1K8AW

Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1k8aW00
4WFAV 3CCEV 1NJIW 3OW2U 3CCJV 1VQ7V 1YIJV 3CCMV 2D3OW 1M90W 4WCEV 1JJ2U 3CCRV 1W2BU 1KD1W 1VQMV 1KC8W 1Q86W 1VQ9V 3CD6V 1Q82W 3CXCU 1K8AW 4WFBV 1M1KW 3CCSV 1YJNV 3CCVV 2QEXV 1YI2V 1VQ6V 1VQPV 3G4SV 1VQ5V 1QVFU 1YITV 3G6EV 1VQOV 3I55V 1YJWV 1K9MW 3CMAV 1VQ4V 3CMEV 3CC2V 2QA4V 5DM6V 1YHQV 3CCQV 1K73W 2OTJV 1YJ9V 1VQNV 1R73A 3CCLV 3CCUV 1S72V 2OTLV 1KQSU 1Q7YW 1VQLV 1VQ8V 3CC4V 1N8RW 3CPWU 1QVGU 3G71V 1VQKV 3CC7V 3I56V 4WF9V 1Q81W
chains in the Genus database with same CATH superfamily
3JALB 5FPRA 3EHBB 3CCRV 4G28B 1JA8A 4DR6O 4LF4O 2PTMA 4FZ1A 2UXDB 3FX7A 1TUBA 3CCSV 2UUAB 4O2AB 4X9QA 4DUYO 2ZNJA 4FFBA 5JJJB 3EFFK 3T2MA 1M93A 1WP8A 3ASOC 4TQDA 4B3MB 2B9ZA 4YJ2A 5CA1A 4JGSA 4O2AA 4I4TA 1IX9A 4LH6A 2BSKB 1SQQH 3KCXA 1N36O 1TAEA 4N21A 1AI7A 2E5LO 4ZOLA 1S77D 1YITV 5GW7A 2O57A 2BOBC 2CGNA 4FPPA 3RVZA 2OIGA 2E5LB 4JI8O 4HNAB 1PPJH 1M56B 2E3CA 2W6JG 3E83A 3FD9A 4DV3O 4CH5A 4G27B 5B3SC 2Z3YA 4DR2O 1G1XB 3ZMZA 1VF5B 2EIKC 2R9RB 4DUYB 2Q68A 3H01A 2QM4A 2UUAO 1BL8A 1CEZA 4UCRA 4JV5B 3JARA 3UQ8A 1AR4A 1NTKH 3CP1A 5LA6A 3N2KA 1XOUA 3FKSG 2OYQA 3DXRA 4UCOA 5H6QA 4K8XA 3FYEB 4AQYO 4DV3B 1XI1A 1P49A 1SS3A 1Y74A 5TISZ 1BZKA 2QWQB 1AI4A 1BSMA 1IBKB 3I56V 4LFBB 3TGUH 4U7NA 4O2BA 1JPXA 2QGNA 4O4JA 2F4VB 1EM1A 3ETGA 1LR1A 1FFXA 1KB9F 1GM9A 3RYCB 4FLVA 4O4JB 1XNQB 3OFNG 3KKYA 2PYLA 4UVCA 3FFQA 4JI0B 1NZ6A 3U10A 4KL1A 3RFRA 2ZR3A 3ZRVA 1FXKA 5LHHA 4IL6Z 2GV9A 3JASA 1Q82W 4I9QA 2BE3A 3R66A 1HR0B 1Y76A 4DV1B 2CH7A 2RQ6A 4MVOA 2NN4A 5C93A 1JFFB 3BVOA 2DQ3A 1Q6HA 4QIWF 4CH6A 1U97A 4I55B 3CCEV 1R3IC 2DN9A 3C90A 4BIZA 2YI9A 3CRQA 1G8MA 3BHPA 3BRCA 2E76B 4FK5C 2WLIA 4LC1A 2ZE8A 2NR5A 4O4HB 3K03A 2BTQB 4MW8A 5IY5B 4WFGA 1Q7YW 4B3RO 2EBOA 2Y48A 4KHPO 4QPKA 1MSWD 4PDVA 3CWBH 3HKBB 5CB4B 1ZL8A 1V54B 2BOCC 2QWNB 2CTRA 2JRIA 1R3LC 1B06A 2P22C 3K08A 2IW5A 1U96A 5B1NA 2YSUB 5JVDB 4MVQA 4FVMA 4U7OA 2H3OA 4UVAA 1DF4A 3ZRSA 1NVPD 5CBFA 2B5UA 1XDCA 4RAIA 4OX9O 4PA7A 3S3XA 3JATA 2Y4UA 2X7RB 1SQVH 1XEQA 