3TCUA

Crystal structure of nak2k channel d68e mutant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
93
structure length
93
Chain Sequence
DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGYGEFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein interactions central to stabilizing the K+ channel selectivity filter in a four-sited configuration for selective K+ permeation.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
molecule keywords Potassium channel protein
total genus 36
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3tcuA00
3OR6C 4R7CA 3IFXA 1J95A 3K0GA 4J9ZB 5B1BC 1ORQC 2AHZA 3FB6C 4R50A 4XDJA 3AG1C 5EC2C 3X2QC 2Q6AA 2A79B 4F4LA 2WLLA 3JYCA 4PDMA 3SYPA 3E8FA 2WLIB 2HVKC 3SJQC 4MVQA 3E8GA 3SYOA 3RVZA 2WLHA 3PJSK 1BL8A 4G28B 2HVJC 2ITDC 4WFHA 4X8AA 1OCZC 4PA6A 5B3SC 2WLIA 1OCRC 2X6AA 4P9OA 3WG7C 3T2MA 3E8HA 1R3JC 5CBGA 4HYOA 5B1AC 3ZRSA 5KUKA 3E89A 1KKDA 3LDCA 3EFFK 3GB7C 3ASOC 5EBWC 2ITCC 4X89A 3R65A 1R3KC 1M57C 3STLC 5KUMA 3SYQA 4JTCB 4XDKA 3SPIA 3ABLC 1XL4A 2OCCC 4I9WA 2AHYA 4MVRA 4PA9A 4EKWA 3BEHA 5BZBA 2K1EA 2BOBC 4RUFA 3AG2C 3RVYA 5EBMC 2BOCC 2ATKC 3UM7A 4JTDB 4GX5A 4QE7A 3T1CA 4DXWA 5EBLC 2WLJA 3FB8C 2HFEC 4J9YB 4QNHB 3F5WC 2QTOA 3HPLC 1OCCC 4MW8A 4R8CA 4PDLA 4WFEA 3SPHA 2WLNA 1LNQA 1V55C 5E1AC 3VOUA 3E86A 1XL6A 3T4DA 5J9PC 3SYCA 4OXSA 3LDDA 3K04A 4P2ZA 4LBEC 2Q67A 4H33A 2NLJC 3E83A 3TETA 3LDEA 1R3LC 1P7BA 2JK5C 4ZBMA 4P9PA 4GX2A 4MVZA 5CBFA 2R9RB 4QE9A 4BW5A 4RO2A 3OUFA 1QLEC 4RUEA 4MVOA 1G4YB 4PA4A 2DWDC 3OR7C 3SPCA 3SPGA 4RAIA 2EINC 3TCUA 4TWKA 4LCUC 3K08A 4MSWC 4UUJC 2EILC 2KB1A 2Y69C 2A0LA 2EIJC 2EIMC 5EC1C 2WLLB 3F7YC 4PDVA 3UKMA 2DYRC 4MS2A 2P7TC 2X6BA 3ASNC 1K4CC 1JVMA 4MW3A 4MTFA 4WFFA 4X88A 1R3IC 3K0DA 3LNMB 4LP8A 3SPJA 3IGAC 4MVMA 4CBCA 3AG3C 3AG4C 3FB5C 3K03A 2W0FC 3RBZA 2A9HA 4JTAB 2X6CA 2HG5C 4PDRA 2Q69A 5EK0A 3F7VC 2WLKA 3K06A 4KFMA 3OGCC 2H8PC 3ABMC 4H37A 2IH3C 5CBHA 3T4ZA 3KG2A 4XDLA 1OCOC 2DYSC 3E8BA 2EIKC 4HZ3A 4PA7A 4MVUA 1ZWIC 4MVSA 4MTOA 2IH1C 1K4DC 2YEVA 3ABKC 3RW0A 1M56C 2HJFC 2DWEC 2ZXWC 3LUTB 3OUSA 4R6ZA 3FB7C 2WLMA 3STZC 2Q68A 2QKSA 4GX0A 4PA3A 2ZD9A 5IY5C 4P30A 1S5HC 4MTGA 4WFGA 4GX1A 3SYAA 4G27B 3ZJZA 1V54C
chains in the Genus database with same CATH superfamily
1PD3A 3OR6C 2YSUB 3K0GA 1YIJV 3HKCB 1JJOA 2QR4A 1AI5A 4DV0O 1GM8A 4HNAA 3K5MA 2WLIB 4JI8B 4DR3B 1AVMA 4WF9V 1XMOB 1HNXO 3IC7A 3CRMA 5IE9A 5JCOC 3H9VA 3CCJV 1XREA 5L3DA 2QGNA 4WFAV 3QO8A 4YJ2A 2DOSA 3AG2C 1Q82W 3UM7A 2PUSA 1Y76A 1L1FA 1WB7A 2YC0A 4UVBA 3OW2U 3CRRA 3K9AA 2GBOA 4J7JA 4JI5O 1GK9A 1MG1A 4I50B 2UU9B 1R1BA 1D5AA 2P22C 2W0XA 4PV1B 5CA3A 1BHAA 3CRCA 4JI7B 2DQ3A 3F5TA 4DK1A 4LFBB 1I7FA 2JRIA 2EIMC 1P4RA 3CE2A 1WB8A 3JSNA 1DF4A 1URFA 1K92A 2L35A 2UXDO 3N2KA 2ZDIC 5B1NA 3OE7G 2IH3C 3HKBB 2X7RB 3JAWA 2IH1C 4LF5B 2F66C 3OUSA 3DSQA 5DM6V 4B08A 5FPRA 1HR0O 1FD9A 4EEQA 1Y6XA 4QJFB 3T1HO 1PM9A 1H2NA 1FAFA 1KU9A 4LF4O 1F23A 4FFBB 3W7TA 2AHZA 4ZHQB 3ZBHA 4JYCA 4X9QA 1QVFU 4X65O 2BE3A 5KLVH 1YDXA 2F95B 2VQEB 5EYPB 5KHHA 4P9OA 2F4VB 4JPRA 3ZRSA 3E89A 1IXMA 1AJQA 3T1YB 3CWBH 4BWAA 1TGOA 1GKFA 2O57A 2UU9O 2EIMB 2GTSA 4TV9B 3ZRWA 4DV2O 4O4JB 4FM2A 5JH7B 1Q3EA 1Q8IA 4EB6B 3RYCB 3LSUA 3DXRB 1M57B 3UO2A 3FYIB 4BW5A 1FKAO 5B66Z 4I4TA 2Z5UA 3OR7C 4JI2O 4B3SO 2Q7EA 4MSWC 2ZIMA 5LGTA 1BHBA 1G1XB 2FB5A 1FFXA 4JZGA 3ZMSA 2QWQB 4IYHA 2CGNA 3KCYA 3EVKA 1COWG 2LGQA 3ETDA 1G6UA 1S72V 2D3OW 2XAQA 3E8BA 5B1AB 1S5LZ 1I08A 1WA8B 3QTCA 2BSKA 4X1YB 3ASNB 4I0XA 3TGUH 3TK1A 1HNWO 5IY5C 2CE4A 4CC5A 4TQFA 1FS0G 2F93B 1YHQV 3ZJZA 3IFXA 3OMAB 2PY5A 2Y4UA 3JD4A 1QBZA 3OT7A 4LH7A 2UUBO 2N05A 3L73H 5A2QN 5E79Z 1ZL8B 2ZT9B 5CA0B 5LA6A 4JAAA 5JWPA 2WA3A 4JASA 4CS4A 1HNZB 5EIBD 2H3OA 4U3FH 5KUKA 1W59A 2YDEA 1HNZO 3CRAA 3R65A 5KX5A 1BGYH 3OM3B 3ZRWB 2UXXA 4DV1B 3N2KB 3CYOA 4J7ZA 5H6RA 4QNHB 1I94B 4B3TO 5H9CA 3HPLC 1VQKV 3K5NA 4YXWG 2RNBA 2YI9A 5BMVA 5J9PC 1JA8A 1JFFA 3HKDA 3BPZA 1IDSA 4DR5O 4YHHO 3WU2Z 2JEXA 4ZKIA 2Y48A 4RO2A 3B77A 1NVPB 2XASA 3ETQA 3WB1A 1B04A 4MVOA 5JVDA 1HR0B 3S3WA 3CPWU 2JIZG 5L3EA 5EC1C 1WP7A 1VQ5V 1M4UA 1Z2GA 1JVMA 1WP8A 1I94O 3GVMA 4TSFG 1A32A 3A8TA 4KHPO 4AI8A 4KFMA 2DQ0A 2BSKB 2P67A 3QO5A 4DO2A 4HZ3A 1BT8A 3G80A 1F7YA 4MVUA 4RQEA 1K4DC 4LF6B 1SQVH 2C2AA 3VQYA 3DGEA 1QCEA 3EHBB 3H1JH 4JV5B 1E79G 4I4TB 1K7DA 3GWKC 3AG2B 1MABG 1BQ0A 2WLLA 3BABA 1YXBA 3E8FA 4DR2O 3SR2C 2ZE7A 5DN6G 1FFXB 1FFTB 3RYHA 3E8GA 1US6A 1M56B 3OFNG 4WFHA 4XBFA 1R3JC 3G67A 1TVKA 1K5QA 2KG7B 2QKCA 2ETNA 4JI6B 4AHCA 5BZBA 5LOVB 3H1LH 1ZLZA 3K79A 3AG1B 4X64B 4DYLA 4J9YB 2EIJB 1AJPA 1MMMA 2CAZC 4I0XB 2RDCA 4J11A 5E1AC 3LDDA 1OCZB 1VF6C 1P84F 4E4EA 1YVWA 4NXNB 1SS3A 1KBHA 2NR5A 3QF7A 4X66O 5KHKA 2YUAA 2WWWA 3CMAV 3EXAA 5JH7A 1XDCA 4CC6A 3M8AA 1XNRB 3CCQV 4X66B 1K97A 1H2LA 3JAKB 4FPPA 1FPOA 2OCCB 2UUBB 2B5UA 1YTFB 4BR6A 1N8RW 2KSDA 3LNMB 1NH2B 2QM4A 4EFEA 3OEHG 3BHPA 2W0FC 5LHGA 4U7OA 1SC5B 4LFCB 3L75H 1GH6A 2PYLA 2QDOA 3I56V 2XAHA 3JATB 3RW0A 1K3EA 1Q7YW 3LUTB 4NKGB 3RGBA 2ZR3A 4GX0A 1IURA 4X65B 3B09A 4MTGA 4WFGA 4GX1A 4MT8A 3KKYA 1Z5WA 3K57A 2IU0A 4CH3A 4DR3O 2QSAA 4IHJB 3AG1C 4PDMA 4DR7O 1WAZA 2WPDG 2DN9A 3SYOA 2F23A 4FLZA 1N33B 1JPXA 3UQ8A 2CGOA 1IBKB 3T2MA 2ZE5A 4HYOA 5H5NA 3EFFK 2NN4A 2W6JG 1N32O 2WSSG 4X62B 1WPBA 1PNMA 2XOKG 2FYUH 3T1CA 1QR8A 2QTOA 4KUMA 4I55B 4FZ1A 3U0ZA 5C8YB 4I50A 3JSLA 4OXSA 1K8AW 3BA9A 3E83A 3WFVA 4JI7O 2AZ0A 5BMVB 1XEQA 3FYEB 5LMUO 3HKCA 4LFAO 2ZNIA 2BTQB 3JD3A 1JR9A 1ENVA 2A0LA 5A9GA 1TUEB 3TXSA 4F6RB 2IJKA 4MTFA 3GWOA 1R3IC 2XAFA 5IY5B 1QLNA 4B3MB 2EBOA 4Z1MG 4OPAA 4B3TB 2QWOB 4NVPA 3C3TA 2V4DA 4LF5O 2H8PC 2A3QA 5JQGA 4XDLA 5LOVA 1MSWD 4ZIBA 1LUVA 2MK3A 2WAMA 1BE3H 2QM8A 4FZ0A 4H44B 1SQBH 3AK1A 4LF9B 2HJFC 3ZHSA 3HR0A 