4FIPC

Structure of the saga ubp8(s144n)/sgf11(1-72, delta-znf)/sus1/sgf73 dub module
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
41
structure length
41
Chain Sequence
TITIDSISNGILNNLLTTLIQDIVARETTQQQLLKTRYPDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
publication title A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 17
structure length 41
sequence length 41
chains with identical sequence G
ec nomenclature
pdb deposition date 2012-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF18519 Sgf11_N SAGA-associated factor 11 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4fipC00
1EBOA 3B77A 1I5YA 1MG1A 1DF4A 5KA6A 1ENVA 2X7RB 3H01A 1Y66A 1QR8A 4JF3A 3CYOA 1JQ0A 1I5XA 3MHHC 3MHSC 2M7WA 5CMUA 5HFLA 2P6JA 5KA5A 4FJCC 1SZTA 4JGSA 3GWOA 5CN0A 3K9AA 5HFMA 4FK5C 3M99B 1F23A 1DLBA 3P30A 4N23A 5H9CA 2MK3A 2EZOA 4JPRA 4E2LA 4N21A 1Y4MA 1QCEA 3B8MA 2LP7A 1DF5A 2EBOA 1MOFA 1QR9A 3CP1A 4FIPC 4G2KA 1JPXA 3B8NA 3WFVA 2EZPA 1K34A 1QBZA 2OT5A 1K33A
chains in the Genus database with same CATH superfamily
3U11A 4R6ZA 3JALB 1Y76B 3A0HZ 3T1HO 3X2QC 2WLHA 3S3XA 2VS0A 5CMUA 3ETGA 5KUMA 5FNVA 2PYLA 2ZD9A 3BFRA 3ETEA 3TXSA 5L3FA 4LF6B 3Q4HB 4NKGB 1P7BA 5LHHA 3CEIA 5JWPA 5BMVB 3K9SA 3OE7G 1E1RG 1FFXA 2ZR3A 2WLLA 2JGDB 4MTOA 5CA3A 1BZKA 2ZE6A 3WU2Z 5DM6V 4MVZA 2VRZA 4X65O 3E8GA 1ZSPA 5JVDA 4DUYB 1V55C 2WWWA 4JYCA 2XAQA 2QE7G 3RW0A 3ZEDA 2PZSA 4JI7O 1AR4A 1XHZA 3ABMC 1NTZH 2LP7A 3RVYA 3RYHA 3B8NA 4JYBA 1JOYA 4MT8A 4IHJB 4PDLA 3RT3C 3ETDA 4LWSA 1I5XA 1NI8A 3ZHUA 4YJ3B 2UXBO 2WLJA 3FB6C 2DE0X 3AG2C 1S77D 3D3IA 3OFNG 4LFAO 5JVDB 2ZR2A 4K0KO 3SYAA 3OR6C 4XDLA 1EFRG 4U3JA 2W6JG 3W7SA 1NTKH 1EN5A 2CH7B 4LWSB 1Z2GA 3SPIA 4FFKA 4XBFA 3ABKB 1SQPH 4QJFB 4LF4B 2KG7B 3RYIA 1P49A 1B3QA 3N2KA 4I7ZB 3QO5A 3CSXA 4DR2O 1M4UA 4X9QA 4J41A 4J7JA 2YIBA 1H2LA 2QM8A 3UO2A 3RYCA 3APQA 4DV6O 1PNKA 4IYIA 4JI6B 4DR5O 1HP8A 1JMKC 1EN4A 1QVFU 5L3EA 1G8MA 3H1KH 3OMIB 1S76D 4B08A 1RPRA 1AP5A 2Z0AA 3ZS8C 5LHIA 3I5DA 1EN6A 1WLEA 1N32O 1FYJA 2Y4TA 3JAKB 3N2KB 2UXDB 1VQOV 1W59A 5ITZA 3SYQA 3LDEA 4JYAB 1BS3A 2E75B 4X66O 2DW4A 4B3SB 3K0GA 4PDVA 2LFSA 3HPLC 2CTPA 2OTJV 1WP7A 4JI3B 3WB1A 2JIZG 2Z5UA 3BCCH 4FZ0A 5IE9A 3I56V 4X64B 1WPXA 2B5UA 3JSLA 5A9GA 4MVSA 4CC5A 3STZC 1VQ9V 4X20B 1M56B 1FS0G 2VQEO 1TVKA 2W6IG 3A0RA 2FB5A 3ABKC 5FLXN 2OCHA 1YTFD 4R50A 4DV0B 2HR3A 4Q20A 4DR7B 4UB8Z 2X6BA 3ZRWB 1OZ0A 3ZX6A 4RO2A 2IH1C 4GX1A 2GSMB 4JI2O 1NTMH 1KBHA 4IYHA 3W7XA 1I94B 4BIZA 4KHPO 3D36A 3K79A 3H01A 4DV5O 2UXCB 1WJZA 1MG1A 3L9DA 4AHCA 5KUKA 1COWG 1YXBA 4WBNB 2EINB 4I55A 1R3IC 5D5QA 4DUZO 2EIKB 3L75H 4QIWF 4MTFA 1ZWIC 5LOVB 3CRAA 1AJPA 1XILA 2NNUA 3OAAG 4JI5B 1BMFG 1GTOA 4NXNO 4LFCO 2YUAA 2GTSA 3OUFA 2Q69A 3BHPA 1XUQA 1YVWA 3F7YC 3K3WA 3MD0A 4J7KA 3QTCA 1GAXA 2XT9A 1MSWD 1CXZB 3BABA 1VEWA 3H9VA 3G67A 1GK9A 4DV7B 4RWUA 1OCZB 4FLXA 1WNSA 2YIBD 4R8CA 4FFBB 1DTOA 3M7MX 3SYPA 1XMQB 2DQ0A 4OXSA 4UVAA 1HNWB 1HW7A 1R73A 4Q6GA 2IJJA 4CS3A 4FLUA 4B3RB 1M56C 5B1BB 1BL8A 5JJJB 1NH2B 1I08A 2IH3C 2XHBA 1XMOO 2QWRB 3THOA 4DR3B 3QNEA 4JAUA 4OGQB 3DTUB 4MW8A 4ZIBA 2EULA 4LF9B 5LMUB 4AI8A 3UQ8A 2N74A 3AG7A 3TCUA 4DXWA 1H38A 4H37A 1JFFB 2EINC 4O4HA 3E22A 1S72V 2WLIA 2EIKC 3ZHRA 2FL4A 1QBZA 1MSDA 3TK1A 1WAZA 3SDLA 4LFBB 2Y0IA 1YZBA 1N8RW 1SETA 2XASA 2PYJA 3WB2A 3CJHA 3TETA 1OHHG 2H94A 3K59A 3W7UA 3CB2A 4O4JA 1GM8A 3CRCA 4NR1A 3CMAV 2JJ1G 3J80N 4PA6A 1ZLZA 4F6RA 2F4VO 1N0NA 4QPKA 4O4IB 4HAMA 2QDOA 1Z5VA 3VBBA 1XNRO 4TV9A 2Q0AA 4FZ1A 2HHHB 2CTQA 2DN9A 1KQSU 4JI8O 1Q82W 4FM0A 1RM1B 4LF7B 2FMLA 1F23A 3JARA 1HNZB 1NVPD 1H2NA 1OJHA 1IBLO 1AI5A 2MW2B 4JPRA 5IJ9B 4KUMA 1AJQA 4DV3B 4UCUA 2UUBB 1EZJA 1Y74A 5B1OA 3SPCA 5CBFA 1XNQO 2QTOA 4JAVA 5B66Z 2A0LA 4JI4B 5KA5A 2QKAA 4EKWA 2ARHA 2ODMA 3EHBB 3LDDA 5IJ0A 3I55V 4P30A 5CA1A 2ADQB 1SF9A 1HDJA 5J2UA 1VQPV 1SA0A 4MVMA 1ZL8B 1TAEA 1VQ5V 3GB7C 1SC5B 3ABLB 4ZOLB 5JCOA 3ZCCA 3P32A 4NTXA 2AHYA 2VWKA 2JDIG 5FPRA 1FFTB 1YCIA 1IXMA 2OCCB 4UCRA 3CCVV 4CC6A 4JI1O 5K1XA 5EZYB 2Q7EA 1K9MW 5LA6A 3IC7A 1IBKO 4TV8A 3VQWA 2F23A 5LYJB 2HFEC 4CH5A 1VQNV 4GKJB 4H13B 2CE4A 3DXRA 2UXXA 2ZM6O 2EZOA 2E74B 4X62B 3SYCA 5KAIZ 3ASOB 1RM1C 2ZDIA 5J9PC 5JQGA 2PTMA 2QWQB 3QO8A 4J10A 2Q0OC 3PN1A 1K3EA 4XDJA 5C93A 5LP6A 4MSWC 2EILC 1BQ0A 4JYYA 2XAHA 2Q9LA 2Y4UA 2C2AA 2O57A 3JD1A 3K5OA 3JCUZ 2YC0A 4MVOA 2CAZC 3ZMUA 3DXRB 2WA4A 2R70A 1LNQA 2RNBA 2DYSB 4I4TB 5B1AB 4MVQA 3L73H 3T1YB 4DV4B 1KP2A 2E5LB 5LXTA 5LP6B 3PJSK 3ZRXA 3ABLC 4PD4F 3UM7A 5L3GA 2VQFB 2DJVA 1R6TA 3L72H 4G2KA 4NTWA 2K9PA 3AK3A 3ICXA 2PI5A 4B3MO 5LGTA 4WCEV 1K8AW 1DF4A 2OCCC 3F5TA 4HYOA 2LGWA 4OX9O 1WP8A 4OPHA 1V55B 1MMMA 3KCYA 5JJNB 5CB4B 1M93A 3T1HB 1XBLA 2JJ2G 2W0FC 1SQGA 5E1AC 2XNDG 5EYPA 2P90A 2CTRA 2BE3A 5IDJA 4TUYA 1VF6A 2QWPB 4X1YB 2UUAO 4YXWG 4N21A 4LNUB 3OTOO 1H2GA 4WFEA 3ZBHA 4PA7A 4YIPA 1XEQA 3B77A 3SGIA 5KAFZ 2B1IA 1MZEA 3OM3B 5KMGA 3K06A 3ASOC 5KX5B 3L70H 4NYKA 1PL0A 1Q6IA 4J9YB 1RP3B 4UCVA 4YY3O 1OCCB 5H6QA 4X65B 2LQTA 5JH7A 4I50A 2FYUH 5FL7G 4WFGA 1JX9A 1N36O 1L1FA 1Q90D 3IGAC 1X4TA 4LF5B 4TSFG 4GYCB 4IL6Z 1NZ6A 2JEUA 2CGNA 5IYCO 1W0KG 4N23A 2UXBB 2IJHA 2ZDIC 2DYSC 2HLDG 3M8AA 4H33A 5BY1A 5B1AC 5F2VO 4BIUA 3BPZA 4LFAB 5LP6C 4I50B 3E8FA 4B3TO 1YEWA 2P22C 2N04A 3HKBA 4DV2B 1LUVA 3VOUA 2E76B 4I5SA 3BEHA 5IWAB 2XOKG 1K5QA 4O2AA 2Q4PA 3O65A 3OEEG 1BT8A 