5LMNB 2Q8VA 1B3QA 2EINB 2YS8A 2DE0X 3CMAV 4NXNB 4DV2B 3NXSA 2LQTA 4LWSB 2B1IA 1OZ0A 1K4DC 1PNKA 3H1IH 4K35A 3T4DA 4NXNO 3CRAA 2VQEO 1F4NA 4X65O 3AEIA 2WAMA 5JH7A 1VQOV 3ZRWB 2ZE5A 1VF6A 4NXMO 3CCUV 2V7QG 4LF9O 2Z0AA 2HVKC 5BZBA 3SYQA 3AG4C 4GX1A 1KBHA 5CBGA 1VF6C 4PJ0Z 1N4CA 1H38A 4XDJA 4FLXA 1OCZB 3K04A 2DYSC 5GTIZ 4GT1A 3ZS8C 2AZ0A 3WG7C 4Z2WA 3OTOB 1H2NA 4PDRA 2MK3A 2YEVA 1R6KA 3GB7C 2XT9A 3ZEDA 4UXNA 3E8GA 3G71V 4ZIBA 3DTUB 1Z2GA 2CH7B 3UO2A 1JFFA 3OEHG 4YY3B 2EILB 1HW7A 1D5AA 1L0LH 2LW1A 3G67A 3K3WA 4MVRA 2YEVB 1RFYA 4LF4B 1W59A 5L3GA 4GZRB 4PI0A 1VQPV 2Q6AA 4JI5B 3CMEV 4BIUA 3CHXA 3SJCC 1JOYA 4DK0A 4L8JA 3F7VC 3SYPA 1NJIW 3SYOA 3MHSC 4LP8A 4CC6A 2BTQA 1AJQA 2W6IG 4LCUC 4D7TA 3L71H 4EEQA 1NU1H 5K1PA 4KP4A 3ZHQA 2ZXWC 5CB4A 2KB1A 1O9HA 4F6RB 1ZL8B 1VQLV 1XMOO 1PM9A 1N33O 1D5NA 2YIBA 3CPWU 4FLTA 5ITZA 4UFZA 2WLNA 4X1KB 1YF2A 3SPIA 4EFEA 3E89A 4ICGA 4F6RA 4DV5B 2ZR2A 4CS3A 1WA8A 1QVFU 4X1KA 3LSUA 5KHGA 1GMGA 1XL4A 4X64O 5HFLA 2R9AA 2YIAA 3APOA 5A2QN 3JATB 4OGQB 4NKGB 3WU2Z 3K5MA 2DMXA 1R3KC 4MTGA 2Z5UA 5KHKA 3A0HZ 5JCOA 2KSDA 3DSQA 2GDSA 2C2AA 1M1KW 4L87A 4TSFG 4ASUG 5IYDO 4OPHA 1YZBA 2L6LA 4NXMB 3T1HO 5KMGB 4PHZA 1WN7A 5KHHA 3ZN0A 1YSCA 3ZHVA 1H8HG 1HP8A 4PV1B 1YDXA 5CA0A 3OR7C 3JAKB 3K5LA 1VQMV 4JI4B 1CPYA 3D3QA 5LXTB 3PJSK 2Q73A 3ABMC 3HKCB 3KG2A 2XNDG 4MT8A 1RM1B 2GUZA 4JASA 1JQ0A 2ZDIC 1SA0B 4HYOA 4XDLA 2YUAA 3GVMA 1I94B 3CX5F 4BWAA 3STLC 3W7WA 3ZRXA 1PV0A 3OMNB 4DW0A 4U3FH 4JI5O 3ZJZA 4DUZO 1L8DA 1OHHG 2LO1A 1RPRA 4BIOA 1WLEA 1NTMH 5KLVH 2UXBB 5EZYB 2E75B 1V55B 3WB2A 2DWDC 2LFRA 2V1DA 2P6JA 1AP5A 1L0NH 2WWWA 5LP6A 1NT2B 3N2GB 1KKCA 1PNMA 2PI5A 2GBOA 5IY5C 2X6CA 1FS0G 2WA4A 1VEWA 1YCIA 5J2UA 4X20B 5KAFZ 2OCCC 3N2GA 2E74B 2Q4PA 1E1QG 3AK1A 5JJEB 5D5QA 5IJ9A 4FLUA 5LGTA 4ZI7A 4JI8B 4EB6A 3MHHC 4JAVA 2UXXA 4JI6B 3QTCA 4DR6B 4LR3A 1OCZC 1MABG 4CZZA 1KP2A 1YIJV 1HNWB 2IJHA 2Y0IA 2JS3A 3OEEG 1I94O 4EB6B 4JTAB 1DLBA 2Q9LA 3JAMN 4X89A 3QO7A 1BHBA 2ZT9B 3I55V 1RSOA 2H8PC 4F6EA 1H2GA 4DR1B 2UU9O 5C8YA 1N8RW 2LGWA 1MZEA 2RCVA 