1YCIA 2EILB 2AGAA 4JI8O 2VWJA 3OTFA 4WBNA 3SYAA 4X1KA 5KAFZ 1J95A 2GDSA 2LFRA 3ZEDA 2ZE6A 4GLXA 1THZA 3H01A 4NB5A 1AP6A 1Q6UA 4DRXA 3BFRA 3SJQC 4IGGA 4NTXA 3RFRA 2HHHB 2HJDA 4G28B 1EFRG 1XUQA 5BY1A 2UUCB 3E8HA 3SJCC 4W4KA 1PNKA 3CHXA 2Y0IA 1F4NA 2ITCC 5LGNA 4DV5O 3OEEG 1JMKC 4JTCB 1KD1W 4PA9A 3BEHA 2K1EA 4ICGA 5EBMC 3FFQA 1R73A 2KG7A 2QWPB 3JD0A 4GX5A 3M99B 1DGSA 1EBOA 1OCCC 4JI0O 4JV5O 2N04A 4FVMA 1V55C 1FYJA 1XL6A 2Q9LA 3MD0A 3B2EE 4DV1O 1NTMH 1AP5A 4NTYA 1S3JA 1VARA 3JAMN 4P9PA 4UV9A 1O9HA 1SESA 4FFBA 2UUCO 4NXNO 2HP8A 4PA4A 2DWDC 1N0JA 4F6RA 4C7UA 4RAIA 4B3MO 2EINC 1FXKA 4NXMO 4LWSA 2UXCO 3JALB 2DYRC 4L87A 2VRZA 3K58A 3CJHB 2Q0OC 4ASUG 4JI3O 1IBLO 2YIAA 3U10A 2KQXA 1WLEA 1M1KW 4IYIA 2Q7HA 4YJ3A 3IGAC 2UXCB 2OCHA 1S5JA 2EZPA 2HG5C 5EK0A 3S3XA 2LW1A 1VQMV 1QLEB 2YS8A 1F4MA 3KG2A 1R6NA 3W7XA 2PI4A 4PA7A 3ZMVA 4UCSA 4FMTA 2M7WA 3THOA 3L9DA 1SQFA 3CCVV 1NTKH 4J7KA 2EINB 4B3RB 1U96A 1VIBA 3W7UA 2ZR2A 1IX9A 5LA6B 1KP3A 4R50A 3M7MX 5IJ0A 3ZHTA 3ETGA 2Q7GA 5IT9N 3JARA 1Y4MA 4IIJB 4F4LA 2F1MA 2DYSB 4FK5C 5K1PA 4FLYA 3P30A 2LQTA 3B40A 2B9ZA 1NS1A 2HVJC 1AI4A 4LFCO 5EZYB 3WG7C 5F2VO 2YI8A 4YIPA 2OCCC 1SQQH 4GZRB 3PN1A 1KP2A 1MZFA 4QE7A 4UV8A 3F5WC 2XHBA 1Y74A 1DK1A 2BCCH 1WPXA 5FNVB 1WA8A 2EX3A 4LBEC 4H33A 2NLJC 2HLDG 2X0LA 1B6QA 3ZHVA 4DR7B 3A0BZ 4QPKA 4WBNB 4O4JA 4B7KA 5IJ9B 4DR5B 1NQTA 3CS5A 1UJWB 3TCUA 4TWKA 4JYYA 1IBMO 4DR6B 3CCRV 3DC6A 1ZL8A 1RSOA 1VQOV 2UXBO 3FKSG 4KL1A 1JJ2U 2GTAA 3TXQA 4GKJO 3RT3C 4J42A 4ZOLB 3SPJA 1YITV 4MVMA 3AG3C 3A2FA 3FB5C 2HR3A 2ZCEA 4E2LA 4BIOA 4JTAB 1N36O 2DMXA 4W4LA 4FM1A 2JS5A 2IJIA 3OTOO 2PGGA 4TV8A 1OCOC 3J80N 3ABTA 1BZKA 5LYJA 2IJHA 2YIBA 2ZXWC 2V1DA 4PJ0Z 3BY6A 1VQ6V 1IBMB 2YEVB 4LF9O 4H0LB 4I5SA 4FLUA 1JOYA 3ICXA 5LHHA 3SYPA 3JALA 4CH4A 2OIGA 1NVPD 4FJCC 2EIKB 1Q43A 3Q4HA 3L72H 1S0VA 1H8EG 1VEWA 2PF4E 2AXTZ 4PI0A 1OCZC 4YJ3B 5FLXN 1H38A 1OCOB 4TT3G 2EJRA 2QM7A 2ARHA 4JI1O 1TUBB 1V54B 1VMGA 1R3KC 2Y69B 5CA1A 2BTOA 4WFBV 4JI0B 1I0HA 1YSCA 4RUFA 4DV2B 3LNNA 3P32A 4DXWA 1IXBA 2CUGA 3FB8C 2HFEC 2KKWA 2P5OA 1LNQA 1N32B 1FXHA 4LF8O 1FXVA 4P2ZA 2Q67A 3G6EV 4X1IB 2XTAA 2OTLV 2AZ2A 4O2AA 3FAVB 4UVAA 1JFFB 4U7NA 1NR7A 3HKDB 1QQCA 3ZMTA 1HW7A 3OUFA 2ZXWB 1AI7A 1XBLA 3SPCA 2QJ1A 5IJ0B 2WLLB 4JI1B 3RYHB 1CXZB 4J41A 3E22A 3E2EA 4DR4O 5EZYA 5LMNB 4LWSB 2LFSA 3AG4C 3RN4A 5CB4B 4TV8B 3N27A 4TUYB 4X20B 3G71V 4O4LB 3ABMC 5CBHA 1IBKO 3C3SA 4YJ2B 5DECA 5FNVA 1VF6A 1N34B 4UCTA 3P3PA 4LNUB 1Y67A 1SERA 2E3CA 4IHJA 2ZD9A 4UB8Z 2UUAB 2Z3YA 5AG2A 3BAAA 5J2TB 3Q4HB 4XDJA 1SA0A 5EC2C 5GTHZ 4NYKA 5JJEB 4MTXA 1VQ9V 2P90A 1WJZA 4TOIA 1LR1A 3TJTA 5GTIZ 4JYAO 1NT2B 3APOA 2QWNB 2CH7A 1AR1B 3LDCA 1TA8A 5BXZA 5EBWC 4DV4B 1VQNV 1VF7A 4DR6O 1PP9H 4AQYB 2YXHA 2AHYA 2CTRA 3FD9A 3RVYA 1TAEA 4GYCB 2ATKC 3JD1A 1R6KA 2IU3A 3CRQA 2CTPA 1HWYA 4X1IA 2DYRB 2IW5A 1KYOF 1AJNA 1YJNV 5LYJB 3K04A 3AK2A 4IL6Z 2Q73A 3AG4B 1XMQO 1XHXA 1XHZA 4J80A 4G2KA 1QLEC 4RUEA 5KMGA 4D7SA 1G4YB 4B7EA 4WCEV 3J81N 1L0LH 2PI5A 4UCOA 2Y4TA 3CMEV 2ADQB 3E22B 4ZHQA 5IYZB 2CTWA 5IJ9A 3F7YC 2LJ2A 5EIBC 3KZIZ 4N23A 2X6BA 1E1QG 4GT1A 3OMIB 4DUZO 2IBZH 1AI6A 5CA1B 1RSOB 2ZIOA 3K03A 1KQSU 2RJZA 4NXMB 3RBZA 1NJIW 2X6CA 3MAQA 2WA4A 2HHHO 4D6TH 1JQ0A 4JGSA 3K9SA 4LNUA 4UFZA 2DYSC 4OX9O 4DR1O 4JF3A 2OWOA 1VQ8V 3SDLA 4MVSA 1RPOA 5HFMA 1VQ7V 3L70H 1ZUQA 5CN0A 3STZC 4ZI7B 5C8YA 3OAAG 1S5HC 1SA0B 4LF6O 3ZIAG 3QVNA 4JAUA 4J9ZB 1RM1B 3NXSA 3RYCA 4DV6O 1I5XA 3RWRD 4MVQA 4KHPB 3B4SA 3ABUA 1OV9A 1BL8A 5KA6A 2ITDC 3JASA 2X6AA 2CK3G 3G4SV 2P4VA 5L3FA 3HKEA 4O4LA 3IJ4A 1S77D 2ZM6B 4I9WA 2BOBC 2XAGA 4JAVA 5K1XA 1M5IA 1FJGB 1TUBA 2WLJA 3O9OA 1QVGU 4LF8B 4R8CA 4FLVA 4KXRA 3E86A 3T4DA 3X2QB 2B1IA 2HKOA 4ZBMA 1P7BA 3AG3B 3RYIB 5JJNB 5LL6Y 5HFLA 5FPOA 5H2FZ 2P6JA 2QWRB 2F4VO 2XT9A 2QEXV 1GRJA 4O2AB 3SPGA 4UCVA 5JCOA 2VQEO 4UXNA 5LHIA 3UKMA 3NR7A 4NR1A 4H13B 4J10A 4X88A 1NU1H 3K0DA 1PL4A 4LP8A 1RPRA 3K5LA 2R9IA 5LP6A 3H1IH 4DV7O 5IYCO 2LW7A 2Q69A 4K35A 2RCVA 2VWKA 4BW9A 1MZEA 2W6IG 5KX5B 4H37A 2GUZB 1NI8A 1VP7A 1EN4A 1EN6A 3ZS8C 1ZAUA 4EB6A 1X4TA 2IM9A 2E76B 4LC1A 3CC7V 4BAYA 5TISZ 2FKXA 1SZXA 3SGIA 4JYAB 2A79B 4LH6A 5KMGB 3E35A 3T1YO 4O4HB 5LMUB 3CCSV 1KC8W 3HKEB 4BIUA 5BR8B 3ABMB 2VQFB 1HDJA 3IC9A 5IYBO 2R9AA 3ASOC 4UVCA 4A5UB 2ZKOA 3N2GB 1M57C 2M6YA 1K9MW 1QR9A 4GKKB 1NH2D 2IJJA 1R6TA 4FIPC 4YY3O 1M90W 4I7ZB 1M93A 3SPHA 4BIZA 4DV5B 3B8MA 1MSDA 3JCUZ 4JYBA 2QA4V 2OYQA 3WB2A 2XNDG 4OX9B 4B3SB 2ZQMA 2R9RB 1H8HG 4O4IB 1AR5A 4U3JA 4PI2A 2UXBB 2OT5A 4UUJC 1S76D 2EIJC 4ZOLA 3JASB 3AG7A 1P49A 4MW3A 1ZSPA 5B1OA 1RFYA 3MHSC 5IYZA 5C93A 4YY3B 2JGDA 3OTOB 3QNEA 3BVOA 3K5OA 3BRCA 5LXTA 1HP8A 4N21A 5FL7G 1SZTA 1O9GA 4YHHB 2FL4A 2JVDA 1WN7A 2EIKC 2FMLA 1GM7A 2ADPA 3CCLV 2YEVA 4LF4B 1YI2V 4X64O 1SQPH 2QKSA 4K0KB 2CTQA 4Q6GA 1NTZH 5D5QA 4GUNA 1YZBA 1OZ0A 1P7GA 4DW0A 1BMFG 1Q5OA 4LF7O 1OCCB 5GONB 1PKXA 1V55B 3PJSK 2E5LB 4PA6A 1OCRC 3GB7C 1QHTA 1XMOO 3HB3B 4JI3B 1F51A 2JDIG 5B1BB 1QU7A 1NKDA 3K3WA 3CCEV 4O2BA 3UT5B 2RMKB 1G8MA 1OHHG 3T1HB 4JI6O 2WLNA 4CH5A 4EFBA 2ZE8A 3JATA 2Q8VA 3W7WA 1D2DA 3TETA 1R3LC 1SRYA 1NR1A 2VS0A 4DV6B 4GX2A 5IYDO 3D36C 4QE9A 1BQZA 2E5LO 2CDYA 1VQLV 1OCRB 3OGIB 2QE7G 3D3IA 4FLWA 1YF2A 2F43G 5CB4A 1DLBA 4DV7B 1MA1A 2YICA 1EM1A 3C90A 3G6BA 3N2GA 4DR1B 1QNMA 4CS2A 3HKBA 1GTOA 4FLTA 1N33O 1PNLA 2LO1A 3A0RA 2DWEC 4HAMA 1VF5B 1NBMG 2WLMA 5LBQA 1XILA 2Q68A 4ABMA 4JI4B 3O65A 4DV0B 3ETEA 1VQ4V 4U3JB 1XOUA 2PTMA 3MDSA 4PD4F 3FB6C 4O4IA 1L0NH 2Q6AA 3JYCA 3I5DA 4DR4B 2QKAA 3CB2A 4HBNA 1AROP 2EZOA 3CEIA 2WLIA 2B1GA 5GW7A 3BCCH 3CXCU 3RYFB 4LFAB 1KKDA 2FTKA 3IAYA 4PHZA 1N34O 1DF5A 3H1HH 2JS3A 1XL4A 4MVRA 1JX9A 3ZN1A 1WNSA 5LXTB 3D36A 3UCSC 3VQWA 5EBLC 3L71H 5JQGB 1X59A 1GN4A 4MW8A 4GKKO 4K8ZA 2DE0X 1GN2A 