1L0LH

Structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
78
structure length
78
Chain Sequence
GDPKEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 23
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1l0lH00
3H1HH 1NU1H 3L74H 3L72H 5KLVH 1SQVH 3L71H 1NTZH 3H1KH 3L70H 3L75H 1BGYH 3TGUH 1PPJH 1EZVH 2BCCH 2IBZH 3CWBH 3H1JH 1NTMH 2FYUH 1SQXH 1P84F 1PP9H 3BCCH 1SQBH 2A06H 4U3FH 1KB9F 1BE3H 1KYOF 1NTKH 3H1IH 1BCCH 1SQPH 1SQQH 4PD4F 4D6TH 1L0LH 1L0NH 3CXHF 3L73H 3H1LH 3CX5F
chains in the Genus database with same CATH superfamily
4B3SO 1OZ0A 2E76B 4JI8B 3G6EV 3N2GB 1IURA 1X59A 4JAVA 5GTIZ 5CA0A 4O4IB 3KG2A 1KYOF 1SQFA 3AG2B 4DW1A 5LXTA 4FM1A 4Z1MG 4W4LA 3JASB 4FLWA 1NH2D 1K34A 5FLXN 4GX5A 1NTZH 3FB6C 3W7XA 3BEHA 1AI7A 3ZMUA 1LUVA 4FM2A 1NVPB 4BW5A 4TV9A 4LFBB 4TQFA 1KU9A 3VQXA 4NTWA 3KZIZ 4JI1B 2R9IA 4GYCB 3B77A 4JZGA 5LYJA 3THOA 1JVMA 2ZR2A 4LR3A 3G4SV 3SR2C 5IY5C 2JS3A 4B3TB 5GTHZ 5H5NA 2UUCB 2EIMB 4MVOA 1FYJA 1I08A 4GKJB 2YICA 1YITV 1EFRG 2Z0AA 1GN4A 4BWAA 3TK1A 3CRAA 2RJZA 2PI4A 2FL4A 2OYQA 1I0HA 1IBMB 1WB8A 2ADPA 1OCRB 1SQVH 4Q20A 4AHCA 3SYCA 2Q6AA 4X20A 3P3NA 3UT5B 5IWAO 2OT5A 3B09A 3ZHVA 1H2KA 1D2DA 4GX2A 3S3XA 2LP7A 3H1LH 2CAZC 1N32O 3OR6C 3G71V 4DW0A 2W6IG 2HFEC 2Q68A 3JD2A 4DYLA 4DUZB 5LYJB 3AG4C 2EIJC 4LC1A 3JATA 2QWQB 4U7OA 1ZX3A 3SJAC 4H0LB 4DR5O 1XDCA 4P2ZA 3PN1A 3UCSC 4O2AB 4WCEV 4NXNO 3VBBA 1BCCH 1SRYA 1VQPV 4B3MO 1VQLV 5LHGA 1PNMA 4MS2A 3JD0A 4J9ZB 1S72V 2UU9O 1PNKA 1ZUQA 3HKEA 2BTQB 1JCHA 4F6RB 3HKCA 4X62O 1R6NA 3CRMA 3DGEA 3CEIA 3OGIB 5FPRA 4QPKA 3G6BA 1XUQA 1S0VA 4JI0O 2YI9A 3GVMA 4YJ3A 3SPGA 3EFFK 3APQA 3P30A 3UM7A 3BA8A 3W7WA 3ICXA 4X65O 4WFAV 3CWBH 4TT3G 3CPWU 4QGPA 4R8CA 4XDLA 1IBLB 3FFQA 4UXNA 1VIBA 4O4LA 3R65A 5LBQA 3RBZA 1YSCA 1OCZB 2QKCA 3E89A 3FYIB 4AQYO 1Z5VA 4FLTA 2UXDO 2JGUA 5IJ9B 1YXBA 5EZYB 2JVDA 1SQXH 3ABUA 4I0XA 5LMNB 3ETEA 3I5DA 1NZ6A 2QJ1A 2R70A 5EYPA 3M8AA 1L0NH 4RQFA 1AILA 3K9AA 4QNHB 3B40A 4I9QA 3DC6A 1ZLZA 4LF9B 3OW2U 3TCUA 2ITDC 1ORQC 2QWPB 4NXMO 1Q43A 2MK3A 2YIBA 4NB5A 1WN7A 2B9ZA 1GH6A 2XAFA 1XMOO 1COWG 3H9VA 4Z1VA 2Y4TA 4X64B 4B3SB 3CHXA 2Q0OC 4JYAO 3TXQA 1GO3F 3B8NA 4K8XA 1IDSA 4TOIA 5IY5B 2XAQA 4O4LB 1Q5OA 5H2FZ 3NXSA 5LMUO 1MNGA 3RGBA 3U0ZA 2W6JG 5JVDA 4UVAA 4QJFB 1VQKV 4DV4O 1FFTB 2XAHA 1ZSPA 4R7CA 4TUYA 3ZHSA 3CCMV 1GAXA 5BXZA 4HNAA 5C8YA 3JYCA 4B08A 4CS2A 1V54B 1BMFG 4R50A 4FLVA 3WB0A 2UUAO 3RYIA 5KHHA 1NTKH 5JQGA 1MOFA 1NQTA 3AK2A 4XBFA 3JAWA 2Z5UA 3TJTA 4I4TB 2D2CB 1B04A 2DE0X 3AG4B 4X1YA 3RYCB 2FTKA 4YJ2B 5KA6A 3OT7A 2P7TC 5D5PA 1VQ8V 2ZINA 3EVKA 3STLC 2R9RB 5EIBD 1F4MA 4O4HA 4WFEA 5KX5A 1TGOA 5B1OA 1ENVA 2JGDA 1VQ6V 5IWAB 1EZJA 5KHIA 5EK0A 1AR4A 4DR1O 4O2BB 5CA3A 2VQEO 2QWRB 5LP6C 1Y76A 2Q4PA 4JTAB 4PA4A 5L3DA 1N32B 3QG5A 1Q3EA 1XHXA 1EZVH 3CRQA 4DR5B 2XAGA 4NXNB 2UUBO 1WA8A 3AG7A 3ZBHA 1SA0A 2A9HA 1QNMA 4B3MB 1YTFD 3CCLV 2ITCC 4MVUA 2ZR3A 3L73H 3HPLC 4RAIA 1ZWIC 2HR3A 2UU9B 4FZ0A 3B8MA 3MHHC 4IIJB 3ZN0A 3CCJV 4X62B 5CA1A 1I94O 3LDDA 5E79Z 1AJNA 5KAFZ 1LUWA 2AGAA 4JI0B 5KX5B 2IU3A 4ZOLA 4K0KO 1N34O 4MTOA 2DJVA 2YEVB 4WBNA 3LNNA 2QE7G 1AJQA 2P5OA 5EBLC 1GM7A 4WFHA 4X65B 4DV7O 3K79A 1IBKO 1X4TA 2Y69C 4CH5A 4QPJA 3SPHA 3OMAB 2EINC 1W59A 1XILA 1AR5A 2LGQA 2YXHA 1FD9A 5AG2A 4AQYB 2WLMA 2UXDB 2NR5A 2FMLA 1YJWV 5IJ0B 1FXKC 4TQDA 1U96A 2KQXA 3DSQA 4MT8A 3H1JH 4I55A 3E2EA 4EFBA 1Y67A 2ZXWC 3SJQC 5KHJA 3KKYA 3F5WC 2YIBD 4UFZA 3Q4HA 1F7YA 5CA1B 1EN6A 2Q7HA 3ZMVA 4CC6A 1H2NA 1T5EA 4PA6A 2Q67A 5LP6A 4DR7O 3ABKC 4WBNB 5LA6A 1BHBA 1Q82W 4NXMB 1F51A 4I50A 4PA7A 2F1MA 1N33O 1XMOB 2AHYA 4FLYA 2Q7EA 3S3WA 4MSWC 5KUMA 3CCSV 3UO3A 4QE7A 4G27B 2LW7A 4ZKIA 2D3OW 5J2UB 4JYAB 4FLZA 3TGUH 1CXZB 5H6QA 2RDCA 2XOKG 2HJFC 2VRZA 3OD4A 1JFFA 5LMUB 1HNZO 5CBHA 2LW1A 4LH7A 4XDKA 3HKDA 5JH7B 4KUMA 3IFXA 4LNUA 2ZIMA 3BAAA 4DV4B 2DOSA 2K9PA 4I9WA 1OHHG 2GUZB 1EN4A 4I55B 4OX9O 3ZHQA 