4IT5A 4J9ZB 2XAGA 4W4LA 5KHKA 1SKVA 5FNVB 1US6A 1N33O 4GKKB 5H6RA 2X0LA 3CCSV 4KL1A 3ABTA 5IY5B 3JD2A 1V54C 3CCJV 1FFXB 1N4CA 4UVCA 1BQZA 2WLLB 2XAFA 4DR2B 2ZNJA 3JATA 2UUCB 4DV6B 2XTAA 4PA3A 3RWRD 2BSKA 1PM9A 1THZA 4D6TH 1VIBA 2RJZA 1QU7A 3SR2C 2JK5C 1OCCC 2AGAA 4ASUG 3CX5F 1YTFB 4X88A 1VQKV 1KU9A 4I9WA 3SPGA 2WAMA 3RYHB 4CH4A 2D3OW 2E3CA 4FM2A 4I9QA 1VF6C 5IT9N 4LF6O 2YIDA 4CS4A 4MTGA 2ETNA 4DR1O 3QVNA 3JATB 1DF5A 2CUGA 3FYEB 3LNNA 4GLXA 3U10A 4X66B 2OT5A 3K58A 4FLVA 5KHJA 3H1LH 1D5AA 4PHZA 1QQCA 1VARA 4FJCC 1JA8A 3EXAA 2NLJC 1N34O 4F6EA 3WG7B 3BA9A 1WB7A 4U3JB 4J80A 3ASNC 2Q73A 4JASA 4PI2A 4J42A 3AG4B 4KP4A 4R7CA 3SJQC 1R3LC 2GV9A 3UCSC 2VQEB 3T4ZA 3ZHQA 5IYZA 3RYIB 4MW3A 2B1GA 2KKWA 1F7YA 2ZQMA 3R65A 5IY5C 5EC2C 3RYCB 3RBZA 1F4MA 1R3KC 3J81N 1XREA 1AI4A 3TJTA 3A8TA 3STLC 2ZCEA 3BA8A 1ORQC 4JI0B 1R6KA 3K57A 1AR5A 2ZIMA 1FPOA 1GN6A 5LBQA 3AK2A 3SJBC 5IYZB 4DUZB 4J11A 4LF4O 2ITCC 4EB6A 4L8JA 3TXQA 5ITZB 1FXKA 5L3DA 4YJ2A 4IIJA 2M6YA 4FMTA 4K3AA 1PKXA 4A5UB 3NR7A 4NXNB 4LFCB 4LC1A 4JGSA 3OR7C 2KB1A 4NVPA 4NXMO 1GH6A 1FAFA 2V1DA 2PUSA 3ZMZA 2RCVA 1Q8IA 3APOA 2CDYA 4GZRB 4DW1A 3WG7C 1AI6A 1EBOA 1OCRB 1QLEB 5KA6A 3HKCA 4MS2A 4O2BA 1NKDA 2DWEC 4P2ZA 1Q7YW 3AG4C 3CC7V 2A9HA 2P6JA 1SZTA 1TVKB 3CC2V 1TUBA 3K9AA 1PNMA 1HWYA 5LGUA 1GKFA 4UV9A 1HNXO 1XI1A 4FLZA 2QM4A 1XMOB 4JI3O 2D2CB 1DK1A 4GX0A 1QLNA 2EIJB 5H2FZ 1BHBA 2LJ2A 3AG3B 4X64O 1Q5OA 1S3JA 2V4DA 3CS5A 1I7FA 1CP9A 1AROP 4K8XA 1NVPB 4DK0A 4I55B 1S5LZ 3WB0A 3OMAB 2G38A 1IVSA 4NB5A 1NR1A 1GN2A 4MVUA 2EZPA 3OEHG 1L0NH 3HB3B 3K03A 2IJKA 2AW9A 3KKYA 2R9RB 4GT1A 5EBWC 5CBHA 2A3QA 4DW0A 4X1KA 4X1IA 3RFRA 2KSDA 4FLYA 2UXCO 2YSUB 3CPWU 2QEXV 3BY6A 4ZBMA 3ZHVA 2OIEA 5EIBD 3DSQA 4H0LB 1Q6UA 3D3QA 4P9PA 4B7EA 2IJIA 4D7SA 2F4VB 2UU9O 4TQFA 1J5EO 1GMGA 3CCQV 5GONA 1B6QA 3MAQA 2QR4A 1OCRC 1QLEC 1YF2A 1KKCA 4GX5A 4JI8B 4DR4B 2DMXA 4O4LA 1JJ2U 4LF8B 1IBLB 2QWOB 3CMEV 1K33A 4U7NA 4AQYO 4C7UA 2IBZH 2GDSA 3E83A 5B3SB 3CCUV 3F7VC 3AG1B 2UXNA 2EIJC 1KP3A 2PI4A 3AG3C 4DR6O 4PJ0Z 1IXBA 4TT3G 3D36C 3ZMVA 1SQQH 3C3TA 3BRCA 3RVZA 4O4HB 3E22B 1H2SB 1LUWA 2YI8A 2WLIB 1URFA 3SYOA 1PL4A 2OIGA 1M57B 1P4RA 3P3NA 4TOIA 4DR3O 2P67A 3CCMV 4JTCB 2DYRB 3EVKA 1Q43A 4LF9O 3IJ4A 4YHHO 3CJHB 1NQTA 3ML0A 2EILB 5EK0A 4O4JB 3LSUA 4F6RB 3J7AU 2F43G 4Z1VA 4ZHQA 1JVMA 4JAAA 1IBKB 2XAJA 1VF7A 4TV9B 4PA9A 1SS3A 3FB7C 4EFBA 3FB5C 3CD6V 3H1HH 1B06A 2QKSA 4WFFA 1WA8A 4CH6A 1GN4A 1KYOF 3JARB 5A2QN 4GX2A 2ZM6B 2OWOA 4LCUC 3HKEA 1FXVA 2W0XA 3RYFA 1BHAA 3LSQA 1YI2V 4MTXA 1Y74B 4UB6Z 1L0LH 2QKCA 3DC6A 4WFHA 1HR0O 3OUSA 5B3SC 2P4VA 4UFZA 3AG1C 4E2LA 5IJ0B 2EX3A 2Q7GA 5CA1B 3K5MA 5J2UB 1WA8B 1SA0B 1YSCA 2Q5ZA 3MDSA 4LH6A 1HNZO 1IBMB 1SRYA 4BR6A 3C3SA 1MABG 4UUJC 2DQ3A 3JASA 3P30A 4ZI7A 4DV1O 4PI0A 1M57C 4DV3O 2LO1A 3VQXA 3LUTB 1YITV 1K34A 3IC9A 2F66C 4RUFA 2DYRC 2P06A 1JR9A 3L71H 2DWDC 1K97A 4B3MB 2RQ6A 2HJFC 4UV8A 2YEVA 3ZHTA 5LA6B 3E2EA 1UFIA 2AHZA 2JRIA 1Y67A 4K35A 4W4KA 5CA0A 4TV8B 2VWJA 3L74H 2ZE8A 3JASB 4ZI7B 2UUAB 2BTQA 4KFMA 4P9OA 1H8EG 2Q6AA 4QE9A 5BXZA 1TA8A 5J2TA 3JD3A 5JQGB 1ROPA 3E8HA 1U96A 1H2MA 4IGGA 1K4CC 4BW9A 1M9NA 2QJ1A 1DGSA 1IDSA 2FTKA 3B40A 5TISZ 1WB8A 4YY3B 2HVKC 3UT5A 1TUEB 2L35A 1SESA 2ZE5A 3QG5A 2CGOA 2R72A 1WPBA 5LMNO 1N36B 5D5PA 3W7WA 1IX9A 2BTQB 3FB8C 1O9GA 4FM1A 5J2TB 4X62O 1VQ4V 2QTSA 1V54B 4I0XA 5FPOA 1JCHA 1MOFA 3BAAA 3CP1A 5LXTB 5JCOC 3UT5B 2P4KA 1G1XB 1F51A 2QM7A 1O9HA 4DRXA 1FJGO 3FFQA 2QSAA 3K5LA 3G4SV 2RDCA 3JALA 4RQFA 1Y76A 5EYPB 5L3BA 2JVDA 1NBMG 4BAYA 5BR8O 3W7TA 3OW2U 4TUYB 1I0HA 4JI7B 4I0XB 5LHGA 1N33B 2EIMB 4JF3A 1QR8A 4DYLA 5CBGA 3CYOA 3D8CA 3MHSC 1SQVH 3O9OA 3QF7A 3Q4HA 3U0ZA 5KMGB 1BCCH 1KUQA 2JGDA 1XOUA 5LGNA 3GWKC 3H1IH 3E86A 4JZGA 3FYIB 4CBCA 5JH7B 4L87A 4K0KB 4JV5O 5JJEB 4OPAA 2JGUA 2YXYA 3KCXA 3ASNB 1G4YB 3UO3A 1VQLV 3KZIZ 2HG5C 2V7QG 2ZNIA 4ZKIA 4IHJA 4DR1B 2YS8A 2NR5A 4YJ3A 1GN3A 3EFFK 1QNMA 2X6AA 1J95A 2F93B 1H2KA 3AEIA 2YXHA 2Q8VA 4F4LA 2Z3YA 3FAVA 1S0VA 3HKBB 4YIOA 2AZ0A 1K5SA 1N34B 4DR5B 2YXLA 2WSSG 3E8BA 4O2AB 4LF5O 2PGGA 1KD1W 3F5WC 1OCOB 1K73W 2H3OA 1ZUQA 2ITDC 3BVOA 2CH7A 2WLMA 2OTLV 2NN4A 3ETQA 2M7WA 5LL6Y 2HVJC 3T2MA 2P5OA 1FKAO 1N32B 4QGPA 4DK1A 2KG7A 2EIMC 1YDXA 1UPGA 3ZRVA 3FAVB 1FXHA 2HKOA 1ZAUA 4QPJA 4UCTA 5KLVH 4DV2O 1F4NA 4EFEA 2BSKB 1R3JC 1I5YA 1Y6XA 4LR3A 5IWAO 4DUYO 1N0JA 1CEZA 3DC5A 5EBMC 4BWAA 4DO2A 1K92A 3JAMN 1VQ7V 1M1KW 1V9PA 2ZINA 4GKKO 4LP8A 1KECA 4K8ZA 3KG2A 3JAKA 1GO3F 1AJNA 1GRJA 4KXRA 2DOSA 4NTYA 2P7TC 1D2DA 2UUCO 3FKSG 2HP8A 4X89A 4WF9V 1T5EA 3TGUH 3LSSA 4HZ3A 3ZMSA 3JYCA 4NXMB 4U3FH 2Y69B 1QCEA 3B4SA 1EM1A 4JI2B 2WLKA 1PD3A 1QHTA 3G6BA 2IW5A 2Q68A 4KHPB 1Y66A 3N27A 4DV5B 1OCOC 3AK1A 2PY5A 1R1BA 4X20A 3GVMA 4G28B 1D5NA 2HEPA 4GCZA 1HNXB 1JJOA 4LH7A 1K4DC 2N05A 1NJIW 1MA1A 1SERA 4JI6O 3ZRWA 5GTHZ 3LNMB 3HR0A 4UXNA 2ADPA 3CRQA 3VQYA 2WPDG 4AILC 1SQBH 1NU1H 1Y4MA 1OV9A 4WBNA 2A7WA 1JPXA 4EB6B 1BE3H 2UXDO 1FXKB 4YJ2B 4IIJB 3B09A 3MHHC 3JD0A 4JYAO 5LOVA 3QO7A 3GWOA 2Y0PA 5CN0A 3ZRSA 1YJWV 2ZXWB 5E79Z 1LR1A 2IU0A 4ABMA 2EJ7A 2K1EA 4HNAA 4B3SO 1KB9F 4JI0O 1AILA 3OMNB 2BOCC 3NXSA 3CRMA 2OYQA 2ZIOA 2Y69C 3RN4A 1QVGU 1E1QG 2AZ2A 3JCZA 5KHGA 3G6EV 2UU9B 1J5EB 2JS5A 3HKCB 4FFBA 3A0BZ 2X6CA 4O2BB 2QWNB 2JEXA 1P84F 1TUBB 3OGCC 2AXTZ 4QE7A 4HNAB 4ICGA 1W2BU 4WFAV 3H1JH 4DV0O 2EJRA 5EIBC 1L8DA 1VQ8V 4E4EA 2JS3A 