1L0LH

Structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
78
structure length
78
Chain Sequence
GDPKEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
total genus 23
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1l0lH00
1NU1H 3H1KH 1NTMH 3L71H 1SQQH 1L0LH 3L75H 4U3FH 3BCCH 1SQVH 4D6TH 2FYUH 1PPJH 3L73H 1L0NH 1NTKH 3L72H 1BGYH 1NTZH 1SQPH 3H1LH 4PD4F 3H1JH 1PP9H 2BCCH 3CWBH 1SQBH 1SQXH 1BE3H 2IBZH 3L74H 3CX5F 3H1HH 3TGUH 5KLVH 1P84F 2A06H 1EZVH 3H1IH 3CXHF 3L70H 1KYOF 1KB9F 1BCCH
chains in the Genus database with same CATH superfamily
2X6BA 3LDCA 2HP8A 1QR9A 1NVPD 1BL8A 1R3LC 4I5SA 5FNVB 1H38A 4X65B 4LFCO 4DR4O 2CGNA 3APOA 2DYSC 3W7WA 3OUFA 1GKFA 4PI2A 4B3RO 4WFFA 4X1KA 2XAJA 4U3JA 3A8TA 4EFEA 4MSWC 1QLEC 4DR7O 1IURA 2F43G 4JI2B 5IE9A 5B3SC 2HG5C 3E35A 4JPRA 4DK1A 5BR8O 2EZPA 5JJNB 3BVOA 5H6RA 3K04A 2QGNA 1MNGA 1BT8A 1VF7A 4WF9V 3SR2C 3ZEDA 3CB2A 1QCEA 2EJ7A 3H9VA 3CHXA 2EINB 3ML0A 5BMVB 1SA0B 1V54B 4X62B 2Y69C 1K34A 1HNXO 3ZIAG 2QM7A 1P7GA 4YY3O 3ZRWB 2B1IA 3JD2A 5JCOC 3JARA 2EIJB 5J2TB 4X9QA 3RVYA 3OMIB 4DV5O 1Q81W 5HFLA 1JFFA 3OD4A 4NYKA 3J7AU 2GHYA 4P30A 5B3SB 1TA8A 2OCHA 3I5DA 1BMFG 2XOKG 2Q67A 4NXNB 2UU9B 4DUZB 2HKOA 1S72V 2UUCO 3TXSA 3AG4C 2ZXWB 3JYCA 3ZX6A 1IDSA 5JH7B 1RPRA 1GAXA 4QJFB 4C7UA 1WA8A 3RW0A 4IIJB 2RDCA 4LF9O 2ZCEA 2ZXWC 4JYAB 4GCZA 2O57A 3RYHA 4FMTA 4JYCA 1ZAUA 2EULA 4ZOLA 4UCVA 4U7NA 3L74H 3CSXA 4X65O 4KP4A 4O4IA 4X89A 4AHCA 1AP6A 1N0NA 3FYIB 5B1OA 1W2BU 5J2UB 4IHJB 3APQA 2DMXA 3TETA 3K3WA 3SGIA 2E5LO 1E79G 4BIUA 4DUYO 4DR7B 1SQXH 1YJNV 2WLLB 4U3JB 1EZJA 2H8PC 5LGNA 4I55A 3ZRVA 2QKCA 3O65A 3TGUH 3ETQA 3K5MA 3GVMA 1PD3A 4J42A 1S5HC 3G6EV 2WLIA 3D3QA 2P7TC 1VQKV 4Z1MG 2BCCH 1YI2V 4X1IA 3HKEB 3HR0A 4JZ2A 2G38A 1S0VA 1SF9A 4K8ZA 1IBLO 1HW7A 2F4VB 4JI7O 1DK1A 1H8HG 1X59A 1V55B 2UUAB 1NZ6A 4B3MB 3E89A 5DN6G 4X64O 1FYJA 3C3SA 1VP7A 3EHBB 1XOUA 1Y67A 1R3IC 1GM8A 2KSDA 4UB8Z 3DXRB 5BZBA 2EILC 3ABLC 4UVAA 1YTFD 4GKKO 1YXBA 1VQ7V 1FAFA 2A79B 4DR6O 4RWUA 3OTOO 4JV5O 2RNBA 1NVPB 5CA1A 2ITCC 3CCQV 3RYCA 4Q6GA 3JSLA 1N34O 1YZBA 3RVZA 5B1AB 1I5YA 4DV0O 2CTWA 3E83A 3ICXA 4TSFG 5C8YA 1FXKB 5EYPB 1Y74B 2VS0A 1COWG 1XHXA 5FPOA 3E22B 4LR3A 1P7BA 1VQ9V 2ZD9A 4NKGB 3G67A 1SZXA 2AHYA 2LW1A 4KFMA 4LF6O 4PA4A 2RN9A 4YHHB 2AZ2A 4X1IB 4E4EA 3R65A 3AG2B 4LFCB 4DR4B 2YC0A 4D7SA 2QSAA 4DV5B 4UVBA 4JTCB 1I94B 4MVZA 3JATA 2Y0IA 2VRZA 2R9RB 2UXDO 1AB3A 5LXTA 4IT5A 1MSWD 1HR0O 2ZR3A 2DQ3A 1YDXA 2EILB 1YHQV 3ZMZA 4CC6A 4JI5B 2M6YA 1RPOA 1Y74A 5TISZ 1V9PA 1M5IA 3OR6C 1PP9H 1N0JA 3JALA 3G71V 1PKXA 2OYQA 1KECA 1J5EO 5LHGA 5L3GA 3AG7A 3CJHB 3ZHRA 1CXZB 4B3TB 4WFEA 1VQ8V 3SPHA 4UCSA 2UXCO 4TOIA 1E1RG 2K1EA 1JR9A 2XAQA 1XMOB 2ILMA 1H2SB 3H1LH 3UO2A 3U0ZA 4O4JA 3SJQC 5H9CA 1N33B 4MTFA 3FKSG 4TT3G 2N74A 2BOBC 2Q7HA 3JD0A 4XDKA 2DJVA 3OAAG 1SERA 2DYSB 1MABG 1NI8A 3VQYA 4B3SO 2C2AA 3K08A 1NJIW 2CDYA 3AK2A 2VWJA 3D36C 2RQ6A 5KHHA 2LGQA 1GN4A 3J81N 1GN3A 4R8CA 4MW3A 2WLIB 1BQ0A 2YICA 3DTUB 1Z5WA 1I7FA 1AI4A 1MSDA 2Q7GA 1L1FA 1IBLB 2AGAA 2W0FC 4DV6B 2UXNA 5E1AC 5ITZA 1M93A 4FFBA 1VQOV 3JAKB 4WFHA 2F93B 1IXBA 4TV8A 5BXZA 1RSOA 3HKDB 4D7TA 3CJHA 4FZ1A 3ZHQA 3K9SA 4O2AB 2UUBB 5CBHA 1SA0A 4CH3A 3CRRA 3LSSA 5LBQA 2YIDA 3T1HB 2ZM6B 2F66C 3KCXA 3B09A 1K5QA 1QQCA 4TV9B 4YIPA 3VQXA 1F7YA 4MVOA 1N4CA 4JI6B 3MDSA 5LOVA 2AZ0A 2A9HA 4LF8O 1N34B 2XAGA 3THOA 3ZHVA 2Q7EA 3B77A 1AI5A 3QNEA 1NH2D 4RUEA 3DGEA 1TUBA 1Y4MA 2JRIA 3G80A 1NR1A 2H94A 3ABUA 3WG7B 2HVKC 2E3CA 3BCCH 1WAZA 3F5WC 4X66O 3MHSC 1AILA 1YVWA 3JCZA 5B66Z 3EVKA 5LMUO 5KHJA 1LR1A 4IL6Z 1M56B 1P84F 3OGCC 2UUBO 4N23A 3RWRD 4DK0A 2P6JA 4MVUA 5BMVA 2E76B 1FXHA 3ZCCA 1GRJA 4ABMA 4RUFA 4TWKA 1XILA 1CPYA 2HVJC 1QBZA 4W4LA 3U10A 1WB7A 1D5AA 5CA1B 2YDEA 1VQ4V 4B3MO 5IJ9B 2ADQB 4DR3B 1BHAA 2GDSA 5IDJA 5H2FZ 5LYJA 1A32A 4X88A 3JD1A 2ZT9B 1ORQC 4PD4F 5KX5A 4JI7B 4Z2WA 5LP6B 1YSCA 3CX5F 