4TT3G

The pathway of binding of the intrinsically disordered mitochondrial inhibitor protein to f1-atpase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
272
structure length
183
Chain Sequence
ATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPASDRGLCGAIHSSVAKQMKSVGDKIRSILHRTHSDQFLTFKEVGRRPPTFGDASVIALELLNSGYRFRSVISYKTQEYSLANIIYYSLKESTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP synthase subunit alpha, mitochondrial
publication title Pathway of binding of the intrinsically disordered mitochondrial inhibitor protein to F1-ATPase.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 60
structure length 183
sequence length 272
ec nomenclature
pdb deposition date 2014-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00231 ATP-synt ATP synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.80 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4tt3G01
3.40.1380.10 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate Kinase; Chain: A, domain 1 4tt3G02
4BAYA 5DN6G 2XAQA 5LHIA 2WPDG 3OEHG 4UV8A 4XBFA 1W0JG 3ZMZA 2IW5A 2JJ2G 2R9IA 2HKOA 1BMFG 5L3GA 4UV9A 2V7QG 3OEEG 4UVAA 2XASA 2F43G 5LGUA 1E1RG 3ZN1A 4UVBA 2W6JG 2XAHA 4Z1MG 5L3EA 3OE7G 5LHGA 2QE7G 3ZMTA 5FL7G 2Y48A 4TT3G 3ZMSA 3ABTA 3ZN0A 4YXWG 2JJ1G 5L3FA 4ASUG 1MABG 5LHHA 3OAAG 5L3BA 1E1QG 1H8EG 2XNDG 1H8HG 2H94A 2EJRA 1NBMG 2CK3G 2W6IG 5H6QA 2XAFA 5L3CA 5L3DA 3OFNG 4UXNA 2DW4A 2XAGA 2XAJA 2JIZG 5LGNA 2Z5UA 1OHHG 1FS0G 2WSSG 3ZMVA 4CZZA 2UXNA 3ABUA 2XOKG 3FKSG 1EFRG 1W0KG 1COWG 2X0LA 2Z3YA 2HLDG 4KUMA 2JDIG 4TSFG 4UVCA 2V1DA 5LBQA 3ZMUA 3ZIAG 1E79G 5LGTA 2UXXA 5H6RA
chains in the Genus database with same CATH superfamily
3B77A 1WNSA 4JAVA 3CS5A 5FPOA 1EN6A 5LP6A 2P22C 1MZEA 3K58A 4XBFA 1YCIA 3CC7V 4CS3A 2EZPA 1BMFG 2O57A 4DV0O 3ABLB 4HYVA 2QM8A 4DYLA 3B4SA 2XASA 3U0ZA 1JX9A 1U96A 4MT8A 1Q3EA 4XDJA 4DR5B 1YJ9V 3RYIB 2Y4TA 3BA8A 3H01A 4P30A 4CH4A 2NR5A 2JGDB 1TUBA 1B06A 3CE2A 5IE9A 5L3EA 3OE7G 1F3XA 3TK1A 5JJJB 5KUMA 4ABMA 1HNWO 2DQ3A 1R1BA 4O4HB 1XMOO 5K1PA 2AXTZ 4DRXB 4O2AB 3SYQA 3AG1C 3VQXA 1Q7YW 3OD4A 1H8HG 2Q7EA 1LUVA 2LO1A 1WPBA 3QV7A 2EZOA 1XHXA 2E5LO 4NXNO 4JI2O 4KRZA 1SZTA 3GQYA 3JAKA 1VQPV 3JSLA 1JQ0A 1BHAA 4U3JB 4B7KA 3W7WA 1K5QA 1ZAUA 3K03A 4YJ3A 2WA4A 4JI8B 4IHJA 4UFZA 2ARHA 2OCCC 1L1FA 4MVUA 1WLEA 3EXAA 3ZRXA 4LF4O 3DC6A 3W7SA 1M57B 4CZZA 1M90W 2UXNA 4JI4O 1WP8A 4DV4B 4AQYO 4LCUC 4QG8A 3R66A 3CCLV 3MHHC 1VQ6V 4NXMO 3K0GA 4AILC 2LGWA 1AJPA 1DTOA 1E0UA 4UCSA 1S5JA 1IXMA 3M99B 5IYCO 2OT5A 4I4TB 3D3QA 3G4SV 3SYCA 4A5UB 1R6NA 1VEWA 1TUEB 4LFBB 4DR6O 4WFBV 3SJQC 2QJ1A 2QDOA 3OTFA 1FD9A 2M6YA 1XDCA 3G67A 2PI5A 4C7UA 3JAWA 1T5EA 4ZKIA 1QLEB 5HFLA 4J42A 1EZJA 2N04A 4BWAA 2CTRA 5JVDB 4YNGA 3AG7A 1IDSA 3U11A 2K1EA 4IMAA 1QR9A 2YICA 5IYDO 2V4DA 2YXHA 1ORQC 4LNUB 1YJNV 2ZE5A 3LDCA 1XL4A 2DYSC 3HQNA 3DC5A 4O4IB 1QU7A 2MW2B 4PA6A 4J7KA 4JTCB 4NB5A 1GN3A 3OUSA 1WJZA 3E86A 2H3OA 1IBMO 1GO3F 5K1XA 1M1KW 3H6OA 3J81N 1K5SA 2F95B 1R6KA 1Q6UA 1NTZH 1BT8A 1M93A 3QVNA 4LR3A 4IL6Z 3SJBC 1NZ6A 1Q43A 1TVKB 3E0VA 3LSSA 1CEZA 1JMKC 1DK1A 1AP5A 1WB7A 2EIJC 1AVMA 1NJIW 3SPJA 5LP6B 2Q7GA 2F4VB 1FS0G 2F66C 4F6EA 1WAZA 4FLUA 2Q0AA 1FAFA 2DE0X 1AQFA 1K34A 3UM7A 1FPOA 4DR4B 1COWG 1I94O 1MZFA 2GUZA 4QPKA 3AG4C 4DW1A 4DR3O 1HDJA 4B3RB 1XNQO 1TUBB 1Q6IA 3E89A 4DV3O 4TV9A 3ZHUA 4LFCB 4TUYA 4JF3A 4QJFB 4TQDA 5JQGA 3P3NA 4UV8A 3WB0A 1PL4A 4I0XA 3A2FA 2QWPB 3WG7B 3ZHRA 4FLVA 2IU0A 1SQPH 4OXSA 1F23A 4FFBB 3JAKB 4CH6A 1R6TA 3UQ8A 1N33O 4YJ3B 2HHHB 1IBLB 3N25A 1UJWB 4IHJB 3F5TA 3RYCA 3CRCA 1A5UA 3MA8A 2F1MA 1DF5A 1HNXB 3CWBH 2LGQA 3BJFA 3JAMN 3LSUA 2DN9A 3ETGA 4QNHB 1FXKA 3L72H 4X64B 4GKKB 2B1GA 2JEUA 1Q8IA 1E1QG 2LJ2A 2W0FC 1MOFA 5KA6A 3L75H 3QTCA 4AHCA 2YIAA 3M7MX 5KLVH 1S5HC 1ZX3A 3HKDA 3OFNG 2RN9A 4ZI7A 2R70A 2UXCB 4DR5O 3C3TA 3N2KA 4U3FH 4GUNA 3BEHA 2ZXWB 3JAWB 3RYFA 1HR0B 4EEQA 3AG2C 1A49A 3D36C 4OPHA 1VQ9V 3I5DA 4FZ0A 2G38A 3K9AA 2XOKG 2P5OA 5CA0A 3SRFA 4I9WA 1K73W 2EINB 1VF6A 5DEDA 4B08A 3A0BZ 4CH3A 4G1NA 4L87A 2UUAB 5GW7A 4O2BA 3OR7C 3BHPA 5A9GA 2C2AA 3K79A 1VQ8V 1N32B 3CB2A 3E8FA 2EILB 2EULA 4F6RA 1PM9A 3E8HA 2QKCA 1KUQA 3K57A 2EJ7A 3FB5C 5JJNB 5EZYA 5IJ0A 2Y69C 3ICXA 5IWAO 1SQVH 3AG3C 2A3QA 4JI8O 2EIMB 2DQ0A 1QR8A 2IJKA 2YXLA 2QA4V 4JI7O 2QSAA 1DGSA 1GKFA 4X20A 3TXQA 3B09A 1Y74A 2W0XA 1FFXA 3ZN1A 3ZCCA 4H37A 3ZBHA 4EB6A 5J2TA 3FAVA 1CPYA 4TWKA 2Q68A 3AK2A 2GTAA 4LF5B 2BTQA 1QCEA 4OX9B 5H2FZ 4ASUG 2GDSA 3ABMC 3RGBA 1MSWD 2GUZB 2CK3G 4K8ZA 5JCOC 2DMXA 3KZIZ 2VGIA 2XAFA 3IC7A 4TV9B 2DW4A 4DW0A 4TUYB 1F4NA 5EBWC 3T0TA 4FLXA 1Y6XA 5KHJA 3JCZA 5JQGB 2EIKC 4EKWA 1YVWA 2YUAA 1V54C 5KHGA 1KC8W 2PYLA 2QEXV 4RPPA 1K4DC 3RYIA 2E76B 5E79Z 4B3SB 1SETA 4DV7O 5BY1A 4DV1B 5LYJA 3L9DA 3RYCB 1W59A 2AZ2A 1ZWIC 4MVOA 4BAYA 3B2EE 4QIWF 3ETDA 3HR0A 3CCUV 4Z2WA 2R72A 1FXKB 3BAAA 4X88A 4NTXA 1XMQO 2AHZA 2LP7A 1PL0A 3KG2A 5ITZA 2X6AA 5CA3A 3DSQA 1KKCA 1R3IC 1Y4MA 4PDMA 1H2SB 3GB7C 3HKDB 4ZI7B 4N23A 5LMUO 1K97A 2JVDA 5AG2A 5F2VO 4X8AA 4DR4O 3HKBA 4PA9A 3H1HH 3N2KB 4JV5B 1QHTA 2UXDO 3RYFB 4LF7B 1ROPA 1N34B 3HB3B 4IYHA 4J7JA 3CCQV 3LNNA 3Q4HA 1AP6A 5CA0B 2IH1C 3CXHF 3STZC 2CGOA 5D5PA 4IGGA 2E28A 2ODMA 2QKAA 3E83A 2YIBD 4FM1A 1JJ2U 4PI0A 1LR1A 2YXYA 4O2BB 1ZLZA 2XT9A 2VRZA 3F7VC 3S3WA 5CBGA 2AGAA 5LMNB 1NKDA 1I7FA 4G28B 4F6RB 4RQEA 1M56B 3ML0A 1TGOA 3JD1A 3ZJZA 2OWOA 2JIZG 5EBMC 2BTOA 4LWSA 5EZYB 1IBLO 5IJ0B 1T5AA 3G6EV 2YEVA 3EVKA 1N8RW 2WLLA 1HNXO 3KTXA 2ETNA 3JATA 3NR7A 3AK1A 1SESA 2WLIA 4X20B 2LFSA 1Y74B 1PNKA 2X0LA 3CRAA 4DK1A 1FFXB 4X64O 3P3PA 1H38A 1XQ8A 1YZBA 4X1KA 4JI0B 3K0DA 5B5EZ 4LBEC 4EB6B 5J2TB 