4DR7O 1WN7A 4AQYB 4PA4A 1Q6HA 2H8PC 5IYDO 4FLWA 3B2EE 3CXHF 1I94O 1A32A 1GM7A 1XL6A 5DN6G 5B5EZ 4DR6B 3IFXA 2YDEA 2WA3A 1PP9H 4JZ2A 2B9ZA 4RUEA 2PF4E 4BIOA 1M90W 1JFFA 5HFLA 3K04A 4FPPA 1NR7A 1XNRB 1FXKC 4JI5O 2MK3A 1VMGA 4Z2WA 3N2GA 1RSOA 2ZXWC 1IZ3A 4X1KB 4X1IB 4YHHB 3RGBA 2Q7HA 4Z1MG 4X8AA 3G71V 1BSMA 4DV7O 1XNQB 1Q81W 1NS1A 1ZTEA 3ZMTA 1ZX3A 4HBNA 5GONB 1XMQO 4O4IA 5KHIA 1VQ6V 2LGQA 2XUMA 5IYBO 1HNWO 3CC4V 1GM9A 3SPHA 4B3RO 1KC8W 3N2GB 4UVBA 1P7GA 2YI9A 1RSOB 3R66A 4O4LB 1B04A 1JQ0A 4MVRA 1VQMV 4D7TA 3K0DA 2WLNA 5IJ9A 5L3CA 3FX7A 5BZBA 4TQDA 1R6NA 1XDCA 2CK3G 5LMUO 3CRRA 3HKDA 1HR0B 1QR9A 3VQVA 1S5HC 1YHQV 1KKDA 3DGEA 1OCZC 2X7RB 4JI1B 1RPOA 2RMKB 3FD9A 5EBLC 2ZKOA 2F1MA 1MNGA 4PV1B 4UCSA 3ZN0A 4DR4O 2A79B 1TGOA 1ZL8A 4LF8O 5B1BC 1PNLA 4LBEC 4B7KA 4LFBO 4J7ZA 2GBOA 4DV1B 2EBOA 4ZOLA 3ZHSA 1PV0A 4XDKA 3HKDB 5K1PA 3ZJZA 2F95B 1RFYA 1M5IA 1YJNV 2LW7A 5HFMA 3UKMA 2GTAA 3M99B 1YIJV 1NH2D 1DLBA 2ATKC 5EZYA 3G80A 4ZHQB 3K5NA 1W0JG 4CZZA 1UJWB 1AVMA 3B8MA 4UCOA 3WFVA 1XL4A 1XQ8A 3JAWA 4CH3A 2QA4V 2YIAA 3JD4A 5LYJA 2HHHO 1BGYH 2QGNA 4LF7O 3HKEB 2IM9A 3RYFB 2YICA 2FKXA 3CCLV 3C90A 3ZIAG 2R9IA 3CCEV 3SJAC 2UUBO 3S3WA 5KHHA 3OT7A 3ZN1A 2BOBC 3E35A 4GUNA 4JI4O 2KQXA 1SQXH 3JAWB 1FD9A 1G6UA 5LMNB 5AG2A 1MZFA 2HJDA 4OX9B 1XHXA 4JTAB 3ABUA 3CXCU 2LW1A 5GTIZ 5GW7A 3SPJA 5DECA 4CS2A 4PELA 4I4TA 1VF5B 2ZT9B 1ENVA 3SJCC 3OTOB 3OTFA 4G27B 1E79G 3CE2A 5EC1C 1X59A 2IU3A 4U7OA 3IAYA 5DEDA 2GUZA 3X2QB 2YEVB 1FJGB 4H44B 2BCCH 3CCRV 3CHXA 2L6LA 5CA0B 1IURA 5CB4A 1AI7A 2ZE7A 1IBMO 1CPYA 1NT2B 4BW5A 5BR8B 3LDCA 1H8HG 3E89A 4GKJO 2Q67A 4X1YA 3JSNA 4WFBV 1AB3A 3OGIB 1Q3EA 1YJ9V 4FK5C 4LNUA 4EEQA 5H5NA 1PPJH 3P3PA 1EZVH 1KMIZ 5B1NA 4FVMA 3OD4A 2RN9A 2GHYA 1S5JA 5KX5A 2GUZB 2CTWA 1AR1B 1AP6A 4TWKA 3T1CA 4QNHB 4RQEA 2R9AA 1Q86W 4B3TB 3K08A 4JV5B 3ABMB 1VP7A 1SQFA 2A06H 2ILMA 1K7DA 2BTOA 5C8YA 1Z5WA 4FLTA 1SZXA 4FIPC 1U97A 3AG2B 2LFRA 2Y48A 3T1YO 4DV4O 2E5LO 3CWBH 5BMVA 2VQFO 4PDMA 4JTDB 5H9CA 5C8YB 4DRXB 4PDRA 3T4DA 4RAIA 3A2FA
chains in the Genus database with same CATH topology
4R6ZA 2IW5A 3X2QC 2Q68A 4P9PA 2IJIA 1Y66A 3IC7A 2WLHA 1GMGA 3CCQV 5CMUA 1B6QA 1OCOC 3ETGA 5KUMA 1OCRC 1QLEC 2HFEC 1VQNV 4G28B 2ZD9A 3ETEA 5L3FA 4GX5A 2UXXA 1P7BA 5LHHA 2EZOA 4GCZA 1JJ2U 3SYCA 3ASOB 1RM1C 3OE7G 1E1RG 2ZDIA 5J9PC 2ZR3A 2WLLA 3CMEV 1K4DC 1K33A 4U7NA 4MTOA 3QO8A 5CA3A 1NJIW 1SERA 3ZRWA 1K3EA 3E83A 4XDJA 5C93A 5B3SB 3LNMB 5DM6V 3F7VC 3AG1B 4MSWC 3CCUV 2EILC 4MVZA 2UXNA 2EIJC 3E8GA 1KP3A 4UXNA 2PI4A 3AG3C 2XAHA 1V55C 2WWWA 4JYCA 2XAQA 2QE7G 3RW0A 2C2AA 4TT3G 2WPDG 3ZMVA 3JD1A 3ABMC 1Y4MA 2LP7A 4MVOA 3RVYA 1JPXA 3B8NA 3ZMUA 3RVZA 4JYBA 1JOYA 1FXKB 2WLIB 4MT8A 3SYOA 4PDLA 3ETDA 1LNQA 1I5XA 3MHHC 3JD0A 1M57B 1P4RA 2DYSB 3QO7A 2P67A 3GWOA 5CN0A 3ZRSA 3CCMV 1YJWV 2ZXWB 5B1AB 4MVQA 2WLJA 3FB6C 3AG2C 1KP2A 4JTCB 2IU0A 1S77D 2K1EA 3PJSK 3ZRXA 2DYRB 3ABLC 3D3IA 3OFNG 3UM7A 5L3GA 2ZR2A 3OMNB 2BOCC 4G2KA 3NXSA 1NQTA 3SYAA 2PI5A 3ML0A 5LGTA 4WCEV 1K8AW 2EILB 3OR6C 5EK0A 4XDLA 1DF4A 2OCCC 4HYOA 2Y69C 1V55B 1QVGU 1E1QG 1EFRG 3JCZA 2F43G 2W6JG 3W7SA 3G6EV 2JJ2G 2W0FC 1JVMA 5E1AC 2XNDG 2P90A 2X6CA 2XAJA 5IDJA 4PA9A 3SPIA 3FB7C 4XBFA 3FB5C 3CD6V 2JEXA 2QKSA 4WFFA 4YXWG 3ABKB 3OGCC 4N21A 4QJFB 1H2GA 4WFEA 4GX2A 4QE7A 4PA7A 4LCUC 1W2BU 3B77A 4WFAV 3QO5A 1FXVA 1BHAA 2EJRA 2B1IA 3OM3B 1VQ8V 3K06A 2QM8A 3ASOC 3LSQA 1YI2V 4PA4A 1PL0A 2H8PC 4J9YB 1PNKA 5IYDO 4MTXA 1QVFU 4WFHA 1GM7A 1OCCB 5L3EA 1G8MA 1XL6A 5DN6G 3OUSA 5H6QA 3OMIB 5B3SC 3AG1C 5FL7G 1S76D 4E2LA 4WFGA 3IFXA 1JX9A 1RPRA 1L1FA 3IGAC 4RUEA 5LHIA 4TSFG 1M90W 1WLEA 1YSCA 5HFLA 1VQOV 3K04A 1SRYA 3SYQA 2JEUA 4FPPA 1MABG 1NR7A 4UUJC 2DQ3A 1FXKC 3LDEA 5IYCO 1W0KG 3P30A 4N23A 2IJHA 2MK3A 1M57C 2DYSC 2ZDIC 2DW4A 2HLDG 2ZXWC 3LUTB 4H33A 1YITV 5B1AC 3K0GA 4PDVA 4BIUA 1K34A 2LFSA 4RUFA 3E8FA 3HPLC 2DYRC 2OTJV 4Z1MG 2DWDC 4X8AA 3G71V 1K97A 2JIZG 2Z5UA 3VOUA 2HJFC 4I5SA 4UV8A 2YEVA 3I56V 3E2EA 3BEHA 1WPXA 1Q81W 2XOKG 1K5QA 2AHZA 2B5UA 3ZMTA 4MVSA 3OEEG 4J9ZB 3STZC 2XAGA 1VQ9V 1VQ6V 1M56B 1FS0G 5IYBO 3CC4V 1GM9A 3SPHA 5H6RA 4KFMA 2X0LA 1KC8W 2W6IG 3A0RA 4UVBA 4P9OA 3CCSV 1H8EG 2Q6AA 3ABTA 3ABKC 4QE9A 5IY5B 3JD2A 1V54C 1JQ0A 3JD3A 4MVRA 3CCJV 1VQMV 1YTFD 4UVCA 1ROPA 2WLLB 2XAFA 4R50A 3E8HA 2HR3A 3K0DA 2WLNA 4Q20A 5L3CA 1K4CC 2X6BA 3ZRWB 5BZBA 1M9NA 1OZ0A 1R6NA 4RO2A 2IH1C 4GX1A 2GSMB 4PA3A 2FTKA 2CK3G 1THZA 3W7XA 4BIZA 2HVKC 1TUEB 1QR9A 1SESA 3D36A 3K79A 2JK5C 1OCCC 3H01A 4ASUG 1S5HC 1YHQV 1YTFB 3DGEA 1MG1A 1KKDA 1OCZC 4X88A 1VQKV 2X7RB 5KUKA 4I9WA 1COWG 1RPOA 5EBLC 3SPGA 2EINB 2WAMA 1R3IC 3W7WA 3FB8C 2D3OW 2EIKB 3ZN0A 2A79B 4MTGA 4QIWF 1VQ4V 5B1BC 4MTFA 1ZWIC 1AJPA 1PNLA 2NNUA 3OAAG 4LBEC 1V54B 1DF5A 1BMFG 3FYEB 1GTOA 2EBOA 1JCHA 1MOFA 3CP1A 2OT5A 4XDKA 3OUFA 3ZJZA 2Q69A 1YJNV 1F51A 4FJCC 2QM7A 3F7YC 3K3WA 3MD0A 1MSWD 5HFMA 2NLJC 3UKMA 3M99B 1YIJV 1NH2D 1DLBA 1GK9A 2ATKC 3WG7B 3G4SV 3ASNC 1W0JG 1OCZB 4CZZA 4RQFA 5L3BA 4JASA 4R8CA 1UJWB 3B8MA 1DTOA 3AG4B 4KP4A 4R7CA 3SYPA 3WFVA 1NBMG 1XL4A 4BAYA 3SJQC 3W7TA 3OW2U 1R3LC 2DQ0A 4OXSA 4UVAA 2QA4V 1R73A 3JD4A 5LHGA 2IJJA 2EIMB 4JF3A 1QR8A 3T4ZA 5CBGA 3CYOA 1M56C 5B1BB 3MHSC 1BL8A 4MW3A 1NH2B 2B1GA 2IH3C 2ZQMA 3R65A 5IY5C 5EC2C 3CCLV 3RBZA 3QNEA 4JAUA 1F4MA 1R3KC 3ZIAG 2R9IA 3DTUB 5LGNA 3CCEV 1AI4A 4MW8A 3STLC 3E86A 1ORQC 3ZN1A 1R6KA 3FYIB 2BOBC 