4DRXB 3B4SA 2PUSA 2ZIOA 3FAVA 1KKCA 3SYAA 4U3JA 4QIWF 3CMAV 3K08A 2IJJA 4AI8A 1I5XA 5K1PA 2UUAB 1Y4MA 4NYKA 2X7RB 5LA6B 1FKAO 4ZHQA 5KMGA 5J2TA 2E3CA 3JARB 4I50B 1WPXA 4GLXA 5BY1A 4ASUG 2DYSB 3QO8A 4DR4O 1D5AA 5EIBC 1GRJA 1URFA 3CC2V 3P3PA 4IGGA 2ARHA 3ETGA 1FXKA 4MVMA 4K3AA 1KC8W 1VQ4V 2X6BA 4LNUB 4FM0A 1AI4A 1SETA 1G1XB 1VQ9V 1NBMG 1SERA 4X66O 1DLBA 1O9GA 4JV5O 1P49A 1YF2A 2BOBC 5ITZB 1H8HG 4GCZA 4EB6A 5LHHA 2GDSA 4ZI7A 2Y4UA 4DR1B 2WSSG 1QQCA 3HB3B 2VQEB 2Q0AA 3RYFA 2UXBO 4U3FH 1MZFA 2RMKB 2Y0IA 5EC1C 1GM9A 1TVKB 2Q73A 4I7ZB 2DQ0A 3IGAC 5LGUA 1E1QG 2PYJA 4X9QA 3JAKB 2Y69B 4MVSA 2BCCH 5JJNB 3U11A 2UUBB 1WJZA 2QTOA 3G80A 4GZRB 4UCTA 1DF5A 1N8RW 4G2KA 1Y6XA 4ZIBA 1VQ7V 2WA3A 2JEXA 2AW9A 3WB2A 2QM8A 5E1AC 4ICGA 1M56C 1K8AW 1FXKB 1I94B 2Y48A 2ZNIA 4C7UA 5FPOA 4PJ0Z 2ZXWB 1N36O 1ZL8A 5IYZA 5FNVB 4OPHA 3AEIA 3FB7C 4K0KB 2F43G 3DXRA 1N34B 5CBGA 1R1BA 4X1IA 4JI3O 2ATKC 3SPJA 4PI0A 5DM6V 4JF3A 1SZXA 4DV7B 5CA0B 1IBKB 2ZKOA 2WPDG 3RW0A 3X2QC 1QR8A 3ZHTA 4ABMA 5CB4A 3EHBB 4P9OA 5LXTB 2H94A 3ASNC 4H13B 1QLEC 4NR1A 1K92A 3ABMC 1BS3A 1SS3A 4D6TH 4B3RO 2ZNJA 3E22A 1Q86W 1HP8A 4PDVA 5GONA 5HFMA 5JJEB 4TV9B 2KG7A 4X1KA 2LGWA 3OR7C 2YIDA 1KUQA 2QKAA 4JYYA 1XNQO 4DR3O 5L3CA 5BZBA 1KP3A 1SQBH 5FL7G 1OCOC 3AG3C 5C93A 2QM7A 4O4JA 2PI5A 3J80N 3RYHA 5BMVA 4LF6O 2QKSA 3DXRB 4DR7B 4DV5O 1RPRA 4IT5A 4RO2A 1N33B 1NTMH 3LDEA 4LH6A 2N05A 1RM1C 1YEWA 2BTOA 2OIEA 1OV9A 1ZTEA 5CB4B 2UXXA 3FB8C 4KHPO 2IU0A 2EBOA 2ADQB 1TUBA 4X20B 1HNZB 4J11A 3EXAA 2QEXV 2Q5ZA 1QU7A 2CE4A 3E22B 2EILB 5B1NA 5GONB 2OCCC 2IH1C 3QVNA 1FAFA 3QO7A 5JWPA 4BW9A 4OX9B 2M6YA 3ZRSA 4H37A 4MTXA 1PD3A 3W7UA 3C3SA 1K33A 4KL1A 3JATB 3K58A 1YI2V 2DYRC 1F23A 3STZC 3VQYA 4LFAO 3U10A 2WLLA 4O4JB 2RCVA 1VQ5V 1QVFU 3ZRWA 3CC4V 5IYCO 5LHIA 4BAYA 4RWUA 4D7SA 3HKEB 3T1HO 1SQPH 3HKCB 5J9PC 2X6AA 2VWKA 1K3EA 5B66Z 1R6KA 1YTFB 4DR4B 4YJ3B 4UV9A 3VQWA 5H9CA 4MW3A 3ZX6A 3C90A 2XT9A 5L3BA 2V4DA 4YIPA 1H2LA 3AK3A 2QSAA 2WA4A 4B7KA 4F6EA 1BSMA 3K0DA 4X66B 1VQMV 3MD0A 5LGNA 3QF7A 4JV5B 3L72H 2GV9A 2OTLV 2EZPA 2QWOB 5K1XA 1UPGA 2LQTA 1DK1A 1DF4A 3K5MA 2BSKA 1IXMA 4GX0A 4YXWG 5CN0A 1GK9A 3F7YC 4UCUA 2UXBB 4GT1A 2ZE5A 2PF4E 1S3JA 1M5IA 4FK5C 2EJ7A 1E1RG 4JAUA 4DO2A 3L9DA 3D36C 4I0XB 3GB7C 3I55V 3BHPA 2CGOA 3WFVA 3N2KA 4PHZA 3L75H 1BGYH 5EYPB 2ZE6A 2LO1A 2HHHO 2LFRA 3IAYA 4L8JA 3ABMB 2KSDA 4FPPA 3CC7V 4NVPA 4PA3A 5DECA 2ZE8A 3SJBC 1G6UA 4DV1O 2WLHA 3JSNA 1WB7A 5KLVH 3CJHA 1EM1A 1MZEA 3QTCA 2WLNA 1N36B 2F23A 2EIJB 3T2MA 3T1CA 3UO2A 2P67A 1OCOB 3AG3B 1HNXO 3OEEG 4LWSA 3F5TA 4JI3B 1S77D 1BE3H 2YXYA 4HYOA 1U97A 3ZMTA 3CCRV 2CUGA 1M57C 5JVDB 3MDSA 1NU1H 2YSUB 4GX1A 1M1KW 3K0GA 3CS5A 3GWKC 4GUNA 4LFCO 1M9NA 3K57A 4TUYB 3ETQA 3RWRD 2ZQMA 4FLXA 3ABLC 1GKFA 3E8HA 3OUFA 2WLIA 4LF5O 3UQ8A 4JI4O 4B3RB 4HNAB 5C8YB 4JZ2A 1OCCC 3MHSC 5GW7A 2QM4A 2QGNA 1FS0G 2R9AA 2QR4A 3RYIB 1XNQB 1M93A 4DR3B 5JQGB 3LSQA 3D8CA 2N74A 2HLDG 3CJHB 3JAWB 3CRRA 4L87A 5EC2C 1KBHA 2QWNB 2UXCO 2H3OA 2IW5A 4X1YB 1R73A 1NJIW 4LF6B 4FIPC 3QNEA 4DV5B 4PA9A 2XASA 5KA5A 5CBFA 3AG1C 5DN6G 2B1GA 1PPJH 2L6LA 1IX9A 1QBZA 3BFRA 2RN9A 3D36A 3K5NA 4MVRA 1Q7YW 4O4HB 1K97A 3E35A 4KHPB 4TV8A 1H38A 2JGDB 5B1BC 4LF8O 5DEDA 1JPXA 2X0LA 2ZDIC 3L71H 5A2QN 1Y76B 5A9GA 4N23A 2YI8A 1PP9H 2YC0A 1FXVA 1I5YA 2P06A 3SJCC 1YVWA 1NS1A 3CE2A 1DGSA 3T4ZA 3BPZA 2JIZG 1H2MA 1K5QA 5LOVA 4LFAB 1WA8B 1Q8IA 4NTXA 1XNRO 2EJRA 2P4VA 1SA0B 2DW4A 3OE7G 4EEQA 1K7DA 2PTMA 1CPYA 2CTQA 3CP1A 1PL4A 2Z3YA 3VQVA 1NH2B 3E8BA 2ZE7A 3K04A 4RQEA 3T1HB 1FFXA 2IM9A 4PV1B 3K9SA 4FFBA 1HW7A 1MSDA 3H01A 2H8PC 3GWOA 2BE3A 4K8ZA 2CDYA 2ZCEA 2B5UA 2O57A 4ZOLB 4UCVA 4CZZA 2EIMC 1LR1A 3CSXA 1YJ9V 4UVBA 3K59A 1VF6C 3BCCH 5L3FA 4I5SA 1NR7A 4IYIA 2K1EA 1K4DC 1XL6A 4UVCA 3A8TA 1L0LH 3CXHF 2VS0A 4UB8Z 3M7MX 3E8FA 3ZRVA 4HBNA 3T4DA 3DC5A 4J10A 1IZ3A 5LGTA 1HNWO 1J95A 2B1IA 2CH7A 2EZOA 4OXSA 1KECA 3TETA 