1M57C 1SC5B 5EC1C 3X2QB 1W59A 1XMQO 5LOVB 3RGBA 3ABMC 3CMAV 3OW2U 1JFFB 4MVRA 1Q86W 4P2ZA 3VBBA 1OV9A 2ATKC 1PL0A 2Q4PA 4NXMB 4JI3O 4JV5B 4WBNA 4UVCA 2DWDC 3GWOA 3KZIZ 5LHHA 4DUYB 4PDRA 4EKWA 2YXLA 1XHZA 4JI0B 3MD0A 4YJ2A 2DWEC 5B1AC 1Q3EA 4LFBB 4KHPB 2JGDB 5LMNO 3QO8A 5EZYA 4DV1B 1G8MA 2ZQMA 1AJQA 2LW7A 3IGAC 3RT3C 1BHBA 5KLVH 2PYJA 1X4TA 1OHHG 4J7ZA 2P67A 3RYCB 4PI0A 3LNMB 3CCRV 2QE7G 2UXDB 1KBHA 1QHTA 5IWAB 1M57B 3T4DA 2K9PA 5CB4B 2N04A 3CD6V 4YY3B 1K4DC 3LDDA 1FD9A 2IU0A 2YIAA 5DEDA 3OFNG 4F6EA 1MA1A 4FJCC 4NXNO 1G4YB 4GKKB 5HFMA 3ZJZA 1KD1W 5LGUA 2NR5A 3K03A 2DOSA 4BR6A 4DW0A 1LNQA 3L73H 4MTOA 3CEIA 4UV8A 1H2NA 2HJFC 1RM1B 4LFAB 4TQFA 2AHZA 3H1HH 4I0XA 5EIBD 1YJ9V 2Y48A 3KKYA 4O2BA 2UUCB 4JI3B 4JI8O 4FIPC 4UCUA 2F4VO 2XUMA 3K58A 3B4SA 1IVSA 2NLJC 3JARB 3SPJA 3O9OA 4DXWA 5CA3A 1PL4A 3CC2V 4RQFA 1XMQB 4TUYA 1FS0G 4LF9B 2Q0AA 1KKCA 2WSSG 1I94O 4OXSA 2DYRB 1XI1A 2WLLA 2IU3A 4UFZA 1N32O 1AI7A 1KP3A 1K8AW 1XMOO 4X66B 3L70H 4JYYA 1VEWA 3LSQA 2R9IA 3LSUA 1K4CC 2P4VA 3WFVA 4DV3B 5KHKA 1I5XA 4I0XB 1BSMA 1SZTA 2CAZC 4FZ0A 1R3JC 4ZHQB 3BEHA 3ABMB 3JASA 3T1CA 1SQGA 2BTOA 4E2LA 4K8XA 1GMGA 2EIKB 4MW8A 1H2GA 4R6ZA 4CBCA 2HLDG 1OJHA 2GUZA 4GX5A 3ZN1A 3L71H 1S76D 1Q90D 4PHZA 3AG2C 1JOYA 3W7XA 3DC5A 4LCUC 2B9ZA 2BSKB 2R72A 3E8GA 4PELA 4JAAA 5CB4A 2XNDG 2UXCB 4DR2O 3HKEA 4DV7O 4K0KO 1QU7A 5LHIA 2ITDC 1TVKA 2E5LB 1YCIA 3W7TA 2X7RB 2AXTZ 4I9WA 1OZ0A 2YXYA 3G6BA 1WNSA 4TV9A 5B5EZ 5EK0A 3ABTA 2VQFB 4MTGA 1ZUQA 4J10A 4JI5O 1E1QG 2GBOA 3T1HO 5JWPA 1I08A 2IBZH 4YIOA 3B40A 3GWKC 4K3AA 4UCTA 2JDIG 3RYFA 3S3WA 3RN4A 2M7WA 2OT5A 4B3RB 1NU1H 3AK3A 1Q6HA 1YJWV 3IAYA 3STLC 2LO1A 4BAYA 3RYHB 2HHHB 2UXXA 3FAVB 4LF5B 1PNKA 3LUTB 3L72H 4DV0B 1QVFU 2PGGA 1N36B 3QTCA 4BW5A 4O2BB 2LGWA 1F4NA 2Y0PA 2PF4E 4BIOA 2IJKA 1BCCH 1OCCB 2ETNA 1JX9A 3X2QC 1QLNA 2Q73A 1VARA 3PJSK 4X1KB 4DR1B 1XEQA 2QWRB 5H5NA 4DV4O 4QNHB 3WG7C 1GM9A 3P30A 2A06H 3BPZA 1IBMB 5L3DA 4DV7B 4K0KB 4NTYA 2YUAA 1B6QA 1K97A 5KX5B 1WP8A 2QWPB 5JVDB 5KUKA 3ETGA 3WB2A 1FJGB 5J9PC 4EEQA 1TUEB 2Q5ZA 2Y69B 3GB7C 5EYPA 3A0BZ 4I7ZB 1JJ2U 5J2UA 5LA6A 3E8HA 4HZ3A 4R50A 2IJJA 1RSOB 2ZM6O 4MVSA 1AJPA 2L35A 3ASOC 1VQPV 5L3FA 1SKVA 2QDOA 1HNZB 2W6IG 1Q43A 1TGOA 4LF4B 3JALB 4WFBV 2DE0X 3I56V 5EC2C 2UUAO 1TVKB 3LNNA 1WA8B 2FKXA 2CUGA 2XASA 5KA5A 4H33A 4F6RA 2YIBA 1IXMA 4O4HA 2WWWA 4N21A 5KUMA 2YS8A 1YF2A 2WAMA 2XT9A 3ZMVA 1DGSA 3K79A 3SYCA 2Q0OC 3AG1B 3P3NA 5JH7A 1Y6XA 4HAMA 4CS2A 2EZOA 4LF5O 2D3OW 5EBWC 5B1BB 2P22C 4PV1B 2MK3A 3ASNB 4DR6B 1O9GA 1V54C 4WFGA 3OT7A 1MOFA 4DV3O 5JJJB 2PZSA 2NNUA 3HPLC 2XTAA 3JD3A 3DSQA 3QO5A 3TK1A 4FM1A 2Y4TA 4LWSB 1MMMA 1GN6A 4BW9A 2QJ1A 5E79Z 3MAQA 1Q7YW 2XAFA 1ZTEA 4NTWA 1FFXB 1MZEA 1K73W 3UT5B 4JI2O 3JAWB 5AG2A 1ZL8B 2EJRA 4YJ3B 2ZE6A 4DRXA 3K0DA 1F23A 2GSMB 1WP7A 3FD9A 3JSNA 5CA0A 2HFEC 2WLMA 1G6UA 3CRQA 3ZRWA 1NS1A 1HWYA 4PA9A 1GTOA 4OPHA 5KMGB 1Q6UA 1YTFB 1N32B 2A3QA 1WB8A 4MT8A 3UCSC 1HNWO 1VQMV 4FFBB 4FLYA 3U11A 3LDEA 2PUSA 1YITV 2EBOA 2FL4A 5JVDA 2QM8A 3ZBHA 4CS3A 4TV8B 3TXQA 2FTKA 2EIMB 5LL6Y 4RAIA 4YJ3A 5ITZB 2LP7A 1DLBA 4JI1B 1N33O 2KG7A 4B08A 2PYLA 4MVQA 3EFFK 3CCMV 2FB5A 4CC5A 3FB8C 4UCOA 3ZRXA 1CEZA 2YI9A 3CXHF 4IYHA 1PNLA 3ZS8C 3CE2A 5KHIA 3SDLA 3SJBC 4PDMA 3A2FA 2A7WA 2Z3YA 1IBKB 1S3JA 4H13B 3STZC 3ZHSA 1IBKO 4F6RB 1J5EB 2P4KA 1GK9A 1D5NA 4PDLA 5D5QA 3FFQA 2F23A 5IWAO 4ZHQA 3ZMTA 5L3BA 2HEPA 5IJ0A 1EBOA 4ZIBA 1R73A 1IX9A 1Y76B 4CS4A 4I4TA 2B5UA 3Q4HB 3G4SV 3NR7A 5JJEB 3N2GB 2P5OA 3BHPA 1S5JA 3F7VC 4FLTA 3CMEV 2D2CB 3ZHUA 1WPBA 2DQ0A 4NXMO 3OGIB 3F7YC 5KA6A 4LF7B 4J7KA 2CGOA 2WPDG 3QVNA 3Q4HA 3ZMSA 1H2KA 4H44B 1SQVH 1YIJV 2JJ1G 5L3CA 4DV2B 3OUSA 1ZL8A 3B2EE 1SS3A 4DV2O 1R6NA 4JTDB 5DM6V 1IZ3A 2PI5A 2QR4A 4AILC 1JVMA 3UM7A 4DYLA 5IJ9A 3OEEG 1ZX3A 1NH2B 1AP5A 2OCCC 4IIJA 3B8MA 3SPCA 2WLHA 3JASB 3L9DA 4PA3A 1XL6A 1NTZH 1AJNA 5A9GA 2DW4A 1BZKA 5CMUA 4GKJB 1XDCA 