1IOAA 1LENA 2RS32 3MHHC 1VF5B 1T6BX 4CH6A 2P6CA 4JASA 4OHVA 3UNPA 4QXKA 1YQ8A 1DGRN 2WWJA 3B40A 1ULDA 4N23A 4LBQD 3BTZA 4CS2A 2EXKA 4UF0B 2WDBA 3KV5A 3LNMB 3WB2A 4N43C 4ONUA 3ZFFC 5FY5A 1W9FA 4I0XB 4MOAA 5KLVH 3OY8B 4PLMA 3SEPA 1FPN1 2E26A 2GNTA 2YGLA 5FPXA 2FQPA 3H1MA 4LFAB 4R6ZA 1HR0B 4FP3A 2YYOA 4ZZ8A 1PZ9A 5FO8B 2OQ6A 1QR9A 1WPBA 1ENXA 2D40A 1TZOA 4QE7A 3QBQA 3M3QA 5H9SA 3VDDC 4LF5O 2AZ5A 4CXYA 1KQRA 4UW5A 4CH4A 1ZRFA 1QJU3 2R6QA 4BYYA 3K9AA 1VIWB 4UVCA 4GWMA 1COV2 1W8UA 5F5CA 2A3XA 1YC61 2CSGA 1IDSA 1W05A 5FMDA 1GLHA 1HNWB 3JAWA 2F93B 3UO3A 1YJNV 3LD8A 2ZZJA 3OUJA 2WFPA 3BYWA 5H9RA 2KG7A 4B3RO 2H3OA 3LFIA 5IK5A 2JGDB 3DC5A 1KFUL 3AVRA 3T3YA 5EIYB 5CG9A 4QGLA 2XAJA 4QQHA 4PDMA 2D3SA 4Q8KA 4EJRA 4XEZA 1AF9A 2XOMA 3RNSA 1YFUA 4CDQC 5EZYB 2E5LO 5DDJ1 4BQ2A 1D4M2 5JH7B 2VY0A 1DCSA 3K58A 1G7YA 4KWKA 4B1LA 1NA1A 3ZXGA 3SISA 3VBHB 1WD4A 4DR2B 5FYSA 1RUH1 3ZCCA 4RHV1 3CCMV 1WD3A 2EULA 4A4AA 1GRJA 3L72H 5ACA1 2Q1ZB 4EKWA 4I9WA 4Z2AA 3P1IA 2VQEB 1Z2GA 4YZ3A 2X5IC 3SYPA 5CISA 2E33A 4CDXA 4PJ0Z 2PA7A 3GWKC 2P3IA 4N21A 1A6CA 4Z8BA 1TNRA 5IE9A 2WLQA 5C5UA 4CU7A 4LF9O 4QB1A 1DU3D 2CK3G 2JEUA 1GWLA 2ZE7A 4WVVA 2HEPA 4DV4B 2A6VA 1IURA 1VR3A 2HJDA 1M4WA 2Y4TA 4META 3HKDA 3S0MA 3ZRVA 3O14A 4QXBA 3MW2A 3KVBA 5KXBA 3MPBA 4LT5A 1VBE2 4WFGA 2RQ6A 1BMV1 4AHWA 4CPBA 2BP6A 2CAUA 5IT9N 3CS5A 2GZWA 1LNQA 4Q0SA 4TYSA 1Z0HA 2RS51 1H8TB 1RB8G 3D0SA 2VU9A 4QPIA 3BTYA 5A7SA 5GALA 1VRH2 3W58A 1ZREA 2P3KA 4AOCA 2ZEZA 4JI7B 1OCCC 2GALA 5FZIA 1DG6A 1W03A 5L7OA 1DFQA 1F35A 2CAZC 2KM2A 5CBHA 3DXRB 1QJU1 3E2EA 4NYKA 3KQRA 5CA0B 5L73A 1TGOA 5AG2A 2JXAA 2YPJA 3IDEA 3UKMA 1CAXA 2QQVA 1CAVA 2YHJA 3SCGA 3NNGA 3H1IH 4V2WA 3D8CA 2CU5A 3VD5A 2OCCB 4FPJA 3ZPYA 3CC7V 2A6YA 2JDYA 2HWF3 4JZGA 1UY1A 4Q5OA 1XNDA 5BNNB 3LB9A 4IEQA 4X64O 4DFSA 1QVFU 4BB3A 4SLIA 3LDCA 2MEV2 