3TCUA

Crystal structure of nak2k channel d68e mutant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGYGEFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Potassium channel protein
publication title Protein interactions central to stabilizing the K+ channel selectivity filter in a four-sited configuration for selective K+ permeation.
pubmed doi rcsb
source organism Bacillus cereus
total genus 36
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3tcuA00
3STLC 4PA4A 5EK0A 3ZJZA 3ABKC 4I9WA 4HZ3A 4MTFA 4PA6A 2EILC 5EC2C 4MVQA 4GX1A 4LBEC 2QKSA 1QLEC 1M57C 3RW0A 4J9YB 3T4ZA 4R7CA 1OCOC 3K06A 1P7BA 2HG5C 5E1AC 3SYAA 3AG4C 3RVZA 1J95A 1M56C 4EKWA 2WLJA 3ABMC 4PDVA 2W0FC 4RAIA 3LUTB 3VOUA 4H33A 5J9PC 3SYOA 2WLLA 4MVRA 3LNMB 4MVOA 4X88A 3SJQC 3SPGA 2BOBC 2DYSC 2R9RB 4PDLA 2HVKC 2X6BA 5CBHA 4J9ZB 1G4YB 1V54C 4MW3A 2YEVA 3FB6C 2P7TC 1XL4A 4MS2A 4X89A 5IY5C 2WLNA 4GX5A 4PA7A 3K0GA 1R3JC 4GX2A 4LP8A 3TETA 2HJFC 3BEHA 2Q6AA 4GX0A 2EIKC 2ZD9A 4TWKA 4P30A 5B3SC 3EFFK 3E86A 1OCRC 2EIJC 3R65A 4XDKA 5EBLC 3E8HA 4X8AA 2DWDC 3F7YC 4HYOA 2AHZA 2WLKA 3PJSK 3IFXA 3JYCA 2A79B 2X6CA 3F7VC 1K4CC 4MTGA 1LNQA 4MVSA 3AG1C 4PDRA 5B1AC 4MSWC 3T2MA 4F4LA 5CBFA 1V55C 4P2ZA 2WLMA 1BL8A 1OCCC 3LDDA 3ASOC 2HVJC 3GB7C 2BOCC 3KG2A 4R6ZA 4WFEA 3OR6C 4MVZA 2WLIA 2HFEC 5EC1C 3E8FA 3WG7C 4QNHB 5KUMA 2WLLB 4G27B 3TCUA 4R8CA 4PA3A 1KKDA 1K4DC 1ORQC 1ZWIC 3K08A 4RO2A 3RBZA 2Q67A 3SYQA 2K1EA 2JK5C 4KFMA 4MVMA 4CBCA 4JTDB 3SPIA 4PDMA 5BZBA 2EIMC 2WLHA 3X2QC 3SYPA 2A0LA 2QTOA 4P9OA 1R3KC 4XDLA 3ZRSA 3STZC 3LDEA 3SPJA 2AHYA 4JTCB 4QE9A 4RUFA 2OCCC 4RUEA 2KB1A 3OR7C 3SPHA 4BW5A 4MVUA 2H8PC 3LDCA 4P9PA 3OUFA 3T4DA 3ASNC 4MTOA 4XDJA 2EINC 1S5HC 2DWEC 5EBWC 3E8GA 3UM7A 2ITDC 2Q69A 3E83A 2IH1C 4G28B 4LCUC 4PA9A 3SYCA 1OCZC 3K0DA 1JVMA 3F5WC 1R3LC 4OXSA 4DXWA 4UUJC 3AG3C 2Q68A 5B1BC 2Y69C 3FB8C 2NLJC 3K04A 3SPCA 1R3IC 1XL6A 3IGAC 2A9HA 2X6AA 4WFGA 2DYRC 3AG2C 4ZBMA 4MW8A 3ABLC 5CBGA 2ATKC 3E89A 4R50A 3UKMA 2WLIB 3HPLC 4QE7A 4WFHA 2ZXWC 3E8BA 3FB5C 3K03A 4WFFA 5KUKA 4H37A 3FB7C 5EBMC 4JTAB 2IH3C 3RVYA 2ITCC 3OUSA 3T1CA 3OGCC
chains in the Genus database with same CATH superfamily
1WA8A 1TUBA 2P90A 1Y76B 4UCTA 2R9AA 4B3TO 2P5OA 3IC7A 4FM2A 1OCOC 4DK1A 2CE4A 2QWOB 4WBNB 4EKWA 4X65B 3Q4HA 4DK0A 3LSSA 4UV8A 2ARHA 2RJZA 3JD3A 1XL4A 3THOA 1RM1C 3TETA 4FLUA 2ZD9A 2LP7A 1XILA 4P30A 4ZKIA 4J41A 3T1HO 2CAZC 4CH4A 1YF2A 1G8MA 2LW7A 3IFXA 1FJGB 3QO8A 1YEWA 2P67A 4FFBB 4I9QA 2WLMA 1OCCC 3DXRA 5CN0A 1MABG 4TUYB 4JZGA 4IL6Z 1KP3A 3OR6C 4JI5B 4JV5B 1K97A 2XAHA 2YIDA 5DM6V 3GVMA 1CPYA 5JCOA 2JK5C 4LR3A 4JTDB 3IC9A 2BSKA 1ENVA 3BFRA 3KCYA 3MHSC 4JTCB 4FVMA 3E83A 3DC5A 5IY5B 1R3LC 1DF5A 4WCEV 2V1DA 1GO3F 3IGAC 2X6AA 4LF9O 3ABLC 4DO2A 4U3JB 1EM1A 5CB4B 1Y74A 4H37A 3P32A 2XAFA 3T1CA 1H2MA 1BS3A 4UXNA 4YJ2A 1PL0A 5FPOA 4J42A 3BY6A 4J7ZA 3RYIB 3OGIB 1SZTA 5JH7B 2AXTZ 1WJZA 3K58A 1SF9A 5E1AC 1M90W 3AG4C 4LH6A 1J95A 5CA0B 2F95B 2JS5A 3ETDA 2ZDIC 3R66A 3W7TA 2LFRA 4DR5B 3SJQC 1SQXH 4YXWG 1NH2D 2GSMB 3TGUH 4LF7O 4E2LA 4AI8A 4NXNO 2JJ2G 4J10A 3EFFK 3E86A 2EIJC 4A5UB 2ADQB 1MSWD 4N23A 2VRZA 2CK3G 4YIOA 3CMAV 4LFAB 1GK9A 3RYHB 3G6EV 1QVFU 4KHPO 2X6CA 3F7VC 3RFRA 3H1KH 3BVOA 3T2MA 5B5EZ 4WFAV 1HW7A 1IBLO 2ZT9B 4X1IB 2HVJC 3IJ4A 2HFEC 1RPRA 1W2BU 1GMGA 2RQ6A 5GW7A 4GT1A 4FJCC 1BSMA 4E4EA 4P9OA 3DSQA 3RN4A 1LR1A 3MAQA 3OD4A 2PI5A 2VS0A 1VQ4V 2X0LA 4C7UA 3SGIA 2DWEC 4LF4B 2ITDC 5GTHZ 1HNXB 4DV4B 4UUJC 1AI4A 1SS3A 2FYUH 3WG7B 4ZBMA 4JI3O 5ITZB 3E89A 2CTRA 2E3CA 3E8BA 3OFNG 1E1QG 1SKVA 3J81N 2FMLA 2R70A 4DV3B 2E5LO 4JYBA 3TK1A 1QU7A 2JGDB 1HNWB 5LMNO 4LNUA 3BRCA 1VQ6V 2LW1A 4LC1A 2QM8A 3FX7A 1HNZB 3F5TA 1A32A 5J9PC 1Q7YW 3CRRA 4UCRA 1BCCH 4MS2A 1IBKO 5IY5C 4GX5A 5L3CA 1Q86W 3SJBC 1P7GA 4X1YA 1U97A 1VQPV 4DR7O 3CJHA 1BQZA 1IX9A 2UXDO 2NR5A 4O4JB 3JYCA 2ZM6O 4NXNB 2G38A 4LFCO 3D36A 1VQ5V 1XOUA 4FLZA 1EN5A 2CTWA 1NU1H 4DR6O 2IJJA 5LXTA 4K8ZA 5LHHA 1XNQB 3HKBB 1O9GA 3ASOC 2Q7GA 1SC5B 4CH3A 3SJAC 5LGNA 2P4KA 4X66B 3TCUA 1K4DC 1ZWIC 1OJHA 2QKCA 4JAAA 3L75H 3N2GB 4CS2A 5LP6A 2UUCB 1V9PA 1KB9F 3STZC 5KMGA 2JDIG 5KX5B 4HNAB 3OR7C 4UB8Z 3ABMB 5B1NA 2JIZG 4U7OA 1WLEA 1SERA 3ZN0A 3A0HZ 3OM3B 3HKEA 2NLJC 1EBOA 1QBZA 4JI1B 2ZQMA 3T1YO 4DUYB 2B1IA 1I94O 2UUAB 2Z3YA 3VQYA 3STLC 1M1KW 5HFMA 3ETQA 4O4LA 1FFXA 1V55B 4HZ3A 4MTFA 1KYOF 2E74B 2DE0X 3ZRWB 1PL4A 4FM0A 2E5LB 1N32B 2A7WA 1LUWA 5JVDA 5KHIA 4YJ3A 2YI9A 2B9ZA 1N34O 5EZYA 3H1IH 4J7KA 4YY3B 3CRAA 3CRMA 3WB2A 1VQMV 3FAVA 4YIPA 3H1HH 2BTOA 3W7SA 3HKCA 3DC6A 4NTXA 3R65A 3J80N 1YJNV 5IJ9A 1WA8B 1WN7A 4TV9A 3U0ZA 1TUBB 5IYCO 4O2BA 4NTWA 2QE7G 5FL7G 2DYRB 1DLBA 4DV0O 5IT9N 2Q8VA 2VQEO 2DN9A 1S77D 3TXSA 4WFEA 2D3OW 3DTUB 3Q4HB 5IYZA 1AR5A 1YTFD 4PHZA 3CB2A 4DR6B 3G71V 2C2AA 4KL1A 4MVMA 1QLEB 1VARA 4RUFA 2YS8A 3OUFA 1H2SB 1NQTA 4UVCA 1VF6C 5B66Z 4NXMO 2ZKOA 3ML0A 2V4DA 1QNMA 3DXRB 2ZE8A 2A9HA 4EEQA 5CBGA 2ZR2A 1VQLV 2RDCA 4JPRA 4B3RB 3M99B 1XBLA 2QKAA 3W7WA 5IWAB 3TJTA 2BSKB 4RQFA 4PI0A 4Q6GA 2YXYA 4ZHQA 1NTMH 1I94B 2UXXA 1FS0G 4CC6A 1IXMA 2JRIA 1MMMA 5L3BA 1QCEA 2WLJA 3ABMC 4PDVA 4QIWF 3RWRD 2LGWA 1HR0B 3SYOA 3LNMB 4DV6B 4FK5C 4TOIA 4ZIBA 1TAEA 4PA7A 4GX2A 3S3XA 1Y74B 3BEHA 2Y48A 1AR4A 1N34B 3OTFA 3UQ8A 4F6RA 4YJ2B 4XDKA 1OCZB 2DWDC 2UUBO 2N05A 3OW2U 1V55C 4IYIA 2OT5A 4X20A 1KKCA 2BOCC 2OCHA 2WPDG 3B09A 4I0XA 4B08A 2YIBA 4DV2B 1GN4A 3WB1A 1SQFA 3CCRV 1IXBA 5BZBA 4DYLA 2WA4A 3LSQA 3OAAG 4PV1B 2OCCC 4PI2A 2QJ1A 3ZHUA 2CGNA 1S5JA 1G6UA 2W6IG 3K04A 2DYRC 5FLXN 1FAFA 3HPLC 3FB5C 3FB7C 2NNUA 4X1KA 2VQFO 3G67A 4GX1A 1J5EB 3K5MA 1QLEC 1M57C 4IHJA 2QDOA 1FXKA 4J9YB 2CH7A 4R7CA 1FYJA 5H9CA 1NKDA 3RVZA 4RAIA 2F4VO 4NB5A 2H3OA 5BXZA 3RYFA 4O4IA 2HP8A 4LF6O 2W6JG 1HP8A 3JAMN 