3FAVB 4FZ1A 5LGTA 2VQFO 2OTLV 4I9QA 3QF7A 4FVMA 4J7ZA 2UXCO 2BTQB 3FB7C 2A0LA 2L35A 2RCVA 2KG7A 2NNUA 4WFGA 5JJEB 3FYEB 4U7NA 1W0JG 4CBCA 1BHBA 4RQFA 3NXSA 3IAYA 1X4TA 1OCZC 2P67A 4X65B 2PY5A 4ZOLA 1Q86W 4UVAA 3MAQA 1V55C 3JD3A 3GWKC 3VQVA 4X66B 5KHKA 3SRKA 1P7GA 1XBLA 2UUAO 1K9MW 1ENVA 4JAAA 3ZHQA 4ZHQA 1G8MA 1B04A 1OCCB 2PF4E 4TT3G 1L0NH 1R73A 2ZE6A 1YI2V 2ADPA 2WAMA 5LHHA 3JSNA 4N21A 4K0KB 4JI6B 3J7AU 4BIUA 2X6CA 5LYJB 2LW7A 3T1YO 2DYRC 2YDEA 2G50A 1FFTB 1KU9A 3O65A 2RMKB 2GHYA 4FM0A 1IZ3A 1EZVH 5LGNA 1ZUQA 1EN4A 4KHPB 1M4UA 3DTUB 3CCJV 5ITZB 2DWDC 2WLNA 4QGPA 3FKSG 4LF5O 1SQQH 3QO7A 4OX9O 5EK0A 4FFBA 4KUMA 1SQBH 3HKBB 1AROP 5LBQA 4B3TB 2WWWA 1I5XA 4W4LA 2ZQMA 2ZM6B 3CHXA 1VQMV 3STLC 4MVMA 4I7ZB 4GZRB 1F7YA 2WPDG 3Q4HB 4RUFA 4UCUA 2UU9B 5EIBD 2GTSA 3C90A 1KYOF 1NTKH 3VQYA 2E3CA 3IGAC 3G71V 3K5LA 1HNZO 5KHHA 2B5UA 3BVOA 2F43G 5LGUA 3D3IA 3ZS8C 4QG9A 4GX1A 1M57C 3LDDA 3ASOB 3PJSK 1BGYH 4LWSB 3P32A 3K59A 2YEVB 3ZMTA 1YEWA 4MTOA 1RPOA 2WLLB 3JD2A 2RNBA 5B1BB 5KAFZ 4LF8O 3JATB 1RM1B 2Q0OC 4B3MB 2WLIB 3DGEA 3ASNB 4DUZB 1Q6HA 3ETQA 4LF6B 2DYSB 4X1KB 4YJ5A 3N27A 4O4JA 4KCVA 4GYCB 1GMGA 1N4CA 4FM2A 1QLEC 3H9VA 4Q6GA 4DV6B 1JVMA 2CH7B 5IY5B 2UUBO 2KG7B 4UB6Z 3BRCA 2WLJA 5CMUA 3L74H 3H1KH 4MVZA 2VGBA 1N34O 3OUFA 4ZOLB 3OW2U 1PP9H 1GN4A 2YIBA 3T1HO 3U10A 5GONA 3OT7A 2IH3C 1VQ4V 4DR7O 4JI1B 2HLDG 3PN1A 2CTQA 3A0RA 4MTXA 4ZHQB 4X62O 2OYQA 2B1IA 1VQLV 3OM3B 4O4LA 2K9PA 2IJHA 5LMNO 1SKVA 4G27B 1VP7A 3QV8A 2HEPA 2CTPA 1ZJHA 1IBKB 1LUWA 3F5WC 3SPHA 3LDEA 5LP6C 4JASA 4DV2B 4GCZA 3W7UA 1RPRA 2YI9A 4YJ2A 4RUEA 4D6TH 3C3SA 3OTOO 2W6JG 1VIBA 1US6A 1BSMA 1KB9F 1X59A 5FPRA 3APOA 4JI3B 1PPJH 4XDLA 3SGIA 4K3AA 2QR4A 4BW5A 5C8YA 2Q4PA 3T1CA 4CC5A 3A8TA 2PTMA 2ZNJA 1HWYA 1N36B 4YY3O 5DECA 4B7EA 3H1JH 1H8EG 3VBBA 1AR1B 5C93A 5KHIA 1N0JA 4I55A 3AAGA 1OCRC 4OPAA 2JS3A 2ZDIC 1XOUA 2XAGA 1J5EO 1EBOA 1FJGB 4DUYB 3WG7C 2E75B 4X66O 2UXBB 4J9ZB 2WSSG 3K04A 3ZMVA 3DXRA 4CC6A 5BZBA 3LNMB 1L8DA 4LH7A 1DLBA 4PA3A 3RWRD 3MD0A 3X2QB 5GTIZ 3J80N 1H2MA 3AG2B 1NQTA 1AI4A 3CX5F 4KP4A 1QQCA 2XAQA 4FK5C 4JI5B 3K3WA 4ICGA 1RSOA 3ZHTA 3EHBB 4O4JB 5L3GA 4UV9A 1ZL8A 2ZXWC 5B1AC 2Q67A 4KHPO 4FMTA 3K5MA 4I50A 4HBNA 3CP1A 1VMGA 1B3QA 1SA0A 5A2QN 2KB1A 1HW7A 3BY6A 2GSMB 3LSQA 2Y48A 1IX9A 2ZM6O 2QWNB 5B66Z 4YXWG 5GONB 5J2UA 4DV4O 2EILC 1AR5A 4DV0B 5KA5A 1YDXA 1MA1A 4PDVA 4HYWA 1NBMG 4YHHB 1GK9A 1JJOA 2HFEC 3W7XA 1AR4A 1OJHA 4PD4F 2JRIA 4UXNA 4O4LB 1YTFB 4LFBO 4MW3A 3CC2V 2ZINA 4PDLA 2IM9A 1K4CC 2UUCB 4H13B 3SYOA 3ZRVA 1KD1W 2DOSA 1XMOB 2P90A 2QM7A 3FB6C 3CC4V 3SJAC 3HQPA 1Y66A 1S72V 2VS0A 4JYAB 1EFRG 4OGQB 2ITCC 3VOUA 2Q5ZA 1L0LH 4YJ2B 4FLZA 5EBLC 4MVRA 2RQ6A 4NXNB 2X7RB 4JI2B 4EFEA 1NR7A 2JDIG 2VQEB 5IYZA 4DUZO 3CRRA 3S3XA 1AI7A 4JZGA 1YHQV 4QGCA 4UCVA 1H2KA 2R9RB 1BL8A 1XNRB 5C8YB 5DN6G 4LF4B 2ZT9B 3FFQA 3OEHG 4DV6O 1KECA 2A79B 3SRHA 2BOBC 5EC2C 1QVFU 1OZ0A 3B8MA 4JI4B 4AQYB 2R9IA 2H8PC 4I55B 1JA8A 1MMMA 3UKMA 2ZR3A 3K06A 4K8XA 1FYJA 4HYOA 4K35A 4WCEV 4Z1MG 1Q90D 1O9HA 4DR6B 4RWUA 3O9OA 3MHSC 2NLJC 4DV5B 3QO8A 3ZMSA 2F4VO 4QPJA 3DXRB 1GN2A 2R9AA 2DWEC 3IS4A 2A7WA 1YSCA 1S0VA 3JCUZ 4F4LA 2PUSA 2P4VA 3JARA 3UO2A 1K8AW 1LNQA 4WBNB 2W6IG 1IBKO 3RT3C 1VP8A 1FXKC 4B3RO 1T57A 1YITV 1EN5A 2XHBA 3T4DA 4BIZA 2ZCEA 3OMNB 4D7TA 4LFCO 3ZHVA 2QWOB 1OHHG 3SRDA 1RSOB 1VF7A 5IYBO 1IBMB 1OCOB 1V9PA 1KKDA 2AHYA 1ZTEA 3RVZA 2LFRA 4PV1B 5FNVA 1ZL8B 3T4ZA 4P9PA 3ABKB 4DK0A 4I50B 4LFAB 4LH6A 4DXWA 2Z3YA 4HZ3A 5E1AC 1SA0B 4TV8A 2PZSA 1Q81W 2Q8VA 2HHHO 5H6RA 1YTFD 4PI2A 3CXCU 4P9OA 2EBOA 1KQSU 4YIOA 1M5IA 3CCRV 1WP7A 1Z5WA 1FXHA 5J2UB 3ZMZA 3KKYA 1M56C 1SQXH 3F7YC 4GKKO 1A32A 4PA7A 3WB1A 3JD0A 1PKYA 1K92A 1I94B 4R6ZA 1K3EA 4DR3B 3OR6C 2FKXA 3H1LH 4BR6A 4UVBA 4GKJB 3FYIB 4DV3B 1JCHA 5LA6A 2CH7A 4U7OA 4FLYA 2QE7G 3L73H 1KBHA 1U97A 1N0NA 1HR0O 3ABTA 2Q69A 4WFEA 3GVMA 2ZR2A 3WFVA 3ZRSA 1VQKV 3HKEA 4JI5O 2IBZH 2XNDG 1SZXA 2H94A 1MSDA 5B3SC 2EJRA 5IYZB 1BCCH 4UCRA 3SYPA 4PHZA 5DM6V 4BIOA 1A3WA 1WA8A 1N33B 1XUQA 1N32O 1S76D 5EYPA 3TJTA 2E74B 3U2ZA 1XILA 1UFIA 1XEQA 2WLKA 3CMEV 1P7BA 3PP7A 5LOVA 2Y0IA 3BA9A 1XL6A 3CCMV 2QWQB 2L6LA 1H2NA 2DYRB 2IU3A 1YF2A 1OCCC 1JFFB 1KP2A 1AI5A 3N2GA 4TSFG 2V1DA 1XREA 3ABLC 3CRQA 4J9YB 4YHHO 3ZMUA 1E79G 2CGNA 1PKMA 3AG1B 1SS3A 3IC9A 5BMVA 2F23A 5B1OA 1GM9A 4KCTA 4UCTA 2FTKA 3JD4A 1KMIZ 1IXBA 2A06H 4QG6A 2OIGA 3UT5A 2IW5A 2UUCO 4FLTA 1VQOV 2BE3A 3JARB 1R3LC 1PKNA 3CJHA 1K7DA 4LF9B 2WLMA 3G2GA 2ZDIA 1THZA 5BR8B 2OCCB 4JYAO 4GX0A 3HPLC 3AK3A 2VQEO 3E2EA 2KSDA 3JYCA 4MVQA 1S3JA 3E0WA 2ZD9A 3A0HZ 4NR1A 4GLXA 1XNRO 5FNVB 5IWAB 1GH6A 2FMLA 1QVGU 1FKAO 2ZNIA 4EFBA 4JPRA 1E0TA 2JS5A 5L3BA 2M7WA 3IJ4A 4IYIA 5CB4A 4JI7B 1YIJV 4TV8B 4B3SO 4P2ZA 1IURA 5L3DA 3QG5A 2Z0AA 1NH2B 4DV1O 2HVKC 3D36A 4FPPA 5CN0A 3ASOC 1AJQA 1Y76A 4ZIBA 4GX5A 1IVSA 2LW1A 1D5NA 3EFFK 3BPZA 4DV5O 4JPGA 1AI6A 3UO3A 2YI8A 3QV9A 1W0KG 2F93B 1SF9A 5KAIZ 3OGCC 5JH7A 5B1BC 5KMGA 5GTHZ 2RJZA 4DO2A 1RM1C 5LA6B 4IIJA 3K5OA 1BZKA 4JGSA 5D5QA 1B6QA 4KFMA 3CCEV 3ASNC 3L70H 3SR2C 1F51A 4JV5O 4X89A 3QV6A 2GBOA 4MTGA 4DR1B 1PNMA 4LF7O 4WFFA 5LHIA 4FXFA 3ZHSA 3T05A 3HKEB 2PGGA 4NTYA 2OCHA 4X1YA 4FXJA 2HVJC 5IY5C 2WA3A 2EIJB 1I08A 4H0LB 1JR9A 2V7QG 3OEEG 2QWRB 4BW9A 2RDCA 1GM8A 3CMAV 4KXRA 3CCVV 1WA8B 4DV7B 4LC1A 2N05A 3BABA 3OGIB 5IJ9A 5EYPB 4LFAO 4JYCA 4FFKA 5H5NA 3SYAA 1BS3A 2IJJA 2AW9A 5LOVB 3CPWU 3AG4B 4CS2A 2ITDC 5JCOA 1XMQB 3T2MA 2P06A 1AB3A 3N2GB 3SDLA 1GAXA 3CSXA 2HP8A 4MW8A 5BXZA 4DR2B 5LMUB 3KCYA 1M9NA 4JI0O 1Q5OA 1GTOA 4JYYA 4AI8A 2KQXA 3FB8C 4ZBMA 2BCCH 2XAJA 5BMVB 2UXDB 2ZIMA 4MVSA 4GKJO 1QLNA 1NTMH 3CD6V 2CTWA 1BE3H 4X9QA 5KUKA 