4FIPC

Structure of the saga ubp8(s144n)/sgf11(1-72, delta-znf)/sus1/sgf73 dub module
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
41
structure length
41
Chain Sequence
b'TITIDSISNGILNNLLTTLIQDIVARETTQQQLLKTRYPDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
publication title A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 17
structure length 41
sequence length 41
chains with identical sequence G
ec nomenclature
pdb deposition date 2012-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF18519 Sgf11_N SAGA-associated factor 11 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4fipC00
1DF5A 4JF3A 4N21A 5HFLA 1JPXA 3M99B 1I5XA 3WFVA 3B8MA 3H01A 1F23A 2X7RB 1QR9A 2EZOA 3B8NA 3MHSC 2OT5A 5KA6A 2EZPA 1QBZA 3K9AA 1DLBA 5HFMA 4N23A 5CMUA 1K34A 3CP1A 2EBOA 1SZTA 2M7WA 3CYOA 2LP7A 2MK3A 5CN0A 1EBOA 3GWOA 1DF4A 3MHHC 1Y4MA 1MG1A 1QCEA 2P6JA 4G2KA 4JPRA 5H9CA 4E2LA 1I5YA 3B77A 4JGSA 1ENVA 3P30A 1QR8A 1K33A 4FK5C 1JQ0A 4FIPC 4FJCC 5KA5A 1Y66A 1MOFA
chains in the Genus database with same CATH superfamily
3OD4A 2F23A 5D5QA 1FFXA 1F23A 2X7RB 3F5TA 3ZN0A 1M56C 5E79Z 3QNEA 1FFTB 4JYBA 4UUJC 2EBOA 2EILB 4HZ3A 1Y4MA 4MT8A 4CH4A 1BMFG 2JS5A 2PZSA 1WPXA 1IZ3A 1W0JG 4JTCB 3CCUV 4FZ0A 1ZLZA 2BTOA 4IIJB 1OCOC 1JFFB 2JGUA 3CB2A 3A0RA 4X65B 3G6BA 5KAIZ 1HNWO 5CB4A 4GX5A 1VQ6V 2GTSA 4MVOA 2YEVB 4Z2WA 4WCEV 3JATB 4K3AA 5IWAO 2D3OW 4DR1B 1KQSU 2Q9LA 1FXKA 2QWRB 3OM3B 4X1YB 1KBHA 3LSQA 1Q8IA 1JX9A 4GYCB 3MDSA 4LCUC 3CWBH 4CS2A 5EIBD 2JDIG 4MS2A 4Z1MG 2HFEC 2P90A 5LHHA 1FYJA 2YUAA 5LHGA 4WFFA 1E1RG 3OEEG 3OMAB 4RUFA 2LO1A 3ZEDA 5A9GA 5KLVH 4ZBMA 2RJZA 4ZKIA 5KA5A 2LJ2A 5ITZA 3VQYA 3WB2A 5L3GA 4DR7B 1L0NH 3FFQA 2Q73A 5BY1A 1BT8A 1AJNA 2BOBC 2EX3A 2E5LB 4LF8B 5CB4B 2DWDC 2QWPB 1XL6A 1Q90D 2OTLV 3LDCA 3G6EV 1NH2D 2QWNB 4BIUA 5LL6Y 3N2GA 1EM1A 2CTPA 5CBGA 5CMUA 4O4HA 2DQ3A 5CA0B 4W4KA 4JYCA 1EZJA 2QGNA 1IURA 3D8CA 2CH7A 4R7CA 3OGIB 4JAUA 4N21A 1X4TA 2HKOA 3NXSA 5HFLA 2Y4UA 1AILA 1NS1A 3ZN1A 3A0BZ 4XDKA 1FKAO 1WLEA 3CC2V 3K5MA 3OW2U 2LFRA 1QLEB 4UB6Z 5ITZB 1URFA 2OWOA 3QF7A 2VQFO 3H1KH 2GDSA 4FLTA 3T2MA 1HNWB 2ILMA 3H9VA 4DR5O 2LGWA 5B3SB 1N36O 2ZXWB 1H2KA 4H13B 2XNDG 3A0HZ 5IWAB 4ASUG 2IU3A 1VQ7V 4GX0A 2AW9A 1PD3A 4IYHA 2QEXV 5IY5C 4X66O 3JD3A 2ZE8A 1VQOV 3WB1A 2HEPA 3N2GB 1WPBA 4YJ2A 4RWUA 4D6TH 1V54B 5JH7A 4RQEA 1IBMO 2R9RB 4H33A 3A8TA 4TQDA 2JEUA 3RFRA 4DRXB 2Y4TA 1RM1C 2ZE6A 4LF7O 2A9HA 1M1KW 3KG2A 2B9ZA 3FX7A 5H6QA 1SQPH 3ZRXA 4X64O 1Y66A 3ABKB 1TGOA 1I7FA 4GUNA 4FVMA 3CMEV 1QVGU 5J2UB 2H94A 3L74H 5EK0A 2V4DA 5JCOC 1SKVA 2JGDB 4MVSA 4UVCA 3ZHSA 3I56V 3ABLB 3OT7A 1NVPD 1QLEC 1XI1A 2WWWA 2P4KA 2ODMA 1KYOF 4YJ2B 2Q7GA 5B3SC 3E8HA 2ZXWC 3T1YO 3FB7C 1N4CA 1XDCA 1TUEB 2F95B 1SRYA 2WLNA 5L3DA 1YEWA 3FB5C 4RUEA 4G2KA 4MTFA 1SETA 2GV9A 3G80A 5IYZA 2E74B 3VBBA 3TJTA 4AI8A 1KKDA 5LBQA 2OT5A 4MVUA 3I55V 4DR5B 4CH5A 1P49A 1V54C 3B40A 1T5EA 2CDYA 2DWEC 1N36B 4DR2O 5L3FA 1VIBA 3DC5A 3E22A 4B08A 2UUBO 2HP8A 1LR1A 3UM7A 4X66B 5C8YA 3U11A 2OCCB 1GN4A 1MMMA 1AB3A 4CS4A 2BE3A 3ABKC 2LGQA 2UXNA 5EZYA 1DTOA 1IBMB 3SPIA 3ASOB 2LW7A 1K73W 2IU0A 3ABLC 4KL1A 4LF7B 5IYZB 4BR6A 2GTAA 4LC1A 4X64B 3FB6C 3G4SV 4WFAV 1PP9H 2PGGA 3FAVA 3UO2A 4JI1O 4GCZA 5DN6G 2HVKC 3H1JH 3IC7A 4RO2A 5GW7A 1MNGA 1VQ8V 5LMNO 5CA3A 5LP6A 4FLUA 2ZT9B 2UUCO 1S3JA 2UXDO 4LNUA 2FTKA 5C8YB 1AI5A 5KA6A 5LA6A 1G1XB 4I9QA 3UO3A 5DEDA 1AVMA 5KHKA 1CP9A 3JASB 1VQLV 5IJ0A 3EHBB 3J81N 4CH6A 4CBCA 1WB7A 1KUQA 1NTZH 2M6YA 3T1YB 3K5NA 2Q5ZA 1NR1A 5EZYB 2RDCA 2QKSA 1HNXO 3RYHA 5H5NA 2MW2B 2Q67A 1BE3H 3K0GA 3IGAC 2DYRB 2OCCC 4YXWG 4FM1A 1XL4A 1V9PA 1YF2A 1I94O 3ASNC 1IBKO 1IDSA 3JD0A 3H1LH 4J9YB 4DR2B 1OCZB 2LFSA 3FAVB 4JZ2A 3SPJA 2DOSA 5IJ9A 1E1QG 1CEZA 2WLIA 4F6EA 4L8JA 2UUBB 5LOVA 3ASOC 4O4IA 5LP6B 2HHHB 3K57A 4IYIA 4B3RO 4WFGA 3J7AU 4K35A 3HKBA 4TV8A 5BZBA 5LA6B 3O65A 4NB5A 1KMIZ 4U3FH 4J7ZA 4NKGB 3BA9A 4PA3A 4G28B 5IJ0B 4OXSA 2UXCO 4JI7O 5JQGA 2YICA 3JCUZ 1K5SA 3WG7B 4I7ZB 3RYHB 1IXMA 4PELA 1GN3A 1NVPB 1M4UA 1NU1H 1XMQO 1Z5VA 3QTCA 1X59A 1AP6A 4TV9A 5L3CA 1WN7A 2VRZA 3X2QB 4BIOA 3K0DA 4K0KO 1GMGA 1M57C 3SYPA 4JI1B 2Q6AA 2C2AA 1GAXA 5LMNB 5IJ9B 1XNRO 2UUCB 4I5SA 2UXDB 5LOVB 3S3XA 4O4IB 3E2EA 1CXZB 4I50A 1YITV 2DMXA 3ZCCA 3CRQA 2VWKA 3HKBB 1GM8A 4TV8B 3K5LA 2OIGA 1PNMA 1QU7A 1OCZC 3ETEA 1ZSPA 2UXBO 4ZI7A 3N27A 3K9AA 1KD1W 1HNXB 5JQGB 3ETQA 4XDLA 4K8XA 1TUBA 2G38A 2Q7EA 1RSOA 1K8AW 1WB8A 2XAQA 5B1BB 3AG2C 1NJIW 3SPCA 5BMVA 2Q0OC 4ABMA 1I94B 3OE7G 3ZS8C 1IBKB 3OR7C 4LH7A 4J7KA 4LR3A 1US6A 1W0KG 4DV2O 2X6BA 1P7BA 4DR6O 3BHPA 3KZIZ 2WSSG 1K3EA 4WBNA 4I0XA 3WG7C 4B3RB 2W0XA 2JJ1G 2ADPA 1S77D 2ZQMA 3RVZA 2K1EA 3NR7A 2ZIMA 1K92A 4I50B 3OMNB 1SQXH 1H8HG 2NN4A 3X2QC 1IBLO 1N33O 1YHQV 1S5LZ 2UXCB 4JI7B 1TA8A 1B3QA 1AJPA 1MZFA 5CN0A 4JPRA 4ZI7B 2W6IG 1M90W 5GTIZ 1NTMH 1H2SB 1TUBB 5H6RA 1XMQB 1RSOB 3W7SA 1VQ9V 2DYSB 1HP8A 3M7MX 1SQBH 1NT2B 1GRJA 1R3IC 3JD4A 5B1NA 4DV3O 3HKCA 3OUFA 2ARHA 2Z3YA 4DR4O 3HPLC 2PI4A 1OCCC 2H3OA 4K0KB 3ZMSA 4O4LA 2LQTA 2ZE5A 1H2LA 5EC1C 4NTYA 1MG1A 1SS3A 3TXQA 2YI8A 3ETGA 3CD6V 1XNRB 1OJHA 4UV8A 1Z5WA 3SYCA 3PN1A 4WBNB 2QKAA 4I0XB 4Z1VA 2XT9A 4KXRA 3CCLV 4MVZA 1I5XA 2R72A 1M93A 3MHSC 4DV4O 2IBZH 1EFRG 2O57A 3APQA 1AROP 1FD9A 2UXBB 1XNQO 2UU9O 4QE9A 4B3MO 4H37A 2X0LA 4X1IB 4NXMO 3AG3B 1ROPA 4FFBA 1VMGA 4HYOA 2IJHA 1NBMG 3AG7A 