3CC7V 4WFAV 1IDSA 1Y6XA 2P5OA 4K8ZA 4GLXA 4QJFB 3OR6C 1M5IA 1BE3H 5BR8B 5BXZA 2ZKOA 1NR7A 2K9PA 1M57B 1CP9A 1UJWB 2HHHB 3CYOA 2AGAA 5KHIA 4LNUB 1IURA 3J80N 2EIMB 4TV8A 3CJHA 4YXWG 3CCMV 4TOIA 1O9GA 1COWG 1AR1B 4QE7A 1DK1A 2P7TC 4WBNB 4DXWA 4LNUA 2EZOA 3JAKA 4GX0A 4UB8Z 2WA3A 3LSSA 3SYCA 4D6TH 4AILC 4JI2O 1IBMB 3HKCA 3TXQA 1SRYA 3BABA 4O4LA 4DRXB 1SQXH 2JEUA 2XUMA 4IT5A 1XMOB 3Q4HA 1Q6IA 3ABLC 4MVMA 4B3TO 1K34A 2EILC 3ABLB 1HNXO 1N34O 3W7TA 1DGSA 4DRXA 3QVNA 1SQPH 3K57A 1M57C 4LF5O 2IJJA 4JYCA 4HBNA 4J41A 5EC1C 4Q6GA 1S3JA 3ZHUA 3RYFB 3B8MA 2DYSB 4X65B 4FLWA 3AG4B 3B2EE 3G80A 1JMKC 1P84F 4YIPA 5DEDA 3SGIA 1K9MW 1OJHA 1K4CC 4R6ZA 3QO8A 3PN1A 4CC5A 1R73A 1IXBA 1FPOA 2HFEC 3QF7A 2LW7A 4UV9A 4JF3A 5B1AC 3H1KH 1T5EA 2HJFC 5IJ9B 3ZX6A 4I0XB 1R1BA 2F4VO 1N33B 4JZ2A 5H5NA 5IT9N 2IJKA 2ETNA 2RDCA 4QNHB 5EC2C 2GTAA 2RN9A 4J7ZA 1S72V 4DV0B 2YDEA 1M9NA 2NLJC 1VP7A 2PUSA 2IU0A 4DR4O 1JJ2U 1Q3EA 2P67A 1FJGB 4X1YA 4GKKO 3B4SA 2ZCEA 4FZ0A 3W7XA 4JI7B 1GO3F 1NR1A 4GX2A 5IYCO 2A7WA 4DR7B 3SPCA 3FB5C 4MSWC 5EIBC 1TVKA 1VQ4V 4JV5O 1JX9A 1HR0O 2M6YA 1XBLA 3OTFA 4IIJA 1H8EG 3DGEA 4FM1A 1I5YA 3ICXA 4PA4A 3TETA 3OW2U 3CCJV 1GM8A 4PA9A 4HAMA 5EIBD 5KA6A 2Y69B 2WLKA 2IM9A 1I5XA 5B1OA 3E35A 1FD9A 3JYCA 2L35A 5LMNO 2WPDG 4DV6B 3L72H 3RYHB 4FFKA 2QJ1A 3E8FA 1V55C 2QTOA 3F5TA 2XAFA 2ZIMA 1VMGA 1BQZA 3F7YC 1KUQA 4CH4A 3UO3A 3RYHA 2ZM6O 4BW5A 2F23A 2KG7A 4P9OA 3MDSA 5JWPA 5F2VO 3J81N 1XNQO 1BCCH 2AW9A 1EN4A 2A0LA 4IYHA 4B3SO 2VQEB 1YXBA 4LF6B 1SESA 2CAZC 4B3RB 2HG5C 4IGGA 1Y67A 3I5DA 3CXCU 1RM1C 4ZHQA 5IJ0A 4R8CA 1HNZB 1VIBA 1HWYA 4JTCB 2Y0PA 3SPHA 4LFAO 1SZTA 3E22A 4WFEA 3K9AA 2CK3G 1DTOA 1GN6A 2UUCB 2GHYA 3OMIB 4LF6O 1KKDA 4FIPC 2ARHA 4GUNA 5FLXN 2WLJA 4NTXA 4TUYA 2DW4A 5L3DA 5DM6V 2YI8A 1IBLB 3DC5A 2XOKG 3D36A 3UKMA 4O4IB 4X66B 4UV8A 1W0KG 2ITCC 4J9YB 3JD0A 5KX5B 4JI1B 4YHHB 4PELA 3ETQA 3OGIB 4DR3O 2GTSA 2G38A 3VQXA 1YJWV 4LF7B 2CE4A 4JYAB 2QSAA 1YHQV 4K0KB 1XHXA 3GWOA 1ROPA 4GKKB 5LA6B 4JTDB 2EULA 1WNSA 2KKWA 1PD3A 4B3TB 1TVKB 1F4MA 3K0GA 3OUSA 1VQ9V 