3FB7C

Open kcsa potassium channel in the presence of rb+ ion
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
89
structure length
89
Chain Sequence
WRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein/metal transport
molecule keywords antibody fab fragment heavy chain
publication title Open KcsA potassium channel in the presence of Rb+ ion
rcsb
source organism Streptomyces lividans
total genus 24
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2008-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3fb7C00
4QE7A 4G28B 5EC1C 3F7VC 3WG7C 2YEVA 4UUJC 4MTOA 3R65A 2WLIB 5EBLC 1OCCC 1R3JC 2DYSC 5E1AC 2WLLA 3SJQC 4GX5A 2R9RB 4H33A 3EFFK 3SPJA 3LDEA 4MTFA 3TETA 3E8GA 4R50A 1QLEC 3SPHA 4QE9A 3STZC 4P9OA 1XL6A 1KKDA 4WFHA 4EKWA 4ZBMA 1V55C 4BW5A 3E83A 3ABMC 3PJSK 5B1AC 1K4CC 3FB8C 4R6ZA 2Q6AA 4WFEA 2X6BA 4TWKA 2W0FC 3OR7C 5BZBA 3SPGA 3ASOC 1LNQA 3RW0A 4JTCB 4H37A 4MVQA 4R8CA 2EILC 4RUFA 3ZJZA 2EIMC 5B1BC 2WLHA 2QTOA 3LNMB 2QKSA 3JYCA 4GX0A 5IY5C 4RO2A 3SYAA 2DYRC 4GX1A 3ABLC 2HVKC 4MW8A 2EINC 3LUTB 3E86A 3AG2C 4PA4A 3ZRSA 5B3SC 2WLKA 3FB6C 2AHZA 2HG5C 1S5HC 2NLJC 4MVSA 4P9PA 3E8BA 2OCCC 4R7CA 2A79B 3SPIA 3T4DA 2IH1C 4MS2A 4GX2A 3K03A 3K0DA 4JTDB 2WLLB 2WLJA 3BEHA 2P7TC 3UM7A 4J9YB 3FB5C 3K04A 2AHYA 2ZXWC 4I9WA 4WFFA 3AG3C 3AG4C 4MVZA 2IH3C 3SYOA 2A9HA 2HFEC 4OXSA 5EK0A 5EBWC 3SYQA 4KFMA 2X6AA 1K4DC 5J9PC 1J95A 1R3KC 3ASNC 3HPLC 4PDLA 3SYCA 4RUEA 2DWEC 2ITDC 4F4LA 3E89A 2WLNA 3OGCC 2K1EA 4XDLA 3OR6C 3T2MA 1R3IC 5CBHA 4LCUC 3T1CA 1M56C 2DWDC 3RVYA 4HZ3A 3VOUA 3E8HA 3STLC 2ITCC 4MSWC 2X6CA 3X2QC 3K08A 4QNHB 3E8FA 3UKMA 3F5WC 2Y69C 4PDVA 4XDJA 1ZWIC 3SYPA 2WLIA 3RBZA 2EIJC 1ORQC 2EIKC 3KG2A 1V54C 1XL4A 1R3LC 2KB1A 2Q69A 2ZD9A 4MVRA 4PA6A 3F7YC 4P2ZA 1OCZC 4PA3A 4X88A 3RVZA 3TCUA 5CBGA 3T4ZA 1G4YB 3SPCA 4HYOA 4LBEC 4MVMA 4LP8A 2Q68A 3FB7C 5KUMA 2JK5C 2HVJC 1BL8A 2BOCC 4P30A 4PDMA 4MVUA 4PDRA 3OUFA 2WLMA 1OCRC 3LDDA 4PA7A 4XDKA 3K0GA 4X8AA 4JTAB 3K06A 4X89A 1JVMA 1OCOC 5EBMC 5EC2C 4RAIA 2BOBC 4MTGA 4PA9A 2H8PC 3AG1C 4J9ZB 3OUSA 2A0LA 2ATKC 4DXWA 3LDCA 1M57C 3ABKC 3IGAC 3IFXA 4G27B 4CBCA 2HJFC 4WFGA 5CBFA 5KUKA 2Q67A 4MW3A 3GB7C 4MVOA 1P7BA
chains in the Genus database with same CATH superfamily
1XDCA 3CC2V 5JJNB 3OTOB 3R65A 2XAFA 2XAHA 1F4MA 4TV8B 2DOSA 4OPAA 3TETA 3L71H 3JD1A 3CPWU 1PL0A 1QLEC 2YIBD 3AEIA 4TQDA 3L72H 4PI2A 2CUGA 2FB5A 4IHJA 3AG1B 2OYQA 2P4KA 1FS0G 1Y76B 5IWAO 5EIBC 1KUQA 3RW0A 1YSCA 3CCJV 4RUFA 1WP7A 1RM1C 4QIWF 3QTCA 2QTOA 3ZHUA 4WF9V 4WFBV 2A06H 1GM9A 5LMUO 2YDEA 4KXRA 4B3SO 4R7CA 1MA1A 4X1KB 4DR2B 1RPRA 4LC1A 1L0NH 1NT2B 3LSQA 2VRZA 3WB1A 5LGNA 2A9HA 3UT5B 1FD9A 2X6AA 4CC6A 1R3KC 5CA3A 3SYCA 1NTMH 1PV0A 5A2QN 1J5EB 1IURA 2FTKA 4JYCA 1YZBA 5CBHA 2PYJA 2EBOA 4E4EA 3RWRD 3OT7A 1W0KG 3RVYA 1VMGA 4JI3B 1XEQA 1XMQO 4JI8O 2QM4A 2IW5A 4JI8B 3AG3B 5FNVB 1H2MA 4NYKA 4X66O 4LH7A 1RM1B 4JI2B 1NH2B 1ZAUA 4J7KA 3FB7C 2AZ2A 3M99B 2GHYA 1Q43A 2LJ2A 3D36C 4O2BB 4X8AA 5LP6A 2Z3YA 3K06A 3SR2C 5CB4B 2WAMA 3CEIA 3M7MX 2LFSA 4CZZA 1KQSU 4LF7B 5KA6A 3K5MA 2YS8A 5IJ9A 4IIJA 3HKEA 1SQPH 2IBZH 1GK9A 3JASB 2WLLA 1F7YA 1URFA 4FFKA 1M9NA 3ABTA 3JD0A 1HNWO 4TT3G 5KX5B 3CC4V 1KB9F 1HNWB 3PJSK 5KHGA 4B3RB 5LA6A 4LNUA 2X6BA 5KAIZ 1YF2A 2JEXA 1US6A 4JTCB 1P49A 4R8CA 4LF8B 5H6QA 3WB2A 4DUYO 2AZ0A 5IY5C 4FPPA 4FLTA 1MOFA 2LP7A 1NJIW 3T4DA 3K5NA 2R9AA 2M7WA 3UM7A 2RJZA 1JPXA 3Q4HB 2PUSA 1R73A 5DECA 4GCZA 1EN6A 3ZMZA 3K57A 1QQCA 2ITDC 2HLDG 1W2BU 2Y4UA 5CA0A 4AQYB 1M56C 4FLXA 4DV0O 2Y69C 4YJ2B 4DV3O 1I94O 2KQXA 4TUYA 1YVWA 4DV3B 1I94B 1K7DA 3H1KH 4LP8A 1KU9A 3CCQV 4O4HA 1I5XA 2UXNA 4U3JB 4U7NA 3L74H 4QPJA 1FXKC 2EZPA 3BABA 1AVMA 1CPYA 5A9GA 4X9QA 4B7EA 3T1HO 1O9GA 1P7BA 2ADQB 3E89A 2IU0A 2KG7A 1VQPV 3F7VC 1TUBA 2NNUA 3T1HB 4NXMO 3AK1A 2P6JA 1WPBA 3A2FA 5F2VO 2FYUH 4R50A 1XL6A 1MSDA 4FVMA 5LHHA 2R72A 1M93A 2GTAA 1N32O 2W0FC 3OR7C 4MVQA 2BE3A 3G80A 4HNAB 1KC8W 2AXTZ 3SYAA 1HR0B 3ABLC 2HVKC 2WLKA 4GKKO 3T1YO 3EXAA 4PV1B 5TISZ 2IU3A 3OTFA 4GKKB 2QGNA 3GWKC 3ZRXA 1SC5B 5GW7A 1M1KW 3BFRA 1JR9A 2NN4A 4X1YB 1OV9A 3CCRV 2WA4A 3FD9A 4KL1A 4MVZA 1AB3A 1Y66A 4X1IB 4DRXA 5LGUA 1Q8IA 3CS5A 4PJ0Z 4H13B 2PI5A 3OGCC 4XDLA 3JALB 2DWDC 4LFCO 4JI5B 3ZIAG 1N34O 1YHQV 1D5NA 2ITCC 1TA8A 4DR5B 3J80N 1V9PA 4K8XA 4ZKIA 1M5IA 4BW5A 3RVZA 3F7YC 4P2ZA 3LNNA 4YY3O 4FMTA 2HEPA 2Q8VA 5B5EZ 3UO2A 4P30A 3LDDA 1IBKO 4JTAB 2W0XA 4FM2A 1AI6A 4FLVA 3CP1A 4LWSB 5JCOC 4YIPA 1VARA 4EB6A 2ZIOA 3I55V 1BHBA 3IGAC 1LUWA 4NTXA 3ETEA 5ITZB 5CN0A 4MW3A 4QE7A 3G6EV 3SJAC 1N0JA 1EFRG 2JGDB 1ZUQA 5L3BA 4FZ1A 5KX5A 3ZHRA 5K1XA 1OCOB 3QNEA 1MZEA 2P5OA 2Y0IA 3RN4A 4LF6O 5EIBD 3DC5A 2Q6AA 4K8ZA 3ETGA 4DUZO 2QWRB 5FL7G 3C90A 2XASA 1KBHA 5FLXN 2QKSA 4JI0B 1K3EA 5LYJB 4GX1A 3LUTB 2AHZA 2NLJC 2ZQMA 4PELA 3ZBHA 3CCUV 2ZE7A 4JI7O 4JI7B 2OIGA 5L3DA 5L3CA 4UCRA 2JDIG 4IHJB 5CMUA 3DTUB 3ZX6A 1LR1A 4F4LA 2WLNA 1VQ9V 4J11A 2XNDG 1M90W 2UUCO 5BXZA 2UUCB 2A7WA 2XAGA 5IE9A 1COWG 4LFBO 2WLIA 5LMNO 4LFBB 4OX9B 5LP6C 1R3LC 2Y4TA 4ZHQA 3CMEV 5LMNB 3AK2A 4CH6A 4J41A 3ML0A 2QJ1A 4DYLA 3A0HZ 4F6RB 1N33B 2PI4A 2DQ3A 2CDYA 2LQTA 2EZOA 4GUNA 1QBZA 5EC2C 1BHAA 1SQVH 5HFMA 3H1IH 1YEWA 3JSNA 2PTMA 4CC5A 1NQTA 5JVDB 3ETDA 3AK3A 1HP8A 2BTOA 1O9HA 1QLNA 2ZINA 2ZDIC 1NR7A 4DV1B 5EZYA 4K3AA 1OCCC 1UJWB 2R9RB 2XAQA 3O9OA 2JJ2G 2UXBO 4FZ0A 3U0ZA 3CC7V 5B1AC 2UXBB 4JI6O 1K73W 1K97A 3G71V 2GDSA 3OE7G 1AJPA 5LXTA 4GX0A 3THOA 1FXVA 2ADPA 5IJ9B 1YJWV 2B1IA 2IM9A 4GZRB 1UPGA 4IIJB 3HKEB 1V55B 4MS2A 3B77A 3K0DA 3VQYA 2WLLB 1B3QA 3ZHQA 2ZXWC 4YXWG 1XBLA 4OXSA 5EBWC 3JALA 4CS2A 5KAFZ 5J9PC 3BA9A 3JCZA 2D2CB 2Z0AA 2YIAA 3FYIB 1OCCB 1E79G 3GWOA 5LA6B 4LNUB 2DN9A 1DGSA 4BW9A 5JWPA 1R3IC 3DGEA 2OCCB 1Q82W 3E8HA 1K9MW 2X6CA 3RYIA 2QR4A 