1JR9A 3T1HO 2IW5A 3AK2A 4NTXA 4JZGA 2XAFA 5BR8O 3HKCB 1FFXB 4DV2B 4DR6B 4XDJA 1AJQA 3P32A 3OEHG 3CCVV 2XAHA 3ETDA 2P06A 4BIZA 3WB0A 2EIKC 2R70A 2KSDA 3QO8A 2LW1A 1ZWIC 3ZIAG 4QJFB 5IYBO 3N2KA 3E8FA 2NR5A 2AZ2A 4X88A 4DR3O 5KMGA 4KUMA 4IGGA 1JCHA 2HR3A 2OYQA 3AK1A 3D36A 2XAJA 1IBLB 1N33B 4LFCO 3RN4A 4I9WA 3GWKC 5EC2C 2EILC 2BOCC 1YSCA 2GUZA 4DV6O 1SQGA 1YTFB 1K4DC 1K97A 2EULA 1FXKB 4FFBB 3TXSA 5HFMA 2ZDIC 3W7XA 1R73A 5L3EA 3O9OA 3ZHQA 1NI8A 4DV3B 2WLHA 3ABMB 4DR4B 4DV5O 3L70H 1PNLA 1RP3B 4FLZA 1AR5A 1Q43A 4GLXA 1TVKA 1PL0A 5LGTA 4PI0A 1ZUQA 2ATKC 2QWQB 3N2KB 4DV4B 2JJ2G 3RYFA 3E86A 3KKYA 4XBFA 5KMGB 2KG7A 1XBLA 3U10A 2ZIOA 4PJ0Z 3TETA 2QTOA 2WLKA 4TT3G 1XNQB 2UU9B 4MTXA 4B3MB 4PV1B 4NXMB 2IJJA 4DYLA 4B3TO 2EJ7A 4NVPA 1OCRB 3C3TA 3T1HB 4EFBA 1Y76A 4GKJO 4LFAO 3E35A 4PDLA 2FL4A 4O4HB 4ICGA 5BR8B 1Q86W 4A5UB 4JI6O 2CTWA 5B1OA 5GONA 2YXHA 1MABG 3E83A 1PV0A 2CH7B 2ZM6O 1IX9A 3AK3A 3JD2A 4JI5O 4X89A 3OAAG 3ABUA 3UQ8A 1SZTA 2RNBA 1FXKC 4L87A 1HW7A 3SPGA 5LYJA 3CSXA 2XASA 1Q82W 4DR3B 4FK5C 2VWJA 1D2DA 3HKEA 3SJAC 3ABMC 4I55A 1O9GA 3RYFB 1VQNV 4LFCB 1S76D 2KG7B 3I5DA 5TISZ 4OPHA 3R66A 4DV6B 1ZL8A 3QO7A 1V55B 1SESA 1Q5OA 1OHHG 4DXWA 2EIMB 5LHIA 5IYDO 5D5PA 1Y76B 3ZRWA 5B1AB 1G6UA 5FLXN 1Q6UA 4DV5B 2CGNA 4DW1A 1VQMV 2ZNJA 3RYIA 2FYUH 1QQCA 1HNZO 5GONB 1VF6A 4AQYB 5JH7B 1UPGA 4IL6Z 4UCOA 1I5YA 3K03A 4JTAB 3ZHVA 2Q0AA 3UT5A 1SQQH 5BXZA 2ZCEA 3HKEB 2CTRA 4LF5O 1DK1A 4OGQB 1Y74A 1AP5A 1B06A 2H8PC 1RFYA 4WFBV 3RT3C 1AI4A 2R9IA 5CBHA 4B3TB 3P30A 3JCZA 2HHHO 4YIPA 4NYKA 4DUYO 4UB8Z 1NTKH 4GKJB 2B1IA 4LFAB 2WA3A 2YS8A 4DW0A 1VQPV 5LXTA 1H38A 3ZRWB 4JI6B 2M7WA 4FM2A 1AI7A 3L9DA 1GH6A 3L73H 4O2BA 2F4VO 1XEQA 2ZM6B 4JI5B 1NH2B 2CE4A 4JAVA 3RYIB 1KECA 1PM9A 3WFVA 2UXXA 3RW0A 3THOA 1JOYA 4N23A 4AILC 5B1AC 1R3KC 2HVJC 3UT5B 1QHTA 1F51A 4TUYA 1PKXA 3OFNG 1HWYA 4PA9A 5DECA 5JJEB 2PI5A 4JGSA 2QR4A 4UCTA 1Y74B 5KX5A 4DV7O 3JD1A 3E22B 3ZX6A 1XHZA 4TOIA 4HBNA 5LMUO 1LUWA 1NQTA 4PDMA 4PA6A 2P4VA 5EIBC 4PA4A 2Y48A 1M5IA 5GTHZ 3ZRVA 5JVDA 3JALA 1BS3A 3BFRA 2WLJA 3FB8C 4I4TA 4TSFG 4IT5A 4GT1A 2P7TC 4X62O 3LNNA 4YJ3A 1HNZB 2QWOB 4K8ZA 4O2BB 5KHIA 2K9PA 4O4JA 3HB3B 1WP8A 2PY5A 3IJ4A 3STLC 2ZR3A 3IAYA 2F1MA 2FKXA 2E75B 1DGSA 1K34A 4U7NA 3GWOA 3DXRA 4LF5B 4J10A 4PA7A 1VQ5V 3CXCU 1N32O 4TUYB 2W0FC 2IJIA 4BWAA 1FXVA 4J11A 5LGUA 3EVKA 4IHJA 3HKDA 3C3SA 3K79A 2EZPA 1NKDA 4JTDB 2FB5A 4DUYB 3HR0A 4MVQA 1KP2A 4P9PA 1BCCH 4LNUB 5B5EZ 2ZKOA 3EXAA 2V1DA 4LF6O 1XREA 5JVDB 3JALB 3TGUH 2ZNIA 4JI0O 2F4VB 1LUVA 5JJJB 5E1AC 2Y69B 2PF4E 3CMAV 1QVFU 4YJ3B 4H0LB 2R9AA 2ITCC 3JAMN 4O4JB 2XAGA 1SC5B 2Y0PA 3F7YC 2EINB 1J95A 4FMTA 5B66Z 3IC9A 4LH6A 1HR0O 4ZHQA 2IM9A 3ZMTA 1P4RA 4X1KA 3DXRB 4R50A 3SYAA 3JSLA 1YVWA 2L6LA 2YIBD 4DV7B 4DO2A 1FXHA 4MW8A 4IHJB 2Q7HA 2WLIB 5LMUB 1ZAUA 3CXHF 3E89A 2DYRC 4J41A 1VF7A 1R6KA 4TQFA 2VQEO 3G71V 3GVMA 1SQFA 3CEIA 2PYLA 4UVBA 4EKWA 3RVYA 1XMOO 4X62B 5CA1A 1FS0G 1KP3A 4JYYA 1GN2A 3MHHC 5LP6C 1IVSA 2AHZA 2YIDA 1BQZA 3K9SA 1M56B 3CHXA 2PTMA 4FJCC 4X8AA 3ZHTA 3LNMB 4MTGA 4MSWC 2QSAA 4TV9B 3CCSV 2Q4PA 2WAMA 1EN5A 3IFXA 4WFHA 5A2QN 4ZHQB 1N32B 4X1KB 3OMIB 3P3NA 2P67A 1R3JC 3BPZA 4GX1A 4J42A 3TCUA 3RYCA 1R6NA 4JI2O 4JI3O 2EIJB 2A79B 1OCOB 3DC6A 4DV1O 4F4LA 4D7TA 5FPRA 2WPDG 3CJHA 3BAAA 4QGPA 2QE7G 1J5EO 4LF6B 2QM8A 4UXNA 1GK9A 4H44B 2GBOA 4JI0B 2JIZG 1PPJH 3SGIA 3R65A 1Z2GA 3JAWA 5CA1B 1K7DA 4GX2A 1ENVA 2X6AA 3AG1B 4UCSA 1JFFA 1QR8A 3P3PA 5EYPA 3FD9A 2QA4V 3DTUB 1D5NA 3M99B 2AGAA 2P22C 1BSMA 1NZ6A 2QJ1A 1GM9A 2YEVA 1HR0B 2IH3C 5BMVB 4DK0A 3WU2Z 4HNAA 2QDOA 1GN6A 3PJSK 1MSDA 2N74A 3JSNA 3BEHA 1S0VA 1K5QA 2YIAA 1B04A 1OV9A 4DV0O 2OTJV 3DSQA 5KAFZ 4JF3A 3RYCB 5B1BC 3CE2A 2VQEB 5K1XA 1N34B 3ABTA 3CJHB 5J9PC 4MW3A 2YIBA 1XMOB 1UJWB 3BABA 1L1FA 3OTOO 1MZEA 2Q68A 2RMKB 2DE0X 3JAWB 2ZE7A 3VQWA 2EIJC 4E4EA 4GKKO 1VF5B 2CUGA 4FLVA 5EYPB 1N8RW 4LF4O 2DJVA 1VARA 2X6CA 3STZC 2KQXA 4TWKA 2Z0AA 4EB6A 3LDDA 1AI6A 4C7UA 3K04A 2E3CA 3LUTB 4KP4A 4HNAB 1GO3F 4O4LB 4JYAO 2FMLA 3C90A 5CA0A 2XTAA 4JI2B 4FLWA 4JI3B 1XHXA 3AG1C 3BRCA 4P9OA 1GKFA 3MAQA 4DV1B 1Q7YW 3UCSC 3AG4B 3E8BA 3K06A 2DYSC 1UFIA 4U7OA 1J5EB 5FL7G 3F7VC 4NTWA 5JCOA 1DF4A 2ETNA 5FNVA 3TK1A 1N0NA 2A3QA 3SJBC 3CC7V 2OIEA 3FYEB 1K33A 2Q69A 4LFBO 2NLJC 1L0LH 2JK5C 5IY5B 1I08A 1TAEA 3QG5A 4B7KA 1D5AA 1S72V 4NXNO 1S5HC 3L75H 3K5OA 4B3SO 1A32A 2QKCA 4JV5O 4FLXA 3ZMZA 1BGYH 3ZHUA 5H9CA 5KHGA 3ZHRA 2ZR2A 3CS5A 1Q6HA 2A06H 4EB6B 4QPJA 4CS3A 4QIWF 1RPRA 4AQYO 1RM1B 1WP7A 3AG3C 2YXYA 4DV0B 2B5UA 2NNUA 3D3QA 2ADQB 4PDVA 3ZJZA 1LNQA 2ITDC 5IDJA 3K58A 1JA8A 1W2BU 2D2CB 1KB9F 3SJCC 4DRXA 5FNVB 3OTFA 5KHHA 1Q6IA 2EZOA 3OTOB 1YJ9V 1ZTEA 3K3WA 3L72H 3T1CA 2AXTZ 2RN9A 2GUZB 3W7TA 1YI2V 3U0ZA 1N0JA 3ZRSA 4GKKB 3CCEV 4JI4O 3VQVA 4JI8O 5IE9A 1VEWA 3AG4C 3OUSA 1QLNA 4LF4B 2Y0IA 5J2UA 1WNSA 3RBZA 1WJZA 2JGDA 2IJKA 1FPOA 4WF9V 3A2FA 4CC5A 1GTOA 1EZVH 1MA1A 4QPKA 4JYAB 4KFMA 1SA0A 1F4NA 1BZKA 4BAYA 1SERA 1Y67A 2HLDG 3APOA 2CTQA 1NR7A 3UKMA 3CCJV 2CAZC 1HDJA 1TVKB 4YIOA 2CGOA 3OGCC 4RAIA 1WAZA 5L3BA 4ZOLA 1O9HA 4HAMA 3B8NA 1COWG 3FYIB 1QBZA 4LFBB 2DQ0A 1KKCA 1F7YA 3DGEA 4NXNB 3OR6C 1BHBA 4B3SB 1YXBA 1H2NA 4JV5B 1JQ0A 3CCRV 1ZX3A 3H1IH 4MTOA 2F93B 3K08A 4DUZO 1YDXA 3D36C 2P5OA 1Y6XA 1QCEA 3JAKA 4E2LA 1SA0B 1K4CC 2Q8VA 3RGBA 3SPHA 3T4ZA 4KHPO 2F66C 2AZ0A 1SQVH 4UVAA 3VQXA 1OCRC 4R6ZA 