4TT3G

The pathway of binding of the intrinsically disordered mitochondrial inhibitor protein to f1-atpase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
272
structure length
183
Chain Sequence
ATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPASDRGLCGAIHSSVAKQMKSVGDKIRSILHRTHSDQFLTFKEVGRRPPTFGDASVIALELLNSGYRFRSVISYKTQEYSLANIIYYSLKESTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ATP synthase subunit alpha, mitochondrial
publication title Pathway of binding of the intrinsically disordered mitochondrial inhibitor protein to F1-ATPase.
pubmed doi rcsb
source organism Bos taurus
total genus 60
structure length 183
sequence length 272
ec nomenclature
pdb deposition date 2014-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00231 ATP-synt ATP synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.80 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4tt3G01
3.40.1380.10 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate Kinase; Chain: A, domain 1 4tt3G02
2XOKG 2XNDG 3ABUA 2WSSG 5L3DA 2HKOA 1OHHG 2JIZG 2W6JG 2WPDG 1H8HG 2V7QG 3OAAG 5LHIA 2IW5A 3ZN1A 2HLDG 2XAJA 4CZZA 2XAQA 4UVCA 3OEHG 3FKSG 5LHHA 3OFNG 5LHGA 3ZIAG 4TSFG 4Z1MG 2UXNA 2XAHA 1W0KG 4UV8A 4ASUG 5LBQA 2XASA 5LGUA 4KUMA 5FL7G 1FS0G 1NBMG 2W6IG 5DN6G 4XBFA 1E1QG 5L3FA 1COWG 2Z3YA 4UVAA 4YXWG 2H94A 4TT3G 1MABG 2JDIG 1E79G 5L3CA 2Z5UA 2XAFA 2R9IA 4UV9A 3ZMVA 5L3GA 5H6QA 2QE7G 2JJ2G 2JJ1G 1H8EG 2V1DA 3ZMTA 4UXNA 3ZN0A 1W0JG 4BAYA 1EFRG 5L3EA 2EJRA 1E1RG 5LGNA 3ZMUA 2XAGA 3ABTA 2DW4A 3OE7G 2CK3G 5L3BA 2UXXA 2Y48A 3OEEG 5LGTA 2X0LA 2F43G 3ZMZA 4UVBA 3ZMSA 5H6RA 1BMFG
chains in the Genus database with same CATH superfamily
4B2DA 1P4RA 3JALB 2XOKG 3L74H 3CCQV 3TETA 5IE9A 1G4YB 1XOUA 2BCCH 4WFGA 3CP1A 1JJ2U 2CDYA 2ZIMA 3CXHF 1A5UA 4CS4A 4IL6Z 1GTOA 2JGUA 4FXFA 4K8XA 2ARHA 2R9RB 3CXCU 1VIBA 4LP8A 2PYLA 1K9MW 1LNQA 1A3XA 2W0FC 4I50B 3MAQA 1JFFB 2DQ0A 4Z1MG 4LFCB 1M5IA 3EVKA 4X9QA 3W7SA 4DR7O 1YXBA 5B1OA 2WWWA 3TK1A 1B6QA 3P30A 4BR6A 2CUGA 5EZYA 2BSKA 4B08A 2P4VA 3HR0A 1F23A 1YJWV 2KSDA 3C3TA 3HB3B 2Q7GA 5LP6A 5B66Z 3ETGA 2FL4A 4K35A 1SESA 1Y6XA 1IXBA 2ZNJA 1N0NA 5CBGA 3AG3B 3ZRWB 1H2MA 1KYOF 2LW7A 2XAFA 1L8DA 1XQ8A 1QHTA 3CRQA 1SQBH 3BJFA 3HQOA 1EFRG 5IYBO 2EJRA 2ZM6B 4LF6B 3K3WA 1BL8A 5KA6A 4WFFA 3HQPA 2P6JA 5L3BA 1P7GA 4TUYA 3T0TA 5FPRA 3CSXA 2DQ3A 2X6AA 3KCYA 3ZMSA 2ATKC 1VQOV 3E89A 3PN1A 2QWQB 3ASNC 5IT9N 3ETEA 3JAMN 3CRRA 4WFAV 1JR9A 3CYOA 3NR7A 1FD9A 3DSQA 3VBBA 1SZXA 5KA5A 4DV2O 3WB1A 1OCZB 5KHJA 5TISZ 4BW5A 1R1BA 4FLTA 3SRDA 2JS3A 1WNSA 3KZIZ 1XMOO 1Z5WA 2DYSC 2UXCB 3DC6A 4MTGA 1N33O 3TGUH 2IM9A 1N34B 4X66B 2ZXWC 4PA9A 4IIJA 4NKGB 1R6KA 3BCCH 3SJBC 2F66C 2PYJA 3SR2C 3HKDA 2EILB 1SQVH 3A0BZ 3IC9A 1V9PA 1M56C 2UUAB 3JATA 2F93B 4I5SA 4XBFA 1RFYA 1YVWA 1COWG 2D3OW 5KMGA 1S72V 2CTWA 1HP8A 2BE3A 4HZ3A 4JI1B 1OCRB 3JAWA 1R3JC 4PA7A 2P7TC 4JI2O 3CE2A 1K8AW 3AG4C 4G1NA 5DECA 5BR8O 4X1KB 5EYPB 2P67A 4DV0O 4DR2O 4JYCA 2UU9B 1YEWA 4KP4A 1AR4A 2CAZC 2KQXA 3I5DA 4EFBA 2VQFB 3JARA 3LDDA 1QCEA 3ZCCA 1M4UA 3K57A 4RUFA 3IAYA 3RN4A 1VQPV 4RUEA 4CH4A 3QTCA 4YY3O 1AI7A 2IBZH 4YHHO 1FFTB 4UCTA 1Z5VA 4FM0A 1A32A 2HJFC 4IP7A 2A9HA 3KTXA 1OHHG 3GQYA 2IW5A 1BQZA 4GYCB 5BZBA 4DR7B 3Q4HA 1J95A 2HVKC 3H1IH 3A8TA 3LSQA 3ZS8C 3OFNG 3JD4A 3UM7A 3N27A 4B2DD 3U0ZA 1XEQA 1VQ8V 4KHPO 4LF5O 4L8JA 1FAFA 2KG7B 1K33A 2NR5A 1YHQV 1AJPA 1ZX3A 3D36C 4MSWC 2IJKA 1S76D 3N2KA 2VGBA 1NT2B 1JCHA 3CC2V 2M6YA 1NJIW 1ZLZA 3K9AA 1K73W 4KL1A 5LXTA 2PY5A 3T05A 5D5QA 3OUFA 2QSAA 2NNUA 3X2QB 3JAKA 4TT3G 2GUZA 2JDIG 3ZBHA 4P9OA 1PKMA 2IJJA 3AG7A 2FKXA 5JQGB 2Y4TA 5GTHZ 4R50A 3ZMTA 3N2GA 1VMGA 4DO2A 1BZKA 4JI4B 2RMKB 4H13B 3CRCA 2QM7A 3T1HB 2EZPA 3RYCA 4LCUC 2DJVA 1OCZC 2B1IA 3SRFA 1US6A 1SF9A 3AG2B 4AILC 3E22A 2XNDG 5FNVA 1MZFA 4U7NA 2ZR3A 2B9ZA 3CEIA 5E1AC 2AHZA 2V7QG 5IYCO 3KKYA 1MSDA 5K1XA 1PNKA 3JASB 4O4HA 5JH7B 1AJNA 5H2FZ 2YSUB 2EILC 2IU3A 3STLC 4I9WA 4TSFG 4X64O 4QNHB 3SPJA 5EC2C 3GWKC 1NZ6A 3BHPA 1Q81W 4YJ2A 2IH3C 4JTDB 2Y4UA 3OR6C 3S3WA 1HDJA 3K5LA 4G28B 2W0XA 4UCUA 1K7DA 1OCRC 1KECA 4YJ3A 2HFEC 1TUBA 3OGCC 5EK0A 1X4TA 4EFEA 3K58A 5CBFA 5BXZA 1SRYA 2KKWA 5BR8B 5EIBD 3M7MX 2QEXV 4J9ZB 2PI5A 2JVDA 3J80N 4DV0B 1QLEB 1FYJA 1E79G 1LUVA 2P06A 2ZINA 3FYIB 3N25A 3K9SA 3KG2A 5C93A 3F7VC 2Z5UA 1TAEA 1XNRB 1H8EG 3QNEA 1K4DC 2ZDIA 2V1DA 2BTQA 3ZHVA 1RSOA 1F3WA 5CA0A 3G6EV 4KCWA 2R9AA 2Q68A 1E1RG 1M1KW 3HPLC 3O9OA 4GX1A 5IDJA 4JI3O 3PJSK 1T5AA 3SGIA 4DV3O 1TVKB 4DRXB 4RQEA 5LGTA 4GKJO 3NXSA 4NB5A 3K0GA 3TXQA 4B3SO 4GKKB 1KP3A 3ME3A 5LMUO 3JD2A 3ZEDA 2AZ0A 3CC7V 3EHBB 1URFA 3K08A 3DGEA 3RYHA 2ZQMA 4I0XB 4YIOA 3QVNA 3ZHQA 4PI2A 2Q6AA 4X1YA 1LUWA 3SJAC 3MDSA 1FKAO 2YXYA 2OTJV 4F4LA 4FMTA 5B1AB 2DOSA 1EN6A 3JCZA 3SDLA 4KS0A 1GN6A 1PD3A 4L87A 1MG1A 1EBOA 1ROPA 1HNXB 4O2AA 3X2QC 5B3SB 2HHHB 3BJTA 4I55A 5EC1C 5LBQA 1L1FA 3ML0A 4Q20A 3K5MA 3UQ8A 5FL7G 2Q67A 4PI0A 2OCHA 1QR8A 2YIDA 1WP7A 1K5SA 2A7WA 1SQGA 4XDLA 2X7RB 5B1NA 3AAGA 3H1JH 2Q73A 2YXHA 4K0KB 1XMQO 1R73A 1NR7A 3UO3A 2IH1C 3CRAA 2YEVB 2E5LO 3J81N 1AVMA 4U7OA 4I7ZB 2JJ2G 2QDOA 1RPOA 3AG2C 1K97A 4BAYA 5L3EA 1T5EA 2DYSB 1SQQH 3SJCC 2OCCB 1VQ7V 2E75B 4DR4O 2Y48A 1H2KA 1BSMA 4U3JB 3ZMZA 2L6LA 1QVGU 3J7AU 1N4CA 1H2SB 5FPOA 2JS5A 1WPXA 4ICGA 1BHAA 1XI1A 4JI0O 3QV6A 5JJEB 3PP7A 4PA6A 3CX5F 4O4JB 4AQYO 4MW8A 5IJ0A 3W7XA 1F3XA 1E0TA 4LNUB 4TQDA 4X64B 3ZHTA 3OAAG 2PGGA 5GONA 3MHHC 4FVMA 4O4LA 2WLKA 3AG4B 4UVCA 4LR3A 1FFXA 4ABMA 2GDSA 4GLXA 1GKFA 3THOA 1JFFA 4DV7B 4I4TB 5KHHA 3BEHA 2VQEO 2QKCA 1AI4A 4X1IA 2N04A 4PDVA 3RT3C 1QLEC 1B04A 2HJDA 4TV8B 5LA6B 4WFEA 1R3IC 3CPWU 3FB7C 