4FIPC

Structure of the saga ubp8(s144n)/sgf11(1-72, delta-znf)/sus1/sgf73 dub module
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
41
structure length
41
Chain Sequence
TITIDSISNGILNNLLTTLIQDIVARETTQQQLLKTRYPDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
total genus 17
structure length 41
sequence length 41
chains with identical sequence G
ec nomenclature
pdb deposition date 2012-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF18519 Sgf11_N SAGA-associated factor 11 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4fipC00
4JGSA 3B8MA 4JF3A 4FJCC 4FIPC 3H01A 3GWOA 2X7RB 4E2LA 1ENVA 1I5YA 1Y4MA 4N21A 5HFLA 1Y66A 1K34A 4FK5C 1QR8A 1F23A 2LP7A 4JPRA 5CMUA 1DLBA 1MG1A 1K33A 5KA6A 5CN0A 2MK3A 1QCEA 3WFVA 3B8NA 1MOFA 1I5XA 3MHHC 1JPXA 5H9CA 5KA5A 1QR9A 1DF4A 3CP1A 1SZTA 4G2KA 2P6JA 3MHSC 1QBZA 3M99B 1DF5A 3CYOA 1EBOA 3P30A 2M7WA 2EZPA 3B77A 4N23A 2EZOA 2EBOA 2OT5A 1JQ0A 3K9AA 5HFMA
chains in the Genus database with same CATH superfamily
1MZFA 2F1MA 4FM1A 5D5QA 3W7UA 4HAMA 2YDEA 4BIZA 3JAKB 2HJDA 4LF8O 4R7CA 4PA9A 1VQKV 4X65O 1PL0A 1SESA 3WB0A 1TUBA 1YJWV 4X1KB 3T4ZA 3RFRA 4UB6Z 5B1OA 4TQDA 4TWKA 3SPIA 4GKJB 3ZHRA 3LDCA 3ETGA 4B3SB 1BL8A 2WLMA 3BAAA 5KUKA 1QU7A 1VEWA 3BEHA 1YITV 5H6QA 4MVMA 3BA9A 3SYOA 1JX9A 3JALA 1QLEB 1Z5WA 5CB4B 5KA6A 3SPCA 4LF9B 4X88A 4D7SA 2JEUA 2ZE6A 4O4LB 1SRYA 2ZIMA 2YIDA 4YJ3A 3HB3B 3O65A 1AR5A 5JH7B 1Q86W 1EN6A 2H8PC 2YUAA 4DR7O 5JJNB 3JD1A 4DV6B 1IX9A 3IC9A 2VRZA 1VQ7V 4GKKO 3K5OA 4AILC 4X8AA 1D2DA 1N0NA 4B3RO 4AQYB 1FAFA 4X66B 4LF6B 1BS3A 1L1FA 4AQYO 1MABG 3L75H 1M9NA 4DR2B 4FZ0A 4N23A 1S5JA 2P4KA 4K8XA 3HKBA 4Z2WA 1RSOB 4DUYB 3MDSA 4NXMB 3T1CA 1TGOA 3BY6A 3ZMTA 2GSMB 3E89A 1S72V 1BGYH 3AG3C 2OTLV 4BR6A 2NR5A 2W6IG 2F66C 3JSLA 2OIEA 1E1RG 1UFIA 3WB2A 1M56B 4UCTA 2EIKC 2Q4PA 1CEZA 3I55V 3D3IA 1PNLA 4GX1A 1K34A 3ZS8C 1SZXA 4DR3O 1XNQB 4I0XB 2HVJC 2EINB 2IJKA 1F4NA 4LWSA 5A9GA 2UXCB 1V55C 2DQ0A 4LF4B 2HHHB 1GN2A 5JVDA 3CSXA 5JCOC 2BSKB 2XAFA 4DR7B 3N2KB 4CS3A 1NH2B 4LNUA 1B3QA 2E74B 3IJ4A 1RM1B 3CCMV 3ZRSA 5LYJB 3VQVA 3G6EV 4BWAA 4UFZA 3QO5A 1ZSPA 4TUYA 1MA1A 2NNUA 3G6BA 3E22A 2QR4A 5B1NA 1QLNA 2OCHA 4UB8Z 1QQCA 5H6RA 3JASB 3NXSA 4X1YB 2WA4A 3L73H 2DWEC 2OYQA 5KX5B 3FAVA 2ILMA 2XTAA 1QNMA 4DW0A 1XNQO 3TJTA 2QJ1A 1G4YB 1PPJH 2KQXA 2YC0A 2KB1A 4I9WA 4DR6O 4JYCA 3H1KH 4ZHQB 1X59A 4WFEA 1MMMA 2ZT9B 4P9PA 2YS8A 3ZJZA 3FFQA 3C90A 1R3LC 4ZI7B 4DR4B 3ETEA 1IXBA 2Q5ZA 4PI0A 2VQEB 2HVKC 4PD4F 2OTJV 5LP6A 1YCIA 2IBZH 3OTOO 3SYCA 4EB6B 1WP8A 2GBOA 1E79G 1KKDA 5HFMA 4JF3A 5B66Z 1WAZA 3TETA 4TSFG 3K0DA 4LWSB 3LUTB 2DYSB 2AXTZ 4FMTA 1I94O 1GK9A 2XAHA 1IZ3A 1JMKC 1WA8A 4J7KA 5EYPB 1PNMA 4ASUG 1HNZO 1FJGB 1QVFU 1HDJA 1FJGO 1X4TA 5GONA 5E79Z 1R3JC 2IJJA 2DYRB 2XOKG 4K35A 4K8ZA 2WLJA 1KP2A 2F43G 3HKDB 4UUJC 1EZJA 4LH7A 2R9AA 4H33A 3IAYA 5BMVB 4X66O 4LF6O 1KP3A 3CMAV 2WLIA 1EM1A 4I55B 4X20A 4UCUA 2P06A 1J5EB 1IBKO 3UT5A 3OR7C 5CN0A 3VOUA 1FFTB 3SJCC 2Q7GA 2Y4UA 3S3XA 1TA8A 5K1PA 1VF6A 3OW2U 4O2BB 2M6YA 5LBQA 1H38A 1SQQH 4QJFB 4MTXA 4NXMO 3K9AA 1SF9A 3CMEV 1RFYA 4HNAA 4L8JA 3T4DA 1AP6A 4YHHB 1KECA 3ASOB 2ZM6O 5B1BC 4RUFA 5HFLA 1K92A 2DYSC 1TVKB 1RSOA 3B8NA 5L3CA 1IURA 1QR9A 3APOA 4A5UB 1ZL8B 4RQFA 4FZ1A 3QVNA 4B7EA 5IY5B 5L3EA 2V7QG 1Q5OA 1KKCA 2QWRB 2OIGA 3WG7C 5K1XA 3WFVA 1EZVH 5CBFA 3ZRVA 3LNNA 2BTQB 1AI7A 3K9SA 1LUVA 2FKXA 3CJHA 4XBFA 1R3IC 4BIOA 4K0KO 2RQ6A 1VQ4V 4K0KB 3K08A 3ETDA 3K59A 2Q0AA 3UCSC 1GM7A 4FK5C 2LP7A 3P3PA 4ZOLB 1OJHA 4P30A 4LR3A 1WJZA 4MVZA 1HR0O 1V54C 4TV8B 3L70H 1FPOA 2AW9A 1JJ2U 2DN9A 2GTSA 3CC4V 1V55B 5TISZ 3E8HA 4DV7B 2X7RB 4YY3O 4PA6A 2UU9B 1RPOA 2LO1A 4DR6B 1P49A 3AEIA 2YI9A 1UPGA 3E83A 1GN4A 4PDMA 5LP6C 4X1IB 3RW0A 3QF7A 2Q73A 2L35A 2PZSA 3HPLC 4IGGA 2HHHO 4CH4A 4LF5B 2PYJA 3WB1A 1JCHA 4TV9B 5J2TA 2YIBA 2ADPA 3D8CA 3CRCA 3R66A 3CCUV 1MOFA 3F7VC 4LNUB 3T1YB 5LYJA 4NXNB 3MD0A 3W7WA 3K5LA 1NI8A 3FB8C 3DGEA 2CTRA 4TT3G 4UCRA 5KX5A 1NS1A 4JI4B 2A9HA 2AHYA 3U10A 4RWUA 5EIBC 2UUBB 1SQGA 3O9OA 5IT9N 3CRRA 3IFXA 3AK2A 1NBMG 3CWBH 4DRXA 5LOVA 1O9GA 3ETQA 2JGDA 3QTCA 1QLEC 3OMNB 3FB7C 1IXMA 3T1HB 4OX9B 3A0BZ 4PJ0Z 1HP8A 1GAXA 5A2QN 1U96A 1F51A 4JAUA 2GV9A 3BFRA 2FL4A 1EN4A 1MZEA 4GX2A 3A0HZ 3J7AU 2CAZC 1R3KC 2WLNA 2HJFC 2EULA 3B09A 4LP8A 1JFFB 2CGNA 4B3MO 2NLJC 2V4DA 1RP3B 3ZHVA 5KHGA 3D36C 4JI1O 3GWOA 1NZ6A 3U0ZA 1Y4MA 3A2FA 4MSWC 5F2VO 3CRQA 3H1JH 1ZX3A 2UUCO 3JD2A 3MHSC 3ZRXA 2AZ2A 4ZKIA 4FM0A 5J2TB 3JCUZ 4CS4A 5JH7A 5L3GA 1S77D 5CMUA 4QNHB 2QWQB 4ZBMA 2XAGA 1VQPV 3B4SA 2DE0X 2Q8VA 2YSUB 1XNRO 3JATA 2K1EA 4LFAB 2QKAA 2UXXA 3ZHUA 1NH2D 4NXNO 4PDRA 2AHZA 5KHHA 4LF7O 1DF4A 2ADQB 4MTOA 1PV0A 3E86A 4AI8A 5B3SC 4F6RB 1YHQV 4DV4O 1S76D 4O4IB 1HR0B 3C3SA 4JI8B 2F4VB 3I5DA 3CCSV 2DWDC 3RYFA 4MVRA 2XAJA 5L3FA 1MSWD 2YIBD 1WNSA 2UU9O 2K9PA 4B3TB 3ZRWB 3J80N 4CS2A 3X2QB 4B3TO 4TOIA 2QTOA 2QKCA 1K3EA 1VARA 3WU2Z 1NT2B 3F5TA 4JYAO 4JI5B 1NR1A 3K03A 2EIJB 1K33A 3CXCU 1GTOA 2Y4TA 1ZUQA 4NYKA 1N34O 1VF7A 1XBLA 2QTSA 4DO2A 5LMNB 5L3BA 4WBNA 3Q4HB 1KC8W 1KUQA 1JA8A 3HKCB 2AZ0A 2IJIA 4QGPA 2ZE8A 1OCZC 4QPKA 1NR7A 2ZNJA 4WF9V 1N32B 4CC6A 2YICA 1AI5A 3UM7A 4NB5A 1DLBA 3CPWU 4ZHQA 4RAIA 2XASA 1I94B 5LGTA 3ASNC 4LBEC 2VQFO 2N74A 1H2LA 5KLVH 4X1KA 1XEQA 3QG5A 5LMUB 2CDYA 3ZHTA 4TQFA 4EEQA 5B3SB 3CCVV 4QIWF 3CJHB 2ZQMA 1XMOO 3KCYA 4DR3B 4YJ2A 