3E35A 4CBCA 4L87A 5LBQA 3TCUA 3ASNB 1G4YB 1VQLV 4JTAB 3ABUA 4DXWA 1H38A 2ITCC 4H37A 2HG5C 2EINC 2V7QG 4ZKIA 3CXCU 1S72V 1FXKA 2WLIA 5L3DA 2EIKC 5GW7A 3SPJA 4FMTA 1QBZA 4PELA 3TK1A 3EFFK 1PKXA 1ENVA 2X6AA 1J95A 4G27B 1E79G 1N8RW 1SETA 2XASA 3AEIA 4LC1A 5EC1C 4JGSA 3OR7C 4F4LA 2IU3A 4U7OA 2Z3YA 2KB1A 3TETA 1S0VA 1OHHG 2H94A 3W7UA 2V1DA 3ZMZA 1K5SA 3X2QB 2YEVB 1GM8A 2WSSG 3E8BA 3CCRV 3CMAV 2JJ1G 1KD1W 4PA6A 3F5WC 1OCOB 1K73W 4QPKA 1AI7A 3WG7C 1AI6A 1CPYA 1EBOA 1OCRB 2ITDC 1QLEB 5KA6A 4MS2A 4HAMA 4BW5A 3VBBA 3LDCA 1H8HG 1NKDA 2WLMA 2DWEC 3E89A 4P2ZA 1Q7YW 3AG4C 2OTLV 2M7WA 3CC7V 2A9HA 2P6JA 2HVJC 1SZTA 2Q67A 3T2MA 3CC2V 4WFBV 1KQSU 3K9AA 1PNMA 1YJ9V 4FK5C 1Q82W 1RM1B 1HWYA 1F23A 5LGUA 1GKFA 2EIMC 4UV9A 1NVPD 1AI5A 3ZRVA 4JPRA 1FXHA 5B1NA 4KUMA 2GHYA 2HKOA 1AJQA 4QPJA 1F4NA 4GX0A 1QLNA 2EIJB 1EZJA 1I5YA 1R3JC 1AR1B 1BHBA 4TWKA 3AG3B 3T1CA 5B1OA 3SPCA 4QNHB 5CBFA 4RQEA 1S3JA 2QTOA 1Q86W 4JAVA 1CP9A 2A0LA 1AROP 5KA5A 3K08A 4EKWA 3ABMB 1NVPB 1CEZA 3LDDA 3EHBB 3I55V 4P30A 5EBMC 1K7DA 4DO2A 1K92A 1VQ7V 3OMAB 1M1KW 4LP8A 1KECA 1VQPV 4MVMA 3KG2A 1NR1A 4FIPC 4MVUA 1GO3F 1AJNA 2EZPA 3HB3B 3K03A 3OEHG 1VQ5V 3GB7C 2IJKA 3AG2B 2LFRA 2P7TC 3ABLB 2Y48A 2R9RB 4GT1A 3ZCCA 3FKSG 5EBWC 1PD3A 4X89A 5CBHA 3P32A 4WF9V 2AHYA 2JDIG 1FFTB 3LSSA 4JTDB 4PDMA 1IXMA 5H9CA 4HZ3A 3ZMSA 2OCCB 3JYCA 3CCVV 2Y69B 2YSUB 3CPWU 1QCEA 2QEXV 3BY6A 4ZBMA 4PDRA 3T4DA 1K9MW 2WLKA 4RAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EBO A;  3B77 A;  1I5Y A;  1MG1 A;  1DF4 A;  5KA6 A;  1ENV A;  2X7R B;  3H01 A;  1Y66 A;  1QR8 A;  4JF3 A;  3CYO A;  1JQ0 A;  1I5X A;  3MHH C;  3MHS C;  2M7W A;  5CMU A;  5HFL A;  2P6J A;  5KA5 A;  4FJC C;  1SZT A;  4JGS A;  3GWO A;  5CN0 A;  3K9A A;  5HFM A;  4FK5 C;  3M99 B;  1F23 A;  1DLB A;  3P30 A;  4N23 A;  5H9C A;  2MK3 A;  2EZO A;  4JPR A;  4E2L A;  4N21 A;  1Y4M A;  1QCE A;  3B8M A;  2LP7 A;  1DF5 A;  2EBO A;  1MOF A;  1QR9 A;  3CP1 A;  4FIP C;  4G2K A;  1JPX A;  3B8N A;  3WFV A;  2EZP A;  1K34 A;  1QBZ A;  2OT5 A;  1K33 A; 
#chains in the Genus database with same CATH topology
 3U11 A;  4R6Z A;  3JAL B;  1Y76 B;  3A0H Z;  3T1H O;  3X2Q C;  2WLH A;  3S3X A;  2VS0 A;  5CMU A;  3ETG A;  5KUM A;  5FNV A;  2PYL A;  2ZD9 A;  3BFR A;  3ETE A;  3TXS A;  5L3F A;  4LF6 B;  3Q4H B;  4NKG B;  1P7B A;  5LHH A;  3CEI A;  5JWP A;  5BMV B;  3K9S A;  3OE7 G;  1E1R G;  1FFX A;  2ZR3 A;  2WLL A;  2JGD B;  4MTO A;  5CA3 A;  1BZK A;  2ZE6 A;  3WU2 Z;  5DM6 V;  4MVZ A;  2VRZ A;  4X65 O;  3E8G A;  1ZSP A;  5JVD A;  4DUY B;  1V55 C;  2WWW A;  4JYC A;  2XAQ A;  2QE7 G;  3RW0 A;  3ZED A;  2PZS A;  4JI7 O;  1AR4 A;  1XHZ A;  3ABM C;  1NTZ H;  2LP7 A;  3RVY A;  3RYH A;  3B8N A;  4JYB A;  1JOY A;  4MT8 A;  4IHJ B;  4PDL A;  3RT3 C;  3ETD A;  4LWS A;  1I5X A;  1NI8 A;  3ZHU A;  4YJ3 B;  2UXB O;  2WLJ A;  3FB6 C;  2DE0 X;  3AG2 C;  1S77 D;  3D3I A;  3OFN G;  4LFA O;  5JVD B;  2ZR2 A;  4K0K O;  3SYA A;  3OR6 C;  4XDL A;  1EFR G;  4U3J A;  2W6J G;  3W7S A;  1NTK H;  1EN5 A;  2CH7 B;  4LWS B;  1Z2G A;  3SPI A;  4FFK A;  4XBF A;  3ABK B;  1SQP H;  4QJF B;  4LF4 B;  2KG7 B;  3RYI A;  1P49 A;  1B3Q A;  3N2K A;  4I7Z B;  3QO5 A;  3CSX A;  4DR2 O;  1M4U A;  4X9Q A;  4J41 A;  4J7J A;  2YIB A;  1H2L A;  2QM8 A;  3UO2 A;  3RYC A;  3APQ A;  4DV6 O;  1PNK A;  4IYI A;  4JI6 B;  4DR5 O;  1HP8 A;  1JMK C;  1EN4 A;  1QVF U;  5L3E A;  1G8M A;  3H1K H;  3OMI B;  1S76 D;  4B08 A;  1RPR A;  1AP5 A;  2Z0A A;  3ZS8 C;  5LHI A;  3I5D A;  1EN6 A;  1WLE A;  1N32 O;  1FYJ A;  2Y4T A;  3JAK B;  3N2K B;  2UXD B;  1VQO V;  1W59 A;  5ITZ A;  3SYQ A;  3LDE A;  4JYA B;  1BS3 A;  2E75 B;  4X66 O;  2DW4 A;  4B3S B;  3K0G A;  4PDV A;  2LFS A;  3HPL C;  2CTP A;  2OTJ V;  1WP7 A;  4JI3 B;  3WB1 A;  2JIZ G;  2Z5U A;  3BCC H;  4FZ0 A;  5IE9 A;  3I56 V;  4X64 B;  1WPX A;  2B5U A;  3JSL A;  5A9G A;  4MVS A;  4CC5 A;  3STZ C;  1VQ9 V;  4X20 B;  1M56 B;  1FS0 G;  2VQE O;  1TVK A;  2W6I G;  3A0R A;  2FB5 A;  3ABK C;  5FLX N;  2OCH A;  1YTF D;  4R50 A;  4DV0 B;  2HR3 A;  4Q20 A;  4DR7 B;  4UB8 Z;  2X6B A;  3ZRW B;  1OZ0 A;  3ZX6 A;  4RO2 A;  2IH1 C;  4GX1 A;  2GSM B;  4JI2 O;  1NTM H;  1KBH A;  4IYH A;  3W7X A;  1I94 B;  4BIZ A;  4KHP O;  3D36 A;  3K79 A;  3H01 A;  4DV5 O;  2UXC B;  1WJZ A;  1MG1 A;  3L9D A;  4AHC A;  5KUK A;  1COW G;  1YXB A;  4WBN B;  2EIN B;  4I55 A;  1R3I C;  5D5Q A;  4DUZ O;  2EIK B;  3L75 H;  4QIW F;  4MTF A;  1ZWI C;  5LOV B;  3CRA A;  1AJP A;  1XIL A;  2NNU A;  3OAA G;  4JI5 B;  1BMF G;  1GTO A;  4NXN O;  4LFC O;  2YUA A;  2GTS A;  3OUF A;  2Q69 A;  3BHP A;  1XUQ A;  1YVW A;  3F7Y C;  3K3W A;  3MD0 A;  4J7K A;  3QTC A;  1GAX A;  2XT9 A;  1MSW D;  1CXZ B;  3BAB A;  1VEW A;  3H9V A;  3G67 A;  1GK9 A;  4DV7 B;  4RWU A;  1OCZ B;  4FLX A;  1WNS A;  2YIB D;  4R8C A;  4FFB B;  1DTO A;  3M7M X;  3SYP A;  1XMQ B;  2DQ0 A;  4OXS A;  4UVA A;  1HNW B;  1HW7 A;  1R73 A;  4Q6G A;  2IJJ A;  4CS3 A;  4FLU A;  4B3R B;  1M56 C;  5B1B B;  1BL8 A;  5JJJ B;  1NH2 B;  1I08 A;  2IH3 C;  2XHB A;  1XMO O;  2QWR B;  3THO A;  4DR3 B;  3QNE A;  4JAU A;  4OGQ B;  3DTU B;  4MW8 A;  4ZIB A;  2EUL A;  4LF9 B;  5LMU B;  4AI8 A;  3UQ8 A;  2N74 A;  3AG7 A;  3TCU A;  4DXW A;  1H38 A;  4H37 A;  1JFF B;  2EIN C;  4O4H A;  3E22 A;  1S72 V;  2WLI A;  2EIK C;  3ZHR