3JARA 1RSOA 5KA5A 5IT9N 1FPOA 2RMKB 3KG2A 1V54C 2Q5ZA 3DXRB 1BE3H 5L3EA 5BR8O 4PA3A 1OCZC 4I4TA 3TCUA 5BR8B 2A3QA 1KD1W 1BL8A 4U3FH 3OW2U 4PDRA 2YXYA 4NB5A 2UUBB 1N36O 1S0VA 3N2GA 1N36B 1SRYA 5IJ0A 4CH5A 3AG1C 1NI8A 1Q6IA 5CA0B 4WFGA 3H01A 3JAKA 3ZRWA 3TJTA 2DQ0A 1VQ4V 2HP8A 2ZNJA 1MABG 1QHTA 2YIBA 2YI8A 4TUYB 3APOA 3EFFK 1HNZO 4MTFA 4CS3A 1HNZB 1P4RA 4HAMA 5AG2A 3E83A 3ABKB 4DO2A 2QA4V 4LF5B 2PZSA 2HJDA 3K59A 4O4HB 2KKWA 4ABMA 3W7TA 3RYHB 2ZM6B 2E5LO 2K9PA 3JAWA 3EVKA 3JD3A 2E5LB 4BIZA 3ZRSA 2YXLA 2KG7B 1TUBB 4JTDB 3QG5A 4K35A 1PD3A 3M8AA 1EN5A 4J42A 4JI4O 3OD4A 3IJ4A 3AG3C 5IWAB 4N23A 3UCSC 1K4DC 1XOUA 2ZT9B 4IYHA 2F4VO 2ZCEA 2F66C 4LR3A 5B66Z 2K1EA 5GTHZ 1SF9A 1H8HG 1HNXO 1S72V 5JQGA 3OM3B 5LMUB 3STLC 1D5AA 1DLBA 1DK1A 4B3SB 2V7QG 3JATA 1P7GA 1D2DA 4F6RA 5H6RA 1ORQC 1S5JA 3KCYA 4UXNA 1NVPB 4FM1A 4LF4O 1VQ5V 1PM9A 1TUEB 4O4LA 1CXZB 2QE7G 4DRXB 5LHGA 1HDJA 2Q7HA 3X2QB 3FX7A 3WU2Z 3G67A 5JVDA 3QVNA 2CTQA 2X0LA 4NXNO 5CA1B 2EIJB 1XMQB 1KMIZ 1QCEA 4WFAV 3NR7A 3FFQA 2XT9A 1Y6XA 4X66B 2JEUA 1R1BA 1JCHA 4CH3A 4F6EA 1WAZA 2JGUA 4DK1A 2QDOA 1SZXA 2P22C 1S77D 4P9OA 4PHZA 1GMGA 3DC6A 3MHHC 2JVDA 3L75H 4AILC 3G4SV 4QGPA 1VEWA 1Q90D 4EB6B 2DYSB 3J81N 1KECA 4RO2A 1GTOA 4FM0A 2E75B 4BR6A 1BGYH 1AJQA 1PNLA 3OEEG 1Y74A 3E35A 3FB5C 3SDLA 1YTFB 2N04A 4UVBA 1R6KA 4LF9O 3TGUH 5IYDO 4DUYB 2M6YA 3T1CA 3DXRA 3JCUZ 1SQFA 3B2EE 2WPDG 3K08A 1FXHA 2CH7A 4L8JA 1F4NA 2XOKG 1G4YB 3IC7A 2VWKA 3NXSA 3CMAV 3B4SA 2HVJC 2IJIA 4J80A 2OWOA 1XI1A 4Z2WA 1CEZA 3K0GA 3EHBB 2Q73A 3JD2A 5D5QA 2CAZC 3OEHG 3ZMUA 4X64O 2CK3G 4X64B 1AROP 1WJZA 2H8PC 2YICA 2EIKB 4DV0B 1I08A 3FYEB 2HR3A 2PGGA 2H3OA 2VQFO 2F95B 4KP4A 2VQFB 1MNGA 1X59A 1B6QA 2MW2B 2WLIB 1Q5OA 2P67A 3WB0A 3CYOA 1VF6C 4ZHQB 2JS3A 2O57A 2Q7GA 3HKCA 1Z5WA 1JJ2U 1R6TA 4JZGA 1BMFG 1GN6A 2QWOB 3RYHA 3J7AU 2PF4E 1K4CC 1E1QG 2LFRA 2BTQA 1EM1A 5L3GA 2CGNA 2Q4PA 4NXMB 2DYRC 4X62O 4PA4A 2HG5C 1GAXA 2P4VA 4P9PA 1B04A 5EZYB 1JMKC 4ASUG 4A5UB 3ABMB 4YHHO 2WLJA 3K04A 4W4LA 1VQNV 5LOVA 2HFEC 5EK0A 3K3WA 1N32B 4I55A 1EZVH 3F5TA 1BQZA 3ETQA 4K0KO 5J2TA 1IBMO 5EYPA 2YSUB 3VQWA 1IBMB 3AG2B 3ICXA 4JYYA 1IBLO 2F43G 1IBLB 1AR4A 1FKAO 5IYZA 5LXTB 3T1YB 3UKMA 1JA8A 1CP9A 1K34A 3A0RA 4BIOA 1Q6HA 4JYBA 1G1XB 1NKDA 2DYRB 2AGAA 5CA1A 1SA0B 4PA7A 2LW7A 2RCVA 1JVMA 1OCOC 3K58A 4LFCB 4DK0A 1N34B 1VF5B 3CWBH 1YJ9V 2YUAA 3K9AA 2Q7EA 4MVOA 1XREA 1M4UA 1N8RW 3RYIB 3JARB 1RSOB 2QTSA 4YY3B 1GM8A 4I4TB 3IC9A 1AR5A 3I5DA 1IBKB 4WFHA 1M57B 4O4IA 4KHPO 3N2GB 2EJRA 4H44B 5IJ0B 1AP6A 1YXBA 2E3CA 1BCCH 3JAKB 3E86A 3ZRWB 4MVSA 4NTYA 2BSKA 1AJNA 4OPHA 3ZMSA 1N4CA 1JFFA 3BEHA 4IT5A 3U10A 3APQA 5JJEB 4LF6B 3ASOB 3GVMA 5KMGA 4ZI7B 1NH2D 3SYQA 4DR7O 4DUZB 4UB8Z 4J7JA 2EINB 1YITV 3K5OA 3I56V 2WSSG 1H2LA 1FYJA 1F51A 4HZ3A 3VOUA 3K79A 3E2EA 4LFAO 3WFVA 3JAWB 2UU9O 2ODMA 2UU9B 3RBZA 2ZE8A 3RGBA 2ZD9A 4PA6A 1XHXA 3ASNB 4IGGA 5KUMA 2LGQA 2JK5C 3MD0A 1EBOA 3D3QA 4JF3A 1IXBA 3H1JH 1NS1A 4O4JB 3LSUA 2IJKA 5FPOA 2ATKC 3IFXA 5JQGB 2HJFC 3BVOA 4FLWA 1BS3A 2QWNB 3JATB 4JZ2A 3BA8A 4GKJO 5EBLC 5E1AC 2Y48A 1OCRB 4FFBA 3SJBC 3ZCCA 3CXCU 4DV4O 2R9IA 2YEVB 1B06A 1QVGU 1RP3B 4PD4F 4O4LB 1V55C 4B3MO 4WCEV 1GO3F 2UUAO 2W6IG 3SPGA 2UUAB 1VP7A 2B5UA 4N21A 2WLHA 1THZA 2QKCA 2ZKOA 4CS4A 1PNMA 1GN4A 1QVFU 1OZ0A 3B09A 3B8MA 2XTAA 2OCCC 4G2KA 4EFEA 4I0XA 4WBNA 3K03A 3CCEV 3ZRVA 4I9WA 2OT5A 3MHSC 5IYCO 2EILB 1MZFA 5B1BB 4JI6B 4DR4O 1VIBA 4DR4B 1VF7A 4H0LB 3B8NA 2F93B 3N2KA 4BWAA 1K5SA 2F23A 1JJOA 3E8FA 3F5WC 4PDVA 3ZEDA 1PP9H 3TK1A 4UCUA 1YIJV 1XL4A 2Y0PA 1MSWD 2ILMA 1SA0A 2UXCO 1Y74B 2Q68A 2ETNA 1NR1A 3K9SA 1E1RG 1PNKA 1FXKA 2WLMA 2MK3A 1I7FA 1GN2A 3QO7A 3UQ8A 1K8AW 4PA9A 5BY1A 4J9ZB 3AG7A 5J2UA 3ABKC 2ZIMA 4JASA 1XNRO 5KUKA 3L70H 4DV7O 1JX9A 1W59A 1Q86W 2CH7B 3MAQA 1SKVA 3JAMN 4DW0A 3OMNB 1KKDA 2QWQB 3A8TA 2VWJA 3CXHF 1SERA 1ENVA 4I9QA 2XHBA 2HHHO 4TWKA 3CRMA 1LNQA 3HKDA 1IXMA 2RQ6A 3HKBA 3W7SA 3FB6C 1FAFA 5LGTA 4ZI7A 3E8BA 2A79B 5C93A 1BSMA 3CCMV 4GX2A 3ZMTA 5GTIZ 3IAYA 3HKCB 3ZMVA 3ABUA 3P30A 4X20A 2G38A 2FL4A 2GTSA 1BQ0A 3H1LH 4DR3O 4DR3B 2BTQB 4I7ZB 1Z5VA 3X2QC 4B3TO 1GN3A 3HB3B 3QO8A 1ZSPA 4B3TB 1AI7A 3CHXA 3FAVA 2EIJC 5K1PA 2ZNIA 4J7ZA 4EFBA 4JI4B 2V4DA 3CE2A 3CD6V 4RWUA 4TV9A 1TVKA 3TXQA 5JCOA 2YXHA 5BMVB 4O4JA 5LOVB 1MMMA 2F4VB 4MVUA 4D7TA 4C7UA 3S3WA 2Q9LA 5B1OA 4I55B 5J2TB 1HNXB 5EYPB 2BOBC 1QNMA 3LDCA 2AW9A 1WB7A 4UCTA 4CBCA 3D3IA 2QM7A 5IYZB 3L73H 4B7KA 3H9VA 2LGWA 4UFZA 5EC1C 2YEVA 1SESA 4EEQA 2DYSC 2F1MA 4LF4B 3ZHVA 4DR2O 3LDEA 4D7SA 1BT8A 1MG1A 3E8GA 4QE9A 2X7RB 4HBNA 2GUZA 1GRJA 5KHHA 3FB8C 4NXNB 1NBMG 1SZTA 2H94A 1J5EO 5GONA 3ZJZA 1HW7A 4Z1MG 5DM6V 5H9CA 4JI3O 1QLEB 2BCCH 4XDJA 2YIDA 1VQ6V 4ZOLA 4GYCB 5C8YB 1SQBH 2HKOA 2P7TC 5KHKA 2QWPB 5H2FZ 2AHYA 4TOIA 4E2LA 5D5PA 3H1HH 4JI2O 4UV9A 3JSLA 3K5LA 2E74B 1YDXA 3CRRA 4O4IB 4JGSA 3RYCA 1NTZH 4AHCA 1EZJA 1G6UA 3A0BZ 4MSWC 3W7UA 3L9DA 4LF7O 1KP2A 3S3XA 3SYPA 4XBFA 2EIKC 4WFFA 2BSKB 3ZS8C 3C3TA 1VQ8V 3T4ZA 1JFFB 5JH7A 2BOCC 2GV9A 2RDCA 5KMGB 5IDJA 4FK5C 4Z1VA 1JQ0A 4LF9B 1IVSA 4I50A 4X65O 5FPRA 4B3RO 3DSQA 2ZDIA 4X65B 3OUSA 4QJFB 2UXXA 4LF8O 4BIUA 3BPZA 1Q6UA 4JI1O 4DR6O 2PYLA 3ZHTA 4JI1B 4YJ3B 4DR6B 1WPXA 4L87A 1ZLZA 2IJJA 5DEDA 1G8MA 3W7XA 3BCCH 4ZBMA 1Q3EA 2V1DA 4DV5O 1L8DA 3ABMC 1ZL8A 4DV5B 4WFEA 2EULA 4R6ZA 5KHJA 1AP5A 4ICGA 4O2AB 3CJHA 1WA8B 4H37A 4TSFG 3RYFA 1S76D 4UVCA 1IX9A 3C3SA 3B40A 4Q6GA 2FKXA 1JOYA 4AQYO 3JD4A 3KKYA 1SS3A 2KSDA 1H38A 3AG2C 2FMLA 1S5HC 3SPIA 2IH1C 4FFBB 2ARHA 4UCSA 4DW1A 3ZN0A 5IYBO 1WNSA 1KKCA 3SYOA 2ZR2A 1HWYA 1BZKA 4NVPA 2RN9A 4J10A 4RUEA 5IY5B 4MT8A 1DF4A 4GLXA 3MDSA 3OR6C 3T2MA 4LCUC 1W0JG 1SQXH 1FFXA 1L0LH 4X62B 1QU7A 4QNHB 1RPOA 5KHIA 3U11A 2WWWA 1PL4A 5BMVA 4YHHB 1H2KA 4TV8A 2PY5A 4I0XB 