4NR1A

Factor inhibiting hif-1 alpha in complex with consensus ankyrin repeat domain-(d)allyl-gly peptide
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
335
structure length
335
Chain Sequence
EPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an oxygenase in complex with substrate
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
total genus 106
structure length 335
sequence length 335
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2013-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4nr1A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4nr1A01
3KCYA 2WA4A 2YC0A 4B7EA 2CGNA 4Z2WA 4JAAA 3P3PA 4BIOA 1MZFA 2WA3A 3KCXA 3P3NA 3D8CA 4Z1VA 4B7KA 4QU2A 1IZ3A 1MZEA 3OD4A 1H2MA 1H2NA 5JWPA 1H2LA 2XUMA 4NR1A 2W0XA 1H2KA 2CGOA 1YCIA 4AI8A 2YDEA 2ILMA 2Y0IA
chains in the Genus database with same CATH superfamily
3KLSA 2VGDA 1GNYA 5BR8B 5JCOC 1ZZ6A 2VZTA 3HJRA 1PX4A 4UVAA 4LBOA 5GW7A 1LHUA 3LOIA 3QVNA 2Y6LA 1W8ZA 1RVF3 1M56C 1OBNA 1Q81W 4DEQA 1UZZA 2R063 5A80A 4HVQA 3MYXA 4XDQA 5FLIA 3L71H 4DR5O 3KF3A 1HB3A 3GJAA 3VZLA 5HXVA 3LEKA 4G9SB 2BRTA 3WX5A 4J9YB 3VKLA 3H9VA 1S0VA 1F35A 4SBVA 4BXFA 1SERA 4CH5A 3DF0A 2WZ8A 4LF9B 2XTAA 4XJ9A 1PNKA 3OGJA 1D4M2 4PI0A 4R7CA 4GKKO 3TXQA 3BYWA 4DXWA 5B1AC 4CDXB 3UO3A 2OXBA 1Y74B 1YIJV 2DURA 2DVDA 5CFCA 4PF5A 2V72A 4UBGA 5FPBA 5FLXN 3FBMA 1KS5A 3ZHRA 1LUWA 4ZOLB 3MHZA 4D3WA 2IJKA 2YI8A 1IQDC 1TUBB 1PO11 3W58A 3CO2A 4FFKA 1AX0A 1QDOA 3DSQA 2WQ4A 4MGQA 4CVUA 2Y6JA 2F17A 3SPHA 4I50A 5H5NA 1FXZA 3WF4A 3L75H 2WLLB 3WG3A 2PHTA 5A1AA 3OEEG 4DO2A 1POV1 4CCNA 3EBRA 3THPA 3V0AB 3TWIA 3JYCA 3AMQA 3H1IH 4XF4A 4IL6Z 1LJ7A 4RR3A 1K45A 3UK9A 5A7PA 5JOWA 1C28A 1WD4A 1X33A 3RZKA 5BMVA 3NJVA 4K3UA 3LEGA 5F3EA 3ETQA 1LU1A 2HBTA 4L92A 2HEWF 4E4DX 2YGMA 5KR7A 4FMTA 3PURA 2ATFA 2Y0IA 1M57B 3WNKA 2Q1ZB 2WAAA 4M4PA 1RUI3 1B35A 3EVKA 3JD73 1HQWA 2XAHA 4FLUA 5FUPA 4FOWA 1OOPC 3ZN6B 1CEZA 4IV1C 1QLNA 3FLPA 2R16A 2WNUC 3IKWA 4UFIA 4A6OA 3M3QA 1XNDA 4LWSB 1ULGA 2V4AA 5CBGA 2GTSA 5DZGA 4X9QA 4JDOA 4IHJB 2B46X 1AILA 4QPIC 4D7YA 5TISZ 2JE8A 2BJSA 1VEWA 1OCCB 1Q6IA 5I0TA 2VQUA 5FY1A 1OD3A 1O3SA 1OH4A 2B42B 2ZTNA 2WPDG 4HAMA 1GYKA 4NRPA 4D6QA 3H1LH 4QXCA 4IE4A 4YW1A 4RQPC 2H6BA 1HNWB 4FM1A 1S5JA 2WFF2 1FS0G 4M00A 5FPUA 1PMIA 2QWNB 1PVXA 2D6OX 2B1GA 4LF4O 3WUCA 3DPRB 1NLRA 3DYOA 1ULOA 2UWBA 4BK4A 5FFOC 2EXIA 2E6VA 2PHXA 3ZEDA 4W8JA 5C8CA 1LTEA 4E2SA 3BVCA 1VPHA 1GOHA 1YQ5A 1ZL8B 1LCLA 2P90A 1PMHX 4BU2A 5BYNA 3MI8A 1X36A 4AGGA 4WFEA 1PVC3 5I8SA 2VQAA 4FPEA 4JV5O 1S0DA 2JEMA 3D6EA 1F5JA 1YCIA 4YHHB 2PYLA 3BAAA 3EXUA 3UJQA 1EPWA 5KXDA 4YGBA 5F7UA 2GBOA 2UUAB 5LYJA 1WWYA 4BQ5A 5J09A 3VKOA 1NQJA 4MGZE 2NYYA 1W8OA 1POQA 1KJLA 5C8YB 1JOPA 1OPOA 5HV0A 1IDSA 1M93A 1JOJA 2XH6A 3HWJA 3AYCA 1NYWA 5FZIA 3WF1A 4SLIA 4CH6A 1HN0A 3M99B 4GKKB 3NV2A 1DCSA 2WQZC 3JD4A 3UQ8A 5GZGA 1AI4A 1WZXA 5L3EA 4FPCA 5BV6A 1KQRA 1SFPA 4FLWA 4W65A 3AKPA 3J4UH 1C3HA 4OUMA 1NT2B 2W91A 3SGIA 1EN6A 2WLIB 1YSCA 1F15A 4B3SB 3FHAA 3WP3A 4RAIA 1N33B 4UFLA 3D3AA 1SLLA 4PLMA 3IDAA 1DG6A 1VB4A 5DAQA 2EBOA 3TYJA 4N53C 1BQZA 4AEDB 1QU7A 4GCZA 3OCPA 3LPGA 3O5SA 3ZDSA 5FY5A 4V2VA 1SHWB 3WLUA 1BEV3 5BNOA 2UXCB 4QU1A 4DS0A 3W21A 1YRZA 4FTEA 2W87A 3ORJA 1TAEA 1HXS2 3LDRA 3LNMB 5AFEA 4LF7B 3N4MA 4CH3A 1ST8A 1SLBA 4U36A 1R093 3OUFA 2PQQA 1QMJA 2XPJA 4CDQC 1XYPA 3CLPA 1JHJA 1E1QG 2EIJC 2AHZA 3BODA 5A9GA 2WWWA 4PA4A 2RMU1 1ZRRA 4EFEA 3A0BZ 4WM7A 1LR1A 1UL9A 1EUUA 1SFNA 1BHGA 4WFAV 1LOFA 4YGDA 3JU9A 3VZKA 5IHRA 4D7TA 3K5NA 3WQ7A 2X6AA 1AJKA 2WSSG 4QQPA 4DXSA 2BWCA 1RUD3 3K3WA 5JVDB 3A7QA 4MV2A 1W2AX 2HWE2 4GB33 2XKOA 3OTOB 2UU9B 4OUSA 4BWOA 4YVSA 1R1A3 4LO4B 2PAMA 2WIIB 1HRI2 3BPSA 1UIJA 1SPPB 4JGZA 1QJFA 5FTTC 2G4IA 1X82A 4XDKA 1UYPA 3JCZA 3TXSA 1D4M3 2OQ7A 1RYYA 1PGW2 4FK5C 2B4KA 4LT5A 3ELNA 4I55A 3JSNA 1U5IA 4AFCA 2FBEA 1QR8A 3FBYA 1QJY3 4NAMA 3UYJA 1WPBA 5IT6A 2YXYA 5KXEA 4NRQA 2VCAA 5LATA 3H50A 4ZKIA 4B4PA 1JBCA 2WO3A 5A7WA 4A45A 3POBA 1X9PA 4E9KA 5F5QA 1W06A 5FMOS 3VL8A 1U5XA 3OGGA 1YXBA 3WR0A 3WINE 4L0PA 4W6XA 3GHNA 2RDQA 2PAEA 4TQFA 5FYVA 4GQ7A 2UY9A 3HPNA 1QH7A 3JB8A 4EZHA 5DUUA 4AFDA 3U10A 1CAUA 3T2PA 4F6RA 2ADQB 4PJYA 1JI6A 1D2SA 2YYOA 1YJWV 4BA6A 1BHBA 3BCWA 3LDDA 4O4JB 1JQ0A 3LCPA 1H0BA 2ZIOA 1MEC2 3FX3A 4DR6B 1GZWA 4JI2B 1ENXA 2WT2A 4HONA 4RYDA 4JI4O 1Q8SA 4JRAA 5LGNA 4O4JA 1TUBA 2QM4A 3RQ0A 3CMAV 1WCQA 2GZWA 1MOFA 1TA8A 5FP9A 4Y5TA 3AFGA 3AM2A 1R092 2DUOA 2PI4A 4EN8B 4XQDA 5IJRA 2YC0A 3POFA 5FP3A 1CONA 4LHKA 3S5QA 2UXBB 1XNKA 4XABA 1AVBA 1W9SA 3ZIWA 2VNGA 1SMVA 4JI7B 4YPJA 4NR1A 2R49A 2IXIA 3NNFA 4MGYE 1GOFA 4PIYA 1RUI1 1JOBA 4UFZA 4OUEA 4IGOA 2WT1A 2JE7A 3OTFA 3J80N 3AP7A 2LW7A 4LLFA 2XJPA 3GF6A 3AP4A 1V6JA 4OX9B 3S3WA 3SLIA 3PVEA 2JGDA 3T09A 1AR62 2JDKA 3ABTA 2BV4A 1UXZA 1DZRA 5IYZA 2OUHA 2VPVA 4RD7A 2KB1A 2HWC1 1SQXH 3T2MA 1O7FA 2GU9A 1UJWB 2EULA 3C3SA 3N2KA 2WNUA 4NPRA 2WLNA 2CNAA 2FMYA 4Y22A 1UOFA 2A73B 1YC61 2YBKA 1F4MA 2PHUA 1O9GA 2A6ZA 2A79B 3VN4A 3VQVA 4A7KA 1YZBA 4FLXA 2C9AA 5CA0B 2DVBA 3BTAA 2Q68A 3INAA 2GNBA 4DQAA 3AK3A 1G8WA 1W6QA 4NTWA 1ZBA3 2RR12 