5KUMA 3TXSA 1X59A 1Y74B 4G2KA 1S5LZ 3RT3C 4DR1O 3ABKC 3ABKB 4KFMA 4RUEA 4H0LB 2JDIG 3JD1A 4B3SB 1J5EO 4JI7O 2OCCB 3SJQC 4GKJB 4JI0O 1K5QA 3QNEA 3O65A 4W4KA 3T1CA 1QHTA 2JS5A 1Q5OA 4J10A 3CS5A 1XMQB 4P9PA 2PGGA 2VS0A 2AZ2A 3JCZA 1TUBB 3C3TA 4JI1O 2ZNIA 5BR8O 1SF9A 3LNMB 2KG7B 3BY6A 4JAUA 5AG2A 4LF5B 5H2FZ 2A3QA 2QKCA 2JGDA 5IYZA 1ZX3A 4I4TB 2WLHA 4PDMA 4I55A 4MVUA 1YJ9V 1BS3A 2CTQA 5FNVA 1N36B 3OM3B 1LNQA 2XAGA 2A9HA 1X4TA 1QLEB 3CRRA 3JSNA 1Q8IA 4BW9A 2IH1C 4HNAA 2CUGA 5FNVB 4DV4B 5CA1B 3A8TA 4P2ZA 4H37A 1K5SA 4LBEC 1S76D 4UUJC 2BSKA 2Q69A 1R6NA 2AHYA 5CA3A 2PF4E 3OD4A 3SR2C 2D2CB 2DJVA 3E86A 4GYCB 1NTZH 5JVDA 1K8AW 3AG7A 2IH3C 3CEIA 4ZKIA 1XNRB 5A9GA 1GAXA 2VWKA 4O4IA 2FYUH 2FL4A 1XQ8A 3RVYA 3H9VA 5LMUB 1QNMA 4I7ZB 3NR7A 3AG3B 2YIDA 3A0BZ 4TV9B 2XTAA 1YEWA 5IWAB 2QM7A 5GTHZ 2YICA 2QKSA 4MTFA 3ABMB 2XAHA 4O2BB 3CC2V 3SDLA 1ZAUA 1L1FA 4PA6A 1EBOA 5L3FA 1F7YA 1AROP 3B8NA 3STZC 4GCZA 1N32O 2FKXA 2Y4TA 3RBZA 3RYCA 3GWKC 4NTYA 4EFBA 2XAJA 2QWPB 1N32B 5JCOC 1J5EB 1FXKB 4WFHA 1QR9A 1TUEB 1K33A 4LFCB 3U0ZA 2P4KA 2YC0A 4MVSA 2LGQA 3H1LH 5EBLC 1IBLO 4RO2A 2HEPA 1HDJA 1AI5A 1MMMA 4I50A 3JALA 1LUVA 3IFXA 2QWRB 2B1GA 5L3CA 3B09A 3APQA 2JGDB 4FFBB 4MS2A 1M90W 4E2LA 1Y76B 4DR3B 3WG7B 4Z1VA 5IDJA 3AG1B 3W7SA 2AHZA 1IVSA 2AXTZ 1VF7A 1FFTB 1WPXA 3HKBA 2Q7GA 2IJIA 3K79A 3HPLC 1DF5A 1Y66A 1KD1W 2WLIB 1SQBH 1K92A 1XREA 4O4HA 1F23A 4QE9A 1NH2B 2Q7HA 1PL0A 3LDDA 3LSQA 1Z5WA 1GH6A 4DV7B 5JQGB 1PNLA 4J7KA 1I0HA 1WP7A 3K0DA 1BMFG 3RGBA 1KC8W 3QG5A 1WA8B 3K58A 2YXYA 4GX5A 4JYAO 3HKDA 4LWSA 4QGPA 3WFVA 4LFCO 1EFRG 5BY1A 3CXHF 2ITDC 1YTFB 5EBWC 3OGCC 1KP3A 3P3PA 5K1XA 2F93B 4JI3O 2IU3A 1KECA 3N27A 1VQNV 2ILMA 1ZUQA 4J42A 3DXRB 4OX9B 4FLYA 3AK3A 3TK1A 5JH7B 5LYJA 2DYRC 1Q86W 3TJTA 5KMGA 1G4YB 4A5UB 1NBMG 1S5HC 4LF9B 3ASNC 5LGUA 5JJNB 2QM8A 3VOUA 5HFMA 3FB7C 2ZQMA 3BPZA 3J7AU 3IJ4A 4P30A 1FFXB 4DO2A 2EIJC 2HJDA 3VBBA 5KUKA 3AK2A 3ZRWA 1HNXB 2UUBB 2QE7G 3CD6V 3F5WC 1SZXA 4MTOA 5LOVB 1OV9A 2YXLA 3G6EV 3L70H 1QR8A 2F1MA 3CCLV 3OAAG 4NTWA 4WFFA 4I50B 5D5PA 