1TUEB 2FTKA 1GN2A 1WPBA 4LF4B 1FXVA 2W6IG 1XDCA 4X20B 3OMAB 1FXKA 4J7KA 1SERA 3EXAA 3MD0A 1K4CC 3D3QA 4NYKA 1MNGA 4F6EA 4IYIA 2G50A 3T1YO 1N32B 4YNGA 4ZI7B 3CS5A 4JTAB 4FM2A 1DF5A 1SC5B 4UV9A 4JI3B 1Q6IA 1XL6A 4B3RB 5IYDO 1P84F 2X6CA 3K79A 2QTOA 3M8AA 3I55V 2QWOB 5LMUB 4LFAB 2XAGA 1IBMO 4DR6O 3K5OA 2RQ6A 4JYAO 1G6UA 4A5UB 3R65A 1H2NA 2RNBA 2EX3A 2VS0A 1S0VA 5B1AC 1VQ4V 3GG8A 3JYCA 4J9YB 1MMMA 4JASA 1FXHA 3K0DA 5B3SC 3G80A 1Q8IA 2WPDG 3SRKA 5EZYB 1BT8A 3BA9A 4CZZA 1O9HA 2BSKB 3E0WA 1OCCB 1G1XB 5CN0A 3HKCA 4GUNA 4NR1A 5LHHA 2UUCO 2QKSA 2EIKB 1DK1A 1SQFA 5LHGA 4UB8Z 5LP6B 2P5OA 3APQA 1WA8A 1GK9A 4UV8A 3ZRSA 2XASA 5LYJA 4LWSA 4YJ5A 3CC4V 4ZBMA 1Q82W 2YI9A 2JGDA 2F23A 1KUQA 3K04A 1XMQB 4DYLA 1JJOA 4QPKA 4B3TB 1FS0G 5J9PC 4LFBB 2E5LB 1Q6UA 3SRHA 1I08A 3ETQA 4GT1A 3LNMB 2WLIA 3WB2A 2VWJA 3MA8A 3QO7A 2OCCC 1THZA 2MW2B 5J2UA 2LGWA 3DTUB 4J42A 4TUYB 1IURA 2DN9A 2LQTA 1DLBA 4AI8A 5F2VO 1AI6A 2D2CB 5H5NA 2YXLA 2AGAA 2QE7G 1BHBA 1WAZA 2K1EA 2ZE6A 3ZN0A 4EEQA 3ZHRA 3CCMV 1YITV 3E2EA 2CTRA 1DGSA 2QWPB 4J80A 4DR3O 3CJHA 1KC8W 2E74B 4AQYB 2Q5ZA 4JPRA 5H6RA 3AG1B 2OIGA 1YIJV 4NTXA 4JV5O 2VGGA 3E8FA 3ABUA 4JAVA 1ZL8B 1Y74A 4JTCB 2UXDO 1H8HG 2VQEB 1M57B 2EBOA 2ZE7A 1HR0O 1ENVA 4R8CA 2Z0AA 3FFQA 5IY5B 1AJQA 1X59A 1AROP 3FYEB 1JOYA 3G2GA 1R6NA 3HKDB 2QJ1A 5IJ9A 2P90A 5JCOA 3CCVV 2ZIOA 3JATB 4BIUA 2EINB 1XNQO 2GTSA 4FLXA 1Z2GA 3LDEA 3IS4A 3CD6V 4G27B 3OUSA 4IT5A 5KMGB 1B3QA 3T1CA 4JZGA 4CS2A 4FPPA 4ASUG 2OT5A 3JAWB 5LGUA 5AG2A 2CH7A 1A3WA 1NQTA 4H0LB 3T1YB 4EB6A 5CA1A 3CMAV 4JI5O 1F4NA 1XREA 1IBKO 2BOCC 2B1GA 3JARB 5BMVA 3OD4A 3APOA 5KHGA 4FLWA 1Q86W 2OTLV 1F51A 2ODMA 3RYIA 5ITZA 4NXNO 1IBMB 1NTKH 4LF7O 1WB8A 4DR6B 2QM4A 3ZMVA 3QO5A 1IXMA 5L3GA 3K5NA 4JYAB 1YTFD 4FXJA 3SPCA 4ZOLA 4TWKA 3QF7A 1VQNV 1FXKC 1D2DA 4UXNA 4FLUA 2PI4A 1FJGO 1PKXA 3D8CA 4LH7A 1G8MA 3CHXA 3Q4HB 4MVQA 2E76B 1Y76A 1OCCC 4Z1VA 3KHDA 2HR3A 3OR7C 4O4IA 2EIKC 4W4LA 2YI8A 4JF3A 1NU1H 2WLLA 1WB7A 2AZ2A 1H38A 4J11A 2UUCB 4GCZA 2LFSA 5LP6C 1M90W 1R3KC 4U3FH 2YIBA 3T4ZA 4R7CA 1YJ9V 2RDCA 3N2KB 4KCVA 3SYCA 1UFIA 1I5XA 4QE7A 2OIEA 5LXTB 4CC6A 4DV2B 2K9PA 1HNZO 3CRMA 3DC5A 4ZKIA 3ZHSA 1Q5OA 3JAKB 4DW1A 1Y67A 4RO2A 1EN4A 2GUZB 3LSUA 1XMOB 4I9QA 1N33B 2CTPA 2UXBO 1GO3F 3UT5A 3OT7A 3GR4A 5K1PA 1IZ3A 3OTOO 4Q6GA 2PUSA 4QPJA 3AEIA 3F5WC 3N2GB 1AI5A 4O2BA 4X62O 2QWRB 2N74A 3QV9A 2P22C 3WB0A 2QR4A 5HFMA 2ITCC 5IYZA 2H94A 3HKBA 3M99B 1M9NA 4N23A 4CH5A 1SA0A 3RYCB 3IJ4A 1AR1B 3RYFA 4LC1A 3AG1C 3E22B 5FNVB 1OCOB 4JI2B 2GBOA 1YJNV 3T07A 5EIBC 3DXRA 1W0JG 1WJZA 3C3SA 1VQ5V 3ABLB 4J41A 2JEUA 4JV5B 4QGPA 5CB4A 3SPGA 5JJNB 1M57C 1PP9H 4DR2B 1TGOA 2B5UA 2L35A 2LO1A 3R66A 3BY6A 1YDXA 4B7EA 5E79Z 4O4HB 2WAMA 5IY5C 3RGBA 1BMFG 4K3AA 4H44B 4DV5O 5GTIZ 4IHJA 5JWPA 4DV1O 2EINC 3E35A 1F4MA 5KX5A 4DUYO 5EBLC 3KCXA 3ABKC 4FK5C 4YJ2B 3B09A 3GWOA 1Q90D 4FFBA 4YY3B 4YHHB 4D7SA 3IFXA 4YJ3B 2MK3A 1TUBB 2NN4A 2N05A 1NTZH 3RVYA 4DR1O 1S5LZ 1VQ6V 4PDRA 3ZX6A 3BPZA 5LOVA 3S3XA 2XTAA 5KLVH 5KHKA 1QBZA 2PZSA 4MT8A 4X89A 2Q9LA 4JI5B 3T4DA 1U96A 4KHPB 1WP8A 3VQWA 4LF5B 4HAMA 4QG9A 3BFRA 1GRJA 4WFHA 2Q0AA 1IVSA 3SYQA 4X65O 1H2GA 1NI8A 4NXNB 2BTQB 4TV9A 1RSOB 4LF7B 5CA0B 1SKVA 5FLXN 4DK0A 2VRZA 1WN7A 2C2AA 1XUQA 3U10A 1WLEA 4UVAA 2WLMA 1QU7A 4ZHQA 1MABG 5C8YA 4E2LA 1FJGB 2WA3A 4FLZA 4HNAA 4NTYA 1HW7A 1AP5A 3CCSV 1NH2D 2R9IA 5H9CA 2ZM6O 4LF6O 2CTQA 3SYOA 3RYHB 4J7ZA 4NXMO 5IWAO 4JI6O 1KKCA 1R6TA 4DR5O 4X1YB 1AP6A 2F95B 3RVZA 3ABTA 4AHCA 3C90A 1NVPD 4P2ZA 1I5YA 2LJ2A 3L9DA 1SQXH 4MTFA 1VQLV 3TCUA 4MVZA 5DM6V 4C7UA 4UVBA 4FIPC 3EOEA 1BS3A 1VF5B 3HKEA 3QV7A 2VWKA 4PHZA 4O2AB 3JSLA 3LSSA 5B1BB 3H6OA 4WBNA 2UUBO 4F6RA 5J2TA 5KHIA 2HKOA 3BA8A 3CB2A 5JVDA 2JRIA 1HNZB 4I55B 2ZKOA 2VGFA 1GMGA 2YDEA 4KCUA 1EM1A 4OGQB 3UO2A 5CMUA 3FAVA 1ZAUA 2Y69B 2XAQA 1OJHA 2CGOA 2PF4E 3FKSG 3OEHG 2OWOA 3ICXA 1N34O 2WLJA 3JALA 4X66O 1F7YA 1V54C 1D5NA 3LUTB 1H2LA 2UXNA 1NKDA 1GM9A 1IDSA 4GZRB 2RCVA 3BVOA 3I56V 5KUMA 1K34A 1IBLO 2YIBD 1CEZA 2EJ7A 1Q3EA 3A2FA 2A06H 4H33A 4DUZO 4I50A 1OCOC 3BRCA 1Q6HA 1JVMA 5A2QN 1SS3A 4FLVA 4KFMA 1GAXA 1AB3A 1KU9A 4RQFA 3ABLC 3H1HH 3T2MA 3JD0A 1VARA 1YZBA 4GX2A 4D6TH 2ZCEA 2DE0X 1I94O 1D5AA 5H6QA 3L75H 1VQKV 4PJ0Z 4J7JA 2VQFO 4GX5A 1HNWO 4H37A 2H3OA 4DV5B 5IJ0B 2QM8A 4B3MO 3G71V 2AW9A 2X6BA 3SYPA 4DV1B 5GONB 4DUYB 2EULA 3L71H 3OE7G 4XDJA 3D36A 4O4LB 1KMIZ 2OYQA 3ZRWA 2Q69A 2DYRB 1AILA 1FFXB 2O57A 1V55B 4BWAA 4DV3B 1RP3B 4GKJB 4DR1B 4B3SB 3B40A 2WSSG 4JYBA 4OPHA 5A9GA 4IMAA 4X1IB 1B06A 2JIZG 1YF2A 4NVPA 3B8MA 3ZN1A 2HLDG 1K5QA 3FB5C 3A0HZ 2ZE5A 2P4KA 4FM1A 1YTFB 3BAAA 2PTMA 1MA1A 2ZDIC 2YUAA 4DK1A 1UJWB 2YICA 1NR1A 1FXKB 4X65B 4CC5A 1QLNA 1YI2V 1XHXA 4LF9O 1KD1W 1K3EA 4CBCA 1W0KG 1CPYA 1XHZA 1PKYA 3ABMB 4DXWA 2H8PC 1RPRA 1NTMH 3JCUZ 3K06A 4TQFA 1XBLA 3QO8A 3P3PA 2HEPA 3W7TA 5L3FA 2DWDC 4PV1B 4NXMB 4JI6B 5IWAB 4DR5B 4MVMA 3EFFK 2CGNA 2BTOA 2BOBC 1KQSU 3LNNA 1W59A 1PKLA 3ZRXA 4K8ZA 4JI4O 4RWUA 4EKWA 4CS3A 2ADPA 2Q8VA 3T1HO 3STZC 5B1BC 2ZR2A 3H9VA 3ZMUA 1J5EO 1GM7A 4JZ2A 1Y4MA 1L0NH 2EIJC 1DTOA 2UUBB 2DMXA 4W4KA 3P32A 2UXXA 3HQNA 4GX0A 2RN9A 1VF7A 2QGNA 2GV9A 2Y69C 3HKCB 1DF4A 4PDLA 3RW0A 2YIAA 4DR4B 3ZHUA 4X1KA 5EYPA 4LH6A 3B2EE 4QG6A 3G4SV 1N8RW 1ZL8A 2F1MA 1M93A 1WA8B 3E83A 4JI0B 3OTFA 3VQXA 5LYJB 4CH3A 4LWSB 1ZWIC 2IJHA 1PKNA 2JGDB 4UCVA 3E8GA 2LW1A 1JMKC 4HYWA 1XL4A 4FFKA 1IBLB 4QJFB 4WJ8A 4JI7O 3B4SA 2WLIB 1Y66A 3VQVA 1E0UA 4MVOA 4DUZB 1ZTEA 1IX9A 1L0LH 2XAHA 1U97A 1N0JA 5J2UB 3IC7A 3FB8C 2LP7A 4IIJB 3D3IA 3TJTA 2GSMB 2R70A 5B5EZ 1MSWD 2HP8A 1VP7A 3JD3A 1I94B 4PD4F 1KB9F 5LL6Y 4JAUA 2QWNB 3OGIB 2Z3YA 3ABKB 3UCSC 5EBWC 3ZJZA 2VGIA 