1M9NA 1RP3B 1U96A 3D8CA 1OCOB 2KB1A 3FX7A 5CN0A 5LYJB 1NTMH 4LNUB 4A5UB 1WLEA 1VQNV 2X6CA 2OIGA 1EM1A 1O9HA 4TQDA 1BGYH 2V1DA 2YEVA 3CCLV 3PN1A 4HNAB 1T5EA 3CXCU 3OEHG 3K59A 3E8FA 4FM2A 5BR8B 2JS5A 2ZINA 1EZVH 2PTMA 2QTOA 1HDJA 3CCJV 4I4TB 2EIKC 1K5SA 5IY5C 2V7QG 1PPJH 2WA4A 1Z5VA 4JF3A 3ASNC 3JCUZ 4YXWG 3H1JH 3RYIA 2GTSA 4WBNB 1B04A 1Q5OA 1JMKC 3K5LA 4L8JA 2JJ2G 1KYOF 1GH6A 4F4LA 1PV0A 1BQZA 3CP1A 3E8BA 4X20B 4DR5B 5GONB 3ZRSA 1OCZB 4GX1A 3JATB 2R70A 1K33A 3TCUA 4O4HB 2YI8A 2IH3C 1R6TA 1OCCC 4FPPA 4DO2A 1DTOA 1KB9F 2H3OA 4FM0A 4H0LB 3ABKC 4JI1O 2JIZG 5EBLC 5C8YB 2NN4A 5IT9N 3AK1A 3JAKA 2QA4V 4RQEA 4UUJC 4R7CA 1F51A 1RFYA 2YEVB 1V55C 1LUWA 4KL1A 2GTAA 1JJOA 1XBLA 4TUYB 4RO2A 1SETA 1QVGU 3K06A 1M1KW 1L8DA 4BIZA 2ZE8A 3CCEV 2CTQA 2WA3A 2FYUH 3D3IA 1SESA 4DRXB 4UXNA 1NTKH 4OPAA 4OGQB 2HR3A 4NB5A 3QO7A 4AI8A 2QM4A 1QR8A 1VF5B 5IYZA 1Q82W 4FLWA 2ODMA 4EB6B 4LH7A 2W6JG 2LFSA 5FNVA 3R66A 1JPXA 1GO3F 5LMNB 3WB0A 3FYEB 3DXRA 5DECA 1B3QA 2V4DA 2QWNB 3T1YB 3CRMA 2UXBB 2ZR2A 4GUNA 3KG2A 1GN2A 3T2MA 4JI0O 2KKWA 2Q9LA 2F1MA 3ETDA 4PJ0Z 5EIBC 4DR2B 1VQ5V 4DV6O 5B1NA 3SJCC 4WFAV 3BAAA 4X62O 1AR1B 5K1PA 1OCOC 4EB6A 4GX0A 1ENVA 3ASOB 1BS3A 3ABKB 3K5NA 5IYDO 5KAFZ 4FLVA 2JK5C 2Q69A 4U7OA 4W4KA 2VQFO 3HKDA 1JCHA 4G27B 2E74B 4X8AA 4JAVA 2MW2B 3AG3B 5GTIZ 5JCOA 2F95B 2X6AA 4Q20A 4PDVA 1P49A 2Z0AA 4BWAA 3FB7C 5FL7G 1M4UA 3C3TA 4KXRA 2BE3A 5L3EA 4FFKA 4I50A 2Z5UA 1FXKC 3RFRA 1ZWIC 2IJIA 3ZHTA 2VQEB 3HKBA 4JASA 5H6QA 2IJHA 1N36O 4NTXA 2QWQB 3SJAC 1R3KC 4B3TO 1US6A 2BSKA 4J9ZB 4JTAB 4AQYB 4LF6B 3QG5A 5F2VO 1EN6A 1J95A 1S5LZ 3H1KH 3AG3C 5LMUB 4GKJO 3BA8A 2GUZB 4X20A 3M7MX 3HKCA 3OE7G 2WLJA 2Q68A 3UQ8A 2QWOB 1FXKA 1Q6IA 1QLEB 1HNWB 4YHHO 4QE7A 3H01A 4CH5A 1AROP 4IHJA 4MS2A 1MG1A 4GYCB 1CP9A 4HYOA 2XHBA 1KKDA 4GZRB 1W0JG 1KUQA 4JGSA 3DC6A 3UO3A 5KAIZ 2RCVA 2YIBD 3UT5A 2P90A 3IFXA 3CC4V 1XNQB 1WPXA 5LGTA 2VQEO 1I0HA 3FAVA 1VF6C 5LA6B 3SYOA 2JGDA 4LFAO 1OCRC 3M8AA 4G28B 5CBGA 2ZNJA 3UKMA 4ZOLB 5GTHZ 3OMNB 1SQFA 5K1XA 5C93A 3AG4B 4JI8B 2ZNIA 2EINC 2QKAA 4LF4O 2WLKA 1THZA 2L6LA 1VQ6V 3OM3B 3OTFA 3K57A 4G2KA 2QTSA 3P3PA 4CZZA 2EIJC 4X64B 2CTPA 1RM1C 5LP6C 4MVMA 5LXTB 1VIBA 1U97A 3N27A 2P06A 2HHHO 1D2DA 3P32A 4B7KA 3AEIA 2EX3A 2GV9A 2LJ2A 4QGPA 3HB3B 1OCZC 2ZDIC 3A0RA 3IJ4A 1R1BA 1IBMO 2XAHA 3RYIB 4KHPO 2LQTA 4IGGA 1YEWA 3E22A 3AG1C 2BTQB 1NR7A 1Z2GA 1SQQH 4YJ2B 2LFRA 3T1YO 1B06A 2YXHA 4JI4O 2ZDIA 4LC1A 5A2QN 4LF7O 2A0LA 4Z1VA 3F5TA 1K7DA 3IC9A 3SPGA 2OIEA 3N2KA 4ICGA 4J7JA 2QEXV 4DV1O 1VQLV 4O2AA 4LNUA 4I9QA 1Y76A 4QIWF 1R6KA 2JS3A 3RYFB 3BA9A 3CCUV 5FLXN 1PM9A 5JQGA 4DV4B 2ARHA 4LH6A 3TJTA 4JYBA 2FMLA 1ZSPA 3WB1A 1KC8W 3OTOB 1LUVA 4ZBMA 1FFTB 4JZGA 3CRAA 1WJZA 4H37A 4DUZO 2OTLV 1VF6A 1XL4A 3ZMUA 1XNRB 1AR4A 4I50B 1WN7A 1HNZO 1NT2B 4B7EA 2N05A 4IYIA 1SQPH 1Y66A 4NR1A 1Q8IA 4CH4A 2KG7B 4KUMA 2AW9A 1N8RW 5JQGB 5KMGA 1FPOA 3VQVA 5IYCO 3KCYA 3VOUA 4J11A 1UFIA 4O4LB 5IYBO 4OX9O 4ZI7A 1JQ0A 3S3XA 3ZN0A 2OWOA 4FK5C 4X1YB 4JYAO 4LF8B 1F4MA 1H8EG 1TAEA 2Q6AA 3N2GA 3W7UA 4DR5O 4O4JB 4LP8A 1G1XB 4JAUA 1P4RA 4HNAA 1PNMA 5EZYB 3JAWA 1EN4A 1KQSU 3RBZA 3H1IH 4GLXA 3K0GA 1URFA 2ZKOA 5KHGA 3CS5A 4X1YA 1DF4A 1K9MW 1AVMA 2KQXA 4XDJA 5B1BC 4UB6Z 2PY5A 1HP8A 4O4IB 3E2EA 1EFRG 1OCRB 1BE3H 4QE9A 2OTJV 3EXAA 4ASUG 2E75B 1XQ8A 4GX2A 4JI4B 3VQWA 3T4ZA 1UPGA 3IC7A 4QPJA 4ZI7B 5EBMC 4LBEC 4U3FH 5GONA 4UCRA 3I55V 4EFBA 4J9YB 4AQYO 1HNXB 2HJDA 1NBMG 4GT1A 4OX9B 1KU9A 3J80N 2VWKA 2YSUB 2ADPA 1DF5A 3N2KB 4P9PA 4D6TH 4I55B 3E86A 3OR7C 3CRCA 1K3EA 2ZIMA 2CH7B 5CA0B 1M90W 1XNRO 1H2LA 3BFRA 2JEUA 3ETEA 1NKDA 2EIMC 2IW5A 2JVDA 1XREA 3FB5C 1KP2A 4ZKIA 3HKCB 4QPKA 4DW1A 1S77D 4O4LA 5IJ0B 2ZIOA 4XDLA 1FKAO 3CCSV 4MTXA 2ZE7A 4FLZA 3D36A 1L0NH 2DYRC 1UJWB 1W0KG 2CH7A 4FVMA 2W0XA 2OCCB 2QKSA 3SYAA 1ROPA 4J80A 4JI6O 3QF7A 2UXBO 2CE4A 1ZLZA 4L87A 2PI4A 1NQTA 3SPIA 3CPWU 2BOCC 3K5OA 1M56C 4LWSA 3SYQA 3JAMN 5FPRA 5BY1A 3OMAB 5GW7A 5D5PA 4NVPA 1TUBB 5IY5B 2IH1C 3M99B 4PA7A 5IYZB 2B1GA 4FLUA 1KMIZ 1AI6A 1MZFA 4DR1O 1VMGA 3A0HZ 2R9AA 2RMKB 3HKBB 5LP6A 4B3SB 3CYOA 2CTRA 2UU9O 2Q8VA 2X0LA 1AR5A 1K92A 3CCVV 1HR0B 2ZE5A 3BABA 1XUQA 5J2TA 1FJGO 4FLXA 4CH6A 1XNQO 3BRCA 1GM7A 2RJZA 3WU2Z 1FFXA 3FB6C 1FXVA 3MHHC 1SRYA 3JD4A 4HBNA 2IM9A 2Y4UA 1L0LH 3L75H 4UV9A 1QNMA 3K9AA 4P9OA 3W7SA 3C90A 4K35A 1JA8A 2CK3G 4PA6A 3NXSA 2WLNA 1H2MA 3CWBH 4DR3O 2BTQA 1SQBH 4WCEV 3SYPA 2JEXA 1EN5A 3BY6A 3CC7V 4XBFA 4LFBO 5CBFA 3B8NA 2DN9A 4J41A 3ABLB 2JGUA