1KB9F 1CEZA 5ITZA 4MVZA 1NZ6A 2P4KA 2Z0AA 3SJBC 1IBLB 5L3CA 2ILMA 5J2TA 1XMQB 3K08A 4IT5A 1XI1A 2YXYA 4MS2A 1YEWA 3ASNC 1GN3A 1K4CC 4GCZA 5IDJA 1KKCA 2CH7B 4Z2WA 2A9HA 3WB0A 2WLKA 2ZNJA 2JEUA 2JGDB 1PPJH 1L8DA 3T4ZA 4JI5B 4X1YA 4DW1A 1IZ3A 3LSQA 2ZM6O 1V9PA 3ZRXA 1ZWIC 2ZINA 5J2UB 4UCUA 3ZHUA 4P30A 4LFBO 3CX5F 1ORQC 1B3QA 3QO7A 5KHGA 3APQA 1AB3A 4GKJB 2HVKC 5CMUA 1I5YA 3RYFA 4DUZB 1KUQA 1BCCH 1GO3F 4X8AA 1IVSA 1Q81W 4DR2B 1XNRO 3CJHA 2HEPA 1GM9A 5CBGA 2Q5ZA 3ZN0A 5B5EZ 3W7SA 1LUWA 3BA8A 1J5EB 3R66A 1CP9A 4X89A 5KUMA 1W2BU 3ABLC 2EJ7A 2V7QG 2BOCC 3I55V 3CXHF 5LMNO 3DC5A 4DV3B 1MNGA 3VOUA 2YIDA 4K3AA 4RQFA 1SQGA 3LDEA 2JK5C 1PV0A 4ZI7A 4K8XA 2ZDIA 5LP6C 1SF9A 4B3RO 1EZVH 3WG7B 4DRXB 4KP4A 5CA0A 5DEDA 1H2SB 2ODMA 2EILC 4IIJA 1SKVA 2LP7A 3SJAC 5IWAB 3D3QA 1PL0A 1D5NA 2A7WA 1Q6IA 4WFFA 1BS3A 4PELA 1KMIZ 1N0NA 4D7TA 2YIBD 1T5EA 1E1RG 1BSMA 3K06A 5KA5A 5B3SB 2Q0AA 2H94A 1SQXH 4RWUA 4MTOA 2LGWA 4DV4O 3CD6V 5JJJB 1M56C 1MOFA 3VQVA 2AW9A 2G38A 2UXNA 1Y74B 1N4CA 3ZMZA 2DW4A 4R7CA 5IWAO 5ITZB 3RYIA 4O4HA 4JI4O 4F6EA 3CP1A 1FXKB 2L6LA 3D8CA 2QTSA 2Y0PA 1J5EO 2A06H 3ZMUA 1KECA 2WLHA 3K59A 5B3SC 5L3GA 2JJ2G 4X62O 3OD4A 2P06A 4L8JA 1ZTEA 4UB6Z 5LP6B 4XDKA 3SPIA 2OIEA 1SETA 4EKWA 1EN5A 1RM1C 1ZX3A 4FLXA 1K34A 4JTDB 5KHJA 1Q86W 1H2KA 3H1KH 4JZ2A 5J2UA 1Z5VA 4PDLA 3ZCCA 2OTJV 2XAJA 1FXKC 2XUMA 3SYCA 3ZRVA 5CBFA 3MHHC 1Q90D 1UPGA 1HNXB 1VQPV 5BR8O 3JARB 4HNAB 4Z1VA 3P3NA 1Y66A 4DK0A 1ROPA 2RQ6A 1CPYA 5JVDB 2P7TC 4OGQB 5D5PA 4AQYO 1TVKB 3DTUB 4CBCA 1B06A 1EZJA 5KHIA 4PDRA 4FM0A 2PYJA 3F7VC 3JAWB 4TQDA 1Y76B 1HNWB 3AK3A 4AILC 1W0JG 1YJWV 1GN6A 4CS3A 4NTWA 4R6ZA 5L3BA 3FB7C 1XNQO 2GUZA 4PA3A 4DV3O 1XQ8A 2K9PA 5LGUA 2E74B 1RP3B 4G27B 1XNQB 5B1BC 3J7AU 1H2GA 5KAIZ 1Q6HA 2GSMB 3X2QC 3FX7A 1UFIA 1YJ9V 2GHYA 3CSXA 5EYPA 1K33A 4Q20A 3RVZA 2UUAO 4LR3A 3UO3A 2R72A 2UXDB 4LF7B 4QPJA 5H6QA 3ML0A 4YIOA 5B1AC 4JI2B 1U97A 4DUYB 3U11A 4O2BB 3UT5A 3ABKB 3VBBA 3B8NA 3STLC 3JD2A 3SYQA 3OMNB 2DJVA 1W0KG 1JCHA 1DTOA 4I55A 2VQFO 4TUYA 4X20A 1GMGA 1M9NA 2EULA 1K5SA 3QG5A 4K0KO 1H2MA 3AEIA 4WFEA 2N74A 4I9QA 2GV9A 2BTQA 3CCMV 2PZSA 1OJHA 1AR4A 2YXLA 2JGUA 3ASOB 3ZHRA 4CZZA 4LCUC 1AILA 2KB1A 2Y69C 4UCRA 3CC4V 3KCXA 4PDVA 3ABLB 4DUYO 3LSSA 3VQXA 5GONA 1FJGO 3JAKA 4OPHA 3A0HZ 4QIWF 2RN9A 4QGPA 2E75B 3OGCC 2JJ1G 1YTFD 1K73W 2Q4PA 4CH6A 2MW2B 2R70A 3ABKC 2D2CB 3JCZA 3L74H 4TV9A 4X1KB 1N36B 3ZHQA 3CC2V 3ZX6A 4FFKA 3FAVA 3DXRA 3CCUV 1GAXA 2NNUA 1V54C
chains in the Genus database with same CATH topology
1PD3A 3OR6C 2YSUB 3K0GA 2IU0A 1YIJV 3FB6C 4XDJA 3AG1C 1AI5A 5EC2C 1GM8A 4MTXA 2Q6AA 3JYCA 4PDMA 2WPDG 2WLIB 1VQ9V 4WF9V 2P90A 3SYOA 1AROP 2EZOA 1JPXA 3IC7A 2WLIA 2B1GA 5GW7A 3T2MA 1AR1B 3CXCU 4HYOA 1KKDA 3LDCA 2FTKA 3EFFK 5EBWC 3CCJV 1DF5A 2W6JG 1VQNV 5L3DA 1XL4A 2WSSG 3QO8A 2AHYA 4MVRA 4WFAV 1JX9A 3ZN1A 3AG2C 3RVYA 1Q82W 2ATKC 3JD1A 3UM7A 3D36A 2XOKG 1PNMA 1R6KA 3T1CA 2IU3A 5EBLC 1HWYA 1QR8A 2QTOA 1L1FA 4KUMA 4MW8A 2DYRB 4UVBA 2IW5A 3OW2U 1AJNA 1YJNV 3K9AA 4OXSA 3K04A 1K8AW 3E83A 3WFVA 1GK9A 1MG1A 3AG4B 1CEZA 4MVZA 3FYEB 5CA3A 4G2KA 1QLEC 4RUEA 5L3CA 1G4YB 4WCEV 1BHAA 2PI5A 2DQ3A 3CMEV 3K08A 3JD3A 2A0LA 1ENVA 2EIMC 1TUEB 3F7YC 1P4RA 4MS2A 4N23A 2IJKA 2X6BA 3ASNC 1K4CC 4GCZA 4MTFA 1E1QG 3GWOA 1R3IC 4GT1A 2XAFA 5IDJA 5IY5B 3OMIB 1DF4A 1K92A 1QLNA 1AI6A 2EBOA 4Z1MG 3K03A 1KQSU 3RBZA 1NJIW 2A9HA 2X6CA 2WLKA 2ZDIC 5B1NA 2JEUA 2H8PC 1JQ0A 4JGSA 3OE7G 2IH3C 3T4ZA 4XDLA 1MSWD 2DYSC 2X7RB 3LSQA 4JF3A 3ZRXA 2MK3A 1VQ8V 1ZWIC 1RPOA 2WAMA 4MVSA 2IH1C 2QM8A 2HJFC 3OUSA 5DM6V 5HFMA 1VQ7V 3STZC 5CN0A 3OAAG 4QJFB 2EILB 4P30A 1S5HC 3ZIAG 1F23A 3SYAA 4JAUA 3W7TA 1J95A 4J9ZB 1ORQC 2AHZA 2LFRA 1RM1B 3NXSA 1THZA 3H01A 3QO7A 4JYCA 1I5XA 1QVFU 2HVKC 5CMUA 3SJQC 1I5YA 4MVQA 3ABUA 1BL8A 4G28B 5KA6A 2ITDC 1EFRG 1GO3F 4X8AA 1Q81W 2X6AA 4P9OA 3E8HA 4JPRA 1GM9A 5CBGA 2CK3G 3ZRSA 3E89A 3ZN0A 3W7SA 1PNKA 1IXMA 3G4SV 1F4NA 5L3FA 1AJQA 2ITCC 5LGNA 1CP9A 4X89A 1S77D 3OEEG 5KUMA 4JTCB 1W2BU 1KD1W 3ABLC 4I9WA 4PA9A 3BEHA 2K1EA 2BOBC 2XAGA 4JAVA 2V7QG 2BOCC 5EBMC 1R73A 1GKFA 3JD0A 4GX5A 3I55V 2WLJA 1QVGU 3M99B 2EIMB 1EBOA 1OCCC 3ZRWA 4R8CA 1V55C 3VOUA 3E86A 1XL6A 3T4DA 3X2QB 4RQFA 2B1IA 3MD0A 2HKOA 3LDEA 4ZBMA 1P7BA 1S3JA 2JK5C 3AG3B 4P9PA 4UV9A 5HFLA 2ZDIA 1M57B 3FYIB 4BW5A 1SESA 3WG7B 2P6JA 2QEXV 4KP4A 2DWDC 4PA4A 2Z5UA 3OR7C 3SPGA 4RAIA 2EINC 4UXNA 5LHIA 4MSWC 1FXKA 2EILC 5LGTA 1BHBA 2LP7A 3UKMA 4L87A 2DYRC 1PL0A 3ZMSA 4ASUG 4WFFA 4X88A 4PELA 1M1KW 1WLEA 3K0DA 4LP8A 1RPRA 2R9IA 3IGAC 5IYCO 2EZPA 1COWG 3ETDA 2HG5C 5EK0A 2Q69A 1VQMV 1S72V 2W6IG 1E1RG 3K06A 2D3OW 1QLEB 5KA5A 4H37A 1F4MA 5B3SB 3KG2A 2XAQA 1R6NA 3E8BA 2H94A 5B1AB 3W7XA 2PI4A 4PA7A 3ZMVA 4FMTA 2M7WA 4MTOA 3CD6V 3CCVV 1M56C 1MOFA 2UXNA 3ZMZA 3ASNB 2EINB 3TK1A 2DW4A 5IY5C 1FS0G 1YHQV 3W7UA 2ZR2A 3ZJZA 4R7CA 3IFXA 3OMAB 4LC1A 3CC7V 4BAYA 3JD4A 1KP3A 1QBZA 4R50A 3CP1A 3ETGA 1FXKB 1Y4MA 4F4LA 2A79B 3E35A 2DYSB 4FK5C 3P30A 3ZMUA 4JASA 1KECA 2WLHA 3CCSV 2HVJC 1KC8W 1AI4A 4BIUA 3ABMB 5B3SC 5L3GA 3WG7C 5KUKA 2JJ2G 5IYBO 3ASOC 4UVCA 3R65A 1M57C 4XDKA 3SPIA 1K9MW 2OCCC 1QR9A 1SETA 3OM3B 3ZRWB 4EKWA 1RM1C 2UXXA 3CYOA 1NH2D 1K34A 2IJJA 4JTDB 5H6RA 1KP2A 4QE7A 4UV8A 4FIPC 1Q86W 4QNHB 3F5WC 1M90W 5H9CA 3HPLC 1VQKV 4YXWG 4PDLA 3SPHA 4BIZA 1WPXA 3B8MA 3ZCCA 2OTJV 4JYBA 2QA4V 2XAJA 1FXKC 5J9PC 3SYCA 2XNDG 3ZRVA 4LBEC 4H33A 2NLJC 2HLDG 2X0LA 2JEXA 2ZQMA 2Y48A 4ZKIA 1B6QA 5CBFA 2R9RB 3MHHC 1H8HG 4QPKA 1VQPV 4RO2A 3B77A 1NVPB 2XASA 4MVOA 1NQTA 2OT5A 1UJWB 3CPWU 1Y66A 2JIZG 3TCUA 4TWKA 4UUJC 1S76D 1ROPA 5L3EA 2EIJC 5EC1C 1VQ5V 3CCRV 1CPYA 1VQOV 2P7TC 3FKSG 1JJ2U 1JVMA 4MW3A 5B1OA 3MHSC 5C93A 3SPJA 3DTUB 1YITV 4TSFG 4MVMA 3QNEA 3AG3C 4CBCA 3FB5C 1EZJA 2HR3A 4E2LA 4PDRA 4JTAB 