3FB7C

Open kcsa potassium channel in the presence of rb+ ion
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
89
structure length
89
Chain Sequence
WRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Open KcsA potassium channel in the presence of Rb+ ion
rcsb
source organism Streptomyces lividans
molecule tags Membrane protein/metal transport
molecule keywords antibody fab fragment heavy chain
total genus 24
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2008-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3fb7C00
4MTGA 3AG4C 3PJSK 4KFMA 1R3JC 2WLHA 2A9HA 2X6AA 3SPCA 3SPHA 4LP8A 2ITDC 3ABMC 4LCUC 2EILC 2KB1A 3R65A 5EC1C 2EIJC 3RBZA 1BL8A 3F5WC 4HYOA 2EIMC 3IGAC 4UUJC 4P30A 4G27B 3K08A 4MVQA 2IH3C 4PA6A 2NLJC 4MVOA 4X8AA 1OCRC 4WFEA 4P2ZA 4MVZA 5B1BC 2AHYA 5J9PC 3F7VC 3E8BA 4PA9A 3E8FA 1S5HC 3FB5C 4PDMA 5EBMC 4R7CA 2R9RB 5EC2C 2HVJC 3X2QC 3LDEA 1K4CC 1JVMA 4LBEC 2X6BA 4PDRA 5KUMA 5BZBA 3KG2A 2QTOA 2X6CA 2HG5C 4MVUA 1OCCC 4CBCA 2BOBC 1G4YB 2ITCC 3SPGA 4RO2A 1R3KC 2DYRC 3ZRSA 4RUFA 1M56C 3E86A 3SPIA 2K1EA 3T4ZA 4R6ZA 3HPLC 4JTCB 4R8CA 2Q6AA 3RW0A 2DYSC 4GX5A 2W0FC 2HVKC 4MVSA 3OR6C 4F4LA 3E89A 4GX0A 1ZWIC 3ASOC 4BW5A 4QNHB 4DXWA 2WLNA 1P7BA 3LUTB 4PDLA 4XDKA 3T4DA 1LNQA 5B1AC 3UKMA 3RVYA 3LDDA 2WLMA 3SPJA 3SYAA 3STLC 3K04A 3K03A 4RUEA 4MTFA 4MW3A 1R3LC 2EINC 3ABKC 2WLKA 3E8HA 3FB7C 4MS2A 4PA3A 3SYCA 5E1AC 4QE7A 4GX2A 5CBFA 1V54C 4J9ZB 1ORQC 4MVMA 2YEVA 3WG7C 2Q68A 3RVZA 1OCOC 4XDLA 1QLEC 2WLJA 4J9YB 1XL4A 4X88A 4PA4A 1J95A 3SJQC 4MW8A 4WFFA 4EKWA 4HZ3A 2IH1C 3FB8C 2WLIA 4P9OA 3GB7C 3UM7A 1M57C 3AG3C 3IFXA 4TWKA 2WLLB 2Q69A 4MSWC 2A79B 4G28B 4ZBMA 3K06A 4MTOA 5B3SC 3T1CA 3ZJZA 3AG1C 3ASNC 3EFFK 2JK5C 3OR7C 4PA7A 3ABLC 5EBLC 2ATKC 3STZC 3F7YC 2A0LA 3SYPA 5KUKA 1KKDA 2HJFC 2QKSA 1OCZC 3E83A 3OUSA 4WFGA 2ZXWC 3OUFA 1R3IC 4H33A 4WFHA 2Q67A 4P9PA 5CBGA 1K4DC 4OXSA 4MVRA 4PDVA 4X89A 3E8GA 3SYOA 4GX1A 2EIKC 3LDCA 1XL6A 4I9WA 3TETA 2H8PC 2HFEC 3K0DA 4RAIA 3T2MA 3FB6C 3AG2C 3OGCC 3VOUA 2OCCC 5IY5C 4H37A 5CBHA 3BEHA 3LNMB 5EK0A 3JYCA 2P7TC 3K0GA 4QE9A 2DWDC 2DWEC 4JTAB 1V55C 2AHZA 4R50A 2Y69C 2ZD9A 2WLLA 3TCUA 3SYQA 4XDJA 4JTDB 5EBWC 2WLIB 2BOCC
chains in the Genus database with same CATH superfamily
2ZM6B 3H9VA 3CRCA 1FPOA 3FYIB 4GCZA 4I7ZB 1J5EB 2LO1A 2NLJC 4JI3B 4LNUA 5JCOC 3SGIA 2Q4PA 1V55B 4JAUA 4RQFA 3MHHC 3E8FA 4DR7O 4R7CA 4DR2O 1H2KA 2YUAA 5BZBA 3E22A 4O2BA 1BQZA 4DV0O 1FFXA 2DE0X 1BQ0A 3CRAA 1K5SA 3CCMV 4R6ZA 1KBHA 2IJKA 1SS3A 5H2FZ 1XOUA 1K33A 2OWOA 3SPJA 1NKDA 1SRYA 4CC5A 3ETDA 1G1XB 1ORQC 4JI2B 1OCOC 3DXRA 3ZHVA 4AQYO 1RFYA 3JD3A 3ASOB 4PI2A 5BMVB 2UXBB 3M99B 3D3IA 3UT5B 1BT8A 3P3NA 2GDSA 3CXHF 4JI0O 1NT2B 2OCHA 4ZKIA 1Q5OA 4WFAV 3CCRV 5CMUA 1KKDA 4AHCA 1VIBA 3DC6A 3OUSA 5ITZA 4LFCO 2QWOB 1S5LZ 3EXAA 2Y0PA 2H94A 4DV2O 4FM2A 1I94B 3DGEA 3AG3B 5E79Z 2GHYA 1XUQA 4O4IB 4B3TO 3LNMB 2XHBA 1MNGA 4I4TB 3F5TA 1BSMA 4AILC 4XDJA 2EZOA 1XILA 5LA6A 2R9IA 3APOA 4FZ1A 4RWUA 3UT5A 2VRZA 2DQ3A 1H2GA 1FXVA 2OT5A 3AG2B 3RYHA 4JI7B 1OCRC 2WAMA 3AG1B 4CH6A 5BY1A 3D36A 3FYEB 5KAFZ 1GKFA 3LDEA 5KUMA 4J42A 3IAYA 2QTOA 2XAGA 4HBNA 2F95B 5FPOA 3HKCA 1IXMA 3SJBC 4EFBA 1DF5A 1SZXA 5KMGB 1HW7A 4JI8O 5LOVA 2UXNA 2EULA 5LHHA 4OX9B 1JFFA 4X64B 4QNHB 2XAHA 3OEHG 3RYCB 4D6TH 3DXRB 2ETNA 1JPXA 1H2NA 3UO2A 2Z5UA 1L0LH 5F2VO 1KC8W 2BSKB 1Q8IA 3FAVA 2OIGA 4K8ZA 1Q82W 1FXKA 3WB1A 2Q73A 2WLJA 4DR7B 2NN4A 4HZ3A 4DO2A 2JRIA 4TSFG 2WLLB 4Z2WA 3EFFK 2JK5C 5JWPA 3NXSA 2CGOA 3ABLC 3STZC 3BABA 3H1LH 4WFBV 4OPHA 1E79G 1YJWV 1YCIA 3RWRD 4LF7B 3OD4A 3K0DA 2VS0A 3HKDA 1Q81W 1KQSU 4FLWA 4JAAA 4C7UA 1OJHA 2E74B 2YIBA 3IC7A 4GUNA 5LL6Y 3CYOA 2LFRA 4JGSA 2JS5A 1OCCB 2WLIB 2FTKA 3RYHB 4MTGA 3AG4C 2UUBB 4X65B 1W0JG 3F5WC 5K1XA 4B3RO 3L71H 1EN4A 2V4DA 5KX5A 4KHPB 5IJ9A 2YIAA 3DC5A 2CDYA 5CA1A 4O4HB 3IJ4A 1VQ5V 2VQFO 4DV3B 4QIWF 1KMIZ 3K79A 1QBZA 1N0JA 2PI4A 1IBLO 1HNXB 1TVKA 3I55V 3ZRSA 4RUFA 2QDOA 2X0LA 2ZINA 4DR6O 3HPLC 4W4LA 5LA6B 3K5LA 4LF8O 3MHSC 3ETQA 1K73W 2RDCA 5H6RA 4I0XA 1F51A 1YXBA 1NTMH 3QO5A 4IT5A 3CRQA 1GRJA 4J41A 4O4HA 2QKAA 5IJ9B 1N32B 2Y4TA 4NXMO 5L3EA 2YEVA 1VQ8V 1PV0A 4LF5B 1EBOA 4RQEA 3RYIB 1Q90D 2YI9A 5IYZA 3ZRWB 4B3TB 3K9AA 4ICGA 3ABKB 2Y0IA 2A0LA 4JZ2A 3KZIZ 2IJHA 5L3DA 4LF9O 3TXSA 2ZDIA 1NTKH 3CXCU 4PV1B 3OT7A 3FB6C 3EVKA 3VOUA 3GWKC 1AR5A 3C3SA 3JYCA 2DWEC 2ZNJA 4EB6A 2F23A 2HKOA 3CD6V 5KLVH 4DUZB 3FKSG 1ZSPA 2QR4A 2RNBA 3PJSK 5KA6A 4H44B 5JVDB 3B77A 1VQ6V 3FAVB 2Q0AA 4DR3O 3E22B 4DV4O 4X8AA 2YXLA 4OX9O 4P2ZA 4MVZA 1SQFA 1K9MW 1S77D 1JR9A 1M90W 4K0KO 1NH2B 1M4UA 3RYFA 4DR2B 2L6LA 1VQ9V 3BY6A 4LBEC 2YI8A 5IT9N 3P32A 4UVBA 2ITCC 4NXNO 1SQXH 3SPGA 2JDIG 3E86A 3CPWU 4LFAO 2DYSC 2P06A 3AK2A 2LW1A 1HNWO 2JVDA 4N23A 4O2AA 1BZKA 3C3TA 1RSOA 4WCEV 1SKVA 1JJOA 4NVPA 3T4DA 4KL1A 1NU1H 3HKDB 4MS2A 2EINB 2GV9A 5E1AC 3JAKA 1FKAO 4IHJB 3ETGA 4IIJB 4PA4A 5EZYB 3CE2A 1Q43A 2WA4A 3ZCCA 1MA1A 3IFXA 5A9GA 5CA0B 1Z2GA 1B3QA 3ASNC 4PELA 2ZIMA 4DR5B 2XAJA 3F7YC 5KUKA 4O4IA 5FL7G 4B3SO 2QKSA 1WP7A 2CE4A 2YDEA 2GSMB 5LMNB 2DW4A 3E35A 4I9WA 3JARA 1HR0B 2HFEC 5LGTA 3VQWA 1XI1A 4WBNB 3TXQA 1GTOA 3ABUA 1V55C 3CCSV 1Q7YW 3OMIB 2A7WA 4X64O 1MG1A 2AXTZ 3NR7A 3RYIA 2VQEO 2A9HA 4DR1O 1QR9A 2ITDC 3RBZA 4CS3A 4DV6O 2PUSA 1SQVH 3CCUV 2F43G 3QO7A 5H6QA 4F6EA 2R9AA 1AP6A 2ZQMA 1VQPV 2PTMA 3LSUA 4X62O 3LSSA 2HVJC 2IJIA 2KG7B 2P6JA 4CS4A 4IGGA 3SPIA 4UB8Z 4I0XB 4R8CA 5IY5B 2QWRB 3A0RA 4YIPA 3A8TA 5HFMA 4TUYB 2JIZG 4J7JA 4K35A 2LGWA 5LP6C 3RVYA 3ETEA 4MW3A 3SYCA 4LNUB 5KX5B 1HR0O 1CXZB 1SQBH 2CUGA 1XMOB 1KP3A 1YTFB 2HEPA 4X1YA 4X66B 5LXTB 3B8NA 3ZHSA 4X65O 1AJPA 4B3RB 4J10A 1XNRO 4U3JA 4LFAB 3ICXA 3I5DA 4O4LB 5DEDA 4DUZO 2HR3A 4FMTA 4GYCB 1THZA 5KHHA 2FB5A 3M8AA 3T1YO 3OGCC 3K57A 