4FIPC

Structure of the saga ubp8(s144n)/sgf11(1-72, delta-znf)/sus1/sgf73 dub module
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
41
structure length
41
Chain Sequence
b'TITIDSISNGILNNLLTTLIQDIVARETTQQQLLKTRYPDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
publication title A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 17
structure length 41
sequence length 41
chains with identical sequence G
ec nomenclature
pdb deposition date 2012-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF18519 Sgf11_N SAGA-associated factor 11 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4fipC00
4E2LA 3K9AA 5KA5A 3B77A 5CMUA 1MG1A 4JGSA 3P30A 1ENVA 1I5YA 1EBOA 1MOFA 3MHSC 5HFLA 1SZTA 1QR8A 1QR9A 2EZOA 2EZPA 4FJCC 3MHHC 2EBOA 3B8NA 1F23A 4FIPC 4N21A 1K34A 5HFMA 3CYOA 3M99B 1Y4MA 4JPRA 5KA6A 1JPXA 2P6JA 5H9CA 3GWOA 1K33A 2X7RB 1QBZA 3H01A 2M7WA 4G2KA 4FK5C 1DLBA 5CN0A 1QCEA 2OT5A 4N23A 3WFVA 4JF3A 1I5XA 1JQ0A 1DF5A 1Y66A 2LP7A 2MK3A 1DF4A 3CP1A 3B8MA
chains in the Genus database with same CATH superfamily
3B77A 2EINB 5JQGB 1JVMA 4J7ZA 1XHXA 3WB1A 3ZCCA 2EIMB 3F7YC 1JMKC 1KECA 3FAVA 3SJCC 3GWKC 4X64B 4DRXB 1SQPH 3J80N 3CCVV 3D3IA 3IJ4A 1XQ8A 3TXQA 3SJAC 1XMQB 3W7UA 1N36O 1BHAA 3HKCA 2A06H 4JYYA 5JH7B 3B2EE 2QTOA 2HLDG 2YEVA 1JFFB 3AG4B 1RM1C 3CMEV 1M5IA 2FB5A 5TISZ 2XAJA 2ZXWB 3FD9A 3ZX6A 4CS3A 1XNQO 1WP8A 5JJEB 2EINC 1SERA 3K5LA 4JI6O 5LOVB 2EIMC 4FK5C 3RFRA 2X6AA 1F4MA 5FNVA 5LYJA 1ZUQA 4UVAA 2UXBO 3SYAA 5CBFA 1JCHA 4GKKB 2E5LB 2VQFB 4NXNO 1L0LH 2UUAO 3E8BA 5C93A 3VQYA 3AG4C 2UXXA 3CB2A 1XNRO 3UQ8A 4DR1B 3P3PA 5E1AC 3U10A 2ZXWC 4OXSA 4X66O 2UU9O 3SPIA 3W7XA 4PA7A 2ZE8A 4QE9A 5IYZA 1N0JA 4MVMA 5IWAB 4P2ZA 5KX5A 4GKJO 5CBHA 4R50A 3NR7A 5J2UA 3N2GA 3LSUA 5IYDO 2QM7A 4XBFA 4O2AA 1SQFA 4J9ZB 2QM8A 2CTQA 4YJ2A 1MMMA 2B1IA 4X64O 3E8GA 3K03A 3CC7V 2AXTZ 5KAFZ 1XMQO 4I9WA 3L72H 1B06A 2A79B 1B3QA 2EIJB 4P9PA 1BQZA 1Q6IA 4DV0B 2UXDB 1MZEA 2NN4A 1BCCH 5EIBC 5EBWC 4MSWC 4PHZA 5B1NA 5KA6A 3BCCH 4TV9B 2Z5UA 3FYIB 1GN3A 2DJVA 4F6EA 5CB4B 4GKKO 3SPJA 2E5LO 2VQFO 2WPDG 3OW2U 2Y69B 4MT8A 2X6CA 2EIJC 1CEZA 3W7SA 4DR1O 4LCUC 1SQVH 2XAGA 2YS8A 1P7BA 3DC6A 1I5XA 2BTOA 3ZRVA 5IWAO 4C7UA 1RSOA 3A0BZ 4K3AA 4UFZA 2GV9A 1HDJA 5AG2A 5EYPA 1FXKB 3QG5A 3T2MA 1U97A 1PNLA 3ETDA 4ZOLB 5L3GA 2Q0AA 2Y69C 3JD0A 3H9VA 1N34B 4JI0B 5L3FA 3D36C 3E83A 3ZHSA 1RPRA 2WLIA 5BZBA 3I56V 1K4DC 2IJJA 4DV0O 4JAVA 4QIWF 1Z2GA 4LR3A 2UXDO 3G6BA 4JI2B 4LWSB 4FLYA 2GDSA 1NT2B 2DOSA 3X2QB 2HEPA 4I0XA 1PL4A 4X1YB 1JJOA 3JCUZ 1R6TA 1FXKC 1BZKA 5D5PA 4MTGA 2BTQB 1FXHA 1XBLA 5EIBD 4H33A 4NB5A 4GX2A 5BR8B 3ABKB 3B40A 3EXAA 3EVKA 1ZWIC 4FLWA 4MS2A 4GX5A 3OUSA 2FKXA 2CUGA 2IH1C 4I7ZB 3K5NA 2JJ1G 2JK5C 4O4JB 3X2QC 3LNMB 1KU9A 1UJWB 3L70H 4O4IB 5JVDB 3ZIAG 2PI4A 3ETGA 1SZTA 1J5EB 3T1YB 1XUQA 2QGNA 2YXYA 4JASA 1M1KW 1HNXB 3CRRA 3ZMSA 2ZCEA 4JAUA 1HW7A 5FL7G 3H1KH 1PP9H 3ABKC 2X7RB 4OGQB 3H01A 1R6KA 4WFAV 2P5OA 1GO3F 3SGIA 1N34O 4JI0O 4UB6Z 3ABUA 1KKDA 2WLNA 2YIAA 1H2KA 5LGNA 1LUWA 3CSXA 4JI2O 3CMAV 4IHJA 1KMIZ 3T4DA 2QDOA 3OMNB 3JASA 1BT8A 4PDMA 3ZN1A 4U3FH 1P7GA 2BSKB 3CCRV 5F2VO 1YI2V 1H2LA 3DTUB 5BR8O 4GT1A 1U96A 1QR9A 2RQ6A 1OCZB 4DV1B 4Z1MG 3JALB 2DWDC 2ZR2A 4CBCA 3M7MX 2HVJC 1Y76A 4JTDB 3G4SV 3E22A 5L3EA 1GKFA 5KHIA 4AHCA 2VWKA 2RJZA 2Y0IA 1GN4A 4O4HA 3OT7A 5GTIZ 3IFXA 3RW0A 1M56B 1J5EO 2ZD9A 1R3IC 3T1YO 1HNXO 2DQ0A 4JI3B 2WSSG 2BOBC 1NTZH 2Q7EA 3KKYA 2FTKA 3HB3B 5H2FZ 1OCZC 2XAFA 4U3JA 1QCEA 4ZI7B 5CA1B 5IJ0A 5KLVH 1X4TA 1K73W 3ZRWB 4I55A 3STLC 3TK1A 1YITV 3DXRA 4MTFA 4LFAB 2RDCA 2D2CB 4DR6B 3GVMA 3CYOA 4IGGA 3JSNA 1LNQA 1M56C 4ZBMA 1PD3A 1S5LZ 1M90W 2GUZB 3THOA 4WBNB 1OHHG 4Q20A 3D8CA 1SQGA 4HNAA 3SR2C 2FYUH 4EKWA 3G6EV 4F6RA 4YJ3A 4PDRA 1Q82W 4BIUA 2EIKB 1MABG 4ASUG 4DV1O 5GONB 2R9RB 2Q73A 1PV0A 1NKDA 3LUTB 5GTHZ 3E8HA 1XEQA 1BSMA 1GRJA 5J2TB 1KB9F 4WCEV 4KXRA 2XAHA 2RN9A 4NTWA 4B3SB 2EZPA 4UB8Z 2HHHB 2B9ZA 1S72V 3K3WA 4QPKA 1K97A 1WPXA 4JI3O 3APQA 4JI4B 2EIKC 4HBNA 3RVZA 2JS3A 3OAAG 2Q7HA 2HKOA 4TUYB 2PTMA 2IU0A 4DUYB 1VF6A 4CH5A 4LFAO 1PL0A 1KUQA 3Q4HB 3JCZA 4MVUA 4DR6O 1YVWA 1ZSPA 4FLTA 2WAMA 3N2KB 3QF7A 1GN6A 2QWPB 4PA6A 3BY6A 4B7KA 1K7DA 1G6UA 3JSLA 1A32A 4FLVA 2B5UA 4DV7B 3AK2A 1THZA 1I0HA 2GTSA 3ZHQA 4DR5B 3N27A 3RYFB 5LBQA 1W2BU 1VQMV 1SA0B 4NKGB 2ZDIC 4HZ3A 4DRXA 4XDJA 4UV9A 3C3TA 2ZM6B 4B3SO 3HKDB 2R72A 1JFFA 1VQ4V 2HHHO 4JYBA 2XTAA 3GWOA 4JI4O 3QO5A 1IZ3A 5DM6V 4RUFA 4G27B 3K5OA 1KD1W 2LFSA 3ZMVA 2YI8A 4XDLA 3OUFA 5LOVA 3KZIZ 4JGSA 4LF8O 3C90A 4DUYO 2GBOA 3CCUV 3KG2A 2PF4E 2WLMA 1YTFB 1R6NA 1SKVA 5EC1C 2W0FC 1GN2A 5GW7A 2JVDA 3TETA 4GX0A 1K92A 3APOA 4MVRA 1YXBA 1XDCA 3BRCA 4KL1A 2ZE7A 4FPPA 4UCSA 1MSWD 4DV7O 4GZRB 4DR5O 4DR7B 2EBOA 3F7VC 5LHGA 2JEUA 2GHYA 1M9NA 2QE7G 1V9PA 3WG7B 1PNMA 5IT9N 1VQ6V 2UXNA 4JAAA 3ZMTA 4ZKIA 3JATB 3CJHB 2BCCH 3UO3A 4F4LA 3J7AU 1T5EA 2GSMB 4I4TA 4QNHB 4WFGA 2ZM6O 2QKAA 3MHHC 3LSSA 4P30A 4UCOA 1PM9A 3AEIA 3H1IH 4B3TB 1XI1A 2ZQMA 2V4DA 3CP1A 4QGPA 4TV9A 3WG7C 1OCCC 3VQWA 3MHSC 3OR6C 1WP7A 2A7WA 5CB4A 3FB5C 3RYCB 5H9CA 2ADPA 2PI5A 3UT5B 1H2GA 2M7WA 2IJIA 1AI6A 1YHQV 4PA3A 2JGDB 3D36A 3ZHUA 2MK3A 4FFKA 2KKWA 2CH7B 2OIEA 2IBZH 4DR7O 4B3MB 1NR1A 2R9IA 1COWG 4DR4B 5LMUB 3CC4V 3M99B 3OTFA 2KG7A 3BA8A 1L1FA 4LFBB 2AGAA 2XUMA 1FXKA 2YUAA 4I50A 1H2NA 1HP8A 4JI1B 2IH3C 1VQ5V 4ZOLA 4UVBA 