4DR7B 4FXKB 3TEYA 5KHKA 1NX9A 1MS4A 4NN0A 1IVSA 3M7AA 1ALYA 2X5IC 5LBEA 3N7KA 5F3CA 4KG0A 3WNXA 3CCQV 1NCRA 2WLMA 2BVVA 1KQSU 3C3VA 4D6RA 3SNMA 4JGYC 1XB9A 5EZYA 4IE0A 4N43C 4MVSA 3E89A 2AEYA 3KM5A 3L2HA 2BP6A 1US3A 4A42A 2HKXA 2G38A 2CAZC 3WG7B 1W3XA 3MLJA 4IL7A 1SKVA 3BIEA 1RITA 3THTA 3F95A 3VZJA 4PDWC 2VVDA 5H2FZ 1D0GA 2W0FC 4UF0A 4LUKA 2RS12 3WT3A 2Q8OA 3L74H 4UV8A 2JB8A 3ABLC 1POV0 4YVWB 3RWKX 2RJLA 5KHGA 4R8CA 1IPKA 4O2AA 2EIGA 1YQ6A 2ZGMA 4OHXA 2QGNA 2YV8A 2PHFA 5LMNO 3KT4A 5HCAA 1J5EO 5IWAO 4IEPA 3NV1A 2LFSA 1V55C 1DFQA 3QCWA 2WA3A 1YQ2A 1J83A 5C93A 4EFBA 4GIQA 1AR63 2F6BA 2CHHA 2Q30A 1SQVH 3A0RA 5JQGA 2EIKB 1QJEA 5FZ1A 3WDYA 2RCVA 3DXRA 3LE0A 2DTYA 1C5HA 4LBKA 4NYKA 1AR72 1CESA 4Q1PA 5T5OA 2J1EA 1JZ7A 2R9RB 3ZFFA 5F5IA 3IIAA 3N9NA 2XJRA 5FZ3A 4JF3A 2H8PC 3H01A 4I0WB 3FFZA 2H6CA 3MZHA 1ND2C 4GWJA 1VRBA 1TNRA 2PY5A 4OCTA 1W8HA 4Q4X2 5IYZB 2RE9A 1IPJA 2HVJC 5FPOA 4V1PA 1JUIA 1RPRA 5C8WA 2VMHA 4C1WA 3PJYA 2BSKB 1RMU3 2MHFA 4X1KA 4FFBA 2OX0A 5LZ6A 2VQTA 2R0HA 3SR2C 1ZRCA 3CB2A 1GP6A 4RSUA 2Q1MA 2Y26A 4LKFA 3M1HA 3RSJA 1CGPA 2PGGA 3VKNA 3H8OA 2TBVA 2WSVA 1R3LC 5C4WB 4W4KA 1GR3A 3GCXA 4AEMA 1R1ZA 5EBLC 3CCVV 2PUSA 4TV8B 4JI5B 2GMEA 2OCCC 3L2YA 1W2BU 3CCJV 4CCOA 4G4FA 3GALA 4AG4A 4LF8O 2BYVE 2GP3A 1V54B 1R3KC 1MZ6A 5JH7B 1UKRA 1ZA7A 2XR4A 1TVGA 2IXJA 2GSMB 4MVTA 4DV1B 5FYYA 3WHTA 3DXTA 1I94O 3MF9A 2QDNA 3RYHB 2ZINA 3OW2U 2E5LB 1KMIZ 2JGUA 1DLCA 3ZYIB 3CNAA 1IG0A 1XE7A 4R8HA 2WS92 4LF8B 1F4AA 2RJ2A 5FV3A 4MLOA 4Q6GA 2ZGQA 4IE5A 4LNVA 3KV6A 4I9WA 1DQ1A 2ARAA 1GV9A 1QJY1 4CCCA 2YICA 3H7YA 1VBD3 1UIKA 2Q4SA 1Q7YW 2EZOA 4AHWA 4LHNA 4ZXKA 4ZHQB 5JQGB 2QQVA 4S2FA 1AR61 1DF5A 3ZXDA 4X65B 3JAKA 2TNFA 1PNFA 3HD8B 2HLDG 4YM2A 4AI2A 4C91A 2QWRB 4LR4A 2GNTA 2YSUB 5KBFA 4TV9A 3IBMA 5DDJ1 5AFBA 1NY71 4DUWA 2LM3A 5CFDA 1K5MC 3E22A 2BOIA 3RZHA 3N3HA 3F5WC 1QDCA 2DVGA 1SA0A 1K73W 1GAXA 2GC1A 2HJFC 5E8AA 5JUVA 4AHYA 4EZ4A 3DGEA 3I49A 3B9IA 2H94A 5DECA 3OD4A 2CK3G 2JD4A 4X1IB 5IJ9B 3WF0A 1H38A 3BIWE 3J7AU 4E2LA 2VBDA 2WNVA 4QDQA 1TZOA 5KXCA 3C90A 4X64B 2CWMA 4N90A 5FYBA 4ZU4A 5JJNB 1DF0A 1I0HA 3R4UA 5JZGC 1XNRO 1VQ7V 2OZJA 1ZBA1 4YM3A 2L35A 1SG3A 4YGCA 4CEWC 5AC92 3N7JA 4A44A 2XMLA 4F7ZA 4GULA 5T55A 4IV3C 4X8PA 4UCVA 4FPPA 4LO5B 4RQFA 3AKTA 2GSYA 2HYKA 5L36A 4AHXA 3ABZA 1NA1A 1VQLV 1JZ2A 1IGOA 3GWOA 2A3WA 5CBLA 4N43B 1CVNA 3CPWU 1OFNA 1TEIA 2VUCA 3H8XA 2HBUA 4J7JA 3UO2A 4ZI7A 4MT8A 2XLAA 1QQCA 4FOVA 1BEV2 3M70A 4DV1O 2Z69A 3RYIA 1VQPV 2ZKOA 3VBUC 2IZWA 1VP7A 1AI7A 3JCUZ 4LBEC 5DAVA 1JN2P 4Z07A 3SYPA 3CS5A 4YM0A 3SPIA 4FOQA 3KKYA 4H33A 2KG7A 4DOUA 5KAIZ 4AF9A 1LGBA 4DV0B 2WO7A 1FOD2 2Y0OA 3N9OA 2DE0X 3HBKA 4XZUG 3WCRA 2W39A 4I0BA 2VXRA 2ZAHA 2RMU3 2WLPA 2X10A 1ULEA 4MX3A 1FXKB 1EZVH 5C3RA 1RINA 4HANA 2Q8CA 3POYA 3BVOA 3TEXA 2VZRA 4XF9A 4I7ZB 3UGHA 2W95A 3CD6V 1NE6A 2Y4UA 3GBGA 1QNWA 2Y6HA 5CNAA 1NCQA 3BB6A 4BDVB 1KU9A 3TEZA 3LA3A 4JI6B 2QNKA 2VD7A 4DFSA 4CP2A 5BNPB 2ZGLA 4X1KB 4QX1A 2D97A 4FVMA 2EICA 3WG1A 2FB5A 3WG2A 4LTAA 3OUIA 2OA2A 5FL7G 2ARCA 4KU8A 1V70A 3PN1A 2JJ1G 1QNYA 3RYFA 1H6XA 1QR9A 1SRYA 4YJ3B 4AEDA 1RC6A 4LMFA 4L11A 5IVBA 1ASJ2 4LR3A 2XJSA 1YJLA 4YWAA 1ZWIC 2YDEA 4JI0B 1Q82W 3C7EA 2ZEWA 3I8TA 2R072 2YG0A 4BE3A 4ZS3A 1KRIA 3K0GA 5KHHA 2XBO1 1HQNA 1XOYA 1WJZA 2P3KA 2XASA 1VQ4V 2OYQA 4QPGB 3T2QA 2LW1A 1Y4MA 3U4SA 4ITCA 1SZTA 5FKCA 1GBGA 3OYWA 3C2UA 1SFYA 4IT5A 3RJ2X 2R32A 5JVVA 2JS5A 4QXKA 5H9PA 5FQ0B 4NO4A 1LEDA 4YZ4A 2OCCB 4XFCA 5E1RA 4UB8Z 4E2QA 3LZZA 1CX1A 4GYCB 5GM0A 1IBKB 5CZKA 1XU1A 4DRXB 1RUH3 2QM8A 1GM9A 4BWAA 4L9BA 3POEA 5A3OA 5LL6Y 4ARYA 4KI5M 3RVYA 3JD1A 1ZRIA 1ZTEA 3B5LB 1R081 2D3RA 1JPXA 4K40A 1HXS1 1QWRA 5B5EZ 2HWF2 3PUQA 3PVNA 1RXGA 2DCJA 1YHFA 1Y3TA 4LF6O 3T08A 3JD72 1RMU1 1KS4A 1TMF2 1VQMV 1X4TA 4PDWB 2OT5A 4WVVA 2WZR2 1SLIA 4HG6B 4XUOA 1YFUA 1F7YA 4FPLA 2GAUA 1EP0A 1K5MB 2W46A 3WNNA 4QQLA 1US2A 1PNMA 3UKMA 3DGTA 5CA1B 4JQRA 3EFFK 5KA6A 5SV5A 2VOTA 3BU7A 4KQ7A 4KMQA 4M3CF 2PA7A 3OE7G 3RG0A 1MR5A 1XOUA 2X8KA 1I5ZA 4PI2A 2VS0A 3CRAA 1NG0A 5C9AC 1WMXA 2WKKA 2DU0A 2LW8A 4GAZA 1VMHA 2X09A 1LGCA 4Q0SA 3NNLA 2JKBA 3PTYA 5I0DA 4XIKA 2VZVA 2NNUA 4NMIA 1UNBA 1NKDA 1Y4WA 4BW5A 4FFGA 3I2FA 4YFZA 2ZZJA 5FZFA 4YW2A 2YZ4A 3OTOO 2UU9O 2CU5A 4KGQA 1BJQA 3PVOA 1G9DA 3PU3A 4LWSA 3VQWA 2V1DA 5JVDA 4N53B 2LO1A 1VBC3 5HFMA 5B4NA 2ZCEA 1MQTB 2XBO2 4YG0A 4Z1VA 4JDNA 2IVJA 4RS5A 4MW8A 1E79G 3RVZA 3MLLA 4KWKA 4WM8B 3ASOB 1CZSA 4OLLA 2UUAO 3K2OA 3O65A 5BPXA 2B9UA 1CIYA 3ZO0B 1VBC2 4CXYA 1C8M1 2VBBA 1RUE2 2CE4A 2GP5A 2F93B 5EWSA 5CB7A 2ENRA 3OFNG 2R041 4CTEA 2CDOA 4UB6Z 1TE1B 1SQ4A 3PUSA 1XQNA 2BGCA 4KWUA 4KGGA 4IW3A 3NNGA 4WVZA 4DY5A 3I2DA 2SBAA 2QTOA 2R061 3IPVB 4B3RB 4BQ2A 4KBZA 2QDRA 2XAGA 2BEOA 4ES9A 2ZPXA 1NR7A 2IUWA 4HPKB 1XMOB 3OGCC 1WMFA 3K3NA 3HEIA 4B3TB 1XMQO 3B4SA 2GUZB 2D7FA 5J7MA 3GVMA 3U75A 4X1YA 4FOYA 3RW0A 3A4UA 2ZIMA 2HG5C 4CH4A 3MV01 5CFDC 2D40A 5FPXA 1Y74A 2QR4A 3FD9A 3MW4A 1BZWA 1JOYA 4EQVA 1O3TA 2QQOA 4P9PA 3MHHC 1WBFA 4P14A 4DV7B 3H3ZA 4GB32 1TMF3 4QPKA 5ANNA 5K1PA 2CDPA 2QQLA 1REFA 1U97A 2VVEA 1DDLA 2A3QA 1NI8A 2G1MA 5FK7A 3C8XA 5ITZB 