4J10A 3CMEV 1EN5A 2WLNA 1HNWB 1XNRO 2KG7A 3CJHB 4MTXA 4XDKA 2ZE8A 4B3MB 1SQPH 3B77A 2DYRC 1GN3A 3H1LH 2EIMB 1V55C 4UB6Z 3WG7B 4MW3A 1BGYH 2Q7HA 1N36O 2GHYA 1Y74B 2Q0OC 3FD9A 4QE9A 4MTOA 4GKKO 4QGCA 5EBMC 4P9PA 1QQCA 1QNMA 2YC0A 5JQGA 1SZTA 2JEXA 5IJ9B 4UCRA 2RJZA 2R72A 4KCTA 2YS8A 3RWRD 4UUJC 1KP2A 2ZNIA 2ZD9A 2AXTZ 1P49A 1HWYA 5LHIA 1VF6A 2Q7EA 1NH2B 4LF9B 4MVUA 3P3NA 3AG3C 4MVRA 2ITDC 3ABMC 4YIPA 2CH7B 4JPGA 1ZUQA 3OMIB 1HNXO 1K92A 1VP8A 4EB6B 1CP9A 5CA1B 3G67A 2HHHO 4KRZA 1PL0A 3ZIAG 1NVPB 2F4VO 4LBEC 4JI8O 5BMVB 4QIWF 3H1KH 3BABA 1RM1B 3RYIB 4PA4A 5ITZB 4KUMA 2QA4V 5LMNO 2E28A 4Z2WA 5KAIZ 3JASA 3LDCA 5JH7A 3AK2A 1S5HC 3VOUA 4ZOLB 5KUKA 2NLJC 4P30A 5DN6G 2V4DA 5CBHA 4K0KO 2A0LA 2WA4A 3E86A 4MVSA 3VQYA 1TA8A 3L72H 1KBHA 2FMLA 4YXWG 3ASOB 1PNMA 1I0HA 1LR1A 1JX9A 2QKAA 4OX9O 1J5EB 1S77D 2LGQA 4LF8O 1OV9A 1Y76B 1QR9A 4O4IB 4DW0A 2JJ1G 3TXSA 2WLLB 1S3JA 3JD1A 1ZJHA 3CCRV 4JAAA 3E8HA 4D7TA 1V54B 3AK1A 4KXRA 4DV4O 3O65A 4B7KA 4DV6O 1T57A 1PV0A 4X8AA 4DRSA 3OEEG 2XT9A 1VQ9V 2CE4A 1ORQC 1GH6A 4DR3B 1A49A 3U11A 2ADQB 4JGSA 3SJQC 1XILA 3L70H 1GN4A 5KAFZ 3RBZA 5L3DA 3H01A 1YSCA 3UKMA 2HVJC 4JI7B 4MS2A 1KKDA 2XAJA 3UT5B 1TVKA 4DRXA 4DV7O 2UXDB 2Q4PA 1HR0B 3G6BA 3ETDA 1Q7YW 4FJCC 4BIOA 4WFBV 1PPJH 1BE3H 1YCIA 4BW9A 2FB5A 4O2BB 1JQ0A 3E0VA 3W7WA 3CCUV 2ILMA 2XUMA 4I0XA 5D5PA 5JJJB 1PM9A 5IYZB 4N21A 3HKBB 1XNQB 4PA3A 1PL4A 1SA0B 4LF4O 4FLYA 1S5JA 4HYVA 4RAIA 4FZ0A 3SPIA 3OM3B 3K59A 3OW2U 3RYFB 3GVMA 4LFCO 4UFZA 4X88A 4G2KA 1Q43A 4HBNA 2A3QA 2EIMC 1AR5A 3CWBH 3DXRB 1E1QG 1QVFU 3WG7C 1N32O 1NS1A 4RPPA 3SPHA 5CB4B 3GB7C 2EZOA 4NTWA 5CA3A 3U2ZA 2JK5C 1GM8A 1N36B 4B3RO 2XHBA 3WFVA 1IBKB 5BY1A 3L73H 1EZVH 2AHYA 3AK3A 5L3CA 3F7YC 5JCOC 4IHJB 4LFAO 1FPOA 5KX5B 1R3LC 3E8BA 2G38A 2DWEC 4FFBB 4E4EA 3QG5A 3WU2Z 2QTSA 4OXSA 2CK3G 3QV8A 5HFLA 2YEVA 1W2BU 1CXZB 1JPXA 3CCEV 4PDMA 1AQFA 2Y0PA 5LOVB 1MZEA 4OPAA 2E3CA 5GW7A 2W6JG 3FX7A 1RM1C 2F4VB 1P7BA 3JSNA 4JI8B 3SYAA 4ZIBA 4UCOA 1ZSPA 2LFRA 4U3JA 3ASNB 4TV9B 5LMNB 4FZ1A 1JA8A 4CH6A 3IGAC 4WF9V 4O4JA 4ZHQB 3ASOC 1SETA 1OZ0A 1VF6C 4LNUA 2IU0A 4BIZA 5C8YB 3OMNB 4TOIA 4WCEV 1PNLA 3QTGA 2EIJB 2GTAA 4HNAB 1VEWA 2KB1A 4B3TO 4LFBO 2ZT9B 4HYOA 3ZRVA 2UXCO 4QG8A 4OX9B 2UXBB 4LF8B 3B8NA 1NBMG 4PELA 4I4TA 3OTOB 3A0RA 4R6ZA 1BQ0A 3CCLV 2Y0IA 3F5TA 1I7FA 2WLHA 2ZXWB 2FYUH 4X62B 1VQMV 4DV4B 4DV6B 4TV8A 1UPGA 5LA6A 1MOFA 3K03A 4UCSA 2UUAO 3FB6C 2A79B 3HKEB 1M56B 3CCJV 1BCCH 4IYHA 4X20A 3MHSC 4WBNB 4IGGA 2M7WA 4JI1O 2ETNA 2IJIA 4F6RB 5LGNA 3W7UA 5J2TB 5JVDB 1O9GA 2DW4A 5DEDA 3FAVB 1EZJA 4JYYA 4ZI7A 2X0LA 2HG5C 2F43G 2UU9O 3RFRA
chains in the Genus database with same CATH topology
1P4RA 3JD2A 2XOKG 3CCQV 2EIKC 3TETA 4JF3A 3CC7V 3EHBB 2WLLA 3K08A 1G4YB 3DGEA 2ZQMA 1H38A 4GCZA 2LFSA 4WFGA 3CP1A 2Q6AA 3G4SV 1N8RW 1JJ2U 1M90W 1R3KC 3E83A 3T4ZA 4R7CA 1YJ9V 1GTOA 2R9RB 3CXCU 1ZWIC 2IJHA 3SYCA 2OTJV 1I5XA 3E8GA 4F4LA 4LP8A 4FMTA 5B1AB 4QE7A 1K9MW 1LNQA 1XL4A 4QJFB 3JCZA 2W0FC 1PD3A 4L87A 2DQ0A 1MG1A 1EBOA 4Z1MG 1ROPA 4ZKIA 2WLIB 3W7SA 3X2QC 1Y66A 4MVOA 4RO2A 5B1OA 5B3SB 2XAHA 2WWWA 3TK1A 1B6QA 3P30A 5EC1C 3IC7A 3FB8C 5LBQA 1L1FA 3ML0A 2LP7A 4Q20A 1GO3F 3D3IA 2GSMB 5FL7G 2Q67A 1MSWD 1QR8A 4QPJA 3AEIA 3F5WC 1F23A 3JD3A 1YJWV 1AI5A 1K5SA 3HB3B 4JAUA 2Z3YA 3ABKB 2X7RB 4XDLA 5B1NA 5EBWC 5HFMA 3ZJZA 2ITCC 3AAGA 3CMEV 3ETGA 2H94A 2WLNA 3M99B 1M9NA 4N23A 1SESA 4MTXA 1R73A 4XDKA 1NR7A 5CBGA 3AG3B 2IH1C 3ZRWB 3B77A 2YEVB 2XAFA 2DYRC 1AR1B 4U7OA 4LC1A 2JJ2G 3AG1C 2EIMB 1RPOA 1V55C 3AG2C 1OCOB 1YJNV 3WG7B 1K97A 4MW3A 1W0JG 4BAYA 1EFRG 5L3EA 2DYSB 5IYBO 2EJRA 2GHYA 2OCCB 1VQ5V 3ABLB 2JEUA 3RW0A 1VQ7V 4QE9A 3K3WA 3SPGA 1BL8A 4MTOA 5KA6A 1M57C 4WFFA 2B5UA 5EBMC 2P6JA 3BY6A 4P9PA 5L3BA 2Y48A 2WAMA 2DQ3A 5IY5C 1SZTA 2JEXA 3ZMZA 2X6AA 3ZMSA 2ATKC 1VQOV 1BMFG 3E89A 1QVGU 3ASNC 1WPXA 3ETEA 1BHAA 2EINC 4UUJC 3E35A 1F4MA 1KP2A 4WFAV 5EBLC 4PA6A 3ABKC 4FK5C 2ZD9A 3CYOA 4MW8A 3W7XA 3GWOA 1HWYA 3OAAG 5LHIA 3VBBA 3MHHC 1NH2B 5KA5A 4MVUA 3IFXA 2MK3A 1OCZB 3AG3C 4MVRA 2ITDC 3ABMC 2WLKA 3AG4B 4UVCA 3RVYA 3OMIB 4BW5A 1K92A 1VQ6V 1GKFA 4PDRA 1CP9A 1PL0A 3BEHA 3ZIAG 2DYSC 4MTGA 1NVPB 1AI4A 4LBEC 4PDVA 1QBZA 2ZXWC 4QIWF 4MT8A 4PA9A 4X89A 1QLEC 1RM1B 3T4DA 4PA4A 4HAMA 4KUMA 2QA4V 4WFEA 1R6KA 4WFHA 1R3IC 3CPWU 3FB7C 1TUEB 2FTKA 3LDCA 3SYQA 1H2GA 2EILB 1S5HC 1FXVA 3VOUA 2W6IG 1M56C 5KUKA 2NLJC 4P30A 5DN6G 3OMAB 4I5SA 4XBFA 1FXKA 5CBHA 2A0LA 3E86A 4MVSA 1SERA 1COWG 2D3OW 2C2AA 1WLEA 3MD0A 1K4CC 2WLMA 4UVAA 3ASOB 1PNMA 4YXWG 1S72V 1MABG 4E2LA 1JX9A 4HZ3A 1OCRB 1R3JC 4PA7A 1S77D 2P7TC 4JTAB 1K8AW 1QR9A 1DF5A 3CCSV 3AG4C 1NH2D 2R9IA 4UV9A 5H9CA 1XL6A 2JJ1G 5IYDO 2X6CA 2WLLB 1S3JA 3K79A 2QTOA 3JD1A 2P67A 3CCRV 3SYOA 3I55V 3E8HA 1V54B 4JYCA 4KP4A 2XAGA 3RVZA 3ABTA 3LDDA 1NVPD 4X8AA 1QCEA 4P2ZA 3ZCCA 1I5YA 3OEEG 4MTFA 1VQ9V 1VQLV 3R65A 3TCUA 1ORQC 4RUFA 4MVZA 5DM6V 4UVBA 1VQPV 4FIPC 1S0VA 4RUEA 5B1AC 4JGSA 3SJQC 1AI7A 1VQ4V 3JYCA 1FFTB 3LSSA 4J9YB 5B1BB 2HJFC 4JASA 2A9HA 1FXHA 3K0DA 3RBZA 5L3DA 5B3SC 2HKOA 1YSCA 3H01A 1OHHG 2WPDG 2HVJC 3UKMA 2IW5A 1GMGA 5BZBA 4MS2A 1KKDA 2XAJA 4CZZA 1J95A 2HVKC 5CMUA 2Y69B 2XAQA 1OCCB 3LSQA 3OEHG 3FKSG 5CN0A 5LHHA 3ETDA 2QKSA 2EIKB 1Q7YW 4FJCC 3OFNG 2WLJA 3JD4A 4WFBV 3UM7A 1JQ0A 5LHGA 3W7WA 3CCUV 1V54C 3LUTB 1VQ8V 2UXNA 4N21A 1NKDA 1GM9A 1GK9A 1K33A 4WCEV 4UV8A 3ZRSA 4PA3A 1YHQV 2XASA 1AJPA 3I56V 4MSWC 5KUMA 1K34A 2IJKA 3CC4V 4RAIA 1S76D 4ZBMA 3SPIA 1CEZA 3OM3B 1Q82W 3OW2U 1JCHA 3K04A 4X88A 3CC2V 4G2KA 1NJIW 3K9AA 1K73W 4H33A 4QPKA 2EIMC 1FS0G 5J9PC 1OCOC 1JVMA 3OUFA 1E1QG 1QVFU 3WG7C 4GT1A 4KFMA 2NNUA 3LNMB 2WLIA 3X2QB 4RQFA 3QO7A 2OCCC 3ABLC 