2A3QA 3AG7A 1AI5A 3K08A 4YIPA 2Y4TA 2EJ7A 1Y74B 3KCXA 2ZKOA 1FYJA 4UXNA 3UO2A 2F66C 4FIPC 3QVNA 1YTFD 2WWWA 1N4CA 3D3QA 4X20B 3CRAA 1H8EG 4LWSA 4B3TO 2AZ0A 2W6JG 2LO1A 1RP3B 3SPGA 1TA8A 4X1YA 4EB6B 4TT3G 2QWRB 5J9PC 3E89A 2BTQA 2WLKA 1Q43A 1DTOA 4LH6A 5LA6A 1YDXA 1VP7A 3ZRSA 3ABLB 1Z5WA 3T1HB 4B3RB 4AQYB 3DGEA 2DE0X 4WFEA 3BVOA 3CXHF 3B8MA 4QE7A 3CS5A 3WU2Z 3B4SA 1G4YB 1ENVA 4QJFB 3ABMB 3ML0A 4FVMA 5JVDA 3K0DA 3CPWU 3RN4A 3EFFK 1NH2B 4B3MO 4DR4O 5B5EZ 3F5TA 4JZ2A 3MAQA 5LMUO 1R73A 4BW9A 1VQ7V 3ASNB 2YEVB 1BQ0A 2KSDA 3HKBA 5KAIZ 3U0ZA 4LFBO 4LNUB 2Q4PA 3G80A 1XILA 2Z0AA 4JI1O 4X9QA 1H38A 1NTMH 3ABLC 2YXHA 3W7WA 1VARA 1NQTA 1M57B 5H6RA 1Y6XA 3P3NA 5LYJB 1R3KC 1K34A 1R3JC 1D5NA 4OPHA 1ZL8A 4LF4B 3ABMC 1Q90D 1VQNV 3SYCA 1JR9A 2G38A 1IBLB 3ASNC 1FKAO 3L74H 1Q8IA 3VQXA 2EJRA 3STZC 4TQFA 2KB1A 4L87A 3CCQV 5CBGA 2P22C 3SPCA 4IYHA 2HG5C 1XMOB 4RQFA 2Q0OC 5J2UB 3N2GB 4I9QA 1M57C 2CTRA 3LDDA 3T1HO 4B3RO 1TUBA 4AQYO 4O2AB 3M8AA 4PDVA 4RAIA 2RCVA 3JARB 1JJ2U 1EM1A 1BGYH 2NNUA 4Q6GA 4LC1A 1WA8A 2IM9A 1N32B 2JEXA 5CA0B 1TUEB 5CN0A 4JYCA 4PA9A 1BL8A 2ZT9B 1VMGA 2UUBB 2YSUB 4MW3A 3JYCA 1N33B 3OGIB 1M4UA 3OGCC 2LFRA 5C8YA 4FM1A 3ZRWA 4CC5A 2F1MA 2HJDA 4WFBV 3CCJV 1SQXH 2P67A 3JAWA 4LF4O 3H1JH 1IBLO 1AI4A 2YXLA 4IIJB 2D3OW 4LF9B 1NH2D 2F95B 1Q86W 1S77D 5IJ9A 3FYEB 3RYHA 1OCRB 1XMOO 1FPOA 3AK1A 1ZTEA 3RWRD 4ABMA 3JD3A 2QTSA 1K8AW 3DSQA 1GH6A 4LF6B 1VQKV 3CE2A 4CH3A 4YIOA 2Q8VA 3OTOB 5J2TA 5DN6G 3SPHA 2L35A 4LF7B 1QLEB 5K1PA 4FM0A 1W0KG 3RYIA 1K5SA 4I5SA 1N32O 3F5WC 4GCZA 3HKEB 1OCRC 4FFBA 3K9AA 5FPOA 1WB8A 3CD6V 2UXCB 2UUBO 1E1QG 2N05A 1MOFA 1N33O 4H37A 5KHKA 5BMVA 2Q68A 3T1CA 1J95A 1FFXB 2YI9A 4X1IB 5FLXN 1MZFA 3Q4HA 2ZDIA 2KQXA 4FLUA 2EULA 2ITCC 4J9YB 3ZMUA 2AHYA 1QLEC 2ILMA 1UFIA 1E79G 2YICA 4PI0A 2F43G 5HFLA 1AP6A 5B1AB 3I55V 4LF9O 2W0XA 2JRIA 2WLHA 4WFHA 3K04A 4JI5B 3SYOA 1Q7YW 4K8XA 3JD2A 1OZ0A 2V1DA 5DEDA 2P4VA 3RYFA 4H13B 1GTOA 5B66Z 3OFNG 4LF6O 1SA0A 5CMUA 4J42A 4MTOA 4D7TA 2ZE6A 4DV5B 2HJFC 3TCUA 3OTOO 1KC8W 1F51A 1SRYA 4LF7O 5ITZA 3HR0A 2PZSA 5B1AC 3RBZA 4CZZA 5IDJA 2EILB 4YXWG 3G71V 3JAMN 2UXCO 4BR6A 1KP2A 1I5YA 1KQSU 3IC9A 2Z3YA 4D6TH 1TVKA 2OYQA 3SJQC 4O2BA 4G2KA 3RT3C 4L8JA 5LP6B 4PJ0Z 4CH4A 3U11A 3CCMV 2OCCB 2K9PA 3OMIB 2O57A 1EN5A 2A0LA 2EILC 3SDLA 5EZYB 3VQVA 1FS0G 1GAXA 1AJQA 2DMXA 4JI5O 1N0NA 4RO2A 2JS5A 4HAMA 2K1EA 1SC5B 5KMGA 1ZAUA 4O4HB 4PV1B 1IXBA 1AB3A 1E1RG 4J10A 2OTJV 2ZNIA 3JATA 2CAZC 1H8HG 4J80A 3SYPA 3UKMA 2ZNJA 5LP6C 4ZHQB 4DV5O 4U3JB 2OCCC 4TQDA 3DC5A 5IJ0B 1JX9A 5LGTA 5JQGA 5B1BB 2H94A 4J41A 4I55B 2BOCC 3DXRB 2CTWA 1VIBA 1EN4A 4CS2A 3JAKB 1HNWB 4E2LA 4R8CA 5KHJA 3TXSA 4YY3B 1W0JG 2EZOA 5JH7A 1O9HA 1XHZA 1QVFU 3ZMZA 1I7FA 3BA9A 1IXMA 1Y4MA 4HNAB 1CP9A 1VQLV 3JD4A 5DECA 4MVOA 1CXZB 4F6RB 3AG3B 4YJ3B 4A5UB 4BIZA 3NXSA 3VBBA 5LGUA 2YDEA 2F4VB 1S3JA 5B1BC 3ZRXA 4UCUA 1EBOA 2JJ2G 3UM7A 1HNZB 4W4LA 4IT5A 4RQEA 4B7EA 1UPGA 1AR4A 3WFVA 2ZR3A 1IBKB 4KHPB 3AG3C 1R3LC 1ZLZA 2DWEC 5L3DA 4MVZA 4LBEC 1F23A 4J7KA 4N21A 1OCOB 5EC2C 1P4RA 1OJHA 1US6A 2QR4A 2YIBD 3EHBB 1OCCB 1H2MA 1AR1B 3QTCA 4X20A 4Z1VA 4O4LB 1HNWO 1Q3EA 2IJKA 1D2DA 2BE3A 4RWUA 4X8AA 2HFEC 3L71H 4YY3O 1TGOA 3QNEA 1F4NA 4RUEA 4XDKA 2CK3G 1P49A 2DW4A 1IX9A 3QO7A 4X1KB 4WF9V 1OCOC 3ABTA 1JQ0A 1Y66A 2F4VO 1K9MW 1SQBH 3FKSG 1S76D 4TV8B 3S3XA 3K58A 1Q81W 1VF6C 2AHZA 2ZINA 2QA4V 1Z5VA 1HNZO 5EK0A 2DQ3A 3ZS8C 2NLJC 1VQ9V 3K9SA 5LHHA 3CEIA 1FFTB 4X88A 3P32A 1B6QA 1IBKO 1NI8A 1AJNA 1L0NH 4LNUA 1MG1A 4KHPO 2WLJA 2ZIOA 3OM3B 4GX1A 2M6YA 3OR7C 1XL6A 4R6ZA 4U7NA 3RGBA 3O9OA 1GK9A 1ORQC 1XOUA 2B1GA 2XASA 4JTAB 4UUJC 1QU7A 4NVPA 2P06A 5IE9A 4DK1A 1WN7A 1SF9A 5EBMC 5L3BA 3R65A 2WLLB 3ASOB 1HWYA 1IURA 1NTKH 1URFA 3BABA 3S3WA 2QSAA 4CC6A 3A2FA 3TJTA 3FX7A 5LL6Y 2ADQB 4NYKA 4FM2A 2CTPA 4GLXA 4BWAA 5JCOC 4BAYA 2A9HA 4DV3B 2QKCA 1K5QA 4KUMA 1QBZA 3CX5F 2C2AA 4DW0A 3MD0A 2JIZG 1BS3A 5LXTB 1QR8A 5FPRA 3JARA 4NTXA 1BHBA 3SYQA 3FB6C 4TOIA 4AILC 1VQOV 1NBMG 4X62B 1CPYA 2Y4UA 3ASOC 3AG1B 4I4TB 2N04A 3E8FA 1TAEA 2OT5A 1EN6A 1DF4A 3FB7C 2QJ1A 3JD1A 4MW8A 3FAVB 4JYAB 2CE4A 5CA0A 1KP3A 2EX3A 4O4JA 3C3SA 1QLNA 4O4IA 3W7TA 3HKCB 4J7JA 1D5AA 1XREA 4EFBA 2GTAA 2ARHA 4NTYA 4YHHB 1EZVH 1BE3H 4X65B 4JV5B 1ZX3A 2E75B 2OCHA 4JF3A 3BPZA 1F7YA 3AG1C 3FFQA 1QNMA 4UCVA 2Q9LA 3ETEA 4DV2B 3OEEG 5FNVB 4IIJA 3OD4A 3HPLC 4DV3O 1K33A 2LW1A 4FZ1A 5B1OA 4GYCB 3E86A 4JI7B 2QEXV 4JI8B 1YCIA 2QWQB 2CGOA 2OTLV 1QHTA 2XHBA 2OWOA 2LGQA 1XL4A 4CH6A 1GM9A 2KG7B 3ZN0A 4D7SA 2BSKA 2QWOB 3ZHRA 2LGWA 3CRCA 2DYRB 4I50B 4X62O 4E4EA 4KFMA 4DR3B 5IYZB 4K35A 4WFFA 3MDSA 5KX5B 1VQPV 2F23A 4UV8A 4N23A 4LP8A 3JALA 2X6BA 2ZIMA 1DF5A 3L9DA 1FJGB 3L75H 4FLZA 1JA8A 1H2SB 1WJZA 2PYLA 5KUMA 4YJ2B 3K06A 3RVYA 4JYAO 4PELA 2H8PC 5KHGA 3HKEA 1AP5A 3H1LH 1YJNV 4BIOA 4DW1A 4OX9B 3K5MA 4YHHO 4K0KB 1IBMB 1FFXA 4X65O 4JV5O 2DYRC 1DGSA 5B3SB 4FJCC 4X1IA 5LA6B 1Q5OA 3CRMA 2Y0PA 1KBHA 4ZI7A 5CA1A 1VF5B 3OEHG 1Q6HA 3WB0A 4P9OA 4DV2O 4AI8A 1IDSA 1S5JA 2CGNA 2Q69A 2Q5ZA 4NXMB 5IYBO 4HYOA 2IJHA 4JI7O 3BFRA 4JI8O 1I94B 2Q6AA 2OIGA 2VRZA 2XNDG 1PKXA 2XT9A 3E2EA 2GUZA 4WBNA 3PN1A 3ZHVA 3LNNA 3HKBB 2W6IG 5B3SC 4KP4A 1YSCA 3J81N 2PYJA 3E35A 1IVSA 5BXZA 2FMLA 3G67A 3A8TA 4DR3O 2HR3A 4OPAA 1ROPA 1K3EA 2IW5A 2LJ2A 1RSOB 5GONA 2LQTA 2WA4A 1FJGO 2E74B 1RPOA 3AK3A 5EYPB 1FXVA 1ZL8B 3IC7A 4UCTA 1RFYA 2ODMA 