1L0LH

Structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
78
structure length
78
Chain Sequence
GDPKEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
total genus 23
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1l0lH00
2A06H 4D6TH 1KB9F 1L0LH 3CWBH 3L75H 4PD4F 2FYUH 1SQVH 3L74H 3H1IH 1PP9H 1SQQH 2BCCH 1BE3H 4U3FH 1BGYH 3H1JH 1KYOF 1BCCH 3L73H 1NTKH 1L0NH 1SQBH 3H1KH 1P84F 2IBZH 1SQXH 3CXHF 3L70H 3L72H 1EZVH 3H1HH 1SQPH 1PPJH 3L71H 3TGUH 1NTMH 3H1LH 5KLVH 3CX5F 3BCCH 1NU1H 1NTZH
chains in the Genus database with same CATH superfamily
1JQ0A 5C8YB 4J9YB 1IXBA 1BSMA 4NB5A 2RJZA 4LF5B 5K1XA 5LOVA 4YHHB 2RMKB 1TVKA 1YTFB 1OCZC 3UCSC 3D8CA 1KU9A 4DR2O 1ZX3A 4OPHA 3AG4B 3E89A 5EZYA 3UT5B 5KA6A 4JI7O 2LGQA 1ZL8B 2BTQB 1SQVH 1OCRB 4FM2A 4UCOA 5LGNA 2ZR3A 4LR3A 3OTOB 1SETA 1IBMO 4NTXA 3ZIAG 1MMMA 1UJWB 4KHPO 3W7SA 2DYSC 2EJ7A 1W2BU 2ZKOA 4JZGA 4O2BA 3ZCCA 4I5SA 4JPRA 4JI0B 3ZRXA 4J7KA 5A9GA 2QM4A 4JI8O 5JWPA 3B40A 2Z5UA 4U3FH 3J81N 2ADQB 1FFTB 3OAAG 3ABTA 1HNZO 3MAQA 2YICA 1Q81W 3ETDA 4FLUA 3CS5A 2WWWA 1GM7A 4IYHA 4FM0A 4MVRA 2HFEC 1S72V 1TUBA 2VRZA 3C3SA 3F7VC 2ZE5A 1DGSA 1EM1A 4F6EA 3JD2A 2A06H 5BZBA 1VQ9V 1CEZA 2OCHA 4G28B 1DK1A 1K73W 2RCVA 4LH6A 1JFFA 2E5LO 1H8EG 2UUCB 2P5OA 3R65A 2KG7A 3ZHQA 2IJHA 4X66O 2WLIA 5CA0B 3ZHRA 3OTFA 4WFFA 4EB6A 1FFXA 1FXKC 3AG1C 4CZZA 2P67A 2VQEO 5ITZA 1SQPH 1A32A 2F95B 2QR4A 4B3MB 4TQDA 1XNQB 1AI7A 4QNHB 4UUJC 5E1AC 2Q9LA 1IZ3A 4QGPA 3FYEB 3MDSA 1D5NA 3WB1A 4YJ2A 2A79B 4MVZA 3O9OA 3S3WA 3OUSA 4MVUA 2Z0AA 3EFFK 4IHJB 1VF6C 3TXQA 5BY1A 4DV1O 1KP2A 2XHBA 4LF4O 1BE3H 4DR5B 4IT5A 4MW3A 4LFBB 4F6RB 3E22A 1MABG 3DGEA 4MVQA 1N36B 3X2QC 3P3PA 5J2UB 2EIKC 1Q6IA 3NXSA 3TK1A 1K4DC 2ZM6O 3F7YC 3JD1A 2FTKA 1NQTA 5IDJA 3CWBH 4B3TO 1KUQA 4PA4A 2CTQA 1WA8B 2PYLA 3DC6A 4CS4A 4GKKB 1PD3A 3BRCA 3RYFB 2QEXV 3B09A 4O4IA 1PNLA 1MNGA 2RDCA 4LWSB 3A0HZ 4LBEC 1QLEC 3HR0A 1AJQA 1P4RA 3ETEA 1XMQO 3UKMA 3AG4C 4GX0A 4U3JB 5GW7A 4H0LB 3RYIB 4YIOA 4EFEA 3G6EV 3PN1A 4O4HA 4Q20A 1HP8A 4X88A 1BQ0A 3B4SA 2JRIA 2XAGA 3JASA 4FZ0A 2RN9A 3ZMVA 1YI2V 3AEIA 4MT8A 3ZRWA 2LQTA 2W0XA 3JCZA 2M6YA 2NNUA 2Q8VA 5EYPB 1IBLB 4CH6A 3BHPA 4BR6A 4IYIA 4A5UB 1R1BA 4B7EA 4I4TA 2WA3A 1W0JG 1KD1W 2R9AA 5LMNO 1Q5OA 2CGOA 3GWKC 1W0KG 3M99B 1M5IA 1YDXA 4J7ZA 5KHKA 5KMGB 5LMUB 1NKDA 1XILA 1HR0O 3ICXA 5CA3A 1R6NA 3S3XA 3AK3A 1IURA 2JGUA 2JEXA 2ZNJA 1M56B 4WF9V 4LC1A 2LP7A 1M90W 4YIPA 3WU2Z 4PA3A 4H44B 3LDEA 1L0LH 2ZXWB 3D3QA 5LP6B 1JJ2U 4UV9A 3L9DA 3JAKA 4UCVA 3RT3C 3D36A 3T1HO 1QR9A 3ZX6A 2CAZC 3ASOC 5LXTA 3LNNA 3WG7C 2OIEA 1AJNA 3L75H 4MVOA 3SPCA 1OCCC 2JIZG 2LJ2A 4BIZA 2F43G 3E83A 1R6KA 1EFRG 1IBKB 2E76B 3AG3C 3OM3B 2OCCB 3ABUA 3H1KH 3CPWU 2Q67A 3T1YB 1P49A 3JATB 1I0HA 3WFVA 1IX9A 2PF4E 5L3FA 5BR8O 2ZDIA 5B1AC 4TV8A 3EHBB 5KLVH 4Q6GA 4AQYO 2P4VA 2ZR2A 4U7OA 3ZHSA 5H2FZ 5FNVB 3E86A 3UO2A 1VQNV 2C2AA 2WLLB 3SJCC 1VQ7V 3QO8A 1THZA 2LFRA 2QJ1A 2IBZH 5IJ9B 4PDVA 3G80A 4XDKA 5IY5B 2EZOA 5CB4A 4LP8A 3K59A 2IU3A 2KQXA 4B3SO 2HR3A 2IU0A 3T2MA 4YJ3B 1FJGB 2BOBC 2DN9A 4X64O 1I5YA 1PP9H 3G67A 1N32O 3L73H 2XAFA 3DTUB 5GONA 5JVDA 4DUYO 4WBNA 5IWAO 1HDJA 1Q7YW 3DXRB 4ZHQB 5LYJB 5JQGA 1V9PA 3ETQA 4FZ1A 4JF3A 3F5TA 1Q6UA 3STZC 1JR9A 5CMUA 1US6A 1AB3A 1AP5A 2X7RB 4K0KO 3W7TA 4JYAO 3CJHA 4ZOLB 4BAYA 4DV7O 1XMOB 2ZE7A 4JI6O 2GV9A 4NYKA 2UXNA 2XT9A 1FXKA 3LSQA 4MTGA 2EIJC 1SQQH 1YIJV 1GMGA 1NH2D 3C3TA 3QVNA 1PNMA 2JVDA 1E1RG 2GHYA 4LFCB 4UCUA 3L71H 3JAWA 1K92A 4EFBA 3JARA 1NU1H 5DECA 2WLHA 3CCUV 4OXSA 3P3NA 4DUZO 1M56C 3HKDB 1ROPA 1WP7A 4GLXA 1HW7A 5GTHZ 3I55V 3H1JH 4LF8B 1VF6A 3CRMA 2Y48A 5LP6C 3CCLV 2LGWA 2HP8A 4AILC 5H6RA 1YHQV 3IFXA 1FD9A 1NTMH 5CA1B 4GKJO 2JGDA 4F4LA 5JH7B 4CS3A 3ZMZA 2YXHA 3A0BZ 2W6JG 2D2CB 1S76D 2UXDO 2QTOA 1N33B 4DV0O 2HHHO 4RQEA 4LF7B 1VARA 2OCCC 4PJ0Z 1Y66A 3BABA 1K8AW 4OGQB 2HJDA 4DR6B 2JEUA 3ZHVA 3ABKC 2PGGA 4CC5A 3C90A 