3FB7C

Open kcsa potassium channel in the presence of rb+ ion
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
89
structure length
89
Chain Sequence
WRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody fab fragment heavy chain
publication title Open KcsA potassium channel in the presence of Rb+ ion
rcsb
source organism Streptomyces lividans
molecule tags Membrane protein/metal transport
total genus 24
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2008-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3fb7C00
2DWDC 4HYOA 3SYCA 5CBHA 4WFFA 5EBLC 3T4ZA 1K4DC 4F4LA 1V54C 4P9OA 2EILC 3LDEA 1KKDA 3SPIA 2EIJC 4PDLA 3K0DA 4QNHB 4MSWC 4RUEA 2AHZA 2HG5C 4QE7A 2WLMA 4R8CA 5BZBA 1OCOC 5CBFA 2ITCC 4GX1A 4PDVA 2WLLB 3T1CA 4PA6A 3SYAA 4UUJC 4JTAB 5B1BC 4P30A 2WLIA 2AHYA 4GX2A 3ASOC 1ZWIC 3LNMB 4OXSA 2QKSA 3RW0A 3F7VC 5B1AC 3EFFK 4MVSA 1JVMA 4EKWA 4X89A 1BL8A 3LUTB 3F7YC 3SJQC 4P2ZA 3WG7C 2YEVA 4G28B 2NLJC 4LCUC 4X8AA 4H37A 1S5HC 2HJFC 2KB1A 3F5WC 3SYPA 5B3SC 2X6AA 1OCCC 2HVKC 1QLEC 2WLKA 2BOBC 4J9YB 2WLIB 3LDCA 2EIMC 3SPJA 2DYSC 5KUMA 4R7CA 5EC1C 3E8BA 2DWEC 2IH3C 3ZJZA 2X6CA 3FB6C 4G27B 4QE9A 3K04A 4TWKA 5CBGA 3AG2C 2Q6AA 1XL6A 3VOUA 4ZBMA 3AG3C 3ZRSA 4MW3A 4MVRA 3SPGA 3AG4C 4XDKA 1G4YB 2HFEC 3RBZA 3ABLC 4P9PA 1LNQA 5IY5C 2JK5C 5J9PC 2EINC 4LP8A 4GX5A 1P7BA 1R3LC 2WLHA 3OR7C 5EK0A 5E1AC 3SYOA 1R3JC 3RVZA 3K0GA 4XDLA 3E89A 4MVZA 3SYQA 3K06A 4HZ3A 3T4DA 2H8PC 2P7TC 4PA7A 1V55C 2ATKC 3T2MA 2ITDC 3STLC 2HVJC 3HPLC 3K08A 2R9RB 5EBMC 4MVMA 1M57C 4MVQA 4PA9A 2Y69C 3IFXA 4MVUA 2ZD9A 3E86A 3FB7C 4PA3A 4R6ZA 2WLJA 4MTOA 3STZC 2Q69A 3E8GA 3UM7A 3AG1C 4RAIA 1OCZC 4WFEA 2WLNA 2IH1C 4H33A 4WFHA 3SPCA 2K1EA 3OR6C 4DXWA 4PDMA 2ZXWC 1R3KC 3OUSA 1R3IC 3UKMA 3E83A 3R65A 4PA4A 2DYRC 3IGAC 4RUFA 2A79B 4X88A 5EC2C 2Q68A 4MTGA 4JTDB 2EIKC 4JTCB 4WFGA 1K4CC 3ABMC 3JYCA 4MTFA 2X6BA 3SPHA 3E8FA 1ORQC 3RVYA 3ASNC 3KG2A 4RO2A 4R50A 3FB5C 2A0LA 2OCCC 4J9ZB 3BEHA 3LDDA 3ABKC 3K03A 4KFMA 4BW5A 4PDRA 5EBWC 2QTOA 2BOCC 3OUFA 2WLLA 4GX0A 4LBEC 3X2QC 1OCRC 1XL4A 2W0FC 3E8HA 3PJSK 1M56C 4MVOA 4MS2A 5KUKA 4XDJA 2Q67A 3FB8C 3OGCC 4I9WA 1J95A 4MW8A 3TCUA 3TETA 4CBCA 2A9HA 3GB7C
chains in the Genus database with same CATH superfamily
1X59A 3W7WA 5CBHA 5CN0A 4DV0O 2Q0OC 5FPOA 1KP2A 2ZIOA 3K0DA 3FYEB 4QNHB 2WA3A 5KMGA 1L0NH 2EJRA 1WPBA 3IJ4A 2E5LO 2ZE8A 4GX2A 2OTLV 4FLTA 1RFYA 2BSKB 2ZINA 5B1NA 3OMAB 3ETGA 2ZR3A 2RCVA 2NLJC 4C7UA 1JA8A 3SGIA 3U10A 3LSUA 1QLEC 4X20A 2JVDA 1SETA 4TV8B 3T1HB 1VIBA 2OCHA 3FD9A 3UT5B 2QM7A 3K04A 2KKWA 4J80A 4XDKA 2PYLA 2HKOA 3CCEV 3ZRVA 4DR4O 4K8ZA 1MZFA 4ZI7B 2HJDA 3OR7C 1FJGO 5KHHA 2L35A 5LYJA 3ZRWB 3SYQA 4JI2O 1R6TA 3K57A 2EULA 1QVGU 1WN7A 2ZE6A 3L70H 2UUCO 2EBOA 4UB6Z 4J10A 3D8CA 2YIDA 4AHCA 2UUAB 1R3KC 2HHHB 1PP9H 1N33B 1A32A 4NR1A 4OPHA 2Q8VA 4X88A 1XHZA 2P5OA 4BW9A 4IL6Z 4FLWA 1WB8A 3Q4HB 5KX5A 1NBMG 1NI8A 2P4KA 4O4LA 4KHPB 4I50A 4LFAB 4BW5A 1M1KW 1HDJA 4LF5O 2ARHA 3DGEA 1N32O 2NN4A 4MS2A 4TOIA 2H3OA 2ADQB 4LF7B 4LWSB 2WWWA 4L8JA 3ZHTA 1AI7A 5E79Z 4DYLA 1V9PA 2CDYA 4U3JA 2E75B 1HR0B 1GN2A 3T1YB 1YJ9V 3BRCA 1Y74A 2YDEA 5CB4B 2AHZA 2ZNIA 1TVKB 3CE2A 1QHTA 2JGDA 3UO2A 1N34B 4K35A 3CXHF 3WB2A 4HNAA 4GLXA 1VF7A 4HAMA 2XAJA 2EZPA 1Q90D 4BR6A 5DECA 3A0RA 3SJQC 3VQXA 2JJ1G 3W7SA 2YEVA 4TUYA 1HW7A 2B9ZA 2W6IG 4J9YB 2QKCA 5EYPB 4WF9V 1Q82W 4DR1O 2F4VO 4GCZA 1PV0A 2RNBA 1GN4A 3CC7V 3HR0A 3CP1A 3ZHSA 1Q8IA 3HKEA 2OTJV 3SYOA 2LW7A 2YUAA 4TT3G 3E35A 2HEPA 1JPXA 4CC6A 3STLC 1JR9A 2F1MA 4GYCB 1IURA 3STZC 3B77A 4LF8O 2WLJA 4MTOA 3E8GA 2YIAA 2E76B 4X66O 1F51A 3J7AU 3R65A 1I94B 1NVPB 1I5XA 4JTCB 5KHJA 3RYFB 3ZMZA 1CEZA 4X62B 1DK1A 4O4IA 1NTZH 2A0LA 1GM9A 4U7NA 5J2TA 1LUVA 2BOCC 2DE0X 4LBEC 3EVKA 1AVMA 5IWAO 4AQYO 1G1XB 2E3CA 3JATB 5EBLC 4F4LA 1T5EA 4RQEA 1P4RA 3LDEA 4I55B 4FLVA 4LF4O 2WLMA 4GUNA 4NVPA 2GUZA 4Q20A 1WAZA 4QGPA 4BIUA 4I4TA 1M93A 2Q5ZA 2RDCA 4X89A 1BL8A 1AROP 1Y66A 1Q86W 4P2ZA 3TJTA 4UV9A 4JASA 2CAZC 3F5WC 4FM1A 4J7JA 2ZNJA 3H01A 3ZHVA 1N36B 4DR7O 4DK0A 4J41A 3A0BZ 3RYIA 1YIJV 4TWKA 2EINB 2Q6AA 1PL4A 2UXXA 1JJ2U 2N05A 5CA0B 2A3QA 5LOVB 5LGTA 1TAEA 4DUYO 1W59A 4P9PA 5IY5C 2EINC 1KMIZ 4PJ0Z 4GX5A 3K5MA 1CP9A 1NTKH 2NNUA 3A8TA 4LFCB 4DV6B 3LSQA 2HVJC 4LF6O 2PI4A 3AK3A 4WFEA 2B1GA 2DOSA 4FK5C 2XT9A 1HNZB 3QVNA 4X1IB 1VQ7V 5F2VO 2QR4A 5DM6V 1ZTEA 2AZ2A 2KG7B 3TXSA 3RVYA 2GBOA 1K5QA 2JS5A 4R50A 3FB5C 3T1HO 1H8HG 2IJIA 4DR2B 3VBBA 5IJ9B 2YI8A 4GX0A 3WU2Z 1URFA 4XDJA 1OCCB 1I7FA 4X1KA 5LBQA 3D3QA 2IM9A 5A9GA 3L72H 4JI8O 1KD1W 1IZ3A 2LP7A 1E1RG 2XNDG 1QR8A 3C90A 1B06A 1ZWIC 3LNMB 3VQWA 1YI2V 2FTKA 5B3SB 5K1XA 2UUAO 2P22C 2HHHO 1N33O 1AR4A 4DR4B 2JIZG 1R1BA 5B3SC 3CYOA 4PD4F 4B3MB 4KHPO 2E74B 2P4VA 5LP6A 1IBMB 2ZXWB 4LFAO 2UUCB 3B09A 1UPGA 2EIKB 3GWOA 2XAHA 4LF7O 3ABMB 3ABLC 4UCVA 3BA9A 3MHHC 1HR0O 2AW9A 3T1YO 1ENVA 2R70A 4FIPC 3CS5A 2PTMA 2GHYA 1EZVH 1JMKC 4PA3A 3ZN1A 1N34O 3UM7A 2Q69A 1QVFU 1GM7A 3E22B 4DV7B 2K1EA 4O2BA 5KHGA 5JJJB 4IHJB 3ZS8C 2F23A 1Y76B 4GKJB 4GZRB 3H1LH 2X6BA 1S76D 1VQPV 4KFMA 2VRZA 3JD0A 3E2EA 4FFKA 1M56C 5IJ0A 5KUKA 1RSOA 3I5DA 4B7EA 2PY5A 4HBNA 5KMGB 1WPXA 3SYCA 2ZM6B 3SPIA 2EIJC 2BTOA 3IC9A 2XTAA 3AG2B 3CMEV 1YZBA 1Z5WA 3SYAA 4UUJC 4ZOLA 4P30A 2YIBD 3O9OA 5HFLA 4O4JB 5CMUA 4DR1B 5KHKA 1H38A 1THZA 3NR7A 3LUTB 2VQFB 3TK1A 1I94O 2QDOA 3OMIB 1QLNA 1KB9F 2WLIB 4X62O 2F95B 5JH7A 5IDJA 2F43G 2MW2B 2DWEC 3RT3C 4LF8B 3BABA 3CRRA 3JAMN 2JGUA 1G4YB 5JJEB 5LYJB 2LW1A 4X66B 2JK5C 5ITZA 3G4SV 1R3LC 4B3TO 4FZ1A 5JCOC 4JI1O 4K3AA 4FLXA 5KA6A 2ZD9A 3AK2A 1JQ0A 1WNSA 5IYZA 3RYCA 4BIOA 5J2UA 2EILB 3KCYA 3OEEG 1PNMA 4PDMA 4AQYB 1F7YA 2P06A 5KX5B 2DYRC 3SJBC 2JJ2G 5B1BB 4O4LB 3D3IA 1VQ8V 3ABKB 4F6EA 1GKFA 3QO7A 1K4CC 2Y0PA 4MTFA 4QJFB 