1SBFA 1UIKA 1WN7A 3ZIAG 4JYBA 4DK0A 1RUG2 1WLDA 1XMOO 1SHWB 1WPXA 1AYN3 3WUCA 3CMEV 4ZI7B 2UXBO 4YG0A 5CBGA 3R66A 3BCCH 4AZZA 3C3VA 1IQDC 2Q0OC 3OMIB 1AROP 4LBNA 5IAVA 4JF3A 4XOGA 2CAVA 3RJRA 1VIBA 5JOXA 3CP1A 2ARBA 4XFBA 3MIHA 1N33O 5BNOA 5AC93 3OFNG 5CKQA 3K3WA 1ULPA 2NR5A 5IUQA 2LFRA 2MNGA 4I0WB 2WS93 4ASUG 2JIGA 4HZFA 3WOGA 1XNTA 3HR9A 1P7GA 4J6GA 4XYXA 4M3CE 3JARA 3AYEA 4FPGA 3LA3A 1Y6XA 2RS13 2OWOA 4AEJA 5TISZ 2QZ2A 3TXSA 3O65A 4ZKTB 4H55A 2DCTA 4MGYE 4HBNA 2WSVA 1AR5A 3H3ZA 1V55C 1LKNA 4JV4A 1FV2A 5DUVA 4YFZA 3RDIA 4UW6A 5CN0A 1KB9F 1AR81 2IM9A 5LHGA 1B04A 1HRV1 3I2FA 4S2FA 3M3IA 4XBFA 1Z5VA 2UWBA 3S5QA 1Y7BA 1V54C 1RP3B 4CU8A 5EFUA 1Y76B 2V09A 3I2DA 3N4MA 4FPPA 4IGPA 1KXGA 2HEVF 1ND3B 4IV3A 3A8TA 1IPSA 2DURA 5KXCA 1XYNA 1SERA 2QGNA 3ZFGB 2FZ1A 4CCCA 1ND2C 3WB1A 2XLAA 1X7NA 3NWKA 1FAFA 2JB8A 3JXSA 1W2NA 3OY8A 3C7GA 2ZAAA 2PYTA 1BVP1 4FJCC 5KUKA 1W6QB 4FLXA 2D44A 3HBKA 1S0CA 5C9AB 3H1LH 3SJCC 2HWF1 2P3YA 4GZRB 2ZDIC 1FJGO 1NE6A 2OS2A 3IT8A 3LPFA 4YJ2B 3GCWA 4C1XA 1HJGA 2HEYF 2QSAA 5T3NA 1WMDA 2ZA9A 1L0LH 1RUI2 3POEA 5LHHA 4ZONA 5JZGA 2EA7A 3LA7A 3F2ZA 1K3IA 1A3KA 2JDIG 3R6SA 5H2FZ 1F4NA 3KWVA 3RPQA 1RUE3 2ETEA 4AG4A 3HKEB 3AL6A 1Z7S2 5FYIA 4COZA 1XE8A 2B7YA 1N1YA 3Q4HB 1OF4A 3MUZ1 3M8AA 4CUAA 1BQZA 2J7MA 3PMSA 5FPUA 5J7MA 4MVRA 1UOFA 1JS9A 4CXWA 1IBMB 2E53A 4GKKO 4O2AA 2X8KA 1TVGA 3BRCA 3OF1A 1VJ2A 4DV3B 4AXOA 3BALA 3WNLA 1GN2A 4WVWA 5JPNB 5JH7A 1B09A 3N36A 5FPBA 4LH6A 4G4FA 3I3QA 5FY8A 4DV5O 5GONB 4TV9B 3VBHA 1OCOB 2VOTA 2XVKA 1GV9A 5FZOA 2Z42A 3SPIA 1HNXB 1G8MA 3CF6E 2AGSA 3DC6A 2R1DA 4IETA 3AKSA 2PHLA 1PNGA 4Y1ZA 4Y20A 2HWE1 2HHHO 3ABKB 3FUOA 3IDBB 3WHTA 4ZU4A 1XEQA 1S55A 5FMBA 2W6IG 4Q0QA 4IYHA 3W5NA 2NYYA 1UKRA 3GXUA 1PPJH 1JA8A 2P34A 1E5RA 1Q6IA 4JYCA 1CR7A 2YIBD 2Q73A 4OPAA 3CDZB 1MOFA 5HCFA 4QKBA 3VBFB 3W7SA 