chains in the Genus database with same CATH topology
1NU1H 3H1KH 1NTMH 3L71H 1SQQH 1L0LH 3L75H 4U3FH 3BCCH 1SQVH 4D6TH 2FYUH 1PPJH 3L73H 1L0NH 1NTKH 3L72H 1BGYH 1NTZH 1SQPH 3H1LH 4PD4F 3H1JH 1PP9H 2BCCH 3CWBH 1SQBH 1SQXH 1BE3H 2IBZH 3L74H 3CX5F 3H1HH 3TGUH 5KLVH 1P84F 2A06H 1EZVH 3H1IH 3CXHF 3L70H 1KYOF 1KB9F 1BCCH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NU1 H;  3H1K H;  1NTM H;  3L71 H;  1SQQ H;  1L0L H;  3L75 H;  4U3F H;  3BCC H;  1SQV H;  4D6T H;  2FYU H;  1PPJ H;  3L73 H;  1L0N H;  1NTK H;  3L72 H;  1BGY H;  1NTZ H;  1SQP H;  3H1L H;  4PD4 F;  3H1J H;  1PP9 H;  2BCC H;  3CWB H;  1SQB H;  1SQX H;  1BE3 H;  2IBZ H;  3L74 H;  3CX5 F;  3H1H H;  3TGU H;  5KLV H;  1P84 F;  2A06 H;  1EZV H;  3H1I H;  3CXH F;  3L70 H;  1KYO F;  1KB9 F;  1BCC H; 
#chains in the Genus database with same CATH topology
 2X6B A;  3LDC A;  2HP8 A;  1QR9 A;  1NVP D;  1BL8 A;  1R3L C;  4I5S A;  5FNV B;  1H38 A;  4X65 B;  4LFC O;  4DR4 O;  2CGN A;  3APO A;  2DYS C;  3W7W A;  3OUF A;  1GKF A;  4PI2 A;  4B3R O;  4WFF A;  4X1K A;  2XAJ A;  4U3J A;  3A8T A;  4EFE A;  4MSW C;  1QLE C;  4DR7 O;  1IUR A;  2F43 G;  4JI2 B;  5IE9 A;  5B3S C;  2HG5 C;  3E35 A;  4JPR A;  4DK1 A;  5BR8 O;  2EZP A;  5JJN B;  3BVO A;  5H6R A;  3K04 A;  2QGN A;  1MNG A;  1BT8 A;  1VF7 A;  4WF9 V;  3SR2 C;  3ZED A;  3CB2 A;  1QCE A;  2EJ7 A;  3H9V A;  3CHX A;  2EIN B;  3ML0 A;  5BMV B;  1SA0 B;  1V54 B;  4X62 B;  2Y69 C;  1K34 A;  1HNX O;  3ZIA G;  2QM7 A;  1P7G A;  4YY3 O;  3ZRW B;  2B1I A;  3JD2 A;  5JCO C;  3JAR A;  2EIJ B;  5J2T B;  4X9Q A;  3RVY A;  3OMI B;  4DV5 O;  1Q81 W;  5HFL A;  1JFF A;  3OD4 A;  4NYK A;  3J7A U;  2GHY A;  4P30 A;  5B3S B;  1TA8 A;  2OCH A;  3I5D A;  1BMF G;  2XOK G;  2Q67 A;  4NXN B;  2UU9 B;  4DUZ B;  2HKO A;  1S72 V;  2UUC O;  3TXS A;  3AG4 C;  2ZXW B;  3JYC A;  3ZX6 A;  1IDS A;  5JH7 B;  1RPR A;  1GAX A;  4QJF B;  4C7U A;  1WA8 A;  3RW0 A;  4IIJ B;  2RDC A;  4LF9 O;  2ZCE A;  2ZXW C;  4JYA B;  4GCZ A;  2O57 A;  3RYH A;  4FMT A;  4JYC A;  1ZAU A;  2EUL A;  4ZOL A;  4UCV A;  4U7N A;  3L74 H;  3CSX A;  4X65 O;  4KP4 A;  4O4I A;  4X89 A;  4AHC A;  1AP6 A;  1N0N A;  3FYI B;  5B1O A;  1W2B U;  5J2U B;  4IHJ B;  3APQ A;  2DMX A;  3TET A;  3K3W A;  3SGI A;  2E5L O;  1E79 G;  4BIU A;  4DUY O;  4DR7 B;  1SQX H;  1YJN V;  2WLL B;  4U3J B;  1EZJ A;  2H8P C;  5LGN A;  4I55 A;  3ZRV A;  2QKC A;  3O65 A;  3TGU H;  3ETQ A;  3K5M A;  3GVM A;  1PD3 A;  4J42 A;  1S5H C;  3G6E V;  2WLI A;  3D3Q A;  2P7T C;  1VQK V;  4Z1M G;  2BCC H;  1YI2 V;  4X1I A;  3HKE B;  3HR0 A;  4JZ2 A;  2G38 A;  1S0V A;  1SF9 A;  4K8Z A;  1IBL O;  1HW7 A;  2F4V B;  4JI7 O;  1DK1 A;  1H8H G;  1X59 A;  1V55 B;  2UUA B;  1NZ6 A;  4B3M B;  3E89 A;  5DN6 G;  4X64 O;  1FYJ A;  3C3S A;  1VP7 A;  3EHB B;  1XOU A;  1Y67 A;  1R3I C;  1GM8 A;  2KSD A;  4UB8 Z;  3DXR B;  5BZB A;  2EIL C;  3ABL C;  4UVA A;  1YTF D;  4GKK O;  1YXB A;  1VQ7 V;  1FAF A;  2A79 B;  4DR6 O;  4RWU A;  3OTO O;  4JV5 O;  2RNB A;  1NVP B;  5CA1 A;  2ITC C;  3CCQ V;  3RYC A;  4Q6G A;  3JSL A;  1N34 O;  1YZB A;  3RVZ A;  5B1A B;  1I5Y A;  4DV0 O;  2CTW A;  3E83 A;  3ICX A;  4TSF G;  5C8Y A;  1FXK B;  5EYP B;  1Y74 B;  2VS0 A;  1COW G;  1XHX A;  5FPO A;  3E22 B;  4LR3 A;  1P7B A;  1VQ9 