1N36O 2Q7HA 3ABKC 1M5IA 3WG7B 2VWJA 4I0XA 3QG5A 2W0FC 1AR5A 4MVOA 4AILC 1V54B 4U3JB 3L73H 3CCRV 1Y74B 3RWRD 1VP7A 2WA4A 1V54C 1FKAO 2VS0A 1N0JA 2ZDIC 1XMOO 2V4DA 3MAQA 1DLBA 4ZHQB 4DV6O 2JRIA 5BZBA 1SQQH 1L0LH 3QTCA 4NTXA 1AP5A 4FVMA 3HKDA 2UXCO 2YEVB 1BGYH 1NU1H 3OTFA 2QJ1A 1HNZO 3ZBHA 1XBLA 3F7YC 1EFRG 3JARA 1OV9A 2WLKA 1Q81W 2BOBC 4LFBO 1NVPD 4ASUG 4LF6B 2YICA 4FZ0A 4DR2O 3MD0A 1EN6A 2X6CA 4NXMB 4JYBA 1KC8W 4DUZO 1R6NA 4JI3B 1EM1A 4FJCC 2BE3A 2RMKB 2OCCB 3JSLA 1K33A 4U3FH 2R9IA 3T4DA 2Q7GA 1SF9A 3K08A 4WBNA 1S3JA 4PA9A 1NT2B 2Z5UA 1VF6A 4GKKO 4W4KA 2IH1C 2QWNB 5L3DA 1XOUA 2G38A 4O4IB 4MTGA 4TV9A 1H2LA 5J2TB 2Q73A 4JI8B 4B3MO 3ZHQA 1IBMO 1MG1A 5LHIA 1SQVH 2LFSA 1H2MA 5DEDA 3TCUA 2PGGA 3GB7C 3SJAC 2GUZB 2XOKG 2MK3A 4QIWF 1VF5B 1FPOA 4F6RA 4J11A 3AG3B 4I4TB 4DW1A 3CC4V 1K7DA 2OT5A 1QCEA 4FFBB 1SA0A 4DV7O 4UVCA 2UXNA 4Z2WA 4JF3A 1ZL8B 1YXBA 1NQTA 2WSSG 4CS3A 2UU9O 1H2SB 2XAQA 1V55B 1KQSU 1FFXA 1IVSA 4KP4A 2PZSA 5B1OA 2ZKOA 4GKJO 2JS3A 1N4CA 1Q6IA 5B5EZ 1WA8A 5BMVB 3JAWA 5JQGA 3D36A 3M8AA 3L71H 2QA4V 2PUSA 4QE9A 1B04A 4ZBMA 2LO1A 3ZRSA 3CSXA 4Z1MG 1EBOA 3P30A 4JI6B 2ZE7A 5EK0A 2ZM6O 4B7KA 2UXBO 4HZ3A 4N23A 2H8PC 5FNVA 3T2MA 3EXAA 3G6BA 1R6KA 3CX5F 1KU9A 2JEUA 1GH6A 1TUBA 3H1HH 2QKAA 3JALA 5BR8B 1IBKO 1VQ6V 5L3CA 1WB7A 4MT8A 1RPRA 3OUSA 1M90W 4CS2A 2C2AA 2VQFO 3W7XA 4UVAA 2HP8A 2JEXA 2XAFA 4RWUA 2F66C 1D2DA 4O4HA 2IU3A 2M7WA 3G67A 5HFMA 3RN4A 4X1KB 4WFAV 2WAMA 3RYHA 1P84F 4H13B 1XUQA 5LXTB 2Q67A 3OGCC 4O2AA 4CBCA 1IXMA 3ZMTA 3PN1A 4DW0A 4HYOA 1P7GA 4JZ2A 1KKDA 1VQ5V 4UVBA 3JAKA 1YEWA 3OGIB 4QE7A 2A7WA 5L3GA 4PDVA 1EN5A 2DN9A 1L8DA 2EX3A 4JTAB 3B40A 2EZOA 5L3FA 3CB2A 3OM3B 2AHYA 4X65O 2QKSA 1BSMA 3S3WA 4XBFA 1N8RW 2H94A 3QO8A 1KKCA 2Y69B 1BHBA 5LP6B 4B3TB 4YXWG 4ZI7A 4JI1B 5KUMA 3N2GA 3HKBA 1H2NA 5IE9A 4DR3B 1KP3A 5LMUB 3ZMUA 2ZQMA 2QEXV 1GM8A 4WCEV 1YITV 1M57B 4MVZA 1SQBH 5H2FZ 2A06H 2CTWA 4EB6A 1M57C 4R6ZA 4O2BB 5KAIZ 2RQ6A 2CGNA 3OR6C 5LA6A 2GTAA 1R3IC 1AI6A 1OCOB 1ZAUA 4PA4A 3ZCCA 1HP8A 4LWSA 4JTDB 4QPJA 2PI5A 3H1IH 1GO3F 1Q6HA 4JI7B 3ASOB 1XMOB 1SESA 4YJ2B 2PF4E 4D7TA 3N2KA 3LDDA 1SZTA 4UFZA 1VARA 5H6QA 1DGSA 1TVKA 4NXMO 1M4UA 1WP8A 1XEQA 2UXCB 4JI3O 5CA1B 2DYSB 3APQA 4ZOLB 3W7TA 5GW7A 1VQMV 4JI0B 2Y0IA 2WLLB 4LFBB 3AG4B 1Q3EA 1Y67A 1BE3H 3WFVA 2P67A 1BQ0A 2Y48A 4DUZB 1Q5OA 1JVMA 5EYPA 3ETQA 1DTOA 1MOFA 3CXCU 4TQDA 4CS4A 3H1JH 3LNNA 1JOYA 1LR1A 1OCCC 2Z0AA 1O9HA 1OCZB 4DO2A 1SQGA 4JYYA 3IC7A 4IIJA 4B3SO 3CHXA 2ZR2A 1CPYA 2Q0AA 2CTQA 4PHZA 3ZJZA 3FB6C 4GKKB 1WLEA 1AJNA 2QWQB 4MW3A 5ITZB 4FLYA 3RBZA 2IJKA 3I55V 4FLZA 5J9PC 3G71V 4LP8A 4KL1A 2P7TC 3RYCB 4UB8Z 5J2UB 3OD4A 5IYDO 2ADPA 2YC0A 5C8YA 4CZZA 5TISZ 1X4TA 4KUMA 3SPCA 2P6JA 2QGNA 2ZXWC 1E1QG 4LR3A 2UXDB 3J80N 1N0NA 1KBHA 1WP7A 2BTQA 3B8MA 2EIKC 3ZMSA 1GMGA 4ZIBA 3ABMC 3L74H 1RP3B 3KG2A 1CXZB 3RFRA 4J9ZB 1XNQO 2QTOA 3DSQA 1JJOA 4JGSA 3DXRA 3FB8C 3TETA 4FM2A 3JASA 2ZIMA 3UQ8A 2UU9B 4X1YA 1FXKB 4JI6O 3ETEA 2AGAA 4DRXA 2D2CB 2HLDG 3M99B 3CWBH 4RUEA 3HKDB 2V1DA 1FXKC 4R8CA 4PV1B 3T1CA 3CCJV 1MMMA 1RPOA 1SQPH 1BCCH 1JFFA 5BR8O 3CCSV 3JARB 1H2GA 1PD3A 1F4MA 4DR5O 1K73W 3K5NA 2AXTZ 3DTUB 4H37A 5LOVA 4JYAO 2DW4A 1G6UA 2UXBB 1NH2B 3ZHRA 2QSAA 2XASA 1SERA 2CUGA 4UCRA 3ZIAG 3AG2C 5JVDA 4LC1A 3U11A 1GN6A 4MVRA 1IBKB 4DV4B 5D5QA 2QM8A 2O57A 1S5JA 4X20B 1COWG 4OX9O 1HNXB 2PYJA 5L3BA 1VQKV 3HKCA 5LHHA 4PA7A 2ATKC 3U0ZA 3O65A 3E86A 2KG7A 4JAVA 3JD3A 4X64B 3CD6V 2YXHA 4TV9B 1B3QA 1QR9A 1B6QA 1G8MA 4ZKIA 4YJ3A 5H9CA 3IGAC 4L87A 4H44B 5DN6G 2ZE5A 5LMNO 1K34A 1OCRB 4KXRA 5B1AB 5GTIZ 1XREA 3CRCA 4W4LA 4YIPA 1OCRC 4DR3O 4X65B 5LMUO 1IXBA 1QBZA 4DV5B 2QE7G 3CRMA 4F6RB 3FYIB 4UV8A 3T4ZA 3CCMV 2EILC 4DV1O 4PDLA 4I50B 5CBFA 1SA0B 3FAVA 3OW2U 5B1BC 1BHAA 1FFXB 1YHQV 1Q43A 4UCUA 1P49A 1AI5A 3SR2C 3L75H 1WA8B 1PKXA 3H1KH 3WG7C 4YY3B 5JQGB 1MSDA 1S5HC 3SYPA 3R66A 2JGDB 4JI7O 2LQTA 3SPJA 4HNAB 1GN3A 2EJ7A 5EC1C 4FM0A 2IH3C 5EZYA 1XL6A 2OWOA 4LH7A 1VEWA 1KECA 3SPGA 4TUYB 1AJQA 4LH6A 3E22A 5FNVB 4CH5A 4D6TH 1Q6UA 1R3JC 4EFBA 2R9AA 4JI0O 4OGQB 4NYKA 1TUBB 3JALB 4QPKA 3K9SA 1AI4A 1RM1B 3K9AA 2P90A 3ML0A 1JCHA 3OFNG 2CGOA 3JD4A 3HKEB 2ZT9B 4UXNA 3UKMA 3E83A 4LF9B 3B8NA 4RUFA 4O4HB 3AG7A 3BVOA 1ROPA 4JZGA 4WFGA 3RYHB 4IYIA 1K9MW 4IYHA 2VQEO 3JCUZ 3H9VA 2OCCC 2YS8A 4O2AB 4PDRA 1BQZA 2FKXA 3S3XA 2LJ2A 3SDLA 1ZSPA 1D5AA 2FL4A 1XMQO 2K9PA 1QLEB 1Y6XA 2Q4PA 4EFEA 4O4JA 1ZUQA 2F93B 3JAKB 3ABUA 4DR6B 3CPWU 3OT7A 4MSWC 1FYJA 2HG5C 1TA8A 5H6RA 4PA6A 4B3SB 1S5LZ 2WLIA 2CH7A 3UO3A 4RQFA 3JSNA 4WFBV 1I0HA 4OXSA 2YSUB 4NTWA 5LHGA 1YCIA 3EFFK 1TUEB 3CJHA 1PNKA 1R73A 2UXDO 3K5OA 1JX9A 1MABG 3N2GB 5JCOA 3HKBB 2NR5A 4B08A 3SJCC 5JWPA 1VQ9V 5CBGA 1H2KA 2YXYA 4FMTA 3AG3C 1HNWO 4JV5B 1LUWA 1J5EB 5A2QN 2RN9A 4UCTA 3P32A 4K0KB 5B66Z 2YI9A 4OPAA 4EB6B 4B3RB 3K06A 4LNUA 1V55C 3VQVA 3RYIB 1ZX3A 4MVMA 4MVUA 5LA6B 1XNQB 1WJZA 2ILMA 4WFHA 3VQYA 4DXWA 3OEHG 3N27A 1BMFG 5GONA 2YXLA 3I56V 3ASNB 4AI8A 1YTFD 2Q68A 2ZDIA 4BWAA 1SKVA 1I5YA 3N2KB 4JI4B 4E2LA 3ASNC 5H5NA 2DQ3A 4J7ZA 4PELA 2UUBO 3K03A 4ZHQA 2XHBA 3FX7A 3OUFA 1YDXA 1KYOF 2FB5A 3CCLV 4DV4O 3BA8A 3CCQV 3TGUH 4Z1VA 4DR5B 1H8EG 1K4DC 3B2EE 1HNXO 2AZ0A 4JYAB 1YVWA 3CC2V 5EIBD 4GX1A 2QWPB 3BHPA 4DV3B 4YHHB 5LL6Y 3WB0A 4D7SA 1FD9A 4FPPA 1VMGA 4DV2O 4BIZA 1KUQA 1YSCA 1QNMA 4EKWA 4X64O 4JI5B 3MHSC 3BPZA 1D5NA 2BSKA 1FFTB 4IIJB 1XILA 2HJFC 4OX9B 1AILA 3G80A 4TQFA 3LDCA 3QF7A 1AB3A 3ZHUA 4TSFG 3F5TA 3ZN0A 1PL0A 2JDIG 1QQCA 4I7ZB 2ZCEA 4NKGB 3A0HZ 2V7QG 1K8AW 3ZMVA 4TV8A 4DV5O 3UT5A 1LNQA 5KA5A 1XQ8A 3UCSC 2OYQA 2KQXA 2WLHA 2RJZA 5E1AC 5BY1A 5C8YB 3AEIA 5LMNB 3QNEA 1VQ4V 2Y69C 3ZRWA 2YIBA 4EEQA 5LP6C 4CH6A 4K8XA 1DF4A 4GT1A 1NR1A 2BTQB 1FXVA 2CTRA 2Q9LA 2IW5A 2M6YA 2QTSA 4UCOA 2CE4A 4YY3O 