1W2BU 1RPOA 4JI7O 1M57B 3WU2Z 1N4CA 1S5JA 3AK1A 1UFIA 2GSMB 3OUSA 2HKOA 1RSOA 2RNBA 1BT8A 1QHTA 3Q4HB 4MW8A 1B6QA 4IHJA 2HHHB 1QCEA 1MG1A 3E86A 3CCEV 1JA8A 1XL4A 1UJWB 2ZDIA 1XQ8A 5LP6B 1MSWD 2HEPA 3ZIAG 3N2GA 1OCCB 2NNUA 1Q6UA 1VMGA 4DV1B 1KKDA 3N27A 4LCUC 4JI5O 2DQ3A 1PV0A 1N0NA 4O4IA 1BL8A 2C2AA 1BQ0A 1V55C 3K3WA 2W0FC 4FJCC 1HNXB 1G4YB 3JASA 1NR1A 4CS4A 1JFFB 4DK0A 1CP9A 2AZ0A 4J80A 4FMTA 3HKDB 3HR0A 4UCRA 4FLUA 1P7BA 3FYEB 2E75B 4E2LA 4LFCB 1WPBA 3RN4A 3W7SA 4AILC 4X88A 4DV3O 5JCOC 2F95B 1AVMA 4DV2O 4LF5B 4JI4B 1RSOB 3FAVB 5F2VO 1XREA 2HVKC 1YDXA 3APOA 4U3JB 2OCHA 5B1BB 1OCZC 3ASOC 1KP2A 1VF6A 1SZTA 1YCIA 1DTOA 4NTYA 4RUEA 2EULA 5IYDO 4P9PA 3M99B 3PJSK 4ZHQB 2EIKC 1VF5B 5KMGB 5J2TB 1R3KC 1ZAUA 1HR0O 3ABTA 2KKWA 2HVJC 4MVQA 3ZN1A 2EINB 2UXCB 3OGCC 3FX7A 1AR1B 3UT5A 2P4KA 2HP8A 2MW2B 4MTFA 3B2EE 3R66A 2E5LO 1THZA 4LF7O 2F93B 3RVZA 4JYBA 1P7GA 1L8DA 3BRCA 4EB6B 4NKGB 3A0BZ 2Y0PA 4ZI7B 4H44B 4LF8B 1M4UA 4RUFA 4J41A 5LL6Y 4HZ3A 3OAAG 3RYFB 3CRCA 1JJOA 3ABKB 4O2AA 2LJ2A 3G67A 2DWEC 3JALA 3FKSG 2XHBA 1RP3B 2VQFO 3OFNG 1GTOA 3RT3C 2V1DA 4BIOA 3OMIB 2YXLA 2GHYA 2BTQA 1N0JA 4F6RA 3ZJZA 1XNRB 3H1HH 4JASA 2ZM6O 4JI6O 1G8MA 2E74B 4J7KA 3WB1A 1J5EO 3W7TA 2IJHA 4DR6O 1V54C 1Y66A 1BHAA 5KAIZ 3D3QA 1K9MW 1YHQV 1NKDA 2JEUA 2Q7GA 5JCOA 1ZL8B 1SKVA 1S5HC 5IYZB 2YUAA 1WP8A 1JJ2U 1PM9A 3L74H 1XBLA 1PL0A 2HG5C 2XAJA 4YY3O 2HJDA 4X1IB 4F4LA 4DUYO 1EN5A 3ZHRA 4K35A 1GM8A 1GMGA 5IJ9A 5EZYA 1I7FA 3IC7A 3JALB 2ZT9B 5L3GA 3CXCU 3JD1A 5BR8O 2Q69A 3J7AU 3ZEDA 1PNLA 4ZBMA 4GKKO 2JDIG 3ZMSA 3T1YO 1HNWB 1V55B 2IBZH 2R72A 5B1AC 3JAMN 2KG7B 4X1KB 1SC5B 3FD9A 5B5EZ 1R3LC 4JI7B 1KB9F 2N04A 2WLJA 4KXRA 2VWJA 1MMMA 3FB5C 1M90W 1L1FA 2PGGA 4YHHO 4LBEC 4PI2A 2W0XA 4KFMA 1FPOA 1S5LZ 4HAMA 5L3EA 2AHZA 3RYHB 1XHZA 2CTWA 1YZBA 5BMVB 3ZS8C 2FKXA 4WFFA 1P4RA 2JK5C 4WF9V 1EBOA 3ASOB 4JI5B 2F4VO 1Z2GA 3CCQV 2GTSA 3BA9A 4UUJC 3OTOO 1NVPD 1XI1A 2EIKB 3L70H 4J7JA 2FYUH 4DV0O 1TUBB 4JGSA 4N21A 1JMKC 2CGNA 2A06H 1XMQO 3A0RA 3RVYA 2GTAA 1TAEA 3KCXA 3SDLA 1QLNA 1LNQA 1M56B 4A5UB 4LP8A 4MVZA 3JSLA 4DV3B 4DV2B 2PYLA 1IXBA 2CTRA 2XNDG 2M7WA 1NT2B 2PY5A 1MA1A 2GBOA 4UV8A 3IJ4A 3JD4A 4I4TA 4WFGA 3SYPA 4CH6A 1FJGO 1O9HA 4MTGA 2WLLB 3CB2A 3RYCA 4YJ2A 3WG7C 4LF4O 1WNSA 3C3TA 3O65A 2OTJV 3ZRWB 4YIOA 4FFKA 3ML0A 3X2QB 3E8GA 3ZMZA 2ETNA 2FB5A 1HR0B 3HKBA 3LSSA 2LFSA 3ASNB 3ETDA 1QLEB 4UB6Z 3KCYA 4JI2O 4JTDB 4PELA 4KP4A 3SGIA 4DR2O 1Z5WA 2A7WA 3CX5F 4Z2WA 2QDOA 4O2BA 1XOUA 4FVMA 1GN6A 2E5LB 4LF7B 1CEZA 5D5QA 1IVSA 2DN9A 1H2GA 1QR9A 2BSKB 2AXTZ 4QE9A 4JAAA 4BR6A 4DXWA 1JQ0A 3TXSA 3BVOA 2G38A 2VQFB 5B3SC 2WWWA 1Q90D 1RM1B 2OIGA 1YJNV 4G28B 1FXHA 4IIJA 2L35A 1B06A 2YIAA 2WAMA 3N2KB 4DV6O 3HKBB 4PDRA 1TA8A 2F66C 1JOYA 2YDEA 3P32A 3UKMA 3ZCCA 4JI6B 2ZM6B 4CBCA 2A3QA 1KMIZ 1J5EB 3ZHUA 4DR6B 2YEVA 4JI8O 3BABA 5B1AB 1AI5A 1AJPA 2OCCB 1K4CC 1GN3A 3SYOA 5IYBO 4CS3A 2BOCC 3CCUV 3BY6A 2RQ6A 3ZRXA 1SF9A 4JTCB 2V7QG 2QA4V 4YY3B 4DUYB 2DYRB 2DYSC 4LWSB 4D7TA 1WLEA 4EKWA 4P30A 3OTFA 3LNMB 3K03A 2AZ2A 4PDLA 4DK1A 1YIJV 5IJ0A 3RFRA 4B7EA 3K5OA 3NR7A 4LFBO 2KB1A 5BR8B 4JI1O 4GKKB 3T1YB 2PZSA 2WLIB 2XUMA 1R3JC 4OGQB 3LUTB 2WLKA 4IL6Z 3JD3A 4B3TO 4J42A 2UUCO 2JRIA 1VQOV 4GKJO 1B3QA 3F7VC 1KD1W 4PD4F 1MABG 1H2SB 2JS5A 1AROP 2CTPA 1OJHA 3AG2C 1NI8A 3K06A 4YHHB 2P90A 4WFBV 4TWKA 1D5NA 3A0HZ 1K73W 1IBMO 1WAZA 1Q81W 5J2UA 1TUEB 3OEHG 3MAQA 3CMEV 3O9OA 2F4VB 3WG7B 2QTSA 3DTUB 5JH7A 3OTOB 4R6ZA 5IT9N 5IE9A 5TISZ 3H1KH 4E4EA 2NN4A 4TV8B 1JX9A 2GUZA 4UCSA 4IYHA 4DV0B 2Q8VA 4FZ1A 4DRXA 3SPIA 2EX3A 1HDJA 1S76D 4DUZO 1XMQB 4CH4A 1AB3A 4J9YB 1Y74A 2IJKA 4X8AA 1W0JG 4JPRA 5KUKA 2ZD9A 1Q6HA 4PDMA 2ODMA 4OPAA 4W4KA 3QO5A 1SQQH 1AI6A 5EBWC 3SPCA 1WP7A 1XEQA 5CMUA 3JCZA 1K5SA 3CCVV 1OCRC 3OMNB 1VEWA 1GN2A 3JARA 3OM3B 1VF7A 2Q9LA 2IH3C 1US6A 4X89A 1VQNV 1FJGB 5LOVB 4LF4B 3JCUZ 1HWYA 1BQZA 4CC5A 3CD6V 5KHKA 1FFXB 3LDCA 1VP7A 5B3SB 2YS8A 4JYCA 4J7ZA 3J81N 4FFBB 1JR9A 1P84F 5EBMC 2XTAA 3ABLB 4JI2B 5ITZA 4TSFG 1KQSU 4DR2B 3I56V 3VOUA 1IBLO 1ROPA 5KHGA 2DMXA 4CH3A 1Y74B 1AP6A 2IJIA 5IDJA 3SYQA 1SESA 1E79G 1V9PA 5HFLA 1TVKA 2P22C 1PKXA 2JJ2G 1W0KG 4XDJA 5JJJB 2UXNA 1Q6IA 2JJ1G 5LMNO 3JAKA 1F4NA 1R3IC 2P6JA 1H8EG 2OWOA 4H33A 1QVGU 1VARA 1SQGA 2DWDC 1BZKA 4BIUA 2CH7B 3AG1B 3K5LA 1A32A 4U7NA 1AP5A 4BIZA 2ILMA 3D3IA 4UCOA 4LF9O 2EILC 4EFEA 3IC9A 1R6TA 4DV6B 2A0LA 5H6RA 1RFYA 2CK3G 3LSUA 2X6CA 3H1IH 3CYOA 2A79B 4IHJB 4Q6GA 3A2FA 3E83A 2NLJC 5FNVA 4X64O