4QPJA 1NH2B 1YCIA 2CUGA 3Q4HA 2EILB 1VQ4V 2CH7B 4JI0O 2ATKC 4LFAO 2ZQMA 1P84F 3CHXA 5IYZA 3QG5A 4KP4A 3QTCA 3E8BA 2A9HA 4HYOA 1G8MA 3LDDA 5IY5C 4DR3O 2B1GA 3JCUZ 1BS3A 3K9SA 2VS0A 5EK0A 1ZUQA 1ZSPA 1Y76B 2B1IA 5EBWC 4G27B 5KX5A 5IJ0B 5CN0A 1WB8A 3KZIZ 4TSFG 3JALB 2BSKA 4HNAA 1NJIW 5L3EA 2R70A 2YC0A 4XDLA 5JJNB 4ZI7A 5B3SB 5HFMA 5FPRA 4B3MO 1FYJA 1XNQO 5IE9A 2XNDG 1VQ6V 4D7SA 4ZIBA 1WJZA 2DYRB 3E8FA 5EC2C 2OTLV 2YEVB 4Z1VA 1SS3A 3M8AA 2XTAA 5KAFZ 3OEEG 4P9PA 5D5PA 1QLNA 1QCEA 1MZFA 1SQGA 5IYDO 1LUWA 4RUEA 2R9RB 2PTMA 3BAAA 3K03A 3ZHUA 1VQ8V 3OE7G 1V55B 3QO7A 2AHZA 3HKEA 5J2TB 2ZINA 2VQFO 4FFBB 3JD0A 1DF5A 1PM9A 4DR5O 3VBBA 3ZS8C 3KKYA 4DR7B 1SKVA 2VWKA 5KHHA 2B9ZA 1N36O 4O4LB 3ZEDA 1M57C 5DEDA 1RSOA 5H6QA 1CP9A 3CE2A 4DV6O 5GTIZ 3A2FA 3G6BA 1AI5A 5A2QN 4O2AB 2YIBA 3ML0A 2WAMA 4JI4O 4DV4B 2IJJA 2EX3A 1Y67A 2H8PC 4LF6O 3P32A 4GKKO 2A7WA 2RNBA 4YY3O 3FB7C 3B8NA 1K9MW 4IGGA 4OPAA 1MG1A 2GBOA 2UU9B 3AK2A 4DV3O 3IGAC 4NXNO 1HNXB 1K97A 4TUYB 2WSSG 4HBNA 2CTPA 3ZMSA 1ZTEA 2UUBB 5B1NA 3H1HH 1WB7A 1Y74B 2YIBD 2Q6AA 1XQ8A 3ABLB 1V54B 4YXWG 1L1FA 1NS1A 2JJ1G 3SYQA 1AR5A 1QQCA 1N0JA 1M9NA 4JYBA 5CBFA 4N21A 4FJCC 2EILC 3HKBA 3L70H 1IXMA 3SYCA 3WB0A 4I55A 5LHHA 4B3RB 1F23A 1SZTA 1PKXA 4QE7A 4FVMA 4DW1A 1BZKA 1K3EA 4XBFA 2P90A 4P2ZA 1S5LZ 1PL0A 4GZRB 2OYQA 2UXXA 5LOVB 1WNSA 4MS2A 1TVKB 4LNUA 4FLVA 2F4VO 1GN3A 2RQ6A 5EZYB 4JI2B 1O9HA 2MK3A 1F4NA 3ZHTA 2HVKC 4B7KA 2YI8A 3SPJA 1SA0A 1TA8A 1BHAA 1FS0G 2AGAA 4MTOA 3OGCC 2JS5A 4MSWC 4I9QA 1GN6A 1YJWV 2DYRC 1SERA 1HWYA 2GTAA 4O2BB 2EIMB 3IAYA 2V7QG 1LNQA 1XNRO 2Y69B 5LGTA 4DR4O 4ASUG 3CEIA 1KP3A 2P22C 4DR2B 4CS2A 3RYHA 1IBKO 3CRAA 3ZN0A 1RM1B 2K9PA 1Q6HA 2UUAO 1QVFU 4JI7B 1QHTA 2YXYA 2F93B 4JI3O 1TUBB 3SYOA 3SGIA 4FLWA 3K3WA 1S5JA 3W7WA 3HKCA 3MD0A 3T4ZA 2Q7HA 1Z5WA 1JFFB 1U96A 1F51A 1XL6A 5BMVA 1N0NA 1OCRC 1VQOV 4J11A 2WLIB 1R6TA 4JI8B 3ABMB 4BW5A 4EB6B 4J42A 1FFXB 4X65O 3K0DA 4I50A 2Z3YA 2NR5A 1R73A 3N2KA 2K1EA 3K58A 1YSCA 3E8GA 2HLDG 4JV5B 3APQA 4ICGA 3THOA 3RYCB 5EIBD 2PY5A 1NTKH 1GN2A 1EN6A 1SQBH 4DK1A 4UCTA 1KMIZ 1AI6A 1SC5B 2F1MA 4ZKIA 3O65A 4YJ2B 3K06A 4DR1B 2XAJA 3U0ZA 4X1KA 4R7CA 2E5LB 4UB6Z 2UXCB 4XDJA 4X66B 1KKCA 4B08A 1NR7A 3N2GA 2X6CA 5BXZA 2CE4A 3E22B 5H5NA 4RAIA 4O4JA 1X4TA 4PHZA 4TV9A 1OCOB 4NXMB 2PYJA 4GYCB 3QF7A 4IIJA 2IH1C 3I56V 2E75B 2IH3C 3BVOA 2ITDC 1XBLA 4X1IA 4TT3G 1SQXH 3H9VA 4CH3A 1H2GA 1NBMG 4X20A 4DV1B 1M1KW 1RPRA 2GUZA 1K4CC 2YIDA 2NN4A 4WFGA 2YI9A 4LF4B 1VP7A 1GKFA 3BFRA 2A0LA 4LFCO 1B06A 1EN4A 4O4IB 5KUMA 2PZSA 4MVSA 2Q0AA 3J80N 4X1YA 2D3OW 4P30A 3PJSK 3B8MA 2XOKG 4BIUA 4WFAV 5CBGA 1JMKC 2ZM6B 4LF8O 3CMEV 3SPGA 3OMIB 1OJHA 1PNKA 4B3TB 3SJAC 2Q7GA 3VOUA 1VQ5V 1KC8W 1G1XB 3JASB 2EINB 1J5EB 3LUTB 3ZRWB 1NVPD 5FLXN 2Q4PA 1WN7A 2JS3A 3FD9A 1XMQB 2WLJA 1BQZA 1X59A 3HB3B 1N33O 2A3QA 4X62O 1AR4A 4JI5B 1I7FA 2X6AA 4R6ZA 4DR6O 4I4TB 3STLC 2HKOA 1FKAO 5IT9N 4OX9B 3FB5C 2DWEC 4N23A 3E35A 1MA1A 2EJRA 4I0XA 4DW0A 3CYOA 3CMAV 3OR6C 4GUNA 2G38A 4FIPC 2QE7G 4JI1O 3AG2B 4KXRA 3ZMUA 3B77A 1N34B 3ABMC 3BEHA 2Y4TA 3JSNA 3KG2A 3CC7V 1HNWO 5LA6A 2DJVA 3SJBC 2QA4V 4DRXA 3DC5A 3UO3A 3LSUA 4K8XA 1I94O 3APOA 1Y6XA 4JZ2A 4MVMA 1H2SB 5LMNB 3JAKB 4UFZA 2QWNB 2Y0PA 2ARHA 2EZPA 4HZ3A 5LXTB 3EVKA 3K5LA 2R9IA 2ZIMA 1VMGA 2ETNA 2ZE8A 2N74A 3CCEV 1YJNV 4RUFA 2VWJA 4TV8B 3AK1A 1QNMA 3SDLA 1Y76A 3VQXA 1OCZB 1Q43A 1OCOC 3P30A 1S77D 1SQFA 2GSMB 2ZXWC 2P7TC 2QM7A 4WCEV 4TQFA 1RP3B 4UVCA 4DYLA 1GH6A 3RBZA 4LH7A 3IC9A 4LF5O 1Q3EA 2PI5A 3JAMN 4YHHO 4NR1A 4H13B 5CB4B 3BY6A 1RFYA 3FAVA 1O9GA 2FYUH 3CC2V 3CCMV 2QKSA 2DYSB 3FB8C 5BR8B 4X9QA 1GK9A 4AQYB 2DWDC 1H2NA 1QU7A 4X8AA 5KA5A 5GONB 3OTOO 5JVDB 2FKXA 4WBNB 5KHGA 4R8CA 4H33A 2UXBB 5C8YA 3QNEA 2XAHA 2W6IG 5HFLA 4GCZA 1XL4A 4LF9B 3SPHA 3CCVV 5JQGB 5J2TA 1T5EA 1VIBA 1XHXA 4FMTA 2ZNIA 2ODMA 3ETGA 3OMNB 4QIWF 4RWUA 3UM7A 3TCUA 1FPOA 4UCSA 4PI2A 2EINC 4X64B 