2AHZA 2AZ0A 1B06A 2WLLA 1OCZB 1K97A 3AG7A 2X6AA 5JH7B 4LCUC 3P30A 1MZEA 1Y76B 3IGAC 4G27B 2E3CA 4MVQA 1AB3A 3WB0A 1MSWD 4Z1MG 2EJRA 4NKGB 1SZTA 3JD0A 5EBMC 1FXKC 5EC2C 4BIZA 4LR3A 2RQ6A 4Z1VA 1K4CC 3G4SV 2PF4E 2PI5A 1IBLB 5JCOA 2BOBC 2WA3A 1LUWA 4DV0B 2IU0A 2K1EA 1A32A 4FM0A 4MVSA 3E89A 4KUMA 3A0BZ 4DW0A 1VQ7V 4PJ0Z 5L3BA 2ILMA 2QKCA 4TQDA 1RPOA 4I55A 5C93A 5FLXN 2ADQB 2WLKA 3OFNG 4DYLA 4QE7A 5DM6V 2QM4A 5CBFA 5KHKA 3WG7C 4DK0A 1AVMA 5B1BB 4JI4B 3SJQC 1XMOO 4EKWA 4UCOA 4P9OA 2XUMA 2YXHA 1US6A 4LF8B 3CC7V 3N2GB 4YJ2B 3L75H 3BA9A 1OCZC 3E83A 4P9PA 1VP7A 1K4DC 5IWAO 2UUCO 1N32O 1EM1A 3RN4A 4F6RB 1D5AA 3WFVA 4BR6A 1Y74A 3BVOA 3HKEA 5L3GA 3OTFA 1H38A 1IBKB 3BA8A 2QWPB 4KFMA 1K92A 1NTZH 3SPCA 3SPHA 3OAAG 5CA0A 1QQCA 1VQNV 3R65A 3ZRWA 3ZMUA 3CMAV 1BL8A 2IM9A 1VQ4V 3QG5A 3JATA 5CA1B 3SJCC 4PHZA 5GONA 2K9PA 1M5IA 1PNMA 2OIEA 4WFEA 2GUZA 3FB5C 2QEXV 4L87A 3N2KB 5LMUB 3GWOA 4QPKA 5A2QN 2X6CA 3MAQA 1FXHA 3OE7G 4ZOLB 2Q0OC 2DQ0A 1V54B 1M56C 1KUQA 4JYAO 2QGNA 4UVAA 1NBMG 4ZI7A 3K5MA 3MD0A 2XT9A 4O2BB 2XOKG 1KKCA 1IDSA 3HKBA 1NR1A 2HP8A 1P7BA 4PDLA 2BCCH 1JCHA 1QR8A 4TV9B 3SYAA 3CCJV 3STLC 3K04A 1AI4A 3D8CA 3FB7C 1FAFA 1PM9A 2YC0A 4ZHQB 1SQPH 4BIOA 3FFQA 4YY3B 1OCOB 1WLEA 4ZHQA 1N34B 4YJ3A 4DV7B 1XL4A 1U97A 4U3JB 1YI2V 5D5QA 4ZIBA 2AZ2A 4KXRA 1P84F 1DGSA 4B7KA 4GKKO 2M7WA 5KMGA 1EZJA 5L3FA 2F4VO 5KAIZ 4H13B 3ZHUA 3X2QB 2UUAO 2GTAA 2XNDG 4OXSA 1KD1W 1ROPA 1L0NH 1VF6A 3ZHQA 2Q7HA 2MK3A 3JSLA 5LGUA 1NS1A 3SR2C 4H37A 1F7YA 1GN3A 2UXDB 2Y69C 1PPJH 3TCUA 4LWSB 1QVFU 4UB6Z 3OGIB 5LXTA 2QSAA 1R3JC 4UXNA 1GM8A 1URFA 1XBLA 1GM7A 3L72H 1M56B 3RYFB 5LBQA 4JZGA 4XBFA 1QHTA 2KG7A 5DN6G 3OTOB 1XMQO 2IBZH 3JALB 4FFBB 4JI5B 2ADPA 1ZAUA 1P4RA 1VF7A 3J80N 3CHXA 5GONB 5IWAB 4FIPC 4FLUA 3GVMA 3H01A 3H1JH 3OMAB 2W0FC 2JJ2G 4DR6B 4LFCB 4E2LA 5K1PA 4JI4O 1R6KA 5IJ0B 1GK9A 1Q86W 4F6RA 2YEVB 1LUVA 3U11A 1M1KW 4JI6B 1BMFG 4IIJA 1Y6XA 1MZFA 1S72V 4KHPO 3JATB 4MVMA 2JEUA 4X88A 3UQ8A 1YSCA 5J2UB 2LJ2A 1OHHG 1H2LA 1L8DA 4JI0B 2NR5A 3ZIAG 3ZEDA 1HP8A 1NQTA 1MOFA 3CRMA 2P5OA 4UV8A 1G6UA 1RM1C 1IBMB 2ZE7A 4EEQA 4O2AB 3OUFA 4FM1A 4MTXA 4N21A 4WFHA 3B8MA 1X4TA 3WG7B 5CN0A 1XQ8A 5JJNB 4J11A 4DV1B 1NH2D 1K8AW 4UVCA 4DUYB 4GT1A 2N04A 1BE3H 4I55B 4TOIA 2DN9A 4JI2O 5EK0A 4FK5C 2IW5A 1OZ0A 3UO3A 3B09A 2UXBO 2W0XA 1ENVA 1AI7A 1QLEB 1Y76A 3G6BA 4MT8A 1O9HA 4LP8A 3BAAA 3G80A 2KB1A 4WF9V 3CEIA 3Q4HA 2EBOA 4X1IA 2IH3C 1S76D 4J80A 4YJ3B 4DV4B 3CWBH 1ZTEA 3Q4HB 1N0NA 4U3FH 4K0KB 1QU7A 1YIJV 4LF6B 1OCCC 1G4YB 4B3MB 4J7KA 4OGQB 1HDJA 1BHBA 1K5QA 2OCCB 1JFFB 4JTCB 2Q6AA 4F4LA 2LGQA 4DRXB 4DV7O 5EIBC 1UFIA 5EYPA 2UUCB 4W4KA 4TQFA 3UKMA 5IYZB 4NTWA 4RUEA 2YS8A 4MTFA 3RFRA 2WWWA 3E8HA 3DSQA 1B6QA 1V54C 2E75B 1K7DA 1IBKO 3AG4B 2YIDA 1J95A 2JS3A 3CJHA 2N05A 2Q69A 4MSWC 3ZHTA 3OEEG 4HNAA 3CRRA 2ZKOA 2QTSA 4DR1B 4TUYA 2ATKC 4YHHB 1QCEA 1ZUQA 2ZXWC 3ZX6A 3JARB 1AI5A 4E4EA 1U96A 1I0HA 3OM3B 1NZ6A 1I5YA 3RYCA 3BPZA 2H8PC 2Q7EA 2D3OW 4LH6A 1JX9A 3BEHA 1SETA 3ZMSA 2HJDA 2P7TC 1N33O 2LW7A 2UXCB 4JV5B 1KYOF 1GN4A 2F1MA 1S5JA 5H5NA 3W7TA 4A5UB 1I08A 2JEXA 1NVPB 3N2GA 4YJ2A 2JJ1G 1KU9A 1K34A 1COWG 4DR4O 4GKJO 4JASA 2CK3G 2PYJA 3E2EA 1XHXA 5B1NA 2EIMC 4P30A 3S3XA 1AR4A 1Y67A 1DLBA 5IYBO 4DV3O 2RCVA 3D3QA 5B1BC 3HB3B 3PN1A 3KKYA 5BR8B 5TISZ 3CCEV 4IYHA 2UU9O 3WB2A 3K5NA 3SJAC 1YJNV 1R3KC 2DYRC 1WJZA 4B3MO 3T4ZA 3B4SA 2HLDG 3IC9A 3ZMZA 4NR1A 5FNVB 2FYUH 1M57B 2RMKB 2QA4V 1NR7A 5ITZB 4FLVA 4NXNB 3AK1A 1HWYA 1T5EA 1P49A 1SERA 4HNAB 4J9YB 1DF4A 2IJJA 2V7QG 1WA8A 3ZRXA 2AGAA 4MW8A 4YXWG 1SESA 1DK1A 3UM7A 4TWKA 3QF7A 4JYAB 1R6NA 2A79B 2YSUB 4G28B 4DR3B 2CTWA 3OR7C 4PA7A 1VQOV 1PNKA 2QE7G 2R70A 2UUAB 4TV9A 1S3JA 2ZM6O 3FX7A 5CBGA 1JMKC 1SC5B 1XNQB 4UV9A 3L73H 5EIBD 2QJ1A 1XL6A 1QVGU 5B5EZ 3KCYA 2N74A 3WU2Z 1EFRG 2UU9B 1MABG 4R50A 1N33B 3JCZA 1VARA 2KQXA 2O57A 5LYJA 1TUEB 4JI1B 2E5LO 1YDXA 1N4CA 4JI6O 1S0VA 2GUZB 4DR4B 4PA6A 1JA8A 1YZBA 1PKXA 3E8BA 1H2MA 2Z3YA 1N8RW 4PDRA 5BR8O 3KG2A 4BIUA 2OTLV 3ASNB 3C90A 3CX5F 1BCCH 3O9OA 1YHQV 1AILA 2B5UA 1Y74B 4JI3O 1XEQA 3ASOC 2CGNA 1F23A 3QNEA 1TUBB 3TK1A 1GAXA 1IZ3A 1H8EG 3THOA 4X62B 4FLZA 5LP6B 3CS5A 2BTQA 5B1AC 1IX9A 1VF6C 3LSQA 2WLMA 1M93A 3ZBHA 1R6TA 1TAEA 2P90A 4UCSA 1JOYA 2ZE8A 2ZIOA 1E1RG 3R66A 4FPPA 2P22C 1YITV 1ZL8A 5C8YA 4BW9A 3JALA 4FFBA 3OMNB 1JJ2U 2C2AA 4CC6A 4DV2B 3FB8C 1AR1B 2HHHB 2ZNIA 4I5SA 4X1KA 3T1HB 1IBMO 4I50B 4MTOA 2Q7GA 5BXZA 5L3CA 1D2DA 4JV5O 4WBNA 1SA0A 3SYPA 2Y69B 4CH5A 2Y4UA 2AW9A 3JASA 2ZR3A 4DV5O 4J7ZA 1BGYH 1CP9A 2X7RB 4MVRA 5IJ0A 3K5OA 3JASB 2PZSA 3T2MA 1SA0B 4UCUA 1X59A 1K3EA 4TV8B 4FJCC 5JH7A 1VQLV 5EBWC 3QTCA 5IDJA 2WLHA 2E76B 4DV6B 3L9DA 3W7SA 3JD1A 2EIJC 3JAMN 4LC1A 4UUJC 5GW7A 1TGOA 5LMNO 2AHYA 5JQGB 4UCTA 3W7UA 2RJZA 5B1AB 1Q6UA 4DK1A 5B1OA 1NI8A 3CP1A 3VQYA 4CBCA 4MVUA 1W2BU 4L8JA 4LF7O 2EJ7A 3K9SA 1KB9F 3AK3A 2R72A 1H2SB 2BTOA 3RW0A 5LYJB 5LGNA 4GX0A 1PD3A 1D5NA 3CC4V 2CTRA 1ZLZA 2XAQA 2CH7A 2UUBO 1RPRA 2IU3A 5KHJA 3BCCH 4EFEA 3ZMTA 1QNMA 5FPRA 3CSXA 1VQKV 4I9QA 1AI6A 1QLEC 1SQQH 2ZE5A 3ZS8C 3B2EE 2EIKB 2IH1C 2WLIA 5JVDA 3BFRA 4ZI7B 5HFLA 3T1CA 1OCRB 3AG1C 4IYIA 2WPDG 2HJFC 4X9QA 4WFGA 5IE9A 2LQTA 1R3IC 5J2TB 1JQ0A 5DECA 1FFTB 4Q6GA 4GZRB 3LDCA 3HKCB 2PY5A 1GMGA 4RAIA 3J81N 4D7SA 4JI8B 1E1QG 5IY5C 1Q6HA 2DWDC 4X66O 1WB8A 1V9PA 4LF5O 2LP7A 1YEWA 3D36C 3BHPA 4B7EA 5EC1C 2JGDA 2M6YA 4JYBA 2DMXA 4MVOA 2FL4A 5J9PC 4CS2A 3F7VC 3OTOO 1XMQB 2BE3A 1S5HC 4PDMA 1NJIW 4NB5A 3EHBB 1JVMA 1Y4MA 4G2KA 2ZE6A 2UXCO 2BTQB 2LFSA 3HKEB 2ZR2A 4FLYA 3L70H 5LHGA 4YY3O 3CC2V 2QWNB 2Y48A 4LWSA 1N36B 4BW5A 2FKXA 4QJFB 1H8HG 5JJEB 1AP5A 3S3WA 3UCSC 1GO3F 5CA3A 2HHHO 2FMLA 1DTOA 1ZX3A 3LDDA 4BAYA 3K03A 1FD9A 3G67A 1AJNA 2F4VB 4J9ZB 1W59A 2UXXA 4LFBB 2Q68A 4PD4F 