chains in the Genus database with same CATH topology
3H1HH 1NU1H 3L74H 3L72H 5KLVH 1SQVH 3L71H 1NTZH 3H1KH 3L70H 3L75H 1BGYH 3TGUH 1PPJH 1EZVH 2BCCH 2IBZH 3CWBH 3H1JH 1NTMH 2FYUH 1SQXH 1P84F 1PP9H 3BCCH 1SQBH 2A06H 4U3FH 1KB9F 1BE3H 1KYOF 1NTKH 3H1IH 1BCCH 1SQPH 1SQQH 4PD4F 4D6TH 1L0LH 1L0NH 3CXHF 3L73H 3H1LH 3CX5F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1H H;  1NU1 H;  3L74 H;  3L72 H;  5KLV H;  1SQV H;  3L71 H;  1NTZ H;  3H1K H;  3L70 H;  3L75 H;  1BGY H;  3TGU H;  1PPJ H;  1EZV H;  2BCC H;  2IBZ H;  3CWB H;  3H1J H;  1NTM H;  2FYU H;  1SQX H;  1P84 F;  1PP9 H;  3BCC H;  1SQB H;  2A06 H;  4U3F H;  1KB9 F;  1BE3 H;  1KYO F;  1NTK H;  3H1I H;  1BCC H;  1SQP H;  1SQQ H;  4PD4 F;  4D6T H;  1L0L H;  1L0N H;  3CXH F;  3L73 H;  3H1L H;  3CX5 F; 
#chains in the Genus database with same CATH topology
 4B3S O;  1OZ0 A;  2E76 B;  4JI8 B;  3G6E V;  3N2G B;  1IUR A;  1X59 A;  4JAV A;  5GTI Z;  5CA0 A;  4O4I B;  3KG2 A;  1KYO F;  1SQF A;  3AG2 B;  4DW1 A;  5LXT A;  4FM1 A;  4Z1M G;  4W4L A;  3JAS B;  4FLW A;  1NH2 D;  1K34 A;  5FLX N;  4GX5 A;  1NTZ H;  3FB6 C;  3W7X A;  3BEH A;  1AI7 A;  3ZMU A;  1LUV A;  4FM2 A;  1NVP B;  4BW5 A;  4TV9 A;  4LFB B;  4TQF A;  1KU9 A;  3VQX A;  4NTW A;  3KZI Z;  4JI1 B;  2R9I A;  4GYC B;  3B77 A;  4JZG A;  5LYJ A;  3THO A;  1JVM A;  2ZR2 A;  4LR3 A;  3G4S V;  3SR2 C;  5IY5 C;  2JS3 A;  4B3T B;  5GTH Z;  5H5N A;  2UUC B;  2EIM B;  4MVO A;  1FYJ A;  1I08 A;  4GKJ B;  2YIC A;  1YIT V;  1EFR G;  2Z0A A;  1GN4 A;  4BWA A;  3TK1 A;  3CRA A;  2RJZ A;  2PI4 A;  2FL4 A;  2OYQ A;  1I0H A;  1IBM B;  1WB8 A;  2ADP A;  1OCR B;  1SQV H;  4Q20 A;  4AHC A;  3SYC A;  2Q6A A;  4X20 A;  3P3N A;  3UT5 B;  5IWA O;  2OT5 A;  3B09 A;  3ZHV A;  1H2K A;  1D2D A;  4GX2 A;  3S3X A;  2LP7 A;  3H1L H;  2CAZ C;  1N32 O;  3OR6 C;  3G71 V;  4DW0 A;  2W6I G;  2HFE C;  2Q68 A;  3JD2 A;  4DYL A;  4DUZ B;  5LYJ B;  3AG4 C;  2EIJ C;  4LC1 A;  3JAT A;  2QWQ B;  4U7O A;  1ZX3 A;  3SJA C;  4H0L B;  4DR5 O;  1XDC A;  4P2Z A;  3PN1 A;  3UCS C;  4O2A B;  4WCE V;  4NXN O;  3VBB A;  1BCC H;  1SRY A;  1VQP V;  4B3M O;  1VQL V;  5LHG A;  1PNM A;  4MS2 A;  3JD0 A;  4J9Z B;  1S72 V;  2UU9 O;  1PNK A;  1ZUQ A;  3HKE A;  2BTQ B;  1JCH A;  4F6R B;  3HKC A;  4X62 O;  1R6N A;  3CRM A;  3DGE A;  3CEI A;  3OGI B;  5FPR A;  4QPK A;  3G6B A;  1XUQ A;  1S0V A;  4JI0 O;  2YI9 A;  3GVM A;  4YJ3 A;  3SPG A;  3EFF K;  3APQ A;  3P30 A;  3UM7 A;  3BA8 A;  3W7W A;  3ICX A;  4X65 O;  4WFA V;  3CWB H;  4TT3 G;  3CPW U;  4QGP A;  4R8C A;  4XDL A;  1IBL B;  3FFQ A;  4UXN A;  1VIB A;  4O4L A;  3R65 A;  5LBQ A;  3RBZ A;  1YSC A;  1OCZ B;  2QKC A;  3E89 A;  3FYI B;  4AQY O;  1Z5V A;  4FLT A;  2UXD O;  2JGU A;  5IJ9 B;  1YXB A;  5EZY B;  2JVD A;  1SQX H;  3ABU A;  4I0X A;  5LMN B;  3ETE A;  3I5D A;  1NZ6 A;  2QJ1 A;  2R70 A;  5EYP A;  3M8A A;  1L0N H;  4RQF A;  1AIL A;  3K9A A;  4QNH B;  3B40 A;  4I9Q A;  3DC6 A;  1ZLZ A;  4LF9 B;  3OW2 U;  3TCU A;  2ITD C;  1ORQ C;  2QWP B;  4NXM O;  1Q43 A;  2MK3 A;  2YIB A;  4NB5 A;  1WN7 A;  2B9Z A;  1GH6 A;  2XAF A;  1XMO O;  1COW G;  3H9V A;  4Z1V A;  2Y4T A;  4X64 B;  4B3S B;  3CHX A;  2Q0O C;  4JYA O;  3TXQ A;  1GO3 F;  3B8N A;  4K8X A;  1IDS A;  4TOI A;  5IY5 B;  2XAQ A;  4O4L B;  1Q5O