4TT3G

The pathway of binding of the intrinsically disordered mitochondrial inhibitor protein to f1-atpase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
272
structure length
183
Chain Sequence
ATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPASDRGLCGAIHSSVAKQMKSVGDKIRSILHRTHSDQFLTFKEVGRRPPTFGDASVIALELLNSGYRFRSVISYKTQEYSLANIIYYSLKESTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP synthase subunit alpha, mitochondrial
publication title Pathway of binding of the intrinsically disordered mitochondrial inhibitor protein to F1-ATPase.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 60
structure length 183
sequence length 272
ec nomenclature
pdb deposition date 2014-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00231 ATP-synt ATP synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.80 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4tt3G01
3.40.1380.10 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate Kinase; Chain: A, domain 1 4tt3G02
2XOKG 5L3DA 2Z5UA 2X0LA 1OHHG 3OFNG 3OEHG 1EFRG 2UXXA 4UVAA 3ZIAG 2WSSG 4KUMA 4Z1MG 2IW5A 3ZMVA 5LHHA 1W0KG 1NBMG 1W0JG 1COWG 4UVCA 3ABTA 2W6JG 2JDIG 5LHGA 1E1QG 5L3BA 4ASUG 2DW4A 2HKOA 2Z3YA 1FS0G 2XAQA 3OAAG 2JJ2G 1E79G 2V7QG 2Y48A 4CZZA 3ZN0A 4UV8A 2H94A 5DN6G 2XASA 5L3FA 2WPDG 2V1DA 3ZMZA 3ABUA 5H6QA 2XNDG 1E1RG 2XAHA 2CK3G 4UV9A 5FL7G 4UVBA 5LBQA 5LGTA 3ZMUA 1H8HG 3ZN1A 5LGNA 2HLDG 2W6IG 2R9IA 2XAJA 2XAFA 2JIZG 3FKSG 4XBFA 5LGUA 4YXWG 4TSFG 1H8EG 3ZMTA 4BAYA 2UXNA 3OEEG 3OE7G 5L3EA 4UXNA 5L3CA 1MABG 2EJRA 1BMFG 3ZMSA 2JJ1G 2QE7G 2XAGA 5L3GA 5LHIA 2F43G 4TT3G 5H6RA
chains in the Genus database with same CATH superfamily
1I7FA 1OHHG 3N2KA 1OCZB 3N2GA 3TXQA 4J7JA 4KHPO 3IGAC 1O9GA 4MSWC 3BVOA 3SGIA 3U2ZA 1J5EO 4JI8B 1M4UA 1RSOB 1EN5A 1NBMG 3FAVA 1JOYA 1Q86W 2ZE6A 3GVMA 1R3JC 1DK1A 2HJDA 3KCYA 5LYJA 5ITZA 2LGWA 1E0TA 1VF6C 4LCUC 2B9ZA 2UXCO 4IIJA 1JA8A 4I4TB 2QDOA 1CEZA 2HKOA 4FMTA 3C3SA 1SQFA 2AHZA 3K59A 1I5YA 3K58A 4U7NA 2A3QA 1AJQA 1SZTA 3ZRXA 2HEPA 2FYUH 1N33B 1XMQB 1N0NA 4UCRA 3QTCA 5JCOA 3B09A 4FLWA 4D7SA 2VS0A 2EZOA 1GN4A 1YSCA 5EBMC 4C7UA 3CCRV 5IWAO 3R65A 1F3WA 2VGBA 3ZMUA 1U96A 5B5EZ 2B1IA 1ZLZA 2O57A 2K1EA 1S3JA 4RUEA 1H2SB 1VQNV 4WJ8A 1FFXA 4OGQB 2E3CA 4O4JA 3ML0A 2DYSB 4R8CA 3J81N 3OUFA 2N04A 4TOIA 2QKCA 1M90W 4CS2A 3CS5A 1H2GA 5E79Z 3DXRA 4B3RO 1XL4A 4BIUA 2UUAO 3OE7G 4LF7O 1AI6A 1YVWA 4AILC 4NTXA 4JI6B 1SESA 2QE7G 1BE3H 3H1JH 1MSWD 1I0HA 4QJFB 2R9RB 1GM9A 5CA1B 3B4SA 3FB5C 3P3NA 2ZIOA 3ZHQA 2IJKA 1MMMA 4YJ2A 5B1OA 4MW3A 3TJTA 3ZHVA 3L9DA 5JJNB 5LA6A 3DC6A 1N32O 5JJJB 5K1PA 4DR6O 5IYZA 4B2DD 4YJ3A 4TUYA 5LHHA 4X65B 4KP4A 2ZQMA 4X62O 2P5OA 4NXMO 1VP8A 3THOA 4JYCA 3RW0A 4ASUG 4QIWF 1BHBA 1KB9F 4LFAB 1N36O 4TV9B 4RQEA 4X64B 3ZCCA 2Y48A 3BEHA 3JD1A 4JI3B 4MTXA 4I0XB 4BW5A 2ZKOA 3JD0A 3HQNA 1SC5B 3W7UA 3A0RA 4B08A 2A06H 4DV6O 5KUMA 4ZI7A 3M7MX 3EHBB 5KAIZ 4UV9A 4JZ2A 1H2MA 3QV8A 4GT1A 2E76B 3IJ4A 1JFFA 4R6ZA 2WA4A 4RUFA 5LMUO 1LNQA 1K33A 3JATA 4AQYO 2UXBB 1XDCA 1VIBA 1HNXO 1ROPA 5LP6A 3N2GB 1L1FA 1VQ9V 3AG2C 3OEEG 4WFAV 1YJNV 3G80A 3CMEV 1YF2A 4FFKA 1EBOA 3IC9A 3CCVV 3FAVB 1Q6HA 2K9PA 4W4LA 1VQPV 5ITZB 4ZIBA 1FFTB 3ZJZA 4TQDA 1RM1C 2JJ1G 3CCJV 3LDEA 1S76D 3JCUZ 1XNRO 5B3SC 4RWUA 2FL4A 2XOKG 2OT5A 1B06A 3OMNB 1AQFA 2BCCH 1PKNA 3LUTB 3S3XA 3AG1C 3W7SA 1VF6A 3W7TA 2EILC 5KA6A 3S3WA 3ABMC 4W4KA 2IH3C 3VQWA 1JCHA 4JTAB 1MSDA 1FJGB 2ZXWB 4DV7O 2QWRB 2Z0AA 1BGYH 5HFMA 4Z1VA 1K4DC 2X6BA 1VQOV 3RT3C 1WLEA 3WG7B 2FKXA 2LW1A 1FFXB 3ASOB 4O4JB 3QV6A 4FIPC 5DN6G 1KQSU 4DV5B 2ZDIC 2Q7HA 3NXSA 1WB7A 3K9SA 3DXRB 1I94O 1XHZA 4J42A 3ABKC 2XAHA 2F95B 2RMKB 2KB1A 2DMXA 2VQEO 1MOFA 1H8HG 1PKXA 1N8RW 2L6LA 1SQPH 3K5OA 1VF7A 3OW2U 5EK0A 2MK3A 3CMAV 5LGUA 1NVPD 4QGPA 1GK9A 3KTXA 4F4LA 3OR7C 4YJ2B 3ABLB 1UPGA 4JI8O 4H33A 4Q20A 3UT5A 5IYZB 3FFQA 4YJ3B 4J7ZA 4TUYB 5EIBD 3B8NA 3SDLA 1NR7A 4CBCA 5JQGA 1A5UA 2R72A 4GKJB 2LFSA 2X6AA 2D2CB 1EZJA 1OZ0A 1VEWA 1ZWIC 4B3MB 1SF9A 5CBHA 2WSSG 3QV7A 2H8PC 2JEUA 1N33O 2DJVA 4HYOA 1XMQO 3L71H 4CH3A 1IBLB 2EIMB 4IHJA 4UVCA 3VQYA 1L8DA 2D3OW 5KHGA 2ITCC 3RBZA 4ZI7B 4JAUA 3RN4A 3VQVA 2Z3YA 1JFFB 2LGQA 3K79A 5KHHA 3JYCA 2CTPA 2GDSA 1I5XA 4QPJA 1GO3F 3LDCA 2H94A 1Q82W 1E0UA 2FMLA 4IMAA 5LP6B 3AG4B 2ZNJA 1TUBA 2HFEC 2DE0X 4LH7A 2E28A 4X1KA 1JQ0A 1V54C 1YZBA 2LW7A 3JD2A 3CRMA 2B1GA 5LGTA 4DK1A 3ZN1A 4JI6O 3ZX6A 1FYJA 1GKFA 2R9IA 4NXNB 2XAFA 4QG9A 4GX1A 3J80N 1OCRC 2UUBB 1XNQB 3G71V 2G50A 1BCCH 1KP3A 3APOA 1OJHA 5CBGA 4NB5A 4LWSA 1NKDA 2YXHA 3CC7V 1FXKA 2QM4A 5LXTA 2CGNA 3BA9A 3AK3A 3E0WA 5JCOC 1M1KW 4X65O 2RNBA 5L3CA 1NTMH 2ODMA 3QO5A 1YJWV 1Z5VA 2ZXWC 5L3GA 4WFFA 1XQ8A 2F43G 4B7EA 4J11A 3HR0A 4NVPA 5LMNB 4LFAO 3E89A 4X64O 3STZC 2WLNA 1P4RA 2B5UA 1GN3A 4TWKA 1K5SA 3IC7A 3KCXA 4JI3O 3ZRSA 3CRRA 1H2NA 4EB6A 4DV0B 3ABTA 1JMKC 3JAKA 1Q3EA 1OCOC 2UXDB 3CWBH 5EBLC 4DR5B 3T07A 1SERA 4KCUA 3N25A 3K0DA 5EYPA 3MHSC 4I55B 1DGSA 3A8TA 2UXBO 1X59A 3GQYA 1ZUQA 1VQMV 2ZR3A 1IBMB 3ABLC 3ZMZA 2VGIA 1IDSA 4DR7B 3OMIB 4RQFA 2P67A 3UT5B 3NR7A 2PUSA 1ZSPA 3HQPA 2RDCA 2M6YA 1K73W 4DV2B 4DW1A 1QHTA 3HB3B 3G4SV 4UCOA 1YI2V 2YXYA 2PF4E 3BPZA 5JQGB 4HNAA 3ZMTA 5BY1A 4DR1B 3GWKC 2RN9A 2P4KA 3CEIA 1JPXA 1P7GA 2XT9A 3RYIA 3QO7A 3T1HB 2L35A 2EIMC 1Q43A 3QVNA 4O4LB 1G1XB 1US6A 5K1XA 4GUNA 5H2FZ 2XAGA 1GN2A 2WLIB 4LBEC 3L75H 5A2QN 3K5MA 1FJGO 5BMVA 2AHYA 1K92A 3IS4A 3SJAC 2EBOA 4PHZA 3L72H 4JASA 2JS3A 5J9PC 4J9YB 4JPGA 1EFRG 1HNZB 1PNLA 1PNMA 5KAFZ 2YIAA 4UVAA 4Z2WA 3QTGA 2F23A 4QE9A 2QWNB 3ZMVA 4DV5O 5A9GA 3UO2A 1TUBB 2LP7A 4J9ZB 2XTAA 4WFGA 4WFEA 1IX9A 1F4MA 5L3BA 1KKCA 4D7TA 