1L0LH

Structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
78
structure length
78
Chain Sequence
GDPKEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 23
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1l0lH00
1PP9H 3BCCH 3CWBH 1L0LH 1EZVH 1KYOF 1BGYH 3L70H 1NTMH 1SQXH 2A06H 1BCCH 3L73H 3H1JH 1NU1H 2BCCH 3H1HH 3L74H 3CX5F 1SQPH 2IBZH 1NTKH 4U3FH 2FYUH 1P84F 1PPJH 1NTZH 1SQBH 3L72H 3H1LH 1SQVH 3L75H 3L71H 4PD4F 3TGUH 4D6TH 1SQQH 3H1IH 5KLVH 1L0NH 3H1KH 3CXHF 1KB9F 1BE3H
chains in the Genus database with same CATH superfamily
3EHBB 1TUBA 2QTSA 1E1RG 1EN5A 1OCZB 2ZIOA 2LW7A 3WB2A 2FB5A 2LJ2A 2LP7A 3E8BA 1N32B 1FXKC 3ZHRA 5LP6A 3OMNB 1MZEA 1XBLA 4WCEV 1I94O 1RPRA 4QE7A 3ZMSA 1K33A 5F2VO 1GN4A 5LOVA 4BIZA 5J2UA 2XT9A 2FKXA 5BMVB 4JI2B 1XHZA 2PYJA 2KSDA 1K4CC 4DR4O 3K5LA 1K4DC 2IU0A 2UUBO 1RP3B 5CBGA 1E79G 1IXMA 3H9VA 4NTWA 2LFSA 5EK0A 4DR1B 1F4MA 4UB8Z 2HVJC 4Z1VA 2X0LA 3CCMV 1IZ3A 1FD9A 3LDCA 2JEUA 1O9GA 3OTOO 2ETNA 4I7ZB 1R3JC 4K8XA 4DR7B 4LFBB 2W6IG 1PNLA 3HKCA 1K73W 5KUKA 1G6UA 5D5QA 2KKWA 4CS3A 2CE4A 3RYIA 4IIJA 2BCCH 2ZIMA 1DTOA 4LH7A 5KA6A 3JYCA 2XAQA 2JGDA 1I5YA 2IM9A 1HDJA 1CP9A 1S72V 3RT3C 3E83A 4YXWG 1S77D 1DK1A 1HNXO 2N04A 4JI4B 2WLNA 3CCEV 1H38A 5B1NA 3ZHTA 1HNZB 1BZKA 4HAMA 4ZI7B 4MS2A 1XREA 4DR3B 3N2KA 1SQXH 4YJ3A 1BCCH 1YJWV 2LQTA 3ICXA 2BSKA 1VQ5V 3ZMUA 3MHSC 3CRMA 4X65B 3VOUA 3N2GB 3CXCU 2PGGA 2P67A 1SC5B 4XDJA 4DV1O 4DV7B 1RSOB 4DR6B 4GYCB 1BHBA 1BS3A 2ZD9A 1Q6IA 2XUMA 4U7NA 4O2AB 5ITZA 2GHYA 1KP2A 3SPIA 3CX5F 1K5SA 5H6QA 4FLTA 1N34O 1Q81W 4FJCC 2MK3A 2B1GA 1Q8IA 1GO3F 1YCIA 2AHYA 3T4ZA 2UXDO 4MTFA 4JYYA 2E76B 4WFBV 3BCCH 3D36A 2GUZA 3ASNC 4IHJA 2XNDG 2C2AA 4G27B 1YHQV 1K7DA 1I08A 3RN4A 3IC9A 4DW1A 3CJHB 2Q9LA 2WLMA 3KCXA 3KG2A 5LHGA 1K5QA 1Z5VA 4FM2A 2M6YA 5CBHA 3OTFA 2EIJC 4JYCA 1NR1A 3ZRSA 3D8CA 2WA4A 3QG5A 4LCUC 5L3GA 1CEZA 1M57C 1YZBA 3JD1A 2HLDG 4FMTA 4YHHB 3ASOC 3J81N 2QKCA 5B1OA 3UO2A 4X20A 4LF4B 3CCUV 2N05A 2AZ2A 3M7MX 2H8PC 1HR0B 4B3RO 1QLEB 3H1KH 3STLC 3BEHA 3BY6A 5E79Z 1Z5WA 4FLYA 1N36O 4FIPC 4PJ0Z 1VQOV 3A0HZ 4DV6B 2RNBA 2R9AA 4N23A 1SERA 1S5HC 4AHCA 3E8FA 3AG3C 3B77A 3FB7C 2QSAA 5FLXN 1JR9A 1Q6UA 4OXSA 3ZHVA 5H6RA 5EZYB 3K5MA 3AG3B 4MW8A 1R6KA 1VQ7V 1XL4A 3IC7A 3AG7A 4ASUG 2QWPB 5BR8B 2X6AA 3VQVA 1M9NA 4X64O 4DV0O 1IURA 3K79A 3FKSG 2RMKB 4LF7O 4I50B 4XDKA 3ZEDA 2D3OW 2QM4A 5KHHA 1L1FA 1GMGA 1H2SB 2KQXA 5LMUB 2OWOA 4LF5B 1OCRB 3C3TA 3G4SV 5KHGA 3LDEA 4Z2WA 4UVBA 3QNEA 1IXBA 1WPBA 3DC6A 3F7VC 1XNRO 1DF5A 2ZM6B 1XMOB 4JASA 3OEHG 1VQ6V 3G6BA 4GLXA 2DQ0A 3P30A 2UUCO 3MDSA 1J5EB 3A8TA 3SPCA 1VF5B 1XL6A 2Y0PA 1R73A 3JAMN 5IYDO 2HKOA 5JJEB 3SYQA 1K9MW 3SYOA 3CB2A 4MW3A 2E75B 4C7UA 5KUMA 4MT8A 5CB4B 4X66B 3ETDA 4O4JA 1KU9A 1AVMA 3JAWA 4B7EA 3JAKA 1EN4A 3FB8C 3DXRA 4U3JA 2W0FC 3B40A 4J11A 1QR8A 1PPJH 2QM8A 1AI7A 1W0KG 4MVQA 1PL0A 2AHZA 3QF7A 4GKKO 2ITDC 4P2ZA 1FS0G 1JVMA 4KUMA 3RW0A 2JJ2G 4FLZA 2CH7B 5LYJA 4TV9B 4CC6A 3CD6V 4NVPA 5IYZA 3C3SA 1B06A 2F43G 1SS3A 5LHIA 1IBLO 3A0RA 1MMMA 3O65A 3K5NA 1BHAA 2QR4A 1SA0B 2HR3A 1NVPD 2DN9A 4JZ2A 4DW0A 5CA3A 4J7JA 1QQCA 2RQ6A 3BFRA 2IJIA 4HNAB 5HFMA 4PA7A 5L3DA 2YXYA 4B3MB 5LXTB 5LHHA 4XBFA 3B4SA 1P49A 4JI5O 4UCRA 1LR1A 3L72H 2W0XA 1E1QG 1BT8A 4MVUA 4JI8B 1FXKA 1PM9A 3M99B 3ZMVA 1SKVA 3HKDB 5LMNB 3IFXA 1QR9A 2ZDIC 4BAYA 5BMVA 2Y4UA 4X8AA 3AG2C 1FPOA 1N33B 1B6QA 1GN2A 3VQWA 1NQTA 3AG1B 2EZPA 1G8MA 3G80A 4DR4B 1VQPV 1AILA 4ZBMA 1R1BA 4ZHQB 4QJFB 5JH7B 1V54C 4G2KA 1BQZA 2AGAA 1LUVA 3BA9A 3BPZA 4CH4A 1AR4A 3T1YB 1SESA 2ZXWB 2YI9A 2DYSC 5DEDA 4P9PA 1M93A 3WG7B 1F51A 3OTOB 1VQ4V 4B3SO 1KBHA 1S5LZ 4X1IB 2K9PA 4YIPA 2ZE5A 2DYSB 4FLUA 2PI4A 4JZGA 4KXRA 4RQFA 1V55C 5CA0A 4DUZB 1LNQA 3LSUA 1ZLZA 1NT2B 3CCJV 4NXNB 1YIJV 2VRZA 2Z0AA 2LGWA 2Q73A 1N0NA 1L0NH 1V55B 4CS4A 4ZI7A 5EYPA 3T2MA 4QE9A 4OPHA 1S76D 2YIBA 3JSLA 3CS5A 3PJSK 1M5IA 3QO5A 4UCVA 4DV4O 