A;  5H2F Z;  3NXS A;  5LMU O;  1MNG A;  3RGB A;  3U0Z A;  2W6J G;  5JVD A;  4UVA A;  4QJF B;  1VQK V;  4DV4 O;  1FFT B;  2XAH A;  1ZSP A;  4R7C A;  4TUY A;  3ZHS A;  3CCM V;  1GAX A;  5BXZ A;  4HNA A;  5C8Y A;  3JYC A;  4B08 A;  4CS2 A;  1V54 B;  1BMF G;  4R50 A;  4FLV A;  3WB0 A;  2UUA O;  3RYI A;  5KHH A;  1NTK H;  5JQG A;  1MOF A;  1NQT A;  3AK2 A;  4XBF A;  3JAW A;  2Z5U A;  3TJT A;  4I4T B;  2D2C B;  1B04 A;  2DE0 X;  3AG4 B;  4X1Y A;  3RYC B;  2FTK A;  4YJ2 B;  5KA6 A;  3OT7 A;  2P7T C;  5D5P A;  1VQ8 V;  2ZIN A;  3EVK A;  3STL C;  2R9R B;  5EIB D;  1F4M A;  4O4H A;  4WFE A;  5KX5 A;  1TGO A;  5B1O A;  1ENV A;  2JGD A;  1VQ6 V;  5IWA B;  1EZJ A;  5KHI A;  5EK0 A;  1AR4 A;  4DR1 O;  4O2B B;  5CA3 A;  2VQE O;  2QWR B;  5LP6 C;  1Y76 A;  2Q4P A;  4JTA B;  4PA4 A;  5L3D A;  1N32 B;  3QG5 A;  1Q3E A;  1XHX A;  1EZV H;  3CRQ A;  4DR5 B;  2XAG A;  4NXN B;  2UUB O;  1WA8 A;  3AG7 A;  3ZBH A;  1SA0 A;  2A9H A;  1QNM A;  4B3M B;  1YTF D;  3CCL V;  2ITC C;  4MVU A;  2ZR3 A;  3L73 H;  3HPL C;  4RAI A;  1ZWI C;  2HR3 A;  2UU9 B;  4FZ0 A;  3B8M A;  3MHH C;  4IIJ B;  3ZN0 A;  3CCJ V;  4X62 B;  5CA1 A;  1I94 O;  3LDD A;  5E79 Z;  1AJN A;  5KAF Z;  1LUW A;  2AGA A;  4JI0 B;  5KX5 B;  2IU3 A;  4ZOL A;  4K0K O;  1N34 O;  4MTO A;  2DJV A;  2YEV B;  4WBN A;  3LNN A;  2QE7 G;  1AJQ A;  2P5O A;  5EBL C;  1GM7 A;  4WFH A;  4X65 B;  4DV7 O;  3K79 A;  1IBK O;  1X4T A;  2Y69 C;  4CH5 A;  4QPJ A;  3SPH A;  3OMA B;  2EIN C;  1W59 A;  1XIL A;  1AR5 A;  2LGQ A;  2YXH A;  1FD9 A;  5AG2 A;  4AQY B;  2WLM A;  2UXD B;  2NR5 A;  2FML A;  1YJW V;  5IJ0 B;  1FXK C;  4TQD A;  1U96 A;  2KQX A;  3DSQ A;  4MT8 A;  3H1J H;  4I55 A;  3E2E A;  4EFB A;  1Y67 A;  2ZXW C;  3SJQ C;  5KHJ A;  3KKY A;  3F5W C;  2YIB D;  4UFZ A;  3Q4H A;  1F7Y A;  5CA1 B;  1EN6 A;  2Q7H A;  3ZMV A;  4CC6 A;  1H2N A;  1T5E A;  4PA6 A;  2Q67 A;  5LP6 A;  4DR7 O;  3ABK C;  4WBN B;  5LA6 A;  1BHB A;  1Q82 W;  4NXM B;  1F51 A;  4I50 A;  4PA7 A;  2F1M A;  1N33 O;  1XMO B;  2AHY A;  4FLY A;  2Q7E A;  3S3W A;  4MSW C;  5KUM A;  3CCS V;  3UO3 A;  4QE7 A;  4G27 B;  2LW7 A;  4ZKI A;  2D3O W;  5J2U B;  4JYA B;  4FLZ A;  3TGU H;  1CXZ B;  5H6Q A;  2RDC A;  2XOK G;  2HJF C;  2VRZ A;  3OD4 A;  1JFF A;  5LMU B;  1HNZ O;  5CBH A;  2LW1 A;  4LH7 A;  4XDK A;  3HKD A;  5JH7 B;  4KUM A;  3IFX A;  4LNU A;  2ZIM A;  3BAA A;  4DV4 B;  2DOS A;  2K9P A;  4I9W A;  1OHH G;  2GUZ B;  1EN4 A;  4I55 B;  4OX9 O;  3ZHQ A;  4DRX B;  3B4S A;  2PUS A;  2ZIO A;  3FAV A;  1KKC A;  3SYA A;  4U3J A;  4QIW F;  3CMA V;  3K08 A;  2IJJ A;  4AI8 A;  1I5X A;  5K1P A;  2UUA B;  1Y4M A;  4NYK A;  2X7R B;  5LA6 B;  1FKA O;  4ZHQ A;  5KMG A;  5J2T A;  2E3C A;  3JAR B;  4I50 B;  1WPX A;  4GLX A;  5BY1 A;  4ASU G;  2DYS B;  3QO8 A;  4DR4 O;  1D5A A;  5EIB C;  1GRJ A;  1URF A;  3CC2 V;  3P3P A;  4IGG A;  2ARH A;  3ETG A;  1FXK A;  4MVM A;  4K3A A;  1KC8 W;  1VQ4 V;  2X6B A;  4LNU B;  4FM0 A;  1AI4 A;  1SET A;  1G1X B;  1VQ9 V;  1NBM G;  1SER A;  4X66 O;  1DLB A;  1O9G A;  4JV5 O;  1P49 A;  1YF2 A;  2BOB C;  5ITZ B;  1H8H G;  4GCZ A;  4EB6 A;  5LHH A;  2GDS A;  4ZI7 A;  2Y4U A;  4DR1 B;  2WSS G;  1QQC A;  3HB3 B;  2VQE B;  2Q0A A;  3RYF A;  2UXB O;  4U3F H;  1MZF A;  2RMK B;  2Y0I A;  5EC1 C;  1GM9 A;  1TVK B;  2Q73 A;  4I7Z B;  2DQ0 A;  3IGA C;  5LGU A;  1E1Q G;  2PYJ A;  4X9Q A;  3JAK B;  2Y69 B;  4MVS A;  2BCC H;  5JJN B;  3U11 A;  2UUB B;  1WJZ A;  2QTO A;  3G80 A;  4GZR B;  4UCT A;  1DF5 A;  1N8R W;  4G2K A;  1Y6X A;  4ZIB A;  1VQ7 V;  2WA3 A;  2JEX A;  2AW9 A;  3WB2 A;  2QM8 A;  5E1A C;  4ICG A;  1M56 C;  1K8A W;  1FXK B;  1I94 B;  2Y48 A;  2ZNI A;  4C7U A;  5FPO A;  4PJ0 Z;  2ZXW B;  1N36 O;  1ZL8 A;  5IYZ A;  5FNV B;  4OPH A;  3AEI A;  3FB7 C;  4K0K B;  2F43 G;  3DXR A;  1N34 B;  5CBG A;  1R1B A;  4X1I A;  4JI3 O;  