3TCUA

Crystal structure of nak2k channel d68e mutant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGYGEFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein interactions central to stabilizing the K+ channel selectivity filter in a four-sited configuration for selective K+ permeation.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
molecule keywords Potassium channel protein
total genus 36
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3tcuA00
3ASNC 1QLEC 3R65A 2WLLB 4KFMA 3STZC 4MW8A 5EK0A 4G27B 4J9ZB 3FB7C 5E1AC 5B1BC 2ZXWC 1KKDA 3AG2C 4LCUC 4MW3A 4BW5A 4QNHB 3AG3C 5J9PC 3E8FA 2R9RB 3KG2A 4WFEA 4XDJA 2DYRC 4LBEC 3RVYA 3TCUA 3X2QC 4PDLA 2IH3C 5EBLC 3SJQC 2AHYA 5KUKA 3FB6C 1OCOC 4MVRA 5EC1C 3SPHA 2BOBC 2ITCC 2EIKC 3K0DA 4DXWA 3ZRSA 4G28B 4F4LA 2K1EA 3HPLC 3K06A 4H37A 4PA4A 2Q69A 3SYAA 3LDCA 2QTOA 4X89A 3SPCA 1J95A 2X6CA 4LP8A 4MVOA 2EIMC 4RUFA 4WFHA 3F5WC 2Y69C 1M56C 2DWEC 3OR6C 4PA6A 4R8CA 4MS2A 4MVUA 5KUMA 3E83A 4H33A 2DWDC 2A0LA 2NLJC 4QE7A 2WLNA 1ZWIC 3SYQA 5EBMC 3ZJZA 3EFFK 4HZ3A 1P7BA 2H8PC 2HVKC 3GB7C 2Q68A 3LDEA 3K0GA 2JK5C 2WLIB 3IFXA 3OGCC 3SPGA 5BZBA 4JTDB 3K08A 4P2ZA 4X88A 4TWKA 4CBCA 4GX5A 1R3JC 3AG4C 4RUEA 2ITDC 1BL8A 3E8BA 5EBWC 3SYCA 3LNMB 4WFFA 2ZD9A 4J9YB 3K03A 3LUTB 1XL6A 3RBZA 1K4CC 5IY5C 4P30A 1S5HC 3OUFA 3UKMA 1LNQA 2WLIA 3FB5C 2KB1A 3OUSA 3OR7C 2WLHA 1V55C 4QE9A 1JVMA 4PDVA 4JTCB 4MTFA 4MVMA 1R3KC 3STLC 3WG7C 2WLMA 4R6ZA 5CBFA 5CBGA 2IH1C 4MSWC 4MVZA 3ABKC 3BEHA 3PJSK 2Q6AA 2OCCC 1V54C 4MVSA 1M57C 1XL4A 4X8AA 2HFEC 4P9PA 1G4YB 3ABMC 4R7CA 5CBHA 4PDMA 4WFGA 3IGAC 2QKSA 5EC2C 2X6BA 3RVZA 2BOCC 3F7VC 3JYCA 2WLJA 1OCZC 2WLKA 4HYOA 3T1CA 4R50A 1R3LC 3T2MA 4PA7A 4ZBMA 3F7YC 4GX1A 2EILC 2HJFC 4XDKA 2Q67A 2HVJC 1K4DC 2ATKC 2EINC 4MVQA 4RO2A 5B1AC 3RW0A 3SPIA 3E8HA 3AG1C 2W0FC 3E89A 5B3SC 4GX0A 4JTAB 4OXSA 4XDLA 2YEVA 3LDDA 1ORQC 4PA3A 3VOUA 2AHZA 3TETA 4I9WA 4PDRA 3UM7A 3T4DA 4P9OA 1OCCC 1R3IC 3ASOC 3E86A 2X6AA 2A9HA 3SPJA 3SYPA 3T4ZA 2DYSC 2P7TC 3E8GA 3FB8C 2HG5C 4RAIA 4GX2A 3ABLC 2A79B 4MTOA 3SYOA 4UUJC 2EIJC 2WLLA 4EKWA 4MTGA 4PA9A 1OCRC 3K04A
chains in the Genus database with same CATH superfamily
2E76B 3B2EE 1AR4A 3FYEB 3OM3B 4GKJB 4DV2O 3ETEA 2P06A 1FKAO 1EZJA 2MW2B 2A06H 1M4UA 2ARHA 3LSUA 1GN2A 4TQDA 4JI2B 3KG2A 4TUYB 2VWKA 4GT1A 2YIDA 5J2UB 2DYRC 3WB2A 2KQXA 2F23A 2LO1A 4ZI7B 4I55B 1L1FA 2Z3YA 5CB4A 2HP8A 3C3SA 1PL0A 3LDCA 4RQFA 4IT5A 3BAAA 2X6CA 1PNKA 4W4LA 5KHHA 2LGQA 1QVGU 5BR8B 1TVKB 1CP9A 2WLNA 5LGNA 3ZMUA 2YUAA 1VQMV 4DUZB 4X65B 1R73A 3SPGA 3OGCC 1CPYA 2LW7A 1ENVA 3LUTB 5LP6B 3H1IH 2B9ZA 1B3QA 3CRAA 1LNQA 1ZL8B 3EXAA 4JAUA 1XNRB 5GONB 2DYRB 4ASUG 4WBNB 1Q81W 5CBFA 4NTWA 4K8ZA 4LF9O 4MVZA 4X9QA 1N34O 1Q6UA 2JS5A 1URFA 4JI6B 2DN9A 2UUAO 4WFGA 2QKSA 2R9AA 2JIZG 4QIWF 1PNLA 4YIOA 4QGPA 5LMNB 5KLVH 4DR3O 2HVJC 4U7NA 5ITZB 4RO2A 2JDIG 4EEQA 1KB9F 2IJKA 4LF7B 4CS3A 2XT9A 2YXYA 1FPOA 1QR9A 4I7ZB 2QKAA 1NVPB 1QLEC 3B8NA 1HNWB 3FX7A 2UUBO 1D5AA 1Q3EA 1FD9A 1TUEB 3AG3C 2F1MA 5JVDB 3W7WA 1XUQA 2XASA 3MHSC 4XDJA 1WPXA 1AI4A 4EB6A 5GTIZ 1BHBA 2N05A 2QM4A 3ZEDA 4EB6B 4YJ2A 3CCEV 2K1EA 4B08A 3T1YO 3SR2C 2LFRA 2RNBA 5IWAB 4ZIBA 1F4MA 1H38A 2JGUA 5D5QA 4QE7A 4JYYA 5L3GA 4TV9A 1YTFB 5EBMC 2HVKC 2ZINA 4X88A 2HR3A 5LOVB 2EIMB 3EVKA 2JJ1G 3H1HH 4WFFA 4OX9B 2VQEB 4J9YB 4ZOLA 1JA8A 1KYOF 3ZN1A 5J2TB 3JATB 3VQWA 4J42A 4O2AA 5IJ9A 1SF9A 2CK3G 2CTWA 1KUQA 1UPGA 4TV8B 5IDJA 3OD4A 4X8AA 1CEZA 2Q7HA 1JOYA 1B04A 4AQYB 4B3RO 2KSDA 4NTXA 3AG7A 4JASA 1M56B 2WA3A 4FMTA 4O2BB 1KQSU 3F7YC 2HJFC 4XDKA 4X20B 3UT5B 1EN4A 1S72V 1ZLZA 2AHZA 2JEXA 5BXZA 3SPJA 2Q7EA 1FXKA 1S0VA 1QBZA 1KP2A 1WJZA 4DV1B 3ASNC 4JI5O 3HB3B 3K5OA 3M7MX 4J7KA 1V55B 4HNAA 2UXCB 4RWUA 3PN1A 1AB3A 5CA3A 5EZYA 4UCRA 5C93A 4QNHB 1BS3A 4NXMO 3CP1A 1PD3A 2MK3A 3IAYA 3OTFA 5EC1C 3RYFB 5KHJA 3L70H 2E3CA 2UUCB 3RYFA 1MA1A 4DV6B 4WF9V 3RT3C 1ZSPA 4MVOA 3AG4B 3Q4HB 1XDCA 4ZKIA 3CJHA 1WA8A 3T1HO 1GK9A 2JVDA 2AZ0A 1Y74A 4UVAA 1NS1A 2DYSB 3ABKB 2JK5C 2UXXA 2F4VB 2LGWA 2IM9A 4TT3G 3OFNG 4X64O 2EIJB 3P3NA 4F6EA 5C8YA 1K4CC 1YSCA 2KG7A 3UKMA 1HNZB 2W0XA 2Q9LA 1XNQB 3LSSA 3N27A 1NR1A 3CSXA 4MVMA 2WAMA 3WG7C 5LMUB 4J10A 4LFCB 5IT9N 2Q6AA 1FYJA 2CGNA 2YSUB 2D3OW 1TVKA 4JI5B 4R50A 1P7GA 3MAQA 1VQ5V 1SQQH 4X1YA 4MVQA 2W0FC 3RYIB 1XMQB 4DR1B 1MMMA 4O2AB 1OCCC 4FM0A 3E86A 5IYBO 4BIZA 4QJFB 2BTQA 2DYSC 4B3SB 1A32A 2PGGA 2Q0OC 4MTGA 4PD4F 5LYJA 2ZE8A 3OT7A 5C8YB 1BMFG 3K04A 3IC9A 2F66C 5D5PA 3CXHF 3G6BA 4LF9B 5LL6Y 3AG2B 4IHJB 1V9PA 2R9RB 1BE3H 3ZHVA 2YC0A 4BIOA 3JASB 2UXBB 5KUKA 3AK2A 4H37A 3DXRB 1JFFB 3CB2A 4FIPC 4X1YB 2ETNA 1DF4A 1E79G 5LA6B 2FKXA 5KUMA 5LP6C 3ASOB 3L72H 3CRCA 2RMKB 4JI0B 5DM6V 2Q68A 4DV7O 1YHQV 3E8BA 3CWBH 4I4TB 3CC4V 3F5TA 1SZTA 4PI2A 3RYIA 4QE9A 2LW1A 1H8EG 3OW2U 4JAVA 4BR6A 5LGTA 2IH1C 4UV8A 1O9HA 4X20A 1PV0A 4FFBA 4ZHQA 2OCCC 4N23A 1M57C 1RFYA 5K1PA 3IGAC 4NYKA 5LHHA 4X66B 2QWNB 3T1YB 4PV1B 3JASA 3T1CA 4TUYA 3B77A 1XQ8A 3MD0A 1VIBA 1S5JA 4FPPA 4CH3A 3AG1C 2XOKG 2EZPA 5CA0A 4JI2O 4I9WA 4LF8O 4KP4A 1GM9A 2JGDA 3AG3B 3HKEA 1BGYH 4FFKA 4O4LA 3SJAC 2EINB 3HKDA 1RPOA 3RN4A 2LQTA 4O4LB 5LOVA 1LUVA 1AVMA 2UXCO 4BW9A 4PA9A 4DV5O 3NXSA 2GTSA 4DO2A 4X62B 1RP3B 5EK0A 5DN6G 4K8XA 1H2SB 2QDOA 1N32B 2DW4A 1F51A 1Q6HA 5B1BC 3U11A 2DQ0A 2G38A 2XNDG 1QVFU 1GM8A 4GKKB 3ZRXA 1PP9H 3D3QA 1JQ0A 1XNRO 4H44B 3CRMA 2PYJA 1PNMA 5FLXN 4RUFA 2F43G 1AP5A 3FFQA 2QM8A 1Q86W 1S5LZ 4FLZA 3D36A 4IYHA 1Y6XA 4DV0B 3A0BZ 2QKCA 3K08A 4O4JA 1XNQO 1BL8A 3SYCA 5IJ0B 1VQ7V 1X59A 1Q8IA 4BAYA 3HKDB 1KD1W 4CH6A 4DR7B 1OCRB 3ZRWB 2IU0A 5CA0B 1WAZA 4R6ZA 1V54C 2V1DA 3CMAV 1P84F 2QJ1A 4NXNB 1K5SA 2X6BA 3M99B 4O4HA 2CDYA 4DV6O 4BWAA 1K7DA 4DR1O 3B4SA 4GX1A 1E1QG 3ABLB 1W59A 1EZVH 