4MVZA 4PA6A 3AG2B 5CA0A 1NQTA 2KKWA 2Q6AA 1EM1A 4FLXA 1ZX3A 2QEXV 3ZN0A 4JPRA 4HYWA 4LF8B 3SJQC 1M56C 4DUZB 2V1DA 4OXSA 1RM1B 1HP8A 4WBNA 4LWSB 4X1IA 3IAYA 1AJPA 3JCZA 1ORQC 5LXTB 5B3SB 4G27B 2BTQA 2PYJA 3TCUA 2CTWA 2JK5C 3F5TA 1R1BA 3E83A 2CE4A 1A32A 4I50A 3AG1B 4I7ZB 2YC0A 3BAAA 3STLC 4YXWG 4GKJO 3G67A 5F2VO 3K04A 2EILB 4IYHA 2ZE5A 4ZBMA 3ABMB 3HPLC 4PI0A 3BHPA 3JAWB 4B3MO 2X6CA 4H44B 1QLNA 2P90A 4JYYA 1DTOA 1IBLO 1YTFB 2PI5A 1VP7A 4EB6B 3A0BZ 1MABG 2YDEA 1WJZA 1Y6XA 2ZR2A 4F6RA 4PELA 3APQA 1DF5A 3JAKB 4ICGA 3O9OA 1WPXA 5IYCO 2RJZA 2X0LA 1WP8A 3T1YB 1NR1A 4P9PA 3B2EE 3A2FA 5EYPB 3IFXA 2Q4PA 3ABKB 5LOVA 1N34B 3H9VA 1M9NA 1Q5OA 2YUAA 3KG2A 3LDDA 3RYCA 4MVQA 3MAQA 1XHXA 4GZRB 1GM8A 3ASNC 1LUVA 4LFCB 1YIJV 5C8YB 5IJ9A 5IYBO 1FS0G 4NXNO 1XREA 3SRDA 1K9MW 2PY5A 4HYVA 1B6QA 3BCCH 2Q7GA 1XBLA 2YIBD 2AZ2A 2ADPA 2UUBO 1XNQO 1F7YA 3HKBB 4PA7A 1WP7A 2WPDG 3E8BA 3RYIB 4B7KA 4MT8A 3OGCC 2GTSA 3C90A 5FL7G 3CCSV 2IH1C 1VF5B 1NJIW 3I5DA 4YIOA 4QGCA 5E1AC 3QNEA 3WB2A 1BL8A 4FM1A 3MHHC 2XAJA 2OYQA 4MVMA 4LF4B 1K5QA 3W7XA 5IY5C 1H8EG 4TQFA 5LMNO 3CXHF 3CXCU 2OWOA 3GR4A 3FD9A 2EZPA 1PPJH 3B40A 4P9OA 4EFBA 2WA3A 1Z5WA 1ENVA 1MZFA 4X88A 4JV5B 1GAXA 4DV0O 1IBKB 4K35A 3CCUV 1Z2GA 1NH2B 4GYCB 3FX7A 2VGGA 2UXDO 3N2KB 4DR5O 5CA0B 1TVKA 1VARA 3E86A 4AI8A 4J7KA 4JYAB 1L0LH 2Q73A 1V54B 1YCIA 4KUMA 2ZD9A 4DYLA 1KUQA 4DV1B 3HKEA 3ZBHA 4LP8A 3F7YC 1IBMO 3RFRA 2QR4A 2DWEC 4WBNB 5LYJB 4XDJA 3H01A 4H0LB 4DR7O 3SRKA 1NH2D 1FXKC 4HAMA 4IIJB 2Q0AA 2BTQB 2ZINA 2CAZC 4MVUA 5KHJA 1OCRB 3MA8A 5GTHZ 5KHIA 3UO3A 4MVSA 5D5PA 3G2GA 4WFHA 4DV2O 3ZS8C 4I50B 1Q8IA 1AI7A 3UM7A 5IE9A 1L0NH 5FNVA 4DR1O 4JYBA 2WWWA 3P30A 1J95A 5L3FA 1SQGA 4L87A 2PZSA 4MW8A 1V9PA 2VWJA 4BR6A 3LSSA 3PP7A 3TETA 2GBOA 3T1HO 2ILMA 2HG5C 2P4VA 2JRIA 5GW7A 4Q6GA 4X1YA 2JS5A 2P06A 2JIZG 1GN6A 4GKKB 5CN0A 5FLXN 3LNNA 3FYEB 3I55V 5GTIZ 4YIPA 3AK2A 1BT8A 4N23A 1HNZO 4O4HA 3SJBC 3ZEDA 1SQBH 4CC5A 2IBZH 1KKDA 3RYCB 1OCOB 5JVDA 5AG2A 5L3EA 2QTSA 3RVYA 3E22A 2R70A 3T4DA 3SPCA 1XMOB 1MA1A 4MS2A 1XUQA 3WB1A 1H2LA 4TT3G 2ZE7A 3D36A 2QWPB 5IJ9B 4NTYA 4CS3A 1H38A 1PV0A 4J80A 2QWQB 4X8AA 2YIDA 5LA6B 1BS3A 1T57A 2VRZA 3CRQA 3T1CA 1S0VA 4LF8O 2X7RB 3RVZA 4YHHB 3DTUB 1VQ5V 2ADQB 2XUMA 2GTAA 4DUZO 2LQTA 1COWG 2OCCC 2BOCC 1YHQV 1NT2B 1H2KA 3ZRWA 2DWDC 4FLVA 3M99B 4OPAA 1R6TA 4KCVA 3AG3C 1PL0A 4PDRA 1R6KA 3OT7A 4JI2B 1YDXA 3EOEA 4WF9V 3OM3B 2PYLA 1PM9A 2P6JA 2RCVA 3A0HZ 4DRXA 3OTOB 1LUWA 5KLVH 2IJHA 1WAZA 1FPOA 3H1KH 1KD1W 2AGAA 1VQKV 2HVJC 5B1AC 4E2LA 2QJ1A 4YY3B 3L74H 4DO2A 3E0VA 4KRZA 3JATB 4DR2B 4P2ZA 4LNUA 4JTDB 4F6EA 1F4NA 1Q81W 5EBWC 2QTOA 4BAYA 5BR8B 1TVKB 3T1YO 1LR1A 4NYKA 1S5LZ 4HBNA 2PTMA 1N34O 3FB6C 4FVMA 4O2BA 3HKEB 5CA3A 3WFVA 4UXNA 1K7DA 1WN7A 2P22C 4PDVA 4LF6B 1F51A 3JAMN 2KG7A 3DSQA 3ZMSA 4K8XA 4EFEA 1IXMA 2OIGA 2BE3A 3ETDA 2ZT9B 1M56B 4LFCO 2P7TC 3OR6C 4O2AA 3SJCC 2GUZA 1S5JA 3AEIA 1KYOF 1K97A 5TISZ 5FNVB 4WCEV 3FB7C 3BJTA 3H1IH 4FM2A 4JTCB 2IJIA 2R9AA 1YXBA 4R50A 2VQFO 4FK5C 4G28B 4JI0B 4FFBA 4FZ0A 2F1MA 1VQ7V 4JZGA 1PKMA 4KCWA 4B3TB 2DW4A 4X1YB 3W7WA 1URFA 2ZM6B 3BABA 1K34A 5FPRA 2JGDA 5CB4A 4LF4O 4PDLA 4FJCC 3I56V 4ZOLA 2BOBC 1IURA 1NTKH 5H9CA 3ZRVA 4PA4A 1HWYA 4LF9B 4O4HB 3JD3A 5KUKA 3GB7C 2EIJB 4BWAA 5JVDB 1E1RG 4JV5O 4PI2A 1R3KC 3E22B 1IBKO 2CDYA 3CHXA 2DYRB 2JGUA 1XILA 2RQ6A 2VWKA 4UUJC 1ZL8A 1QBZA 2EINB 1OCCC 3K03A 4JYAO 4DV4B 4ABMA 3K57A 1N0JA 1HR0B 3ASNB 1Y67A 4JAAA 1VQ6V 1Y74A 4DV1O 4GLXA 4B2DA 3OTFA 2A0LA 4H37A 2HHHB 1TUEB 1KU9A 4XDLA 1B04A 3ZRWB 4RO2A 5IT9N 1XL6A 2F93B 5EZYA 1IZ3A 2YXLA 1M57C 3JSNA 2NR5A 3QO8A 4ZHQA 5KX5A 3SYOA 4K3AA 4DRXB 3UKMA 4FLYA 3K5LA 4FZ1A 4NKGB 3SRHA 1YITV 4IHJB 4GX0A 1T5AA 1MG1A 3AG7A 1AI4A 2YSUB 3JALA 4NTWA 3SYPA 2Y69C 5IY5B 4QG8A 1ZAUA 4X20A 3CC4V 4YNGA 2LFRA 5DECA 4L8JA 4GKKO 4X66B 4LNUB 4U3FH 3K5NA 5IDJA 1GRJA 2QM7A 1Y4MA 1JVMA 2Q9LA 4BIZA 4X1KB 4BIOA 1XI1A 2BSKA 2Y4UA 3CPWU 3KKYA 2Y0IA 4JI5B 4O2BB 1WB8A 4DUYB 1BQZA 2EIKC 2IM9A 5J2UA 4UVBA 5LBQA 2OIEA 2KG7B 1XMOO 2HLDG 2WLKA 3CX5F 4LFBB 4CH6A 3KHDA 2EJ7A 4N21A 1W2BU 3CCQV 1ZTEA 2G38A 4O2AB 1U97A 2GUZB 2MW2B 5EC1C 1YJ9V 5C93A 4NR1A 5LL6Y 1FXKB 1V55C 3Q4HA 2Y4TA 4YHHO 5HFLA 2V4DA 1BZKA 2HR3A 2EJRA 4FFBB 1BMFG 5CBFA 2YEVA 4P30A 4JAVA 4U3JA 3E35A 1A3WA 4DR3B 2JGDB 2ARHA 5CB4B 4JI2O 1F3XA 2W0FC 4JI4B 3T0TA 3CCLV 4QG6A 1K4CC 3ETEA 2YICA 2Q8VA 1KBHA 1QVGU 4ZOLB 3T4ZA 4QNHB 1BHAA 3HQOA 3OTOO 1FXVA 1W0JG 3T2MA 2PI4A 1R3LC 2EIJC 2A9HA 4MTFA 4AHCA 1RPRA 1VMGA 3CRAA 5LHGA 1AR5A 2CTRA 1O9HA 3HKDA 5KHKA 2WLJA 4DV3B 4OX9B 4FXJA 2WAMA 4YY3O 2XAQA 4FPPA 1KP2A 4DR2O 2DYRC 2HVKC 3D36C 1ZJHA 5BR8O 1YTFD 1AR4A 1VQ4V 3FB8C 1ZL8B 1T5EA 2EINC 4PA3A 2KQXA 4PV1B 3RWRD 5H6QA 3X2QB 2LJ2A 3U0ZA 1NU1H 1Y74B 2ZE8A 1BSMA 5IJ0A 1FAFA 3VBBA 3DGEA 1NS1A 1GH6A 2DQ0A 3JD4A 3RGBA 4LF6O 5J2TA 4JI1B 4FLUA 4UCTA 5JWPA 4DR4B 4HNAB 4FXFA 2A79B 3BJFA 5EZYB 4LC1A 3SR2C 2HJFC 3D3IA 2OCCB 3UCSC 2VQFB 5H5NA 4ZHQB 5KX5B 1S5HC 2M7WA 1SRYA 3JARA 2NN4A 3JALB 3K0GA 1JJOA 3AG3B 1B3QA 4GX5A 4JI0O 2AZ0A 5B1BB 5BMVB 1I08A 4EEQA 3L70H 4U7OA 2OCHA 5LHIA 4X20B 4B3TO 2QM8A 4B3SB 4JI7B 2Z5UA 3CCEV 2ZM6O 3O65A 3OFNG 4PA9A 5B66Z 2UXXA 3T05A 5BZBA 4YJ5A 4UCSA 5KA5A 4MVOA 5B1AB 4Z1MG 1PNKA 3K9AA 1IXBA 2YI8A 4LF9O 3F7VC 5GONA 1IVSA 1P84F 3TK1A 2BSKB 1R6NA 1CP9A 1EN4A 3VQXA 2QGNA 2W6JG 2JDIG 4LF5B 1SQQH 2UU9B 2F4VB 1QQCA 4LR3A 5J2UB 4IGGA 1Y76A 3OAAG 2PGGA 1SKVA 4IYIA 1F23A 2V7QG 4CZZA 2DQ3A 2E75B 1Q90D 1YEWA 2KSDA 4O4IA 1TGOA 4X9QA 1A49A 4X1IB 1HNWB 4CC6A 4DV4O 2ZCEA 2VGFA 1G8MA 1OCZC 3ABUA 3H6OA 1HR0O 3Q4HB 2IU3A 4IP7A 2E74B 2EX3A 4CS4A 1Q6UA 1S77D 5LGNA 1Q7YW 1SA0A 2HHHO 2YEVB 4K8ZA 