4NTXA 1P84F 3G4SV 2P67A 1B6QA 1XUQA 1FKAO 5KHJA 2CGOA 3JALB 3JSNA 3SJAC 5KMGA 3F7YC 3M99B 1VP7A 2QA4V 3OFNG 2RCVA 2XUMA 4ICGA 4X9QA 1WPXA 1WA8B 1B04A 3ABMC 2CE4A 3LSUA 1Y66A 2UXNA 1Q90D 2C2AA 2QWNB 1L0LH 4OGQB 4R50A 3ZN1A 2RMKB 3CB2A 5KHKA 3K5NA 1KD1W 3AG7A 4YIOA 2QSAA 5IJ0B 4HBNA 4X62B 1SQVH 1Q7YW 5JQGA 2VQFB 4DK0A 2R9IA 3I56V 2F23A 4LF9O 1WB8A 4F6EA 4KXRA 1H2SB 2RN9A 4FFBA 2WAMA 1D5AA 5FLXN 4JTAB 1XMOB 1M56C 3AG3B 3RVZA 1G1XB 2Q7HA 2QM8A 2JIZG 3T1HO 1NQTA 4JI6O 1M57B 3FB5C 2EILC 2PI4A 2DQ3A 3E8BA 4K3AA 2ZINA 1BE3H 2FYUH 3ZMVA 1FD9A 1ZLZA 1CXZB 2CTPA 4WFHA 5IJ9A 3JD0A 1BZKA 1N32O 3VQXA 1TVKA 2EINC 4J7JA 3RT3C 1I5XA 4CH3A 4W4KA 3K79A 3QNEA 5DM6V 4FLZA 3CD6V 2KKWA 3L74H 2VS0A 4X64B 3OTFA 3E22B 2WPDG 1RM1C 4FIPC 2YXHA 2Y0IA 4JI2O 1QHTA 2L6LA 1F23A 1YJNV 2OCCB 4GYCB 3ZIAG 5ITZB 4JTCB 3GB7C 4OXSA 2X0LA 4DV4B 2RNBA 1Q6HA 3OUSA 2HKOA 3B77A 4UV9A 3ABTA 4H44B 3W7TA 2YXLA 2YIAA 2YXYA 1S5HC 2Z5UA 1V54B 1THZA 3K57A 5J2UA 1CPYA 1XDCA 2DJVA 5CB4A 5BR8B 3EHBB 3OUFA 2GUZA 5LA6A 2H3OA 4X65B 5CBGA 1XNRB 5IYZA 4LF4O 3STLC 1XREA 3W7SA 3RBZA 3FYEB 1I08A 4FPPA 2QM7A 4MT8A 4PELA 4JI1B 4JGSA 3H01A 4MVUA 3U11A 2XNDG 4DUYO 4FLWA 4LF7B 4LFBB 3CCEV 5EBMC 1XOUA 5CBHA 1M1KW 1DK1A 4GCZA 4MVSA 4NTWA 1SQXH 1QVGU 1G6UA 3F5WC 4GZRB 4PA3A 1H8EG 1Y74A 4I5SA 2JDIG 5H2FZ 4DV3O 2JS5A 5IYDO 1OCCB 2E3CA 1SA0B 2Q67A 1K9MW 3M8AA 1PD3A 2A7WA 2WLLB 4Z1VA 2QWOB 2A06H 4DR2O 5KAIZ 1M93A 2CUGA 3A0RA 3OMIB 1QCEA 2UXBO 5B1AB 2BCCH 1IBMO 3T2MA 4FLYA 4I9QA 4GKJO 1H2MA 5E1AC 4X64O 3EXAA 1L8DA 1GO3F 1SKVA 3D3QA 3ZRWA 1F4MA 1AB3A 4DRXB 3ABLC 2X6BA 2GUZB 4GX5A 3BRCA 2R72A 2BTOA 5IYZB 1SQPH 3TCUA 2CTQA 4LC1A 3OR6C 4Z1MG 4DR5B 3JD4A 1SERA 4B3SO 3L72H 2PY5A 3SYPA 3TXSA 1YXBA 4YY3B 4WCEV 1N4CA 3JYCA 5LXTA 3ASNB 4FLXA 4NTYA 5C8YA 2P90A 5IWAO 3JASA 3AG4B 1QR8A 3KZIZ 1Y76B 2P22C 2A3QA 1FXVA 3HR0A 4G28B 1TAEA 4IIJB 2UXDO 4CC5A 3K58A 2Q6AA 4FFBB 5FPOA 2HR3A 3FB6C 4DV2B 1ROPA 1TUBB 1IVSA 5IY5C 4GKKB 1PM9A 3K0GA 2WWWA 1AI6A 1GN3A 3AG1B 2P7TC 1WPBA 3JARB 4RQEA 3RYCA 5GW7A 1NVPB 4JI4O 5FNVA 3VQYA 3MAQA 1MSDA 1R1BA 4LFCO 1P7GA 3DXRB 3ICXA 4DR1B 4ZI7A 3AK1A 3C3TA 1JQ0A 1AROP 4L87A 1N8RW 2DOSA 4CZZA 3BABA 4IYHA 1LNQA 2ZNIA 4X89A 1NVPD 4JV5O 3GVMA 2LGWA 2O57A 2JJ1G 2V1DA 1JPXA 2JGUA 3PN1A 3KCXA 3ABKC 4EFEA 5DEDA 3N2GB 4FFKA 1L0NH 4F6RA 5LMNO 5JJEB 2W0XA 1NTMH 4LF5O 4DV1O 1GKFA 4O4IA 3K3WA 4IT5A 2ARHA 2P5OA 2LFRA 2ZXWC 1ENVA 1AJPA 4GT1A 1M5IA 4KFMA 5BY1A 3HKBB 3OE7G 3HKEA 1WB7A 1LUWA 4KUMA 5GONB 2JEXA 2YEVA 4MVQA 4QE7A 1EN5A 1KU9A 2FB5A 2QKSA 1UJWB 4DV0O 2HFEC 3DC5A 1LR1A 5GTIZ 5EC1C 4FLVA 3X2QC 3DXRA 3P3NA 2F4VO 1XMQB 2EJRA 1VQLV 2JJ2G 5KHIA 5BXZA 5J9PC 1Q43A 3JAWB 1N36B 1J95A 2ATKC 3IC7A 5IJ9B 1OCZB 2ZD9A 4MS2A 2OCCC 4O2AB 2OT5A 4JI3O 1D5NA 2F95B 2N04A 1FXHA 5CA3A 5KUMA 4DV7O 2WA3A 1K4CC 3G80A 3ZN0A 4I0XA 4JPRA 2LW7A 4W4LA 1VQ5V 4UVCA 3ZMZA 3OD4A 1P4RA 5JJJB 5KA5A 3UT5B 5LA6B 1Y74B 2QWPB 4WFFA 1Q8IA 1IBLO 2OWOA 1XQ8A 1KB9F 3CE2A 4KP4A 1AILA 2GHYA 2M7WA 2YEVB 2BSKA 1URFA 4FVMA 1AR4A 3B8MA 5B1BB 3Q4HA 3ZHQA 2Q69A 1SS3A 3A8TA 5CA1B 3SYAA 1HNXB 2ZCEA 3G71V 4HNAB 4YIPA 1K7DA 1OCOB 1K5SA 2EIKB 2QGNA 4B08A 3CS5A 2UUAB 4OX9O 4LFCB 4I4TB 1KMIZ 4QE9A 3GWKC 1Q82W 1CP9A 3STZC 4X62O 1K4DC 1K5QA 2ITCC 4J80A 4U7OA 2X6AA 3OM3B 4B7KA 1BMFG 1ZL8A 2PTMA 2WLHA 5IWAB 4ZOLA 1PP9H 1BSMA 1B06A 1N36O 5EBWC 5IJ0A 4UCOA 4P2ZA 2EBOA 2D3OW 4X1YA 4O4HB 1K8AW 2Y69B 1GM9A 1N33O 1YZBA 2ZKOA 1R73A 1M57C 1OHHG 1K97A 1JR9A 4O4JB 2HG5C 2EILB 3J81N 4JAAA 3CCQV 1XL6A 4B3MB 4OPAA 4NVPA 4ABMA 1HW7A 4IIJA 3ZEDA 1RPRA 4JI2B 1I7FA 3RWRD 4KHPO 1V9PA 1VIBA 3D36A 4H0LB 1XMQO 4YJ3B 3LNMB 3ZMSA 5FPRA 4EB6A 5DN6G 2EX3A 3TK1A 4IL6Z 3PJSK 1FFXA 2KSDA 2PYLA 2EZOA 3EFFK 5EK0A 1VMGA 2E5LO 3G67A 3H1LH 2H94A 1SQBH 3RN4A 5IDJA 4GLXA 1PL4A 4XDJA 1S5LZ 1Y6XA 4DV5B 3RYFB 5B5EZ 3CC2V 2WLKA 4H37A 1HNWB 1W2BU 2QEXV 3ZCCA 4LCUC 2WLIB 4WFGA 2EJ7A 4PV1B 3SYQA 3CC7V 3KG2A 1G8MA 1BHBA 4BAYA 1E1QG 2RJZA 1BHAA 1WLEA 2W6JG 4UXNA 2GDSA 2MK3A 3CHXA 1BT8A 3OMAB 3UQ8A 4J7ZA 3R65A 4FM2A 5FL7G 4MW3A 4U3JB 3RYHB 4IYIA 2EZPA 4I55A 3ZHSA 1VQ6V 1FYJA 2Y0PA 2D2CB 2ZE7A 3IGAC 1O9HA 2JGDB 4EKWA 3N2KA 3CEIA 5IYCO 1H2KA 4X20B 1FFXB 1JFFA 2CK3G 4U7NA 2ITDC 4YJ2B 2B5UA 4EFBA 4IHJA 2IH3C 5GTHZ 4I7ZB 3SR2C 5J2UB 3RYIB 3AG2C 5H9CA 2F93B 4DR5O 4GUNA 2ETNA 4PDLA 3ABMB 2LW1A 2ZXWB 1EBOA 3SJQC 3SGIA 2ZDIA 3N2GA 1JJOA 4DV1B 1EFRG 4UCVA 1HNWO 1NTKH 2JK5C 4JYAB 1I0HA 2IH1C 3N27A 1VQ9V 1U97A 2X6CA 5CA0A 4C7UA 3WG7B 3RGBA 2LGQA 1Q6IA 1SC5B 4LFBO 2B1IA 1Q6UA 1WN7A 1XILA 2UUBO 3OEHG 2VQEO 4DYLA 5KMGB 2NN4A 1DTOA 3ABUA 2KG7B 5JQGB 1ZTEA 1YF2A 4I50A 3UO2A 4YHHO 3JAKA 2E76B 4JI8O 4O4LA 1H8HG 4JYBA 3JAWA 4DV3B 3BPZA 2LFSA 4DK1A 2JVDA 3CYOA 2VWKA 1XL4A 1PNKA 3JAMN 3LDEA 2HP8A 2Z0AA 2R9RB 1YVWA 4OPHA 1AI4A 1S3JA 1VQOV 4Q20A 1GRJA 3K06A 5LHIA 1DGSA 5C93A 3W7XA 1IBKB 4PI2A 2P4VA 1VF6C 4H13B 2QE7G 3SPHA 3ZMUA 4XDLA 3AK3A 3ABLB 4WFAV 1F7YA 4IHJB 3CRAA 1ORQC 1SQFA 2CH7B 1Y67A 1OCRC 1HNZB 1ZWIC 3CXHF 5IE9A 4HYOA 3LDDA 2BE3A 1AVMA 3E35A 4BW9A 1VQMV 1GH6A 1QBZA 1FXKA 3KKYA 4UV8A 2UUCB 2UUAO 4TV9A 4QPJA 2EIMB 1JOYA 2IU3A 3B40A 1T5EA 2IW5A 5H5NA 4MW8A 4JI3B 2Y69C 1JVMA 1P7BA 4BW5A 2R70A 1R6TA 3JARA 3MHHC 4UCSA 2KG7A 1R6KA 1IBLB 2W0FC 2ZR3A 4DR4O 4KL1A 1R6NA 4JZGA 4DUZO 3CCLV 1AR1B 4JI7B 4PA4A 3QO7A 2FMLA 5LOVB 1AJNA 3T1YO 4O4JA 2CH7A 4E4EA 1SETA 