1NU1H 1U96A 4WBNB 2C2AA 3CSXA 2QM8A 2YC0A 1Y76A 4K0KB 1M56B 3OUFA 1AR1B 3BAAA 3BHPA 4UCOA 2NR5A 5EBMC 2Y69B 1H2NA 1M57C 3N2KB 1TGOA 4G27B 1X4TA 2Q0AA 3QO5A 4U7OA 4X1KA 1K33A 1HR0O 4UUJC 1F23A 1XQ8A 3CRAA 4MTOA 3CRCA 3SJQC 1OHHG 3UO3A 3ZN1A 3SPJA 1DTOA 3UT5A 1XHZA 4EKWA 1WP8A 1FXKB 2B9ZA 1FJGO 1GKFA 3ASOC 4FIPC 1FJGB 5J2UB 2JJ1G 5C8YA 2CTRA 4JI5O 2B1GA 2CE4A 2EINC 5FNVA 2JIZG 3FKSG 5B3SC 2UXDO 2L6LA 4DR5O 3D8CA 2UXDB 1S3JA 4RQEA 1I5YA 3OMIB 4BAYA 5E79Z 1U97A 1K5QA 1NZ6A 3E22B 2CTWA 4O2BA 2JS5A 1NVPD 1XNQO 1J95A 3ASNC 5CB4A 2LW1A 3HPLC 1XNQB 4KHPB 2N74A 2DWEC 3ABLB 1TAEA 3G6BA 4GT1A 3RT3C 2OTLV 5DN6G 1S5LZ 3HKDB 3HKBB 2DJVA 5H5NA 1ZWIC 1VQ7V 3JASA 2P90A 2OCHA 4MVRA 1I0HA 3TXSA 3SPCA 4HYOA 4MVMA 1T5EA 3OMAB 2EJ7A 3CCVV 4DR7B 4LH6A 2YI9A 2QKAA 1R6NA 1SQGA 1IDSA 4XDKA 3ZHSA 1OCRC 5B3SB 4X20B 4X89A 5HFLA 1WLEA 4RAIA 3CB2A 1GH6A 4AI8A 3CRQA 4MTGA 4UVAA 2A0LA 4LFAB 1A32A 3D36A 4YJ3A 3GB7C 4ZIBA 4JI0O 1XUQA 1NTKH 3R66A 1H2SB 3FAVB 1R3JC 1N0NA 1DF5A 1PKXA 4TV9B 1TVKB 3Q4HA 4O2AA 1WA8A 5KLVH 5B1NA 3PN1A 2GSMB 2RNBA 2R70A 1YTFD 1PPJH 1P84F 2EILC 1GM7A 4W4KA 3SJCC 2EIMC 4I5SA 5B1BC 4NTWA 4JAVA 3JYCA 4FLYA 4YJ2A 4MW8A 4GKJB 4DV4B 4TQFA 4OX9O 2P06A 2ZE6A 3BY6A 1VQKV 2L35A 2IJHA 4B3MB 1VQOV 1N33O 3VBBA 2JRIA 4KFMA 3CCLV 2GUZB 4Q20A 1VQLV 3CX5F 4KUMA 4U3JA 3W7WA 4DV2O 2Q0OC 1QR8A 5GONB 4DV2B 1XMOO 2OIEA 1XMOB 3KCXA 1AI5A 1KP3A 1LUVA 4RQFA 2Q69A 2OTJV 4FJCC 2N05A 4ZOLB 1Y4MA 5CBGA 4DV1O 4JAAA 2EIMB 1RFYA 2QEXV 3O65A 1YI2V 2DE0X 4PDMA 1VQMV 1EN4A 4B08A 5LL6Y 1Z2GA 1FFTB 1AILA 1H8EG 1SQQH 2VQEO 4HNAA 2VQEB 3RYCB 4DXWA 1VF6A 5LP6B 1Q81W 1K92A 3OFNG 2ZR3A 4PI0A 2Q67A 4OGQB 2W6JG 4G28B 3WG7C 2UXCB 1YCIA 2ZE5A 4GX5A 4X1YA 1QR9A 4H33A 3QF7A 3CCSV 4NR1A 3SPHA 2WA3A 2XAJA 4X1IA 3STZC 5JH7B 3P3NA 1WN7A 4IL6Z 4JV5O 1SETA 1Q7YW 4I50B 5BZBA 4JV5B 3RFRA 1XNRB 3VQXA 3HR0A 1ZTEA 4YIOA 3KZIZ 3LNMB 4DV7B 3P32A 2E76B 4UCVA 1Y67A 3E22A 5B1AB 4J9YB 4CH4A 3P3PA 4JPRA 2QSAA 3LSSA 3N27A 4UV8A 3AG4C 1OJHA 2IH3C 2GBOA 2HHHB 1H2GA 2VS0A 4QPKA 3WG7B 4PDLA 4UB6Z 2LO1A 1ZL8B 4LWSA 2UUBO 1L1FA 3VQVA 2Z5UA 4FLZA 3CJHB 1KYOF 1UFIA 4D6TH 4FLUA 3RYFB 3OAAG 2CTPA 5ITZA 1WB8A 1IZ3A 2ZXWB 2DMXA 2CGOA 2JGDA 1ROPA 2KB1A 2DW4A 2XUMA 2EX3A 1XILA 1ZX3A 4X88A 1AI4A 1YJNV 4MTXA 4LBEC 4JYAO 4JYAB 4NKGB 5LHIA 4JAUA 5JJJB 3OGIB 4LF5O 3SGIA 4DR1O 2D3OW 3BRCA 4IYIA 1V54B 4DR1B 5LYJA 4DV6O 1OCZB 1FFXB 3AG4B 5LBQA 2ZM6O 5CBFA 4DV6B 5L3FA 3OTOO
chains in the Genus database with same CATH topology
3CC2V 1N8RW 1QLNA 2ZDIC 1NR7A 3R65A 2XAFA 1OCCC 2XAHA 1F4MA 1UJWB 1GM8A 1WPXA 2R9RB 4L87A 2XAQA 3TETA 2IJJA 1G8MA 3JD1A 2JJ2G 1PL0A 3CPWU 1QLEC 3AEIA 3W7XA 4WFHA 3AG1B 4ZBMA 2V1DA 1FS0G 1M57B 3ABMC 3CC7V 5B1AC 4WFEA 4R6ZA 1K73W 1K97A 1YSCA 3RW0A 4H37A 2EJRA 4RUFA 3CCJV 4TSFG 1RM1C 3G71V 1S76D 4UVCA 4QIWF 3OE7G 1AJPA 2QTOA 4WF9V 1JOYA 4WFBV 4GX0A 1GM9A 3JD4A 3ZRWB 3E86A 1H38A 1FXVA 3AG2C 1YJWV 2B1IA 4R7CA 1S5HC 4MVSA 3SPIA 1AJNA 1RPRA 1V55B 2IH1C 4LC1A 4MS2A 3LSQA 3B77A 3ZMSA 3K0DA 2WLLB 3BEHA 2ZXWC 4YXWG 3ZN0A 5IYBO 3ASOB 3SYOA 5LGNA 2A9HA 4OXSA 2ZR2A 1NH2D 5EBWC 1HWYA 3SYQA 5J9PC 2X6AA 1R3KC 5CA3A 3JCZA 3SYCA 4RUEA 3FYIB 5IY5B 4MT8A 1OCCB 1E79G 3GWOA 1DF4A 2EINB 1YITV 2FTKA 3OR6C 3T2MA 4JYCA 1R3IC 5CBHA 4LCUC 1W0JG 2EBOA 2WSSG 3DGEA 3I56V 1W0KG 2OCCB 1Q82W 1F51A 3RVYA 4HZ3A 3VOUA 3K79A 3E8HA 1K9MW 3E2EA 2X6CA 3WFVA 4QNHB 1RPOA 2WWWA 2IW5A 5KA5A 3AG3B 3RBZA 3KG2A 1V54C 2ZD9A 4PA6A 5L3EA 4PA3A 1OCZC 3ASNB 3TCUA 1RM1B 1NH2B 2C2AA 3FB7C 5KUMA 2JK5C 1KD1W 2QM8A 1BL8A 2GHYA 3M99B 3OW2U 3MD0A 1EBOA 1M56B 3OUFA 4PDRA 1AR1B 4JF3A 4X8AA 2Z3YA 1S0VA 3K06A 5EBMC 2WAMA 1SRYA 2Y69B 2LFSA 3AG1C 2IJKA 2ATKC 4CZZA 1M57C 3IFXA 4G27B 1KQSU 2HJFC 5KA6A 4WFGA 3H01A 3ZRWA 3QO5A 2DQ0A 4U7OA 1VQ4V 1MABG 1K33A 4UUJC 1F23A 4MTOA 5EBLC 5E1AC 1GK9A 2Y48A 2WLLA 3SJQC 1OCRB 1OHHG 3ZN1A 3ZCCA 3EFFK 1M9NA 3SPJA 3CXCU 4MTFA 2R9IA 2YEVB 1P4RA 3ABTA 3JD0A 1DTOA 1QVGU 4TT3G 4EKWA 1V55C 4HAMA 3CC4V 3E83A 3ABKB 4DO2A 2QA4V 1FXKB 3PJSK 4WCEV 1GO3F 2X6BA 2JEXA 1GKFA 2W6IG 3ASOC 3SPGA 4FIPC 4JTCB 4R8CA 3W7TA 2B5UA 5H6QA 4N21A 2WLHA 1THZA 2JJ1G 5IY5C 4FPPA 3JD3A 2B1GA 4BIZA 1PNMA 1QVFU 2EINC 1OZ0A 1MOFA 2JIZG 3FKSG 5B3SC 3ZRSA 2LP7A 1NJIW 3B8MA 3T4DA 2OCCC 1S3JA 4RQEA 2M7WA 4G2KA 1I5YA 3K03A 4JTDB 3OMIB 3UM7A 1PD3A 3CCEV 4BAYA 3ZRVA 4I9WA 3AG3C 2OT5A 3MHSC 1K5QA 1JPXA 5IYCO 2EILB 1NVPD 4N23A 1K4DC 5B1BB 1J95A 3ASNC 1R73A 4GCZA 3HPLC 3ZMZA 2DWEC 2ITDC 2HLDG 1W2BU 3ABLB 2K1EA 3B8NA 1H8HG 1S72V 4GT1A 1M56C 2OTLV 3OM3B 5DN6G 3STLC 1K5SA 1DLBA 3E8FA 2V7QG 3F5WC 2Y69C 4PDVA 1ZWIC 3TK1A 1VQ7V 5H6RA 1ORQC 1YIJV 2P90A 1XL4A 4MVRA 4UXNA 1MSWD 1K7DA 1NVPB 3SPCA 4HYOA 4MVMA 1VQ5V 4LP8A 3OMAB 2Q68A 3CCVV 1NR1A 1TUEB 3CCQV 2QE7G 1E1RG 1R6NA 1PNKA 1FXKA 4XDKA 2WLMA 1OCRC 5B3SB 2MK3A 5LHGA 3QO7A 4X89A 5HFLA 1I5XA 3X2QB 1K8AW 2UXNA 1WLEA 4RAIA 4MTGA 4PA9A 2X0LA 4UVAA 4U7NA 2EIJB 4J9ZB 2A0LA 4QPJA 3ABKC 4JASA 1FXKC 2EZPA 1QCEA 3D36A 1CPYA 4WFAV 5KUKA 3GB7C 1P7BA 3E89A 2IU0A 1VQPV 3F7VC 1JX9A 2NNUA 2JEUA 1JCHA 1Q86W 1R3JC 1DF5A 2P6JA 1PKXA 4R50A 3OMNB 1S77D 4P9OA 1XL6A 1KKDA 1GMGA 3MHHC 5LHHA 1SERA 5B1NA 2GSMB 1ENVA 4TWKA 2W0FC 3OR7C 1YTFD 3G4SV 1LNQA 4MVQA 2EILC 1GM7A 2EIMC 4I5SA 5B1BC 2DYSB 4JAVA 1IXMA 1KC8W 3JYCA 1KECA 4RO2A 3SYAA 1GTOA 3ABLC 2HVKC 4MW8A 3W7SA 2WLKA 3FB6C 5LGTA 1AJQA 2IU3A 3E8BA 2A79B 1PNLA 5C93A 3CCMV 3ZRXA 1M1KW 4GX2A 3OEEG 5GW7A 3E35A 3FB5C 3ZMTA 3BY6A 3CCRV 1VQKV 4MVZA 2IJHA 3ZMVA 1VQOV 1Y66A 3VBBA 3ABUA 4KFMA 5LGUA 3CCLV 1YTFB 3P30A 4Q20A 1VQLV 4KUMA 4UVBA 2PI5A 3OGCC 1R6KA 4XDLA 5IYDO 3W7WA 1QR8A 3T1CA 2DWDC 3ZIAG 1YHQV 2ITCC 2WPDG 3X2QC 3K08A 1AI5A 1FXHA 3HB3B 3QO8A 1KP3A 1AI7A 4ZKIA 2EIJC 4RQFA 2Q69A 4BW5A 2OTJV 4FJCC 3RVZA 3F7YC 