3B8NA 3A0RA 4DXWA 3UCSC 1EFRG 3QO8A 4DYLA 4LFCB 2WLIB 3IAYA 4OX9O 1AILA 4K0KO 3K59A 1IBMO 4H44B 1WPBA 2YIBA 1G8MA 3FB8C 4I0XB 5CA3A 2WA3A 5LP6A 4DK0A 4U7OA 3H1HH 4JTCB 1KYOF 1TUBB 3L73H 3ZHTA 1QQCA 4TUYA 4PA4A 2ETNA 3ZBHA 4NXMO 5EZYA 1L8DA 2PUSA 1YJ9V 4DV6B 4TWKA 4Z2WA 5JJJB 4DUZB 1S0VA 3R66A 4JZGA 1I94O 3N2KA 4DO2A 1K4CC 3B09A 2R9AA 1WA8B 3T4ZA 1MSDA 2YC0A 1I08A 2RMKB 5H6QA 3O65A 1NVPB 4MVQA 1JOYA 4ZHQA 1NR7A 2AW9A 1R1BA 3TGUH 3OE7G 1AR5A 4LF5B 5C8YB 1YJWV 5LMNB 1WNSA 1NZ6A 2Q67A 2DYSB 1HR0B 3JAWB 3JAKA 2ATKC 2E3CA 2R70A 2VQEB 1NJIW 3HKDA 2QWNB 4DV4B 1WB7A 2H3OA 4K8ZA 4LFCO 5A9GA 2V7QG 1PPJH 5HFMA 2P90A 3ZEDA 2YIDA 5LHIA 4DR2B 2AZ2A 5A2QN 5KA5A 2UUCB 4UVCA 5IJ9B 4IHJB 3JASB 3RYHB 3CCLV 4MTXA 4BW5A 5K1XA 3LDEA 2IU3A 1GM7A 4QPJA 1SS3A 2ZE5A 3GB7C 2DYSC 3ETQA 3AG2B 4FMTA 1FD9A 1WAZA 2P6JA 2Y48A 1FAFA 4EFEA 2LP7A 4DV6O 3CRQA 4DUZO 2E76B 1P84F 3CWBH 1EZJA 1W59A 3VOUA 1VF7A 2HP8A 3RYIB 4NR1A 4R7CA 1Y76B 3K0GA 3E22B 1VQ8V 1JPXA 4FFBB 5KHHA 3SJBC 2JGUA 5L3CA 1BMFG 2F93B 4H0LB 3LSQA 5BMVB 4ZIBA 4LF5O 5BY1A 3AG2C 5LMNO 1AROP 4LH7A 4LF8B 2P4KA 1G1XB 3PJSK 1HR0O 4X89A 4ICGA 3CJHA 4O4LA 1O9GA 2X0LA 2VQEO 3CHXA 2ITDC 1SESA 4FZ0A 1YZBA 4DV4O 2CDYA 1DLBA 4B08A 1QVGU 2PY5A 2N74A 4DR2O 3BEHA 3CC2V 1NS1A 1B04A 2UUCO 1YF2A 1LUVA 4X1KA 2L6LA 2JDIG 3ZJZA 4IYIA 4GUNA 1SZXA 1KKCA 3A0HZ 1NVPD 3WB2A 4TV8A 1YEWA 1GMGA 3CCEV 2QKSA 1PNKA 1NU1H 3OMAB 3RYCA 1V54B 2FL4A 2LW7A 4PD4F 1MNGA 1X59A 3UT5A 4CS4A 5ITZB 4EEQA 2NR5A 2JGDA 2HVKC 3KCYA 5IY5B 1DK1A 3LDCA 2CH7A 2PGGA 5JCOA 2MW2B 2VWJA 4PI2A 4IL6Z 1N36B 3CXCU 1YIJV 2P7TC 2VS0A 1MA1A 2DN9A 5E79Z 1M93A 1N8RW 1LR1A 1GM8A 4MVSA 5IYCO 1TVKB 5H5NA 5JWPA 1AJPA 3P30A 4PDLA 1SQQH 4O2BB 1Y67A 4TSFG 1V54C 3I5DA 3BHPA 3K57A 1XNQB 5EBLC 2WLLA 4W4KA 2XAQA 1V55B 4JPRA 1AI7A 4JI6B 3ICXA 2RNBA 1Y74A 5D5QA 3CCSV 5IY5C 1S5HC 2UXBB 3IGAC 1SETA 4FLXA 5JJNB 4NXNB 1OV9A 2UUAB 5KMGB 2QM4A 5KUKA 4G28B 2Q7GA 2XOKG 4EB6A 1Q6UA 1XNRB 3K79A 5LXTA 4X66B 1RM1B 2UU9B 1VEWA 1AVMA 4UCRA 4J11A 4GKJB 1V55C 1WLEA 3BAAA
chains in the Genus database with same CATH topology
1K8AW 3AG1C 2HKOA 3B77A 2EINB 2IU0A 1JVMA 1VQKV 3ZCCA 1PL0A 2EIMB 3F7YC 3ETEA 3JCZA 1KECA 3OEEG 4MVUA 5DN6G 3SPHA 3HPLC 1QLEB 2WAMA 3CCVV 3D3IA 1W0KG 1K33A 1K5SA 5B1OA 4I5SA 4PA6A 3W7UA 3BY6A 1BHAA 3F5WC 3E86A 2QEXV 1K7DA 4GCZA 1OCRC 2QTOA 2HLDG 2YEVA 3AG4B 3K9AA 1RM1C 2OTLV 3CD6V 3CMEV 2B5UA 1XL4A 1E1QG 1GM9A 3ZN0A 1MOFA 4H37A 1THZA 2XAJA 2ZXWB 2Q68A 3T1CA 1J95A 2DYRB 1W2BU 5LBQA 2EINC 4KFMA 1VQMV 1SERA 4WFFA 1VQPV 2EIMC 2ZDIA 4FK5C 4UV8A 2X6AA 1F4MA 2ZDIC 2ITCC 4HZ3A 4J9YB 4LP8A 4N23A 2AHYA 2X6BA 3ZMUA 4UVAA 1DF5A 4XDJA 4UV9A 1QLEC 3SYAA 5CBFA 1JCHA 1E79G 5KUMA 3K06A 3RVYA 4PELA 2F43G 5HFLA 2H8PC 3E8BA 5B1AB 5C93A 3I55V 3AG4C 2WLHA 1VQ4V 4WFHA 2UXXA 4JYBA 3K04A 1YJNV 3SYOA 1Q7YW 5E1AC 3JD2A 2ZXWC 4OXSA 3GWOA 1OZ0A 3QO5A 2V1DA 3SPIA 3W7XA 5DM6V 4PA7A 4G27B 4RUFA 2DYRC 1KD1W 4QE9A 1GTOA 4MVMA 5B3SB 4P2ZA 2LFSA 4FJCC 3ZMVA 4R50A 5CBHA 4XDLA 3OUFA 3OFNG 5CMUA 4JGSA 5IYDO 4MTOA 2QM7A 4XBFA 2HJFC 3CCUV 3KG2A 4J9ZB 2QM8A 3OEHG 3TCUA 4P9OA 2WLMA 2B1IA 1KC8W 1YTFB 1R6NA 2Q69A 1F51A 1SRYA 3E8GA 3K03A 5EC1C 2W0FC 3CC7V 5IYBO 5B1AC 5GW7A 4HYOA 3RBZA 3TETA 4I9WA 4CZZA 2IJHA 4GX0A 5IDJA 2EILB 4YXWG 1K92A 2A79B 3G71V 4MVRA 2EIJB 2Q6AA 4P9PA 2XNDG 4FPPA 1PKXA 3E2EA 1KP2A 1I5YA 1MSWD 2W6IG 1KQSU 5B3SC 2Z3YA 4KP4A 1YSCA 3E35A 2EBOA 3F7VC 5LHGA 2JEUA 5EBWC 2GHYA 4MSWC 1M9NA 2QE7G 5B1NA 2HR3A 5KA6A 3SJQC 3WG7B 1ROPA 1K3EA 1PNMA 2IW5A 1VQ6V 2UXNA 4G2KA 3ZMTA 4ZKIA 2Z5UA 3FYIB 4F4LA 1RPOA 2OCCB 3OMIB 3CCMV 2GSMB 1FXVA 3SPJA 4QNHB 4WFGA 2A0LA 3IC7A 2WPDG 2EILC 3MHHC 3OW2U 1FS0G 2Y69B 3B8NA 4MT8A 1AJQA 2EIJC 2X6CA 3A0RA 1CEZA 3W7SA 3LSSA 4P30A 4DXWA 1EFRG 3AEIA 4RO2A 4HAMA 2K1EA 2XAGA 4LCUC 3QO8A 2ZQMA 1P7BA 2WLIB 1E1RG 1I5XA 3CP1A 3ZRVA 2OTJV 3WG7C 1G8MA 1OCCC 3FB8C 5CA3A 1H8HG 3MHSC 3OR6C 3SYPA 3UKMA 4U7OA 4JTCB 2OCCC 1FXKB 3FB5C 3T2MA 1JX9A 5LGTA 4PA4A 5B1BB 2H94A 5H9CA 1PNLA 3ETDA 2PI5A 5L3GA 2BOCC 1H2GA 2M7WA 2IJIA 2Y69C 1YJ9V 1AI6A 3JD0A 1YHQV 4PA3A 5L3FA 3D36A 4TWKA 2MK3A 3E83A 1S0VA 4E2LA 1RPRA 4R8CA 2WLIA 5BZBA 3I56V 4DO2A 1K4CC 1K4DC 2IJJA 4JAVA 4QIWF 1W0JG 2EZOA 3T4ZA 1NR1A 2R9IA 1COWG 1QVFU 3ZMZA 3X2QB 5H6QA 3CC4V 1IXMA 3M99B 1Y4MA 1CP9A 1VQLV 3JD4A 1NVPB 4MVQA 1JOYA 4MVOA 1L1FA 1NR7A 1FXKA 3AG3B 4BIZA 1FXKC 3NXSA 3VBBA 5LGUA 4MTGA 3OE7G 1FXHA 1S3JA 1YJWV 5B1BC 4H33A 2IH3C 4GX2A 1VQ5V 4UVBA 3ZRXA 2Q67A 2DYSB 1EBOA 1AI5A 2JJ2G 3K08A 3ABKB 3UM7A 4UXNA 1ZWIC 2ATKC 4MS2A 4RQEA 4FIPC 1YTFD 4GX5A 2WWWA 1NJIW 3OUSA 2IH1C 1H8EG 2W6JG 2JJ1G 3WFVA 2JK5C 3SPGA 2V7QG 2ZR3A 3X2QC 3LNMB 1UJWB 5HFMA 2P90A 5LHIA 3ZIAG 4TT3G 5KA5A 4UVCA 5J9PC 3E89A 3CCLV 3AG3C 2PI4A 3ETGA 1SZTA 1R3LC 4MTXA 2DWEC 5L3DA 4BW5A 4MVZA 2WLKA 4LBEC 1DTOA 3LDEA 4JASA 1F23A 1M1KW 4N21A 2IU3A 1GM7A 4QPJA 1OCOB 5EC2C 3ZMSA 1P4RA 3GB7C 4JAUA 2DYSC 5FL7G 3AG2B 3ZRSA 4FMTA 2P6JA 3ABKC 2Y48A 2X7RB 3ABLB 3EHBB 3H01A 1R6KA 1OCCB 4WFAV 3DGEA 1GO3F 1AR1B 4WFEA 2LP7A 3ABUA 1KKDA 3B8MA 4QE7A 2IJKA 1EZJA 2WLNA 3VOUA 1G4YB 1ENVA 4QJFB 5LGNA 3ABMB 4X8AA 2HFEC 3ML0A 3K0DA 3CPWU 4R7CA 3QNEA 1F4NA 3CMAV 3K0GA 3EFFK 4RUEA 3T4DA 1NH2B 4XDKA 2CK3G 3OMNB 4PDMA 1R73A 1VQ7V 3ASNB 1VQ8V 3ZN1A 2YEVB 1JPXA 2DW4A 5L3CA 1BMFG 3LSQA 3QO7A 4WF9V 1OCOC 3ABTA 1JQ0A 1Y66A 3AG2C 3CCRV 1K9MW 1AROP 1YI2V 3FKSG 