4W4LA 3BABA 5FNVB 1XNQO 1GM7A 4GX1A 1H2MA 5KA5A 1MSDA 1K92A 4FM0A 4MSWC 4DRXB 1X4TA 5LGTA 3OMIB 4EFEA 3N2GA 2R9RB 4X62O 1H2KA 4LFCO 2EULA 3ZX6A 1COWG 4EEQA 4Z1MG 4PDMA 4O2AA 4DV1B 4K0KO 3OR7C 1NH2D 5JQGA 4J9ZB 2BTOA 4DV2O 1N8RW 5IWAB 1ZX3A 1IBMB 4HYOA 4WFGA 2L35A 1AJQA 2EINC 3ML0A 2HFEC 1TUEB 4ABMA 2ZR2A 4J10A 2V1DA 1Q86W 2O57A 5LGNA 3FAVB 4FFBB 1N34B 1OCZC 1YDXA 5JJNB 2QWNB 3I55V 4O4HA 1YJNV 3CJHA 1QVGU 3JARA 1L0LH 5KAIZ 4KHPO 3I5DA 3NXSA 2F4VO 3X2QC 4L8JA 2ATKC 2Q0AA 2IBZH 3P32A 3JATB 1BL8A 3IJ4A 1PNMA 1FYJA 2XAJA 3X2QB 3W7TA 1QU7A 4JTCB 3OAAG 2Q6AA 3F5TA 3DC5A 5K1PA 3QO8A 2UUAO 3OMAB 1ORQC 3K03A 3E2EA 2CTQA 5J9PC 5IJ9B 2CK3G 4YY3O 5IYCO 4JYBA 5JVDB 4I55B 4RAIA 1BSMA 4R6ZA 4LR3A 3TCUA 2QM7A 3OT7A 1WB7A 1WA8B 4PELA 3ZRXA 2X6BA 2M7WA 3SJCC 2UU9O 2A0LA 2GTSA 2WAMA 1M1KW 1OJHA 2DW4A 1ZUQA 5EZYA 1NKDA 1XHXA 4X1KB 4TT3G 4LWSB 1NR7A 3OGIB 4BR6A 4DR5B 4H13B 3JALB 2D2CB 4NXMO 4JTAB 3E8HA 4X88A 1MABG 3P3PA 3CCSV 2GV9A 2KG7B 1YTFD 1AI4A 1JJOA 3K9SA 1NTMH 3ABTA 2DWEC 4JI3O 4JI1O 2CTPA 1AROP 2EJRA 1NI8A 3E22B 1WAZA 2Y4TA 4TSFG 4OX9O 3K59A 3FYIB 2LO1A 1SZTA 1YSCA 1VQ9V 2YI8A 2QKSA 3ZRWB 3E8GA 2ITCC 1H2NA 2P22C 4IGGA 2UXNA 1OHHG 5H9CA 2UXXA 4K3AA 3DSQA 1F7YA 4LNUB 2H3OA 3MD0A 3ABMC 1XDCA 5B5EZ 2EILC 2UUCB 1EFRG 4KP4A 2IH1C 4EB6B 5GONB 3ZIAG 5CB4A 4NTYA 3STZC 2WLIB 4LP8A 3U0ZA 1IBKO 2ZCEA 3ABMB 4NKGB 2CTRA 1GN6A 3CHXA 4R7CA 2EILB 2HG5C 2DMXA 3WB0A 5IJ0B 3RYHB 1QCEA 2A06H 1AJPA 1O9HA 4UCOA 2VQFO 3C90A 4GX2A 2RN9A 4PI2A 1Z2GA 1RM1C 3RVYA 4DV5O 1FFTB 1Y67A 1W59A 2OTJV 2CH7A 3MAQA 3HKEB 2B1IA 2VWKA 1S0VA 2DQ3A 3WB1A 4G28B 1XEQA 1HNWO 1RM1B 2ILMA 5JJJB 1G4YB 3BVOA 3GWOA 1WNSA 1UPGA 3K06A 1Y76B 4TV8A 3L74H 5JWPA 1FJGO 4ZKIA 1SA0A 1SQPH 3WFVA 3W7WA 5IYBO 1XOUA 2Z3YA 4XDLA 5DM6V 4RUFA 1Y74B 4WFEA 3SJBC 4HNAA 3TXSA 4DV3B 3JD2A 4UXNA 1Q82W 2YICA 4PDVA 5LXTA 3HPLC 3RVZA 3CC7V 3TJTA 3RBZA 4RUEA 3K9AA 2LGQA 1ZWIC 4JI5B 2XAHA 4RWUA 1LUWA 4R50A 3RYCA 3HKDA 4D7SA 4UFZA 4DR2O 1PP9H 2UXBB 4LC1A 2ZKOA 4I5SA 2H94A 1QLEC 2OT5A 2ZDIA 1XI1A 1AR5A 2ZT9B 3CYOA 5CA1A 1N32O 2A3QA 3MHHC 1JFFB 1BE3H 4X9QA 1VQ8V 1GH6A 5LP6B 5B66Z 2K1EA 2WLHA 2YIBD 2DYRC 3U11A 4JI6B 4I0XB 2WWWA 3OD4A 4ZOLB 3CRRA 4PV1B 4IL6Z 3B09A 4AQYO 3W7UA 3CCQV 2CGOA 1G1XB 4P30A 4CS2A 2DYRB 2X6CA 4B3SB 5J2UB 4NYKA 1D5AA 1K34A 1JOYA 1P7BA 2DE0X 3S3WA 2JS3A 2A7WA 3E35A 5IY5B 2OIEA 2UXCB 3GWKC 1OCRC 1YF2A 2F66C 3ZN0A 3TGUH 4D6TH 1B3QA 4DR7O 4TQFA 1MNGA 1X59A 2BTQB 3G6EV 1MSWD 5FNVA 4B3TB 1JPXA 1VF6C 3EVKA 4K35A 4AI8A 3H1HH 3EFFK 4DRXA 3RYIB 1IDSA 4MVZA 3M8AA 2E3CA 2JRIA 1SETA 4DO2A 1Y66A 3CE2A 2F95B 1ZL8B 4JI4O 2W6JG 4JI0O 1HNZO 1GRJA 4UVAA 5LBQA 3W7SA 5EC2C 1ZTEA 4JYAO 2BE3A 4FFKA 4DR3O 1XMQB 5B1BC 1W0JG 2CDYA 4DV2B 1SZXA 3FAVA 4FFBA 4J7ZA 2ZQMA 1M56C 1NJIW 1S3JA 3S3XA 5B1BB 2XHBA 2HJDA 3K57A 4X65O 1TGOA 2NN4A 3BRCA 3TXQA 1FAFA 3F5WC 2BSKB 1M56B 4DK1A 1TA8A 5H5NA 1ROPA 5E1AC 3JATA 4R8CA 2F4VB 4BWAA 5GTHZ 1MOFA 1U97A 1QNMA 2VS0A 4GX5A 2P5OA 2YC0A 3SJAC 2P7TC 4L87A 4NB5A 3ZMZA 4LF8O 2GSMB 5IJ9A 1AI6A 1GN3A 1I94B 1DGSA 4BW5A 4I55A 4E2LA 1R3KC 1SF9A 3LSQA 2RCVA 3AG1C 4YY3B 1R3IC 3K58A 1B04A 2GUZB 4WFAV 1AI5A 4H37A 1WA8A 2Y69C 2OYQA 2YDEA 5C93A 3EXAA 3OR6C 1Y6XA 3CMEV 2PYLA 2R9IA 3SJQC 4ZIBA 3AK3A 2P4VA 1PD3A 5A2QN 5KHKA 1V9PA 4X1KA 3HB3B 1FFXB 4LWSA 1NH2B 2Y69B 3H01A 2UUBB 2ZXWC 2P06A 4YHHO 3JALA 3PN1A 1JJ2U 3WG7C 5EIBC 4N21A 4EFBA 2HHHO 2ZE6A 2YEVB 3FD9A 3ZMTA 1TVKB 2ARHA 1VP7A 4PA9A 5BZBA 1HR0O 2KG7A 3SPGA 1BMFG 3L9DA 2VWJA 3T1HO 4P9OA 4LFAO 2WPDG 4CH3A 1VARA 4LF9O 4DV6O 4PI0A 1HW7A 3BA8A 3OUSA 3ZCCA 3UT5B 4WF9V 3OEEG 4FLWA 4MVOA 2YS8A 4JAVA 2Q5ZA 5L3CA 3ZRWA 3H1LH 5EC1C 4J80A 2Q68A 4LNUA 4BW9A 2YXHA 1HNXB 3W7XA 3ETEA 3ZBHA 4DXWA 4E4EA 4EB6A 3D3QA 5GONA 1FKAO 4FM1A 1PNKA 1WB8A 2WLIA 2L6LA 3ABKC 1NTZH 2PF4E 5LMUO 5IJ0A 4LF5O 2ZR3A 3APOA 1QBZA 3JSNA 3SPHA 3BHPA 4QPKA 3ABKB 2HJFC 3LUTB 2NNUA 