4P2ZA 1F4NA 2XOKG 1Y4MA 5CBGA 4FMTA 1G4YB 2EIMB 3IC7A 3CD6V 2QEXV 3NXSA 3CMAV 1YI2V 2HVJC 2IJIA 4P30A 4PDMA 4MVUA 1VQMV 1CEZA 3LDDA 5B1OA 3K0GA 3EHBB 4JTAB 1FFTB 3JD2A 3OEHG 3ZMUA 1AI6A 1H8EG 2CK3G 2BOBC 3CP1A 1AROP 2H8PC 2EIKB 4DXWA 3LDCA 3I55V 1BHBA 1Q81W 3IGAC 1K92A 3OFNG 2ZR3A 4CBCA 3ETEA 3D3IA 3FYEB 2Q67A 4MW3A 2HR3A 5CN0A 2QM7A 4QE7A 3G6EV 2W6JG 4G28B 5EC1C 4KP4A 3WG7C 2YEVA 1SESA 1EFRG 1B6QA 2WLIB 2P67A 5L3BA 2DYSC 3CYOA 4GX5A 1QR9A 4H33A 3LDEA 3CCSV 1MG1A 1OCOB 3QNEA 3E8GA 3SPHA 4QE9A 2X7RB 2XAJA 1JJ2U 3STZC 1BMFG 1K4CC 3FB8C 1SETA 2Q6AA 1Q7YW 1E1QG 2LFRA 1NBMG 1SZTA 3ETGA 2H94A 5BZBA 5FL7G 3ZJZA 2XASA 5L3GA 3LNMB 2QKSA 1K3EA 4Z1MG 2DYRC 4GX1A 3P32A 3LUTB 5DM6V 5H9CA 4PA4A 1QLEB 2AHZA 2HG5C 2NLJC 4XDJA 4P9PA 1VQ6V 2ZQMA 4PELA 4ASUG 3CCUV 3ABMB 2HKOA 5B1AB 2WLJA 2P7TC 4J9YB 3K04A 1VQNV 2AHYA 4E2LA 4JPRA 5L3DA 5L3CA 3LSSA 4UV8A 2JDIG 3AG4C 2IH3C 2HFEC 5EK0A 3K3WA 4UV9A 1H2GA 4QPKA 3WG7B 5CMUA 3DTUB 4PDLA 4F4LA 2WLNA 2YSUB 1L1FA 1VQ9V 3AG2B 4JGSA 2Z5UA 2XNDG 2F43G 1M90W 3OAAG 1EZJA 4MSWC 3W7UA 3UKMA 2XAGA 2ZXWB 1COWG 1KP2A 3SYPA 2WLIA 4XBFA 1ROPA 2EIKC 1CP9A 2KB1A 1K34A 1R3LC 2DW4A 4WFFA 3CMEV 4X88A 1AI4A 1YJNV 3A0RA 3ML0A 4MTXA 3T4ZA 1VQ8V 4LBEC 4JYBA 2PI4A 1NKDA 2DQ3A 2BOCC 2DYRB 5IDJA 4FK5C 5LHIA 2EZOA 4PA7A 1JQ0A 4JAUA 1JVMA 1OCOC 1QBZA 5EC2C 1BHAA 5HFMA 2ZDIA 2D3OW 3OUSA 4QJFB 2UXXA 1V54B 1YJ9V 1OCZB 3AG4B 5LBQA 3K9AA 4BIUA 1NQTA 5CBFA 5L3FA 4MVOA 3ETDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QE7 A;  4G28 B;  5EC1 C;  3F7V C;  3WG7 C;  2YEV A;  4UUJ C;  4MTO A;  3R65 A;  2WLI B;  5EBL C;  1OCC C;  1R3J C;  2DYS C;  5E1A C;  2WLL A;  3SJQ C;  4GX5 A;  2R9R B;  4H33 A;  3EFF K;  3SPJ A;  3LDE A;  4MTF A;  3TET A;  3E8G A;  4R50 A;  1QLE C;  3SPH A;  4QE9 A;  3STZ C;  4P9O A;  1XL6 A;  1KKD A;  4WFH A;  4EKW A;  4ZBM A;  1V55 C;  4BW5 A;  3E83 A;  3ABM C;  3PJS K;  5B1A C;  1K4C C;  3FB8 C;  4R6Z A;  2Q6A A;  4WFE A;  2X6B A;  4TWK A;  2W0F C;  3OR7 C;  5BZB A;  3SPG A;  3ASO C;  1LNQ A;  3RW0 A;  4JTC B;  4H37 A;  4MVQ A;  4R8C A;  2EIL C;  4RUF A;  3ZJZ A;  2EIM C;  5B1B C;  2WLH A;  2QTO A;  3LNM B;  2QKS A;  3JYC A;  4GX0 A;  5IY5 C;  4RO2 A;  3SYA A;  2DYR C;  4GX1 A;  3ABL C;  2HVK C;  4MW8 A;  2EIN C;  3LUT B;  3E86 A;  3AG2 C;  4PA4 A;  3ZRS A;  5B3S C;  2WLK A;  3FB6 C;  2AHZ A;  2HG5 C;  1S5H C;  2NLJ C;  4MVS A;  4P9P A;  3E8B A;  2OCC C;  4R7C A;  2A79 B;  3SPI A;  3T4D A;  2IH1 C;  4MS2 A;  4GX2 A;  3K03 A;  3K0D A;  4JTD B;  2WLL B;  2WLJ A;  3BEH A;  2P7T C;  3UM7 A;  4J9Y B;  3FB5 C;  3K04 A;  2AHY A;  2ZXW C;  4I9W A;  4WFF A;  3AG3 C;  3AG4 C;  4MVZ A;  2IH3 C;  3SYO A;  2A9H A;  2HFE C;  4OXS A;  5EK0 A;  5EBW C;  3SYQ A;  4KFM A;  2X6A A;  1K4D C;  5J9P C;  1J95 A;  1R3K C;  3ASN C;  3HPL C;  4PDL A;  3SYC A;  4RUE A;  2DWE C;  2ITD C;  4F4L A;  3E89 A;  2WLN A;  3OGC C;  2K1E A;  4XDL A;  3OR6 C;  3T2M A;  1R3I C;  5CBH A;  4LCU C;  3T1C A;  1M56 C;  2DWD C;  3RVY A;  4HZ3 A;  3VOU A;  3E8H A;  3STL C;  2ITC C;  4MSW C;  2X6C A;  3X2Q C;  3K08 A;  4QNH B;  3E8F A;  3UKM A;  3F5W C;  2Y69 C;  4PDV A;  4XDJ A;  1ZWI C;  3SYP A;  2WLI A;  3RBZ A;  2EIJ C;  1ORQ C;  2EIK C;  3KG2 A;  1V54 C;  1XL4 A;  1R3L C;  2KB1 A;  2Q69 A;  2ZD9 A;  4MVR A;  4PA6 A;  3F7Y C;  4P2Z A;  1OCZ C;  4PA3 A;  4X88 A;  3RVZ A;  3TCU A;  5CBG A;  3T4Z A;  1G4Y B;  3SPC A;  4HYO A;  4LBE C;  4MVM A;  4LP8 A;  2Q68 A;  3FB7 C;  5KUM A;  2JK5 C;  2HVJ C;  1BL8 A;  2BOC C;  4P30 A;  4PDM A;  4MVU A;  4PDR A;  3OUF A;  2WLM A;  1OCR C;  3LDD A;  4PA7 A;  4XDK A;  3K0G A;  4X8A A;  4JTA B;  3K06 A;  4X89 A;  1JVM A;  1OCO C;  5EBM C;  5EC2 C;  4RAI A;  2BOB C;  4MTG A;  4PA9 A;  2H8P C;  3AG1 C;  4J9Z B;  3OUS A;  2A0L A;  2ATK C;  4DXW A;  3LDC A;  1M57 C;  3ABK C;  3IGA C;  3IFX A;  4G27 B;  4CBC A;  2HJF C;  4WFG A;  5CBF A;  5KUK A;  2Q67 A;  4MW3 A;  3GB7 C;  4MVO A;  1P7B A; 
#chains in the Genus database with same CATH topology
 1XDC A;  3CC2 V;  5JJN B;  3OTO B;  3R65 A;  2XAF A;  2XAH A;  1F4M A;  4TV8 B;  2DOS A;  4OPA A;  3TET A;  3L71 H;  3JD1 A;  3CPW U;  1PL0 A;  1QLE C;  2YIB D;  3AEI A;  4TQD A;  3L72 H;  4PI2 A;  2CUG A;  2FB5 A;  4IHJ A;  3AG1 B;  2OYQ A;  2P4K A;  1FS0 G;  1Y76 B;  5IWA O;  5EIB C;  1KUQ A;  3RW0 A;  1YSC A;  3CCJ V;  4RUF A;  1WP7 A;  1RM1 C;  4QIW F;  3QTC A;  2QTO A;  3ZHU A;  4WF9 V;  4WFB V;  2A06 H;  1GM9 A;  5LMU O;  2YDE A;  4KXR A;  4B3S O;  4R7C A;  1MA1 A;  4X1K B;  4DR2 B;  1RPR A;  4LC1 A;  1L0N H;  1NT2 B;  3LSQ A;  2VRZ A;  3WB1 A;  5LGN A;  2A9H A;  3UT5 B;  1FD9 A;  2X6A A;  4CC6 A;  1R3K C;  5CA3 A;  3SYC A;  1NTM H;  1PV0 A;  5A2Q N;  1J5E B;  1IUR A;  2FTK A;  4JYC A;  1YZB A;  5CBH A;  2PYJ A;  2EBO A;  4E4E A;  3RWR D;  3OT7 A;  1W0K G;  3RVY A;  1VMG A;  4JI3 B;  1XEQ A;  1XMQ O;  4JI8 O;  2QM4 A;  2IW5 A;  4JI8 B;  3AG3 B;  5FNV B;  1H2M A;  4NYK A;  4X66 O;  4LH7 A;  1RM1 B;  4JI2 B;  1NH2 B;  1ZAU A;  4J7K A;  3FB7 C;  2AZ2 A;  3M99 B;  2GHY A;  1Q43 A;  2LJ2 A;  3D36 C;  4O2B B;  4X8A A;  5LP6 A;  2Z3Y A;  3K06 A;  3SR2 C;  5CB4 B;  2WAM A;  3CEI A;  3M7M X;  2LFS A;  4CZZ A;  1KQS U;  4LF7 B;  5KA6 A;  3K5M A;  2YS8 A;  5IJ9 A;  4IIJ A;  3HKE A;  1SQP H;  2IBZ H;  1GK9 A;  3JAS B;  2WLL A;  1F7Y A;  1URF A;  4FFK A;  1M9N A;  3ABT A;  3JD0 A;  1HNW O;  4TT3 G;  5KX5 B;  3CC4 V;  1KB9 F;  1HNW B;  3PJS K;  5KHG A;  4B3R B;  5LA6 A;  4LNU A;  2X6B A;  5KAI Z;  1YF2 A;  2JEX A;  1US6 A;  4JTC B;  1P49 A;  4R8C A;  4LF8 B;  5H6Q A;  3WB2 A;  4DUY O;  2AZ0 A;  5IY5 C;  4FPP A;  4FLT A;  1MOF A;  2LP7 A;  1NJI W;  3T4D A;  3K5N A;  2R9A A;  2M7W A;  3UM7 A;  