2ATK C;  3SPJ A;  4PI0 A;  5DM6 V;  4JF3 A;  1SZX A;  4DV7 B;  5CA0 B;  1IBK B;  2ZKO A;  2WPD G;  3RW0 A;  3X2Q C;  1QR8 A;  3ZHT A;  4ABM A;  5CB4 A;  3EHB B;  4P9O A;  5LXT B;  2H94 A;  3ASN C;  4H13 B;  1QLE C;  4NR1 A;  1K92 A;  3ABM C;  1BS3 A;  1SS3 A;  4D6T H;  4B3R O;  2ZNJ A;  3E22 A;  1Q86 W;  1HP8 A;  4PDV A;  5GON A;  5HFM A;  5JJE B;  4TV9 B;  2KG7 A;  4X1K A;  2LGW A;  3OR7 C;  2YID A;  1KUQ A;  2QKA A;  4JYY A;  1XNQ O;  4DR3 O;  5L3C A;  5BZB A;  1KP3 A;  1SQB H;  5FL7 G;  1OCO C;  3AG3 C;  5C93 A;  2QM7 A;  4O4J A;  2PI5 A;  3J80 N;  3RYH A;  5BMV A;  4LF6 O;  2QKS A;  3DXR B;  4DR7 B;  4DV5 O;  1RPR A;  4IT5 A;  4RO2 A;  1N33 B;  1NTM H;  3LDE A;  4LH6 A;  2N05 A;  1RM1 C;  1YEW A;  2BTO A;  2OIE A;  1OV9 A;  1ZTE A;  5CB4 B;  2UXX A;  3FB8 C;  4KHP O;  2IU0 A;  2EBO A;  2ADQ B;  1TUB A;  4X20 B;  1HNZ B;  4J11 A;  3EXA A;  2QEX V;  2Q5Z A;  1QU7 A;  2CE4 A;  3E22 B;  2EIL B;  5B1N A;  5GON B;  2OCC C;  2IH1 C;  3QVN A;  1FAF A;  3QO7 A;  5JWP A;  4BW9 A;  4OX9 B;  2M6Y A;  3ZRS A;  4H37 A;  4MTX A;  1PD3 A;  3W7U A;  3C3S A;  1K33 A;  4KL1 A;  3JAT B;  3K58 A;  1YI2 V;  2DYR C;  1F23 A;  3STZ C;  3VQY A;  4LFA O;  3U10 A;  2WLL A;  4O4J B;  2RCV A;  1VQ5 V;  1QVF U;  3ZRW A;  3CC4 V;  5IYC O;  5LHI A;  4BAY A;  4RWU A;  4D7S A;  3HKE B;  3T1H O;  1SQP H;  3HKC B;  5J9P C;  2X6A A;  2VWK A;  1K3E A;  5B66 Z;  1R6K A;  1YTF B;  4DR4 B;  4YJ3 B;  4UV9 A;  3VQW A;  5H9C A;  4MW3 A;  3ZX6 A;  3C90 A;  2XT9 A;  5L3B A;  2V4D A;  4YIP A;  1H2L A;  3AK3 A;  2QSA A;  2WA4 A;  4B7K A;  4F6E A;  1BSM A;  3K0D A;  4X66 B;  1VQM V;  3MD0 A;  5LGN A;  3QF7 A;  4JV5 B;  3L72 H;  2GV9 A;  2OTL V;  2EZP A;  2QWO B;  5K1X A;  1UPG A;  2LQT A;  1DK1 A;  1DF4 A;  3K5M A;  2BSK A;  1IXM A;  4GX0 A;  4YXW G;  5CN0 A;  1GK9 A;  3F7Y C;  4UCU A;  2UXB B;  4GT1 A;  2ZE5 A;  2PF4 E;  1S3J A;  1M5I A;  4FK5 C;  2EJ7 A;  1E1R G;  4JAU A;  4DO2 A;  3L9D A;  3D36 C;  4I0X B;  3GB7 C;  3I55 V;  3BHP A;  2CGO A;  3WFV A;  3N2K A;  4PHZ A;  3L75 H;  1BGY H;  5EYP B;  2ZE6 A;  2LO1 A;  2HHH O;  2LFR A;  3IAY A;  4L8J A;  3ABM B;  2KSD A;  4FPP A;  3CC7 V;  4NVP A;  4PA3 A;  5DEC A;  2ZE8 A;  3SJB C;  1G6U A;  4DV1 O;  2WLH A;  3JSN A;  1WB7 A;  5KLV H;  3CJH A;  1EM1 A;  1MZE A;  3QTC A;  2WLN A;  1N36 B;  2F23 A;  2EIJ B;  3T2M A;  3T1C A;  3UO2 A;  2P67 A;  1OCO B;  3AG3 B;  1HNX O;  3OEE G;  4LWS A;  3F5T A;  4JI3 B;  1S77 D;  1BE3 H;  2YXY A;  4HYO A;  1U97 A;  3ZMT A;  3CCR V;  2CUG A;  1M57 C;  5JVD B;  3MDS A;  1NU1 H;  2YSU B;  4GX1 A;  1M1K W;  3K0G A;  3CS5 A;  3GWK C;  4GUN A;  4LFC O;  1M9N A;  3K57 A;  4TUY B;  3ETQ A;  3RWR D;  2ZQM A;  4FLX A;  3ABL C;  1GKF A;  3E8H A;  3OUF A;  2WLI A;  4LF5 O;  3UQ8 A;  4JI4 O;  4B3R B;  4HNA B;  5C8Y B;  4JZ2 A;  1OCC C;  3MHS C;  5GW7 A;  2QM4 A;  2QGN A;  1FS0 G;  2R9A A;  2QR4 A;  3RYI B;  1XNQ B;  1M93 A;  4DR3 B;  5JQG B;  3LSQ A;  3D8C A;  2N74 A;  2HLD G;  3CJH B;  3JAW B;  3CRR A;  4L87 A;  5EC2 C;  1KBH A;  2QWN B;  2UXC O;  2H3O A;  2IW5 A;  4X1Y B;  1R73 A;  1NJI W;  4LF6 B;  4FIP C;  3QNE A;  4DV5 B;  4PA9 A;  2XAS A;  5KA5 A;  5CBF A;  3AG1 C;  5DN6 G;  2B1G A;  1PPJ H;  2L6L A;  1IX9 A;  1QBZ A;  3BFR A;  2RN9 A;  3D36 A;  3K5N A;  4MVR A;  1Q7Y W;  4O4H B;  1K97 A;  3E35 A;  4KHP B;  4TV8 A;  1H38 A;  2JGD B;  5B1B C;  4LF8 O;  5DED A;  1JPX A;  2X0L A;  2ZDI C;  3L71 H;  5A2Q N;  1Y76 B;  5A9G A;  4N23 A;  2YI8 A;  1PP9 H;  2YC0 A;  1FXV A;  1I5Y A;  2P06 A;  3SJC C;  1YVW A;  1NS1 A;  3CE2 A;  1DGS A;  3T4Z A;  3BPZ A;  2JIZ G;  1H2M A;  1K5Q A;  5LOV A;  4LFA B;  1WA8 B;  1Q8I A;  4NTX A;  1XNR O;  2EJR A;  2P4V A;  1SA0 B;  2DW4 A;  3OE7 G;  4EEQ A;  1K7D A;  2PTM A;  1CPY A;  2CTQ A;  3CP1 A;  1PL4 A;  2Z3Y A;  3VQV A;  1NH2 B;  3E8B A;  2ZE7 A;  3K04 A;  