1BQ0A 1XMOO 2ZM6O 3HKBB 3LDDA 2FL4A 2VQFB 1A32A 2MW2B 3FYEB 3ABLC 3K08A 1R3LC 4X89A 1RSOA 4TUYB 1J5EO 4J42A 4UVCA 4OPAA 2DJVA 1YITV 2ZNJA 2DWDC 3JD4A 5TISZ 4LBEC 4J7KA 4U7OA 3ABLB 5CN0A 2N74A 1Y76A 4FPPA 1R6NA 3VQXA 3VQYA 5KX5B 1YJ9V 1RPOA 1KECA 1P4RA 1Y74A 4JAUA 3KKYA 5KAFZ 1JA8A 4WBNB 4K8ZA 3AG4C 3DXRB 4U3JB 4MTXA 1JX9A 2Y48A 3CCVV 2UXDB 4PA6A 4BIUA 3CWBH 3R66A 3RWRD 4FK5C 4B7KA 3AG4B 3L70H 3T4DA 1R6TA 2ADQB 2JEXA 2Q4PA 5D5PA 5C8YB 2IJKA 3FFQA 3RYFB 4DUYO 1OCOC 3ZJZA 5EIBD 3K04A 5IYZB 3ZS8C 4JGSA 2JK5C 1IX9A 3Q4HB 5GTIZ 3GVMA 4YJ2B 1OCOB 4DR2B 5DN6G 4UV8A 4Q6GA 2KB1A 4I4TB 4O4IB 3OE7G 5FPRA 1WJZA 4BIOA 1KMIZ 4B3MO 3ZHUA 1JFFA 2QWRB 4UV9A 1XILA 5BY1A 4F6RB 4YIOA 2IW5A 4JI8O 4IYHA 2PI5A 4B3RB 4LH6A 3DTUB 4I0XA 4GKJO 4ZOLA 1N36B 1H2LA 2JS5A 2OCHA 5LMNO 3L73H 1FXKB 3CCLV 3SYPA 3G71V 4LF6O 4FVMA 1N33O 2JIZG 1AJNA 4AQYB 2XAGA 1P7GA 4X1YB 2LW1A 5L3EA 2HEPA 5H2FZ 4O2BB 4X64B 2FTKA 4I50A 4DV0B 1I7FA 1GK9A 3T1YO 3OGCC 2CAZC 1TAEA 4LF7B 2V7QG 2BTQA 2Y0IA 1FXVA 2R70A 5K1XA 3P3NA 3B8MA 4IT5A 1MG1A 1JQ0A 5KMGB 1THZA 2WLLB 4D7TA 3JASB 1RFYA 1AP5A 1XNRB 4DUZO 4H0LB 4TOIA 2Q7GA 1VF6A 1AR1B 1QLNA 1HWYA 4NXNO 2IH3C 4HZ3A 2F23A 1ZL8A 2EIKC 5CA0B 3UKMA 4UCTA 2PTMA 4DYLA 3CRQA 5EBMC 4O4LB 3CP1A 3FB6C 1Y4MA 2G38A 3UM7A 1H8EG 5L3BA 3SPJA 4RO2A 1DLBA 2EIKB 3CMAV 4JI0B 3JD0A 3A0BZ 5EYPB 1I0HA 4PA4A 5B1AC 4JYAB 1ZSPA 4H33A 3CCRV 3FX7A 1SQBH 3N27A 1VMGA 4UCSA 1KKDA 1Q90D 1SQGA 4TV9A 4GKKB 4GCZA 5CBFA 1EZJA 5B1AB 1H2GA 3IAYA 5LA6B 3OFNG 4IYIA 3ZN1A 2JJ1G 4QPJA 4JV5O 2FYUH 1YVWA 1JCHA 5HFLA 2VQEO 1IBLB 3G67A 5A9GA 1AP6A 3H1IH 5J2TB 1N0JA 2WA3A 2QA4V 1PL4A 1Q6HA 5IWAO 4PHZA 1IBMO 1YEWA 2ODMA 2E5LO 2XAFA 5JQGB 5JCOC 2PUSA 3O9OA 2X7RB 1F4NA 3IGAC 4F4LA 2JDIG 3AK1A 2IJJA 2EBOA 4QNHB 1WLEA 2YXLA 3VBBA 2GTAA 3K0GA 2Q67A 2EJ7A 3APQA 4LF8B 4JI7O 3QTCA 4NR1A 1VQKV 1NS1A 1XQ8A 5FPOA 2ZNIA 2F1MA 1GAXA 4O4HB 3CRAA 1OCCC 4CBCA 3JARB 1UJWB 1TUBB 3NR7A 2GDSA 1SRYA 5DECA 3ASNB 1FFXA 5LP6C 2B5UA 2ADPA 4ZHQA 1OCCB 1HP8A 1F23A 1D5NA 2Q69A 2WSSG 5JH7A 3CSXA 1EZVH 4CC5A 2YEVA 2HVKC 1TVKA 2EIJB 3BAAA 4I9WA 2QE7G 3KZIZ 2QDOA 2YIDA 1K3EA 4UCUA 2QGNA 2HHHB 1QVFU 3ZHSA 3AEIA 1KD1W 1AB3A 1P84F 1S5JA 1M57B 3CC4V 4X1IA 4JI2O 2RJZA 3ASOB 1NZ6A 5IY5C 2YIAA 3T1HB 5LOVB 2GBOA 4LFAB 5KHIA 4KFMA 4FLVA 2OIGA 3UT5A 2YUAA 1WP7A 4LF9B 5GW7A 1NVPB 1YXBA 4H44B 3CC2V 1T5EA 4DR1O 3OW2U 5KHJA 4DR5O 2XASA 1CPYA 3GB7C 4TWKA 1GM8A 4PDLA 2QWQB 2R72A 4AILC 4J9YB 3DGEA 4PD4F 4LFBO 4F6EA 1EM1A 2BOBC 4QIWF 3CPWU 2JVDA 4NTXA 2AW9A 1GM9A 2WLJA 3HKCB 3OUFA 1DF4A 3SYAA 1WN7A 4DV4B 2QJ1A 2FMLA 1N4CA 4PA3A 1XNQB 4IIJB 1I5XA 4EKWA 3J80N 5KLVH 3HKBA 2AXTZ 2ZINA 4CH6A 2JGDB 3CXHF 2A9HA 2LFRA 1WPXA 3QO7A 4TUYA 1VIBA 2EIMC 2QTOA 4WFHA 3CRCA 4KL1A 4UUJC 2CGNA 4X62B 2QKAA 2V4DA 5CMUA 4LFCB 4OGQB 2EIMB 4GX0A 2CUGA 4K0KB 4PDRA 5KX5A 1KB9F 1EN6A 3JCZA 4JAAA 2EZOA 4WBNA 4I9QA 3N2KB 1KP3A 1MZFA 2RDCA 3LNMB 2AZ0A 1NBMG 1L8DA 4MVRA 1K8AW 4YJ3B 2OTLV 4TQDA 4DV7O 3B8NA 3D3IA 3J7AU 4MVSA 4DR6O 4DK0A 3HR0A 5C8YA 3RYFA 1VF7A 1BGYH 4KHPB 1FXHA 1H8HG 4DUYB 5ITZB 1K97A 2JGUA 3Q4HA 2EX3A 4YJ2A 2Q8VA 4TV8B 3THOA 1SQVH 1EBOA 1ENVA 4I4TA 2IU3A 4O4IA 4Q20A 5LL6Y 3B2EE 3D36C 1M90W 4DV3O 5IT9N 1GKFA 2UUAB 5JVDA 2PZSA 2A79B 2Q0OC 3ZRVA 3SDLA 2ZE8A 3KCYA 4F6RA 2YSUB 4FLXA 2Q7HA 4IHJB 4U3FH 2NR5A 4GUNA 5L3FA 2UXBO 2B9ZA 4GKJB 1KYOF 3T1CA 3K0DA 2UU9B 4FZ0A 4W4KA 3CEIA 3RYCB 1OV9A 3SGIA 4LF6B 4X1YA 1M4UA 4LF4O 4RQEA 4JTDB 5IE9A 4NXMB 2P6JA 4O2BA 4X20B 2E74B 4WFFA 1XUQA 5CA1B 3AG2B 1PV0A 3K3WA 1URFA 5IDJA 3TETA 5B3SC 4JF3A 3E22A 2PY5A 3FB5C 3H1JH 4JI6O 2XTAA 5EBLC 1KQSU 4JI3B 4JI1B 2Z5UA 2HP8A 5KMGA 5B3SB 1KKCA 3JD3A 2QWOB 2WLLA 1Q43A 1V54B 3JASA 4OX9B 1VQNV 3LSSA 1SQFA 3I56V 3AK2A 1YI2V 3A2FA 5BR8O 3ETGA 2Q7EA 5FL7G 2UXCO 1KUQA 4HBNA 2XOKG 4CZZA 4MVMA 3F7YC 1MA1A 1NTKH 4FZ1A 2P4KA 4O4LA 4JPRA 4B08A 3SYCA 3RFRA 3UCSC 3L75H 3L71H 4GT1A 4MTGA 3RYHA 1IBKB 3LNNA 4B3TO 3UQ8A 1VEWA 4A5UB 3UO3A 1J95A 3U10A 5AG2A 2IJHA 3HKEA 2BOCC 4DV5B 1IVSA 3WU2Z 5LA6A 2CTWA 1VQMV 4UB6Z 3ABUA 1Q5OA 1PKXA 5LGUA 3E89A 2WLKA 4X66O 1WP8A 4QGPA 1D2DA 1HNWB 1YTFB 1NU1H 3SR2C 4JV5B 3E86A 4CH5A 1GTOA 1FJGB 2NLJC 5EBWC 4O4JB 3JAWB 5J2TA 2VQEB 1Q3EA 1QHTA 2F93B 1OZ0A 3JAKB 1XMQO 2OCCC 1W2BU 4ICGA 1SQQH 2QEXV 2P90A 2ZE7A 5BXZA 1VQLV 2DOSA 2E5LB 1CXZB 1US6A 1U96A 2OCCB 1ZAUA 3RGBA 5JCOA 3JCUZ 3ETQA 3QVNA 1JMKC 1Q7YW 3OM3B 5LYJB 4MTOA 2EINB 3R65A 4J41A 3TK1A 3K5OA 3ZHQA 4JI7B 4GZRB 1KC8W 1UFIA