3DTUB 1S76D 1H38A 4GT1A 3ABLC 3W7WA 3PJSK 4X89A 1Q81W 1NQTA 1QR9A 1M57B 2AHZA 5H6RA 2QA4V 1OCZB 5EK0A 1R3KC 1K34A 2DQ3A 4Z1MG 1R3JC 2NLJC 2DWDC 2X0LA 2ZR2A 4CBCA 2ITDC 1SESA 1VQ9V 3ABMC 5LHHA 2HVJC 1VQNV 1FFTB 1DLBA 4JTDB 4X88A 3SYCA 3P32A 3G4SV 1B6QA 1QVGU 5L3EA 1GKFA 3ASNC 1AJNA 3BEHA 3CC2V 2EJRA 3STZC 1MG1A 2WLJA 3OM3B 2JDIG 2KB1A 3IFXA 4L87A 3RW0A 1M56B 4GX1A 3ZJZA 3CCQV 5CBGA 3OR7C 1XL6A 1R3IC 2ZD9A 3SPCA 2DQ0A 4R6ZA 1NVPD 4U7NA 2WSSG 2BOBC 1GMGA 2HG5C 1GK9A 3CCEV 1ORQC 4RQFA 2QKSA 2FTKA 3HB3B 1PNKA 1M57C 2B1GA 1OCZC 2XAFA 3LDDA 2XASA 3OMAB 4JTAB 1QCEA 4UUJC 1V54B 4PDVA 4RAIA 5EBMC 5L3BA 3R65A 1K73W 3ZRWB 2WLLB 3STLC 3TK1A 1JJ2U 3ASOB 1YITV 1HWYA 4MTFA 2HVKC 5IY5B 2NNUA 3LDCA 4LC1A 3CYOA 4BAYA 2A9HA 1LNQA 1K5QA 1M56C 4KUMA 4ZBMA 2JEXA 1PD3A 1QBZA 3CXCU 1M90W 1TUEB 2P7TC 5CN0A 1YIJV 4JYCA 1OHHG 4Q20A 4PA9A 2C2AA 1BL8A 4EKWA 3G6EV 1N8RW 3MD0A 1GM8A 2YSUB 2JIZG 4MVSA 4MW3A 5IYCO 3JYCA 1AJPA 3P30A 4PDLA 4PDRA 4TSFG 1V54C 1QR8A 3OGCC 1Q82W 4BIUA 2LFRA 2EIKB 1BHBA 1MABG 3ZRWA 3SYQA 3FB6C 5EBLC 2WLLA 4ASUG 1VQOV 1NBMG 2R9RB 1CPYA 4WFBV 3CCJV 2XAQA 1V55B 3ASOC 4JPRA 1AI7A 2P67A 3AG1B 1NKDA 3LUTB 3CCSV 5IY5C 3E8FA 1S5HC 2OT5A 3E8HA 1DF4A 3FB7C 3JD1A 1AI4A 4MW8A 3IGAC 4WCEV 1SETA 2XAHA 1KP3A 2D3OW 2EZPA 5KUKA 1QLNA 1NH2D 4G28B 2XOKG 1Q86W 3W7TA 1S72V 1S77D 3FYEB 3K3WA 4QPKA 1K97A 1WPXA 3K79A 1OCRB 1RM1B 2EIKC 3RVZA 3JD3A 4JF3A 3OAAG 1V55C 1WLEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E2L A;  3K9A A;  5KA5 A;  3B77 A;  5CMU A;  1MG1 A;  4JGS A;  3P30 A;  1ENV A;  1I5Y A;  1EBO A;  1MOF A;  3MHS C;  5HFL A;  1SZT A;  1QR8 A;  1QR9 A;  2EZO A;  2EZP A;  4FJC C;  3MHH C;  2EBO A;  3B8N A;  1F23 A;  4FIP C;  4N21 A;  1K34 A;  5HFM A;  3CYO A;  3M99 B;  1Y4M A;  4JPR A;  5KA6 A;  1JPX A;  2P6J A;  5H9C A;  3GWO A;  1K33 A;  2X7R B;  1QBZ A;  3H01 A;  2M7W A;  4G2K A;  4FK5 C;  1DLB A;  5CN0 A;  1QCE A;  2OT5 A;  4N23 A;  3WFV A;  4JF3 A;  1I5X A;  1JQ0 A;  1DF5 A;  1Y66 A;  2LP7 A;  2MK3 A;  1DF4 A;  3CP1 A;  3B8M A; 
#chains in the Genus database with same CATH topology
 3B77 A;  2EIN B;  5JQG B;  1JVM A;  4J7Z A;  1XHX A;  3WB1 A;  3ZCC A;  2EIM B;  3F7Y C;  1JMK C;  1KEC A;  3FAV A;  3SJC C;  3GWK C;  4X64 B;  4DRX B;  1SQP H;  3J80 N;  3CCV V;  3D3I A;  3IJ4 A;  1XQ8 A;  3TXQ A;  3SJA C;  1XMQ B;  3W7U A;  1N36 O;  1BHA A;  3HKC A;  2A06 H;  4JYY A;  5JH7 B;  3B2E E;  2QTO A;  2HLD G;  2YEV A;  1JFF B;  3AG4 B;  1RM1 C;  3CME V;  1M5I A;  2FB5 A;  5TIS Z;  2XAJ A;  2ZXW B;  3FD9 A;  3ZX6 A;  4CS3 A;  1XNQ O;  1WP8 A;  5JJE B;  2EIN C;  1SER A;  3K5L A;  4JI6 O;  5LOV B;  2EIM C;  4FK5 C;  3RFR A;  2X6A A;  1F4M A;  5FNV A;  5LYJ A;  1ZUQ A;  4UVA A;  2UXB O;  3SYA A;  5CBF A;  1JCH A;  4GKK B;  2E5L B;  2VQF B;  4NXN O;  1L0L H;  2UUA O;  3E8B A;  5C93 A;  3VQY A;  3AG4 C;  2UXX A;  3CB2 A;  1XNR O;  3UQ8 A;  4DR1 B;  3P3P A;  5E1A C;  3U10 A;  2ZXW C;  4OXS A;  4X66 O;  2UU9 O;  3SPI A;  3W7X A;  4PA7 A;  2ZE8 A;  4QE9 A;  5IYZ A;  1N0J A;  4MVM A;  5IWA B;  4P2Z A;  5KX5 A;  4GKJ O;  5CBH A;  4R50 A;  3NR7 A;  5J2U A;  3N2G A;  3LSU A;  5IYD O;  2QM7 A;  4XBF A;  4O2A A;  1SQF A;  4J9Z B;  2QM8 A;  2CTQ A;  4YJ2 A;  1MMM A;  2B1I A;  4X64 O;  3E8G A;  3K03 A;  3CC7 V;  2AXT Z;  5KAF Z;  1XMQ O;  4I9W A;  3L72 H;  1B06 A;  2A79 B;  1B3Q A;  2EIJ B;  4P9P A;  1BQZ A;  1Q6I A;  4DV0 B;  2UXD B;  1MZE A;  2NN4 A;  1BCC H;  5EIB C;  5EBW C;  4MSW C;  4PHZ A;  5B1N A;  5KA6 A;  3BCC H;  4TV9 B;  2Z5U A;  3FYI B;  1GN3 A;  2DJV A;  4F6E A;  5CB4 B;  4GKK O;  3SPJ A;  2E5L O;  2VQF O;  2WPD G;  3OW2 U;  2Y69 B;  4MT8 A;  2X6C A;  2EIJ C;  1CEZ A;  3W7S A;  4DR1 O;  4LCU C;  1SQV H;  2XAG A;  2YS8 A;  1P7B A;  3DC6 A;  1I5X A;  2BTO A;  3ZRV A;  5IWA O;  4C7U A;  1RSO A;  3A0B Z;  4K3A A;  4UFZ A;  2GV9 A;  1HDJ A;  5AG2 A;  5EYP A;  1FXK B;  3QG5 A;  3T2M A;  1U97 A;  1PNL A;  3ETD A;  4ZOL B;  5L3G A;  2Q0A A;  2Y69 C;  3JD0 A;  3H9V A;  1N34 B;  4JI0 B;  5L3F A;  3D36 C;  3E83 A;  3ZHS A;  1RPR A;  2WLI A;  5BZB A;  3I56 V;  1K4D C;  2IJJ A;  4DV0 O;  4JAV A;  4QIW F;  1Z2G A;  4LR3 A;  2UXD O;  3G6B A;  4JI2 B;  4LWS B;  4FLY A;  2GDS A;  1NT2 B;  2DOS A;  3X2Q B;  2HEP A;  4I0X A;  1PL4 A;  4X1Y B;  1JJO A;  3JCU Z;  1R6T A;  1FXK C;  1BZK A;  5D5P A;  4MTG A;  2BTQ B;  1FXH A;  1XBL A;  5EIB D;  4H33 A;  4NB5 A;  4GX2 A;  5BR8 B;  3ABK B;  3B40 A;  3EXA A;  3EVK A;  1ZWI C;  4FLW A;  4MS2 A;  4GX5 A;  3OUS A;  2FKX A;  2CUG A;  2IH1 C;  4I7Z B;  3K5N A;  2JJ1 G;  2JK5 C;  4O4J B;  3X2Q C;  3LNM B;  1KU9 A;  1UJW B;  3L70 H;  4O4I B;  5JVD B;  3ZIA G;  2PI4 A;  3ETG A;  1SZT A;  1J5E B;  3T1Y B;  1XUQ A;  2QGN A;  2YXY A;  4JAS A;  1M1K W;  1HNX B;  3CRR A;  3ZMS A;  2ZCE A;  4JAU A;  1HW7 A;  5FL7 G;  3H1K H;  1PP9 H;  3ABK C;  2X7R B;  4OGQ B;  3H01 A;  1R6K A;  4WFA V;  2P5O A;  1GO3 F;  3SGI A;  1N34 O;  4JI0 O;  4UB6 Z;  3ABU A;  1KKD A;  2WLN A;  2YIA A;  1H2K A;  5LGN A;  1LUW A;  3CSX A;  4JI2 O;  3CMA V;  4IHJ A;  1KMI Z;  3T4D A;  2QDO A;  3OMN B;  3JAS A;  1BT8 A;  4PDM A;  3ZN1 A;  4U3F H;  1P7G A;  2BSK B;  3CCR V;  5F2V O;  1YI2 V;  1H2L A;  3DTU B;  5BR8 O;  4GT1 A;  1U96 A;  1QR9 A;  2RQ6 A;  1OCZ B;  4DV1 B;  4Z1M G;  3JAL B;  2DWD C;  2ZR2 A;  4CBC