3F7VC 2IJIA 4KFMA 4N21A 2DQ0A 5FL7G 1SZTA 2P67A 1OCOC 3QO5A 4DO2A 2EIKC 4HZ3A 1GM7A 3ABTA 4MVUA 1W0JG 1YJWV 4RQEA 1K4DC 3CCLV 2IJHA 2YEVA 1YI2V 2ZXWC 4R6ZA 5L3BA 2V1DA 3FB7C 3BY6A 2QKSA 1VQ6V 4PA3A 2C2AA 2YEVB 5LGUA 3DGEA 1QCEA 4G27B 4I5SA 3EHBB 1OZ0A 5B1BC 1E79G 1JOYA 1K7DA 1H2GA 5LHHA 3AG2B 1MABG 1BMFG 2GSMB 3X2QC 1YJ9V 2WLLA 3SYPA 3E8FA 2GHYA 5DN6G 1NVPD 1OCCB 4FJCC 1FFTB 3E8GA 2EIKB 1K33A 4Q20A 3RVZA 1S0VA 1PKXA 1V55B 3PJSK 1H8EG 1M56B 3OFNG 4WFHA 1OCZC 4PA6A 1OCRC 1OCOB 1H38A 4TT3G 2EJRA 4QPJA 1R3JC 5H6QA 4XBFA 3ML0A 5B1AC 2QM7A 3GB7C 1K5QA 3ABKB 1V54B 3HB3B 1R3KC 2Y69B 3VBBA 1F51A 3B8NA 3JD2A 3STLC 2JDIG 5B1BB 3OMNB 3SYQA 1W0KG 1JCHA 4WFBV 1DTOA 5BZBA 1YSCA 1NKDA 3K3WA 4RUFA 3K79A 3AG1B 3CCEV 1GMGA 1M9NA 3P32A 4DXWA 1G8MA 1K5SA 1OHHG 3FB8C 2HFEC 4J9YB 2EIJB 1AJPA 3AEIA 4WFEA 2WLNA 1LNQA 1FXHA 5E1AC 3LDDA 1OCZB 1FXVA 4P2ZA 2Q67A 3W7WA 3G6EV 3TETA 2OTLV 1R3LC 1SRYA 1NR1A 4GX2A 1V54C 5IYDO 3CCMV 4UVAA 4QE9A 4U7NA 1NR7A 3ZMTA 1VQLV 1OCRB 3OUFA 2WWWA 3CMAV 2ZXWB 1AI7A 3SPCA 2QE7G 3D3IA 3ASOB 4CZZA 4LCUC 3CCQV 2KB1A 1K97A 2Y69C 3CC4V 2WLLB 4FPPA 4PDVA 3ABLB 2OCCB 2B5UA 1YTFB 2F43G 3LSSA 1DLBA 3E2EA 1N8RW 3LNMB 1NH2B 4QIWF 2LFSA 3AG4C 3OEHG 2W0FC 1GTOA 5LHGA 3G71V 4U7OA 1PNLA 3OGCC 3ABMC 2JJ1G 1YTFD 5CBHA 1K73W 3A0RA 3I56V 2XAHA 3ABKC 1K3EA 3JCZA 3RW0A 3LUTB 2DWEC 1Q7YW 4HAMA 1NBMG 2WLMA 2ZR3A 5LBQA 3CC2V 2Q68A 4GX0A 1SERA 2ZD9A 4MTGA 3ETEA 4WFGA 4GX1A 4MT8A 3CCUV 1VQ4V 2NNUA 2Z3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OR6 C;  4R7C A;  3IFX A;  1J95 A;  3K0G A;  4J9Z B;  5B1B C;  1ORQ C;  2AHZ A;  3FB6 C;  4R50 A;  4XDJ A;  3AG1 C;  5EC2 C;  3X2Q C;  2Q6A A;  2A79 B;  4F4L A;  2WLL A;  3JYC A;  4PDM A;  3SYP A;  3E8F A;  2WLI B;  2HVK C;  3SJQ C;  4MVQ A;  3E8G A;  3SYO A;  3RVZ A;  2WLH A;  3PJS K;  1BL8 A;  4G28 B;  2HVJ C;  2ITD C;  4WFH A;  4X8A A;  1OCZ C;  4PA6 A;  5B3S C;  2WLI A;  1OCR C;  2X6A A;  4P9O A;  3WG7 C;  3T2M A;  3E8H A;  1R3J C;  5CBG A;  4HYO A;  5B1A C;  3ZRS A;  5KUK A;  3E89 A;  1KKD A;  3LDC A;  3EFF K;  3GB7 C;  3ASO C;  5EBW C;  2ITC C;  4X89 A;  3R65 A;  1R3K C;  1M57 C;  3STL C;  5KUM A;  3SYQ A;  4JTC B;  4XDK A;  3SPI A;  3ABL C;  1XL4 A;  2OCC C;  4I9W A;  2AHY A;  4MVR A;  4PA9 A;  4EKW A;  3BEH A;  5BZB A;  2K1E A;  2BOB C;  4RUF A;  3AG2 C;  3RVY A;  5EBM C;  2BOC C;  2ATK C;  3UM7 A;  4JTD B;  4GX5 A;  4QE7 A;  3T1C A;  4DXW A;  5EBL C;  2WLJ A;  3FB8 C;  2HFE C;  4J9Y B;  4QNH B;  3F5W C;  2QTO A;  3HPL C;  1OCC C;  4MW8 A;  4R8C A;  4PDL A;  4WFE A;  3SPH A;  2WLN A;  1LNQ A;  1V55 C;  5E1A C;  3VOU A;  3E86 A;  1XL6 A;  3T4D A;  5J9P C;  3SYC A;  4OXS A;  3LDD A;  3K04 A;  4P2Z A;  4LBE C;  2Q67 A;  4H33 A;  2NLJ C;  3E83 A;  3TET A;  3LDE A;  1R3L C;  1P7B A;  2JK5 C;  4ZBM A;  4P9P A;  4GX2 A;  4MVZ A;  5CBF A;  2R9R B;  4QE9 A;  4BW5 A;  4RO2 A;  3OUF A;  1QLE C;  4RUE A;  4MVO A;  1G4Y B;  4PA4 A;  2DWD C;  3OR7 C;  3SPC A;  3SPG A;  4RAI A;  2EIN C;  3TCU A;  4TWK A;  4LCU C;  3K08 A;  4MSW C;  4UUJ C;  2EIL C;  2KB1 A;  2Y69 C;  2A0L A;  2EIJ C;  2EIM C;  5EC1 C;  2WLL B;  3F7Y C;  4PDV A;  3UKM A;  2DYR C;  4MS2 A;  2P7T C;  2X6B A;  3ASN C;  1K4C C;  1JVM A;  4MW3 A;  4MTF A;  4WFF A;  4X88 A;  1R3I C;  3K0D A;  3LNM B;  4LP8 A;  3SPJ A;  3IGA C;  4MVM A;  4CBC A;  3AG3 C;  3AG4 C;  3FB5 C;  3K03 A;  2W0F C;  3RBZ A;  2A9H A;  4JTA B;  2X6C A;  2HG5 C;  4PDR A;  2Q69 A;  5EK0 A;  3F7V C;  2WLK A;  3K06 A;  4KFM A;  3OGC C;  2H8P C;  3ABM C;  4H37 A;  2IH3 C;  5CBH A;  3T4Z A;  3KG2 A;  4XDL A;  1OCO C;  2DYS C;  3E8B A;  2EIK C;  4HZ3 A;  4PA7 A;  4MVU A;  1ZWI C;  4MVS A;  4MTO A;  2IH1 C;  1K4D C;  2YEV A;  3ABK C;  3RW0 A;  1M56 C;  2HJF C;  2DWE C;  2ZXW C;  3LUT B;  3OUS A;  4R6Z A;  3FB7 C;  2WLM A;  3STZ C;  2Q68 A;  2QKS A;  4GX0 A;  4PA3 A;  2ZD9 A;  5IY5 C;  4P30 A;  1S5H C;  4MTG A;  4WFG A;  4GX1 A;  3SYA A;  4G27 B;  3ZJZ A;  1V54 C; 
#chains in the Genus database with same CATH topology
 1PD3 A;  3OR6 C;  2YSU B;  3K0G A;  1YIJ V;  3HKC B;  1JJO A;  2QR4 A;  1AI5 A;  4DV0 O;  1GM8 A;  4HNA A;  3K5M A;  2WLI B;  4JI8 B;  4DR3 B;  1AVM A;  4WF9 V;  1XMO B;  1HNX O;  3IC7 A;  3CRM A;  5IE9 A;  5JCO C;  3H9V A;  3CCJ V;  1XRE A;  5L3D A;  2QGN A;  4WFA V;  3QO8 A;  4YJ2 A;  2DOS A;  3AG2 C;  1Q82 W;  3UM7 A;  2PUS A;  1Y76 A;  1L1F A;  1WB7 A;  2YC0 A;  4UVB A;  3OW2 U;  3CRR A;  3K9A A;  2GBO A;  4J7J A;  4JI5 O;  1GK9 A;  1MG1 A;  4I50 B;  2UU9 B;  1R1B A;  1D5A A;  2P22 C;  2W0X A;  4PV1 B;  5CA3 A;  1BHA A;  3CRC A;  4JI7 B;  2DQ3 A;  3F5T A;  4DK1 A;  4LFB B;  1I7F A;  2JRI A;  2EIM C;  1P4R A;  3CE2 A;  1WB8 A;  3JSN A;  1DF4 A;  1URF A;  1K92 A;  2L35 A;  2UXD O;  3N2K A;  2ZDI C;  5B1N A;  3OE7 G;  2IH3 C;  3HKB B;  2X7R B;  3JAW A;  2IH1 C;  4LF5 B;  2F66 C;  3OUS A;  3DSQ A;  5DM6 V;  4B08 A;  5FPR A;  1HR0 O;  1FD9 A;  4EEQ A;  1Y6X A;  4QJF B;  3T1H O;  1PM9 A;  1H2N A;  1FAF A;  1KU9 A;  4LF4 O;  1F23 A;  4FFB B;  3W7T A;  2AHZ A;  4ZHQ B;  3ZBH A;  4JYC A;  4X9Q A;  1QVF U;  4X65 O;  2BE3 A;  5KLV H;  1YDX A;  2F95 B;  2VQE B;  5EYP B;  5KHH A;  4P9O A;  2F4V B;  4JPR A;  3ZRS A;  3E89 A;  1IXM A;  1AJQ A;  3T1Y B;  3CWB H;  4BWA A;  1TGO A;  1GKF A;  2O57 A;  2UU9 O;  2EIM B;  2GTS A;  4TV9 B;  3ZRW A;  4DV2 O;  4O4J B;  4FM2 A;  5JH7 B;  1Q3E A;  1Q8I A;  4EB6 B;  3RYC B;  3LSU A;  3DXR B;  1M57 B;  3UO2 A;  3FYI B;  4BW5 A;  1FKA O;  5B66 Z;  4I4T A;  2Z5U A;  3OR7 C;  4JI2 O;  4B3S O;  2Q7E A;  4MSW C;  2ZIM A;  5LGT A;  1BHB A;  1G1X B;  2FB5 A;  1FFX A;  4JZG A;  3ZMS A;  2QWQ B;  4IYH A;  2CGN A;  3KCY A;  3EVK A;  1COW G;  2LGQ A;  3ETD