2JGUA 2Q6AA 5LBQA 3ZHQA 4UB6Z 3BPZA 2IU0A 1VMGA 1VQ9V 4FLWA 3E8HA 1YIJV 2LFSA 2QSAA 3LNNA 5KHKA 5JCOC 4L87A 5L3DA 5KLVH 1KU9A 3AG2B 3AG1C 4LNUB 3ZHVA 3L71H 4B7KA 5C8YA 4X64B 1JJOA 4JAUA 1Z5WA 4GKKB 1CEZA 4RWUA 1GN3A 3E8FA 4QNHB 1N33B 4LF5B 5EYPA 3WU2Z 2K1EA 1FKAO 3SPIA 4X1YB 4CC5A 4K0KB 3SYPA 2A0LA 2QTOA 1Q6IA 3CE2A 1Q6UA 4QE9A 4CH6A 4PELA 2F66C 3LDCA 1AI6A 1OV9A 4G28B 1RP3B 1OCZC 3F5WC 5LXTB 3FD9A 5EIBC 5DEDA 3OT7A 3PN1A 4JGSA 3ZRVA 3IAYA 3SPCA 1XL6A 5KA5A 2UXCO 5B3SB 1ZL8A 3S3WA 3LSUA 4I4TA 5KHGA 1L0NH 1NT2B 4FLYA 5D5QA 1MA1A 1SA0A 1RPOA 3VQXA 2PYJA 3QTCA 1ZLZA 4JI0B 1F51A 1QQCA 3H9VA 4EFEA 5LP6B 4K3AA 5KMGB 4YHHO 4JI6O 2ZE6A 1R1BA 3RW0A 3FKSG 2BTQA 1VP7A 4ICGA 2OWOA 1D5NA 2NN4A 1DGSA 5JQGA 1XMOO 3VOUA 3HKEB 3VQWA 4BIOA 4B3MB 2IBZH 2KSDA 1K3EA 1K5SA 2HJFC 1UJWB 1SRYA 2PGGA 1AI5A 4DR2B 5JJJB 2LQTA 3CXHF 3QO5A 4LFBO 4H0LB 1WB7A 4O4LB 1FFXB 2A79B 4BIUA 1B06A 5B1BB 1MNGA 2N74A 4JI7O 1LNQA 4DR1O 3G6BA 4DV7O 4B7EA 5JVDB 4B3TB 4YJ3B 3JD4A 1XMQO 1JFFA 1WPBA 2XTAA 4H13B 5EZYB 4PJ0Z 2K9PA 2E76B 2QM7A 1T5EA 1MOFA 4AQYO 2Q67A 3FAVB 4ASUG 4GLXA 1NH2B 1MSDA 3HKCB 5A2QN 5IJ9B 3K57A 1Q82W 4KXRA 2P4VA 4RUEA 4TV9B 4LF8O 5TISZ 4P9PA 1EZJA 4OGQB 3T1HB 3FYIB 3K59A 3JSLA 4O2BB 1SQPH 1KD1W 1TUEB 2KQXA 3AG2C 4MW8A 2IJHA 3QF7A 4I55A 3CSXA 5IYZB 3H1JH 1S76D 1Y67A 2Y0IA 3AG7A 2HHHO 4JF3A 2EJRA 2YICA 5B1AB 5LYJA 1XEQA 5EC2C 1P4RA 1DTOA 1YDXA 2ODMA 1MZEA 2RN9A 2XT9A 1GH6A 2ZE7A 2YIAA 3ICXA 4GKJO 2QWNB 4J80A 2DQ3A 4YHHB 4JI6B 3D36C 3X2QB 4X88A 1X59A 2X7RB 2HVKC 2P6JA 1NI8A 1IBMO 4LF9B 4DR3O 1WP8A 2F1MA 2GTSA 4EB6A 5B3SC 1XHZA 2GBOA 2IJIA 1XNRO 2AHZA 3B77A 4FM1A 3AG3B 2UU9O 4ZHQB 5BMVA 5GONA 1E1RG 1XUQA 3CCLV 5LP6C 2PYLA 4KUMA 2IM9A 3K9SA 1JQ0A 2PI4A 2WLIA 3E2EA 1BE3H 4TSFG 4FPPA 2YDEA 3D8CA 4PA3A 4Q20A 2EILB 1K73W 2O57A 1QLNA 3BHPA 4LF7B 1XHXA 4QPJA 4FFKA 3JASA 4QPKA 4F6RB 1JR9A 3LDEA 3TXQA 1M56B 3AK2A 3SPHA 4AQYB 1Q43A 2ZE5A 3D3QA 1PD3A 1M5IA 4KHPB 1I08A 3SYCA 3L72H 1W0JG 5B1BC 3VBBA 1MG1A 3OTOO 5BR8O 3SR2C 1IBLB 4X20B 4WF9V 2ZNIA 2ATKC 1JPXA 1NR1A 1Y66A 2EZPA 4I0XB 4NVPA 1Q8IA 2L6LA 3ZBHA 1KQSU 2MW2B 2Q0OC 3ZJZA 5J2UA 1N36O 2Q4PA 2XASA 4UCVA 4DUZO 3W7XA 4QGPA 2XAJA 1VQ7V 1P7BA 2HG5C 3APQA 4NYKA 4U7NA 4W4LA 3CCVV 4OPAA 1Y4MA 4H33A 4O2AA 2EIMB 1KP2A 5CBHA 1JX9A 4DRXA 2LJ2A 2JS3A 2YEVA 1HDJA 4JI3B 5D5PA 2UXBO 4GX0A 1SQQH 3B2EE 3OE7G 4X62O 1K9MW 4D6TH 2JEUA 4X1KB 4TQDA 2PZSA 5KHJA 2ETNA 4PDRA 5B1AC 4MSWC 4F4LA 2DOSA 4IHJB 5LMNB 5DN6G 1FXKB 3SDLA 2CH7B 4P2ZA 1BL8A 1NS1A 2Y0PA 1D2DA 1Z2GA 3O65A 2CGOA 3WG7C 2KG7A 4BR6A 3RYFB 4B3SO 4R8CA 1BGYH 1H2NA 2HKOA 1ORQC 1VQNV 4TV8A 4FLXA 2ZR3A 1OCRB 2WLHA 1BT8A 3X2QC 1IBKB 1I0HA 1VEWA 4DW0A 1K92A 4DR7B 4CH5A 3RYCA 1HWYA 4JASA 1PNKA 1ZTEA 2UXDB 2ZM6B 2LGQA 4LFCB 4LCUC 3EXAA 1AJNA 3K0DA 4GZRB 4AILC 1BHBA 3AG3C 2Q68A 3FB8C 3GWKC 3QNEA 5C8YB 4GUNA 2EIKB 3ZN1A 1YCIA 1S72V 1M9NA 4QE7A 3J7AU 3CC4V 2IH3C 5EYPB 3P3PA 1R6TA 1UFIA 3QVNA 4CS3A 4D7SA 3OTOB 5BR8B 1BZKA 3CCSV 1KUQA 2EILC 2VWJA 4DV5O 1SQGA 1ZX3A 3RT3C 1Q81W 1B6QA 3A8TA 3C3SA 4JI2O 3JARA 4CZZA 1KECA 1XDCA 1M56C 1WPXA 2V7QG 2H94A 2WLLA 4MVRA 2R9RB 3D3IA 4J9ZB 4OX9O 1RFYA 1ZL8B 4I4TB 4FZ0A 4JI8O 2WLNA 1NTKH 2ZINA 3CMEV 3CRCA 1KMIZ 4TWKA 1SA0B 3T1YB 4JI4O 2B1GA 2R9IA 1I5YA 5FNVA 5J2TA 4X8AA 3CCJV 4HYOA 2BCCH 3ZS8C 3HKDA 1KBHA 3MHHC 2UXBB 5CBFA 4X62B 1JCHA 2ZXWB 2D2CB 4IIJA 2BTQB 2OIGA 1FXHA 3I55V 5JQGB 3JD2A 2AZ2A 5KUMA 5LL6Y 1NTZH 3AK1A 2OIEA 2OTJV 1US6A 2EIMC 1NVPD 4Z1MG 4U3FH 1R3KC 4NKGB 4I50A 2AHYA 4NTYA 1VF6A 5L3GA 5CA1A 5IJ0A 4MVUA 4O4HA 3CXCU 1WAZA 1RSOA 3VQVA 4FLTA 1S5HC 1K33A 4X65O 1V54B 4BW9A 4IT5A 4GCZA 5LGUA 4OXSA 4JAVA 2DMXA 4DV0B 4WFGA 2Q7HA 1VQ8V 1JFFB 1FXKC 3UKMA 2VQEB 5KUKA 4ABMA 3JD0A 5EBMC 1YJ9V 1GM8A 1QVGU 5K1XA 3BCCH 2XUMA 1O9HA 3L70H 2ZIOA 1AP6A 4MVQA 1H2KA 3CHXA 1BMFG 2L35A 2GUZA 4JI5O 4JV5O 1CXZB 2N04A 4NXMB 1LUVA 2W0FC 2WWWA 3SPGA 2Q5ZA 2BOBC 4MW3A 4I55B 4JI2B 4X89A 5LA6A 3M8AA 4GYCB 2FL4A 2CUGA 4N21A 2QTSA 2EIKC 1F23A 4JYAO 3ZEDA 1Q6HA 2YXHA 5L3FA 5LYJB 2WAMA 3H01A 1YZBA 1SESA 4UVBA 1NBMG 5CA3A 2PY5A 3P3NA 5H2FZ 2F43G 1R6NA 1YI2V 3JSNA 3CCQV 5C93A 2QWQB 1F4MA 2CTPA 1FFTB 1GN6A 2GTAA 1FPOA 3ABKB 2XAQA 2P06A 1KKDA 4QJFB 3SYQA 3E22A 4KFMA 1W0KG 1Q90D 4ZOLA 4EB6B 3A2FA 4XDLA 2DQ0A 3JALA 4TT3G 3A0RA 2ILMA 2KB1A 4HAMA 2H8PC 2UXNA 3T4DA 1YJWV 3BA8A 5H6QA 1QHTA 3CCEV 2UUBB 5BMVB 2A3QA 5GONB 4DR5O 1TGOA 4DXWA 3QG5A 1NR7A 3OMAB 1TVKA 4K35A 1XI1A 2WLIB 2ZXWC 1AJQA 4JTAB 3FFQA 3CJHB 3CC7V 1UPGA 5AG2A 4LFAO 3UT5A 1JA8A 4K8XA 5FPRA 2Y4UA 3JASB 5LMUO 4LBEC 3JATA 3UO2A 4EFBA 4NR1A 2ADPA 3CYOA 1QR8A 3SYAA 3JAKA 3KZIZ 4UVAA 3I5DA 1P49A 3NR7A 1V54C 1YITV 4JYYA 1YSCA 3ASNB 2XHBA 2EINB 3B4SA 4JZ2A 2M6YA 1KC8W 5EBLC 2EZOA 5J2UB 4I5SA 4J7JA 5LGTA 4LF4O 1AB3A 1HNXO 2IW5A 4DV4O 1X4TA 2VWKA 4MVSA 2VQFB 1Q5OA 1L0LH 3LDDA 4JYAB 4DR4O 4G2KA 4J11A 4R6ZA 1VIBA 4MVZA 4BIZA 4BAYA 5EC1C 4O2AB 4DV3O 4G27B 2F4VB 4DRXB 1YXBA 3JAWA 3RBZA 2YEVB 1I5XA 4LF6B 2YSUB 1ZUQA 1HNWO 2FTKA 2GV9A 1M93A 1G1XB 3L73H 4XBFA 3QO7A 1N0JA 1HNZO 3K5OA 5LOVA 1B04A 4MTOA 4XDJA 3CCMV 2PTMA 4PA9A 3ASOB 1GM9A 3APOA 3K79A 3CX5F 2EBOA 2EX3A 2KG7B 1K34A 2ZNJA 3CS5A 4TV8B 2Z5UA 3CEIA 3ABKC 4DW1A 4I9WA 3O9OA 1H2GA 3RYCB 2Q0AA 1XNQO 4IGGA 5LHIA 2FB5A 3ZMVA 4X66O 5LMUB 1S0VA 1Q3EA 5JJNB 1AJPA 3FB6C 2WA3A 2UXCB 3ZRXA 3ETEA 2UUCO 4F6EA 2DJVA 4L8JA 3N2KA 1BHAA 3PJSK 3ZCCA 2ZDIA 2Y69B 4ZI7A 1I7FA 3OMNB 4FIPC 5IYDO 3JARB 4JI1O 3BABA 3NXSA 3UCSC 4LWSA 2JJ1G 4DUYO 1PNMA 1DK1A 2XOKG 2UUAO 2WLLB 3GWOA 1XMOB 1U96A 5JJEB 3OEHG 2RMKB 4DR4B 3K5NA 2ZIMA 1IDSA 1ZSPA 1Y76A 3OEEG 1Z5VA 5FNVB 1N32O 5KAFZ 5J2TB 1AI7A 2EJ7A 1GM7A 4LFBB 3HKDB 3ASNC 2EINC 3UM7A 2GHYA 3E8GA 2DYSB 3BA9A 3B40A 3U11A 4WBNA 2EULA 4JI7B 4DR1B 1VF7A 