2RJZ A;  1JPX A;  3Q4H B;  2PUS A;  1R73 A;  5DEC A;  4GCZ A;  1EN6 A;  3ZMZ A;  3K57 A;  1QQC A;  2ITD C;  2HLD G;  1W2B U;  2Y4U A;  5CA0 A;  4AQY B;  1M56 C;  4FLX A;  4DV0 O;  2Y69 C;  4YJ2 B;  4DV3 O;  1I94 O;  2KQX A;  4TUY A;  1YVW A;  4DV3 B;  1I94 B;  1K7D A;  3H1K H;  4LP8 A;  1KU9 A;  3CCQ V;  4O4H A;  1I5X A;  2UXN A;  4U3J B;  4U7N A;  3L74 H;  4QPJ A;  1FXK C;  2EZP A;  3BAB A;  1AVM A;  1CPY A;  5A9G A;  4X9Q A;  4B7E A;  3T1H O;  1O9G A;  1P7B A;  2ADQ B;  3E89 A;  2IU0 A;  2KG7 A;  1VQP V;  3F7V C;  1TUB A;  2NNU A;  3T1H B;  4NXM O;  3AK1 A;  2P6J A;  1WPB A;  3A2F A;  5F2V O;  2FYU H;  4R50 A;  1XL6 A;  1MSD A;  4FVM A;  5LHH A;  2R72 A;  1M93 A;  2GTA A;  1N32 O;  2W0F C;  3OR7 C;  4MVQ A;  2BE3 A;  3G80 A;  4HNA B;  1KC8 W;  2AXT Z;  3SYA A;  1HR0 B;  3ABL C;  2HVK C;  2WLK A;  4GKK O;  3T1Y O;  3EXA A;  4PV1 B;  5TIS Z;  2IU3 A;  3OTF A;  4GKK B;  2QGN A;  3GWK C;  3ZRX A;  1SC5 B;  5GW7 A;  1M1K W;  3BFR A;  1JR9 A;  2NN4 A;  4X1Y B;  1OV9 A;  3CCR V;  2WA4 A;  3FD9 A;  4KL1 A;  4MVZ A;  1AB3 A;  1Y66 A;  4X1I B;  4DRX A;  5LGU A;  1Q8I A;  3CS5 A;  4PJ0 Z;  4H13 B;  2PI5 A;  3OGC C;  4XDL A;  3JAL B;  2DWD C;  4LFC O;  4JI5 B;  3ZIA G;  1N34 O;  1YHQ V;  1D5N A;  2ITC C;  1TA8 A;  4DR5 B;  3J80 N;  1V9P A;  4K8X A;  4ZKI A;  1M5I A;  4BW5 A;  3RVZ A;  3F7Y C;  4P2Z A;  3LNN A;  4YY3 O;  4FMT A;  2HEP A;  2Q8V A;  5B5E Z;  3UO2 A;  4P30 A;  3LDD A;  1IBK O;  4JTA B;  2W0X A;  4FM2 A;  1AI6 A;  4FLV A;  3CP1 A;  4LWS B;  5JCO C;  4YIP A;  1VAR A;  4EB6 A;  2ZIO A;  3I55 V;  1BHB A;  3IGA C;  1LUW A;  4NTX A;  3ETE A;  5ITZ B;  5CN0 A;  4MW3 A;  4QE7 A;  3G6E V;  3SJA C;  1N0J A;  1EFR G;  2JGD B;  1ZUQ A;  5L3B A;  4FZ1 A;  5KX5 A;  3ZHR A;  5K1X A;  1OCO B;  3QNE A;  1MZE A;  2P5O A;  2Y0I A;  3RN4 A;  4LF6 O;  5EIB D;  3DC5 A;  2Q6A A;  4K8Z A;  3ETG A;  4DUZ O;  2QWR B;  5FL7 G;  3C90 A;  2XAS A;  1KBH A;  5FLX N;  2QKS A;  4JI0 B;  1K3E A;  5LYJ B;  4GX1 A;  3LUT B;  2AHZ A;  2NLJ C;  2ZQM A;  4PEL A;  3ZBH A;  3CCU V;  2ZE7 A;  4JI7 O;  4JI7 B;  2OIG A;  5L3D A;  5L3C A;  4UCR A;  2JDI G;  4IHJ B;  5CMU A;  3DTU B;  3ZX6 A;  1LR1 A;  4F4L A;  2WLN A;  1VQ9 V;  4J11 A;  2XND G;  1M90 W;  2UUC O;  5BXZ A;  2UUC B;  2A7W A;  2XAG A;  5IE9 A;  1COW G;  4LFB O;  2WLI A;  5LMN O;  4LFB B;  4OX9 B;  5LP6 C;  1R3L C;  2Y4T A;  4ZHQ A;  3CME V;  5LMN B;  3AK2 A;  4CH6 A;  4J41 A;  3ML0 A;  2QJ1 A;  4DYL A;  3A0H Z;  4F6R B;  1N33 B;  2PI4 A;  2DQ3 A;  2CDY A;  2LQT A;  2EZO A;  4GUN A;  1QBZ A;  5EC2 C;  1BHA A;  1SQV H;  5HFM A;  3H1I H;  1YEW A;  3JSN A;  2PTM A;  4CC5 A;  1NQT A;  5JVD B;  3ETD A;  3AK3 A;  1HP8 A;  2BTO A;  1O9H A;  1QLN A;  2ZIN A;  2ZDI C;  1NR7 A;  4DV1 B;  5EZY A;  4K3A A;  1OCC C;  1UJW B;  2R9R B;  2XAQ A;  3O9O A;  2JJ2 G;  2UXB O;  4FZ0 A;  3U0Z A;  3CC7 V;  5B1A C;  2UXB B;  4JI6 O;  1K73 W;  1K97 A;  3G71 V;  2GDS A;  3OE7 G;  1AJP A;  5LXT A;  4GX0 A;  3THO A;  1FXV A;  2ADP A;  5IJ9 B;  1YJW V;  2B1I A;  2IM9 A;  4GZR B;  1UPG A;  4IIJ B;  3HKE B;  1V55 B;  4MS2 A;  3B77 A;  3K0D A;  3VQY A;  2WLL B;  1B3Q A;  3ZHQ A;  2ZXW C;  4YXW G;  1XBL A;  4OXS A;  5EBW C;  3JAL A;  4CS2 A;  5KAF Z;  5J9P C;  3BA9 A;  3JCZ A;  2D2C B;  2Z0A A;  2YIA A;  3FYI B;  1OCC B;  1E79 G;  3GWO A;  5LA6 B;  4LNU B;  2DN9 A;  1DGS A;  4BW9 A;  5JWP A;  1R3I C;  3DGE A;  2OCC B;  1Q82 W;  3E8H A;  1K9M W;  2X6C A;  3RYI A;  2QR4 A;  3JAR A;  1RSO A;  5KA5 A;  5IT9 N;  1FPO A;  2RMK B;  3KG2 A;  1V54 C;  2Q5Z A;  3DXR B;  1BE3 H;  5L3E A;  5BR8 O;  4PA3 A;  1OCZ C;  4I4T A;  3TCU A;  5BR8 B;  2A3Q A;  1KD1 W;  1BL8 A;  4U3F H;  3OW2 U;  4PDR A;  2YXY A;  4NB5 A;  2UUB B;  1N36 O;  1S0V A;  3N2G A;  1N36 B;  1SRY A;  5IJ0 A;  4CH5 A;  3AG1 C;  1NI8 A;  1Q6I A;  5CA0 B;  4WFG A;  3H01 A;  3JAK A;  3ZRW A;  3TJT A;  2DQ0 A;  1VQ4 V;  2HP8 A;  2ZNJ A;  1MAB G;  1QHT A;  2YIB A;  2YI8 A;  4TUY B;  3APO A;  3EFF K;  1HNZ O;  4MTF A;  4CS3 A;  1HNZ B;  1P4R A;  4HAM A;  5AG2 A;  3E83 A;  3ABK B;  4DO2 A;  2QA4 V;  4LF5 B;  2PZS A;  2HJD A;  3K59 A;  4O4H B;  2KKW A;  4ABM A;  3W7T A;  3RYH B;  2ZM6 B;  2E5L O;  2K9P A;  3JAW A;  3EVK A;  3JD3 A;  2E5L B;  4BIZ A;  3ZRS A;  2YXL A;  2KG7 B;  1TUB B;  4JTD B;  3QG5 A;  4K35 A;  1PD3 A;  3M8A A;  1EN5 A;  4J42 A;  4JI4 O;  3OD4 A;  3IJ4 A;  3AG3 C;  5IWA B;  4N23 A;  3UCS C;  1K4D C;  1XOU A;  2ZT9 B;  4IYH A;  2F4V O;  2ZCE A;  2F66 C;  4LR3 A;  5B66 Z;  2K1E A;  5GTH Z;  1SF9 A;  1H8H G;  1HNX O;  1S72 V;  5JQG A;  3OM3 B;  5LMU B;  3STL C;  1D5A A;  1DLB A;  1DK1 A;  4B3S B;  2V7Q G;  3JAT A;  1P7G A;  1D2D A;  4F6R A;  5H6R A;  1ORQ C;  1S5J A;  3KCY A;  4UXN A;  1NVP B;  4FM1 A;  4LF4 O;  1VQ5 V;  1PM9 A;  1TUE B;  4O4L A;  1CXZ B;  2QE7 G;  4DRX B;  5LHG A;  1HDJ A;  2Q7H A;  3X2Q B;  3FX7 A;  3WU2 Z;  3G67 A;  5JVD A;  3QVN A;  2CTQ A;  2X0L A;  4NXN O;  5CA1 B;  2EIJ B;  1XMQ B;  1KMI Z;  1QCE A;  4WFA V;  3NR7 A;  3FFQ A;  2XT9 A;  1Y6X A;  4X66 B;  2JEU A;  1R1B A;  1JCH A;  4CH3 A;  4F6E A;  1WAZ A;  2JGU A;  4DK1 A;  2QDO A;  1SZX A;  2P22 C;  1S77 D;  4P9O A;  4PHZ A;  1GMG A;  3DC6 A;  3MHH C;  2JVD A;  3L75 H;  4AIL C;  3G4S V;  4QGP A;  1VEW A;  1Q90 D;  4EB6 B;  2DYS B;  3J81 N;  1KEC A;  4RO2 A;  1GTO A;  4FM0 A;  2E75 B;  4BR6 A;  1BGY H;  1AJQ A;  1PNL A;  3OEE G;  1Y74 A;  3E35 A;  3FB5 C;  3SDL A;  1YTF B;  2N04 A;  4UVB A;  1R6K A;  4LF9 O;  3TGU H;  5IYD O;  4DUY B;  2M6Y A;  3T1C A;  3DXR A;  3JCU Z;  1SQF A;  3B2E E;  2WPD G;  3K08 A;  1FXH A;  2CH7 A;  4L8J A;  1F4N A;  2XOK G;  1G4Y B;  3IC7 A;  2VWK A;  3NXS A;  3CMA V;  3B4S A;  