chains in the Genus database with same CATH topology
1PP9H 3BCCH 3CWBH 1L0LH 1EZVH 1KYOF 1BGYH 3L70H 1NTMH 1SQXH 2A06H 1BCCH 3L73H 3H1JH 1NU1H 2BCCH 3H1HH 3L74H 3CX5F 1SQPH 2IBZH 1NTKH 4U3FH 2FYUH 1P84F 1PPJH 1NTZH 1SQBH 3L72H 3H1LH 1SQVH 3L75H 3L71H 4PD4F 3TGUH 4D6TH 1SQQH 3H1IH 5KLVH 1L0NH 3H1KH 3CXHF 1KB9F 1BE3H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PP9 H;  3BCC H;  3CWB H;  1L0L H;  1EZV H;  1KYO F;  1BGY H;  3L70 H;  1NTM H;  1SQX H;  2A06 H;  1BCC H;  3L73 H;  3H1J H;  1NU1 H;  2BCC H;  3H1H H;  3L74 H;  3CX5 F;  1SQP H;  2IBZ H;  1NTK H;  4U3F H;  2FYU H;  1P84 F;  1PPJ H;  1NTZ H;  1SQB H;  3L72 H;  3H1L H;  1SQV H;  3L75 H;  3L71 H;  4PD4 F;  3TGU H;  4D6T H;  1SQQ H;  3H1I H;  5KLV H;  1L0N H;  3H1K H;  3CXH F;  1KB9 F;  1BE3 H; 
#chains in the Genus database with same CATH topology
 3EHB B;  1TUB A;  2QTS A;  1E1R G;  1EN5 A;  1OCZ B;  2ZIO A;  2LW7 A;  3WB2 A;  2FB5 A;  2LJ2 A;  2LP7 A;  3E8B A;  1N32 B;  1FXK C;  3ZHR A;  5LP6 A;  3OMN B;  1MZE A;  1XBL A;  4WCE V;  1I94 O;  1RPR A;  4QE7 A;  3ZMS A;  1K33 A;  5F2V O;  1GN4 A;  5LOV A;  4BIZ A;  5J2U A;  2XT9 A;  2FKX A;  5BMV B;  4JI2 B;  1XHZ A;  2PYJ A;  2KSD A;  1K4C C;  4DR4 O;  3K5L A;  1K4D C;  2IU0 A;  2UUB O;  1RP3 B;  5CBG A;  1E79 G;  1IXM A;  3H9V A;  4NTW A;  2LFS A;  5EK0 A;  4DR1 B;  1F4M A;  4UB8 Z;  2HVJ C;  4Z1V A;  2X0L A;  3CCM V;  1IZ3 A;  1FD9 A;  3LDC A;  2JEU A;  1O9G A;  3OTO O;  2ETN A;  4I7Z B;  1R3J C;  4K8X A;  4DR7 B;  4LFB B;  2W6I G;  1PNL A;  3HKC A;  1K73 W;  5KUK A;  1G6U A;  5D5Q A;  2KKW A;  4CS3 A;  2CE4 A;  3RYI A;  4IIJ A;  2BCC H;  2ZIM A;  1DTO A;  4LH7 A;  5KA6 A;  3JYC A;  2XAQ A;  2JGD A;  1I5Y A;  2IM9 A;  1HDJ A;  1CP9 A;  1S72 V;  3RT3 C;  3E83 A;  4YXW G;  1S77 D;  1DK1 A;  1HNX O;  2N04 A;  4JI4 B;  2WLN A;  3CCE V;  1H38 A;  5B1N A;  3ZHT A;  1HNZ B;  1BZK A;  4HAM A;  4ZI7 B;  4MS2 A;  1XRE A;  4DR3 B;  3N2K A;  1SQX H;  4YJ3 A;  1BCC H;  1YJW V;  2LQT A;  3ICX A;  2BSK A;  1VQ5 V;  3ZMU A;  3MHS C;  3CRM A;  4X65 B;  3VOU A;  3N2G B;  3CXC U;  2PGG A;  2P67 A;  1SC5 B;  4XDJ A;  4DV1 O;  4DV7 B;  1RSO B;  4DR6 B;  4GYC B;  1BHB A;  1BS3 A;  2ZD9 A;  1Q6I A;  2XUM A;  4U7N A;  4O2A B;  5ITZ A;  2GHY A;  1KP2 A;  3SPI A;  3CX5 F;  1K5S A;  5H6Q A;  4FLT A;  1N34 O;  1Q81 W;  4FJC C;  2MK3 A;  2B1G A;  1Q8I A;  1GO3 F;  1YCI A;  2AHY A;  3T4Z A;  2UXD O;  4MTF A;  4JYY A;  2E76 B;  4WFB V;  3BCC H;  3D36 A;  2GUZ A;  3ASN C;  4IHJ A;  2XND G;  2C2A A;  4G27 B;  1YHQ V;  1K7D A;  1I08 A;  3RN4 A;  3IC9 A;  4DW1 A;  3CJH B;  2Q9L A;  2WLM A;  3KCX A;  3KG2 A;  5LHG A;  1K5Q A;  1Z5V A;  4FM2 A;  2M6Y A;  5CBH A;  3OTF A;  2EIJ C;  4JYC A;  1NR1 A;  3ZRS A;  3D8C A;  2WA4 A;  3QG5 A;  4LCU C;  5L3G A;  1CEZ A;  1M57 C;  1YZB A;  3JD1 A;  2HLD G;  4FMT A;  4YHH B;  3ASO C;  3J81 N;  2QKC A;  5B1O A;  3UO2 A;  4X20 A;  4LF4 B;  3CCU V;  2N05 A;  2AZ2 A;  3M7M X;  2H8P C;  1HR0 B;  4B3R O;  1QLE B;  3H1K H;  3STL C;  3BEH A;  3BY6 A;  5E79 Z;  1Z5W A;  4FLY A;  1N36 O;  4FIP C;  4PJ0 Z;  1VQO V;  3A0H Z;  4DV6 B;  2RNB A;  2R9A A;  4N23 A;  1SER A;  1S5H C;  4AHC A;  3E8F A;  3AG3 C;  3B77 A;  3FB7 C;  2QSA A;  5FLX N;  1JR9 A;  1Q6U A;  4OXS A;  3ZHV A;  5H6R A;  5EZY