1W2BU 3UT5B 1AILA 4DRSA 3CJHB 5H9CA 1OCRB 4X65O 3QO5A 5IDJA 4D7SA 2WLHA 2VWJA 2DJVA 1NH2D 2B9ZA 2BSKA 2HJFC 1VARA 1F3WA 1TAEA 5FLXN 1P4RA 5TISZ 4L8JA 4XDKA 4GT1A 1QBZA 1DF4A 3THOA 4KCWA 3I56V 3ZRWA 1P49A 3CRMA 4MTFA 3K08A 1XI1A 5CB4B 2P7TC 4PDRA 3WB2A 2JJ2G 3LUTB 2HKOA 2JGUA 4RO2A 4WFAV 4JTAB 1XHZA 1WN7A 4CS4A 3RYHA 4WBNA 4K0KO 2P6JA 4JI6O 1K33A 1OV9A 1SERA 3BJTA 1J95A 1G4YB 2VQFB 4NKGB 2X6BA 3K9SA 3CYOA 1Y76B 5FL7G 4KCUA 3X2QC 2A9HA 1WPXA 3TETA 2ZE7A 3MDSA 3E8GA 3E8BA 5B1AB 3T07A 2CDYA 5CA1A 1MABG 3JALA 1I5YA 3OAAG 3GR4A 2VGGA 5JH7B 5KMGB 1Q82W 1ZSPA 3IFXA 3QTGA 3G6BA 4IIJB 2LQTA 1SC5B 2EINC 3JASA 2D3OW 2XTAA 4B2DD 4LF9O 4B3TO 2Y69B 3AG3B 2HG5C 2YSUB 2ADQB 5BR8O 2YIDA 3APQA 2Y4UA 1R3JC 1TA8A 3E22A 3ME3A 1NU1H 2Z5UA 3KCXA 4FIPC 1WB8A 1EM1A 1PKXA 1R3KC 3CCSV 4X1YB 2UU9O 3FX7A 3HKCA 3G80A 3ABUA 3RN4A 2YS8A 1PD3A 1O9GA 2EIMC 3T1YB 3QNEA 1NVPB 5IJ9B 3SPGA 5LXTA 1GM7A 1NI8A 3ZIAG 3CEIA 3HQOA 2UXXA 4R8CA 2VGFA 1HNWB 3ABMB 4HNAA 4KS0A 1P84F 1PV0A 2N74A 3AEIA 4J41A 4X1IA 4E4EA 5J9PC 3OMIB 5KX5A 2E5LB 4B3MO 2JK5C 1F4MA 4RAIA 3B40A 4Z1VA 4LF6O 2EIKB 3TXSA 3W7TA 1E1RG 2ATKC 1MNGA 3RFRA 2JEXA 1PNLA 4E2LA 2NN4A 1NT2B 1SRYA 4MS2A 2QTOA 1GRJA 2EX3A 4Q20A 1V54B 1JPXA 4G2KA 4WF9V 1H2LA 1NR1A 3SJCC 3SPIA 2Y0PA 4DR1O 4H33A 2JJ1G 4NXMB 4WJ8A 1BQ0A 2PI4A 3P30A 4I0XB 1HNZB 1QNMA 4UCOA 4UB8Z 1JFFA 5H6QA 4JI1O 3I55V 2BSKB 5L3CA 2AZ0A 4W4KA 2BOCC 4YIPA 2CUGA 2CE4A 2KKWA 2JGDA 1VQ7V 1VQNV 4IP7A 1YJWV 4PA4A 3ZRWB 3SPCA 3BCCH 2Q6AA 1VF5B 4PELA 4LF8B 4TOIA 1Z5VA 2QM4A 1S77D 3D8CA 3RYHB 4O4HA 3BFRA 4DRXA 4O2AA 5HFMA 1CP9A 4QE9A 4JAUA 2ZIOA 4DV2O 3VQWA 4UVCA 3TGUH 1UPGA 4WFHA 2PYJA 1RP3B 3B8NA 1Y67A 1AJNA 3H1IH 5EC1C 4DR2O 2ZE8A 4R50A 4JYBA 2Q73A 2FB5A 4JI3O 2UUBB 1URFA 5B1NA 2FYUH 4U3JA 3ZEDA 1CXZB 3FD9A 2VWKA 3K5NA 2QTSA 5CA1B 3JALB 5CBFA 4J11A 3T1HB 2D2CB 1N36O 3E35A 3M8AA 2FL4A 5IT9N 4I5SA 1G1XB 4DR7B 4QE7A 3L71H 1MG1A 1VF6C 3JASB 1SQGA 1NVPD 1OCOC 2HR3A 2P4KA 2XAHA 4IT5A 4X62B 3E22B 1PKLA 1FJGO 4I4TA 4DUYO 3ABKC 1A3XA 2QGNA 5LHGA 1VQ5V 2UXBO 2OTJV 4JZ2A 4CH5A 3HKCB 5LL6Y 2IJIA 2ILMA 3ZN0A 4J80A 4JTDB 4J10A 5L3FA 2CAZC 4PJ0Z 4NTWA 1S5LZ 1D2DA 4H44B 3RW0A 1XNQB 1RFYA 5EIBC 1H2GA 5JVDA 4MSWC 3GG8A 5LXTB 1BQZA 4GX2A 3OTOB 3GWOA 4LNUA 2Q7HA 3RVYA 2ZKOA 1JOYA 3OMAB 4R7CA 3R65A 4HNAB 4LP8A 1OCZB 4O4IA 3ETEA 4X1IB 1G6UA 1V55B 1SQFA 5KX5B 4FLWA 5B3SB 3TCUA 2QKSA 3RBZA 1Z2GA 2YC0A 1I0HA 2HJDA 4NYKA 4YY3B 5CBHA 3UCSC 2Q9LA 2XUMA 4KL1A 1D5AA 4TQFA 5JWPA 1NS1A 1GN6A 3ZX6A 1KP3A 1FXVA 4FJCC 2GV9A 3WU2Z 4B2DA 3EOEA 1HP8A 4UUJC 1YXBA 1J5EB 2MK3A 2OIEA 4HAMA 1TVKA 4NVPA 3KHDA
chains in the Genus database with same CATH topology
1ZWIC 3B77A 4MVOA 4BAYA 4KP4A 4JAVA 1PNMA 4WFFA 2XAQA 4QIWF 5LHIA 3ETDA 3CCUV 4FK5C 1FXKB 4XBFA 3K3WA 4X88A 3CC7V 2AHZA 2LP7A 1PL0A 2EZPA 3KG2A 2HVJC 1BMFG 5IY5C 3ABLB 3EHBB 2EIJB 2QM8A 2X6AA 5CA3A 4UV9A 5L3GA 2V7QG 2ZXWC 2Q67A 3OEEG 1R3IC 2XASA 5B1AC 1JX9A 4MT8A 4XDJA 1Y4MA 4PDMA 1YJ9V 4FMTA 1GM8A 3CMAV 3GB7C 3CCVV 4N23A 4LC1A 1K97A 3CP1A 3H01A 4P30A 4X8AA 4PA9A 4JYCA 2KB1A 5L3EA 3OE7G 3BY6A 3TK1A 1ROPA 2GSMB 3LSQA 3SYAA 2Y48A 3HB3B 2IJJA 5KUMA 3CCQV 3CPWU 3AG4B 2DQ3A 2ITDC 4YXWG 2IH1C 3SYQA 3AG1C 3STZC 3T2MA 2EILC 3E83A 1Q7YW 5KA5A 4PDVA 1H8HG 1JJ2U 1NBMG 2EZOA 1GK9A 4MW8A 2HFEC 3W7XA 1M9NA 3F7VC 5CBGA 1GTOA 1SZTA 4UXNA 1NKDA 3FB8C 4G28B 4RQEA 1M56B 3ML0A 4ZBMA 1VQPV 2XAJA 3JD1A 3ZJZA 1YTFB 1JQ0A 2JIZG 4MVSA 4MW3A 5EBMC 3CC2V 1BHAA 3W7WA 1K5QA 3K03A 1QLNA 3CD6V 3ZRXA 4PDLA 1L1FA 2OCCC 1K4CC 1WLEA 4MVUA 3SYOA 3G6EV 3ZRVA 2YEVA 5KUKA 1W2BU 1KD1W 3W7SA 1M57B 2P90A 4CZZA 2QM7A 2WLLA 3FB6C 1N8RW 2UXNA 1M90W 1Y66A 1S72V 3CC4V 5H9CA 1OCRB 1EFRG 1SESA 2ITCC 3QO5A 4LCUC 5IDJA 3VOUA 2WLIA 2LFSA 3CCLV 3MHHC 1VQ6V 1PNKA 2X0LA 4MVRA 3K0GA 5EBLC 1H38A 2X7RB 1AJPA 1NR7A 2JDIG 1DTOA 2WLHA 3K0DA 1IXMA 1NH2D 3M99B 4LBEC 5IYCO 2OT5A 3G4SV 2HJFC 5LGTA 1AI7A 3SYCA 1YHQV 1R6NA 1TUEB 4WFBV 2R9RB 1P4RA 1BL8A 4XDKA 4GT1A 2OTLV 1QBZA 5DN6G 3SJQC 1DF4A 3FB7C 2A0LA 3OEHG 4WFGA 3I56V 2NNUA 2PI5A 1KECA 3ZRWA 2A79B 3FYEB 2BOBC 4U7NA 1W0JG 4ZKIA 4MTFA 4CBCA 1QLEB 5HFLA 3K08A 4RQFA 1BHBA 1EZJA 3NXSA 5EC2C 1QVFU 1OZ0A 2P7TC 1OCZC 3B8MA 4PDRA 2JJ2G 2R9IA 2P67A 3LUTB 2HKOA 4RO2A 4WFAV 4JTAB 2H8PC 1Q86W 2K1EA 4UVAA 1QR9A 2P6JA 5IYDO 1V55C 1K33A 3JD3A 3UKMA 2ZR3A 1ORQC 1YJNV 3K06A 3LDCA 4HYOA 1SERA 1XL4A 2DYSC 4WCEV 1J95A 1G4YB 1K9MW 4Z1MG 1ENVA 4PA6A 2X6BA 1G8MA 4JTCB 3CYOA 3MHSC 5FL7G 1OCCB 2NLJC 4TT3G 3QO8A 3X2QC 3ZMSA 3OUSA 4QPJA 2A9HA 1R73A 1WPXA 3E86A 3TETA 3E8GA 3E8BA 2DWEC 5B1AB 1YI2V 1GO3F 1M1KW 2WAMA 1MABG 1I5YA 1YSCA 3OAAG 1K5SA 5LHHA 1S0VA 4N21A 1R6KA 4F4LA 1Q82W 1K8AW 4BIUA 3IFXA 2X6CA 1LNQA 2W6IG 1FXKC 2DYRC 2EINC 1FFTB 2D3OW 1YITV 3T4DA 2Y69B 3AG3B 2HG5C 2YSUB 3LSSA 1CEZA 2GHYA 2EIJC 1R3JC 1NJIW 4BIZA 3OMNB 3SPJA 5LGNA 2Z5UA 4FIPC 1OHHG 1PKXA 1R3KC 1FS0G 3CCSV 5IYBO 1OCOB 1KKDA 2AHYA 3RVZA 2LFRA 3DTUB 3ABUA 3CCJV 2DWDC 2WLNA 3T4ZA 3FKSG 4P9PA 1K34A 3ABKB 3UM7A 1PD3A 3QO7A 5EK0A 1COWG 2EIMC 4DXWA 2Z3YA 4HZ3A 3AG4C 4KUMA 3QNEA 4QPKA 5E1AC 1NVPB 3SPGA 1AROP 1GM7A 5LBQA 1Q81W 3E89A 2WWWA 1I5XA 3ZIAG 2ZQMA 2UXXA 5H6RA 4R8CA 1YTFD 3CXCU 1VQMV 3STLC 3ABMB 4MVMA 4JF3A 4QJFB 4P9OA 2EBOA 1KQSU 2WPDG 3AEIA 3CCRV 4RUFA 4UV8A 5J9PC 1FXHA 3ZMZA 3OMIB 1M56C 3F7YC 2JK5C 1F4MA 4RAIA 4PA7A 3IGAC 3WG7B 3G71V 3JD0A 1K92A 2EIKB 2B5UA 2IU0A 2F43G 4R6ZA 4OXSA 1K3EA 5LGUA 3D3IA 3OR6C 3W7TA 4GX1A 1E1RG 1M57C 3LDDA 1F23A 3ASOB 3PJSK 2ATKC 4UVBA 2JEXA 3FYIB 1PNLA 4E2LA 4MS2A 1SRYA 1JCHA 2QTOA 4Q20A 1V54B 1JPXA 4G2KA 1UJWB 4WF9V 1NR1A 4U7OA 3P32A 2QE7G 2YEVB 3ZMTA 3SPIA 1DF5A 4MTOA 1RPOA 2WLLB 3ABTA 