4DUYB 1VBA3 1MABG 1I3HA 2AXTZ 2DUPA 1W99A 3OPTA 4BK5A 1LOCA 3I2KA 2CDYA 2UUCO 3WW3A 1SBEA 2HWD2 4JI0O 3LKJA 4Q4V3 4NRMA 1YDXA 5I8TA 3BRCA 1XEQA 2WNUB 2UXDO 4DMIA 1M1KW 1HW5A 1UMIA 2RJZA 1FPOA 5FWJA 3DV8A 1YXWA 1I94B 3THDA 1HNZB 2QE7G 2J7MA 2JEXA 5IWFA 1I6XA 1YYNA 3X2QB 2DCZA 1OHFA 1XHXA 2RS52 1FXKC 5EJZB 4XJAA 3UJOA 5FZLA 4AWDA 5FUNA 2WZR3 2FHRA 5JJJB 1KUQA 2F4VB 2D43A 3QO7A 4KUMA 1S5LZ 3WDUA 2ZD9A 1N1TA 4DW1A 4P9OA 4K9SA 4S2GA 4CYDA 2DV9A 5ACA2 1HQLA 3ACLA 3N2GA 3N7LA 1UN1A 3VZNA 1BGYH 1W90A 4DO0A 5DG2A 1RMU2 1COV2 4K0KO 3H8UA 4Z2WA 3ZMSA 1H8TB 3MFCA 1QGLA 2E74B 4CDUA 4PLNA 2ZXQA 5LBBA 4AAXA 4PBPA 1Y76B 1OMIA 1ND3B 4BXSV 4JAVA 4WCEV 4RA0A 1L1FA 2I74A 3AP5A 1N0JA 4PDVA 2Y6GA 5FYHA 3LSDA 1J3PA 1UY2A 4BQWA 5LP6A 1OUXA 4LA2A 3L70H 3ILRA 4Y3OA 4A6SA 1WW7A 5DZEA 4CA9A 4X65O 1NAEA 4MO3M 4H14A 2CTPA 4LE3A 1UXXX 3GGLA 2RS51 2AZ0A 1HP8A 3BHPA 4COWA 3D36A 5C3PA 3MUZ1 4AVCA 1RVF1 4TV9B 3VBSC 3GNEA 5I0UA 1LESA 1AL22 4DV2O 3JAMN 4L8JA 4MTGA 2Y6FA 1VRH2 2P7TC 4ISQA 5JR7B 2FDJA 1YVWA 2IJIA 3GBWA 3MICA 3D4KA 5A7SA 5BUVA 2FZ1A 4MOAA 3WP4A 5F2WA 3MV11 3QOPA 1FOD3 2ZKNA 1OV9A 2IFWA 5DMYA 2XAQA 4FLZA 2WWJA 4JTNA 1G9AA 4ONUA 5BMVB 4FI9A 2VXJA 1QJU3 5FY7A 3Q4HA 1RUI2 4RGAA 2X05A 4HN0A 1W59A 2VW0A 3O1OA 5IK8A 5IE9A 2HP8A 3E2EA 2DCKA 3ZHVA 1O5UA 5GALA 5D5QA 2UYBA 3T4VA 2YU1A 2YXSA 4CCMA 1H2LA 3T1YO 1ENRA 5BXZA 2WLQA 3SKJE 2W9XA 1J59A 3B40A 5A7NA 4XMIA 2BE3A 4HOOA 2GH2A 1XNBA 3G7DA 5CN0A 4ZZ8A 3AYAA 3E1F1 4JV4A 3RS6A 1UOBA 1EPZA 1W6OB 2ATKC 4U3JB 4BM8A 4Y5SA 3EHBB 2Z0AA 4DV5O 2AH2A 4OULA 1JZ4A 3CEWA 2BGPA 1X9TA 4AGRA 1MSDA 4AZZA 1DQ2A 3SH4A 4B08A 3CCEV 4RS5B 5I91A 1C8NA 4TYSA 1COWG 4OQ8A 3NXSA 4CCEA 3CEIA 5L3CA 1JCHA 1JUHA 4CDUC 1LB2A 3AP9A 4RHV2 1WAZA 2YGLA 2E33A 1XHZA 3NAPB 2HWC2 5LHIA 3MHSC 4QGPA 2ZX4A 4X62B 1IS5A 4KNCA 5EZWA 1MVEA 3K59A 2A06H 1B3QA 4RGKA 2AEZA 4RFRB 4IGPA 2OCHA 4DR2O 1WLTA 1KDKA 5FZDA 4N7UA 4KH9A 1GM8A 4R9CA 3GCWA 2ET7A 3AKRA 4RHV1 3ASNB 2BVBA 4IERA 1IXBA 3G6EV 3BU0A 1CXZB 4CXXA 2VM9A 4HSLA 1VBE3 3M3EA 1ZBE1 1VAVA 3JB4C 4LIVA 2DN9A 3WFVA 3E6DA 5A33B 2ERFA 2LQTA 3KQ4B 4CUAA 1AUYA 1AYN3 1F51A 1ENVA 3QO5A 1RUNA 2P4VA 3KCCA 2CTRA 2R70A 2QEXV 1HIXA 1BS3A 3I3QA 5BR8O 2A70A 4Q2FA 2GHYA 1HRI3 1J58A 4B1LA 3ZFGA 4HVRA 1AR82 3AX4A 5C71A 2R6QA 3EO6A 3AK2A 1FPN1 5FMBA 3ZSEA 2ES3A 1MS9A 4UF0B 2QQIA 1M57C 4L97A 1SA0B 2E53A 5FZ0A 3WW4A 4UW6A 1ZM1A 2J1AA 1FAYA 5L73A 4J80A 1JU3A 2BPA2 4AYUA 4TWTA 4WZCA 3RYKA 5F2VO 1UZWA 1JVMA 5D8AB 4XJZA 5J3UA 2RQ6A 1QVFU 1VQ5V 4W50A 4EN7B 1XSRA 4XTMA 3WF3A 2UXXA 4P9WA 1AR83 3A2FA 4RGGA 3ZYHA 2NN4A 3UT5A 4QHBA 5C5UA 5CBFA 3OGRA 3I3BA 4XF0A 3ZOIA 4KG8A 5DDJ2 2ZQMA 2PYJA 2XONA 1ND3C 3K46A 1UX7A 1LOAA 1OT5A 1QJY2 4HYOA 2VCBA 2E75B 4MH0E 2JG9C 4IESA 3FX7A 2Y34A 4K6BA 3UESA 2XB6C 3B09A 4JTOA 1QJU1 1J1LA 2JJ2G 2HWF3 2A3YA 1DZQA 5C7GA 1WGPA 4CS4A 4QKBA 4BIFA 4HKWA 4JGYA 1CN1A 4DV3O 3CL1A 2QQPA 2I45A 3T0BA 5FWEA 2J1RA 2QWPB 2Y60A 2WS91 2D6KA 5FAXA 3VD4A 1UD1A 3G4SV 1WCDJ 2HWE1 4NXMB 3AKSA 2EXHA 2QBXA 3S5AA 5C3OA 4R6ZA 3O12A 2J1SA 3N9LA 4MTOA 4XUPA 1V6LA 4Q0UA 4XAAA 2R1BA 3KB5A 2XVGA 3FLRA 1BCXA 3JATB 2F23A 4XFGA 1NCQB 1VB2A 5EQUA 1G9FA 1HJFA 1XNTA 2BUKA 1MS8A 3I3MA 4JGZC 5LEJA 4RHV3 2ORZA 3ABKB 2XXZA 3W7UA 3TEWA 2ARXA 1BT8A 3KHCA 4BJ0A 2NPIA 2VU9A 2LS6A 3VDAA 4LE4A 1BMV1 4XE9A 4GH4B 3SC7X 4N9IA 5FY8A 4AVAA 4CSWA 1RUF1 1COV1 1G86A 4Q0VA 2E51A 3POGA 4A7YA 5LY2A 1VR3A 2C9KA 4Q0QA 2PLV3 1UU4A 2ZE8A 1UCXA 4COUA 2PFWA 2QFEA 4YZ1A 2ZXWC 3HNBM 3POSA 5A6QA 5FOJB 5L9BA 4Y22B 3G80A 3HNYM 3RZZA 5LHGA 3FE5A 4MGTA 3FAVB 4LQRA 1U96A 4ASLA 4TSVA 1QXRA 5CVRA 1AL23 1VE0A 3JATA 3R05A 2PI5A 1W9WA 2VUJA 1PZ7A 3TETA 1AJPA 4XDPA 1WB7A 5FO7B 4DV4B 4DRXA 3TB0A 3OPWA 3I55V 1N47A 4R9AA 3HBZA 1NVPB 5F3IA 2EJ7A 1M9NA 2DMXA 1MG1A 3OT7A 2RM23 4I0AA 4LFCO 1W0KG 4EWDA 1CP9A 2LP7A 1IS3A 4AVBA 4LF5B 3SH3A 3A21A 3H1HH 4NHKA 4YJ2B 5GTIZ 5B2GB 2W92A 1SQPH 2GC0A 4CEWA 1P49A 2E26A 5A70A 5JI9A 5ERLA 4EB6A 2JVDA 2YB7A 3MF6A 2O8OA 1EBOA 3OMIB 1UPIA 4CDWB 5H9CA 2EIJB 2BOBC 4JDMA 1IHMA 4AR2A 5HCBA 2E9QA 5C8YA 1E1RG 5CB4B 3CSXA 4R9BA 1RUE1 3K51A 4E4EA 3VDDC 2JIZG 5DN6G 3AJZA 3QNEA 4YM1A 4CUBA 1UMZA 1V54C 1OSGA 3WNPA 1S0FA 1I5PA 1XNAA 2JWPA 1TVKA 3PTRB 5T50A 1TNFA 3K03A 2W5FA 4CU6A 4B4QA 4ES8A 4HKOA 5FUIA 5BNOC 1KITA 3DPRC 5KX5B 3PUIA 5BNPC 1AJQA 2FZ2A 2VL4A 4WM7B 5J2UA 1NCRB 4NHXA 1YJKA 2HWF1 1VALA 1RUJ1 1GLHA 5FNVB 5DN2A 2W2IA 5J2TB 1ZLZA 3LSQA 3DXRB 1S0GA 2JG8A 1RUG3 3N27A 2WLJA 2GNMA 3P3PA 4J1XA 5BNNA 4RQPA 2R72A 3FYIB 2D6NA 4F8AA 4INDA 3ALQA 4FM2A 1UYYA 1PNGA 4UFMA 3E8GA 5G05L 4JCKA 2ETEA 3H3UA 1MZFA 4KFMA 2C2AA 1GANA 4ET7A 3IDCB 4YW5A 1XPWA 1IS6A 1DLLA 2QE3A 5D8AC 1O3RA 2WZR1 3KWVA 5LMNB 3K4ZA 1ZZ8A 4NROA 5IT9N 4BLJA 1DYPA 3HKEA 3AYDA 4I01A 4GJYA 2Z4FA 2WNVC 4X64O 2EINC 5LXTA 4XACA 2GH8A 2YC4A 3DKQA 2DW4A 2E7TA 2Y4TA 1MS5A 1VQOV 4OHWA 3ZMNA 4JYYA 2AR6A 1FMD1 3Q8CA 5HCHA 3ZN6A 3JASA 5IFTA 5FCCA 4CEYC 4XZPA 1FXKA 2JENA 1XL6A 2VECA 2FDIA 5H6QA 4RL7A 2PHWA 2MK3A 2UXBO 4S2HA 3T30A 4UCTA 1STMA 3UGGA 2WSUA 4L8QA 3N9MA 4UT5A 4MVQA 1W0NA 1C57A 1ZYBA 3S7EA 2Y0PA 3JZVA 1YITV 3HKDA 1WCSA 