V;  2ZD9 A;  4NKG B;  3G67 A;  1SZX A;  2AHY A;  2LW1 A;  4KFM A;  4LF6 O;  4PA4 A;  2RN9 A;  4YHH B;  2AZ2 A;  4X1I B;  4E4E A;  3R65 A;  3AG2 B;  4LFC B;  4DR4 B;  2YC0 A;  4D7S A;  2QSA A;  4DV5 B;  4UVB A;  4JTC B;  1I94 B;  4MVZ A;  3JAT A;  2Y0I A;  2VRZ A;  2R9R B;  2UXD O;  1AB3 A;  5LXT A;  4IT5 A;  1MSW D;  1HR0 O;  2ZR3 A;  2DQ3 A;  1YDX A;  2EIL B;  1YHQ V;  3ZMZ A;  4CC6 A;  4JI5 B;  2M6Y A;  1RPO A;  1Y74 A;  5TIS Z;  1V9P A;  1M5I A;  3OR6 C;  1PP9 H;  1N0J A;  3JAL A;  3G71 V;  1PKX A;  2OYQ A;  1KEC A;  1J5E O;  5LHG A;  5L3G A;  3AG7 A;  3CJH B;  3ZHR A;  1CXZ B;  4B3T B;  4WFE A;  1VQ8 V;  3SPH A;  4UCS A;  2UXC O;  4TOI A;  1E1R G;  2K1E A;  1JR9 A;  2XAQ A;  1XMO B;  2ILM A;  1H2S B;  3H1L H;  3UO2 A;  3U0Z A;  4O4J A;  3SJQ C;  5H9C A;  1N33 B;  4MTF A;  3FKS G;  4TT3 G;  2N74 A;  2BOB C;  2Q7H A;  3JD0 A;  4XDK A;  2DJV A;  3OAA G;  1SER A;  2DYS B;  1MAB G;  1NI8 A;  3VQY A;  4B3S O;  2C2A A;  3K08 A;  1NJI W;  2CDY A;  3AK2 A;  2VWJ A;  3D36 C;  2RQ6 A;  5KHH A;  2LGQ A;  1GN4 A;  3J81 N;  1GN3 A;  4R8C A;  4MW3 A;  2WLI B;  1BQ0 A;  2YIC A;  3DTU B;  1Z5W A;  1I7F A;  1AI4 A;  1MSD A;  2Q7G A;  1L1F A;  1IBL B;  2AGA A;  2W0F C;  4DV6 B;  2UXN A;  5E1A C;  5ITZ A;  1M93 A;  4FFB A;  1VQO V;  3JAK B;  4WFH A;  2F93 B;  1IXB A;  4TV8 A;  5BXZ A;  1RSO A;  3HKD B;  4D7T A;  3CJH A;  4FZ1 A;  3ZHQ A;  3K9S A;  4O2A B;  2UUB B;  5CBH A;  1SA0 A;  4CH3 A;  3CRR A;  3LSS A;  5LBQ A;  2YID A;  3T1H B;  2ZM6 B;  2F66 C;  3KCX A;  3B09 A;  1K5Q A;  1QQC A;  4TV9 B;  4YIP A;  3VQX A;  1F7Y A;  4MVO A;  1N4C A;  4JI6 B;  3MDS A;  5LOV A;  2AZ0 A;  2A9H A;  4LF8 O;  1N34 B;  2XAG A;  3THO A;  3ZHV A;  2Q7E A;  3B77 A;  1AI5 A;  3QNE A;  1NH2 D;  4RUE A;  3DGE A;  1TUB A;  1Y4M A;  2JRI A;  3G80 A;  1NR1 A;  2H94 A;  3ABU A;  3WG7 B;  2HVK C;  2E3C A;  3BCC H;  1WAZ A;  3F5W C;  4X66 O;  3MHS C;  1AIL A;  1YVW A;  3JCZ A;  5B66 Z;  3EVK A;  5LMU O;  5KHJ A;  1LR1 A;  4IL6 Z;  1M56 B;  1P84 F;  3OGC C;  2UUB O;  4N23 A;  3RWR D;  4DK0 A;  2P6J A;  4MVU A;  5BMV A;  2E76 B;  1FXH A;  3ZCC A;  1GRJ A;  4ABM A;  4RUF A;  4TWK A;  1XIL A;  1CPY A;  2HVJ C;  1QBZ A;  4W4L A;  3U10 A;  1WB7 A;  1D5A A;  5CA1 B;  2YDE A;  1VQ4 V;  4B3M O;  5IJ9 B;  2ADQ B;  4DR3 B;  1BHA A;  2GDS A;  5IDJ A;  5H2F Z;  5LYJ A;  1A32 A;  4X88 A;  3JD1 A;  2ZT9 B;  1ORQ C;  4PD4 F;  5KX5 A;  4JI7 B;  4Z2W A;  5LP6 B;  1YSC A;  3CX5 F;  1M57 C;  1SC5 B;  5EC1 C;  3X2Q B;  1W59 A;  1XMQ O;  5LOV B;  3RGB A;  3ABM C;  3CMA V;  3OW2 U;  1JFF B;  4MVR A;  1Q86 W;  4P2Z A;  3VBB A;  1OV9 A;  2ATK C;  1PL0 A;  2Q4P A;  4NXM B;  4JI3 O;  4JV5 B;  4WBN A;  4UVC A;  2DWD C;  3GWO A;  3KZI Z;  5LHH A;  4DUY B;  4PDR A;  4EKW A;  2YXL A;  1XHZ A;  4JI0 B;  3MD0 A;  4YJ2 A;  2DWE C;  5B1A C;  1Q3E A;  4LFB B;  4KHP B;  2JGD B;  5LMN O;  3QO8 A;  5EZY A;  4DV1 B;  1G8M A;  2ZQM A;  1AJQ A;  2LW7 A;  3IGA C;  3RT3 C;  1BHB A;  5KLV H;  2PYJ A;  1X4T A;  1OHH G;  4J7Z A;  2P67 A;  3RYC B;  4PI0 A;  3LNM B;  3CCR V;  2QE7 G;  2UXD B;  1KBH A;  1QHT A;  5IWA B;  1M57 B;  3T4D A;  2K9P A;  5CB4 B;  2N04 A;  3CD6 V;  4YY3 B;  1K4D C;  3LDD A;  1FD9 A;  2IU0 A;  2YIA A;  5DED A;  3OFN G;  4F6E A;  1MA1 A;  4FJC C;  4NXN O;  1G4Y B;  4GKK B;  5HFM A;  3ZJZ A;  1KD1 W;  5LGU A;  2NR5 A;  3K03 A;  2DOS A;  4BR6 A;  4DW0 A;  1LNQ A;  3L73 H;  4MTO A;  3CEI A;  4UV8 A;  1H2N A;  2HJF C;  1RM1 B;  4LFA B;  4TQF A;  2AHZ A;  3H1H H;  4I0X A;  5EIB D;  1YJ9 V;  2Y48 A;  3KKY A;  4O2B A;  2UUC B;  4JI3 B;  4JI8 O;  4FIP C;  4UCU A;  2F4V O;  2XUM A;  3K58 A;  3B4S A;  1IVS A;  2NLJ C;  3JAR B;  3SPJ A;  3O9O A;  4DXW A;  5CA3 A;  1PL4 A;  3CC2 V;  4RQF A;  1XMQ B;  4TUY A;  1FS0 G;  4LF9 B;  2Q0A A;  1KKC A;  2WSS G;  1I94 O;  4OXS A;  2DYR B;  1XI1 A;  2WLL A;  