4PDRA 5IYCO 4P9OA 1R6TA 1VQPV 2EJRA 1GRJA 3VQYA 1HW7A 5GONA 4LC1A 1IURA 3BVOA 3D8CA 4J80A 2NNUA 3RFRA 1PPJH 1WNSA 3OMNB 4IIJA 4DK0A 2PF4E 3UO2A 1MG1A 1Z5WA 1X4TA 1E1RG 1KC8W 1KECA 4FVMA 2P67A 1VARA 3CCUV 3TCUA 3X2QC 4DR7O 3BPZA 1GN6A 4X89A 1CXZB 1AR5A 1Q90D 1KKCA 5HFLA 2DWDC 1Y76A 2NLJC 3FD9A 3QO7A 2UUBB 4DV4O 2GUZA 4YY3B 1Q82W 5L3CA 3U10A 2R9IA 4ZHQB 1BQ0A 1JJOA 3CCMV 1WPBA 1F4NA 4J7ZA 5EBWC 5LXTB 3E22B 4IIJB 2BSKB 4ICGA 1J5EB 4NKGB 3ZHRA 5IWAO 2FTKA 4YHHO 4KXRA 1R3KC 3CCJV 3P30A 3KZIZ 5CBGA 1KP3A 1OV9A 3BEHA 1YCIA 2ZR2A 2N74A 5H5NA 1XHZA 4OPHA 1O9GA 3K58A 4DR4O 3RGBA 3F7VC 1FFTB 4H0LB 2R70A 4DYLA 1G8MA 2JS3A 3QVNA 4OX9O 3QG5A 2UXDB 2Q67A 3WFVA 4LF6B 4AILC 2HLDG 4K0KO 2Q0AA 2RDCA 3WG7B 3DXRA 3ZX6A 1G6UA 1EN5A 1GN3A 1MZEA 2O57A 1QLEB 5JWPA 5B1BB 5J2TA 4DV7B 3FB8C 2EZOA 4GX2A 1Y67A 4IGGA 4U7OA 3JD2A 3APQA 1P49A 1Q43A 5IY5B 2CGOA 2V7QG 4FLYA 1I94O 2QTSA 5BMVB 3DC6A 3U0ZA 4DR5B 3N2GB 5A9GA 1I7FA 5JQGA 4QPKA 4PDLA 1Q5OA 3RYHB 3SPHA 2BOBC 1YVWA 3ZRSA 4FK5C 4CS4A 4DV0O 3ZHTA 4CH5A 1K8AW 2A0LA 4YJ3A 1SESA 1UFIA 5B3SB 4ZOLB 1Q6IA 4FZ1A 4X1KA 2ITDC 1FXVA 1ZX3A 3FAVB 1HNXO 2P6JA 4JYCA 2ZE5A 3E35A 3WU2Z 4Q20A 4LR3A 5FPOA 5F2VO 1W0KG 4I4TA 4MSWC 3CC7V 1ZUQA 3Q4HA 2PI5A 1H2KA 5DEDA 4HBNA 5CBHA 4YJ2B 2A3QA 1IXMA 2X7RB 3B40A 2F4VO 1OCZC 1IBKB 2QGNA 3G6EV 2ZKOA 1S3JA 4I9QA 2P90A 3ZCCA 1VMGA 3BY6A 4XDLA 3D3IA 2HKOA 1I0HA 1TA8A 4FLTA 5H6RA 4PI0A 5KMGB 2IU3A 3APOA 5B1NA 3SYPA 4LF5O 4JI8B 2UXNA 2E74B 4NR1A 4Z2WA 1GM7A 4LF7O 4EKWA 4O4IA 1NTZH 2VQEO 2E5LB 4O4JB 3R65A 3OEHG 4FM1A 2CTRA 3JAKA 4G27B 4L87A 2ZR3A 4YIPA 5KA6A 5K1XA 5H2FZ 5LBQA 3AG2C 5J9PC 3QTCA 2BTOA 1WB8A 3QNEA 2F93B 3K06A 4PA4A 1N4CA 3SYAA 4U3FH 1L0LH 2EIMC 2W6JG 4DV4B 3AK3A 4JI4B 4PA6A 3CRRA 2OTJV 2P4VA 2P4KA 1L8DA 1XBLA 1FJGB 3B09A 1COWG 1QHTA 4H13B 4HZ3A 1P7BA 3LDEA 1IZ3A 1VQOV 3OTOB 1GO3F 3AG1B 2H94A 2JEUA 3J81N 4I50B 3BHPA 2JRIA 4YHHB 3GWOA 2UXBO 2ZD9A 4D7SA 4KL1A 1P4RA 2OIGA 1V55C 2YIBD 4NB5A 3X2QB 2PY5A 2QWOB 2CH7A 3WB0A 3CE2A 4UCSA 3ABKC 3KKYA 2FYUH 1IBLB 2DOSA 2HFEC 4I55A 5CB4B 4PDMA 1SQFA 1FFXB 3RVZA 4FLVA 2WLKA 4NTYA 1R3LC 2UUCO 1D2DA 4PA7A 2GHYA 1YIJV 5FPRA 1K4DC 3RW0A 2Y4TA 3E89A 4FFBB 2ZM6B 2AZ2A 4OXSA 4WBNA 2JJ2G 1K73W 3VOUA 1H2LA 3ASOC 1R3IC 3CXCU 2FB5A 2KG7B 2A79B 4JPRA 3SYOA 1XMOO 1N36B 1OJHA 1SA0B 2PYLA 4LF4B 1FJGO 1M9NA 1IX9A 4CS2A 4B7KA 1HP8A 2QE7G 3QO5A 5EYPA 1FXKB 1HWYA 5KMGA 2WSSG 2DMXA 4YJ3B 3CCRV 1NR7A 1TAEA 1K3EA 1DGSA 3JD4A 4GUNA 3RYCB 2QTOA 4FM2A 4B3TO 3GVMA 4LF6O 5HFMA 1YDXA 2Y69C 1M56C 2QWQB 4MVUA 1EN6A 3JAKB 3K9AA 4PHZA 1OCCB 1SETA 1WN7A 3I5DA 3HKCA 2Q4PA 1N32O 3ZJZA 1HNXB 4BW5A 2H8PC 5LYJB 3IFXA 5BZBA 4P2ZA 3A0HZ 4GX5A 1R3JC 4RUEA 2UU9O 2ZT9B 3ZHSA 5LP6A 4JZGA 1HR0O 2XHBA 1XL6A 4E2LA 5IY5C 1UJWB 5L3EA 4GKKO 1JCHA 2B1IA 2IJHA 3A2FA 3A0RA 1I94B 4JF3A 3OR7C 2C2AA 2P5OA 4JI3O 1RPRA 1OHHG 2YI9A 4F6RA 2QEXV 1WB7A 1YITV 4WCEV 4FLWA 2W6IG 3IJ4A 4DV2B 2AGAA 3AEIA 4TOIA 5LA6A 3T2MA 5GTHZ 1ZAUA 1EBOA 1PKXA 1GAXA 4U3JA 3GWKC 3K5NA 2EINC 4LF5B 1HDJA 2YEVA 3TETA 4DW1A 5BY1A 2A9HA 1M90W 4JI0O 3ZMSA 2EIJC 4NXNO 2PUSA 1S76D 1TUBB 4DV3B 3JD1A 1T5EA 2EJ7A 1H2NA 5IYZA 2GUZB 5LXTA 3O65A 3ABMB 1NT2B 3UCSC 1DTOA 2GBOA 3CRQA 3RWRD 4GYCB 3L75H 1KBHA 2CTQA 3W7SA 5TISZ 2B5UA 3HR0A 4TQFA 3FB6C 3JAWA 3HPLC 2B1GA 3JSNA 1IBKO 1K34A 1VQ9V 1SZXA 3OAAG 1VQKV 4LP8A 2Q8VA 3BRCA 1U97A 1XEQA 3OR6C 3ZRVA 2Z5UA 3RYHA 2D2CB 5IYDO 3TXSA 3DTUB 3ETGA 4LFAO 1NH2D 2KKWA 3JD0A 4JI8O 2OCCB 3KCYA 3OMAB 3W7UA 1JR9A 3ZN0A 4TWKA 4W4KA 4KHPB 3L73H 2Q5ZA 1VQ6V 4JYAO 3I56V 3K9SA 3RBZA 4K0KB 1MSWD 3CHXA 2L35A 2YEVB 1NH2B 3G80A 3STLC 3JD3A 5H9CA 2X0LA 3J7AU 1W2BU 1PL4A 2V4DA 1AJNA 4MVSA 1XL4A 4DUYO 1G4YB 3UO3A 1M57B 1VF6C 3JSLA 3N2KB 3CCSV 3G71V 1BZKA 2ZNJA 2RN9A 3WB1A 2VS0A 1XI1A 1HNZO 3T4DA 3CEIA 5BMVA 2YI8A 4UCOA 4DR2O 4LFCO 4UUJC 1NTMH 2WLLA 1YJWV 1OCRC 2BE3A 3ZRWA 2CUGA 3BCCH 5AG2A 3ZMTA 5KAIZ 4KHPO 2RCVA 3E8FA 4IYIA 1XMQO 5EBLC 2AHYA 1N0JA 1N33B 3N2KA 1QLNA 1SC5B 2VQFB 4AHCA 4WFBV 4DW0A 4CC5A 4B3SO 4UFZA 4R8CA 4MS2A 3IC7A 1K33A 1SS3A 3H9VA 3JALB 3LNNA 5B1OA 2HHHO 1HR0B 5CMUA 4BIUA 3K3WA 4D7TA 3EFFK 4LFBO 4OGQB 1K9MW 2XAHA 1AJQA 5JH7B 4UV9A 3AG4C 1S77D 5CN0A 4JV5O 4LH7A 1US6A 1VF5B 3CS5A 1S5HC 4JI7O 1AP6A 2WLIA 1NTKH 4JI6O 4O4IB 2WLMA 3HKEB 1VF7A 2LJ2A 1EM1A 1VQLV 2JGDB 1GTOA 1M93A 4LNUB 2M7WA 4A5UB 4HYOA 3UQ8A 1Z2GA 2VWJA 4PELA 1VQ4V 2ATKC 1NBMG 3SPIA 4HNAB 4JGSA 2ZQMA 3LDDA 3MHHC 2QSAA 3UM7A 2ZNIA 3ETDA 2DE0X 2M6YA 1AI5A 4YY3O 4JZ2A 2WPDG 4D6TH 2Y0PA 3C3TA 5JH7A 2LFSA 1MZFA 1YXBA 1RM1B 3ASNB 4X66O 3STZC 4MW8A 3VBBA 3UT5A 3ZS8C 4MW3A 1VEWA 4U3JB 2EX3A 1XOUA 1YEWA 4GLXA 4DXWA 4JI7B 2ITCC 5JJEB 3L9DA 3OGIB 1ROPA 5J2UA 4LWSB 1N8RW 1SKVA 4B7EA 4ZI7A 1IBLO 1FAFA 5KHIA 4DV5B 3W7XA 2GV9A 2OCHA 1FXKC 1ZWIC 3SYQA 3JATA 2ILMA 4FZ0A 2NR5A 5IYZB 3H1LH 4CBCA 3JAMN 1OZ0A 4I5SA 4L8JA 3K03A 5L3DA 2KB1A 2WLHA 4XBFA 4DRXB 4B3RB 1FXHA 4MT8A 1I08A 3H1JH 1J5EO 1GH6A 2BOCC 3THOA 2WLJA 3H1KH 2IJIA 1SERA 4GCZA 1GMGA 1QR8A 2EILC 4DR4B 5B1AC 5L3FA 4J7JA 3ZMVA 5B3SC 4GX0A 3K79A 3JARB 1ORQC 4UB6Z 5EZYB 1Y4MA 4DV1O 3CPWU 3ABLC 5JCOA 4MTOA 5B66Z 2ZIMA 3TGUH 3OE7G 2R72A 2GDSA 3ABUA 5BR8O 1BQZA 2P22C 4J9ZB 3CCLV 1Y76B 2ZM6O 3CJHB 2ZXWC 4X1IA 2WWWA 4LCUC 3BA8A 2UU9B 1WLEA 4WFEA 5EIBD 4OPAA 1Y74B 3FKSG 1YI2V 4CZZA 1I5XA 3ZMZA 4CH4A 2EIKC 2CTPA 2XAFA 1YJNV 1THZA 2XUMA 2AXTZ 2Q69A 4RQEA 3T1HB 1JMKC 1XMOB 1N36O 1NKDA 4O2BA 3N2GA 4WFHA 4JI3B 2DWEC 3NR7A 1WP8A 4GKJO 2EILB 4DR6O 2NN4A 3L71H 1AROP 2IW5A 3DSQA 4JTDB 5A2QN 1SQBH 4UVBA 4K3AA 5LHGA 1B06A 2Y0IA 3ML0A 3ABTA 3K57A 5L3BA 3OUFA 3EHBB 5H6QA 4B3MO 3D36C 4PDVA 1IBMO 3SJBC 1MABG 4LWSA 2ZDIA 4JI1O 4I0XB 3PJSK 2ADQB 1W0JG 1U96A 2LP7A 1N33O 1H8HG 4DUZO 1RSOA 3JCZA 2ZE7A 4Z1MG 1WA8B 