A;  3M7M X;  2HVJ C;  1Y76 A;  4JTD B;  3G4S V;  3E22 A;  5L3E A;  1GKF A;  5KHI A;  4AHC A;  2VWK A;  2RJZ A;  2Y0I A;  1GN4 A;  4O4H A;  3OT7 A;  5GTI Z;  3IFX A;  3RW0 A;  1M56 B;  1J5E O;  2ZD9 A;  1R3I C;  3T1Y O;  1HNX O;  2DQ0 A;  4JI3 B;  2WSS G;  2BOB C;  1NTZ H;  2Q7E A;  3KKY A;  2FTK A;  3HB3 B;  5H2F Z;  1OCZ C;  2XAF A;  4U3J A;  1QCE A;  4ZI7 B;  5CA1 B;  5IJ0 A;  5KLV H;  1X4T A;  1K73 W;  3ZRW B;  4I55 A;  3STL C;  3TK1 A;  1YIT V;  3DXR A;  4MTF A;  4LFA B;  2RDC A;  2D2C B;  4DR6 B;  3GVM A;  3CYO A;  4IGG A;  3JSN A;  1LNQ A;  1M56 C;  4ZBM A;  1PD3 A;  1S5L Z;  1M90 W;  2GUZ B;  3THO A;  4WBN B;  1OHH G;  4Q20 A;  3D8C A;  1SQG A;  4HNA A;  3SR2 C;  2FYU H;  4EKW A;  3G6E V;  4F6R A;  4YJ3 A;  4PDR A;  1Q82 W;  4BIU A;  2EIK B;  1MAB G;  4ASU G;  4DV1 O;  5GON B;  2R9R B;  2Q73 A;  1PV0 A;  1NKD A;  3LUT B;  5GTH Z;  3E8H A;  1XEQ A;  1BSM A;  1GRJ A;  5J2T B;  1KB9 F;  4WCE V;  4KXR A;  2XAH A;  2RN9 A;  4NTW A;  4B3S B;  2EZP A;  4UB8 Z;  2HHH B;  2B9Z A;  1S72 V;  3K3W A;  4QPK A;  1K97 A;  1WPX A;  4JI3 O;  3APQ A;  4JI4 B;  2EIK C;  4HBN A;  3RVZ A;  2JS3 A;  3OAA G;  2Q7H A;  2HKO A;  4TUY B;  2PTM A;  2IU0 A;  4DUY B;  1VF6 A;  4CH5 A;  4LFA O;  1PL0 A;  1KUQ A;  3Q4H B;  3JCZ A;  4MVU A;  4DR6 O;  1YVW A;  1ZSP A;  4FLT A;  2WAM A;  3N2K B;  3QF7 A;  1GN6 A;  2QWP B;  4PA6 A;  3BY6 A;  4B7K A;  1K7D A;  1G6U A;  3JSL A;  1A32 A;  4FLV A;  2B5U A;  4DV7 B;  3AK2 A;  1THZ A;  1I0H A;  2GTS A;  3ZHQ A;  4DR5 B;  3N27 A;  3RYF B;  5LBQ A;  1W2B U;  1VQM V;  1SA0 B;  4NKG B;  2ZDI C;  4HZ3 A;  4DRX A;  4XDJ A;  4UV9 A;  3C3T A;  2ZM6 B;  4B3S O;  3HKD B;  2R72 A;  1JFF A;  1VQ4 V;  2HHH O;  4JYB A;  2XTA A;  3GWO A;  4JI4 O;  3QO5 A;  1IZ3 A;  5DM6 V;  4RUF A;  4G27 B;  3K5O A;  1KD1 W;  2LFS A;  3ZMV A;  2YI8 A;  4XDL A;  3OUF A;  5LOV A;  3KZI Z;  4JGS A;  4LF8 O;  3C90 A;  4DUY O;  2GBO A;  3CCU V;  3KG2 A;  2PF4 E;  2WLM A;  1YTF B;  1R6N A;  1SKV A;  5EC1 C;  2W0F C;  1GN2 A;  5GW7 A;  2JVD A;  3TET A;  4GX0 A;  1K92 A;  3APO A;  4MVR A;  1YXB A;  1XDC A;  3BRC A;  4KL1 A;  2ZE7 A;  4FPP A;  4UCS A;  1MSW D;  4DV7 O;  4GZR B;  4DR5 O;  4DR7 B;  2EBO A;  3F7V C;  5LHG A;  2JEU A;  2GHY A;  1M9N A;  2QE7 G;  1V9P A;  3WG7 B;  1PNM A;  5IT9 N;  1VQ6 V;  2UXN A;  4JAA A;  3ZMT A;  4ZKI A;  3JAT B;  3CJH B;  2BCC H;  3UO3 A;  4F4L A;  3J7A U;  1T5E A;  2GSM B;  4I4T A;  4QNH B;  4WFG A;  2ZM6 O;  2QKA A;  3MHH C;  3LSS A;  4P30 A;  4UCO A;  1PM9 A;  3AEI A;  3H1I H;  4B3T B;  1XI1 A;  2ZQM A;  2V4D A;  3CP1 A;  4QGP A;  4TV9 A;  3WG7 C;  1OCC C;  3VQW A;  3MHS C;  3OR6 C;  1WP7 A;  2A7W A;  5CB4 A;  3FB5 C;  3RYC B;  5H9C A;  2ADP A;  2PI5 A;  3UT5 B;  1H2G A;  2M7W A;  2IJI A;  1AI6 A;  1YHQ V;  4PA3 A;  2JGD B;  3D36 A;  3ZHU A;  2MK3 A;  4FFK A;  2KKW A;  2CH7 B;  2OIE A;  2IBZ H;  4DR7 O;  4B3M B;  1NR1 A;  2R9I A;  1COW G;  4DR4 B;  5LMU B;  3CC4 V;  3M99 B;  3OTF A;  2KG7 A;  3BA8 A;  1L1F A;  4LFB B;  2AGA A;  2XUM A;  1FXK A;  2YUA A;  4I50 A;  1H2N A;  1HP8 A;  4JI1 B;  2IH3 C;  1VQ5 V;  4ZOL A;  4UVB A;  2A3Q A;  3AG7 A;  1AI5 A;  3K08 A;  4YIP A;  2Y4T A;  2EJ7 A;  1Y74 B;  3KCX A;  2ZKO A;  1FYJ A;  4UXN A;  3UO2 A;  2F66 C;  4FIP C;  3QVN A;  1YTF D;  2WWW A;  1N4C A;  3D3Q A;  4X20 B;  3CRA A;  1H8E G;  4LWS A;  4B3T O;  2AZ0 A;  2W6J G;  2LO1 A;  1RP3 B;  3SPG A;  1TA8 A;  4X1Y A;  4EB6 B;  4TT3 G;  2QWR B;  5J9P C;  3E89 A;  2BTQ A;  2WLK A;  1Q43 A;  1DTO A;  4LH6 A;  5LA6 A;  1YDX A;  1VP7 A;  3ZRS A;  3ABL B;  1Z5W A;  3T1H B;  4B3R B;  4AQY B;  3DGE A;  2DE0 X;  4WFE A;  3BVO A;  3CXH F;  3B8M A;  4QE7 A;  3CS5 A;  3WU2 Z;  3B4S A;  1G4Y B;  1ENV A;  4QJF B;  3ABM B;  3ML0 A;  4FVM A;  5JVD A;  3K0D A;  3CPW U;  3RN4 A;  3EFF K;  1NH2 B;  4B3M O;  4DR4 O;  5B5E Z;  3F5T A;  4JZ2 A;  3MAQ A;  5LMU O;  1R73 A;  4BW9 A;  1VQ7 V;  3ASN B;  2YEV B;  1BQ0 A;  2KSD A;  3HKB A;  5KAI Z;  3U0Z A;  4LFB O;  4LNU B;  2Q4P A;  3G80 A;  1XIL A;  2Z0A A;  4JI1 O;  4X9Q A;  1H38 A;  1NTM H;  3ABL C;  2YXH A;  3W7W A;  1VAR A;  1NQT A;  1M57 B;  5H6R A;  1Y6X A;  3P3N A;  5LYJ B;  1R3K C;  1K34 A;  1R3J C;  1D5N A;  4OPH A;  1ZL8 A;  4LF4 B;  3ABM C;  1Q90 D;  1VQN V;  3SYC A;  1JR9 A;  2G38 A;  1IBL B;  3ASN C;  1FKA O;  3L74 H;  1Q8I A;  3VQX A;  2EJR A;  3STZ C;  4TQF A;  2KB1 A;  4L87 A;  3CCQ V;  5CBG A;  2P22 C;  3SPC A;  4IYH A;  2HG5 C;  1XMO B;  4RQF A;  2Q0O C;  5J2U B;  3N2G B;  4I9Q A;  1M57 C;  2CTR A;  3LDD A;  3T1H O;  4B3R O;  1TUB A;  4AQY O;  4O2A B;  3M8A A;  4PDV A;  4RAI A;  2RCV A;  3JAR B;  1JJ2 U;  1EM1 A;  1BGY H;  2NNU A;  4Q6G A;  4LC1 A;  1WA8 A;  2IM9 A;  1N32 B;  2JEX A;  5CA0 B;  1TUE B;  5CN0 A;  4JYC A;  4PA9 A;  1BL8 A;  2ZT9 B;  1VMG A;  2UUB B;  2YSU B;  4MW3 A;  3JYC A;  1N33 B;  3OGI B;  1M4U A;  3OGC C;  2LFR A;  5C8Y A;  4FM1 A;  3ZRW A;  4CC5 A;  2F1M A;  2HJD A;  4WFB V;  3CCJ V;  1SQX H;  2P67 A;  3JAW A;  4LF4 O;  3H1J H;  1IBL O;  1AI4 A;  2YXL A;  4IIJ B;  2D3O W;  4LF9 B;  1NH2 D;  2F95 B;  1Q86 W;  1S77 D;  5IJ9 A;  3FYE B;  3RYH A;  1OCR B;  1XMO O;  1FPO A;  3AK1 A;  1ZTE A;  3RWR D;  4ABM A;  3JD3 A;  2QTS A;  1K8A W;  3DSQ A;  1GH6 A;  4LF6 B;  1VQK V;  3CE2 A;  4CH3 A;  4YIO A;  2Q8V A;  