2IU3 A;  4UFZ A;  1N32 O;  1AI7 A;  1KP3 A;  1K8A W;  1XMO O;  4X66 B;  3L70 H;  4JYY A;  1VEW A;  3LSQ A;  2R9I A;  3LSU A;  1K4C C;  2P4V A;  3WFV A;  4DV3 B;  5KHK A;  1I5X A;  4I0X B;  1BSM A;  1SZT A;  2CAZ C;  4FZ0 A;  1R3J C;  4ZHQ B;  3BEH A;  3ABM B;  3JAS A;  3T1C A;  1SQG A;  2BTO A;  4E2L A;  4K8X A;  1GMG A;  2EIK B;  4MW8 A;  1H2G A;  4R6Z A;  4CBC A;  2HLD G;  1OJH A;  2GUZ A;  4GX5 A;  3ZN1 A;  3L71 H;  1S76 D;  1Q90 D;  4PHZ A;  3AG2 C;  1JOY A;  3W7X A;  3DC5 A;  4LCU C;  2B9Z A;  2BSK B;  2R72 A;  3E8G A;  4PEL A;  4JAA A;  5CB4 A;  2XND G;  2UXC B;  4DR2 O;  3HKE A;  4DV7 O;  4K0K O;  1QU7 A;  5LHI A;  2ITD C;  1TVK A;  2E5L B;  1YCI A;  3W7T A;  2X7R B;  2AXT Z;  4I9W A;  1OZ0 A;  2YXY A;  3G6B A;  1WNS A;  4TV9 A;  5B5E Z;  5EK0 A;  3ABT A;  2VQF B;  4MTG A;  1ZUQ A;  4J10 A;  4JI5 O;  1E1Q G;  2GBO A;  3T1H O;  5JWP A;  1I08 A;  2IBZ H;  4YIO A;  3B40 A;  3GWK C;  4K3A A;  4UCT A;  2JDI G;  3RYF A;  3S3W A;  3RN4 A;  2M7W A;  2OT5 A;  4B3R B;  1NU1 H;  3AK3 A;  1Q6H A;  1YJW V;  3IAY A;  3STL C;  2LO1 A;  4BAY A;  3RYH B;  2HHH B;  2UXX A;  3FAV B;  4LF5 B;  1PNK A;  3LUT B;  3L72 H;  4DV0 B;  1QVF U;  2PGG A;  1N36 B;  3QTC A;  4BW5 A;  4O2B B;  2LGW A;  1F4N A;  2Y0P A;  2PF4 E;  4BIO A;  2IJK A;  1BCC H;  1OCC B;  2ETN A;  1JX9 A;  3X2Q C;  1QLN A;  2Q73 A;  1VAR A;  3PJS K;  4X1K B;  4DR1 B;  1XEQ A;  2QWR B;  5H5N A;  4DV4 O;  4QNH B;  3WG7 C;  1GM9 A;  3P30 A;  2A06 H;  3BPZ A;  1IBM B;  5L3D A;  4DV7 B;  4K0K B;  4NTY A;  2YUA A;  1B6Q A;  1K97 A;  5KX5 B;  1WP8 A;  2QWP B;  5JVD B;  5KUK A;  3ETG A;  3WB2 A;  1FJG B;  5J9P C;  4EEQ A;  1TUE B;  2Q5Z A;  2Y69 B;  3GB7 C;  5EYP A;  3A0B Z;  4I7Z B;  1JJ2 U;  5J2U A;  5LA6 A;  3E8H A;  4HZ3 A;  4R50 A;  2IJJ A;  1RSO B;  2ZM6 O;  4MVS A;  1AJP A;  2L35 A;  3ASO C;  1VQP V;  5L3F A;  1SKV A;  2QDO A;  1HNZ B;  2W6I G;  1Q43 A;  1TGO A;  4LF4 B;  3JAL B;  4WFB V;  2DE0 X;  3I56 V;  5EC2 C;  2UUA O;  1TVK B;  3LNN A;  1WA8 B;  2FKX A;  2CUG A;  2XAS A;  5KA5 A;  4H33 A;  4F6R A;  2YIB A;  1IXM A;  4O4H A;  2WWW A;  4N21 A;  5KUM A;  2YS8 A;  1YF2 A;  2WAM A;  2XT9 A;  3ZMV A;  1DGS A;  3K79 A;  3SYC A;  2Q0O C;  3AG1 B;  3P3N A;  5JH7 A;  1Y6X A;  4HAM A;  4CS2 A;  2EZO A;  4LF5 O;  2D3O W;  5EBW C;  5B1B B;  2P22 C;  4PV1 B;  2MK3 A;  3ASN B;  4DR6 B;  1O9G A;  1V54 C;  4WFG A;  3OT7 A;  1MOF A;  4DV3 O;  5JJJ B;  2PZS A;  2NNU A;  3HPL C;  2XTA A;  3JD3 A;  3DSQ A;  3QO5 A;  3TK1 A;  4FM1 A;  2Y4T A;  4LWS B;  1MMM A;  1GN6 A;  4BW9 A;  2QJ1 A;  5E79 Z;  3MAQ A;  1Q7Y W;  2XAF A;  1ZTE A;  4NTW A;  1FFX B;  1MZE A;  1K73 W;  3UT5 B;  4JI2 O;  3JAW B;  5AG2 A;  1ZL8 B;  2EJR A;  4YJ3 B;  2ZE6 A;  4DRX A;  3K0D A;  1F23 A;  2GSM B;  1WP7 A;  3FD9 A;  3JSN A;  5CA0 A;  2HFE C;  2WLM A;  1G6U A;  3CRQ A;  3ZRW A;  1NS1 A;  1HWY A;  4PA9 A;  1GTO A;  4OPH A;  5KMG B;  1Q6U A;  1YTF B;  1N32 B;  2A3Q A;  1WB8 A;  4MT8 A;  3UCS C;  1HNW O;  1VQM V;  4FFB B;  4FLY A;  3U11 A;  3LDE A;  2PUS A;  1YIT V;  2EBO A;  2FL4 A;  5JVD A;  2QM8 A;  3ZBH A;  4CS3 A;  4TV8 B;  3TXQ A;  2FTK A;  2EIM B;  5LL6 Y;  4RAI A;  4YJ3 A;  5ITZ B;  2LP7 A;  1DLB A;  4JI1 B;  1N33 O;  2KG7 A;  4B08 A;  2PYL A;  4MVQ A;  3EFF K;  3CCM V;  2FB5 A;  4CC5 A;  3FB8 C;  4UCO A;  3ZRX A;  1CEZ A;  2YI9 A;  3CXH F;  4IYH A;  1PNL A;  3ZS8 C;  3CE2 A;  5KHI A;  3SDL A;  3SJB C;  4PDM A;  3A2F A;  2A7W A;  2Z3Y A;  1IBK B;  1S3J A;  4H13 B;  3STZ C;  3ZHS A;  1IBK O;  4F6R B;  1J5E B;  2P4K A;  1GK9 A;  1D5N A;  4PDL A;  5D5Q A;  3FFQ A;  2F23 A;  5IWA O;  4ZHQ A;  3ZMT A;  5L3B A;  2HEP A;  5IJ0 A;  1EBO A;  4ZIB A;  1R73 A;  1IX9 A;  1Y76 B;  4CS4 A;  4I4T A;  2B5U A;  3Q4H B;  3G4S V;  3NR7 A;  5JJE B;  3N2G B;  2P5O A;  3BHP A;  1S5J A;  3F7V C;  4FLT A;  3CME V;  2D2C B;  