A;  2FL4 A;  1QBZ A;  1MSD A;  3TK1 A;  1WAZ A;  3SDL A;  4LFB B;  2Y0I A;  1YZB A;  1N8R W;  1SET A;  2XAS A;  2PYJ A;  3WB2 A;  3CJH A;  3TET A;  1OHH G;  2H94 A;  3K59 A;  3W7U A;  3CB2 A;  4O4J A;  1GM8 A;  3CRC A;  4NR1 A;  3CMA V;  2JJ1 G;  3J80 N;  4PA6 A;  1ZLZ A;  4F6R A;  2F4V O;  1N0N A;  4QPK A;  4O4I B;  4HAM A;  2QDO A;  1Z5V A;  3VBB A;  1XNR O;  4TV9 A;  2Q0A A;  4FZ1 A;  2HHH B;  2CTQ A;  2DN9 A;  1KQS U;  4JI8 O;  1Q82 W;  4FM0 A;  1RM1 B;  4LF7 B;  2FML A;  1F23 A;  3JAR A;  1HNZ B;  1NVP D;  1H2N A;  1OJH A;  1IBL O;  1AI5 A;  2MW2 B;  4JPR A;  5IJ9 B;  4KUM A;  1AJQ A;  4DV3 B;  4UCU A;  2UUB B;  1EZJ A;  1Y74 A;  5B1O A;  3SPC A;  5CBF A;  1XNQ O;  2QTO A;  4JAV A;  5B66 Z;  2A0L A;  4JI4 B;  5KA5 A;  2QKA A;  4EKW A;  2ARH A;  2ODM A;  3EHB B;  3LDD A;  5IJ0 A;  3I55 V;  4P30 A;  5CA1 A;  2ADQ B;  1SF9 A;  1HDJ A;  5J2U A;  1VQP V;  1SA0 A;  4MVM A;  1ZL8 B;  1TAE A;  1VQ5 V;  3GB7 C;  1SC5 B;  3ABL B;  4ZOL B;  5JCO A;  3ZCC A;  3P32 A;  4NTX A;  2AHY A;  2VWK A;  2JDI G;  5FPR A;  1FFT B;  1YCI A;  1IXM A;  2OCC B;  4UCR A;  3CCV V;  4CC6 A;  4JI1 O;  5K1X A;  5EZY B;  2Q7E A;  1K9M W;  5LA6 A;  3IC7 A;  1IBK O;  4TV8 A;  3VQW A;  2F23 A;  5LYJ B;  2HFE C;  4CH5 A;  1VQN V;  4GKJ B;  4H13 B;  2CE4 A;  3DXR A;  2UXX A;  2ZM6 O;  2EZO A;  2E74 B;  4X62 B;  3SYC A;  5KAI Z;  3ASO B;  1RM1 C;  2ZDI A;  5J9P C;  5JQG A;  2PTM A;  2QWQ B;  3QO8 A;  4J10 A;  2Q0O C;  3PN1 A;  1K3E A;  4XDJ A;  5C93 A;  5LP6 A;  4MSW C;  2EIL C;  1BQ0 A;  4JYY A;  2XAH A;  2Q9L A;  2Y4U A;  2C2A A;  2O57 A;  3JD1 A;  3K5O A;  3JCU Z;  2YC0 A;  4MVO A;  2CAZ C;  3ZMU A;  3DXR B;  2WA4 A;  2R70 A;  1LNQ A;  2RNB A;  2DYS B;  4I4T B;  5B1A B;  4MVQ A;  3L73 H;  3T1Y B;  4DV4 B;  1KP2 A;  2E5L B;  5LXT A;  5LP6 B;  3PJS K;  3ZRX A;  3ABL C;  4PD4 F;  3UM7 A;  5L3G A;  2VQF B;  2DJV A;  1R6T A;  3L72 H;  4G2K A;  4NTW A;  2K9P A;  3AK3 A;  3ICX A;  2PI5 A;  4B3M O;  5LGT A;  4WCE V;  1K8A W;  1DF4 A;  2OCC C;  3F5T A;  4HYO A;  2LGW A;  4OX9 O;  1WP8 A;  4OPH A;  1V55 B;  1MMM A;  3KCY A;  5JJN B;  5CB4 B;  1M93 A;  3T1H B;  1XBL A;  2JJ2 G;  2W0F C;  1SQG A;  5E1A C;  2XND G;  5EYP A;  2P90 A;  2CTR A;  2BE3 A;  5IDJ A;  4TUY A;  1VF6 A;  2QWP B;  4X1Y B;  2UUA O;  4YXW G;  4N21 A;  4LNU B;  3OTO O;  1H2G A;  4WFE A;  3ZBH A;  4PA7 A;  4YIP A;  1XEQ A;  3B77 A;  3SGI A;  5KAF Z;  2B1I A;  1MZE A;  3OM3 B;  5KMG A;  3K06 A;  3ASO C;  5KX5 B;  3L70 H;  4NYK A;  1PL0 A;  1Q6I A;  4J9Y B;  1RP3 B;  4UCV A;  4YY3 O;  1OCC B;  5H6Q A;  4X65 B;  2LQT A;  5JH7 A;  4I50 A;  2FYU H;  5FL7 G;  4WFG A;  1JX9 A;  1N36 O;  1L1F A;  1Q90 D;  3IGA C;  1X4T A;  4LF5 B;  4TSF G;  4GYC B;  4IL6 Z;  1NZ6 A;  2JEU A;  2CGN A;  5IYC O;  1W0K G;  4N23 A;  2UXB B;  2IJH A;  2ZDI C;  2DYS C;  2HLD G;  3M8A A;  4H33 A;  5BY1 A;  5B1A C;  5F2V O;  4BIU A;  3BPZ A;  4LFA B;  5LP6 C;  4I50 B;  3E8F A;  4B3T O;  1YEW A;  2P22 C;  2N04 A;  3HKB A;  4DV2 B;  1LUV A;  3VOU A;  2E76 B;  4I5S A;  3BEH A;  5IWA B;  2XOK G;  1K5Q A;  4O2A A;  2Q4P A;  3O65 A;  3OEE G;  1BT8 A;  4IT5 A;  4J9Z B;  2XAG A;  4W4L A;  5KHK A;  1SKV A;  5FNV B;  1US6 A;  1N33 O;  4GKK B;  5H6R A;  2X0L A;  3CCS V;  4KL1 A;  3ABT A;  5IY5 B;  3JD2 A;  1V54 C;  3CCJ V;  1FFX B;  1N4C A;  4UVC A;  1BQZ A;  2WLL B;  2XAF A;  4DR2 B;  2ZNJ A;  3JAT A;  2UUC B;  4DV6 B;  2XTA A;  4PA3 A;  3RWR D;  2BSK A;  1PM9 A;  1THZ A;  4D6T H;  1VIB A;  2RJZ A;  1QU7 A;  3SR2 C;  2JK5 C;  1OCC C;  2AGA A;  4ASU G;  3CX5 F;  1YTF B;  4X88 A;  1VQK V;  1KU9 A;  4I9W A;  3SPG A;  2WAM A;  3RYH B;  4CH4 A;  2D3O W;  2E3C A;  4FM2 A;  4I9Q A;  1VF6 C;  5IT9 N;  4LF6 O;  2YID A;  4CS4 A;  4MTG A;  2ETN A;  4DR1 O;  3QVN A;  3JAT B;  1DF5 A;  2CUG A;  3FYE B;  3LNN A;  4GLX A;  3U10 A;  4X66 B;  2OT5 A;  3K58 A;  4FLV A;  5KHJ A;  3H1L H;  1D5A A;  4PHZ A;  1QQC A;  1VAR A;  4FJC C;  1JA8 A;  3EXA A;  2NLJ C;  1N34 O;  4F6E A;  3WG7 B;  3BA9 A;  1WB7 A;  4U3J B;  4J80 A;  3ASN C;  2Q73 A;  4JAS A;  4PI2 A;  4J42 A;  3AG4 B;  4KP4 A;  4R7C A;  3SJQ C;  1R3L C;  2GV9 A;  3UCS C;  2VQE B;  3T4Z A;  3ZHQ A;  5IYZ A;  3RYI B;  4MW3 A;  2B1G A;  2KKW A;  1F7Y A;  2ZQM A;  3R65 A;  5IY5 C;  5EC2 C;  3RYC B;  3RBZ A;  1F4M A;  1R3K C;  3J81 N;  1XRE A;  1AI4 A;  3TJT A;  3A8T A;  3STL C;  2ZCE A;  3BA8 A;  1ORQ C;  4JI0 B;  1R6K A;  3K57 A;  1AR5 A;  2ZIM A;  1FPO A;  1GN6 A;  5LBQ A;  3AK2 A;  3SJB C;  5IYZ B;  4DUZ B;  4J11 A;  4LF4 O;  2ITC C;  4EB6 A;  4L8J A;  3TXQ A;  5ITZ B;  1FXK A;  5L3D A;  4YJ2 A;  4IIJ A;  2M6Y A;  4FMT A;  4K3A A;  1PKX A;  4A5U B;  3NR7 A;  4NXN B;  4LFC B;  4LC1 A;  4JGS A;  3OR7 C;  2KB1 A;  4NVP A;  4NXM O;  1GH6 A;  1FAF A;  2V1D A;  2PUS A;  3ZMZ A;  2RCV A;  1Q8I A;  3APO A;  2CDY A;  4GZR B;  4DW1 A;  3WG7 C;  1AI6 A;  1EBO A;  1OCR B;  1QLE B;  5KA6 A;  3HKC A;  4MS2 A;  4O2B A;  1NKD A;  2DWE C;  4P2Z A;  1Q7Y W;  3AG4 C;  3CC7 V;  2A9H A;  2P6J A;  1SZT A;  1TVK B;  3CC2 V;  1TUB A;  3K9A A;  1PNM A;  1HWY A;  5LGU A;  1GKF A;  4UV9 A;  1HNX O;  1XI1 A;  4FLZ A;  2QM4 A;  1XMO B;  4JI3 O;  2D2C B;  1DK1 A;  4GX0 A;  1QLN A;  2EIJ B;  5H2F Z;  1BHB A;  2LJ2 A;  3AG3 B;  4X64 O;  1Q5O A;  1S3J A;  2V4D A;  3CS5 A;  1I7F A;  