5LOVA 4DR5B 1GK9A 3VQYA 5GONA 2Q67A 3ZHRA 4K3AA 4B08A 4I9WA 1M4UA 1EZJA 3IGAC 4CS2A 1SC5B 4NR1A 5KAIZ 3THOA 2DQ0A 5J2UB 4X20A 1BQ0A 1XUQA 4DV7O 3FB6C 4YIOA 1OCCB 4YY3O 2BTOA 2K1EA 4UCUA 4JI2B 4UCSA 4KHPB 3JD2A 1VQ5V 4UCVA 4Q20A 3IAYA 1GN3A 5LMUO 2EINC 4DYLA 1NQTA 4NYKA 3VQVA 3K5OA 1WPBA 2WSSG 1I7FA 1EZVH 5JQGA 4JI3B 1RP3B 4JAAA 4NVPA 1Y4MA 2UXCO 2W0XA 3HKEA 4PA3A 5C8YB 3JSLA 1VQ6V 5ITZB 3FAVA 2Q0AA 3HKDB 3QO5A 1MNGA 2UXNA 2QWOB 2VQFO 2FB5A 3HKEB 2XAQA 2ZD9A 4DV0O 2FTKA 3L74H 2V4DA 3FAVB 3KZIZ 2LFSA 4DV4O 4X1IB 4PI2A 2PI4A 5B1BC 1SQGA 4MVZA 2X6AA 2F43G 5LYJB 3G4SV 3CE2A 1ZWIC 2YIBD 4UVBA 3OUFA 1FXKC 2GUZB 5IWAO 3M7MX 4EKWA 1F51A 2PY5A 4J9ZB 4DW1A 1VQ7V 4CS4A 1OCOB 1AB3A 1QLEC 5BMVA 4JYYA 3K06A 1AVMA 3S3WA 5LHGA 3KCYA 2WLLB 1GN4A 4FM2A 1XHZA 5CA0B 5H6RA 1EN5A 1GM7A 3CCQV 3OE7G 4DV5O 3ZMSA 1N0NA 3HR0A 4IHJA 1FYJA 2GSMB 2EIJB 3CC4V 3SJAC 1NI8A 5EZYA 4AHCA 2WLLA 2A06H 3FB8C 5B3SB 4UB6Z 3VQWA 1SETA 5LP6B 3L9DA 2KQXA 2VQFB 3OMAB 3ASOB 1QQCA 2F66C 1XILA 4DR5O 1R6TA 3UM7A 4UCTA 3U11A 3SJBC 2R9IA 3RYFA 3A0RA 5GONB 1K3EA 2UU9B 5LBQA 1QVGU 5EYPB 4F4LA 4RWUA 1NKDA 1AJNA 4J7JA 2LJ2A 1NS1A 1AR5A 1Q43A 3K9SA 3WB0A 1XNRO 2QKAA 1OCOC 5B5EZ 4OPAA 4W4LA 2OWOA 2PYJA 1KYOF 2CTWA 4JI6O 3MAQA 1HNWO 2HKOA 4RUFA 4I5SA 2CGOA 4D7SA 4IYIA 3E8BA 4KUMA 1JVMA 3FYIB 2ZDIA 4K0KO 1Q6UA 1GTOA 1P7GA 3LUTB 3SYAA 3RN4A 3OT7A 1XMQO 1W0JG 2JJ2G 4ZI7B 1ZLZA 1H2MA 1MA1A 2EIKB 4B3MO 2PZSA 2HVJC 3SPGA 3ZBHA 4TWKA 4R7CA 2R72A 2OTJV 5B66Z 4N23A 3ZMTA 5EK0A 1PKXA 3SPJA 4X88A 1UFIA 3W7UA 1BHAA 2UXBO 2W0FC 1RSOB 3T1HB 2P90A 1RPOA 2JJ1G 1OCRB 2ADPA 1V54C 2YXHA 3ML0A 2EJRA 5FPOA 1URFA 3ABTA 2P4VA 1QCEA 2ADQB 1MG1A 1TGOA 4FMTA 2QA4V 1THZA 4LH7A 4X1IA 1FKAO 4B7EA 2WLMA 3H1HH 1LUWA 2D3OW 4WCEV 4XBFA 1S5JA 3BA9A 4FJCC 4PDLA 2N05A 1N34B 5IYBO 3B40A 2LP7A 1ORQC 1K7DA 4AI8A 3CJHB 2CDYA 2FMLA 5LXTA 4YJ3B 1NH2D 5BMVB 4MW3A 3B77A 3Q4HB 2OTLV 1S0VA 2DWEC 3UCSC 1SA0A 3L75H 1Q90D 3K5NA 4IHJB 2ATKC 4HZ3A 1YJNV 4TQFA 1R3JC 1E1RG 2BCCH 5E1AC 1PP9H 4X8AA 1GN2A 4DUZB 3A2FA 1B6QA 3JD4A 1J95A 