B;  3K5M A;  3AG3 B;  4MW8 A;  1R6K A;  1VQ7 V;  1XL4 A;  3IC7 A;  3AG7 A;  4ASU G;  2QWP B;  5BR8 B;  2X6A A;  3VQV A;  1M9N A;  4X64 O;  4DV0 O;  1IUR A;  3K79 A;  3FKS G;  2RMK B;  4LF7 O;  4I50 B;  4XDK A;  3ZED A;  2D3O W;  2QM4 A;  5KHH A;  1L1F A;  1GMG A;  1H2S B;  2KQX A;  5LMU B;  2OWO A;  4LF5 B;  1OCR B;  3C3T A;  3G4S V;  5KHG A;  3LDE A;  4Z2W A;  4UVB A;  3QNE A;  1IXB A;  1WPB A;  3DC6 A;  3F7V C;  1XNR O;  1DF5 A;  2ZM6 B;  1XMO B;  4JAS A;  3OEH G;  1VQ6 V;  3G6B A;  4GLX A;  2DQ0 A;  3P30 A;  2UUC O;  3MDS A;  1J5E B;  3A8T A;  3SPC A;  1VF5 B;  1XL6 A;  2Y0P A;  1R73 A;  3JAM N;  5IYD O;  2HKO A;  5JJE B;  3SYQ A;  1K9M W;  3SYO A;  3CB2 A;  4MW3 A;  2E75 B;  4C7U A;  5KUM A;  4MT8 A;  5CB4 B;  4X66 B;  3ETD A;  4O4J A;  1KU9 A;  1AVM A;  3JAW A;  4B7E A;  3JAK A;  1EN4 A;  3FB8 C;  3DXR A;  4U3J A;  2W0F C;  3B40 A;  4J11 A;  1QR8 A;  1PPJ H;  2QM8 A;  1AI7 A;  1W0K G;  4MVQ A;  1PL0 A;  2AHZ A;  3QF7 A;  4GKK O;  2ITD C;  4P2Z A;  1FS0 G;  1JVM A;  4KUM A;  3RW0 A;  2JJ2 G;  4FLZ A;  2CH7 B;  5LYJ A;  4TV9 B;  4CC6 A;  3CD6 V;  4NVP A;  5IYZ A;  3C3S A;  1B06 A;  2F43 G;  1SS3 A;  5LHI A;  1IBL O;  3A0R A;  1MMM A;  3O65 A;  3K5N A;  1BHA A;  2QR4 A;  1SA0 B;  2HR3 A;  1NVP D;  2DN9 A;  4JZ2 A;  4DW0 A;  5CA3 A;  4J7J A;  1QQC A;  2RQ6 A;  3BFR A;  2IJI A;  4HNA B;  5HFM A;  4PA7 A;  5L3D A;  2YXY A;  4B3M B;  5LXT B;  5LHH A;  4XBF A;  3B4S A;  1P49 A;  4JI5 O;  4UCR A;  1LR1 A;  3L72 H;  2W0X A;  1E1Q G;  1BT8 A;  4MVU A;  4JI8 B;  1FXK A;  1PM9 A;  3M99 B;  3ZMV A;  1SKV A;  3HKD B;  5LMN B;  3IFX A;  1QR9 A;  2ZDI C;  4BAY A;  5BMV A;  2Y4U A;  4X8A A;  3AG2 C;  1FPO A;  1N33 B;  1B6Q A;  1GN2 A;  3VQW A;  1NQT A;  3AG1 B;  2EZP A;  1G8M A;  3G80 A;  4DR4 B;  1VQP V;  1AIL A;  4ZBM A;  1R1B A;  4ZHQ B;  4QJF B;  5JH7 B;  1V54 C;  4G2K A;  1BQZ A;  2AGA A;  1LUV A;  3BA9 A;  3BPZ A;  4CH4 A;  1AR4 A;  3T1Y B;  1SES A;  2ZXW B;  2YI9 A;  2DYS C;  5DED A;  4P9P A;  1M93 A;  3WG7 B;  1F51 A;  3OTO B;  1VQ4 V;  4B3S O;  1KBH A;  1S5L Z;  4X1I B;  2K9P A;  4YIP A;  2ZE5 A;  2DYS B;  4FLU A;  2PI4 A;  4JZG A;  4KXR A;  4RQF A;  1V55 C;  5CA0 A;  4DUZ B;  1LNQ A;  3LSU A;  1ZLZ A;  1NT2 B;  3CCJ V;  4NXN B;  1YIJ V;  2VRZ A;  2Z0A A;  2LGW A;  2Q73 A;  1N0N A;  1L0N H;  1V55 B;  4CS4 A;  4ZI7 A;  5EYP A;  3T2M A;  4QE9 A;  4OPH A;  1S76 D;  2YIB A;  3JSL A;  3CS5 A;  3PJS K;  1M5I A;  3QO5 A;  4UCV A;  4DV4 O;  4W4L A;  3BAB A;  5FNV B;  1XNQ O;  1GM7 A;  4GX1 A;  1H2M A;  5KA5 A;  1MSD A;  1K92 A;  4FM0 A;  4MSW C;  4DRX B;  1X4T A;  5LGT A;  3OMI B;  4EFE A;  3N2G A;  2R9R B;  4X62 O;  1H2K A;  4LFC O;  2EUL A;  3ZX6 A;  1COW G;  4EEQ A;  4Z1M G;  4PDM A;  4O2A A;  4DV1 B;  4K0K O;  3OR7 C;  1NH2 D;  5JQG A;  4J9Z B;  2BTO A;  4DV2 O;  1N8R W;  5IWA B;  1ZX3 A;  1IBM B;  4HYO A;  4WFG A;  2L35 A;  1AJQ A;  2EIN C;  3ML0 A;  2HFE C;  1TUE B;  4ABM A;  2ZR2 A;  4J10 A;  2V1D A;  1Q86 W;  2O57 A;  5LGN A;  3FAV B;  4FFB B;  1N34 B;  1OCZ C;  1YDX A;  5JJN B;  2QWN B;  3I55 V;  4O4H A;  1YJN V;  3CJH A;  1QVG U;  3JAR A;  1L0L H;  5KAI Z;  4KHP O;  3I5D A;  3NXS A;  2F4V O;  3X2Q C;  4L8J A;  2ATK C;  2Q0A A;  2IBZ H;  3P32 A;  3JAT B;  1BL8 A;  3IJ4 A;  1PNM A;  1FYJ A;  2XAJ A;  3X2Q B;  3W7T A;  1QU7 A;  4JTC B;  3OAA G;  2Q6A A;  3F5T A;  3DC5 A;  5K1P A;  3QO8 A;  2UUA O;  3OMA B;  1ORQ C;  3K03 A;  3E2E A;  2CTQ A;  5J9P C;  5IJ9 B;  2CK3 G;  4YY3 O;  5IYC O;  4JYB A;  5JVD B;  4I55 B;  4RAI A;  1BSM A;  4R6Z A;  4LR3 A;  3TCU A;  2QM7 A;  3OT7 A;  1WB7 A;  1WA8 B;  4PEL A;  3ZRX A;  2X6B A;  2M7W A;  3SJC C;  2UU9 O;  2A0L A;  2GTS A;  2WAM A;  1M1K W;  1OJH A;  2DW4 A;  1ZUQ A;  5EZY A;  1NKD A;  1XHX A;  4X1K B;  4TT3 G;  4LWS B;  1NR7 A;  3OGI B;  4BR6 A;  4DR5 B;  4H13 B;  3JAL B;  