1CP9 A;  1ARO P;  4K8X A;  1NVP B;  4DK0 A;  4I55 B;  1S5L Z;  3WB0 A;  3OMA B;  2G38 A;  1IVS A;  4NB5 A;  1NR1 A;  1GN2 A;  4MVU A;  2EZP A;  3OEH G;  1L0N H;  3HB3 B;  3K03 A;  2IJK A;  2AW9 A;  3KKY A;  2R9R B;  4GT1 A;  5EBW C;  5CBH A;  2A3Q A;  4DW0 A;  4X1K A;  4X1I A;  3RFR A;  2KSD A;  4FLY A;  2UXC O;  2YSU B;  3CPW U;  2QEX V;  3BY6 A;  4ZBM A;  3ZHV A;  2OIE A;  5EIB D;  3DSQ A;  4H0L B;  1Q6U A;  3D3Q A;  4P9P A;  4B7E A;  2IJI A;  4D7S A;  2F4V B;  2UU9 O;  4TQF A;  1J5E O;  1GMG A;  3CCQ V;  5GON A;  1B6Q A;  3MAQ A;  2QR4 A;  1OCR C;  1QLE C;  1YF2 A;  1KKC A;  4GX5 A;  4JI8 B;  4DR4 B;  2DMX A;  4O4L A;  1JJ2 U;  4LF8 B;  1IBL B;  2QWO B;  3CME V;  1K33 A;  4U7N A;  4AQY O;  4C7U A;  2IBZ H;  2GDS A;  3E83 A;  5B3S B;  3CCU V;  3F7V C;  3AG1 B;  2UXN A;  2EIJ C;  1KP3 A;  2PI4 A;  3AG3 C;  4DR6 O;  4PJ0 Z;  1IXB A;  4TT3 G;  3D36 C;  3ZMV A;  1SQQ H;  3C3T A;  3BRC A;  3RVZ A;  4O4H B;  3E22 B;  1H2S B;  1LUW A;  2YI8 A;  2WLI B;  1URF A;  3SYO A;  1PL4 A;  2OIG A;  1M57 B;  1P4R A;  3P3N A;  4TOI A;  4DR3 O;  2P67 A;  3CCM V;  4JTC B;  2DYR B;  3EVK A;  1Q43 A;  4LF9 O;  3IJ4 A;  4YHH O;  3CJH B;  1NQT A;  3ML0 A;  2EIL B;  5EK0 A;  4O4J B;  3LSU A;  4F6R B;  3J7A U;  2F43 G;  4Z1V A;  4ZHQ A;  1JVM A;  4JAA A;  1IBK B;  2XAJ A;  1VF7 A;  4TV9 B;  4PA9 A;  1SS3 A;  3FB7 C;  4EFB A;  3FB5 C;  3CD6 V;  3H1H H;  1B06 A;  2QKS A;  4WFF A;  1WA8 A;  4CH6 A;  1GN4 A;  1KYO F;  3JAR B;  5A2Q N;  4GX2 A;  2ZM6 B;  2OWO A;  4LCU C;  3HKE A;  1FXV A;  2W0X A;  3RYF A;  1BHA A;  3LSQ A;  1YI2 V;  4MTX A;  1Y74 B;  4UB6 Z;  1L0L H;  2QKC A;  3DC6 A;  4WFH A;  1HR0 O;  3OUS A;  5B3S C;  2P4V A;  4UFZ A;  3AG1 C;  4E2L A;  5IJ0 B;  2EX3 A;  2Q7G A;  5CA1 B;  3K5M A;  5J2U B;  1WA8 B;  1SA0 B;  1YSC A;  2Q5Z A;  3MDS A;  4LH6 A;  1HNZ O;  1IBM B;  1SRY A;  4BR6 A;  3C3S A;  1MAB G;  4UUJ C;  2DQ3 A;  3JAS A;  3P30 A;  4ZI7 A;  4DV1 O;  4PI0 A;  1M57 C;  4DV3 O;  2LO1 A;  3VQX A;  3LUT B;  1YIT V;  1K34 A;  3IC9 A;  2F66 C;  4RUF A;  2DYR C;  2P06 A;  1JR9 A;  3L71 H;  2DWD C;  1K97 A;  4B3M B;  2RQ6 A;  2HJF C;  4UV8 A;  2YEV A;  3ZHT A;  5LA6 B;  3E2E A;  1UFI A;  2AHZ A;  2JRI A;  1Y67 A;  4K35 A;  4W4K A;  5CA0 A;  4TV8 B;  2VWJ A;  3L74 H;  2ZE8 A;  3JAS B;  4ZI7 B;  2UUA B;  2BTQ A;  4KFM A;  4P9O A;  1H8E G;  2Q6A A;  4QE9 A;  5BXZ A;  1TA8 A;  5J2T A;  3JD3 A;  5JQG B;  1ROP A;  3E8H A;  1U96 A;  1H2M A;  4IGG A;  1K4C C;  4BW9 A;  1M9N A;  2QJ1 A;  1DGS A;  1IDS A;  2FTK A;  3B40 A;  5TIS Z;  1WB8 A;  4YY3 B;  2HVK C;  3UT5 A;  1TUE B;  2L35 A;  1SES A;  2ZE5 A;  3QG5 A;  2CGO A;  2R72 A;  1WPB A;  5LMN O;  1N36 B;  5D5P A;  3W7W A;  1IX9 A;  2BTQ B;  3FB8 C;  1O9G A;  4FM1 A;  5J2T B;  4X62 O;  1VQ4 V;  2QTS A;  1V54 B;  4I0X A;  5FPO A;  1JCH A;  1MOF A;  3BAA A;  3CP1 A;  5LXT B;  5JCO C;  3UT5 B;  2P4K A;  1G1X B;  1F51 A;  2QM7 A;  1O9H A;  4DRX A;  1FJG O;  3FFQ A;  2QSA A;  3K5L A;  3G4S V;  2RDC A;  3JAL A;  4RQF A;  1Y76 A;  5EYP B;  5L3B A;  2JVD A;  1NBM G;  4BAY A;  5BR8 O;  3W7T A;  3OW2 U;  4TUY B;  1I0H A;  4JI7 B;  4I0X B;  5LHG A;  1N33 B;  2EIM B;  4JF3 A;  1QR8 A;  4DYL A;  5CBG A;  3CYO A;  3D8C A;  3MHS C;  1SQV H;  3O9O A;  3QF7 A;  3Q4H A;  3U0Z A;  5KMG B;  1BCC H;  1KUQ A;  2JGD A;  1XOU A;  5LGN A;  3GWK C;  3H1I H;  3E86 A;  4JZG A;  3FYI B;  4CBC A;  5JH7 B;  4L87 A;  4K0K B;  4JV5 O;  5JJE B;  4OPA A;  2JGU A;  2YXY A;  3KCX A;  3ASN B;  1G4Y B;  3UO3 A;  1VQL V;  3KZI Z;  2HG5 C;  2V7Q G;  2ZNI A;  4ZKI A;  4IHJ A;  4DR1 B;  2YS8 A;  2NR5 A;  4YJ3 A;  1GN3 A;  3EFF K;  1QNM A;  2X6A A;  1J95 A;  2F93 B;  1H2K A;  3AEI A;  2YXH A;  2Q8V A;  4F4L A;  2Z3Y A;  3FAV A;  1S0V A;  3HKB B;  4YIO A;  2AZ0 A;  1K5S A;  1N34 B;  4DR5 B;  2YXL A;  2WSS G;  3E8B A;  4O2A B;  4LF5 O;  2PGG A;  1KD1 W;  3F5W C;  1OCO B;  1K73 W;  2H3O A;  1ZUQ A;  2ITD C;  3BVO A;  2CH7 A;  2WLM A;  2OTL V;  2NN4 A;  3ETQ A;  2M7W A;  5LL6 Y;  2HVJ C;  3T2M A;  2P5O A;  1FKA O;  1N32 B;  4QGP A;  4DK1 A;  2KG7 A;  2EIM C;  1YDX A;  1UPG A;  3ZRV A;  3FAV B;  1FXH A;  2HKO A;  1ZAU A;  4QPJ A;  4UCT A;  5KLV H;  4DV2 O;  1F4N A;  4EFE A;  2BSK B;  1R3J C;  1I5Y A;  1Y6X A;  4LR3 A;  5IWA O;  4DUY O;  1N0J A;  1CEZ A;  3DC5 A;  5EBM C;  4BWA A;  4DO2 A;  1K92 A;  3JAM N;  1VQ7 V;  1M1K W;  1V9P A;  2ZIN A;  4GKK O;  4LP8 A;  1KEC A;  4K8Z A;  3KG2 A;  3JAK A;  1GO3 F;  1AJN A;  1GRJ A;  4KXR A;  2DOS A;  4NTY A;  2P7T C;  1D2D A;  2UUC O;  3FKS G;  2HP8 A;  4X89 A;  4WF9 V;  1T5E A;  3TGU H;  3LSS A;  4HZ3 A;  3ZMS A;  3JYC A;  4NXM B;  4U3F H;  2Y69 B;  1QCE A;  3B4S A;  1EM1 A;  4JI2 B;  2WLK A;  1PD3 A;  1QHT A;  3G6B A;  2IW5 A;  2Q68 A;  4KHP B;  1Y66 A;  3N27 A;  4DV5 B;  1OCO C;  3AK1 A;  2PY5 A;  1R1B A;  4X20 A;  3GVM A;  4G28 B;  1D5N A;  2HEP A;  4GCZ A;  1HNX B;  1JJO A;  4LH7 A;  1K4D C;  2N05 A;  1NJI W;  1MA1 A;  1SER A;  4JI6 O;  3ZRW A;  5GTH Z;  3LNM B;  3HR0 A;  4UXN A;  2ADP A;  3CRQ A;  3VQY A;  2WPD G;  4AIL C;  1SQB H;  1NU1 H;  1Y4M A;  1OV9 A;  4WBN A;  2A7W A;  1JPX A;  4EB6 B;  1BE3 H;  2UXD O;  1FXK B;  4YJ2 B;  4IIJ B;  3B09 A;  3MHH C;  3JD0 A;  4JYA O;  5LOV A;  3QO7 A;  3GWO A;  2Y0P A;  5CN0 A;  3ZRS A;  1YJW V;  2ZXW B;  5E79 