3FKSG 1HWYA 4MVOA 1TUEB 3FYIB 5FNVB 3JCZA 5JVDB 1OCRB 4DR1O 3BA8A 1NKDA 5D5PA 1H2NA 3FAVB 1XI1A 2LQTA 4JI0O 2JRIA 2ZDIC 2FTKA 3TXQA 1VQ8V 4LFAO 5IYBO 5LL6Y 4LH6A 1PKXA 2A0LA 1NJIW 3BCCH 1FS0G 3DSQA 1GN6A 2Q9LA 1N34B 1GMGA 1YTFD 1OCCC 3E2EA 4FJCC 3OGIB 4U3JA 2PF4E 4J10A 1KYOF 4D6TH 1BQ0A 5LHHA 4MTFA 5EBLC 4B3RB 4JI5O 4G2KA 5BZBA 4F4LA 4G27B 1AJQA 1YI2V 2G38A 3EVKA 2B9ZA 3CCJV 3L71H 1XHZA 4J11A 1N33B 4N21A 1M90W 3RYHA 1Q3EA 1KQSU 2YI8A 5B1AC 4TV8A 2CTWA 4KHPB 2ZR2A 4YXWG 2ZE5A 2AGAA 3DC6A 5DECA 1KBHA 2UXCO 2ZM6B 3OAAG 4JI6B 1W0JG 2Q0OC 4WFBV 4O2AA 1GM8A 1Q81W 4BIUA 5LGUA 1AP5A 4JAVA 1MG1A 1NTZH 3SPGA 2XHBA 3HKDA 4JI7O 2WSSG 1H2GA 4LF8B 1S0VA 3OEEG 1COWG 4FLUA 1Z2GA 5EC2C 3DTUB 3ZBHA 5CA0B 2N05A 2RDCA 4CBCA 4CH5A 2DYRC 1MNGA 2IM9A 2Y48A 3HKCA 4PDVA 4DW1A 5C8YB 3M7MX 1FXKC 4NKGB 1VF5B 5LMUO 3RYCB 2PUSA 2JS3A 4R8CA 3CP1A 2IU0A 1IBMB 5AG2A 4DV2O 1YTFB 2E75B 2GTAA 1YIJV 4I50B 2PGGA 2B1GA 3RVYA 2HLDG 4JTDB 5BMVA 2IJHA 4GX0A 3FX7A 5ITZA 3ABKB 3SJBC 3E8FA 2Q7EA 3VBBA 4O2BA 4DV6O 3UKMA 3APQA 4NR1A 3LSSA 4JZ2A 3SDLA 1YSCA 3B2EE 4JI0B 4JYYA 4U3FH 2DMXA 4WBNB 3BVOA 1US6A 5EZYA 3BHPA 1J5EO 1NU1H 4O4HA 1VQNV 2HEPA 3QO8A 2BTQA 3H9VA 4DV0B 3OT7A 4PHZA 1Z5VA 2UXDB 3NR7A 2P6JA 2XT9A 4TUYB 3FD9A 2VWJA 4D7TA 3ASOC 1BQZA 3OTOB 1W59A 4ZIBA 1SA0A 3CX5F 3CCRV 4E2LA 2MW2B 2PI5A 3E8GA 1OZ0A 1FXKB 3H1IH 5JWPA 3SPJA 3JD3A 1XHXA 5LHGA 2DW4A 4HZ3A 3ZX6A 3HKEB 3THOA 3UO3A 3TGUH 4RO2A 1DF5A 2QDOA 1YEWA 2BOCC 4UVAA 5LGNA 1OV9A 2Q68A 4XDKA 5EIBD 2EIMC 1N0JA 1YDXA 4X1IA 1ZAUA 3P32A 2WLLA 4RUEA 2ODMA 2UXBB 4DV5O 5LP6B 1IDSA 1M4UA 2QM4A 2Z3YA 3AG4C 3OGCC 4P9OA 4AHCA 3S3WA 3JATB 1W0KG 3VQWA 1WP7A 4J9ZB 5L3DA 5LXTB 4FLTA 3AG2B 2XAQA 3K04A 2ZIOA 3L9DA 5CA1A 5JCOA 1K73W 3CRMA 4PA7A 4CH6A 4UVBA 3RYIA 5EZYB 4J9YB 1OCOC 3K5MA 3LSQA 3AG1C 3H1HH 2LJ2A 4Q6GA 5EYPA 1HNXO 5BR8O 1I5YA 4I4TA 1YJ9V 4J42A 2E5LB 5KAFZ 2BOBC 4JV5B 1A32A 1Y76A 4JASA 1SZTA 4DXWA 2A79B 4R6ZA 3P30A 4MTGA 4DUZB 4J41A 1BCCH 2EIJC 3ML0A
chains in the Genus database with same CATH topology
3W7UA 4HAMA 4BIZA 2A9HA 2AHYA 4R7CA 3A0RA 4PA9A 1H8HG 1VQKV 3OMIB 1QCEA 4JYBA 1PL0A 1SESA 5B1AB 3T2MA 3IFXA 1YJWV 5E1AC 1NBMG 2LFSA 3T4ZA 3CYOA 1GO3F 1XL4A 1PNKA 3SPIA 5B1OA 4TWKA 3LDEA 3ZRWA 2R9RB 1F4MA 1AI4A 1QLEC 1S3JA 3ETGA 3LDCA 3OMNB 3FB7C 1IXMA 4Q20A 1VQOV 3ABLC 1BL8A 2WLMA 3K06A 2X6BA 5LHIA 4GX5A 5KUKA 3BEHA 1F51A 4JAUA 5C93A 3W7XA 1YITV 5H6QA 4MVMA 3SYOA 1JX9A 3TCUA 1QLEB 4LC1A 5KA6A 3SPCA 3OR6C 4GX2A 4X88A 2JEUA 4Z1MG 2QE7G 3JD4A 1SERA 3SPHA 1SRYA 3ZMUA 1R3KC 2WLNA 4XDLA 3SYPA 3HB3B 2HJFC 3ABLB 4LP8A 4WFAV 2NLJC 4WCEV 1ORQC 3JYCA 1Q86W 2H8PC 3ASNB 2P90A 3GWOA 3JD1A 1OCRC 1Y4MA 1ZWIC 1VQ7V 3AG4B 1QR8A 4HYOA 1FXVA 4G28B 4MSWC 4X8AA 3LDDA 3E35A 1VQMV 3JD2A 3MHSC 1QBZA 1FXKA 1L1FA 3ZRXA 2Q6AA 4ZKIA 4UV8A 2HR3A 4QPJA 1MABG 1M9NA 3FB6C 2EIMB 1JOYA 4N23A 1ROPA 2IU3A 5IY5C 2IW5A 4MW8A 3K0GA 3T1CA 2WWWA 1AI6A 2Y69C 5L3GA 1JVMA 3AG1B 1S77D 1P7BA 4BW5A 3BY6A 5CMUA 4QNHB 2P7TC 4RQEA 4ZBMA 2XAGA 3MHHC 2GSMB 5GW7A 3ZMTA 1R6KA 1VQPV 1NVPB 3E89A 1S72V 3AG3C 2OTLV 2W0FC 2ZR3A 2W6IG 2YSUB 1R6NA 1JQ0A 1E1RG 1AROP 4L87A 3CCLV 1N8RW 1AR1B 2K1EA 1M56B 4CZZA 2EIKC 2UXXA 1CEZA 3I55V 1NH2D 4PA4A 3D3IA 1LNQA 1PNLA 4GX1A 3QO7A 4X89A 1K34A 1NVPD 4PDRA 1AJNA 2AHZA 2JJ1G 2V1DA 1SETA 1JPXA 2HVJC 3FKSG 1DF4A 4MTOA 2EINB 2IJKA 1HWYA 3ABKC 4MVOA 1F4NA 3E86A 1TUEB 5B3SC 3FYIB 1V55C 2DQ0A 1YHQV 1S76D 1GKFA 3JCZA 1OCRB 3K3WA 2LFRA 1NKDA 2XAFA 2ZXWC 3CCSV 1ENVA 1AJPA 4GT1A 4KFMA 2DWDC 3OE7G 4MVRA 4KUMA 1NH2B 2XAJA 2JEXA 2YEVA 4MVQA 5L3FA 1MSWD 2ZDIC 4QE7A 2FTKA 1RM1B 3CCMV 3ZRSA 3ZRWB 1VQ8V 3X2QB 3G6EV 2QKSA 5IYBO 3QO5A 2QTOA 1UJWB 2NNUA 1PKXA 2A0LA 1NJIW 2HFEC 1FS0G 1K3EA 1QLNA 5B1NA 1GMGA 1YTFD 5EC1C 1OCCC 3E2EA 4FJCC 5H6RA 3X2QC 1NR1A 2EJRA 5LHHA 1VQLV 3K03A 2JJ2G 4MTFA 3NXSA 5EBLC 2EIJB 1K33A 5J9PC 3CXCU 2DWEC 1GTOA 1J95A 2ATKC 3IC7A 1OCZB 2ZD9A 4G2KA 5BZBA 4MS2A 4DO2A 4F4LA 2OCCC 5L3BA 1KC8W 1G4YB 2IJIA 2OT5A 4G27B 1AJQA 4I9WA 2KB1A 1YI2V 1OCZC 4QPKA 1NR7A 4JYCA 1FXHA 4WF9V 4WFEA 3CCJV 5CA3A 5KUMA 1AI5A 4N21A 3UM7A 1M90W 1K4CC 3ZN0A 4P9PA 1KQSU 5B1AC 4JPRA 1DLBA 2ZR2A 3ZJZA 1VQ5V 4YXWG 3CPWU 4UVCA 4RAIA 3ZMZA 1P4RA 2XASA 1R3LC 5KA5A 3ETEA 5LGTA 3ASNC 4LBEC 2HVKC 4WFFA 2OTJV 2EIJC 4KP4A 3OAAG 2GHYA 1W0JG 2M7WA 2YEVB 3SYCA 1E79G 1KKDA 5B3SB 5HFMA 3CCVV 4WFBV 3B8MA 5B1BB 4JF3A 1GM8A 4QIWF 1Q81W 2ZQMA 4BIUA 2Q69A 5LGUA 4JAVA 3TETA 4TSFG 3SYAA 3K0DA 3G71V 3LUTB 1K7DA 1MG1A 1OCOB 3SPGA 2WSSG 3G4SV 1H2GA 1K5SA 2P67A 1B6QA 2DYSB 2EIKB 4FMTA 3F7YC 3M99B 2QA4V 1S0VA 3OEEG 1COWG 1GK9A 2XAHA 3OFNG 5EC2C 3DTUB 1WPXA 4QE9A 1Q82W 1CP9A 3STZC 4CBCA 4ASUG 1PNMA 2DYRC 3ABMC 1K4DC 1K5QA 2Y48A 2ITCC 4U7OA 1QVFU 1Y66A 2UXNA 2X6AA 2C2AA 4R50A 3OM3B 4PDVA 3ZN1A 1BMFG 2WLHA 1FXKC 1R3JC 2IJJA 2DYRB 2XOKG 4R8CA 3CP1A 2IU0A 2WLJA 1KP2A 2F43G 1KD1W 1YTFB 4UUJC 1YIJV 1EZJA 5EBWC 2B1GA 3RVYA 4P2ZA 2HLDG 4H33A 4JTDB 1Q7YW 2EBOA 2IJHA 2D3OW 1KP3A 2R9IA 4GX0A 3I56V 3CMAV 2WLIA 1K8AW 2Y69B 1GM9A 3ABKB 3E8FA 1R73A 1M57C 2WAMA 3VBBA 1OHHG 1K97A 3OR7C 4JTAB 5CN0A 3UKMA 3VOUA 1FFTB 2EILB 2HG5C 1M56C 3AG3B 3RVZA 3LSSA 3CCQV 2QM8A 1YSCA 2JIZG 1XL6A 3OW2U 1NQTA 1M57B 5LBQA 1H38A 3FB5C 4QJFB 4MTXA 2EILC 2PI4A 2DQ3A 3E8BA 3K9AA 3CMEV 3T4DA 1KECA 3ASOB 1RPRA 3ZMVA 5B1BC 4RUFA 5HFLA 1K92A 3D36A 4WFHA 1VQNV 2DYSC 3JD0A 3QO8A 