4YYOA 1A78A 1X8EA 3IGAC 1Y9QA 4A2UA 1GN4A 4MTFA 3TBDA 4GH4C 2B39A 4DUVA 2EILB 3ZSLA 4OPHA 3T1HO 3ECQA 3WSOA 1VQ9V 4IIJA 2WJSA 2W0XA 4LK6A 4X20B 3W5MA 4WBNB 1DGWA 4YG6A 1PK6C 4KWJA 4OYUA 2XGXA 4XQ4A 5FZEA 4MHRA 4A7ZA 1WCUA 1OCZB 1LHOA 3B94A 4JTCB 3N9PA 4NXMO 2YI9A 4YW7A 1F23A 2QTWB 4KP4A 3FN9A 2YBPA 2DDUA 4QX2A 5A6YA 1SLAA 4CEWB 3CCUV 1NCQC 3MFAA 1LHWA 1GH6A 2BBVA 3RYCB 3ZM8A 3K5LA 2HWE3 3ZKUA 5HFLA 1HDJA 4UFHA 2YUAA 4META 1VQKV 3K79A 3K08A 1W6OA 1EV13 4JYBA 1VLNA 1SPPA 4CCJA 4OI0A 3J7LA 2ZGTA 1EFRG 2OPKA 3B7MA 3VL9A 2Q1FA 5CA1A 2W1UA 5DABA 1YLLA 3MDPA 3LDBA 3FHIB 2VMEA 2D98A 1G6NA 5LP6B 1DYOA 1JJOA 4AVVA 4AI8A 3G6BA 2KA3A 5T5LA 2W1SA 3QLQA 1CAUB 4BH9A 4D94A 3GYDA 3CWBH 5C8CB 1S0CA 3VZOA 3DC6A 3VD9A 4PLOA 3VOUA 4BLIA 3LEIA 1KEXA 5FP7A 5FLJA 2W3JA 1AYM1 3WDWA 1HV0A 4QX7A 1H6YA 1V9U1 1GN2A 3KF5A 4QPIA 5FYUA 4AI9A 3BTZA 2ORXA 2WBKA 3CX5F 2O57A 5A1LA 1GKFA 1X8MA 3RYIB 2VG9A 3U78A 4JQTA 5FXWA 5J98B 4TT3G 3OMNB 3CBNA 1N33O 5D21A 4ZI7B 2VUDA 4CS3A 3OF1A 4MGKE 5B4XA 2EX3A 3LNNA 1NTMH 2ID4A 3T0DA 3JCIA 1IURA 4GUNA 3AKQA 1IOAA 4QPJA 3ZMZA 5FMOL 4FM0A 4MSVA 5LMUO 5A3WA 1ZA4A 3POWA 2DCTA 5J96B 1ZREA 5KUKA 4AQYB 3ZYGA 4WM7C 4MADA 4FLTA 2DTWA 2P6HA 3ETGA 4V2WA 2HWD1 1CX4A 4DPNA 5ISLA 3E86A 1WW4A 3ITQA 2C6SA 3ABMC 1JYCA 4LBMA 4AAPA 1LNSA 2WLIA 2Y69C 4TV8A 3NSTA 3VBFB 3UT5B 3I56V 2E31A 3ZRXA 1BBT3 4BMBA 3PMSA 3F7VC 1FYJA 1P7BA 3SITA 1U12A 2OUJA 3C7GA 4LUMA 1V0AA 4GZRB 1OCRB 2BFUL 5A3PA 1K4DC 2RDRA 3CJIC 3I7DA 4CUCA 4XDJA 2FDGA 3MEPA 4BOWA 5FRAA 3ZBHA 4IV3A 1VF5B 2NQYA 3TNPB 1HWYA 3DC5A 5IY5C 2QZ3A 4WVMB 2P22C 3PVBB 4YW4A 2VR4A 1UYXA 4FPYA 4H2AA 1ULPA 3M8AA 1YFWA 1Q6HA 1AR5A 2VZUA 1VBD1 2RM22 3ZFGC 2CSGA 1G4YB 3O14A 4LHSA 2E76B 2YXHA 1HX6A 2QZ2A 2QQJA 1I5XA 4FLYA 1G1XB 2VZ3A 5IATA 1W04A 2WFF3 4HKLA 2L6LA 5GLVA 5BNQA 1BKZA 1URFA 2B9VA 4N53A 3H3LA 2VQEB 3U14A 2IWGB 3BCCH 1XYNA 4JKLA 4CEYB 4HLTA 4QB2A 4OI1A 3H1YA 2VW1A 1PPJH 1J3QA 1QXPA 4K8FA 1YTFB 1V00A 4XFFA 1KXGA 4WM8C 4UAPA 1JA8A 2DVAA 3DPRA 3PUHA 4H13B 3IIIA 3NV3A 2VWJA 1LGNA 1S2EA 3IM0A 4D0QA 4CC6A 1ZZ9A 3RYFB 4TXWA 3O1VA 3OPZA 5JIAA 3PHMA 4NXNB 1IBMO 5BNNB 2UXDB 5DG1A 2WA4A 1QOOA 3A0HZ 1W6MA 2JD9A 4PBOA 4LFBB 1UF2C 1T5EA 4GMP3 1YI7A 1K5MA 1Z0HA 3N36A 4QX5A 2ZEXA 3UV9A 3VBOA 4OX9O 5A3UA 4HNAA 1DQ4A 3B01A 1AI5A 1Q8OA 5IAXA 4KBBA 1UY0A 4NIAA 3CCMV 3DECA 1NTZH 4NPMA 1AYN1 4DR7O 5JI7A 3RI9A 1MACA 1L8DA 2IM9A 4XDLA 2XUMA 3HR0A 2RDCA 4LFAB 1WMEA 4FAGA 3X29B 5FZ4A 2P4KA 1KC8W 3CIHA 5J2UB 2LROA 4DY3A 5B66Z 1NR1A 4MVUA 2FCVA 5JZGA 4Q4W3 5TSWA 4UUJC 5GZFA 3T1HB 1VJ2A 2BGOA 3CZUA 1KFXL 4QPYA 2ZZQA 1TVKB 3ASIA 1M56B 3NR7A 3AXDA 5BNOB 2W6JG 5DUWA 3UM7A 3KCXA 1KP3A 1W6PB 5SV8A 5LK5A 5JOXA 4JASA 4P9JA 2XDVA 4B3NA 4BR6A 1Y6XA 4QKDA 4Y33A 3H1KH 1RUD2 1AXZA 4IEQA 4J7KA 1V55B 3MPBA 1VF6A 1RHI1 2Z42A 3WCSA 5K0UA 1E5HA 1H4GA 3ACIA 3GDBA 1JZ5A 1HRV3 3IMMA 3ZHQA 1AHSA 1N3OA 5FMCA 3K06A 3NNMA 2PXJA 3V65A 2RS31 3ETDA 4G2KA 1JHNA 1PGSA 2RNBA 1CZVA 5B3SB 4LH7A 1Z5WA 2EINB 1DK1A 1MNGA 4XC9A 4GX1A 5FZ8A 3NVCA 1M90W 5JJEB 5JAXA 1AX1A 4NAOA 4CUGA 4R4XA 1ONAA 2ADPA 1UY1A 2IJJA 1DU3D 3H7JA 1NZ6A 4QX8A 2EIEA 3OUSA 5CFCC 3SPJA 2K2SA 1GK9A 5IWAB 4XPVA 3KVBA 3B00A 2W1QA 1N36B 2X6BA 5B1BC 2JDZA 3S3XA 1SZBA 2HWB1 1MEC1 3PLQA 3FAVA 3E97A 1V6KA 1CPMA 4BQ1A 1LKNA 3IN9A 1AP5A 1PIV1 4XCAA 2VOWA 3B93A 1Z7S3 1HR0O 2DYSC 2HH9A 1PL4A 2BOCC 5L9VA 1URXA 2JDPA 4BZ4A 1QNMA 4ZHQA 1R6NA 1R3IC 1IBMB 3VDDA 1D4VB 2VOVA 3ZVXA 1S1AA 2HWB2 4JZRA 3OBZA 5FZKA 1C1FA 3B8NA 2ZHKA 4B29A 4LCUC 3AG7A 5JOYA 2A7WA 3KSCA 3DYMA 3K4DA 3QG5A 1DQ0A 5J9PC 2F1MA 4EN9B 1O8PA 4NHLA 3CJIB 3RWRD 2CH7A 3K5OA 3VZMA 1GTOA 4AEKA 1NZCA 4CPBD 1JZ3A 1VMGA 4QPWA 5GKAC 2LFRA 4MXWB 3JBG3 1T6BX 5JSRA 1AR73 2JG8C 1IG3A 1OQEA 1R6KA 4NIGA 5FOBB 3FL7A 2W68A 5JH7A 4C8DA 1OCOC 5A32B 3ZXFA 4AQ6A 4I3GA 1TUEB 5A3TA 4JI7O 1GZCA 4H7LA 2VO5A 4URAA 5JMOA 1ZX3A 3WG4A 4TZDA 4DUZB 3W7XA 3NL1A 1JTZX 4UCSA 3NKTA 5KC6A 4FAHA 2VTXJ 3NJYA 1UOGA 3POJA 4DR1B 4TWKA 2XT9A 1AR91 4GWMA 5D8AA 1O91A 2ETNA 1EAH2 3V0BA 1FPN3 5FBZA 2YHJA 2ADDA 3M3CA 4X1YB 3TK1A 2OQ6A 4JX0A 2EZPA 1GM7A 3RGBA 4FPGA 4AQTA 1DZTA 4GX5A 4QT6A 1UU5A 3AP6A 2A9HA 4F6RB 4A3XA 4B3MO 5FPLA 2YXLA 4AGVA 3IWZA 1R1BA 1MPXA 5CIRA 4KXRA 4FTBA 5ACA3 1H4HA 3V0BB 1KDMA 3E6BA 2BNNA 5E88A 3ZRSA 5DM6V 1C8M3 1GICA 3UKTA 1Q8PA 1FYUA 3JAKB 2ZDIC 1WKYA 4K1ZA 2BU9A 3ILFA 5F39A 4MTXA 4E27A 1FKAO 2RS32 2ZT9B 4JI1O 5IYDO 1MQTC 1REEA 4X89A 3B77A 3VV1A 4LORA 1CAWB 2B9ZA 1ULDA 3P6BA 4OI4A 3VBUA 1OHHG 1PK6A 4W6YA 5LK7B 3O1RA 4K1YA 4PV1B 2ZGUA 1VBA2 5JSOA 3S0MA 3HOBA 1W03A 4CCDA 1W6MB 4W4ZA 3SYCA 4J1WA 2RMKB 4J25A 3SYQA 2JDUA 1THZA 5EXOA 2FDFA 4FFIA 1T2XA 1QJU2 2ZS6B 2XHNA 3U11A 2AREA 3R4SA 4H3WA 5LB6A 4LOSA 3G67A 3O1TA 1WW6A 1W6NA 3D3QA 2GALA 3JD71 1DP0A 4QM9A 3J8F3 3WY6A 3APBA 4IEXA 4XETA 3QTCA 2XNDG 4J42A 3AZZA 1GO3F 2P4EA 3FWEA 4O2BA 5IK5A 4Q4Y3 1VQNV 3D36C 1UZVA 1B04A 1FAFA 2QKDA 3B8MA 3WUDA 1DQ5A 4JI8O 1NA1C 4IEOA 3J7MA 4P00B 4IGQA 2R9IA 2A5ZA 4WFFA 1SETA 5FZ9A 4BQYA 4LF6B 1ZRDA 1ULFA 1M06G 1V6MA 2Z79A 2JXAA 1P84F 1NY72 1YJ9V 1EAH1 5JIUA 1C1LA 1WLDA 4ZY9A 3OBRA 4OFGA 