3U10A 4YY3O 4IIJB 1P84F 1TA8A 1DF4A 3C3TA 3ETGA 4FZ1A 4DV7B 4R50A 3ZMZA 4WFHA 1XMQB 1PNLA 1COWG 3RVYA 3SJCC 2ITCC 5KHHA 3CC2V 2CTQA 3JD1A 2QWRB 4I50B 1L1FA 2QKSA 1PV0A 3CPWU 1EN6A 1SQVH 5CA1B 3KKYA 5IJ0B 4FFBA 3T4ZA 4O4HB 3BAAA 2QA4V 2LO1A 3K06A 1RSOB 1IURA 4LF8B 4TUYA 3B8NA 4UCOA 1H8EG 1AVMA 2GDSA 3K3WA 2Q9LA 3DGEA 2JEXA 3EHBB 2AGAA 2YIBD 1URFA 3CCUV 3HB3B 1K5QA 3K5LA 1GN2A 2QEXV 1AR1B 5H6RA 2HHHB 3F7YC 4AHCA 4RQEA 3CWBH 1JOYA 2GUZB 2F93B 3GB7C 5E79Z 2HLDG 4B3RO 2A06H 4U3JA 5CB4A 4GKJB 2CDYA 2HEPA 5IWAO 1B3QA 1S3JA 1XQ8A 5LA6B 1IBMB 3FYEB 3ZHTA 1F4NA 4DR3B 3RYIA 1VQOV 3ZRSA 5JH7A 1ZAUA 4FMTA 3ABUA 4WFBV 4Z2WA 5IDJA 1XNRB 2PF4E 1HR0O 2Q69A 1YHQV 5CMUA 2UU9B 5CA0A 2KKWA 1JVMA 4DV6O 1K7DA 1YVWA 4O4IB 2Y69C 2Y4TA 2P22C 3W7UA 1H2LA 5LHGA 3CRQA 2W0XA 2FKXA 5IE9A 2JVDA 1JJ2U 2F23A 3E22B 2QR4A 2B5UA 3P30A 4KP4A 2OCCB 3RYHA 1FXVA 1AILA 4ZOLB 3JALB 2Q73A 1PP9H 5KAIZ 4LH7A 2IJKA 3ZX6A 4DV1O 1SZXA 4X1IA 2YC0A 1H8HG 2YUAA 3OMIB 4UV9A 4DV2O 2AZ0A 4MVOA 1YTFB 4PDLA 2DYSC 4X9QA 1TVKB 2X6BA 1G4YB 2P7TC 1R3JC 1ROPA 4LP8A 4HBNA 3A0BZ 1QR9A 3UT5B 3WB0A 2ZCEA 3HR0A 1OZ0A 1OHHG 1M57B 3K9AA 3JATB 5A9GA 1K4CC 1R73A 1XREA 3H1LH 1WB8A 1N36B 2RCVA 3MD0A 2HR3A 4CS4A 1THZA 2OYQA 5BY1A 4DUZB 2DW4A 2AW9A 1EFRG 5F2VO 1W59A 3G80A 3ABTA 3G4SV 1VQKV 3JAKB 5ITZA 3WFVA 1EZVH 2PUSA 3N27A 2YI8A 4RO2A 3UO3A 4PDMA 4W4KA 1J5EO 1OCOB 2QWPB 2JGDA 1L8DA 1BQ0A 1N4CA 3SPJA 2XNDG 5IYBO 1Y6XA 4PD4F 1M4UA 2WSSG 3L74H 3AG1B 3I56V 2E75B 2BE3A 3ZMSA 1EN4A 5KA6A 5EBWC 1WNSA 2RNBA 2IH1C 5HFLA 1RM1B 4BWAA 1AROP 3JCZA 5H5NA 2HJDA 4UCSA 3K03A 4WFFA 3ZHSA 3KCXA 5GTIZ 4H44B 3JAWB 5B1OA 4JYCA 4B3SB 2QM4A 4D7TA 4PA4A 1H38A 5EK0A 1PPJH 5EIBD 3C90A 4O4JA 2Q7EA 1NVPB 1OCCB 1VF5B 4PA6A 4UCUA 1E79G 5K1PA 4X64O 5LOVB 4GKKO 1PKXA 3HKBA 3M7MX 4IYHA 1PM9A 1JMKC 1N33O 1CP9A 3LUTB 4Z1VA 4LF5O 5DECA 3ZMUA 2YXLA 4DV1B 1NJIW 4K0KO 1FJGO 3K0GA 1IVSA 1R6KA 2R72A 3N2GA 4I7ZB 1OCRC 5KX5A 4HNAA 2WLKA 1K8AW 1AP5A 4OPHA 4MTGA 1SETA 3L9DA 3ABLB 3AEIA 4DV5B 1GAXA 3MDSA 1MZFA 1GRJA 3KG2A 1FD9A 1IZ3A 4UFZA 2OTLV 3EVKA 1NZ6A 1SQBH 1GTOA 4TQFA 2IU3A 3ZHRA 3AK3A 3K08A 4JI0O 2M7WA 4CBCA 4OX9B 1N8RW 4JI8B 2Z0AA 1WP7A 3AG4B 4JI4B 3ZRWA 3N2KB 4BW5A 1GKFA 4ZI7B 2XAGA 3ZMTA 5JWPA 5L3EA 3E35A 1D5AA 3ZIAG 4B3MO 2QGNA 1R3IC 3RGBA 4LWSB 1S5LZ 4MTXA 1F7YA 1N0NA 2MK3A 2EIJB 3B8MA 4DR2O 4FLVA 3JCUZ 3CP1A 4MT8A 3CD6V 3OUSA 3OGCC
chains in the Genus database with same CATH topology
1KQSU 3W7WA 2Z5UA 3ZJZA 3ABKC 4RQFA 4I9WA 2P90A 1H2GA 2XASA 2UXXA 3IC7A 3W7XA 1FS0G 1IXMA 1OCOC 2XAJA 5LHIA 1VQ7V 1P7BA 2HG5C 3ZMVA 5L3BA 1QCEA 4EKWA 4U7NA 3CCVV 2WLJA 3ABMC 4PDVA 1Y4MA 4QIWF 4H33A 2EIMB 3SYOA 1S0VA 3LNMB 1KP2A 3LSSA 5CBHA 1JX9A 4FK5C 4UV8A 3JD3A 1AJPA 2YEVA 3FB6C 1XL4A 4PA7A 1RM1C 4GX2A 3TETA 3BEHA 3ZRXA 2Y48A 3ETEA 4GX0A 2ZD9A 3OE7G 2LP7A 4P30A 4ZKIA 1K9MW 4XDKA 1OCZB 2DWDC 1BHAA 3PJSK 1G8MA 2JEUA 3IFXA 3ZCCA 2ZDIA 2Y69B 3QO8A 4PDRA 5B1AC 4MSWC 4F4LA 3OMNB 2P67A 5DN6G 3OW2U 4FIPC 1FXKB 1V55C 4P2ZA 1BL8A 1OCCC 2WLMA 5CN0A 1MABG 5IYDO 2OT5A 1KP3A 3NXSA 2BOCC 3OR6C 2JJ1G 2WPDG 1PNMA 3WG7C 2XOKG 2WLLB 3GWOA 1K97A 4R8CA 2HKOA 3OEHG 1ORQC 2XAHA 5DM6V 1CPYA 3CCRV 2JK5C 1VQNV 2ZR3A 4JTDB 1OCRB 5BZBA 2WLHA 3X2QC 1ENVA 1K92A 3OEEG 3LSQA 3MHSC 1HWYA 3OAAG 4JASA 4JTCB 2OCCC 1PNKA 1AI7A 1GM7A 3ASNC 2EINC 3UM7A 2GHYA 3E8GA 2DYSB 3E83A 4LCUC 1AJNA 3K0DA 5IY5B 1R3LC 1BHBA 1DF5A 3AG3C 2Q68A 4WCEV 3FB8C 3QNEA 2V1DA 2W6IG 1DF4A 1GO3F 3ETGA 3K04A 3IGAC 2X6AA 2EIKB 2DYRC 3ZN1A 3ABLC 1S72V 1M9NA 4R50A 3ZMZA 3HPLC 4QE7A 4WFHA 4DO2A 3FB5C 1PNLA 4H37A 3FB7C 1COWG 3P32A 3CC4V 2IH3C 3RVYA 2ITCC 2XAFA 3T1CA 4UXNA 2NNUA 1PL0A 3CCSV 3CC2V 3BY6A 2EILC 1SZTA 3JD1A 4GX1A 1L1FA 2QKSA 1QLEC 3CPWU 1M57C 1Q81W 1B6QA 4J9YB 1FXKA 3T4ZA 4R7CA 2QA4V 3K06A 5E1AC 1M90W 3B8NA 4CZZA 5H9CA 1NKDA 1KECA 3AG4C 3RVZA 1J95A 1M56C 4RAIA 1H8EG 3ETDA 2ZDIC 3W7TA 2LFRA 3K3WA 1WPXA 2V7QG 2H94A 2WLLA 3DGEA 4MVRA 3SJQC 2JEXA 2R9RB 3D3IA 4YXWG 1NH2D 2GSMB 2W6JG 4J9ZB 4E2LA 3EHBB 2WLNA 2JJ2G 3CMEV 3CCUV 2Q6AA 3HB3B 5LBQA 4TWKA 1K5QA 2B1GA 2R9IA 1I5YA 3EFFK 3E86A 2QEXV 2EIJC 2IU0A 1MSWD 1AR1B 1VQ9V 4N23A 5H6RA 3E8HA 1YIJV 4X8AA 2CK3G 3CMAV 2LFSA 3F7YC 3CCJV 4HYOA 1GK9A 3G6EV 1QVFU 4RQEA 2X6CA 3F7VC 3MHHC 4L87A 5L3DA 1JOYA 3AG2B 3AG1C 3T2MA 5CBFA 1JCHA 2ZXWB 4WFAV 4JAUA 1FXHA 2HVJC 3GB7C 1CEZA 3I55V 2HFEC 2HLDG 3JD2A 3E8FA 1RPRA 4QNHB 5KUMA 1W2BU 1GMGA 5GW7A 4GT1A 4FJCC 2OTJV 2K1EA 1S3JA 3SPIA 3FYEB 2EIMC 1NVPD 3SYPA 2A0LA 2QTOA 4P9OA 1F4NA 4Z1MG 1R3KC 1VQOV 3ZRSA 2AHYA 4QE9A 4FMTA 3ABUA 2PI5A 4PELA 5L3GA 4WFBV 1VQ4V 4MVUA 2X0LA 3LDCA 3CXCU 5IDJA 1S5HC 1AI6A 2DWEC 1K33A 2ITDC 2Q69A 4G28B 1YHQV 1OCZC 1V54B 5CMUA 4GCZA 5LGUA 1JVMA 3F5WC 4JAVA 4OXSA 4UUJC 1K7DA 1AI4A 2Y69C 3ZRVA 4JGSA 3WG7B 3SPCA 1XL6A 4WFGA 5KA5A 4ZBMA 5LHGA 3W7UA 1VQ8V 5B3SB 3E89A 1FXKC 3UKMA 5KUKA 3E8BA 3OFNG 1E1QG 3JD0A 5EBMC 1YJ9V 1GM8A 1QVGU 1JJ2U 1RPOA 4JYBA 2B5UA 3TK1A 3P30A 4KP4A 1F51A 2OCCB 1FXVA 4MVQA 1BMFG 1VQ6V 2IJKA 3RW0A 4LC1A 2QM8A 3FKSG 1H8HG 2W0FC 2WWWA 3OMIB 5J9PC 4UV9A 3VOUA 1Q7YW 3SPGA 4MVOA 1YTFB 2BOBC 2DYSC 4PDLA 2X6BA 1G4YB 4MW3A 4MS2A 2P7TC 4X89A 5IY5C 4GX5A 5L3CA 1K3EA 1Q86W 1K5SA 1R3JC 1ROPA 4LP8A 2HJFC 1UJWB 1VQPV 1SRYA 4N21A 1QR9A 2EIKC 1F23A 1AI5A 3QO5A 1OZ0A 1OHHG 5L3FA 1M57B 3JYCA 2A79B 4BIUA 5B1BB 2WAMA 3D36A 3H01A 1VQ5V 3K9AA 1K4CC 1SESA 1LNQA 1R73A 4UVBA 1NBMG 5CA3A 3MD0A 2HR3A 1THZA 2IJJA 2DW4A 2F43G 1EFRG 5LHHA 1R6NA 1YI2V 3CCQV 5C93A 3ASOC 3JD4A 3ABTA 3G4SV 1VQKV 1F4MA 3WFVA 1FFTB 2QM7A 5LGNA 3ABKB 2XAQA 3TCUA 1KKDA 1K4DC 1ZWIC 1MOFA 4RO2A 4QJFB 2Q67A 3SYQA 4ASUG 1NH2B 4KFMA 4PDMA 1W0KG 1OCOB 4XDLA 2DQ0A 3STZC 4TT3G 2JDIG 3SPJA 2XNDG 3A0RA 5IYBO 1Q82W 4RUEA 2KB1A 2WSSG 3OR7C 3AG1B 