3DTUB 3P3PA 4JI1O 2A06H 1RP3B 3H1HH 3GB7C 1M57C 5B66Z 5H9CA 2WSSG 3U0ZA 4IHJA 1Q3EA 1VMGA 2F93B 1F4NA 2UXDO 4NYKA 4DR5O 5IYCO 1J5EO 1XDCA 5LMUO 2CH7B 3ABMB 1EN5A 4GX1A 1R1BA 2G38A 1YJ9V 1IURA 1GM9A 3FD9A 2YIBD 2EIMB 3JAWB 4LF4O 4LH7A 3M7MX 4BWAA 4QE9A 4HAMA 3L74H 1YF2A 1GN2A 2NNUA 3CJHB 4LF9B 3N27A 4JPRA 2QWQB 3LNNA 4EB6B 1QLNA 1AROP 4CH4A 1TA8A 1Z5WA 2DYRB 1KP2A 5CB4B 3K58A 2BSKA 2Z0AA 3K08A 1AJQA 1YTFD 1KECA 1FYJA 3VQXA 3N2KA 3G71V 5CB4A 2EX3A 4PA9A 3AEIA 4LFBO 5EYPB 1PNLA 3CMEV 2XASA 5KHGA 2EILB 2RN9A 3CB2A 1I7FA 1TUBA 2Q9LA 2HVKC 1G8MA 1WNSA 4X20B 4FVMA 1WP8A 4DV5B 2B1IA 4QPJA 3CCQV 1R3LC 2EINC 5J2UA 1I94O 4JYCA 1NVPD 3G6EV 3K59A 4XDLA 1P7GA 3TGUH 4K8XA 2JGDB 3AG3C 3APQA 1VF5B 3K06A 1GH6A 2ZDIC 3ABTA 1FJGO 3RGBA 4U7NA 1EN6A 4GKJB 1XNRB 4H33A 4CZZA 2Q67A 4TV8A 4OPAA 4X89A 2VWKA 5D5PA 4B08A 4PI0A 3TJTA 4GLXA 1W0KG 3AG2C 5CBHA 3MDSA 5J2TA 3RT3C 2W6JG 3A2FA 1HNWB 4JAVA 4B3SB 1TVKB 1O9GA 3W7WA 2CTPA 5BMVA 3T1HO 3JCUZ 1LR1A 3ZMVA 1R73A 3KCXA 4GKKB 2EILC 1B04A 4HYOA 1WB7A 4FLTA 1PL0A 1Q6IA 1CEZA 2ZCEA 4AI8A 2D2CB 1IXBA 3VBBA 3JAKB 2ZXWB 2F66C 2X6BA 3ZN0A 2CAZC 2HG5C 1L1FA 4X20A 4DRXA 4RO2A 3K3WA 5FNVA 5LHIA 1SQGA 1WPBA 3OR6C 2Q5ZA 1FFXB 4QGPA 4ZOLA 4AQYB 3H1IH 4DXWA 3O65A 1WA8B 2DJVA 2P4KA 3LUTB 2EZPA 5B3SB 1HNZB 4X1YB 2VWJA 4UFZA 5JJJB 4X1IB 2OYQA 3ABLB 4GX2A 4TT3G 2H3OA 2XAFA 1GN6A 3RVZA 2GTSA 3J7AU 2EIJB 4ASUG 4O4JB 1YVWA 2MW2B 1WAZA 4ABMA 4ZBMA 5B3SC 1RM1B 3ZJZA 4LF4B 2B1GA 5EBLC 1WPXA 3ML0A 3JAWA 5IYDO 2ARHA 4Q20A 4UCRA 5GTIZ 1IVSA 4NTYA 4LF6O 4DV1O 2B9ZA 3E8GA 3SYOA 2EIKC 3CCVV 4FFKA 3TETA 2CTQA 1XNQO 2W6IG 4O4LA 5AG2A 4JYYA 2PYLA 3K0GA 4FZ0A 4U7OA 1UPGA 5KA5A 2ZD9A 3SDLA 1WN7A 1XHZA 1BS3A 4K3AA 4I50A 1I5XA 3HR0A 3ABMC 2ZT9B 1FS0G 2QM8A 2L35A 5JQGA 3T1YB 1VQMV 5GTHZ 3QO8A 3BRCA 4H0LB 1M9NA 1FXKB 1ZL8B 5C8YB 3I56V 4UCVA 2XTAA 2KSDA 2R9RB 3X2QC 2VQFB 4DUYO 3HKBB 1Y66A 3U10A 1EZVH 2GBOA 3B40A 2QM7A 5LP6A 5KHIA 4YHHO 4CH3A 1N36O 4JI7O 4GX5A 2JGUA 2VQEB 1ZWIC 3W7XA 2YXYA 1VEWA 2WLNA 5LOVB 4XDKA 1LNQA 2PGGA 4FLXA 2Q8VA 1UJWB 4KP4A 1FJGB 4DW1A 3ABKC 4PA3A 4D7TA 1XREA 2DOSA 4JF3A 1MMMA 2DYSB 3VQVA 2KKWA 1CPYA 4X1KB 2OTJV 4WFFA 1N34O 1F4MA 3H1KH 2V1DA 3OW2U 1Z5VA 1PL4A 3ZN1A 4YIOA 1HNXO 1SF9A 5EZYA 1BHAA 2P4VA 3JSNA 3ZHRA 4I4TA 2ODMA 2YICA 3JD2A 3CCLV 4PDVA 4JI5O 2E5LB 3JD4A 3A0HZ 1MSDA 4IL6Z 2OCCC 1HNZO 2P67A 2A3QA 4JTAB 4NTXA 4NXMB 1PP9H 1RSOB 3SYQA 4O4JA 1OV9A 4JTDB 3ZRVA 2BOCC 3QVNA
chains in the Genus database with same CATH topology
1QLEB 2LP7A 2A9HA 1QR9A 4MT8A 4LP8A 2ITDC 2KB1A 3FYIB 4WF9V 5EC1C 3RBZA 2EBOA 4GCZA 3CCUV 2F43G 2IH3C 2NLJC 3QO7A 4JYBA 4MVOA 5H6QA 1S76D 5J9PC 1V55B 2ZQMA 4JAUA 4RQFA 3F7VC 3MHHC 1VQPV 3E8FA 1S5HC 4PDMA 1NJIW 4R7CA 3LSSA 2HVJC 3EHBB 1JVMA 2IJIA 1Y4MA 5BZBA 1YIJV 2P6JA 1OCCC 4G2KA 1G4YB 1K5SA 2LFSA 1BHBA 2ZR2A 1K5QA 3SPIA 3CCMV 5LHGA 2OCCB 4R6ZA 3A0RA 4JTCB 2Q6AA 4R8CA 2IJKA 5IY5B 3CC2V 4F4LA 2Y48A 1K33A 4BW5A 4QJFB 5HFMA 1H8HG 2JIZG 1GO3F 5CA3A 3UKMA 1DTOA 3RVYA 3LDDA 4BAYA 3SPJA 1NKDA 3ETEA 3K03A 1SRYA 4MTFA 4MW3A 2WWWA 4RUEA 3SYCA 3E8HA 3ETDA 1AJNA 1B6QA 1V54C 4J9ZB 1ORQC 2UXXA 1K7DA 2Q68A 1KP3A 1OCOC 3AG4B 1YTFB 1J95A 3DTUB 3JD3A 3ASOB 3B8NA 3M99B 3D3IA 3GB7C 1AJPA 1M57C 5H9CA 2WSSG 2Q69A 4MSWC 3OEEG 1QLNA 4ZKIA 1F4NA 4WFAV 3CCRV 5CMUA 2ATKC 1KKDA 1QCEA 5IYCO 3OUSA 2ZXWC 1AI5A 2HR3A 4FMTA 3ABMB 3OM3B 1I5YA 2H94A 4GX1A 1THZA 2H8PC 3DGEA 3AG3B 2GHYA 1YJ9V 1GM9A 2D3OW 2EIMB 3OGCC 1JX9A 3BEHA 3LNMB 1SETA 3ZMSA 2P7TC 4QE9A 2AHZA 2WLLA 4HAMA 4XDJA 3W7TA 2JEXA 2EZOA 2NNUA 1NVPB 1OCZB 1K97A 2R9IA 4JPRA 2X6AA 2JJ1G 1K34A 1COWG 1AROP 2DQ3A 1H2GA 1FXVA 2OT5A 3P30A 4JASA 2CK3G 4LCUC 3E2EA 3AG2B 2DYRB 5B1NA 2EIMC 1KP2A 3IGAC 4P30A 4G27B 3K08A 1AJQA 4MVQA 1KECA 1YTFD 1MSWD 1DLBA 5IYBO 1OCRC 2WAMA 3AG1B 3G71V 5B1BC 2EJRA 3HB3B 4Z1MG 1SZTA 4PA9A 3D36A 3JD0A 3FYEB 5EBMC 1FXKC 1GKFA 5EC2C 4BIZA 3CCEV 3LDEA 1K4CC 3AEIA 5KUMA 3G4SV 2PI5A 1PNLA 2QTOA 3CMEV 2XAGA 1IXMA 2BOBC 2XASA 1DF5A 2EILB 1YJNV 1R3KC 2DYRC 2UXNA 2IU0A 2K1EA 3T4ZA 5LHHA 2HLDG 2HVKC 4MVSA 3E89A 1G8MA 4KUMA 3ZMZA 2B1IA 4QNHB 2XAHA 3OEHG 1VQ7V 5L3BA 1M57B 1RPOA 5C93A 2QA4V 1NR7A 1JPXA 4QPJA 3CCQV 1R3LC 2EINC 2WLKA 1HWYA 2Z5UA 3OFNG 1KC8W 4JYCA 4QE7A 5DM6V 1NVPD 5CBFA 1SERA 1Q82W 3G6EV 1FXKA 3WG7C 4XDLA 5B1BB 2WLJA 4J9YB 1DF4A 2IJJA 2V7QG 3SJQC 3ZRXA 4MW8A 4YXWG 1SESA 4EKWA 4HZ3A 4P9OA 3UM7A 4DO2A 4TSFG 4TWKA 3AG3C 2WLLB 1R6NA 2A79B 2YSUB 4G28B 3K06A 2ZDIC 3ABTA 3EFFK 4U7NA 2JK5C 3OR7C 3CC7V 4PA7A 1VQOV 1PNKA 3NXSA 2QE7G 3ABLC 3STZC 1OCZC 3E83A 4WFBV 4H33A 1E79G 1S3JA 2Q67A 4P9PA 4CZZA 1YJWV 5CBGA 1K4DC 4UV9A 4X89A 1XL6A 1QVGU 3K0DA 1W0KG 3AG2C 1Q81W 1KQSU 5CBHA 3WFVA 1EFRG 1MABG 2W6JG 4R50A 5L3GA 4JAVA 3JCZA 3IC7A 1H38A 3CYOA 2LFRA 4JGSA 3W7WA 1OCCB 2WLIB 2FTKA 4MTGA 3AG4C 4KFMA 1TUEB 3ZMVA 1R73A 1K92A 3SPCA 3SPHA 3OAAG 1W0JG 2EILC 1VQNV 3R65A 3ZRWA 3ZMUA 3CMAV 1BL8A 3F5WC 4HYOA 1VQ4V 1S0VA 4PA6A 1PNMA 1PL0A 1PKXA 4WFEA 1CEZA 3E8BA 1VQ5V 4QIWF 3FB5C 3VBBA 2Z3YA 3K79A 1N8RW 2QEXV 4L87A 2ZXWB 3GWOA 4PDRA 2X6BA 3ZN0A 1QBZA 4QPKA 3KG2A 2X6CA 4BIUA 2HG5C 2OTLV 1FXHA 1L1FA 3OE7G 2PI4A 3ASNB 2DQ0A 4RO2A 3I55V 1V54B 3ZRSA 3K3WA 4RUFA 1M56C 5LHIA 2X0LA 1YHQV 3HPLC 2B5UA 4UVAA 1NBMG 3OR6C 3MD0A 3MHSC 3ASOC 1F23A 3QNEA 3TK1A 1K73W 1H8EG 2XOKG 5H6RA 4DXWA 1F51A 1NR1A 1P7BA 3LUTB 4PDLA 5B1AC 3QO5A 1JCHA 2EZPA 3LSQA 1QR8A 5B3SB 2WLMA 3SYAA 3CCJV 3STLC 3K04A 1AI4A 3FB7C 2P90A 1JOYA 3ABLB 1E1RG 4FPPA 4GX2A 5L3EA 1YITV 4TT3G 1OCOB 2XAFA 2YEVA 3RVZA 1WLEA 1VQ8V 3OMNB 1JJ2U 1XL4A 1EBOA 4RQEA 2C2AA 1YI2V 3FB8C 2EIJB 4ASUG 1AR1B 3ZRWB 4I5SA 4ZBMA 5B3SC 4MTOA 1RM1B 3ZJZA 5L3CA 2B1GA 2M7WA 3K9AA 5EBLC 1EZJA 3ABKB 3SYPA 1WPXA 2A0LA 3ML0A 5L3FA 5IYDO 2Y69B 2IJHA 4Q20A 