1THZA 3SPHA 3GB7C 2EZOA 5CA3A 3T2MA 4TT3G 2JK5C 3JD0A 1GM8A 2JDIG 4GX2A 3DTUB 4P9OA 2IJJA 3WFVA 1DLBA 1AI6A 2AHYA 5L3CA 3F7YC 5H6QA 2QE7G 1BHBA 1VQKV 4R50A 2K1EA 3ZMTA 1R3LC 4GX5A 3ZN0A 3E8BA 4H37A 4DO2A 3CCMV 1YITV 3E2EA 2DWEC 2QM8A 3G71V 2X6BA 3SYPA 2QM7A 3OE7G 4OXSA 2CK3G 1KC8W 4XDJA 3D36A 2EZPA 4LCUC 1OCZC 5HFLA 2B1IA 4JPRA 3ZRWA 2Q69A 2DYRB 2YEVA 1W2BU 1JPXA 5H6RA 3AG1B 1YIJV 1V55B 3AG2B 3CCEV 4PDMA 2XNDG 4U7NA 2ZR3A 3E8FA 3ABUA 4JAVA 4JYBA 2WSSG 4JTCB 5GW7A 2JIZG 5E1AC 2W6JG 2AHZA 1H8HG 2V7QG 1M57B 5IYCO 3B8MA 2EBOA 3ZN1A 2HLDG 1ENVA 1RM1C 4R8CA 1K5QA 3FB5C 1P7BA 1PNKA 3SYAA 5IY5B 1AJQA 1AROP 3FYEB 1AJNA 1YTFB 1R6NA 2LFRA 1JOYA 2YSUB 2EILC 2IU3A 2P90A 3ASNB 3CCVV 2ZDIC 3STLC 1UJWB 4I9WA 4BIUA 2EINB 1NR1A 3IGAC 1FXKB 4TSFG 3LDEA 4QNHB 3SPJA 1QLNA 3CD6V 5EC2C 1YI2V 4G27B 3OUSA 4WF9V 1Q81W 1KD1W 3T1CA 2IH3C 4JTDB 1K3EA 3OR6C 4CBCA 3ASOC 1SETA 1OZ0A 1W0KG 4FPPA 2IU0A 2OT5A 4ASUG 3OMNB 4G28B 4BIZA 1PNLA 1CPYA 2EIJB 5LGUA 1K7DA 1OCRC 2KB1A 1KECA 3ABMB 4DXWA 2HFEC 4HYOA 2H8PC 3ZRVA 1NQTA 3OGCC 1RPRA 3K06A 5EK0A 3QO8A 3B8NA 1NBMG 4PELA 3W7TA 3CMAV 5L3FA 1F4NA 5CBFA 3A0RA 1SRYA 4R6ZA 3CCLV 2BOCC 2WLHA 2DWDC 2ZXWB 2QEXV 4J9ZB 2PI5A 2B1GA 1VQMV 1QLEB 4MVMA 1Q86W 3EFFK 2OTLV 1E79G 1F51A 1KQSU 2BOBC 1MOFA 3FYIB 3K03A 3ZRXA 3KG2A 5C93A 3F7VC 2Z5UA 3FB6C 3ZMVA 2A79B 3QO5A 1IXMA 5L3GA 1H8EG 3QNEA 1K4DC 2ZDIA 1M56B 2V1DA 3SPCA 4EKWA 3CCJV 1YTFD 4TWKA 1VQNV 1FXKC 4UXNA 3G6EV 3MHSC 3STZC 2PI4A 2M7WA 2Q68A 1E1RG 1PKXA 2IJIA 2ZR2A 5B1BC 3HPLC 5LGNA 3ZMUA 3W7UA 1M1KW 1GM7A 4GX1A 1Y4MA 1G8MA 2DW4A 5IDJA 2EIJC 1DTOA 3PJSK 3P32A 4RQEA 2UXXA 1EZJA 4GX0A 4MVQA 5LGTA 2X0LA 3NXSA 2HG5C 2F43G 3K0GA 2Y69C 1KP3A 1OCCC 2HR3A 1DF4A 4PDLA 3OR7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XOK G;  2XND G;  3ABU A;  2WSS G;  5L3D A;  2HKO A;  1OHH G;  2JIZ G;  2W6J G;  2WPD G;  1H8H G;  2V7Q G;  3OAA G;  5LHI A;  2IW5 A;  3ZN1 A;  2HLD G;  2XAJ A;  4CZZ A;  2XAQ A;  4UVC A;  3OEH G;  3FKS G;  5LHH A;  3OFN G;  5LHG A;  3ZIA G;  4TSF G;  4Z1M G;  2UXN A;  2XAH A;  1W0K G;  4UV8 A;  4ASU G;  5LBQ A;  2XAS A;  5LGU A;  4KUM A;  5FL7 G;  1FS0 G;  1NBM G;  2W6I G;  5DN6 G;  4XBF A;  1E1Q G;  5L3F A;  1COW G;  2Z3Y A;  4UVA A;  4YXW G;  2H94 A;  4TT3 G;  1MAB G;  2JDI G;  1E79 G;  5L3C A;  2Z5U A;  2XAF A;  2R9I A;  4UV9 A;  3ZMV A;  5L3G A;  5H6Q A;  2QE7 G;  2JJ2 G;  2JJ1 G;  1H8E G;  2V1D A;  3ZMT A;  4UXN A;  3ZN0 A;  1W0J G;  4BAY A;  1EFR G;  5L3E A;  2EJR A;  1E1R G;  5LGN A;  3ZMU A;  2XAG A;  3ABT A;  2DW4 A;  3OE7 G;  2CK3 G;  5L3B A;  2UXX A;  2Y48 A;  3OEE G;  5LGT A;  2X0L A;  2F43 G;  3ZMZ A;  4UVB A;  3ZMS A;  5H6R A;  1BMF G; 
#chains in the Genus database with same CATH topology
 4B2D A;  1P4R A;  3JAL B;  2XOK G;  3L74 H;  3CCQ V;  3TET A;  5IE9 A;  1G4Y B;  1XOU A;  2BCC H;  4WFG A;  3CP1 A;  1JJ2 U;  2CDY A;  2ZIM A;  3CXH F;  1A5U A;  4CS4 A;  4IL6 Z;  1GTO A;  2JGU A;  4FXF A;  4K8X A;  2ARH A;  2R9R B;  3CXC U;  1VIB A;  4LP8 A;  2PYL A;  1K9M W;  1LNQ A;  1A3X A;  2W0F C;  4I50 B;  3MAQ A;  1JFF B;  2DQ0 A;  4Z1M G;  4LFC B;  1M5I A;  3EVK A;  4X9Q A;  3W7S A;  4DR7 O;  1YXB A;  5B1O A;  2WWW A;  3TK1 A;  1B6Q A;  3P30 A;  4BR6 A;  2CUG A;  5EZY A;  2BSK A;  4B08 A;  2P4V A;  3HR0 A;  1F23 A;  1YJW V;  2KSD A;  3C3T A;  3HB3 B;  2Q7G A;  5LP6 A;  5B66 Z;  3ETG A;  2FL4 A;  4K35 A;  1SES A;  1Y6X A;  1IXB A;  2ZNJ A;  1N0N A;  5CBG A;  3AG3 B;  3ZRW B;  1H2M A;  1KYO F;  2LW7 A;  2XAF A;  1L8D A;  1XQ8 A;  1QHT A;  3CRQ A;  1SQB H;  3BJF A;  3HQO A;  1EFR G;  5IYB O;  2EJR A;  2ZM6 B;  4LF6 B;  3K3W A;  1BL8 A;  5KA6 A;  4WFF A;  3HQP A;  2P6J A;  5L3B A;  1P7G A;  4TUY A;  3T0T A;  5FPR A;  3CSX A;  2DQ3 A;  2X6A A;  3KCY A;  3ZMS A;  2ATK C;  1VQO V;  3E89 A;  3PN1 A;  2QWQ B;  3ASN C;  5IT9 N;  3ETE A;  3JAM N;  3CRR A;  4WFA V;  1JR9 A;  3CYO A;  3NR7 A;  1FD9 A;  3DSQ A;  3VBB A;  1SZX A;  5KA5 A;  4DV2 O;  3WB1 A;  1OCZ B;  5KHJ A;  5TIS Z;  4BW5 A;  1R1B A;  4FLT A;  3SRD A;  2JS3 A;  1WNS A;  3KZI Z;  1XMO O;  1Z5W A;  2DYS C;  2UXC B;  3DC6 A;  4MTG A;  1N33 O;  3TGU H;  2IM9 A;  1N34 B;  4X66 B;  2ZXW C;  4PA9 A;  4IIJ A;  4NKG B;  1R6K A;  3BCC H;  3SJB C;  2F66 C;  2PYJ A;  3SR2 C;  3HKD A;  2EIL B;  1SQV H;  3A0B Z;  3IC9 A;  1V9P A;  1M56 C;  2UUA B;  3JAT A;  2F93 B;  4I5S A;  4XBF A;  1RFY A;  1YVW A;  1COW G;  2D3O W;  5KMG A;  1S72 V;  2CTW A;  1HP8 A;  2BE3 A;  4HZ3 A;  4JI1 B;  1OCR B;  3JAW A;  1R3J C;  4PA7 A;  2P7T C;  4JI2 O;  3CE2 A;  1K8A W;  3AG4 C;  4G1N A;  5DEC A;  5BR8 O;  4X1K B;  5EYP B;  2P67 A;  4DV0 O;  4DR2 O;  4JYC A;  2UU9 B;  1YEW A;  4KP4 A;  1AR4 A;  2CAZ C;  2KQX A;  3I5D A;  4EFB A;  2VQF B;  3JAR A;  3LDD A;  1QCE A;  3ZCC A;  1M4U A;  3K57 A;  4RUF A;  3IAY A;  3RN4 A;  1VQP V;  4RUE A;  4CH4 A;  3QTC A;  4YY3 O;  1AI7 A;  2IBZ H;  4YHH O;  1FFT B;  4UCT A;  1Z5V A;  4FM0 A;  1A32 A;  2HJF C;  4IP7 A;  2A9H A;  3KTX A;  1OHH G;  3GQY A;  2IW5 A;  1BQZ A;  4GYC B;  5BZB A;  4DR7 B;  3Q4H A;  1J95 A;  2HVK C;  3H1I H;  3A8T A;  3LSQ A;  3ZS8 C;  3OFN G;  3JD4 A;  3UM7 A;  3N27 A;  4B2D D;  3U0Z A;  1XEQ A;  1VQ8 V;  4KHP O;  4LF5 O;  4L8J A;  1FAF A;  2KG7 B;  1K33 A;  2NR5 A;  1YHQ V;  1AJP A;  1ZX3 A;  3D36 C;  4MSW C;  2IJK A;  1S76 D;  3N2K A;  2VGB A;  1NT2 B;  1JCH A;  3CC2 V;  2M6Y A;  1NJI W;  1ZLZ A;  3K9A A;  1K73 W;  4KL1 A;  5LXT A;  2PY5 A;  3T05 A;  5D5Q A;  3OUF A;  2QSA A;  2NNU A;  3X2Q B;  3JAK A;  4TT3 G;  2GUZ A;  2JDI G;  3ZBH A;  4P9O A;  1PKM A;  2IJJ A;  3AG7 A;  2FKX A;  