A;  1G6U A;  1S72 V;  2D3O W;  2XAQ A;  3E8B A;  5B1A B;  1S5L Z;  1I08 A;  1WA8 B;  3QTC A;  2BSK A;  4X1Y B;  3ASN B;  4I0X A;  3TGU H;  3TK1 A;  1HNW O;  5IY5 C;  2CE4 A;  4CC5 A;  4TQF A;  1FS0 G;  2F93 B;  1YHQ V;  3ZJZ A;  3IFX A;  3OMA B;  2PY5 A;  2Y4U A;  3JD4 A;  1QBZ A;  3OT7 A;  4LH7 A;  2UUB O;  2N05 A;  3L73 H;  5A2Q N;  5E79 Z;  1ZL8 B;  2ZT9 B;  5CA0 B;  5LA6 A;  4JAA A;  5JWP A;  2WA3 A;  4JAS A;  4CS4 A;  1HNZ B;  5EIB D;  2H3O A;  4U3F H;  5KUK A;  1W59 A;  2YDE A;  1HNZ O;  3CRA A;  3R65 A;  5KX5 A;  1BGY H;  3OM3 B;  3ZRW B;  2UXX A;  4DV1 B;  3N2K B;  3CYO A;  4J7Z A;  5H6R A;  4QNH B;  1I94 B;  4B3T O;  5H9C A;  3HPL C;  1VQK V;  3K5N A;  4YXW G;  2RNB A;  2YI9 A;  5BMV A;  5J9P C;  1JA8 A;  1JFF A;  3HKD A;  3BPZ A;  1IDS A;  4DR5 O;  4YHH O;  3WU2 Z;  2JEX A;  4ZKI A;  2Y48 A;  4RO2 A;  3B77 A;  1NVP B;  2XAS A;  3ETQ A;  3WB1 A;  1B04 A;  4MVO A;  5JVD A;  1HR0 B;  3S3W A;  3CPW U;  2JIZ G;  5L3E A;  5EC1 C;  1WP7 A;  1VQ5 V;  1M4U A;  1Z2G A;  1JVM A;  1WP8 A;  1I94 O;  3GVM A;  4TSF G;  1A32 A;  3A8T A;  4KHP O;  4AI8 A;  4KFM A;  2DQ0 A;  2BSK B;  2P67 A;  3QO5 A;  4DO2 A;  4HZ3 A;  1BT8 A;  3G80 A;  1F7Y A;  4MVU A;  4RQE A;  1K4D C;  4LF6 B;  1SQV H;  2C2A A;  3VQY A;  3DGE A;  1QCE A;  3EHB B;  3H1J H;  4JV5 B;  1E79 G;  4I4T B;  1K7D A;  3GWK C;  3AG2 B;  1MAB G;  1BQ0 A;  2WLL A;  3BAB A;  1YXB A;  3E8F A;  4DR2 O;  3SR2 C;  2ZE7 A;  5DN6 G;  1FFX B;  1FFT B;  3RYH A;  3E8G A;  1US6 A;  1M56 B;  3OFN G;  4WFH A;  4XBF A;  1R3J C;  3G67 A;  1TVK A;  1K5Q A;  2KG7 B;  2QKC A;  2ETN A;  4JI6 B;  4AHC A;  5BZB A;  5LOV B;  3H1L H;  1ZLZ A;  3K79 A;  3AG1 B;  4X64 B;  4DYL A;  4J9Y B;  2EIJ B;  1AJP A;  1MMM A;  2CAZ C;  4I0X B;  2RDC A;  4J11 A;  5E1A C;  3LDD A;  1OCZ B;  1VF6 C;  1P84 F;  4E4E A;  1YVW A;  4NXN B;  1SS3 A;  1KBH A;  2NR5 A;  3QF7 A;  4X66 O;  5KHK A;  2YUA A;  2WWW A;  3CMA V;  3EXA A;  5JH7 A;  1XDC A;  4CC6 A;  3M8A A;  1XNR B;  3CCQ V;  4X66 B;  1K97 A;  1H2L A;  3JAK B;  4FPP A;  1FPO A;  2OCC B;  2UUB B;  2B5U A;  1YTF B;  4BR6 A;  1N8R W;  2KSD A;  3LNM B;  1NH2 B;  2QM4 A;  4EFE A;  3OEH G;  3BHP A;  2W0F C;  5LHG A;  4U7O A;  1SC5 B;  4LFC B;  3L75 H;  1GH6 A;  2PYL A;  2QDO A;  3I56 V;  2XAH A;  3JAT B;  3RW0 A;  1K3E A;  1Q7Y W;  3LUT B;  4NKG B;  3RGB A;  2ZR3 A;  4GX0 A;  1IUR A;  4X65 B;  3B09 A;  4MTG A;  4WFG A;  4GX1 A;  4MT8 A;  3KKY A;  1Z5W A;  3K57 A;  2IU0 A;  4CH3 A;  4DR3 O;  2QSA A;  4IHJ B;  3AG1 C;  4PDM A;  4DR7 O;  1WAZ A;  2WPD G;  2DN9 A;  3SYO A;  2F23 A;  4FLZ A;  1N33 B;  1JPX A;  3UQ8 A;  2CGO A;  1IBK B;  3T2M A;  2ZE5 A;  4HYO A;  5H5N A;  3EFF K;  2NN4 A;  2W6J G;  1N32 O;  2WSS G;  4X62 B;  1WPB A;  1PNM A;  2XOK G;  2FYU H;  3T1C A;  1QR8 A;  2QTO A;  4KUM A;  4I55 B;  4FZ1 A;  3U0Z A;  5C8Y B;  4I50 A;  3JSL A;  4OXS A;  1K8A W;  3BA9 A;  3E83 A;  3WFV A;  4JI7 O;  2AZ0 A;  5BMV B;  1XEQ A;  3FYE B;  5LMU O;  3HKC A;  4LFA O;  2ZNI A;  2BTQ B;  3JD3 A;  1JR9 A;  1ENV A;  2A0L A;  5A9G A;  1TUE B;  3TXS A;  4F6R B;  2IJK A;  4MTF A;  3GWO A;  1R3I C;  2XAF A;  5IY5 B;  1QLN A;  4B3M B;  2EBO A;  4Z1M G;  4OPA A;  4B3T B;  2QWO B;  4NVP A;  3C3T A;  2V4D A;  4LF5 O;  2H8P C;  2A3Q A;  5JQG A;  4XDL A;  5LOV A;  1MSW D;  4ZIB A;  1LUV A;  2MK3 A;  2WAM A;  1BE3 H;  2QM8 A;  4FZ0 A;  4H44 B;  1SQB H;  3AK1 A;  4LF9 B;  2HJF C;  3ZHS A;  3HR0 A;  1YCI A;  2EIL B;  2AGA A;  4JI8 O;  2VWJ A;  3OTF A;  4WBN A;  3SYA A;  4X1K A;  5KAF Z;  1J95 A;  2GDS A;  2LFR A;  3ZED A;  2ZE6 A;  4GLX A;  1THZ A;  3H01 A;  4NB5 A;  1AP6 A;  1Q6U A;  4DRX A;  3BFR A;  3SJQ C;  4IGG A;  4NTX A;  3RFR A;  2HHH B;  2HJD A;  4G28 B;  1EFR G;  1XUQ A;  5BY1 A;  2UUC B;  3E8H A;  3SJC C;  4W4K A;  1PNK A;  3CHX A;  2Y0I A;  1F4N A;  2ITC C;  5LGN A;  4DV5 O;  3OEE G;  1JMK C;  4JTC B;  1KD1 W;  4PA9 A;  3BEH A;  2K1E A;  4ICG A;  5EBM C;  3FFQ A;  1R73 A;  2KG7 A;  2QWP B;  3JD0 A;  4GX5 A;  3M99 B;  1DGS A;  1EBO A;  1OCC C;  4JI0 O;  4JV5 O;  2N04 A;  4FVM A;  1V55 C;  1FYJ A;  1XL6 A;  2Q9L A;  3MD0 A;  3B2E E;  4DV1 O;  1NTM H;  1AP5 A;  4NTY A;  1S3J A;  1VAR A;  3JAM N;  4P9P A;  4UV9 A;  1O9H A;  1SES A;  4FFB A;  2UUC O;  4NXN O;  2HP8 A;  4PA4 A;  2DWD C;  1N0J A;  4F6R A;  4C7U A;  4RAI A;  4B3M O;  2EIN C;  1FXK A;  4NXM O;  4LWS A;  2UXC O;  3JAL B;  2DYR C;  4L87 A;  2VRZ A;  3K58 A;  3CJH B;  2Q0O C;  4ASU G;  4JI3 O;  1IBL O;  2YIA A;  3U10 A;  2KQX A;  1WLE A;  1M1K W;  4IYI A;  2Q7H A;  4YJ3 A;  3IGA C;  2UXC B;  2OCH A;  1S5J A;  2EZP A;  2HG5 C;  5EK0 A;  3S3X A;  2LW1 A;  1VQM V;  1QLE B;  2YS8 A;  1F4M A;  3KG2 A;  1R6N A;  3W7X A;  2PI4 A;  4PA7 A;  3ZMV A;  4UCS A;  4FMT A;  2M7W A;  3THO A;  3L9D A;  1SQF A;  3CCV V;  1NTK H;  4J7K A;  2EIN B;  4B3R B;  1U96 A;  1VIB A;  3W7U A;  2ZR2 A;  1IX9 A;  5LA6 B;  1KP3 A;  4R50 A;  3M7M X;  5IJ0 A;  3ZHT A;  3ETG A;  2Q7G A;  5IT9 N;  3JAR A;  1Y4M A;  4IIJ B;  4F4L A;  2F1M A;  2DYS B;  4FK5 C;  5K1P A;  4FLY A;  3P30 A;  2LQT A;  3B40 A;  2B9Z A;  1NS1 A;  2HVJ C;  1AI4 A;  4LFC O;  5EZY B;  3WG7 C;  5F2V O;  2YI8 A;  4YIP A;  2OCC C;  1SQQ H;  4GZR B;  3PN1 A;  1KP2 A;  1MZF A;  4QE7 A;  4UV8 A;  3F5W C;  2XHB A;  1Y74 A;  1DK1 A;  2BCC H;  1WPX A;  5FNV B;  1WA8 A;  2EX3 A;  4LBE C;  4H33 A;  2NLJ C;  2HLD G;  2X0L A;  1B6Q A;  3ZHV A;  4DR7 B;  3A0B Z;  4QPK A;  4WBN B;  4O4J A;  4B7K A;  5IJ9 B;  4DR5 B;  1NQT A;  3CS5 A;  1UJW B;  3TCU A;  4TWK A;  4JYY A;  1IBM O;  4DR6 B;  3CCR V;  3DC6 A;  1ZL8 A;  1RSO A;  1VQO V;  2UXB O;  3FKS G;  4KL1 A;  1JJ2 U;  2GTA A;  3TXQ A;  4GKJ O;  3RT3 C;  4J42 