1HNXO 2BTOA 3CJHB 3UT5A 4UXNA 1JCHA 4UVAA 1N32B 1ZL8A 2BTQA 3OUFA 2UUBO 1UFIA 4K35A 2LW1A 2N05A 4DUYB 1FXKB 1JPXA 1OHHG 1GO3F 1NI8A 2KB1A 1E1QG 2LW7A 2DMXA 3MHSC 1YTFD 2UUCO 2QM8A 4DV5B 1SRYA 4GX5A 3SYPA 3U11A 3JAWB 4JGSA 4K0KB 3NR7A 3JARB 2HJFC 3AG2C 4DV7B 2Q7EA 3D3IA 4PDRA 1YITV 2CK3G 4JI6B 2ADPA 4D7TA 1URFA 2R72A 4MTXA 4LCUC 2B5UA 3B2EE 4Z1MG 3A0RA 4G2KA 2WPDG 3K9AA 1TUEB 4X89A 2F23A 2JGDB 3GB7C 4J9ZB 3D36C 3IJ4A 4DXWA 1BGYH 5CA0A 3X2QB 5IYCO 1DTOA 1J95A 1H2KA 1RPOA 3CXHF 5C93A 5L3GA 3FKSG 2YUAA 4LFBO 4DUZB 4KFMA 3K0GA 3OEHG 4L87A 2X6BA 4BIOA 3ZBHA 1S0VA 4JYYA 3ZN1A 1K7DA 1JOYA 4CH4A 2ZDIC 4QJFB 3Q4HB 2HVJC 4GKJB 4IHJA 1NT2B 4HAMA 3T4DA 1QLEB 3BA8A 4QE9A 1H2LA 4UCRA 5EBMC 5IYZB 3JD3A 2ILMA 2UXDB 2LO1A 5H9CA 4W4KA 4DV0B 4F6RA 2HHHB 1K34A 1DF4A 5B66Z 3OR7C 2YIAA 4PI0A 1Z2GA 5LHIA 5J2UA 4Z2WA 1YVWA 2CTWA 2O57A 2AHYA 1PPJH 1WPBA 1QR8A 5KX5B 3G4SV 2HG5C 4NVPA 4E2LA 1YJ9V 4LFAB 2BSKB 1H2MA 3RFRA 5LGUA 1WA8A 3ZRSA 4HNAB 5J9PC 2Q0OC 2BOCC 1R3LC 2QWPB 4ZI7B 2QWQB 3CP1A 5B5EZ 2Y0IA 4NKGB 4JV5O 3RYFA 4DR3B 1JX9A 1KECA 2HEPA 4DO2A 2FMLA 2WA4A 4LWSA 5B1BB 1DLBA 3SR2C 2ZD9A 1IBLO 4D6TH 3CCQV 2L6LA 4DR1O 3OGIB 4NTWA 3RW0A 4U3JA 2UXCO 3RYIA 1XOUA 1NR1A 2QWOB 1B3QA 3HKEB 5EC1C 1AP6A 4U7NA 1P7BA 5LMUO 3I5DA 2QKCA 1GM8A 1NTZH 3LSSA 1TGOA 4TWKA 2Q5ZA 2IM9A 2E74B 3RYCA 1SESA 1XDCA 5CBHA 3K5NA 3HPLC 4DV2B 3CRCA 4NXMO 1RSOB 1Q82W 5K1PA 3JYCA 1L0NH 2YS8A 1CPYA 5EYPA 1G4YB 2ZIOA 5B3SC 4I7ZB 3ASOB 2KKWA 3WG7B 1GRJA 2GTSA 5JJEB 1OCCB 4C7UA 2F66C 3K04A 2GDSA 3ZRVA 4EKWA 2DE0X 4I9WA 5LBQA 3AG3B 3OMAB 3RN4A 2VQFB 4JAVA 1Y4MA 5KMGA 1ZWIC 2N04A 3CC4V 5B1AB 3FX7A 4JTCB 4QPKA 1V55C 3TJTA 1K5QA 2X0LA 3UQ8A 4PELA 4DV6B 3T1YO 2P6JA 3CCSV 3SPIA 1IBMB 5LP6A 3FYIB 1EN5A 4JI4B 1VQLV 4FLYA 4KHPB 3CD6V 4LF6B 2Q68A 1SZXA 4WFEA 4YY3B 2KG7B 2YXLA 4UVBA 4NTYA 1J5EO 2JJ2G 3HKBB 3TGUH 1IVSA 2PI4A 4DV3B 4NXNB 4I55B 5ITZB 1HNZB 1AR1B 3OD4A 3K08A 1XUQA 3F5WC 5JJJB 1BT8A 4JI5O 1WPXA 3JATA 2LFSA 3CCJV 1FJGO 1Z5VA 1CXZB 4IL6Z 1AJPA 4OX9O 1BHBA 5TISZ 4FM1A 5FNVA 4KL1A 4LNUB 2OIGA 3VQYA 1H8HG 1ORQC 2WLLA 3GVMA 1NZ6A 1F7YA 3KCXA 5DM6V 4FLZA 2AZ0A 4AHCA 5IJ9A 1FAFA 1N34O 1FXHA 5LHGA 3OW2U 2VQEB 3ABLC 5IYBO 3OFNG 4H37A 1EBOA 1SA0B 1V54C 3K57A 4JTDB 1E79G 2IJIA 4J7JA 4JTAB 2EIJB 3FFQA 4YJ3A 4JYCA 5JCOC 2V4DA 2QKAA 3L74H 1XMOO 1I08A 3K79A 5B1BC 3ASNB 1GAXA 3CRRA 3E2EA 3BPZA 4ABMA 2DQ0A 2F4VB 1KQSU 3DXRA 2V1DA 2OTJV 3RYHB 5LYJA 4ZHQA 1VQMV 2P4KA 3A8TA 1R3IC 3CXCU 2BE3A 5EBLC 5L3CA 3OT7A 1BMFG 1VQPV 2QSAA 3HKCB 4ZOLA 1MOFA 4UV8A 4R50A 4K8ZA 1YXBA 3BA9A 3J7AU 1R3KC 2AXTZ 4K3AA 5BMVB 5KHIA 2DW4A 1XNRB 1EZVH 4GX2A 4DR4B 2DQ3A 1S5HC 2W0FC 1M93A 4O4HB 4FK5C 4I50B 4CH5A 3M7MX 5KAIZ 4E4EA 3N2KB 2UUAB 4WFHA 2Y4UA 2EIMC 2EULA 2EBOA 2Y69C 3ABKB 4JI3B 4PA9A 3SYAA 3W7XA 3AG7A 1OZ0A 3H01A 4W4LA 3K5MA 2KSDA 2QDOA 4RO2A 1VF5B 4PA6A 1RM1C 3LDCA 4LF7O 3HKDA 1YEWA 4X1KB 1SF9A 2UXBO 4L8JA 4LF9O 3JSLA 2NLJC 4X65B 3FB6C 3N2GB 4MTFA 3K5OA 3RVZA 5CA1A 2L35A 3ZJZA 5JH7A 2JK5C 4PDLA 4O4JB 1LR1A 2M7WA 2XAQA 4CBCA 5L3BA 1VEWA 2CDYA 4TV9B 5LL6Y 1K33A 4PD4F 3TXSA 5AG2A 1XHZA 2Q69A 1D5AA 4IIJB 1Q8IA 3E8HA 1M4UA 4X1IB 2FL4A 3DSQA 2OT5A 3LNMB 2DOSA 1Q90D 5L3DA 4X20B 2GUZB 1P7GA 1ZAUA 3CSXA 3SJQC 1WAZA 1HR0B 1I5XA 4TOIA 4DV5O 2CH7A 3H1IH 1GM9A 2WLKA 3VQWA 4RQFA 1NVPB 4GX1A 1OV9A 4J41A 1JVMA 1GN4A 4X1YB 1GTOA 2WLNA 1XI1A 3RVYA 3QO5A 4J80A 4BWAA 1G6UA 1COWG 2YDEA 4ZBMA 1K5SA 1H38A 3G71V 4FPPA 1TAEA 1KYOF 1UPGA 3T1HB 1D2DA 2PUSA 2ZE6A 3R66A 5IJ0A 3ASNC 4JAAA 3JALA 1M57B 2OWOA 4FFKA 4UB8Z 4GT1A 3CX5F 5E79Z 4AI8A 1AVMA 1W59A 5DN6G 3VQVA 4DR7O 2ITCC 1YZBA 1LUVA 1L8DA 5FL7G 1XREA 4PV1B 2YEVA 5EIBC 4I0XB 1WP8A 2MW2B 2ZT9B 2WLMA 1AI4A 3H1LH 1PL4A 1PV0A 3CRQA 3BCCH 2XASA 1BL8A 1KB9F 4DV4O 4FLTA 2JDIG 3W7UA 1FXVA 4FFBA 2FB5A 1VF7A 5LA6B 2CTRA 4P9OA 2E3CA 4DK0A 4DRXB 4X62B 4B3SB 3EXAA 1EZJA 2QTSA 4O4LA 1JA8A 1N8RW 2UU9O 3CCRV 2QWRB 4JAUA 3WB2A 1S3JA 3U10A 5FPOA 3RGBA 5KHJA 3N27A 2YSUB 3TETA 4O2AA 2IW5A 3T1CA 3AG1B 4BW9A 5IWAB 4JI1B 1ZLZA 3KCYA 1XEQA 1ENVA 1R3JC 2AW9A 1KKDA 5B1OA 4CC6A 3MHHC 4EEQA 1HNWB 1AROP 1U97A 3RWRD 2ZCEA 2XUMA 1MSDA 5D5QA 1I94B 1JJOA 3IC7A 3ZMTA 2BCCH 4JYAB 4B3RO 2P06A 4TUYA 1IDSA 1N4CA 2QGNA 3CB2A 2CGNA 3GWOA 4KUMA 1MSWD 5F2VO 3L72H 1Y74A 1VQKV 1AILA 1KBHA 4PA7A 1B04A 1B6QA 4J10A 2AZ2A 3FAVB 3JD4A 1QBZA 1WLEA 1BCCH 1MZEA 4MW8A 1YF2A 2IJKA 4WFBV 2EIKB 5KUKA 1F4MA 5JCOA 4PDMA 4DV2O 4JI2O 2H94A 1QVGU 2Q73A 1Q86W 4JASA 2H3OA 4FLXA