5JQG B;  2Y4T A;  5GTH Z;  4R50 A;  3ZMT A;  3N2G A;  1VMG A;  4DO2 A;  1BZK A;  4JI4 B;  2RMK B;  4H13 B;  3CRC A;  2QM7 A;  3T1H B;  2EZP A;  3RYC A;  4LCU C;  2DJV A;  1OCZ C;  2B1I A;  3SRF A;  1US6 A;  1SF9 A;  3AG2 B;  4AIL C;  3E22 A;  2XND G;  5FNV A;  1MZF A;  4U7N A;  2ZR3 A;  2B9Z A;  3CEI A;  5E1A C;  2AHZ A;  2V7Q G;  5IYC O;  3KKY A;  1MSD A;  5K1X A;  1PNK A;  3JAS B;  4O4H A;  5JH7 B;  1AJN A;  5H2F Z;  2YSU B;  2EIL C;  2IU3 A;  3STL C;  4I9W A;  4TSF G;  4X64 O;  4QNH B;  3SPJ A;  5EC2 C;  3GWK C;  1NZ6 A;  3BHP A;  1Q81 W;  4YJ2 A;  2IH3 C;  4JTD B;  2Y4U A;  3OR6 C;  3S3W A;  1HDJ A;  3K5L A;  4G28 B;  2W0X A;  4UCU A;  1K7D A;  1OCR C;  1KEC A;  4YJ3 A;  2HFE C;  1TUB A;  3OGC C;  5EK0 A;  1X4T A;  4EFE A;  3K58 A;  5CBF A;  5BXZ A;  1SRY A;  2KKW A;  5BR8 B;  5EIB D;  3M7M X;  2QEX V;  4J9Z B;  2PI5 A;  2JVD A;  3J80 N;  4DV0 B;  1QLE B;  1FYJ A;  1E79 G;  1LUV A;  2P06 A;  2ZIN A;  3FYI B;  3N25 A;  3K9S A;  3KG2 A;  5C93 A;  3F7V C;  2Z5U A;  1TAE A;  1XNR B;  1H8E G;  3QNE A;  1K4D C;  2ZDI A;  2V1D A;  2BTQ A;  3ZHV A;  1RSO A;  1F3W A;  5CA0 A;  3G6E V;  4KCW A;  2R9A A;  2Q68 A;  1E1R G;  1M1K W;  3HPL C;  3O9O A;  4GX1 A;  5IDJ A;  4JI3 O;  3PJS K;  1T5A A;  3SGI A;  4DV3 O;  1TVK B;  4DRX B;  4RQE A;  5LGT A;  4GKJ O;  3NXS A;  4NB5 A;  3K0G A;  3TXQ A;  4B3S O;  4GKK B;  1KP3 A;  3ME3 A;  5LMU O;  3JD2 A;  3ZED A;  2AZ0 A;  3CC7 V;  3EHB B;  1URF A;  3K08 A;  3DGE A;  3RYH A;  2ZQM A;  4I0X B;  4YIO A;  3QVN A;  3ZHQ A;  4PI2 A;  2Q6A A;  4X1Y A;  1LUW A;  3SJA C;  3MDS A;  1FKA O;  2YXY A;  2OTJ V;  4F4L A;  4FMT A;  5B1A B;  2DOS A;  1EN6 A;  3JCZ A;  3SDL A;  4KS0 A;  1GN6 A;  1PD3 A;  4L87 A;  1MG1 A;  1EBO A;  1ROP A;  1HNX B;  4O2A A;  3X2Q C;  5B3S B;  2HHH B;  3BJT A;  4I55 A;  5EC1 C;  5LBQ A;  1L1F A;  3ML0 A;  4Q20 A;  3K5M A;  3UQ8 A;  5FL7 G;  2Q67 A;  4PI0 A;  2OCH A;  1QR8 A;  2YID A;  1WP7 A;  1K5S A;  2A7W A;  1SQG A;  4XDL A;  2X7R B;  5B1N A;  3AAG A;  3H1J H;  2Q73 A;  2YXH A;  4K0K B;  1XMQ O;  1R73 A;  1NR7 A;  3UO3 A;  2IH1 C;  3CRA A;  2YEV B;  2E5L O;  3J81 N;  1AVM A;  4U7O A;  4I7Z B;  2JJ2 G;  2QDO A;  1RPO A;  3AG2 C;  1K97 A;  4BAY A;  5L3E A;  1T5E A;  2DYS B;  1SQQ H;  3SJC C;  2OCC B;  1VQ7 V;  2E75 B;  4DR4 O;  2Y48 A;  1H2K A;  1BSM A;  4U3J B;  3ZMZ A;  2L6L A;  1QVG U;  3J7A U;  1N4C A;  1H2S B;  5FPO A;  2JS5 A;  1WPX A;  4ICG A;  1BHA A;  1XI1 A;  4JI0 O;  3QV6 A;  5JJE B;  3PP7 A;  4PA6 A;  3CX5 F;  4O4J B;  4AQY O;  4MW8 A;  5IJ0 A;  3W7X A;  1F3X A;  1E0T A;  4LNU B;  4TQD A;  4X64 B;  3ZHT A;  3OAA G;  2PGG A;  5GON A;  3MHH C;  4FVM A;  4O4L A;  2WLK A;  3AG4 B;  4UVC A;  4LR3 A;  1FFX A;  4ABM A;  2GDS A;  4GLX A;  1GKF A;  3THO A;  1JFF A;  4DV7 B;  4I4T B;  5KHH A;  3BEH A;  2VQE O;  2QKC A;  1AI4 A;  4X1I A;  2N04 A;  4PDV A;  3RT3 C;  1QLE C;  1B04 A;  2HJD A;  4TV8 B;  5LA6 B;  4WFE A;  1R3I C;  3CPW U;  3FB7 C;  1TUE B;  2FTK A;  1GN2 A;  1WPB A;  4LF4 B;  1FXV A;  2W6I G;  1XDC A;  4X20 B;  3OMA B;  1FXK A;  4J7K A;  1SER A;  3EXA A;  3MD0 A;  1K4C C;  3D3Q A;  4NYK A;  1MNG A;  4F6E A;  4IYI A;  2G50 A;  3T1Y O;  1N32 B;  4YNG A;  4ZI7 B;  3CS5 A;  4JTA B;  4FM2 A;  1DF5 A;  1SC5 B;  4UV9 A;  4JI3 B;  1Q6I A;  1XL6 A;  4B3R B;  5IYD O;  1P84 F;  2X6C A;  3K79 A;  2QTO A;  3M8A A;  3I55 V;  2QWO B;  5LMU B;  4LFA B;  2XAG A;  1IBM O;  4DR6 O;  3K5O A;  2RQ6 A;  4JYA O;  1G6U A;  4A5U B;  3R65 A;  1H2N A;  2RNB A;  2EX3 A;  2VS0 A;  1S0V A;  5B1A C;  1VQ4 V;  3GG8 A;  3JYC A;  4J9Y B;  1MMM A;  4JAS A;  1FXH A;  3K0D A;  5B3S C;  3G80 A;  1Q8I A;  2WPD G;  3SRK A;  5EZY B;  1BT8 A;  3BA9 A;  4CZZ A;  1O9H A;  2BSK B;  3E0W A;  1OCC B;  1G1X B;  5CN0 A;  3HKC A;  4GUN A;  4NR1 A;  5LHH A;  2UUC O;  2QKS A;  2EIK B;  1DK1 A;  1SQF A;  5LHG A;  4UB8 Z;  5LP6 B;  2P5O A;  3APQ A;  1WA8 A;  1GK9 A;  4UV8 A;  3ZRS A;  2XAS A;  5LYJ A;  4LWS A;  4YJ5 A;  3CC4 V;  4ZBM A;  1Q82 W;  2YI9 A;  2JGD A;  2F23 A;  1KUQ A;  3K04 A;  1XMQ B;  4DYL A;  1JJO A;  4QPK A;  4B3T B;  1FS0 G;  5J9P C;  4LFB B;  2E5L B;  1Q6U A;  3SRH A;  1I08 A;  3ETQ A;  4GT1 A;  3LNM B;  2WLI A;  3WB2 A;  2VWJ A;  3MA8 A;  3QO7 A;  2OCC C;  1THZ A;  2MW2 B;  5J2U A;  2LGW A;  3DTU B;  4J42 A;  4TUY B;  1IUR A;  2DN9 A;  2LQT A;  1DLB A;  4AI8 A;  5F2V O;  1AI6 A;  2D2C B;  5H5N A;  2YXL A;  2AGA A;  2QE7 G;  1BHB A;  1WAZ A;  2K1E A;  2ZE6 A;  3ZN0 A;  4EEQ A;  3ZHR A;  3CCM V;  1YIT V;  3E2E A;  2CTR A;  1DGS A;  2QWP B;  4J80 A;  4DR3 O;  3CJH A;  1KC8 W;  2E74 B;  4AQY B;  2Q5Z A;  4JPR A;  5H6R A;  3AG1 B;  2OIG A;  1YIJ V;  4NTX A;  4JV5 O;  2VGG A;  3E8F A;  3ABU A;  4JAV A;  1ZL8 B;  1Y74 A;  4JTC B;  2UXD O;  1H8H G;  2VQE B;  1M57 B;  2EBO A;  2ZE7 A;  1HR0 O;  1ENV A;  4R8C A;  2Z0A A;  3FFQ A;  5IY5 B;  1AJQ A;  1X59 A;  1ARO P;  3FYE B;  1JOY A;  3G2G A;  1R6N A;  3HKD B;  2QJ1 A;  5IJ9 A;  2P90 A;  5JCO A;  3CCV V;  2ZIO A;  3JAT B;  4BIU A;  2EIN B;  1XNQ O;  2GTS A;  4FLX A;  1Z2G A;  3LDE A;  3IS4 A;  3CD6 V;  4G27 B;  3OUS A;  4IT5 A;  5KMG B;  1B3Q A;  3T1C A;  4JZG A;  4CS2 A;  4FPP A;  4ASU G;  2OT5 A;  3JAW B;  5LGU A;  5AG2 A;  2CH7 A;  1A3W A;  1NQT A;  4H0L B;  3T1Y B;  4EB6 A;  5CA1 A;  3CMA V;  4JI5 O;  1F4N A;  1XRE A;  1IBK O;  2BOC C;  2B1G A;  3JAR B;  5BMV A;  3OD4 A;  3APO A;  5KHG A;  4FLW A;  1Q86 W;  2OTL V;  1F51 A;  2ODM A;  3RYI A;  5ITZ A;  4NXN O;  1IBM B;  1NTK H;  4LF7 O;  1WB8 A;  4DR6 B;  2QM4 A;  3ZMV A;  3QO5 A;  1IXM A;  5L3G A;  3K5N A;  4JYA B;  