4HAMA 3I56V 3ABMB 2H8PC 2UXNA 3ZMSA 4P9PA 1EZJA 3T4DA 5B1NA 3FYIB 1YJWV 5H6QA 2JIZG 5KA6A 5EBWC 3CCEV 2IH1C 4U7OA 1WLEA 5HFLA 1SERA 3ZN0A 1KD1W 1TUEB 4DXWA 1RM1B 3OM3B 1NR7A 2NLJC 3OMAB 3AG2C 4MW8A 2IJHA 1AROP 1EBOA 1QBZA 3JCZA 2WLIB 1S76D 2ZQMA 2ZXWC 1AJQA 3K03A 4WFFA 4JTAB 3CC7V 2B1IA 5B1OA 4JYCA 2Z3YA 4JF3A 2EJRA 3STLC 5B1AB 4PA4A 1M1KW 5EK0A 1H38A 5HFMA 1V55B 4HZ3A 4MTFA 1NVPB 1OCCB 4PA6A 5EC2C 1P4RA 4LBEC 1DTOA 1E79G 3ZRWB 3CYOA 1PKXA 1QR8A 3SYAA 2DQ3A 1CP9A 3LUTB 4UVAA 3X2QB 4X88A 3ZMUA 2X7RB 2HVKC 1VQMV 1V54C 2P6JA 1NJIW 3K0GA 1YITV 1R6KA 3W7SA 1YSCA 3ASNB 5B3SC 2EINB 1OCRC 3R65A 1YJNV 1KC8W 5EBLC 2IJIA 2EZOA 4I5SA 2AHZA 2WLKA 3B77A 5LGTA 1K8AW 5IYCO 3AG3B 2IW5A 2QE7G 4MTGA 5FL7G 1SETA 2DYRB 4MVSA 3ABLB 1E1RG 3AEIA 1DLBA 3LDDA 3CCLV 4G2KA 4KUMA 1S77D 4R6ZA 1JQ0A 3KG2A 4WFEA 2D3OW 2PI4A 3DTUB 4MVZA 4BIZA 2WLIA 4BAYA 2OTLV 5EC1C 3E2EA 1GTOA 1YTFD 4TSFG 4FPPA 4G27B 4PA3A 2IU3A 3K08A 4Q20A 3RBZA 3G71V 2C2AA 2EILB 2YEVB 1K73W 1QLNA 1I5XA 2M7WA 2YSUB 1QLEB 4MVMA 4CBCA 1N8RW 4QPJA 2FTKA 4QPKA 3LDEA 4RUFA 3AG4B 3ZRWA 4XBFA 1M56B 3QO7A 4BW5A 3SPHA 1GKFA 3OUFA 4MTOA 4XDJA 1NQTA 1PD3A 4UVCA 2XAGA 3ZMTA 3CCMV 5L3EA 3SYCA 3ML0A 4PA9A 3ASOB 3E35A 3ZIAG 1W0JG 1GM9A 5B1BC 3VBBA 1MG1A 3K79A 1R3IC 2A9HA 4MTXA 4WF9V 5CBGA 2ATKC 2EBOA 1JPXA 2MK3A 2ZR2A 2EIJB 1VQLV 1NR1A 1K34A 1Y66A 2EZPA 3B8MA 4JPRA 3CP1A 3M99B 4MT8A 3CD6V 3OUSA 3OGCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3STL C;  4PA4 A;  5EK0 A;  3ZJZ A;  3ABK C;  4I9W A;  4HZ3 A;  4MTF A;  4PA6 A;  2EIL C;  5EC2 C;  4MVQ A;  4GX1 A;  4LBE C;  2QKS A;  1QLE C;  1M57 C;  3RW0 A;  4J9Y B;  3T4Z A;  4R7C A;  1OCO C;  3K06 A;  1P7B A;  2HG5 C;  5E1A C;  3SYA A;  3AG4 C;  3RVZ A;  1J95 A;  1M56 C;  4EKW A;  2WLJ A;  3ABM C;  4PDV A;  2W0F C;  4RAI A;  3LUT B;  3VOU A;  4H33 A;  5J9P C;  3SYO A;  2WLL A;  4MVR A;  3LNM B;  4MVO A;  4X88 A;  3SJQ C;  3SPG A;  2BOB C;  2DYS C;  2R9R B;  4PDL A;  2HVK C;  2X6B A;  5CBH A;  4J9Z B;  1G4Y B;  1V54 C;  4MW3 A;  2YEV A;  3FB6 C;  2P7T C;  1XL4 A;  4MS2 A;  4X89 A;  5IY5 C;  2WLN A;  4GX5 A;  4PA7 A;  3K0G A;  1R3J C;  4GX2 A;  4LP8 A;  3TET A;  2HJF C;  3BEH A;  2Q6A A;  4GX0 A;  2EIK C;  2ZD9 A;  4TWK A;  4P30 A;  5B3S C;  3EFF K;  3E86 A;  1OCR C;  2EIJ C;  3R65 A;  4XDK A;  5EBL C;  3E8H A;  4X8A A;  2DWD C;  3F7Y C;  4HYO A;  2AHZ A;  2WLK A;  3PJS K;  3IFX A;  3JYC A;  2A79 B;  2X6C A;  3F7V C;  1K4C C;  4MTG A;  1LNQ A;  4MVS A;  3AG1 C;  4PDR A;  5B1A C;  4MSW C;  3T2M A;  4F4L A;  5CBF A;  1V55 C;  4P2Z A;  2WLM A;  1BL8 A;  1OCC C;  3LDD A;  3ASO C;  2HVJ C;  3GB7 C;  2BOC C;  3KG2 A;  4R6Z A;  4WFE A;  3OR6 C;  4MVZ A;  2WLI A;  2HFE C;  5EC1 C;  3E8F A;  3WG7 C;  4QNH B;  5KUM A;  2WLL B;  4G27 B;  3TCU A;  4R8C A;  4PA3 A;  1KKD A;  1K4D C;  1ORQ C;  1ZWI C;  3K08 A;  4RO2 A;  3RBZ A;  2Q67 A;  3SYQ A;  2K1E A;  2JK5 C;  4KFM A;  4MVM A;  4CBC A;  4JTD B;  3SPI A;  4PDM A;  5BZB A;  2EIM C;  2WLH A;  3X2Q C;  3SYP A;  2A0L A;  2QTO A;  4P9O A;  1R3K C;  4XDL A;  3ZRS A;  3STZ C;  3LDE A;  3SPJ A;  2AHY A;  4JTC B;  4QE9 A;  4RUF A;  2OCC C;  4RUE A;  2KB1 A;  3OR7 C;  3SPH A;  4BW5 A;  4MVU A;  2H8P C;  3LDC A;  4P9P A;  3OUF A;  3T4D A;  3ASN C;  4MTO A;  4XDJ A;  2EIN C;  1S5H C;  2DWE C;  5EBW C;  3E8G A;  3UM7 A;  2ITD C;  2Q69 A;  3E83 A;  2IH1 C;  4G28 B;  4LCU C;  4PA9 A;  3SYC A;  1OCZ C;  3K0D A;  1JVM A;  3F5W C;  1R3L C;  4OXS A;  4DXW A;  4UUJ C;  3AG3 C;  2Q68 A;  5B1B C;  2Y69 C;  3FB8 C;  2NLJ C;  3K04 A;  3SPC A;  1R3I C;  1XL6 A;  3IGA C;  2A9H A;  2X6A A;  4WFG A;  2DYR C;  3AG2 C;  4ZBM A;  4MW8 A;  3ABL C;  5CBG A;  2ATK C;  3E89 A;  4R50 A;  3UKM A;  2WLI B;  3HPL C;  4QE7 A;  4WFH A;  2ZXW C;  3E8B A;  3FB5 C;  3K03 A;  4WFF A;  5KUK A;  4H37 A;  3FB7 C;  5EBM C;  4JTA B;  2IH3 C;  3RVY A;  2ITC C;  3OUS A;  3T1C A;  3OGC C; 
#chains in the Genus database with same CATH topology
 1WA8 A;  1TUB A;  2P90 A;  1Y76 B;  4UCT A;  2R9A A;  4B3T O;  2P5O A;  3IC7 A;  4FM2 A;  1OCO C;  4DK1 A;  2CE4 A;  2QWO B;  4WBN B;  4EKW A;  4X65 B;  3Q4H A;  4DK0 A;  3LSS A;  4UV8 A;  2ARH A;  2RJZ A;  3JD3 A;  1XL4 A;  3THO A;  1RM1 C;  3TET A;  4FLU A;  2ZD9 A;  2LP7 A;  1XIL A;  4P30 A;  4ZKI A;  4J41 A;  3T1H O;  2CAZ C;  4CH4 A;  1YF2 A;  1G8M A;  2LW7 A;  3IFX A;  1FJG B;  3QO8 A;  1YEW A;  2P67 A;  4FFB B;  4I9Q A;  2WLM A;  1OCC C;  3DXR A;  5CN0 A;  1MAB G;  4TUY B;  4JZG A;  4IL6 Z;  1KP3 A;  3OR6 C;  4JI5 B;  4JV5 B;  1K97 A;  2XAH A;  2YID A;  5DM6 V;  3GVM A;  1CPY A;  5JCO A;  2JK5 C;  4LR3 A;  4JTD B;  3IC9 A;  2BSK A;  1ENV A;  3BFR A;  3KCY A;  3MHS C;  4JTC B;  4FVM A;  3E83 A;  3DC5 A;  5IY5 B;  1R3L C;  1DF5 A;  4WCE V;  2V1D A;  1GO3 F;  3IGA C;  2X6A A;  4LF9 O;  3ABL C;  4DO2 A;  4U3J B;  1EM1 A;  5CB4 B;  1Y74 A;  4H37 A;  3P32 A;  2XAF A;  3T1C A;  1H2M A;  1BS3 A;  4UXN A;  4YJ2 A;  1PL0 A;  5FPO A;  4J42 A;  3BY6 A;  4J7Z A;  3RYI B;  3OGI B;  1SZT A;  5JH7 B;  2AXT Z;  1WJZ A;  3K58 A;  1SF9 A;  5E1A C;  1M90 W;  3AG4 C;  4LH6 A;  1J95 A;  5CA0 B;  2F95 B;  2JS5 A;  3ETD A;  2ZDI C;  3R66 A;  3W7T A;  2LFR A;  4DR5 B;  3SJQ C;  1SQX H;  4YXW G;  1NH2 D;  2GSM B;  3TGU H;  4LF7 O;  4E2L A;  4AI8 A;  4NXN O;  2JJ2 G;  4J10 A;  3EFF K;  3E86 A;  2EIJ C;  4A5U B;  2ADQ B;  1MSW D;  4N23 A;  2VRZ A;  2CK3 G;  4YIO A;  3CMA V;  4LFA B;  1GK9 A;  3RYH B;  3G6E V;  1QVF U;  4KHP O;  2X6C A;  3F7V C;  3RFR A;  3H1K H;  3BVO A;  3T2M A;  5B5E Z;  4WFA V;  1HW7 A;  1IBL O;  2ZT9 B;  4X1I B;  2HVJ C;  3IJ4 A;  2HFE C;  1RPR A;  1W2B U;  1GMG A;  2RQ6 A;  5GW7 A;  4GT1 A;  4FJC C;  1BSM A;  4E4E