chains in the Genus database with same CATH topology
2A06H 4D6TH 1KB9F 1L0LH 3CWBH 3L75H 4PD4F 2FYUH 1SQVH 3L74H 3H1IH 1PP9H 1SQQH 2BCCH 1BE3H 4U3FH 1BGYH 3H1JH 1KYOF 1BCCH 3L73H 1NTKH 1L0NH 1SQBH 3H1KH 1P84F 2IBZH 1SQXH 3CXHF 3L70H 3L72H 1EZVH 3H1HH 1SQPH 1PPJH 3L71H 3TGUH 1NTMH 3H1LH 5KLVH 3CX5F 3BCCH 1NU1H 1NTZH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A06 H;  4D6T H;  1KB9 F;  1L0L H;  3CWB H;  3L75 H;  4PD4 F;  2FYU H;  1SQV H;  3L74 H;  3H1I H;  1PP9 H;  1SQQ H;  2BCC H;  1BE3 H;  4U3F H;  1BGY H;  3H1J H;  1KYO F;  1BCC H;  3L73 H;  1NTK H;  1L0N H;  1SQB H;  3H1K H;  1P84 F;  2IBZ H;  1SQX H;  3CXH F;  3L70 H;  3L72 H;  1EZV H;  3H1H H;  1SQP H;  1PPJ H;  3L71 H;  3TGU H;  1NTM H;  3H1L H;  5KLV H;  3CX5 F;  3BCC H;  1NU1 H;  1NTZ H; 
#chains in the Genus database with same CATH topology
 1JQ0 A;  5C8Y B;  4J9Y B;  1IXB A;  1BSM A;  4NB5 A;  2RJZ A;  4LF5 B;  5K1X A;  5LOV A;  4YHH B;  2RMK B;  1TVK A;  1YTF B;  1OCZ C;  3UCS C;  3D8C A;  1KU9 A;  4DR2 O;  1ZX3 A;  4OPH A;  3AG4 B;  3E89 A;  5EZY A;  3UT5 B;  5KA6 A;  4JI7 O;  2LGQ A;  1ZL8 B;  2BTQ B;  1SQV H;  1OCR B;  4FM2 A;  4UCO A;  5LGN A;  2ZR3 A;  4LR3 A;  3OTO B;  1SET A;  1IBM O;  4NTX A;  3ZIA G;  1MMM A;  1UJW B;  4KHP O;  3W7S A;  2DYS C;  2EJ7 A;  1W2B U;  2ZKO A;  4JZG A;  4O2B A;  3ZCC A;  4I5S A;  4JPR A;  4JI0 B;  3ZRX A;  4J7K A;  5A9G A;  2QM4 A;  4JI8 O;  5JWP A;  3B40 A;  2Z5U A;  4U3F H;  3J81 N;  2ADQ B;  1FFT B;  3OAA G;  3ABT A;  1HNZ O;  3MAQ A;  2YIC A;  1Q81 W;  3ETD A;  4FLU A;  3CS5 A;  2WWW A;  1GM7 A;  4IYH A;  4FM0 A;  4MVR A;  2HFE C;  1S72 V;  1TUB A;  2VRZ A;  3C3S A;  3F7V C;  2ZE5 A;  1DGS A;  1EM1 A;  4F6E A;  3JD2 A;  2A06 H;  5BZB A;  1VQ9 V;  1CEZ A;  2OCH A;  4G28 B;  1DK1 A;  1K73 W;  2RCV A;  4LH6 A;  1JFF A;  2E5L O;  1H8E G;  2UUC B;  2P5O A;  3R65 A;  2KG7 A;  3ZHQ A;  2IJH A;  4X66 O;  2WLI A;  5CA0 B;  3ZHR A;  3OTF A;  4WFF A;  4EB6 A;  1FFX A;  1FXK C;  3AG1 C;  4CZZ A;  2P67 A;  2VQE O;  5ITZ A;  1SQP H;  1A32 A;  2F95 B;  2QR4 A;  4B3M B;  4TQD A;  1XNQ B;  1AI7 A;  4QNH B;  4UUJ C;  5E1A C;  2Q9L A;  1IZ3 A;  4QGP A;  3FYE B;  3MDS A;  1D5N A;  3WB1 A;  4YJ2 A;  2A79 B;  4MVZ A;  3O9O A;  3S3W A;  3OUS A;  4MVU A;  2Z0A A;  3EFF K;  4IHJ B;  1VF6 C;  3TXQ A;  5BY1 A;  4DV1 O;  1KP2 A;  2XHB A;  4LF4 O;  1BE3 H;  4DR5 B;  4IT5 A;  4MW3 A;  4LFB B;  4F6R B;  3E22 A;  1MAB G;  3DGE A;  4MVQ A;  1N36 B;  3X2Q C;  3P3P A;  5J2U B;  2EIK C;  1Q6I A;  3NXS A;  3TK1 A;  1K4D C;  2ZM6 O;  3F7Y C;  3JD1 A;  2FTK A;  1NQT A;  5IDJ A;  3CWB H;  4B3T O;  1KUQ A;  4PA4 A;  2CTQ A;  1WA8 B;  2PYL A;  3DC6 A;  4CS4 A;  4GKK B;  1PD3 A;  3BRC A;  3RYF B;  2QEX V;  3B09 A;  4O4I A;  1PNL A;  1MNG A;  2RDC A;  4LWS B;  3A0H Z;  4LBE C;  1QLE C;  3HR0 A;  1AJQ A;  1P4R A;  3ETE A;  1XMQ O;  3UKM A;  3AG4 C;  4GX0 A;  4U3J B;  5GW7 A;  4H0L B;  3RYI B;  4YIO A;  4EFE A;  3G6E V;  3PN1 A;  4O4H A;  4Q20 A;  1HP8 A;  4X88 A;  1BQ0 A;  3B4S A;  2JRI A;  2XAG A;  3JAS A;  4FZ0 A;  2RN9 A;  3ZMV A;  1YI2 V;  3AEI A;  4MT8 A;  3ZRW A;  2LQT A;  2W0X A;  3JCZ A;  2M6Y A;  2NNU A;  2Q8V A;  5EYP B;  1IBL B;  4CH6 A;  3BHP A;  4BR6 A;  4IYI A;  4A5U B;  1R1B A;  4B7E A;  4I4T A;  2WA3 