5L3DA 3X2QB 2ZR3A 2ZDIA 2XNDG 4OXSA 1CP9A 2X7RB 1ROPA 4MVRA 3E8GA 3SYOA 3CXCU 1KD1W 2EIKC 2MK3A 3CCVV 3TETA 5LGUA 2W6IG 3T2MA 3FB6C 3VOUA 4H37A 3JYCA 3K0GA 1K3EA 2DWEC 4U7OA 5KA5A 2Y69C 2ZD9A 4FJCC 3TCUA 1VQLV 5EBWC 2HKOA 3CD6V 5IDJA 1QVFU 3FKSG 3PJSK 1R3JC 2WLHA 4UXNA 5KA6A 1GM8A 1I5XA 1GM7A 3ABMC 1M56B 3W7SA 3JD1A 2EIJC 5LBQA 4LC1A 1FS0G 3B77A 1VQ6V 2QM8A 4XBFA 4UUJC 5GW7A 1VQMV 5DN6G 4X8AA 3QO8A 4P2ZA 4MVZA 1K9MW 2AHYA 1S77D 1M90W 1M9NA 1FXKB 3W7UA 1NH2B 3I56V 2R9RB 1P4RA 5B1AB 3X2QC 5B1OA 1VQ9V 3BY6A 3CP1A 4LBEC 4CBCA 4MVUA 1Y66A 4FIPC 3P32A 4UVBA 1W2BU 2ITCC 2QM7A 3SPGA 3H01A 2JDIG 3E86A 3CPWU 3RW0A 2DYSC 3OMAB 2W0FC 4GX5A 5LGNA 2JJ2G 4N23A 4E2LA 4GX0A 1ZWIC 1PD3A 4WCEV 1R6KA 3CC4V 3W7XA 1GK9A 2XAQA 2WLNA 4XDKA 1Q86W 3T4DA 1LNQA 2YEVB 1UJWB 4KP4A 1RPRA 2IU3A 1M1KW 3ABKC 4MS2A 4PA3A 2EINB 3ZMTA 1BMFG 5E1AC 1S72V 4JF3A 2DYSB 1VQKV 4MVMA 1CPYA 1AI6A 3ETGA 1QLEC 2JEUA 2OTJV 4X88A 4PA4A 1YSCA 4WFFA 1F4MA 2EIKB 1OHHG 2IH1C 2WLIA 3ZCCA 2V1DA 3IFXA 3OW2U 3ZIAG 5HFLA 3ZN1A 3T1CA 1NQTA 1MOFA 4UV8A 1RM1C 1OCRB 3AG1C 3ASNC 4PELA 2XAJA 1BHAA 3F7YC 5KUKA 2WPDG 5FL7G 2HJFC 2QKSA 4WFGA 3OUFA 2GSMB 4MTXA 1R3IC 4N21A 4WFHA 3B8MA 1JQ0A 1FFTB 3WG7B 5CN0A 3JD2A 3CCLV 4PDVA 2DW4A 3E35A 3LDCA 3JD4A 4I9WA 2HFEC 1GMGA 4RAIA 1NH2D 5LGTA 1K8AW 4UVCA 4GT1A 1E1QG 2OCCC 5IY5C 2P67A 5EK0A 4FK5C 1GTOA 2DWDC 2IW5A 3ABUA 1OZ0A 4JTAB 1V55C 3CCSV 1Q7YW 3OMIB 1ENVA 3SYQA 1MG1A 3ZRVA 1AI7A 4JTDB 2BOCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MTG A;  3AG4 C;  3PJS K;  4KFM A;  1R3J C;  2WLH A;  2A9H A;  2X6A A;  3SPC A;  3SPH A;  4LP8 A;  2ITD C;  3ABM C;  4LCU C;  2EIL C;  2KB1 A;  3R65 A;  5EC1 C;  2EIJ C;  3RBZ A;  1BL8 A;  3F5W C;  4HYO A;  2EIM C;  3IGA C;  4UUJ C;  4P30 A;  4G27 B;  3K08 A;  4MVQ A;  2IH3 C;  4PA6 A;  2NLJ C;  4MVO A;  4X8A A;  1OCR C;  4WFE A;  4P2Z A;  4MVZ A;  5B1B C;  2AHY A;  5J9P C;  3F7V C;  3E8B A;  4PA9 A;  3E8F A;  1S5H C;  3FB5 C;  4PDM A;  5EBM C;  4R7C A;  2R9R B;  5EC2 C;  2HVJ C;  3X2Q C;  3LDE A;  1K4C C;  1JVM A;  4LBE C;  2X6B A;  4PDR A;  5KUM A;  5BZB A;  3KG2 A;  2QTO A;  2X6C A;  2HG5 C;  4MVU A;  1OCC C;  4CBC A;  2BOB C;  1G4Y B;  2ITC C;  3SPG A;  4RO2 A;  1R3K C;  2DYR C;  3ZRS A;  4RUF A;  1M56 C;  3E86 A;  3SPI A;  2K1E A;  3T4Z A;  4R6Z A;  3HPL C;  4JTC B;  4R8C A;  2Q6A A;  3RW0 A;  2DYS C;  4GX5 A;  2W0F C;  2HVK C;  4MVS A;  3OR6 C;  4F4L A;  3E89 A;  4GX0 A;  1ZWI C;  3ASO C;  4BW5 A;  4QNH B;  4DXW A;  2WLN A;  1P7B A;  3LUT B;  4PDL A;  4XDK A;  3T4D A;  1LNQ A;  5B1A C;  3UKM A;  3RVY A;  3LDD A;  2WLM A;  3SPJ A;  3SYA A;  3STL C;  3K04 A;  3K03 A;  4RUE A;  4MTF A;  4MW3 A;  1R3L C;  2EIN C;  3ABK C;  2WLK A;  3E8H A;  3FB7 C;  4MS2 A;  4PA3 A;  3SYC A;  5E1A C;  4QE7 A;  4GX2 A;  5CBF A;  1V54 C;  4J9Z B;  1ORQ C;  4MVM A;  2YEV A;  3WG7 C;  2Q68 A;  3RVZ A;  1OCO C;  4XDL A;  1QLE C;  2WLJ A;  4J9Y B;  1XL4 A;  4X88 A;  4PA4 A;  1J95 A;  3SJQ C;  4MW8 A;  4WFF A;  4EKW A;  4HZ3 A;  2IH1 C;  3FB8 C;  2WLI A;  4P9O A;  3GB7 C;  3UM7 A;  1M57 C;  3AG3 C;  3IFX A;  4TWK A;  2WLL B;  2Q69 A;  4MSW C;  2A79 B;  4G28 B;  4ZBM A;  3K06 A;  4MTO A;  5B3S C;  3T1C A;  3ZJZ A;  3AG1 C;  3ASN C;  3EFF K;  2JK5 C;  3OR7 C;  4PA7 A;  3ABL C;  5EBL C;  2ATK C;  3STZ C;  3F7Y C;  2A0L A;  3SYP A;  5KUK A;  1KKD A;  2HJF C;  2QKS A;  1OCZ C;  3E83 A;  3OUS A;  4WFG A;  2ZXW C;  3OUF A;  1R3I C;  4H33 A;  4WFH A;  2Q67 A;  4P9P A;  5CBG A;  1K4D C;  4OXS A;  4MVR A;  4PDV A;  4X89 A;  3E8G A;  3SYO A;  4GX1 A;  2EIK C;  3LDC A;  1XL6 A;  4I9W A;  3TET A;  2H8P C;  2HFE C;  3K0D A;  4RAI A;  3T2M A;  3FB6 C;  3AG2 C;  3OGC C;  3VOU A;  2OCC C;  5IY5 C;  4H37 A;  5CBH A;  3BEH A;  3LNM B;  5EK0 A;  3JYC A;  2P7T C;  3K0G A;  4QE9 A;  2DWD C;  2DWE C;  4JTA B;  1V55 C;  2AHZ A;  4R50 A;  2Y69 C;  2ZD9 A;  2WLL A;  3TCU A;  3SYQ A;  4XDJ A;  4JTD B;  5EBW C;  2WLI B;  2BOC C; 
#chains in the Genus database with same CATH topology
 2ZM6 B;  3H9V A;  3CRC A;  1FPO A;  3FYI B;  4GCZ A;  4I7Z B;  1J5E B;  2LO1 A;  2NLJ C;  4JI3 B;  4LNU A;  5JCO C;  3SGI A;  2Q4P A;  1V55 B;  4JAU A;  4RQF A;  3MHH C;  3E8F A;  4DR7 O;  4R7C A;  4DR2 O;  1H2K A;  2YUA A;  5BZB A;  3E22 A;  4O2B A;  1BQZ A;  4DV0 O;  1FFX A;  2DE0 X;  1BQ0 A;  3CRA A;  1K5S A;  3CCM V;  4R6Z A;  1KBH A;  2IJK A;  1SS3 A;  5H2F Z;  1XOU A;  1K33 A;  2OWO A;  3SPJ A;  1NKD A;  1SRY A;  4CC5 A;  3ETD A;  1G1X B;  1ORQ C;  4JI2 B;  1OCO C;  3DXR A;  3ZHV A;  4AQY O;  1RFY A;  3JD3 A;  3ASO B;  4PI2 A;  5BMV B;  2UXB B;  3M99 B;  3D3I A;  3UT5 B;  1BT8 A;  3P3N A;  2GDS A;  3CXH F;  4JI0 O;  1NT2 B;  2OCH A;  4ZKI A;  1Q5O A;  4WFA V;  3CCR V;  5CMU A;  1KKD A;  4AHC A;  1VIB A;  3DC6 A;  3OUS A;  5ITZ A;  4LFC O;  2QWO B;  1S5L Z;  3EXA A;  2Y0P A;  2H94 A;  4DV2 O;  4FM2 A;  1I94 B;  3DGE A;  3AG3 B;  5E79 Z;  2GHY A;  1XUQ A;  4O4I B;  4B3T O;  3LNM B;  2XHB A;  1MNG A;  4I4T B;  3F5T A;  1BSM A;  4AIL C;  4XDJ A;  2EZO A;  1XIL A;  5LA6 A;  2R9I A;  3APO A;  4FZ1 A;  4RWU A;  3UT5 A;  2VRZ A;  2DQ3 A;  1H2G A;  1FXV A;  2OT5 A;  3AG2 B;  3RYH A;  4JI7 B;  1OCR C;  2WAM A;  3AG1 B;  4CH6 A;  5BY1 A;  3D36 A;  3FYE B;  5KAF Z;  1GKF A;  3LDE A;  5KUM A;  4J42 A;  3IAY A;  2QTO A;  2XAG A;  4HBN A;  2F95 B;  5FPO A;  3HKC A;  1IXM A;  3SJB C;  4EFB A;  1DF5 A;  1SZX A;  5KMG B;  1HW7 A;  4JI8 O;  5LOV A;  2UXN A;  2EUL A;  5LHH A;  4OX9 B;  1JFF A;  4X64 B;  4QNH B;  2XAH A;  3OEH G;  3RYC B;  4D6T H;  3DXR B;  2ETN A;  1JPX A;  1H2N A;  3UO2 A;  2Z5U A;  1L0L H;  5F2V O;  1KC8 W;  2BSK B;  1Q8I A;  3FAV A;  2OIG A;  4K8Z A;  1Q82 W;  1FXK A;  3WB1 