1VQNV 2OWOA 5JVDA 1YF2A 1JPXA 2QWRB 1AILA 4JI4O 4J11A 4KUMA 4JYBA 2QR4A 3C90A 2QM7A 4PJ0Z 2FL4A 3L74H 2Y48A 3SDLA 3E8GA 5KX5A 2XAGA 5KX5B 2YXLA 2ZE6A 2BSKA 3SGIA 1QCEA 2YIBA 1M5IA 3B8MA 3S3XA 1OCOB 2WLLB 2ZDIC 5LMNO 4Q6GA 5LMUO 3FB7C 2CAZC 2OYQA 2RQ6A 2YDEA 3CYOA 3CC2V 2EBOA 3RVYA 1YTFD 4TV9B 3ZHUA 2ZCEA 4GZRB 1AI7A 1IBMB 2GTAA 1F7YA 1BSMA 1DF5A 2YS8A 2N04A 4UVCA 1AJPA 4DV3O 1XHXA 5IE9A 1QNMA 2K9PA 4H33A 1K97A 4DRXA 1JX9A 3P32A 4AQYO 4E4EA 1RM1C 1G1XB 3K0GA 2PTMA 1SRYA 5JJNB 3E22A 1SQPH 4IL6Z 3TK1A 5GW7A 2PI4A 3OTOO 2ZXWB 4AI8A 3FB5C 3CMEV 1M1KW 2RJZA 3W7TA 1K5QA 3K59A 4J41A 1R6KA 1GN4A 2WA4A 3K5LA 2HEPA 4UXNA 3RYCA 3CCQV 4JAAA 5FL7G 2ZIOA 4ZBMA 2HJDA 4LF8B 1JFFA 3CX5F 2EIKB 2CH7B 3E8HA 2EULA 4JTAB 4LNUA 4NXMB 4PA3A 1LR1A 1NJIW 3K5MA 3T4ZA 4HAMA 3P3PA 5IJ9B 4RAIA 3CD6V 1ZL8A 1GKFA 3ZHQA 2OT5A 2FMLA 3J80N 1B6QA 4CC6A 3QF7A 4KFMA 1IVSA 2HHHB 4LFBB 3FYIB 4LF4O 1WP7A 5KA5A 1XILA 2F95B 3S3WA 3DGEA 2QWPB 2IBZH 3E2EA 4YXWG 3ZBHA 4LBEC 4JV5B 2XTAA 5LGUA 2IH3C 3SJQC 3BA9A 4MVRA 1OCOC 2UUAB 4DR2B 5KHKA 4G28B 3ETQA 4TSFG 2OIEA 3SPCA 4EFEA 5ITZA 1D5NA 5EYPB 4DR3B 2YICA 1OCZB 2E75B 1SQXH 1MNGA 5JJJB 4FLUA 3KCXA 1KU9A 4B3TB 3R66A 3G67A 4ABMA 4I0XA 3JCUZ 3BFRA 5CA1B 3QO8A 1H2MA 2DJVA 1TUBA 3LNMB 1VF6A 2L6LA 4JI1B 1NI8A 1NU1H 4N21A 2BTQB 3LSQA 1LUWA 3OEEG 3HKCB 4X62O 3OUSA 1BHAA 3TJTA 1HNWO 4MTFA 1NQTA 5LHIA 1EFRG 3HKBB 4EFBA 4K35A 1ZTEA 2ODMA 3JAWB 5EC2C 3JALA 2IJJA 1F23A 1N34B 1TGOA 1K92A 1BT8A 3M8AA 2H3OA 2XAQA 4DR5O 3SJCC 4F6RB 5E79Z 1Q7YW 3AK1A 1H2GA 5B5EZ 4DR6B 1FS0G 4LFAB 4FJCC 2Z0AA 1SQVH 4LH6A 2A7WA 3OMIB 4UCTA 3G4SV 4QPJA 3VQXA 4NVPA 1AI6A 1QQCA 2Y4UA 1SQGA 3FAVA 3I55V 2OTLV 4X1KB 2QA4V 4B3MB 2XAJA 1JJ2U 5E1AC 1KKDA 1NZ6A 2YXHA 3VQVA 5CA1A 1V54B 4UB8Z 4DUYB 2YIAA 3H01A 1NVPD 3ZIAG 3K0DA 1I5YA 1VQ8V 2GSMB 4F4LA 3MDSA 4WFAV 1XREA 1J95A 5FNVA 3ICXA 4IHJA 5FNVB 3CCVV 3F5WC 4O4HB 3O9OA 1DK1A 4C7UA 3E83A 3TXQA 4Z1VA 5JQGB 2Q7GA 3GB7C 1N0NA 4FLXA 2WLIB 2Q73A 1MSDA 1Z5VA 2PZSA 3A8TA 1SA0A 1R6NA 3DC5A 4P30A 5EIBC 5IJ0A 4DK1A 1JVMA 2BCCH 4JTCB 4UCVA 1VP7A 1AR1B 4JYAB 4G2KA 1YJ9V 5KHGA 4P9PA 3JARA 3ABMC 2UXDO 4MTXA 4R7CA 2E5LO 1PM9A 1MOFA 3JYCA 2VRZA 4X65O 1FFXA 1L0NH 5KAFZ 2VQFO 2AW9A 4TV8A 1RSOB 2CE4A 3BABA 2Y69B 5JCOC 4UCUA 1QU7A 1IXBA 1YZBA 1R1BA 2ADPA 2X6AA 1IDSA 1DLBA 1KMIZ 2P7TC 2HG5C 3HKBA 4X1IB 5DECA 1Y66A 1BCCH 2DQ3A 4X64B 4I50A 5B1AB
chains in the Genus database with same CATH topology
3ABUA 3FYEB 1M9NA 4DO2A 3OM3B 3ETEA 5EK0A 5DN6G 1EZJA 4J9ZB 3CCLV 2DW4A 1F51A 2QE7G 3QO5A 5B1BC 2ZXWC 2WWWA 4LCUC 1FXKB 1HWYA 1WLEA 3KG2A 4GT1A 4WFEA 2DYRC 2DQ0A 2WSSG 3FKSG 1YI2V 4CZZA 1I5XA 3ZMZA 2XNDG 3CCRV 1NR7A 1QVFU 1GM8A 1K3EA 2EIKC 2XAFA 1YJNV 1THZA 3ZRXA 1L1FA 2Z3YA 4RQEA 2Q69A 3JD4A 1JQ0A 3LDCA 1PL0A 2QTOA 4RQFA 2X6CA 1NKDA 1PNKA 1PNMA 4RUFA 4WFHA 5HFMA 2F43G 2Y69C 1M56C 2DWEC 2QM8A 4MVUA 1Q86W 3K9AA 1QVGU 3D36A 1CP9A 1OCCB 1SETA 2WLNA 2EILB 5LGNA 3ZMUA 3ZJZA 1VQMV 4BW5A 1AROP 2H8PC 2IW5A 1R73A 3IFXA 3OGCC 3SPGA 5BZBA 1CPYA 4JTDB 3K08A 4P2ZA 4GX5A 1R3JC 4RUEA 1BL8A 4UVBA 5LHGA 1ENVA 3SYCA 3ML0A 3ABTA 3LUTB 1VQ7V 5L3BA 1XL6A 4BAYA 4E2LA 5IY5C 1UJWB 5L3EA 1JCHA 2B1IA 2IJHA 3EHBB 1LNQA 3OUFA 1KD1W 4JAUA 3A0RA 1OCRB 4JF3A 3OR7C 2IU0A 5H6QA 3ZRWB 2C2AA 2DYRB 4ASUG 4PDVA 1Q81W 4R6ZA 1RPRA 5CBFA 1MABG 4MVZA 1OHHG 2ZDIA 3PJSK 1V54C 1W0JG 2LP7A 2V1DA 2QEXV 1YITV 3CMAV 4WCEV 1K5SA 4WFGA 1H8HG 2QKSA 3JCZA 2JIZG 2W6IG 2X6BA 3M99B 4QIWF 4Z1MG 1VQNV 1PNLA 3AEIA 1K7DA 3W7WA 3T2MA 1EBOA 1JPXA 1PKXA 4GX1A 1E1QG 3ABLB 2HVJC 2EINC 4U7NA 4RO2A 4KUMA 2JDIG 4JYBA 2YEVA 2QM7A 2IJKA 3TETA 4PDRA 5IYCO 4P9OA 2A9HA 1VQPV 2EJRA 1M90W 2Y48A 3E8GA 3ZMSA 1QR9A 2EIJC 2XAGA 4LC1A 1S76D 2NNUA 1QCEA 3OMNB 1NVPB 3JD1A 3B8MA 1QLEC 3B8NA 1OCOB 2WLLB 1MG1A 2ZDIC 3ABMB 1E1RG 1DTOA 3FB7C 1KC8W 1KECA 1TUEB 3AG3C 3CYOA 2P67A 3W7SA 3CC2V 3CCUV 2EBOA 2XASA 2B5UA 3MHSC 4XDJA 3RVYA 1WPXA 1AI4A 3TCUA 3X2QC 1YTFD 3FB6C 1BHBA 3CCEV 2K1EA 2B1GA 3HPLC 1VQ9V 1K34A 2LFRA 1AI7A 4X89A 3OAAG 1VQKV 4LP8A 1F4MA 1DF5A 1H38A 4UVCA 1AJPA 3OR6C 3ZRVA 2Z5UA 5IYDO 3DTUB 3ETGA 4H33A 5HFLA 2DWDC 1K97A 2NLJC 4QE7A 3QO7A 5L3GA 1JX9A 1YTFB 5EBMC 3P32A 1NH2D 2HVKC 3JD0A 1RM1C 2OCCB 3K0GA 3OMAB 5L3CA 3W7UA 2R9IA 1Q82W 4X88A 3ZN0A 2HR3A 4TWKA 1SRYA 2EIMB 2JJ1G 3CCMV 1F4NA 5EBWC 4WFFA 1VQ6V 4J9YB 3I56V 3TK1A 5GW7A 3RBZA 2PI4A 1MSWD 2ZXWB 3FB5C 3CMEV 3ZN1A 2FTKA 2YEVB 1NH2B 3W7TA 1M1KW 1K5QA 1R3KC 3STLC 3JD3A 5H9CA 2X0LA 3CCJV 3P30A 2CK3G 5CBGA 1KP3A 1W2BU 3BEHA 2ZR2A 1R6KA 1AJNA 5IDJA 4MVSA 1XL4A 4X8AA 1G4YB 1CEZA 1M57B 1JOYA 4JASA 1M56B 4UXNA 3CCQV 3F7VC 1FFTB 3CCSV 4FMTA 5FL7G 3G71V 1G8MA 1KQSU 4ZBMA 3F7YC 2HJFC 4XDKA 2Q67A 3WFVA 2EIKB 2HLDG 3E8HA 3WG7B 1S72V 4JTAB 4PA3A 2AHZA 1NJIW 3T4DA 1QLEB 5B1BB 2JEXA 3SPJA 1FXKA 3T4ZA 4HAMA 3FB8C 2EZOA 4GX2A 4RAIA 1S0VA 4U7OA 4UUJC 3CD6V 2WLLA 1YJWV 1QBZA 1KP2A 1GKFA 2OT5A 3JD2A 1OCRC 3ZRWA 1B6QA 3ASNC 5IY5B 2V7QG 3HB3B 4KFMA 3ZMTA 1V55B 3FYIB 5KA5A 5CA3A 5C93A 4QNHB 3CP1A 3E8FA 1PD3A 2MK3A 3DGEA 4QPKA 4YXWG 3E2EA 4LBEC 5LGUA 4PDLA 2IH3C 5EBLC 3SJQC 2AHYA 4MVRA 1OCOC 5EC1C 3SPHA 2BOBC 3ZRSA 4G28B 4FK5C 1QLNA 4TSFG 3SPCA 4WF9V 4WFBV 4MVOA 3AG4B 4R8CA 4ZKIA 4MS2A 1OCZB 3IC7A 1K33A 1K8AW 1GK9A 2A0LA 5B1OA 5CMUA 4BIUA 3K3WA 4UVAA 3EFFK 3ABKB 2DYSB 1SESA 1K9MW 2XAHA 2JK5C 5B3SB 1AJQA 2UXXA 3QO8A 4UV9A 3AG4C 1S77D 2ITDC 5CN0A 1FXVA 3LNMB 4TT3G 3OFNG 2EIJB 2P6JA 4JYCA 1K4CC 1YSCA 1S5HC 3OEEG 4N21A 3UKMA 3LSQA 3E35A 2WLIA 3OUSA 3LSSA 1BHAA 4Q20A 1NR1A 4MTFA 4MVMA 2WAMA 1W0KG 3WG7C 2WLMA 4MSWC 1NQTA 5LHIA 1EFRG 3CC7V 2Q6AA 1VQLV 2PI5A 5CBHA 1GTOA 2YSUB 2D3OW 1IXMA 5EC2C 2X7RB 2IJJA 1F23A 2M7WA 1OCZC 4HYOA 1K92A 4R50A 1VQ5V 4PELA 1VQ4V 2XAQA 3G6EV 1S3JA 2ATKC 1NBMG 