A;  1W0J G;  1KD1 W;  2R9A A;  5LMN O;  1Q5O A;  2CGO A;  3GWK C;  1W0K G;  3M99 B;  1M5I A;  1YDX A;  4J7Z A;  5KHK A;  5KMG B;  5LMU B;  1NKD A;  1XIL A;  1HR0 O;  3ICX A;  5CA3 A;  1R6N A;  3S3X A;  3AK3 A;  1IUR A;  2JGU A;  2JEX A;  2ZNJ A;  1M56 B;  4WF9 V;  4LC1 A;  2LP7 A;  1M90 W;  4YIP A;  3WU2 Z;  4PA3 A;  4H44 B;  3LDE A;  1L0L H;  2ZXW B;  3D3Q A;  5LP6 B;  1JJ2 U;  4UV9 A;  3L9D A;  3JAK A;  4UCV A;  3RT3 C;  3D36 A;  3T1H O;  1QR9 A;  3ZX6 A;  2CAZ C;  3ASO C;  5LXT A;  3LNN A;  3WG7 C;  2OIE A;  1AJN A;  3L75 H;  4MVO A;  3SPC A;  1OCC C;  2JIZ G;  2LJ2 A;  4BIZ A;  2F43 G;  3E83 A;  1R6K A;  1EFR G;  1IBK B;  2E76 B;  3AG3 C;  3OM3 B;  2OCC B;  3ABU A;  3H1K H;  3CPW U;  2Q67 A;  3T1Y B;  1P49 A;  3JAT B;  1I0H A;  3WFV A;  1IX9 A;  2PF4 E;  5L3F A;  5BR8 O;  2ZDI A;  5B1A C;  4TV8 A;  3EHB B;  5KLV H;  4Q6G A;  4AQY O;  2P4V A;  2ZR2 A;  4U7O A;  3ZHS A;  5H2F Z;  5FNV B;  3E86 A;  3UO2 A;  1VQN V;  2C2A A;  2WLL B;  3SJC C;  1VQ7 V;  3QO8 A;  1THZ A;  2LFR A;  2QJ1 A;  2IBZ H;  5IJ9 B;  4PDV A;  3G80 A;  4XDK A;  5IY5 B;  2EZO A;  5CB4 A;  4LP8 A;  3K59 A;  2IU3 A;  2KQX A;  4B3S O;  2HR3 A;  2IU0 A;  3T2M A;  4YJ3 B;  1FJG B;  2BOB C;  2DN9 A;  4X64 O;  1I5Y A;  1PP9 H;  3G67 A;  1N32 O;  3L73 H;  2XAF A;  3DTU B;  5GON A;  5JVD A;  4DUY O;  4WBN A;  5IWA O;  1HDJ A;  1Q7Y W;  3DXR B;  4ZHQ B;  5LYJ B;  5JQG A;  1V9P A;  3ETQ A;  4FZ1 A;  4JF3 A;  3F5T A;  1Q6U A;  3STZ C;  1JR9 A;  5CMU A;  1US6 A;  1AB3 A;  1AP5 A;  2X7R B;  4K0K O;  3W7T A;  4JYA O;  3CJH A;  4ZOL B;  4BAY A;  4DV7 O;  1XMO B;  2ZE7 A;  4JI6 O;  2GV9 A;  4NYK A;  2UXN A;  2XT9 A;  1FXK A;  3LSQ A;  4MTG A;  2EIJ C;  1SQQ H;  1YIJ V;  1GMG A;  1NH2 D;  3C3T A;  3QVN A;  1PNM A;  2JVD A;  1E1R G;  2GHY A;  4LFC B;  4UCU A;  3L71 H;  3JAW A;  1K92 A;  4EFB A;  3JAR A;  1NU1 H;  5DEC A;  2WLH A;  3CCU V;  4OXS A;  3P3N A;  4DUZ O;  1M56 C;  3HKD B;  1ROP A;  1WP7 A;  4GLX A;  1HW7 A;  5GTH Z;  3I55 V;  3H1J H;  4LF8 B;  1VF6 A;  3CRM A;  2Y48 A;  5LP6 C;  3CCL V;  2LGW A;  2HP8 A;  4AIL C;  5H6R A;  1YHQ V;  3IFX A;  1FD9 A;  1NTM H;  5CA1 B;  4GKJ O;  2JGD A;  4F4L A;  5JH7 B;  4CS3 A;  3ZMZ A;  2YXH A;  3A0B Z;  2W6J G;  2D2C B;  1S76 D;  2UXD O;  2QTO A;  1N33 B;  4DV0 O;  2HHH O;  4RQE A;  4LF7 B;  1VAR A;  2OCC C;  4PJ0 Z;  1Y66 A;  3BAB A;  1K8A W;  4OGQ B;  2HJD A;  4DR6 B;  2JEU A;  3ZHV A;  3ABK C;  2PGG A;  4CC5 A;  3C90 A;  4QPJ A;  1NH2 B;  1YCI A;  2CUG A;  3Q4H A;  2EIL B;  1VQ4 V;  2CH7 B;  4JI0 O;  2ATK C;  4LFA O;  2ZQM A;  1P84 F;  3CHX A;  5IYZ A;  3QG5 A;  4KP4 A;  3QTC A;  3E8B A;  2A9H A;  4HYO A;  1G8M A;  3LDD A;  5IY5 C;  4DR3 O;  2B1G A;  3JCU Z;  1BS3 A;  3K9S A;  2VS0 A;  5EK0 A;  1ZUQ A;  1ZSP A;  1Y76 B;  2B1I A;  5EBW C;  4G27 B;  5KX5 A;  5IJ0 B;  5CN0 A;  1WB8 A;  3KZI Z;  4TSF G;  3JAL B;  2BSK A;  4HNA A;  1NJI W;  5L3E A;  2R70 A;  2YC0 A;  4XDL A;  5JJN B;  4ZI7 A;  5B3S B;  5HFM A;  5FPR A;  4B3M O;  1FYJ A;  1XNQ O;  5IE9 A;  2XND G;  1VQ6 V;  4D7S A;  4ZIB A;  1WJZ A;  2DYR B;  3E8F A;  5EC2 C;  2OTL V;  2YEV B;  4Z1V A;  1SS3 A;  3M8A A;  2XTA A;  5KAF Z;  3OEE G;  4P9P A;  5D5P A;  1QLN A;  1QCE A;  1MZF A;  1SQG A;  5IYD O;  1LUW A;  4RUE A;  2R9R B;  2PTM A;  3BAA A;  3K03 A;  3ZHU A;  1VQ8 V;  3OE7 G;  1V55 B;  3QO7 A;  2AHZ A;  3HKE A;  5J2T B;  2ZIN A;  2VQF O;  4FFB B;  3JD0 A;  1DF5 A;  1PM9 A;  4DR5 O;  3VBB A;  3ZS8 C;  3KKY A;  4DR7 B;  1SKV A;  2VWK A;  5KHH A;  2B9Z A;  1N36 O;  4O4L B;  3ZED A;  1M57 C;  5DED A;  1RSO A;  5H6Q A;  1CP9 A;  3CE2 A;  4DV6 O;  5GTI Z;  3A2F A;  3G6B A;  1AI5 A;  5A2Q N;  4O2A B;  2YIB A;  3ML0 A;  2WAM A;  4JI4 O;  4DV4 B;  2IJJ A;  2EX3 A;  1Y67 A;  2H8P C;  4LF6 O;  3P32 A;  4GKK O;  2A7W A;  2RNB A;  4YY3 O;  3FB7 C;  3B8N A;  1K9M W;  4IGG