Z;  1LR1 A;  2IU0 A;  4ABM A;  2EJ7 A;  2K1E A;  4HNA A;  4B3S O;  1KB9 F;  4JI0 O;  1AIL A;  3OMN B;  2BOC C;  3NXS A;  3CRM A;  2OYQ A;  2ZIO A;  2Y69 C;  3RN4 A;  1QVG U;  1E1Q G;  2AZ2 A;  3JCZ A;  5KHG A;  3G6E V;  2UU9 B;  1J5E B;  2JS5 A;  3HKC B;  4FFB A;  3A0B Z;  2X6C A;  4O2B B;  2QWN B;  2JEX A;  1P84 F;  1TUB B;  3OGC C;  2AXT Z;  4QE7 A;  4HNA B;  4ICG A;  1W2B U;  4WFA V;  3H1J H;  4DV0 O;  2EJR A;  5EIB C;  1L8D A;  1VQ8 V;  4E4E A;  2JS3 A;  4DR7 O;  1WN7 A;  4AQY B;  4PA4 A;  1Q6H A;  2H8P C;  5IYD O;  4FLW A;  3B2E E;  3CXH F;  1I94 O;  1A32 A;  1GM7 A;  1XL6 A;  5DN6 G;  5B5E Z;  4DR6 B;  3IFX A;  2YDE A;  2WA3 A;  1PP9 H;  4JZ2 A;  2B9Z A;  4RUE A;  2PF4 E;  4BIO A;  1M90 W;  1JFF A;  5HFL A;  3K04 A;  4FPP A;  1NR7 A;  1XNR B;  1FXK C;  4JI5 O;  2MK3 A;  1VMG A;  4Z2W A;  3N2G A;  1RSO A;  2ZXW C;  1IZ3 A;  4X1K B;  4X1I B;  4YHH B;  3RGB A;  2Q7H A;  4Z1M G;  4X8A A;  3G71 V;  1BSM A;  4DV7 O;  1XNQ B;  1Q81 W;  1NS1 A;  1ZTE A;  3ZMT A;  1ZX3 A;  4HBN A;  5GON B;  1XMQ O;  4O4I A;  5KHI A;  1VQ6 V;  2LGQ A;  2XUM A;  5IYB O;  1HNW O;  3CC4 V;  1GM9 A;  3SPH A;  4B3R O;  1KC8 W;  3N2G B;  4UVB A;  1P7G A;  2YI9 A;  1RSO B;  3R66 A;  4O4L B;  1B04 A;  1JQ0 A;  4MVR A;  1VQM V;  4D7T A;  3K0D A;  2WLN A;  5IJ9 A;  5L3C A;  3FX7 A;  5BZB A;  4TQD A;  1R6N A;  1XDC A;  2CK3 G;  5LMU O;  3CRR A;  3HKD A;  1HR0 B;  1QR9 A;  3VQV A;  1S5H C;  1YHQ V;  1KKD A;  3DGE A;  1OCZ C;  2X7R B;  4JI1 B;  1RPO A;  2RMK B;  3FD9 A;  5EBL C;  2ZKO A;  2F1M A;  1MNG A;  4PV1 B;  4UCS A;  3ZN0 A;  4DR4 O;  2A79 B;  1TGO A;  1ZL8 A;  4LF8 O;  5B1B C;  1PNL A;  4LBE C;  4B7K A;  4LFB O;  4J7Z A;  2GBO A;  4DV1 B;  2EBO A;  4ZOL A;  3ZHS A;  1PV0 A;  4XDK A;  3HKD B;  5K1P A;  3ZJZ A;  2F95 B;  1RFY A;  1M5I A;  1YJN V;  2LW7 A;  5HFM A;  3UKM A;  2GTA A;  3M99 B;  1YIJ V;  1NH2 D;  1DLB A;  2ATK C;  5EZY A;  3G80 A;  4ZHQ B;  3K5N A;  1W0J G;  4CZZ A;  1UJW B;  1AVM A;  3B8M A;  4UCO A;  3WFV A;  1XL4 A;  1XQ8 A;  3JAW A;  4CH3 A;  2QA4 V;  2YIA A;  3JD4 A;  5LYJ A;  2HHH O;  1BGY H;  2QGN A;  4LF7 O;  3HKE B;  2IM9 A;  3RYF B;  2YIC A;  2FKX A;  3CCL V;  3C90 A;  3ZIA G;  2R9I A;  3CCE V;  3SJA C;  2UUB O;  3S3W A;  5KHH A;  3OT7 A;  3ZN1 A;  2BOB C;  3E35 A;  4GUN A;  4JI4 O;  2KQX A;  1SQX H;  3JAW B;  1FD9 A;  1G6U A;  5LMN B;  5AG2 A;  1MZF A;  2HJD A;  4OX9 B;  1XHX A;  4JTA B;  3ABU A;  3CXC U;  2LW1 A;  5GTI Z;  5GW7 A;  3SPJ A;  5DEC A;  4CS2 A;  4PEL A;  4I4T A;  1VF5 B;  2ZT9 B;  1ENV A;  3SJC C;  3OTO B;  3OTF A;  4G27 B;  1E79 G;  3CE2 A;  5EC1 C;  1X59 A;  2IU3 A;  4U7O A;  3IAY A;  5DED A;  2GUZ A;  3X2Q B;  2YEV B;  1FJG B;  4H44 B;  2BCC H;  3CCR V;  3CHX A;  2L6L A;  5CA0 B;  1IUR A;  5CB4 A;  1AI7 A;  2ZE7 A;  1IBM O;  1CPY A;  1NT2 B;  4BW5 A;  5BR8 B;  3LDC A;  1H8H G;  3E89 A;  4GKJ O;  2Q67 A;  4X1Y A;  3JSN A;  4WFB V;  1AB3 A;  3OGI B;  1Q3E A;  1YJ9 V;  4FK5 C;  4LNU A;  4EEQ A;  5H5N A;  1PPJ H;  3P3P A;  1EZV H;  1KMI Z;  5B1N A;  4FVM A;  3OD4 A;  2RN9 A;  2GHY A;  1S5J A;  5KX5 A;  2GUZ B;  2CTW A;  1AR1 B;  1AP6 A;  4TWK A;  3T1C A;  4QNH B;  4RQE A;  2R9A A;  1Q86 W;  4B3T B;  3K08 A;  4JV5 B;  3ABM B;  1VP7 A;  1SQF A;  2A06 H;  2ILM A;  1K7D A;  2BTO A;  5C8Y A;  1Z5W A;  4FLT A;  1SZX A;  4FIP C;  1U97 A;  3AG2 B;  2LFR A;  2Y48 A;  3T1Y O;  4DV4 O;  2E5L O;  3CWB H;  5BMV A;  2VQF O;  4PDM A;  4JTD B;  5H9C A;  5C8Y B;  4DRX B;  4PDR A;  3T4D A;  4RAI A;  3A2F A; 
#chains in the Genus database with same CATH homology
 4R6Z A;  2IW5 A;  3X2Q C;  2Q68 A;  4P9P A;  2IJI A;  1Y66 A;  3IC7 A;  2WLH A;  1GMG A;  3CCQ V;  5CMU A;  1B6Q A;  1OCO C;  3ETG A;  5KUM A;  1OCR C;  1QLE C;  2HFE C;  1VQN V;  4G28 B;  2ZD9 A;  3ETE A;  5L3F A;  4GX5 A;  2UXX A;  1P7B A;  5LHH A;  2EZO A;  4GCZ A;  1JJ2 U;  3SYC A;  3ASO B;  1RM1 C;  3OE7 G;  1E1R G;  2ZDI A;  5J9P C;  2ZR3 A;  2WLL A;  3CME V;  1K4D C;  1K33 A;  4U7N A;  4MTO A;  3QO8 A;  5CA3 A;  1NJI W;  1SER A;  3ZRW A;  1K3E A;  3E83 A;  4XDJ A;  5C93 A;  5B3S B;  3LNM B;  5DM6 V;  3F7V C;  3AG1 B;  4MSW C;  3CCU V;  2EIL C;  4MVZ A;  2UXN A;  2EIJ C;  3E8G A;  1KP3 A;  4UXN A;  2PI4 A;  3AG3 C;  2XAH A;  1V55 C;  2WWW A;  4JYC A;  2XAQ A;  2QE7 G;  3RW0 A;  2C2A A;  4TT3 G;  2WPD G;  3ZMV A;  3JD1 A;  3ABM C;  1Y4M A;  2LP7 A;  4MVO A;  3RVY A;  1JPX A;  3B8N A;  3ZMU A;  3RVZ A;  4JYB A;  1JOY A;  1FXK B;  2WLI B;  4MT8 A;  3SYO A;  4PDL A;  3ETD A;  1LNQ A;  1I5X A;  3MHH C;  3JD0 A;  1M57 B;  1P4R A;  2DYS B;  3QO7 A;  2P67 A;  3GWO A;  5CN0 A;  3ZRS A;  3CCM V;  1YJW V;  2ZXW B;  5B1A B;  4MVQ A;  2WLJ A;  3FB6 C;  3AG2 C;  1KP2 A;  4JTC B;  2IU0 A;  1S77 D;  2K1E A;  3PJS K;  3ZRX A;  2DYR B;  3ABL C;  3D3I A;  3OFN G;  3UM7 A;  5L3G A;  2ZR2 A;  3OMN B;  2BOC C;  4G2K A;  3NXS A;  1NQT A;  3SYA A;  2PI5 A;  3ML0 A;  5LGT A;  4WCE V;  1K8A W;  2EIL B;  3OR6 C;  5EK0 A;  4XDL A;  1DF4 A;  2OCC C;  4HYO A;  2Y69 C;  1V55 B;  1QVG U;  1E1Q G;  1EFR G;  3JCZ A;  2F43 G;  2W6J G;  3W7S A;  3G6E V;  2JJ2 G;  2W0F C;  1JVM A;  5E1A C;  2XND G;  2P90 A;  2X6C A;  2XAJ A;  5IDJ A;  4PA9 A;  3SPI A;  3FB7 C;  4XBF A;  3FB5 C;  3CD6 V;  2JEX A;  2QKS A;  4WFF A;  4YXW G;  3ABK B;  3OGC C;  4N21 A;  