3V65A 1AR91 1FNZA 4FFBB 3AG3C 5HFLA 4LBKA 4QPGB 3WW3A 5KX5B 5FYUA 4IEXA 2P1BA 4D8MA 2BGOA 3ASNB 4KU7A 2JG9B 4DIQA 2BTQA 2VD7A 4OGQB 2UYBA 3QG5A 4L8QA 3LEIA 2YU1A 2FMDA 5F1RA 3RS6A 2RJLA 3SR2C 3VKOA 3GHNA 4YIOA 4BK4A 2ZEYA 1FMD2 1DLLA 5FZKA 2GTSA 5IYZB 1R1ZA 4HVQA 2NN8A 1LR5A 4UT5A 3PHMA 1C8NA 1JYVA 3N9OA 2B9UA 1GN6A 1XE0A 5CA0A 4N43B 4OZOA 3CEWA 4EEQA 4XMIA 2B5UA 3ZFFB 4B3MB 2B45X 1SLAA 4P9JA 2HWC2 3R0RA 3AMPA 4RGKA 4G28B 3VV1A 3J7LA 4ICGA 4LCUC 4RD7A 3PVOA 5C4WA 2WNUC 2BE3A 3WDXA 3DPRC 3A22A 2W0FC 2X0LA 1ST8A 2JRIA 1TUBA 3JBG3 4K40A 3RI9A 5BNNA 2UUBO 3KCYA 2DUOA 2XWJB 4JGZC 5E6HA 3VDDB 1FX5A 4EN9B 3ZHQA 4DEQA 4L92A 2EIGA 5BNPA 4HNAB 2UWAA 2VUDA 3U78A 1QKQA 2XXZA 1YHFA 1KS5A 3ZEDA 3ACIA 4E4DX 1EP0A 4B3SO 3FC0A 4Q4Y3 2JDAA 1CWPA 4AWDA 4FFKA 4AVCA 5F5AA 4UYBA 3KV6A 4MXVA 3Q8BA 2WYFA 2W3JA 2AEYA 3IB3A 5BXXA 3H01A 4BM8A 1WLEA 2WR9A 4RGGA 4CP1A 2MK3A 4WBNB 4MXWA 3VBUA 4CDQB 1XL4A 1OD3A 4OXSA 1W06A 2XR4A 2EXHA 4DQAA 1CAUB 4CP9A 2PF4E 3NJYA 3OEAA 4HK8A 4OX9B 3GJBA 4IV1C 1YFWA 5EP9A 1N36B 3QH6A 2VWJA 1TMF3 2XWBB 5FP9A 3KCXA 3CE2A 5ABJC 4TWKA 4AI9A 1OQDA 2UXCB 3POFA 1L7LA 2YFZA 3BUCA 1JBCA 2A3YA 4MYEA 3NV3A 1SZXA 1W6PA 1C5HA 4AHZA 2RG4A 2R70A 3AP4A 4D6RA 1LECA 3TN92 4BISA 5A7PA 2FD8A 2ZGOA 4HAMA 2Q67A 2XHNA 1PM9A 1XE7A 2UU9O 2X5IB 2VRZA 4FIPC 4KFMA 3VZOA 2GDFA 2R042 4COVA 5I8SA 4CYDA 2NPIA 1Q8VA 5CKNA 2RR11 2BOBC 4TUYA 4BPZA 1AXKA 4CCMA 4LHKA 5FP3A 5LK5A 4XCAA 1CD3G 1Q8QA 3H3LA 2B42B 1OUSA 5DN2A 1ND3A 3NAPC 1IS5A 1AL0G 1GM8A 2IVIB 4S2HA 5LP6A 2ZOEB 3MEPA 1AL23 2DQ0A 3T30A 2JENA 2WQ4A 2EILC 3RW0A 4QXCA 4ZPIA 1W8TA 4LF6O 4L8JA 1AZDA 4X1YB 4F4LA 4B8EA 1QJY3 4KUMA 3MDPA 3CCQV 3THOA 3JCZA 4XJZA 3X2QC 3RYHA 2DTYA 5FXVA 1V6IA 1DDLA 5EPAA 2Q5TA 1WUVA 2EALA 4ZY9A 3SKVA 3OEEG 3N35A 5GLZA 4CA9A 2RS33 4MTFA 5EYYA 3O1RA 3JBG1 1PVC1 4MS2A 4JI1O 