A;  4ZOL B;  3SPJ A;  1YIT V;  4MVM A;  3AG3 C;  3A2F A;  3FB5 C;  2HR3 A;  2ZCE A;  4E2L A;  4BIO A;  4JTA B;  1N36 O;  2DMX A;  4W4L A;  4FM1 A;  2JS5 A;  2IJI A;  3OTO O;  2PGG A;  4TV8 A;  1OCO C;  3J80 N;  3ABT A;  1BZK A;  5LYJ A;  2IJH A;  2YIB A;  2ZXW C;  2V1D A;  4PJ0 Z;  3BY6 A;  1VQ6 V;  1IBM B;  2YEV B;  4LF9 O;  4H0L B;  4I5S A;  4FLU A;  1JOY A;  3ICX A;  5LHH A;  3SYP A;  3JAL A;  4CH4 A;  2OIG A;  1NVP D;  4FJC C;  2EIK B;  1Q43 A;  3Q4H A;  3L72 H;  1S0V A;  1H8E G;  1VEW A;  2PF4 E;  2AXT Z;  4PI0 A;  1OCZ C;  4YJ3 B;  5FLX N;  1H38 A;  1OCO B;  4TT3 G;  2EJR A;  2QM7 A;  2ARH A;  4JI1 O;  1TUB B;  1V54 B;  1VMG A;  1R3K C;  2Y69 B;  5CA1 A;  2BTO A;  4WFB V;  4JI0 B;  1I0H A;  1YSC A;  4RUF A;  4DV2 B;  3LNN A;  3P32 A;  4DXW A;  1IXB A;  2CUG A;  3FB8 C;  2HFE C;  2KKW A;  2P5O A;  1LNQ A;  1N32 B;  1FXH A;  4LF8 O;  1FXV A;  4P2Z A;  2Q67 A;  3G6E V;  4X1I B;  2XTA A;  2OTL V;  2AZ2 A;  4O2A A;  3FAV B;  4UVA A;  1JFF B;  4U7N A;  1NR7 A;  3HKD B;  1QQC A;  3ZMT A;  1HW7 A;  3OUF A;  2ZXW B;  1AI7 A;  1XBL A;  3SPC A;  2QJ1 A;  5IJ0 B;  2WLL B;  4JI1 B;  3RYH B;  1CXZ B;  4J41 A;  3E22 A;  3E2E A;  4DR4 O;  5EZY A;  5LMN B;  4LWS B;  2LFS A;  3AG4 C;  3RN4 A;  5CB4 B;  4TV8 B;  3N27 A;  4TUY B;  4X20 B;  3G71 V;  4O4L B;  3ABM C;  5CBH A;  1IBK O;  3C3S A;  4YJ2 B;  5DEC A;  5FNV A;  1VF6 A;  1N34 B;  4UCT A;  3P3P A;  4LNU B;  1Y67 A;  1SER A;  2E3C A;  4IHJ A;  2ZD9 A;  4UB8 Z;  2UUA B;  2Z3Y A;  5AG2 A;  3BAA A;  5J2T B;  3Q4H B;  4XDJ A;  1SA0 A;  5EC2 C;  5GTH Z;  4NYK A;  5JJE B;  4MTX A;  1VQ9 V;  2P90 A;  1WJZ A;  4TOI A;  1LR1 A;  3TJT A;  5GTI Z;  4JYA O;  1NT2 B;  3APO A;  2QWN B;  2CH7 A;  1AR1 B;  3LDC A;  1TA8 A;  5BXZ A;  5EBW C;  4DV4 B;  1VQN V;  1VF7 A;  4DR6 O;  1PP9 H;  4AQY B;  2YXH A;  2AHY A;  2CTR A;  3FD9 A;  3RVY A;  1TAE A;  4GYC B;  2ATK C;  3JD1 A;  1R6K A;  2IU3 A;  3CRQ A;  2CTP A;  1HWY A;  4X1I A;  2DYR B;  2IW5 A;  1KYO F;  1AJN A;  1YJN V;  5LYJ B;  3K04 A;  3AK2 A;  4IL6 Z;  2Q73 A;  3AG4 B;  1XMQ O;  1XHX A;  1XHZ A;  4J80 A;  4G2K A;  1QLE C;  4RUE A;  5KMG A;  4D7S A;  1G4Y B;  4B7E A;  4WCE V;  3J81 N;  1L0L H;  2PI5 A;  4UCO A;  2Y4T A;  3CME V;  2ADQ B;  3E22 B;  4ZHQ A;  5IYZ B;  2CTW A;  5IJ9 A;  3F7Y C;  2LJ2 A;  5EIB C;  3KZI Z;  4N23 A;  2X6B A;  1E1Q G;  4GT1 A;  3OMI B;  4DUZ O;  2IBZ H;  1AI6 A;  5CA1 B;  1RSO B;  2ZIO A;  3K03 A;  1KQS U;  2RJZ A;  4NXM B;  3RBZ A;  1NJI W;  2X6C A;  3MAQ A;  2WA4 A;  2HHH O;  4D6T H;  1JQ0 A;  4JGS A;  3K9S A;  4LNU A;  4UFZ A;  2DYS C;  4OX9 O;  4DR1 O;  4JF3 A;  2OWO A;  1VQ8 V;  3SDL A;  4MVS A;  1RPO A;  5HFM A;  1VQ7 V;  3L70 H;  1ZUQ A;  5CN0 A;  3STZ C;  4ZI7 B;  5C8Y A;  3OAA G;  1S5H C;  1SA0 B;  4LF6 O;  3ZIA G;  3QVN A;  4JAU A;  4J9Z B;  1RM1 B;  3NXS A;  3RYC A;  4DV6 O;  1I5X A;  3RWR D;  4MVQ A;  4KHP B;  3B4S A;  3ABU A;  1OV9 A;  1BL8 A;  5KA6 A;  2ITD C;  3JAS A;  2X6A A;  2CK3 G;  3G4S V;  2P4V A;  5L3F A;  3HKE A;  4O4L A;  3IJ4 A;  1S77 D;  2ZM6 B;  4I9W A;  2BOB C;  2XAG A;  4JAV A;  5K1X A;  1M5I A;  1FJG B;  1TUB A;  2WLJ A;  3O9O A;  1QVG U;  4LF8 B;  4R8C A;  4FLV A;  4KXR A;  3E86 A;  3T4D A;  3X2Q B;  2B1I A;  2HKO A;  4ZBM A;  1P7B A;  3AG3 B;  3RYI B;  5JJN B;  5LL6 Y;  5HFL A;  5FPO A;  5H2F Z;  2P6J A;  2QWR B;  2F4V O;  2XT9 A;  2QEX V;  1GRJ A;  4O2A B;  3SPG A;  4UCV A;  5JCO A;  2VQE O;  4UXN A;  5LHI A;  3UKM A;  3NR7 A;  4NR1 A;  4H13 B;  4J10 A;  4X88 A;  1NU1 H;  3K0D A;  1PL4 A;  4LP8 A;  1RPR A;  3K5L A;  2R9I A;  5LP6 A;  3H1I H;  4DV7 O;  5IYC O;  2LW7 A;  2Q69 A;  4K35 A;  2RCV A;  2VWK A;  4BW9 A;  1MZE A;  2W6I G;  5KX5 B;  4H37 A;  2GUZ B;  1NI8 A;  1VP7 A;  1EN4 A;  1EN6 A;  3ZS8 C;  1ZAU A;  4EB6 A;  1X4T A;  2IM9 A;  2E76 B;  4LC1 A;  3CC7 V;  4BAY A;  5TIS Z;  2FKX A;  1SZX A;  3SGI A;  4JYA B;  2A79 B;  4LH6 A;  5KMG B;  3E35 A;  3T1Y O;  4O4H B;  5LMU B;  3CCS V;  1KC8 W;  3HKE B;  4BIU A;  5BR8 B;  3ABM B;  2VQF B;  1HDJ A;  3IC9 A;  5IYB O;  2R9A A;  3ASO C;  4UVC A;  4A5U B;  2ZKO A;  3N2G B;  1M57 C;  2M6Y A;  1K9M W;  1QR9 A;  4GKK B;  1NH2 D;  2IJJ A;  1R6T A;  4FIP C;  4YY3 O;  1M90 W;  4I7Z B;  1M93 A;  3SPH A;  4BIZ A;  4DV5 B;  3B8M A;  1MSD A;  3JCU Z;  4JYB A;  2QA4 V;  2OYQ A;  3WB2 A;  2XND G;  4OX9 B;  4B3S B;  2ZQM A;  2R9R B;  1H8H G;  4O4I B;  1AR5 A;  4U3J A;  4PI2 A;  2UXB B;  2OT5 A;  4UUJ C;  1S76 D;  2EIJ C;  4ZOL A;  3JAS B;  3AG7 A;  1P49 A;  4MW3 A;  1ZSP A;  5B1O A;  1RFY A;  3MHS C;  5IYZ A;  5C93 A;  4YY3 B;  2JGD A;  3OTO B;  3QNE A;  3BVO A;  3K5O A;  3BRC A;  5LXT A;  1HP8 A;  4N21 A;  5FL7 G;  1SZT A;  1O9G A;  4YHH B;  2FL4 A;  2JVD A;  1WN7 A;  2EIK C;  2FML A;  1GM7 A;  2ADP A;  3CCL V;  2YEV A;  4LF4 B;  1YI2 V;  4X64 O;  1SQP H;  2QKS A;  4K0K B;  2CTQ A;  4Q6G A;  1NTZ H;  5D5Q A;  4GUN A;  1YZB A;  1OZ0 A;  1P7G A;  4DW0 A;  1BMF G;  1Q5O A;  4LF7 O;  1OCC B;  5GON B;  1PKX A;  1V55 B;  3PJS K;  2E5L B;  4PA6 A;  1OCR C;  3GB7 C;  1QHT A;  1XMO O;  3HB3 B;  4JI3 B;  1F51 A;  2JDI G;  5B1B B;  1QU7 A;  1NKD A;  3K3W A;  3CCE V;  4O2B A;  3UT5 B;  2RMK B;  1G8M A;  1OHH G;  3T1H B;  4JI6 O;  2WLN A;  4CH5 A;  4EFB A;  2ZE8 A;  3JAT A;  2Q8V A;  3W7W A;  1D2D A;  3TET A;  1R3L C;  1SRY A;  1NR1 A;  2VS0 A;  4DV6 B;  4GX2 A;  5IYD O;  3D36 C;  4QE9 A;  1BQZ A;  2E5L O;  2CDY A;  1VQL V;  1OCR B;  3OGI B;  2QE7 G;  3D3I A;  4FLW A;  1YF2 A;  2F43 G;  5CB4 A;  1DLB A;  4DV7 B;  1MA1 A;  2YIC A;  1EM1 A;  3C90 A;  3G6B A;  3N2G A;  4DR1 B;  1QNM A;  4CS2 A;  3HKB A;  1GTO A;  4FLT A;  1N33 O;  1PNL A;  2LO1 A;  3A0R A;  2DWE C;  4HAM