1YTF D;  4FXJ A;  3SPC A;  4ZOL A;  4TWK A;  3QF7 A;  1VQN V;  1FXK C;  1D2D A;  4UXN A;  4FLU A;  2PI4 A;  1FJG O;  1PKX A;  3D8C A;  4LH7 A;  1G8M A;  3CHX A;  3Q4H B;  4MVQ A;  2E76 B;  1Y76 A;  1OCC C;  4Z1V A;  3KHD A;  2HR3 A;  3OR7 C;  4O4I A;  2EIK C;  4W4L A;  2YI8 A;  4JF3 A;  1NU1 H;  2WLL A;  1WB7 A;  2AZ2 A;  1H38 A;  4J11 A;  2UUC B;  4GCZ A;  2LFS A;  5LP6 C;  1M90 W;  1R3K C;  4U3F H;  2YIB A;  3T4Z A;  4R7C A;  1YJ9 V;  2RDC A;  3N2K B;  4KCV A;  3SYC A;  1UFI A;  1I5X A;  4QE7 A;  2OIE A;  5LXT B;  4CC6 A;  4DV2 B;  2K9P A;  1HNZ O;  3CRM A;  3DC5 A;  4ZKI A;  3ZHS A;  1Q5O A;  3JAK B;  4DW1 A;  1Y67 A;  4RO2 A;  1EN4 A;  2GUZ B;  3LSU A;  1XMO B;  4I9Q A;  1N33 B;  2CTP A;  2UXB O;  1GO3 F;  3UT5 A;  3OT7 A;  3GR4 A;  5K1P A;  1IZ3 A;  3OTO O;  4Q6G A;  2PUS A;  4QPJ A;  3AEI A;  3F5W C;  3N2G B;  1AI5 A;  4O2B A;  4X62 O;  2QWR B;  2N74 A;  3QV9 A;  2P22 C;  3WB0 A;  2QR4 A;  5HFM A;  2ITC C;  5IYZ A;  2H94 A;  3HKB A;  3M99 B;  1M9N A;  4N23 A;  4CH5 A;  1SA0 A;  3RYC B;  3IJ4 A;  1AR1 B;  3RYF A;  4LC1 A;  3AG1 C;  3E22 B;  5FNV B;  1OCO B;  4JI2 B;  2GBO A;  1YJN V;  3T07 A;  5EIB C;  3DXR A;  1W0J G;  1WJZ A;  3C3S A;  1VQ5 V;  3ABL B;  4J41 A;  2JEU A;  4JV5 B;  4QGP A;  5CB4 A;  3SPG A;  5JJN B;  1M57 C;  1PP9 H;  4DR2 B;  1TGO A;  2B5U A;  2L35 A;  2LO1 A;  3R66 A;  3BY6 A;  1YDX A;  4B7E A;  5E79 Z;  4O4H B;  2WAM A;  5IY5 C;  3RGB A;  1BMF G;  4K3A A;  4H44 B;  4DV5 O;  5GTI Z;  4IHJ A;  5JWP A;  4DV1 O;  2EIN C;  3E35 A;  1F4M A;  5KX5 A;  4DUY O;  5EBL C;  3KCX A;  3ABK C;  4FK5 C;  4YJ2 B;  3B09 A;  3GWO A;  1Q90 D;  4FFB A;  4YY3 B;  4YHH B;  4D7S A;  3IFX A;  4YJ3 B;  2MK3 A;  1TUB B;  2NN4 A;  2N05 A;  1NTZ H;  3RVY A;  4DR1 O;  1S5L Z;  1VQ6 V;  4PDR A;  3ZX6 A;  3BPZ A;  5LOV A;  3S3X A;  2XTA A;  5KLV H;  5KHK A;  1QBZ A;  2PZS A;  4MT8 A;  4X89 A;  2Q9L A;  4JI5 B;  3T4D A;  1U96 A;  4KHP B;  1WP8 A;  3VQW A;  4LF5 B;  4HAM A;  4QG9 A;  3BFR A;  1GRJ A;  4WFH A;  2Q0A A;  1IVS A;  3SYQ A;  4X65 O;  1H2G A;  1NI8 A;  4NXN B;  2BTQ B;  4TV9 A;  1RSO B;  4LF7 B;  5CA0 B;  1SKV A;  5FLX N;  4DK0 A;  2VRZ A;  1WN7 A;  2C2A A;  1XUQ A;  3U10 A;  1WLE A;  4UVA A;  2WLM A;  1QU7 A;  4ZHQ A;  1MAB G;  5C8Y A;  4E2L A;  1FJG B;  2WA3 A;  4FLZ A;  4HNA A;  4NTY A;  1HW7 A;  1AP5 A;  3CCS V;  1NH2 D;  2R9I A;  5H9C A;  2ZM6 O;  4LF6 O;  2CTQ A;  3SYO A;  3RYH B;  4J7Z A;  4NXM O;  5IWA O;  4JI6 O;  1KKC A;  1R6T A;  4DR5 O;  4X1Y B;  1AP6 A;  2F95 B;  3RVZ A;  3ABT A;  4AHC A;  3C90 A;  1NVP D;  4P2Z A;  1I5Y A;  2LJ2 A;  3L9D A;  1SQX H;  4MTF A;  1VQL V;  3TCU A;  4MVZ A;  5DM6 V;  4C7U A;  4UVB A;  4FIP C;  3EOE A;  1BS3 A;  1VF5 B;  3HKE A;  3QV7 A;  2VWK A;  4PHZ A;  4O2A B;  3JSL A;  3LSS A;  5B1B B;  3H6O A;  4WBN A;  2UUB O;  4F6R A;  5J2T A;  5KHI A;  2HKO A;  3BA8 A;  3CB2 A;  5JVD A;  2JRI A;  1HNZ B;  4I55 B;  2ZKO A;  2VGF A;  1GMG A;  2YDE A;  4KCU A;  1EM1 A;  4OGQ B;  3UO2 A;  5CMU A;  3FAV A;  1ZAU A;  2Y69 B;  2XAQ A;  1OJH A;  2CGO A;  2PF4 E;  3FKS G;  3OEH G;  2OWO A;  3ICX A;  1N34 O;  2WLJ A;  3JAL A;  4X66 O;  1F7Y A;  1V54 C;  1D5N A;  3LUT B;  1H2L A;  2UXN A;  1NKD A;  1GM9 A;  1IDS A;  4GZR B;  2RCV A;  3BVO A;  3I56 V;  5KUM A;  1K34 A;  1IBL O;  2YIB D;  1CEZ A;  2EJ7 A;  1Q3E A;  3A2F A;  2A06 H;  4H33 A;  4DUZ O;  4I50 A;  1OCO C;  3BRC A;  1Q6H A;  1JVM A;  5A2Q N;  1SS3 A;  4FLV A;  4KFM A;  1GAX A;  1AB3 A;  1KU9 A;  4RQF A;  3ABL C;  3H1H H;  3T2M A;  3JD0 A;  1VAR A;  1YZB A;  4GX2 A;  4D6T H;  2ZCE A;  2DE0 X;  1I94 O;  1D5A A;  5H6Q A;  3L75 H;  1VQK V;  4PJ0 Z;  4J7J A;  2VQF O;  4GX5 A;  1HNW O;  4H37 A;  2H3O A;  4DV5 B;  5IJ0 B;  2QM8 A;  4B3M O;  3G71 V;  2AW9 A;  2X6B A;  3SYP A;  4DV1 B;  5GON B;  4DUY B;  2EUL A;  3L71 H;  3OE7 G;  4XDJ A;  3D36 A;  4O4L B;  1KMI Z;  2OYQ A;  3ZRW A;  2Q69 A;  2DYR B;  1AIL A;  1FFX B;  2O57 A;  1V55 B;  4BWA A;  4DV3 B;  1RP3 B;  4GKJ B;  4DR1 B;  4B3S B;  3B40 A;  2WSS G;  4JYB A;  4OPH A;  5A9G A;  4IMA A;  4X1I B;  1B06 A;  2JIZ G;  1YF2 A;  4NVP A;  3B8M A;  3ZN1 A;  2HLD G;  1K5Q A;  3FB5 C;  3A0H Z;  2ZE5 A;  2P4K A;  4FM1 A;  1YTF B;  3BAA A;  2PTM A;  1MA1 A;  2ZDI C;  2YUA A;  4DK1 A;  1UJW B;  2YIC A;  1NR1 A;  1FXK B;  4X65 B;  4CC5 A;  1QLN A;  1YI2 V;  1XHX A;  4LF9 O;  1KD1 W;  1K3E A;  4CBC A;  1W0K G;  1CPY A;  1XHZ A;  1PKY A;  3ABM B;  4DXW A;  2H8P C;  1RPR A;  1NTM H;  3JCU Z;  3K06 A;  4TQF A;  1XBL A;  3QO8 A;  3P3P A;  2HEP A;  3W7T A;  5L3F A;  2DWD C;  4PV1 B;  4NXM B;  4JI6 B;  5IWA B;  4DR5 B;  4MVM A;  3EFF K;  2CGN A;  2BTO A;  2BOB C;  1KQS U;  3LNN A;  1W59 A;  1PKL A;  3ZRX A;  4K8Z A;  4JI4 O;  4RWU A;  4EKW A;  4CS3 A;  2ADP A;  2Q8V A;  3T1H O;  3STZ C;  5B1B C;  2ZR2 A;  3H9V A;  3ZMU A;  1J5E O;  1GM7 A;  4JZ2 A;  1Y4M A;  1L0N H;  2EIJ C;  1DTO A;  2UUB B;  2DMX A;  4W4K A;  3P32 A;  2UXX A;  3HQN A;  4GX0 A;  2RN9 A;  1VF7 A;  2QGN A;  2GV9 A;  2Y69 C;  3HKC B;  1DF4 A;  4PDL A;  3RW0 A;  2YIA A;  4DR4 B;  3ZHU A;  4X1K A;  5EYP A;  4LH6 A;  3B2E E;  4QG6 A;  3G4S V;  1N8R W;  1ZL8 A;  2F1M A;  1M93 A;  1WA8 B;  3E83 A;  4JI0 B;  3OTF A;  3VQX A;  5LYJ B;  4CH3 A;  4LWS B;  1ZWI C;  2IJH A;  1PKN A;  2JGD B;  4UCV A;  3E8G A;  2LW1 A;  1JMK C;  4HYW A;  1XL4 A;  4FFK A;  1IBL B;  4QJF B;  4WJ8 A;  4JI7 O;  3B4S A;  2WLI B;  1Y66 A;  3VQV A;  1E0U A;  4MVO A;  4DUZ B;  1ZTE A;  1IX9 A;  1L0L H;  2XAH A;  1U97 A;  1N0J A;  5J2U B;  3IC7 A;  3FB8 C;  2LP7 A;  4IIJ B;  3D3I A;  3TJT A;  2GSM