A;  4OPA A;  1MG1 A;  2GBO A;  2UU9 B;  3AK2 A;  4DV3 O;  3IGA C;  4NXN O;  1HNX B;  1K97 A;  4TUY B;  2WSS G;  4HBN A;  2CTP A;  3ZMS A;  1ZTE A;  2UUB B;  5B1N A;  3H1H H;  1WB7 A;  1Y74 B;  2YIB D;  2Q6A A;  1XQ8 A;  3ABL B;  1V54 B;  4YXW G;  1L1F A;  1NS1 A;  2JJ1 G;  3SYQ A;  1AR5 A;  1QQC A;  1N0J A;  1M9N A;  4JYB A;  5CBF A;  4N21 A;  4FJC C;  2EIL C;  3HKB A;  3L70 H;  1IXM A;  3SYC A;  3WB0 A;  4I55 A;  5LHH A;  4B3R B;  1F23 A;  1SZT A;  1PKX A;  4QE7 A;  4FVM A;  4DW1 A;  1BZK A;  1K3E A;  4XBF A;  2P90 A;  4P2Z A;  1S5L Z;  1PL0 A;  4GZR B;  2OYQ A;  2UXX A;  5LOV B;  1WNS A;  4MS2 A;  1TVK B;  4LNU A;  4FLV A;  2F4V O;  1GN3 A;  2RQ6 A;  5EZY B;  4JI2 B;  1O9H A;  2MK3 A;  1F4N A;  3ZHT A;  2HVK C;  4B7K A;  2YI8 A;  3SPJ A;  1SA0 A;  1TA8 A;  1BHA A;  1FS0 G;  2AGA A;  4MTO A;  3OGC C;  2JS5 A;  4MSW C;  4I9Q A;  1GN6 A;  1YJW V;  2DYR C;  1SER A;  1HWY A;  2GTA A;  4O2B B;  2EIM B;  3IAY A;  2V7Q G;  1LNQ A;  1XNR O;  2Y69 B;  5LGT A;  4DR4 O;  4ASU G;  3CEI A;  1KP3 A;  2P22 C;  4DR2 B;  4CS2 A;  3RYH A;  1IBK O;  3CRA A;  3ZN0 A;  1RM1 B;  2K9P A;  1Q6H A;  2UUA O;  1QVF U;  4JI7 B;  1QHT A;  2YXY A;  2F93 B;  4JI3 O;  1TUB B;  3SYO A;  3SGI A;  4FLW A;  3K3W A;  1S5J A;  3W7W A;  3HKC A;  3MD0 A;  3T4Z A;  2Q7H A;  1Z5W A;  1JFF B;  1U96 A;  1F51 A;  1XL6 A;  5BMV A;  1N0N A;  1OCR C;  1VQO V;  4J11 A;  2WLI B;  1R6T A;  4JI8 B;  3ABM B;  4BW5 A;  4EB6 B;  4J42 A;  1FFX B;  4X65 O;  3K0D A;  4I50 A;  2Z3Y A;  2NR5 A;  1R73 A;  3N2K A;  2K1E A;  3K58 A;  1YSC A;  3E8G A;  2HLD G;  4JV5 B;  3APQ A;  4ICG A;  3THO A;  3RYC B;  5EIB D;  2PY5 A;  1NTK H;  1GN2 A;  1EN6 A;  1SQB H;  4DK1 A;  4UCT A;  1KMI Z;  1AI6 A;  1SC5 B;  2F1M A;  4ZKI A;  3O65 A;  4YJ2 B;  3K06 A;  4DR1 B;  2XAJ A;  3U0Z A;  4X1K A;  4R7C A;  2E5L B;  4UB6 Z;  2UXC B;  4XDJ A;  4X66 B;  1KKC A;  4B08 A;  1NR7 A;  3N2G A;  2X6C A;  5BXZ A;  2CE4 A;  3E22 B;  5H5N A;  4RAI A;  4O4J A;  1X4T A;  4PHZ A;  4TV9 A;  1OCO B;  4NXM B;  2PYJ A;  4GYC B;  3QF7 A;  4IIJ A;  2IH1 C;  3I56 V;  2E75 B;  2IH3 C;  3BVO A;  2ITD C;  1XBL A;  4X1I A;  4TT3 G;  1SQX H;  3H9V A;  4CH3 A;  1H2G A;  1NBM G;  4X20 A;  4DV1 B;  1M1K W;  1RPR A;  2GUZ A;  1K4C C;  2YID A;  2NN4 A;  4WFG A;  2YI9 A;  4LF4 B;  1VP7 A;  1GKF A;  3BFR A;  2A0L A;  4LFC O;  1B06 A;  1EN4 A;  4O4I B;  5KUM A;  2PZS A;  4MVS A;  2Q0A A;  3J80 N;  4X1Y A;  2D3O W;  4P30 A;  3PJS K;  3B8M A;  2XOK G;  4BIU A;  4WFA V;  5CBG A;  1JMK C;  2ZM6 B;  4LF8 O;  3CME V;  3SPG A;  3OMI B;  1OJH A;  1PNK A;  4B3T B;  3SJA C;  2Q7G A;  3VOU A;  1VQ5 V;  1KC8 W;  1G1X B;  3JAS B;  2EIN B;  1J5E B;  3LUT B;  3ZRW B;  1NVP D;  5FLX N;  2Q4P A;  1WN7 A;  2JS3 A;  3FD9 A;  1XMQ B;  2WLJ A;  1BQZ A;  1X59 A;  3HB3 B;  1N33 O;  2A3Q A;  4X62 O;  1AR4 A;  4JI5 B;  1I7F A;  2X6A A;  4R6Z A;  4DR6 O;  4I4T B;  3STL C;  2HKO A;  1FKA O;  5IT9 N;  4OX9 B;  3FB5 C;  2DWE C;  4N23 A;  3E35 A;  1MA1 A;  2EJR A;  4I0X A;  4DW0 A;  3CYO A;  3CMA V;  3OR6 C;  4GUN A;  2G38 A;  4FIP C;  2QE7 G;  4JI1 O;  3AG2 B;  4KXR A;  3ZMU A;  3B77 A;  1N34 B;  3ABM C;  3BEH A;  2Y4T A;  3JSN A;  3KG2 A;  3CC7 V;  1HNW O;  5LA6 A;  2DJV A;  3SJB C;  2QA4 V;  4DRX A;  3DC5 A;  3UO3 A;  3LSU A;  4K8X A;  1I94 O;  3APO A;  1Y6X A;  4JZ2 A;  4MVM A;  1H2S B;  5LMN B;  3JAK B;  4UFZ A;  2QWN B;  2Y0P A;  2ARH A;  2EZP A;  4HZ3 A;  5LXT B;  3EVK A;  3K5L A;  2R9I A;  2ZIM A;  1VMG A;  2ETN A;  2ZE8 A;  2N74 A;  3CCE V;  1YJN V;  4RUF A;  2VWJ A;  4TV8 B;  3AK1 A;  1QNM A;  3SDL A;  1Y76 A;  3VQX A;  1OCZ B;  1Q43 A;  1OCO C;  3P30 A;  1S77 D;  1SQF A;  2GSM B;  2ZXW C;  2P7T C;  2QM7 A;  4WCE V;  4TQF A;  1RP3 B;  4UVC A;  4DYL A;  1GH6 A;  3RBZ A;  4LH7 A;  3IC9 A;  4LF5 O;  1Q3E A;  2PI5 A;  3JAM N;  4YHH O;  4NR1 A;  4H13 