1Y66A 5L3GA 2EXJA 2XUEA 3JD2A 4AFAA 3NV4A 2AHYA 2BTVC 3VBBA 3WXPA 2ZNIA 2KM2A 1KD1W 3NQHA 3IMNA 4XHBA 3SCHA 2UWAA 2P3YA 1DBNA 4CP1A 3DN7A 1CAXA 4ARXA 3GZTB 2ZKLA 2VCMA 4L2NA 3OEBA 3I3EA 2IH1C 3WW2A 4DZGA 1AXKA 3W7SA 2I2SA 1HB1A 1PMJX 5FQ0A 4ZU7A 4CZSA 4PA3A 4Y24A 3THCA 3N7MA 2UXCO 4CBCA 4DB5A 3U4XA 5J2TA 3MBWA 2Z5UA 1HDKA 3U37A 3EB7A 1O5LA 1H2GA 2ZGOA 4E2GA 3SJQC 1DHKB 4I4TA 4Q27A 2VTXA 4J9ZB 4XDOA 4YJ3A 5T5PA 2QQWA 5FY9A 1BE3H 1BBT1 4G28B 3J81N 4S2DA 3WD5A 5FYMA 3TNQA 3TN92 5GLZA 4XUTA 4IIJB 2WNVB 1CWPA 5FP8A 4XBFA 2XHBA 2XVLA 3BPZA 4PHZA 2WYSA 1NS1A 4NTXA 1RUE3 5BXXA 4OZOA 4DV7O 2W47A 1PM7A 2PN5A 5LA0A 2QKSA 4DV5B 3O7OA 1EV11 1L7LA 4HPKA 3JAWA 4OVEA 4Z8BA 3PJSK 4YZ3A 1NTKH 1H9PA 5JDBA 2GMPA 1SS3A 1JW6A 4Q4X3 1RUJ2 4MVZA 3ZHUA 1OA2A 1QJX3 1IPSA 5JPMB 2XVKA 3RFRA 1N34B 4U2AA 2P6CA 3RZLA 1KECA 4IETA 1GZTA 5FY0A 3JQXA 4KL1A 5FJKA 3VKFC 2J42A 3ABKC 1EV12 3ZLIA 2C0ZA 5FZ6A 3CCSV 4CCKA 2V09A 3QF7A 1QHTA 3VD3A 3JALA 4DR4O 1N8RW 4AW7A 4J10A 1RM1B 2D44A 2JKXA 1PKXA 4AI0A 5FK8A 4DRRA 1X7NA 1C5IA 2PHLA 4I2OA 1SACA 2VOXA 3MD0A 5JXIA 4LF4B 3I5DA 2CL2A 3R65A 2Q7EA 2P1BA 2ADEA 3ILNA 2R9AA 4C0HA 2HWC3 4YIOA 4FP2A 1N4CA 3I59B 5J37A 4B7EA 2NMOA 4GLXA 1OVSA 4YNIA 2CH7B 1GFF2 2HEVF 3GJBA 3KV4A 4LF5O 4AXOA 3ZS8C 4HVOA 5F32A 1ZBE3 3PIGA 1T6GC 4JI1B 5IVYA 2K46A 4PELA 4MSWC 3VGIA 4XIOA 4GKJO 2VOKA 1P4RA 4QKFA 4E4ZA 1Q5OA 4NWVA 2XAFA 1C4RA 1S0IA 3WG7C 4AL9A 2E63A 1KKDA 4XOGA 1H2SB 5CBHA 1YTFD 3VDDB 5LGTA 1BQPA 1FMD3 1YHQV 4ASKA 2YUEA 4DYLA 2P06A 2QQNA 3TAYA 4YW6A 4O4LB 3P1IA 2O8QA 1YEWA 3WVJA 1YO8A 1HJGA 3HPLC 2D6MA 2JIGA 3UGFA 1XJAA 2A3XA 3RWNA 5LBFA 2J22A 2VQFO 4ZKTB 5B1BB 1UPGA 1XC6A 1HB4A 3DUIA 4OGQB 5JCTA 2GV9A 4QAWA 2V4VA 4GKYA 5IJ0A 4JI5O 2CTWA 4QU2A 2XHKA 3A0NA 3FMGA 3LWCA 3VBOC 1GZWB 1JXNA 1W2OA 4YZ5A 1JMKC 4ZPIA 1FJGO 1FI2A 1DGRN 2QA4V 1OC1A 1JYNA 1PL0A 4P08A 5IJ9A 3HQXA 2F95B 3VHPA 3DXUA 4P9XA 4DEVA 4XBQA 4OHVA 3ACFA 1U5ZA 1VRH3 2ZBJA 2N05A 4O9EA 3CCRV 1G6UA 2BERA 4GX2A 3M3IA 4ZXEA 4RN5A 4EV0A 1OOPA 5I0SA 1ZBE2 3NRUA 3WQ1A 4AILC 1UO9A 3ZXAC 1S76D 3NW4A 3CE2A 1CZTA 3WV6A 2UUBO 1KJRA 2DVFA 1J84A 4JHZA 2AW9A 3M2MA 3ON7A 4K0KB 1K33A 3OMAB 4MGSA 1H8TC 3EYPA 4UFJA 2YIDA 4IE6A 2LRPA 4AQYO 1LENA 4P30A 2Z2SB 1D7PM 5L19A 2OKXA 4WZFA 4QB1A 5FZ7A 3A0KA 1CPYA 4RQEA 5J36A 2VMFA 1RHI2 1Q6UA 1CAXB 1VF6C 1FNYA 4CZZA 1ZUQA 2ZGPA 1N3PA 5AC93 2ZM6B 1AVMA 2A6WA 4DXZA 3RYHA 5LRSA 4DV2B 5AVPA 4XBLA 1GSLA 2VBPA 4D8MA 2VH9A 2QUOA 2O0OA 5L9RA 1U5YA 1RHI3 3VBUB 4H37A 1RUJ3 1UKGA 2ZX0A 5C4WC 4XVHA 1PZ8A 1RUC1 4K20A 3AEIA 1XE0A 5C4WA 5EBMC 2VJXA 3DKWA 3DL3A 3CP1A 5FZHA 1AZDA 1QVGU 1FT9A 1OCCC 1GQPA 3ML0A 3O1PA 2AGAA 3HR9A 4HXCA 4E8DA 4FXGB 4RWUA 3I2IA 4FPOB 1SDDB 4NIIA 4O4IA 1HLCA 4YY3B 1OOPB 1BBT2 3HKCA 1AJNA 4HBNA 4ISRA 4PCRA 4B4RA 3L9DA 1R64A 4IDZA 4FFBB 3HKEB 2PAKA 3T1YB 1K9MW 3SJCC 3K0DA 1W2UA 4ZIBA 3K3OA 3I97A 1RGSA 2DJVA 4PA9A 3ZX6A 4JI3B 2JDAA 5EP9A 3VKMA 3KQRA 4MVRA 3MAQA 4L99A 3D0SA 1W0JG 1W05A 5FO9B 3QBQA 5CU1A 4D69A 4UXNA 2RDSA 1RUOA 2VMCA 3T2TA 3JD3A 2WFPA 5LWBA 4LXLA 4QQOA 5FPZA 4YW3A 1AXYA 3APOA 1SQBH 4Y20B 4XJWA 1H9WA 4OPAA 2J1TA 2QQKA 4XURA 3VB9A 3USUB 4F3JA 1CAWA 4AVTA 3JBG2 3W20A 2BNMA 5HPOA 1RTVA 4TUYA 2Q67A 2WUHA 3BKZA 4A5UB 4JGSA 3OM3B 5CISA 2YFZA 5FP4A 2YPJA 2WABA 2VQEO 5CADA 4Z1MG 1K7DA 1QQP3 2ILMA 3LFMA 1XE8A 2JDNA 5FBJA 3LIGA 1NQDA 2OVUA 5JMCA 5G04L 3AG1B 1HN1A 3BFRA 2VAUA 2FYUH 1H30A 1W2NA 3JQWA 3TJTA 4JKKA 2UURA 4J11A 3LSEA 1JMUB 3HKDB 1YQ8A 1EZJA 2K1EA 1Q3EA 5FPVA 3ZFEA 3OR7C 3ZFEB 1KD7A 3ASNC 3WP5A 4PQQA 3TCUA 1WBLA 1HV1A 2ZR3A 4Y1UA 3CHXA 4C7UA 3U07A 1OF3A 2JJ6A 4AEDC 4YLZA 3TGUH 4XF3A 4W4LA 2JEUA 2WWUA 5FDBA 2P67A 3LIHA 2KQXA 1E5SA 1FX5A 2YBSA 3ZR5A 3UCSC 4MS2A 2Q5TA 4YVSC 4XF1A 1BSMA 1LHNA 3VD7A 4P9IA 1QEXA 2RJKA 3TRSB 1ODNA 4DR1O 5KXBA 5KC5A 2UXNA 3F7YC 2W52A 1DGRA 5LA2A 2YY1A 1UYZA 2Q4PA 3G6JB 1K5QA 5EIBC 4Q4W2 2YMZA 3STLC 1XNQB 4K21A 1D2DA 1FD9A 4I0XB 1TME1 1VRH1 1UU6A 1LODA 1JR9A 4YVWA 1K8AW 3N2KB 1OLMA 2XOMA 1OJHA 3QH6A 4DV3B 2VULA 1HRV1 2ITDC 4ABMA 3FFQA 1OFSA 2BWAA 3SMHA 2R071 2EXKA 2R0FA 3ACGA 3URFA 2HHHO 5DAXA 1SESA 4OQ9A 4CE8A 2EA7A 1J3RA 4M0NA 4UW3A 1BLZA 1SEFA 5K0UC 1RUH1 3IDEA 4ZBMA 3PIJA 3O1SA 4CPBA 3SHRA 4ZU5A 4CDQB 1W8FA 1PVC2 5DEDA 2RVAA 3T1CA 2WS93 1L0NH 2CTQA 3BTXA 2QJ1A 3AZYA 3GZUC 4MG2A 2AZ2A 5A3MA 3WZ1A 5D1IA 2N04A 1W8UA 2VNVA 1W39A 1ROPA 1WA6X 1DGSA 3BY6A 4DR6O 1ORQC 3ZYBA 1G9CA 5FREA 1NXMA 5FZCA 4CS2A 3RPQA 1OH3A 5LGUA 1NJIW 1XXNA 1ZZBA 3P30A 2X7RB 3E6CC 4JTAB 1AYN2 4COVA 1US6A 1K42A 4QPGC 4QE9A 4URTA 1RUC2 4XYXA 2B1IA 1N34O 1NZIA 2C1FA 1A6CA 4CU9A 5CG8A 1GP4A 1ASJ3 2ZMKA 5GTHZ 4HK8A 4X66B 2HJIA 4FIPC 4P5YA 3VDBA 3WNOA 2EJRA 4Y1VA 3ZSJA 2RMU2 3LSSA 3ZRWA 2YU2A 2QWQB 4PJ0Z 4IUGA 2WYFA 1QBZA 2BZDA 4GKJB 2W1WA 5CFCB 2Z3YA 4QHZA 4UV9A 1JYTA 5CKQA 4QE7A 5JWPA 1IX9A 3T1LA 4LFCB 1H8HG 4XUQA 2Q9LA 2VVFA 1HXS3 4FPKA 5FZBA 5CG9A 4OHYA 1KB9F 5A7WB 4TQDA 1F31A 1AR71 4ORFA 5CYYA 1FFXB 1QH6A 3K04A 5J1XA 2V5DA 5GONB 3ZSKA 2OZ6A 1QOTA 3F5TA 1PHMA 3BGAA 5LA9A 1HW7A 3EXAA 4JI6O 4LITA 4QHOA 1TQ5A 4NPLA 1IKQA 1W0OA 4Z92B 3LDCA 2QQMA 5D5PA 1K3IA 