1OZ0A 1YF2A 1AP6A 3OTOB 3P3NA 3P3PA 5FLXN 4DV1B 2X7RB 3E8FA 1ORQC 5IYCO 3CRAA 3DXRB 2ODMA 3Q4HA 4NXNB 1W0JG 2KSDA 3JASB 1EZJA 5KHIA 1NH2D 1GK9A 4X1YB 1VQNV 4CC5A 3GVMA 2QWOB 5AG2A 1QU7A 1J95A 3K3WA 4FFBA 4DRXB 1U97A 3RGBA 1NKDA 1ZL8A 3ICXA 3ETDA 3W7UA 3CCVV 1IBLB 5C93A 2IU0A 1JFFB 1OCOC 1XNRO 3CMAV 5IJ0B 4I5SA 5CB4A 1IDSA 5IY5B 1E79G 1RSOB 5BMVA 3ASOC 3HB3B 1BZKA 4FLUA 3F7VC 1MSWD 1YJNV 4MTXA 4LF9O 4LCUC 4J7KA 1L1FA 3IAYA 5K1PA 2X6AA 2DYSC 1K3EA 5JVDB 3K58A 1OHHG 4ICGA 1S77D 1VQOV 4U7OA 4CH3A 3K59A 4X9QA 1AR1B 3LSSA 3M7MX 3AG4C 1YTFB 2HR3A 3HKCB 4DR6O 4DV0B 4E4EA 3RVZA 3KZIZ 4NB5A 3E89A 5JH7B 1K92A 1XDCA 4JPRA 2ITDC 1HWYA 2R9RB 4JAUA 2Z3YA 1VQLV 4XDLA 4MVQA 2VQEB 3CEIA 5IYBO 2E5LB 3FB7C 3A2FA 2DQ0A 3L9DA 1OCZC 4YJ3B 1O9GA 2WLNA 3JD2A 5FPRA 1S72V 1BS3A 1XMQB 1GAXA 3THOA 5LXTA 3FFQA 1YJWV 3MDSA 3QO5A 3KKYA 3DC6A 1NTMH 4JAAA 3X2QB 5EIBC 5IYZB 4RO2A 5EBWC 3RYFA 1I08A 2VWKA 5KLVH 3X2QC 1GRJA 2CTPA 4JV5O 3NXSA 2IJHA 4MW8A 1J5EO 1DF5A 3B4SA 4G27B 4K0KO 3EHBB 3FAVB 1F4NA 1Z5VA 1FJGB 4ABMA 4B3RO 3JATA 2CK3G 4JI2B 2ITCC 4I0XB 2N74A 4I55A 4PI2A 3ABLB 2LFRA 4PI0A 1US6A 3K5LA 3RW0A 2QWRB 4MVSA 1MZEA 1HNWB 1Y4MA 2IBZH 4BAYA 4X8AA 2W6JG 3WB1A 2KB1A 5BXZA 1FAFA 1W0KG 3ZEDA 2XAGA 4JI4O 1SC5B 2HVKC 3TXQA 2ETNA 1SQXH 5FL7G 2GDSA 3C3TA 5EZYB 2Q7EA 2IJJA 3E8BA 4LF5B 1U96A 1GTOA 1N32B 1NS1A 5CA0A 1OJHA 2R72A 3K0GA 1SRYA 1SQFA 1M56B 1NR7A 3OAAG 4DV3O 3HPLC 4YHHO 5EBMC 2B5UA 1FXHA 3C3SA 1XI1A 4YJ2A 2UUBB 2GV9A 4RAIA 1SS3A 4Q6GA 2X0LA 4H33A 2EIJB 4JI5O 1TGOA 2A79B 1S0VA 5CA1A 4WBNB 1MNGA 2B1IA 4IT5A 4X1IA 1Z2GA 3SPHA 5LGUA 3BEHA 2XUMA 4G2KA 5CA3A 1UJWB 1VF6C 2WLLA 2F4VB 1XL4A 3E8HA 3PJSK 1Q7YW 3BAAA 4DV2B 3JCZA 3JD1A 2L6LA 2Y4TA 5IJ9A 2A9HA 3APOA 4N21A 2DWDC 4WFFA 4P9OA 3CRQA 1IX9A 2CH7B 5D5PA 2GSMB 3BCCH 3CJHB 4YIOA 3J81N 3CCUV 2QM4A 5IT9N 3ZX6A 3AK1A 2GTSA 4DK1A 1K97A 5B1AC 5LGNA 3FKSG 3G6EV 2BCCH 3DC5A 1FS0G 2EIMB 4G28B 3BFRA 3OTOO 2FMLA 2LGWA 3K79A 2DJVA 2EIMC 2FYUH 3ABTA 1UFIA 4R7CA 4UCSA 3ZRXA 4NXNO 4JYCA 2DYRB 4I9QA 3VOUA 5IWAB 2D3OW 2HFEC 3GWKC 4CH4A 4LNUB 2OIGA 2OIEA 1PM9A 1P7BA 3JAWB 1XHXA 4J42A 1EN4A 1IBLO 3AG1B 4LF4B 5GTHZ 3IFXA 2LGQA 3D36C 2DMXA 1NZ6A 1AJPA 3AG1C 3BY6A 4A5UB 5GONB 2Y4UA 1W2BU 5L3EA 5KAFZ 1SZXA 4IGGA 4NTYA 1PPJH 5EC2C 2WPDG 4IHJA 1ZLZA 3OMNB 3KCXA 4LFCO 1FXKA 1M9NA 2W0XA 3JYCA 1K5SA 1Y76A 2N04A 1PNLA 1XNRB 1F23A 1BT8A 3OE7G 5JJNB 4DR7B 4H0LB 4I9WA 1MA1A 1NJIW 4DUYB 1RM1C
chains in the Genus database with same CATH topology
2DYSB 1H8EG 1WPXA 3W7WA 3SYCA 5CBHA 5CN0A 1K4DC 1KP2A 3SPIA 2EIJC 3W7TA 3CC2V 3K0DA 3FYEB 5GW7A 4QNHB 1VQMV 3AG2B 3CMEV 4GX1A 2WLLB 2EJRA 4UUJC 3AG4B 3SYAA 4FPPA 4P30A 4GX2A 5HFLA 3WFVA 2OTLV 2P67A 5CMUA 2Y48A 4BIZA 5B1NA 1YSCA 3OMAB 1JVMA 4EKWA 1H38A 3ETGA 3MHSC 1THZA 3LUTB 2ZR3A 1DTOA 1MOFA 1FFTB 2NLJC 3TK1A 3CXCU 2HJFC 3OMIB 1JOYA 1QLNA 1OCCC 1QLEC 1OCZB 2WLIB 3LDCA 4DO2A 3IC7A 4TSFG 1SETA 2ZR2A 1CPYA 5IDJA 2F43G 3ZN0A 1PL0A 2JDIG 2DWEC 3ZJZA 3FB6C 2QM7A 3K04A 2V7QG 1K8AW 3ZMVA 1WLEA 1AJNA 4MW3A 4XDKA 1G4YB 2HKOA 3CCEV 3ZRVA 3RBZA 1LNQA 2IJKA 5KA5A 3I55V 2JK5C 5J9PC 3G71V 4LP8A 3G4SV 1R3LC 2WLHA 3OR7C 5E1AC 3ZRWB 3SYQA 3AEIA 2P7TC 1QVGU 3QNEA 1VQ4V 5KA6A 2Y69C 5IYDO 3ZRWA 2ZD9A 2EBOA 4CZZA 1JQ0A 4KUMA 1DF4A 2EILB 1NR1A 4GT1A 1FXVA 3OEEG 3SPCA 2P6JA 1PNMA 2IW5A 4PDMA 2ZXWC 1R3KC 1E1QG 2DYRC 1OZ0A 4X88A 2JJ2G 5B1BB 1VQ8V 3D3IA 3B8MA 2EIKC 3ZMSA 1GMGA 3ABKB 1GKFA 3QO7A 1K4CC 3ABMC 4MTFA 1NBMG 2X7RB 3E8FA 1ORQC 3KG2A 5IYCO 4QJFB 4J9ZB 4BW5A 3ABKC 1M1KW 1W0JG 2QTOA 3DGEA 3WG7B 1EZJA 1NH2D 1GK9A 1VQNV 2W0FC 4MVOA 4JGSA 4MS2A 1V54B 3FB8C 1J95A 3K3WA 3TETA 3CCRV 2WWWA 1AI7A 1FXKB 1NKDA 3ETEA 1V54C 1YJ9V 3ETDA 3W7UA 2ZDIC 3M99B 2HLDG 3CCVV 1DLBA 2AHZA 4RUEA 2V1DA 1FXKC 5C93A 4R8CA 2IU0A 1OCOC 5BZBA 3T1CA 3CMAV 3CCJV 4I5SA 5IY5B 1E79G 1RPOA 3ASOC 3HB3B 2XAJA 4HAMA 3CCSV 2YEVB 2EZPA 3F7VC 1H2GA 1MSWD 3A0RA 1YJNV 1PD3A 1F4MA 3F7YC 4MTXA 3SJQC 2JJ1G 3W7SA 1K73W 1EFRG 2YEVA 4LCUC 3DTUB 4H37A 1L1FA 2DW4A 2X6AA 2WLKA 2W6IG 1Q81W 2BOBC 4J9YB 2DYSC 1NVPD 1NH2B 1K3EA 4ASUG 1OHHG 3MD0A 2XASA 2X6CA 4WF9V 1Q82W 1SERA 1S77D 3ZIAG 1VQOV 3AG2C 4GCZA 4JYBA 1KC8W 4U7OA 4LC1A 1AR1B 3LSSA 4MVRA 3CC7V 1R6NA 3AG4C 1YTFB 2HR3A 2QM8A 3CP1A 4FJCC 2OCCB 2OTJV 3SYOA 1COWG 1K33A 3RVZA 3E89A 5L3BA 2R9IA 4TT3G 1K92A 3E35A 3T4DA 1VQKV 1JPXA 4JPRA 4PA7A 5LHHA 2ATKC 2ITDC 3STLC 3K08A 1HWYA 2R9RB 4JAUA 1S3JA 2Z3YA 4XDLA 4MVQA 4PA9A 1VQLV 5IYBO 2Z5UA 3B77A 3E86A 3FB7C 3STZC 2WLJA 4MTOA 2DQ0A 3E8GA 1OCZC 4JAVA 3JD3A 2WLNA 2IH1C 3JD2A 5L3DA 1S72V 3CD6V 1F51A 1QR9A 1B6QA 1YJWV 1G8MA 4ZKIA 3R65A 3QO5A 3IGAC 5H9CA 1NVPB 4L87A 4MTGA 1I5XA 4JTCB 5DN6G 1K34A 3X2QB 3ZMZA 1OCRB 1CEZA 5B1AB 4RO2A 2A0LA 1GM9A 4U7NA 1MG1A 5LHIA 5EBWC 2LFSA 2BOCC 4LBEC 3X2QC 1OCRC 3NXSA 2IJHA 4MW8A 3TCUA 1QBZA 1DF5A 2QE7G 3GB7C 4G27B 3EHBB 3FYIB 5EBLC 4UV8A 3T4ZA 4F4LA 3CCMV 4RQEA 1F4NA 2XOKG 2EILC 2MK3A 1P4RA 3LDEA 4QIWF 4PDLA 2CK3G 2WLMA 5CBFA 2ITCC 3AG3B 4Q20A 3OW2U 3CC4V 1K7DA 5B1BC 2OT5A 3ABLB 1BHAA 2LFRA 1QCEA 4BIUA 4UVCA 2UXNA 1YHQV 3RW0A 4JF3A 4MVSA 4X89A 1NQTA 2WSSG 1AI5A 1AROP 1BL8A 1Y4MA 1Y66A 2XAQA 1PKXA 1V55B 1KQSU 1Q86W 4P2ZA 3WG7C 4BAYA 4KP4A 4X8AA 2W6JG 4JASA 4UV9A 5B1OA 1S5HC 2KB1A 3F5WC 3SYPA 1W0KG 2XAGA 2HVKC 5FL7G 3SPJA 3H01A 5EC1C 3D36A 2QA4V 2IJJA 3E8BA 2IH3C 4QE9A 1YIJV 4TWKA 1GTOA 2EINB 1XL6A 2Q6AA 2UXXA 1JJ2U 4ZBMA 3ZRSA 1KECA 4Z1MG 3SPGA 5LGTA 1EBOA 1AJQA 4P9PA 5IY5C 3P30A 2EINC 4GX5A 5EK0A 1CP9A 1R3JC 3K0GA 2NNUA 1SRYA 4HZ3A 4N23A 2H8PC 1M56B 3T2MA 3LSQA 1NR7A 3OAAG 2HVJC 3HPLC 5EBMC 2B5UA 4QPKA 1FXHA 1R6KA 1AI4A 2PI4A 1RM1B 2JEUA 3K9AA 2P90A 3ML0A 1JCHA 4RAIA 3OFNG 4WFEA 2B1GA 2X0LA 4H33A 1VQ6V 2EIJB 3JD4A 5L3CA 4FK5C 4MT8A 1RPRA 3OUSA 4UXNA 