B;  5CB4 B;  3BY6 A;  1RFY A;  3FAV A;  1O9G A;  2FYU H;  3CC2 V;  3CCM V;  2QKS A;  2DYS B;  3FB8 C;  5BR8 B;  4X9Q A;  1GK9 A;  4AQY B;  2DWD C;  1H2N A;  1QU7 A;  4X8A A;  5KA5 A;  5GON B;  3OTO O;  5JVD B;  2FKX A;  4WBN B;  5KHG A;  4R8C A;  4H33 A;  2UXB B;  5C8Y A;  3QNE A;  2XAH A;  2W6I G;  5HFL A;  4GCZ A;  1XL4 A;  4LF9 B;  3SPH A;  3CCV V;  5JQG B;  5J2T A;  1T5E A;  1VIB A;  1XHX A;  4FMT A;  2ZNI A;  2ODM A;  3ETG A;  3OMN B;  4QIW F;  4RWU A;  3UM7 A;  3TCU A;  1FPO A;  4UCS A;  4PI2 A;  2EIN C;  4X64 B;  1HNX O;  2BTO A;  3CJH B;  3UT5 A;  4UXN A;  1JCH A;  4UVA A;  1N32 B;  1ZL8 A;  2BTQ A;  3OUF A;  2UUB O;  1UFI A;  4K35 A;  2LW1 A;  2N05 A;  4DUY B;  1FXK B;  1JPX A;  1OHH G;  1GO3 F;  1NI8 A;  2KB1 A;  1E1Q G;  2LW7 A;  2DMX A;  3MHS C;  1YTF D;  2UUC O;  2QM8 A;  4DV5 B;  1SRY A;  4GX5 A;  3SYP A;  3U11 A;  3JAW B;  4JGS A;  4K0K B;  3NR7 A;  3JAR B;  2HJF C;  3AG2 C;  4DV7 B;  2Q7E A;  3D3I A;  4PDR A;  1YIT V;  2CK3 G;  4JI6 B;  2ADP A;  4D7T A;  1URF A;  2R72 A;  4MTX A;  4LCU C;  2B5U A;  3B2E E;  4Z1M G;  3A0R A;  4G2K A;  2WPD G;  3K9A A;  1TUE B;  4X89 A;  2F23 A;  2JGD B;  3GB7 C;  4J9Z B;  3D36 C;  3IJ4 A;  4DXW A;  1BGY H;  5CA0 A;  3X2Q B;  5IYC O;  1DTO A;  1J95 A;  1H2K A;  1RPO A;  3CXH F;  5C93 A;  5L3G A;  3FKS G;  2YUA A;  4LFB O;  4DUZ B;  4KFM A;  3K0G A;  3OEH G;  4L87 A;  2X6B A;  4BIO A;  3ZBH A;  1S0V A;  4JYY A;  3ZN1 A;  1K7D A;  1JOY A;  4CH4 A;  2ZDI C;  4QJF B;  3Q4H B;  2HVJ C;  4GKJ B;  4IHJ A;  1NT2 B;  4HAM A;  3T4D A;  1QLE B;  3BA8 A;  4QE9 A;  1H2L A;  4UCR A;  5EBM C;  5IYZ B;  3JD3 A;  2ILM A;  2UXD B;  2LO1 A;  5H9C A;  4W4K A;  4DV0 B;  4F6R A;  2HHH B;  1K34 A;  1DF4 A;  5B66 Z;  3OR7 C;  2YIA A;  4PI0 A;  1Z2G A;  5LHI A;  5J2U A;  4Z2W A;  1YVW A;  2CTW A;  2O57 A;  2AHY A;  1PPJ H;  1WPB A;  1QR8 A;  5KX5 B;  3G4S V;  2HG5 C;  4NVP A;  4E2L A;  1YJ9 V;  4LFA B;  2BSK B;  1H2M A;  3RFR A;  5LGU A;  1WA8 A;  3ZRS A;  4HNA B;  5J9P C;  2Q0O C;  2BOC C;  1R3L C;  2QWP B;  4ZI7 B;  2QWQ B;  3CP1 A;  5B5E Z;  2Y0I A;  4NKG B;  4JV5 O;  3RYF A;  4DR3 B;  1JX9 A;  1KEC A;  2HEP A;  4DO2 A;  2FML A;  2WA4 A;  4LWS A;  5B1B B;  1DLB A;  3SR2 C;  2ZD9 A;  1IBL O;  4D6T H;  3CCQ V;  2L6L A;  4DR1 O;  3OGI B;  4NTW A;  3RW0 A;  4U3J A;  2UXC O;  3RYI A;  1XOU A;  1NR1 A;  2QWO B;  1B3Q A;  3HKE B;  5EC1 C;  1AP6 A;  4U7N A;  1P7B A;  5LMU O;  3I5D A;  2QKC A;  1GM8 A;  1NTZ H;  3LSS A;  1TGO A;  4TWK A;  2Q5Z A;  2IM9 A;  2E74 B;  3RYC A;  1SES A;  1XDC A;  5CBH A;  3K5N A;  3HPL C;  4DV2 B;  3CRC A;  4NXM O;  1RSO B;  1Q82 W;  5K1P A;  3JYC A;  1L0N H;  2YS8 A;  1CPY A;  5EYP A;  1G4Y B;  2ZIO A;  5B3S C;  4I7Z B;  3ASO B;  2KKW A;  3WG7 B;  1GRJ A;  2GTS A;  5JJE B;  1OCC B;  4C7U A;  2F66 C;  3K04 A;  2GDS A;  3ZRV A;  4EKW A;  2DE0 X;  4I9W A;  5LBQ A;  3AG3 B;  3OMA B;  3RN4 A;  2VQF B;  4JAV A;  1Y4M A;  5KMG A;  1ZWI C;  2N04 A;  3CC4 V;  5B1A B;  3FX7 A;  4JTC B;  4QPK A;  1V55 C;  3TJT A;  1K5Q A;  2X0L A;  3UQ8 A;  4PEL A;  4DV6 B;  3T1Y O;  2P6J A;  3CCS V;  3SPI A;  1IBM B;  5LP6 A;  3FYI B;  1EN5 A;  4JI4 B;  1VQL V;  4FLY A;  4KHP B;  3CD6 V;  4LF6 B;  2Q68 A;  1SZX A;  4WFE A;  4YY3 B;  2KG7 B;  2YXL A;  4UVB A;  4NTY A;  1J5E O;  2JJ2 G;  3HKB B;  3TGU H;  1IVS A;  2PI4 A;  4DV3 B;  4NXN B;  4I55 B;  5ITZ B;  1HNZ B;  1AR1 B;  3OD4 A;  3K08 A;  1XUQ A;  3F5W C;  5JJJ B;  1BT8 A;  4JI5 O;  1WPX A;  3JAT A;  2LFS A;  3CCJ V;  1FJG O;  1Z5V A;  1CXZ B;  4IL6 Z;  1AJP A;  4OX9 O;  1BHB A;  5TIS Z;  4FM1 A;  5FNV A;  4KL1 A;  4LNU B;  2OIG A;  3VQY A;  1H8H G;  1ORQ C;  2WLL A;  3GVM A;  1NZ6 A;  1F7Y A;  3KCX A;  5DM6 V;  4FLZ A;  2AZ0 A;  4AHC A;  5IJ9 A;  1FAF A;  1N34 O;  1FXH A;  5LHG A;  3OW2 U;  2VQE B;  3ABL C;  5IYB O;  3OFN G;  4H37 A;  1EBO