A;  2Q73 A;  2WLJ A;  4DR7 B;  2NN4 A;  4HZ3 A;  4DO2 A;  2JRI A;  4TSF G;  2WLL B;  4Z2W A;  3EFF K;  2JK5 C;  5JWP A;  3NXS A;  2CGO A;  3ABL C;  3STZ C;  3BAB A;  3H1L H;  4WFB V;  4OPH A;  1E79 G;  1YJW V;  1YCI A;  3RWR D;  4LF7 B;  3OD4 A;  3K0D A;  2VS0 A;  3HKD A;  1Q81 W;  1KQS U;  4FLW A;  4JAA A;  4C7U A;  1OJH A;  2E74 B;  2YIB A;  3IC7 A;  4GUN A;  5LL6 Y;  3CYO A;  2LFR A;  4JGS A;  2JS5 A;  1OCC B;  2WLI B;  2FTK A;  3RYH B;  4MTG A;  3AG4 C;  2UUB B;  4X65 B;  1W0J G;  3F5W C;  5K1X A;  4B3R O;  3L71 H;  1EN4 A;  2V4D A;  5KX5 A;  4KHP B;  5IJ9 A;  2YIA A;  3DC5 A;  2CDY A;  5CA1 A;  4O4H B;  3IJ4 A;  1VQ5 V;  2VQF O;  4DV3 B;  4QIW F;  1KMI Z;  3K79 A;  1QBZ A;  1N0J A;  2PI4 A;  1IBL O;  1HNX B;  1TVK A;  3I55 V;  3ZRS A;  4RUF A;  2QDO A;  2X0L A;  2ZIN A;  4DR6 O;  3HPL C;  4W4L A;  5LA6 B;  3K5L A;  4LF8 O;  3MHS C;  3ETQ A;  1K73 W;  2RDC A;  5H6R A;  4I0X A;  1F51 A;  1YXB A;  1NTM H;  3QO5 A;  4IT5 A;  3CRQ A;  1GRJ A;  4J41 A;  4O4H A;  2QKA A;  5IJ9 B;  1N32 B;  2Y4T A;  4NXM O;  5L3E A;  2YEV A;  1VQ8 V;  1PV0 A;  4LF5 B;  1EBO A;  4RQE A;  3RYI B;  1Q90 D;  2YI9 A;  5IYZ A;  3ZRW B;  4B3T B;  3K9A A;  4ICG A;  3ABK B;  2Y0I A;  2A0L A;  4JZ2 A;  3KZI Z;  2IJH A;  5L3D A;  4LF9 O;  3TXS A;  2ZDI A;  1NTK H;  3CXC U;  4PV1 B;  3OT7 A;  3FB6 C;  3EVK A;  3VOU A;  3GWK C;  1AR5 A;  3C3S A;  3JYC A;  2DWE C;  2ZNJ A;  4EB6 A;  2F23 A;  2HKO A;  3CD6 V;  5KLV H;  4DUZ B;  3FKS G;  1ZSP A;  2QR4 A;  2RNB A;  3PJS K;  5KA6 A;  4H44 B;  5JVD B;  3B77 A;  1VQ6 V;  3FAV B;  2Q0A A;  4DR3 O;  3E22 B;  4DV4 O;  4X8A A;  2YXL A;  4OX9 O;  4P2Z A;  4MVZ A;  1SQF A;  1K9M W;  1S77 D;  1JR9 A;  1M90 W;  4K0K O;  1NH2 B;  1M4U A;  3RYF A;  4DR2 B;  2L6L A;  1VQ9 V;  3BY6 A;  4LBE C;  2YI8 A;  5IT9 N;  3P32 A;  4UVB A;  2ITC C;  4NXN O;  1SQX H;  3SPG A;  2JDI G;  3E86 A;  3CPW U;  4LFA O;  2DYS C;  2P06 A;  3AK2 A;  2LW1 A;  1HNW O;  2JVD A;  4N23 A;  4O2A A;  1BZK A;  3C3T A;  1RSO A;  4WCE V;  1SKV A;  1JJO A;  4NVP A;  3T4D A;  4KL1 A;  1NU1 H;  3HKD B;  4MS2 A;  2EIN B;  2GV9 A;  5E1A C;  3JAK A;  1FKA O;  4IHJ B;  3ETG A;  4IIJ B;  4PA4 A;  5EZY B;  3CE2 A;  1Q43 A;  2WA4 A;  3ZCC A;  1MA1 A;  3IFX A;  5A9G A;  5CA0 B;  1Z2G A;  1B3Q A;  3ASN C;  4PEL A;  2ZIM A;  4DR5 B;  2XAJ A;  3F7Y C;  5KUK A;  4O4I A;  5FL7 G;  4B3S O;  2QKS A;  1WP7 A;  2CE4 A;  2YDE A;  2GSM B;  5LMN B;  2DW4 A;  3E35 A;  4I9W A;  3JAR A;  1HR0 B;  2HFE C;  5LGT A;  3VQW A;  1XI1 A;  4WBN B;  3TXQ A;  1GTO A;  3ABU A;  1V55 C;  3CCS V;  1Q7Y W;  3OMI B;  2A7W A;  4X64 O;  1MG1 A;  2AXT Z;  3NR7 A;  3RYI A;  2VQE O;  2A9H A;  4DR1 O;  1QR9 A;  2ITD C;  3RBZ A;  4CS3 A;  4DV6 O;  2PUS A;  1SQV H;  3CCU V;  2F43 G;  3QO7 A;  5H6Q A;  4F6E A;  2R9A A;  1AP6 A;  2ZQM A;  1VQP V;  2PTM A;  3LSU A;  4X62 O;  3LSS A;  2HVJ C;  2IJI A;  2KG7 B;  2P6J A;  4CS4 A;  4IGG A;  3SPI A;  4UB8 Z;  4I0X B;  4R8C A;  5IY5 B;  2QWR B;  3A0R A;  4YIP A;  3A8T A;  5HFM A;  4TUY B;  2JIZ G;  4J7J A;  4K35 A;  2LGW A;  5LP6 C;  3RVY A;  3ETE A;  4MW3 A;  3SYC A;  4LNU B;  5KX5 B;  1HR0 O;  1CXZ B;  1SQB H;  2CUG A;  1XMO B;  1KP3 A;  1YTF B;  2HEP A;  4X1Y A;  4X66 B;  5LXT B;  3B8N A;  3ZHS A;  4X65 O;  1AJP A;  4B3R B;  4J10 A;  1XNR O;  4U3J A;  4LFA B;  3ICX A;  3I5D A;  4O4L B;  5DED A;  4DUZ O;  2HR3 A;  4FMT A;  4GYC B;  1THZ A;  5KHH A;  2FB5 A;  3M8A A;  3T1Y O;  3OGC C;  3K57 A;  2AHZ A;  2AZ0 A;  1B06 A;  2WLL A;  1OCZ B;  1K97 A;  3AG7 A;  2X6A A;  5JH7 B;  4LCU C;  3P30 A;  1MZE A;  1Y76 B;  3IGA C;  4G27 B;  2E3C A;  4MVQ A;  1AB3 A;  3WB0 A;  1MSW D;  4Z1M G;  2EJR A;  4NKG B;  1SZT A;  3JD0 A;  5EBM C;  1FXK C;  5EC2 C;  4BIZ A;  4LR3 A;  2RQ6 A;  4Z1V A;  1K4C C;  3G4S V;  2PF4 E;  2PI5 A;  1IBL B;  5JCO A;  2BOB C;  2WA3 A;  1LUW A;  4DV0 B;  2IU0 A;  2K1E A;  1A32 A;  4FM0 A;  4MVS A;  3E89 A;  4KUM A;  3A0B Z;  4DW0 A;  1VQ7 V;  4PJ0 Z;  5L3B A;  2ILM A;  2QKC A;  4TQD A;  1RPO A;  4I55 A;  5C93 A;  5FLX N;  2ADQ B;  2WLK A;  3OFN G;  4DYL A;  4QE7 A;  5DM6 V;  2QM4 A;  5CBF A;  5KHK A;  3WG7 C;  4DK0 A;  1AVM A;  5B1B B;  4JI4 B;  3SJQ C;  1XMO O;  4EKW A;  4UCO A;  4P9O A;  2XUM A;  2YXH A;  1US6 A;  4LF8 B;  3CC7 V;  3N2G B;  4YJ2 B;  3L75 H;  3BA9 A;  1OCZ C;  3E83 A;  4P9P A;  1VP7 A;  1K4D C;  5IWA O;  2UUC O;  1N32 O;  1EM1 A;  3RN4 A;  4F6R B;  1D5A A;  3WFV A;  4BR6 A;  1Y74 A;  3BVO A;  3HKE A;  5L3G A;  3OTF A;  1H38 A;  1IBK B;  3BA8 A;  2QWP B;  4KFM A;  1K92 A;  1NTZ H;  3SPC A;  3SPH A;  3OAA G;  5CA0 A;  1QQC A;  1VQN V;  3R65 A;  3ZRW A;  3ZMU A;  3CMA V;  1BL8 A;  2IM9 A;  1VQ4 V;  3QG5 A;  3JAT A;  5CA1 B;  3SJC C;  4PHZ A;  5GON A;  2K9P A;  1M5I A;  1PNM A;  2OIE A;  4WFE A;  2GUZ A;  3FB5 C;  2QEX V;  4L87 A;  3N2K B;  5LMU B;  3GWO A;  4QPK A;  5A2Q N;  2X6C A;  3MAQ A;  1FXH A;  3OE7 G;  4ZOL B;  2Q0O C;  2DQ0 A;  1V54 B;  1M56 C;  1KUQ A;  4JYA O;  2QGN A;  4UVA A;  1NBM G;  4ZI7 A;  3K5M A;  3MD0 A;  2XT9 A;  4O2B B;  2XOK G;  1KKC A;  1IDS A;  3HKB A;  1NR1 A;  2HP8 A;  1P7B A;  4PDL A;  2BCC H;  1JCH A;  1QR8 A;  4TV9 B;  3SYA A;  3CCJ V;  3STL C;  3K04 A;  1AI4 A;  3D8C A;  3FB7 C;  1FAF A;  1PM9 A;  2YC0 A;  4ZHQ B;  1SQP H;  4BIO A;  3FFQ A;  4YY3 B;  1OCO B;  1WLE A;  4ZHQ A;  1N34 B;  4YJ3 A;  4DV7 B;  1XL4 A;  1U97 A;  4U3J B;  1YI2 V;  5D5Q A;  4ZIB A;  2AZ2 A;  4KXR A;  1P84 F;  1DGS A;  4B7K A;  4GKK O;  2M7W A;  5KMG A;  1EZJ A;  5L3F A;  2F4V O;  5KAI Z;  4H13 B;  3ZHU A;  3X2Q B;  2UUA O;  2GTA A;  2XND G;  4OXS A;  1KD1 W;  1ROP A;  1L0N H;  1VF6 A;  3ZHQ A;  2Q7H A;  2MK3 A;  3JSL A;  5LGU A;  1NS1 