1M90W 3UKMA 3E83A 1VQ7V 2C2AA 3B8NA 3W7XA 4RUFA 2A79B 1S0VA 4UVAA 1ROPA 4WFGA 2B1IA 5DM6V 2JEXA 2XAFA 1K9MW 3SPHA 3RVYA 1K5QA 2IU3A 2M7WA 5LGUA 4R50A 5HFMA 3FB5C 2OCCC 3BEHA 1H8HG 2IJIA 4G2KA 2WAMA 4PDRA 3VBBA 4WFAV 5CA3A 1UJWB 4GX0A 2WLLA 1XL4A 3E8HA 3PJSK 1Q7YW 4XDJA 2Q67A 1OCCB 3JCZA 1QLEB 3JD1A 3OGCC 5LBQA 4CBCA 2A9HA 1IXMA 3ZMTA 4N21A 2DWDC 4HYOA 3ABUA 4WFFA 4P9OA 3CPWU 1KKDA 1VQ5V 4MSWC 4UVBA 1KD1W 2HG5C 4QE7A 5L3GA 2LP7A 4PDVA 5H6RA 1E1RG 2XNDG 4PA6A 2GSMB 4JTAB 1QR8A 2EZOA 5L3FA 3OM3B 2WLIA 2AHYA 4RQFA 4WFBV 3CCUV 1ZWIC 3LNMB 4OXSA 1YI2V 2QKSA 2YSUB 1K97A 5LHGA 2FTKA 5B1AC 3EFFK 5B3SB 5LGNA 1TUEB 3FKSG 1PNKA 1R73A 3G6EV 4XBFA 1FS0G 2EIMB 1N8RW 1JX9A 2JIZG 4G28B 2H94A 3QO8A 1MABG 2Y69B 1BHBA 5B3SC 3CYOA 4YXWG 3K79A 2EIMC 3ABTA 5KUMA 4R7CA 3ZRXA 2ZXWB 4JYCA 1VQ9V 5CBGA 2DYRB 4FMTA 3VOUA 2EIKB 1KP3A 3AG3C 3GWOA 2XAHA 2D3OW 3ABMB 2HFEC 2ZQMA 3ABLC 3ZMUA 2QEXV 3P32A 1GM8A 4WCEV 1YITV 3MHHC 1P7BA 1M57B 1ENVA 4FIPC 4MVZA 3AG1B 3K06A 1V55C 2GHYA 4MVMA 1M57C 3IFXA 4MVUA 4PA3A 3ZN1A 4R6ZA 3UM7A 2Q69A 1AJPA 3AG1C 3BY6A 1QVFU 1GM7A 4WFHA 2K1EA 1W2BU 3OR6C 4DXWA 3OEHG 5L3EA 1R3IC 1BMFG 1AI6A 1OCOB 4PA4A 3I56V 3ASNB 3ZCCA 5EC2C 1YTFD 2Q68A 2ZDIA 4JTDB 4QPJA 2WPDG 1I5YA 3OMNB 2PI5A 1GO3F 1FXKA 1M9NA 3ASOB 3JYCA 4E2LA 1K5SA 1SESA 2X6BA 1S76D 1VQPV 3ASNC 1PNLA 2DQ3A 4KFMA 1F23A 3LDDA 3OE7G 1SZTA 3K03A 3JD0A 4PELA 3E2EA 5H6QA 3OUFA 1M56C 5KUKA 3CCLV 4I9WA 1NJIW 3CCQV 1RM1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DWD C;  4HYO A;  3SYC A;  5CBH A;  4WFF A;  5EBL C;  3T4Z A;  1K4D C;  4F4L A;  1V54 C;  4P9O A;  2EIL C;  3LDE A;  1KKD A;  3SPI A;  2EIJ C;  4PDL A;  3K0D A;  4QNH B;  4MSW C;  4RUE A;  2AHZ A;  2HG5 C;  4QE7 A;  2WLM A;  4R8C A;  5BZB A;  1OCO C;  5CBF A;  2ITC C;  4GX1 A;  4PDV A;  2WLL B;  3T1C A;  4PA6 A;  3SYA A;  4UUJ C;  4JTA B;  5B1B C;  4P30 A;  2WLI A;  2AHY A;  4GX2 A;  3ASO C;  1ZWI C;  3LNM B;  4OXS A;  2QKS A;  3RW0 A;  3F7V C;  5B1A C;  3EFF K;  4MVS A;  1JVM A;  4EKW A;  4X89 A;  1BL8 A;  3LUT B;  3F7Y C;  3SJQ C;  4P2Z A;  3WG7 C;  2YEV A;  4G28 B;  2NLJ C;  4LCU C;  4X8A A;  4H37 A;  1S5H C;  2HJF C;  2KB1 A;  3F5W C;  3SYP A;  5B3S C;  2X6A A;  1OCC C;  2HVK C;  1QLE C;  2WLK A;  2BOB C;  4J9Y B;  2WLI B;  3LDC A;  2EIM C;  3SPJ A;  2DYS C;  5KUM A;  4R7C A;  5EC1 C;  3E8B A;  2DWE C;  2IH3 C;  3ZJZ A;  2X6C A;  3FB6 C;  4G27 B;  4QE9 A;  3K04 A;  4TWK A;  5CBG A;  3AG2 C;  2Q6A A;  1XL6 A;  3VOU A;  4ZBM A;  3AG3 C;  3ZRS A;  4MW3 A;  4MVR A;  3SPG A;  3AG4 C;  4XDK A;  1G4Y B;  2HFE C;  3RBZ A;  3ABL C;  4P9P A;  1LNQ A;  5IY5 C;  2JK5 C;  5J9P C;  2EIN C;  4LP8 A;  4GX5 A;  1P7B A;  1R3L C;  2WLH A;  3OR7 C;  5EK0 A;  5E1A C;  3SYO A;  1R3J C;  3RVZ A;  3K0G A;  4XDL A;  3E89 A;  4MVZ A;  3SYQ A;  3K06 A;  4HZ3 A;  3T4D A;  2H8P C;  2P7T C;  4PA7 A;  1V55 C;  2ATK C;  3T2M A;  2ITD C;  3STL C;  2HVJ C;  3HPL C;  3K08 A;  2R9R B;  5EBM C;  4MVM A;  1M57 C;  4MVQ A;  4PA9 A;  2Y69 C;  3IFX A;  4MVU A;  2ZD9 A;  3E86 A;  3FB7 C;  4PA3 A;  4R6Z A;  2WLJ A;  4MTO A;  3STZ C;  2Q69 A;  3E8G A;  3UM7 A;  3AG1 C;  4RAI A;  1OCZ C;  4WFE A;  2WLN A;  2IH1 C;  4H33 A;  4WFH A;  3SPC A;  2K1E A;  3OR6 C;  4DXW A;  4PDM A;  2ZXW C;  1R3K C;  3OUS A;  1R3I C;  3UKM A;  3E83 A;  3R65 A;  4PA4 A;  2DYR C;  3IGA C;  4RUF A;  2A79 B;  4X88 A;  5EC2 C;  2Q68 A;  4MTG A;  4JTD B;  2EIK C;  4JTC B;  4WFG A;  1K4C C;  3ABM C;  3JYC A;  4MTF A;  2X6B A;  3SPH A;  3E8F A;  1ORQ C;  3RVY A;  3ASN C;  3KG2 A;  4RO2 A;  4R50 A;  3FB5 C;  2A0L A;  2OCC C;  4J9Z B;  3BEH A;  3LDD A;  3ABK C;  3K03 A;  4KFM A;  4BW5 A;  4PDR A;  5EBW C;  2QTO A;  2BOC C;  3OUF A;  2WLL A;  4GX0 A;  4LBE C;  3X2Q C;  1OCR C;  1XL4 A;  2W0F C;  3E8H A;  3PJS K;  1M56 C;  4MVO A;  4MS2 A;  5KUK A;  4XDJ A;  2Q67 A;  3FB8 C;  3OGC C;  4I9W A;  1J95 A;  4MW8 A;  3TCU A;  3TET A;  4CBC A;  2A9H A;  3GB7 C; 
#chains in the Genus database with same CATH topology
 1X59 A;  3W7W A;  5CBH A;  5CN0 A;  4DV0 O;  2Q0O C;  5FPO A;  1KP2 A;  2ZIO A;  3K0D A;  3FYE B;  4QNH B;  2WA3 A;  5KMG A;  1L0N H;  2EJR A;  1WPB A;  3IJ4 A;  2E5L O;  2ZE8 A;  4GX2 A;  2OTL V;  4FLT A;  1RFY A;  2BSK B;  2ZIN A;  5B1N A;  3OMA B;  3ETG A;  2ZR3 A;  2RCV A;  2NLJ C;  4C7U A;  1JA8 A;  3SGI A;  3U10 A;  3LSU A;  1QLE C;  4X20 A;  2JVD A;  1SET A;  4TV8 B;  3T1H B;  1VIB A;  2OCH A;  3FD9 A;  3UT5 B;  2QM7 A;  3K04 A;  2KKW A;  4J80 A;  4XDK A;  2PYL A;  2HKO A;  3CCE V;  3ZRV A;  4DR4 O;  4K8Z A;  1MZF A;  4ZI7 B;  2HJD A;  3OR7 C;  1FJG O;  5KHH A;  2L35 A;  5LYJ A;  3ZRW B;  3SYQ A;  4JI2 O;  1R6T A;  3K57 A;  2EUL A;  1QVG U;  1WN7 A;  2ZE6 A;  3L70 H;  2UUC O;  2EBO A;  4UB6 Z;  4J10 A;  3D8C A;  2YID A;  4AHC A;  2UUA B;  1R3K C;  2HHH B;  1PP9 H;  1N33 B;  1A32 A;  4NR1 A;  4OPH A;  2Q8V A;  4X88 A;  1XHZ A;  2P5O A;  4BW9 A;  4IL6 Z;  4FLW A;  1WB8 A;  3Q4H B;  5KX5 A;  1NBM G;  1NI8 A;  2P4K A;  4O4L A;  4KHP B;  4I50 A;  4LFA B;  4BW5 A;  1M1K W;  1HDJ A;  4LF5 O;  2ARH A;  3DGE A;  1N32 O;  2NN4 A;  4MS2 A;  4TOI A;  2H3O A;  2ADQ B;  4LF7 B;  4LWS B;  2WWW A;  4L8J A;  3ZHT A;  1AI7 A;  5E79 Z;  4DYL A;  1V9P A;  2CDY A;  4U3J A;  2E75 B;  1HR0 B;  1GN2 A;  3T1Y B;  1YJ9 V;  3BRC A;  1Y74 A;  2YDE A;  5CB4 B;  2AHZ A;  2ZNI A;  1TVK B;  3CE2 A;  1QHT A;  2JGD A;  3UO2 A;  1N34 B;  4K35 A;  3CXH F;  3WB2 A;  4HNA A;  4GLX A;  1VF7 A;  4HAM A;  2XAJ A;  2EZP A;  1Q90 D;  4BR6 A;  5DEC A;  3A0R A;  3SJQ C;  3VQX A;  2JJ1 G;  3W7S A;  2YEV A;  4TUY A;  1HW7 A;  2B9Z A;  2W6I G;  4J9Y B;  2QKC A;  5EYP B;  4WF9 V;  1Q82 W;  4DR1 O;  2F4V O;  4GCZ A;  1PV0 A;  