4RQE A;  3T1H B;  1FFX A;  2IM9 A;  4PV1 B;  3K9S A;  4FFB A;  1HW7 A;  1MSD A;  3H01 A;  2H8P C;  3GWO A;  2BE3 A;  4K8Z A;  2CDY A;  2ZCE A;  2B5U A;  2O57 A;  4ZOL B;  4UCV A;  4CZZ A;  2EIM C;  1LR1 A;  3CSX A;  1YJ9 V;  4UVB A;  3K59 A;  1VF6 C;  3BCC H;  5L3F A;  4I5S A;  1NR7 A;  4IYI A;  2K1E A;  1K4D C;  1XL6 A;  4UVC A;  3A8T A;  1L0L H;  3CXH F;  2VS0 A;  4UB8 Z;  3M7M X;  3E8F A;  3ZRV A;  4HBN A;  3T4D A;  3DC5 A;  4J10 A;  1IZ3 A;  5LGT A;  1HNW O;  1J95 A;  2B1I A;  2CH7 A;  2EZO A;  4OXS A;  1KEC A;  3TET A;  1W2B U;  1RPO A;  4JI7 O;  1M57 B;  3WU2 Z;  1N4C A;  1S5J A;  3AK1 A;  1UFI A;  2GSM B;  3OUS A;  2HKO A;  1RSO A;  2RNB A;  1BT8 A;  1QHT A;  3Q4H B;  4MW8 A;  1B6Q A;  4IHJ A;  2HHH B;  1QCE A;  1MG1 A;  3E86 A;  3CCE V;  1JA8 A;  1XL4 A;  1UJW B;  2ZDI A;  1XQ8 A;  5LP6 B;  1MSW D;  2HEP A;  3ZIA G;  3N2G A;  1OCC B;  2NNU A;  1Q6U A;  1VMG A;  4DV1 B;  1KKD A;  3N27 A;  4LCU C;  4JI5 O;  2DQ3 A;  1PV0 A;  1N0N A;  4O4I A;  1BL8 A;  2C2A A;  1BQ0 A;  1V55 C;  3K3W A;  2W0F C;  4FJC C;  1HNX B;  1G4Y B;  3JAS A;  1NR1 A;  4CS4 A;  1JFF B;  4DK0 A;  1CP9 A;  2AZ0 A;  4J80 A;  4FMT A;  3HKD B;  3HR0 A;  4UCR A;  4FLU A;  1P7B A;  3FYE B;  2E75 B;  4E2L A;  4LFC B;  1WPB A;  3RN4 A;  3W7S A;  4AIL C;  4X88 A;  4DV3 O;  5JCO C;  2F95 B;  1AVM A;  4DV2 O;  4LF5 B;  4JI4 B;  1RSO B;  3FAV B;  5F2V O;  1XRE A;  2HVK C;  1YDX A;  3APO A;  4U3J B;  2OCH A;  5B1B B;  1OCZ C;  3ASO C;  1KP2 A;  1VF6 A;  1SZT A;  1YCI A;  1DTO A;  4NTY A;  4RUE A;  2EUL A;  5IYD O;  4P9P A;  3M99 B;  3PJS K;  4ZHQ B;  2EIK C;  1VF5 B;  5KMG B;  5J2T B;  1R3K C;  1ZAU A;  1HR0 O;  3ABT A;  2KKW A;  2HVJ C;  4MVQ A;  3ZN1 A;  2EIN B;  2UXC B;  3OGC C;  3FX7 A;  1AR1 B;  3UT5 A;  2P4K A;  2HP8 A;  2MW2 B;  4MTF A;  3B2E E;  3R66 A;  2E5L O;  1THZ A;  4LF7 O;  2F93 B;  3RVZ A;  4JYB A;  1P7G A;  1L8D A;  3BRC A;  4EB6 B;  4NKG B;  3A0B Z;  2Y0P A;  4ZI7 B;  4H44 B;  4LF8 B;  1M4U A;  4RUF A;  4J41 A;  5LL6 Y;  4HZ3 A;  3OAA G;  3RYF B;  3CRC A;  1JJO A;  3ABK B;  4O2A A;  2LJ2 A;  3G67 A;  2DWE C;  3JAL A;  3FKS G;  2XHB A;  1RP3 B;  2VQF O;  3OFN G;  1GTO A;  3RT3 C;  2V1D A;  4BIO A;  3OMI B;  2YXL A;  2GHY A;  2BTQ A;  1N0J A;  4F6R A;  3ZJZ A;  1XNR B;  3H1H H;  4JAS A;  2ZM6 O;  4JI6 O;  1G8M A;  2E74 B;  4J7K A;  3WB1 A;  1J5E O;  3W7T A;  2IJH A;  4DR6 O;  1V54 C;  1Y66 A;  1BHA A;  5KAI Z;  3D3Q A;  1K9M W;  1YHQ V;  1NKD A;  2JEU A;  2Q7G A;  5JCO A;  1ZL8 B;  1SKV A;  1S5H C;  5IYZ B;  2YUA A;  1WP8 A;  1JJ2 U;  1PM9 A;  3L74 H;  1XBL A;  1PL0 A;  2HG5 C;  2XAJ A;  4YY3 O;  2HJD A;  4X1I B;  4F4L A;  4DUY O;  1EN5 A;  3ZHR A;  4K35 A;  1GM8 A;  1GMG A;  5IJ9 A;  5EZY A;  1I7F A;  3IC7 A;  3JAL B;  2ZT9 B;  5L3G A;  3CXC U;  3JD1 A;  5BR8 O;  2Q69 A;  3J7A U;  3ZED A;  1PNL A;  4ZBM A;  4GKK O;  2JDI G;  3ZMS A;  3T1Y O;  1HNW B;  1V55 B;  2IBZ H;  2R72 A;  5B1A C;  3JAM N;  2KG7 B;  4X1K B;  1SC5 B;  3FD9 A;  5B5E Z;  1R3L C;  4JI7 B;  1KB9 F;  2N04 A;  2WLJ A;  4KXR A;  2VWJ A;  1MMM A;  3FB5 C;  1M90 W;  1L1F A;  2PGG A;  4YHH O;  4LBE C;  4PI2 A;  2W0X A;  4KFM A;  1FPO A;  1S5L Z;  4HAM A;  5L3E A;  2AHZ A;  3RYH B;  1XHZ A;  2CTW A;  1YZB A;  5BMV B;  3ZS8 C;  2FKX A;  4WFF A;  1P4R A;  2JK5 C;  4WF9 V;  1EBO A;  3ASO B;  4JI5 B;  2F4V O;  1Z2G A;  3CCQ V;  2GTS A;  3BA9 A;  4UUJ C;  3OTO O;  1NVP D;  1XI1 A;  2EIK B;  3L70 H;  4J7J A;  2FYU H;  4DV0 O;  1TUB B;  4JGS A;  4N21 A;  1JMK C;  2CGN A;  2A06 H;  1XMQ O;  3A0R A;  3RVY A;  2GTA A;  1TAE A;  3KCX A;  3SDL A;  1QLN A;  1LNQ A;  1M56 B;  4A5U B;  4LP8 A;  4MVZ A;  3JSL A;  4DV3 B;  4DV2 B;  2PYL A;  1IXB A;  2CTR A;  2XND G;  2M7W A;  1NT2 B;  2PY5 A;  1MA1 A;  2GBO A;  4UV8 A;  3IJ4 A;  3JD4 A;  4I4T A;  4WFG A;  3SYP A;  4CH6 A;  1FJG O;  1O9H A;  