4MVQA 3SPIA 2P90A 2W0FC 3ZCCA 4JGSA 3BY6A 1Q7YW 2ZQMA 3D3IA 4XDLA 3LDDA 1H2GA 2HKOA 3MHHC 1FS0G 3UM7A 4FJCC 1OCCC 3E86A 5IYBO 4BIZA 3ETDA 3OMIB 5H6RA 2IU3A 5B1NA 3SYPA 1AI5A 4QJFB 3G4SV 2DYSC 2UXNA 2WPDG 4QPJA 1AI6A 1GM7A 4EKWA 3I55V 2LFSA 4MTGA 2OTLV 1BMFG 1RM1B 3ASNB 3K04A 2QA4V 3R65A 3OEHG 2XAJA 1JJ2U 3STZC 4MW8A 3VBBA 4G27B 4L87A 2ZR3A 5E1AC 3AG2B 5KA6A 5LBQA 1KKDA 3AG2C 4MW3A 5J9PC 2R9RB 1V54B 5KUKA 3H01A 1NVPD 3ZIAG 4DXWA 2ITCC 1I5YA 3K0DA 1VQ8V 2GSMB 4F4LA 3QNEA 3K06A 4H37A 4PA4A 4WFAV 3SYAA 4FIPC 1J95A 1ROPA 2EIMC 2W6JG 3CCVV 3F5WC 1N8RW 4PA6A 2OTJV 1DF4A 1E79G 5KUMA 3E83A 3ASOB 3W7XA 1COWG 1FXKC 1ZWIC 3SYQA 4HZ3A 1P7BA 3GB7C 5DM6V 2Q68A 3LDEA 1VQOV 2WLIB 1GO3F 3AG1B 4CBCA 2H94A 2JEUA 1OZ0A 1YHQV 3E8BA 3GWOA 4I5SA 2ZD9A 3K03A 1R6NA 3CC4V 5L3DA 4P30A 1SZTA 1P4RA 2KB1A 2WLHA 1V55C 4QE9A 3X2QB 1JVMA 4JTCB 1H8EG 4XBFA 3OW2U 4JAVA 1AR1B 1FXHA 4MT8A 5LGTA 2IH1C 4UV8A 4G2KA 3ABKC 1YJ9V 2OCCC 4N23A 1M57C 2HFEC 4P9PA 3ABMC 4MTXA 4R7CA 4PDMA 1MOFA 3IGAC 5LHHA 3RVZA 2BOCC 3JYCA 2WLJA 2WLKA 3T1CA 2IJIA 1R3LC 1SERA 4GCZA 4PA7A 1GMGA 3B77A 3MD0A 1QR8A 2GHYA 2EILC 1YIJV 1K4DC 3RW0A 5B1AC 4FPPA 5L3FA 3AG1C 3E89A 3ZMVA 5B3SC 2XOKG 2EZPA 4GX0A 4OXSA 2Y69B 3K79A 2JJ2G 1K73W 1ORQC 3VOUA 4I9WA 4KP4A 3ASOC 1R3IC 1GM9A 2X6AA 1Y4MA 3AG3B 3CXCU 1DLBA 2P7TC 2HG5C 2EINB 3ABLC 3CPWU 2A79B 1RPOA 4MTOA 4JPRA 3SYOA 1Y66A 3OE7G 2DQ3A 4PA9A 5B1AB 3NXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASN C;  1QLE C;  3R65 A;  2WLL B;  4KFM A;  3STZ C;  4MW8 A;  5EK0 A;  4G27 B;  4J9Z B;  3FB7 C;  5E1A C;  5B1B C;  2ZXW C;  1KKD A;  3AG2 C;  4LCU C;  4MW3 A;  4BW5 A;  4QNH B;  3AG3 C;  5J9P C;  3E8F A;  2R9R B;  3KG2 A;  4WFE A;  4XDJ A;  2DYR C;  4LBE C;  3RVY A;  3TCU A;  3X2Q C;  4PDL A;  2IH3 C;  5EBL C;  3SJQ C;  2AHY A;  5KUK A;  3FB6 C;  1OCO C;  4MVR A;  5EC1 C;  3SPH A;  2BOB C;  2ITC C;  2EIK C;  3K0D A;  4DXW A;  3ZRS A;  4G28 B;  4F4L A;  2K1E A;  3HPL C;  3K06 A;  4H37 A;  4PA4 A;  2Q69 A;  3SYA A;  3LDC A;  2QTO A;  4X89 A;  3SPC A;  1J95 A;  2X6C A;  4LP8 A;  4MVO A;  2EIM C;  4RUF A;  4WFH A;  3F5W C;  2Y69 C;  1M56 C;  2DWE C;  3OR6 C;  4PA6 A;  4R8C A;  4MS2 A;  4MVU A;  5KUM A;  3E83 A;  4H33 A;  2DWD C;  2A0L A;  2NLJ C;  4QE7 A;  2WLN A;  1ZWI C;  3SYQ A;  5EBM C;  3ZJZ A;  3EFF K;  4HZ3 A;  1P7B A;  2H8P C;  2HVK C;  3GB7 C;  2Q68 A;  3LDE A;  3K0G A;  2JK5 C;  2WLI B;  3IFX A;  3OGC C;  3SPG A;  5BZB A;  4JTD B;  3K08 A;  4P2Z A;  4X88 A;  4TWK A;  4CBC A;  4GX5 A;  1R3J C;  3AG4 C;  4RUE A;  2ITD C;  1BL8 A;  3E8B A;  5EBW C;  3SYC A;  3LNM B;  4WFF A;  2ZD9 A;  4J9Y B;  3K03 A;  3LUT B;  1XL6 A;  3RBZ A;  1K4C C;  5IY5 C;  4P30 A;  1S5H C;  3OUF A;  3UKM A;  1LNQ A;  2WLI A;  3FB5 C;  2KB1 A;  3OUS A;  3OR7 C;  2WLH A;  1V55 C;  4QE9 A;  1JVM A;  4PDV A;  4JTC B;  4MTF A;  4MVM A;  1R3K C;  3STL C;  3WG7 C;  2WLM A;  4R6Z A;  5CBF A;  5CBG A;  2IH1 C;  4MSW C;  4MVZ A;  3ABK C;  3BEH A;  3PJS K;  2Q6A A;  2OCC C;  1V54 C;  4MVS A;  1M57 C;  1XL4 A;  4X8A A;  2HFE C;  4P9P A;  1G4Y B;  3ABM C;  4R7C A;  5CBH A;  4PDM A;  4WFG A;  3IGA C;  2QKS A;  5EC2 C;  2X6B A;  3RVZ A;  2BOC C;  3F7V C;  3JYC A;  2WLJ A;  1OCZ C;  2WLK A;  4HYO A;  3T1C A;  4R50 A;  1R3L C;  3T2M A;  4PA7 A;  4ZBM A;  3F7Y C;  4GX1 A;  2EIL C;  2HJF C;  4XDK A;  2Q67 A;  2HVJ C;  1K4D C;  2ATK C;  2EIN C;  4MVQ A;  4RO2 A;  5B1A C;  3RW0 A;  3SPI A;  3E8H A;  3AG1 C;  2W0F C;  3E89 A;  5B3S C;  4GX0 A;  4JTA B;  4OXS A;  4XDL A;  2YEV A;  3LDD A;  1ORQ C;  4PA3 A;  3VOU A;  2AHZ A;  3TET A;  4I9W A;  4PDR A;  3UM7 A;  3T4D A;  4P9O A;  1OCC C;  1R3I C;  3ASO C;  3E86 A;  2X6A A;  2A9H A;  3SPJ A;  3SYP A;  3T4Z A;  2DYS C;  2P7T C;  3E8G A;  3FB8 C;  2HG5 C;  4RAI A;  4GX2 A;  3ABL C;  2A79 B;  4MTO A;  3SYO A;  4UUJ C;  2EIJ C;  2WLL A;  4EKW A;  4MTG A;  4PA9 A;  1OCR C;  3K04 A; 
#chains in the Genus database with same CATH topology
 2E76 B;  3B2E E;  1AR4 A;  3FYE B;  3OM3 B;  4GKJ B;  4DV2 O;  3ETE A;  2P06 A;  1FKA O;  1EZJ A;  2MW2 B;  2A06 H;  1M4U A;  2ARH A;  3LSU A;  1GN2 A;  4TQD A;  4JI2 B;  3KG2 A;  4TUY B;  2VWK A;  4GT1 A;  2YID A;  5J2U B;  2DYR C;  3WB2 A;  2KQX A;  2F23 A;  2LO1 A;  4ZI7 B;  4I55 B;  1L1F A;  2Z3Y A;  5CB4 A;  2HP8 A;  3C3S A;  1PL0 A;  3LDC A;  4RQF A;  4IT5 A;  3BAA A;  2X6C A;  1PNK A;  4W4L A;  5KHH A;  2LGQ A;  1QVG U;  5BR8 B;  1TVK B;  1CP9 A;  2WLN A;  5LGN A;  3ZMU A;  2YUA A;  1VQM V;  4DUZ B;  4X65 B;  1R73 A;  3SPG A;  3OGC C;  1CPY A;  2LW7 A;  1ENV A;  3LUT B;  5LP6 B;  3H1I H;  2B9Z A;  1B3Q A;  3CRA A;  1LNQ A;  1ZL8 B;  3EXA A;  4JAU A;  1XNR B;  5GON B;  2DYR B;  4ASU G;  4WBN B;  1Q81 W;  5CBF A;  4NTW A;  4K8Z A;  4LF9 O;  4MVZ A;  4X9Q A;  1N34 O;  1Q6U A;  2JS5 A;  1URF A;  4JI6 B;  2DN9 A;  2UUA O;  4WFG A;  2QKS A;  2R9A A;  2JIZ G;  4QIW F;  1PNL A;  4YIO A;  4QGP A;  5LMN B;  5KLV H;  4DR3 O;  2HVJ C;  4U7N A;  5ITZ B;  4RO2 A;  2JDI G;  4EEQ A;  1KB9 F;  2IJK A;  4LF7 B;  4CS3 A;  2XT9 A;  2YXY A;  1FPO A;  1QR9 A;  4I7Z B;  2QKA A;  1NVP B;  1QLE C;  3B8N A;  1HNW B;  3FX7 A;  2UUB O;  1D5A A;  1Q3E A;  1FD9 A;  1TUE B;  3AG3 C;  2F1M A;  5JVD B;  3W7W A;  1XUQ A;  2XAS A;  3MHS C;  4XDJ A;  1WPX A;  1AI4 A;  4EB6 A;  5GTI Z;  1BHB A;  2N05 A;  2QM4 A;  3ZED A;  4EB6 B;  4YJ2 A;  3CCE V;  2K1E A;  4B08 A;  3T1Y O;  3SR2 C;  2LFR A;  2RNB A;  5IWA B;  4ZIB A;  1F4M A;  1H38 A;  2JGU A;  5D5Q A;  4QE7 A;  4JYY A;  5L3G A;  4TV9 A;  1YTF B;  5EBM C;  2HVK C;  2ZIN A;  4X88 A;  2HR3 A;  5LOV B;  2EIM B;  3EVK A;  2JJ1 G;  3H1H H;  4WFF A;  4OX9 B;  2VQE B;  4J9Y B;  4ZOL A;  1JA8 A;  1KYO