3OTO B;  5J2T A;  5DN6 G;  3SPH A;  2L35 A;  4LF7 B;  1QLE B;  5K1P A;  4FM0 A;  1W0K G;  3RYI A;  1K5S A;  4I5S A;  1N32 O;  3F5W C;  4GCZ A;  3HKE B;  1OCR C;  4FFB A;  3K9A A;  5FPO A;  1WB8 A;  3CD6 V;  2UXC B;  2UUB O;  1E1Q G;  2N05 A;  1MOF A;  1N33 O;  4H37 A;  5KHK A;  5BMV A;  2Q68 A;  3T1C A;  1J95 A;  1FFX B;  2YI9 A;  4X1I B;  5FLX N;  1MZF A;  3Q4H A;  2ZDI A;  2KQX A;  4FLU A;  2EUL A;  2ITC C;  4J9Y B;  3ZMU A;  2AHY A;  1QLE C;  2ILM A;  1UFI A;  1E79 G;  2YIC A;  4PI0 A;  2F43 G;  5HFL A;  1AP6 A;  5B1A B;  3I55 V;  4LF9 O;  2W0X A;  2JRI A;  2WLH A;  4WFH A;  3K04 A;  4JI5 B;  3SYO A;  1Q7Y W;  4K8X A;  3JD2 A;  1OZ0 A;  2V1D A;  5DED A;  2P4V A;  3RYF A;  4H13 B;  1GTO A;  5B66 Z;  3OFN G;  4LF6 O;  1SA0 A;  5CMU A;  4J42 A;  4MTO A;  4D7T A;  2ZE6 A;  4DV5 B;  2HJF C;  3TCU A;  3OTO O;  1KC8 W;  1F51 A;  1SRY A;  4LF7 O;  5ITZ A;  3HR0 A;  2PZS A;  5B1A C;  3RBZ A;  4CZZ A;  5IDJ A;  2EIL B;  4YXW G;  3G71 V;  3JAM N;  2UXC O;  4BR6 A;  1KP2 A;  1I5Y A;  1KQS U;  3IC9 A;  2Z3Y A;  4D6T H;  1TVK A;  2OYQ A;  3SJQ C;  4O2B A;  4G2K A;  3RT3 C;  4L8J A;  5LP6 B;  4PJ0 Z;  4CH4 A;  3U11 A;  3CCM V;  2OCC B;  2K9P A;  3OMI B;  2O57 A;  1EN5 A;  2A0L A;  2EIL C;  3SDL A;  5EZY B;  3VQV A;  1FS0 G;  1GAX A;  1AJQ A;  2DMX A;  4JI5 O;  1N0N A;  4RO2 A;  2JS5 A;  4HAM A;  2K1E A;  1SC5 B;  5KMG A;  1ZAU A;  4O4H B;  4PV1 B;  1IXB A;  1AB3 A;  1E1R G;  4J10 A;  2OTJ V;  2ZNI A;  3JAT A;  2CAZ C;  1H8H G;  4J80 A;  3SYP A;  3UKM A;  2ZNJ A;  5LP6 C;  4ZHQ B;  4DV5 O;  4U3J B;  2OCC C;  4TQD A;  3DC5 A;  5IJ0 B;  1JX9 A;  5LGT A;  5JQG A;  5B1B B;  2H94 A;  4J41 A;  4I55 B;  2BOC C;  3DXR B;  2CTW A;  1VIB A;  1EN4 A;  4CS2 A;  3JAK B;  1HNW B;  4E2L A;  4R8C A;  5KHJ A;  3TXS A;  4YY3 B;  1W0J G;  2EZO A;  5JH7 A;  1O9H A;  1XHZ A;  1QVF U;  3ZMZ A;  1I7F A;  3BA9 A;  1IXM A;  1Y4M A;  4HNA B;  1CP9 A;  1VQL V;  3JD4 A;  5DEC A;  4MVO A;  1CXZ B;  4F6R B;  3AG3 B;  4YJ3 B;  4A5U B;  4BIZ A;  3NXS A;  3VBB A;  5LGU A;  2YDE A;  2F4V B;  1S3J A;  5B1B C;  3ZRX A;  4UCU A;  1EBO A;  2JJ2 G;  3UM7 A;  1HNZ B;  4W4L A;  4IT5 A;  4RQE A;  4B7E A;  1UPG A;  1AR4 A;  3WFV A;  2ZR3 A;  1IBK B;  4KHP B;  3AG3 C;  1R3L C;  1ZLZ A;  2DWE C;  5L3D A;  4MVZ A;  4LBE C;  1F23 A;  4J7K A;  4N21 A;  1OCO B;  5EC2 C;  1P4R A;  1OJH A;  1US6 A;  2QR4 A;  2YIB D;  3EHB B;  1OCC B;  1H2M A;  1AR1 B;  3QTC A;  4X20 A;  4Z1V A;  4O4L B;  1HNW O;  1Q3E A;  2IJK A;  1D2D A;  2BE3 A;  4RWU A;  4X8A A;  2HFE C;  3L71 H;  4YY3 O;  1TGO A;  3QNE A;  1F4N A;  4RUE A;  4XDK A;  2CK3 G;  1P49 A;  2DW4 A;  1IX9 A;  3QO7 A;  4X1K B;  4WF9 V;  1OCO C;  3ABT A;  1JQ0 A;  1Y66 A;  2F4V O;  1K9M W;  1SQB H;  3FKS G;  1S76 D;  4TV8 B;  3S3X A;  3K58 A;  1Q81 W;  1VF6 C;  2AHZ A;  2ZIN A;  2QA4 V;  1Z5V A;  1HNZ O;  5EK0 A;  2DQ3 A;  3ZS8 C;  2NLJ C;  1VQ9 V;  3K9S A;  5LHH A;  3CEI A;  1FFT B;  4X88 A;  3P32 A;  1B6Q A;  1IBK O;  1NI8 A;  1AJN A;  1L0N H;  4LNU A;  1MG1 A;  4KHP O;  2WLJ A;  2ZIO A;  3OM3 B;  4GX1 A;  2M6Y A;  3OR7 C;  1XL6 A;  4R6Z A;  4U7N A;  3RGB A;  3O9O A;  1GK9 A;  1ORQ C;  1XOU A;  2B1G A;  2XAS A;  4JTA B;  4UUJ C;  1QU7 A;  4NVP A;  2P06 A;  5IE9 A;  4DK1 A;  1WN7 A;  1SF9 A;  5EBM C;  5L3B A;  3R65 A;  2WLL B;  3ASO B;  1HWY A;  1IUR A;  1NTK H;  1URF A;  3BAB A;  3S3W A;  2QSA A;  4CC6 A;  3A2F A;  3TJT A;  3FX7 A;  5LL6 Y;  2ADQ B;  4NYK A;  4FM2 A;  2CTP A;  4GLX A;  4BWA A;  5JCO C;  4BAY A;  2A9H A;  4DV3 B;  2QKC A;  1K5Q A;  4KUM A;  1QBZ A;  3CX5 F;  2C2A A;  4DW0 A;  3MD0 A;  2JIZ G;  1BS3 A;  5LXT B;  1QR8 A;  5FPR A;  3JAR A;  4NTX A;  1BHB A;  3SYQ A;  3FB6 C;  4TOI A;  4AIL C;  1VQO V;  1NBM G;  4X62 B;  1CPY A;  2Y4U A;  3ASO C;  3AG1 B;  4I4T B;  2N04 A;  3E8F A;  1TAE A;  2OT5 A;  1EN6 A;  1DF4 A;  3FB7 C;  2QJ1 A;  3JD1 A;  4MW8 A;  3FAV B;  4JYA B;  2CE4 A;  5CA0 A;  1KP3 A;  2EX3 A;  4O4J A;  3C3S A;  1QLN A;  4O4I A;  3W7T A;  3HKC B;  4J7J A;  1D5A A;  1XRE A;  4EFB A;  2GTA A;  2ARH A;  4NTY A;  4YHH B;  1EZV H;  1BE3 H;  4X65 B;  4JV5 B;  1ZX3 A;  2E75 B;  2OCH A;  4JF3 A;  3BPZ A;  1F7Y A;  3AG1 C;  3FFQ A;  1QNM A;  4UCV A;  2Q9L A;  3ETE A;  4DV2 B;  3OEE G;  5FNV B;  4IIJ A;  3OD4 A;  3HPL C;  4DV3 O;  1K33 A;  2LW1 A;  4FZ1 A;  5B1O A;  4GYC B;  3E86 A;  4JI7 B;  2QEX V;  4JI8 B;  1YCI A;  2QWQ B;  2CGO A;  2OTL V;  1QHT A;  2XHB A;  2OWO A;  2LGQ A;  1XL4 A;  4CH6 A;  1GM9 A;  2KG7 B;  3ZN0 A;  4D7S A;  2BSK A;  2QWO B;  3ZHR A;  2LGW A;  3CRC A;  2DYR B;  4I50 B;  4X62 O;  4E4E A;  4KFM A;  4DR3 B;  5IYZ B;  4K35 A;  4WFF A;  3MDS A;  5KX5 B;  1VQP V;  2F23 A;  4UV8 A;  4N23 A;  4LP8 A;  3JAL A;  2X6B A;  2ZIM A;  1DF5 A;  3L9D A;  1FJG B;  3L75 H;  4FLZ A;  1JA8 A;  1H2S B;  1WJZ A;  2PYL A;  5KUM A;  4YJ2 B;  3K06 A;  3RVY A;  4JYA O;  4PEL A;  2H8P C;  5KHG A;  3HKE A;  1AP5 A;  3H1L H;  1YJN V;  4BIO A;  4DW1 A;  4OX9 B;  3K5M A;  4YHH O;  4K0K B;  1IBM B;  1FFX A;  4X65 O;  4JV5 O;  2DYR C;  1DGS A;  5B3S B;  4FJC C;  4X1I A;  5LA6 B;  1Q5O A;  3CRM A;  2Y0P A;  1KBH A;  4ZI7 A;  5CA1 A;  1VF5 B;  3OEH G;  1Q6H A;  3WB0 A;  4P9O A;  4DV2 O;  4AI8 A;  1IDS A;  1S5J A;  2CGN A;  2Q69 A;  2Q5Z A;  4NXM B;  5IYB O;  4HYO A;  2IJH A;  4JI7 