2EINC 3LNMB 3ZMSA 3B8NA 1I5XA 5L3CA 1QR9A 2P6JA 5DN6G 3K79A 3QNEA 3TK1A 5DM6V 4RQFA 3PJSK 3CD6V 2EZOA 3ASOC 3EFFK 2WPDG 1RM1C 5EK0A 4FIPC 3CCRV 4E2LA 5IY5B 2PI5A 3E8GA 5L3EA 2V7QG 1OZ0A 1FXKB 2H94A 3SPJA 1F23A 1YJNV 3WG7C 2OCCB 3JD3A 3ZIAG 5IDJA 5LHGA 2DW4A 4XDJA 3WFVA 4JTCB 3GB7C 4HZ3A 5CBFA 3ZRVA 4OXSA 3CC2V 2WLKA 4H37A 4RO2A 1AI7A 1DF5A 2X0LA 2BOCC 4UVAA 5LGNA 1W2BU 2QEXV 3ZCCA 4LCUC 2Q68A 2WLIB 3OUSA 2HKOA 3B77A 4WFGA 4UV9A 3ABTA 3W7TA 4XBFA 1R3IC 3SYQA 3CC7V 3KG2A 1G8MA 1S5HC 1VQ4V 2Z5UA 1BHBA 4XDKA 4BAYA 3K08A 1E1QG 1V54B 1THZA 3ETDA 1GM7A 1BHAA 2EIMC 4FK5C 2LP7A 1WLEA 2W6JG 1CPYA 4UXNA 3P32A 2MK3A 4P30A 3EHBB 3OUFA 2WLLA 4RUEA 3OMAB 3R65A 4MVZA 1V54C 5CBGA 5FL7G 4MW3A 3STLC 3W7SA 3RBZA 3FYEB 1JJ2U 2Z3YA 4FPPA 2QM7A 4MT8A 3AG4C 3OGCC 2EZPA 4P9OA 1VQ6V 3CC4V 4PELA 1W0KG 1V55B 3IGAC 4JGSA 3E8HA 4J9ZB 5L3DA 4EKWA 3AG2B 2XAQA 3H01A 2X7RB 4MVUA 3K04A 5IYCO 4PA6A 2CK3G 2XNDG 1RPOA 4U7NA 2ITDC 2B5UA 1K73W 3AEIA 2IH3C 3E83A 4PA7A 4PDMA 4UVBA 3CCEV 3AG2C 5EBMC 5H9CA 5CBHA 1M1KW 3RW0A 4PDLA 3ABMB 4GCZA 2ZXWB 1EBOA 3SJQC 4MVSA 2ZDIA 4J9YB 3HPLC 1OCOC 3LSQA 1QVGU 3AG1C 1EFRG 3F5WC 4PA3A 2JK5C 1H8EG 1JCHA 1I5YA 1YJ9V 2IH1C 1VQ9V 2X6CA 3CCUV 4I5SA 2JDIG 2BOBC 3F7VC 1MOFA 3WG7B 5IYDO 1OCCB 4JASA 1SZTA 4DXWA 2B1IA 2A79B 3MD0A 4R6ZA 3P30A 2Q67A 3OEHG 3W7WA 1K9MW 4MTGA 1PD3A 2WLLB 1DTOA 3FB8C 3ABUA 3DGEA 4TT3G 3ML0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JGS A;  3B8M A;  4JF3 A;  4FJC C;  4FIP C;  3H01 A;  3GWO A;  2X7R B;  4E2L A;  1ENV A;  1I5Y A;  1Y4M A;  4N21 A;  5HFL A;  1Y66 A;  1K34 A;  4FK5 C;  1QR8 A;  1F23 A;  2LP7 A;  4JPR A;  5CMU A;  1DLB A;  1MG1 A;  1K33 A;  5KA6 A;  5CN0 A;  2MK3 A;  1QCE A;  3WFV A;  3B8N A;  1MOF A;  1I5X A;  3MHH C;  1JPX A;  5H9C A;  5KA5 A;  1QR9 A;  1DF4 A;  3CP1 A;  1SZT A;  4G2K A;  2P6J A;  3MHS C;  1QBZ A;  3M99 B;  1DF5 A;  3CYO A;  1EBO A;  3P30 A;  2M7W A;  2EZP A;  3B77 A;  4N23 A;  2EZO A;  2EBO A;  2OT5 A;  1JQ0 A;  3K9A A;  5HFM A; 
#chains in the Genus database with same CATH topology
 1MZF A;  2F1M A;  4FM1 A;  5D5Q A;  3W7U A;  4HAM A;  2YDE A;  4BIZ A;  3JAK B;  2HJD A;  4LF8 O;  4R7C A;  4PA9 A;  1VQK V;  4X65 O;  1PL0 A;  1SES A;  3WB0 A;  1TUB A;  1YJW V;  4X1K B;  3T4Z A;  3RFR A;  4UB6 Z;  5B1O A;  4TQD A;  4TWK A;  3SPI A;  4GKJ B;  3ZHR A;  3LDC A;  3ETG A;  4B3S B;  1BL8 A;  2WLM A;  3BAA A;  5KUK A;  1QU7 A;  1VEW A;  3BEH A;  1YIT V;  5H6Q A;  4MVM A;  3BA9 A;  3SYO A;  1JX9 A;  3JAL A;  1QLE B;  1Z5W A;  5CB4 B;  5KA6 A;  3SPC A;  4LF9 B;  4X88 A;  4D7S A;  2JEU A;  2ZE6 A;  4O4L B;  1SRY A;  2ZIM A;  2YID A;  4YJ3 A;  3HB3 B;  3O65 A;  1AR5 A;  5JH7 B;  1Q86 W;  1EN6 A;  2H8P C;  2YUA A;  4DR7 O;  5JJN B;  3JD1 A;  4DV6 B;  1IX9 A;  3IC9 A;  2VRZ A;  1VQ7 V;  4GKK O;  3K5O A;  4AIL C;  4X8A A;  1D2D A;  1N0N A;  4B3R O;  4AQY B;  1FAF A;  4X66 B;  4LF6 B;  1BS3 A;  1L1F A;  4AQY O;  1MAB G;  3L75 H;  1M9N A;  4DR2 B;  4FZ0 A;  4N23 A;  1S5J A;  2P4K A;  4K8X A;  3HKB A;  4Z2W A;  1RSO B;  4DUY B;  3MDS A;  4NXM B;  3T1C A;  1TGO A;  3BY6 A;  3ZMT A;  2GSM B;  3E89 A;  1S72 V;  1BGY H;  3AG3 C;  2OTL V;  4BR6 A;  2NR5 A;  2W6I G;  2F66 C;  3JSL A;  2OIE A;  1E1R G;  1UFI A;  3WB2 A;  1M56 B;  4UCT A;  2EIK C;  2Q4P A;  1CEZ A;  3I55 V;  3D3I A;  1PNL A;  4GX1 A;  1K34 A;  3ZS8 C;  1SZX A;  4DR3 O;  1XNQ B;  4I0X B;  2HVJ C;  2EIN B;  2IJK A;  1F4N A;  4LWS A;  5A9G A;  2UXC B;  1V55 C;  2DQ0 A;  4LF4 B;  2HHH B;  1GN2 A;  5JVD A;  3CSX A;  5JCO C;  2BSK B;  2XAF A;  4DR7 B;  3N2K B;  4CS3 A;  1NH2 B;  4LNU A;  1B3Q A;  2E74 B;  3IJ4 A;  1RM1 B;  3CCM V;  3ZRS A;  5LYJ B;  3VQV A;  3G6E V;  4BWA A;  4UFZ A;  3QO5 A;  1ZSP A;  4TUY A;  1MA1 A;  2NNU A;  3G6B A;  3E22 A;  2QR4 A;  5B1N A;  1QLN A;  2OCH A;  4UB8 Z;  1QQC A;  5H6R A;  3JAS B;  3NXS A;  4X1Y B;  2WA4 A;  3L73 H;  2DWE C;  2OYQ A;  5KX5 B;  3FAV A;  2ILM A;  2XTA A;  1QNM A;  4DW0 A;  1XNQ O;  3TJT A;  2QJ1 A;  1G4Y B;  1PPJ H;  2KQX A;  2YC0 A;  2KB1 A;  4I9W A;  4DR6 O;  4JYC A;  3H1K H;  4ZHQ B;  1X59 A;  4WFE A;  1MMM A;  2ZT9 B;  4P9P A;  2YS8 A;  3ZJZ A;  3FFQ A;  3C90 A;  1R3L C;  4ZI7 B;  4DR4 B;  3ETE A;  1IXB A;  2Q5Z A;  4PI0 A;  2VQE B;  2HVK C;  4PD4 F;  2OTJ V;  5LP6 A;  1YCI A;  2IBZ H;  3OTO O;  3SYC A;  4EB6 B;  1WP8 A;  2GBO A;  1E79 G;  1KKD A;  5HFM A;  4JF3 A;  5B66 Z;  1WAZ A;  3TET A;  4TSF G;  3K0D A;  4LWS B;  3LUT B;  2DYS B;  2AXT Z;  4FMT A;  1I94 O;  1GK9 A;  2XAH A;  1IZ3 A;  1JMK C;  1WA8 A;  4J7K A;  5EYP B;  1PNM A;  4ASU G;  1HNZ O;  1FJG B;  1QVF U;  1HDJ A;  1FJG O;  1X4T A;  5GON A;  5E79 Z;  1R3J C;  2IJJ A;  2DYR B;  2XOK G;  4K35 A;  4K8Z A;  2WLJ A;  1KP2 A;  2F43 G;  3HKD B;  4UUJ C;  1EZJ A;  4LH7 A;  2R9A A;  4H33 A;  3IAY A;  5BMV B;  4X66 O;  4LF6 O;  1KP3 A;  3CMA V;  2WLI A;  1EM1 A;  4I55 B;  4X20 A;  4UCU A;  2P06 A;  1J5E B;  1IBK O;  3UT5 A;  3OR7 C;  5CN0 A;  3VOU A;  1FFT B;  3SJC C;  2Q7G A;  2Y4U A;  3S3X A;  1TA8 A;  5K1P A;  1VF6 A;  3OW2 U;  4O2B B;  2M6Y A;  5LBQ A;  1H38 A;  1SQQ H;  4QJF B;  4MTX A;  4NXM O;  3K9A A;  1SF9 A;  3CME V;  1RFY A;  4HNA A;  4L8J A;  3T4D A;  1AP6 A;  4YHH B;  1KEC A;  3ASO B;  2ZM6 O;  5B1B C;  4RUF A;  5HFL A;  1K92 A;  2DYS C;  1TVK B;  1RSO A;  