3CCRV 2GTAA 2H6CA 1OCCB 1YJWV 4AR2A 4MSVA 1LOGA 4ASMB 4JI4B 5CU1A 2AEZA 1MSWD 1DZRA 4HETA 4TTGA 2O14A 4GJYA 2ETNA 1JX9A 3ENRA 3RMXA 4IEUA 4XF9A 4ZHQB 4NXNB 2HKXA 4W50A 3HQXA 4CU6A 2ZE8A 2F6BA 2PHDA 2WO2A 2CTPA 1GWKA 3ZKYA 4K1YA 5IWFA 2OZJA 3SGIA 1ZBE2 4NPLA 2CGNA 4EN7B 4WM7C 3VDCA 5EZWA 2WAAA 3VBRC 4HMZA 5A6YA 1BQ0A 3JZVA 5F2VO 2PLV1 3BODA 5FMOS 1Q8IA 1LUVA 2XJVA 2UUAB 4FXGB 2MW2B 4GD4A 1OBNA 2QVSB 1X9TA 4EROA 1COV3 4HN0A 2AUYA 1AP6A 3LPGA 3VKLA 1AI5A 4KBZA 1NCQA 1W9WA 1SC5B 1TMF1 1AR62 2HWB3 4AGVA 2DOSA 4WZCA 1NR1A 4XW3A 1SQ4A 1IX9A 1NXD1 3CBNA 4GWIA 5HBAA 4DYLA 3KGLA 4P9XA 4XFGA 3WNOA 2CUGA 3LGRA 1POV1 4WVMA 4X1IA 3INAA 1JZ4A 3K57A 2ARAA 5LGNA 3FWEA 1N0NA 3I97A 5T55A 1D4M3 2RM22 1HJFA 4RO2A 3FB7C 3AM2A 2KR2A 2JB4A 3M3OA 5HCHA 4OFGA 1VF7A 3SHRA 4CZSA 3L71H 3IMMA 1DHKB 3HMYA 3ZHTA 2OPKA 1AL21 1OC1A 5BNQA 1FD9A 1V55B 1QXJA 1YNAA 5A3TA 1K5SA 4JTNA 1T5EA 4H3WA 1I0HA 5A7QA 4ARXA 1Q8PA 1R1A3 1FFXA 2QQWA 3MHZA 2Y0PA 1V54B 3DF0A 1R73A 1UMHA 4G27B 4E2QA 2P5BA 4KHPO 2CWMA 3GNEA 3B8MA 3KQ4B 3PUHA 1YUDA 3HJRA 1EFRG 1JYCA 3WDVA 2RS31 5DABA 1PNMA 1E5IA 5IYZA 1O5LA 4ZOLB 3WG2A 3ZRSA 3SH4A 4BA6A 4QDSA 2OIEA 1BT8A 2ZHNA 3FN9A 1ND2B 1AJQA 4ES9A 3QTCA 3AL5A 3DYMA 2Y34A 4DXTA 5CADA 3H7YA 4XBQA 1ZLZA 4GMP0 4NN0A 5BMVA 3N9LA 1PKXA 4O9EA 5SV5A 4UFMA 1K5MC 4PDVA 4HYOA 5FFOC 3T1HO 1AYM2 1ZYBA 1VRH3 2DCKA 1W90A 1XI1A 4P02B 2PYLA 3E8FA 3MF9A 5J2UB 3OT7A 4X62B 2QTWB 3IPVA 1H2MA 3D4KA 1VBB2 3BCWA 1FOD2 4NPRA 1K8AW 2UURA 4NIIA 3A2FA 4QDRA 1JYIA 1AX0A 2V4AA 2PN5A 1TVKA 4D94A 4FM1A 1S0DA 1VARA 4PF5A 1OFNA 2VZQA 5ANQA 1GP6A 1GUIA 4IGQA 4RWUA 4C90A 1VQ8V 4W4ZA 5L19A 3THDA 5ANNA 3AKRA 3RYPA 1IXBA 3T4DA 2EF6A 2MEV3 3QOPA 2YG0A 1NYWA 3V64A 1D4M1 4LO5B 1I6XA 4LA3A 1GKFA 3CZUA 3Q8EA 3R4UA 5A32B 2CTQA 1QH7A 1WWYA 1LOFA 3IAYA 5L3DA 3HKCA 1UCXA 3AKTA 3PU8A 5FCCA 