2RNB A;  1GN4 A;  3CC7 V;  3HR0 A;  3CP1 A;  3ZHS A;  1Q8I A;  3HKE A;  2OTJ V;  3SYO A;  2LW7 A;  2YUA A;  4TT3 G;  3E35 A;  2HEP A;  1JPX A;  4CC6 A;  3STL C;  1JR9 A;  2F1M A;  4GYC B;  1IUR A;  3STZ C;  3B77 A;  4LF8 O;  2WLJ A;  4MTO A;  3E8G A;  2YIA A;  2E76 B;  4X66 O;  1F51 A;  3J7A U;  3R65 A;  1I94 B;  1NVP B;  1I5X A;  4JTC B;  5KHJ A;  3RYF B;  3ZMZ A;  1CEZ A;  4X62 B;  1DK1 A;  4O4I A;  1NTZ H;  2A0L A;  1GM9 A;  4U7N A;  5J2T A;  1LUV A;  2BOC C;  2DE0 X;  4LBE C;  3EVK A;  1AVM A;  5IWA O;  4AQY O;  1G1X B;  2E3C A;  3JAT B;  5EBL C;  4F4L A;  1T5E A;  4RQE A;  1P4R A;  3LDE A;  4I55 B;  4FLV A;  4LF4 O;  2WLM A;  4GUN A;  4NVP A;  2GUZ A;  4Q20 A;  1WAZ A;  4QGP A;  4BIU A;  4I4T A;  1M93 A;  2Q5Z A;  2RDC A;  4X89 A;  1BL8 A;  1ARO P;  1Y66 A;  1Q86 W;  4P2Z A;  3TJT A;  4UV9 A;  4JAS A;  2CAZ C;  3F5W C;  4FM1 A;  4J7J A;  2ZNJ A;  3H01 A;  3ZHV A;  1N36 B;  4DR7 O;  4DK0 A;  4J41 A;  3A0B Z;  3RYI A;  1YIJ V;  4TWK A;  2EIN B;  2Q6A A;  1PL4 A;  2UXX A;  1JJ2 U;  2N05 A;  5CA0 B;  2A3Q A;  5LOV B;  5LGT A;  1TAE A;  4DUY O;  1W59 A;  4P9P A;  5IY5 C;  2EIN C;  1KMI Z;  4PJ0 Z;  4GX5 A;  3K5M A;  1CP9 A;  1NTK H;  2NNU A;  3A8T A;  4LFC B;  4DV6 B;  3LSQ A;  2HVJ C;  4LF6 O;  2PI4 A;  3AK3 A;  4WFE A;  2B1G A;  2DOS A;  4FK5 C;  2XT9 A;  1HNZ B;  3QVN A;  4X1I B;  1VQ7 V;  5F2V O;  2QR4 A;  5DM6 V;  1ZTE A;  2AZ2 A;  2KG7 B;  3TXS A;  3RVY A;  2GBO A;  1K5Q A;  2JS5 A;  4R50 A;  3FB5 C;  3T1H O;  1H8H G;  2IJI A;  4DR2 B;  3VBB A;  5IJ9 B;  2YI8 A;  4GX0 A;  3WU2 Z;  1URF A;  4XDJ A;  1OCC B;  1I7F A;  4X1K A;  5LBQ A;  3D3Q A;  2IM9 A;  5A9G A;  3L72 H;  4JI8 O;  1KD1 W;  1IZ3 A;  2LP7 A;  1E1R G;  2XND G;  1QR8 A;  3C90 A;  1B06 A;  1ZWI C;  3LNM B;  3VQW A;  1YI2 V;  2FTK A;  5B3S B;  5K1X A;  2UUA O;  2P22 C;  2HHH O;  1N33 O;  1AR4 A;  4DR4 B;  2JIZ G;  1R1B A;  5B3S C;  3CYO A;  4PD4 F;  4B3M B;  4KHP O;  2E74 B;  2P4V A;  5LP6 A;  1IBM B;  2ZXW B;  4LFA O;  2UUC B;  3B09 A;  1UPG A;  2EIK B;  3GWO A;  2XAH A;  4LF7 O;  3ABM B;  3ABL C;  4UCV A;  3BA9 A;  3MHH C;  1HR0 O;  2AW9 A;  3T1Y O;  1ENV A;  2R70 A;  4FIP C;  3CS5 A;  2PTM A;  2GHY A;  1EZV H;  1JMK C;  4PA3 A;  3ZN1 A;  1N34 O;  3UM7 A;  2Q69 A;  1QVF U;  1GM7 A;  3E22 B;  4DV7 B;  2K1E A;  4O2B A;  5KHG A;  5JJJ B;  4IHJ B;  3ZS8 C;  2F23 A;  1Y76 B;  4GKJ B;  4GZR B;  3H1L H;  2X6B A;  1S76 D;  1VQP V;  4KFM A;  2VRZ A;  3JD0 A;  3E2E A;  4FFK A;  1M56 C;  5IJ0 A;  5KUK A;  1RSO A;  3I5D A;  4B7E A;  2PY5 A;  4HBN A;  5KMG B;  1WPX A;  3SYC A;  2ZM6 B;  3SPI A;  2EIJ C;  2BTO A;  3IC9 A;  2XTA A;  3AG2 B;  3CME V;  1YZB A;  1Z5W A;  3SYA A;  4UUJ C;  4ZOL A;  4P30 A;  2YIB D;  3O9O A;  5HFL A;  4O4J B;  5CMU A;  4DR1 B;  5KHK A;  1H38 A;  1THZ A;  3NR7 A;  3LUT B;  2VQF B;  3TK1 A;  1I94 O;  2QDO A;  3OMI B;  1QLN A;  1KB9 F;  2WLI B;  4X62 O;  2F95 B;  5JH7 A;  5IDJ A;  2F43 G;  2MW2 B;  2DWE C;  3RT3 C;  4LF8 B;  3BAB A;  3CRR A;  3JAM N;  2JGU A;  1G4Y B;  5JJE B;  5LYJ B;  2LW1 A;  4X66 B;  2JK5 C;  5ITZ A;  3G4S V;  1R3L C;  4B3T O;  4FZ1 A;  5JCO C;  4JI1 O;  4K3A A;  4FLX A;  5KA6 A;  2ZD9 A;  3AK2 A;  1JQ0 A;  1WNS A;  5IYZ A;  3RYC A;  4BIO A;  5J2U A;  2EIL B;  3KCY A;  3OEE G;  1PNM A;  4PDM A;  4AQY B;  1F7Y A;  2P06 A;  5KX5 B;  2DYR C;  3SJB C;  2JJ2 G;  5B1B B;  4O4L B;  3D3I A;  1VQ8 V;  3ABK B;  4F6E A;  1GKF A;  3QO7 A;  1K4C C;  2Y0P A;  4MTF A;  4QJF B;  1N36 O;  2Q7H A;  3ABK C;  1M5I A;  3WG7 B;  2VWJ A;  4I0X A;  3QG5 A;  2W0F C;  1AR5 A;  4MVO A;  4AIL C;  1V54 B;  4U3J B;  3L73 H;  3CCR V;  1Y74 B;  3RWR D;  1VP7 A;  2WA4 A;  1V54 C;  1FKA O;  2VS0 A;  1N0J A;  2ZDI C;  1XMO O;  2V4D A;  3MAQ A;  1DLB A;  4ZHQ B;  4DV6 O;  2JRI A;  5BZB A;  1SQQ H;  1L0L H;  3QTC A;  4NTX A;  1AP5 A;  4FVM A;  3HKD A;  2UXC O;  2YEV B;  1BGY H;  1NU1 H;  3OTF A;  2QJ1 A;  1HNZ O;  3ZBH A;  1XBL A;  3F7Y C;  1EFR G;  3JAR A;  1OV9 A;  2WLK A;  1Q81 W;  2BOB C;  4LFB O;  1NVP D;  4ASU G;  4LF6 B;  2YIC A;  4FZ0 A;  4DR2 O;  3MD0 A;  1EN6 A;  2X6C A;  4NXM B;  4JYB A;  1KC8 W;  4DUZ O;  1R6N A;  4JI3 B;  1EM1 A;  4FJC C;  2BE3 A;  2RMK B;  2OCC B;  3JSL A;  1K33 A;  4U3F H;  2R9I A;  3T4D A;  2Q7G A;  1SF9 A;  3K08 A;  4WBN A;  1S3J A;  4PA9 A;  1NT2 B;  2Z5U A;  1VF6 A;  4GKK O;  4W4K A;  2IH1 C;  2QWN B;  5L3D A;  1XOU A;  2G38 A;  4O4I B;  4MTG A;  4TV9 A;  1H2L A;  5J2T B;  2Q73 A;  4JI8 B;  4B3M O;  3ZHQ A;  1IBM O;  1MG1 A;  5LHI A;  1SQV H;  2LFS A;  1H2M A;  5DED A;  3TCU A;  2PGG A;  3GB7 C;  3SJA C;  2GUZ B;  2XOK G;  2MK3 A;  4QIW F;  1VF5 B;  1FPO A;  4F6R A;  4J11 A;  3AG3 B;  4I4T B;  4DW1 A;  3CC4 V;  1K7D A;  2OT5 A;  1QCE A;  4FFB B;  1SA0 A;  4DV7 O;  4UVC A;  2UXN A;  4Z2W A;  4JF3 A;  1ZL8 B;  1YXB A;  1NQT A;  2WSS G;  4CS3 A;  2UU9 O;  1H2S B;  2XAQ A;  1V55 B;  1KQS U;  1FFX A;  1IVS A;  4KP4 A;  2PZS A;  5B1O A;  2ZKO A;  4GKJ O;  2JS3 A;  1N4C A;  1Q6I A;  5B5E Z;  1WA8 A;  5BMV B;  3JAW A;  5JQG A;  3D36 A;  3M8A A;  3L71 H;  2QA4 V;  2PUS A;  4QE9 A;  1B04 A;  4ZBM A;  2LO1 A;  3ZRS A;  3CSX A;  4Z1M G;  1EBO A;  3P30 A;  4JI6 B;  2ZE7 A;  5EK0 A;  2ZM6 O;  4B7K A;  2UXB O;  4HZ3 A;  4N23 A;  2H8P C;  5FNV A;  3T2M A;  3EXA A;  3G6B A;  1R6K A;  3CX5 F;  1KU9 A;  2JEU A;  1GH6 A;  1TUB A;  3H1H H;  2QKA A;  3JAL A;  5BR8 B;  1IBK O;  1VQ6 V;  5L3C A;  1WB7 A;  4MT8 A;  1RPR A;  3OUS A;  1M90 W;  4CS2 A;  2C2A A;  2VQF O;  3W7X A;  4UVA A;  2HP8 A;  2JEX A;  2XAF A;  4RWU A;  2F66 C;  1D2D A;  4O4H A;  2IU3 A;  2M7W A;  3G67 A;  5HFM A;  3RN4 A;  4X1K B;  4WFA V;  2WAM A;  3RYH A;  1P84 F;  4H13 B;  1XUQ A;  5LXT B;  2Q67 A;  3OGC C;  4O2A A;  4CBC A;  1IXM A;  3ZMT A;  3PN1 A;  4DW0 A;  4HYO A;  1P7G A;  4JZ2 A;  1KKD A;  1VQ5 V;  4UVB A;  3JAK A;  1YEW A;  3OGI B;  4QE7 A;  2A7W A;  5L3G A;  4PDV A;  1EN5 A;  2DN9 A;  1L8D A;  2EX3 A;  4JTA B;  3B40 A;  2EZO A;  5L3F A;  3CB2 A;  3OM3 B;  2AHY A;  4X65 O;  2QKS A;  1BSM A;  3S3W A;  4XBF A;  1N8R W;  2H94 A;  3QO8 A;  1KKC A;  2Y69 B;  1BHB A;  5LP6 B;  4B3T B;  4YXW G;  4ZI7 A;  4JI1 B;  5KUM A;  3N2G A;  3HKB A;  1H2N A;  5IE9 A;  4DR3 B;  1KP3 A;  5LMU B;  3ZMU A;  2ZQM A;  2QEX V;  1GM8 A;  4WCE V;  1YIT V;  1M57 B;  4MVZ A;  1SQB H;  5H2F Z;  2A06 H;  2CTW A;  4EB6 A;  1M57 C;  4R6Z A;  4O2B B;  5KAI Z;  2RQ6 A;  2CGN A;  3OR6 C;  5LA6 A;  2GTA A;  1R3I C;  1AI6 A;  1OCO B;  1ZAU A;  4PA4 A;  3ZCC A;  1HP8 A;  4LWS A;  4JTD B;  4QPJ A;  2PI5 A;  3H1I H;  1GO3 F;  1Q6H A;  4JI7 B;  3ASO B;  1XMO B;  1SES A;  4YJ2 B;  2PF4 E;  4D7T A;  3N2K A;  3LDD A;  1SZT A;  4UFZ A;  1VAR A;  5H6Q A;  1DGS A;  1TVK A;  4NXM O;  1M4U A;  1WP8 A;  1XEQ A;  2UXC B;  4JI3 O;  5CA1 B;  2DYS B;  3APQ A;  4ZOL B;  3W7T A;  5GW7 A;  1VQM V;  4JI0 B;  2Y0I A;  2WLL B;  4LFB B;  3AG4 B;  1Q3E A;  1Y67 A;  1BE3 H;  3WFV A;  2P67 A;  1BQ0 A;  2Y48 A;  4DUZ B;  1Q5O A;  1JVM A;  5EYP A;  3ETQ A;  1DTO A;  1MOF A;  3CXC U;  4TQD A;  4CS4 A;  3H1J H;  3LNN A;  1JOY A;  1LR1 A;  1OCC C;  2Z0A A;  1O9H A;  1OCZ B;  4DO2 A;  1SQG A;  4JYY A;  3IC7 A;  4IIJ A;  4B3S O;  3CHX A;  2ZR2 A;  1CPY A;  2Q0A A;  2CTQ A;  4PHZ A;  3ZJZ A;  3FB6 C;  4GKK B;  1WLE A;  1AJN A;  2QWQ B;  4MW3 A;  5ITZ B;  4FLY A;  3RBZ A;  2IJK A;  3I55 V;  4FLZ A;  5J9P C;  3G71 V;  4LP8 A;  4KL1 A;  2P7T C;  3RYC B;  4UB8 Z;  5J2U B;  3OD4 A;  5IYD O;  2ADP A;  2YC0 A;  5C8Y A;  4CZZ A;  5TIS Z;  1X4T A;  4KUM A;  3SPC A;  2P6J A;  2QGN A;  2ZXW C;  1E1Q G;  4LR3 A;  2UXD B;  3J80 N;  1N0N A;  1KBH A;  1WP7 A;  2BTQ A;  3B8M A;  2EIK C;  3ZMS A;  1GMG A;  4ZIB A;  3ABM C;  3L74 H;  1RP3 B;  3KG2 A;  1CXZ B;  3RFR A;  4J9Z B;  1XNQ O;  2QTO A;  3DSQ A;  1JJO A;  4JGS A;  3DXR A;  3FB8 C;  3TET A;  4FM2 A;  3JAS A;  2ZIM A;  3UQ8 A;  2UU9 B;  4X1Y A;  1FXK B;  4JI6 O;  3ETE A;  2AGA A;  4DRX A;  2D2C B;  2HLD G;  3M99 B;  3CWB H;  4RUE A;  3HKD B;  2V1D A;  1FXK C;  4R8C A;  4PV1 B;  3T1C A;  3CCJ V;  1MMM A;  1RPO A;  1SQP H;  1BCC H;  1JFF A;  5BR8 O;  3CCS V;  3JAR B;  1H2G A;  1PD3 A;  1F4M A;  4DR5 O;  1K73 W;  3K5N A;  2AXT Z;  3DTU B;  4H37 A;  5LOV A;  4JYA O;  2DW4 A;  1G6U A;  2UXB B;  1NH2 B;  3ZHR A;  2QSA A;  2XAS A;  1SER A;  2CUG A;  4UCR A;  3ZIA G;  3AG2 C;  5JVD A;  4LC1 A;  3U11 A;  1GN6 A;  4MVR A;  1IBK B;  4DV4 B;  5D5Q A;  2QM8 A;  2O57 A;  1S5J A;  4X20 B;  1COW G;  4OX9 O;  1HNX B;  2PYJ A;  5L3B A;  1VQK V;  3HKC A;  5LHH A;  4PA7 A;  2ATK C;  3U0Z A;  3O65 A;  3E86 A;  2KG7 A;  4JAV A;  3JD3 A;  4X64 B;  3CD6 V;  2YXH A;  4TV9 B;  1B3Q A;  1QR9 A;  1B6Q A;  1G8M A;  4ZKI A;  4YJ3 A;  5H9C A;  3IGA C;  4L87 A;  4H44 B;  5DN6 G;  2ZE5 A;  5LMN O;  1K34 A;  1OCR B;  4KXR A;  5B1A B;  5GTI Z;  1XRE A;  3CRC A;  4W4L A;  4YIP A;  1OCR C;  4DR3 O;  4X65 B;  5LMU O;  1IXB A;  1QBZ A;  4DV5 B;  2QE7 G;  3CRM A;  4F6R B;  3FYI B;  4UV8 A;  3T4Z A;  3CCM V;  2EIL C;  4DV1 O;  4PDL A;  4I50 B;  5CBF A;  1SA0 B;  3FAV A;  3OW2 U;  5B1B C;  1BHA A;  1FFX B;  1YHQ V;  1Q43 A;  4UCU A;  1P49 A;  1AI5 A;  3SR2 C;  3L75 H;  1WA8 B;  1PKX A;  3H1K H;  3WG7 C;  4YY3 B;  5JQG B;  1MSD A;  1S5H C;  3SYP A;  3R66 A;  2JGD B;  4JI7 O;  2LQT A;  3SPJ A;  4HNA B;  1GN3 A;  2EJ7 A;  5EC1 C;  4FM0 A;  2IH3 C;  5EZY A;  1XL6 A;  2OWO A;  4LH7 A;  1VEW A;  1KEC A;  3SPG A;  4TUY B;  1AJQ A;  4LH6 A;  3E22 A;  5FNV B;  4CH5 A;  4D6T H;  1Q6U A;  1R3J C;  4EFB A;  2R9A A;  4JI0 O;  4OGQ B;  4NYK A;  1TUB B;  3JAL B;  4QPK A;  3K9S A;  1AI4 A;  1RM1 B;  3K9A A;  2P90 A;  3ML0 A;  1JCH A;  3OFN G;  2CGO A;  3JD4 A;  3HKE B;  2ZT9 B;  4UXN A;  3UKM A;  3E83 A;  4LF9 B;  3B8N A;  4RUF A;  4O4H B;  3AG7 A;  3BVO A;  1ROP A;  4JZG A;  4WFG A;  3RYH B;  4IYI A;  1K9M W;  4IYH A;  2VQE O;  3JCU Z;  3H9V A;  2OCC C;  2YS8 A;  4O2A B;  4PDR A;  1BQZ A;  2FKX A;  3S3X A;  2LJ2 A;  3SDL A;  1ZSP A;  1D5A A;  2FL4 A;  1XMQ O;  2K9P A;  1QLE B;  1Y6X A;  2Q4P A;  4EFE A;  4O4J A;  1ZUQ A;  2F93 B;  3JAK B;  3ABU A;  4DR6 B;  3CPW U;  3OT7 A;  4MSW C;  1FYJ A;  2HG5 C;  1TA8 A;  5H6R A;  4PA6 A;  4B3S B;  1S5L Z;  2WLI A;  2CH7 A;  3UO3 A;  4RQF A;  3JSN A;  4WFB V;  1I0H A;  4OXS A;  2YSU B;  4NTW A;  5LHG A;  1YCI A;  3EFF K;  1TUE B;  3CJH A;  1PNK A;  1R73 A;  2UXD O;  3K5O A;  1JX9 A;  1MAB G;  3N2G B;  5JCO A;  3HKB B;  2NR5 A;  4B08 A;  3SJC C;  5JWP A;  1VQ9 V;  5CBG A;  1H2K A;  2YXY A;  4FMT A;  3AG3 C;  1HNW O;  4JV5 B;  1LUW A;  1J5E B;  5A2Q N;  2RN9 A;  4UCT A;  3P32 A;  4K0K B;  5B66 Z;  2YI9 A;  4OPA A;  4EB6 B;  4B3R B;  3K06 A;  4LNU A;  1V55 C;  3VQV A;  3RYI B;  1ZX3 A;  4MVM A;  4MVU A;  5LA6 B;  1XNQ B;  1WJZ A;  2ILM A;  4WFH A;  3VQY A;  4DXW A;  3OEH G;  3N27 A;  1BMF G;  5GON A;  2YXL A;  3I56 V;  3ASN B;  4AI8 A;  1YTF D;  2Q68 A;  2ZDI A;  4BWA A;  1SKV A;  1I5Y A;  3N2K B;  4JI4 B;  4E2L A;  3ASN C;  5H5N A;  2DQ3 A;  4J7Z A;  4PEL A;  2UUB O;  3K03 A;  4ZHQ A;  2XHB A;  3FX7 A;  3OUF A;  1YDX A;  1KYO F;  2FB5 A;  3CCL V;  4DV4 O;  3BA8 A;  3CCQ V;  3TGU H;  4Z1V A;  4DR5 B;  1H8E G;  1K4D C;  3B2E E;  1HNX O;  2AZ0 A;  4JYA B;  1YVW A;  3CC2 V;  5EIB D;  4GX1 A;  2QWP B;  3BHP A;  4DV3 B;  4YHH B;  5LL6 Y;  3WB0 A;  4D7S A;  1FD9 A;  4FPP A;  1VMG A;  4DV2 O;  4BIZ A;  1KUQ A;  1YSC A;  1QNM A;  4EKW A;  4X64 O;  4JI5 