2ZD9A 2B1GA 5LYJB 3D3IA 2F43G 3QO5A 1QR9A 4LF9O 4YY3O 3E8GA 4I55B 3B2EE 4ZOLB 3M8AA 4FFKA 2YSUB 1ZL8B 2VQFB 2BTQA 4JI4B 5C93A 4JI8B 2ZINA 3SYQA 2Z5UA 1BHAA 2HG5C 4QE7A 2BSKA 1Q81W 3SR2C 4OX9O 1FJGO 3SDLA 4G27B 2GSMB 1SF9A 3Q4HA 5EBWC 2OCHA 1KU9A 2DN9A 4LWSA 5LGNA 2UUAO 2N04A 2CK3G 3CC4V 1V55C 5EBMC 3F5WC 3SJQC 3K59A 3JAKB 2WLMA 3AEIA 3CCMV 3JASA 2EIMC 3ASNB 4D7SA 1U97A 2A7WA 2RQ6A 2L35A 2YC0A 4P30A 2KB1A 3MD0A 1P7GA 3EFFK 5AG2A 3LSSA 1ORQC 3B77A 3RWRD 4U3JA 4AHCA 4X20A 5KHJA 4P2ZA 1F4MA 1JPXA 4FZ1A 3G67A 1XUQA 4FM0A 2BTQB 3VOUA 1BL8A 5KUKA 5J2TA 3GB7C 1EBOA 1YIJV 2BSKB 5LXTB 3S3WA 2JVDA 1R3LC 4ZIBA 4DUZB 1JVMA 1U96A 3Q4HB 2JS3A 2QM4A 3ZMVA 4LWSB 4J7JA 3LDEA 3CRRA 3B09A 4KHPB 2YXLA 1JJOA 3B4SA 3QVNA 4UCUA 2A0LA 3JARA 5JWPA 1M57B 4LF9B 5KUMA 4YY3B 4FLYA 3BA8A 1W59A 1H2MA 1EN6A 2QM7A 1PNKA 2RCVA 2HJFC 1AR1B 4U3JB 3LSUA 3H01A 2HJDA 3KCYA 1GM7A 4X20B 5KX5B 1VF6C 4JASA 1KC8W 3SYOA 3L71H 4LP8A 1QNMA 1THZA 1JMKC 2JEXA 3BY6A 4OX9B 1WA8A 5J2TB 3CCQV 1FJGB 1XQ8A 4UCVA 1FAFA 2XUMA 3KCXA 4CH3A 2JRIA 3ICXA 3CRAA 4PDRA 3ZMUA 2PUSA 1XOUA 4I4TB 2UUAB 3B8MA 4UFZA 4Q20A 1CPYA 1H2GA 3AG2B 4YHHO 3W7WA 2LP7A 4J9ZB 1G8MA 5K1PA 1YJNV 4OPAA 3CPWU 1E79G 3T4DA 3JARB 3CRCA 4DK1A 4PHZA 5F2VO 2GHYA 5FPOA 1DF5A 4B7EA 4QNHB 3BVOA 1L8DA 1EN4A 5CBFA 1IXBA 1Q3EA 5JJNB 3H1HH 4WFEA 1R6TA 4O2AA 4Q6GA 3ML0A 2MK3A 3HKDB 1MSWD 1YJWV 4CC6A 3FKSG 3CX5F 4PD4F 1N34O 1MOFA 1K9MW 2WLLA 1WA8B 2YI9A 1H8EG 3CRMA 1YTFD 1AR4A 3W7UA 4CZZA 2EJRA 1YCIA 1SZXA 4X65O 4F6RA 1OCCB 2AHYA 4RQFA 4NR1A 1YZBA 2XOKG 1B6QA 1I0HA 4MVMA 4EEQA 4DR1O 1RPOA 4LBEC 5H2FZ 2W6JG 2Y69C 1R1BA 1VP7A 1OZ0A 3J80N 4UV9A 4J80A 2BCCH 4FPPA 4O2AB 1VQ4V 1JJ2U 2PYJA 2V7QG 4JAAA 3JYCA 2EINC 4GZRB 5IT9N 3BCCH 3ZBHA 4W4LA 1S5JA 1M9NA 3CP1A 2WLLB 1BQ0A 5EBLC 1VQKV 4UCRA 2ZDIA 2QTSA 2P6JA 1PL4A 5IYCO 2XHBA 2N05A 2IH1C 4BW9A 4YHHB 1G4YB 4DR7O 4IIJA 4FIPC 5DM6V 2YDEA 4X9QA 1XILA 4MVRA 2DW4A 4F6RB 2E5LO 4LF8O 1DLBA 3JATA 4X1IA 2E76B 4EFEA 2KKWA 3CYOA 4X1YA 4PI2A 4BW5A 2VS0A 2EIKB 2WA4A 1P84F 4R8CA
chains in the Genus database with same CATH topology
2B1IA 1VQPV 1F23A 2X7RB 2EZOA 3ZN0A 1YJ9V 3K3WA 1K5SA 1M56C 3T1CA 3WG7B 1H38A 3QNEA 1IXMA 4PELA 3ZRWB 1FFTB 3W7TA 4JYBA 4UUJC 1YI2V 2EBOA 1NVPB 2M7WA 3ZRSA 1AI7A 2EILB 3CCEV 4HZ3A 1Y4MA 3AG4C 3OUSA 4MT8A 1QLNA 1BMFG 1NH2B 5L3CA 1WPXA 1W0JG 4JAVA 1KECA 4JTCB 3X2QB 3CCUV 3RBZA 3K0DA 1GMGA 1M57C 3SYPA 2IJKA 2Q6AA 2C2AA 4WF9V 3WFVA 1GTOA 1OCOC 2UXXA 3A0RA 3RW0A 4QPKA 4KFMA 1F4NA 1JOYA 4BAYA 4N23A 1SERA 4I5SA 5B1AC 2HLDG 1R3KC 2HVJC 4GX5A 1F51A 1NR7A 1VQ6V 1PKXA 3OFNG 3E2EA 4MVOA 1HWYA 2YEVB 3UKMA 3CCJV 4PA9A 4WCEV 1YITV 2PI5A 4JGSA 2D3OW 1KQSU 1FXKA 3OM3B 3ZCCA 3OGCC 3JD1A 3LSQA 4RAIA 1JX9A 1GM8A 5L3BA 1PNMA 4LCUC 1NQTA 1OCZC 3ETEA 4HAMA 2JDIG 3B8NA 4MS2A 1COWG 2HFEC 2P90A 3FYIB 4PA6A 4PDMA 4Z1MG 5LHHA 1QBZA 3K9AA 4PA4A 1KD1W 5LHGA 2Y48A 2DQ0A 4WFFA 1E1RG 3OEEG 3OMAB 3ZRVA 4XDLA 4RUFA 3DGEA 1K8AW 2WLJA 3OR6C 2XAQA 3FB8C 1BHBA 4TSFG 5B1BB 3AG2C 1NJIW 4ZBMA 4GT1A 1JQ0A 2P7TC 3SPCA 3CCRV 4ZKIA 3OE7G 5KA5A 3OR7C 4MTOA 3HB3B 1W0KG 3STLC 2X6BA 1P7BA 2ZR3A 5L3GA 3K08A 1K34A 2WSSG 1K3EA 4U7NA 3GWOA 1AJNA 3WG7C 2BOBC 1QCEA 4E2LA 2DWDC 2JJ1G 1K4CC 1XL6A 3SPHA 3T4ZA 1S77D 4PA7A 2ZQMA 3RVZA 2K1EA 3LDCA 3CXCU 1VQ5V 2OTLV 2W0FC 3G6EV 1NH2D 1K92A 2IJIA 4UVAA 1OCRC 4R6ZA 2ZD9A 2B1GA 1FXVA 3D3IA 5LGUA 3OMNB 1H8HG 2F43G 3QO5A 3X2QC 1QR9A 3K79A 4BIUA 2EZPA 1YHQV 1NKDA 4JTDB 5CBGA 3E8GA 5CMUA 4MVQA 2DQ3A 1KP2A 4JYCA 4P9PA 1AJPA 5CN0A 2YSUB 4JPRA 2W6IG 1EZJA 2V1DA 1M90W 4R7CA 4JAUA 5H6RA 3W7SA 1VQ9V 2DYSB 4N21A 2HKOA 5C93A 3NXSA 5HFLA 5E1AC 1R3IC 2Y69B 3JD4A 5B1NA 3ZN1A 3CMAV 3SYQA 1QVFU 2Z5UA 1BHAA 4XDKA 3OUFA 2Z3YA 1WLEA 3CC2V 2HG5C 4QE7A 3HPLC 3OW2U 1Q81W 1OCCC 2LFRA 2PI4A 3ZMSA 2ITCC 1QLEB 4G27B 2GSMB 2XAGA 5EBWC 5EC1C 1MG1A 3F7YC 3T2MA 2EINB 3ETGA 5LGNA 3CD6V 1J95A 2CK3G 4FMTA 4UV8A 3CC4V 1V55C 5EBMC 3SYCA 5B3SB 3F5WC 3SJQC 3ZMTA 1P4RA 2ZXWB 2WLMA 3AEIA 2XNDG 3CCMV 4R50A 3CCLV 4ASUG 4MVZA 1I5XA 2EIMC 2IU3A 3ASNB 4GX0A 3SYAA 1VQ7V 3MHSC 1PD3A 2QEXV 4DO2A 5IY5C 1EFRG 4P30A 1FXHA 4MW8A 2KB1A 3JD3A 3MD0A 2WLIB 3EFFK 3LSSA 1AROP 1VQOV 3E89A 2DYRC 1ORQC 4QE9A 3B77A 1R6KA 4H37A 2X0LA 3AG3B 1ROPA 1V54B 3G71V 4P2ZA 1F4MA 4HYOA 2IJHA 1NBMG 1JPXA 4UVBA 4EKWA 4RQEA 2IW5A 2R9RB 3RVYA 4H33A 2JEUA 1FS0G 1KP3A 3VOUA 1BL8A 2XAFA 5KUKA 3GB7C 1EBOA 3MHHC 1RM1C 2A9HA 1YIJV 1M1KW 3KG2A 2AHZA 1R3LC 4XDJA 5H6QA 3ZRXA 1M56B 1AJQA 1JVMA 4FJCC 4X8AA 3P32A 3OEHG 3CCVV 2XAHA 3ETDA 3ABKB 1Y66A 3LNMB 3ZMVA 4BIZA 4MTGA 2EIKC 4MSWC 3CMEV 3QO8A 3CCSV 1QVGU 3LDEA 2WAMA 4WFHA 3IFXA 1ZWIC 2H94A 3ZIAG 4QJFB 5IYBO 3E8FA 5EK0A 3OMIB 4MVSA 4X88A 2P67A 1R3JC 4UVCA 2A0LA 4KUMA 3I56V 1JCHA 2HR3A 3ABLB 1M57B 4GX1A 3D36A 2XAJA 3TCUA 1R6NA 5KUMA 1NVPD 2EIJB 1QLEC 2A79B 4I9WA 1OCOB 5EC2C 2EILC 2BOCC 4F4LA 1YSCA 2QM7A 2WPDG 2WWWA 1PNKA 1YTFB 2HJFC 1AR1B 2QE7G 3H01A 1K4DC 1K97A 2QM8A 1FXKB 1GM7A 3E8HA 4UXNA 5B3SC 2ZXWC 4JASA 1GK9A 3FB7C 5HFMA 2ZDIC 3W7XA 1R73A 5L3EA 2JIZG 3SYOA 1TUEB 1KC8W 1SRYA 2WLNA 4LP8A 5L3DA 3FB5C 1THZA 4RUEA 3R65A 2WLHA 4G2KA 3ABMB 2JEXA 1K7DA 3BY6A 1SETA 4GX2A 4MTFA 1ENVA 2X6AA 3CCQV 3AG1B 1QR8A 3VBBA 1KKDA 4PDRA 3ZMUA 2OT5A 3DTUB 4MVUA 1PNLA 5LBQA 3I55V 2QA4V 3M99B 3B8MA 1GM9A 1V54C 2YEVA 4Q20A 2IH3C 2DWEC 1CPYA 1H2GA 3AG2B 5L3FA 3W7WA 1PL0A 2LP7A 4J9ZB 5LGTA 