2HVJ C;  2IJI A;  4J80 A;  2OWO A;  1XI1 A;  4Z2W A;  1CEZ A;  3K0G A;  3EHB B;  2Q73 A;  3JD2 A;  5D5Q A;  2CAZ C;  3OEH G;  3ZMU A;  4X64 O;  2CK3 G;  4X64 B;  1ARO P;  1WJZ A;  2H8P C;  2YIC A;  2EIK B;  4DV0 B;  1I08 A;  3FYE B;  2HR3 A;  2PGG A;  2H3O A;  2VQF O;  2F95 B;  4KP4 A;  2VQF B;  1MNG A;  1X59 A;  1B6Q A;  2MW2 B;  2WLI B;  1Q5O A;  2P67 A;  3WB0 A;  3CYO A;  1VF6 C;  4ZHQ B;  2JS3 A;  2O57 A;  2Q7G A;  3HKC A;  1Z5W A;  1JJ2 U;  1R6T A;  4JZG A;  1BMF G;  1GN6 A;  2QWO B;  3RYH A;  3J7A U;  2PF4 E;  1K4C C;  1E1Q G;  2LFR A;  2BTQ A;  1EM1 A;  5L3G A;  2CGN A;  2Q4P A;  4NXM B;  2DYR C;  4X62 O;  4PA4 A;  2HG5 C;  1GAX A;  2P4V A;  4P9P A;  1B04 A;  5EZY B;  1JMK C;  4ASU G;  4A5U B;  3ABM B;  4YHH O;  2WLJ A;  3K04 A;  4W4L A;  1VQN V;  5LOV A;  2HFE C;  5EK0 A;  3K3W A;  1N32 B;  4I55 A;  1EZV H;  3F5T A;  1BQZ A;  3ETQ A;  4K0K O;  5J2T A;  1IBM O;  5EYP A;  2YSU B;  3VQW A;  1IBM B;  3AG2 B;  3ICX A;  4JYY A;  1IBL O;  2F43 G;  1IBL B;  1AR4 A;  1FKA O;  5IYZ A;  5LXT B;  3T1Y B;  3UKM A;  1JA8 A;  1CP9 A;  1K34 A;  3A0R A;  4BIO A;  1Q6H A;  4JYB A;  1G1X B;  1NKD A;  2DYR B;  2AGA A;  5CA1 A;  1SA0 B;  4PA7 A;  2LW7 A;  2RCV A;  1JVM A;  1OCO C;  3K58 A;  4LFC B;  4DK0 A;  1N34 B;  1VF5 B;  3CWB H;  1YJ9 V;  2YUA A;  3K9A A;  2Q7E A;  4MVO A;  1XRE A;  1M4U A;  1N8R W;  3RYI B;  3JAR B;  1RSO B;  2QTS A;  4YY3 B;  1GM8 A;  4I4T B;  3IC9 A;  1AR5 A;  3I5D A;  1IBK B;  4WFH A;  1M57 B;  4O4I A;  4KHP O;  3N2G B;  2EJR A;  4H44 B;  5IJ0 B;  1AP6 A;  1YXB A;  2E3C A;  1BCC H;  3JAK B;  3E86 A;  3ZRW B;  4MVS A;  4NTY A;  2BSK A;  1AJN A;  4OPH A;  3ZMS A;  1N4C A;  1JFF A;  3BEH A;  4IT5 A;  3U10 A;  3APQ A;  5JJE B;  4LF6 B;  3ASO B;  3GVM A;  5KMG A;  4ZI7 B;  1NH2 D;  3SYQ A;  4DR7 O;  4DUZ B;  4UB8 Z;  4J7J A;  2EIN B;  1YIT V;  3K5O A;  3I56 V;  2WSS G;  1H2L A;  1FYJ A;  1F51 A;  4HZ3 A;  3VOU A;  3K79 A;  3E2E A;  4LFA O;  3WFV A;  3JAW B;  2UU9 O;  2ODM A;  2UU9 B;  3RBZ A;  2ZE8 A;  3RGB A;  2ZD9 A;  4PA6 A;  1XHX A;  3ASN B;  4IGG A;  5KUM A;  2LGQ A;  2JK5 C;  3MD0 A;  1EBO A;  3D3Q A;  4JF3 A;  1IXB A;  3H1J H;  1NS1 A;  4O4J B;  3LSU A;  2IJK A;  5FPO A;  2ATK C;  3IFX A;  5JQG B;  2HJF C;  3BVO A;  4FLW A;  1BS3 A;  2QWN B;  3JAT B;  4JZ2 A;  3BA8 A;  4GKJ O;  5EBL C;  5E1A C;  2Y48 A;  1OCR B;  4FFB A;  3SJB C;  3ZCC A;  3CXC U;  4DV4 O;  2R9I A;  2YEV B;  1B06 A;  1QVG U;  1RP3 B;  4PD4 F;  4O4L B;  1V55 C;  4B3M O;  4WCE V;  1GO3 F;  2UUA O;  2W6I G;  3SPG A;  2UUA B;  1VP7 A;  2B5U A;  4N21 A;  2WLH A;  1THZ A;  2QKC A;  2ZKO A;  4CS4 A;  1PNM A;  1GN4 A;  1QVF U;  1OZ0 A;  3B09 A;  3B8M A;  2XTA A;  2OCC C;  4G2K A;  4EFE A;  4I0X A;  4WBN A;  3K03 A;  3CCE V;  3ZRV A;  4I9W A;  2OT5 A;  3MHS C;  5IYC O;  2EIL B;  1MZF A;  5B1B B;  4JI6 B;  4DR4 O;  1VIB A;  4DR4 B;  1VF7 A;  4H0L B;  3B8N A;  2F93 B;  3N2K A;  4BWA A;  1K5S A;  2F23 A;  1JJO A;  3E8F A;  3F5W C;  4PDV A;  3ZED A;  1PP9 H;  3TK1 A;  4UCU A;  1YIJ V;  1XL4 A;  2Y0P A;  1MSW D;  2ILM A;  1SA0 A;  2UXC O;  1Y74 B;  2Q68 A;  2ETN A;  1NR1 A;  3K9S A;  1E1R G;  1PNK A;  1FXK A;  2WLM A;  2MK3 A;  1I7F A;  1GN2 A;  3QO7 A;  3UQ8 A;  1K8A W;  4PA9 A;  5BY1 A;  4J9Z B;  3AG7 A;  5J2U A;  3ABK C;  2ZIM A;  4JAS A;  1XNR O;  5KUK A;  3L70 H;  4DV7 O;  1JX9 A;  1W59 A;  1Q86 W;  2CH7 B;  3MAQ A;  1SKV A;  3JAM N;  4DW0 A;  3OMN B;  1KKD A;  2QWQ B;  3A8T A;  2VWJ A;  3CXH F;  1SER A;  1ENV A;  4I9Q A;  2XHB A;  2HHH O;  4TWK A;  3CRM A;  1LNQ A;  3HKD A;  1IXM A;  2RQ6 A;  3HKB A;  3W7S A;  3FB6 C;  1FAF A;  5LGT A;  4ZI7 A;  3E8B A;  2A79 B;  5C93 A;  1BSM A;  3CCM V;  4GX2 A;  3ZMT A;  5GTI Z;  3IAY A;  3HKC B;  3ZMV A;  3ABU A;  3P30 A;  4X20 A;  2G38 A;  2FL4 A;  2GTS A;  1BQ0 A;  3H1L H;  4DR3 O;  4DR3 B;  2BTQ B;  4I7Z B;  1Z5V A;  3X2Q C;  4B3T O;  1GN3 A;  3HB3 B;  3QO8 A;  1ZSP A;  4B3T B;  1AI7 A;  3CHX A;  3FAV A;  2EIJ C;  5K1P A;  2ZNI A;  4J7Z A;  4EFB A;  4JI4 B;  2V4D A;  3CE2 A;  3CD6 V;  4RWU A;  4TV9 A;  1TVK A;  3TXQ A;  5JCO A;  2YXH A;  5BMV B;  4O4J A;  5LOV B;  1MMM A;  2F4V B;  4MVU A;  4D7T A;  4C7U A;  3S3W A;  2Q9L A;  5B1O A;  4I55 B;  5J2T B;  1HNX B;  5EYP B;  2BOB C;  1QNM A;  3LDC A;  2AW9 A;  1WB7 A;  4UCT A;  4CBC A;  3D3I A;  2QM7 A;  5IYZ B;  3L73 H;  4B7K A;  3H9V A;  2LGW A;  4UFZ A;  5EC1 C;  2YEV A;  1SES A;  4EEQ A;  2DYS C;  2F1M A;  4LF4 B;  3ZHV A;  4DR2 O;  3LDE A;  4D7S A;  1BT8 A;  1MG1 A;  3E8G A;  4QE9 A;  2X7R B;  4HBN A;  2GUZ A;  1GRJ A;  5KHH A;  3FB8 C;  4NXN B;  1NBM G;  1SZT A;  2H94 A;  1J5E O;  5GON A;  3ZJZ A;  1HW7 A;  4Z1M G;  5DM6 V;  5H9C A;  4JI3 O;  1QLE B;  2BCC H;  4XDJ A;  2YID A;  1VQ6 V;  4ZOL A;  4GYC B;  5C8Y B;  1SQB H;  2HKO A;  2P7T C;  5KHK A;  2QWP B;  5H2F Z;  2AHY A;  4TOI A;  4E2L A;  5D5P A;  3H1H H;  4JI2 O;  4UV9 A;  3JSL A;  3K5L A;  2E74 B;  1YDX A;  3CRR A;  4O4I B;  4JGS A;  3RYC A;  1NTZ H;  4AHC A;  1EZJ A;  1G6U A;  3A0B Z;  4MSW C;  3W7U A;  3L9D A;  4LF7 O;  1KP2 A;  3S3X A;  3SYP A;  4XBF A;  2EIK C;  4WFF A;  2BSK B;  3ZS8 C;  3C3T A;  1VQ8 V;  3T4Z A;  1JFF B;  5JH7 A;  2BOC C;  2GV9 A;  2RDC A;  5KMG B;  5IDJ A;  4FK5 C;  4Z1V A;  1JQ0 A;  4LF9 B;  1IVS A;  4I50 A;  4X65 O;  5FPR A;  4B3R O;  3DSQ A;  2ZDI A;  4X65 B;  3OUS A;  4QJF B;  2UXX A;  4LF8 O;  4BIU A;  3BPZ A;  1Q6U A;  4JI1 O;  4DR6 O;  2PYL A;  3ZHT A;  4JI1 B;  4YJ3 B;  4DR6 B;  1WPX A;  4L87 A;  1ZLZ A;  2IJJ A;  5DED A;  1G8M A;  3W7X A;  3BCC H;  4ZBM A;  1Q3E A;  2V1D A;  4DV5 O;  1L8D A;  3ABM C;  1ZL8 A;  4DV5 B;  4WFE A;  2EUL A;  4R6Z A;  5KHJ A;  1AP5 A;  4ICG