A;  1VF5 B;  1NBM G;  2WLM A;  5LBQ A;  1XIL A;  2Q68 A;  4ABM A;  4JI4 B;  3O65 A;  4DV0 B;  3ETE A;  1VQ4 V;  4U3J B;  1XOU A;  2PTM A;  3MDS A;  4PD4 F;  3FB6 C;  4O4I A;  1L0N H;  2Q6A A;  3JYC A;  3I5D A;  4DR4 B;  2QKA A;  3CB2 A;  4HBN A;  1ARO P;  2EZO A;  3CEI A;  2WLI A;  2B1G A;  5GW7 A;  3BCC H;  3CXC U;  3RYF B;  4LFA B;  1KKD A;  2FTK A;  3IAY A;  4PHZ A;  1N34 O;  1DF5 A;  3H1H H;  2JS3 A;  1XL4 A;  4MVR A;  1JX9 A;  3ZN1 A;  1WNS A;  5LXT B;  3D36 A;  3UCS C;  3VQW A;  5EBL C;  3L71 H;  5JQG B;  1X59 A;  1GN4 A;  4MW8 A;  4GKK O;  4K8Z A;  2DE0 X;  1GN2 A;  1KB9 F;  1CEZ A;  5ITZ A;  4MVZ A;  1NZ6 A;  2P4K A;  2Z0A A;  3SJB C;  1IBL B;  5L3C A;  2ILM A;  5J2T A;  1XMQ B;  3K08 A;  4IT5 A;  1XI1 A;  2YXY A;  4MS2 A;  1YEW A;  3ASN C;  1GN3 A;  1K4C C;  4GCZ A;  5IDJ A;  1KKC A;  2CH7 B;  4Z2W A;  2A9H A;  3WB0 A;  2WLK A;  2ZNJ A;  2JEU A;  2JGD B;  1PPJ H;  1L8D A;  3T4Z A;  4JI5 B;  4X1Y A;  4DW1 A;  1IZ3 A;  3LSQ A;  2ZM6 O;  1V9P A;  3ZRX A;  1ZWI C;  2ZIN A;  5J2U B;  4UCU A;  3ZHU A;  4P30 A;  4LFB O;  3CX5 F;  1ORQ C;  1B3Q A;  3QO7 A;  5KHG A;  3APQ A;  1AB3 A;  4GKJ B;  2HVK C;  5CMU A;  1I5Y A;  3RYF A;  4DUZ B;  1KUQ A;  1BCC H;  1GO3 F;  4X8A A;  1IVS A;  1Q81 W;  4DR2 B;  1XNR O;  3CJH A;  2HEP A;  1GM9 A;  5CBG A;  2Q5Z A;  3ZN0 A;  5B5E Z;  3W7S A;  1LUW A;  3BA8 A;  1J5E B;  3R66 A;  1CP9 A;  4X89 A;  5KUM A;  1W2B U;  3ABL C;  2EJ7 A;  2V7Q G;  2BOC C;  3I55 V;  3CXH F;  5LMN O;  3DC5 A;  4DV3 B;  1MNG A;  3VOU A;  2YID A;  4K3A A;  4RQF A;  1SQG A;  3LDE A;  2JK5 C;  1PV0 A;  4ZI7 A;  4K8X A;  2ZDI A;  5LP6 C;  1SF9 A;  4B3R O;  1EZV H;  3WG7 B;  4DRX B;  4KP4 A;  5CA0 A;  5DED A;  1H2S B;  2ODM A;  2EIL C;  4IIJ A;  1SKV A;  2LP7 A;  3SJA C;  5IWA B;  3D3Q A;  1PL0 A;  1D5N A;  2A7W A;  1Q6I A;  4WFF A;  1BS3 A;  4PEL A;  1KMI Z;  1N0N A;  4D7T A;  2YIB D;  1T5E A;  1E1R G;  1BSM A;  3K06 A;  5KA5 A;  5B3S B;  2Q0A A;  2H94 A;  1SQX H;  4RWU A;  4MTO A;  2LGW A;  4DV4 O;  3CD6 V;  5JJJ B;  1M56 C;  1MOF A;  3VQV A;  2AW9 A;  2G38 A;  2UXN A;  1Y74 B;  1N4C A;  3ZMZ A;  2DW4 A;  4R7C A;  5IWA O;  5ITZ B;  3RYI A;  4O4H A;  4JI4 O;  4F6E A;  3CP1 A;  1FXK B;  2L6L A;  3D8C A;  2QTS A;  2Y0P A;  1J5E O;  2A06 H;  3ZMU A;  1KEC A;  2WLH A;  3K59 A;  5B3S C;  5L3G A;  2JJ2 G;  4X62 O;  3OD4 A;  2P06 A;  4L8J A;  1ZTE A;  4UB6 Z;  5LP6 B;  4XDK A;  3SPI A;  2OIE A;  1SET A;  4EKW A;  1EN5 A;  1RM1 C;  1ZX3 A;  4FLX A;  1K34 A;  4JTD B;  5KHJ A;  1Q86 W;  1H2K A;  3H1K H;  4JZ2 A;  5J2U A;  1Z5V A;  4PDL A;  3ZCC A;  2OTJ V;  2XAJ A;  1FXK C;  2XUM A;  3SYC A;  3ZRV A;  5CBF A;  3MHH C;  1Q90 D;  1UPG A;  1HNX B;  1VQP V;  5BR8 O;  3JAR B;  4HNA B;  4Z1V A;  3P3N A;  1Y66 A;  4DK0 A;  1ROP A;  2RQ6 A;  1CPY A;  5JVD B;  2P7T C;  4OGQ B;  5D5P A;  4AQY O;  1TVK B;  3DTU B;  4CBC A;  1B06 A;  1EZJ A;  5KHI A;  4PDR A;  4FM0 A;  2PYJ A;  3F7V C;  3JAW B;  4TQD A;  1Y76 B;  1HNW B;  3AK3 A;  4AIL C;  1W0J G;  1YJW V;  1GN6 A;  4CS3 A;  4NTW A;  4R6Z A;  5L3B A;  3FB7 C;  1XNQ O;  2GUZ A;  4PA3 A;  4DV3 O;  1XQ8 A;  2K9P A;  5LGU A;  2E74 B;  1RP3 B;  4G27 B;  1XNQ B;  5B1B C;  3J7A U;  1H2G A;  5KAI Z;  1Q6H A;  2GSM B;  3X2Q C;  3FX7 A;  1UFI A;  1YJ9 V;  2GHY A;  3CSX A;  5EYP A;  1K33 A;  4Q20 A;  3RVZ A;  2UUA O;  4LR3 A;  3UO3 A;  2R72 A;  2UXD B;  4LF7 B;  4QPJ A;  5H6Q A;  3ML0 A;  4YIO A;  5B1A C;  4JI2 B;  1U97 A;  4DUY B;  3U11 A;  4O2B B;  3UT5 A;  3ABK B;  3VBB A;  3B8N A;  3STL C;  3JD2 A;  3SYQ A;  3OMN B;  2DJV A;  1W0K G;  1JCH A;  1DTO A;  4I55 A;  2VQF O;  4TUY A;  4X20 A;  1GMG A;  1M9N A;  2EUL A;  1K5S A;  3QG5 A;  4K0K O;  1H2M A;  3AEI A;  4WFE A;  2N74 A;  4I9Q A;  2GV9 A;  2BTQ A;  3CCM V;  2PZS A;  1OJH A;  1AR4 A;  2YXL A;  2JGU A;  3ASO B;  3ZHR A;  4CZZ A;  4LCU C;  1AIL A;  2KB1 A;  2Y69 C;  4UCR A;  3CC4 V;  3KCX A;  4PDV A;  3ABL B;  4DUY O;  3LSS A;  3VQX A;  5GON A;  1FJG O;  3JAK A;  4OPH A;  3A0H Z;  4QIW F;  2RN9 A;  4QGP A;  2E75 B;  3OGC C;  2JJ1 G;  1YTF D;  1K73 W;  2Q4P A;  4CH6 A;  2MW2 B;  2R70 A;  3ABK C;  2D2C B;  3JCZ A;  3L74 H;  4TV9 A;  4X1K B;  1N36 B;  3ZHQ A;  3CC2 V;  3ZX6 A;  4FFK A;  3FAV A;  3DXR A;  3CCU V;  1GAX A;  2NNU A;  1V54 C; 
#chains in the Genus database with same CATH homology
 1PD3 A;  3OR6 C;  2YSU B;  3K0G A;  2IU0 A;  1YIJ V;  3FB6 C;  4XDJ A;  3AG1 C;  1AI5 A;  5EC2 C;  1GM8 A;  4MTX A;  2Q6A A;  3JYC A;  4PDM A;  2WPD G;  2WLI B;  1VQ9 V;  4WF9 V;  2P90 A;  3SYO A;  1ARO P;  2EZO A;  1JPX A;  3IC7 A;  2WLI A;  2B1G A;  5GW7 A;  3T2M A;  1AR1 B;  3CXC U;  4HYO A;  1KKD A;  3LDC A;  2FTK A;  3EFF K;  5EBW C;  3CCJ V;  1DF5 A;  2W6J G;  1VQN V;  5L3D A;  1XL4 A;  2WSS G;  3QO8 A;  2AHY A;  4MVR A;  4WFA V;  1JX9 A;  3ZN1 A;  3AG2 C;  3RVY A;  1Q82 W;  2ATK C;  3JD1 A;  3UM7 A;  3D36 A;  2XOK G;  1PNM A;  1R6K A;  3T1C A;  2IU3 A;  5EBL C;  1HWY A;  1QR8 A;  2QTO A;  1L1F A;  4KUM A;  4MW8 A;  2DYR B;  4UVB A;  2IW5 A;  3OW2 U;  1AJN A;  1YJN V;  3K9A A;  4OXS A;  3K04 A;  1K8A W;  3E83 A;  3WFV A;  1GK9 A;  1MG1 A;  3AG4 B;  1CEZ A;  4MVZ A;  3FYE B;  5CA3 A;  4G2K A;  1QLE C;  4RUE A;  5L3C A;  1G4Y B;  4WCE V;  1BHA A;  2PI5 A;  2DQ3 A;  3CME V;  3K08 A;  3JD3 A;  2A0L A;  1ENV A;  2EIM C;  1TUE B;  3F7Y C;  1P4R A;  4MS2 A;  4N23 A;  2IJK A;  2X6B A;  3ASN C;  1K4C C;  4GCZ A;  4MTF A;  1E1Q G;  3GWO A;  1R3I C;  4GT1 A;  2XAF A;  5IDJ A;  5IY5 B;  3OMI B;  1DF4 A;  1K92 A;  1QLN A;  1AI6 A;  2EBO A;  4Z1M G;  3K03 A;  1KQS U;  3RBZ A;  1NJI W;  2A9H A;  2X6C A;  2WLK A;  2ZDI C;  5B1N A;  2JEU A;  2H8P C;  1JQ0 A;  4JGS A;  3OE7 