3E8FA 2ITDC 2N74A 2Q67A 3K3WA 3FKSG 1QU7A 3BRCA 4U3JB 4R7CA 4TSFG 2YI9A 5BXZA 1OV9A 1AROP 1PKLA 3ETGA 1JJ2U 3OMAB 3LSUA 2CH7A 4UCUA 3SYAA 3MD0A 3RYFA 1QNMA 4TV8A 2AW9A 2GV9A 4F6RB 3G6EV 1AB3A 3U10A 1NZ6A 2JEXA 4LH6A 3HKCA 3TXSA 3HKDB 1TAEA 3GG8A 5KMGA 5EC2C 1EZVH 4G2KA 2OTJV 3CC2V 3BFRA 1S72V 5LOVB 2CUGA 4X66O 2WLMA 3CE2A 4JGSA 1HDJA 1TA8A 4KCTA 1NVPB 4K0KB 2DYSC 2Q7EA 1VQLV 2Q5ZA 1KMIZ 2DOSA 3X2QC 1FD9A 1P49A 4KL1A 4JI5O 4DUYO 5IJ0B 1G6UA 2A7WA 2E5LB 2UUCB 3B8MA 3WU2Z 3EVKA 3CB2A 5J2TB 2GSMB 1FXHA 1OCCB 3C3TA 1WPBA 3BA8A 3EXAA 2BTOA 4LFBO 3CJHA 4KHPB 2CGOA 2QKSA 3PJSK 1J5EB 5IYDO 3J7AU 3ETQA 4I55A 4PDMA 3R66A 3SPJA 3ME3A 4I5SA 1QCEA 4GCZA 2XNDG 3JARB 2JVDA 3RYHA 3CCMV 2UXCB 1M57B 1RPOA 3LNMB 5B1BC 2QKAA 4OPHA 1D5NA 5JH7A 4FLTA 3QV9A 4JF3A 1NTZH 4DR3O 1CXZB 3CP1A 4MTGA 4JI4O 1AI5A 5B1NA 1AP5A 2Y69B 2Y0PA 3JASA 4G1NA 3TGUH 3SRFA 2QWOB 3QG5A 1M5IA 3U11A 5GONB 5IWAB 1R73A 1SQXH 1P7BA 4UB6Z 4DW0A 2CTQA 3K08A 2FB5A 4O4LA 2OTLV 1GM7A 1AILA 2EULA 1K3EA 1WA8A 1GTOA 2WLIA 1AVMA 1G4YB 4DV3O 4OX9O 3M8AA 5L3DA 5JJEB 1Y76B 1R3IC 1SETA 1UFIA 4CH5A 1QLEB 4QPKA 1SQVH 1VQ8V 4B3RB 4O4IB 2EIKB 2UUAB 4FM0A 2IW5A 2DN9A 4LF7B 1PD3A 2WLLA 3OUSA 1QVFU 4KXRA 2Q69A 1E1QG 2WLHA 3FYIB 2ZIMA 1EN6A 4UFZA 2QA4V 4J10A 2GHYA 4H13B 1HW7A 4KS0A 4MVRA 2FTKA 4BW9A 1SA0B 1KC8W 4JI1O 2N05A 1D2DA 4DR4O 1E79G 3ZHRA 1V55B 3H1LH 1GMGA 1WNSA 3SPGA 1PKYA 4DK0A 1A3XA 3WB0A 1N32B 4E4EA 4I9QA 4KFMA 4DR6B 2ATKC 3AK1A 3CYOA 3UQ8A 1RSOA 3SYQA 4X62B 2CH7B 3E8GA 4IL6Z 4MTOA 1BQ0A 3P3PA 4UCVA 1AP6A 2Q68A 3RYFB 4NXMB 4TV8B 3BY6A 1NI8A 3F5WC 3VOUA 1D5AA 4I4TA 4RPPA 1N36B 1RFYA 4A5UB 3OD4A 3E8HA 2NLJC 3HKCB 4J41A 1XOUA 5FPOA 4B3SO 5KMGB 4JI7O 3SPIA 1Y66A 3H1HH 3ICXA 1THZA 4X89A 3WG7C 3E2EA 3JAWA 3ASOC 4DV6B 1KECA 3LSQA 1M93A 4GX2A 3L73H 4D6TH 1JX9A 1X4TA 2ETNA 4LF5O 1CPYA 2UU9O 2F4VO 4IT5A 4CH4A 1QR9A 5LMUB 5EIBC 5H6RA 4AQYB 3P32A 1HNXB 3OEHG 3CJHB 1SS3A 2ZDIA 2LO1A 3DC5A 3ZIAG 4RAIA 1XEQA 3D8CA 4WFBV 1AJNA 3SYCA 1HNWO 1W0KG 2YIBA 1MZEA 4UB8Z 1AR1B 4DXWA 1DF4A 1N4CA 1PL4A 3RYHB 1UJWB 2QSAA 1K8AW 1XNRB 1PP9H 4FLZA 4QE7A 2IU0A 2W0XA 5CA1A 3PN1A 2JJ2G 2NNUA 3AAGA 5C8YA 1SZXA 2AXTZ 3B77A 5JH7B 4UV8A 1RP3B 1MNGA 2F66C 2XASA 1DLBA 1W59A 1Q6IA 3ZHTA 3HKBA 5DEDA 3JASB 1FKAO 4DRSA 5DM6V 1JR9A 2Q0OC 3CD6V 3JSLA 4DV7B 4HZ3A 2CK3G 5D5QA 2ZNIA 2IJJA 4ZKIA 2W6IG 3KZIZ 3GWOA 4TV9A 3G6BA 1WA8B 4XBFA 4EKWA 2XHBA 4PJ0Z 2H3OA 3K06A 3ZHUA 4I0XA 1QLEC 2UXNA 3EFFK 1I94B 4PD4F 3MDSA 4K0KO 4I9WA 3OGIB 4XDKA 3ZHSA 2HP8A 5LP6C 3AG4C 2VQEB 2WLLB 3D3QA 3N27A 1QR8A 3CRCA 5CMUA 3QF7A 2YS8A 3SPHA 3CSXA 2C2AA 2E5LO 2UUCO
chains in the Genus database with same CATH topology
2Z5UA 3CCEV 2OTLV 1OHHG 3E89A 3OFNG 4PA9A 1H38A 3STZC 1OCZB 2WLNA 1P4RA 2UXXA 3IGAC 2B5UA 4X8AA 4MSWC 5BZBA 4TWKA 1K5SA 3IC7A 3T1CA 5KA5A 1S0VA 2X7RB 4MVOA 5B1AB 3RVZA 3ZRSA 1PNKA 3K9AA 3DTUB 4Z1MG 1VQ5V 3F7VC 1NBMG 3TK1A 1JOYA 1R6NA 1CP9A 1COWG 1Q86W 2OCCC 2BOCC 3ABTA 1R3JC 2W6JG 1YHQV 2JDIG 3ZRWA 2DWDC 4LCUC 1OCOC 3M99B 5EBLC 1CEZA 2HKOA 4FMTA 3AG3C 2AHZA 1PL0A 4PDRA 1I5YA 3OAAG 1SERA 1R6KA 4U7NA 1F23A 2V7QG 4CZZA 2DQ3A 4WF9V 3OM3B 3K0DA 1AJQA 2P6JA 3MHSC 1SZTA 3ZRXA 1VQMV 2IJHA 2ZR3A 1G8MA 3ABLC 1OCZC 3ABUA 2EZOA 3ZMZA 1KD1W 3OMIB 4RQFA 2IU3A 2P67A 1VQKV 2HVJC 1YSCA 5EBMC 5B1AC 3CCRV 4E2LA 3R65A 1S77D 1K73W 3ZMUA 2B1IA 5LGNA 1Q7YW 2YEVB 4DO2A 3E8FA 2K1EA 3HB3B 2ITDC 1S3JA 2Q67A 4RUEA 3G4SV 3K3WA 3FKSG 1YI2V 1VQNV 4P2ZA 4JTDB 4R7CA 4TSFG 1F4NA 1Q81W 3ML0A 2DYSB 3ZMTA 4R8CA 5EBWC 2QTOA 4BAYA 3OUFA 1AROP 3ETGA 1M90W 1JJ2U 3OMAB 1H2GA 1JPXA 3SYAA 1XL4A 4BIUA 3FB6C 3MD0A 3QO7A 3OE7G 5CA3A 3WFVA 2EIMC 1AI6A 4UXNA 1K7DA 4PDVA 3G6EV 1F51A 1SESA 3ZMSA 2QE7G 2XAGA 1IXMA 2WLIB 4LBEC 2JEXA 1MSWD 2AHYA 1K92A 4QJFB 3ETDA 2EBOA 2R9RB 1GM9A 1M56B 4JASA 2P7TC 3FB5C 3OR6C 5J9PC 4J9YB 5EC2C 4G2KA 2OTJV 3AEIA 3CC2V 1EFRG 1S72V 1PNLA 1PNMA 2IJKA 4UVAA 2WLMA 4MW3A 5B1OA 1K97A 4JGSA 4QE9A 1NVPB 4WCEV 3ZMVA 3FB7C 2DYSC 5LHHA 2LP7A 4KP4A 4JTCB 2IJIA 2ZQMA 1VQLV 4J9ZB 4R50A 4FK5C 4G28B 3X2QC 4WFGA 4WFEA 1F4MA 1VQ7V 4JYCA 3RW0A 5L3BA 4ASUG 4QIWF 3B8MA 4MVZA 4PA6A 1BHBA 2DW4A 2GSMB 1FXHA 1OCCB 3W7WA 3AG2B 1NQTA 4RQEA 1K34A 2Q6AA 3ZCCA 2Y48A 3BEHA 2QEXV 3ZN0A 4PDLA 2QKSA 3JD1A 3PJSK 4FJCC 4JPRA 3I56V 4MTXA 2BOBC 3SJQC 4BW5A 5IYDO 5H9CA 3ZRVA 3JD0A 4PA4A 4PDMA 1HWYA 3SPJA 1M56C 4I5SA 3JD3A 3W7UA 3A0RA 5KUKA 2V1DA 4OXSA 1RM1B 3GB7C 1QCEA 2EIJB 1AJPA 3JCZA 1ORQC 4GCZA 2XNDG 1E1RG 5B3SB 5KUMA 4G27B 3CCMV 3EHBB 4UV9A 3TCUA 2JK5C 1M57B 1R3KC 4GT1A 3E83A 1RPOA 3LNMB 5B1BC 4R6ZA 3AG1B 4RUFA 2DYRB 3STLC 4YXWG 1LNQA 1K33A 4UUJC 3K04A 2EILB 4JF3A 4ZBMA 1ROPA 1QBZA 3ABMB 1L1FA 2EINB 1OCCC 1VQ9V 3CP1A 3HPLC 3AG2C 3K03A 4MTGA 3OEEG 1AI5A 5B1NA 2X6CA 4WFAV 1YJNV 2Y69B 1QLNA 3CMEV 2P90A 3ASNB 1EBOA 3CCVV 1VQ6V 1DTOA 1YTFB 1R73A 2PI5A 1P7BA 1MABG 1VQPV 2ZR2A 4PELA 1FFTB 2A0LA 3K08A 4H37A 1TUEB 3ZJZA 1GM7A 1RM1C 4XDLA 2JJ1G 3ZRWB 3CCJV 3LDEA 4RO2A 1DF5A 1S76D 1K3EA 1GTOA 1XL6A 1WPXA 5B3SC 2WLIA 5IYCO 1G4YB 2XOKG 5L3DA 2OT5A 1M57C 2X0LA 3OMNB 1R3IC 1SETA 1NR1A 1QLEB 4P9PA 3LUTB 4QPKA 3QO8A 3IFXA 3SYOA 3ABKB 3AG1C 3UKMA 1VQ8V 2EIKB 1M9NA 3KG2A 3LDDA 3W7SA 2IW5A 1YITV 4GX0A 3W7TA 4MVQA 1MG1A 1AI4A 2EILC 2YSUB 1PD3A 5KA6A 2WLLA 3ABMC 2IH3C 3SYPA 1JCHA 3OUSA 4JTAB 1QVFU 1GM8A 2Q69A 2Y69C 5IY5B 1E1QG 2WLHA 2ZXWB 3FYIB 2QA4V 3ASNC 2GHYA 5HFMA 3CC4V 4MVRA 2FTKA 2LFRA 1K4DC 1YIJV 2X6BA 1KC8W 1VQOV 5IYBO 1FS0G 3WG7B 1WLEA 1K9MW 1B6QA 1E79G 3ASOB 1V55B 1GMGA 3SPGA 4FIPC 5IDJA 5DN6G 1KQSU 2QM7A 4KFMA 2ATKC 1Y4MA 3CYOA 1JVMA 4PA7A 4BIZA 2ZDIC 2WPDG 3NXSA 3SYQA 3E8BA 3CPWU 3E8GA 4MTOA 4MT8A 3OGCC 2Q68A 3ABKC 