4MTG A;  2WLL B;  3CB2 A;  3RYC A;  4YJ2 A;  3WG7 C;  4LF4 O;  1WNS A;  3C3T A;  3O65 A;  2OTJ V;  3ZRW B;  4YIO A;  4FFK A;  3ML0 A;  3X2Q B;  3E8G A;  3ZMZ A;  2ETN A;  2FB5 A;  1HR0 B;  3HKB A;  3LSS A;  2LFS A;  3ASN B;  3ETD A;  1QLE B;  4UB6 Z;  3KCY A;  4JI2 O;  4JTD B;  4PEL A;  4KP4 A;  3SGI A;  4DR2 O;  1Z5W A;  2A7W A;  3CX5 F;  4Z2W A;  2QDO A;  4O2B A;  1XOU A;  4FVM A;  1GN6 A;  2E5L B;  4LF7 B;  1CEZ A;  5D5Q A;  1IVS A;  2DN9 A;  1H2G A;  1QR9 A;  2BSK B;  2AXT Z;  4QE9 A;  4JAA A;  4BR6 A;  4DXW A;  1JQ0 A;  3TXS A;  3BVO A;  2G38 A;  2VQF B;  5B3S C;  2WWW A;  1Q90 D;  1RM1 B;  2OIG A;  1YJN V;  4G28 B;  1FXH A;  4IIJ A;  2L35 A;  1B06 A;  2YIA A;  2WAM A;  3N2K B;  4DV6 O;  3HKB B;  4PDR A;  1TA8 A;  2F66 C;  1JOY A;  2YDE A;  3P32 A;  3UKM A;  3ZCC A;  4JI6 B;  2ZM6 B;  4CBC A;  2A3Q A;  1KMI Z;  1J5E B;  3ZHU A;  4DR6 B;  2YEV A;  4JI8 O;  3BAB A;  5B1A B;  1AI5 A;  1AJP A;  2OCC B;  1K4C C;  1GN3 A;  3SYO A;  5IYB O;  4CS3 A;  2BOC C;  3CCU V;  3BY6 A;  2RQ6 A;  3ZRX A;  1SF9 A;  4JTC B;  2V7Q G;  2QA4 V;  4YY3 B;  4DUY B;  2DYR B;  2DYS C;  4LWS B;  4D7T A;  1WLE A;  4EKW A;  4P30 A;  3OTF A;  3LNM B;  3K03 A;  2AZ2 A;  4PDL A;  4DK1 A;  1YIJ V;  5IJ0 A;  3RFR A;  4B7E A;  3K5O A;  3NR7 A;  4LFB O;  2KB1 A;  5BR8 B;  4JI1 O;  4GKK B;  3T1Y B;  2PZS A;  2WLI B;  2XUM A;  1R3J C;  4OGQ B;  3LUT B;  2WLK A;  4IL6 Z;  3JD3 A;  4B3T O;  4J42 A;  2UUC O;  2JRI A;  1VQO V;  4GKJ O;  1B3Q A;  3F7V C;  1KD1 W;  4PD4 F;  1MAB G;  1H2S B;  2JS5 A;  1ARO P;  2CTP A;  1OJH A;  3AG2 C;  1NI8 A;  3K06 A;  4YHH B;  2P90 A;  4WFB V;  4TWK A;  1D5N A;  3A0H Z;  1K73 W;  1IBM O;  1WAZ A;  1Q81 W;  5J2U A;  1TUE B;  3OEH G;  3MAQ A;  3CME V;  3O9O A;  2F4V B;  3WG7 B;  2QTS A;  3DTU B;  5JH7 A;  3OTO B;  4R6Z A;  5IT9 N;  5IE9 A;  5TIS Z;  3H1K H;  4E4E A;  2NN4 A;  4TV8 B;  1JX9 A;  2GUZ A;  4UCS A;  4IYH A;  4DV0 B;  2Q8V A;  4FZ1 A;  4DRX A;  3SPI A;  2EX3 A;  1HDJ A;  1S76 D;  4DUZ O;  1XMQ B;  4CH4 A;  1AB3 A;  4J9Y B;  1Y74 A;  2IJK A;  4X8A A;  1W0J G;  4JPR A;  5KUK A;  2ZD9 A;  1Q6H A;  4PDM A;  2ODM A;  4OPA A;  4W4K A;  3QO5 A;  1SQQ H;  1AI6 A;  5EBW C;  3SPC A;  1WP7 A;  1XEQ A;  5CMU A;  3JCZ A;  1K5S A;  3CCV V;  1OCR C;  3OMN B;  1VEW A;  1GN2 A;  3JAR A;  3OM3 B;  1VF7 A;  2Q9L A;  2IH3 C;  1US6 A;  4X89 A;  1VQN V;  1FJG B;  5LOV B;  4LF4 B;  3JCU Z;  1HWY A;  1BQZ A;  4CC5 A;  3CD6 V;  5KHK A;  1FFX B;  3LDC A;  1VP7 A;  5B3S B;  2YS8 A;  4JYC A;  4J7Z A;  3J81 N;  4FFB B;  1JR9 A;  1P84 F;  5EBM C;  2XTA A;  3ABL B;  4JI2 B;  5ITZ A;  4TSF G;  1KQS U;  4DR2 B;  3I56 V;  3VOU A;  1IBL O;  1ROP A;  5KHG A;  2DMX A;  4CH3 A;  1Y74 B;  1AP6 A;  2IJI A;  5IDJ A;  3SYQ A;  1SES A;  1E79 G;  1V9P A;  5HFL A;  1TVK A;  2P22 C;  1PKX A;  2JJ2 G;  1W0K G;  4XDJ A;  5JJJ B;  2UXN A;  1Q6I A;  2JJ1 G;  5LMN O;  3JAK A;  1F4N A;  1R3I C;  2P6J A;  1H8E G;  2OWO A;  4H33 A;  1QVG U;  1VAR A;  1SQG A;  2DWD C;  1BZK A;  4BIU A;  2CH7 B;  3AG1 B;  3K5L A;  1A32 A;  4U7N A;  1AP5 A;  4BIZ A;  2ILM A;  3D3I A;  4UCO A;  4LF9 O;  2EIL C;  4EFE A;  3IC9 A;  1R6T A;  4DV6 B;  2A0L A;  5H6R A;  1RFY A;  2CK3 G;  3LSU A;  2X6C A;  3H1I H;  3CYO A;  2A79 B;  4IHJ B;  4Q6G A;  3A2F A;  3E83 A;  2NLJ C;  5FNV A;  4X64 O; 
#chains in the Genus database with same CATH homology
 3H1H H;  1NU1 H;  3L74 H;  3L72 H;  5KLV H;  1SQV H;  3L71 H;  1NTZ H;  3H1K H;  3L70 H;  3L75 H;  1BGY H;  3TGU H;  1PPJ H;  1EZV H;  2BCC H;  2IBZ H;  3CWB H;  3H1J H;  1NTM H;  2FYU H;  1SQX H;  1P84 F;  1PP9 H;  3BCC H;  1SQB H;  2A06 H;  4U3F H;  1KB9 F;  1BE3 H;  1KYO F;  1NTK H;  3H1I H;  1BCC H;  1SQP H;  1SQQ H;  4PD4 F;  4D6T H;  1L0L H;  1L0N H;  3CXH F;  3L73 H;  3H1L H;  3CX5 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...