3ZHU A;  1WPB A;  2DQ0 A;  4NXM O;  3OGI B;  3F7Y C;  5KA6 A;  4LF7 B;  4J7K A;  2CGO A;  2WPD G;  3QVN A;  3Q4H A;  3ZMS A;  1H2K A;  4H44 B;  1SQV H;  1YIJ V;  2JJ1 G;  5L3C A;  4DV2 B;  3OUS A;  1ZL8 A;  3B2E E;  1SS3 A;  4DV2 O;  1R6N A;  4JTD B;  5DM6 V;  1IZ3 A;  2PI5 A;  2QR4 A;  4AIL C;  1JVM A;  3UM7 A;  4DYL A;  5IJ9 A;  3OEE G;  1ZX3 A;  1NH2 B;  1AP5 A;  2OCC C;  4IIJ A;  3B8M A;  3SPC A;  2WLH A;  3JAS B;  3L9D A;  4PA3 A;  1XL6 A;  1NTZ H;  1AJN A;  5A9G A;  2DW4 A;  1BZK A;  5CMU A;  4GKJ B;  1XDC A;  1M9N A;  1RP3 B;  1U96 A;  3D8C A;  1OCO B;  2KB1 A;  3FX7 A;  5CN0 A;  5LYJ B;  1NTM H;  4LNU B;  4A5U B;  1WLE A;  1VQN V;  2X6C A;  2OIG A;  1EM1 A;  1O9H A;  4TQD A;  1BGY H;  2V1D A;  2YEV A;  3CCL V;  3PN1 A;  4HNA B;  1T5E A;  3CXC U;  3OEH G;  3K59 A;  3E8F A;  4FM2 A;  5BR8 B;  2JS5 A;  2ZIN A;  1EZV H;  2PTM A;  2QTO A;  1HDJ A;  3CCJ V;  4I4T B;  2EIK C;  1K5S A;  5IY5 C;  2V7Q G;  1PPJ H;  2WA4 A;  1Z5V A;  4JF3 A;  3ASN C;  3JCU Z;  4YXW G;  3H1J H;  3RYI A;  2GTS A;  4WBN B;  1B04 A;  1Q5O A;  1JMK C;  3K5L A;  4L8J A;  2JJ2 G;  1KYO F;  1GH6 A;  4F4L A;  1PV0 A;  1BQZ A;  3CP1 A;  3E8B A;  4X20 B;  4DR5 B;  5GON B;  3ZRS A;  1OCZ B;  4GX1 A;  3JAT B;  2R70 A;  1K33 A;  3TCU A;  4O4H B;  2YI8 A;  2IH3 C;  1R6T A;  1OCC C;  4FPP A;  4DO2 A;  1DTO A;  1KB9 F;  2H3O A;  4FM0 A;  4H0L B;  3ABK C;  4JI1 O;  2JIZ G;  5EBL C;  5C8Y B;  2NN4 A;  5IT9 N;  3AK1 A;  3JAK A;  2QA4 V;  4RQE A;  4UUJ C;  4R7C A;  1F51 A;  1RFY A;  2YEV B;  1V55 C;  1LUW A;  4KL1 A;  2GTA A;  1JJO A;  1XBL A;  4TUY B;  4RO2 A;  1SET A;  1QVG U;  3K06 A;  1M1K W;  1L8D A;  4BIZ A;  2ZE8 A;  3CCE V;  2CTQ A;  2WA3 A;  2FYU H;  3D3I A;  1SES A;  4DRX B;  4UXN A;  1NTK H;  4OPA A;  4OGQ B;  2HR3 A;  4NB5 A;  3QO7 A;  4AI8 A;  2QM4 A;  1QR8 A;  1VF5 B;  5IYZ A;  1Q82 W;  4FLW A;  2ODM A;  4EB6 B;  4LH7 A;  2W6J G;  2LFS A;  5FNV A;  3R66 A;  1JPX A;  1GO3 F;  5LMN B;  3WB0 A;  3FYE B;  3DXR A;  5DEC A;  1B3Q A;  2V4D A;  2QWN B;  3T1Y B;  3CRM A;  2UXB B;  2ZR2 A;  4GUN A;  3KG2 A;  1GN2 A;  3T2M A;  4JI0 O;  2KKW A;  2Q9L A;  2F1M A;  3ETD A;  4PJ0 Z;  5EIB C;  4DR2 B;  1VQ5 V;  4DV6 O;  5B1N A;  3SJC C;  4WFA V;  3BAA A;  4X62 O;  1AR1 B;  5K1P A;  1OCO C;  4EB6 A;  4GX0 A;  1ENV A;  3ASO B;  1BS3 A;  3ABK B;  3K5N A;  5IYD O;  5KAF Z;  4FLV A;  2JK5 C;  2Q69 A;  4U7O A;  4W4K A;  2VQF O;  3HKD A;  1JCH A;  4G27 B;  2E74 B;  4X8A A;  4JAV A;  2MW2 B;  3AG3 B;  5GTI Z;  5JCO A;  2F95 B;  2X6A A;  4Q20 A;  4PDV A;  1P49 A;  2Z0A A;  4BWA A;  3FB7 C;  5FL7 G;  1M4U A;  3C3T A;  4KXR A;  2BE3 A;  5L3E A;  4FFK A;  4I50 A;  2Z5U A;  1FXK C;  3RFR A;  1ZWI C;  2IJI A;  3ZHT A;  2VQE B;  3HKB A;  4JAS A;  5H6Q A;  2IJH A;  1N36 O;  4NTX A;  2QWQ B;  3SJA C;  1R3K C;  4B3T O;  1US6 A;  2BSK A;  4J9Z B;  4JTA B;  4AQY B;  4LF6 B;  3QG5 A;  5F2V O;  1EN6 A;  1J95 A;  1S5L Z;  3H1K H;  3AG3 C;  5LMU B;  4GKJ O;  3BA8 A;  2GUZ B;  4X20 A;  3M7M X;  3HKC A;  3OE7 G;  2WLJ A;  2Q68 A;  3UQ8 A;  2QWO B;  1FXK A;  1Q6I A;  1QLE B;  1HNW B;  4YHH O;  4QE7 A;  3H01 A;  4CH5 A;  1ARO P;  4IHJ A;  4MS2 A;  1MG1 A;  4GYC B;  1CP9 A;  4HYO A;  2XHB A;  1KKD A;  4GZR B;  1W0J G;  1KUQ A;  4JGS A;  3DC6 A;  3UO3 A;  5KAI Z;  2RCV A;  2YIB D;  3UT5 A;  2P90 A;  3IFX A;  3CC4 V;  1XNQ B;  1WPX A;  5LGT A;  2VQE O;  1I0H A;  3FAV A;  1VF6 C;  5LA6 B;  3SYO A;  2JGD A;  4LFA O;  1OCR C;  3M8A A;  4G28 B;  5CBG A;  2ZNJ A;  3UKM A;  4ZOL B;  5GTH Z;  3OMN B;  1SQF A;  5K1X A;  5C93 A;  3AG4 B;  4JI8 B;  2ZNI A;  2EIN C;  2QKA A;  4LF4 O;  2WLK A;  1THZ A;  2L6L A;  1VQ6 V;  3OM3 B;  3OTF A;  3K57 A;  4G2K A;  2QTS A;  3P3P A;  4CZZ A;  2EIJ C;  4X64 B;  2CTP A;  1RM1 C;  5LP6 C;  4MVM A;  5LXT B;  1VIB A;  1U97 A;  3N27 A;  2P06 A;  2HHH O;  1D2D A;  