A;  1SA0 B;  1V54 C;  3K57 A;  4JTD B;  1E79 G;  2IJI A;  4J7J A;  4JTA B;  2EIJ B;  3FFQ A;  4YJ3 A;  4JYC A;  5JCO C;  2V4D A;  2QKA A;  3L74 H;  1XMO O;  1I08 A;  3K79 A;  5B1B C;  3ASN B;  1GAX A;  3CRR A;  3E2E A;  3BPZ A;  4ABM A;  2DQ0 A;  2F4V B;  1KQS U;  3DXR A;  2V1D A;  2OTJ V;  3RYH B;  5LYJ A;  4ZHQ A;  1VQM V;  2P4K A;  3A8T A;  1R3I C;  3CXC U;  2BE3 A;  5EBL C;  5L3C A;  3OT7 A;  1BMF G;  1VQP V;  2QSA A;  3HKC B;  4ZOL A;  1MOF A;  4UV8 A;  4R50 A;  4K8Z A;  1YXB A;  3BA9 A;  3J7A U;  1R3K C;  2AXT Z;  4K3A A;  5BMV B;  5KHI A;  2DW4 A;  1XNR B;  1EZV H;  4GX2 A;  4DR4 B;  2DQ3 A;  1S5H C;  2W0F C;  1M93 A;  4O4H B;  4FK5 C;  4I50 B;  4CH5 A;  3M7M X;  5KAI Z;  4E4E A;  3N2K B;  2UUA B;  4WFH A;  2Y4U A;  2EIM C;  2EUL A;  2EBO A;  2Y69 C;  3ABK B;  4JI3 B;  4PA9 A;  3SYA A;  3W7X A;  3AG7 A;  1OZ0 A;  3H01 A;  4W4L A;  3K5M A;  2KSD A;  2QDO A;  4RO2 A;  1VF5 B;  4PA6 A;  1RM1 C;  3LDC A;  4LF7 O;  3HKD A;  1YEW A;  4X1K B;  1SF9 A;  2UXB O;  4L8J A;  4LF9 O;  3JSL A;  2NLJ C;  4X65 B;  3FB6 C;  3N2G B;  4MTF A;  3K5O A;  3RVZ A;  5CA1 A;  2L35 A;  3ZJZ A;  5JH7 A;  2JK5 C;  4PDL A;  4O4J B;  1LR1 A;  2M7W A;  2XAQ A;  4CBC A;  5L3B A;  1VEW A;  2CDY A;  4TV9 B;  5LL6 Y;  1K33 A;  4PD4 F;  3TXS A;  5AG2 A;  1XHZ A;  2Q69 A;  1D5A A;  4IIJ B;  1Q8I A;  3E8H A;  1M4U A;  4X1I B;  2FL4 A;  3DSQ A;  2OT5 A;  3LNM B;  2DOS A;  1Q90 D;  5L3D A;  4X20 B;  2GUZ B;  1P7G A;  1ZAU A;  3CSX A;  3SJQ C;  1WAZ A;  1HR0 B;  1I5X A;  4TOI A;  4DV5 O;  2CH7 A;  3H1I H;  1GM9 A;  2WLK A;  3VQW A;  4RQF A;  1NVP B;  4GX1 A;  1OV9 A;  4J41 A;  1JVM A;  1GN4 A;  4X1Y B;  1GTO A;  2WLN A;  1XI1 A;  3RVY A;  3QO5 A;  4J80 A;  4BWA A;  1G6U A;  1COW G;  2YDE A;  4ZBM A;  1K5S A;  1H38 A;  3G71 V;  4FPP A;  1TAE A;  1KYO F;  1UPG A;  3T1H B;  1D2D A;  2PUS A;  2ZE6 A;  3R66 A;  5IJ0 A;  3ASN C;  4JAA A;  3JAL A;  1M57 B;  2OWO A;  4FFK A;  4UB8 Z;  4GT1 A;  3CX5 F;  5E79 Z;  4AI8 A;  1AVM A;  1W59 A;  5DN6 G;  3VQV A;  4DR7 O;  2ITC C;  1YZB A;  1LUV A;  1L8D A;  5FL7 G;  1XRE A;  4PV1 B;  2YEV A;  5EIB C;  4I0X B;  1WP8 A;  2MW2 B;  2ZT9 B;  2WLM A;  1AI4 A;  3H1L H;  1PL4 A;  1PV0 A;  3CRQ A;  3BCC H;  2XAS A;  1BL8 A;  1KB9 F;  4DV4 O;  4FLT A;  2JDI G;  3W7U A;  1FXV A;  4FFB A;  2FB5 A;  1VF7 A;  5LA6 B;  2CTR A;  4P9O A;  2E3C A;  4DK0 A;  4DRX B;  4X62 B;  4B3S B;  3EXA A;  1EZJ A;  2QTS A;  4O4L A;  1JA8 A;  1N8R W;  2UU9 O;  3CCR V;  2QWR B;  4JAU A;  3WB2 A;  1S3J A;  3U10 A;  5FPO A;  3RGB A;  5KHJ A;  3N27 A;  2YSU B;  3TET A;  4O2A A;  2IW5 A;  3T1C A;  3AG1 B;  4BW9 A;  5IWA B;  4JI1 B;  1ZLZ A;  3KCY A;  1XEQ A;  1ENV A;  1R3J C;  2AW9 A;  1KKD A;  5B1O A;  4CC6 A;  3MHH C;  4EEQ A;  1HNW B;  1ARO P;  1U97 A;  3RWR D;  2ZCE A;  2XUM A;  1MSD A;  5D5Q A;  1I94 B;  1JJO A;  3IC7 A;  3ZMT A;  2BCC H;  4JYA B;  4B3R O;  2P06 A;  4TUY A;  1IDS A;  1N4C A;  2QGN A;  3CB2 A;  2CGN A;  3GWO A;  4KUM A;  1MSW D;  5F2V O;  3L72 H;  1Y74 A;  1VQK V;  1AIL A;  1KBH A;  4PA7 A;  1B04 A;  1B6Q A;  4J10 A;  2AZ2 A;  3FAV B;  3JD4 A;  1QBZ A;  1WLE A;  1BCC H;  1MZE A;  4MW8 A;  1YF2 A;  2IJK A;  4WFB V;  2EIK B;  5KUK A;  1F4M A;  5JCO A;  4PDM A;  4DV2 O;  4JI2 O;  2H94 A;  1QVG U;  2Q73 A;  1Q86 W;  4JAS A;  2H3O A;  4FLX A; 
#chains in the Genus database with same CATH homology
 2A06 H;  4D6T H;  1KB9 F;  1L0L H;  3CWB H;  3L75 H;  4PD4 F;  2FYU H;  1SQV H;  3L74 H;  3H1I H;  1PP9 H;  1SQQ H;  2BCC H;  1BE3 H;  4U3F H;  1BGY H;  3H1J H;  1KYO F;  1BCC H;  3L73 H;  1NTK H;  1L0N H;  1SQB H;  3H1K H;  1P84 F;  2IBZ H;  1SQX H;  3CXH F;  3L70 H;  3L72 H;  1EZV H;  3H1H H;  1SQP H;  1PPJ H;  3L71 H;  3TGU H;  1NTM H;  3H1L H;  5KLV H;  3CX5 F;  3BCC H;  1NU1 H;  1NTZ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...