2Q69A 3JD2A 4WFEA 5B1BB 2ZR2A 4H33A 3WFVA 2JJ1G 1RM1B 3ETGA 4QNHB 1FXKA 3ZRSA 1VQKV 2WLIB 3DGEA 2PI4A 2B1GA 3ASNB 2JEUA 3P30A 1E1QG 2W0FC 2XNDG 1MOFA 5KA6A 2H94A 5B3SC 2DYSB 2EJRA 5H6QA 3SYPA 3I55V 5DM6V 1GMGA 5L3CA 1QLEC 1S5HC 3OFNG 2BOCC 1S76D 1VQ7V 1VQNV 1JVMA 1YJWV 5IY5B 4PA4A 3ZRWB 3BEHA 2ZXWB 3SPCA 2WLJA 5CMUA 2Q6AA 3AG2C 2WLKA 3CMEV 4PELA 1P7BA 4MVZA 1VQ9V 3OUFA 3CCMV 1XL6A 1S77D 3K9AA 3OW2U 2XOKG 2DYRB 4I9WA 1K73W 2IU3A 2EINB 5HFMA 1CP9A 1OCCC 4QE9A 2IH3C 4JAUA 1VQ4V 4L87A 1KP2A 5GW7A 1AI5A 2HLDG 4TSFG 4UVCA 2V1DA 3ABLC 3OR7C 4WFHA 4J9YB 3B8NA 3A0RA 1AJNA 2C2AA 4MTXA 5EC1C 1E79G 3K79A 3ZMUA 1VQ8V 3AG1B 4R50A 4JYBA 2B1IA 1VQLV 3E8FA 2EILB 3OM3B 2IJHA 5B1NA 5B1OA 1GM9A 3E8HA 4G27B 2FTKA 3FB5C 3JD4A 2Y69C 5CBFA 3AG3C 2IW5A 1VQOV 2EIMB 2DQ0A 3F5WC 3E35A 1QR8A 2IJKA 3SPHA 2QA4V 1R3LC 3LDEA 4I5SA 4JASA 1K7DA 1GKFA 4QE7A 4GCZA 1MG1A 2WLMA 3W7UA 1RPRA 2ZDIA 1THZA 2OCCB 1NVPD 4RUEA 1OCOC 3ZN1A 2HR3A 2W6JG 3ZCCA 2XAHA 4H37A 4GX0A 3HPLC 3ABKC 1CPYA 4XDLA 5LHGA 4TWKA 1VQ5V 3E2EA 2OTJV 3JYCA 2Q68A 4MVQA 1S3JA 4BW5A 2ZD9A 2IJIA 3ZN0A 3T1CA 4JTDB 1QVGU 5L3FA 1QCEA 1HWYA 4JPRA 4ASUG 3ABMC 2M7WA 5L3BA 1MSWD 3RW0A 1H8EG 3VBBA 1AR1B 1H2GA 5C93A 4MSWC 1YIJV 2CK3G 4P2ZA 3AAGA 2XAFA 1OCRC 4GX2A 3GWOA 2ZDIC 3IC7A 5L3DA 1NH2B 3RVYA 2DW4A 1JOYA 2XAGA 3OMAB 4R7CA 3R65A 1F4NA 5EBWC 4LP8A 1EBOA 1OCZB 3WG7C 2HVKC 3D36A 4FPPA 3JCZA 3ETEA 2EIKC 4EKWA 5CN0A 1V55B 3ASOC 4J9ZB 1AJQA 2WSSG 3K04A 3ZMVA 4GX5A 5B3SB 3TCUA 2QKSA 3RBZA 3EFFK 1V54C 5BZBA 3LNMB 1KC8W 5CBHA 1AI6A 1DLBA 2QEXV 4PA3A 1K4DC 1W0KG 1KP3A 1FXVA 1SETA 4FJCC 3OGCC 3MD0A 5B1BC 3X2QB 4DO2A 1RM1C 4UUJC 4JGSA 1B6QA 4KFMA 3CCEV 3ASNC 2MK3A 1F51A 3AG2B 1NQTA 1AI4A 4X89A 4HAMA 4MTGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BAY A;  5DN6 G;  2XAQ A;  5LHI A;  2WPD G;  3OEH G;  4UV8 A;  4XBF A;  1W0J G;  3ZMZ A;  2IW5 A;  2JJ2 G;  2R9I A;  2HKO A;  1BMF G;  5L3G A;  4UV9 A;  2V7Q G;  3OEE G;  4UVA A;  2XAS A;  2F43 G;  5LGU A;  1E1R G;  3ZN1 A;  4UVB A;  2W6J G;  2XAH A;  4Z1M G;  5L3E A;  3OE7 G;  5LHG A;  2QE7 G;  3ZMT A;  5FL7 G;  2Y48 A;  4TT3 G;  3ZMS A;  3ABT A;  3ZN0 A;  4YXW G;  2JJ1 G;  5L3F A;  4ASU G;  1MAB G;  5LHH A;  3OAA G;  5L3B A;  1E1Q G;  1H8E G;  2XND G;  1H8H G;  2H94 A;  2EJR A;  1NBM G;  2CK3 G;  2W6I G;  5H6Q A;  2XAF A;  5L3C A;  5L3D A;  3OFN G;  4UXN A;  2DW4 A;  2XAG A;  2XAJ A;  2JIZ G;  5LGN A;  2Z5U A;  1OHH G;  1FS0 G;  2WSS G;  3ZMV A;  4CZZ A;  2UXN A;  3ABU A;  2XOK G;  3FKS G;  1EFR G;  1W0K G;  1COW G;  2X0L A;  2Z3Y A;  2HLD G;  4KUM A;  2JDI G;  4TSF G;  4UVC A;  2V1D A;  5LBQ A;  3ZMU A;  3ZIA G;  1E79 G;  5LGT A;  2UXX A;  5H6R A; 
#chains in the Genus database with same CATH topology
 3B77 A;  1WNS A;  4JAV A;  3CS5 A;  5FPO A;  1EN6 A;  5LP6 A;  2P22 C;  1MZE A;  3K58 A;  4XBF A;  1YCI A;  3CC7 V;  4CS3 A;  2EZP A;  1BMF G;  2O57 A;  4DV0 O;  3ABL B;  4HYV A;  2QM8 A;  4DYL A;  3B4S A;  2XAS A;  3U0Z A;  1JX9 A;  1U96 A;  4MT8 A;  1Q3E A;  4XDJ A;  4DR5 B;  1YJ9 V;  3RYI B;  2Y4T A;  3BA8 A;  3H01 A;  4P30 A;  4CH4 A;  2NR5 A;  2JGD B;  1TUB A;  1B06 A;  3CE2 A;  5IE9 A;  5L3E A;  3OE7 G;  1F3X A;  3TK1 A;  5JJJ B;  5KUM A;  4ABM A;  1HNW O;  2DQ3 A;  1R1B A;  4O4H B;  1XMO O;  5K1P A;  2AXT Z;  4DRX B;  4O2A B;  3SYQ A;  3AG1 C;  3VQX A;  1Q7Y W;  3OD4 A;  1H8H G;  2Q7E A;  1LUV A;  2LO1 A;  1WPB A;  3QV7 A;  2EZO A;  1XHX A;  2E5L O;  4NXN O;  4JI2 O;  4KRZ A;  1SZT A;  3GQY A;  3JAK A;  1VQP V;  3JSL A;  1JQ0 A;  1BHA A;  4U3J B;  4B7K A;  3W7W A;  1K5Q A;  1ZAU A;  3K03 A;  4YJ3 A;  2WA4 A;  4JI8 B;  4IHJ A;  4UFZ A;  2ARH A;  2OCC C;  1L1F A;  4MVU A;  1WLE A;  3EXA A;  3ZRX A;  4LF4 O;  3DC6 A;  3W7S A;  1M57 B;  4CZZ A;  1M90 W;  2UXN A;  4JI4 O;  1WP8 A;  4DV4 B;  4AQY O;  4LCU C;  4QG8 A;  3R66 A;  3CCL V;  3MHH C;  1VQ6 V;  4NXM O;  3K0G A;  4AIL C;  2LGW A;  1AJP A;  1DTO A;  1E0U A;  4UCS A;  1S5J A;  1IXM A;  3M99 B;  5IYC O;  2OT5 A;  4I4T B;  3D3Q A;  3G4S V;  3SYC A;  4A5U B;  1R6N A;  1VEW A;  1TUE B;  4LFB B;  4DR6 O;  4WFB V;  3SJQ C;  2QJ1 A;  2QDO A;  3OTF A;  1FD9 A;  2M6Y A;  1XDC A;  3G67 A;  2PI5 A;  4C7U A;  3JAW A;  1T5E A;  4ZKI A;  1QLE B;  5HFL A;  4J42 A;  1EZJ A;  2N04 A;  4BWA A;  2CTR A;  5JVD B;  4YNG A;  3AG7 A;  1IDS A;  3U11 A;  2K1E A;  4IMA A;  1QR9 A;  2YIC A;  5IYD O;  2V4D A;  2YXH A;  1ORQ C;  4LNU B;  1YJN V;  2ZE5 A;  3LDC A;  1XL4 A;  2DYS C;  3HQN A;  3DC5 A;  4O4I B;  1QU7 A;  2MW2 B;  4PA6 A;  4J7K A;  4JTC B;  4NB5 A;  1GN3 A;  3OUS A;  1WJZ A;  3E86 A;  2H3O A;  1IBM O;  1GO3 F;  5K1X A;  1M1K W;  3H6O A;  3J81 N;  1K5S A;  2F95 B;  1R6K A;  1Q6U A;  1NTZ H;  1BT8 A;  1M93 A;  3QVN A;  4LR3 A;  4IL6 Z;  3SJB C;  1NZ6 A;  1Q43 A;  1TVK B;  3E0V A;  3LSS A;  1CEZ A;  1JMK C;  1DK1 A;  1AP5 A;  1WB7 A;  2EIJ C;  1AVM A;  1NJI W;  3SPJ A;  5LP6 B;  2Q7G A;  2F4V B;  1FS0 G;  2F66 C;  4F6E A;  1WAZ A;  4FLU A;  2Q0A A;  1FAF A;  2DE0 X;  1AQF A;  1K34 A;  3UM7 A;  1FPO A;  4DR4 B;  1COW G;  1I94 O;  1MZF A;  2GUZ A;  4QPK A;  3AG4 C;  4DW1 A;  4DR3 O;  1HDJ A;  4B3R B;  1XNQ O;  1TUB B;  1Q6I A;  3E89 A;  4DV3 O;  4TV9 A;  3ZHU A;  4LFC B;  4TUY A;  4JF3 A;  4QJF B;  4TQD A;  5JQG A;  3P3N A;  4UV8 A;  3WB0 A;  1PL4 A;  4I0X A;  3A2F A;  2QWP B;  3WG7 B;  3ZHR A;  4FLV A;  2IU0 A;  1SQP H;  4OXS A;  1F23 A;  4FFB B;  3JAK B;  4CH6 A;  1R6T A;  3UQ8 A;  1N33 O;  4YJ3 B;  2HHH B;  1IBL B;  3N25 A;  1UJW B;  4IHJ B;  3F5T A;  3RYC A;  3CRC A;  1A5U A;  3MA8 A;  2F1M A;  1DF5 A;  1HNX B;  3CWB H;  2LGQ A;  3BJF A;  3JAM N;  3LSU A;  2DN9 A;  3ETG A;  4QNH B;  1FXK A;  3L72 H;  4X64 B;  4GKK B;  2B1G A;  2JEU A;  1Q8I A;  1E1Q G;  2LJ2 A;  2W0F C;  1MOF A;  5KA6 A;  3L75 H;  3QTC A;  4AHC A;  2YIA A;  3M7M X;  5KLV H;  1S5H C;  1ZX3 A;  3HKD A;  3OFN G;  2RN9 A;  4ZI7 A;  2R70 A;  2UXC B;  4DR5 O;  3C3T A;  3N2K A;  4U3F H;  4GUN A;  3BEH A;  2ZXW B;  3JAW B;  3RYF A;  1HR0 B;  4EEQ A;  3AG2 C;  1A49 A;  3D36 C;  4OPH A;  1VQ9 V;  3I5D A;  4FZ0 A;  2G38 A;  3K9A A;  2XOK G;  2P5O A;  5CA0 A;  3SRF A;  4I9W A;  1K73 W;  2EIN B;  1VF6 A;  5DED A;  4B08 A;  3A0B Z;  4CH3 A;  4G1N A;  4L87 A;  2UUA B;  5GW7 A;  4O2B A;  3OR7 C;  3BHP A;  5A9G A;  2C2A A;  3K79 A;  1VQ8 V;  1N32 B;  3CB2 A;  3E8F A;  2EIL B;  2EUL A;  4F6R A;  1PM9 A;  3E8H A;  2QKC A;  1KUQ A;  3K57 A;  2EJ7 A;  3FB5 C;  5JJN B;  5EZY A;  5IJ0 A;  2Y69 C;  3ICX A;  5IWA O;  1SQV H;  3AG3 C;  2A3Q A;  4JI8 O;  2EIM B;  2DQ0 A;  1QR8 A;  2IJK A;  2YXL A;  2QA4 V;  4JI7 O;  2QSA A;  1DGS A;  1GKF A;  4X20 A;  3TXQ A;  3B09 A;  1Y74 A;  2W0X A;  1FFX A;  3ZN1 A;  3ZCC A;  4H37 A;  3ZBH A;  4EB6 A;  5J2T A;  3FAV A;  1CPY A;  4TWK A;  2Q68 A;  3AK2 A;  2GTA A;  4LF5 B;  2BTQ A;  1QCE A;  4OX9 B;  5H2F Z;  4ASU G;  2GDS A;  3ABM C;  3RGB A;  1MSW D;  2GUZ B;  2CK3 G;  4K8Z A;  5JCO C;  2DMX A;  3KZI Z;  2VGI A;  2XAF A;  3IC7 A;  4TV9 B;  2DW4 A;  4DW0 A;  4TUY B;  1F4N A;  5EBW C;  3T0T A;  4FLX A;  1Y6X A;  5KHJ A;  3JCZ A;  5JQG B;  2EIK C;  4EKW A;  1YVW A;  2YUA A;  1V54 C;  5KHG A;  1KC8 W;  2PYL A;  2QEX V;  4RPP A;  1K4D C;  3RYI A;  2E76 B;  5E79 Z;  4B3S B;  1SET A;  4DV7 O;  5BY1 A;  4DV1 B;  5LYJ A;  3L9D A;  3RYC B;  1W59 A;  2AZ2 A;  1ZWI C;  4MVO A;  4BAY A;  3B2E E;  4QIW F;  3ETD A;  3HR0 A;  3CCU V;  4Z2W A;  2R72 A;  1FXK B;  3BAA A;  4X88 A;  4NTX A;  1XMQ O;  2AHZ A;  2LP7 A;  1PL0 A;  3KG2 A;  5ITZ A;  2X6A A;  5CA3 A;  3DSQ A;  1KKC A;  1R3I C;  1Y4M A;  4PDM A;  1H2S B;  3GB7 C;  3HKD B;  4ZI7 B;  4N23 A;  5LMU O;  1K97 A;  2JVD A;  5AG2 A;  5F2V O;  4X8A A;  4DR4 O;  3HKB A;  4PA9 A;  3H1H H;  3N2K B;  4JV5 B;  1QHT A;  2UXD O;  3RYF B;  4LF7 B;  1ROP A;  1N34 B;  3HB3 B;  4IYH A;  4J7J A;  3CCQ V;  3LNN A;  3Q4H A;  1AP6 A;  5CA0 B;  2IH1 C;  3CXH F;  3STZ C;  2CGO A;  5D5P A;  4IGG A;  2E28 A;  2ODM A;  2QKA A;  3E83 A;  2YIB D;  4FM1 A;  1JJ2 U;  4PI0 A;  1LR1 A;  2YXY A;  4O2B B;  1ZLZ A;  2XT9 A;  2VRZ A;  3F7V C;  3S3W A;  5CBG A;  2AGA A;  5LMN B;  1NKD A;  1I7F A;  4G28 B;  4F6R B;  4RQE A;  1M56 B;  3ML0 A;  1TGO A;  3JD1 A;  3ZJZ A;  2OWO A;  2JIZ G;  5EBM C;  2BTO A;  4LWS A;  5EZY B;  1IBL O;  5IJ0 B;  1T5A A;  3G6E V;  2YEV A;  3EVK A;  1N8R W;  2WLL A;  1HNX O;  3KTX A;  2ETN A;  3JAT A;  3NR7 A;  3AK1 A;  1SES A;  2WLI A;  4X20 B;  2LFS A;  1Y74 B;  1PNK A;  2X0L A;  3CRA A;  4DK1 A;  1FFX B;  4X64 O;  3P3P A;  1H38 A;  1XQ8 A;  1YZB A;  4X1K A;  4JI0 B;  3K0D A;  5B5E Z;  4LBE C;  4EB6 B;  5J2T B;  3FAV B;  4FZ1 A;  5LGT A;  2VQF O;  2OTL V;  4I9Q A;  3QF7 A;  4FVM A;  4J7Z A;  2UXC O;  2BTQ B;  3FB7 C;  2A0L A;  2L35 A;  2RCV A;  2KG7 A;  2NNU A;  4WFG A;  5JJE B;  3FYE B;  4U7N A;  1W0J G;  4CBC A;  1BHB A;  4RQF A;  3NXS A;  3IAY A;  1X4T A;  1OCZ C;  2P67 A;  4X65 B;  2PY5 A;  4ZOL A;  1Q86 W;  4UVA A;  3MAQ A;  1V55 C;  3JD3 A;  3GWK C;  3VQV A;  4X66 B;  5KHK A;  3SRK A;  1P7G A;  1XBL A;  2UUA O;  1K9M W;  1ENV A;  4JAA A;  3ZHQ A;  4ZHQ A;  1G8M A;  1B04 A;  1OCC B;  2PF4 E;  4TT3 G;  1L0N H;  1R73 A;  2ZE6 A;  1YI2 V;  2ADP A;  2WAM A;  5LHH A;  3JSN A;  4N21 A;  4K0K B;  4JI6 B;  3J7A U;  4BIU A;  2X6C A;  5LYJ B;  2LW7 A;  3T1Y O;  2DYR C;  2YDE A;  2G50 A;  1FFT B;  1KU9 A;  3O65 A;  2RMK B;  2GHY A;  4FM0 A;  1IZ3 A;  1EZV H;  5LGN A;  1ZUQ A;  1EN4 A;  4KHP B;  1M4U A;  3DTU B;  3CCJ V;  5ITZ B;  2DWD C;  2WLN A;  4QGP A;  3FKS G;  4LF5 O;  1SQQ H;  3QO7 A;  4OX9 O;  5EK0 A;  4FFB A;  4KUM A;  1SQB H;  3HKB B;  1ARO P;  5LBQ A;  4B3T B;  2WWW A;  1I5X A;  4W4L A;  2ZQM A;  2ZM6 B;  3CHX A;  1VQM V;  3STL C;  4MVM A;  4I7Z B;  4GZR B;  1F7Y A;  2WPD G;  3Q4H B;  4RUF A;  4UCU A;  2UU9 B;  5EIB D;  2GTS A;  3C90 A;  1KYO F;  1NTK H;  3VQY A;  2E3C A;  3IGA C;  3G71 V;  3K5L A;  1HNZ O;  5KHH A;  2B5U A;  3BVO A;  2F43 G;  5LGU A;  3D3I A;  3ZS8 C;  4QG9 A;  4GX1 A;  1M57 C;  3LDD A;  3ASO B;  3PJS K;  1BGY H;  4LWS B;  3P32 A;  3K59 A;  2YEV B;  3ZMT A;  1YEW A;  4MTO A;  1RPO A;  2WLL B;  3JD2 A;  2RNB A;  5B1B B;  5KAF Z;  4LF8 O;  3JAT B;  1RM1 B;  2Q0O C;  4B3M B;  2WLI B;  3DGE A;  3ASN B;  4DUZ B;  1Q6H A;  3ETQ A;  4LF6 B;  2DYS B;  4X1K B;  4YJ5 A;  3N27 A;  4O4J A;  4KCV A;  4GYC B;  1GMG A;  1N4C A;  4FM2 A;  1QLE C;  3H9V A;  4Q6G A;  4DV6 B;  1JVM A;  2CH7 B;  5IY5 B;  2UUB O;  2KG7 B;  4UB6 Z;  3BRC A;  2WLJ A;  5CMU A;  3L74 H;  3H1K H;  4MVZ A;  2VGB A;  1N34 O;  3OUF A;  4ZOL B;  3OW2 U;  1PP9 H;  1GN4 A;  2YIB A;  3T1H O;  3U10 A;  5GON A;  3OT7 A;  2IH3 C;  1VQ4 V;  4DR7 O;  4JI1 B;  2HLD G;  3PN1 A;  2CTQ A;  3A0R A;  4MTX A;  4ZHQ B;  4X62 O;  2OYQ A;  2B1I A;  1VQL V;  3OM3 B;  4O4L A;  2K9P A;  2IJH A;  5LMN O;  1SKV A;  4G27 B;  1VP7 A;  3QV8 A;  2HEP A;  2CTP A;  1ZJH A;  1IBK B;  1LUW A;  3F5W C;  3SPH A;  3LDE A;  5LP6 C;  4JAS A;  4DV2 B;  4GCZ A;  3W7U A;  1RPR A;  2YI9 A;  4YJ2 A;  4RUE A;  4D6T H;  3C3S A;  3OTO O;  2W6J G;  1VIB A;  1US6 A;  1BSM A;  1KB9 F;  1X59 A;  5FPR A;  3APO A;  4JI3 B;  1PPJ H;  4XDL A;  3SGI A;  4K3A A;  2QR4 A;  4BW5 A;  5C8Y A;  2Q4P A;  3T1C A;  4CC5 A;  3A8T A;  2PTM A;  