3B8N A;  5L3C A;  1IUR A;  1QR9 A;  3APO A;  4A5U B;  1ZL8 B;  4RQF A;  4FZ1 A;  3QVN A;  4B7E A;  5IY5 B;  5L3E A;  2V7Q G;  1Q5O A;  1KKC A;  2QWR B;  2OIG A;  3WG7 C;  5K1X A;  3WFV A;  1EZV H;  5CBF A;  3ZRV A;  3LNN A;  2BTQ B;  1AI7 A;  3K9S A;  1LUV A;  2FKX A;  3CJH A;  4XBF A;  1R3I C;  4BIO A;  4K0K O;  2RQ6 A;  1VQ4 V;  4K0K B;  3K08 A;  3ETD A;  3K59 A;  2Q0A A;  3UCS C;  1GM7 A;  4FK5 C;  2LP7 A;  3P3P A;  4ZOL B;  1OJH A;  4P30 A;  4LR3 A;  1WJZ A;  4MVZ A;  1HR0 O;  1V54 C;  4TV8 B;  3L70 H;  1FPO A;  2AW9 A;  1JJ2 U;  2DN9 A;  2GTS A;  3CC4 V;  1V55 B;  5TIS Z;  3E8H A;  4DV7 B;  2X7R B;  4YY3 O;  4PA6 A;  2UU9 B;  1RPO A;  2LO1 A;  4DR6 B;  1P49 A;  3AEI A;  2YI9 A;  1UPG A;  3E83 A;  1GN4 A;  4PDM A;  5LP6 C;  4X1I B;  3RW0 A;  3QF7 A;  2Q73 A;  2L35 A;  2PZS A;  3HPL C;  4IGG A;  2HHH O;  4CH4 A;  4LF5 B;  2PYJ A;  3WB1 A;  1JCH A;  4TV9 B;  5J2T A;  2YIB A;  2ADP A;  3D8C A;  3CRC A;  3R66 A;  3CCU V;  1MOF A;  3F7V C;  4LNU B;  3T1Y B;  5LYJ A;  4NXN B;  3MD0 A;  3W7W A;  3K5L A;  1NI8 A;  3FB8 C;  3DGE A;  2CTR A;  4TT3 G;  4UCR A;  5KX5 A;  1NS1 A;  4JI4 B;  2A9H A;  2AHY A;  3U10 A;  4RWU A;  5EIB C;  2UUB B;  1SQG A;  3O9O A;  5IT9 N;  3CRR A;  3IFX A;  3AK2 A;  1NBM G;  3CWB H;  4DRX A;  5LOV A;  1O9G A;  3ETQ A;  2JGD A;  3QTC A;  1QLE C;  3OMN B;  3FB7 C;  1IXM A;  3T1H B;  4OX9 B;  3A0B Z;  4PJ0 Z;  1HP8 A;  1GAX A;  5A2Q N;  1U96 A;  1F51 A;  4JAU A;  2GV9 A;  3BFR A;  2FL4 A;  1EN4 A;  1MZE A;  4GX2 A;  3A0H Z;  3J7A U;  2CAZ C;  1R3K C;  2WLN A;  2HJF C;  2EUL A;  3B09 A;  4LP8 A;  1JFF B;  2CGN A;  4B3M O;  2NLJ C;  2V4D A;  1RP3 B;  3ZHV A;  5KHG A;  3D36 C;  4JI1 O;  3GWO A;  1NZ6 A;  3U0Z A;  1Y4M A;  3A2F A;  4MSW C;  5F2V O;  3CRQ A;  3H1J H;  1ZX3 A;  2UUC O;  3JD2 A;  3MHS C;  3ZRX A;  2AZ2 A;  4ZKI A;  4FM0 A;  5J2T B;  3JCU Z;  4CS4 A;  5JH7 A;  5L3G A;  1S77 D;  5CMU A;  4QNH B;  2QWQ B;  4ZBM A;  2XAG A;  1VQP V;  3B4S A;  2DE0 X;  2Q8V A;  2YSU B;  1XNR O;  3JAT A;  2K1E A;  4LFA B;  2QKA A;  2UXX A;  3ZHU A;  1NH2 D;  4NXN O;  4PDR A;  2AHZ A;  5KHH A;  4LF7 O;  1DF4 A;  2ADQ B;  4MTO A;  1PV0 A;  3E86 A;  4AI8 A;  5B3S C;  4F6R B;  1YHQ V;  4DV4 O;  1S76 D;  4O4I B;  1HR0 B;  3C3S A;  4JI8 B;  2F4V B;  3I5D A;  3CCS V;  2DWD C;  3RYF A;  4MVR A;  2XAJ A;  5L3F A;  1MSW D;  2YIB D;  1WNS A;  2UU9 O;  2K9P A;  4B3T B;  3ZRW B;  3J80 N;  4CS2 A;  3X2Q B;  4B3T O;  4TOI A;  2QTO A;  2QKC A;  1K3E A;  1VAR A;  3WU2 Z;  1NT2 B;  3F5T A;  4JYA O;  4JI5 B;  1NR1 A;  3K03 A;  2EIJ B;  1K33 A;  3CXC U;  1GTO A;  2Y4T A;  1ZUQ A;  4NYK A;  1N34 O;  1VF7 A;  1XBL A;  2QTS A;  4DO2 A;  5LMN B;  5L3B A;  4WBN A;  3Q4H B;  1KC8 W;  1KUQ A;  1JA8 A;  3HKC B;  2AZ0 A;  2IJI A;  4QGP A;  2ZE8 A;  1OCZ C;  4QPK A;  1NR7 A;  2ZNJ A;  4WF9 V;  1N32 B;  4CC6 A;  2YIC A;  1AI5 A;  3UM7 A;  4NB5 A;  1DLB A;  3CPW U;  4ZHQ A;  4RAI A;  2XAS A;  1I94 B;  5LGT A;  3ASN C;  4LBE C;  2VQF O;  2N74 A;  1H2L A;  5KLV H;  4X1K A;  1XEQ A;  3QG5 A;  5LMU B;  2CDY A;  3ZHT A;  4TQF A;  4EEQ A;  5B3S B;  3CCV V;  4QIW F;  3CJH B;  2ZQM A;  1XMO O;  3KCY A;  4DR3 B;  4YJ2 A;  4NTX A;  1P84 F;  3G4S V;  2P67 A;  1B6Q A;  1XUQ A;  1FKA O;  5KHJ A;  2CGO A;  3JAL B;  3JSN A;  3SJA C;  5KMG A;  3F7Y C;  3M99 B;  1VP7 A;  2QA4 V;  3OFN G;  2RCV A;  2XUM A;  4ICG A;  4X9Q A;  1WPX A;  1WA8 B;  1B04 A;  3ABM C;  2CE4 A;  3LSU A;  1Y66 A;  2UXN A;  1Q90 D;  2C2A A;  2QWN B;  1L0L H;  4OGQ B;  4R50 A;  3ZN1 A;  2RMK B;  3CB2 A;  5KHK A;  3K5N A;  1KD1 W;  3AG7 A;  4YIO A;  2QSA A;  5IJ0 B;  4HBN A;  4X62 B;  1SQV H;  1Q7Y W;  5JQG A;  2VQF B;  4DK0 A;  2R9I A;  3I56 V;  2F23 A;  4LF9 O;  1WB8 A;  4F6E A;  4KXR A;  1H2S B;  2RN9 A;  4FFB A;  2WAM A;  1D5A A;  5FLX N;  4JTA B;  1XMO B;  1M56 C;  3AG3 B;  3RVZ A;  1G1X B;  2Q7H A;  2QM8 A;  2JIZ G;  3T1H O;  1NQT A;  4JI6 O;  1M57 B;  3FB5 C;  2EIL C;  2PI4 A;  2DQ3 A;  3E8B A;  4K3A A;  2ZIN A;  1BE3 H;  2FYU H;  3ZMV A;  1FD9 A;  1ZLZ A;  1CXZ B;  2CTP A;  4WFH A;  5IJ9 A;  3JD0 A;  1BZK A;  1N32 O;  3VQX A;  1TVK A;  2EIN C;  4J7J A;  3RT3 C;  1I5X A;  4CH3 A;  4W4K A;  3K79 A;  3QNE A;  5DM6 V;  4FLZ A;  3CD6 V;  2KKW A;  3L74 H;  2VS0 A;  4X64 B;  3OTF A;  3E22 B;  2WPD G;  1RM1 C;  4FIP C;  2YXH A;  2Y0I A;  4JI2 O;  1QHT A;  2L6L A;  1F23 A;  1YJN V;  2OCC B;  4GYC B;  3ZIA G;  5ITZ B;  4JTC B;  3GB7 C;  4OXS A;  2X0L A;  4DV4 B;  2RNB A;  1Q6H A;  3OUS A;  2HKO A;  3B77 A;  4UV9 A;  3ABT A;  4H44 B;  3W7T A;  2YXL A;  2YIA A;  2YXY A;  1S5H C;  2Z5U A;  1V54 B;  1THZ A;  3K57 A;  5J2U A;  1CPY A;  1XDC A;  2DJV A;  5CB4 A;  5BR8 B;  3EHB B;  3OUF A;  2GUZ A;  5LA6 A;  2H3O A;  4X65 B;  5CBG A;  1XNR B;  5IYZ A;  4LF4 O;  3STL C;  1XRE A;  3W7S A;  3RBZ A;  3FYE B;  1I08 A;  4FPP A;  2QM7 A;  4MT8 A;  4PEL A;  4JI1 B;  4JGS A;  3H01 A;  4MVU A;  3U11 A;  2XND G;  4DUY O;  4FLW A;  4LF7 B;  4LFB B;  3CCE V;  5EBM C;  1XOU A;  5CBH A;  1M1K W;  1DK1 A;  4GCZ A;  4MVS A;  4NTW A;  1SQX H;  1QVG U;  1G6U A;  3F5W C;  4GZR B;  4PA3 A;  1H8E G;  1Y74 A;  4I5S A;  2JDI G;  5H2F Z;  4DV3 O;  2JS5 A;  5IYD O;  1OCC B;  2E3C A;  1SA0 B;  2Q67 A;  1K9M W;  3M8A A;  1PD3 A;  2A7W A;  2WLL B;  4Z1V A;  2QWO B;  2A06 