2D2C B;  4NXM O;  4JTA B;  3E8H A;  4X88 A;  1MAB G;  3P3P A;  3CCS V;  2GV9 A;  2KG7 B;  1YTF D;  1AI4 A;  1JJO A;  3K9S A;  1NTM H;  3ABT A;  2DWE C;  4JI3 O;  4JI1 O;  2CTP A;  1ARO P;  2EJR A;  1NI8 A;  3E22 B;  1WAZ A;  2Y4T A;  4TSF G;  4OX9 O;  3K59 A;  3FYI B;  2LO1 A;  1SZT A;  1YSC A;  1VQ9 V;  2YI8 A;  2QKS A;  3ZRW B;  3E8G A;  2ITC C;  1H2N A;  2P22 C;  4IGG A;  2UXN A;  1OHH G;  5H9C A;  2UXX A;  4K3A A;  3DSQ A;  1F7Y A;  4LNU B;  2H3O A;  3MD0 A;  3ABM C;  1XDC A;  5B5E Z;  2EIL C;  2UUC B;  1EFR G;  4KP4 A;  2IH1 C;  4EB6 B;  5GON B;  3ZIA G;  5CB4 A;  4NTY A;  3STZ C;  2WLI B;  4LP8 A;  3U0Z A;  1IBK O;  2ZCE A;  3ABM B;  4NKG B;  2CTR A;  1GN6 A;  3CHX A;  4R7C A;  2EIL B;  2HG5 C;  2DMX A;  3WB0 A;  5IJ0 B;  3RYH B;  1QCE A;  2A06 H;  1AJP A;  1O9H A;  4UCO A;  2VQF O;  3C90 A;  4GX2 A;  2RN9 A;  4PI2 A;  1Z2G A;  1RM1 C;  3RVY A;  4DV5 O;  1FFT B;  1Y67 A;  1W59 A;  2OTJ V;  2CH7 A;  3MAQ A;  3HKE B;  2B1I A;  2VWK A;  1S0V A;  2DQ3 A;  3WB1 A;  4G28 B;  1XEQ A;  1HNW O;  1RM1 B;  2ILM A;  5JJJ B;  1G4Y B;  3BVO A;  3GWO A;  1WNS A;  1UPG A;  3K06 A;  1Y76 B;  4TV8 A;  3L74 H;  5JWP A;  1FJG O;  4ZKI A;  1SA0 A;  1SQP H;  3WFV A;  3W7W A;  5IYB O;  1XOU A;  2Z3Y A;  4XDL A;  5DM6 V;  4RUF A;  1Y74 B;  4WFE A;  3SJB C;  4HNA A;  3TXS A;  4DV3 B;  3JD2 A;  4UXN A;  1Q82 W;  2YIC A;  4PDV A;  5LXT A;  3HPL C;  3RVZ A;  3CC7 V;  3TJT A;  3RBZ A;  4RUE A;  3K9A A;  2LGQ A;  1ZWI C;  4JI5 B;  2XAH A;  4RWU A;  1LUW A;  4R50 A;  3RYC A;  3HKD A;  4D7S A;  4UFZ A;  4DR2 O;  1PP9 H;  2UXB B;  4LC1 A;  2ZKO A;  4I5S A;  2H94 A;  1QLE C;  2OT5 A;  2ZDI A;  1XI1 A;  1AR5 A;  2ZT9 B;  3CYO A;  5CA1 A;  1N32 O;  2A3Q A;  3MHH C;  1JFF B;  1BE3 H;  4X9Q A;  1VQ8 V;  1GH6 A;  5LP6 B;  5B66 Z;  2K1E A;  2WLH A;  2YIB D;  2DYR C;  3U11 A;  4JI6 B;  4I0X B;  2WWW A;  3OD4 A;  4ZOL B;  3CRR A;  4PV1 B;  4IL6 Z;  3B09 A;  4AQY O;  3W7U A;  3CCQ V;  2CGO A;  1G1X B;  4P30 A;  4CS2 A;  2DYR B;  2X6C A;  4B3S B;  5J2U B;  4NYK A;  1D5A A;  1K34 A;  1JOY A;  1P7B A;  2DE0 X;  3S3W A;  2JS3 A;  2A7W A;  3E35 A;  5IY5 B;  2OIE A;  2UXC B;  3GWK C;  1OCR C;  1YF2 A;  2F66 C;  3ZN0 A;  3TGU H;  4D6T H;  1B3Q A;  4DR7 O;  4TQF A;  1MNG A;  1X59 A;  2BTQ B;  3G6E V;  1MSW D;  5FNV A;  4B3T B;  1JPX A;  1VF6 C;  3EVK A;  4K35 A;  4AI8 A;  3H1H H;  3EFF K;  4DRX A;  3RYI B;  1IDS A;  4MVZ A;  3M8A A;  2E3C A;  2JRI A;  1SET A;  4DO2 A;  1Y66 A;  3CE2 A;  2F95 B;  1ZL8 B;  4JI4 O;  2W6J G;  4JI0 O;  1HNZ O;  1GRJ A;  4UVA A;  5LBQ A;  3W7S A;  5EC2 C;  1ZTE A;  4JYA O;  2BE3 A;  4FFK A;  4DR3 O;  1XMQ B;  5B1B C;  1W0J G;  2CDY A;  4DV2 B;  1SZX A;  3FAV A;  4FFB A;  4J7Z A;  2ZQM A;  1M56 C;  1NJI W;  1S3J A;  3S3X A;  5B1B B;  2XHB A;  2HJD A;  3K57 A;  4X65 O;  1TGO A;  2NN4 A;  3BRC A;  3TXQ A;  1FAF A;  3F5W C;  2BSK B;  1M56 B;  4DK1 A;  1TA8 A;  5H5N A;  1ROP A;  5E1A C;  3JAT A;  4R8C A;  2F4V B;  4BWA A;  5GTH Z;  1MOF A;  1U97 A;  1QNM A;  2VS0 A;  4GX5 A;  2P5O A;  2YC0 A;  3SJA C;  2P7T C;  4L87 A;  4NB5 A;  3ZMZ A;  4LF8 O;  2GSM B;  5IJ9 A;  1AI6 A;  1GN3 A;  1I94 B;  1DGS A;  4BW5 A;  4I55 A;  4E2L A;  1R3K C;  1SF9 A;  3LSQ A;  2RCV A;  3AG1 C;  4YY3 B;  1R3I C;  3K58 A;  1B04 A;  2GUZ B;  4WFA V;  1AI5 A;  4H37 A;  1WA8 A;  2Y69 C;  2OYQ A;  2YDE A;  5C93 A;  3EXA A;  3OR6 C;  1Y6X A;  3CME V;  2PYL A;  2R9I A;  3SJQ C;  4ZIB A;  3AK3 A;  2P4V A;  1PD3 A;  5A2Q N;  5KHK A;  1V9P A;  4X1K A;  3HB3 B;  1FFX B;  4LWS A;  1NH2 B;  2Y69 B;  3H01 A;  2UUB B;  2ZXW C;  2P06 A;  4YHH O;  3JAL A;  3PN1 A;  1JJ2 U;  3WG7 C;  5EIB C;  4N21 A;  4EFB A;  2HHH O;  2ZE6 A;  2YEV B;  3FD9 A;  3ZMT A;  1TVK B;  2ARH A;  1VP7 A;  4PA9 A;  5BZB A;  1HR0 O;  2KG7 A;  3SPG A;  1BMF G;  3L9D A;  2VWJ A;  3T1H O;  4P9O A;  4LFA O;  