G;  2IH3 C;  3T4Z A;  4XDL A;  1MSW D;  2DYS C;  2X7R B;  3LSQ A;  4JF3 A;  3ZRX A;  2MK3 A;  1VQ8 V;  1ZWI C;  1RPO A;  2WAM A;  4MVS A;  2IH1 C;  2QM8 A;  2HJF C;  3OUS A;  5DM6 V;  5HFM A;  1VQ7 V;  3STZ C;  5CN0 A;  3OAA G;  4QJF B;  2EIL B;  4P30 A;  1S5H C;  3ZIA G;  1F23 A;  3SYA A;  4JAU A;  3W7T A;  1J95 A;  4J9Z B;  1ORQ C;  2AHZ A;  2LFR A;  1RM1 B;  3NXS A;  1THZ A;  3H01 A;  3QO7 A;  4JYC A;  1I5X A;  1QVF U;  2HVK C;  5CMU A;  3SJQ C;  1I5Y A;  4MVQ A;  3ABU A;  1BL8 A;  4G28 B;  5KA6 A;  2ITD C;  1EFR G;  1GO3 F;  4X8A A;  1Q81 W;  2X6A A;  4P9O A;  3E8H A;  4JPR A;  1GM9 A;  5CBG A;  2CK3 G;  3ZRS A;  3E89 A;  3ZN0 A;  3W7S A;  1PNK A;  1IXM A;  3G4S V;  1F4N A;  5L3F A;  1AJQ A;  2ITC C;  5LGN A;  1CP9 A;  4X89 A;  1S77 D;  3OEE G;  5KUM A;  4JTC B;  1W2B U;  1KD1 W;  3ABL C;  4I9W A;  4PA9 A;  3BEH A;  2K1E A;  2BOB C;  2XAG A;  4JAV A;  2V7Q G;  2BOC C;  5EBM C;  1R73 A;  1GKF A;  3JD0 A;  4GX5 A;  3I55 V;  2WLJ A;  1QVG U;  3M99 B;  2EIM B;  1EBO A;  1OCC C;  3ZRW A;  4R8C A;  1V55 C;  3VOU A;  3E86 A;  1XL6 A;  3T4D A;  3X2Q B;  4RQF A;  2B1I A;  3MD0 A;  2HKO A;  3LDE A;  4ZBM A;  1P7B A;  1S3J A;  2JK5 C;  3AG3 B;  4P9P A;  4UV9 A;  5HFL A;  2ZDI A;  1M57 B;  3FYI B;  4BW5 A;  1SES A;  3WG7 B;  2P6J A;  2QEX V;  4KP4 A;  2DWD C;  4PA4 A;  2Z5U A;  3OR7 C;  3SPG A;  4RAI A;  2EIN C;  4UXN A;  5LHI A;  4MSW C;  1FXK A;  2EIL C;  5LGT A;  1BHB A;  2LP7 A;  3UKM A;  4L87 A;  2DYR C;  1PL0 A;  3ZMS A;  4ASU G;  4WFF A;  4X88 A;  4PEL A;  1M1K W;  1WLE A;  3K0D A;  4LP8 A;  1RPR A;  2R9I A;  3IGA C;  5IYC O;  2EZP A;  1COW G;  3ETD A;  2HG5 C;  5EK0 A;  2Q69 A;  1VQM V;  1S72 V;  2W6I G;  1E1R G;  3K06 A;  2D3O W;  1QLE B;  5KA5 A;  4H37 A;  1F4M A;  5B3S B;  3KG2 A;  2XAQ A;  1R6N A;  3E8B A;  2H94 A;  5B1A B;  3W7X A;  2PI4 A;  4PA7 A;  3ZMV A;  4FMT A;  2M7W A;  4MTO A;  3CD6 V;  3CCV V;  1M56 C;  1MOF A;  2UXN A;  3ZMZ A;  3ASN B;  2EIN B;  3TK1 A;  2DW4 A;  5IY5 C;  1FS0 G;  1YHQ V;  3W7U A;  2ZR2 A;  3ZJZ A;  4R7C A;  3IFX A;  3OMA B;  4LC1 A;  3CC7 V;  4BAY A;  3JD4 A;  1KP3 A;  1QBZ A;  4R50 A;  3CP1 A;  3ETG A;  1FXK B;  1Y4M A;  4F4L A;  2A79 B;  3E35 A;  2DYS B;  4FK5 C;  3P30 A;  3ZMU A;  4JAS A;  1KEC A;  2WLH A;  3CCS V;  2HVJ C;  1KC8 W;  1AI4 A;  4BIU A;  3ABM B;  5B3S C;  5L3G A;  3WG7 C;  5KUK A;  2JJ2 G;  5IYB O;  3ASO C;  4UVC A;  3R65 A;  1M57 C;  4XDK A;  3SPI A;  1K9M W;  2OCC C;  1QR9 A;  1SET A;  3OM3 B;  3ZRW B;  4EKW A;  1RM1 C;  2UXX A;  3CYO A;  1NH2 D;  1K34 A;  2IJJ A;  4JTD B;  5H6R A;  1KP2 A;  4QE7 A;  4UV8 A;  4FIP C;  1Q86 W;  4QNH B;  3F5W C;  1M90 W;  5H9C A;  3HPL C;  1VQK V;  4YXW G;  4PDL A;  3SPH A;  4BIZ A;  1WPX A;  3B8M A;  3ZCC A;  2OTJ V;  4JYB A;  2QA4 V;  2XAJ A;  1FXK C;  5J9P C;  3SYC A;  2XND G;  3ZRV A;  4LBE C;  4H33 A;  2NLJ C;  2HLD G;  2X0L A;  2JEX A;  2ZQM A;  2Y48 A;  4ZKI A;  1B6Q A;  5CBF A;  2R9R B;  3MHH C;  1H8H G;  4QPK A;  1VQP V;  4RO2 A;  3B77 A;  1NVP B;  2XAS A;  4MVO A;  1NQT A;  2OT5 A;  1UJW B;  3CPW U;  1Y66 A;  2JIZ G;  3TCU A;  4TWK A;  4UUJ C;  1S76 D;  1ROP A;  5L3E A;  2EIJ C;  5EC1 C;  1VQ5 V;  3CCR V;  1CPY A;  1VQO V;  2P7T C;  3FKS G;  1JJ2 U;  1JVM A;  4MW3 A;  5B1O A;  3MHS C;  5C93 A;  3SPJ A;  3DTU B;  1YIT V;  4TSF G;  4MVM A;  3QNE A;  3AG3 C;  4CBC A;  3FB5 C;  1EZJ A;  2HR3 A;  4E2L A;  4PDR A;  4JTA B;  3F7V C;  2IJI A;  4KFM A;  4N21 A;  2DQ0 A;  5FL7 G;  1SZT A;  2P67 A;  1OCO C;  3QO5 A;  4DO2 A;  2EIK C;  4HZ3 A;  1GM7 A;  3ABT A;  4MVU A;  1W0J G;  1YJW V;  4RQE A;  1K4D C;  3CCL V;  2IJH A;  2YEV A;  1YI2 V;  2ZXW C;  4R6Z A;  5L3B A;  2V1D A;  3FB7 C;  3BY6 A;  2QKS A;  1VQ6 V;  4PA3 A;  2C2A A;  2YEV B;  5LGU A;  3DGE A;  1QCE A;  4G27 B;  4I5S A;  3EHB B;  1OZ0 A;  5B1B C;  1E79 G;  1JOY A;  1K7D A;  1H2G A;  5LHH A;  3AG2 B;  1MAB G;  1BMF G;  2GSM B;  3X2Q C;  1YJ9 V;  2WLL A;  3SYP A;  3E8F A;  2GHY A;  5DN6 G;  1NVP D;  1OCC B;  4FJC C;  1FFT B;  3E8G A;  2EIK B;  1K33 A;  4Q20 A;  3RVZ A;  1S0V A;  1PKX A;  1V55 B;  3PJS K;  1H8E G;  1M56 B;  3OFN G;  4WFH A;  1OCZ C;  4PA6 A;  1OCR C;  1OCO B;  1H38 A;  4TT3 G;  2EJR A;  4QPJ A;  1R3J C;  5H6Q A;  4XBF A;  3ML0 A;  5B1A C;  2QM7 A;  3GB7 C;  1K5Q A;  3ABK B;  1V54 B;  3HB3 B;  1R3K C;  2Y69 B;  3VBB A;  1F51 A;  3B8N A;  3JD2 A;  3STL C;  2JDI G;  5B1B B;  3OMN B;  3SYQ A;  1W0K G;  1JCH A;  4WFB V;  1DTO A;  5BZB A;  1YSC A;  1NKD A;  3K3W A;  4RUF A;  3K79 A;  3AG1 B;  3CCE V;  1GMG A;  1M9N A;  3P32 A;  4DXW A;  1G8M A;  1K5S A;  1OHH G;  3FB8 C;  2HFE C;  4J9Y B;  2EIJ B;  1AJP A;  3AEI A;  4WFE A;  2WLN A;  1LNQ A;  1FXH A;  5E1A C;  3LDD A;  1OCZ B;  1FXV A;  4P2Z A;  2Q67 A;  3W7W A;  3G6E V;  3TET A;  2OTL V;  1R3L C;  1SRY A;  1NR1 A;  4GX2 A;  1V54 C;  5IYD O;  3CCM V;  4UVA A;  4QE9 A;  4U7N A;  1NR7 A;  3ZMT A;  1VQL V;  1OCR B;  3OUF A;  2WWW A;  3CMA V;  2ZXW B;  1AI7 A;  3SPC A;  2QE7 G;  3D3I A;  3ASO B;  4CZZ A;  4LCU C;  3CCQ V;  2KB1 A;  1K97 A;  2Y69 C;  3CC4 V;  2WLL B;  4FPP A;  4PDV A;  3ABL B;  2OCC B;  2B5U A;  1YTF B;  2F43 G;  3LSS A;  1DLB A;  3E2E A;  1N8R W;  3LNM B;  1NH2 B;  4QIW F;  2LFS A;  3AG4 C;  3OEH G;  2W0F C;  1GTO A;  5LHG A;  3G71 V;  4U7O A;  1PNL A;  3OGC C;  3ABM C;  2JJ1 G;  1YTF D;  5CBH A;  1K73 W;  3A0R A;  3I56 V;  2XAH A;  3ABK C;  1K3E A;  3JCZ A;  3RW0 A;  3LUT B;  2DWE C;  1Q7Y W;  4HAM A;  1NBM G;  2WLM A;  2ZR3 A;  5LBQ A;  3CC2 V;  2Q68 A;  4GX0 A;  1SER A;  2ZD9 A;  4MTG A;  3ETE A;  4WFG A;  4GX1 A;  4MT8 A;  3CCU V;  1VQ4 V;  2NNU A;  2Z3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...