A;  3SR2 C;  4H37 A;  1F7Y A;  1GN3 A;  2UXD B;  2Y69 C;  1PPJ H;  3TCU A;  4LWS B;  1QVF U;  4UB6 Z;  3OGI B;  5LXT A;  2QSA A;  1R3J C;  4UXN A;  1GM8 A;  1URF A;  1XBL A;  1GM7 A;  3L72 H;  1M56 B;  3RYF B;  5LBQ A;  4JZG A;  4XBF A;  1QHT A;  2KG7 A;  5DN6 G;  3OTO B;  1XMQ O;  2IBZ H;  3JAL B;  4FFB B;  4JI5 B;  2ADP A;  1ZAU A;  1P4R A;  1VF7 A;  3J80 N;  3CHX A;  5GON B;  5IWA B;  4FIP C;  4FLU A;  3GVM A;  3H01 A;  3H1J H;  3OMA B;  2W0F C;  2JJ2 G;  4DR6 B;  4LFC B;  4E2L A;  5K1P A;  4JI4 O;  1R6K A;  5IJ0 B;  1GK9 A;  1Q86 W;  4F6R A;  2YEV B;  1LUV A;  3U11 A;  1M1K W;  4JI6 B;  1BMF G;  4IIJ A;  1Y6X A;  1MZF A;  1S72 V;  4KHP O;  3JAT B;  4MVM A;  2JEU A;  4X88 A;  3UQ8 A;  1YSC A;  5J2U B;  2LJ2 A;  1OHH G;  1H2L A;  1L8D A;  4JI0 B;  2NR5 A;  3ZIA G;  3ZED A;  1HP8 A;  1NQT A;  1MOF A;  3CRM A;  2P5O A;  4UV8 A;  1G6U A;  1RM1 C;  1IBM B;  2ZE7 A;  4EEQ A;  4O2A B;  3OUF A;  4FM1 A;  4MTX A;  4N21 A;  4WFH A;  3B8M A;  1X4T A;  3WG7 B;  5CN0 A;  1XQ8 A;  5JJN B;  4J11 A;  4DV1 B;  1NH2 D;  1K8A W;  4UVC A;  4DUY B;  4GT1 A;  2N04 A;  1BE3 H;  4I55 B;  4TOI A;  2DN9 A;  4JI2 O;  5EK0 A;  4FK5 C;  2IW5 A;  1OZ0 A;  3UO3 A;  3B09 A;  2UXB O;  2W0X A;  1ENV A;  1AI7 A;  1QLE B;  1Y76 A;  3G6B A;  4MT8 A;  1O9H A;  4LP8 A;  3BAA A;  3G80 A;  2KB1 A;  4WF9 V;  3CEI A;  3Q4H A;  2EBO A;  4X1I A;  2IH3 C;  1S76 D;  4J80 A;  4YJ3 B;  4DV4 B;  3CWB H;  1ZTE A;  3Q4H B;  1N0N A;  4U3F H;  4K0K B;  1QU7 A;  1YIJ V;  4LF6 B;  1OCC C;  1G4Y B;  4B3M B;  4J7K A;  4OGQ B;  1HDJ A;  1BHB A;  1K5Q A;  2OCC B;  1JFF B;  4JTC B;  2Q6A A;  4F4L A;  2LGQ A;  4DRX B;  4DV7 O;  5EIB C;  1UFI A;  5EYP A;  2UUC B;  4W4K A;  4TQF A;  3UKM A;  5IYZ B;  4NTW A;  4RUE A;  2YS8 A;  4MTF A;  3RFR A;  2WWW A;  3E8H A;  3DSQ A;  1B6Q A;  1V54 C;  2E75 B;  1K7D A;  1IBK O;  3AG4 B;  2YID A;  1J95 A;  2JS3 A;  3CJH A;  2N05 A;  2Q69 A;  4MSW C;  3ZHT A;  3OEE G;  4HNA A;  3CRR A;  2ZKO A;  2QTS A;  4DR1 B;  4TUY A;  2ATK C;  4YHH B;  1QCE A;  1ZUQ A;  2ZXW C;  3ZX6 A;  3JAR B;  1AI5 A;  4E4E A;  1U96 A;  1I0H A;  3OM3 B;  1NZ6 A;  1I5Y A;  3RYC A;  3BPZ A;  2H8P C;  2Q7E A;  2D3O W;  4LH6 A;  1JX9 A;  3BEH A;  1SET A;  3ZMS A;  2HJD A;  2P7T C;  1N33 O;  2LW7 A;  2UXC B;  4JV5 B;  1KYO F;  1GN4 A;  2F1M A;  1S5J A;  5H5N A;  3W7T A;  4A5U B;  1I08 A;  2JEX A;  1NVP B;  3N2G A;  4YJ2 A;  2JJ1 G;  1KU9 A;  1K34 A;  1COW G;  4DR4 O;  4GKJ O;  4JAS A;  2CK3 G;  2PYJ A;  3E2E A;  1XHX A;  5B1N A;  2EIM C;  4P30 A;  3S3X A;  1AR4 A;  1Y67 A;  1DLB A;  5IYB O;  4DV3 O;  2RCV A;  3D3Q A;  5B1B C;  3HB3 B;  3PN1 A;  3KKY A;  5BR8 B;  5TIS Z;  3CCE V;  4IYH A;  2UU9 O;  3WB2 A;  3K5N A;  3SJA C;  1YJN V;  1R3K C;  2DYR C;  1WJZ A;  4B3M O;  3T4Z A;  3B4S A;  2HLD G;  3IC9 A;  3ZMZ A;  4NR1 A;  5FNV B;  2FYU H;  1M57 B;  2RMK B;  2QA4 V;  1NR7 A;  5ITZ B;  4FLV A;  4NXN B;  3AK1 A;  1HWY A;  1T5E A;  1P49 A;  1SER A;  4HNA B;  4J9Y B;  1DF4 A;  2IJJ A;  2V7Q G;  1WA8 A;  3ZRX A;  2AGA A;  4MW8 A;  4YXW G;  1SES A;  1DK1 A;  3UM7 A;  4TWK A;  3QF7 A;  4JYA B;  1R6N A;  2A79 B;  2YSU B;  4G28 B;  4DR3 B;  2CTW A;  3OR7 C;  4PA7 A;  1VQO V;  1PNK A;  2QE7 G;  2R70 A;  2UUA B;  4TV9 A;  1S3J A;  2ZM6 O;  3FX7 A;  5CBG A;  1JMK C;  1SC5 B;  1XNQ B;  4UV9 A;  3L73 H;  5EIB D;  2QJ1 A;  1XL6 A;  1QVG U;  5B5E Z;  3KCY A;  2N74 A;  3WU2 Z;  1EFR G;  2UU9 B;  1MAB G;  4R50 A;  1N33 B;  3JCZ A;  1VAR A;  2KQX A;  2O57 A;  5LYJ A;  1TUE B;  4JI1 B;  2E5L O;  1YDX A;  1N4C A;  4JI6 O;  1S0V A;  2GUZ B;  4DR4 B;  4PA6 A;  1JA8 A;  1YZB A;  1PKX A;  3E8B A;  1H2M A;  2Z3Y A;  1N8R W;  4PDR A;  5BR8 O;  3KG2 A;  4BIU A;  2OTL V;  3ASN B;  3C90 A;  3CX5 F;  1BCC H;  3O9O A;  1YHQ V;  1AIL A;  2B5U A;  1Y74 B;  4JI3 O;  1XEQ A;  3ASO C;  2CGN A;  1F23 A;  3QNE A;  1TUB B;  3TK1 A;  1GAX A;  1IZ3 A;  1H8E G;  3THO A;  4X62 B;  4FLZ A;  5LP6 B;  3CS5 A;  2BTQ A;  5B1A C;  1IX9 A;  1VF6 C;  3LSQ A;  2WLM A;  1M93 A;  3ZBH A;  1R6T A;  1TAE A;  2P90 A;  4UCS A;  1JOY A;  2ZE8 A;  2ZIO A;  1E1R G;  3R66 A;  4FPP A;  2P22 C;  1YIT V;  1ZL8 A;  5C8Y A;  4BW9 A;  3JAL A;  4FFB A;  3OMN B;  1JJ2 U;  2C2A A;  4CC6 A;  4DV2 B;  3FB8 C;  1AR1 B;  2HHH B;  2ZNI A;  4I5S A;  4X1K A;  3T1H B;  1IBM O;  4I50 B;  4MTO A;  2Q7G A;  5BXZ A;  5L3C A;  1D2D A;  4JV5 O;  4WBN A;  1SA0 A;  3SYP A;  2Y69 B;  4CH5 A;  2Y4U A;  2AW9 A;  3JAS A;  2ZR3 A;  4DV5 O;  4J7Z A;  1BGY H;  1CP9 A;  2X7R B;  4MVR A;  5IJ0 A;  3K5O A;  3JAS B;  2PZS A;  3T2M A;  1SA0 B;  4UCU A;  1X59 A;  1K3E A;  4TV8 B;  4FJC C;  5JH7 A;  1VQL V;  5EBW C;  3QTC A;  5IDJ A;  2WLH A;  2E76 B;  4DV6 B;  3L9D A;  3W7S A;  3JD1 A;  2EIJ C;  3JAM N;  4LC1 A;  4UUJ C;  5GW7 A;  1TGO A;  5LMN O;  2AHY A;  5JQG B;  4UCT A;  3W7U A;  2RJZ A;  5B1A B;  1Q6U A;  4DK1 A;  5B1O A;  1NI8 A;  3CP1 A;  3VQY A;  4CBC A;  4MVU A;  1W2B U;  4L8J A;  4LF7 O;  2EJ7 A;  3K9S A;  1KB9 F;  3AK3 A;  2R72 A;  1H2S B;  2BTO A;  3RW0 A;  5LYJ B;  5LGN A;  4GX0 A;  1PD3 A;  1D5N A;  3CC4 V;  2CTR A;  1ZLZ A;  2XAQ A;  2CH7 A;  2UUB O;  1RPR A;  2IU3 A;  5KHJ A;  3BCC H;  4EFE A;  3ZMT A;  1QNM A;  5FPR A;  3CSX A;  1VQK V;  4I9Q A;  1AI6 A;  1QLE C;  1SQQ H;  2ZE5 A;  3ZS8 C;  3B2E E;  2EIK B;  2IH1 C;  2WLI A;  5JVD A;  3BFR A;  4ZI7 B;  5HFL A;  3T1C A;  1OCR B;  3AG1 C;  4IYI A;  2WPD G;  2HJF C;  4X9Q A;  4WFG A;  5IE9 A;  2LQT A;  1R3I C;  5J2T B;  1JQ0 A;  5DEC A;  1FFT B;  4Q6G A;  4GZR B;  3LDC A;  3HKC B;  2PY5 A;  1GMG A;  4RAI A;  3J81 N;  4D7S A;  4JI8 B;  1E1Q G;  5IY5 C;  1Q6H A;  2DWD C;  4X66 O;  1WB8 A;  1V9P A;  4LF5 O;  2LP7 A;  