2WPD G;  4CH3 A;  1VAR A;  4LF9 O;  4DV6 O;  4PI0 A;  1HW7 A;  3BA8 A;  3OUS A;  3ZCC A;  3UT5 B;  4WF9 V;  3OEE G;  4FLW A;  4MVO A;  2YS8 A;  4JAV A;  2Q5Z A;  5L3C A;  3ZRW A;  3H1L H;  5EC1 C;  4J80 A;  2Q68 A;  4LNU A;  4BW9 A;  2YXH A;  1HNX B;  3W7X A;  3ETE A;  3ZBH A;  4DXW A;  4E4E A;  4EB6 A;  3D3Q A;  5GON A;  1FKA O;  4FM1 A;  1PNK A;  1WB8 A;  2WLI A;  2L6L A;  3ABK C;  1NTZ H;  2PF4 E;  5LMU O;  5IJ0 A;  4LF5 O;  2ZR3 A;  3APO A;  1QBZ A;  3JSN A;  3SPH A;  3BHP A;  4QPK A;  3ABK B;  2HJF C;  3LUT B;  2NNU A;  1BQ0 A;  1XMO O;  2ZM6 O;  3HKB B;  3LDD A;  2FL4 A;  2VQF B;  1A32 A;  2MW2 B;  3FYE B;  3ABL C;  3K08 A;  1R3L C;  4X89 A;  1RSO A;  4TUY B;  1J5E O;  4J42 A;  4UVC A;  4OPA A;  2DJV A;  1YIT V;  2ZNJ A;  2DWD C;  3JD4 A;  5TIS Z;  4LBE C;  4J7K A;  4U7O A;  3ABL B;  5CN0 A;  2N74 A;  1Y76 A;  4FPP A;  1R6N A;  3VQX A;  3VQY A;  5KX5 B;  1YJ9 V;  1RPO A;  1KEC A;  1P4R A;  1Y74 A;  4JAU A;  3KKY A;  5KAF Z;  1JA8 A;  4WBN B;  4K8Z A;  3AG4 C;  3DXR B;  4U3J B;  4MTX A;  1JX9 A;  2Y48 A;  3CCV V;  2UXD B;  4PA6 A;  4BIU A;  3CWB H;  3R66 A;  3RWR D;  4FK5 C;  4B7K A;  3AG4 B;  3L70 H;  3T4D A;  1R6T A;  2ADQ B;  2JEX A;  2Q4P A;  5D5P A;  5C8Y B;  2IJK A;  3FFQ A;  3RYF B;  4DUY O;  1OCO C;  3ZJZ A;  5EIB D;  3K04 A;  5IYZ B;  3ZS8 C;  4JGS A;  2JK5 C;  1IX9 A;  3Q4H B;  5GTI Z;  3GVM A;  4YJ2 B;  1OCO B;  4DR2 B;  5DN6 G;  4UV8 A;  4Q6G A;  2KB1 A;  4I4T B;  4O4I B;  3OE7 G;  5FPR A;  1WJZ A;  4BIO A;  1KMI Z;  4B3M O;  3ZHU A;  1JFF A;  2QWR B;  4UV9 A;  1XIL A;  5BY1 A;  4F6R B;  4YIO A;  2IW5 A;  4JI8 O;  4IYH A;  2PI5 A;  4B3R B;  4LH6 A;  3DTU B;  4I0X A;  4GKJ O;  4ZOL A;  1N36 B;  1H2L A;  2JS5 A;  2OCH A;  5LMN O;  3L73 H;  1FXK B;  3CCL V;  3SYP A;  3G71 V;  4LF6 O;  4FVM A;  1N33 O;  2JIZ G;  1AJN A;  4AQY B;  2XAG A;  1P7G A;  4X1Y B;  2LW1 A;  5L3E A;  2HEP A;  5H2F Z;  4O2B B;  4X64 B;  2FTK A;  4I50 A;  4DV0 B;  1I7F A;  1GK9 A;  3T1Y O;  3OGC C;  2CAZ C;  1TAE A;  4LF7 B;  2V7Q G;  2BTQ A;  2Y0I A;  1FXV A;  2R70 A;  5K1X A;  3P3N A;  3B8M A;  4IT5 A;  1MG1 A;  1JQ0 A;  5KMG B;  1THZ A;  2WLL B;  4D7T A;  3JAS B;  1RFY A;  1AP5 A;  1XNR B;  4DUZ O;  4H0L B;  4TOI A;  2Q7G A;  1VF6 A;  1AR1 B;  1QLN A;  1HWY A;  4NXN O;  2IH3 C;  4HZ3 A;  2F23 A;  1ZL8 A;  2EIK C;  5CA0 B;  3UKM A;  4UCT A;  2PTM A;  4DYL A;  3CRQ A;  5EBM C;  4O4L B;  3CP1 A;  3FB6 C;  1Y4M A;  2G38 A;  3UM7 A;  1H8E G;  5L3B A;  3SPJ A;  4RO2 A;  1DLB A;  2EIK B;  3CMA V;  4JI0 B;  3JD0 A;  3A0B Z;  5EYP B;  1I0H A;  4PA4 A;  5B1A C;  4JYA B;  1ZSP A;  4H33 A;  3CCR V;  3FX7 A;  1SQB H;  3N27 A;  1VMG A;  4UCS A;  1KKD A;  1Q90 D;  1SQG A;  4TV9 A;  4GKK B;  4GCZ A;  5CBF A;  1EZJ A;  5B1A B;  1H2G A;  3IAY A;  5LA6 B;  3OFN G;  4IYI A;  3ZN1 A;  2JJ1 G;  4QPJ A;  4JV5 O;  2FYU H;  1YVW A;  1JCH A;  5HFL A;  2VQE O;  1IBL B;  3G67 A;  5A9G A;  1AP6 A;  3H1I H;  5J2T B;  1N0J A;  2WA3 A;  2QA4 V;  1PL4 A;  1Q6H A;  5IWA O;  4PHZ A;  1IBM O;  1YEW A;  2ODM A;  2E5L O;  2XAF A;  5JQG B;  5JCO C;  2PUS A;  3O9O A;  2X7R B;  1F4N A;  3IGA C;  4F4L A;  2JDI G;  3AK1 A;  2IJJ A;  2EBO A;  4QNH B;  1WLE A;  2YXL A;  3VBB A;  2GTA A;  3K0G A;  2Q67 A;  2EJ7 A;  3APQ A;  4LF8 B;  4JI7 O;  3QTC A;  4NR1 A;  1VQK V;  1NS1 A;  1XQ8 A;  5FPO A;  2ZNI A;  2F1M A;  1GAX A;  4O4H B;  3CRA A;  1OCC C;  4CBC A;  3JAR B;  1UJW B;  1TUB B;  3NR7 A;  2GDS A;  1SRY A;  5DEC A;  3ASN B;  1FFX A;  5LP6 C;  2B5U A;  2ADP A;  4ZHQ A;  1OCC B;  1HP8 A;  1F23 A;  1D5N A;  2Q69 A;  2WSS G;  5JH7 A;  3CSX A;  1EZV H;  4CC5 A;  2YEV A;  2HVK C;  1TVK A;  2EIJ B;  3BAA A;  4I9W A;  2QE7 G;  3KZI Z;  2QDO A;  2YID A;  1K3E A;  4UCU A;  2QGN A;  2HHH B;  1QVF U;  3ZHS A;  3AEI A;  1KD1 W;  1AB3 A;  1P84 F;  1S5J A;  1M57 B;  3CC4 V;  4X1I A;  