3RMYA 4QWNA 3BUCA 4JGZB 3VHOA 5BNNC 2R043 3BN6A 2VMDA 4UYBA 3VQXA 3ZR6A 1XMOO 2P3JA 1AR1B 2G9GA 2JICA 2Q0OC 4ZHNA 4K8XA 4AHCA 3RYPA 1I5YA 5CEHA 2FKXA 1J95A 4J41A 3NKGA 3ASOC 1RUG1 4UCUA 3CKHA 2HEYF 1R082 1S5HC 3QO8A 1ULCA 1O6UA 3JARA 1KGYA 3R4DB 4BB3A 3HNMA 2RN9A 2WL1A 1HNZO 4UWDA 1UY3A 3OG2A 1VAMA 2M7WA 1UW8A 3ZMUA 2VMGA 4HL0A 4GMP1 3I2HA 4CCLA 2DBNA 3AK0A 5GZDA 2JRIA 5LBQA 3CMEV 1SC5B 3WW1A 1D2QA 1ENSA 3POIA 3AG2B 1FXVA 1XU2A 3MIFA 1V6IA 4NKGB 1QXJA 4JPRA 2I07B 5CMUA 4NHMA 5KHJA 5IJ0B 4COZA 5A2QN 3U0ZA 4B3SO 4JZGA 4FQZA 3LFIA 5C9AA 4YVSB 5A7OA 2XWBB 3KVAA 1POV3 1AP6A 5GONA 3HQUA 5EC1C 2IJHA 1S77D 2D2CB 3M3OA 1ZZCA 5JOZA 3OD0A 3ZXEA 2O1QA 4UCOA 1R091 5APAA 1BK0A 1TME2 5F2SA 4Q4W1 5KLVH 4LULA 3B9CA 3B2EE 1RJ7A 3AVSA 1D5AA 2D6PA 1HR0B 1XI1A 3LOBA 4X8NA 2ZR2A 2VUAA 4H55A 1SLCA 3ATGA 4LLOA 5L3DA 1QY4A 3WNMA 1COV3 1PX3A 1Y9MA 2D6LX 1K4CC 3WU2Z 2E32A 4GWIA 5H9QA 1SCRA 2FMDA 5JLVA 4EKWA 3NJXA 2NM1A 5IVVA 5E16A 2Q8VA 3O0XA 3CXHF 2YEVA 2PYTA 1GMGA 2RS53 1HB2A 1YFXA 3RN4A 1H8VA 2V5YA 2Z5WA 4XTPA 5DAWA 2X5IA 4ASMB 3MIHA 3IJ4A 2OYZA 3AC0A 3ENRA 3E5XA 3Q9OA 4M3CE 4CDUB 1HNWO 2HWD3 1OQ1A 5DPNA 5IYYA 2P17A 4I4TB 5ABJC 1SLTA 5C8CC 5L7OA 4TUYB 1NQTA 2X6CA 4ZZ5A 2GDFA 4BMEA 2XL7A 2EAKA 1H2KA 2Q7GA 1NE4A 3LAGA 5FXZA 4XJUA 1JZ6A 2Y69B 4DR3B 2IBZH 3PNAA 1JS9A 1M4UA 1Y67A 1RSOA 5H6RA 2XKPA 3BA9A 3BA8A 4X8AA 5EYPA 4F83A 4JI3O 5C5TA 3A23A 5DDJ3 4X88A 1R3JC 3ME2A 4IGGA 4ZONA 1PO13 4AFBA 1LOBA 1HRV2 3KZ4C 3RNSA 4LOTA 4W6WA 1OCRC 2VY0A 3CRQA 1Q8VA 3TN93 2EVXA 2W6IG 3AG4C 3IFXA 4XILA 3HKCB 4OXSA 5LMUB 3MPPG 2R073 1VQ8V 4IE7A 3KG2A 5IFPA 4LO7A 4Q8KA 2AYHA 3NAPA 1BYHA 1WN7A 4B3MB 5CA3A 2WINB 2V7QG 1CJPA 1PP9H 1RJ8A 2F4LA 3OB8A 3ZHSA 1JYWA 4QDRA 3ABMB 4RR3B 3FHQA 2QWOB 1S4CA 3VBHB 1OLME 5FKBA 3ZFEC 4J7ZA 4N23A 1RUF2 3ZYPA 4B1MA 3N9QA 3IC7A 1B6QA 4XHXA 2VZSA 3Q8AA 3K9AA 5FO8B 5E6HA 2WN3A 4X20A 3E8HA 1WP8A 2NR5A 4YY3O 2NMNA 1OKQA 4FPJA 4YZ2A 1Z5VA 4I5SA 1PO23 4Y1XA 3PU8A 4D6TH 3ZN5A 4NUBA 3ZYJB 4UI9L 3N35A 2Y8KA 3RI8A 4MXVA 5E79Z 1RM1C 4JTDB 3IPVA 4FT8A 4XFIA 2A0LA 3KT7A 3WB0A 3WDXA 2DWEC 4KWLA 1REDA 3ZMTA 5J48A 2Q5ZA 4FCAA 4LBJA 2ZJCA 4FPFA 4Q26A 1CPNA 2KSDA 2QDOA 5A1FA 3ZFGB 3FB5C 1WB8A 1JZ8A 4FBFA 5IK7A 2N7GA 4CDQA 2EIMB 3KMHA 4NE9A 4XMAA 2UUCB 1VBB2 4ATFA 4QD2A 4GT1A 4X66O 5ABJA 4DR2B 3SYAA 5M0TA 2YC2A 3UNPA 3PUAA 4CU8A 2JDYA 3WF2A 1NH2B 3AMPA 1VQ6V 3ES1A 2ARHA 1LAJA 1XREA 2L9LA 1XNRB 3AVRA 5L3BA 4I50B 4G3YC 1WA8A 4XXPA 2HEPA 1HRI1 3UETA 3QACA 1K97A 2PTMA 1SF9A 1MVQA 3CU7A 5A6ZA 2WWSA 1F4NA 2R1DA 1D0HA 2KXLA 5GLUA 1VBB3 4PT6A 3CC7V 1N1VA 2JDHA 2ZABA 2QCSB 3D82A 5JXJA 1IXMA 4BAYA 3ZJZA 4GXLA 1ZZ7A 2YFUA 4RUEA 1W8NA 3LDEA 2Q73A 4IV1B 2ZX2A 1G9BA 1IBLB 1ND3A 1JX9A 3ZN0A 3OEHG 2D3OW 1XYOA 4FTSA 1EN5A 1K5JA 3I2GA 5A33A 2LUWA 4JI8B 3VBFC 1JU4A 4XW3A 1GNHA 3KV9A 2C26A 3MW3A 1IBKO 4Q4X1 1S2KA 1ZVFA 5DXDA 2AENA 5IVCA 4BIOA 1I9RA 5T52A 3AL5A 1CAVA 4CU7A 4IEWA 1RSOB 4AI3A 4M4RA 5EC2C 2RV9A 5D2AA 1ACCA 4QQ2A 2XLGA 1UFIA 1NLQA 2CGOA 2A6XA 3GM8A 3ZIAG 3TN91 4L87A 3HN3A 4JVAA 2KR2A 4IEUA 5LHHA 5EYPB 4LA3A 3ZIXA 2FL4A 3LF7A 2VZPA 2E5LO 3JSLA 2OTLV 3FC0A 3T1MA 1Q8IA 5F5CA 3NJZA 1QLEB 1GOGA 1RVF2 2QJVA 2CY6A 3HT1A 4YFWA 2GMMA 2RDNA 4AFMA 4JYAO 3R66A 1UPSA 1Q56A 2AACA 1O59A 2HWB3 3ZXGA 4Z82A 1WCKA 1X50A 3AB0A 4MUVA 1PGL2 2BBAA 2XWJB 1K3EA 2YEVB 3O1MA 1Y9GA 2DQ3A 2WC2A 4COYA 2A6VA 2ZGSA 3C7FA 4QMAA 4QIWF 2ODMA 1FMD2 5E1AC 2D3PA 2D5FA 5LYJB 3WP6A 1XILA 2K0GA 2A75A 1LEMA 1JFFB 2PQSA 2DWRA 3ZSMA 3HB3B 1RUD1 3KV5A 1VARA 3W59A 1SQQH 1OA4A 1MZEA 1YWKA 4DNYA 4HSJA 1WA8B 4ZS2A 3PDQA 4PIZA 1SZXA 1N32O 1QU0A 3HN1A 4LNUB 5DAPA 1MSWD 4CP0A 1D4M1 3LQCA 2LTNA 3HT2A 3SQOA 2NZ9A 3JARB 1IS4A 1BL8A 2AZ5A 2DUQA 4Y4RA 1MMMA 1H1MA 2ZAAA 3H1JH 4R50A 3ETPA 1XBLA 5CKNA 5F1RA 3ZMVA 2B5HA 4QQHA 4AVSA 1O8SA 4NXNO 1PO12 4NVPA 1Z7S2 5IYBO 4Q4V2 2PMWB 2CAUA 5LCWL 2ZCWA 2DYSB 3SEPA 3C7OA 3OGIB 4XFAA 3ZX7A 3VHNA 2XLFA 1BK1A 3HVDA 1RIRA 3N2GB 2DYCA 5C3SA 2MPFA 1AR92 4LBQB 2Q7HA 4XXAA 1AROP 2P3IA 2CUGA 1QQP2 2ZOEB 4AOCA 2FCUA 3MO4A 3MUY1 4C90A 1TME3 3LPFA 2UU8A 3WDTA 1JYVA 4NIHA 1OURA 4BHPA 5DUVA 3OGSA 3R6SA 4QXBA 3J7NA 5L7OC 2CWSA 3VBHC 3LDKA 4QDSA 5IVJA 1YF2A 1YIPA 3KCYA 1WMDA 1W6PA 3M4FA 2JGDB 2O14A 3OUHA 3APQA 2CYFA 4DR3O 3W7TA 2YIBD 4YHHO 5F6KA 2JG8B 2XJVA 3CRMA 3UKVA 4DIQA 4GALA 1CQ9A 1Q8QA 1A8DA 4O4HB 3USSA 2F43G 4MGIE 4YXWG 2GNDA 4B3TO 4DRVA 3BTYA 4AI1A 1B35B 5KMGA 5EYYA 4CDWC 3ST7A 2ET1A 3E8FA 1OA3A 1QF3A 5C70A 4FO9A 2HLEA 1PZ9A 4OI2A 1CD3G 1JJ2U 2OIEA 1XMQB 4M3CB 3IB3A 4LJHA 1KKCA 4Q4Y2 2ZDIA 5IUQA 2M6YA 1EYBA 4X1IA 4IEVA 2VCCA 4X6QB 1WA4A 3VBOB 5FYZA 2XQRA 3BABA 1N36O 1AF9A 1W6NB 4LFAO 1UZYA 3S57A 3ROUA 1N1SA 5ANQA 2H0VA 2QKAA 3OBAA 4BQ3A 2X0LA 5A6XA 5K9YA 5ABJB 1L3JA 3PJQA 3ABLB 3LB9A 4EROA 3L9JT 2B45X 2JIJA 3OOXA 3IT8A 3AG3B 3ZFFB 1UWWA 1XNCA 1QQP1 1I1EA 4NJ4A 1QOSA 3STZC 1G7YA 1GN6A 4XQWA 2JB4A 1SQFA 2OWOA 2MEV3 2FTKA 4O9GA 2ZX1A 2MNGA 1NU1H 5FLHA 2BTQA 2E7QA 4JGYB 5BY5A 3ABUA 2G19A 4PDMA 4GX0A 2ZEYA 5B3SC 5FZGA 1AI6A 2WRAA 4QM8A 4LC1A 3IAPA 3KGZA 5HBAA 5BY1A 2IXHA 3BI3A 2RM21 5LOVB 4P9YA 1ND2B 1S72V 