F;  3ZN1 A;  5J2T B;  3JAT B;  3VQW A;  4J42 A;  4O2A A;  5IJ9 A;  1SF9 A;  2CK3 G;  2CTW A;  1KUQ A;  1UPG A;  4TV8 B;  5IDJ A;  3OD4 A;  4X8A A;  1CEZ A;  2Q7H A;  1JOY A;  1B04 A;  4AQY B;  4B3R O;  2KSD A;  4NTX A;  3AG7 A;  4JAS A;  1M56 B;  2WA3 A;  4FMT A;  4O2B B;  1KQS U;  3F7Y C;  2HJF C;  4XDK A;  4X20 B;  3UT5 B;  1EN4 A;  1S72 V;  1ZLZ A;  2AHZ A;  2JEX A;  5BXZ A;  3SPJ A;  2Q7E A;  1FXK A;  1S0V A;  1QBZ A;  1KP2 A;  1WJZ A;  4DV1 B;  3ASN C;  4JI5 O;  3HB3 B;  3K5O A;  3M7M X;  4J7K A;  1V55 B;  4HNA A;  2UXC B;  4RWU A;  3PN1 A;  1AB3 A;  5CA3 A;  5EZY A;  4UCR A;  5C93 A;  4QNH B;  1BS3 A;  4NXM O;  3CP1 A;  1PD3 A;  2MK3 A;  3IAY A;  3OTF A;  5EC1 C;  3RYF B;  5KHJ A;  3L70 H;  2E3C A;  2UUC B;  3RYF A;  1MA1 A;  4DV6 B;  4WF9 V;  3RT3 C;  1ZSP A;  4MVO A;  3AG4 B;  3Q4H B;  1XDC A;  4ZKI A;  3CJH A;  1WA8 A;  3T1H O;  1GK9 A;  2JVD A;  2AZ0 A;  1Y74 A;  4UVA A;  1NS1 A;  2DYS B;  3ABK B;  2JK5 C;  2UXX A;  2F4V B;  2LGW A;  2IM9 A;  4TT3 G;  3OFN G;  4X64 O;  2EIJ B;  3P3N A;  4F6E A;  5C8Y A;  1K4C C;  1YSC A;  2KG7 A;  3UKM A;  1HNZ B;  2W0X A;  2Q9L A;  1XNQ B;  3LSS A;  3N27 A;  1NR1 A;  3CSX A;  4MVM A;  2WAM A;  3WG7 C;  5LMU B;  4J10 A;  4LFC B;  5IT9 N;  2Q6A A;  1FYJ A;  2CGN A;  2YSU B;  2D3O W;  1TVK A;  4JI5 B;  4R50 A;  1P7G A;  3MAQ A;  1VQ5 V;  1SQQ H;  4X1Y A;  4MVQ A;  2W0F C;  3RYI B;  1XMQ B;  4DR1 B;  1MMM A;  4O2A B;  1OCC C;  4FM0 A;  3E86 A;  5IYB O;  4BIZ A;  4QJF B;  2BTQ A;  2DYS C;  4B3S B;  1A32 A;  2PGG A;  2Q0O C;  4MTG A;  4PD4 F;  5LYJ A;  2ZE8 A;  3OT7 A;  5C8Y B;  1BMF G;  3K04 A;  3IC9 A;  2F66 C;  5D5P A;  3CXH F;  3G6B A;  4LF9 B;  5LL6 Y;  3AG2 B;  4IHJ B;  1V9P A;  2R9R B;  1BE3 H;  3ZHV A;  2YC0 A;  4BIO A;  3JAS B;  2UXB B;  5KUK A;  3AK2 A;  4H37 A;  3DXR B;  1JFF B;  3CB2 A;  4FIP C;  4X1Y B;  2ETN A;  1DF4 A;  1E79 G;  5LA6 B;  2FKX A;  5KUM A;  5LP6 C;  3ASO B;  3L72 H;  3CRC A;  2RMK B;  4JI0 B;  5DM6 V;  2Q68 A;  4DV7 O;  1YHQ V;  3E8B A;  3CWB H;  4I4T B;  3CC4 V;  3F5T A;  1SZT A;  4PI2 A;  3RYI A;  4QE9 A;  2LW1 A;  1H8E G;  3OW2 U;  4JAV A;  4BR6 A;  5LGT A;  2IH1 C;  4UV8 A;  1O9H A;  4X20 A;  1PV0 A;  4FFB A;  4ZHQ A;  2OCC C;  4N23 A;  1M57 C;  1RFY A;  5K1P A;  3IGA C;  4NYK A;  5LHH A;  4X66 B;  2QWN B;  3T1Y B;  4PV1 B;  3JAS A;  3T1C A;  4TUY A;  3B77 A;  1XQ8 A;  3MD0 A;  1VIB A;  1S5J A;  4FPP A;  4CH3 A;  3AG1 C;  2XOK G;  2EZP A;  5CA0 A;  4JI2 O;  4I9W A;  4LF8 O;  4KP4 A;  1GM9 A;  2JGD A;  3AG3 B;  3HKE A;  1BGY H;  4FFK A;  4O4L A;  3SJA C;  2EIN B;  3HKD A;  1RPO A;  3RN4 A;  2LQT A;  4O4L B;  5LOV A;  1LUV A;  1AVM A;  2UXC O;  4BW9 A;  4PA9 A;  4DV5 O;  3NXS A;  2GTS A;  4DO2 A;  4X62 B;  1RP3 B;  5EK0 A;  5DN6 G;  4K8X A;  1H2S B;  2QDO A;  1N32 B;  2DW4 A;  1F51 A;  1Q6H A;  5B1B C;  3U11 A;  2DQ0 A;  2G38 A;  2XND G;  1QVF U;  1GM8 A;  4GKK B;  3ZRX A;  1PP9 H;  3D3Q A;  1JQ0 A;  1XNR O;  4H44 B;  3CRM A;  2PYJ A;  1PNM A;  5FLX N;  4RUF A;  2F43 G;  1AP5 A;  3FFQ A;  2QM8 A;  1Q86 W;  1S5L Z;  4FLZ A;  3D36 A;  4IYH A;  1Y6X A;  4DV0 B;  3A0B Z;  2QKC A;  3K08 A;  4O4J A;  1XNQ O;  1BL8 A;  3SYC A;  5IJ0 B;  1VQ7 V;  1X59 A;  1Q8I A;  4BAY A;  3HKD B;  1KD1 W;  4CH6 A;  4DR7 B;  1OCR B;  3ZRW B;  2IU0 A;  5CA0 B;  1WAZ A;  4R6Z A;  1V54 C;  2V1D A;  3CMA V;  1P84 F;  2QJ1 A;  4NXN B;  1K5S A;  2X6B A;  3M99 B;  4O4H A;  2CDY A;  4DV6 O;  4BWA A;  1K7D A;  4DR1 O;  3B4S A;  4GX1 A;  1E1Q G;  3ABL B;  1W59 A;  1EZV H;  4PDR A;  5IYC O;  4P9O A;  1R6T A;  1VQP V;  2EJR A;  1GRJ A;  3VQY A;  1HW7 A;  5GON A;  4LC1 A;  1IUR A;  3BVO A;  3D8C A;  4J80 A;  2NNU A;  3RFR A;  1PPJ H;  1WNS A;  3OMN B;  4IIJ A;  4DK0 A;  2PF4 E;  3UO2 A;  1MG1 A;  1Z5W A;  1X4T A;  1E1R G;  1KC8 W;  1KEC A;  4FVM A;  2P67 A;  1VAR A;  3CCU V;  3TCU A;  3X2Q C;  4DR7 O;  3BPZ A;  1GN6 A;  4X89 A;  1CXZ B;  1AR5 A;  1Q90 D;  1KKC A;  5HFL A;  2DWD C;  1Y76 A;  2NLJ C;  3FD9 A;  3QO7 A;  2UUB B;  4DV4 O;  2GUZ A;  4YY3 B;  1Q82 W;  5L3C A;  3U10 A;  2R9I A;  4ZHQ B;  1BQ0 A;  1JJO A;  3CCM V;  1WPB A;  1F4N A;  4J7Z A;  5EBW C;  5LXT B;  3E22 B;  4IIJ B;  2BSK B;  4ICG A;  1J5E B;  4NKG B;  3ZHR A;  5IWA O;  2FTK A;  4YHH O;  4KXR A;  1R3K C;  3CCJ V;  3P30 A;  3KZI Z;  5CBG A;  1KP3 A;  1OV9 A;  3BEH A;  1YCI A;  2ZR2 A;  2N74 A;  5H5N A;  1XHZ A;  4OPH A;  1O9G A;  3K58 A;  4DR4 O;  3RGB A;  3F7V C;  1FFT B;  4H0L B;  2R70 A;  4DYL A;  1G8M A;  2JS3 A;  3QVN A;  4OX9 O;  3QG5 A;  2UXD B;  2Q67 A;  3WFV A;  4LF6 B;  4AIL C;  2HLD G;  4K0K O;  2Q0A A;  2RDC A;  3WG7 B;  3DXR A;  3ZX6 A;  1G6U A;  1EN5 A;  1GN3 A;  1MZE A;  2O57 A;  1QLE B;  5JWP A;  5B1B B;  5J2T A;  4DV7 B;  3FB8 C;  2EZO A;  4GX2 A;  1Y67 A;  4IGG A;  4U7O A;  3JD2 A;  3APQ A;  1P49 A;  1Q43 A;  5IY5 B;  2CGO A;  2V7Q G;  4FLY A;  1I94 O;  2QTS A;  5BMV B;  3DC6 A;  3U0Z A;  4DR5 B;  3N2G B;  5A9G A;  1I7F A;  5JQG A;  4QPK A;  4PDL A;  1Q5O A;  3RYH B;  3SPH A;  2BOB C;  1YVW A;  3ZRS A;  4FK5 C;  4CS4 A;  4DV0 O;  3ZHT A;  4CH5 A;  1K8A W;  2A0L A;  4YJ3 A;  1SES A;  1UFI A;  5B3S B;  4ZOL B;  1Q6I A;  4FZ1 A;  4X1K A;  2ITD C;  1FXV A;  1ZX3 A;  3FAV B;  1HNX O;  2P6J A;  4JYC A;  2ZE5 A;  3E35 A;  3WU2 Z;  4Q20 A;  4LR3 A;  5FPO A;  5F2V O;  1W0K G;  4I4T A;  4MSW C;  3CC7 V;  1ZUQ A;  3Q4H A;  2PI5 A;  1H2K A;  5DED A;  4HBN A;  5CBH A;  4YJ2 B;  2A3Q A;  1IXM A;  2X7R B;  3B40 A;  2F4V O;  1OCZ C;  1IBK B;  2QGN A;  3G6E V;  2ZKO A;  1S3J A;  4I9Q A;  2P90 A;  3ZCC A;  1VMG A;  3BY6 A;  4XDL A;  3D3I A;  2HKO A;  1I0H A;  1TA8 A;  4FLT A;  5H6R A;  4PI0 A;  5KMG B;  2IU3 A;  3APO