1G8MA 2ATKC 1YJNV 3PJSK 2JJ2G 3BEHA 1S0VA 3CPWU 3E86A 1K5QA 1E79G 3T4DA 4XBFA 3UM7A 2OTJV 3TETA 2QTOA 2GHYA 2WLKA 2OCCB 4TT3G 1DF5A 4JF3A 4QNHB 4MTXA 5B1BC 2IJJA 5CBFA 3ABKC 3ABTA 5J9PC 4MW3A 2UXNA 4WFEA 3ML0A 2MK3A 1DTOA 1OCRB 1MSWD 1YJWV 1UJWB 3E35A 1L1FA 4PDLA 3SPIA 2Q68A 3ASOB 3FKSG 1K73W 2IU0A 1Q86W 3ABLC 1MOFA 1K9MW 2WLLA 2EIJC 5B1OA 1MABG 3E83A 1H8EG 1YTFD 1N8RW 3JD2A 4X89A 3OAAG 4LC1A 3ABUA 3FB6C 3G4SV 3W7UA 2X6CA 3STZC 4WFAV 1SZTA 4TWKA 3LDDA 1AI6A 1FXKC 4L87A 4CZZA 3SPGA 4GCZA 5DN6G 3K04A 2HVKC 2EJRA 3IC7A 4RO2A 5GW7A 3LUTB 2XASA 4KP4A 1VQ8V 1Q82W 1GO3F 5CA3A 4FK5C 1OCCB 2AHYA 1S3JA 3ABMC 4RQFA 1VQNV 1S76D 3AG1C 4P9OA 1GKFA 2FTKA 1AI5A 2XOKG 5KA6A 1Q7YW 1B6QA 4MVMA 3AG4B 3E8BA 3K06A 2DYSC 3QO7A 1RPOA 1V55B 1SESA 4LBEC 1CP9A 1VQLV 2W6JG 4U7OA 2Y69C 5FL7G 3F7VC 3EHBB 1DF4A 1OHHG 3TK1A 4DXWA 4CBCA 1OZ0A 4UV9A 2EIMB 5LHIA 3CC7V 3FYEB 1NR1A 4FPPA 1K33A 2Q69A 2QKSA 1VQ4V 1JJ2U 5IYDO 2NLJC 5IY5B 2JK5C 2V7QG 3ZRWA 3JYCA 2EINC 2Q67A 5B1AB 1S72V 1S5HC 3K0GA 3IGAC 2DYRB 2OCCC 4YXWG 1VQMV 1M9NA 3CP1A 2WLLB 1XL4A 5EBLC 3ZMZA 3ASNC 1VQKV 2ZDIA 2P6JA 5H9CA 3JD0A 5IYCO 1I5YA 3K03A 2IH1C 4J9YB 1OCZB 2ZR2A 1G4YB 2LFSA 3SPJA 4FIPC 4JTAB 4QPJA 5DM6V 1E1QG 4QIWF 1CEZA 2WLIA 1RPRA 4MVRA 3ASOC 1RM1B 3AG3C 2DW4A 2B5UA 2NNUA 4PDVA 1DLBA 4WFGA 3ZJZA 1LNQA 3CYOA 2ITDC 2H8PC 4WFBV 4BW5A 1AI4A 2R9IA 5BZBA 5CBHA 5IDJA 2EIKB 1W2BU 4PA3A 3P30A 3JCZA 4G28B 4R8CA 4OXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DF5 A;  4JF3 A;  4N21 A;  5HFL A;  1JPX A;  3M99 B;  1I5X A;  3WFV A;  3B8M A;  3H01 A;  1F23 A;  2X7R B;  1QR9 A;  2EZO A;  3B8N A;  3MHS C;  2OT5 A;  5KA6 A;  2EZP A;  1QBZ A;  3K9A A;  1DLB A;  5HFM A;  4N23 A;  5CMU A;  1K34 A;  3CP1 A;  2EBO A;  1SZT A;  2M7W A;  3CYO A;  2LP7 A;  2MK3 A;  5CN0 A;  1EBO A;  3GWO A;  1DF4 A;  3MHH C;  1Y4M A;  1MG1 A;  1QCE A;  2P6J A;  4G2K A;  4JPR A;  5H9C A;  4E2L A;  1I5Y A;  3B77 A;  4JGS A;  1ENV A;  3P30 A;  1QR8 A;  1K33 A;  4FK5 C;  1JQ0 A;  4FIP C;  4FJC C;  5KA5 A;  1Y66 A;  1MOF A; 
#chains in the Genus database with same CATH topology
 3OD4 A;  2F23 A;  5D5Q A;  1FFX A;  1F23 A;  2X7R B;  3F5T A;  3ZN0 A;  1M56 C;  5E79 Z;  3QNE A;  1FFT B;  4JYB A;  4UUJ C;  2EBO A;  2EIL B;  4HZ3 A;  1Y4M A;  4MT8 A;  4CH4 A;  1BMF G;  2JS5 A;  2PZS A;  1WPX A;  1IZ3 A;  1W0J G;  4JTC B;  3CCU V;  4FZ0 A;  1ZLZ A;  2BTO A;  4IIJ B;  1OCO C;  1JFF B;  2JGU A;  3CB2 A;  3A0R A;  4X65 B;  3G6B A;  5KAI Z;  1HNW O;  5CB4 A;  4GX5 A;  1VQ6 V;  2GTS A;  4MVO A;  2YEV B;  4Z2W A;  4WCE V;  3JAT B;  4K3A A;  5IWA O;  2D3O W;  4DR1 B;  1KQS U;  2Q9L A;  1FXK A;  2QWR B;  3OM3 B;  4X1Y B;  1KBH A;  3LSQ A;  1Q8I A;  1JX9 A;  4GYC B;  3MDS A;  4LCU C;  3CWB H;  4CS2 A;  5EIB D;  2JDI G;  4MS2 A;  4Z1M G;  2HFE C;  2P90 A;  5LHH A;  1FYJ A;  2YUA A;  5LHG A;  4WFF A;  1E1R G;  3OEE G;  3OMA B;  4RUF A;  2LO1 A;  3ZED A;  5A9G A;  5KLV H;  4ZBM A;  2RJZ A;  4ZKI A;  5KA5 A;  2LJ2 A;  5ITZ A;  3VQY A;  3WB2 A;  5L3G A;  4DR7 B;  1L0N H;  3FFQ A;  2Q73 A;  5BY1 A;  1BT8 A;  1AJN A;  2BOB C;  2EX3 A;  2E5L B;  4LF8 B;  5CB4 B;  2DWD C;  2QWP B;  1XL6 A;  1Q90 D;  2OTL V;  3LDC A;  3G6E V;  1NH2 D;  2QWN B;  4BIU A;  5LL6 Y;  3N2G A;  1EM1 A;  2CTP A;  5CBG A;  5CMU A;  4O4H A;  2DQ3 A;  5CA0 B;  4W4K A;  4JYC A;  1EZJ A;  2QGN A;  1IUR A;  3D8C A;  2CH7 A;  4R7C A;  3OGI B;  4JAU A;  4N21 A;  1X4T A;  2HKO A;  3NXS A;  5HFL A;  2Y4U A;  1AIL A;  1NS1 A;  3ZN1 A;  3A0B Z;  4XDK A;  1FKA O;  1WLE A;  3CC2 V;  3K5M A;  3OW2 U;  2LFR A;  1QLE B;  4UB6 Z;  5ITZ B;  1URF A;  2OWO A;  3QF7 A;  2VQF O;  3H1K H;  2GDS A;  4FLT A;  3T2M A;  1HNW B;  2ILM A;  3H9V A;  4DR5 O;  2LGW A;  5B3S B;  1N36 O;  2ZXW B;  1H2K A;  4H13 B;  2XND G;  3A0H Z;  5IWA B;  4ASU G;  2IU3 A;  1VQ7 V;  4GX0 A;  2AW9 A;  1PD3 A;  4IYH A;  2QEX V;  5IY5 C;  4X66 O;  3JD3 A;  2ZE8 A;  1VQO V;  3WB1 A;  2HEP A;  3N2G B;  1WPB A;  4YJ2 A;  4RWU A;  4D6T H;  1V54 B;  5JH7 A;  4RQE A;  1IBM O;  2R9R B;  4H33 A;  3A8T A;  4TQD A;  2JEU A;  3RFR A;  4DRX B;  2Y4T A;  1RM1 C;  2ZE6 A;  4LF7 O;  2A9H A;  1M1K W;  3KG2 A;  2B9Z A;  3FX7 A;  5H6Q A;  1SQP H;  3ZRX A;  4X64 O;  1Y66 A;  3ABK B;  1TGO A;  1I7F A;  4GUN A;  4FVM A;  3CME V;  1QVG U;  5J2U B;  2H94 A;  3L74 H;  5EK0 A;  2V4D A;  5JCO C;  1SKV A;  2JGD B;  4MVS A;  4UVC A;  3ZHS A;  3I56 V;  3ABL B;  3OT7 A;  1NVP D;  1QLE C;  1XI1 A;  2WWW A;  2P4K A;  2ODM A;  1KYO F;  4YJ2 B;  2Q7G A;  5B3S C;  3E8H A;  2ZXW C;  3T1Y O;  3FB7 C;  1N4C A;  1XDC A;  1TUE B;  2F95 B;  1SRY A;  2WLN A;  5L3D A;  1YEW A;  3FB5 C;  4RUE A;  4G2K A;  4MTF A;  1SET A;  2GV9 A;  3G80 A;  5IYZ A;  2E74 B;  3VBB A;  3TJT A;  4AI8 A;  1KKD A;  5LBQ A;  2OT5 A;  4MVU A;  3I55 V;  4DR5 B;  4CH5 A;  1P49 A;  1V54 C;  3B40 A;  1T5E A;  2CDY A;  2DWE C;  1N36 B;  4DR2 O;  5L3F A;  1VIB A;  3DC5 A;  3E22 A;  4B08 A;  2UUB O;  2HP8 A;  1LR1 A;  3UM7 A;  4X66 B;  5C8Y A;  3U11 A;  2OCC B;  1GN4 A;  1MMM A;  1AB3 A;  4CS4 A;  2BE3 A;  3ABK C;  2LGQ A;  2UXN A;  5EZY A;  1DTO A;  1IBM B;  3SPI A;  3ASO B;  2LW7 A;  1K73 W;  2IU0 A;  3ABL C;  4KL1 A;  4LF7 B;  5IYZ B;  4BR6 A;  2GTA A;  4LC1 A;  4X64 B;  3FB6 C;  3G4S V;  4WFA V;  1PP9 H;  2PGG A;  3FAV A;  3UO2 A;  4JI1 O;  4GCZ A;  5DN6 G;  2HVK C;  3H1J H;  3IC7 A;  4RO2 A;  5GW7 A;  1MNG A;  1VQ8 V;  5LMN O;  5CA3 A;  5LP6 A;  4FLU A;  2ZT9 B;  2UUC O;  1S3J A;  2UXD O;  4LNU A;  2FTK A;  5C8Y B;  1AI5 A;  5KA6 A;  5LA6 A;  1G1X B;  4I9Q A;  3UO3 A;  5DED A;  1AVM A;  5KHK A;  1CP9 A;  3JAS B;  1VQL V;  5IJ0 A;  3EHB B;  3J81 N;  4CH6 A;  4CBC A;  1WB7 A;  1KUQ A;  1NTZ H;  2M6Y A;  3T1Y B;  3K5N A;  2Q5Z A;  1NR1 A;  5EZY B;  2RDC A;  2QKS A;  1HNX O;  3RYH A;  5H5N A;  2MW2 B;  2Q67 A;  1BE3 H;  3K0G A;  3IGA C;  2DYR B;  2OCC C;  4YXW G;  4FM1 A;  1XL4 A;  1V9P A;  1YF2 A;  1I94 O;  3ASN C;  1IBK O;  1IDS A;  3JD0 A;  3H1L H;  4J9Y B;  4DR2 B;  1OCZ B;  2LFS A;  3FAV B;  4JZ2 A;  3SPJ A;  2DOS A;  5IJ9 A;  1E1Q G;  1CEZ A;  2WLI A;  4F6E A;  4L8J A;  2UUB B;  5LOV A;  3ASO C;  4O4I A;  5LP6 B;  2HHH B;  3K57 A;  4IYI A;  4B3R O;  4WFG A;  3J7A U;  4K35 A;  3HKB A;  4TV8 A;  5BZB A;  5LA6 B;  3O65 A;  4NB5 A;  1KMI Z;  4U3F H;  4J7Z A;  4NKG B;  3BA9 A;  4PA3 A;  4G28 B;  5IJ0 B;  4OXS A;  2UXC O;  4JI7 O;  5JQG A;  2YIC A;  3JCU Z;  1K5S A;  3WG7 B;  4I7Z B;  3RYH B;  1IXM A;  4PEL A;  1GN3 A;  1NVP B;  1M4U A;  1NU1 H;  1XMQ O;  1Z5V A;  3QTC A;  1X59 A;  1AP6 A;  4TV9 A;  5L3C A;  1WN7 A;  2VRZ A;  3X2Q B;  4BIO A;  3K0D A;  4K0K O;  1GMG A;  1M57 C;  3SYP A;  4JI1 B;  2Q6A A;  2C2A A;  1GAX A;  5LMN B;  5IJ9 B;  1XNR O;  2UUC B;  4I5S A;  2UXD B;  5LOV B;  3S3X A;  4O4I B;  3E2E A;  1CXZ B;  4I50 A;  1YIT V;  2DMX A;  3ZCC A;  3CRQ A;  2VWK A;  3HKB B;  1GM8 A;  4TV8 B;  3K5L A;  2OIG A;  1PNM A;  1QU7 A;  1OCZ C;  3ETE A;  1ZSP A;  2UXB O;  4ZI7 A;  3N27 A;  3K9A A;  1KD1 W;  1HNX B;  5JQG B;  3ETQ A;  4XDL A;  4K8X A;  1TUB A;  2G38 A;  2Q7E A;  1RSO A;  1K8A W;  1WB8 A;  2XAQ A;  5B1B B;  3AG2 C;  1NJI W;  3SPC A;  5BMV A;  2Q0O C;  4ABM A;  1I94 B;  3OE7 G;  3ZS8 C;  1IBK B;  3OR7 C;  4LH7 A;  4J7K A;  4LR3 A;  1US6 A;  1W0K G;  4DV2 O;  2X6B A;  1P7B A;  4DR6 O;  3BHP A;  3KZI Z;  2WSS G;  1K3E A;  4WBN A;  4I0X A;  3WG7 C;  4B3R B;  2W0X A;  2JJ1 G;  2ADP A;  1S77 D;  2ZQM A;  3RVZ A;  2K1E A;  3NR7 A;  2ZIM A;  1K92 A;  4I50 B;  3OMN B;  1SQX H;  1H8H G;  2NN4 A;  3X2Q C;  1IBL O;  1N33 O;  1YHQ V;  1S5L Z;  2UXC B;  4JI7 B;  1TA8 A;  1B3Q A;  1AJP A;  1MZF A;  5CN0 A;  4JPR A;  4ZI7 B;  2W6I G;  1M90 W;  5GTI Z;  1NTM H;  1H2S B;  1TUB B;  5H6R A;  1XMQ B;  1RSO B;  3W7S A;  1VQ9 V;  2DYS B;  1HP8 A;  3M7M X;  1SQB H;  1NT2 B;  1GRJ A;  1R3I C;  3JD4 A;  5B1N A;  4DV3 O;  3HKC A;  3OUF A;  2ARH A;  2Z3Y A;  4DR4 O;  3HPL C;  2PI4 A;  1OCC C;  2H3O A;  4K0K B;  3ZMS A;  4O4L A;  2LQT A;  2ZE5 A;  1H2L A;  5EC1 C;  4NTY A;  1MG1 A;  1SS3 A;  3TXQ A;  2YI8 A;  3ETG A;  3CD6 V;  1XNR B;  1OJH A;  4UV8 A;  1Z5W A;  3SYC A;  3PN1 A;  4WBN B;  2QKA A;  4I0X B;  4Z1V A;  2XT9 A;  4KXR A;  3CCL V;  4MVZ A;  1I5X A;  2R72 A;  1M93 A;  3MHS C;  4DV4 O;  2IBZ H;  1EFR G;  2O57 A;  3APQ A;  1ARO P;  1FD9 A;  2UXB B;  1XNQ O;  2UU9 O;  4QE9 A;  4B3M O;  4H37 A;  2X0L A;  4X1I B;  4NXM O;  3AG3 B;  1ROP A;  4FFB A;  1VMG A;  4HYO A;  2IJH A;  1NBM G;  3AG7 A;  1JR9 A;  3T1H O;  2IW5 A;  3AK2 A;  4NTX A;  4JZG A;  2XAF A;  5BR8 O;  3HKC B;  1FFX B;  4DV2 B;  4DR6 B;  4XDJ A;  1AJQ A;  3P32 A;  3OEH G;  3CCV V;  2XAH A;  3ETD A;  2P06 A;  4BIZ A;  3WB0 A;  2EIK C;  2R70 A;  2KSD A;  3QO8 A;  2LW1 A;  1ZWI C;  3ZIA G;  4QJF B;  5IYB O;  3N2K A;  3E8F A;  2NR5 A;  2AZ2 A;  4X88 A;  4DR3 O;  5KMG A;  4KUM A;  4IGG A;  1JCH A;  2HR3 A;  2OYQ A;  3AK1 A;  3D36 A;  2XAJ A;  1IBL B;  1N33 B;  4LFC O;  3RN4 A;  4I9W A;  3GWK C;  5EC2 C;  2EIL C;  2BOC C;  1YSC A;  2GUZ A;  4DV6 O;  1SQG A;  1YTF B;  1K4D C;  1K97 A;  2EUL A;  1FXK B;  4FFB B;  3TXS A;  5HFM A;  2ZDI C;  3W7X A;  1R73 A;  5L3E A;  3O9O A;  3ZHQ A;  1NI8 A;  4DV3 B;  2WLH A;  3ABM B;  4DR4 B;  4DV5 O;  3L70 H;  1PNL A;  1RP3 B;  4FLZ A;  1AR5 A;  1Q43 A;  4GLX A;  1TVK A;  1PL0 A;  5LGT A;  4PI0 A;  1ZUQ A;  2ATK C;  2QWQ B;  3N2K B;  4DV4 B;  2JJ2 G;  3RYF A;  3E86 A;  3KKY A;  4XBF A;  5KMG B;  2KG7 A;  1XBL A;  3U10 A;  2ZIO A;  4PJ0 Z;  3TET A;  2QTO A;  2WLK A;  4TT3 G;  1XNQ B;  2UU9 B;  4MTX A;  4B3M B;  4PV1 B;  4NXM B;  2IJJ A;  4DYL A;  4B3T O;  2EJ7 A;  4NVP A;  1OCR B;  3C3T A;  3T1H B;  4EFB A;  1Y76 A;  4GKJ O;  4LFA O;  3E35 A;  4PDL A;  2FL4 A;  4O4H B;  4ICG A;  5BR8 B;  1Q86 W;  4A5U B;  4JI6 O;  2CTW A;  5B1O A;  5GON A;  2YXH A;  1MAB G;  3E83 A;  1PV0 A;  2CH7 B;  2ZM6 O;  1IX9 A;  3AK3 A;  3JD2 A;  4JI5 O;  4X89 A;  3OAA G;  3ABU A;  3UQ8 A;  1SZT A;  2RNB A;  1FXK C;  4L87 A;  1HW7 A;  3SPG A;  5LYJ A;  3CSX A;  2XAS A;  1Q82 W;  4DR3 B;  4FK5 C;  2VWJ A;  1D2D A;  3HKE A;  3SJA C;  3ABM C;  4I55 A;  1O9G A;  3RYF B;  1VQN V;  4LFC B;  1S76 D;  2KG7 B;  3I5D A;  5TIS Z;  4OPH A;  3R66 A;  4DV6 B;  1ZL8 A;  3QO7 A;  1V55 B;  1SES A;  1Q5O A;  1OHH G;  4DXW A;  2EIM B;  5LHI A;  5IYD O;  5D5P A;  1Y76 B;  3ZRW A;  5B1A B;  1G6U A;  5FLX N;  1Q6U A;  4DV5 B;  2CGN A;  4DW1 A;  1VQM V;  2ZNJ A;  3RYI A;  2FYU H;  1QQC A;  1HNZ O;  5GON B;  1VF6 A;  4AQY B;  5JH7 B;  1UPG A;  4IL6 Z;  4UCO A;  1I5Y A;  3K03 A;  4JTA B;  3ZHV A;  2Q0A A;  3UT5 A;  1SQQ H;  5BXZ A;  2ZCE A;  3HKE B;  2CTR A;  4LF5 O;  1DK1 A;  4OGQ B;  