H;  4DR2 O;  5KAI Z;  1M93 A;  2CUG A;  3A0R A;  3OMI B;  1QCE A;  2UXB O;  5B1A B;  2BCC H;  1IBM O;  3T2M A;  4FLY A;  4I9Q A;  4GKJ O;  1H2M A;  5E1A C;  4X64 O;  3EXA A;  1L8D A;  1GO3 F;  1SKV A;  3D3Q A;  3ZRW A;  1F4M A;  1AB3 A;  4DRX B;  3ABL C;  2X6B A;  2GUZ B;  4GX5 A;  3BRC A;  2R72 A;  2BTO A;  5IYZ B;  1SQP H;  3TCU A;  2CTQ A;  4LC1 A;  3OR6 C;  4Z1M G;  4DR5 B;  3JD4 A;  1SER A;  4B3S O;  3L72 H;  2PY5 A;  3SYP A;  3TXS A;  1YXB A;  4YY3 B;  4WCE V;  1N4C A;  3JYC A;  5LXT A;  3ASN B;  4FLX A;  4NTY A;  5C8Y A;  2P90 A;  5IWA O;  3JAS A;  3AG4 B;  1QR8 A;  3KZI Z;  1Y76 B;  2P22 C;  2A3Q A;  1FXV A;  3HR0 A;  4G28 B;  1TAE A;  4IIJ B;  2UXD O;  4CC5 A;  3K58 A;  2Q6A A;  4FFB B;  5FPO A;  2HR3 A;  3FB6 C;  4DV2 B;  1ROP A;  1TUB B;  1IVS A;  5IY5 C;  4GKK B;  1PM9 A;  3K0G A;  2WWW A;  1AI6 A;  1GN3 A;  3AG1 B;  2P7T C;  1WPB A;  3JAR B;  4RQE A;  3RYC A;  5GW7 A;  1NVP B;  4JI4 O;  5FNV A;  3VQY A;  3MAQ A;  1MSD A;  1R1B A;  4LFC O;  1P7G A;  3DXR B;  3ICX A;  4DR1 B;  4ZI7 A;  3AK1 A;  3C3T A;  1JQ0 A;  1ARO P;  4L87 A;  1N8R W;  2DOS A;  4CZZ A;  3BAB A;  4IYH A;  1LNQ A;  2ZNI A;  4X89 A;  1NVP D;  4JV5 O;  3GVM A;  2LGW A;  2O57 A;  2JJ1 G;  2V1D A;  1JPX A;  2JGU A;  3PN1 A;  3KCX A;  3ABK C;  4EFE A;  5DED A;  3N2G B;  4FFK A;  1L0N H;  4F6R A;  5LMN O;  5JJE B;  2W0X A;  1NTM H;  4LF5 O;  4DV1 O;  1GKF A;  4O4I A;  3K3W A;  4IT5 A;  2ARH A;  2P5O A;  2LFR A;  2ZXW C;  1ENV A;  1AJP A;  4GT1 A;  1M5I A;  4KFM A;  5BY1 A;  3HKB B;  3OE7 G;  3HKE A;  1WB7 A;  1LUW A;  4KUM A;  5GON B;  2JEX A;  2YEV A;  4MVQ A;  4QE7 A;  1EN5 A;  1KU9 A;  2FB5 A;  2QKS A;  1UJW B;  4DV0 O;  2HFE C;  3DC5 A;  1LR1 A;  5GTI Z;  5EC1 C;  4FLV A;  3X2Q C;  3DXR A;  3P3N A;  2F4V O;  1XMQ B;  2EJR A;  1VQL V;  2JJ2 G;  5KHI A;  5BXZ A;  5J9P C;  1Q43 A;  3JAW B;  1N36 B;  1J95 A;  2ATK C;  3IC7 A;  5IJ9 B;  1OCZ B;  2ZD9 A;  4MS2 A;  2OCC C;  4O2A B;  2OT5 A;  4JI3 O;  1D5N A;  2F95 B;  2N04 A;  1FXH A;  5CA3 A;  5KUM A;  4DV7 O;  2WA3 A;  1K4C C;  3G80 A;  3ZN0 A;  4I0X A;  4JPR A;  2LW7 A;  4W4L A;  1VQ5 V;  4UVC A;  3ZMZ A;  3OD4 A;  1P4R A;  5JJJ B;  5KA5 A;  3UT5 B;  5LA6 B;  1Y74 B;  2QWP B;  4WFF A;  1Q8I A;  1IBL O;  2OWO A;  1XQ8 A;  1KB9 F;  3CE2 A;  4KP4 A;  1AIL A;  2GHY A;  2M7W A;  2YEV B;  2BSK A;  1URF A;  4FVM A;  1AR4 A;  3B8M A;  5B1B B;  3Q4H A;  3ZHQ A;  2Q69 A;  1SS3 A;  3A8T A;  5CA1 B;  3SYA A;  1HNX B;  2ZCE A;  3G71 V;  4HNA B;  4YIP A;  1K7D A;  1OCO B;  1K5S A;  2EIK B;  2QGN A;  4B08 A;  3CS5 A;  2UUA B;  4OX9 O;  4LFC B;  4I4T B;  1KMI Z;  4QE9 A;  3GWK C;  1Q82 W;  1CP9 A;  3STZ C;  4X62 O;  1K4D C;  1K5Q A;  2ITC C;  4J80 A;  4U7O A;  2X6A A;  3OM3 B;  4B7K A;  1BMF G;  1ZL8 A;  2PTM A;  2WLH A;  5IWA B;  4ZOL A;  1PP9 H;  1BSM A;  1B06 A;  1N36 O;  5EBW C;  5IJ0 A;  4UCO A;  4P2Z A;  2EBO A;  2D3O W;  4X1Y A;  4O4H B;  1K8A W;  2Y69 B;  1GM9 A;  1N33 O;  1YZB A;  2ZKO A;  1R73 A;  1M57 C;  1OHH G;  1K97 A;  1JR9 A;  4O4J B;  2HG5 C;  2EIL B;  3J81 N;  4JAA A;  3CCQ V;  1XL6 A;  4B3M B;  4OPA A;  4NVP A;  4ABM A;  1HW7 A;  4IIJ A;  3ZED A;  1RPR A;  4JI2 B;  1I7F A;  3RWR D;  4KHP O;  1V9P A;  1VIB A;  3D36 A;  4H0L B;  1XMQ O;  4YJ3 B;  3LNM B;  3ZMS A;  5FPR A;  4EB6 A;  5DN6 G;  2EX3 A;  3TK1 A;  4IL6 Z;  3PJS K;  1FFX A;  2KSD A;  2PYL A;  2EZO A;  3EFF K;  5EK0 A;  1VMG A;  2E5L O;  3G67 A;  3H1L H;  2H94 A;  1SQB H;  3RN4 A;  5IDJ A;  4GLX A;  1PL4 A;  4XDJ A;  1S5L Z;  1Y6X A;  4DV5 B;  3RYF B;  5B5E Z;  3CC2 V;  2WLK A;  4H37 A;  1HNW B;  1W2B U;  2QEX V;  3ZCC A;  4LCU C;  2WLI B;  4WFG A;  2EJ7 A;  4PV1 B;  3SYQ A;  3CC7 V;  3KG2 A;  1G8M A;  1BHB A;  4BAY A;  1E1Q G;  2RJZ A;  1BHA A;  1WLE A;  2W6J G;  4UXN A;  2GDS A;  2MK3 A;  3CHX A;  1BT8 A;  3OMA B;  3UQ8 A;  4J7Z A;  3R65 A;  4FM2 A;  5FL7 G;  4MW3 A;  4U3J B;  3RYH B;  4IYI A;  2EZP A;  4I55 A;  3ZHS A;  1VQ6 V;  1FYJ A;  2Y0P A;  2D2C B;  2ZE7 A;  3IGA C;  1O9H A;  2JGD B;  4EKW A;  3N2K A;  3CEI A;  5IYC O;  1H2K A;  4X20 B;  1FFX B;  1JFF A;  2CK3 G;  4U7N A;  2ITD C;  4YJ2 B;  2B5U A;  4EFB A;  4IHJ A;  2IH3 C;  5GTH Z;  4I7Z B;  3SR2 C;  5J2U B;  3RYI B;  3AG2 C;  5H9C A;  2F93 B;  4DR5 O;  4GUN A;  2ETN A;  4PDL A;  3ABM B;  2LW1 A;  2ZXW B;  1EBO A;  3SJQ C;  3SGI A;  2ZDI A;  3N2G A;  1JJO A;  4DV1 B;  1EFR G;  4UCV A;  1HNW O;  1NTK H;  2JK5 C;  4JYA B;  1I0H A;  2IH1 C;  3N27 A;  1VQ9 V;  1U97 A;  2X6C A;  5CA0 A;  4C7U A;  3WG7 B;  3RGB A;  2LGQ A;  1Q6I A;  1SC5 B;  4LFB O;  2B1I A;  1Q6U A;  1WN7 A;  1XIL A;  2UUB O;  3OEH G;  2VQE O;  4DYL A;  5KMG B;  2NN4 A;  1DTO A;  3ABU A;  2KG7 B;  5JQG B;  1ZTE A;  1YF2 A;  4I50 A;  3UO2 A;  4YHH O;  3JAK A;  2E76 B;  4JI8 O;  4O4L A;  1H8H G;  4JYB A;  3JAW A;  4DV3 B;  3BPZ A;  2LFS A;  4DK1 A;  2JVD A;  3CYO A;  2VWK A;  1XL4 A;  1PNK A;  3JAM N;  3LDE A;  2HP8 A;  2Z0A A;  2R9R B;  1YVW A;  4OPH A;  1AI4 A;  1S3J A;  1VQO V;  4Q20 A;  1GRJ A;  3K06 A;  5LHI A;  1DGS A;  5C93 A;  3W7X A;  1IBK B;  4PI2 A;  2P4V A;  1VF6 C;  4H13 B;  2QE7 G;  3SPH A;  3ZMU A;  4XDL A;  3AK3 A;  3ABL B;  4WFA V;  1F7Y A;  4IHJ B;  3CRA A;  1ORQ C;  1SQF A;  2CH7 B;  1Y67 A;  1OCR C;  1HNZ B;  1ZWI C;  3CXH F;  5IE9 A;  4HYO A;  3LDD A;  2BE3 A;  1AVM A;  3E35 A;  4BW9 A;  1VQM V;  1GH6 A;  1QBZ A;  1FXK A;  3KKY A;  4UV8 A;  2UUC B;  2UUA O;  4TV9 A;  4QPJ A;  2EIM B;  1JOY A;  2IU3 A;  3B40 A;  1T5E A;  2IW5 A;  5H5N A;  4MW8 A;  4JI3 B;  2Y69 C;  1JVM A;  1P7B A;  4BW5 A;  2R70 A;  1R6T A;  3JAR A;  3MHH C;  4UCS A;  2KG7 A;  1R6K A;  1IBL B;  2W0F C;  2ZR3 A;  4DR4 O;  4KL1 A;  1R6N A;  4JZG A;  4DUZ O;  3CCL V;  1AR1 B;  4JI7 B;  4PA4 A;  3QO7 A;  2FML A;  5LOV B;  1AJN A;  3T1Y O;  4O4J A;  2CH7 A;  4E4E A;  1SET A;  3FKS G;  1HWY A;  4MVO A;  1TUE B;  3FYI B;  5FNV B;  3JCZ A;  5JVD B;  1OCR B;  4DR1 O;  3BA8 A;  1NKD A;  5D5P A;  1H2N A;  3FAV B;  1XI1 A;  2LQT A;  4JI0 O;  2JRI A;  2ZDI C;  2FTK A;  3TXQ A;  1VQ8 V;  4LFA O;  5IYB O;  5LL6 Y;  4LH6 A;  1PKX A;  2A0L A;  1NJI W;  3BCC H;  1FS0 G;  3DSQ A;  1GN6 A;  2Q9L A;  1N34 B;  1GMG A;  1YTF D;  1OCC C;  3E2E A;  4FJC C;  3OGI B;  4U3J A;  2PF4 E;  4J10 A;  1KYO F;  4D6T H;  1BQ0 A;  5LHH A;  4MTF A;  5EBL C;  4B3R B;  4JI5 O;  4G2K A;  5BZB A;  4F4L A;  4G27 B;  1AJQ A;  1YI2 V;  2G38 A;  3EVK A;  2B9Z A;  3CCJ V;  3L71 H;  1XHZ A;  4J11 A;  1N33 B;  4N21 A;  1M90 W;  3RYH A;  1Q3E A;  1KQS U;  2YI8 A;  5B1A C;  4TV8 A;  2CTW A;  4KHP B;  2ZR2 A;  4YXW G;  2ZE5 A;  2AGA A;  3DC6 A;  5DEC A;  1KBH A;  2UXC O;  2ZM6 B;  3OAA G;  4JI6 B;  1W0J G;  2Q0O C;  4WFB V;  4O2A A;  1GM8 A;  1Q81 W;  4BIU A;  5LGU A;  1AP5 A;  4JAV A;  1MG1 A;  1NTZ H;  3SPG A;  2XHB A;  3HKD A;  4JI7 O;  2WSS G;  1H2G A;  4LF8 B;  1S0V A;  3OEE G;  1COW G;  4FLU A;  1Z2G A;  5EC2 C;  3DTU B;  3ZBH A;  5CA0 B;  2N05 A;  2RDC A;  4CBC A;  4CH5 A;  2DYR C;  1MNG A;  2IM9 A;  2Y48 A;  3HKC A;  4PDV A;  4DW1 A;  5C8Y B;  3M7M X;  1FXK C;  4NKG B;  1VF5 B;  5LMU O;  3RYC B;  2PUS A;  2JS3 A;  4R8C A;  3CP1 A;  2IU0 A;  1IBM B;  5AG2 A;  4DV2 O;  1YTF B;  2E75 B;  2GTA A;  1YIJ V;  4I50 B;  2PGG A;  2B1G A;  3RVY A;  2HLD G;  4JTD B;  5BMV A;  2IJH A;  4GX0 A;  3FX7 A;  5ITZ A;  3ABK B;  3SJB C;  3E8F A;  2Q7E A;  3VBB A;  4O2B A;  4DV6 O;  3UKM A;  3APQ A;  4NR1 A;  3LSS A;  4JZ2 A;  3SDL A;  1YSC A;  3B2E E;  4JI0 B;  4JYY A;  4U3F H;  2DMX A;  4WBN B;  3BVO A;  1US6 A;  5EZY A;  3BHP A;  1J5E O;  1NU1 H;  4O4H A;  1VQN V;  2HEP A;  3QO8 A;  2BTQ A;  3H9V A;  4DV0 B;  3OT7 A;  4PHZ A;  1Z5V A;  2UXD B;  3NR7 A;  2P6J A;  2XT9 A;  4TUY B;  3FD9 A;  2VWJ A;  4D7T A;  3ASO C;  1BQZ A;  3OTO B;  1W59 A;  4ZIB A;  1SA0 A;  3CX5 F;  3CCR V;  4E2L A;  2MW2 B;  2PI5 A;  3E8G A;  1OZ0 A;  1FXK B;  3H1I H;  5JWP A;  3SPJ A;  3JD3 A;  1XHX A;  5LHG A;  2DW4 A;  4HZ3 A;  3ZX6 A;  3HKE B;  3THO A;  3UO3 A;  3TGU H;  4RO2 A;  1DF5 A;  2QDO A;  1YEW A;  2BOC C;  4UVA A;  5LGN A;  1OV9 A;  2Q68 A;  4XDK A;  5EIB D;  2EIM C;  1N0J A;  1YDX A;  4X1I A;  1ZAU A;  3P32 A;  2WLL A;  4RUE A;  2ODM A;  2UXB B;  4DV5 O;  5LP6 B;  1IDS A;  1M4U A;  2QM4 A;  2Z3Y A;  3AG4 C;  3OGC C;  4P9O A;  4AHC A;  3S3W A;  3JAT B;  1W0K G;  3VQW A;  1WP7 A;  4J9Z B;  5L3D A;  5LXT B;  4FLT A;  3AG2 B;  2XAQ A;  3K04 A;  2ZIO A;  3L9D A;  5CA1 A;  5JCO A;  1K73 W;  3CRM A;  4PA7 A;  4CH6 A;  4UVB A;  3RYI A;  5EZY B;  4J9Y B;  1OCO C;  3K5M A;  3LSQ A;  3AG1 C;  3H1H H;  2LJ2 A;  4Q6G A;  5EYP A;  1HNX O;  5BR8 O;  1I5Y A;  4I4T A;  1YJ9 V;  4J42 A;  2E5L B;  5KAF Z;  2BOB C;  4JV5 B;  1A32 A;  1Y76 A;  4JAS A;  1SZT A;  4DXW A;  2A79 B;  4R6Z A;  3P30 A;  4MTG A;  4DUZ B;  4J41 A;  1BCC H;  2EIJ C;  3ML0 A; 
#chains in the Genus database with same CATH homology
 3W7U A;  4HAM A;  4BIZ A;  2A9H A;  2AHY A;  4R7C A;  3A0R A;  4PA9 A;  1H8H G;  1VQK V;  3OMI B;  1QCE A;  4JYB A;  1PL0 A;  1SES A;  5B1A B;  3T2M A;  3IFX A;  1YJW V;  5E1A C;  1NBM G;  2LFS A;  3T4Z A;  3CYO A;  1GO3 F;  1XL4 A;  1PNK A;  3SPI A;  5B1O A;  4TWK A;  3LDE A;  3ZRW A;  2R9R B;  1F4M A;  1AI4 A;  1QLE C;  1S3J A;  3ETG A;  3LDC A;  3OMN B;  3FB7 C;  1IXM A;  4Q20 A;  1VQO V;  3ABL C;  1BL8 A;  2WLM A;  3K06 A;  2X6B A;  5LHI A;  4GX5 A;  5KUK A;  3BEH A;  1F51 A;  4JAU A;  5C93 A;  3W7X A;  1YIT V;  5H6Q A;  4MVM A;  3SYO A;  1JX9 A;  3TCU A;  1QLE B;  4LC1 A;  5KA6 A;  3SPC A;  3OR6 C;  4GX2 A;  4X88 A;  2JEU A;  4Z1M G;  2QE7 G;  3JD4 A;  1SER A;  3SPH A;  1SRY A;  3ZMU A;  1R3K C;  2WLN A;  4XDL A;  3SYP A;  3HB3 B;  2HJF C;  3ABL B;  4LP8 A;  4WFA V;  2NLJ C;  4WCE V;  1ORQ C;  3JYC A;  1Q86 W;  2H8P C;  3ASN B;  2P90 A;  3GWO A;  3JD1 A;  1OCR C;  1Y4M A;  1ZWI C;  1VQ7 V;  3AG4 B;  1QR8 A;  4HYO A;  1FXV A;  4G28 B;  4MSW C;  4X8A A;  3LDD A;  3E35 A;  1VQM V;  3JD2 A;  3MHS C;  1QBZ A;  1FXK A;  1L1F A;  3ZRX A;  2Q6A A;  4ZKI A;  4UV8 A;  2HR3 A;  4QPJ A;  1MAB G;  1M9N A;  3FB6 C;  2EIM B;  1JOY A;  4N23 A;  1ROP A;  2IU3 A;  5IY5 C;  2IW5 A;  4MW8 A;  3K0G A;  3T1C A;  2WWW A;  1AI6 A;  2Y69 C;  5L3G A;  1JVM A;  3AG1 B;  1S77 D;  1P7B A;  4BW5 A;  3BY6 A;  5CMU A;  4QNH B;  2P7T C;  4RQE A;  4ZBM A;  2XAG A;  3MHH C;  2GSM B;  5GW7 A;  3ZMT A;  1R6K A;  1VQP V;  1NVP B;  3E89 A;  1S72 V;  3AG3 C;  2OTL V;  2W0F C;  2ZR3 A;  2W6I G;  2YSU B;  1R6N A;  1JQ0 A;  1E1R G;  1ARO P;  4L87 A;  3CCL V;  1N8R W;  1AR1 B;  2K1E A;  1M56 B;  4CZZ A;  2EIK C;  2UXX A;  1CEZ A;  3I55 V;  1NH2 D;  4PA4 A;  3D3I A;  