A;  4P9O A;  3DSQ A;  3RN4 A;  1LR1 A;  3MAQ A;  3OD4 A;  2PI5 A;  2VS0 A;  1VQ4 V;  2X0L A;  4C7U A;  3SGI A;  2DWE C;  4LF4 B;  2ITD C;  5GTH Z;  1HNX B;  4DV4 B;  4UUJ C;  1AI4 A;  1SS3 A;  2FYU H;  3WG7 B;  4ZBM A;  4JI3 O;  5ITZ B;  3E89 A;  2CTR A;  2E3C A;  3E8B A;  3OFN G;  1E1Q G;  1SKV A;  3J81 N;  2FML A;  2R70 A;  4DV3 B;  2E5L O;  4JYB A;  3TK1 A;  1QU7 A;  2JGD B;  1HNW B;  5LMN O;  4LNU A;  3BRC A;  1VQ6 V;  2LW1 A;  4LC1 A;  2QM8 A;  3FX7 A;  1HNZ B;  3F5T A;  1A32 A;  5J9P C;  1Q7Y W;  3CRR A;  4UCR A;  1BCC H;  4MS2 A;  1IBK O;  5IY5 C;  4GX5 A;  5L3C A;  1Q86 W;  3SJB C;  1P7G A;  4X1Y A;  1U97 A;  1VQP V;  4DR7 O;  3CJH A;  1BQZ A;  1IX9 A;  2UXD O;  2NR5 A;  4O4J B;  3JYC A;  2ZM6 O;  4NXN B;  2G38 A;  4LFC O;  3D36 A;  1VQ5 V;  1XOU A;  4FLZ A;  1EN5 A;  2CTW A;  1NU1 H;  4DR6 O;  2IJJ A;  5LXT A;  4K8Z A;  5LHH A;  1XNQ B;  3HKB B;  1O9G A;  3ASO C;  2Q7G A;  1SC5 B;  4CH3 A;  3SJA C;  5LGN A;  2P4K A;  4X66 B;  3TCU A;  1K4D C;  1ZWI C;  1OJH A;  2QKC A;  4JAA A;  3L75 H;  3N2G B;  4CS2 A;  5LP6 A;  2UUC B;  1V9P A;  1KB9 F;  3STZ C;  5KMG A;  2JDI G;  5KX5 B;  4HNA B;  3OR7 C;  4UB8 Z;  3ABM B;  5B1N A;  2JIZ G;  4U7O A;  1WLE A;  1SER A;  3ZN0 A;  3A0H Z;  3OM3 B;  3HKE A;  2NLJ C;  1EBO A;  1QBZ A;  4JI1 B;  2ZQM A;  3T1Y O;  4DUY B;  2B1I A;  1I94 O;  2UUA B;  2Z3Y A;  3VQY A;  3STL C;  1M1K W;  5HFM A;  3ETQ A;  4O4L A;  1FFX A;  1V55 B;  4HZ3 A;  4MTF A;  1KYO F;  2E74 B;  2DE0 X;  3ZRW B;  1PL4 A;  4FM0 A;  2E5L B;  1N32 B;  2A7W A;  1LUW A;  5JVD A;  5KHI A;  4YJ3 A;  2YI9 A;  2B9Z A;  1N34 O;  5EZY A;  3H1I H;  4J7K A;  4YY3 B;  3CRA A;  3CRM A;  3WB2 A;  1VQM V;  3FAV A;  4YIP A;  3H1H H;  2BTO A;  3W7S A;  3HKC A;  3DC6 A;  4NTX A;  3R65 A;  3J80 N;  1YJN V;  5IJ9 A;  1WA8 B;  1WN7 A;  4TV9 A;  3U0Z A;  1TUB B;  5IYC O;  4O2B A;  4NTW A;  2QE7 G;  5FL7 G;  2DYR B;  1DLB A;  4DV0 O;  5IT9 N;  2Q8V A;  2VQE O;  2DN9 A;  1S77 D;  3TXS A;  4WFE A;  2D3O W;  3DTU B;  3Q4H B;  5IYZ A;  1AR5 A;  1YTF D;  4PHZ A;  3CB2 A;  4DR6 B;  3G71 V;  2C2A A;  4KL1 A;  4MVM A;  1QLE B;  1VAR A;  4RUF A;  2YS8 A;  3OUF A;  1H2S B;  1NQT A;  4UVC A;  1VF6 C;  5B66 Z;  4NXM O;  2ZKO A;  3ML0 A;  2V4D A;  1QNM A;  3DXR B;  2ZE8 A;  2A9H A;  4EEQ A;  5CBG A;  2ZR2 A;  1VQL V;  2RDC A;  4JPR A;  4B3R B;  3M99 B;  1XBL A;  2QKA A;  3W7W A;  5IWA B;  3TJT A;  2BSK B;  4RQF A;  4PI0 A;  4Q6G A;  2YXY A;  4ZHQ A;  1NTM H;  1I94 B;  2UXX A;  1FS0 G;  4CC6 A;  1IXM A;  2JRI A;  1MMM A;  5L3B A;  1QCE A;  2WLJ A;  3ABM C;  4PDV A;  4QIW F;  3RWR D;  2LGW A;  1HR0 B;  3SYO A;  3LNM B;  4DV6 B;  4FK5 C;  4TOI A;  4ZIB A;  1TAE A;  4PA7 A;  4GX2 A;  3S3X A;  1Y74 B;  3BEH A;  2Y48 A;  1AR4 A;  1N34 B;  3OTF A;  3UQ8 A;  4F6R A;  4YJ2 B;  4XDK A;  1OCZ B;  2DWD C;  2UUB O;  2N05 A;  3OW2 U;  1V55 C;  4IYI A;  2OT5 A;  4X20 A;  1KKC A;  2BOC C;  2OCH A;  2WPD G;  3B09 A;  4I0X A;  4B08 A;  2YIB A;  4DV2 B;  1GN4 A;  3WB1 A;  1SQF A;  3CCR V;  1IXB A;  5BZB A;  4DYL A;  2WA4 A;  3LSQ A;  3OAA G;  4PV1 B;  2OCC C;  4PI2 A;  2QJ1 A;  3ZHU A;  2CGN A;  1S5J A;  1G6U A;  2W6I G;  3K04 A;  2DYR C;  5FLX N;  1FAF A;  3HPL C;  3FB5 C;  3FB7 C;  2NNU A;  4X1K A;  2VQF O;  3G67 A;  4GX1 A;  1J5E B;  3K5M A;  1QLE C;  1M57 C;  4IHJ A;  2QDO A;  1FXK A;  4J9Y B;  2CH7 A;  4R7C A;  1FYJ A;  5H9C A;  1NKD A;  3RVZ A;  4RAI A;  2F4V O;  4NB5 A;  2H3O A;  5BXZ A;  3RYF A;  4O4I A;  2HP8 A;  4LF6 O;  2W6J G;  1HP8 A;  3JAM N;  2JGU A;  2Q6A A;  5LBQ A;  3ZHQ A;  4UB6 Z;  3BPZ A;  2IU0 A;  1VMG A;  1VQ9 V;  4FLW A;  3E8H A;  1YIJ V;  2LFS A;  2QSA A;  3LNN A;  5KHK A;  5JCO C;  4L87 A;  5L3D A;  5KLV H;  1KU9 A;  3AG2 B;  3AG1 C;  4LNU B;  3ZHV A;  3L71 H;  4B7K A;  5C8Y A;  4X64 B;  1JJO A;  4JAU A;  1Z5W A;  4GKK B;  1CEZ A;  4RWU A;  1GN3 A;  3E8F A;  4QNH B;  1N33 B;  4LF5 B;  5EYP A;  3WU2 Z;  2K1E A;  1FKA O;  3SPI A;  4X1Y B;  4CC5 A;  4K0K B;  3SYP A;  2A0L A;  2QTO A;  1Q6I A;  3CE2 A;  1Q6U A;  4QE9 A;  4CH6 A;  4PEL A;  2F66 C;  3LDC A;  1AI6 A;  1OV9 A;  4G28 B;  1RP3 B;  1OCZ C;  3F5W C;  5LXT B;  3FD9 A;  5EIB C;  5DED A;  3OT7 A;  3PN1 A;  4JGS A;  3ZRV A;  3IAY A;  3SPC A;  1XL6 A;  5KA5 A;  2UXC O;  5B3S B;  1ZL8 A;  3S3W A;  3LSU A;  4I4T A;  5KHG A;  1L0N H;  1NT2 B;  4FLY A;  5D5Q A;  1MA1 A;  1SA0 A;  1RPO A;  3VQX A;  2PYJ A;  3QTC A;  1ZLZ A;  4JI0 B;  1F51 A;  1QQC A;  3H9V A;  4EFE A;  5LP6 B;  4K3A A;  5KMG B;  4YHH O;  4JI6 O;  2ZE6 A;  1R1B A;  3RW0 A;  3FKS G;  2BTQ A;  1VP7 A;  4ICG A;  2OWO A;  1D5N A;  2NN4 A;  1DGS A;  5JQG A;  1XMO O;  3VOU A;  3HKE B;  3VQW A;  4BIO A;  4B3M B;  2IBZ H;  2KSD A;  1K3E A;  1K5S A;  2HJF C;  1UJW B;  1SRY A;  2PGG A;  1AI5 A;  4DR2 B;  5JJJ B;  2LQT A;  3CXH F;  3QO5 A;  4LFB O;  4H0L B;  1WB7 A;  4O4L B;  1FFX B;  2A79 B;  4BIU A;  1B06 A;  5B1B B;  1MNG A;  2N74 A;  4JI7 O;  1LNQ A;  4DR1 O;  3G6B A;  4DV7 O;  4B7E A;  5JVD B;  4B3T B;  4YJ3 B;  3JD4 A;  1XMQ O;  1JFF A;  1WPB A;  2XTA A;  4H13 B;  5EZY B;  4PJ0 Z;  2K9P A;  2E76 B;  2QM7 A;  1T5E A;  1MOF A;  4AQY O;  2Q67 A;  3FAV B;  4ASU G;  4GLX A;  1NH2 B;  1MSD A;  3HKC B;  5A2Q N;  5IJ9 B;  3K57 A;  1Q82 W;  4KXR A;  2P4V A;  4RUE A;  4TV9 B;  4LF8 O;  5TIS Z;  4P9P A;  1EZJ A;  4OGQ B;  3T1H B;  3FYI B;  3K59 A;  3JSL A;  4O2B B;  1SQP H;  1KD1 W;  1TUE B;  2KQX A;  3AG2 C;  4MW8 A;  2IJH A;  3QF7 A;  4I55 A;  3CSX A;  5IYZ B;  3H1J H;  1S76 D;  1Y67 A;  2Y0I A;  3AG7 A;  2HHH O;  4JF3 A;  2EJR A;  2YIC A;  5B1A B;  5LYJ A;  1XEQ A;  5EC2 C;  1P4R A;  1DTO A;  1YDX A;  2ODM A;  1MZE A;  2RN9 A;  2XT9 A;  1GH6 