O;  3BFR A;  4JI8 O;  1I94 B;  2Q6A A;  2OIG A;  2VRZ A;  2XND G;  1PKX A;  2XT9 A;  3E2E A;  2GUZ A;  4WBN A;  3PN1 A;  3ZHV A;  3LNN A;  3HKB B;  2W6I G;  5B3S C;  4KP4 A;  1YSC A;  3J81 N;  2PYJ A;  3E35 A;  1IVS A;  5BXZ A;  2FML A;  3G67 A;  3A8T A;  4DR3 O;  2HR3 A;  4OPA A;  1ROP A;  1K3E A;  2IW5 A;  2LJ2 A;  1RSO B;  5GON A;  2LQT A;  2WA4 A;  1FJG O;  2E74 B;  1RPO A;  3AK3 A;  5EYP B;  1FXV A;  1ZL8 B;  3IC7 A;  4UCT A;  1RFY A;  2ODM A;  3B8N A;  3A0R A;  4DXW A;  3UCS C;  1EFR G;  3QO8 A;  4DYL A;  4LFC B;  2WLI B;  3IAY A;  4OX9 O;  1AIL A;  4K0K O;  3K59 A;  1IBM O;  4H44 B;  1WPB A;  2YIB A;  1G8M A;  3FB8 C;  4I0X B;  5CA3 A;  2WA3 A;  5LP6 A;  4DK0 A;  4U7O A;  3H1H H;  4JTC B;  1KYO F;  1TUB B;  3L73 H;  3ZHT A;  1QQC A;  4TUY A;  4PA4 A;  2ETN A;  3ZBH A;  4NXM O;  5EZY A;  1L8D A;  2PUS A;  1YJ9 V;  4DV6 B;  4TWK A;  4Z2W A;  5JJJ B;  4DUZ B;  1S0V A;  3R66 A;  4JZG A;  1I94 O;  3N2K A;  4DO2 A;  1K4C C;  3B09 A;  2R9A A;  1WA8 B;  3T4Z A;  1MSD A;  2YC0 A;  1I08 A;  2RMK B;  5H6Q A;  3O65 A;  1NVP B;  4MVQ A;  1JOY A;  4ZHQ A;  1NR7 A;  2AW9 A;  1R1B A;  3TGU H;  3OE7 G;  1AR5 A;  4LF5 B;  5C8Y B;  1YJW V;  5LMN B;  1WNS A;  1NZ6 A;  2Q67 A;  2DYS B;  1HR0 B;  3JAW B;  3JAK A;  2ATK C;  2E3C A;  2R70 A;  2VQE B;  1NJI W;  3HKD A;  2QWN B;  4DV4 B;  1WB7 A;  2H3O A;  4K8Z A;  4LFC O;  5A9G A;  2V7Q G;  1PPJ H;  5HFM A;  2P90 A;  3ZED A;  2YID A;  5LHI A;  4DR2 B;  2AZ2 A;  5A2Q N;  5KA5 A;  2UUC B;  4UVC A;  5IJ9 B;  4IHJ B;  3JAS B;  3RYH B;  3CCL V;  4MTX A;  4BW5 A;  5K1X A;  3LDE A;  2IU3 A;  1GM7 A;  4QPJ A;  1SS3 A;  2ZE5 A;  3GB7 C;  2DYS C;  3ETQ A;  3AG2 B;  4FMT A;  1FD9 A;  1WAZ A;  2P6J A;  2Y48 A;  1FAF A;  4EFE A;  2LP7 A;  4DV6 O;  3CRQ A;  4DUZ O;  2E76 B;  1P84 F;  3CWB H;  1EZJ A;  1W59 A;  3VOU A;  1VF7 A;  2HP8 A;  3RYI B;  4NR1 A;  4R7C A;  1Y76 B;  3K0G A;  3E22 B;  1VQ8 V;  1JPX A;  4FFB B;  5KHH A;  3SJB C;  2JGU A;  5L3C A;  1BMF G;  2F93 B;  4H0L B;  3LSQ A;  5BMV B;  4ZIB A;  4LF5 O;  5BY1 A;  3AG2 C;  5LMN O;  1ARO P;  4LH7 A;  4LF8 B;  2P4K A;  1G1X B;  3PJS K;  1HR0 O;  4X89 A;  4ICG A;  3CJH A;  4O4L A;  1O9G A;  2X0L A;  2VQE O;  3CHX A;  2ITD C;  1SES A;  4FZ0 A;  1YZB A;  4DV4 O;  2CDY A;  1DLB A;  4B08 A;  1QVG U;  2PY5 A;  2N74 A;  4DR2 O;  3BEH A;  3CC2 V;  1NS1 A;  1B04 A;  2UUC O;  1YF2 A;  1LUV A;  4X1K A;  2L6L A;  2JDI G;  3ZJZ A;  4IYI A;  4GUN A;  1SZX A;  1KKC A;  3A0H Z;  1NVP D;  3WB2 A;  4TV8 A;  1YEW A;  1GMG A;  3CCE V;  2QKS A;  1PNK A;  1NU1 H;  3OMA B;  3RYC A;  1V54 B;  2FL4 A;  2LW7 A;  4PD4 F;  1MNG A;  1X59 A;  3UT5 A;  4CS4 A;  5ITZ B;  4EEQ A;  2NR5 A;  2JGD A;  2HVK C;  3KCY A;  5IY5 B;  1DK1 A;  3LDC A;  2CH7 A;  2PGG A;  5JCO A;  2MW2 B;  2VWJ A;  4PI2 A;  4IL6 Z;  1N36 B;  3CXC U;  1YIJ V;  2P7T C;  2VS0 A;  1MA1 A;  2DN9 A;  5E79 Z;  1M93 A;  1N8R W;  1LR1 A;  1GM8 A;  4MVS A;  5IYC O;  1TVK B;  5H5N A;  5JWP A;  1AJP A;  3P30 A;  4PDL A;  1SQQ H;  4O2B B;  1Y67 A;  4TSF G;  1V54 C;  3I5D A;  3BHP A;  3K57 A;  1XNQ B;  5EBL C;  2WLL A;  4W4K A;  2XAQ A;  1V55 B;  4JPR A;  1AI7 A;  4JI6 B;  3ICX A;  2RNB A;  1Y74 A;  5D5Q A;  3CCS V;  5IY5 C;  1S5H C;  2UXB B;  3IGA C;  1SET A;  4FLX A;  5JJN B;  4NXN B;  1OV9 A;  2UUA B;  5KMG B;  2QM4 A;  5KUK A;  4G28 B;  2Q7G A;  2XOK G;  4EB6 A;  1Q6U A;  1XNR B;  3K79 A;  5LXT A;  4X66 B;  1RM1 B;  2UU9 B;  1VEW A;  1AVM A;  4UCR A;  4J11 A;  4GKJ B;  1V55 C;  1WLE A;  3BAA A; 
#chains in the Genus database with same CATH homology
 1K8A W;  3AG1 C;  2HKO A;  3B77 A;  2EIN B;  2IU0 A;  1JVM A;  1VQK V;  3ZCC A;  1PL0 A;  2EIM B;  3F7Y C;  3ETE A;  3JCZ A;  1KEC A;  3OEE G;  4MVU A;  5DN6 G;  3SPH A;  3HPL C;  1QLE B;  2WAM A;  3CCV V;  3D3I A;  1W0K G;  1K33 A;  1K5S A;  5B1O A;  4I5S A;  4PA6 A;  3W7U A;  3BY6 A;  1BHA A;  3F5W C;  3E86 A;  2QEX V;  1K7D A;  4GCZ A;  1OCR C;  2QTO A;  2HLD G;  2YEV A;  3AG4 B;  3K9A A;  1RM1 C;  2OTL V;  3CD6 V;  3CME V;  2B5U A;  1XL4 A;  1E1Q G;  1GM9 A;  3ZN0 A;  1MOF A;  4H37 A;  1THZ A;  2XAJ A;  2ZXW B;  2Q68 A;  3T1C A;  1J95 A;  2DYR B;  1W2B U;  5LBQ A;  2EIN C;  4KFM A;  1VQM V;  1SER A;  4WFF A;  1VQP V;  2EIM C;  2ZDI A;  4FK5 C;  4UV8 A;  2X6A A;  1F4M A;  2ZDI C;  2ITC C;  4HZ3 A;  4J9Y B;  4LP8 A;  4N23 A;  2AHY A;  2X6B A;  3ZMU A;  4UVA A;  1DF5 A;  4XDJ A;  4UV9 A;  1QLE C;  3SYA A;  5CBF A;  1JCH A;  1E79 G;  5KUM A;  3K06 A;  3RVY A;  4PEL A;  2F43 G;  5HFL A;  2H8P C;  3E8B A;  5B1A B;  5C93 A;  3I55 V;  3AG4 C;  2WLH A;  1VQ4 V;  4WFH A;  2UXX A;  4JYB A;  3K04 A;  1YJN V;  3SYO A;  1Q7Y W;  5E1A C;  3JD2 A;  2ZXW C;  4OXS A;  3GWO A;  1OZ0 A;  3QO5 A;  2V1D A;  3SPI A;  3W7X A;  5DM6 V;  4PA7 A;  4G27 B;  4RUF A;  2DYR C;  1KD1 W;  4QE9 A;  1GTO A;  4MVM A;  5B3S B;  4P2Z A;  2LFS A;  4FJC C;  3ZMV A;  4R50 A;  5CBH A;  4XDL A;  3OUF A;  3OFN G;  5CMU A;  4JGS A;  5IYD O;  4MTO A;  2QM7 A;  4XBF A;  2HJF C;  3CCU V;  3KG2 A;  4J9Z B;  2QM8 A;  3OEH G;  3TCU A;  4P9O A;  2WLM A;  2B1I A;  1KC8 W;  1YTF B;  1R6N A;  2Q69 A;  1F51 A;  1SRY A;  3E8G A;  3K03 A;  5EC1 C;  2W0F C;  3CC7 V;  5IYB O;  5B1A C;  5GW7 A;  4HYO A;  3RBZ A;  3TET A;  4I9W A;  4CZZ A;  2IJH A;  4GX0 A;  5IDJ A;  2EIL B;  