2ZNJ A;  1HWY A;  1N36 B;  4YY3 O;  5DEC A;  4B7E A;  3H1J H;  1H8E G;  3VBB A;  1AR1 B;  5C93 A;  5KHI A;  1N0J A;  4I55 A;  3AAG A;  1OCR C;  4OPA A;  2JS3 A;  2ZDI C;  1XOU A;  2XAG A;  1J5E O;  1EBO A;  1FJG B;  4DUY B;  3WG7 C;  2E75 B;  4X66 O;  2UXB B;  4J9Z B;  2WSS G;  3K04 A;  3ZMV A;  3DXR A;  4CC6 A;  5BZB A;  3LNM B;  1L8D A;  4LH7 A;  1DLB A;  4PA3 A;  3RWR D;  3MD0 A;  3X2Q B;  5GTI Z;  3J80 N;  1H2M A;  3AG2 B;  1NQT A;  1AI4 A;  3CX5 F;  4KP4 A;  1QQC A;  2XAQ A;  4FK5 C;  4JI5 B;  3K3W A;  4ICG A;  1RSO A;  3ZHT A;  3EHB B;  4O4J B;  5L3G A;  4UV9 A;  1ZL8 A;  2ZXW C;  5B1A C;  2Q67 A;  4KHP O;  4FMT A;  3K5M A;  4I50 A;  4HBN A;  3CP1 A;  1VMG A;  1B3Q A;  1SA0 A;  5A2Q N;  2KB1 A;  1HW7 A;  3BY6 A;  2GSM B;  3LSQ A;  2Y48 A;  1IX9 A;  2ZM6 O;  2QWN B;  5B66 Z;  4YXW G;  5GON B;  5J2U A;  4DV4 O;  2EIL C;  1AR5 A;  4DV0 B;  5KA5 A;  1YDX A;  1MA1 A;  4PDV A;  4HYW A;  1NBM G;  4YHH B;  1GK9 A;  1JJO A;  2HFE C;  3W7X A;  1AR4 A;  1OJH A;  4PD4 F;  2JRI A;  4UXN A;  4O4L B;  1YTF B;  4LFB O;  4MW3 A;  3CC2 V;  2ZIN A;  4PDL A;  2IM9 A;  1K4C C;  2UUC B;  4H13 B;  3SYO A;  3ZRV A;  1KD1 W;  2DOS A;  1XMO B;  2P90 A;  2QM7 A;  3FB6 C;  3CC4 V;  3SJA C;  3HQP A;  1Y66 A;  1S72 V;  2VS0 A;  4JYA B;  1EFR G;  4OGQ B;  2ITC C;  3VOU A;  2Q5Z A;  1L0L H;  4YJ2 B;  4FLZ A;  5EBL C;  4MVR A;  2RQ6 A;  4NXN B;  2X7R B;  4JI2 B;  4EFE A;  1NR7 A;  2JDI G;  2VQE B;  5IYZ A;  4DUZ O;  3CRR A;  3S3X A;  1AI7 A;  4JZG A;  1YHQ V;  4QGC A;  4UCV A;  1H2K A;  2R9R B;  1BL8 A;  1XNR B;  5C8Y B;  5DN6 G;  4LF4 B;  2ZT9 B;  3FFQ A;  3OEH G;  4DV6 O;  1KEC A;  2A79 B;  3SRH A;  2BOB C;  5EC2 C;  1QVF U;  1OZ0 A;  3B8M A;  4JI4 B;  4AQY B;  2R9I A;  2H8P C;  4I55 B;  1JA8 A;  1MMM A;  3UKM A;  2ZR3 A;  3K06 A;  4K8X A;  1FYJ A;  4HYO A;  4K35 A;  4WCE V;  4Z1M G;  1Q90 D;  1O9H A;  4DR6 B;  4RWU A;  3O9O A;  3MHS C;  2NLJ C;  4DV5 B;  3QO8 A;  3ZMS A;  2F4V O;  4QPJ A;  3DXR B;  1GN2 A;  2R9A A;  2DWE C;  3IS4 A;  2A7W A;  1YSC A;  1S0V A;  3JCU Z;  4F4L A;  2PUS A;  2P4V A;  3JAR A;  3UO2 A;  1K8A W;  1LNQ A;  4WBN B;  2W6I G;  1IBK O;  3RT3 C;  1VP8 A;  1FXK C;  4B3R O;  1T57 A;  1YIT V;  1EN5 A;  2XHB A;  3T4D A;  4BIZ A;  2ZCE A;  3OMN B;  4D7T A;  4LFC O;  3ZHV A;  2QWO B;  1OHH G;  3SRD A;  1RSO B;  1VF7 A;  5IYB O;  1IBM B;  1OCO B;  1V9P A;  1KKD A;  2AHY A;  1ZTE A;  3RVZ A;  2LFR A;  4PV1 B;  5FNV A;  1ZL8 B;  3T4Z A;  4P9P A;  3ABK B;  4DK0 A;  4I50 B;  4LFA B;  4LH6 A;  4DXW A;  2Z3Y A;  4HZ3 A;  5E1A C;  1SA0 B;  4TV8 A;  2PZS A;  1Q81 W;  2Q8V A;  2HHH O;  5H6R A;  1YTF D;  4PI2 A;  3CXC U;  4P9O A;  2EBO A;  1KQS U;  4YIO A;  1M5I A;  3CCR V;  1WP7 A;  1Z5W A;  1FXH A;  5J2U B;  3ZMZ A;  3KKY A;  1M56 C;  1SQX H;  3F7Y C;  4GKK O;  1A32 A;  4PA7 A;  3WB1 A;  3JD0 A;  1PKY A;  1K92 A;  1I94 B;  4R6Z A;  1K3E A;  4DR3 B;  3OR6 C;  2FKX A;  3H1L H;  4BR6 A;  4UVB A;  4GKJ B;  3FYI B;  4DV3 B;  1JCH A;  5LA6 A;  2CH7 A;  4U7O A;  4FLY A;  2QE7 G;  3L73 H;  1KBH A;  1U97 A;  1N0N A;  1HR0 O;  3ABT A;  2Q69 A;  4WFE A;  3GVM A;  2ZR2 A;  3WFV A;  3ZRS A;  1VQK V;  3HKE A;  4JI5 O;  2IBZ H;  2XND G;  1SZX A;  2H94 A;  1MSD A;  5B3S C;  2EJR A;  5IYZ B;  1BCC H;  4UCR A;  3SYP A;  4PHZ A;  5DM6 V;  4BIO A;  1A3W A;  1WA8 A;  1N33 B;  1XUQ A;  1N32 O;  1S76 D;  5EYP A;  3TJT A;  2E74 B;  3U2Z A;  1XIL A;  1UFI A;  1XEQ A;  2WLK A;  3CME V;  1P7B A;  3PP7 A;  5LOV A;  2Y0I A;  3BA9 A;  1XL6 A;  3CCM V;  2QWQ B;  2L6L A;  1H2N A;  2DYR B;  2IU3 A;  1YF2 A;  1OCC C;  1JFF B;  1KP2 A;  1AI5 A;  3N2G A;  4TSF G;  2V1D A;  1XRE A;  3ABL C;  3CRQ A;  4J9Y B;  4YHH O;  3ZMU A;  1E79 G;  2CGN A;  1PKM A;  3AG1 B;  1SS3 A;  3IC9 A;  5BMV A;  2F23 A;  5B1O A;  1GM9 A;  4KCT A;  4UCT A;  2FTK A;  3JD4 A;  1KMI Z;  1IXB A;  2A06 H;  4QG6 A;  2OIG A;  3UT5 A;  2IW5 A;  2UUC O;  4FLT A;  1VQO V;  2BE3 A;  3JAR B;  1R3L C;  1PKN A;  3CJH A;  1K7D A;  4LF9 B;  2WLM A;  3G2G A;  2ZDI A;  1THZ A;  5BR8 B;  2OCC B;  4JYA O;  4GX0 A;  3HPL C;  3AK3 A;  2VQE O;  3E2E A;  2KSD A;  3JYC A;  4MVQ A;  1S3J A;  3E0W A;  2ZD9 A;  3A0H Z;  4NR1 A;  4GLX A;  1XNR O;  5FNV B;  5IWA B;  1GH6 A;  2FML A;  1QVG U;  1FKA O;  2ZNI A;  4EFB A;  4JPR A;  1E0T A;  2JS5 A;  5L3B A;  2M7W A;  3IJ4 A;  4IYI A;  5CB4 A;  4JI7 B;  1YIJ V;  4TV8 B;  4B3S O;  4P2Z A;  1IUR A;  5L3D A;  3QG5 A;  2Z0A A;  1NH2 B;  4DV1 O;  2HVK C;  3D36 A;  4FPP A;  5CN0 A;  3ASO C;  1AJQ A;  1Y76 A;  4ZIB A;  4GX5 A;  1IVS A;  2LW1 A;  1D5N A;  3EFF K;  3BPZ A;  4DV5 O;  4JPG A;  1AI6 A;  3UO3 A;  2YI8 A;  3QV9 A;  1W0K G;  2F93 B;  1SF9 A;  5KAI Z;  3OGC C;  5JH7 A;  5B1B C;  5KMG A;  5GTH Z;  2RJZ A;  4DO2 A;  1RM1 C;  5LA6 B;  4IIJ A;  3K5O A;  1BZK A;  4JGS A;  5D5Q A;  1B6Q A;  4KFM A;  3CCE V;  3ASN C;  3L70 H;  3SR2 C;  1F51 A;  4JV5 O;  4X89 A;  3QV6 A;  2GBO A;  4MTG A;  4DR1 B;  1PNM A;  4LF7 O;  4WFF A;  5LHI A;  4FXF A;  3ZHS A;  3T05 A;  3HKE B;  2PGG A;  4NTY A;  2OCH A;  4X1Y A;  4FXJ A;  2HVJ C;  5IY5 C;  2WA3 A;  2EIJ B;  1I08 A;  4H0L B;  1JR9 A;  2V7Q G;  3OEE G;  2QWR B;  4BW9 A;  2RDC A;  1GM8 A;  3CMA V;  4KXR A;  3CCV V;  1WA8 B;  4DV7 B;  4LC1 A;  2N05 A;  3BAB A;  3OGI B;  5IJ9 A;  5EYP B;  4LFA O;  4JYC A;  4FFK A;  5H5N A;  3SYA A;  1BS3 A;  2IJJ A;  2AW9 A;  5LOV B;  3CPW U;  3AG4 B;  4CS2 A;  2ITD C;  5JCO A;  1XMQ B;  3T2M A;  2P06 A;  1AB3 A;  3N2G B;  3SDL A;  1GAX A;  3CSX A;  2HP8 A;  4MW8 A;  5BXZ A;  4DR2 B;  5LMU B;  3KCY A;  1M9N A;  4JI0 O;  1Q5O A;  1GTO