A;  2ZE7 A;  2YIA A;  3ICX A;  4GKJ O;  2QWN B;  4J80 A;  2DQ3 A;  4YHH B;  4JI6 B;  3D36 C;  3X2Q B;  4X88 A;  1X59 A;  2X7R B;  2HVK C;  2P6J A;  1NI8 A;  1IBM O;  4LF9 B;  4DR3 O;  1WP8 A;  2F1M A;  2GTS A;  4EB6 A;  5B3S C;  1XHZ A;  2GBO A;  2IJI A;  1XNR O;  2AHZ A;  3B77 A;  4FM1 A;  3AG3 B;  2UU9 O;  4ZHQ B;  5BMV A;  5GON A;  1E1R G;  1XUQ A;  3CCL V;  5LP6 C;  2PYL A;  4KUM A;  2IM9 A;  3K9S A;  1JQ0 A;  2PI4 A;  2WLI A;  3E2E A;  1BE3 H;  4TSF G;  4FPP A;  2YDE A;  3D8C A;  4PA3 A;  4Q20 A;  2EIL B;  1K73 W;  2O57 A;  1QLN A;  3BHP A;  4LF7 B;  1XHX A;  4QPJ A;  4FFK A;  3JAS A;  4QPK A;  4F6R B;  1JR9 A;  3LDE A;  3TXQ A;  1M56 B;  3AK2 A;  3SPH A;  4AQY B;  1Q43 A;  2ZE5 A;  3D3Q A;  1PD3 A;  1M5I A;  4KHP B;  1I08 A;  3SYC A;  3L72 H;  1W0J G;  5B1B C;  3VBB A;  1MG1 A;  3OTO O;  5BR8 O;  3SR2 C;  1IBL B;  4X20 B;  4WF9 V;  2ZNI A;  2ATK C;  1JPX A;  1NR1 A;  1Y66 A;  2EZP A;  4I0X B;  4NVP A;  1Q8I A;  2L6L A;  3ZBH A;  1KQS U;  2MW2 B;  2Q0O C;  3ZJZ A;  5J2U A;  1N36 O;  2Q4P A;  2XAS A;  4UCV A;  4DUZ O;  3W7X A;  4QGP A;  2XAJ A;  1VQ7 V;  1P7B A;  2HG5 C;  3APQ A;  4NYK A;  4U7N A;  4W4L A;  3CCV V;  4OPA A;  1Y4M A;  4H33 A;  4O2A A;  2EIM B;  1KP2 A;  5CBH A;  1JX9 A;  4DRX A;  2LJ2 A;  2JS3 A;  2YEV A;  1HDJ A;  4JI3 B;  5D5P A;  2UXB O;  4GX0 A;  1SQQ H;  3B2E E;  3OE7 G;  4X62 O;  1K9M W;  4D6T H;  2JEU A;  4X1K B;  4TQD A;  2PZS A;  5KHJ A;  2ETN A;  4PDR A;  5B1A C;  4MSW C;  4F4L A;  2DOS A;  4IHJ B;  5LMN B;  5DN6 G;  1FXK B;  3SDL A;  2CH7 B;  4P2Z A;  1BL8 A;  1NS1 A;  2Y0P A;  1D2D A;  1Z2G A;  3O65 A;  2CGO A;  3WG7 C;  2KG7 A;  4BR6 A;  3RYF B;  4B3S O;  4R8C A;  1BGY H;  1H2N A;  2HKO A;  1ORQ C;  1VQN V;  4TV8 A;  4FLX A;  2ZR3 A;  1OCR B;  2WLH A;  1BT8 A;  3X2Q C;  1IBK B;  1I0H A;  1VEW A;  4DW0 A;  1K92 A;  4DR7 B;  4CH5 A;  3RYC A;  1HWY A;  4JAS A;  1PNK A;  1ZTE A;  2UXD B;  2ZM6 B;  2LGQ A;  4LFC B;  4LCU C;  3EXA A;  1AJN A;  3K0D A;  4GZR B;  4AIL C;  1BHB A;  3AG3 C;  2Q68 A;  3FB8 C;  3GWK C;  3QNE A;  5C8Y B;  4GUN A;  2EIK B;  3ZN1 A;  1YCI A;  1S72 V;  1M9N A;  4QE7 A;  3J7A U;  3CC4 V;  2IH3 C;  5EYP B;  3P3P A;  1R6T A;  1UFI A;  3QVN A;  4CS3 A;  4D7S A;  3OTO B;  5BR8 B;  1BZK A;  3CCS V;  1KUQ A;  2EIL C;  2VWJ A;  4DV5 O;  1SQG A;  1ZX3 A;  3RT3 C;  1Q81 W;  1B6Q A;  3A8T A;  3C3S A;  4JI2 O;  3JAR A;  4CZZ A;  1KEC A;  1XDC A;  1M56 C;  1WPX A;  2V7Q G;  2H94 A;  2WLL A;  4MVR A;  2R9R B;  3D3I A;  4J9Z B;  4OX9 O;  1RFY A;  1ZL8 B;  4I4T B;  4FZ0 A;  4JI8 O;  2WLN A;  1NTK H;  2ZIN A;  3CME V;  3CRC A;  1KMI Z;  4TWK A;  1SA0 B;  3T1Y B;  4JI4 O;  2B1G A;  2R9I A;  1I5Y A;  5FNV A;  5J2T A;  4X8A A;  3CCJ V;  4HYO A;  2BCC H;  3ZS8 C;  3HKD A;  1KBH A;  3MHH C;  2UXB B;  5CBF A;  4X62 B;  1JCH A;  2ZXW B;  2D2C B;  4IIJ A;  2BTQ B;  2OIG A;  1FXH A;  3I55 V;  5JQG B;  3JD2 A;  2AZ2 A;  5KUM A;  5LL6 Y;  1NTZ H;  3AK1 A;  2OIE A;  2OTJ V;  1US6 A;  2EIM C;  1NVP D;  4Z1M G;  4U3F H;  1R3K C;  4NKG B;  4I50 A;  2AHY A;  4NTY A;  1VF6 A;  5L3G A;  5CA1 A;  5IJ0 A;  4MVU A;  4O4H A;  3CXC U;  1WAZ A;  1RSO A;  3VQV A;  4FLT A;  1S5H C;  1K33 A;  4X65 O;  1V54 B;  4BW9 A;  4IT5 A;  4GCZ A;  5LGU A;  4OXS A;  4JAV A;  2DMX A;  4DV0 B;  4WFG A;  2Q7H A;  1VQ8 V;  1JFF B;  1FXK C;  3UKM A;  2VQE B;  5KUK A;  4ABM A;  3JD0 A;  5EBM C;  1YJ9 V;  1GM8 A;  1QVG U;  5K1X A;  3BCC H;  2XUM A;  1O9H A;  3L70 H;  2ZIO A;  1AP6 A;  4MVQ A;  1H2K A;  3CHX A;  1BMF G;  2L35 A;  2GUZ A;  4JI5 O;  4JV5 O;  1CXZ B;  2N04 A;  4NXM B;  1LUV A;  2W0F C;  2WWW A;  3SPG A;  2Q5Z A;  2BOB C;  4MW3 A;  4I55 B;  4JI2 B;  4X89 A;  5LA6 A;  3M8A A;  4GYC B;  2FL4 A;  2CUG A;  4N21 A;  2QTS A;  2EIK C;  1F23 A;  4JYA O;  3ZED A;  1Q6H A;  2YXH A;  5L3F A;  5LYJ B;  2WAM A;  3H01 A;  1YZB A;  1SES A;  4UVB A;  1NBM G;  5CA3 A;  2PY5 A;  3P3N A;  5H2F Z;  2F43 G;  1R6N A;  1YI2 V;  3JSN A;  3CCQ V;  5C93 A;  2QWQ B;  1F4M A;  2CTP A;  1FFT B;  1GN6 A;  2GTA A;  1FPO A;  3ABK B;  2XAQ A;  2P06 A;  1KKD A;  4QJF B;  3SYQ A;  3E22 A;  4KFM A;  1W0K G;  1Q90 D;  4ZOL A;  4EB6 B;  3A2F A;  4XDL A;  2DQ0 A;  3JAL A;  4TT3 G;  3A0R A;  2ILM A;  2KB1 A;  4HAM A;  2H8P C;  2UXN A;  3T4D A;  1YJW V;  3BA8 A;  5H6Q A;  1QHT A;  3CCE V;  2UUB B;  5BMV B;  2A3Q A;  5GON B;  4DR5 O;  1TGO A;  4DXW A;  3QG5 A;  1NR7 A;  3OMA B;  1TVK A;  4K35 A;  1XI1 A;  2WLI B;  2ZXW C;  1AJQ A;  4JTA B;  3FFQ A;  3CJH B;  3CC7 V;  1UPG A;  5AG2 A;  4LFA O;  3UT5 A;  1JA8 A;  4K8X A;  5FPR A;  2Y4U A;  3JAS B;  5LMU O;  4LBE C;  3JAT A;  3UO2 A;  4EFB A;  4NR1 A;  2ADP A;  3CYO A;  1QR8 A;  3SYA A;  3JAK A;  3KZI Z;  4UVA A;  3I5D A;  1P49 A;  3NR7 A;  1V54 C;  1YIT V;  4JYY A;  1YSC A;  3ASN B;  2XHB A;  2EIN B;  3B4S A;  4JZ2 A;  2M6Y A;  1KC8 W;  5EBL C;  2EZO A;  5J2U B;  4I5S A;  4J7J A;  5LGT A;  4LF4 O;  1AB3 A;  1HNX O;  2IW5 A;  4DV4 O;  1X4T A;  2VWK A;  4MVS A;  2VQF B;  1Q5O A;  1L0L H;  3LDD A;  4JYA B;  4DR4 O;  4G2K A;  4J11 A;  4R6Z A;  1VIB A;  4MVZ A;  4BIZ A;  4BAY A;  5EC1 C;  4O2A B;  4DV3 O;  4G27 B;  2F4V B;  4DRX B;  1YXB A;  3JAW A;  3RBZ A;  2YEV B;  1I5X A;  4LF6 B;  2YSU B;  1ZUQ A;  1HNW O;  2FTK A;  2GV9 A;  1M93 A;  1G1X B;  3L73 H;  4XBF A;  3QO7 A;  1N0J A;  1HNZ O;  3K5O A;  5LOV A;  1B04 A;  4MTO A;  4XDJ A;  3CCM V;  2PTM A;  4PA9 A;  3ASO B;  1GM9 A;  3APO A;  3K79 A;  3CX5 F;  2EBO A;  2EX3 A;  2KG7 B;  1K34 A;  2ZNJ A;  3CS5 A;  4TV8 B;  2Z5U A;  3CEI A;  3ABK C;  4DW1 A;  4I9W A;  3O9O A;  1H2G A;  3RYC B;  2Q0A A;  1XNQ O;  4IGG A;  5LHI A;  2FB5 A;  3ZMV A;  4X66 O;  5LMU B;  