A;  4O2A B;  3CJH A;  1WA8 B;  4H37 A;  4TSF G;  3RYF A;  1S76 D;  4UVC A;  1IX9 A;  3C3S A;  3B40 A;  4Q6G A;  2FKX A;  1JOY A;  4AQY O;  3JD4 A;  3KKY A;  1SS3 A;  2KSD A;  1H38 A;  3AG2 C;  2FML A;  1S5H C;  3SPI A;  2IH1 C;  4FFB B;  2ARH A;  4UCS A;  4DW1 A;  3ZN0 A;  5IYB O;  1WNS A;  1KKC A;  3SYO A;  2ZR2 A;  1HWY A;  1BZK A;  4NVP A;  2RN9 A;  4J10 A;  4RUE A;  5IY5 B;  4MT8 A;  1DF4 A;  4GLX A;  3MDS A;  3OR6 C;  3T2M A;  4LCU C;  1W0J G;  1SQX H;  1FFX A;  1L0L H;  4X62 B;  1QU7 A;  4QNH B;  1RPO A;  5KHI A;  3U11 A;  2WWW A;  1PL4 A;  5BMV A;  4YHH B;  1H2K A;  4TV8 A;  2PY5 A;  4I0X B;  1NU1 H;  1U96 A;  4WBN B;  2C2A A;  3CSX A;  2QM8 A;  2YC0 A;  1Y76 A;  4K0K B;  1M56 B;  3OUF A;  1AR1 B;  3BAA A;  3BHP A;  4UCO A;  2NR5 A;  5EBM C;  2Y69 B;  1H2N A;  1M57 C;  3N2K B;  1TGO A;  4G27 B;  1X4T A;  2Q0A A;  3QO5 A;  4U7O A;  4X1K A;  1K33 A;  1HR0 O;  4UUJ C;  1F23 A;  1XQ8 A;  3CRA A;  4MTO A;  3CRC A;  3SJQ C;  1OHH G;  3UO3 A;  3ZN1 A;  3SPJ A;  1DTO A;  3UT5 A;  1XHZ A;  4EKW A;  1WP8 A;  1FXK B;  2B9Z A;  1FJG O;  1GKF A;  3ASO C;  4FIP C;  1FJG B;  5J2U B;  2JJ1 G;  5C8Y A;  2CTR A;  4JI5 O;  2B1G A;  2CE4 A;  2EIN C;  5FNV A;  2JIZ G;  3FKS G;  5B3S C;  2UXD O;  2L6L A;  4DR5 O;  3D8C A;  2UXD B;  1S3J A;  4RQE A;  1I5Y A;  3OMI B;  4BAY A;  5E79 Z;  1U97 A;  1K5Q A;  1NZ6 A;  3E22 B;  2CTW A;  4O2B A;  2JS5 A;  1NVP D;  1XNQ O;  1J95 A;  3ASN C;  5CB4 A;  2LW1 A;  3HPL C;  1XNQ B;  4KHP B;  2N74 A;  2DWE C;  3ABL B;  1TAE A;  3G6B A;  4GT1 A;  3RT3 C;  2OTL V;  5DN6 G;  1S5L Z;  3HKD B;  3HKB B;  2DJV A;  5H5N A;  1ZWI C;  1VQ7 V;  3JAS A;  2P90 A;  2OCH A;  4MVR A;  1I0H A;  3TXS A;  3SPC A;  4HYO A;  4MVM A;  1T5E A;  3OMA B;  2EJ7 A;  3CCV V;  4DR7 B;  4LH6 A;  2YI9 A;  2QKA A;  1R6N A;  1SQG A;  1IDS A;  4XDK A;  3ZHS A;  1OCR C;  5B3S B;  4X20 B;  4X89 A;  5HFL A;  1WLE A;  4RAI A;  3CB2 A;  1GH6 A;  4AI8 A;  3CRQ A;  4MTG A;  4UVA A;  2A0L A;  4LFA B;  1A32 A;  3D36 A;  4YJ3 A;  3GB7 C;  4ZIB A;  4JI0 O;  1XUQ A;  1NTK H;  3R66 A;  1H2S B;  3FAV B;  1R3J C;  1N0N A;  1DF5 A;  1PKX A;  4TV9 B;  1TVK B;  3Q4H A;  4O2A A;  1WA8 A;  5KLV H;  5B1N A;  3PN1 A;  2GSM B;  2RNB A;  2R70 A;  1YTF D;  1PPJ H;  1P84 F;  2EIL C;  1GM7 A;  4W4K A;  3SJC C;  2EIM C;  4I5S A;  5B1B C;  4NTW A;  4JAV A;  3JYC A;  4FLY A;  4YJ2 A;  4MW8 A;  4GKJ B;  4DV4 B;  4TQF A;  4OX9 O;  2P06 A;  2ZE6 A;  3BY6 A;  1VQK V;  2L35 A;  2IJH A;  4B3M B;  1VQO V;  1N33 O;  3VBB A;  2JRI A;  4KFM A;  3CCL V;  2GUZ B;  4Q20 A;  1VQL V;  3CX5 F;  4KUM A;  4U3J A;  3W7W A;  4DV2 O;  2Q0O C;  1QR8 A;  5GON B;  4DV2 B;  1XMO O;  2OIE A;  1XMO B;  3KCX A;  1AI5 A;  1KP3 A;  1LUV A;  4RQF A;  2Q69 A;  2OTJ V;  4FJC C;  2N05 A;  4ZOL B;  1Y4M A;  5CBG A;  4DV1 O;  4JAA A;  2EIM B;  1RFY A;  2QEX V;  3O65 A;  1YI2 V;  2DE0 X;  4PDM A;  1VQM V;  1EN4 A;  4B08 A;  5LL6 Y;  1Z2G A;  1FFT B;  1AIL A;  1H8E G;  1SQQ H;  2VQE O;  4HNA A;  2VQE B;  3RYC B;  4DXW A;  1VF6 A;  5LP6 B;  1Q81 W;  1K92 A;  3OFN G;  2ZR3 A;  4PI0 A;  2Q67 A;  4OGQ B;  2W6J G;  4G28 B;  3WG7 C;  2UXC B;  1YCI A;  2ZE5 A;  4GX5 A;  4X1Y A;  1QR9 A;  4H33 A;  3QF7 A;  3CCS V;  4NR1 A;  3SPH A;  2WA3 A;  2XAJ A;  4X1I A;  3STZ C;  5JH7 B;  3P3N A;  1WN7 A;  4IL6 Z;  4JV5 O;  1SET A;  1Q7Y W;  4I50 B;  5BZB A;  4JV5 B;  3RFR A;  1XNR B;  3VQX A;  3HR0 A;  1ZTE A;  4YIO A;  3KZI Z;  3LNM B;  4DV7 B;  3P32 A;  2E76 B;  4UCV A;  1Y67 A;  3E22 A;  5B1A B;  4J9Y B;  4CH4 A;  3P3P A;  4JPR A;  2QSA A;  3LSS A;  3N27 A;  4UV8 A;  3AG4 C;  1OJH A;  2IH3 C;  2GBO A;  2HHH B;  1H2G A;  2VS0 A;  4QPK A;  3WG7 B;  4PDL A;  4UB6 Z;  2LO1 A;  1ZL8 B;  4LWS A;  2UUB O;  1L1F A;  3VQV A;  2Z5U A;  4FLZ A;  3CJH B;  1KYO F;  1UFI A;  4D6T H;  4FLU A;  3RYF B;  3OAA G;  2CTP A;  5ITZ A;  1WB8 A;  1IZ3 A;  2ZXW B;  2DMX A;  2CGO A;  2JGD A;  1ROP A;  2KB1 A;  2DW4 A;  2XUM A;  2EX3 A;  1XIL A;  1ZX3 A;  4X88 A;  1AI4 A;  1YJN V;  4MTX A;  4LBE C;  4JYA O;  4JYA B;  4NKG B;  5LHI A;  4JAU A;  5JJJ B;  3OGI B;  4LF5 O;  3SGI A;  4DR1 O;  2D3O W;  3BRC A;  4IYI A;  1V54 B;  4DR1 B;  5LYJ A;  4DV6 O;  1OCZ B;  1FFX B;  3AG4 B;  5LBQ A;  2ZM6 O;  5CBF A;  4DV6 B;  5L3F A;  3OTO O; 
#chains in the Genus database with same CATH homology
 3CC2 V;  1N8R W;  1QLN A;  2ZDI C;  1NR7 A;  3R65 A;  2XAF A;  1OCC C;  2XAH A;  1F4M A;  1UJW B;  1GM8 A;  1WPX A;  2R9R B;  4L87 A;  2XAQ A;  3TET A;  2IJJ A;  1G8M A;  3JD1 A;  2JJ2 G;  1PL0 A;  3CPW U;  1QLE C;  3AEI A;  3W7X A;  4WFH A;  3AG1 B;  4ZBM A;  2V1D A;  1FS0 G;  1M57 B;  3ABM C;  3CC7 V;  5B1A C;  4WFE A;  4R6Z A;  1K73 W;  1K97 A;  1YSC A;  3RW0 A;  4H37 A;  2EJR A;  4RUF A;  3CCJ V;  4TSF G;  1RM1 C;  3G71 V;  1S76 D;  4UVC A;  4QIW F;  3OE7 G;  1AJP A;  2QTO A;  4WF9 V;  1JOY A;  4WFB V;  4GX0 A;  1GM9 A;  3JD4 A;  3ZRW B;  3E86 A;  1H38 A;  1FXV A;  3AG2 C;  1YJW V;  2B1I A;  4R7C A;  1S5H C;  4MVS A;  3SPI A;  1AJN A;  1RPR A;  1V55 B;  2IH1 C;  4LC1 A;  4MS2 A;  3LSQ A;  3B77 A;  3ZMS A;  3K0D A;  2WLL B;  3BEH A;  2ZXW C;  4YXW G;  3ZN0 A;  5IYB O;  3ASO B;  3SYO A;  5LGN A;  2A9H A;  4OXS A;  2ZR2 A;  1NH2 D;  5EBW C;  1HWY A;  3SYQ A;  5J9P C;  2X6A A;  1R3K C;  5CA3 A;  3JCZ A;  3SYC A;  4RUE A;  3FYI B;  5IY5 B;  4MT8 A;  1OCC B;  1E79 G;  3GWO A;  1DF4 A;  2EIN B;  1YIT V;  2FTK A;  3OR6 C;  3T2M A;  4JYC A;  1R3I C;  5CBH A;  4LCU C;  1W0J G;  2EBO A;  2WSS G;  3DGE A;  3I56 V;  1W0K G;  2OCC B;  1Q82 W;  1F51 A;  3RVY A;  4HZ3 A;  3VOU A;  3K79 A;  3E8H A;  1K9M W;  3E2E A;  2X6C A;  3WFV A;  4QNH B;  1RPO A;  2WWW A;  2IW5 A;  5KA5 A;  