2XAHA 3BY6A 2EIKC 2KB1A 3F5WC 4UVBA 5FL7G 2IH1C 3VOUA 5LBQA 3CCSV 1MOFA 1NJIW 1H8HG 1PKXA 1N8RW 5E1AC 3QNEA 2HLDG 2WLKA 1BL8A 3MHHC 2XAJA 3OW2U 3E8HA 2NLJC 4MVMA 2MK3A 5EK0A 3CMAV 1K5QA 4N21A 5LGUA 3W7XA 5IY5C 1NVPD 1W2BU 3CCQV 1GK9A 1H8EG 4F4LA 3CXCU 3SPIA 1Y66A 3OR7C 2EZPA 1THZA 4X89A 3ABLB 5EC1C 5C93A 1YJ9V 3WG7C 3E2EA 1FXKB 4P9OA 3ASOC 1V55C 4H33A 1KECA 3LSQA 4Q20A 5HFLA 1ENVA 4X88A 4GX2A 2HR3A 3B8NA 1NR7A 2EJRA 3CCUV 1JX9A 1BMFG 5CBFA 2YEVA 1NH2B 4P30A 1CPYA 4CBCA 4JAVA 1QR9A 3E35A 5H6RA 2LFSA 2X6AA 3P32A 3OEHG 1EZJA 1OZ0A 1ZWIC 3E86A 2ZDIA 2W0FC 3CCLV 1K4CC 3ETEA 3ZIAG 5CBHA 1QVGU 1V54B 2WSSG 4RAIA 3T4ZA 4QNHB 4KUMA 2H8PC 4WFBV 2ZD9A 1AJNA 2JEUA 4HYOA 1BHAA 3SYCA 1W0KG 2EIMB 3F7YC 4LP8A 1FXVA 1W0JG 2DWEC 3T2MA 4UVCA 2PI4A 1R3LC 1AR1B 2D3OW 4XDJA 2EIJC 3H01A 2A9HA 4MTFA 1DF4A 4DXWA 1RPRA 2ITCC 3RBZA 1NH2D 1FXKC 5LHGA 4HAMA 1UJWB 4MVUA 1K8AW 4JAUA 1OCRB 2WLJA 4MVSA 4QE7A 2IU0A 4WFHA 2Z3YA 2WAMA 3K79A 2XAQA 3JYCA 2JJ2G 2NNUA 4FPPA 1KP2A 3AAGA 1I5XA 2DYRC 3B77A 2HVKC 4QPJA 4UV8A 1GO3F 1AI7A 3LDCA 3UM7A 2H94A 1Q82W 1YTFD 1VQ4V 4JYBA 3FB8C 2WWWA 3AG4B 2XASA 1DLBA 1J95A 3P30A 5L3FA 2EINC 4PA3A 2HFEC 4L87A 4MW8A 5H6QA 3LSSA 3X2QB 5DM6V 3CD6V 3TETA 1JQ0A 1V54C 3JD2A 4HZ3A 2B1GA 2CK3G 3VBBA 3DGEA 2HG5C 5LGTA 2DQ0A 3JD4A 3ZN1A 5GW7A 1GKFA 2IJJA 4ZKIA 2W6IG 2R9IA 3GWOA 2XAFA 2JIZG 2A79B 5CN0A 4XBFA 4GX1A 4LC1A 4EKWA 3FYEB 3K06A 3I55V 1OCRC 2HJFC 3G71V 3D3IA 2OCCB 4N23A 1QLEC 2UXNA 3EFFK 1KP3A 5CBGA 1S5HC 2M7WA 1NKDA 1SRYA 1KKDA 3CC7V 1OCOB 1FXKA 4I9WA 4XDKA 1M1KW 5L3EA 3K0GA 3RVYA 5L3CA 3AG4C 2WLLB 3AG3B 4GX5A 3T4DA 3SPCA 1QR8A 5CMUA 3QO5A 5B1BB 4MS2A 3SPHA 1YJWV 4U7OA 2C2AA 2ZXWC 5L3GA 5LHIA 4WFFA 2F43G 4TT3G 3D36A 2QM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XOK G;  5L3D A;  2Z5U A;  2X0L A;  1OHH G;  3OFN G;  3OEH G;  1EFR G;  2UXX A;  4UVA A;  3ZIA G;  2WSS G;  4KUM A;  4Z1M G;  2IW5 A;  3ZMV A;  5LHH A;  1W0K G;  1NBM G;  1W0J G;  1COW G;  4UVC A;  3ABT A;  2W6J G;  2JDI G;  5LHG A;  1E1Q G;  5L3B A;  4ASU G;  2DW4 A;  2HKO A;  2Z3Y A;  1FS0 G;  2XAQ A;  3OAA G;  2JJ2 G;  1E79 G;  2V7Q G;  2Y48 A;  4CZZ A;  3ZN0 A;  4UV8 A;  2H94 A;  5DN6 G;  2XAS A;  5L3F A;  2WPD G;  2V1D A;  3ZMZ A;  3ABU A;  5H6Q A;  2XND G;  1E1R G;  2XAH A;  2CK3 G;  4UV9 A;  5FL7 G;  4UVB A;  5LBQ A;  5LGT A;  3ZMU A;  1H8H G;  3ZN1 A;  5LGN A;  2HLD G;  2W6I G;  2R9I A;  2XAJ A;  2XAF A;  2JIZ G;  3FKS G;  4XBF A;  5LGU A;  4YXW G;  4TSF G;  1H8E G;  3ZMT A;  4BAY A;  2UXN A;  3OEE G;  3OE7 G;  5L3E A;  4UXN A;  5L3C A;  1MAB G;  2EJR A;  1BMF G;  3ZMS A;  2JJ1 G;  2QE7 G;  2XAG A;  5L3G A;  5LHI A;  2F43 G;  4TT3 G;  5H6R A; 
#chains in the Genus database with same CATH topology
 1I7F A;  1OHH G;  3N2K A;  1OCZ B;  3N2G A;  3TXQ A;  4J7J A;  4KHP O;  3IGA C;  1O9G A;  4MSW C;  3BVO A;  3SGI A;  3U2Z A;  1J5E O;  4JI8 B;  1M4U A;  1RSO B;  1EN5 A;  1NBM G;  3FAV A;  1JOY A;  1Q86 W;  2ZE6 A;  3GVM A;  1R3J C;  1DK1 A;  2HJD A;  3KCY A;  5LYJ A;  5ITZ A;  2LGW A;  1E0T A;  1VF6 C;  4LCU C;  2B9Z A;  2UXC O;  4IIJ A;  1JA8 A;  4I4T B;  2QDO A;  1CEZ A;  2HKO A;  4FMT A;  3C3S A;  1SQF A;  2AHZ A;  3K59 A;  1I5Y A;  3K58 A;  4U7N A;  2A3Q A;  1AJQ A;  1SZT A;  3ZRX A;  2HEP A;  2FYU H;  1N33 B;  1XMQ B;  1N0N A;  4UCR A;  3QTC A;  5JCO A;  3B09 A;  4FLW A;  4D7S A;  2VS0 A;  2EZO A;  1GN4 A;  1YSC A;  5EBM C;  4C7U A;  3CCR V;  5IWA O;  3R65 A;  1F3W A;  2VGB A;  3ZMU A;  1U96 A;  5B5E Z;  2B1I A;  1ZLZ A;  2O57 A;  2K1E A;  1S3J A;  4RUE A;  1H2S B;  1VQN V;  4WJ8 A;  1FFX A;  4OGQ B;  2E3C A;  4O4J A;  3ML0 A;  2DYS B;  4R8C A;  3J81 N;  3OUF A;  2N04 A;  4TOI A;  2QKC A;  1M90 W;  4CS2 A;  3CS5 A;  1H2G A;  5E79 Z;  3DXR A;  4B3R O;  1XL4 A;  4BIU A;  2UUA O;  3OE7 G;  4LF7 O;  1AI6 A;  1YVW A;  4AIL C;  4NTX A;  4JI6 B;  1SES A;  2QE7 G;  1BE3 H;  3H1J H;  1MSW D;  1I0H A;  4QJF B;  2R9R B;  1GM9 A;  5CA1 B;  3B4S A;  3FB5 C;  3P3N A;  2ZIO A;  3ZHQ A;  2IJK A;  1MMM A;  4YJ2 A;  5B1O A;  4MW3 A;  3TJT A;  3ZHV A;  3L9D A;  5JJN B;  5LA6 A;  3DC6 A;  1N32 O;  5JJJ B;  5K1P A;  4DR6 O;  5IYZ A;  4B2D D;  4YJ3 A;  4TUY A;  5LHH A;  4X65 B;  4KP4 A;  2ZQM A;  4X62 O;  2P5O A;  4NXM O;  1VP8 A;  3THO A;  4JYC A;  3RW0 A;  4ASU G;  4QIW F;  1BHB A;  1KB9 F;  4LFA B;  1N36 O;  4TV9 B;  4RQE A;  4X64 B;  3ZCC A;  2Y48 A;  3BEH A;  3JD1 A;  4JI3 B;  4MTX A;  4I0X B;  4BW5 A;  2ZKO A;  3JD0 A;  3HQN A;  1SC5 B;  3W7U A;  3A0R A;  4B08 A;  2A06 H;  4DV6 O;  5KUM A;  4ZI7 A;  3M7M X;  3EHB B;  5KAI Z;  4UV9 A;  4JZ2 A;  1H2M A;  3QV8 A;  4GT1 A;  2E76 B;  3IJ4 A;  1JFF A;  4R6Z A;  2WA4 A;  4RUF A;  5LMU O;  1LNQ A;  1K33 A;  3JAT A;  4AQY O;  2UXB B;  1XDC A;  1VIB A;  1HNX O;  1ROP A;  5LP6 A;  3N2G B;  1L1F A;  1VQ9 V;  3AG2 C;  3OEE G;  4WFA V;  1YJN V;  3G80 A;  3CME V;  1YF2 A;  4FFK A;  1EBO A;  3IC9 A;  3CCV V;  3FAV B;  1Q6H A;  2K9P A;  4W4L A;  1VQP V;  5ITZ B;  4ZIB A;  1FFT B;  3ZJZ A;  4TQD A;  1RM1 C;  2JJ1 G;  3CCJ V;  3LDE A;  1S76 D;  3JCU Z;  1XNR O;  5B3S C;  4RWU A;  2FL4 A;  2XOK G;  2OT5 A;  1B06 A;  3OMN B;  1AQF A;  2BCC H;  1PKN A;  3LUT B;  3S3X A;  3AG1 C;  3W7S A;  1VF6 A;  3W7T A;  2EIL C;  5KA6 A;  3S3W A;  3ABM C;  4W4K A;  2IH3 C;  3VQW A;  1JCH A;  4JTA B;  1MSD A;  1FJG B;  2ZXW B;  4DV7 O;  2QWR B;  2Z0A A;  1BGY H;  5HFM A;  4Z1V A;  1K4D C;  2X6B A;  1VQO V;  3RT3 C;  1WLE A;  3WG7 B;  2FKX A;  2LW1 A;  1FFX B;  3ASO B;  4O4J B;  3QV6 A;  4FIP C;  5DN6 G;  1KQS U;  4DV5 B;  2ZDI C;  2Q7H A;  3NXS A;  1WB7 A;  3K9S A;  3DXR