4I0AA 2OIGA 3W59A 3WDWA 3WSOA 5T5PA 1XDCA 3OTOB 3BEHA 1S0FA 1H4GA 5L9RA 3AP9A 1PO11 2AHZA 4H37A 1SQQH 2ENRA 4JHTA 3THTA 1WJZA 3H1KH 5BY5A 2WLLB 1VALA 3STLC 5SV8A 2FDJA 4Q0PA 1ULFA 2PQSA 5HCBA 4YM0A 3ALQA 3OUFA 2NQYA 1OZ0A 2Q68A 2YUEA 4ZBMA 1ZBA2 1IGOA 2PQQA 3HNBM 1OOPA 4QQ2A 3SXWA 3H7JA 1PMHX 3NJZA 4DNYA 3BKZA 2IXCA 2RMKB 4YW1A 3I2IA 5LMUB 2Q9LA 3MW3A 1MR5A 1YO8A 3RYIA 1OJHA 1CAWA 3S3WA 1VQ7V 2C2AA 3ZXKA 3SLIA 3W21A 4M0HA 1VBE1 3AG3B 1ASJ2 2EIJC 2D6PA 4TXWA 4ITCA 2XGXA 1EPZA 2EZPA 4DW0A 2QNKA 3ILNA 4QHOA 1GMMA 1W2OA 1ZZ8A 2DVFA 3ZYBA 3H50A 3UJOA 1H9WA 2Q7EA 1IS3A 3RYFB 3MIBA 3E8BA 4OULA 5F8PA 4BLJA 2ZNIA 1G9BA 3ILFA 4KWLA 1QOTA 3ZDVA 3AP6A 3OB8A 4CZZA 2Y6JA 2C9AA 3BB6A 4CCLA 1BQPA 1FXHA 5K7PA 5FPRA 3AG1C 2YC2A 3VZLA 5FMCA 1Y74B 2CY6A 2Y69C 3VBBA 1O3QA 3H1JH 4NR1A 4BXFA 2Q8VA 4ZU5A 3VBSC 3WXPA 5LXTB 5DZFA 3OGJA 2VS0A 4AVBA 1RMU2 3OTFA 1OKQA 1B6QA 3TETA 3UGFA 1QJFA 3DPRB 1PD3A 1RGSA 1CZSA 3F95A 1VBC2 2IXLA 1RUI3 5F3GA 1BK0A 4JGZB 3KF3A 2MEV1 2G1MA 1JJOA 3JSNA 2A6ZA 1CONA 1RUG1 5FREA 3NVCA 4NRMA 2ZCWA 4YNIA 4PBPA 1Z7S3 2DW4A 3FYIB 2GP3A 4RR3A 4DB5A 1KYOF 2GSMB 1YTFD 5DG2A 3WP6A 4YZ5A 2WO7A 3W7XA 4C91A 4FOYA 3TXQA 1QH6A 4DXRA 3TRSB 1O91A 3BFRA 3I55V 2NNUA 4UV8A 1FPN2 2NMNA 2LQTA 4JKMA 4AQ2A 5BR8B 4LO6B 4GKJO 5B1AC 1NLSA 5FZBA 4IYIA 3ABZA 3THCA 2DJVA 3L9JT 4ZU7A 3WQBA 5IDJA 1N32B 3UV9A 1W0JG 3BVOA 3OBTA 2VCAA 1US2A 1HW5A 1CN1A 5I0UA 2HEWF 4YY3B 3WHUA 1X50A 1SLCA 3NXSA 4AE2A 4IV1B 1W3VA 1UPSA 4BE3A 4C0HA 5IJ0A 2AHYA 1HP8A 2ZTNA 4CSWA 2GHYA 5ABJB 4NHMA 3H1YA 1VQ5V 1YQCA 4X88A 3K4ZA 3AXDA 3OYWA 5IVFA 4K3UA 1SLBA 2JGUA 3IJ4A 1XOYA 1JCHA 5FY9A 3WG4A 1JMKC 2YEVA 3NV1A 4LO4B 2DBNA 3SYOA 4I55A 2VZVA 1VRBA 4XJAA 4FPHA 5KC6A 5DQ0A 4QE9A 2VOVA 5IW0A 2FCTA 2R072 4B7EA 3RFRA 3JD1A 4AK3A 2YZ4A 2ZMKA 5FYYA 1V6MA 3NNLA 2YPDA 3MFAA 5EIBD 1C28A 