1S0V A;  1Q3E A;  5JJN B;  1AJP A;  3FB6 C;  2WA3 A;  2UXC B;  3ZRX A;  3ETE A;  2UUC O;  4F6E A;  2DJV A;  4L8J A;  3N2K A;  1BHA A;  3PJS K;  3ZCC A;  2ZDI A;  2Y69 B;  4ZI7 A;  1I7F A;  3OMN B;  4FIP C;  5IYD O;  3JAR B;  4JI1 O;  3BAB A;  3NXS A;  3UCS C;  4LWS A;  2JJ1 G;  4DUY O;  1PNM A;  1DK1 A;  2XOK G;  2UUA O;  2WLL B;  3GWO A;  1XMO B;  1U96 A;  5JJE B;  3OEH G;  2RMK B;  4DR4 B;  3K5N A;  2ZIM A;  1IDS A;  1ZSP A;  1Y76 A;  3OEE G;  1Z5V A;  5FNV B;  1N32 O;  5KAF Z;  5J2T B;  1AI7 A;  2EJ7 A;  1GM7 A;  4LFB B;  3HKD B;  3ASN C;  2EIN C;  3UM7 A;  2GHY A;  3E8G A;  2DYS B;  3BA9 A;  3B40 A;  3U11 A;  4WBN A;  2EUL A;  4JI7 B;  4DR1 B;  1VF7 A;  3U10 A;  4YY3 O;  4IIJ B;  1P84 F;  1TA8 A;  1DF4 A;  3C3T A;  3ETG A;  4FZ1 A;  4DV7 B;  4R50 A;  3ZMZ A;  4WFH A;  1XMQ B;  1PNL A;  1COW G;  3RVY A;  3SJC C;  2ITC C;  5KHH A;  3CC2 V;  2CTQ A;  3JD1 A;  2QWR B;  4I50 B;  1L1F A;  2QKS A;  1PV0 A;  3CPW U;  1EN6 A;  1SQV H;  5CA1 B;  3KKY A;  5IJ0 B;  4FFB A;  3T4Z A;  4O4H B;  3BAA A;  2QA4 V;  2LO1 A;  3K06 A;  1RSO B;  1IUR A;  4LF8 B;  4TUY A;  3B8N A;  4UCO A;  1H8E G;  1AVM A;  2GDS A;  3K3W A;  2Q9L A;  3DGE A;  2JEX A;  3EHB B;  2AGA A;  2YIB D;  1URF A;  3CCU V;  3HB3 B;  1K5Q A;  3K5L A;  1GN2 A;  2QEX V;  1AR1 B;  5H6R A;  2HHH B;  3F7Y C;  4AHC A;  4RQE A;  3CWB H;  1JOY A;  2GUZ B;  2F93 B;  3GB7 C;  5E79 Z;  2HLD G;  4B3R O;  2A06 H;  4U3J A;  5CB4 A;  4GKJ B;  2CDY A;  2HEP A;  5IWA O;  1B3Q A;  1S3J A;  1XQ8 A;  5LA6 B;  1IBM B;  3FYE B;  3ZHT A;  1F4N A;  4DR3 B;  3RYI A;  1VQO V;  3ZRS A;  5JH7 A;  1ZAU A;  4FMT A;  3ABU A;  4WFB V;  4Z2W A;  5IDJ A;  1XNR B;  2PF4 E;  1HR0 O;  2Q69 A;  1YHQ V;  5CMU A;  2UU9 B;  5CA0 A;  2KKW A;  1JVM A;  4DV6 O;  1K7D A;  1YVW A;  4O4I B;  2Y69 C;  2Y4T A;  2P22 C;  3W7U A;  1H2L A;  5LHG A;  3CRQ A;  2W0X A;  2FKX A;  5IE9 A;  2JVD A;  1JJ2 U;  2F23 A;  3E22 B;  2QR4 A;  2B5U A;  3P30 A;  4KP4 A;  2OCC B;  3RYH A;  1FXV A;  1AIL A;  4ZOL B;  3JAL B;  2Q73 A;  1PP9 H;  5KAI Z;  4LH7 A;  2IJK A;  3ZX6 A;  4DV1 O;  1SZX A;  4X1I A;  2YC0 A;  1H8H G;  2YUA A;  3OMI B;  4UV9 A;  4DV2 O;  2AZ0 A;  4MVO A;  1YTF B;  4PDL A;  2DYS C;  4X9Q A;  1TVK B;  2X6B A;  1G4Y B;  2P7T C;  1R3J C;  1ROP A;  4LP8 A;  4HBN A;  3A0B Z;  1QR9 A;  3UT5 B;  3WB0 A;  2ZCE A;  3HR0 A;  1OZ0 A;  1OHH G;  1M57 B;  3K9A A;  3JAT B;  5A9G A;  1K4C C;  1R73 A;  1XRE A;  3H1L H;  1WB8 A;  1N36 B;  2RCV A;  3MD0 A;  2HR3 A;  4CS4 A;  1THZ A;  2OYQ A;  5BY1 A;  4DUZ B;  2DW4 A;  2AW9 A;  1EFR G;  5F2V O;  1W59 A;  3G80 A;  3ABT A;  3G4S V;  1VQK V;  3JAK B;  5ITZ A;  3WFV A;  1EZV H;  2PUS A;  3N27 A;  2YI8 A;  4RO2 A;  3UO3 A;  4PDM A;  4W4K A;  1J5E O;  1OCO B;  2QWP B;  2JGD A;  1L8D A;  1BQ0 A;  1N4C A;  3SPJ A;  2XND G;  5IYB O;  1Y6X A;  4PD4 F;  1M4U A;  2WSS G;  3L74 H;  3AG1 B;  3I56 V;  2E75 B;  2BE3 A;  3ZMS A;  1EN4 A;  5KA6 A;  5EBW C;  1WNS A;  2RNB A;  2IH1 C;  5HFL A;  1RM1 B;  4BWA A;  1ARO P;  3JCZ A;  5H5N A;  2HJD A;  4UCS A;  3K03 A;  4WFF A;  3ZHS A;  3KCX A;  5GTI Z;  4H44 B;  3JAW B;  5B1O A;  4JYC A;  4B3S B;  2QM4 A;  4D7T A;  4PA4 A;  1H38 A;  5EK0 A;  1PPJ H;  5EIB D;  3C90 A;  4O4J A;  2Q7E A;  1NVP B;  1OCC B;  1VF5 B;  4PA6 A;  4UCU A;  1E79 G;  5K1P A;  4X64 O;  5LOV B;  4GKK O;  1PKX A;  3HKB A;  3M7M X;  4IYH A;  1PM9 A;  1JMK C;  1N33 O;  1CP9 A;  3LUT B;  4Z1V A;  4LF5 O;  5DEC A;  3ZMU A;  2YXL A;  4DV1 B;  1NJI W;  4K0K O;  1FJG O;  3K0G A;  1IVS A;  1R6K A;  2R72 A;  3N2G A;  4I7Z B;  1OCR C;  5KX5 A;  4HNA A;  2WLK A;  1K8A W;  1AP5 A;  4OPH A;  4MTG A;  1SET A;  3L9D A;  3ABL B;  3AEI A;  4DV5 B;  1GAX A;  3MDS A;  1MZF A;  1GRJ A;  3KG2 A;  1FD9 A;  1IZ3 A;  4UFZ A;  2OTL V;  3EVK A;  1NZ6 A;  1SQB H;  1GTO A;  4TQF A;  2IU3 A;  3ZHR A;  3AK3 A;  3K08 A;  4JI0 O;  2M7W A;  4CBC A;  4OX9 B;  1N8R W;  4JI8 B;  2Z0A A;  1WP7 A;  3AG4 B;  4JI4 B;  3ZRW A;  3N2K B;  4BW5 A;  1GKF A;  4ZI7 B;  2XAG A;  3ZMT A;  5JWP A;  5L3E A;  3E35 A;  1D5A A;  3ZIA G;  4B3M O;  2QGN A;  1R3I C;  3RGB A;  4LWS B;  1S5L Z;  4MTX A;  1F7Y A;  1N0N A;  2MK3 A;  2EIJ B;  3B8M A;  4DR2 O;  4FLV A;  3JCU Z;  3CP1 A;  4MT8 A;  3CD6 V;  3OUS A;  3OGC C; 
#chains in the Genus database with same CATH homology
 1KQS U;  3W7W A;  2Z5U A;  3ZJZ A;  3ABK C;  4RQF A;  4I9W A;  2P90 A;  1H2G A;  2XAS A;  2UXX A;  3IC7 A;  3W7X A;  1FS0 G;  1IXM A;  1OCO C;  2XAJ A;  5LHI A;  1VQ7 V;  1P7B A;  2HG5 C;  3ZMV A;  5L3B A;  1QCE A;  4EKW A;  4U7N A;  3CCV V;  2WLJ A;  3ABM C;  4PDV A;  1Y4M A;  4QIW F;  4H33 A;  2EIM B;  3SYO A;  1S0V A;  3LNM B;  1KP2 A;  3LSS A;  5CBH A;  1JX9 A;  4FK5 C;  4UV8 A;  3JD3 A;  1AJP A;  2YEV A;  3FB6 C;  1XL4 A;  4PA7 A;  1RM1 C;  4GX2 A;  3TET A;  3BEH A;  3ZRX A;  2Y48 A;  3ETE A;  4GX0 A;  2ZD9 A;  3OE7 G;  2LP7 A;  4P30 A;  4ZKI A;  1K9M W;  4XDK A;  1OCZ B;  2DWD C;  1BHA A;  3PJS K;  1G8M A;  2JEU A;  3IFX A;  3ZCC A;  2ZDI A;  2Y69 B;  3QO8 A;  4PDR A;  5B1A C;  4MSW C;  4F4L A;  3OMN B;  2P67 A;  5DN6 G;  3OW2 U;  4FIP C;  1FXK B;  1V55 C;  4P2Z A;  1BL8 A;  1OCC C;  2WLM A;  5CN0 A;  1MAB G;  5IYD O;  2OT5 A;  1KP3 A;  3NXS A;  2BOC C;  3OR6 C;  2JJ1 G;  2WPD G;  1PNM A;  3WG7 C;  2XOK G;  2WLL B;  3GWO A;  1K97 A;  4R8C A;  2HKO A;  3OEH G;  1ORQ C;  2XAH A;  5DM6 V;  1CPY A;  3CCR V;  2JK5 C;  1VQN V;  2ZR3 A;  4JTD B;  1OCR B;  5BZB A;  2WLH A;  3X2Q C;  1ENV A;  1K92 A;  3OEE G;  3LSQ A;  3MHS C;  1HWY A;  3OAA G;  4JAS A;  4JTC B;  2OCC C;  1PNK A;  1AI7 A;  1GM7 A;  3ASN C;  2EIN C;  3UM7 A;  2GHY A;  3E8G A;  2DYS B;  3E83 A;  4LCU C;  1AJN A;  