4YXW G;  1K92 A;  2A79 B;  3G71 V;  4MVR A;  2EIJ B;  2Q6A A;  4P9P A;  2XND G;  4FPP A;  1PKX A;  3E2E A;  1KP2 A;  1I5Y A;  1MSW D;  2W6I G;  1KQS U;  5B3S C;  2Z3Y A;  4KP4 A;  1YSC A;  3E35 A;  2EBO A;  3F7V C;  5LHG A;  2JEU A;  5EBW C;  2GHY A;  4MSW C;  1M9N A;  2QE7 G;  5B1N A;  2HR3 A;  5KA6 A;  3SJQ C;  3WG7 B;  1ROP A;  1K3E A;  1PNM A;  2IW5 A;  1VQ6 V;  2UXN A;  4G2K A;  3ZMT A;  4ZKI A;  2Z5U A;  3FYI B;  4F4L A;  1RPO A;  2OCC B;  3OMI B;  3CCM V;  2GSM B;  1FXV A;  3SPJ A;  4QNH B;  4WFG A;  2A0L A;  3IC7 A;  2WPD G;  2EIL C;  3MHH C;  3OW2 U;  1FS0 G;  2Y69 B;  3B8N A;  4MT8 A;  1AJQ A;  2EIJ C;  2X6C A;  3A0R A;  1CEZ A;  3W7S A;  3LSS A;  4P30 A;  4DXW A;  1EFR G;  3AEI A;  4RO2 A;  4HAM A;  2K1E A;  2XAG A;  4LCU C;  3QO8 A;  2ZQM A;  1P7B A;  2WLI B;  1E1R G;  1I5X A;  3CP1 A;  3ZRV A;  2OTJ V;  3WG7 C;  1G8M A;  1OCC C;  3FB8 C;  5CA3 A;  1H8H G;  3MHS C;  3OR6 C;  3SYP A;  3UKM A;  4U7O A;  4JTC B;  2OCC C;  1FXK B;  3FB5 C;  3T2M A;  1JX9 A;  5LGT A;  4PA4 A;  5B1B B;  2H94 A;  5H9C A;  1PNL A;  3ETD A;  2PI5 A;  5L3G A;  2BOC C;  1H2G A;  2M7W A;  2IJI A;  2Y69 C;  1YJ9 V;  1AI6 A;  3JD0 A;  1YHQ V;  4PA3 A;  5L3F A;  3D36 A;  4TWK A;  2MK3 A;  3E83 A;  1S0V A;  4E2L A;  1RPR A;  4R8C A;  2WLI A;  5BZB A;  3I56 V;  4DO2 A;  1K4C C;  1K4D C;  2IJJ A;  4JAV A;  4QIW F;  1W0J G;  2EZO A;  3T4Z A;  1NR1 A;  2R9I A;  1COW G;  1QVF U;  3ZMZ A;  3X2Q B;  5H6Q A;  3CC4 V;  1IXM A;  3M99 B;  1Y4M A;  1CP9 A;  1VQL V;  3JD4 A;  1NVP B;  4MVQ A;  1JOY A;  4MVO A;  1L1F A;  1NR7 A;  1FXK A;  3AG3 B;  4BIZ A;  1FXK C;  3NXS A;  3VBB A;  5LGU A;  4MTG A;  3OE7 G;  1FXH A;  1S3J A;  1YJW V;  5B1B C;  4H33 A;  2IH3 C;  4GX2 A;  1VQ5 V;  4UVB A;  3ZRX A;  2Q67 A;  2DYS B;  1EBO A;  1AI5 A;  2JJ2 G;  3K08 A;  3ABK B;  3UM7 A;  4UXN A;  1ZWI C;  2ATK C;  4MS2 A;  4RQE A;  4FIP C;  1YTF D;  4GX5 A;  2WWW A;  1NJI W;  3OUS A;  2IH1 C;  1H8E G;  2W6J G;  2JJ1 G;  3WFV A;  2JK5 C;  3SPG A;  2V7Q G;  2ZR3 A;  3X2Q C;  3LNM B;  1UJW B;  5HFM A;  2P90 A;  5LHI A;  3ZIA G;  4TT3 G;  5KA5 A;  4UVC A;  5J9P C;  3E89 A;  3CCL V;  3AG3 C;  2PI4 A;  3ETG A;  1SZT A;  1R3L C;  4MTX A;  2DWE C;  5L3D A;  4BW5 A;  4MVZ A;  2WLK A;  4LBE C;  1DTO A;  3LDE A;  4JAS A;  1F23 A;  1M1K W;  4N21 A;  2IU3 A;  1GM7 A;  4QPJ A;  1OCO B;  5EC2 C;  3ZMS A;  1P4R A;  3GB7 C;  4JAU A;  2DYS C;  5FL7 G;  3AG2 B;  3ZRS A;  4FMT A;  2P6J A;  3ABK C;  2Y48 A;  2X7R B;  3ABL B;  3EHB B;  3H01 A;  1R6K A;  1OCC B;  4WFA V;  3DGE A;  1GO3 F;  1AR1 B;  4WFE A;  2LP7 A;  3ABU A;  1KKD A;  3B8M A;  4QE7 A;  2IJK A;  1EZJ A;  2WLN A;  3VOU A;  1G4Y B;  1ENV A;  4QJF B;  5LGN A;  3ABM B;  4X8A A;  2HFE C;  3ML0 A;  3K0D A;  3CPW U;  4R7C A;  3QNE A;  1F4N A;  3CMA V;  3K0G A;  3EFF K;  4RUE A;  3T4D A;  1NH2 B;  4XDK A;  2CK3 G;  3OMN B;  4PDM A;  1R73 A;  1VQ7 V;  3ASN B;  1VQ8 V;  3ZN1 A;  2YEV B;  1JPX A;  2DW4 A;  5L3C A;  1BMF G;  3LSQ A;  3QO7 A;  4WF9 V;  1OCO C;  3ABT A;  1JQ0 A;  1Y66 A;  3AG2 C;  3CCR V;  1K9M W;  1ARO P;  1YI2 V;  3FKS G;  3DTU B;  1S76 D;  1H38 A;  4GT1 A;  3ABL C;  3W7W A;  3PJS K;  4X89 A;  1Q81 W;  1NQT A;  1QR9 A;  1M57 B;  2AHZ A;  5H6R A;  2QA4 V;  1OCZ B;  5EK0 A;  1R3K C;  1K34 A;  2DQ3 A;  4Z1M G;  1R3J C;  2NLJ C;  2DWD C;  2X0L A;  2ZR2 A;  4CBC A;  2ITD C;  1SES A;  1VQ9 V;  3ABM C;  5LHH A;  2HVJ C;  1VQN V;  1FFT B;  1DLB A;  4JTD B;  4X88 A;  3SYC A;  3P32 A;  3G4S V;  1B6Q A;  1QVG U;  5L3E A;  1GKF A;  3ASN C;  1AJN A;  3BEH A;  3CC2 V;  2EJR A;  3STZ C;  1MG1 A;  2WLJ A;  3OM3 B;  2JDI G;  2KB1 A;  3IFX A;  4L87 A;  3RW0 A;  1M56 B;  4GX1 A;  3ZJZ A;  3CCQ V;  5CBG A;  3OR7 C;  1XL6 A;  1R3I C;  2ZD9 A;  3SPC A;  2DQ0 A;  4R6Z A;  1NVP D;  4U7N A;  2WSS G;  2BOB C;  1GMG A;  2HG5 C;  1GK9 A;  3CCE V;  1ORQ C;  4RQF A;  2QKS A;  2FTK A;  3HB3 B;  1PNK A;  1M57 C;  2B1G A;  1OCZ C;  2XAF A;  3LDD A;  2XAS A;  3OMA B;  4JTA B;  1QCE A;  4UUJ C;  1V54 B;  4PDV A;  4RAI A;  5EBM C;  5L3B A;  3R65 A;  1K73 W;  3ZRW B;  2WLL B;  3STL C;  3TK1 A;  1JJ2 U;  3ASO B;  1YIT V;  1HWY A;  4MTF A;  2HVK C;  5IY5 B;  2NNU A;  3LDC A;  4LC1 A;  3CYO A;  4BAY A;  2A9H A;  1LNQ A;  1K5Q A;  1M56 C;  4KUM A;  4ZBM A;  2JEX A;  1PD3 A;  1QBZ A;  3CXC U;  1M90 W;  1TUE B;  2P7T C;  5CN0 A;  1YIJ V;  4JYC A;  1OHH G;  4Q20 A;  4PA9 A;  2C2A A;  1BL8 A;  4EKW A;  3G6E V;  1N8R W;  3MD0 A;  1GM8 A;  2YSU B;  2JIZ G;  4MVS A;  4MW3 A;  5IYC O;  3JYC A;  1AJP A;  3P30 A;  4PDL A;  4PDR A;  4TSF G;  1V54 C;  1QR8 A;  3OGC C;  1Q82 W;  4BIU A;  2LFR A;  2EIK B;  1BHB A;  1MAB G;  3ZRW A;  3SYQ A;  3FB6 C;  5EBL C;  2WLL A;  4ASU G;  1VQO V;  1NBM G;  2R9R B;  1CPY A;  4WFB V;  3CCJ V;  2XAQ A;  1V55 B;  3ASO C;  4JPR A;  1AI7 A;  2P67 A;  3AG1 B;  1NKD A;  3LUT B;  3CCS V;  5IY5 C;  3E8F A;  1S5H C;  2OT5 A;  3E8H A;  1DF4 A;  3FB7 C;  3JD1 A;  1AI4 A;  4MW8 A;  3IGA C;  4WCE V;  1SET A;  2XAH A;  1KP3 A;  2D3O W;  2EZP A;  5KUK A;  1QLN A;  1NH2 D;  4G28 B;  2XOK G;  1Q86 W;  3W7T A;  1S72 V;  1S77 D;  3FYE B;  3K3W A;  4QPK A;  1K97 A;  1WPX A;  3K79 A;  1OCR B;  1RM1 B;  2EIK C;  3RVZ A;  3JD3 A;  4JF3 A;  3OAA G;  1V55 C;  1WLE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...