B;  2R70 A;  5B5E Z;  1MSW D;  2HP8 A;  1VP7 A;  3JD3 A;  1I94 B;  4PD4 F;  1KB9 F;  5LL6 Y;  4JAU A;  2QWN B;  3OGI B;  2Z3Y A;  3ABK B;  3UCS C;  5EBW C;  3ZJZ A;  2VGI A;  4J10 A;  3CME V;  1EN5 A;  2WLN A;  1HNW B;  1XNR O;  2KG7 A;  3CJH B;  4MTX A;  4XDK A;  2ZE8 A;  4B3M B;  1SQP H;  3B77 A;  2DYR C;  1GN3 A;  3H1L H;  2EIM B;  1V55 C;  4UB6 Z;  3WG7 B;  4MW3 A;  1BGY H;  2Q7H A;  1N36 O;  2GHY A;  1Y74 B;  2Q0O C;  3FD9 A;  4QE9 A;  4MTO A;  4GKK O;  4QGC A;  5EBM C;  4P9P A;  1QQC A;  1QNM A;  2YC0 A;  5JQG A;  1SZT A;  2JEX A;  5IJ9 B;  4UCR A;  2RJZ A;  2R72 A;  4KCT A;  2YS8 A;  3RWR D;  4UUJ C;  1KP2 A;  2ZNI A;  2ZD9 A;  2AXT Z;  1P49 A;  1HWY A;  5LHI A;  1VF6 A;  2Q7E A;  1NH2 B;  4LF9 B;  4MVU A;  3P3N A;  3AG3 C;  4MVR A;  2ITD C;  3ABM C;  4YIP A;  2CH7 B;  4JPG A;  1ZUQ A;  3OMI B;  1HNX O;  1K92 A;  1VP8 A;  4EB6 B;  1CP9 A;  5CA1 B;  3G67 A;  2HHH O;  4KRZ A;  1PL0 A;  3ZIA G;  1NVP B;  2F4V O;  4LBE C;  4JI8 O;  5BMV B;  4QIW F;  3H1K H;  3BAB A;  1RM1 B;  3RYI B;  4PA4 A;  5ITZ B;  4KUM A;  2QA4 V;  5LMN O;  2E28 A;  4Z2W A;  5KAI Z;  3JAS A;  3LDC A;  5JH7 A;  3AK2 A;  1S5H C;  3VOU A;  4ZOL B;  5KUK A;  2NLJ C;  4P30 A;  5DN6 G;  2V4D A;  5CBH A;  4K0K O;  2A0L A;  2WA4 A;  3E86 A;  4MVS A;  3VQY A;  1TA8 A;  3L72 H;  1KBH A;  2FML A;  4YXW G;  3ASO B;  1PNM A;  1I0H A;  1LR1 A;  1JX9 A;  2QKA A;  4OX9 O;  1J5E B;  1S77 D;  2LGQ A;  4LF8 O;  1OV9 A;  1Y76 B;  1QR9 A;  4O4I B;  4DW0 A;  2JJ1 G;  3TXS A;  2WLL B;  1S3J A;  3JD1 A;  1ZJH A;  3CCR V;  4JAA A;  3E8H A;  4D7T A;  1V54 B;  3AK1 A;  4KXR A;  4DV4 O;  3O65 A;  4B7K A;  4DV6 O;  1T57 A;  1PV0 A;  4X8A A;  4DRS A;  3OEE G;  2XT9 A;  1VQ9 V;  2CE4 A;  1ORQ C;  1GH6 A;  4DR3 B;  1A49 A;  3U11 A;  2ADQ B;  4JGS A;  3SJQ C;  1XIL A;  3L70 H;  1GN4 A;  5KAF Z;  3RBZ A;  5L3D A;  3H01 A;  1YSC A;  3UKM A;  2HVJ C;  4JI7 B;  4MS2 A;  1KKD A;  2XAJ A;  3UT5 B;  1TVK A;  4DRX A;  4DV7 O;  2UXD B;  2Q4P A;  1HR0 B;  3G6B A;  3ETD A;  1Q7Y W;  4FJC C;  4BIO A;  4WFB V;  1PPJ H;  1BE3 H;  1YCI A;  4BW9 A;  2FB5 A;  4O2B B;  1JQ0 A;  3E0V A;  3W7W A;  3CCU V;  2ILM A;  2XUM A;  4I0X A;  5D5P A;  5JJJ B;  1PM9 A;  5IYZ B;  4N21 A;  3HKB B;  1XNQ B;  4PA3 A;  1PL4 A;  1SA0 B;  4LF4 O;  4FLY A;  1S5J A;  4HYV A;  4RAI A;  4FZ0 A;  3SPI A;  3OM3 B;  3K59 A;  3OW2 U;  3RYF B;  3GVM A;  4LFC O;  4UFZ A;  4X88 A;  4G2K A;  1Q43 A;  4HBN A;  2A3Q A;  2EIM C;  1AR5 A;  3CWB H;  3DXR B;  1E1Q G;  1QVF U;  3WG7 C;  1N32 O;  1NS1 A;  4RPP A;  3SPH A;  5CB4 B;  3GB7 C;  2EZO A;  4NTW A;  5CA3 A;  3U2Z A;  2JK5 C;  1GM8 A;  1N36 B;  4B3R O;  2XHB A;  3WFV A;  1IBK B;  5BY1 A;  3L73 H;  1EZV H;  2AHY A;  3AK3 A;  5L3C A;  3F7Y C;  5JCO C;  4IHJ B;  4LFA O;  1FPO A;  5KX5 B;  1R3L C;  3E8B A;  2G38 A;  2DWE C;  4FFB B;  4E4E A;  3QG5 A;  3WU2 Z;  2QTS A;  4OXS A;  2CK3 G;  3QV8 A;  5HFL A;  2YEV A;  1W2B U;  1CXZ B;  1JPX A;  3CCE V;  4PDM A;  1AQF A;  2Y0P A;  5LOV B;  1MZE A;  4OPA A;  2E3C A;  5GW7 A;  2W6J G;  3FX7 A;  1RM1 C;  2F4V B;  1P7B A;  3JSN A;  4JI8 B;  3SYA A;  4ZIB A;  4UCO A;  1ZSP A;  2LFR A;  4U3J A;  3ASN B;  4TV9 B;  5LMN B;  4FZ1 A;  1JA8 A;  4CH6 A;  3IGA C;  4WF9 V;  4O4J A;  4ZHQ B;  3ASO C;  1SET A;  1OZ0 A;  1VF6 C;  4LNU A;  2IU0 A;  4BIZ A;  5C8Y B;  3OMN B;  4TOI A;  4WCE V;  1PNL A;  3QTG A;  2EIJ B;  2GTA A;  4HNA B;  1VEW A;  2KB1 A;  4B3T O;  4LFB O;  2ZT9 B;  4HYO A;  3ZRV A;  2UXC O;  4QG8 A;  4OX9 B;  2UXB B;  4LF8 B;  3B8N A;  1NBM G;  4PEL A;  4I4T A;  3OTO B;  3A0R A;  4R6Z A;  1BQ0 A;  3CCL V;  2Y0I A;  3F5T A;  1I7F A;  2WLH A;  2ZXW B;  2FYU H;  4X62 B;  1VQM V;  4DV4 B;  4DV6 B;  4TV8 A;  1UPG A;  5LA6 A;  1MOF A;  3K03 A;  4UCS A;  2UUA O;  3FB6 C;  2A79 B;  3HKE B;  1M56 B;  3CCJ V;  1BCC H;  4IYH A;  4X20 A;  3MHS C;  4WBN B;  4IGG A;  2M7W A;  4JI1 O;  2ETN A;  2IJI A;  4F6R B;  5LGN A;  3W7U A;  5J2T B;  5JVD B;  1O9G A;  2DW4 A;  5DED A;  3FAV B;  1EZJ A;  4JYY A;  4ZI7 A;  2X0L A;  2HG5 C;  2F43 G;  2UU9 O;  3RFR A; 
#chains in the Genus database with same CATH homology
 1P4R A;  3JD2 A;  2XOK G;  3CCQ V;  2EIK C;  3TET A;  4JF3 A;  3CC7 V;  3EHB B;  2WLL A;  3K08 A;  1G4Y B;  3DGE A;  2ZQM A;  1H38 A;  4GCZ A;  2LFS A;  4WFG A;  3CP1 A;  2Q6A A;  3G4S V;  1N8R W;  1JJ2 U;  1M90 W;  1R3K C;  3E83 A;  3T4Z A;  4R7C A;  1YJ9 V;  1GTO A;  2R9R B;  3CXC U;  1ZWI C;  2IJH A;  3SYC A;  2OTJ V;  1I5X A;  3E8G A;  4F4L A;  4LP8 A;  4FMT A;  5B1A B;  4QE7 A;  1K9M W;  1LNQ A;  1XL4 A;  4QJF B;  3JCZ A;  2W0F C;  1PD3 A;  4L87 A;  2DQ0 A;  1MG1 A;  1EBO A;  4Z1M G;  1ROP A;  4ZKI A;  2WLI B;  3W7S A;  3X2Q C;  1Y66 A;  4MVO A;  4RO2 A;  5B1O A;  5B3S B;  2XAH A;  2WWW A;  3TK1 A;  1B6Q A;  3P30 A;  5EC1 C;  3IC7 A;  3FB8 C;  5LBQ A;  1L1F A;  3ML0 A;  2LP7 A;  4Q20 A;  1GO3 F;  3D3I A;  2GSM B;  5FL7 G;  2Q67 A;  1MSW D;  1QR8 A;  4QPJ A;  3AEI A;  3F5W C;  1F23 A;  3JD3 A;  1YJW V;  1AI5 A;  1K5S A;  3HB3 B;  4JAU A;  2Z3Y A;  3ABK B;  2X7R B;  4XDL A;  5B1N A;  5EBW C;  5HFM A;  3ZJZ A;  2ITC C;  3AAG A;  3CME V;  3ETG A;  2H94 A;  2WLN A;  3M99 B;  1M9N A;  4N23 A;  1SES A;  4MTX A;  1R73 A;  4XDK A;  1NR7 A;  5CBG A;  3AG3 B;  2IH1 C;  3ZRW B;  3B77 A;  2YEV B;  2XAF A;  2DYR C;  1AR1 B;  4U7O A;  4LC1 A;  2JJ2 G;  3AG1 C;  2EIM B;  1RPO A;  1V55 C;  3AG2 C;  1OCO B;  1YJN V;  3WG7 B;  1K97 A;  4MW3 A;  1W0J G;  4BAY A;  1EFR G;  5L3E A;  2DYS B;  5IYB O;  2EJR A;  2GHY A;  2OCC B;  1VQ5 V;  3ABL B;  2JEU A;  3RW0 A;  1VQ7 V;  4QE9 A;  