1YEW A;  3D36 C;  3BHP A;  4B7E A;  5EC1 C;  2JGD A;  2M6Y A;  4JYB A;  2DMX A;  4MVO A;  2FL4 A;  5J9P C;  4CS2 A;  3F7V C;  3OTO O;  1XMQ B;  2BE3 A;  1S5H C;  4PDM A;  1NJI W;  4NB5 A;  3EHB B;  1JVM A;  1Y4M A;  4G2K A;  2ZE6 A;  2UXC O;  2BTQ B;  2LFS A;  3HKE B;  2ZR2 A;  4FLY A;  3L70 H;  5LHG A;  4YY3 O;  3CC2 V;  2QWN B;  2Y48 A;  4LWS A;  1N36 B;  4BW5 A;  2FKX A;  4QJF B;  1H8H G;  5JJE B;  1AP5 A;  3S3W A;  3UCS C;  1GO3 F;  5CA3 A;  2HHH O;  2FML A;  1DTO A;  1ZX3 A;  3LDD A;  4BAY A;  3K03 A;  1FD9 A;  3G67 A;  1AJN A;  2F4V B;  4J9Z B;  1W59 A;  2UXX A;  4LFB B;  2Q68 A;  4PD4 F;  3DTU B;  3P3P A;  4JI1 O;  2A06 H;  1RP3 B;  3H1H H;  3GB7 C;  1M57 C;  5B66 Z;  5H9C A;  2WSS G;  3U0Z A;  4IHJ A;  1Q3E A;  1VMG A;  2F93 B;  1F4N A;  2UXD O;  4NYK A;  4DR5 O;  5IYC O;  1J5E O;  1XDC A;  5LMU O;  2CH7 B;  3ABM B;  1EN5 A;  4GX1 A;  1R1B A;  2G38 A;  1YJ9 V;  1IUR A;  1GM9 A;  3FD9 A;  2YIB D;  2EIM B;  3JAW B;  4LF4 O;  4LH7 A;  3M7M X;  4BWA A;  4QE9 A;  4HAM A;  3L74 H;  1YF2 A;  1GN2 A;  2NNU A;  3CJH B;  4LF9 B;  3N27 A;  4JPR A;  2QWQ B;  3LNN A;  4EB6 B;  1QLN A;  1ARO P;  4CH4 A;  1TA8 A;  1Z5W A;  2DYR B;  1KP2 A;  5CB4 B;  3K58 A;  2BSK A;  2Z0A A;  3K08 A;  1AJQ A;  1YTF D;  1KEC A;  1FYJ A;  3VQX A;  3N2K A;  3G71 V;  5CB4 A;  2EX3 A;  4PA9 A;  3AEI A;  4LFB O;  5EYP B;  1PNL A;  3CME V;  2XAS A;  5KHG A;  2EIL B;  2RN9 A;  3CB2 A;  1I7F A;  1TUB A;  2Q9L A;  2HVK C;  1G8M A;  1WNS A;  4X20 B;  4FVM A;  1WP8 A;  4DV5 B;  2B1I A;  4QPJ A;  3CCQ V;  1R3L C;  2EIN C;  5J2U A;  1I94 O;  4JYC A;  1NVP D;  3G6E V;  3K59 A;  4XDL A;  1P7G A;  3TGU H;  4K8X A;  2JGD B;  3AG3 C;  3APQ A;  1VF5 B;  3K06 A;  1GH6 A;  2ZDI C;  3ABT A;  1FJG O;  3RGB A;  4U7N A;  1EN6 A;  4GKJ B;  1XNR B;  4H33 A;  4CZZ A;  2Q67 A;  4TV8 A;  4OPA A;  4X89 A;  2VWK A;  5D5P A;  4B08 A;  4PI0 A;  3TJT A;  4GLX A;  1W0K G;  3AG2 C;  5CBH A;  3MDS A;  5J2T A;  3RT3 C;  2W6J G;  3A2F A;  1HNW B;  4JAV A;  4B3S B;  1TVK B;  1O9G A;  3W7W A;  2CTP A;  5BMV A;  3T1H O;  3JCU Z;  1LR1 A;  3ZMV A;  1R73 A;  3KCX A;  4GKK B;  2EIL C;  1B04 A;  4HYO A;  1WB7 A;  4FLT A;  1PL0 A;  1Q6I A;  1CEZ A;  2ZCE A;  4AI8 A;  2D2C B;  1IXB A;  3VBB A;  3JAK B;  2ZXW B;  2F66 C;  2X6B A;  3ZN0 A;  2CAZ C;  2HG5 C;  1L1F A;  4X20 A;  4DRX A;  4RO2 A;  3K3W A;  5FNV A;  5LHI A;  1SQG A;  1WPB A;  3OR6 C;  2Q5Z A;  1FFX B;  4QGP A;  4ZOL A;  4AQY B;  3H1I H;  4DXW A;  3O65 A;  1WA8 B;  2DJV A;  2P4K A;  3LUT B;  2EZP A;  5B3S B;  1HNZ B;  4X1Y B;  2VWJ A;  4UFZ A;  5JJJ B;  4X1I B;  2OYQ A;  3ABL B;  4GX2 A;  4TT3 G;  2H3O A;  2XAF A;  1GN6 A;  3RVZ A;  2GTS A;  3J7A U;  2EIJ B;  4ASU G;  4O4J B;  1YVW A;  2MW2 B;  1WAZ A;  4ABM A;  4ZBM A;  5B3S C;  1RM1 B;  3ZJZ A;  4LF4 B;  2B1G A;  5EBL C;  1WPX A;  3ML0 A;  3JAW A;  5IYD O;  2ARH A;  4Q20 A;  4UCR A;  5GTI Z;  1IVS A;  4NTY A;  4LF6 O;  4DV1 O;  2B9Z A;  3E8G A;  3SYO A;  2EIK C;  3CCV V;  4FFK A;  3TET A;  2CTQ A;  1XNQ O;  2W6I G;  4O4L A;  5AG2 A;  4JYY A;  2PYL A;  3K0G A;  4FZ0 A;  4U7O A;  1UPG A;  5KA5 A;  2ZD9 A;  3SDL A;  1WN7 A;  1XHZ A;  1BS3 A;  4K3A A;  4I50 A;  1I5X A;  3HR0 A;  3ABM C;  2ZT9 B;  1FS0 G;  2QM8 A;  2L35 A;  5JQG A;  3T1Y B;  1VQM V;  5GTH Z;  3QO8 A;  3BRC A;  4H0L B;  1M9N A;  1FXK B;  1ZL8 B;  5C8Y B;  3I56 V;  4UCV A;  2XTA A;  2KSD A;  2R9R B;  3X2Q C;  2VQF B;  4DUY O;  3HKB B;  1Y66 A;  3U10 A;  1EZV H;  2GBO A;  3B40 A;  2QM7 A;  5LP6 A;  5KHI A;  4YHH O;  4CH3 A;  1N36 O;  4JI7 O;  4GX5 A;  2JGU A;  2VQE B;  1ZWI C;  3W7X A;  2YXY A;  1VEW A;  2WLN A;  5LOV B;  4XDK A;  1LNQ A;  2PGG A;  4FLX A;  2Q8V A;  1UJW B;  4KP4 A;  1FJG B;  4DW1 A;  3ABK C;  4PA3 A;  4D7T A;  1XRE A;  2DOS A;  4JF3 A;  1MMM A;  2DYS B;  3VQV A;  2KKW A;  1CPY A;  4X1K B;  2OTJ V;  4WFF A;  1N34 O;  1F4M A;  3H1K H;  2V1D A;  3OW2 U;  1Z5V A;  1PL4 A;  3ZN1 A;  4YIO A;  1HNX O;  1SF9 A;  5EZY A;  1BHA A;  2P4V A;  3JSN A;  3ZHR A;  4I4T A;  2ODM A;  2YIC A;  3JD2 A;  3CCL V;  4PDV A;  4JI5 O;  2E5L B;  3JD4 A;  3A0H Z;  1MSD A;  4IL6 Z;  2OCC C;  1HNZ O;  2P67 A;  2A3Q A;  4JTA B;  4NTX A;  4NXM B;  1PP9 H;  1RSO B;  3SYQ A;  4O4J A;  1OV9 A;  4JTD B;  3ZRV A;  2BOC C;  3QVN A; 
#chains in the Genus database with same CATH homology
 1QLE B;  2LP7 A;  2A9H A;  1QR9 A;  4MT8 A;  4LP8 A;  2ITD C;  2KB1 A;  3FYI B;  4WF9 V;  5EC1 C;  3RBZ A;  2EBO A;  4GCZ A;  3CCU V;  2F43 G;  2IH3 C;  2NLJ C;  3QO7 A;  4JYB A;  4MVO A;  5H6Q A;  1S76 D;  5J9P C;  1V55 B;  2ZQM A;  4JAU A;  4RQF A;  3F7V C;  3MHH C;  1VQP V;  3E8F A;  1S5H C;  4PDM A;  1NJI W;  4R7C A;  3LSS A;  2HVJ C;  3EHB B;  1JVM A;  2IJI A;  1Y4M A;  5BZB A;  1YIJ V;  2P6J A;  1OCC C;  4G2K A;  1G4Y B;  1K5S A;  2LFS A;  1BHB A;  2ZR2 A;  1K5Q A;  3SPI A;  3CCM V;  5LHG A;  2OCC B;  4R6Z A;  3A0R A;  4JTC B;  2Q6A A;  4R8C A;  2IJK A;  5IY5 B;  3CC2 V;  4F4L A;  2Y48 A;  1K33 A;  4BW5 A;  4QJF B;  5HFM A;  1H8H G;  2JIZ G;  1GO3 F;  5CA3 A;  3UKM A;  1DTO A;  3RVY A;  3LDD A;  4BAY A;  3SPJ A;  1NKD A;  3ETE A;  3K03 A;  1SRY A;  4MTF A;  4MW3 A;  2WWW A;  4RUE A;  3SYC A;  3E8H A;  3ETD A;  1AJN A;  1B6Q A;  1V54 C;  4J9Z B;  1ORQ C;  2UXX A;  1K7D A;  2Q68 A;  1KP3 A;  1OCO C;  3AG4 B;  1YTF B;  1J95 A;  3DTU B;  3JD3 A;  3ASO B;  3B8N A;  3M99 B;  3D3I A;  3GB7 C;  1AJP A;  1M57 C;  5H9C A;  2WSS G;  2Q69 A;  4MSW C;  3OEE G;  1QLN A;  4ZKI A;  1F4N A;  4WFA V;  3CCR V;  5CMU A;  2ATK C;  1KKD A;  1QCE A;  5IYC O;  3OUS A;  2ZXW C;  1AI5 A;  2HR3 A;  4FMT A;  3ABM B;  3OM3 B;  1I5Y A;  2H94 A;  4GX1 A;  1THZ A;  2H8P C;  3DGE A;  3AG3 B;  