3AG3 B;  3RBZ A;  3KG2 A;  1V54 C;  2ZD9 A;  4PA6 A;  5L3E A;  4PA3 A;  1OCZ C;  3ASN B;  3TCU A;  1RM1 B;  1NH2 B;  2C2A A;  3FB7 C;  5KUM A;  2JK5 C;  1KD1 W;  2QM8 A;  1BL8 A;  2GHY A;  3M99 B;  3OW2 U;  3MD0 A;  1EBO A;  1M56 B;  3OUF A;  4PDR A;  1AR1 B;  4JF3 A;  4X8A A;  2Z3Y A;  1S0V A;  3K06 A;  5EBM C;  2WAM A;  1SRY A;  2Y69 B;  2LFS A;  3AG1 C;  2IJK A;  2ATK C;  4CZZ A;  1M57 C;  3IFX A;  4G27 B;  1KQS U;  2HJF C;  5KA6 A;  4WFG A;  3H01 A;  3ZRW A;  3QO5 A;  2DQ0 A;  4U7O A;  1VQ4 V;  1MAB G;  1K33 A;  4UUJ C;  1F23 A;  4MTO A;  5EBL C;  5E1A C;  1GK9 A;  2Y48 A;  2WLL A;  3SJQ C;  1OCR B;  1OHH G;  3ZN1 A;  3ZCC A;  3EFF K;  1M9N A;  3SPJ A;  3CXC U;  4MTF A;  2R9I A;  2YEV B;  1P4R A;  3ABT A;  3JD0 A;  1DTO A;  1QVG U;  4TT3 G;  4EKW A;  1V55 C;  4HAM A;  3CC4 V;  3E83 A;  3ABK B;  4DO2 A;  2QA4 V;  1FXK B;  3PJS K;  4WCE V;  1GO3 F;  2X6B A;  2JEX A;  1GKF A;  2W6I G;  3ASO C;  3SPG A;  4FIP C;  4JTC B;  4R8C A;  3W7T A;  2B5U A;  5H6Q A;  4N21 A;  2WLH A;  1THZ A;  2JJ1 G;  5IY5 C;  4FPP A;  3JD3 A;  2B1G A;  4BIZ A;  1PNM A;  1QVF U;  2EIN C;  1OZ0 A;  1MOF A;  2JIZ G;  3FKS G;  5B3S C;  3ZRS A;  2LP7 A;  1NJI W;  3B8M A;  3T4D A;  2OCC C;  1S3J A;  4RQE A;  2M7W A;  4G2K A;  1I5Y A;  3K03 A;  4JTD B;  3OMI B;  3UM7 A;  1PD3 A;  3CCE V;  4BAY A;  3ZRV A;  4I9W A;  3AG3 C;  2OT5 A;  3MHS C;  1K5Q A;  1JPX A;  5IYC O;  2EIL B;  1NVP D;  4N23 A;  1K4D C;  5B1B B;  1J95 A;  3ASN C;  1R73 A;  4GCZ A;  3HPL C;  3ZMZ A;  2DWE C;  2ITD C;  2HLD G;  1W2B U;  3ABL B;  2K1E A;  3B8N A;  1H8H G;  1S72 V;  4GT1 A;  1M56 C;  2OTL V;  3OM3 B;  5DN6 G;  3STL C;  1K5S A;  1DLB A;  3E8F A;  2V7Q G;  3F5W C;  2Y69 C;  4PDV A;  1ZWI C;  3TK1 A;  1VQ7 V;  5H6R A;  1ORQ C;  1YIJ V;  2P90 A;  1XL4 A;  4MVR A;  4UXN A;  1MSW D;  1K7D A;  1NVP B;  3SPC A;  4HYO A;  4MVM A;  1VQ5 V;  4LP8 A;  3OMA B;  2Q68 A;  3CCV V;  1NR1 A;  1TUE B;  3CCQ V;  2QE7 G;  1E1R G;  1R6N A;  1PNK A;  1FXK A;  4XDK A;  2WLM A;  1OCR C;  5B3S B;  2MK3 A;  5LHG A;  3QO7 A;  4X89 A;  5HFL A;  1I5X A;  3X2Q B;  1K8A W;  2UXN A;  1WLE A;  4RAI A;  4MTG A;  4PA9 A;  2X0L A;  4UVA A;  4U7N A;  2EIJ B;  4J9Z B;  2A0L A;  4QPJ A;  3ABK C;  4JAS A;  1FXK C;  2EZP A;  1QCE A;  3D36 A;  1CPY A;  4WFA V;  5KUK A;  3GB7 C;  1P7B A;  3E89 A;  2IU0 A;  1VQP V;  3F7V C;  1JX9 A;  2NNU A;  2JEU A;  1JCH A;  1Q86 W;  1R3J C;  1DF5 A;  2P6J A;  1PKX A;  4R50 A;  3OMN B;  1S77 D;  4P9O A;  1XL6 A;  1KKD A;  1GMG A;  3MHH C;  5LHH A;  1SER A;  5B1N A;  2GSM B;  1ENV A;  4TWK A;  2W0F C;  3OR7 C;  1YTF D;  3G4S V;  1LNQ A;  4MVQ A;  2EIL C;  1GM7 A;  2EIM C;  4I5S A;  5B1B C;  2DYS B;  4JAV A;  1IXM A;  1KC8 W;  3JYC A;  1KEC A;  4RO2 A;  3SYA A;  1GTO A;  3ABL C;  2HVK C;  4MW8 A;  3W7S A;  2WLK A;  3FB6 C;  5LGT A;  1AJQ A;  2IU3 A;  3E8B A;  2A79 B;  1PNL A;  5C93 A;  3CCM V;  3ZRX A;  1M1K W;  4GX2 A;  3OEE G;  5GW7 A;  3E35 A;  3FB5 C;  3ZMT A;  3BY6 A;  3CCR V;  1VQK V;  4MVZ A;  2IJH A;  3ZMV A;  1VQO V;  1Y66 A;  3VBB A;  3ABU A;  4KFM A;  5LGU A;  3CCL V;  1YTF B;  3P30 A;  4Q20 A;  1VQL V;  4KUM A;  4UVB A;  2PI5 A;  3OGC C;  1R6K A;  4XDL A;  5IYD O;  3W7W A;  1QR8 A;  3T1C A;  2DWD C;  3ZIA G;  1YHQ V;  2ITC C;  2WPD G;  3X2Q C;  3K08 A;  1AI5 A;  1FXH A;  3HB3 B;  3QO8 A;  1KP3 A;  1AI7 A;  4ZKI A;  2EIJ C;  4RQF A;  2Q69 A;  4BW5 A;  2OTJ V;  4FJC C;  3RVZ A;  3F7Y C;  4P2Z A;  1F4N A;  2XOK G;  1Y4M A;  5CBG A;  4FMT A;  1G4Y B;  2EIM B;  3IC7 A;  3CD6 V;  2QEX V;  3NXS A;  3CMA V;  1YI2 V;  2HVJ C;  2IJI A;  4P30 A;  4PDM A;  4MVU A;  1VQM V;  1CEZ A;  3LDD A;  5B1O A;  3K0G A;  3EHB B;  4JTA B;  1FFT B;  3JD2 A;  3OEH G;  3ZMU A;  1AI6 A;  1H8E G;  2CK3 G;  2BOB C;  3CP1 A;  1ARO P;  2H8P C;  2EIK B;  4DXW A;  3LDC A;  3I55 V;  1BHB A;  1Q81 W;  3IGA C;  1K92 A;  3OFN G;  2ZR3 A;  4CBC A;  3ETE A;  3D3I A;  3FYE B;  2Q67 A;  4MW3 A;  2HR3 A;  5CN0 A;  2QM7 A;  4QE7 A;  3G6E V;  2W6J G;  4G28 B;  5EC1 C;  4KP4 A;  3WG7 C;  2YEV A;  1SES A;  1EFR G;  1B6Q A;  2WLI B;  2P67 A;  5L3B A;  2DYS C;  3CYO A;  4GX5 A;  1QR9 A;  4H33 A;  3LDE A;  3CCS V;  1MG1 A;  1OCO B;  3QNE A;  3E8G A;  3SPH A;  4QE9 A;  2X7R B;  2XAJ A;  1JJ2 U;  3STZ C;  1BMF G;  1K4C C;  3FB8 C;  1SET A;  2Q6A A;  1Q7Y W;  1E1Q G;  2LFR A;  1NBM G;  1SZT A;  3ETG A;  2H94 A;  5BZB A;  5FL7 G;  3ZJZ A;  2XAS A;  5L3G A;  3LNM B;  2QKS A;  1K3E A;  4Z1M G;  2DYR C;  4GX1 A;  3P32 A;  3LUT B;  5DM6 V;  5H9C A;  4PA4 A;  1QLE B;  2AHZ A;  2HG5 C;  2NLJ C;  4XDJ A;  4P9P A;  1VQ6 V;  2ZQM A;  4PEL A;  4ASU G;  3CCU V;  3ABM B;  2HKO A;  5B1A B;  2WLJ A;  2P7T C;  4J9Y B;  3K04 A;  1VQN V;  2AHY A;  4E2L A;  4JPR A;  5L3D A;  5L3C A;  3LSS A;  4UV8 A;  2JDI G;  3AG4 C;  2IH3 C;  2HFE C;  5EK0 A;  3K3W A;  4UV9 A;  1H2G A;  4QPK A;  3WG7 B;  5CMU A;  3DTU B;  4PDL A;  4F4L A;  2WLN A;  2YSU B;  1L1F A;  1VQ9 V;  3AG2 B;  4JGS A;  2Z5U A;  2XND G;  2F43 G;  1M90 W;  3OAA G;  1EZJ A;  4MSW C;  3W7U A;  3UKM A;  2XAG A;  2ZXW B;  1COW G;  1KP2 A;  3SYP A;  2WLI A;  4XBF A;  1ROP A;  2EIK C;  1CP9 A;  2KB1 A;  1K34 A;  1R3L C;  2DW4 A;  4WFF A;  3CME V;  4X88 A;  1AI4 A;  1YJN V;  3A0R A;  3ML0 A;  4MTX A;  3T4Z A;  1VQ8 V;  4LBE C;  4JYB A;  2PI4 A;  1NKD A;  2DQ3 A;  2BOC C;  2DYR B;  5IDJ A;  4FK5 C;  5LHI A;  2EZO A;  4PA7 A;  1JQ0 A;  4JAU A;  1JVM A;  1OCO C;  1QBZ A;  5EC2 C;  1BHA A;  5HFM A;  2ZDI A;  2D3O W;  3OUS A;  4QJF B;  2UXX A;  1V54 B;  1YJ9 V;  1OCZ B;  3AG4 B;  5LBQ A;  3K9A A;  4BIU A;  1NQT A;  5CBF A;  5L3F A;  4MVO A;  3ETD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...