A;  4JYY A;  4AI8 A;  2KQX A;  3FB8 C;  4ZBM A;  2BCC H;  2XAJ A;  5BMV B;  2UXD B;  2ZIM A;  4MVS A;  4GKJ O;  1QLN A;  1NTM H;  3CD6 V;  2CTW A;  1BE3 H;  4X9Q A;  5KUK A;  1W2B U;  3UT5 B;  1AIL A;  4DRS A;  3CJH B;  5H9C A;  1OCR B;  4X65 O;  3QO5 A;  5IDJ A;  4D7S A;  2WLH A;  2VWJ A;  2DJV A;  1NH2 D;  2B9Z A;  2BSK A;  2HJF C;  1VAR A;  1F3W A;  1TAE A;  5FLX N;  1P4R A;  5TIS Z;  4L8J A;  4XDK A;  4GT1 A;  1QBZ A;  1DF4 A;  3THO A;  4KCW A;  3I56 V;  3ZRW A;  1P49 A;  3CRM A;  4MTF A;  3K08 A;  1XI1 A;  5CB4 B;  2P7T C;  4PDR A;  3WB2 A;  2JJ2 G;  3LUT B;  2HKO A;  2JGU A;  4RO2 A;  4WFA V;  4JTA B;  1XHZ A;  1WN7 A;  4CS4 A;  3RYH A;  4WBN A;  4K0K O;  2P6J A;  4JI6 O;  1K33 A;  1OV9 A;  1SER A;  3BJT A;  1J95 A;  1G4Y B;  2VQF B;  4NKG B;  2X6B A;  3K9S A;  3CYO A;  1Y76 B;  5FL7 G;  4KCU A;  3X2Q C;  2A9H A;  1WPX A;  3TET A;  2ZE7 A;  3MDS A;  3E8G A;  3E8B A;  5B1A B;  3T07 A;  2CDY A;  5CA1 A;  1MAB G;  3JAL A;  1I5Y A;  3OAA G;  3GR4 A;  2VGG A;  5JH7 B;  5KMG B;  1Q82 W;  1ZSP A;  3IFX A;  3QTG A;  3G6B A;  4IIJ B;  2LQT A;  1SC5 B;  2EIN C;  3JAS A;  2D3O W;  2XTA A;  4B2D D;  4LF9 O;  4B3T O;  2Y69 B;  3AG3 B;  2HG5 C;  2YSU B;  2ADQ B;  5BR8 O;  2YID A;  3APQ A;  2Y4U A;  1R3J C;  1TA8 A;  3E22 A;  3ME3 A;  1NU1 H;  2Z5U A;  3KCX A;  4FIP C;  1WB8 A;  1EM1 A;  1PKX A;  1R3K C;  3CCS V;  4X1Y B;  2UU9 O;  3FX7 A;  3HKC A;  3G80 A;  3ABU A;  3RN4 A;  2YS8 A;  1PD3 A;  1O9G A;  2EIM C;  3T1Y B;  3QNE A;  1NVP B;  5IJ9 B;  3SPG A;  5LXT A;  1GM7 A;  1NI8 A;  3ZIA G;  3CEI A;  3HQO A;  2UXX A;  4R8C A;  2VGF A;  1HNW B;  3ABM B;  4HNA A;  4KS0 A;  1P84 F;  1PV0 A;  2N74 A;  3AEI A;  4J41 A;  4X1I A;  4E4E A;  5J9P C;  3OMI B;  5KX5 A;  2E5L B;  4B3M O;  2JK5 C;  1F4M A;  4RAI A;  3B40 A;  4Z1V A;  4LF6 O;  2EIK B;  3TXS A;  3W7T A;  1E1R G;  2ATK C;  1MNG A;  3RFR A;  2JEX A;  1PNL A;  4E2L A;  2NN4 A;  1NT2 B;  1SRY A;  4MS2 A;  2QTO A;  1GRJ A;  2EX3 A;  4Q20 A;  1V54 B;  1JPX A;  4G2K A;  4WF9 V;  1H2L A;  1NR1 A;  3SJC C;  3SPI A;  2Y0P A;  4DR1 O;  4H33 A;  2JJ1 G;  4NXM B;  4WJ8 A;  1BQ0 A;  2PI4 A;  3P30 A;  4I0X B;  1HNZ B;  1QNM A;  4UCO A;  4UB8 Z;  1JFF A;  5H6Q A;  4JI1 O;  3I55 V;  2BSK B;  5L3C A;  2AZ0 A;  4W4K A;  2BOC C;  4YIP A;  2CUG A;  2CE4 A;  2KKW A;  2JGD A;  1VQ7 V;  1VQN V;  4IP7 A;  1YJW V;  4PA4 A;  3ZRW B;  3SPC A;  3BCC H;  2Q6A A;  1VF5 B;  4PEL A;  4LF8 B;  4TOI A;  1Z5V A;  2QM4 A;  1S77 D;  3D8C A;  3RYH B;  4O4H A;  3BFR A;  4DRX A;  4O2A A;  5HFM A;  1CP9 A;  4QE9 A;  4JAU A;  2ZIO A;  4DV2 O;  3VQW A;  4UVC A;  3TGU H;  1UPG A;  4WFH A;  2PYJ A;  1RP3 B;  3B8N A;  1Y67 A;  1AJN A;  3H1I H;  5EC1 C;  4DR2 O;  2ZE8 A;  4R50 A;  4JYB A;  2Q73 A;  2FB5 A;  4JI3 O;  2UUB B;  1URF A;  5B1N A;  2FYU H;  4U3J A;  3ZED A;  1CXZ B;  3FD9 A;  2VWK A;  3K5N A;  2QTS A;  5CA1 B;  3JAL B;  5CBF A;  4J11 A;  3T1H B;  2D2C B;  1N36 O;  3E35 A;  3M8A A;  2FL4 A;  5IT9 N;  4I5S A;  1G1X B;  4DR7 B;  4QE7 A;  3L71 H;  1MG1 A;  1VF6 C;  3JAS B;  1SQG A;  1NVP D;  1OCO C;  2HR3 A;  2P4K A;  2XAH A;  4IT5 A;  4X62 B;  3E22 B;  1PKL A;  1FJG O;  4I4T A;  4DUY O;  3ABK C;  1A3X A;  2QGN A;  5LHG A;  1VQ5 V;  2UXB O;  2OTJ V;  4JZ2 A;  4CH5 A;  3HKC B;  5LL6 Y;  2IJI A;  2ILM A;  3ZN0 A;  4J80 A;  4JTD B;  4J10 A;  5L3F A;  2CAZ C;  4PJ0 Z;  4NTW A;  1S5L Z;  1D2D A;  4H44 B;  3RW0 A;  1XNQ B;  1RFY A;  5EIB C;  1H2G A;  5JVD A;  4MSW C;  3GG8 A;  5LXT B;  1BQZ A;  4GX2 A;  3OTO B;  3GWO A;  4LNU A;  2Q7H A;  3RVY A;  2ZKO A;  1JOY A;  3OMA B;  4R7C A;  3R65 A;  4HNA B;  4LP8 A;  1OCZ B;  4O4I A;  3ETE A;  4X1I B;  1G6U A;  1V55 B;  1SQF A;  5KX5 B;  4FLW A;  5B3S B;  3TCU A;  2QKS A;  3RBZ A;  1Z2G A;  2YC0 A;  1I0H A;  2HJD A;  4NYK A;  4YY3 B;  5CBH A;  3UCS C;  2Q9L A;  2XUM A;  4KL1 A;  1D5A A;  4TQF A;  5JWP A;  1NS1 A;  1GN6 A;  3ZX6 A;  1KP3 A;  1FXV A;  4FJC C;  2GV9 A;  3WU2 Z;  4B2D A;  3EOE A;  1HP8 A;  4UUJ C;  1YXB A;  1J5E B;  2MK3 A;  2OIE A;  4HAM A;  1TVK A;  4NVP A;  3KHD A; 
#chains in the Genus database with same CATH homology
 1ZWI C;  3B77 A;  4MVO A;  4BAY A;  4KP4 A;  4JAV A;  1PNM A;  4WFF A;  2XAQ A;  4QIW F;  5LHI A;  3ETD A;  3CCU V;  4FK5 C;  1FXK B;  4XBF A;  3K3W A;  4X88 A;  3CC7 V;  2AHZ A;  2LP7 A;  1PL0 A;  2EZP A;  3KG2 A;  2HVJ C;  1BMF G;  5IY5 C;  3ABL B;  3EHB B;  2EIJ B;  2QM8 A;  2X6A A;  5CA3 A;  4UV9 A;  5L3G A;  2V7Q G;  2ZXW C;  2Q67 A;  3OEE G;  1R3I C;  2XAS A;  5B1A C;  1JX9 A;  4MT8 A;  4XDJ A;  1Y4M A;  4PDM A;  1YJ9 V;  4FMT A;  1GM8 A;  3CMA V;  3GB7 C;  3CCV V;  4N23 A;  4LC1 A;  1K97 A;  3CP1 A;  3H01 A;  4P30 A;  4X8A A;  4PA9 A;  4JYC A;  2KB1 A;  5L3E A;  3OE7 G;  3BY6 A;  3TK1 A;  1ROP A;  2GSM B;  3LSQ A;  3SYA A;  2Y48 A;  3HB3 B;  2IJJ A;  5KUM A;  3CCQ V;  3CPW U;  3AG4 B;  2DQ3 A;  2ITD C;  4YXW G;  2IH1 C;  3SYQ A;  3AG1 C;  3STZ C;  3T2M A;  2EIL C;  3E83 A;  1Q7Y W;  5KA5 A;  4PDV A;  1H8H G;  1JJ2 U;  1NBM G;  2EZO A;  1GK9 A;  4MW8 A;  2HFE C;  3W7X A;  1M9N A;  3F7V C;  5CBG A;  1GTO A;  1SZT A;  4UXN A;  1NKD A;  3FB8 C;  4G28 B;  4RQE A;  1M56 B;  3ML0 A;  4ZBM A;  1VQP V;  2XAJ A;  3JD1 A;  3ZJZ A;  1YTF B;  1JQ0 A;  2JIZ G;  4MVS A;  4MW3 A;  5EBM C;  3CC2 V;  1BHA A;  3W7W A;  1K5Q A;  3K03 A;  1QLN A;  3CD6 V;  3ZRX A;  4PDL A;  1L1F A;  2OCC C;  1K4C C;  1WLE A;  4MVU A;  3SYO A;  3G6E V;  3ZRV A;  2YEV A;  5KUK A;  1W2B U;  1KD1 W;  3W7S A;  1M57 B;  2P90 A;  4CZZ A;  2QM7 A;  2WLL A;  3FB6 C;  1N8R W;  2UXN A;  1M90 W;  1Y66 A;  