B;  1I94 O;  1XHZ A;  4J42 A;  3ABK C;  2XAH A;  2F95 B;  2RMK B;  2KB1 A;  2DMX A;  2VQE O;  1MOF A;  1H8H G;  1PKX A;  1N8R W;  2L6L A;  1SQP H;  3K5O A;  1VF7 A;  3OW2 U;  5EK0 A;  2MK3 A;  3CMA V;  5LGU A;  1NVP D;  4QGP A;  1GK9 A;  3KTX A;  4F4L A;  3OR7 C;  4YJ2 B;  3ABL B;  1UPG A;  4JI8 O;  4H33 A;  4Q20 A;  3UT5 A;  5IYZ B;  3FFQ A;  4YJ3 B;  4J7Z A;  4TUY B;  5EIB D;  3B8N A;  3SDL A;  1NR7 A;  4CBC A;  5JQG A;  1A5U A;  2R72 A;  4GKJ B;  2LFS A;  2X6A A;  2D2C B;  1EZJ A;  1OZ0 A;  1VEW A;  1ZWI C;  4B3M B;  1SF9 A;  5CBH A;  2WSS G;  3QV7 A;  2H8P C;  2JEU A;  1N33 O;  2DJV A;  4HYO A;  1XMQ O;  3L71 H;  4CH3 A;  1IBL B;  2EIM B;  4IHJ A;  4UVC A;  3VQY A;  1L8D A;  2D3O W;  5KHG A;  2ITC C;  3RBZ A;  4ZI7 B;  4JAU A;  3RN4 A;  3VQV A;  2Z3Y A;  1JFF B;  2LGQ A;  3K79 A;  5KHH A;  3JYC A;  2CTP A;  2GDS A;  1I5X A;  4QPJ A;  1GO3 F;  3LDC A;  2H94 A;  1Q82 W;  1E0U A;  2FML A;  4IMA A;  5LP6 B;  3AG4 B;  2ZNJ A;  1TUB A;  2HFE C;  2DE0 X;  4LH7 A;  2E28 A;  4X1K A;  1JQ0 A;  1V54 C;  1YZB A;  2LW7 A;  3JD2 A;  3CRM A;  2B1G A;  5LGT A;  4DK1 A;  3ZN1 A;  4JI6 O;  3ZX6 A;  1FYJ A;  1GKF A;  2R9I A;  4NXN B;  2XAF A;  4QG9 A;  4GX1 A;  3J80 N;  1OCR C;  2UUB B;  1XNQ B;  3G71 V;  2G50 A;  1BCC H;  1KP3 A;  3APO A;  1OJH A;  5CBG A;  4NB5 A;  4LWS A;  1NKD A;  2YXH A;  3CC7 V;  1FXK A;  2QM4 A;  5LXT A;  2CGN A;  3BA9 A;  3AK3 A;  3E0W A;  5JCO C;  1M1K W;  4X65 O;  2RNB A;  5L3C A;  1NTM H;  2ODM A;  3QO5 A;  1YJW V;  1Z5V A;  2ZXW C;  5L3G A;  4WFF A;  1XQ8 A;  2F43 G;  4B7E A;  4J11 A;  3HR0 A;  4NVP A;  5LMN B;  4LFA O;  3E89 A;  4X64 O;  3STZ C;  2WLN A;  1P4R A;  2B5U A;  1GN3 A;  4TWK A;  1K5S A;  3IC7 A;  3KCX A;  4JI3 O;  3ZRS A;  3CRR A;  1H2N A;  4EB6 A;  4DV0 B;  3ABT A;  1JMK C;  3JAK A;  1Q3E A;  1OCO C;  2UXD B;  3CWB H;  5EBL C;  4DR5 B;  3T07 A;  1SER A;  4KCU A;  3N25 A;  3K0D A;  5EYP A;  3MHS C;  4I55 B;  1DGS A;  3A8T A;  2UXB O;  1X59 A;  3GQY A;  1ZUQ A;  1VQM V;  2ZR3 A;  1IBM B;  3ABL C;  3ZMZ A;  2VGI A;  1IDS A;  4DR7 B;  3OMI B;  4RQF A;  2P67 A;  3UT5 B;  3NR7 A;  2PUS A;  1ZSP A;  3HQP A;  2RDC A;  2M6Y A;  1K73 W;  4DV2 B;  4DW1 A;  1QHT A;  3HB3 B;  3G4S V;  4UCO A;  1YI2 V;  2YXY A;  2PF4 E;  3BPZ A;  5JQG B;  4HNA A;  3ZMT A;  5BY1 A;  4DR1 B;  3GWK C;  2RN9 A;  2P4K A;  3CEI A;  1JPX A;  1P7G A;  2XT9 A;  3RYI A;  3QO7 A;  3T1H B;  2L35 A;  2EIM C;  1Q43 A;  3QVN A;  4O4L B;  1G1X B;  1US6 A;  5K1X A;  4GUN A;  5H2F Z;  2XAG A;  1GN2 A;  2WLI B;  4LBE C;  3L75 H;  5A2Q N;  3K5M A;  1FJG O;  5BMV A;  2AHY A;  1K92 A;  3IS4 A;  3SJA C;  2EBO A;  4PHZ A;  3L72 H;  4JAS A;  2JS3 A;  5J9P C;  4J9Y B;  4JPG A;  1EFR G;  1HNZ B;  1PNL A;  1PNM A;  5KAF Z;  2YIA A;  4UVA A;  4Z2W A;  3QTG A;  2F23 A;  4QE9 A;  2QWN B;  3ZMV A;  4DV5 O;  5A9G A;  3UO2 A;  1TUB B;  2LP7 A;  4J9Z B;  2XTA A;  4WFG A;  4WFE A;  1IX9 A;  1F4M A;  5L3B A;  1KKC A;  4D7T A;  4MVZ A;  4PA6 A;  3AG2 B;  5CA0 A;  1NQT A;  2KKW A;  2Q6A A;  1EM1 A;  4FLX A;  1ZX3 A;  2QEX V;  3ZN0 A;  4JPR A;  4HYW A;  4LF8 B;  3SJQ C;  1M56 C;  4DUZ B;  2V1D A;  4OXS A;  1RM1 B;  1HP8 A;  4WBN A;  4LWS B;  4X1I A;  3IAY A;  1AJP A;  3JCZ A;  1ORQ C;  5LXT B;  5B3S B;  4G27 B;  2BTQ A;  2PYJ A;  3TCU A;  2CTW A;  2JK5 C;  3F5T A;  1R1B A;  3E83 A;  2CE4 A;  1A32 A;  4I50 A;  3AG1 B;  4I7Z B;  2YC0 A;  3BAA A;  3STL C;  4YXW G;  4GKJ O;  3G67 A;  5F2V O;  3K04 A;  2EIL B;  4IYH A;  2ZE5 A;  4ZBM A;  3ABM B;  3HPL C;  4PI0 A;  3BHP A;  3JAW B;  4B3M O;  2X6C A;  4H44 B;  1QLN A;  2P90 A;  4JYY A;  1DTO A;  1IBL O;  1YTF B;  2PI5 A;  1VP7 A;  4EB6 B;  3A0B Z;  1MAB G;  2YDE A;  1WJZ A;  1Y6X A;  2ZR2 A;  4F6R A;  4PEL A;  3APQ A;  1DF5 A;  3JAK B;  4ICG A;  3O9O A;  1WPX A;  5IYC O;  2RJZ A;  2X0L A;  1WP8 A;  3T1Y B;  1NR1 A;  4P9P A;  3B2E E;  3A2F A;  5EYP B;  3IFX A;  2Q4P A;  3ABK B;  5LOV A;  1N34 B;  3H9V A;  1M9N A;  1Q5O A;  2YUA A;  3KG2 A;  3LDD A;  3RYC A;  4MVQ A;  3MAQ A;  1XHX A;  4GZR B;  1GM8 A;  3ASN C;  1LUV A;  4LFC B;  1YIJ V;  5C8Y B;  5IJ9 A;  5IYB O;  1FS0 G;  4NXN O;  1XRE A;  3SRD A;  1K9M W;  2PY5 A;  4HYV A;  1B6Q A;  3BCC H;  2Q7G A;  1XBL A;  2YIB D;  2AZ2 A;  2ADP A;  2UUB O;  1XNQ O;  1F7Y A;  3HKB B;  4PA7 A;  1WP7 A;  2WPD G;  3E8B A;  3RYI B;  4B7K A;  4MT8 A;  3OGC C;  2GTS A;  3C90 A;  5FL7 G;  3CCS V;  2IH1 C;  1VF5 B;  1NJI W;  3I5D A;  4YIO A;  4QGC A;  5E1A C;  3QNE A;  3WB2 A;  1BL8 A;  4FM1 A;  3MHH C;  2XAJ A;  2OYQ A;  4MVM A;  4LF4 B;  1K5Q A;  3W7X A;  5IY5 C;  1H8E G;  4TQF A;  5LMN O;  3CXH F;  3CXC U;  2OWO A;  3GR4 A;  3FD9 A;  2EZP A;  1PPJ H;  3B40 A;  4P9O A;  4EFB A;  2WA3 A;  1Z5W A;  1ENV A;  1MZF A;  4X88 A;  4JV5 B;  1GAX A;  4DV0 O;  1IBK B;  4K35 A;  3CCU V;  1Z2G A;  1NH2 B;  4GYC B;  3FX7 A;  2VGG A;  2UXD O;  3N2K B;  4DR5 O;  5CA0 B;  1TVK A;  1VAR A;  3E86 A;  4AI8 A;  4J7K A;  4JYA B;  1L0L H;  2Q73 A;  1V54 B;  1YCI A;  4KUM A;  2ZD9 A;  4DYL A;  1KUQ A;  4DV1 B;  3HKE A;  3ZBH A;  4LP8 A;  3F7Y C;  1IBM O;  3RFR A;  2QR4 A;  2DWE C;  4WBN B;  5LYJ B;  4XDJ A;  3H01 A;  4H0L B;  4DR7 O;  3SRK A;  1NH2 D;  1FXK C;  4HAM A;  4IIJ B;  2Q0A A;  2BTQ B;  2ZIN A;  2CAZ C;  4MVU A;  5KHJ A;  1OCR B;  3MA8 A;  5GTH Z;  5KHI A;  3UO3 A;  4MVS A;  5D5P A;  3G2G A;  4WFH A;  4DV2 O;  3ZS8 C;  4I50 B;  1Q8I A;  1AI7 A;  3UM7 A;  5IE9 A;  1L0N H;  5FNV A;  4DR1 O;  4JYB A;  2WWW A;  3P30 A;  1J95 A;  5L3F A;  1SQG A;  4L87 A;  2PZS A;  4MW8 A;  1V9P A;  2VWJ A;  4BR6 A;  3LSS A;  3PP7 A;  