1I08A 4DV6O 2N74A 5IJ0B 2HHHO 1WAZA 1FAFA 2HP8A 1GKFA 3LDEA 3P30A 4RQFA 3ZMVA 5EYPA 2QEXV 3T4ZA 5EBMC 5B1BB 3E22B 2VWJA 4GKJO 2XHBA 4JI4O 3P3NA 3AG3C 3E2EA 2QR4A 2HLDG 1US6A 1D2DA 2MW2B 3BA8A 4DK1A 2NNUA 2IBZH 2Y69C 3EXAA 5E79Z 2DYRB 4DR7O 5LHIA 1AI6A 3HB3B 5H9CA 1IZ3A 2VRZA 1ENVA 3D36C 3T1YB 3P32A 4FLZA 4ZBMA 4B7KA 1FXHA 2ZIOA 2RJZA 1TA8A 3RWRD 4I0XA 5KX5A 3UT5B 2DOSA 1SKVA 2EJ7A 2HR3A 2Q7EA 3BEHA 1HNZO 1YTFD 3DC6A 3E8HA 4IIJB 3IC9A 4WFBV 2JVDA 1IBMO 3UT5A 4LFAB 2Q0OC 4X62B 2ZINA 4DV2O 1H2KA 2Q5ZA 3M99B 1G6UA 2XASA 1MSDA 3ZHTA 3D3IA 1P4RA 4JYBA 5IE9A 1KQSU 1AP6A 1VARA 2JGUA 3BFRA 5CN0A 1H2LA 4H44B 4BAYA 3ZN1A 2QTSA 1Z5VA 1A32A 2QDOA 1YI2V 5FL7G 4TV8B 2UXDO 1YVWA 3CRCA 2UUCO 1K97A 4AQYB 3ZHSA 1GRJA 3R65A 3O9OA 3TCUA 4WBNA 1WJZA 1VQ8V 3AG1C 3G6BA 5J9PC 3JD3A 1FJGO 1E79G 2UXCB 2UUBO 1JR9A 4Z1MG 4QPJA 4YJ3A 1KU9A 3JCUZ 2JEXA 3H1JH 2X0LA 4PD4F 3CCVV 4R50A 5CMUA 4O4LB 4OXSA 5LGNA 4LF8B 5LP6C 3ZIAG 3AG2C 4FM0A 3JAWB 4DR2B 3D8CA 2OT5A 1NVPB 1SERA 4ZHQB 4YHHO 4X62O 1IXMA 1AJPA 3ETEA 1VQKV 3K59A 1KMIZ 1WB8A 1UPGA 1JCHA 2OCHA 3JAWA 2JIZG 4J11A 2ZM6B 4X66O 3C3SA 1SQFA 1BT8A 4YJ2B 3BCCH 5KHJA 4DR4B 3X2QB 5L3EA 1WB7A 4LFBO 1K73W 2ZE7A 4TT3G 2RNBA 3M8AA 2EX3A 3L73H 2R70A 5DN6G 4WF9V 4XDKA 4ZOLB 2X6BA 2EIMC 1W2BU 4ABMA 3AG2B 4CH3A 1MZFA 3RYIB 1XL6A 4CBCA 5DECA 2EZPA 1P7BA 2RMKB 3IC7A 1EN6A 3EVKA 3MD0A 5J2TB 3RYIA 1Q81W 1MOFA 2ZXWB 3BAAA 2OIEA 4TUYB 1OCRC 2ZE6A 3LDCA 5J2TA 1ZSPA 3ZMUA 4X1YB 4H33A 3JARB 3X2QC 4TV9A 1V9PA 5L3BA 3OTOO 2N04A 3N2KB 4JPRA 1AILA 1QBZA 4U3JB 3CSXA 1QU7A 4C7UA 4DV1O 4LF7O 1CXZB 2CTPA 5LL6Y 3RW0A 4JZGA 3T1YO 4H13B 4U3JA 4E4EA 1OCCC 1ZTEA 3CB2A 3ABUA 5CBHA 1QLNA 4MTXA 1B04A 5B1AB 1PL4A 4J80A 3LNNA 1FXVA 4BR6A 1JJOA 5KA5A 3WB1A 1H2SB 3ZCCA 4LF8O 1BGYH 2JK5C 1IBKO 4X64B 2ODMA 2A79B 2F95B 2M7WA 3ASNB 2P06A 3JASB 2H94A 3CRMA 5IYZB 3ETDA 4NB5A 1M56C 4RQEA 1N0JA 4KXRA
chains in the Genus database with same CATH topology