3P32 A;  4B7K A;  3AEI A;  2EX3 A;  2GV9 A;  2LJ2 A;  4QGP A;  3HB3 B;  1OCZ C;  2ZDI C;  3A0R A;  3IJ4 A;  1R1B A;  1IBM O;  2XAH A;  3RYI B;  4KHP O;  2LQT A;  4IGG A;  1YEW A;  3E22 A;  3AG1 C;  2BTQ B;  1NR7 A;  1Z2G A;  1SQQ H;  4YJ2 B;  2LFR A;  3T1Y O;  1B06 A;  2YXH A;  4JI4 O;  2ZDI A;  4LC1 A;  5A2Q N;  4LF7 O;  2A0L A;  4Z1V A;  3F5T A;  1K7D A;  3IC9 A;  3SPG A;  2OIE A;  3N2K A;  4ICG A;  4J7J A;  2QEX V;  4DV1 O;  1VQL V;  4O2A A;  4LNU A;  4I9Q A;  1Y76 A;  4QIW F;  1R6K A;  2JS3 A;  3RYF B;  3BA9 A;  3CCU V;  5FLX N;  1PM9 A;  5JQG A;  4DV4 B;  2ARH A;  4LH6 A;  3TJT A;  4JYB A;  2FML A;  1ZSP A;  3WB1 A;  1KC8 W;  3OTO B;  1LUV A;  4ZBM A;  1FFT B;  4JZG A;  3CRA A;  1WJZ A;  4H37 A;  4DUZ O;  2OTL V;  1VF6 A;  1XL4 A;  3ZMU A;  1XNR B;  1AR4 A;  4I50 B;  1WN7 A;  1HNZ O;  1NT2 B;  4B7E A;  2N05 A;  4IYI A;  1SQP H;  1Y66 A;  4NR1 A;  1Q8I A;  4CH4 A;  2KG7 B;  4KUM A;  2AW9 A;  1N8R W;  5JQG B;  5KMG A;  1FPO A;  3VQV A;  5IYC O;  3KCY A;  3VOU A;  4J11 A;  1UFI A;  4O4L B;  5IYB O;  4OX9 O;  4ZI7 A;  1JQ0 A;  3S3X A;  3ZN0 A;  2OWO A;  4FK5 C;  4X1Y B;  4JYA O;  4LF8 B;  1F4M A;  1H8E G;  1TAE A;  2Q6A A;  3N2G A;  3W7U A;  4DR5 O;  4O4J B;  4LP8 A;  1G1X B;  4JAU A;  1P4R A;  4HNA A;  1PNM A;  5EZY B;  3JAW A;  1EN4 A;  1KQS U;  3RBZ A;  3H1I H;  4GLX A;  3K0G A;  1URF A;  2ZKO A;  5KHG A;  3CS5 A;  4X1Y A;  1DF4 A;  1K9M W;  1AVM A;  2KQX A;  4XDJ A;  5B1B C;  4UB6 Z;  2PY5 A;  1HP8 A;  4O4I B;  3E2E A;  1EFR G;  1OCR B;  1BE3 H;  4QE9 A;  2OTJ V;  3EXA A;  4ASU G;  2E75 B;  1XQ8 A;  4GX2 A;  4JI4 B;  3VQW A;  3T4Z A;  1UPG A;  3IC7 A;  4QPJ A;  4ZI7 B;  5EBM C;  4LBE C;  4U3F H;  5GON A;  4UCR A;  3I55 V;  4EFB A;  4J9Y B;  4AQY O;  1HNX B;  2HJD A;  1NBM G;  4GT1 A;  4OX9 B;  1KU9 A;  3J80 N;  2VWK A;  2YSU B;  2ADP A;  1DF5 A;  3N2K B;  4P9P A;  4D6T H;  4I55 B;  3E86 A;  3OR7 C;  3CRC A;  1K3E A;  2ZIM A;  2CH7 B;  5CA0 B;  1M90 W;  1XNR O;  1H2L A;  3BFR A;  2JEU A;  3ETE A;  1NKD A;  2EIM C;  2IW5 A;  2JVD A;  1XRE A;  3FB5 C;  1KP2 A;  4ZKI A;  3HKC B;  4QPK A;  4DW1 A;  1S77 D;  4O4L A;  5IJ0 B;  2ZIO A;  4XDL A;  1FKA O;  3CCS V;  4MTX A;  2ZE7 A;  4FLZ A;  3D36 A;  1L0N H;  2DYR C;  1UJW B;  1W0K G;  2CH7 A;  4FVM A;  2W0X A;  2OCC B;  2QKS A;  3SYA A;  1ROP A;  4J80 A;  4JI6 O;  3QF7 A;  2UXB O;  2CE4 A;  1ZLZ A;  4L87 A;  2PI4 A;  1NQT A;  3SPI A;  3CPW U;  2BOC C;  3K5O A;  1M56 C;  4LWS A;  3SYQ A;  3JAM N;  5FPR A;  5BY1 A;  3OMA B;  5GW7 A;  5D5P A;  4NVP A;  1TUB B;  5IY5 B;  2IH1 C;  3M99 B;  4PA7 A;  5IYZ B;  2B1G A;  4FLU A;  1KMI Z;  1AI6 A;  1MZF A;  4DR1 O;  1VMG A;  3A0H Z;  2R9A A;  2RMK B;  3HKB B;  5LP6 A;  4B3S B;  3CYO A;  2CTR A;  2UU9 O;  2Q8V A;  2X0L A;  1AR5 A;  1K92 A;  3CCV V;  1HR0 B;  2ZE5 A;  3BAB A;  1XUQ A;  5J2T A;  1FJG O;  4FLX A;  4CH6 A;  1XNQ O;  3BRC A;  1GM7 A;  2RJZ A;  3WU2 Z;  1FFX A;  3FB6 C;  1FXV A;  3MHH C;  1SRY A;  3JD4 A;  4HBN A;  2IM9 A;  2Y4U A;  1L0L H;  3L75 H;  4UV9 A;  1QNM A;  3K9A A;  4P9O A;  3W7S A;  3C90 A;  4K35 A;  1JA8 A;  2CK3 G;  4PA6 A;  3NXS A;  2WLN A;  1H2M A;  3CWB H;  4DR3 O;  2BTQ A;  1SQB H;  4WCE V;  3SYP A;  2JEX A;  1EN5 A;  3BY6 A;  3CC7 V;  4XBF A;  4LFB O;  5CBF A;  3B8N A;  2DN9 A;  4J41 A;  3ABL B;  2JGU A; 
#chains in the Genus database with same CATH homology
 1NU1 H;  3H1K H;  1NTM H;  3L71 H;  1SQQ H;  1L0L H;  3L75 H;  4U3F H;  3BCC H;  1SQV H;  4D6T H;  2FYU H;  1PPJ H;  3L73 H;  1L0N H;  1NTK H;  3L72 H;  1BGY H;  1NTZ H;  1SQP H;  3H1L H;  4PD4 F;  3H1J H;  1PP9 H;  2BCC H;  3CWB H;  1SQB H;  1SQX H;  1BE3 H;  2IBZ H;  3L74 H;  3CX5 F;  3H1H H;  3TGU H;  5KLV H;  1P84 F;  2A06 H;  1EZV H;  3H1I H;  3CXH F;  3L70 H;  1KYO F;  1KB9 F;  1BCC H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...