3TET A;  2GBO A;  3T1H O;  2ILM A;  2HG5 C;  2P4V A;  2JRI A;  5GW7 A;  4Q6G A;  4X1Y A;  2JS5 A;  2P06 A;  2JIZ G;  1GN6 A;  4GKK B;  5CN0 A;  5FLX N;  3LNN A;  3FYE B;  3I55 V;  5GTI Z;  4YIP A;  3AK2 A;  1BT8 A;  4N23 A;  1HNZ O;  4O4H A;  3SJB C;  3ZED A;  1SQB H;  4CC5 A;  2IBZ H;  1KKD A;  3RYC B;  1OCO B;  5JVD A;  5AG2 A;  5L3E A;  2QTS A;  3RVY A;  3E22 A;  2R70 A;  3T4D A;  3SPC A;  1XMO B;  1MA1 A;  4MS2 A;  1XUQ A;  3WB1 A;  1H2L A;  4TT3 G;  2ZE7 A;  3D36 A;  2QWP B;  5IJ9 B;  4NTY A;  4CS3 A;  1H38 A;  1PV0 A;  4J80 A;  2QWQ B;  4X8A A;  2YID A;  5LA6 B;  1BS3 A;  1T57 A;  2VRZ A;  3CRQ A;  3T1C A;  1S0V A;  4LF8 O;  2X7R B;  3RVZ A;  4YHH B;  3DTU B;  1VQ5 V;  2ADQ B;  2XUM A;  2GTA A;  4DUZ O;  2LQT A;  1COW G;  2OCC C;  2BOC C;  1YHQ V;  1NT2 B;  1H2K A;  3ZRW A;  2DWD C;  4FLV A;  3M99 B;  4OPA A;  1R6T A;  4KCV A;  3AG3 C;  1PL0 A;  4PDR A;  1R6K A;  3OT7 A;  4JI2 B;  1YDX A;  3EOE A;  4WF9 V;  3OM3 B;  2PYL A;  1PM9 A;  2P6J A;  2RCV A;  3A0H Z;  4DRX A;  3OTO B;  1LUW A;  5KLV H;  2IJH A;  1WAZ A;  1FPO A;  3H1K H;  1KD1 W;  2AGA A;  1VQK V;  2HVJ C;  5B1A C;  4E2L A;  2QJ1 A;  4YY3 B;  3L74 H;  4DO2 A;  3E0V A;  4KRZ A;  3JAT B;  4DR2 B;  4P2Z A;  4LNU A;  4JTD B;  4F6E A;  1F4N A;  1Q81 W;  5EBW C;  2QTO A;  4BAY A;  5BR8 B;  1TVK B;  3T1Y O;  1LR1 A;  4NYK A;  1S5L Z;  4HBN A;  2PTM A;  1N34 O;  3FB6 C;  4FVM A;  4O2B A;  3HKE B;  5CA3 A;  3WFV A;  4UXN A;  1K7D A;  1WN7 A;  2P22 C;  4PDV A;  4LF6 B;  1F51 A;  3JAM N;  2KG7 A;  3DSQ A;  3ZMS A;  4K8X A;  4EFE A;  1IXM A;  2OIG A;  2BE3 A;  3ETD A;  2ZT9 B;  1M56 B;  4LFC O;  2P7T C;  3OR6 C;  4O2A A;  3SJC C;  2GUZ A;  1S5J A;  3AEI A;  1KYO F;  1K97 A;  5TIS Z;  5FNV B;  4WCE V;  3FB7 C;  3BJT A;  3H1I H;  4FM2 A;  4JTC B;  2IJI A;  2R9A A;  1YXB A;  4R50 A;  2VQF O;  4FK5 C;  4G28 B;  4JI0 B;  4FFB A;  4FZ0 A;  2F1M A;  1VQ7 V;  4JZG A;  1PKM A;  4KCW A;  4B3T B;  2DW4 A;  4X1Y B;  3W7W A;  1URF A;  2ZM6 B;  3BAB A;  1K34 A;  5FPR A;  2JGD A;  5CB4 A;  4LF4 O;  4PDL A;  4FJC C;  3I56 V;  4ZOL A;  2BOB C;  1IUR A;  1NTK H;  5H9C A;  3ZRV A;  4PA4 A;  1HWY A;  4LF9 B;  4O4H B;  3JD3 A;  5KUK A;  3GB7 C;  2EIJ B;  4BWA A;  5JVD B;  1E1R G;  4JV5 O;  4PI2 A;  1R3K C;  3E22 B;  1IBK O;  2CDY A;  3CHX A;  2DYR B;  2JGU A;  1XIL A;  2RQ6 A;  2VWK A;  4UUJ C;  1ZL8 A;  1QBZ A;  2EIN B;  1OCC C;  3K03 A;  4JYA O;  4DV4 B;  4ABM A;  3K57 A;  1N0J A;  1HR0 B;  3ASN B;  1Y67 A;  4JAA A;  1VQ6 V;  1Y74 A;  4DV1 O;  4GLX A;  4B2D A;  3OTF A;  2A0L A;  4H37 A;  2HHH B;  1TUE B;  1KU9 A;  4XDL A;  1B04 A;  3ZRW B;  4RO2 A;  5IT9 N;  1XL6 A;  2F93 B;  5EZY A;  1IZ3 A;  2YXL A;  1M57 C;  3JSN A;  2NR5 A;  3QO8 A;  4ZHQ A;  5KX5 A;  3SYO A;  4K3A A;  4DRX B;  3UKM A;  4FLY A;  3K5L A;  4FZ1 A;  4NKG B;  3SRH A;  1YIT V;  4IHJ B;  4GX0 A;  1T5A A;  1MG1 A;  3AG7 A;  1AI4 A;  2YSU B;  3JAL A;  4NTW A;  3SYP A;  2Y69 C;  5IY5 B;  4QG8 A;  1ZAU A;  4X20 A;  3CC4 V;  4YNG A;  2LFR A;  5DEC A;  4L8J A;  4GKK O;  4X66 B;  4LNU B;  4U3F H;  3K5N A;  5IDJ A;  1GRJ A;  2QM7 A;  1Y4M A;  1JVM A;  2Q9L A;  4BIZ A;  4X1K B;  4BIO A;  1XI1 A;  2BSK A;  2Y4U A;  3CPW U;  3KKY A;  2Y0I A;  4JI5 B;  4O2B B;  1WB8 A;  4DUY B;  1BQZ A;  2EIK C;  2IM9 A;  5J2U A;  4UVB A;  5LBQ A;  2OIE A;  2KG7 B;  1XMO O;  2HLD G;  2WLK A;  3CX5 F;  4LFB B;  4CH6 A;  3KHD A;  2EJ7 A;  4N21 A;  1W2B U;  3CCQ V;  1ZTE A;  2G38 A;  4O2A B;  1U97 A;  2GUZ B;  2MW2 B;  5EC1 C;  1YJ9 V;  5C93 A;  4NR1 A;  5LL6 Y;  1FXK B;  1V55 C;  3Q4H A;  2Y4T A;  4YHH O;  5HFL A;  2V4D A;  1BZK A;  2HR3 A;  2EJR A;  4FFB B;  1BMF G;  5CBF A;  2YEV A;  4P30 A;  4JAV A;  4U3J A;  3E35 A;  1A3W A;  4DR3 B;  2JGD B;  2ARH A;  5CB4 B;  4JI2 O;  1F3X A;  2W0F C;  4JI4 B;  3T0T A;  3CCL V;  4QG6 A;  1K4C C;  3ETE A;  2YIC A;  2Q8V A;  1KBH A;  1QVG U;  4ZOL B;  3T4Z A;  4QNH B;  1BHA A;  3HQO A;  3OTO O;  1FXV A;  1W0J G;  3T2M A;  2PI4 A;  1R3L C;  2EIJ C;  2A9H A;  4MTF A;  4AHC A;  1RPR A;  1VMG A;  3CRA A;  5LHG A;  1AR5 A;  2CTR A;  1O9H A;  3HKD A;  5KHK A;  2WLJ A;  4DV3 B;  4OX9 B;  4FXJ A;  2WAM A;  4YY3 O;  2XAQ A;  4FPP A;  1KP2 A;  4DR2 O;  2DYR C;  2HVK C;  3D36 C;  1ZJH A;  5BR8 O;  1YTF D;  1AR4 A;  1VQ4 V;  3FB8 C;  1ZL8 B;  1T5E A;  2EIN C;  4PA3 A;  2KQX A;  4PV1 B;  3RWR D;  5H6Q A;  3X2Q B;  2LJ2 A;  3U0Z A;  1NU1 H;  1Y74 B;  2ZE8 A;  1BSM A;  5IJ0 A;  1FAF A;  3VBB A;  3DGE A;  1NS1 A;  1GH6 A;  2DQ0 A;  3JD4 A;  3RGB A;  4LF6 O;  5J2T A;  4JI1 B;  4FLU A;  4UCT A;  5JWP A;  4DR4 B;  4HNA B;  4FXF A;  2A79 B;  3BJF A;  5EZY B;  4LC1 A;  3SR2 C;  2HJF C;  3D3I A;  2OCC B;  3UCS C;  2VQF B;  5H5N A;  4ZHQ B;  5KX5 B;  1S5H C;  2M7W A;  1SRY A;  3JAR A;  2NN4 A;  3JAL B;  3K0G A;  1JJO A;  3AG3 B;  1B3Q A;  4GX5 A;  4JI0 O;  2AZ0 A;  5B1B B;  5BMV B;  1I08 A;  4EEQ A;  3L70 H;  4U7O A;  2OCH A;  5LHI A;  4X20 B;  4B3T O;  2QM8 A;  4B3S B;  4JI7 B;  2Z5U A;  3CCE V;  2ZM6 O;  3O65 A;  3OFN G;  4PA9 A;  5B66 Z;  2UXX A;  3T05 A;  5BZB A;  4YJ5 A;  4UCS A;  5KA5 A;  4MVO A;  5B1A B;  4Z1M G;  1PNK A;  3K9A A;  1IXB A;  2YI8 A;  4LF9 O;  3F7V C;  5GON A;  1IVS A;  1P84 F;  3TK1 A;  2BSK B;  1R6N A;  1CP9 A;  1EN4 A;  3VQX A;  2QGN A;  2W6J G;  2JDI G;  4LF5 B;  1SQQ H;  2UU9 B;  2F4V B;  1QQC A;  4LR3 A;  5J2U B;  4IGG A;  1Y76 A;  3OAA G;  2PGG A;  1SKV A;  4IYI A;  1F23 A;  2V7Q G;  4CZZ A;  2DQ3 A;  2E75 B;  1Q90 D;  1YEW A;  2KSD A;  4O4I A;  1TGO A;  4X9Q A;  1A49 A;  4X1I B;  1HNW B;  4CC6 A;  4DV4 O;  2ZCE A;  2VGF