2GHY A;  1YJ9 V;  1GM9 A;  2D3O W;  2EIM B;  3OGC C;  1JX9 A;  3BEH A;  3LNM B;  1SET A;  3ZMS A;  2P7T C;  4QE9 A;  2AHZ A;  2WLL A;  4HAM A;  4XDJ A;  3W7T A;  2JEX A;  2EZO A;  2NNU A;  1NVP B;  1OCZ B;  1K97 A;  2R9I A;  4JPR A;  2X6A A;  2JJ1 G;  1K34 A;  1COW G;  1ARO P;  2DQ3 A;  1H2G A;  1FXV A;  2OT5 A;  3P30 A;  4JAS A;  2CK3 G;  4LCU C;  3E2E A;  3AG2 B;  2DYR B;  5B1N A;  2EIM C;  1KP2 A;  3IGA C;  4P30 A;  4G27 B;  3K08 A;  1AJQ A;  4MVQ A;  1KEC A;  1YTF D;  1MSW D;  1DLB A;  5IYB O;  1OCR C;  2WAM A;  3AG1 B;  3G71 V;  5B1B C;  2EJR A;  3HB3 B;  4Z1M G;  1SZT A;  4PA9 A;  3D36 A;  3JD0 A;  3FYE B;  5EBM C;  1FXK C;  1GKF A;  5EC2 C;  4BIZ A;  3CCE V;  3LDE A;  1K4C C;  3AEI A;  5KUM A;  3G4S V;  2PI5 A;  1PNL A;  2QTO A;  3CME V;  2XAG A;  1IXM A;  2BOB C;  2XAS A;  1DF5 A;  2EIL B;  1YJN V;  1R3K C;  2DYR C;  2UXN A;  2IU0 A;  2K1E A;  3T4Z A;  5LHH A;  2HLD G;  2HVK C;  4MVS A;  3E89 A;  1G8M A;  4KUM A;  3ZMZ A;  2B1I A;  4QNH B;  2XAH A;  3OEH G;  1VQ7 V;  5L3B A;  1M57 B;  1RPO A;  5C93 A;  2QA4 V;  1NR7 A;  1JPX A;  4QPJ A;  3CCQ V;  1R3L C;  2EIN C;  2WLK A;  1HWY A;  2Z5U A;  3OFN G;  1KC8 W;  4JYC A;  4QE7 A;  5DM6 V;  1NVP D;  5CBF A;  1SER A;  1Q82 W;  3G6E V;  1FXK A;  3WG7 C;  4XDL A;  5B1B B;  2WLJ A;  4J9Y B;  1DF4 A;  2IJJ A;  2V7Q G;  3SJQ C;  3ZRX A;  4MW8 A;  4YXW G;  1SES A;  4EKW A;  4HZ3 A;  4P9O A;  3UM7 A;  4DO2 A;  4TSF G;  4TWK A;  3AG3 C;  2WLL B;  1R6N A;  2A79 B;  2YSU B;  4G28 B;  3K06 A;  2ZDI C;  3ABT A;  3EFF K;  4U7N A;  2JK5 C;  3OR7 C;  3CC7 V;  4PA7 A;  1VQO V;  1PNK A;  3NXS A;  2QE7 G;  3ABL C;  3STZ C;  1OCZ C;  3E83 A;  4WFB V;  4H33 A;  1E79 G;  1S3J A;  2Q67 A;  4P9P A;  4CZZ A;  1YJW V;  5CBG A;  1K4D C;  4UV9 A;  4X89 A;  1XL6 A;  1QVG U;  3K0D A;  1W0K G;  3AG2 C;  1Q81 W;  1KQS U;  5CBH A;  3WFV A;  1EFR G;  1MAB G;  2W6J G;  4R50 A;  5L3G A;  4JAV A;  3JCZ A;  3IC7 A;  1H38 A;  3CYO A;  2LFR A;  4JGS A;  3W7W A;  1OCC B;  2WLI B;  2FTK A;  4MTG A;  3AG4 C;  4KFM A;  1TUE B;  3ZMV A;  1R73 A;  1K92 A;  3SPC A;  3SPH A;  3OAA G;  1W0J G;  2EIL C;  1VQN V;  3R65 A;  3ZRW A;  3ZMU A;  3CMA V;  1BL8 A;  3F5W C;  4HYO A;  1VQ4 V;  1S0V A;  4PA6 A;  1PNM A;  1PL0 A;  1PKX A;  4WFE A;  1CEZ A;  3E8B A;  1VQ5 V;  4QIW F;  3FB5 C;  3VBB A;  2Z3Y A;  3K79 A;  1N8R W;  2QEX V;  4L87 A;  2ZXW B;  3GWO A;  4PDR A;  2X6B A;  3ZN0 A;  1QBZ A;  4QPK A;  3KG2 A;  2X6C A;  4BIU A;  2HG5 C;  2OTL V;  1FXH A;  1L1F A;  3OE7 G;  2PI4 A;  3ASN B;  2DQ0 A;  4RO2 A;  3I55 V;  1V54 B;  3ZRS A;  3K3W A;  4RUF A;  1M56 C;  5LHI A;  2X0L A;  1YHQ V;  3HPL C;  2B5U A;  4UVA A;  1NBM G;  3OR6 C;  3MD0 A;  3MHS C;  3ASO C;  1F23 A;  3QNE A;  3TK1 A;  1K73 W;  1H8E G;  2XOK G;  5H6R A;  4DXW A;  1F51 A;  1NR1 A;  1P7B A;  3LUT B;  4PDL A;  5B1A C;  3QO5 A;  1JCH A;  2EZP A;  3LSQ A;  1QR8 A;  5B3S B;  2WLM A;  3SYA A;  3CCJ V;  3STL C;  3K04 A;  1AI4 A;  3FB7 C;  2P90 A;  1JOY A;  3ABL B;  1E1R G;  4FPP A;  4GX2 A;  5L3E A;  1YIT V;  4TT3 G;  1OCO B;  2XAF A;  2YEV A;  3RVZ A;  1WLE A;  1VQ8 V;  3OMN B;  1JJ2 U;  1XL4 A;  1EBO A;  4RQE A;  2C2A A;  1YI2 V;  3FB8 C;  2EIJ B;  4ASU G;  1AR1 B;  3ZRW B;  4I5S A;  4ZBM A;  5B3S C;  4MTO A;  1RM1 B;  3ZJZ A;  5L3C A;  2B1G A;  2M7W A;  3K9A A;  5EBL C;  1EZJ A;  3ABK B;  3SYP A;  1WPX A;  2A0L A;  3ML0 A;  5L3F A;  5IYD O;  2Y69 B;  2IJH A;  4Q20 A;  5L3D A;  3X2Q B;  2ZR3 A;  2ZDI A;  2XND G;  4OXS A;  1CP9 A;  2X7R B;  1ROP A;  4MVR A;  3E8G A;  3SYO A;  3CXC U;  1KD1 W;  2EIK C;  2MK3 A;  3CCV V;  3TET A;  5LGU A;  2W6I G;  3T2M A;  3FB6 C;  3VOU A;  4H37 A;  3JYC A;  3K0G A;  1K3E A;  2DWE C;  4U7O A;  5KA5 A;  2Y69 C;  2ZD9 A;  4FJC C;  3TCU A;  1VQL V;  5EBW C;  2HKO A;  3CD6 V;  5IDJ A;  1QVF U;  3FKS G;  3PJS K;  1R3J C;  2WLH A;  4UXN A;  5KA6 A;  1GM8 A;  1I5X A;  1GM7 A;  3ABM C;  1M56 B;  3W7S A;  3JD1 A;  2EIJ C;  5LBQ A;  4LC1 A;  1FS0 G;  3B77 A;  1VQ6 V;  2QM8 A;  4XBF A;  4UUJ C;  5GW7 A;  1VQM V;  5DN6 G;  4X8A A;  3QO8 A;  4P2Z A;  4MVZ A;  1K9M W;  2AHY A;  1S77 D;  1M90 W;  1M9N A;  1FXK B;  3W7U A;  1NH2 B;  3I56 V;  2R9R B;  1P4R A;  5B1A B;  3X2Q C;  5B1O A;  1VQ9 V;  3BY6 A;  3CP1 A;  4LBE C;  4CBC A;  4MVU A;  1Y66 A;  4FIP C;  3P32 A;  4UVB A;  1W2B U;  2ITC C;  2QM7 A;  3SPG A;  3H01 A;  2JDI G;  3E86 A;  3CPW U;  3RW0 A;  2DYS C;  3OMA B;  2W0F C;  4GX5 A;  5LGN A;  2JJ2 G;  4N23 A;  4E2L A;  4GX0 A;  1ZWI C;  1PD3 A;  4WCE V;  1R6K A;  3CC4 V;  3W7X A;  1GK9 A;  2XAQ A;  2WLN A;  4XDK A;  1Q86 W;  3T4D A;  1LNQ A;  2YEV B;  1UJW B;  4KP4 A;  1RPR A;  2IU3 A;  1M1K W;  3ABK C;  4MS2 A;  4PA3 A;  2EIN B;  3ZMT A;  1BMF G;  5E1A C;  1S72 V;  4JF3 A;  2DYS B;  1VQK V;  4MVM A;  1CPY A;  1AI6 A;  3ETG A;  1QLE C;  2JEU A;  2OTJ V;  4X88 A;  4PA4 A;  1YSC A;  4WFF A;  1F4M A;  2EIK B;  1OHH G;  2IH1 C;  2WLI A;  3ZCC A;  2V1D A;  3IFX A;  3OW2 U;  3ZIA G;  5HFL A;  3ZN1 A;  3T1C A;  1NQT A;  1MOF A;  4UV8 A;  1RM1 C;  1OCR B;  3AG1 C;  3ASN C;  4PEL A;  2XAJ A;  1BHA A;  3F7Y C;  5KUK A;  2WPD G;  5FL7 G;  2HJF C;  2QKS A;  4WFG A;  3OUF A;  2GSM B;  4MTX A;  1R3I C;  4N21 A;  4WFH A;  3B8M A;  1JQ0 A;  1FFT B;  3WG7 B;  5CN0 A;  3JD2 A;  3CCL V;  4PDV A;  2DW4 A;  3E35 A;  3LDC A;  3JD4 A;  4I9W A;  2HFE C;  1GMG A;  4RAI A;  1NH2 D;  5LGT A;  1K8A W;  4UVC A;  4GT1 A;  1E1Q G;  2OCC C;  5IY5 C;  2P67 A;  5EK0 A;  4FK5 C;  1GTO A;  2DWD C;  2IW5 A;  3ABU A;  1OZ0 A;  4JTA B;  1V55 C;  3CCS V;  1Q7Y W;  3OMI B;  1ENV A;  3SYQ A;  1MG1 A;  3ZRV A;  1AI7 A;  4JTD B;  2BOC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...