1Y74 A;  1AP5 A;  1B06 A;  2H8P C;  1RFY A;  4WFB V;  3RT3 C;  1AI4 A;  2R9I A;  5CBH A;  4B3T B;  3P30 A;  3JCZ A;  2HHH O;  4YIP A;  4NYK A;  4DUY O;  4UB8 Z;  1NTK H;  4GKJ B;  2B1I A;  4LFA B;  2WA3 A;  2YS8 A;  4DW0 A;  1VQP V;  5LXT A;  1H38 A;  3ZRW B;  4JI6 B;  2M7W A;  4FM2 A;  1AI7 A;  3L9D A;  1GH6 A;  3L73 H;  4O2B A;  2F4V O;  1XEQ A;  2ZM6 B;  4JI5 B;  1NH2 B;  2CE4 A;  4JAV A;  3RYI B;  1KEC A;  1PM9 A;  3WFV A;  2UXX A;  3RW0 A;  3THO A;  1JOY A;  4N23 A;  4AIL C;  5B1A C;  1R3K C;  2HVJ C;  3UT5 B;  1QHT A;  1F51 A;  4TUY A;  1PKX A;  3OFN G;  1HWY A;  4PA9 A;  5DEC A;  5JJE B;  2PI5 A;  4JGS A;  2QR4 A;  4UCT A;  1Y74 B;  5KX5 A;  4DV7 O;  3JD1 A;  3E22 B;  3ZX6 A;  1XHZ A;  4TOI A;  4HBN A;  5LMU O;  1LUW A;  1NQT A;  4PDM A;  4PA6 A;  2P4V A;  5EIB C;  4PA4 A;  2Y48 A;  1M5I A;  5GTH Z;  3ZRV A;  5JVD A;  3JAL A;  1BS3 A;  3BFR A;  2WLJ A;  3FB8 C;  4I4T A;  4TSF G;  4IT5 A;  4GT1 A;  2P7T C;  4X62 O;  3LNN A;  4YJ3 A;  1HNZ B;  2QWO B;  4K8Z A;  4O2B B;  5KHI A;  2K9P A;  4O4J A;  3HB3 B;  1WP8 A;  2PY5 A;  3IJ4 A;  3STL C;  2ZR3 A;  3IAY A;  2F1M A;  2FKX A;  2E75 B;  1DGS A;  1K34 A;  4U7N A;  3GWO A;  3DXR A;  4LF5 B;  4J10 A;  4PA7 A;  1VQ5 V;  3CXC U;  1N32 O;  4TUY B;  2W0F C;  2IJI A;  4BWA A;  1FXV A;  4J11 A;  5LGU A;  3EVK A;  4IHJ A;  3HKD A;  3C3S A;  3K79 A;  2EZP A;  1NKD A;  4JTD B;  2FB5 A;  4DUY B;  3HR0 A;  4MVQ A;  1KP2 A;  4P9P A;  1BCC H;  4LNU B;  5B5E Z;  2ZKO A;  3EXA A;  2V1D A;  4LF6 O;  1XRE A;  5JVD B;  3JAL B;  3TGU H;  2ZNI A;  4JI0 O;  2F4V B;  1LUV A;  5JJJ B;  5E1A C;  2Y69 B;  2PF4 E;  3CMA V;  1QVF U;  4YJ3 B;  4H0L B;  2R9A A;  2ITC C;  3JAM N;  4O4J B;  2XAG A;  1SC5 B;  2Y0P A;  3F7Y C;  2EIN B;  1J95 A;  4FMT A;  5B66 Z;  3IC9 A;  4LH6 A;  1HR0 O;  4ZHQ A;  2IM9 A;  3ZMT A;  1P4R A;  4X1K A;  3DXR B;  4R50 A;  3SYA A;  3JSL A;  1YVW A;  2L6L A;  2YIB D;  4DV7 B;  4DO2 A;  1FXH A;  4MW8 A;  4IHJ B;  2Q7H A;  2WLI B;  5LMU B;  1ZAU A;  3CXH F;  3E89 A;  2DYR C;  4J41 A;  1VF7 A;  1R6K A;  4TQF A;  2VQE O;  3G71 V;  3GVM A;  1SQF A;  3CEI A;  2PYL A;  4UVB A;  4EKW A;  3RVY A;  1XMO O;  4X62 B;  5CA1 A;  1FS0 G;  1KP3 A;  4JYY A;  1GN2 A;  3MHH C;  5LP6 C;  1IVS A;  2AHZ A;  2YID A;  1BQZ A;  3K9S A;  1M56 B;  3CHX A;  2PTM A;  4FJC C;  4X8A A;  3ZHT A;  3LNM B;  4MTG A;  4MSW C;  2QSA A;  4TV9 B;  3CCS V;  2Q4P A;  2WAM A;  1EN5 A;  3IFX A;  4WFH A;  5A2Q N;  4ZHQ B;  1N32 B;  4X1K B;  3OMI B;  3P3N A;  2P67 A;  1R3J C;  3BPZ A;  4GX1 A;  4J42 A;  3TCU A;  3RYC A;  1R6N A;  4JI2 O;  4JI3 O;  2EIJ B;  2A79 B;  1OCO B;  3DC6 A;  4DV1 O;  4F4L A;  4D7T A;  5FPR A;  2WPD G;  3CJH A;  3BAA A;  4QGP A;  2QE7 G;  1J5E O;  4LF6 B;  2QM8 A;  4UXN A;  1GK9 A;  4H44 B;  2GBO A;  4JI0 B;  2JIZ G;  1PPJ H;  3SGI A;  3R65 A;  1Z2G A;  3JAW A;  5CA1 B;  1K7D A;  4GX2 A;  1ENV A;  2X6A A;  3AG1 B;  4UCS A;  1JFF A;  1QR8 A;  3P3P A;  5EYP A;  3FD9 A;  2QA4 V;  3DTU B;  1D5N A;  3M99 B;  2AGA A;  2P22 C;  1BSM A;  1NZ6 A;  2QJ1 A;  1GM9 A;  2YEV A;  1HR0 B;  2IH3 C;  5BMV B;  4DK0 A;  3WU2 Z;  4HNA A;  2QDO A;  1GN6 A;  3PJS K;  1MSD A;  2N74 A;  3JSN A;  3BEH A;  1S0V A;  1K5Q A;  2YIA A;  1B04 A;  1OV9 A;  4DV0 O;  2OTJ V;  3DSQ A;  5KAF Z;  4JF3 A;  3RYC B;  5B1B C;  3CE2 A;  2VQE B;  5K1X A;  1N34 B;  3ABT A;  3CJH B;  5J9P C;  4MW3 A;  2YIB A;  1XMO B;  1UJW B;  3BAB A;  1L1F A;  3OTO O;  1MZE A;  2Q68 A;  2RMK B;  2DE0 X;  3JAW B;  2ZE7 A;  3VQW A;  2EIJ C;  4E4E A;  4GKK O;  1VF5 B;  2CUG A;  4FLV A;  5EYP B;  1N8R W;  4LF4 O;  2DJV A;  1VAR A;  2X6C A;  3STZ C;  2KQX A;  4TWK A;  2Z0A A;  4EB6 A;  3LDD A;  1AI6 A;  4C7U A;  3K04 A;  2E3C A;  3LUT B;  4KP4 A;  4HNA B;  1GO3 F;  4O4L B;  4JYA O;  2FML A;  3C90 A;  5CA0 A;  2XTA A;  4JI2 B;  4FLW A;  4JI3 B;  1XHX A;  3AG1 C;  3BRC A;  4P9O A;  1GKF A;  3MAQ A;  4DV1 B;  1Q7Y W;  3UCS C;  3AG4 B;  3E8B A;  3K06 A;  2DYS C;  1UFI A;  4U7O A;  1J5E B;  5FL7 G;  3F7V C;  4NTW A;  5JCO A;  1DF4 A;  2ETN A;  5FNV A;  3TK1 A;  1N0N A;  2A3Q A;  3SJB C;  3CC7 V;  2OIE A;  3FYE B;  1K33 A;  2Q69 A;  4LFB O;  2NLJ C;  1L0L H;  2JK5 C;  5IY5 B;  1I08 A;  1TAE A;  3QG5 A;  4B7K A;  1D5A A;  1S72 V;  4NXN O;  1S5H C;  3L75 H;  3K5O A;  4B3S O;  1A32 A;  2QKC A;  4JV5 O;  4FLX A;  3ZMZ A;  1BGY H;  3ZHU A;  5H9C A;  5KHG A;  3ZHR A;  2ZR2 A;  3CS5 A;  1Q6H A;  2A06 H;  4EB6 B;  4QPJ A;  4CS3 A;  4QIW F;  1RPR A;  4AQY O;  1RM1 B;  1WP7 A;  3AG3 C;  2YXY A;  4DV0 B;  2B5U A;  2NNU A;  3D3Q A;  2ADQ B;  4PDV A;  3ZJZ A;  1LNQ A;  2ITD C;  5IDJ A;  3K58 A;  1JA8 A;  1W2B U;  2D2C B;  1KB9 F;  3SJC C;  4DRX A;  5FNV B;  3OTF A;  5KHH A;  1Q6I A;  2EZO A;  3OTO B;  1YJ9 V;  1ZTE A;  3K3W A;  3L72 H;  3T1C A;  2AXT Z;  2RN9 A;  2GUZ B;  3W7T A;  1YI2 V;  3U0Z A;  1N0J A;  3ZRS A;  4GKK B;  3CCE V;  4JI4 O;  3VQV A;  4JI8 O;  5IE9 A;  1VEW A;  3AG4 C;  3OUS A;  1QLN A;  4LF4 B;  2Y0I A;  5J2U A;  1WNS A;  3RBZ A;  1WJZ A;  2JGD A;  2IJK A;  1FPO A;  4WF9 V;  3A2F A;  4CC5 A;  1GTO A;  1EZV H;  1MA1 A;  4QPK A;  4JYA B;  4KFM A;  1SA0 A;  1F4N A;  1BZK A;  4BAY A;  1SER A;  1Y67 A;  2HLD G;  3APO A;  2CTQ A;  1NR7 A;  3UKM A;  3CCJ V;  2CAZ C;  1HDJ A;  1TVK B;  4YIO A;  2CGO A;  3OGC C;  4RAI