A;  1G8M A;  1OCZ C;  3ABU A;  3H6O A;  1HR0 O;  3Q4H B;  2IU3 A;  4IP7 A;  2E74 B;  2EX3 A;  4CS4 A;  1Q6U A;  1S77 D;  5LGN A;  1Q7Y W;  1SA0 A;  2HHH O;  2YEV B;  4K8Z A;  3E8F A;  2ITD C;  2N74 A;  2Q67 A;  3K3W A;  3FKS G;  1QU7 A;  3BRC A;  4U3J B;  4R7C A;  4TSF G;  2YI9 A;  5BXZ A;  1OV9 A;  1ARO P;  1PKL A;  3ETG A;  1JJ2 U;  3OMA B;  3LSU A;  2CH7 A;  4UCU A;  3SYA A;  3MD0 A;  3RYF A;  1QNM A;  4TV8 A;  2AW9 A;  2GV9 A;  4F6R B;  3G6E V;  1AB3 A;  3U10 A;  1NZ6 A;  2JEX A;  4LH6 A;  3HKC A;  3TXS A;  3HKD B;  1TAE A;  3GG8 A;  5KMG A;  5EC2 C;  1EZV H;  4G2K A;  2OTJ V;  3CC2 V;  3BFR A;  1S72 V;  5LOV B;  2CUG A;  4X66 O;  2WLM A;  3CE2 A;  4JGS A;  1HDJ A;  1TA8 A;  4KCT A;  1NVP B;  4K0K B;  2DYS C;  2Q7E A;  1VQL V;  2Q5Z A;  1KMI Z;  2DOS A;  3X2Q C;  1FD9 A;  1P49 A;  4KL1 A;  4JI5 O;  4DUY O;  5IJ0 B;  1G6U A;  2A7W A;  2E5L B;  2UUC B;  3B8M A;  3WU2 Z;  3EVK A;  3CB2 A;  5J2T B;  2GSM B;  1FXH A;  1OCC B;  3C3T A;  1WPB A;  3BA8 A;  3EXA A;  2BTO A;  4LFB O;  3CJH A;  4KHP B;  2CGO A;  2QKS A;  3PJS K;  1J5E B;  5IYD O;  3J7A U;  3ETQ A;  4I55 A;  4PDM A;  3R66 A;  3SPJ A;  3ME3 A;  4I5S A;  1QCE A;  4GCZ A;  2XND G;  3JAR B;  2JVD A;  3RYH A;  3CCM V;  2UXC B;  1M57 B;  1RPO A;  3LNM B;  5B1B C;  2QKA A;  4OPH A;  1D5N A;  5JH7 A;  4FLT A;  3QV9 A;  4JF3 A;  1NTZ H;  4DR3 O;  1CXZ B;  3CP1 A;  4MTG A;  4JI4 O;  1AI5 A;  5B1N A;  1AP5 A;  2Y69 B;  2Y0P A;  3JAS A;  4G1N A;  3TGU H;  3SRF A;  2QWO B;  3QG5 A;  1M5I A;  3U11 A;  5GON B;  5IWA B;  1R73 A;  1SQX H;  1P7B A;  4UB6 Z;  4DW0 A;  2CTQ A;  3K08 A;  2FB5 A;  4O4L A;  2OTL V;  1GM7 A;  1AIL A;  2EUL A;  1K3E A;  1WA8 A;  1GTO A;  2WLI A;  1AVM A;  1G4Y B;  4DV3 O;  4OX9 O;  3M8A A;  5L3D A;  5JJE B;  1Y76 B;  1R3I C;  1SET A;  1UFI A;  4CH5 A;  1QLE B;  4QPK A;  1SQV H;  1VQ8 V;  4B3R B;  4O4I B;  2EIK B;  2UUA B;  4FM0 A;  2IW5 A;  2DN9 A;  4LF7 B;  1PD3 A;  2WLL A;  3OUS A;  1QVF U;  4KXR A;  2Q69 A;  1E1Q G;  2WLH A;  3FYI B;  2ZIM A;  1EN6 A;  4UFZ A;  2QA4 V;  4J10 A;  2GHY A;  4H13 B;  1HW7 A;  4KS0 A;  4MVR A;  2FTK A;  4BW9 A;  1SA0 B;  1KC8 W;  4JI1 O;  2N05 A;  1D2D A;  4DR4 O;  1E79 G;  3ZHR A;  1V55 B;  3H1L H;  1GMG A;  1WNS A;  3SPG A;  1PKY A;  4DK0 A;  1A3X A;  3WB0 A;  1N32 B;  4E4E A;  4I9Q A;  4KFM A;  4DR6 B;  2ATK C;  3AK1 A;  3CYO A;  3UQ8 A;  1RSO A;  3SYQ A;  4X62 B;  2CH7 B;  3E8G A;  4IL6 Z;  4MTO A;  1BQ0 A;  3P3P A;  4UCV A;  1AP6 A;  2Q68 A;  3RYF B;  4NXM B;  4TV8 B;  3BY6 A;  1NI8 A;  3F5W C;  3VOU A;  1D5A A;  4I4T A;  4RPP A;  1N36 B;  1RFY A;  4A5U B;  3OD4 A;  3E8H A;  2NLJ C;  3HKC B;  4J41 A;  1XOU A;  5FPO A;  4B3S O;  5KMG B;  4JI7 O;  3SPI A;  1Y66 A;  3H1H H;  3ICX A;  1THZ A;  4X89 A;  3WG7 C;  3E2E A;  3JAW A;  3ASO C;  4DV6 B;  1KEC A;  3LSQ A;  1M93 A;  4GX2 A;  3L73 H;  4D6T H;  1JX9 A;  1X4T A;  2ETN A;  4LF5 O;  1CPY A;  2UU9 O;  2F4V O;  4IT5 A;  4CH4 A;  1QR9 A;  5LMU B;  5EIB C;  5H6R A;  4AQY B;  3P32 A;  1HNX B;  3OEH G;  3CJH B;  1SS3 A;  2ZDI A;  2LO1 A;  3DC5 A;  3ZIA G;  4RAI A;  1XEQ A;  3D8C A;  4WFB V;  1AJN A;  3SYC A;  1HNW O;  1W0K G;  2YIB A;  1MZE A;  4UB8 Z;  1AR1 B;  4DXW A;  1DF4 A;  1N4C A;  1PL4 A;  3RYH B;  1UJW B;  2QSA A;  1K8A W;  1XNR B;  1PP9 H;  4FLZ A;  4QE7 A;  2IU0 A;  2W0X A;  5CA1 A;  3PN1 A;  2JJ2 G;  2NNU A;  3AAG A;  5C8Y A;  1SZX A;  2AXT Z;  3B77 A;  5JH7 B;  4UV8 A;  1RP3 B;  1MNG A;  2F66 C;  2XAS A;  1DLB A;  1W59 A;  1Q6I A;  3ZHT A;  3HKB A;  5DED A;  3JAS B;  1FKA O;  4DRS A;  5DM6 V;  1JR9 A;  2Q0O C;  3CD6 V;  3JSL A;  4DV7 B;  4HZ3 A;  2CK3 G;  5D5Q A;  2ZNI A;  2IJJ A;  4ZKI A;  2W6I G;  3KZI Z;  3GWO A;  4TV9 A;  3G6B A;  1WA8 B;  4XBF A;  4EKW A;  2XHB A;  4PJ0 Z;  2H3O A;  3K06 A;  3ZHU A;  4I0X A;  1QLE C;  2UXN A;  3EFF K;  1I94 B;  4PD4 F;  3MDS A;  4K0K O;  4I9W A;  3OGI B;  4XDK A;  3ZHS A;  2HP8 A;  5LP6 C;  3AG4 C;  2VQE B;  2WLL B;  3D3Q A;  3N27 A;  1QR8 A;  3CRC A;  5CMU A;  3QF7 A;  2YS8 A;  3SPH A;  3CSX A;  2C2A A;  2E5L O;  2UUC O; 
#chains in the Genus database with same CATH homology
 2Z5U A;  3CCE V;  2OTL V;  1OHH G;  3E89 A;  3OFN G;  4PA9 A;  1H38 A;  3STZ C;  1OCZ B;  2WLN A;  1P4R A;  2UXX A;  3IGA C;  2B5U A;  4X8A A;  4MSW C;  5BZB A;  4TWK A;  1K5S A;  3IC7 A;  3T1C A;  5KA5 A;  1S0V A;  2X7R B;  4MVO A;  5B1A B;  3RVZ A;  3ZRS A;  1PNK A;  3K9A A;  3DTU B;  4Z1M G;  1VQ5 V;  3F7V C;  1NBM G;  3TK1 A;  1JOY A;  1R6N A;  1CP9 A;  1COW G;  1Q86 W;  2OCC C;  2BOC C;  3ABT A;  1R3J C;  2W6J G;  1YHQ V;  2JDI G;  3ZRW A;  2DWD C;  4LCU C;  1OCO C;  3M99 B;  5EBL C;  1CEZ A;  2HKO A;  4FMT A;  3AG3 C;  2AHZ A;  1PL0 A;  4PDR A;  1I5Y A;  3OAA G;  1SER A;  1R6K A;  4U7N A;  1F23 A;  2V7Q G;  4CZZ A;  2DQ3 A;  4WF9 V;  3OM3 B;  3K0D A;  1AJQ A;  2P6J A;  3MHS C;  1SZT A;  3ZRX A;  1VQM V;  2IJH A;  2ZR3 A;  1G8M A;  3ABL C;  1OCZ C;  3ABU A;  2EZO A;  3ZMZ A;  1KD1 W;  3OMI B;  4RQF A;  2IU3 A;  2P67 A;  1VQK V;  2HVJ C;  1YSC A;  5EBM C;  5B1A C;  3CCR V;  4E2L A;  3R65 A;  1S77 D;  1K73 W;  3ZMU A;  2B1I A;  5LGN A;  1Q7Y W;  2YEV B;  4DO2 A;  3E8F A;  2K1E A;  3HB3 B;  2ITD C;  1S3J A;  2Q67 A;  4RUE A;  3G4S V;  3K3W A;  3FKS G;  1YI2 V;  1VQN V;  4P2Z A;  4JTD B;  4R7C A;  4TSF G;  1F4N A;  1Q81 W;  3ML0 A;  2DYS B;  3ZMT A;  4R8C A;  5EBW C;  2QTO A;  4BAY A;  3OUF A;  1ARO P;  3ETG A;  1M90 W;  1JJ2 U;  3OMA B;  1H2G A;  1JPX A;  3SYA A;  1XL4 A;  4BIU A;  3FB6 C;  3MD0 A;  3QO7 A;  3OE7 G;  5CA3 A;  3WFV A;  2EIM C;  1AI6 A;  4UXN A;  