B;  3MHS C;  3BPZ A;  1D5N A;  2BSK A;  1FFT B;  4IIJ B;  1XIL A;  2HJF C;  4OX9 B;  1AIL A;  3G80 A;  4TQF A;  3LDC A;  3QF7 A;  1AB3 A;  3ZHU A;  4TSF G;  3F5T A;  3ZN0 A;  1PL0 A;  2JDI G;  1QQC A;  4I7Z B;  2ZCE A;  4NKG B;  3A0H Z;  2V7Q G;  1K8A W;  3ZMV A;  4TV8 A;  4DV5 O;  3UT5 A;  1LNQ A;  5KA5 A;  1XQ8 A;  3UCS C;  2OYQ A;  2KQX A;  2WLH A;  2RJZ A;  5E1A C;  5BY1 A;  5C8Y B;  3AEI A;  5LMN B;  3QNE A;  1VQ4 V;  2Y69 C;  3ZRW A;  2YIB A;  4EEQ A;  5LP6 C;  4CH6 A;  4K8X A;  1DF4 A;  4GT1 A;  1NR1 A;  2BTQ B;  1FXV A;  2CTR A;  2Q9L A;  2IW5 A;  2M6Y A;  2QTS A;  4UCO A;  2CE4 A;  4YY3 O;  1OZ0 A;  1YF2 A;  1AP6 A;  3OTO B;  3P3N A;  3P3P A;  5FLX N;  4DV1 B;  2X7R B;  3E8F A;  1ORQ C;  5IYC O;  3CRA A;  3DXR B;  2ODM A;  3Q4H A;  4NXN B;  1W0J G;  2KSD A;  3JAS B;  1EZJ A;  5KHI A;  1NH2 D;  1GK9 A;  4X1Y B;  1VQN V;  4CC5 A;  3GVM A;  2QWO B;  5AG2 A;  1QU7 A;  1J95 A;  3K3W A;  4FFB A;  4DRX B;  1U97 A;  3RGB A;  1NKD A;  1ZL8 A;  3ICX A;  3ETD A;  3W7U A;  3CCV V;  1IBL B;  5C93 A;  2IU0 A;  1JFF B;  1OCO C;  1XNR O;  3CMA V;  5IJ0 B;  4I5S A;  5CB4 A;  1IDS A;  5IY5 B;  1E79 G;  1RSO B;  5BMV A;  3ASO C;  3HB3 B;  1BZK A;  4FLU A;  3F7V C;  1MSW D;  1YJN V;  4MTX A;  4LF9 O;  4LCU C;  4J7K A;  1L1F A;  3IAY A;  5K1P A;  2X6A A;  2DYS C;  1K3E A;  5JVD B;  3K58 A;  1OHH G;  4ICG A;  1S77 D;  1VQO V;  4U7O A;  4CH3 A;  3K59 A;  4X9Q A;  1AR1 B;  3LSS A;  3M7M X;  3AG4 C;  1YTF B;  2HR3 A;  3HKC B;  4DR6 O;  4DV0 B;  4E4E A;  3RVZ A;  3KZI Z;  4NB5 A;  3E89 A;  5JH7 B;  1K92 A;  1XDC A;  4JPR A;  2ITD C;  1HWY A;  2R9R B;  4JAU A;  2Z3Y A;  1VQL V;  4XDL A;  4MVQ A;  2VQE B;  3CEI A;  5IYB O;  2E5L B;  3FB7 C;  3A2F A;  2DQ0 A;  3L9D A;  1OCZ C;  4YJ3 B;  1O9G A;  2WLN A;  3JD2 A;  5FPR A;  1S72 V;  1BS3 A;  1XMQ B;  1GAX A;  3THO A;  5LXT A;  3FFQ A;  1YJW V;  3MDS A;  3QO5 A;  3KKY A;  3DC6 A;  1NTM H;  4JAA A;  3X2Q B;  5EIB C;  5IYZ B;  4RO2 A;  5EBW C;  3RYF A;  1I08 A;  2VWK A;  5KLV H;  3X2Q C;  1GRJ A;  2CTP A;  4JV5 O;  3NXS A;  2IJH A;  4MW8 A;  1J5E O;  1DF5 A;  3B4S A;  4G27 B;  4K0K O;  3EHB B;  3FAV B;  1F4N A;  1Z5V A;  1FJG B;  4ABM A;  4B3R O;  3JAT A;  2CK3 G;  4JI2 B;  2ITC C;  4I0X B;  2N74 A;  4I55 A;  4PI2 A;  3ABL B;  2LFR A;  4PI0 A;  1US6 A;  3K5L A;  3RW0 A;  2QWR B;  4MVS A;  1MZE A;  1HNW B;  1Y4M A;  2IBZ H;  4BAY A;  4X8A A;  2W6J G;  3WB1 A;  2KB1 A;  5BXZ A;  1FAF A;  1W0K G;  3ZED A;  2XAG A;  4JI4 O;  1SC5 B;  2HVK C;  3TXQ A;  2ETN A;  1SQX H;  5FL7 G;  2GDS A;  3C3T A;  5EZY B;  2Q7E A;  2IJJ A;  3E8B A;  4LF5 B;  1U96 A;  1GTO A;  1N32 B;  1NS1 A;  5CA0 A;  1OJH A;  2R72 A;  3K0G A;  1SRY A;  1SQF A;  1M56 B;  1NR7 A;  3OAA G;  4DV3 O;  3HPL C;  4YHH O;  5EBM C;  2B5U A;  1FXH A;  3C3S A;  1XI1 A;  4YJ2 A;  2UUB B;  2GV9 A;  4RAI A;  1SS3 A;  4Q6G A;  2X0L A;  4H33 A;  2EIJ B;  4JI5 O;  1TGO A;  2A79 B;  1S0V A;  5CA1 A;  4WBN B;  1MNG A;  2B1I A;  4IT5 A;  4X1I A;  1Z2G A;  3SPH A;  5LGU A;  3BEH A;  2XUM A;  4G2K A;  5CA3 A;  1UJW B;  1VF6 C;  2WLL A;  2F4V B;  1XL4 A;  3E8H A;  3PJS K;  1Q7Y W;  3BAA A;  4DV2 B;  3JCZ A;  3JD1 A;  2L6L A;  2Y4T A;  5IJ9 A;  2A9H A;  3APO A;  4N21 A;  2DWD C;  4WFF A;  4P9O A;  3CRQ A;  1IX9 A;  2CH7 B;  5D5P A;  2GSM B;  3BCC H;  3CJH B;  4YIO A;  3J81 N;  3CCU V;  2QM4 A;  5IT9 N;  3ZX6 A;  3AK1 A;  2GTS A;  4DK1 A;  1K97 A;  5B1A C;  5LGN A;  3FKS G;  3G6E V;  2BCC H;  3DC5 A;  1FS0 G;  2EIM B;  4G28 B;  3BFR A;  3OTO O;  2FML A;  2LGW A;  3K79 A;  2DJV A;  2EIM C;  2FYU H;  3ABT A;  1UFI A;  4R7C A;  4UCS A;  3ZRX A;  4NXN O;  4JYC A;  2DYR B;  4I9Q A;  3VOU A;  5IWA B;  2D3O W;  2HFE C;  3GWK C;  4CH4 A;  4LNU B;  2OIG A;  2OIE A;  1PM9 A;  1P7B A;  3JAW B;  1XHX A;  4J42 A;  1EN4 A;  1IBL O;  3AG1 B;  4LF4 B;  5GTH Z;  3IFX A;  2LGQ A;  3D36 C;  2DMX A;  1NZ6 A;  1AJP A;  3AG1 C;  3BY6 A;  4A5U B;  5GON B;  2Y4U A;  1W2B U;  5L3E A;  5KAF Z;  1SZX A;  4IGG A;  4NTY A;  1PPJ H;  5EC2 C;  2WPD G;  4IHJ A;  1ZLZ A;  3OMN B;  3KCX A;  4LFC O;  1FXK A;  1M9N A;  2W0X A;  3JYC A;  1K5S A;  1Y76 A;  2N04 A;  1PNL A;  1XNR B;  1F23 A;  1BT8 A;  3OE7 G;  5JJN B;  4DR7 B;  4H0L B;  4I9W A;  1MA1 A;  1NJI W;  4DUY B;  1RM1 C; 
#chains in the Genus database with same CATH homology
 2DYS B;  1H8E G;  1WPX A;  3W7W A;  3SYC A;  5CBH A;  5CN0 A;  1K4D C;  1KP2 A;  3SPI A;  2EIJ C;  3W7T A;  3CC2 V;  3K0D A;  3FYE B;  5GW7 A;  4QNH B;  1VQM V;  3AG2 B;  3CME V;  4GX1 A;  2WLL B;  2EJR A;  4UUJ C;  3AG4 B;  3SYA A;  4FPP A;  4P30 A;  4GX2 A;  5HFL A;  3WFV A;  2OTL V;  2P67 A;  5CMU A;  2Y48 A;  4BIZ A;  5B1N A;  1YSC A;  3OMA B;  1JVM A;  4EKW A;  1H38 A;  3ETG A;  3MHS C;  1THZ A;  3LUT B;  2ZR3 A;  1DTO A;  1MOF A;  1FFT B;  2NLJ C;  3TK1 A;  3CXC U;  2HJF C;  3OMI B;  1JOY A;  1QLN A;  1OCC C;  1QLE C;  1OCZ B;  2WLI B;  3LDC A;  4DO2 A;  3IC7 A;  4TSF G;  1SET A;  2ZR2 A;  1CPY A;  5IDJ A;  2F43 G;  3ZN0 A;  1PL0 A;  2JDI G;  2DWE C;  3ZJZ A;  3FB6 C;  2QM7 A;  3K04 A;  2V7Q G;  1K8A W;  3ZMV A;  1WLE A;  1AJN A;  4MW3 A;  4XDK A;  1G4Y B;  2HKO A;  3CCE V;  3ZRV A;  3RBZ A;  1LNQ A;  2IJK A;  5KA5 A;  3I55 V;  2JK5 C;  5J9P C;  3G71 V;  4LP8 A;  3G4S V;  1R3L C;  2WLH A;  3OR7 C;  5E1A C;  3ZRW B;  3SYQ A;  3AEI A;  2P7T C;  1QVG U;  3QNE A;  1VQ4 V;  5KA6 A;  2Y69 C;  5IYD O;  3ZRW A;  2ZD9 A;  2EBO A;  4CZZ A;  1JQ0 A;  4KUM A;  1DF4 A;  2EIL B;  1NR1 A;  4GT1 A;  1FXV A;  3OEE G;  3SPC A;  2P6J A;  1PNM A;  2IW5 A;  4PDM A;  2ZXW C;  1R3K C;  1E1Q G;  2DYR C;  1OZ0 A;  4X88 A;  2JJ2 G;  5B1B B;  1VQ8 V;  3D3I A;  3B8M A;  2EIK C;  3ZMS A;  