4JI2 O;  2RJZ A;  3ASO B;  1NZ6 A;  5IY5 C;  2YIA A;  3T1H B;  5LOV B;  2GBO A;  4LFA B;  5KHI A;  4KFM A;  4FLV A;  2OIG A;  3UT5 A;  2YUA A;  1WP7 A;  4LF9 B;  5GW7 A;  1NVP B;  1YXB A;  4H44 B;  3CC2 V;  1T5E A;  4DR1 O;  3OW2 U;  5KHJ A;  4DR5 O;  2XAS A;  1CPY A;  3GB7 C;  4TWK A;  1GM8 A;  4PDL A;  2QWQ B;  2R72 A;  4AIL C;  4J9Y B;  3DGE A;  4PD4 F;  4LFB O;  4F6E A;  1EM1 A;  2BOB C;  4QIW F;  3CPW U;  2JVD A;  4NTX A;  2AW9 A;  1GM9 A;  2WLJ A;  3HKC B;  3OUF A;  1DF4 A;  3SYA A;  1WN7 A;  4DV4 B;  2QJ1 A;  2FML A;  1N4C A;  4PA3 A;  1XNQ B;  4IIJ B;  1I5X A;  4EKW A;  3J80 N;  5KLV H;  3HKB A;  2AXT Z;  2ZIN A;  4CH6 A;  2JGD B;  3CXH F;  2A9H A;  2LFR A;  1WPX A;  3QO7 A;  4TUY A;  1VIB A;  2EIM C;  2QTO A;  4WFH A;  3CRC A;  4KL1 A;  4UUJ C;  2CGN A;  4X62 B;  2QKA A;  2V4D A;  5CMU A;  4LFC B;  4OGQ B;  2EIM B;  4GX0 A;  2CUG A;  4K0K B;  4PDR A;  5KX5 A;  1KB9 F;  1EN6 A;  3JCZ A;  4JAA A;  2EZO A;  4WBN A;  4I9Q A;  3N2K B;  1KP3 A;  1MZF A;  2RDC A;  3LNM B;  2AZ0 A;  1NBM G;  1L8D A;  4MVR A;  1K8A W;  4YJ3 B;  2OTL V;  4TQD A;  4DV7 O;  3B8N A;  3D3I A;  3J7A U;  4MVS A;  4DR6 O;  4DK0 A;  3HR0 A;  5C8Y A;  3RYF A;  1VF7 A;  1BGY H;  4KHP B;  1FXH A;  1H8H G;  4DUY B;  5ITZ B;  1K97 A;  2JGU A;  3Q4H A;  2EX3 A;  4YJ2 A;  2Q8V A;  4TV8 B;  3THO A;  1SQV H;  1EBO A;  1ENV A;  4I4T A;  2IU3 A;  4O4I A;  4Q20 A;  5LL6 Y;  3B2E E;  3D36 C;  1M90 W;  4DV3 O;  5IT9 N;  1GKF A;  2UUA B;  5JVD A;  2PZS A;  2A79 B;  2Q0O C;  3ZRV A;  3SDL A;  2ZE8 A;  3KCY A;  4F6R A;  2YSU B;  4FLX A;  2Q7H A;  4IHJ B;  4U3F H;  2NR5 A;  4GUN A;  5L3F A;  2UXB O;  2B9Z A;  4GKJ B;  1KYO F;  3T1C A;  3K0D A;  2UU9 B;  4FZ0 A;  4W4K A;  3CEI A;  3RYC B;  1OV9 A;  3SGI A;  4LF6 B;  4X1Y A;  1M4U A;  4LF4 O;  4RQE A;  4JTD B;  5IE9 A;  4NXM B;  2P6J A;  4O2B A;  4X20 B;  2E74 B;  4WFF A;  1XUQ A;  5CA1 B;  3AG2 B;  1PV0 A;  3K3W A;  1URF A;  5IDJ A;  3TET A;  5B3S C;  4JF3 A;  3E22 A;  2PY5 A;  3FB5 C;  3H1J H;  4JI6 O;  2XTA A;  5EBL C;  1KQS U;  4JI3 B;  4JI1 B;  2Z5U A;  2HP8 A;  5KMG A;  5B3S B;  1KKC A;  3JD3 A;  2QWO B;  2WLL A;  1Q43 A;  1V54 B;  3JAS A;  4OX9 B;  1VQN V;  3LSS A;  1SQF A;  3I56 V;  3AK2 A;  1YI2 V;  3A2F A;  5BR8 O;  3ETG A;  2Q7E A;  5FL7 G;  2UXC O;  1KUQ A;  4HBN A;  2XOK G;  4CZZ A;  4MVM A;  3F7Y C;  1MA1 A;  1NTK H;  4FZ1 A;  2P4K A;  4O4L A;  4JPR A;  4B08 A;  3SYC A;  3RFR A;  3UCS C;  3L75 H;  3L71 H;  4GT1 A;  4MTG A;  3RYH A;  1IBK B;  3LNN A;  4B3T O;  3UQ8 A;  1VEW A;  4A5U B;  3UO3 A;  1J95 A;  3U10 A;  5AG2 A;  2IJH A;  3HKE A;  2BOC C;  4DV5 B;  1IVS A;  3WU2 Z;  5LA6 A;  2CTW A;  1VQM V;  4UB6 Z;  3ABU A;  1Q5O A;  1PKX A;  5LGU A;  3E89 A;  2WLK A;  4X66 O;  1WP8 A;  4QGP A;  1D2D A;  1HNW B;  1YTF B;  1NU1 H;  3SR2 C;  4JV5 B;  3E86 A;  4CH5 A;  1GTO A;  1FJG B;  2NLJ C;  5EBW C;  4O4J B;  3JAW B;  5J2T A;  2VQE B;  1Q3E A;  1QHT A;  2F93 B;  1OZ0 A;  3JAK B;  1XMQ O;  2OCC C;  1W2B U;  4ICG A;  1SQQ H;  2QEX V;  2P90 A;  2ZE7 A;  5BXZ A;  1VQL V;  2DOS A;  2E5L B;  1CXZ B;  1US6 A;  1U96 A;  2OCC B;  1ZAU A;  3RGB A;  5JCO A;  3JCU Z;  3ETQ A;  3QVN A;  1JMK C;  1Q7Y W;  3OM3 B;  5LYJ B;  4MTO A;  2EIN B;  3R65 A;  4J41 A;  3TK1 A;  3K5O A;  3ZHQ A;  4JI7 B;  4GZR B;  1KC8 W;  1UFI A; 
#chains in the Genus database with same CATH homology
 1PP9 H;  3BCC H;  3CWB H;  1L0L H;  1EZV H;  1KYO F;  1BGY H;  3L70 H;  1NTM H;  1SQX H;  2A06 H;  1BCC H;  3L73 H;  3H1J H;  1NU1 H;  2BCC H;  3H1H H;  3L74 H;  3CX5 F;  1SQP H;  2IBZ H;  1NTK H;  4U3F H;  2FYU H;  1P84 F;  1PPJ H;  1NTZ H;  1SQB H;  3L72 H;  3H1L H;  1SQV H;  3L75 H;  3L71 H;  4PD4 F;  3TGU H;  4D6T H;  1SQQ H;  3H1I H;  5KLV H;  1L0N H;  3H1K H;  3CXH F;  1KB9 F;  1BE3 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...