3K0D A;  5IY5 B;  1R3L C;  1BHB A;  1DF5 A;  3AG3 C;  2Q68 A;  4WCE V;  3FB8 C;  3QNE A;  2V1D A;  2W6I G;  1DF4 A;  1GO3 F;  3ETG A;  3K04 A;  3IGA C;  2X6A A;  2EIK B;  2DYR C;  3ZN1 A;  3ABL C;  1S72 V;  1M9N A;  4R50 A;  3ZMZ A;  3HPL C;  4QE7 A;  4WFH A;  4DO2 A;  3FB5 C;  1PNL A;  4H37 A;  3FB7 C;  1COW G;  3P32 A;  3CC4 V;  2IH3 C;  3RVY A;  2ITC C;  2XAF A;  3T1C A;  4UXN A;  2NNU A;  1PL0 A;  3CCS V;  3CC2 V;  3BY6 A;  2EIL C;  1SZT A;  3JD1 A;  4GX1 A;  1L1F A;  2QKS A;  1QLE C;  3CPW U;  1M57 C;  1Q81 W;  1B6Q A;  4J9Y B;  1FXK A;  3T4Z A;  4R7C A;  2QA4 V;  3K06 A;  5E1A C;  1M90 W;  3B8N A;  4CZZ A;  5H9C A;  1NKD A;  1KEC A;  3AG4 C;  3RVZ A;  1J95 A;  1M56 C;  4RAI A;  1H8E G;  3ETD A;  2ZDI C;  3W7T A;  2LFR A;  3K3W A;  1WPX A;  2V7Q G;  2H94 A;  2WLL A;  3DGE A;  4MVR A;  3SJQ C;  2JEX A;  2R9R B;  3D3I A;  4YXW G;  1NH2 D;  2GSM B;  2W6J G;  4J9Z B;  4E2L A;  3EHB B;  2WLN A;  2JJ2 G;  3CME V;  3CCU V;  2Q6A A;  3HB3 B;  5LBQ A;  4TWK A;  1K5Q A;  2B1G A;  2R9I A;  1I5Y A;  3EFF K;  3E86 A;  2QEX V;  2EIJ C;  2IU0 A;  1MSW D;  1AR1 B;  1VQ9 V;  4N23 A;  5H6R A;  3E8H A;  1YIJ V;  4X8A A;  2CK3 G;  3CMA V;  2LFS A;  3F7Y C;  3CCJ V;  4HYO A;  1GK9 A;  3G6E V;  1QVF U;  4RQE A;  2X6C A;  3F7V C;  3MHH C;  4L87 A;  5L3D A;  1JOY A;  3AG2 B;  3AG1 C;  3T2M A;  5CBF A;  1JCH A;  2ZXW B;  4WFA V;  4JAU A;  1FXH A;  2HVJ C;  3GB7 C;  1CEZ A;  3I55 V;  2HFE C;  2HLD G;  3JD2 A;  3E8F A;  1RPR A;  4QNH B;  5KUM A;  1W2B U;  1GMG A;  5GW7 A;  4GT1 A;  4FJC C;  2OTJ V;  2K1E A;  1S3J A;  3SPI A;  3FYE B;  2EIM C;  1NVP D;  3SYP A;  2A0L A;  2QTO A;  4P9O A;  1F4N A;  4Z1M G;  1R3K C;  1VQO V;  3ZRS A;  2AHY A;  4QE9 A;  4FMT A;  3ABU A;  2PI5 A;  4PEL A;  5L3G A;  4WFB V;  1VQ4 V;  4MVU A;  2X0L A;  3LDC A;  3CXC U;  5IDJ A;  1S5H C;  1AI6 A;  2DWE C;  1K33 A;  2ITD C;  2Q69 A;  4G28 B;  1YHQ V;  1OCZ C;  1V54 B;  5CMU A;  4GCZ A;  5LGU A;  1JVM A;  3F5W C;  4JAV A;  4OXS A;  4UUJ C;  1K7D A;  1AI4 A;  2Y69 C;  3ZRV A;  4JGS A;  3WG7 B;  3SPC A;  1XL6 A;  4WFG A;  5KA5 A;  4ZBM A;  5LHG A;  3W7U A;  1VQ8 V;  5B3S B;  3E89 A;  1FXK C;  3UKM A;  5KUK A;  3E8B A;  3OFN G;  1E1Q G;  3JD0 A;  5EBM C;  1YJ9 V;  1GM8 A;  1QVG U;  1JJ2 U;  1RPO A;  4JYB A;  2B5U A;  3TK1 A;  3P30 A;  4KP4 A;  1F51 A;  2OCC B;  1FXV A;  4MVQ A;  1BMF G;  1VQ6 V;  2IJK A;  3RW0 A;  4LC1 A;  2QM8 A;  3FKS G;  1H8H G;  2W0F C;  2WWW A;  3OMI B;  5J9P C;  4UV9 A;  3VOU A;  1Q7Y W;  3SPG A;  4MVO A;  1YTF B;  2BOB C;  2DYS C;  4PDL A;  2X6B A;  1G4Y B;  4MW3 A;  4MS2 A;  2P7T C;  4X89 A;  5IY5 C;  4GX5 A;  5L3C A;  1K3E A;  1Q86 W;  1K5S A;  1R3J C;  1ROP A;  4LP8 A;  2HJF C;  1UJW B;  1VQP V;  1SRY A;  4N21 A;  1QR9 A;  2EIK C;  1F23 A;  1AI5 A;  3QO5 A;  1OZ0 A;  1OHH G;  5L3F A;  1M57 B;  3JYC A;  2A79 B;  4BIU A;  5B1B B;  2WAM A;  3D36 A;  3H01 A;  1VQ5 V;  3K9A A;  1K4C C;  1SES A;  1LNQ A;  1R73 A;  4UVB A;  1NBM G;  5CA3 A;  3MD0 A;  2HR3 A;  1THZ A;  2IJJ A;  2DW4 A;  2F43 G;  1EFR G;  5LHH A;  1R6N A;  1YI2 V;  3CCQ V;  5C93 A;  3ASO C;  3JD4 A;  3ABT A;  3G4S V;  1VQK V;  1F4M A;  3WFV A;  1FFT B;  2QM7 A;  5LGN A;  3ABK B;  2XAQ A;  3TCU A;  1KKD A;  1K4D C;  1ZWI C;  1MOF A;  4RO2 A;  4QJF B;  2Q67 A;  3SYQ A;  4ASU G;  1NH2 B;  4KFM A;  4PDM A;  1W0K G;  1OCO B;  4XDL A;  2DQ0 A;  3STZ C;  4TT3 G;  2JDI G;  3SPJ A;  2XND G;  3A0R A;  5IYB O;  1Q82 W;  4RUE A;  2KB1 A;  2WSS G;  3OR7 C;  3AG1 B;  4HAM A;  3I56 V;  3ABM B;  2H8P C;  2UXN A;  3ZMS A;  4P9P A;  1EZJ A;  3T4D A;  5B1N A;  3FYI B;  1YJW V;  5H6Q A;  2JIZ G;  5KA6 A;  5EBW C;  3CCE V;  2IH1 C;  4U7O A;  1WLE A;  5HFL A;  1SER A;  3ZN0 A;  1KD1 W;  1TUE B;  4DXW A;  1RM1 B;  3OM3 B;  1NR7 A;  2NLJ C;  3OMA B;  3AG2 C;  4MW8 A;  2IJH A;  1ARO P;  1EBO A;  1QBZ A;  3JCZ A;  2WLI B;  1S76 D;  2ZQM A;  2ZXW C;  1AJQ A;  3K03 A;  4WFF A;  4JTA B;  3CC7 V;  2B1I A;  5B1O A;  4JYC A;  2Z3Y A;  4JF3 A;  2EJR A;  3STL C;  5B1A B;  4PA4 A;  1M1K W;  5EK0 A;  1H38 A;  5HFM A;  1V55 B;  4HZ3 A;  4MTF A;  1NVP B;  1OCC B;  4PA6 A;  5EC2 C;  1P4R A;  4LBE C;  1DTO A;  1E79 G;  3ZRW B;  3CYO A;  1PKX A;  1QR8 A;  3SYA A;  2DQ3 A;  1CP9 A;  3LUT B;  4UVA A;  3X2Q B;  4X88 A;  3ZMU A;  2X7R B;  2HVK C;  1VQM V;  1V54 C;  2P6J A;  1NJI W;  3K0G A;  1YIT V;  1R6K A;  3W7S A;  1YSC A;  3ASN B;  5B3S C;  2EIN B;  1OCR C;  3R65 A;  1YJN V;  1KC8 W;  5EBL C;  2IJI A;  2EZO A;  4I5S A;  2AHZ A;  2WLK A;  3B77 A;  5LGT A;  1K8A W;  5IYC O;  3AG3 B;  2IW5 A;  2QE7 G;  4MTG A;  5FL7 G;  1SET A;  2DYR B;  4MVS A;  3ABL B;  1E1R G;  3AEI A;  1DLB A;  3LDD A;  3CCL V;  4G2K A;  4KUM A;  1S77 D;  4R6Z A;  1JQ0 A;  3KG2 A;  4WFE A;  2D3O W;  2PI4 A;  3DTU B;  4MVZ A;  4BIZ A;  2WLI A;  4BAY A;  2OTL V;  5EC1 C;  3E2E A;  1GTO A;  1YTF D;  4TSF G;  4FPP A;  4G27 B;  4PA3 A;  2IU3 A;  3K08 A;  4Q20 A;  3RBZ A;  3G71 V;  2C2A A;  2EIL B;  2YEV B;  1K73 W;  1QLN A;  1I5X A;  2M7W A;  2YSU B;  1QLE B;  4MVM A;  4CBC A;  1N8R W;  4QPJ A;  2FTK A;  4QPK A;  3LDE A;  4RUF A;  3AG4 B;  3ZRW A;  4XBF A;  1M56 B;  3QO7 A;  4BW5 A;  3SPH A;  1GKF A;  3OUF A;  4MTO A;  4XDJ A;  1NQT A;  1PD3 A;  4UVC A;  2XAG A;  3ZMT A;  3CCM V;  5L3E A;  3SYC A;  3ML0 A;  4PA9 A;  3ASO B;  3E35 A;  3ZIA G;  1W0J G;  1GM9 A;  5B1B C;  3VBB A;  1MG1 A;  3K79 A;  1R3I C;  2A9H A;  4MTX A;  4WF9 V;  5CBG A;  2ATK C;  2EBO A;  1JPX A;  2MK3 A;  2ZR2 A;  2EIJ B;  1VQL V;  1NR1 A;  1K34 A;  1Y66 A;  2EZP A;  3B8M A;  4JPR A;  3CP1 A;  3M99 B;  4MT8 A;  3CD6 V;  3OUS A;  3OGC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...