3OMNB 2WLLA 3EHBB 3ZJZA 3LNMB 3FB8C 3CCRV 3BY6A 4G28B 5B3SB 4JAUA 1OHHG 1SETA 1RPRA 1WLEA 3CCSV 3OMAB 3ASOB 2WLHA 4PDMA 1V55B 3EFFK 3T2MA 2DWDC 3UM7A 2LFRA 2V1DA 3ASOC 2P6JA 2R9IA 4MVUA 1YJ9V 3A0RA 2WWWA 1K3EA 5LBQA 1PNMA 4JGSA 1QVGU 3OM3B 4F4LA 2PI5A 5IY5C 2X6CA 1FS0G 1NKDA 1AJNA 1LNQA 2XAGA 2A9HA 1QLEB 1OCOC 2IH1C 2OCCC 4N21A 1E1QG 1AI7A 1S77D 4P2ZA 1YITV 2HKOA 4H37A 4RUFA 4I5SA 1K5SA 5GW7A 4LBEC 1S76D 4UUJC 5LGTA 2BOBC 2Q69A 3E8BA 3MHHC 4FPPA 3RVZA 4KUMA 4JAVA 1JVMA 2UXXA 1R6NA 3FYIB 2ZDIA 1OCZC 1M56B 1MABG 1GTOA 2AHYA 1KP2A 3LUTB 3SYAA 4CZZA 5CA3A 1YIJV 2IJHA 1W0JG 2JJ2G 3E86A 3OEEG 2W6JG 3E83A 1K8AW 4JTAB 2IH3C 4G27B 1DLBA 4ZKIA 5B3SC 4X89A 2Z3YA 3QO7A 2EIKB 1BHBA 3I55V 2HVJC 3SPGA 4TWKA 2H8PC 3ZMZA 4R7CA 1H2GA 2OTJV 3RVYA 4N23A 3ZMTA 2EIKC 2R9RB 5EK0A 1PKXA 2Q68A 3SPJA 1N8RW 3H01A 3CC7V 4X88A 1BL8A 4WFAV 3W7UA 3AG3B 1CEZA 1BHAA 2W0FC 4QJFB 2P90A 3OR6C 1RPOA 3CP1A 2QM7A 2JJ1G 2QKSA 1OCRB 1V54C 3FKSG 2EJRA 3ML0A 5H6QA 4MTFA 3FYEB 1NR7A 3ABMB 2XAHA 3ABTA 1M57B 3CC2V 1QCEA 1CP9A 1MG1A 1UJWB 1L1FA 4FMTA 2QA4V 4PA6A 1EBOA 1THZA 3CYOA 5L3FA 1AROP 2WLMA 3B8NA 3STZC 4GCZA 1AI4A 3I56V 2EIMB 3RBZA 4U7NA 4YXWG 3CCMV 2D3OW 4WCEV 1JPXA 4XBFA 1COWG 2XAJA 1AR1B 4QE7A 4FJCC 2P7TC 4PDLA 3ETGA 5IYBO 4DXWA 2LP7A 1ORQC 1K7DA 2EZOA 4GX0A 1FXKB 4WFHA 1QR9A 1GM9A 1TUEB 3LSSA 3SYCA 1NH2D 3OFNG 4MW3A 3B77A 2OTLV 1K33A 1S0VA 2DWEC 4UVCA 1SRYA 4MVSA 2ZR3A 5EBLC 3ZRVA 2JEUA 4RO2A 1FXKA 5LHHA 1Q82W 4MVMA 2ATKC 3ABLC 4HZ3A 1K34A 1YJNV 1AI5A 2EILC 3ABLB 1R3JC 3W7TA 1E1RG 5E1AC 4MVOA 5C93A 3IFXA 1M57C 2B1GA 2DQ3A 4X8AA 5L3CA 2IJJA 4JYCA 4QIWF 1B6QA 3JD4A 1J95A 5EC1C 4MS2A 3CCEV 1M90W 1S3JA 4E2LA 1R3IC 3WG7B 5IDJA 3B8MA 3AG1B 2DYSB 4BIZA 1GKFA 3LDEA 3P30A 4RQFA 3W7SA 3AG4B 1G8MA 2AHZA 3ZMVA 2QEXV 3T4ZA 5EBMC 5B1BB 1FFTB 4FK5C 1K9MW 2WLIA 4LC1A 1WPXA 3K03A 1K4CC 4R6ZA 3QO8A 4MW8A 5IY5B 1R73A 3AG3C 4WFGA 1Q7YW 3E2EA 2IJIA 2HFEC 2HLDG 4UV9A 2EBOA 2Y48A 4QPKA 3K79A 4JF3A 1MSWD 4PDVA 2NNUA 3HPLC 1DF5A 5B1AC 2HJFC 1Y66A 1KD1W 2WLIB 2Y69C 1K92A 4QE9A 1F23A 2DYRB 5LHIA 1NH2B 1AI6A 1PL0A 3HB3B 1V54B 5H9CA 2BOCC 3LDDA 1ENVA 3LSQA 3P32A 2IJKA 1R3LC 4ZBMA 1PNLA 1FXHA 