1K7D A;  4PDV A;  3G6E V;  1F51 A;  1SES A;  3ZMS A;  2QE7 G;  2XAG A;  1IXM A;  2WLI B;  4LBE C;  2JEX A;  1MSW D;  2AHY A;  1K92 A;  4QJF B;  3ETD A;  2EBO A;  2R9R B;  1GM9 A;  1M56 B;  4JAS A;  2P7T C;  3FB5 C;  3OR6 C;  5J9P C;  4J9Y B;  5EC2 C;  4G2K A;  2OTJ V;  3AEI A;  3CC2 V;  1EFR G;  1S72 V;  1PNL A;  1PNM A;  2IJK A;  4UVA A;  2WLM A;  4MW3 A;  5B1O A;  1K97 A;  4JGS A;  4QE9 A;  1NVP B;  4WCE V;  3ZMV A;  3FB7 C;  2DYS C;  5LHH A;  2LP7 A;  4KP4 A;  4JTC B;  2IJI A;  2ZQM A;  1VQL V;  4J9Z B;  4R50 A;  4FK5 C;  4G28 B;  3X2Q C;  4WFG A;  4WFE A;  1F4M A;  1VQ7 V;  4JYC A;  3RW0 A;  5L3B A;  4ASU G;  4QIW F;  3B8M A;  4MVZ A;  4PA6 A;  1BHB A;  2DW4 A;  2GSM B;  1FXH A;  1OCC B;  3W7W A;  3AG2 B;  1NQT A;  4RQE A;  1K34 A;  2Q6A A;  3ZCC A;  2Y48 A;  3BEH A;  2QEX V;  3ZN0 A;  4PDL A;  2QKS A;  3JD1 A;  3PJS K;  4FJC C;  4JPR A;  3I56 V;  4MTX A;  2BOB C;  3SJQ C;  4BW5 A;  5IYD O;  5H9C A;  3ZRV A;  3JD0 A;  4PA4 A;  4PDM A;  1HWY A;  3SPJ A;  1M56 C;  4I5S A;  3JD3 A;  3W7U A;  3A0R A;  5KUK A;  2V1D A;  4OXS A;  1RM1 B;  3GB7 C;  1QCE A;  2EIJ B;  1AJP A;  3JCZ A;  1ORQ C;  4GCZ A;  2XND G;  1E1R G;  5B3S B;  5KUM A;  4G27 B;  3CCM V;  3EHB B;  4UV9 A;  3TCU A;  2JK5 C;  1M57 B;  1R3K C;  4GT1 A;  3E83 A;  1RPO A;  3LNM B;  5B1B C;  4R6Z A;  3AG1 B;  4RUF A;  2DYR B;  3STL C;  4YXW G;  1LNQ A;  1K33 A;  4UUJ C;  3K04 A;  2EIL B;  4JF3 A;  4ZBM A;  1ROP A;  1QBZ A;  3ABM B;  1L1F A;  2EIN B;  1OCC C;  1VQ9 V;  3CP1 A;  3HPL C;  3AG2 C;  3K03 A;  4MTG A;  3OEE G;  1AI5 A;  5B1N A;  2X6C A;  4WFA V;  1YJN V;  2Y69 B;  1QLN A;  3CME V;  2P90 A;  3ASN B;  1EBO A;  3CCV V;  1VQ6 V;  1DTO A;  1YTF B;  1R73 A;  2PI5 A;  1P7B A;  1MAB G;  1VQP V;  2ZR2 A;  4PEL A;  1FFT B;  2A0L A;  3K08 A;  4H37 A;  1TUE B;  3ZJZ A;  1GM7 A;  1RM1 C;  4XDL A;  2JJ1 G;  3ZRW B;  3CCJ V;  3LDE A;  4RO2 A;  1DF5 A;  1S76 D;  1K3E A;  1GTO A;  1XL6 A;  1WPX A;  5B3S C;  2WLI A;  5IYC O;  1G4Y B;  2XOK G;  5L3D A;  2OT5 A;  1M57 C;  2X0L A;  3OMN B;  1R3I C;  1SET A;  1NR1 A;  1QLE B;  4P9P A;  3LUT B;  4QPK A;  3QO8 A;  3IFX A;  3SYO A;  3ABK B;  3AG1 C;  3UKM A;  1VQ8 V;  2EIK B;  1M9N A;  3KG2 A;  3LDD A;  3W7S A;  2IW5 A;  1YIT V;  4GX0 A;  3W7T A;  4MVQ A;  1MG1 A;  1AI4 A;  2EIL C;  2YSU B;  1PD3 A;  5KA6 A;  2WLL A;  3ABM C;  2IH3 C;  3SYP A;  1JCH A;  3OUS A;  4JTA B;  1QVF U;  1GM8 A;  2Q69 A;  2Y69 C;  5IY5 B;  1E1Q G;  2WLH A;  2ZXW B;  3FYI B;  2QA4 V;  3ASN C;  2GHY A;  5HFM A;  3CC4 V;  4MVR A;  2FTK A;  2LFR A;  1K4D C;  1YIJ V;  2X6B A;  1KC8 W;  1VQO V;  5IYB O;  1FS0 G;  3WG7 B;  1WLE A;  1K9M W;  1B6Q A;  1E79 G;  3ASO B;  1V55 B;  1GMG A;  3SPG A;  4FIP C;  5IDJ A;  5DN6 G;  1KQS U;  2QM7 A;  4KFM A;  2ATK C;  1Y4M A;  3CYO A;  1JVM A;  4PA7 A;  4BIZ A;  2ZDI C;  2WPD G;  3NXS A;  3SYQ A;  3E8B A;  3CPW U;  3E8G A;  4MTO A;  4MT8 A;  3OGC C;  2Q68 A;  3ABK C;  2XAH A;  3BY6 A;  2EIK C;  2KB1 A;  3F5W C;  4UVB A;  5FL7 G;  2IH1 C;  3VOU A;  5LBQ A;  3CCS V;  1MOF A;  1NJI W;  1H8H G;  1PKX A;  1N8R W;  5E1A C;  3QNE A;  2HLD G;  2WLK A;  1BL8 A;  3MHH C;  2XAJ A;  3OW2 U;  3E8H A;  2NLJ C;  4MVM A;  2MK3 A;  5EK0 A;  3CMA V;  1K5Q A;  4N21 A;  5LGU A;  3W7X A;  5IY5 C;  1NVP D;  1W2B U;  3CCQ V;  1GK9 A;  1H8E G;  4F4L A;  3CXC U;  3SPI A;  1Y66 A;  3OR7 C;  2EZP A;  1THZ A;  4X89 A;  3ABL B;  5EC1 C;  5C93 A;  1YJ9 V;  3WG7 C;  3E2E A;  1FXK B;  4P9O A;  3ASO C;  1V55 C;  4H33 A;  1KEC A;  3LSQ A;  4Q20 A;  5HFL A;  1ENV A;  4X88 A;  4GX2 A;  2HR3 A;  3B8N A;  1NR7 A;  2EJR A;  3CCU V;  1JX9 A;  1BMF G;  5CBF A;  2YEV A;  1NH2 B;  4P30 A;  1CPY A;  4CBC A;  4JAV A;  1QR9 A;  3E35 A;  5H6R A;  2LFS A;  2X6A A;  3P32 A;  3OEH G;  1EZJ A;  1OZ0 A;  1ZWI C;  3E86 A;  2ZDI A;  2W0F C;  3CCL V;  1K4C C;  3ETE A;  3ZIA G;  5CBH A;  1QVG U;  1V54 B;  2WSS G;  4RAI A;  3T4Z A;  4QNH B;  4KUM A;  2H8P C;  4WFB V;  2ZD9 A;  1AJN A;  2JEU A;  4HYO A;  1BHA A;  3SYC A;  1W0K G;  2EIM B;  3F7Y C;  4LP8 A;  1FXV A;  1W0J G;  2DWE C;  3T2M A;  4UVC A;  2PI4 A;  1R3L C;  1AR1 B;  2D3O W;  4XDJ A;  2EIJ C;  3H01 A;  2A9H A;  4MTF A;  1DF4 A;  4DXW A;  1RPR A;  2ITC C;  3RBZ A;  1NH2 D;  1FXK C;  5LHG A;  4HAM A;  1UJW B;  4MVU A;  1K8A W;  4JAU A;  1OCR B;  2WLJ A;  4MVS A;  4QE7 A;  2IU0 A;  4WFH A;  2Z3Y A;  2WAM A;  3K79 A;  2XAQ A;  3JYC A;  2JJ2 G;  2NNU A;  4FPP A;  1KP2 A;  3AAG A;  1I5X A;  2DYR C;  3B77 A;  2HVK C;  4QPJ A;  4UV8 A;  1GO3 F;  1AI7 A;  3LDC A;  3UM7 A;  2H94 A;  1Q82 W;  1YTF D;  1VQ4 V;  4JYB A;  3FB8 C;  2WWW A;  3AG4 B;  2XAS A;  1DLB A;  1J95 A;  3P30 A;  5L3F A;  2EIN C;  4PA3 A;  2HFE C;  4L87 A;  4MW8 A;  5H6Q A;  3LSS A;  3X2Q B;  5DM6 V;  3CD6 V;  3TET A;  1JQ0 A;  1V54 C;  3JD2 A;  4HZ3 A;  2B1G A;  2CK3 G;  3VBB A;  3DGE A;  2HG5 C;  5LGT A;  2DQ0 A;  3JD4 A;  3ZN1 A;  5GW7 A;  1GKF A;  2IJJ A;  4ZKI A;  2W6I G;  2R9I A;  3GWO A;  2XAF A;  2JIZ G;  2A79 B;  5CN0 A;  4XBF A;  4GX1 A;  4LC1 A;  4EKW A;  3FYE B;  3K06 A;  3I55 V;  1OCR C;  2HJF C;  3G71 V;  3D3I A;  2OCC B;  4N23 A;  1QLE C;  2UXN A;  3EFF K;  1KP3 A;  5CBG A;  1S5H C;  2M7W A;  1NKD A;  1SRY A;  1KKD A;  3CC7 V;  1OCO B;  1FXK A;  4I9W A;  4XDK A;  1M1K W;  5L3E A;  3K0G A;  3RVY A;  5L3C A;  3AG4 C;  2WLL B;  3AG3 B;  4GX5 A;  3T4D A;  3SPC A;  1QR8 A;  5CMU A;  3QO5 A;  5B1B B;  4MS2 A;  3SPH A;  1YJW V;  4U7O A;  2C2A A;  2ZXW C;  5L3G A;  5LHI A;  4WFF A;  2F43 G;  4TT3 G;  3D36 A;  2QM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...