3BOPA 4GZ9A 1N0NA 4YARA 4LKEA 4BQ4A 1YUDA 4WBNA 1V9PA 1XBFA 3I4IA 1Q90D 3JD0A 1U0AA 4GMP0 1A3KA 3Q8FA 2VMIA 3LSUA 2DOSA 3H1WA 3CQOA 2WLHA 4DR4B 1ND2A 2R7EB 2G9ZA 1HNXB 4IXLA 2VNOA 3VBHA 2LJ2A 4ZOLA 3K57A 2Y6KA 5B1AB 4CDXC 4EE2A 5F6LB 1MA1A 1RUG2 1XUQA 1OI6A 4MVOA 3VBRC 3THOA 3ZN1A 4K35A 2R042 1OCOB 1SCSA 3AZVA 4ASUG 3CMGA 4GJZA 1LNQA 1F4HA 2K9ZA 2OIIA 5EJ3A 2IU3A 3E5QA 4TLGA 2HJDA 4HMZA 5EBWC 3OGVA 3JASB 4GKXA 2EALA 3USUA 3ZCCA 2A71A 2W94A 4I09A 5F8PA 1YI2V 3Q8EA 1KBHA 1NUKA 2AUYA 5JXHA 2DFCA 2Q6AA 1QLEC 4XFHA 4PDLA 2XJQA 4DK0A 5C9AB 4QXHA 2P5BA 5FPRA 1NVPD 4WVMA 1QJX1 1MS3A 3CYOA 1BCCH 4XFBA 1JYXA 1PVC1 4HFSA 2HFEC 1Z7S1 3ZRVA 4FJCC 4TTGA 4GA9A 4AK3A 1VBA1 1GMMA 1FATA 1AB3A 4IEZA 1AYM3 4OZXA 2NP0A 2VE1A 3OJBA 4CRQA 4HK9A 3FB6C 4EN0A 4X62O 4R52A 3S7IA 4CP9B 2E7AA 1WP7A 1RB8G 4QX0A 4G27B 1IZ3A 4Y1ZA 2X5IB 2B8MA 2OS2A 3SPCA 2Q8EA 4UVCA 4PDWA 2UYAA 3ZDVA 5KMGB 3CF6E 4P9LA 4JI4B 4IYIA 1LOEA 4OMCA 4FP3A 4F4LA 4IV1A 3OY8B 5A3NA 1ZSPA 4WBBA 4HZ3A 3SEEA 4C0BA 1UAIA 4LK7A 1CIWA 4B8EA 1H1IA 4MZUA 3HAGA 4KHPO 3AXEA 4U3JA 4BIUA 1GU3A 5LA6A 1R1A2 2EIBA 3AG1C 3WQ0A 4EJRA 3O1UA 5LA6B 5FZOB 2KD7A 1QKQA 4P2ZA 1PV0A 1PGL1 5FXVA 1SBFA 2BNOA 3EHKA 3NNJA 1UQXA 4WFBV 1BMV2 3UL2A 3OY8A 2XJTA 3LEMA 4HZFA 4J6GA 4LF9O 5GJ6A 2WZPP 2IW5A 5CB4A 3VD5A 4CXWA 2DWDC 1K34A 1FFXA 4CDXA 4PIXA 4DR5B 1WD3A 4IEYA 1A34A 4YSFA 3JBG1 4MVMA 2RR11 2V4DA 1IQAA 4CP9A 4NHYA 3ZPOA 3AZWA 2WQ8A 1S0JA 4DV0O 5FYIA 1FNZA 2YS8A 4OHZA 4RFT0 2ZM6O 4DUZO 5K0UB 2IU0A 3OYWB 2D3SA 3FKSG 3CC4V 4D6SA 3K58A 3M7MX 5LP6C 2F4VO 2C5DA 4Y5Z0 2Y48A 1PO21 1OD5A 1EM1A 1GQHA 5HV4A 3F2ZA 2QM7A 2WT0A 3CRRA 4LHLA 5AC91 3ZYFA 5EIBD 3I54A 2HVKC 3UT0A 1RP3B 4PD4F 3EQEA 4LPLA 1SQGA 1H2MA 2BTOA 1QJX2 3FUQA 4LFBO 4AEJA 4HT1T 1OUSA 4WV8A 4DV6B 3LD8A 1RXFA 1VBB1 3W9AA 2IFRA 1ZX5A 1W9TA 1XQ8A 2CV6A 1YJNV 3VQYA 1E5IA 4D7SA 1PGW1 1TGOA 4WFGA 4QKNA 3ZMOA 3CZJA 4IQPA 1AL21 4XEZA 1XNQO 3NMBA 4Q1RA 4TOIA 4K7JA 1N32B 3ZFFC 1S2BA 3RBZA 3AL6A 2ZGNA 2IXCA 4E4SA 1WNSA 1Y76A 4LO8A 3WHUA 2RS11 3H8RA 3CXCU 2JE9A 4RS5C 1FJGB 1S3JA 5AG2A 4O61A 2ZMLA 4JAAA 5F9TA 1BVVA 5FZAA 1V6NA 5JSPA 3D3IA 2JDMA 1J1TA 3SH5A 1R73A 4BW9A 1TMF1 1WLWA 4AE2A 1AYM2 5LXTB 4CC5A 3FLTA 3JXSA 4GD4A 1PM9A 3T3YA 5T3NA 2WDBA 4MW3A 2DU1A 2A1XA 2WFF1 1NXD1 2Y38A 3ZYRA 3OR6C 4UXAA 4A4AA 2JG9A 5EK0A 3KD4A 5GLTA 3OSDA 2BCCH 4Y1YA 1Q86W 1AX2A 1CAVB 2OW4A 5IAVA 1LUVA 3I59A 4FVVA 4Q4V1 5F5AA 3FJSA 2RG4A 5KAFZ 1H8EG 2GTAA 3D0JA 1W8TA 1WLCA 1ODMA 1VBE2 3U1XA 3O0WA 3C7HA 5EJ1B 3MGUA 2GDSA 4RQPB 3EMRA 4OMDA 2EF6A 4JAUA 4I30A 4BQXA 2NLRA 4XCBA 4LH6A 1RFYA 1YNAA 5FYTA 1UY4A 2TUNA 3FUOA 1M5IA 3V56A 1JODA 2UY8A 4XAEA 1GWLA 2GUZA 5KX5A 2YIBA 1VIBA 3CDZB 4NOTA 1O4ZA 1H1AA 3IC9A 2TEPA 4GWNA 3J8F2 3IZOA 3I2OA 4M3CA 2JG9B 1ENQA 3CJIA 4FSJA 4U7OA 3B3QE 2XOKG 2B5UA 4Q29A 4NB5A 1VIWB 1GQGA 2WR9A 3AK1A 1VAKA 4JHTA 5T54A 5LOVA 5JZGB 5EPAA 4Z2AA 5LBCA 2D93A 4EEQA 3RYRA 3V64A 1WUVA 1A32A 4DW0A 1WW5A 1FXHA 3T4DA 3QH7A 3AZXA 5B1NA 3IAYA 4Q8LA 5L3FA 4P5HA 1ZL8A 1RL3A 2YROA 2XQXA 1L7QA 4LF7O 3RZGA 3WOGA 4Q20A 2XL9A 4UCRA 2CTVA 3JUUA 1BHAA 1UOJA 4HNAB 3KZIZ 2B7YA 1CJDA 3AMMA 2XG3A 1VMFA 4O2BB 4DINB 2ZMNA 1RPOA 3MIGA 1FOD1 3JAWB 5GZEA 2PHDA 1X59A 4UW5A 3H9AA 1Z2GA 1EUTA 4BIZA 2RS33 2FQPA 3SJBC 2BDRA 5CA6A 2BOJA 3PMEA 5LY1A 4FQ4A 2VTFA 3GZEA 5FPAA 4FLVA 3J7HA 3FYEB 4DUXA 3WB1A 4EWAA 1LECA 2ZEZA 4QGNA 4PF1A 1ZBA2 3ZPYA 3ACHA 2EAAA 2VW2A 2ZXWB 2NLJC 2RS13 4JYCA 2A6YA 3SCFA 5AVAA 4XUNA 3VBSA 3MIBA 3WQBA 4A41A 4YGEA 3E83A 3GBFA 4RO2A 1DIWA 5ITZA 1EN4A 1EAH3 4QNHB 4B7KA 4WFHA 5JR2A 1MS0A 3KS7A 2Y64A 2H3OA 3SYOA 5LRRA 5F37A 1K12A 2PHRA 1LOFC 4H0LB 4Y26A 1J5EB 1JH5A 3LGRA 5LA1A 4B3RO 3SPGA 3IDBB 2BW8A 1W9YA 3IAQA 3CCLV 5EYXA 3SISA 4MHUA 4P9GA 1TG7A 3RT3C 3MIDA 3J8F1 4UOJA 1DYKA 1JFFA 3VBRB 3VBRA 4DXTA 4MYEA 2EIMC 2WAOA 4UBHA 1N3QA 3S6PA 2DBIA 3K9SA 3GXUA 5F3GA 2WLLA 2LGQA 4X6RB 4PQ9A 3HIFA 1BEV1 4HETA 2OT7A 5E89A 2ZA9A 2OIGA 3ETEA 5BNPA 4DV6O 3CC2V 5EFUA 1RUF3 1L7RA 1JYIA 1BVP1 1LRHA 5FY4A 2WNEA 1VF7A 3EJKA 3AYEA 1AR93 3HMYA 2BQPA 5IYCO 1V9U3 5FIXA 4O65A 4UFKA 1VBE1 2FCTA 3GZAA 1WLEA 1FV3A 5A7QA 4FFFA 2CAVA 3RMXA 2Q8DA 4M01A 5EV7A 5FR3A 3GWKC 4NTYA 2YIAA 5DZFA 1F8VA 3J9SA 1OF4A 3AG4B 5K8SA 3Q4HB 2X53S 1DLBA 3VBFA 3SXWA 5HCFA 2Q69A 4P02B 1NCRC 1MZ5A 3D5OA 1NH2D 4F6EA 5CA0A 1KFUL 3M8LA 4Y20A 3C3TA 3P5BA 1UMHA 4AQSA 3ZXLA 4BYYA 1IKPA 3K77A 5LEKA 3MIEA 1ZAUA 1UX6A 5FYCA 3SKVA 3AMNA 2UUBB 2OTJV 1ASJ1 5H9RA 1LOGA 5T5JA 4GB31 2EIKC 4JI2O 5FZOA 4N8MA 2X29A 5I93A 2VZQA 1F2NA 3E35A 2MEV1 1W8WA 1K5SA 4QX3A 4IYHA 4IHJA 4CEYA 1OXCA 2XJUA 3ES4A 2HKOA 5CAZA 1NOVA 2JDIG 1AJOA 3FB8C 4EYUA 1OLQA 2C24A 1V9U2 3RZJA 5FNVA 1AR81 1AL0G 2GC3A 5JCOA 3DCQA 4JV5B 1N1YA 3Q8BA 2ITCC 1FV2A 1W6QB 4R9DA 2J1UA 3ZKYA 2ZACA 3HQRA 3UKNA 4PA6A 4PDRA 1B09A 1W0PA 4H7MA 2HR3A 5HI0A 2GC2A 4RR3C 4K3AA 3SDLA 2ZGKA 4TSFG 1F5FA 5KWRA 1PD3A 1YI9A 4JC1A 1R1A1 2BFUS 3CJXA 5ACA1 5FXXA 4GH4A 4A3ZA 4WVWA 1S55A 2GN3A 2R30A 5BZBA 5FMDA 1AR4A 5EHDA 3H1MA 4BISA 1ZRFA 5B1OA 1DTOA 1GRJA 1F9KA 2VNRA 4JZ2A 3T4HB 1L0LH 4TN7A 1Y7BA 2DYRC 5GLWA 3VHRA 2IC1A 1SBDA 3RYCA 