A;  1WAZ A;  5L3B A;  4ZOL A;  1O9H A;  4HAM A;  3B8N A;  1COW G;  3FYI B;  1QBZ A;  4LFB B;  2DQ0 A;  1KKC A;  1F7Y A;  3DGE A;  4NXN B;  3OR6 C;  1BHB A;  4B3S B;  1YXB A;  1H2N A;  4JV5 B;  1JQ0 A;  3CCR V;  1ZX3 A;  3H1I H;  4MTO A;  2F93 B;  3K08 A;  4DUZ O;  1YDX A;  3D36 C;  2P5O A;  1Y6X A;  1QCE A;  3JAK A;  4E2L A;  1SA0 B;  1K4C C;  2Q8V A;  3RGB A;  3SPH A;  3T4Z A;  4KHP O;  2F66 C;  2AZ0 A;  1SQV H;  4UVA A;  3VQX A;  1OCR C;  4R6Z A;  2ZD9 A;  2B1G A;  5LYJ B;  3D3I A;  2F43 G;  3QO5 A;  1QR9 A;  4LF9 O;  4YY3 O;  3E8G A;  4I55 B;  3B2E E;  4ZOL B;  3M8A A;  4FFK A;  2YSU B;  1ZL8 B;  2VQF B;  2BTQ A;  4JI4 B;  5C93 A;  4JI8 B;  2ZIN A;  3SYQ A;  2Z5U A;  1BHA A;  2HG5 C;  4QE7 A;  2BSK A;  1Q81 W;  3SR2 C;  4OX9 O;  1FJG O;  3SDL A;  4G27 B;  2GSM B;  1SF9 A;  3Q4H A;  5EBW C;  2OCH A;  1KU9 A;  2DN9 A;  4LWS A;  5LGN A;  2UUA O;  2N04 A;  2CK3 G;  3CC4 V;  1V55 C;  5EBM C;  3F5W C;  3SJQ C;  3K59 A;  3JAK B;  2WLM A;  3AEI A;  3CCM V;  3JAS A;  2EIM C;  3ASN B;  4D7S A;  1U97 A;  2A7W A;  2RQ6 A;  2L35 A;  2YC0 A;  4P30 A;  2KB1 A;  3MD0 A;  1P7G A;  3EFF K;  5AG2 A;  3LSS A;  1ORQ C;  3B77 A;  3RWR D;  4U3J A;  4AHC A;  4X20 A;  5KHJ A;  4P2Z A;  1F4M A;  1JPX A;  4FZ1 A;  3G67 A;  1XUQ A;  4FM0 A;  2BTQ B;  3VOU A;  1BL8 A;  5KUK A;  5J2T A;  3GB7 C;  1EBO A;  1YIJ V;  2BSK B;  5LXT B;  3S3W A;  2JVD A;  1R3L C;  4ZIB A;  4DUZ B;  1JVM A;  1U96 A;  3Q4H B;  2JS3 A;  2QM4 A;  3ZMV A;  4LWS B;  4J7J A;  3LDE A;  3CRR A;  3B09 A;  4KHP B;  2YXL A;  1JJO A;  3B4S A;  3QVN A;  4UCU A;  2A0L A;  3JAR A;  5JWP A;  1M57 B;  4LF9 B;  5KUM A;  4YY3 B;  4FLY A;  3BA8 A;  1W59 A;  1H2M A;  1EN6 A;  2QM7 A;  1PNK A;  2RCV A;  2HJF C;  1AR1 B;  4U3J B;  3LSU A;  3H01 A;  2HJD A;  3KCY A;  1GM7 A;  4X20 B;  5KX5 B;  1VF6 C;  4JAS A;  1KC8 W;  3SYO A;  3L71 H;  4LP8 A;  1QNM A;  1THZ A;  1JMK C;  2JEX A;  3BY6 A;  4OX9 B;  1WA8 A;  5J2T B;  3CCQ V;  1FJG B;  1XQ8 A;  4UCV A;  1FAF A;  2XUM A;  3KCX A;  4CH3 A;  2JRI A;  3ICX A;  3CRA A;  4PDR A;  3ZMU A;  2PUS A;  1XOU A;  4I4T B;  2UUA B;  3B8M A;  4UFZ A;  4Q20 A;  1CPY A;  1H2G A;  3AG2 B;  4YHH O;  3W7W A;  2LP7 A;  4J9Z B;  1G8M A;  5K1P A;  1YJN V;  4OPA A;  3CPW U;  1E79 G;  3T4D A;  3JAR B;  3CRC A;  4DK1 A;  4PHZ A;  5F2V O;  2GHY A;  5FPO A;  1DF5 A;  4B7E A;  4QNH B;  3BVO A;  1L8D A;  1EN4 A;  5CBF A;  1IXB A;  1Q3E A;  5JJN B;  3H1H H;  4WFE A;  1R6T A;  4O2A A;  4Q6G A;  3ML0 A;  2MK3 A;  3HKD B;  1MSW D;  1YJW V;  4CC6 A;  3FKS G;  3CX5 F;  4PD4 F;  1N34 O;  1MOF A;  1K9M W;  2WLL A;  1WA8 B;  2YI9 A;  1H8E G;  3CRM A;  1YTF D;  1AR4 A;  3W7U A;  4CZZ A;  2EJR A;  1YCI A;  1SZX A;  4X65 O;  4F6R A;  1OCC B;  2AHY A;  4RQF A;  4NR1 A;  1YZB A;  2XOK G;  1B6Q A;  1I0H A;  4MVM A;  4EEQ A;  4DR1 O;  1RPO A;  4LBE C;  5H2F Z;  2W6J G;  2Y69 C;  1R1B A;  1VP7 A;  1OZ0 A;  3J80 N;  4UV9 A;  4J80 A;  2BCC H;  4FPP A;  4O2A B;  1VQ4 V;  1JJ2 U;  2PYJ A;  2V7Q G;  4JAA A;  3JYC A;  2EIN C;  4GZR B;  5IT9 N;  3BCC H;  3ZBH A;  4W4L A;  1S5J A;  1M9N A;  3CP1 A;  2WLL B;  1BQ0 A;  5EBL C;  1VQK V;  4UCR A;  2ZDI A;  2QTS A;  2P6J A;  1PL4 A;  5IYC O;  2XHB A;  2N05 A;  2IH1 C;  4BW9 A;  4YHH B;  1G4Y B;  4DR7 O;  4IIJ A;  4FIP C;  5DM6 V;  2YDE A;  4X9Q A;  1XIL A;  4MVR A;  2DW4 A;  4F6R B;  2E5L O;  4LF8 O;  1DLB A;  3JAT A;  4X1I A;  2E76 B;  4EFE A;  2KKW A;  3CYO A;  4X1Y A;  4PI2 A;  4BW5 A;  2VS0 A;  2EIK B;  2WA4 A;  1P84 F;  4R8C A; 
#chains in the Genus database with same CATH homology
 2B1I A;  1VQP V;  1F23 A;  2X7R B;  2EZO A;  3ZN0 A;  1YJ9 V;  3K3W A;  1K5S A;  1M56 C;  3T1C A;  3WG7 B;  1H38 A;  3QNE A;  1IXM A;  4PEL A;  3ZRW B;  1FFT B;  3W7T A;  4JYB A;  4UUJ C;  1YI2 V;  2EBO A;  1NVP B;  2M7W A;  3ZRS A;  1AI7 A;  2EIL B;  3CCE V;  4HZ3 A;  1Y4M A;  3AG4 C;  3OUS A;  4MT8 A;  1QLN A;  1BMF G;  1NH2 B;  5L3C A;  1WPX A;  1W0J G;  4JAV A;  1KEC A;  4JTC B;  3X2Q B;  3CCU V;  3RBZ A;  3K0D A;  1GMG A;  1M57 C;  3SYP A;  2IJK A;  2Q6A A;  2C2A A;  4WF9 V;  3WFV A;  1GTO A;  1OCO C;  2UXX A;  3A0R A;  3RW0 A;  4QPK A;  4KFM A;  1F4N A;  1JOY A;  4BAY A;  4N23 A;  1SER A;  4I5S A;  5B1A C;  2HLD G;  1R3K C;  2HVJ C;  4GX5 A;  1F51 A;  1NR7 A;  1VQ6 V;  1PKX A;  3OFN G;  3E2E A;  4MVO A;  1HWY A;  2YEV B;  3UKM A;  3CCJ V;  4PA9 A;  4WCE V;  1YIT V;  2PI5 A;  4JGS A;  2D3O W;  1KQS U;  1FXK A;  3OM3 B;  3ZCC A;  3OGC C;  3JD1 A;  3LSQ A;  4RAI A;  1JX9 A;  1GM8 A;  5L3B A;  1PNM A;  4LCU C;  1NQT A;  1OCZ C;  3ETE A;  4HAM A;  2JDI G;  3B8N A;  4MS2 A;  1COW G;  2HFE C;  2P90 A;  3FYI B;  4PA6 A;  4PDM A;  4Z1M G;  5LHH A;  1QBZ A;  3K9A A;  4PA4 A;  1KD1 W;  5LHG A;  2Y48 A;  2DQ0 A;  4WFF A;  1E1R G;  3OEE G;  3OMA B;  3ZRV A;  4XDL A;  4RUF A;  3DGE A;  1K8A W;  2WLJ A;  3OR6 C;  2XAQ A;  3FB8 C;  1BHB A;  4TSF G;  5B1B B;  3AG2 C;  1NJI W;  4ZBM A;  4GT1 A;  1JQ0 A;  2P7T C;  3SPC A;  3CCR V;  4ZKI A;  3OE7 G;  5KA5 A;  3OR7 C;  4MTO A;  3HB3 B;  1W0K G;  3STL C;  2X6B A;  1P7B A;  2ZR3 A;  5L3G A;  3K08 A;  1K34 A;  2WSS G;  1K3E A;  4U7N A;  3GWO A;  1AJN A;  3WG7 C;  2BOB C;  1QCE A;  4E2L A;  2DWD C;  2JJ1 G;  1K4C C;  1XL6 A;  3SPH A;  3T4Z A;  1S77 D;  4PA7 A;  2ZQM A;  3RVZ A;  2K1E A;  