A;  5B1N A;  3SYP A;  4LF5 O;  4JI8 B;  2UXN A;  2E74 B;  4NR1 A;  4Z2W A;  1GM7 A;  4LF7 O;  4EKW A;  4O4I A;  1NTZ H;  2VQE O;  2E5L B;  4O4J B;  3R65 A;  3OEH G;  4FM1 A;  2CTR A;  3JAK A;  4G27 B;  4L87 A;  2ZR3 A;  4YIP A;  5KA6 A;  5K1X A;  5H2F Z;  5LBQ A;  3AG2 C;  5J9P C;  3QTC A;  2BTO A;  1WB8 A;  3QNE A;  2F93 B;  3K06 A;  4PA4 A;  1N4C A;  3SYA A;  4U3F H;  1L0L H;  2EIM C;  2W6J G;  4DV4 B;  3AK3 A;  4JI4 B;  4PA6 A;  3CRR A;  2OTJ V;  2P4V A;  2P4K A;  1L8D A;  1XBL A;  1FJG B;  3B09 A;  1COW G;  1QHT A;  4H13 B;  4HZ3 A;  1P7B A;  3LDE A;  1IZ3 A;  1VQO V;  3OTO B;  1GO3 F;  3AG1 B;  2H94 A;  2JEU A;  3J81 N;  4I50 B;  3BHP A;  2JRI A;  4YHH B;  3GWO A;  2UXB O;  2ZD9 A;  4D7S A;  4KL1 A;  1P4R A;  2OIG A;  1V55 C;  2YIB D;  4NB5 A;  3X2Q B;  2PY5 A;  2QWO B;  2CH7 A;  3WB0 A;  3CE2 A;  4UCS A;  3ABK C;  3KKY A;  2FYU H;  1IBL B;  2DOS A;  2HFE C;  4I55 A;  5CB4 B;  4PDM A;  1SQF A;  1FFX B;  3RVZ A;  4FLV A;  2WLK A;  4NTY A;  1R3L C;  2UUC O;  1D2D A;  4PA7 A;  2GHY A;  1YIJ V;  5FPR A;  1K4D C;  3RW0 A;  2Y4T A;  3E89 A;  4FFB B;  2ZM6 B;  2AZ2 A;  4OXS A;  4WBN A;  2JJ2 G;  1K73 W;  3VOU A;  1H2L A;  3ASO C;  1R3I C;  3CXC U;  2FB5 A;  2KG7 B;  2A79 B;  4JPR A;  3SYO A;  1XMO O;  1N36 B;  1OJH A;  1SA0 B;  2PYL A;  4LF4 B;  1FJG O;  1M9N A;  1IX9 A;  4CS2 A;  4B7K A;  1HP8 A;  2QE7 G;  3QO5 A;  5EYP A;  1FXK B;  1HWY A;  5KMG A;  2WSS G;  2DMX A;  4YJ3 B;  3CCR V;  1NR7 A;  1TAE A;  1K3E A;  1DGS A;  3JD4 A;  4GUN A;  3RYC B;  2QTO A;  4FM2 A;  4B3T O;  3GVM A;  4LF6 O;  5HFM A;  1YDX A;  2Y69 C;  1M56 C;  2QWQ B;  4MVU A;  1EN6 A;  3JAK B;  3K9A A;  4PHZ A;  1OCC B;  1SET A;  1WN7 A;  3I5D A;  3HKC A;  2Q4P A;  1N32 O;  3ZJZ A;  1HNX B;  4BW5 A;  2H8P C;  5LYJ B;  3IFX A;  5BZB A;  4P2Z A;  3A0H Z;  4GX5 A;  1R3J C;  4RUE A;  2UU9 O;  2ZT9 B;  3ZHS A;  5LP6 A;  4JZG A;  1HR0 O;  2XHB A;  1XL6 A;  4E2L A;  5IY5 C;  1UJW B;  5L3E A;  4GKK O;  1JCH A;  2B1I A;  2IJH A;  3A2F A;  3A0R A;  1I94 B;  4JF3 A;  3OR7 C;  2C2A A;  2P5O A;  4JI3 O;  1RPR A;  1OHH G;  2YI9 A;  4F6R A;  2QEX V;  1WB7 A;  1YIT V;  4WCE V;  4FLW A;  2W6I G;  3IJ4 A;  4DV2 B;  2AGA A;  3AEI A;  4TOI A;  5LA6 A;  3T2M A;  5GTH Z;  1ZAU A;  1EBO A;  1PKX A;  1GAX A;  4U3J A;  3GWK C;  3K5N A;  2EIN C;  4LF5 B;  1HDJ A;  2YEV A;  3TET A;  4DW1 A;  5BY1 A;  2A9H A;  1M90 W;  4JI0 O;  3ZMS A;  2EIJ C;  4NXN O;  2PUS A;  1S76 D;  1TUB B;  4DV3 B;  3JD1 A;  1T5E A;  2EJ7 A;  1H2N A;  5IYZ A;  2GUZ B;  5LXT A;  3O65 A;  3ABM B;  1NT2 B;  3UCS C;  1DTO A;  2GBO A;  3CRQ A;  3RWR D;  4GYC B;  3L75 H;  1KBH A;  2CTQ A;  3W7S A;  5TIS Z;  2B5U A;  3HR0 A;  4TQF A;  3FB6 C;  3JAW A;  3HPL C;  2B1G A;  3JSN A;  1IBK O;  1K34 A;  1VQ9 V;  1SZX A;  3OAA G;  1VQK V;  4LP8 A;  2Q8V A;  3BRC A;  1U97 A;  1XEQ A;  3OR6 C;  3ZRV A;  2Z5U A;  3RYH A;  2D2C B;  5IYD O;  3TXS A;  3DTU B;  3ETG A;  4LFA O;  1NH2 D;  2KKW A;  3JD0 A;  4JI8 O;  2OCC B;  3KCY A;  3OMA B;  3W7U A;  1JR9 A;  3ZN0 A;  4TWK A;  4W4K A;  4KHP B;  3L73 H;  2Q5Z A;  1VQ6 V;  4JYA O;  3I56 V;  3K9S A;  3RBZ A;  4K0K B;  1MSW D;  3CHX A;  2L35 A;  2YEV B;  1NH2 B;  3G80 A;  3STL C;  3JD3 A;  5H9C A;  2X0L A;  3J7A U;  1W2B U;  1PL4 A;  2V4D A;  1AJN A;  4MVS A;  1XL4 A;  4DUY O;  1G4Y B;  3UO3 A;  1M57 B;  1VF6 C;  3JSL A;  3N2K B;  3CCS V;  3G71 V;  1BZK A;  2ZNJ A;  2RN9 A;  3WB1 A;  2VS0 A;  1XI1 A;  1HNZ O;  3T4D A;  3CEI A;  5BMV A;  2YI8 A;  4UCO A;  4DR2 O;  4LFC O;  4UUJ C;  1NTM H;  2WLL A;  1YJW V;  1OCR C;  2BE3 A;  3ZRW A;  2CUG A;  3BCC H;  5AG2 A;  3ZMT A;  5KAI Z;  4KHP O;  2RCV A;  3E8F A;  4IYI A;  1XMQ O;  5EBL C;  2AHY A;  1N0J A;  1N33 B;  3N2K A;  1QLN A;  1SC5 B;  2VQF B;  4AHC A;  4WFB V;  4DW0 A;  4CC5 A;  4B3S O;  4UFZ A;  4R8C A;  4MS2 A;  3IC7 A;  1K33 A;  1SS3 A;  3H9V A;  3JAL B;  3LNN A;  5B1O A;  2HHH O;  1HR0 B;  5CMU A;  4BIU A;  3K3W A;  4D7T A;  3EFF K;  4LFB O;  4OGQ B;  1K9M W;  2XAH A;  1AJQ A;  5JH7 B;  4UV9 A;  3AG4 C;  1S77 D;  5CN0 A;  4JV5 O;  4LH7 A;  1US6 A;  1VF5 B;  3CS5 A;  1S5H C;  4JI7 O;  1AP6 A;  2WLI A;  1NTK H;  4JI6 O;  4O4I B;  2WLM A;  3HKE B;  1VF7 A;  2LJ2 A;  1EM1 A;  1VQL V;  2JGD B;  1GTO A;  1M93 A;  4LNU B;  2M7W A;  4A5U B;  4HYO A;  3UQ8 A;  1Z2G A;  2VWJ A;  4PEL A;  1VQ4 V;  2ATK C;  1NBM G;  3SPI A;  4HNA B;  4JGS A;  2ZQM A;  3LDD A;  3MHH C;  2QSA A;  3UM7 A;  2ZNI A;  3ETD A;  2DE0 X;  2M6Y A;  1AI5 A;  4YY3 O;  4JZ2 A;  2WPD G;  4D6T H;  2Y0P A;  3C3T A;  5JH7 A;  2LFS A;  1MZF A;  1YXB A;  1RM1 B;  3ASN B;  4X66 O;  3STZ C;  4MW8 A;  3VBB A;  3UT5 A;  3ZS8 C;  4MW3 A;  1VEW A;  4U3J B;  2EX3 A;  1XOU A;  1YEW A;  4GLX A;  4DXW A;  4JI7 B;  2ITC C;  5JJE B;  3L9D A;  3OGI B;  1ROP A;  5J2U A;  4LWS B;  1N8R W;  1SKV A;  4B7E A;  4ZI7 A;  1IBL O;  1FAF A;  5KHI A;  4DV5 B;  3W7X A;  2GV9 A;  2OCH A;  1FXK C;  1ZWI C;  3SYQ A;  3JAT A;  2ILM A;  4FZ0 A;  2NR5 A;  5IYZ B;  3H1L H;  4CBC A;  3JAM N;  1OZ0 A;  4I5S A;  4L8J A;  3K03 A;  5L3D A;  2KB1 A;  2WLH A;  4XBF A;  4DRX B;  4B3R B;  1FXH A;  4MT8 A;  1I08 A;  3H1J H;  1J5E O;  1GH6 A;  2BOC C;  3THO A;  2WLJ A;  3H1K H;  2IJI A;  1SER A;  4GCZ A;  1GMG A;  1QR8 A;  2EIL C;  4DR4 B;  5B1A C;  5L3F A;  4J7J A;  3ZMV A;  5B3S C;  4GX0 A;  3K79 A;  3JAR B;  1ORQ C;  4UB6 Z;  5EZY B;  1Y4M A;  4DV1 O;  3CPW U;  3ABL C;  5JCO A;  4MTO A;  5B66 Z;  2ZIM A;  3TGU H;  3OE7 G;  2R72 A;  2GDS A;  3ABU A;  5BR8 O;  1BQZ A;  2P22 C;  4J9Z B;  3CCL V;  1Y76 B;  2ZM6 O;  3CJH B;  2ZXW C;  4X1I A;  2WWW A;  4LCU C;  3BA8 A;  2UU9 B;  1WLE A;  4WFE A;  5EIB D;  4OPA A;  