1UZWA 4BQ1A 4XQ4A 1E5HA 1HNZO 5JI9A 4JI8O 5KHKA 1J83A 3GWOA 1B35A 5HV0A 5DDJ2 3NAPB 2M7WA 3FBYA 5GZFA 3DTUB 4F6RB 3OR7C 3B3QE 1NA1C 4I7ZB 1SQXH 1W6OA 4UBGA 3USSA 4E9KA 2EILB 3NQHA 4IQPA 3I2JA 4OI4A 3KHBA 1FS0G 2GH2A 4E8CA 3C7HA 1RUH2 4H33A 3AX4A 5LWBA 1BGYH 4Q2FA 1O4TA 3HPLC 4Y24A 1EN4A 4OI0A 2OXBA 4DV7B 1ZX3A 3X2QB 2YGMA 2GH8A 4O4LA 1V9U3 1EAH1 1FV3A 4AFMA 2VBBA 1Q6HA 4PI2A 4CDXC 4XVHA 3ZN1A 5IK4A 1CVNA 1K3EA 2W87A 3R05A 2GSYA 1FMD3 2HG5C 3UETA 4L2NA 2P22C 4JI3B 4QX3A 4JC1A 4IUGA 1RUI1 5FO7B 2QWQB 1Q56A 4D6TH 4A7ZA 1I5XA 2J1RA 5LBBA 2VZ1A 1ZRRA 1S2EA 2NZ9A 4IW3A 3PUAA 3BIEA 4K8FA 1I9RA 3EHBB 3CSXA 1NAEA 2B1GA 4FFFA 5I8YA 3OR6C 3C3TA 1Z7S1 2HWC3 4AHXA 1NVPB 4QQPA 2JECA 1D4VB 1KGYA 3GHMA 2JDHA 4AYUA 1F5JA 4TLFA 5LBEA 2XVLA 3NRUA 3AG2C 4A3XA 2C4XA 1DGWX 2BERA 2ZGKA 2GU9A 3U1XA 4WM7B 3BA8A 3G80A 2VR4A 4NIGA 3VBRB 4DR6O 1X4TA 4BDVB 3TB0A 4A45A 4QPIC 4LWSB 4F7ZA 4CCNA 1E1QG 3W20A 2XL7A 5LEKA 1ZA7A 1OLQA 1G86A 1HWYA 1F8VA 5L7OC 1DZTA 5FY0A 5LW9A 5LOVB 3T1MA 1NG0A 1IBLO 1Q6UA 4AEKA 1U96A 2ZE5A 2UXDO 4YIPA 2QKCA 5A7WA 1QGLA 1JU3A 3N2GA 3VQXA 2K1EA 3J7AU 4ISRA 1A8MA 4O61A 5B66Z 3P3NA 4E4SA 5LL6Y 3LZZA 1J59A 1M56C 1WW4A 5J1XA 5KXEA 4I50B 2JG8A 4XFHA 5FUNA 3KF5A 3LDRA 2YFUA 3OSDA 4Q4W2 5J2TA 5IVVA 2WZ8A 2LFSA 4YW5A 1KECA 2X29A 5FTTC 4GIQA 1KP2A 1R1BA 5FWJA 1PGL1 4LOTA 1R3JC 3NKTA 2BNOA 1R3IC 5E88A 1AJNA 1C8M2 5FWEA 2ZHLA 4F6EA 4RQFA 1K92A 3TN93 2NMOA 5CFCC 3USUA 2OZ6A 2XQRA 2WZR1 5FLXN 4K8XA 5AVAA 2R061 4HPKA 1YCIA 2WA4A 2R043 3EBRA 3QLQA 5ITZB 4W4LA 5BNOC 3ACHA 2YBSA 2KXLA 2R9AA 2GC3A 2RJZA 5EYPB 2IH1C 2AREA 4L0PA 2EIKB 1AILA 3ZX7A 3ABMC 1ULOA 1JJ2U 5JXGA 3RVZA 3E6DA 4TLGA 2WWSA 2R7EB 1BEV2 3NV2A 4UVAA 4X9QA 2QQJA 4QPJA 4BLIA 3HEIA 5EJ3A 5L3EA 4AFAA 1N4CA 1ODNA 3WP4A 4AFCA 3LFMA 3QO7A 3AYCA 2PHWA 4CXXA 3AK3A 3L2HA 1SBDA 3T0AA 3FD9A 