1S72 V;  3CC4 V;  5H9C A;  1OCR B;  1EFR G;  1SES A;  2ITC C;  3QO5 A;  4LCU C;  5IDJ A;  3VOU A;  2WLI A;  2LFS A;  3CCL V;  3MHH C;  1VQ6 V;  1PNK A;  2X0L A;  4MVR A;  3K0G A;  5EBL C;  1H38 A;  2X7R B;  1AJP A;  1NR7 A;  2JDI G;  1DTO A;  2WLH A;  3K0D A;  1IXM A;  1NH2 D;  3M99 B;  4LBE C;  5IYC O;  2OT5 A;  3G4S V;  2HJF C;  5LGT A;  1AI7 A;  3SYC A;  1YHQ V;  1R6N A;  1TUE B;  4WFB V;  2R9R B;  1P4R A;  1BL8 A;  4XDK A;  4GT1 A;  2OTL V;  1QBZ A;  5DN6 G;  3SJQ C;  1DF4 A;  3FB7 C;  2A0L A;  3OEH G;  4WFG A;  3I56 V;  2NNU A;  2PI5 A;  1KEC A;  3ZRW A;  2A79 B;  3FYE B;  2BOB C;  4U7N A;  1W0J G;  4ZKI A;  4MTF A;  4CBC A;  1QLE B;  5HFL A;  3K08 A;  4RQF A;  1BHB A;  1EZJ A;  3NXS A;  5EC2 C;  1QVF U;  1OZ0 A;  2P7T C;  1OCZ C;  3B8M A;  4PDR A;  2JJ2 G;  2R9I A;  2P67 A;  3LUT B;  2HKO A;  4RO2 A;  4WFA V;  4JTA B;  2H8P C;  1Q86 W;  2K1E A;  4UVA A;  1QR9 A;  2P6J A;  5IYD O;  1V55 C;  1K33 A;  3JD3 A;  3UKM A;  2ZR3 A;  1ORQ C;  1YJN V;  3K06 A;  3LDC A;  4HYO A;  1SER A;  1XL4 A;  2DYS C;  4WCE V;  1J95 A;  1G4Y B;  1K9M W;  4Z1M G;  1ENV A;  4PA6 A;  2X6B A;  1G8M A;  4JTC B;  3CYO A;  3MHS C;  5FL7 G;  1OCC B;  2NLJ C;  4TT3 G;  3QO8 A;  3X2Q C;  3ZMS A;  3OUS A;  4QPJ A;  2A9H A;  1R73 A;  1WPX A;  3E86 A;  3TET A;  3E8G A;  3E8B A;  2DWE C;  5B1A B;  1YI2 V;  1GO3 F;  1M1K W;  2WAM A;  1MAB G;  1I5Y A;  1YSC A;  3OAA G;  1K5S A;  5LHH A;  1S0V A;  4N21 A;  1R6K A;  4F4L A;  1Q82 W;  1K8A W;  4BIU A;  3IFX A;  2X6C A;  1LNQ A;  2W6I G;  1FXK C;  2DYR C;  2EIN C;  1FFT B;  2D3O W;  1YIT V;  3T4D A;  2Y69 B;  3AG3 B;  2HG5 C;  2YSU B;  3LSS A;  1CEZ A;  2GHY A;  2EIJ C;  1R3J C;  1NJI W;  4BIZ A;  3OMN B;  3SPJ A;  5LGN A;  2Z5U A;  4FIP C;  1OHH G;  1PKX A;  1R3K C;  1FS0 G;  3CCS V;  5IYB O;  1OCO B;  1KKD A;  2AHY A;  3RVZ A;  2LFR A;  3DTU B;  3ABU A;  3CCJ V;  2DWD C;  2WLN A;  3T4Z A;  3FKS G;  4P9P A;  1K34 A;  3ABK B;  3UM7 A;  1PD3 A;  3QO7 A;  5EK0 A;  1COW G;  2EIM C;  4DXW A;  2Z3Y A;  4HZ3 A;  3AG4 C;  4KUM A;  3QNE A;  4QPK A;  5E1A C;  1NVP B;  3SPG A;  1ARO P;  1GM7 A;  5LBQ A;  1Q81 W;  3E89 A;  2WWW A;  1I5X A;  3ZIA G;  2ZQM A;  2UXX A;  5H6R A;  4R8C A;  1YTF D;  3CXC U;  1VQM V;  3STL C;  3ABM B;  4MVM A;  4JF3 A;  4QJF B;  4P9O A;  2EBO A;  1KQS U;  2WPD G;  3AEI A;  3CCR V;  4RUF A;  4UV8 A;  5J9P C;  1FXH A;  3ZMZ A;  3OMI B;  1M56 C;  3F7Y C;  2JK5 C;  1F4M A;  4RAI A;  4PA7 A;  3IGA C;  3WG7 B;  3G71 V;  3JD0 A;  1K92 A;  2EIK B;  2B5U A;  2IU0 A;  2F43 G;  4R6Z A;  4OXS A;  1K3E A;  5LGU A;  3D3I A;  3OR6 C;  3W7T A;  4GX1 A;  1E1R G;  1M57 C;  3LDD A;  1F23 A;  3ASO B;  3PJS K;  2ATK C;  4UVB A;  2JEX A;  3FYI B;  1PNL A;  4E2L A;  4MS2 A;  1SRY A;  1JCH A;  2QTO A;  4Q20 A;  1V54 B;  1JPX A;  4G2K A;  1UJW B;  4WF9 V;  1NR1 A;  4U7O A;  3P32 A;  2QE7 G;  2YEV B;  3ZMT A;  3SPI A;  1DF5 A;  4MTO A;  1RPO A;  2WLL B;  3ABT A;  2Q69 A;  3JD2 A;  4WFE A;  5B1B B;  2ZR2 A;  4H33 A;  3WFV A;  2JJ1 G;  1RM1 B;  3ETG A;  4QNH B;  1FXK A;  3ZRS A;  1VQK V;  2WLI B;  3DGE A;  2PI4 A;  2B1G A;  3ASN B;  2JEU A;  3P30 A;  1E1Q G;  2W0F C;  2XND G;  1MOF A;  5KA6 A;  2H94 A;  5B3S C;  2DYS B;  2EJR A;  5H6Q A;  3SYP A;  3I55 V;  5DM6 V;  1GMG A;  5L3C A;  1QLE C;  1S5H C;  3OFN G;  2BOC C;  1S76 D;  1VQ7 V;  1VQN V;  1JVM A;  1YJW V;  5IY5 B;  4PA4 A;  3ZRW B;  3BEH A;  2ZXW B;  3SPC A;  2WLJ A;  5CMU A;  2Q6A A;  3AG2 C;  2WLK A;  3CME V;  4PEL A;  1P7B A;  4MVZ A;  1VQ9 V;  3OUF A;  3CCM V;  1XL6 A;  1S77 D;  3K9A A;  3OW2 U;  2XOK G;  2DYR B;  4I9W A;  1K73 W;  2IU3 A;  2EIN B;  5HFM A;  1CP9 A;  1OCC C;  4QE9 A;  2IH3 C;  4JAU A;  1VQ4 V;  4L87 A;  1KP2 A;  5GW7 A;  1AI5 A;  2HLD G;  4TSF G;  4UVC A;  2V1D A;  3ABL C;  3OR7 C;  4WFH A;  4J9Y B;  3B8N A;  3A0R A;  1AJN A;  2C2A A;  4MTX A;  5EC1 C;  1E79 G;  3K79 A;  3ZMU A;  1VQ8 V;  3AG1 B;  4R50 A;  4JYB A;  2B1I A;  1VQL V;  3E8F A;  2EIL B;  3OM3 B;  2IJH A;  5B1N A;  5B1O A;  1GM9 A;  3E8H A;  4G27 B;  2FTK A;  3FB5 C;  3JD4 A;  2Y69 C;  5CBF A;  3AG3 C;  2IW5 A;  1VQO V;  2EIM B;  2DQ0 A;  3F5W C;  3E35 A;  1QR8 A;  2IJK A;  3SPH A;  2QA4 V;  1R3L C;  3LDE A;  4I5S A;  4JAS A;  1K7D A;  1GKF A;  4QE7 A;  4GCZ A;  1MG1 A;  2WLM A;  3W7U A;  1RPR A;  2ZDI A;  1THZ A;  2OCC B;  1NVP D;  4RUE A;  1OCO C;  3ZN1 A;  2HR3 A;  2W6J G;  3ZCC A;  2XAH A;  4H37 A;  4GX0 A;  3HPL C;  3ABK C;  1CPY A;  4XDL A;  5LHG A;  4TWK A;  1VQ5 V;  3E2E A;  2OTJ V;  3JYC A;  2Q68 A;  4MVQ A;  1S3J A;  4BW5 A;  2ZD9 A;  2IJI A;  3ZN0 A;  3T1C A;  4JTD B;  1QVG U;  5L3F A;  1QCE A;  1HWY A;  4JPR A;  4ASU G;  3ABM C;  2M7W A;  5L3B A;  1MSW D;  3RW0 A;  1H8E G;  3VBB A;  1AR1 B;  1H2G A;  5C93 A;  4MSW C;  1YIJ V;  2CK3 G;  4P2Z A;  3AAG A;  2XAF A;  1OCR C;  4GX2 A;  3GWO A;  2ZDI C;  3IC7 A;  5L3D A;  1NH2 B;  3RVY A;  2DW4 A;  1JOY A;  2XAG A;  3OMA B;  4R7C A;  3R65 A;  1F4N A;  5EBW C;  4LP8 A;  1EBO A;  1OCZ B;  3WG7 C;  2HVK C;  3D36 A;  4FPP A;  3JCZ A;  3ETE A;  2EIK C;  4EKW A;  5CN0 A;  1V55 B;  3ASO C;  4J9Z B;  1AJQ A;  2WSS G;  3K04 A;  3ZMV A;  4GX5 A;  5B3S B;  3TCU A;  2QKS A;  3RBZ A;  3EFF K;  1V54 C;  5BZB A;  3LNM B;  1KC8 W;  5CBH A;  1AI6 A;  1DLB A;  2QEX V;  4PA3 A;  1K4D C;  1W0K G;  1KP3 A;  1FXV A;  1SET A;  4FJC C;  3OGC C;  3MD0 A;  5B1B C;  3X2Q B;  4DO2 A;  1RM1 C;  4UUJ C;  4JGS A;  1B6Q A;  4KFM A;  3CCE V;  3ASN C;  2MK3 A;  1F51 A;  3AG2 B;  1NQT A;  1AI4 A;  4X89 A;  4HAM A;  4MTG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...