1Y74 B;  3FKS G;  1YI2 V;  4CZZ A;  1I5X A;  3ZMZ A;  4CH4 A;  2EIK C;  2CTP A;  2XAF A;  1YJN V;  1THZ A;  2XUM A;  2AXT Z;  2Q69 A;  4RQE A;  3T1H B;  1JMK C;  1XMO B;  1N36 O;  1NKD A;  4O2B A;  3N2G A;  4WFH A;  4JI3 B;  2DWE C;  3NR7 A;  1WP8 A;  4GKJ O;  2EIL B;  4DR6 O;  2NN4 A;  3L71 H;  1ARO P;  2IW5 A;  3DSQ A;  4JTD B;  5A2Q N;  1SQB H;  4UVB A;  4K3A A;  5LHG A;  1B06 A;  2Y0I A;  3ML0 A;  3ABT A;  3K57 A;  5L3B A;  3OUF A;  3EHB B;  5H6Q A;  4B3M O;  3D36 C;  4PDV A;  1IBM O;  3SJB C;  1MAB G;  4LWS A;  2ZDI A;  4JI1 O;  4I0X B;  3PJS K;  2ADQ B;  1W0J G;  1U96 A;  2LP7 A;  1N33 O;  1H8H G;  4DUZ O;  1RSO A;  3JCZ A;  2ZE7 A;  4Z1M G;  1WA8 B;  1VQN V;  2OWO A;  5JVD A;  1YF2 A;  1JPX A;  2QWR B;  1AIL A;  4JI4 O;  4J11 A;  4KUM A;  4JYB A;  2QR4 A;  3C90 A;  2QM7 A;  4PJ0 Z;  2FL4 A;  3L74 H;  2Y48 A;  3SDL A;  3E8G A;  5KX5 A;  2XAG A;  5KX5 B;  2YXL A;  2ZE6 A;  2BSK A;  3SGI A;  1QCE A;  2YIB A;  1M5I A;  3B8M A;  3S3X A;  1OCO B;  2WLL B;  2ZDI C;  5LMN O;  4Q6G A;  5LMU O;  3FB7 C;  2CAZ C;  2OYQ A;  2RQ6 A;  2YDE A;  3CYO A;  3CC2 V;  2EBO A;  3RVY A;  1YTF D;  4TV9 B;  3ZHU A;  2ZCE A;  4GZR B;  1AI7 A;  1IBM B;  2GTA A;  1F7Y A;  1BSM A;  1DF5 A;  2YS8 A;  2N04 A;  4UVC A;  1AJP A;  4DV3 O;  1XHX A;  5IE9 A;  1QNM A;  2K9P A;  4H33 A;  1K97 A;  4DRX A;  1JX9 A;  3P32 A;  4AQY O;  4E4E A;  1RM1 C;  1G1X B;  3K0G A;  2PTM A;  1SRY A;  5JJN B;  3E22 A;  1SQP H;  4IL6 Z;  3TK1 A;  5GW7 A;  2PI4 A;  3OTO O;  2ZXW B;  4AI8 A;  3FB5 C;  3CME V;  1M1K W;  2RJZ A;  3W7T A;  1K5Q A;  3K59 A;  4J41 A;  1R6K A;  1GN4 A;  2WA4 A;  3K5L A;  2HEP A;  4UXN A;  3RYC A;  3CCQ V;  4JAA A;  5FL7 G;  2ZIO A;  4ZBM A;  2HJD A;  4LF8 B;  1JFF A;  3CX5 F;  2EIK B;  2CH7 B;  3E8H A;  2EUL A;  4JTA B;  4LNU A;  4NXM B;  4PA3 A;  1LR1 A;  1NJI W;  3K5M A;  3T4Z A;  4HAM A;  3P3P A;  5IJ9 B;  4RAI A;  3CD6 V;  1ZL8 A;  1GKF A;  3ZHQ A;  2OT5 A;  2FML A;  3J80 N;  1B6Q A;  4CC6 A;  3QF7 A;  4KFM A;  1IVS A;  2HHH B;  4LFB B;  3FYI B;  4LF4 O;  1WP7 A;  5KA5 A;  1XIL A;  2F95 B;  3S3W A;  3DGE A;  2QWP B;  2IBZ H;  3E2E A;  4YXW G;  3ZBH A;  4LBE C;  4JV5 B;  2XTA A;  5LGU A;  2IH3 C;  3SJQ C;  3BA9 A;  4MVR A;  1OCO C;  2UUA B;  4DR2 B;  5KHK A;  4G28 B;  3ETQ A;  4TSF G;  2OIE A;  3SPC A;  4EFE A;  5ITZ A;  1D5N A;  5EYP B;  4DR3 B;  2YIC A;  1OCZ B;  2E75 B;  1SQX H;  1MNG A;  5JJJ B;  4FLU A;  3KCX A;  1KU9 A;  4B3T B;  3R66 A;  3G67 A;  4ABM A;  4I0X A;  3JCU Z;  3BFR A;  5CA1 B;  3QO8 A;  1H2M A;  2DJV A;  1TUB A;  3LNM B;  1VF6 A;  2L6L A;  4JI1 B;  1NI8 A;  1NU1 H;  4N21 A;  2BTQ B;  3LSQ A;  1LUW A;  3OEE G;  3HKC B;  4X62 O;  3OUS A;  1BHA A;  3TJT A;  1HNW O;  4MTF A;  1NQT A;  5LHI A;  1EFR G;  3HKB B;  4EFB A;  4K35 A;  1ZTE A;  2ODM A;  3JAW B;  5EC2 C;  3JAL A;  2IJJ A;  1F23 A;  1N34 B;  1TGO A;  1K92 A;  1BT8 A;  3M8A A;  2H3O A;  2XAQ A;  4DR5 O;  3SJC C;  4F6R B;  5E79 Z;  1Q7Y W;  3AK1 A;  1H2G A;  5B5E Z;  4DR6 B;  1FS0 G;  4LFA B;  4FJC C;  2Z0A A;  1SQV H;  4LH6 A;  2A7W A;  3OMI B;  4UCT A;  3G4S V;  4QPJ A;  3VQX A;  4NVP A;  1AI6 A;  1QQC A;  2Y4U A;  1SQG A;  3FAV A;  3I55 V;  2OTL V;  4X1K B;  2QA4 V;  4B3M B;  2XAJ A;  1JJ2 U;  5E1A C;  1KKD A;  1NZ6 A;  2YXH A;  3VQV A;  5CA1 A;  1V54 B;  4UB8 Z;  4DUY B;  2YIA A;  3H01 A;  1NVP D;  3ZIA G;  3K0D A;  1I5Y A;  1VQ8 V;  2GSM B;  4F4L A;  3MDS A;  4WFA V;  1XRE A;  1J95 A;  5FNV A;  3ICX A;  4IHJ A;  5FNV B;  3CCV V;  3F5W C;  4O4H B;  3O9O A;  1DK1 A;  4C7U A;  3E83 A;  3TXQ A;  4Z1V A;  5JQG B;  2Q7G A;  3GB7 C;  1N0N A;  4FLX A;  2WLI B;  2Q73 A;  1MSD A;  1Z5V A;  2PZS A;  3A8T A;  1SA0 A;  1R6N A;  3DC5 A;  4P30 A;  5EIB C;  5IJ0 A;  4DK1 A;  1JVM A;  2BCC H;  4JTC B;  4UCV A;  1VP7 A;  1AR1 B;  4JYA B;  4G2K A;  1YJ9 V;  5KHG A;  4P9P A;  3JAR A;  3ABM C;  2UXD O;  4MTX A;  4R7C A;  2E5L O;  1PM9 A;  1MOF A;  3JYC A;  2VRZ A;  4X65 O;  1FFX A;  1L0N H;  5KAF Z;  2VQF O;  2AW9 A;  4TV8 A;  1RSO B;  2CE4 A;  3BAB A;  2Y69 B;  5JCO C;  4UCU A;  1QU7 A;  1IXB A;  1YZB A;  1R1B A;  2ADP A;  2X6A A;  1IDS A;  1DLB A;  1KMI Z;  2P7T C;  2HG5 C;  3HKB A;  4X1I B;  5DEC A;  1Y66 A;  1BCC H;  2DQ3 A;  4X64 B;  4I50 A;  5B1A B; 
#chains in the Genus database with same CATH homology
 3ABU A;  3FYE B;  1M9N A;  4DO2 A;  3OM3 B;  3ETE A;  5EK0 A;  5DN6 G;  1EZJ A;  4J9Z B;  3CCL V;  2DW4 A;  1F51 A;  2QE7 G;  3QO5 A;  5B1B C;  2ZXW C;  2WWW A;  4LCU C;  1FXK B;  1HWY A;  1WLE A;  3KG2 A;  4GT1 A;  4WFE A;  2DYR C;  2DQ0 A;  2WSS G;  3FKS G;  1YI2 V;  4CZZ A;  1I5X A;  3ZMZ A;  2XND G;  3CCR V;  1NR7 A;  1QVF U;  1GM8 A;  1K3E A;  2EIK C;  2XAF A;  1YJN V;  1THZ A;  3ZRX A;  1L1F A;  2Z3Y A;  4RQE A;  2Q69 A;  3JD4 A;  1JQ0 A;  3LDC A;  1PL0 A;  2QTO A;  4RQF A;  2X6C A;  1NKD A;  1PNK A;  1PNM A;  4RUF A;  4WFH A;  5HFM A;  2F43 G;  2Y69 C;  1M56 C;  2DWE C;  2QM8 A;  4MVU A;  1Q86 W;  3K9A A;  1QVG U;  3D36 A;  1CP9 A;  1OCC B;  1SET A;  2WLN A;  2EIL B;  5LGN A;  3ZMU A;  3ZJZ A;  1VQM V;  4BW5 A;  1ARO P;  2H8P C;  2IW5 A;  1R73 A;  3IFX A;  3OGC C;  3SPG A;  5BZB A;  1CPY A;  4JTD B;  3K08 A;  4P2Z A;  4GX5 A;  1R3J C;  4RUE A;  1BL8 A;  4UVB A;  5LHG A;  1ENV A;  3SYC A;  3ML0 A;  3ABT A;  3LUT B;  1VQ7 V;  5L3B A;  1XL6 A;  4BAY A;  4E2L A;  5IY5 C;  1UJW B;  5L3E A;  1JCH A;  2B1I A;  2IJH A;  3EHB B;  1LNQ A;  3OUF A;  1KD1 W;  4JAU A;  3A0R A;  1OCR B;  4JF3 A;  3OR7 C;  2IU0 A;  5H6Q A;  3ZRW B;  2C2A A;  2DYR B;  4ASU G;  4PDV A;  1Q81 W;  4R6Z A;  1RPR A;  5CBF A;  1MAB G;  4MVZ A;  1OHH G;  2ZDI A;  3PJS K;  1V54 C;  1W0J G;  2LP7 A;  2V1D