3LDC A;  3CXC U;  1VQ5 V;  2OTL V;  2W0F C;  3G6E V;  1NH2 D;  1K92 A;  2IJI A;  4UVA A;  1OCR C;  4R6Z A;  2ZD9 A;  2B1G A;  1FXV A;  3D3I A;  5LGU A;  3OMN B;  1H8H G;  2F43 G;  3QO5 A;  3X2Q C;  1QR9 A;  3K79 A;  4BIU A;  2EZP A;  1YHQ V;  1NKD A;  4JTD B;  5CBG A;  3E8G A;  5CMU A;  4MVQ A;  2DQ3 A;  1KP2 A;  4JYC A;  4P9P A;  1AJP A;  5CN0 A;  2YSU B;  4JPR A;  2W6I G;  1EZJ A;  2V1D A;  1M90 W;  4R7C A;  4JAU A;  5H6R A;  3W7S A;  1VQ9 V;  2DYS B;  4N21 A;  2HKO A;  5C93 A;  3NXS A;  5HFL A;  5E1A C;  1R3I C;  2Y69 B;  3JD4 A;  5B1N A;  3ZN1 A;  3CMA V;  3SYQ A;  1QVF U;  2Z5U A;  1BHA A;  4XDK A;  3OUF A;  2Z3Y A;  1WLE A;  3CC2 V;  2HG5 C;  4QE7 A;  3HPL C;  3OW2 U;  1Q81 W;  1OCC C;  2LFR A;  2PI4 A;  3ZMS A;  2ITC C;  1QLE B;  4G27 B;  2GSM B;  2XAG A;  5EBW C;  5EC1 C;  1MG1 A;  3F7Y C;  3T2M A;  2EIN B;  3ETG A;  5LGN A;  3CD6 V;  1J95 A;  2CK3 G;  4FMT A;  4UV8 A;  3CC4 V;  1V55 C;  5EBM C;  3SYC A;  5B3S B;  3F5W C;  3SJQ C;  3ZMT A;  1P4R A;  2ZXW B;  2WLM A;  3AEI A;  2XND G;  3CCM V;  4R50 A;  3CCL V;  4ASU G;  4MVZ A;  1I5X A;  2EIM C;  2IU3 A;  3ASN B;  4GX0 A;  3SYA A;  1VQ7 V;  3MHS C;  1PD3 A;  2QEX V;  4DO2 A;  5IY5 C;  1EFR G;  4P30 A;  1FXH A;  4MW8 A;  2KB1 A;  3JD3 A;  3MD0 A;  2WLI B;  3EFF K;  3LSS A;  1ARO P;  1VQO V;  3E89 A;  2DYR C;  1ORQ C;  4QE9 A;  3B77 A;  1R6K A;  4H37 A;  2X0L A;  3AG3 B;  1ROP A;  1V54 B;  3G71 V;  4P2Z A;  1F4M A;  4HYO A;  2IJH A;  1NBM G;  1JPX A;  4UVB A;  4EKW A;  4RQE A;  2IW5 A;  2R9R B;  3RVY A;  4H33 A;  2JEU A;  1FS0 G;  1KP3 A;  3VOU A;  1BL8 A;  2XAF A;  5KUK A;  3GB7 C;  1EBO A;  3MHH C;  1RM1 C;  2A9H A;  1YIJ V;  1M1K W;  3KG2 A;  2AHZ A;  1R3L C;  4XDJ A;  5H6Q A;  3ZRX A;  1M56 B;  1AJQ A;  1JVM A;  4FJC C;  4X8A A;  3P32 A;  3OEH G;  3CCV V;  2XAH A;  3ETD A;  3ABK B;  1Y66 A;  3LNM B;  3ZMV A;  4BIZ A;  4MTG A;  2EIK C;  4MSW C;  3CME V;  3QO8 A;  3CCS V;  1QVG U;  3LDE A;  2WAM A;  4WFH A;  3IFX A;  1ZWI C;  2H94 A;  3ZIA G;  4QJF B;  5IYB O;  3E8F A;  5EK0 A;  3OMI B;  4MVS A;  4X88 A;  2P67 A;  1R3J C;  4UVC A;  2A0L A;  4KUM A;  3I56 V;  1JCH A;  2HR3 A;  3ABL B;  1M57 B;  4GX1 A;  3D36 A;  2XAJ A;  3TCU A;  1R6N A;  5KUM A;  1NVP D;  2EIJ B;  1QLE C;  2A79 B;  4I9W A;  1OCO B;  5EC2 C;  2EIL C;  2BOC C;  4F4L A;  1YSC A;  2QM7 A;  2WPD G;  2WWW A;  1PNK A;  1YTF B;  2HJF C;  1AR1 B;  2QE7 G;  3H01 A;  1K4D C;  1K97 A;  2QM8 A;  1FXK B;  1GM7 A;  3E8H A;  4UXN A;  5B3S C;  2ZXW C;  4JAS A;  1GK9 A;  3FB7 C;  5HFM A;  2ZDI C;  3W7X A;  1R73 A;  5L3E A;  2JIZ G;  3SYO A;  1TUE B;  1KC8 W;  1SRY A;  2WLN A;  4LP8 A;  5L3D A;  3FB5 C;  1THZ A;  4RUE A;  3R65 A;  2WLH A;  4G2K A;  3ABM B;  2JEX A;  1K7D A;  3BY6 A;  1SET A;  4GX2 A;  4MTF A;  1ENV A;  2X6A A;  3CCQ V;  3AG1 B;  1QR8 A;  3VBB A;  1KKD A;  4PDR A;  3ZMU A;  2OT5 A;  3DTU B;  4MVU A;  1PNL A;  5LBQ A;  3I55 V;  2QA4 V;  3M99 B;  3B8M A;  1GM9 A;  1V54 C;  2YEV A;  4Q20 A;  2IH3 C;  2DWE C;  1CPY A;  1H2G A;  3AG2 B;  5L3F A;  3W7W A;  1PL0 A;  2LP7 A;  4J9Z B;  5LGT A;  1G8M A;  2ATK C;  1YJN V;  3PJS K;  2JJ2 G;  3BEH A;  1S0V A;  3CPW U;  3E86 A;  1K5Q A;  1E79 G;  3T4D A;  4XBF A;  3UM7 A;  2OTJ V;  3TET A;  2QTO A;  2GHY A;  2WLK A;  2OCC B;  4TT3 G;  1DF5 A;  4JF3 A;  4QNH B;  4MTX A;  5B1B C;  2IJJ A;  5CBF A;  3ABK C;  3ABT A;  5J9P C;  4MW3 A;  2UXN A;  4WFE A;  3ML0 A;  2MK3 A;  1DTO A;  1OCR B;  1MSW D;  1YJW V;  1UJW B;  3E35 A;  1L1F A;  4PDL A;  3SPI A;  2Q68 A;  3ASO B;  3FKS G;  1K73 W;  2IU0 A;  1Q86 W;  3ABL C;  1MOF A;  1K9M W;  2WLL A;  2EIJ C;  5B1O A;  1MAB G;  3E83 A;  1H8E G;  1YTF D;  1N8R W;  3JD2 A;  4X89 A;  3OAA G;  4LC1 A;  3ABU A;  3FB6 C;  3G4S V;  3W7U A;  2X6C A;  3STZ C;  4WFA V;  1SZT A;  4TWK A;  3LDD A;  1AI6 A;  1FXK C;  4L87 A;  4CZZ A;  3SPG A;  4GCZ A;  5DN6 G;  3K04 A;  2HVK C;  2EJR A;  3IC7 A;  4RO2 A;  5GW7 A;  3LUT B;  2XAS A;  4KP4 A;  1VQ8 V;  1Q82 W;  1GO3 F;  5CA3 A;  4FK5 C;  1OCC B;  2AHY A;  1S3J A;  3ABM C;  4RQF A;  1VQN V;  1S76 D;  3AG1 C;  4P9O A;  1GKF A;  2FTK A;  1AI5 A;  2XOK G;  5KA6 A;  1Q7Y W;  1B6Q A;  4MVM A;  3AG4 B;  3E8B A;  3K06 A;  2DYS C;  3QO7 A;  1RPO A;  1V55 B;  1SES A;  4LBE C;  1CP9 A;  1VQL V;  2W6J G;  4U7O A;  2Y69 C;  5FL7 G;  3F7V C;  3EHB B;  1DF4 A;  1OHH G;  3TK1 A;  4DXW A;  4CBC A;  1OZ0 A;  4UV9 A;  2EIM B;  5LHI A;  3CC7 V;  3FYE B;  1NR1 A;  4FPP A;  1K33 A;  2Q69 A;  2QKS A;  1VQ4 V;  1JJ2 U;  5IYD O;  2NLJ C;  5IY5 B;  2JK5 C;  2V7Q G;  3ZRW A;  3JYC A;  2EIN C;  2Q67 A;  5B1A B;  1S72 V;  1S5H C;  3K0G A;  3IGA C;  2DYR B;  2OCC C;  4YXW G;  1VQM V;  1M9N A;  3CP1 A;  2WLL B;  1XL4 A;  5EBL C;  3ZMZ A;  3ASN C;  1VQK V;  2ZDI A;  2P6J A;  5H9C A;  3JD0 A;  5IYC O;  1I5Y A;  3K03 A;  2IH1 C;  4J9Y B;  1OCZ B;  2ZR2 A;  1G4Y B;  2LFS A;  3SPJ A;  4FIP C;  4JTA B;  4QPJ A;  5DM6 V;  1E1Q G;  4QIW F;  1CEZ A;  2WLI A;  1RPR A;  4MVR A;  3ASO C;  1RM1 B;  3AG3 C;  2DW4 A;  2B5U A;  2NNU A;  4PDV A;  1DLB A;  4WFG A;  3ZJZ A;  1LNQ A;  3CYO A;  2ITD C;  2H8P C;  4WFB V;  4BW5 A;  1AI4 A;  2R9I A;  5BZB A;  5CBH A;  5IDJ A;  2EIK B;  1W2B U;  4PA3 A;  3P30 A;  3JCZ A;  4G28 B;  4R8C A;  4OXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...