1GMG A;  3ABK B;  1GKF A;  3QO7 A;  1K4C C;  3ABM C;  4MTF A;  1NBM G;  2X7R B;  3E8F A;  1ORQ C;  3KG2 A;  5IYC O;  4QJF B;  4J9Z B;  4BW5 A;  3ABK C;  1M1K W;  1W0J G;  2QTO A;  3DGE A;  3WG7 B;  1EZJ A;  1NH2 D;  1GK9 A;  1VQN V;  2W0F C;  4MVO A;  4JGS A;  4MS2 A;  1V54 B;  3FB8 C;  1J95 A;  3K3W A;  3TET A;  3CCR V;  2WWW A;  1AI7 A;  1FXK B;  1NKD A;  3ETE A;  1V54 C;  1YJ9 V;  3ETD A;  3W7U A;  2ZDI C;  3M99 B;  2HLD G;  3CCV V;  1DLB A;  2AHZ A;  4RUE A;  2V1D A;  1FXK C;  5C93 A;  4R8C A;  2IU0 A;  1OCO C;  5BZB A;  3T1C A;  3CMA V;  3CCJ V;  4I5S A;  5IY5 B;  1E79 G;  1RPO A;  3ASO C;  3HB3 B;  2XAJ A;  4HAM A;  3CCS V;  2YEV B;  2EZP A;  3F7V C;  1H2G A;  1MSW D;  3A0R A;  1YJN V;  1PD3 A;  1F4M A;  3F7Y C;  4MTX A;  3SJQ C;  2JJ1 G;  3W7S A;  1K73 W;  1EFR G;  2YEV A;  4LCU C;  3DTU B;  4H37 A;  1L1F A;  2DW4 A;  2X6A A;  2WLK A;  2W6I G;  1Q81 W;  2BOB C;  4J9Y B;  2DYS C;  1NVP D;  1NH2 B;  1K3E A;  4ASU G;  1OHH G;  3MD0 A;  2XAS A;  2X6C A;  4WF9 V;  1Q82 W;  1SER A;  1S77 D;  3ZIA G;  1VQO V;  3AG2 C;  4GCZ A;  4JYB A;  1KC8 W;  4U7O A;  4LC1 A;  1AR1 B;  3LSS A;  4MVR A;  3CC7 V;  1R6N A;  3AG4 C;  1YTF B;  2HR3 A;  2QM8 A;  3CP1 A;  4FJC C;  2OCC B;  2OTJ V;  3SYO A;  1COW G;  1K33 A;  3RVZ A;  3E89 A;  5L3B A;  2R9I A;  4TT3 G;  1K92 A;  3E35 A;  3T4D A;  1VQK V;  1JPX A;  4JPR A;  4PA7 A;  5LHH A;  2ATK C;  2ITD C;  3STL C;  3K08 A;  1HWY A;  2R9R B;  4JAU A;  1S3J A;  2Z3Y A;  4XDL A;  4MVQ A;  4PA9 A;  1VQL V;  5IYB O;  2Z5U A;  3B77 A;  3E86 A;  3FB7 C;  3STZ C;  2WLJ A;  4MTO A;  2DQ0 A;  3E8G A;  1OCZ C;  4JAV A;  3JD3 A;  2WLN A;  2IH1 C;  3JD2 A;  5L3D A;  1S72 V;  3CD6 V;  1F51 A;  1QR9 A;  1B6Q A;  1YJW V;  1G8M A;  4ZKI A;  3R65 A;  3QO5 A;  3IGA C;  5H9C A;  1NVP B;  4L87 A;  4MTG A;  1I5X A;  4JTC B;  5DN6 G;  1K34 A;  3X2Q B;  3ZMZ A;  1OCR B;  1CEZ A;  5B1A B;  4RO2 A;  2A0L A;  1GM9 A;  4U7N A;  1MG1 A;  5LHI A;  5EBW C;  2LFS A;  2BOC C;  4LBE C;  3X2Q C;  1OCR C;  3NXS A;  2IJH A;  4MW8 A;  3TCU A;  1QBZ A;  1DF5 A;  2QE7 G;  3GB7 C;  4G27 B;  3EHB B;  3FYI B;  5EBL C;  4UV8 A;  3T4Z A;  4F4L A;  3CCM V;  4RQE A;  1F4N A;  2XOK G;  2EIL C;  2MK3 A;  1P4R A;  3LDE A;  4QIW F;  4PDL A;  2CK3 G;  2WLM A;  5CBF A;  2ITC C;  3AG3 B;  4Q20 A;  3OW2 U;  3CC4 V;  1K7D A;  5B1B C;  2OT5 A;  3ABL B;  1BHA A;  2LFR A;  1QCE A;  4BIU A;  4UVC A;  2UXN A;  1YHQ V;  3RW0 A;  4JF3 A;  4MVS A;  4X89 A;  1NQT A;  2WSS G;  1AI5 A;  1ARO P;  1BL8 A;  1Y4M A;  1Y66 A;  2XAQ A;  1PKX A;  1V55 B;  1KQS U;  1Q86 W;  4P2Z A;  3WG7 C;  4BAY A;  4KP4 A;  4X8A A;  2W6J G;  4JAS A;  4UV9 A;  5B1O A;  1S5H C;  2KB1 A;  3F5W C;  3SYP A;  1W0K G;  2XAG A;  2HVK C;  5FL7 G;  3SPJ A;  3H01 A;  5EC1 C;  3D36 A;  2QA4 V;  2IJJ A;  3E8B A;  2IH3 C;  4QE9 A;  1YIJ V;  4TWK A;  1GTO A;  2EIN B;  1XL6 A;  2Q6A A;  2UXX A;  1JJ2 U;  4ZBM A;  3ZRS A;  1KEC A;  4Z1M G;  3SPG A;  5LGT A;  1EBO A;  1AJQ A;  4P9P A;  5IY5 C;  3P30 A;  2EIN C;  4GX5 A;  5EK0 A;  1CP9 A;  1R3J C;  3K0G A;  2NNU A;  1SRY A;  4HZ3 A;  4N23 A;  2H8P C;  1M56 B;  3T2M A;  3LSQ A;  1NR7 A;  3OAA G;  2HVJ C;  3HPL C;  5EBM C;  2B5U A;  4QPK A;  1FXH A;  1R6K A;  1AI4 A;  2PI4 A;  1RM1 B;  2JEU A;  3K9A A;  2P90 A;  3ML0 A;  1JCH A;  4RAI A;  3OFN G;  4WFE A;  2B1G A;  2X0L A;  4H33 A;  1VQ6 V;  2EIJ B;  3JD4 A;  5L3C A;  4FK5 C;  4MT8 A;  1RPR A;  3OUS A;  4UXN A;  1M90 W;  3UKM A;  3E83 A;  1VQ7 V;  2C2A A;  3B8N A;  3W7X A;  4RUF A;  2A79 B;  1S0V A;  4UVA A;  1ROP A;  4WFG A;  2B1I A;  5DM6 V;  2JEX A;  2XAF A;  1K9M W;  3SPH A;  3RVY A;  1K5Q A;  2IU3 A;  2M7W A;  5LGU A;  4R50 A;  5HFM A;  3FB5 C;  2OCC C;  3BEH A;  1H8H G;  2IJI A;  4G2K A;  2WAM A;  4PDR A;  3VBB A;  4WFA V;  5CA3 A;  1UJW B;  4GX0 A;  2WLL A;  1XL4 A;  3E8H A;  3PJS K;  1Q7Y W;  4XDJ A;  2Q67 A;  1OCC B;  3JCZ A;  1QLE B;  3JD1 A;  3OGC C;  5LBQ A;  4CBC A;  2A9H A;  1IXM A;  3ZMT A;  4N21 A;  2DWD C;  4HYO A;  3ABU A;  4WFF A;  4P9O A;  3CPW U;  1KKD A;  1VQ5 V;  4MSW C;  4UVB A;  1KD1 W;  2HG5 C;  4QE7 A;  5L3G A;  2LP7 A;  4PDV A;  5H6R A;  1E1R G;  2XND G;  4PA6 A;  2GSM B;  4JTA B;  1QR8 A;  2EZO A;  5L3F A;  3OM3 B;  2WLI A;  2AHY A;  4RQF A;  4WFB V;  3CCU V;  1ZWI C;  3LNM B;  4OXS A;  1YI2 V;  2QKS A;  2YSU B;  1K97 A;  5LHG A;  2FTK A;  5B1A C;  3EFF K;  5B3S B;  5LGN A;  1TUE B;  3FKS G;  1PNK A;  1R73 A;  3G6E V;  4XBF A;  1FS0 G;  2EIM B;  1N8R W;  1JX9 A;  2JIZ G;  4G28 B;  2H94 A;  3QO8 A;  1MAB G;  2Y69 B;  1BHB A;  5B3S C;  3CYO A;  4YXW G;  3K79 A;  2EIM C;  3ABT A;  5KUM A;  4R7C A;  3ZRX A;  2ZXW B;  4JYC A;  1VQ9 V;  5CBG A;  2DYR B;  4FMT A;  3VOU A;  2EIK B;  1KP3 A;  3AG3 C;  3GWO A;  2XAH A;  2D3O W;  3ABM B;  2HFE C;  2ZQM A;  3ABL C;  3ZMU A;  2QEX V;  3P32 A;  1GM8 A;  4WCE V;  1YIT V;  3MHH C;  1P7B A;  1M57 B;  1ENV A;  4FIP C;  4MVZ A;  3AG1 B;  3K06 A;  1V55 C;  2GHY A;  4MVM A;  1M57 C;  3IFX A;  4MVU A;  4PA3 A;  3ZN1 A;  4R6Z A;  3UM7 A;  2Q69 A;  1AJP A;  3AG1 C;  3BY6 A;  1QVF U;  1GM7 A;  4WFH A;  2K1E A;  1W2B U;  3OR6 C;  4DXW A;  3OEH G;  5L3E A;  1R3I C;  1BMF G;  1AI6 A;  1OCO B;  4PA4 A;  3I56 V;  3ASN B;  3ZCC A;  5EC2 C;  1YTF D;  2Q68 A;  2ZDI A;  4JTD B;  4QPJ A;  2WPD G;  1I5Y A;  3OMN B;  2PI5 A;  1GO3 F;  1FXK A;  1M9N A;  3ASO B;  3JYC A;  4E2L A;  1K5S A;  1SES A;  2X6B A;  1S76 D;  1VQP V;  3ASN C;  1PNL A;  2DQ3 A;  4KFM A;  1F23 A;  3LDD A;  3OE7 G;  1SZT A;  3K03 A;  3JD0 A;  4PEL A;  3E2E A;  5H6Q A;  3OUF A;  1M56 C;  5KUK A;  3CCL V;  4I9W A;  1NJI W;  3CCQ V;  1RM1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...