1LNQ A;  1PNL A;  4GX1 A;  3QO7 A;  4X89 A;  1K34 A;  1NVP D;  4PDR A;  1AJN A;  2AHZ A;  2JJ1 G;  2V1D A;  1SET A;  1JPX A;  2HVJ C;  3FKS G;  1DF4 A;  4MTO A;  2EIN B;  2IJK A;  1HWY A;  3ABK C;  4MVO A;  1F4N A;  3E86 A;  1TUE B;  5B3S C;  3FYI B;  1V55 C;  2DQ0 A;  1YHQ V;  1S76 D;  1GKF A;  3JCZ A;  1OCR B;  3K3W A;  2LFR A;  1NKD A;  2XAF A;  2ZXW C;  3CCS V;  1ENV A;  1AJP A;  4GT1 A;  4KFM A;  2DWD C;  3OE7 G;  4MVR A;  4KUM A;  1NH2 B;  2XAJ A;  2JEX A;  2YEV A;  4MVQ A;  5L3F A;  1MSW D;  2ZDI C;  4QE7 A;  2FTK A;  1RM1 B;  3CCM V;  3ZRS A;  3ZRW B;  1VQ8 V;  3X2Q B;  3G6E V;  2QKS A;  5IYB O;  3QO5 A;  2QTO A;  1UJW B;  2NNU A;  1PKX A;  2A0L A;  1NJI W;  2HFE C;  1FS0 G;  1K3E A;  1QLN A;  5B1N A;  1GMG A;  1YTF D;  5EC1 C;  1OCC C;  3E2E A;  4FJC C;  5H6R A;  3X2Q C;  1NR1 A;  2EJR A;  5LHH A;  1VQL V;  3K03 A;  2JJ2 G;  4MTF A;  3NXS A;  5EBL C;  2EIJ B;  1K33 A;  5J9P C;  3CXC U;  2DWE C;  1GTO A;  1J95 A;  2ATK C;  3IC7 A;  1OCZ B;  2ZD9 A;  4G2K A;  5BZB A;  4MS2 A;  4DO2 A;  4F4L A;  2OCC C;  5L3B A;  1KC8 W;  1G4Y B;  2IJI A;  2OT5 A;  4G27 B;  1AJQ A;  4I9W A;  2KB1 A;  1YI2 V;  1OCZ C;  4QPK A;  1NR7 A;  4JYC A;  1FXH A;  4WF9 V;  4WFE A;  3CCJ V;  5CA3 A;  5KUM A;  1AI5 A;  4N21 A;  3UM7 A;  1M90 W;  1K4C C;  3ZN0 A;  4P9P A;  1KQS U;  5B1A C;  4JPR A;  1DLB A;  2ZR2 A;  3ZJZ A;  1VQ5 V;  4YXW G;  3CPW U;  4UVC A;  4RAI A;  3ZMZ A;  1P4R A;  2XAS A;  1R3L C;  5KA5 A;  3ETE A;  5LGT A;  3ASN C;  4LBE C;  2HVK C;  4WFF A;  2OTJ V;  2EIJ C;  4KP4 A;  3OAA G;  2GHY A;  1W0J G;  2M7W A;  2YEV B;  3SYC A;  1E79 G;  1KKD A;  5B3S B;  5HFM A;  3CCV V;  4WFB V;  3B8M A;  5B1B B;  4JF3 A;  1GM8 A;  4QIW F;  1Q81 W;  2ZQM A;  4BIU A;  2Q69 A;  5LGU A;  4JAV A;  3TET A;  4TSF G;  3SYA A;  3K0D A;  3G71 V;  3LUT B;  1K7D A;  1MG1 A;  1OCO B;  3SPG A;  2WSS G;  3G4S V;  1H2G A;  1K5S A;  2P67 A;  1B6Q A;  2DYS B;  2EIK B;  4FMT A;  3F7Y C;  3M99 B;  2QA4 V;  1S0V A;  3OEE G;  1COW G;  1GK9 A;  2XAH A;  3OFN G;  5EC2 C;  3DTU B;  1WPX A;  4QE9 A;  1Q82 W;  1CP9 A;  3STZ C;  4CBC A;  4ASU G;  1PNM A;  2DYR C;  3ABM C;  1K4D C;  1K5Q A;  2Y48 A;  2ITC C;  4U7O A;  1QVF U;  1Y66 A;  2UXN A;  2X6A A;  2C2A A;  4R50 A;  3OM3 B;  4PDV A;  3ZN1 A;  1BMF G;  2WLH A;  1FXK C;  1R3J C;  2IJJ A;  2DYR B;  2XOK G;  4R8C A;  3CP1 A;  2IU0 A;  2WLJ A;  1KP2 A;  2F43 G;  1KD1 W;  1YTF B;  4UUJ C;  1YIJ V;  1EZJ A;  5EBW C;  2B1G A;  3RVY A;  4P2Z A;  2HLD G;  4H33 A;  4JTD B;  1Q7Y W;  2EBO A;  2IJH A;  2D3O W;  1KP3 A;  2R9I A;  4GX0 A;  3I56 V;  3CMA V;  2WLI A;  1K8A W;  2Y69 B;  1GM9 A;  3ABK B;  3E8F A;  1R73 A;  1M57 C;  2WAM A;  3VBB A;  1OHH G;  1K97 A;  3OR7 C;  4JTA B;  5CN0 A;  3UKM A;  3VOU A;  1FFT B;  2EIL B;  2HG5 C;  1M56 C;  3AG3 B;  3RVZ A;  3LSS A;  3CCQ V;  2QM8 A;  1YSC A;  2JIZ G;  1XL6 A;  3OW2 U;  1NQT A;  1M57 B;  5LBQ A;  1H38 A;  3FB5 C;  4QJF B;  4MTX A;  2EIL C;  2PI4 A;  2DQ3 A;  3E8B A;  3K9A A;  3CME V;  3T4D A;  1KEC A;  3ASO B;  1RPR A;  3ZMV A;  5B1B C;  4RUF A;  5HFL A;  1K92 A;  3D36 A;  4WFH A;  1VQN V;  2DYS C;  3JD0 A;  3QO8 A;  2EIN C;  3LNM B;  3ZMS A;  3B8N A;  1I5X A;  5L3C A;  1QR9 A;  2P6J A;  5DN6 G;  3K79 A;  3QNE A;  3TK1 A;  5DM6 V;  4RQF A;  3PJS K;  3CD6 V;  2EZO A;  3ASO C;  3EFF K;  2WPD G;  1RM1 C;  5EK0 A;  4FIP C;  3CCR V;  4E2L A;  5IY5 B;  2PI5 A;  3E8G A;  5L3E A;  2V7Q G;  1OZ0 A;  1FXK B;  2H94 A;  3SPJ A;  1F23 A;  1YJN V;  3WG7 C;  2OCC B;  3JD3 A;  3ZIA G;  5IDJ A;  5LHG A;  2DW4 A;  4XDJ A;  3WFV A;  4JTC B;  3GB7 C;  4HZ3 A;  5CBF A;  3ZRV A;  4OXS A;  3CC2 V;  2WLK A;  4H37 A;  4RO2 A;  1AI7 A;  1DF5 A;  2X0L A;  2BOC C;  4UVA A;  5LGN A;  1W2B U;  2QEX V;  3ZCC A;  4LCU C;  2Q68 A;  2WLI B;  3OUS A;  2HKO A;  3B77 A;  4WFG A;  4UV9 A;  3ABT A;  3W7T A;  4XBF A;  1R3I C;  3SYQ A;  3CC7 V;  3KG2 A;  1G8M A;  1S5H C;  1VQ4 V;  2Z5U A;  1BHB A;  4XDK A;  4BAY A;  3K08 A;  1E1Q G;  1V54 B;  1THZ A;  3ETD A;  1GM7 A;  1BHA A;  2EIM C;  4FK5 C;  2LP7 A;  1WLE A;  2W6J G;  1CPY A;  4UXN A;  3P32 A;  2MK3 A;  4P30 A;  3EHB B;  3OUF A;  2WLL A;  4RUE A;  3OMA B;  3R65 A;  4MVZ A;  1V54 C;  5CBG A;  5FL7 G;  4MW3 A;  3STL C;  3W7S A;  3RBZ A;  3FYE B;  1JJ2 U;  2Z3Y A;  4FPP A;  2QM7 A;  4MT8 A;  3AG4 C;  3OGC C;  2EZP A;  4P9O A;  1VQ6 V;  3CC4 V;  4PEL A;  1W0K G;  1V55 B;  3IGA C;  4JGS A;  3E8H A;  4J9Z B;  5L3D A;  4EKW A;  3AG2 B;  2XAQ A;  3H01 A;  2X7R B;  4MVU A;  3K04 A;  5IYC O;  4PA6 A;  2CK3 G;  2XND G;  1RPO A;  4U7N A;  2ITD C;  2B5U A;  1K73 W;  3AEI A;  2IH3 C;  3E83 A;  4PA7 A;  4PDM A;  4UVB A;  3CCE V;  3AG2 C;  5EBM C;  5H9C A;  5CBH A;  1M1K W;  3RW0 A;  4PDL A;  3ABM B;  4GCZ A;  2ZXW B;  1EBO A;  3SJQ C;  4MVS A;  2ZDI A;  4J9Y B;  3HPL C;  1OCO C;  3LSQ A;  1QVG U;  3AG1 C;  1EFR G;  3F5W C;  4PA3 A;  2JK5 C;  1H8E G;  1JCH A;  1I5Y A;  1YJ9 V;  2IH1 C;  1VQ9 V;  2X6C A;  3CCU V;  4I5S A;  2JDI G;  2BOB C;  3F7V C;  1MOF A;  3WG7 B;  5IYD O;  1OCC B;  4JAS A;  1SZT A;  4DXW A;  2B1I A;  2A79 B;  3MD0 A;  4R6Z A;  3P30 A;  2Q67 A;  3OEH G;  3W7W A;  1K9M W;  4MTG A;  1PD3 A;  2WLL B;  1DTO A;  3FB8 C;  3ABU A;  3DGE A;  4TT3 G;  3ML0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...