4UFKA 5LRSA 2GBOA 1V6JA 1PO22 2DVAA 1GM9A 2V4VA 5GKAC 1YHQV 3QCWA 2PZSA 2BGPA 2BTOA 1K5MB 2RVAA 1R092 1AR82 1RITA 1HRV2 2C24A 3KT1A 3U07A 1W8FA 3AYAA 5H5NA 1SPPB 5L3BA 4JDNA 2J1UA 3A0NA 2H94A 3EFFK 2Z5WA 3IC9A 4IIJA 4L97A 3WF3A 4IV3C 4MW8A 1HKDA 5LA1A 1QY4A 4JTCB 2WWUA 4HZ3A 1PM7A 4I3GA 1ZSPA 2IXJA 1Z78A 4PD4F 4U3JA 4GYCB 1MG1A 3BVCA 4AGGA 4OUSA 3HD8B 3ZS8C 1ZBE3 2W1WA 5K0UA 1HLCA 3HT1A 1PK6A 4YRDA 4QGMA 2CTRA 3JD72 2Q7HA 4NWVA 2K2SA 3WP5A 3LIGA 4HVOA 1I1EA 1W6MB 5GZCA 2RJ2A 3HKBA 5LMNO 2GMMA 2VL4A 5A6XA 2IVJA 2JDMA 4RQPA 3OOXA 3Q9OA 4GQ7A 1GQPA 1AR63 4AQYB 2J1VA 5JZGC 3ETEA 3POGA 4DRVA 2VNRA 5B1OA 5FY7A 5IYYA 3OD4A 4F3JA 2VQFB 2Y6FA 5FZDA 5G04L 1N36O 2HVKC 2F95B 3DGEA 3TN91 4LKSA 4FAHA 3LQCA 3N9QA 2UXCO 2DVGA 4F83A 2ZKNA 4AQTA 5IK7A 5IY5C 1TME2 2R041 4CDUA 2DMXA 4UCSA 4ZXEA 4K3AA 3NR7A 1ZZ6A 2DCJA 4XJUA 1APNA 2IU0A 2GUZA 1U5ZA 5KHJA 4NRPA 5GLTA 1H6XA 1XNRO 1AI6A 1SA0A 1UZYA 4FFIA 5F37A 1XSQA 4PA3A 5A3WA 4JHZA 4Z82A 4XUPA 4J11A 1YI7A 3I7DA 2JS5A 3W9AA 4F6RA 5C3PA 3I59B 5FZFA 3ZOIA 3VBHC 4BZ4A 2IUWA 3IDAA 4FVMA 4MLOA 4FPLA 2FMYA 5FYZA 2BBVA 1RUF1 2QKAA 4X8PA 4Y33A 2EIJB 3AKPA 1GZ9A 1O8SA 1NTMH 2A06H 4BQYA 4TOIA 4IEZA 3K9SA 3K2OA 1X82A 1PV0A 4QNHB 2Q4SA 4URTA 4UCOA 3KV9A 5JVDA
chains in the Genus database with same CATH topology
1A3KA 1WBLA 4RGAA 2JX9A 1ZZCA 3R6SA 1S0GA 4RR3B 5CFDC 1RUC3 4DINB 2MPFA 1IZ3A 4JQRA 3RPQA 3M4FA 1LEMA 1RUE3 2ETEA 5H9QA 4AG4A 2YC0A 1KRIA 4HN1A 1IS6A 1Z7S2 4COZA 1GZWB 1OIJC 2XJPA 1JH5A 1LULA 1UMZA 4M01A 1XE8A 2B7YA 1N1YA 4I30A 1PZ7A 4KG8A 2WBOA 4COUA 4BGKA 1UZZA 3PMSA 4C0BA 1RIRA 5JR7B 4AVTA 4K9SA 3JB8A 2Q4AA 3MLJA 3RZZA 5J7MA 1ZA4A 4Y5Z0 1SCSA 3CJIA 4OHXA 1PGW2 1OMIA 1QMJA 2ZAHA 4M3CB 1WMFA 1QJZA 2E53A 4ASLA 3UL2A 2WC2A 2O1QA 3PNAA 2X8KA 3ZMOA 1AR92 4Q26A 2TEPA 1AR72 1ND2A 5F6LB 3ILRA 4PDWA 4YVSC 3VBSB 