3K3W A;  3SPG A;  1BL8 A;  4MTO A;  5KA6 A;  1M57 C;  4WFF A;  2B5U A;  5EBM C;  2P6J A;  3BY6 A;  4P9P A;  5L3B A;  2Y48 A;  2WAM A;  2DQ3 A;  5IY5 C;  1SZT A;  2JEX A;  3ZMZ A;  2X6A A;  3ZMS A;  2ATK C;  1VQO V;  1BMF G;  3E89 A;  1QVG U;  3ASN C;  1WPX A;  3ETE A;  1BHA A;  2EIN C;  4UUJ C;  3E35 A;  1F4M A;  1KP2 A;  4WFA V;  5EBL C;  4PA6 A;  3ABK C;  4FK5 C;  2ZD9 A;  3CYO A;  4MW8 A;  3W7X A;  3GWO A;  1HWY A;  3OAA G;  5LHI A;  3VBB A;  3MHH C;  1NH2 B;  5KA5 A;  4MVU A;  3IFX A;  2MK3 A;  1OCZ B;  3AG3 C;  4MVR A;  2ITD C;  3ABM C;  2WLK A;  3AG4 B;  4UVC A;  3RVY A;  3OMI B;  4BW5 A;  1K92 A;  1VQ6 V;  1GKF A;  4PDR A;  1CP9 A;  1PL0 A;  3BEH A;  3ZIA G;  2DYS C;  4MTG A;  1NVP B;  1AI4 A;  4LBE C;  4PDV A;  1QBZ A;  2ZXW C;  4QIW F;  4MT8 A;  4PA9 A;  4X89 A;  1QLE C;  1RM1 B;  3T4D A;  4PA4 A;  4HAM A;  4KUM A;  2QA4 V;  4WFE A;  1R6K A;  4WFH A;  1R3I C;  3CPW U;  3FB7 C;  1TUE B;  2FTK A;  3LDC A;  3SYQ A;  1H2G A;  2EIL B;  1S5H C;  1FXV A;  3VOU A;  2W6I G;  1M56 C;  5KUK A;  2NLJ C;  4P30 A;  5DN6 G;  3OMA B;  4I5S A;  4XBF A;  1FXK A;  5CBH A;  2A0L A;  3E86 A;  4MVS A;  1SER A;  1COW G;  2D3O W;  2C2A A;  1WLE A;  3MD0 A;  1K4C C;  2WLM A;  4UVA A;  3ASO B;  1PNM A;  4YXW G;  1S72 V;  1MAB G;  4E2L A;  1JX9 A;  4HZ3 A;  1OCR B;  1R3J C;  4PA7 A;  1S77 D;  2P7T C;  4JTA B;  1K8A W;  1QR9 A;  1DF5 A;  3CCS V;  3AG4 C;  1NH2 D;  2R9I A;  4UV9 A;  5H9C A;  1XL6 A;  2JJ1 G;  5IYD O;  2X6C A;  2WLL B;  1S3J A;  3K79 A;  2QTO A;  3JD1 A;  2P67 A;  3CCR V;  3SYO A;  3I55 V;  3E8H A;  1V54 B;  4JYC A;  4KP4 A;  2XAG A;  3RVZ A;  3ABT A;  3LDD A;  1NVP D;  4X8A A;  1QCE A;  4P2Z A;  3ZCC A;  1I5Y A;  3OEE G;  4MTF A;  1VQ9 V;  1VQL V;  3R65 A;  3TCU A;  1ORQ C;  4RUF A;  4MVZ A;  5DM6 V;  4UVB A;  1VQP V;  4FIP C;  1S0V A;  4RUE A;  5B1A C;  4JGS A;  3SJQ C;  1AI7 A;  1VQ4 V;  3JYC A;  1FFT B;  3LSS A;  4J9Y B;  5B1B B;  2HJF C;  4JAS A;  2A9H A;  1FXH A;  3K0D A;  3RBZ A;  5L3D A;  5B3S C;  2HKO A;  1YSC A;  3H01 A;  1OHH G;  2WPD G;  2HVJ C;  3UKM A;  2IW5 A;  1GMG A;  5BZB A;  4MS2 A;  1KKD A;  2XAJ A;  4CZZ A;  1J95 A;  2HVK C;  5CMU A;  2Y69 B;  2XAQ A;  1OCC B;  3LSQ A;  3OEH G;  3FKS G;  5CN0 A;  5LHH A;  3ETD A;  2QKS A;  2EIK B;  1Q7Y W;  4FJC C;  3OFN G;  2WLJ A;  3JD4 A;  4WFB V;  3UM7 A;  1JQ0 A;  5LHG A;  3W7W A;  3CCU V;  1V54 C;  3LUT B;  1VQ8 V;  2UXN A;  4N21 A;  1NKD A;  1GM9 A;  1GK9 A;  1K33 A;  4WCE V;  4UV8 A;  3ZRS A;  4PA3 A;  1YHQ V;  2XAS A;  1AJP A;  3I56 V;  4MSW C;  5KUM A;  1K34 A;  2IJK A;  3CC4 V;  4RAI A;  1S76 D;  4ZBM A;  3SPI A;  1CEZ A;  3OM3 B;  1Q82 W;  3OW2 U;  1JCH A;  3K04 A;  4X88 A;  3CC2 V;  4G2K A;  1NJI W;  3K9A A;  1K73 W;  4H33 A;  4QPK A;  2EIM C;  1FS0 G;  5J9P C;  1OCO C;  1JVM A;  3OUF A;  1E1Q G;  1QVF U;  3WG7 C;  4GT1 A;  4KFM A;  2NNU A;  3LNM B;  2WLI A;  3X2Q B;  4RQF A;  3QO7 A;  2OCC C;  3ABL C;  1THZ A;  3SPH A;  3GB7 C;  2EZO A;  5CA3 A;  3T2M A;  4TT3 G;  2JK5 C;  3JD0 A;  1GM8 A;  2JDI G;  4GX2 A;  3DTU B;  4P9O A;  2IJJ A;  3WFV A;  1DLB A;  1AI6 A;  2AHY A;  5L3C A;  3F7Y C;  5H6Q A;  2QE7 G;  1BHB A;  1VQK V;  4R50 A;  2K1E A;  3ZMT A;  1R3L C;  4GX5 A;  3ZN0 A;  3E8B A;  4H37 A;  4DO2 A;  3CCM V;  1YIT V;  3E2E A;  2DWE C;  2QM8 A;  3G71 V;  2X6B A;  3SYP A;  2QM7 A;  3OE7 G;  4OXS A;  2CK3 G;  1KC8 W;  4XDJ A;  3D36 A;  2EZP A;  4LCU C;  1OCZ C;  5HFL A;  2B1I A;  4JPR A;  3ZRW A;  2Q69 A;  2DYR B;  2YEV A;  1W2B U;  1JPX A;  5H6R A;  3AG1 B;  1YIJ V;  1V55 B;  3AG2 B;  3CCE V;  4PDM A;  2XND G;  4U7N A;  2ZR3 A;  3E8F A;  3ABU A;  4JAV A;  4JYB A;  2WSS G;  4JTC B;  5GW7 A;  2JIZ G;  5E1A C;  2W6J G;  2AHZ A;  1H8H G;  2V7Q G;  1M57 B;  5IYC O;  3B8M A;  2EBO A;  3ZN1 A;  2HLD G;  1ENV A;  1RM1 C;  4R8C A;  1K5Q A;  3FB5 C;  1P7B A;  1PNK A;  3SYA A;  5IY5 B;  1AJQ A;  1ARO P;  3FYE B;  1AJN A;  1YTF B;  1R6N A;  2LFR A;  1JOY A;  2YSU B;  2EIL C;  2IU3 A;  2P90 A;  3ASN B;  3CCV V;  2ZDI C;  3STL C;  1UJW B;  4I9W A;  4BIU A;  2EIN B;  1NR1 A;  3IGA C;  1FXK B;  4TSF G;  3LDE A;  4QNH B;  3SPJ A;  1QLN A;  3CD6 V;  5EC2 C;  1YI2 V;  4G27 B;  3OUS A;  4WF9 V;  1Q81 W;  1KD1 W;  3T1C A;  2IH3 C;  4JTD B;  1K3E A;  3OR6 C;  4CBC A;  3ASO C;  1SET A;  1OZ0 A;  1W0K G;  4FPP A;  2IU0 A;  2OT5 A;  4ASU G;  3OMN B;  4G28 B;  4BIZ A;  1PNL A;  1CPY A;  2EIJ B;  5LGU A;  1K7D A;  1OCR C;  2KB1 A;  1KEC A;  3ABM B;  4DXW A;  2HFE C;  4HYO A;  2H8P C;  3ZRV A;  1NQT A;  3OGC C;  1RPR A;  3K06 A;  5EK0 A;  3QO8 A;  3B8N A;  1NBM G;  4PEL A;  3W7T A;  3CMA V;  5L3F A;  1F4N A;  5CBF A;  3A0R A;  1SRY A;  4R6Z A;  3CCL V;  2BOC C;  2WLH A;  2DWD C;  2ZXW B;  2QEX V;  4J9Z B;  2PI5 A;  2B1G A;  1VQM V;  1QLE B;  4MVM A;  1Q86 W;  3EFF K;  2OTL V;  1E79 G;  1F51 A;  1KQS U;  2BOB C;  1MOF A;  3FYI B;  3K03 A;  3ZRX A;  3KG2 A;  5C93 A;  3F7V C;  2Z5U A;  3FB6 C;  3ZMV A;  2A79 B;  3QO5 A;  1IXM A;  5L3G A;  1H8E G;  3QNE A;  1K4D C;  2ZDI A;  1M56 B;  2V1D A;  3SPC A;  4EKW A;  3CCJ V;  1YTF D;  4TWK A;  1VQN V;  1FXK C;  4UXN A;  3G6E V;  3MHS C;  3STZ C;  2PI4 A;  2M7W A;  2Q68 A;  1E1R G;  1PKX A;  2IJI A;  2ZR2 A;  5B1B C;  3HPL C;  5LGN A;  3ZMU A;  3W7U A;  1M1K W;  1GM7 A;  4GX1 A;  1Y4M A;  1G8M A;  2DW4 A;  5IDJ A;  2EIJ C;  1DTO A;  3PJS K;  3P32 A;  4RQE A;  2UXX A;  1EZJ A;  4GX0 A;  4MVQ A;  5LGT A;  2X0L A;  3NXS A;  2HG5 C;  2F43 G;  3K0G A;  2Y69 C;  1KP3 A;  1OCC C;  2HR3 A;  1DF4 A;  4PDL A;  3OR7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...