4QJF B;  1H2G A;  4WFE A;  4GX2 A;  4QE7 A;  4PA7 A;  4LCU C;  1W2B U;  3B77 A;  4WFA V;  3QO5 A;  1FXV A;  1BHA A;  2EJR A;  2B1I A;  3OM3 B;  1VQ8 V;  3K06 A;  2QM8 A;  3ASO C;  3LSQ A;  1YI2 V;  4PA4 A;  1PL0 A;  2H8P C;  4J9Y B;  1PNK A;  5IYD O;  4MTX A;  1QVF U;  4WFH A;  1GM7 A;  1OCC B;  5L3E A;  1G8M A;  1XL6 A;  5DN6 G;  3OUS A;  5H6Q A;  3OMI B;  5B3S C;  3AG1 C;  5FL7 G;  1S76 D;  4E2L A;  4WFG A;  3IFX A;  1JX9 A;  1RPR A;  1L1F A;  3IGA C;  4RUE A;  5LHI A;  4TSF G;  1M90 W;  1WLE A;  1YSC A;  5HFL A;  1VQO V;  3K04 A;  1SRY A;  3SYQ A;  2JEU A;  4FPP A;  1MAB G;  1NR7 A;  4UUJ C;  2DQ3 A;  1FXK C;  3LDE A;  5IYC O;  1W0K G;  3P30 A;  4N23 A;  2IJH A;  2MK3 A;  1M57 C;  2DYS C;  2ZDI C;  2DW4 A;  2HLD G;  2ZXW C;  3LUT B;  4H33 A;  1YIT V;  5B1A C;  3K0G A;  4PDV A;  4BIU A;  1K34 A;  2LFS A;  4RUF A;  3E8F A;  3HPL C;  2DYR C;  2OTJ V;  4Z1M G;  2DWD C;  4X8A A;  3G71 V;  1K97 A;  2JIZ G;  2Z5U A;  3VOU A;  2HJF C;  4I5S A;  4UV8 A;  2YEV A;  3I56 V;  3E2E A;  3BEH A;  1WPX A;  1Q81 W;  2XOK G;  1K5Q A;  2AHZ A;  2B5U A;  3ZMT A;  4MVS A;  3OEE G;  4J9Z B;  3STZ C;  2XAG A;  1VQ9 V;  1VQ6 V;  1M56 B;  1FS0 G;  5IYB O;  3CC4 V;  1GM9 A;  3SPH A;  5H6R A;  4KFM A;  2X0L A;  1KC8 W;  2W6I G;  3A0R A;  4UVB A;  4P9O A;  3CCS V;  1H8E G;  2Q6A A;  3ABT A;  3ABK C;  4QE9 A;  5IY5 B;  3JD2 A;  1V54 C;  1JQ0 A;  3JD3 A;  4MVR A;  3CCJ V;  1VQM V;  1YTF D;  4UVC A;  1ROP A;  2WLL B;  2XAF A;  4R50 A;  3E8H A;  2HR3 A;  3K0D A;  2WLN A;  4Q20 A;  5L3C A;  1K4C C;  2X6B A;  3ZRW B;  5BZB A;  1M9N A;  1OZ0 A;  1R6N A;  4RO2 A;  2IH1 C;  4GX1 A;  2GSM B;  4PA3 A;  2FTK A;  2CK3 G;  1THZ A;  3W7X A;  4BIZ A;  2HVK C;  1TUE B;  1QR9 A;  1SES A;  3D36 A;  3K79 A;  2JK5 C;  1OCC C;  3H01 A;  4ASU G;  1S5H C;  1YHQ V;  1YTF B;  3DGE A;  1MG1 A;  1KKD A;  1OCZ C;  4X88 A;  1VQK V;  2X7R B;  5KUK A;  4I9W A;  1COW G;  1RPO A;  5EBL C;  3SPG A;  2EIN B;  2WAM A;  1R3I C;  3W7W A;  3FB8 C;  2D3O W;  2EIK B;  3ZN0 A;  2A79 B;  4MTG A;  4QIW F;  1VQ4 V;  5B1B C;  4MTF A;  1ZWI C;  1AJP A;  1PNL A;  2NNU A;  3OAA G;  4LBE C;  1V54 B;  1DF5 A;  1BMF G;  3FYE B;  1GTO A;  2EBO A;  1JCH A;  1MOF A;  3CP1 A;  2OT5 A;  4XDK A;  3OUF A;  3ZJZ A;  2Q69 A;  1YJN V;  1F51 A;  4FJC C;  2QM7 A;  3F7Y C;  3K3W A;  3MD0 A;  1MSW D;  5HFM A;  2NLJ C;  3UKM A;  3M99 B;  1YIJ V;  1NH2 D;  1DLB A;  1GK9 A;  2ATK C;  3WG7 B;  3G4S V;  3ASN C;  1W0J G;  1OCZ B;  4CZZ A;  4RQF A;  5L3B A;  4JAS A;  4R8C A;  1UJW B;  3B8M A;  1DTO A;  3AG4 B;  4KP4 A;  4R7C A;  3SYP A;  3WFV A;  1NBM G;  1XL4 A;  4BAY A;  3SJQ C;  3W7T A;  3OW2 U;  1R3L C;  2DQ0 A;  4OXS A;  4UVA A;  2QA4 V;  1R73 A;  3JD4 A;  5LHG A;  2IJJ A;  2EIM B;  4JF3 A;  1QR8 A;  3T4Z A;  5CBG A;  3CYO A;  1M56 C;  5B1B B;  3MHS C;  1BL8 A;  4MW3 A;  1NH2 B;  2B1G A;  2IH3 C;  2ZQM A;  3R65 A;  5IY5 C;  5EC2 C;  3CCL V;  3RBZ A;  3QNE A;  4JAU A;  1F4M A;  1R3K C;  3ZIA G;  2R9I A;  3DTU B;  5LGN A;  3CCE V;  1AI4 A;  4MW8 A;  3STL C;  3E86 A;  1ORQ C;  3ZN1 A;  1R6K A;  3FYI B;  2BOB C;  3E35 A;  4CBC A;  4L87 A;  5LBQ A;  3TCU A;  3ASN B;  1G4Y B;  1VQL V;  4JTA B;  3ABU A;  4DXW A;  1H38 A;  2ITC C;  4H37 A;  2HG5 C;  2EIN C;  2V7Q G;  4ZKI A;  3CXC U;  1S72 V;  1FXK A;  2WLI A;  5L3D A;  2EIK C;  5GW7 A;  3SPJ A;  4FMT A;  1QBZ A;  4PEL A;  3TK1 A;  3EFF K;  1PKX A;  1ENV A;  2X6A A;  1J95 A;  4G27 B;  1E79 G;  1N8R W;  1SET A;  2XAS A;  3AEI A;  4LC1 A;  5EC1 C;  4JGS A;  3OR7 C;  4F4L A;  2IU3 A;  4U7O A;  2Z3Y A;  2KB1 A;  3TET A;  1S0V A;  1OHH G;  2H94 A;  3W7U A;  2V1D A;  3ZMZ A;  1K5S A;  3X2Q B;  2YEV B;  1GM8 A;  2WSS G;  3E8B A;  3CCR V;  3CMA V;  2JJ1 G;  1KD1 W;  4PA6 A;  3F5W C;  1OCO B;  1K73 W;  4QPK A;  1AI7 A;  3WG7 C;  1AI6 A;  1CPY A;  1EBO A;  1OCR B;  2ITD C;  1QLE B;  5KA6 A;  4MS2 A;  4HAM A;  4BW5 A;  3VBB A;  3LDC A;  1H8H G;  1NKD A;  2WLM A;  2DWE C;  3E89 A;  4P2Z A;  1Q7Y W;  3AG4 C;  2OTL V;  2M7W A;  3CC7 V;  2A9H A;  2P6J A;  2HVJ C;  1SZT A;  2Q67 A;  3T2M A;  3CC2 V;  4WFB V;  1KQS U;  3K9A A;  1PNM A;  1YJ9 V;  4FK5 C;  1Q82 W;  1RM1 B;  1HWY A;  1F23 A;  5LGU A;  1GKF A;  2EIM C;  4UV9 A;  1NVP D;  1AI5 A;  3ZRV A;  4JPR A;  1FXH A;  5B1N A;  4KUM A;  2GHY A;  2HKO A;  1AJQ A;  4QPJ A;  1F4N A;  4GX0 A;  1QLN A;  2EIJ B;  1EZJ A;  1I5Y A;  1R3J C;  1AR1 B;  1BHB A;  4TWK A;  3AG3 B;  3T1C A;  5B1O A;  3SPC A;  4QNH B;  5CBF A;  4RQE A;  1S3J A;  2QTO A;  1Q86 W;  4JAV A;  1CP9 A;  2A0L A;  1ARO P;  5KA5 A;  3K08 A;  4EKW A;  3ABM B;  1NVP B;  1CEZ A;  3LDD A;  3EHB B;  3I55 V;  4P30 A;  5EBM C;  1K7D A;  4DO2 A;  1K92 A;  1VQ7 V;  3OMA B;  1M1K W;  4LP8 A;  1KEC A;  1VQP V;  4MVM A;  3KG2 A;  1NR1 A;  4FIP C;  4MVU A;  1GO3 F;  1AJN A;  2EZP A;  3HB3 B;  3K03 A;  3OEH G;  1VQ5 V;  3GB7 C;  2IJK A;  3AG2 B;  2LFR A;  2P7T C;  3ABL B;  2Y48 A;  2R9R B;  4GT1 A;  3ZCC A;  3FKS G;  5EBW C;  1PD3 A;  4X89 A;  5CBH A;  3P32 A;  4WF9 V;  2AHY A;  2JDI G;  1FFT B;  3LSS A;  4JTD B;  4PDM A;  1IXM A;  5H9C A;  4HZ3 A;  3ZMS A;  2OCC B;  3JYC A;  3CCV V;  2Y69 B;  2YSU B;  3CPW U;  1QCE A;  2QEX V;  3BY6 A;  4ZBM A;  4PDR A;  3T4D A;  1K9M W;  2WLK A;  4RAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...