3G6JB 1J3RA 4RHV2 1U5IA 3WQ1A 2WNEA 4QM8A 5KEUA 2IC1A 2BWCA 3OF1A 4CRQA 1VJ2A 5ACA2 4AXOA 3BALA 1AYM3 1ZBE1 4WVWA 5K9YA 3D5OA 5JPNB 1B09A 1Q8OA 3N36A 3POSA 5CB7A 4G4FA 5KC5A 2ZX1A 3WDTA 3ZN4A 1QNWA 3RWNA 4FQ4A 1NY72 4CWDA 1J1LA 1KFXL 3VBHA 4KG0A 2XVKA 1GV9A 4DMIA 1PO13 3AZXA 3OYWB 2W0XA 1Q3EA 4FT8A 2BQPA 1MQTB 1VBB3 2WINB 2Z42A 4NHKA 1OQEA 1LOCA 5DUXA 1G9AA 1IKPA 1RUNA 1FOD3 3CF6E 2HWB2 3RYRA 2AGSA 2R1DA 1S0IA 1MEC1 4IETA 3AKSA 2PHLA 1RUD2 5BYNA 2ILMA 3AMQA 5GZEA 4M2IA 1VBA2 3CO2A 1PNGA 4Y1ZA 1VZ4A 1QJX2 1FT9A 2A71A 2HWE1 2ZJCA 4Y20A 2D97A 3M8LA 3FUOA 5KXDA 4OLLA 5K8SA 4IEVA 2SBAA 3IDBB 1PGSA 2DU0A 3WHTA 2IFWA 4ZU4A 5A33A 3FMGA 4AGRA 5CFDA 3FHIB 1S55A 4RS5C 4G3YC 5I8TA 2BWAA 1DRTA 4PLOA 3TNQA 4Q0QA 2VECA 1N1SA 2PTMA 4AEMA 3MYXA 1DQ1A 2NYYA 4B4PA 1OIJA 1SCRA 4LE4A 1RHI3 1UKRA 3IN9A 2XKOA 3SH5A 1B35B 4GKXA 4Q4V3 3TBDA 4HSLA 1HQNA 2D5FA 1BVVA 1GQGA 2BPA2 1EY2A 1DQ5A 1V6LA 3VLBB 2P34A 1UN1A 1W6OB 5A3MA 1O7FA 4GKYA 5C4WC 3O2GA 3KLSA 3ZN6A 1CR7A 2D93A 4IEPA 1BMV2 5JAXA 5HCFA 1VBE3 3VBFB 2WLPA 3V65A 1JOJA 5C8CA 1AR91 2RM21 2GN7A 4Q29A 1J58A 1FNZA 4FP2A 2RS52 1OIIA 1YYNA 4YVSA 1N47A 4DXZA 1RJ7A 4LBKA 1D2QA 1FNYA 4QPGB 3WW3A 4Q4X1 4FBFA 4EN6B 5BNPC 5J92A 4MGIE 4OHZA 4IEXA 1O3TA 2WT2A 2ZZQA 4KU7A 5A32A 3MF6A 3AYDA 1RVF2 1SLIA 3U11A 2JG9B 4M23A 2XJUA 2UYBA 4GB33 5JDBA 3KZ4C 4L8QA 4Q27A 2FMDA 4IEOA 5F1RA 4D7TA 3RS6A 1QJU2 1REDA 1ZM1A 2RJLA 1R1A2 4GWNA 1VB2A 1T6GC 2TBVA 2ZX3A 3VKOA 4FCAA 5KHGA 5A3LA 1IPKA 4YW4A 3GHNA 3SH3A 4MUVA 1BCXA 1FMD2 1RUD1 3MFCA 2JE7A 1DLLA 3DGTA 1PZ8A 3D6EA 5GLWA 1QJX1 4Y22B 3T1LA 4YZ2A 4Y1YA 1R1ZA 3BOPA 3WCSA 4HVQA 3PTYA 1MS1A 2NN8A 3E5UA 1LR5A 2WNVA 3PHMA 1C8NA 2CYFA 3J8F1 3ZO0B 2B9UA 1OPMA 3H9AA 3AMMA 3VBUC 4IERA 3AKQA 4RS5A 1DQ0A 1OLRA 1RUC1 4N43B 3CEWA 3MI8A 4XMIA 4FTEA 4JDMA 2ZPXA 3ZFFB 5T5JA 1LGNA 1QXPA