A;  2QEX V;  1YIT V;  3CMA V;  4WCE V;  1K5S A;  4WFG A;  1H8H G;  2QKS A;  3JCZ A;  2JIZ G;  2W6I G;  2X6B A;  3M99 B;  4QIW F;  4Z1M G;  1VQN V;  1PNL A;  3AEI A;  1K7D A;  3W7W A;  3T2M A;  1EBO A;  1JPX A;  1PKX A;  4GX1 A;  1E1Q G;  3ABL B;  2HVJ C;  2EIN C;  4U7N A;  4RO2 A;  4KUM A;  2JDI G;  4JYB A;  2YEV A;  2QM7 A;  2IJK A;  3TET A;  4PDR A;  5IYC O;  4P9O A;  2A9H A;  1VQP V;  2EJR A;  1M90 W;  2Y48 A;  3E8G A;  3ZMS A;  1QR9 A;  2EIJ C;  2XAG A;  4LC1 A;  1S76 D;  2NNU A;  1QCE A;  3OMN B;  1NVP B;  3JD1 A;  3B8M A;  1QLE C;  3B8N A;  1OCO B;  2WLL B;  1MG1 A;  2ZDI C;  3ABM B;  1E1R G;  1DTO A;  3FB7 C;  1KC8 W;  1KEC A;  1TUE B;  3AG3 C;  3CYO A;  2P67 A;  3W7S A;  3CC2 V;  3CCU V;  2EBO A;  2XAS A;  2B5U A;  3MHS C;  4XDJ A;  3RVY A;  1WPX A;  1AI4 A;  3TCU A;  3X2Q C;  1YTF D;  3FB6 C;  1BHB A;  3CCE V;  2K1E A;  2B1G A;  3HPL C;  1VQ9 V;  1K34 A;  2LFR A;  1AI7 A;  4X89 A;  3OAA G;  1VQK V;  4LP8 A;  1F4M A;  1DF5 A;  1H38 A;  4UVC A;  1AJP A;  3OR6 C;  3ZRV A;  2Z5U A;  5IYD O;  3DTU B;  3ETG A;  4H33 A;  5HFL A;  2DWD C;  1K97 A;  2NLJ C;  4QE7 A;  3QO7 A;  5L3G A;  1JX9 A;  1YTF B;  5EBM C;  3P32 A;  1NH2 D;  2HVK C;  3JD0 A;  1RM1 C;  2OCC B;  3K0G A;  3OMA B;  5L3C A;  3W7U A;  2R9I A;  1Q82 W;  4X88 A;  3ZN0 A;  2HR3 A;  4TWK A;  1SRY A;  2EIM B;  2JJ1 G;  3CCM V;  1F4N A;  5EBW C;  4WFF A;  1VQ6 V;  4J9Y B;  3I56 V;  3TK1 A;  5GW7 A;  3RBZ A;  2PI4 A;  1MSW D;  2ZXW B;  3FB5 C;  3CME V;  3ZN1 A;  2FTK A;  2YEV B;  1NH2 B;  3W7T A;  1M1K W;  1K5Q A;  1R3K C;  3STL C;  3JD3 A;  5H9C A;  2X0L A;  3CCJ V;  3P30 A;  2CK3 G;  5CBG A;  1KP3 A;  1W2B U;  3BEH A;  2ZR2 A;  1R6K A;  1AJN A;  5IDJ A;  4MVS A;  1XL4 A;  4X8A A;  1G4Y B;  1CEZ A;  1M57 B;  1JOY A;  4JAS A;  1M56 B;  4UXN A;  3CCQ V;  3F7V C;  1FFT B;  3CCS V;  4FMT A;  5FL7 G;  3G71 V;  1G8M A;  1KQS U;  4ZBM A;  3F7Y C;  2HJF C;  4XDK A;  2Q67 A;  3WFV A;  2EIK B;  2HLD G;  3E8H A;  3WG7 B;  1S72 V;  4JTA B;  4PA3 A;  2AHZ A;  1NJI W;  3T4D A;  1QLE B;  5B1B B;  2JEX A;  3SPJ A;  1FXK A;  3T4Z A;  4HAM A;  3FB8 C;  2EZO A;  4GX2 A;  4RAI A;  1S0V A;  4U7O A;  4UUJ C;  3CD6 V;  2WLL A;  1YJW V;  1QBZ A;  1KP2 A;  1GKF A;  2OT5 A;  3JD2 A;  1OCR C;  3ZRW A;  1B6Q A;  3ASN C;  5IY5 B;  2V7Q G;  3HB3 B;  4KFM A;  3ZMT A;  1V55 B;  3FYI B;  5KA5 A;  5CA3 A;  5C93 A;  4QNH B;  3CP1 A;  3E8F A;  1PD3 A;  2MK3 A;  3DGE A;  4QPK A;  4YXW G;  3E2E A;  4LBE C;  5LGU A;  4PDL A;  2IH3 C;  5EBL C;  3SJQ C;  2AHY A;  4MVR A;  1OCO C;  5EC1 C;  3SPH A;  2BOB C;  3ZRS A;  4G28 B;  4FK5 C;  1QLN A;  4TSF G;  3SPC A;  4WF9 V;  4WFB V;  4MVO A;  3AG4 B;  4R8C A;  4ZKI A;  4MS2 A;  1OCZ B;  3IC7 A;  1K33 A;  1K8A W;  1GK9 A;  2A0L A;  5B1O A;  5CMU A;  4BIU A;  3K3W A;  4UVA A;  3EFF K;  3ABK B;  2DYS B;  1SES A;  1K9M W;  2XAH A;  2JK5 C;  5B3S B;  1AJQ A;  2UXX A;  3QO8 A;  4UV9 A;  3AG4 C;  1S77 D;  2ITD C;  5CN0 A;  1FXV A;  3LNM B;  4TT3 G;  3OFN G;  2EIJ B;  2P6J A;  4JYC A;  1K4C C;  1YSC A;  1S5H C;  3OEE G;  4N21 A;  3UKM A;  3LSQ A;  3E35 A;  2WLI A;  3OUS A;  3LSS A;  1BHA A;  4Q20 A;  1NR1 A;  4MTF A;  4MVM A;  2WAM A;  1W0K G;  3WG7 C;  2WLM A;  4MSW C;  1NQT A;  5LHI A;  1EFR G;  3CC7 V;  2Q6A A;  1VQL V;  2PI5 A;  5CBH A;  1GTO A;  2YSU B;  2D3O W;  1IXM A;  5EC2 C;  2X7R B;  2IJJ A;  1F23 A;  2M7W A;  1OCZ C;  4HYO A;  1K92 A;  4R50 A;  1VQ5 V;  4PEL A;  1VQ4 V;  2XAQ A;  3G6E V;  1S3J A;  2ATK C;  1NBM G;  4MVQ A;  3SPI A;  2P90 A;  2W0F C;  3ZCC A;  4JGS A;  3BY6 A;  1Q7Y W;  2ZQM A;  3D3I A;  4XDL A;  3LDD A;  1H2G A;  2HKO A;  3MHH C;  1FS0 G;  3UM7 A;  4FJC C;  1OCC C;  3E86 A;  5IYB O;  4BIZ A;  3ETD A;  3OMI B;  5H6R A;  2IU3 A;  5B1N A;  3SYP A;  1AI5 A;  4QJF B;  3G4S V;  2DYS C;  2UXN A;  2WPD G;  4QPJ A;  1AI6 A;  1GM7 A;  4EKW A;  3I55 V;  2LFS A;  4MTG A;  2OTL V;  1BMF G;  1RM1 B;  3ASN B;  3K04 A;  2QA4 V;  3R65 A;  3OEH G;  2XAJ A;  1JJ2 U;  3STZ C;  4MW8 A;  3VBB A;  4G27 B;  4L87 A;  2ZR3 A;  5E1A C;  3AG2 B;  5KA6 A;  5LBQ A;  1KKD A;  3AG2 C;  4MW3 A;  5J9P C;  2R9R B;  1V54 B;  5KUK A;  3H01 A;  1NVP D;  3ZIA G;  4DXW A;  2ITC C;  1I5Y A;  3K0D A;  1VQ8 V;  2GSM B;  4F4L A;  3QNE A;  3K06 A;  4H37 A;  4PA4 A;  4WFA V;  3SYA A;  4FIP C;  1J95 A;  1ROP A;  2EIM C;  2W6J G;  3CCV V;  3F5W C;  1N8R W;  4PA6 A;  2OTJ V;  1DF4 A;  1E79 G;  5KUM A;  3E83 A;  3ASO B;  3W7X A;  1COW G;  1FXK C;  1ZWI C;  3SYQ A;  4HZ3 A;  1P7B A;  3GB7 C;  5DM6 V;  2Q68 A;  3LDE A;  1VQO V;  2WLI B;  1GO3 F;  3AG1 B;  4CBC A;  2H94 A;  2JEU A;  1OZ0 A;  1YHQ V;  3E8B A;  3GWO A;  4I5S A;  2ZD9 A;  3K03 A;  1R6N A;  3CC4 V;  5L3D A;  4P30 A;  1SZT A;  1P4R A;  2KB1 A;  2WLH A;  1V55 C;  4QE9 A;  3X2Q B;  1JVM A;  4JTC B;  1H8E G;  4XBF A;  3OW2 U;  4JAV A;  1AR1 B;  1FXH A;  4MT8 A;  5LGT A;  2IH1 C;  4UV8 A;  4G2K A;  3ABK C;  1YJ9 V;  2OCC C;  4N23 A;  1M57 C;  2HFE C;  4P9P A;  3ABM C;  4MTX A;  4R7C A;  4PDM A;  1MOF A;  3IGA C;  5LHH A;  3RVZ A;  2BOC C;  3JYC A;  2WLJ A;  2WLK A;  3T1C A;  2IJI A;  1R3L C;  1SER A;  4GCZ A;  4PA7 A;  1GMG A;  3B77 A;  3MD0 A;  1QR8 A;  2GHY A;  2EIL C;  1YIJ V;  1K4D C;  3RW0 A;  5B1A C;  4FPP A;  5L3F A;  3AG1 C;  3E89 A;  3ZMV A;  5B3S C;  2XOK G;  2EZP A;  4GX0 A;  4OXS A;  2Y69 B;  3K79 A;  2JJ2 G;  1K73 W;  1ORQ C;  3VOU A;  4I9W A;  4KP4 A;  3ASO C;  1R3I C;  1GM9 A;  2X6A A;  1Y4M A;  3AG3 B;  3CXC U;  1DLB A;  2P7T C;  2HG5 C;  2EIN B;  3ABL C;  3CPW U;  2A79 B;  1RPO A;  4MTO A;  4JPR A;  3SYO A;  1Y66 A;  3OE7 G;  2DQ3 A;  4PA9 A;  5B1A B;  3NXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...