2AGSA 3DYPA 2DFBA 2JECA 4I0XA 2IVIB 3R0RA 4DK1A 4LBQA 3H42B 3I3DA 3FB7C 1O4TA 5IW0A 3KGLA 1O3QA 1R6TA 2ZHNA 4BCUA 2Q0AA 3MLKA 2ZE5A 4QPGA 3OAAG 1YQCA 3ZHTA 2BTQB 2HHHB 4H44B 3CJHB 2LALA 4LP8A 1NT0A 1R083 3RZMA 3HKBA 2VZOA 2ZX3A 1XDCA 4R4ZA 1E57A 2XBO3 1PIV3 4FPHA 3MW2A 2VWKA 2WZEA 3RVHA 4C1XA 2EILC 4N21A 2P34A 1OQDA 3MDSA 3DEMA 2HYXA 3H0OA 3RJRA 1M4WA 5FJHA 1GZ9A 3VDCA 2E3CA 2WAMA 2JX9A 4U3FH 1DGLA 1XSQA 1CR7A 1GNZA 2VQ0A 4RUFA 4LEJA 1XL4A 3CRCA 2AC1A 1OCZC 1OZ0A 4JKMA 4FZ1A 5A3LA 1LHVA 1V6OA 5CFDB 1B35C 1YIFA 2PLV1 2CGNA 2OPWA 2H0BA 4LO6B 3B02A 2C4XA 1PNLA 2ZE7A 3GHMA 1OLRA 3KT1A 1BZKA 5K4LA 2EIDA 2Y33A 1DGWX 5I8YA 2KKWA 3O0VA 1DQ6A 3E22B 1P7GA 1LR5A 1NBMG 3GB7C 2ZHLA 3HKBB 3BEHA 2GN7A 1C8M2 3W5NA 1VBC1 1Z78A 5K1XA 2WNOA 1G8MA 4I02A 1W3VA 4LBNA 1RUH2 4YVWC 5LASA 3E5UA 1NLSA 4NWWA 4O4LA 1FPN2 2RHPA 3OEAA 1QCEA 2QVSB 4O4HA 5LW9A 3T4ZA 4WF9V 2KG7B 2IXKA 3NAPC 1BXHA 2QQUA 4NIDA 2K9PA 2P37A 2ZE6A 3K5MA 4K8RB 1S0BA 2ZGRA 3AG3C 3LA7A 1GWMA 1YFYA 4DV4O 3S30A 1MQTA 1APNA 4M0HA 5IDJA 4I9QA 2PF4E 4DUYO 4FFHA 4QJFB 4KU7A 3T2OA 4BPZA 4UW4A 2N74A 1VP6A 1RUC3 5I0RA 4LBLA 3RRDA 1GN3A 2RR13 3LA2A 2DCYA 4QGLA 3AG2C 2P5OA 1PM4A 1PO22 3K4AA 2LGWA 2QKCA 1NA1B 4QPIB 2F4PA 3E8BA 1DF4A 3FZ3A 3K48A 4AHZA 5GZCA 3WB2A 5FZMA 3WEZA 1IBLO 1WPXA 1SDWA 5C33A 1W9FA 4N9HA 4Y4YA 4LKSA 2DF7A 1B06A 3QD6A 3X2QC 3B69A 2PLV2 5DQ0A 4LNUA 2FD8A 3JALB 2ZHMA 3VLBB 2FDKA 2G9FA 1QHDA 1D5NA 4YG3A 3G71V 3J26N 1LULA 3DTUB 2SLIA 3W7WA 1E5RA 3BALA 1ZNPA 1KYOF 2ARBA 3ZXKA 3V0AA 4TLFA 3OUJA 4JRLA 3KHBA 2JK5C 1VBD2 4QB6A 4K8ZA 2ZNJA 2MEV2 2WLKA 3ZN4A 1OKOA 4HN1A 1QIQA 2IH3C 2VRZA 1GP5A 4N7IA 4Q4Y1 1HNXO 4E8CA 2WO2A 1BMFG 2F66C 5EIYB 2J1VA 3A8TA 1I7FA 5IY5B 5IK4A 5JXGA 2WN2A 3WDVA 5EZYB 1PK6B 2W08A 3WNLA 2PELA 5KUMA 1VMJA 2IXLA 4O7XA 5L7OB 3NWKA 4EB6B 2VQFB 4Q0PA 1H2NA 3CJHA 4WM8A 4JYAB 3BOWA 5IVEA 3L73H 4CDWA 4XBNA 5A32A 2YPDA 1MEC3 2NN8A 5IVFA 1BQ0A 2D5HA 3OBTA 2FMLA 2P2KA 3VBSB 3TOJA 1O9HA 3ZRWB 1W2TA 4YJ2A 4O2AB 2JS3A 4QGMA 2PZSA 4E4HA 1FFTB 4AQ2A 4U7NA 3NO8A 4EN6B 2QTSA 1OPMA 3P3NA 1UZ0A 3LUTB 5KHIA 4I55B 2V73A 3A22A 2WO1A 4EWEA 1P8JA 4YIPA 4ICGA 4MXWA 4I3PA 5K7PA 5FYSA 1XRUA 2QSAA 3AMHA 1Q43A 4LBQD 3SCGA 4N43A 2FDHA 5C6CA 1LU2A 5C3QA 1MS1A 4O4IB 3RDIA 4XJ8A 4IV3B 5HXMA 4YRDA 3T0AA 3PL0A 3ZXJA 2A7AA 1OVPA 4KHPB 4UVBA 2R062 1GKBA 5JPNB 1GWKA 3AJYA 3O9OA 2DQ0A 1QJZA 5DUXA 5H9SA 1I08A 1NKGA 2MW2B 3P32A 4FZ0A 1KP2A 2P6JA 2VC9A 1Y43B 1S0EA 1HKDA 4ATEA 1O4YA 1A8MA 3SJAC 2CGPA 3L72H 3ICXA 1GUIA 4LIUA 4Q5OA 2VZ1A 4LKDA 1K92A 4DXRA 3I2JA 5KA5A 2UWCA 2DYRB 2XAJA 1PIV2 3D8CA 4PA7A 1EY2A 1H8TA 3VUOA 2BSKA 3K75B 1W28A 5CKMA 3AFKA
chains in the Genus database with same CATH topology
1C8M3 1GICA 2D43A 3KLSA 2VGDA 3UKTA 3WDUA 1Q8PA 1N1TA 1ZZ6A 2WC2A 4K9SA 1FYUA 4S2GA 4CYDA 4COYA 2A6VA 2DV9A 2ZGSA 5ACA2 1HQLA 4K1ZA 4QMAA 4LBOA 3ACLA 3N7LA 1UN1A 1FMD2 1LHUA 3ILFA 3LOIA 2D3PA 3VZNA 2D5FA 4E27A 1RVF3 3WP6A 5DG2A 1RMU2 2RS32 1COV2 2K0GA 3H8UA 4Z2WA 2A75A 1LEMA 1MQTC 1H8TB 1REEA 1UZZA 3MFCA 1QGLA 2DWRA 3ZSMA 4CDUA 4PLNA 2R063 1RUD1 4PBPA 3VV1A 4HVQA 3W59A 1OMIA 3MYXA 4XDQA 1OA4A 1CAWB 1MZEA 5FLIA 1YWKA 1ND3B 1ULDA 4DNYA 4HSJA 3VZLA 4OI4A 5HXVA 3VBUA 1PK6A 4W6YA 5LK7B 4G9SB 4K1YA 4PIZA 1QU0A 2ZGUA 1VBA2 3HN1A 5JSOA 4RA0A 3S0MA 2I74A 3WX5A 3AP5A 3VKLA 1W6MB 4CP0A 4J1WA 1D4M1 4SBVA 5EXOA 2LTNA 3HT2A 2NZ9A 3LSDA 1J3PA 1IS4A 3DF0A 1QJU2 2ZS6B 2AZ5A 3U11A 2DUQA 4XJ9A 3OGJA 1D4M2 2AREA 4LA2A 1H1MA 4CDXB 3ILRA 3R4SA 4H3WA 2ZAAA 1WW7A 5DZEA 1WW6A 1W6NA 2DURA 2DVDA 2GALA 3JD71 5CFCA 4QM9A 4PF5A 5F1RA 4H14A 4UBGA 3J8F3 3FBMA 3WY6A 4LE3A 3APBA 2B5HA 4QQHA 2RS51 1KS5A 4IEXA 4XETA 4AVSA 3AZZA 1PO12 4NVPA 1Z7S2 4D3WA 4Q4V2 3FWEA 2CAUA 4COWA 5IK5A 1PO11 2ZCWA 4Q4Y3 4AVCA 1RVF1 3W58A 3VBSC 3CO2A 3GNEA 2QKDA 4XFAA 5I0UA 1LESA 3ZX7A 1AL22 3VHNA 1AX0A 1BK1A 2XLFA 3WUDA 1QDOA 1RIRA 2WQ4A 1DQ5A 2DYCA 1NA1C 4IEOA 2MPFA 1AR92 4LBQB 1FXZA 4XXAA 1VRH2 2A5ZA 4ISQA 2P3IA 3WG3A 2PHTA 5JR7B 1QQP2 2ZOEB 1POV1 3EBRA 3THPA 3V0AB 1ZRDA 4C90A 1TME3 1ULFA 3TWIA 3GBWA 3MICA 3D4KA 1M06G 2UU8A 3AMQA 5BUVA 2FZ1A 3WDTA 3WP4A 4XF4A 1V6MA 1LJ7A 2Z79A 4RR3A 2JXAA 3UK9A 3QOPA 4BHPA 1NY72 1FOD3 5JOWA 2ZKNA 1C28A 1WD4A 2IFWA 5DUVA 1EAH1 5JIUA 1C1LA 1X33A 1WLDA 4JTNA 3R6SA 1G9AA 4ONUA 4K3UA 3OBRA 5L7OC 4OFGA 1QJU3 2CWSA 3ETQA 1LU1A 3VBHC 4L92A 2HEWF 1RUI2 4E4DX 2YGMA 1YIPA 2EXJA 4AFAA 4RGAA 3NV4A 2BTVC 2ATFA 4HN0A 2VW0A 3WXPA 2Y0IA 3KCYA 5IK8A 1WMDA 1W6PA 2KM2A 2Q1ZB 3M4FA 2CYFA 3IMNA 1RUI3 4XHBA 1B35A 2DCKA 3JD73 1HQWA 1O5UA 3SCHA 2UWAA 5F6KA 1DBNA 5GALA 4FOWA 1OOPC 2JG8B 2UYBA 3ZN6B 4IV1C 4CP1A 1DS0A 4CVYA 3DN7A 1CAXA 2XJVA 2YXSA 3FLPA 2R16A 3UKVA 2WNUC 3IKWA 3GZTB 1H2LA 2ZKLA 3M3QA 1XNDA 4GALA 4L2NA 1CQ9A 1Q8QA 1ULGA 1A8DA 1ENRA 2WLQA 3USSA 3WW2A 4DZGA 1AXKA 1J59A 4MGIE 2GNDA 5DZGA 4DRVA 4XMIA 2I2SA 4AI1A 4JDOA 1B35B 5FQ0A 2GH2A 1XNBA 3G7DA 2B46X 4QPIC 4D7YA 4ZU7A 5EYYA 4CDWC 3AYAA 4JV4A 3RS6A 2ET1A 3ST7A 1EPZA 4CZSA 4Y24A 3N7MA 1W6OB 5I0TA 4BM8A 1OA3A 1QF3A 4FO9A 1O3SA 4DB5A 3U4XA 2B42B 1PZ9A 1HDKA 2AH2A 1GYKA 2ZTNA 1CD3G 4OI2A 1O5LA 2ZGOA 4YW1A 4RQPC