4QNHB 3K08A 5EC2C 2IW5A 5B1NA 2YSUB 4MVQA 4U7OA 1S72V 3K0DA 1M9NA 2NLJC 1BMFG 1KC8W 2HR3A 4UVAA 1DF4A 2IU0A 3ZRSA 3BEHA 1JJ2U 1YTFD 2P67A 1NVPD 5CBFA 4GX5A 2B5UA 3E8HA 4RAIA 3WFVA 3W7XA 4PA7A 4WFBV 1EFRG 1GO3F 1NR1A 4GX2A 5IYCO 2X7RB 3SPCA 3FB5C 4MSWC 2ITDC 1YTFB 5EBWC 2EINB 3OGCC 1KP3A 1VQ4V 3CMAV 3M99B 1JX9A 2XASA 2IU3A 1KECA 3D3IA 3NXSA 1VQNV 1P4RA 4JYBA 1H8EG 1KQSU 2B1IA 3DGEA 1I5YA 5CN0A 4PA4A 1OZ0A 1K4DC 3TK1A 3TETA 1PNKA 3CCJV 3OW2U 4BAYA 1GM8A 2DYRC 4PA9A 1Q86W 4HAMA 3T4DA 5KA6A 3ZN1A 2Y69B 1G4YB 2WLKA 1F4NA 3AEIA 1I5XA 5B1OA 3E35A 1YI2V 1NBMG 1S5HC 5FL7G 2WAMA 3ASNC 3JYCA 1VQOV 5LGUA 3ZRWB 1K97A 2QM8A 3VOUA 5HFMA 2WPDG 3FB7C 2ZQMA 3R65A 3TCUA 3CCUV 2V7QG 4P30A 1VQ8V 4DO2A 3AG1C 2EIJC 5J9PC 3JD3A 3VBBA 2HVKC 1E79G 5BZBA 3SYQA 3AG4C 4GX1A 5KUKA 3ZRWA 5CBGA 4Z1MG 4QPJA 1H38A 3E8FA 4XDJA 2JEXA 2QE7G 1V55C 3CD6V 2QTOA 1OCZB 3K04A 2DYSC 3F5WC 4GT1A 2X0LA 2XAFA 3CCVV 4R50A 4MTOA 5CMUA 3F7YC 3WG7C 4OXSA 5LGNA 3ZIAG 3AG2C 3G6EV 4BW5A 1QR8A 4P9OA 4PDRA 2OT5A 2MK3A 1NVPB 1SERA 3CCLV 2YEVA 1R6KA 3GB7C 3OAAG 4UXNA 4WFFA 1IXMA 1AJPA 3E8GA 3G71V 2A0LA 3ETEA 1VQKV 3DTUB 1GK9A 3OEHG 1JCHA 2EILB 1SESA 2JIZG 2HG5C 3CXCU 2Q67A 3K3WA 4MVRA 1RM1C 2YEVB 5L3GA 4I9WA 2Q6AA 1VQPV 4R8CA 3X2QB 1HWYA 5L3EA 1EZJA 4JTCB 3IGAC 3CMEV 4BIUA 1K73W 2DQ0A 4TT3G 3SPHA 1SZTA 1JOYA 5DN6G 3F7VC 3SYPA 4WF9V 4XDKA 4WFEA 1NJIW 3SYOA 2X6BA 3K9AA 3MHSC 2EIMC 2CK3G 3FB6C 1W2BU 4LP8A 1DTOA 1OCCB 2GHYA 3OMIB 1KKDA 3AG2B 4FIPC 1AJQA 2W6IG 4LCUC 1XL6A 2K1EA 2WLJA 3JD2A 4CBCA 1VQ5V 5L3DA 2DW4A 2EZPA 1P7BA 3IC7A 4Q20A 4KP4A 5DM6V 3MD0A 2ZXWC 2KB1A 2EINC 2XOKG 1NQTA 1VQLV 3D36A 3CPWU 3UKMA 1Q81W 1MOFA 2WLNA 2WSSG 2ZXWB 3SPIA 4UV8A 1W0KG 2ITCC 4J9YB 1OCRC 3JD0A 1Y4MA 3LDCA 3E89A 4PA3A 2ZR2A 4PELA 1VQ6V 1QVFU 3ZMUA 1YJWV 4H33A 1GMGA 1XL4A 3X2QC 3QO5A 1YHQV 5HFLA 3GWOA 1ROPA 2UXNA 5L3BA 4JTDB 4JPRA 1QBZA 1PD3A 2XAQA 2ZD9A 1R3KC 2FTKA 4MTGA 2Z5UA 1F4MA 3K0GA 3OUSA 1VQ9V 5KUMA 3RW0A 2C2AA 2LFSA 1M1KW 4L87A 4TSFG 4ASUG 5IYDO 5B1BC 2PI4A 4G2KA 4MVZA 2X6AA 1OCCC 2F43G 3ABKC 3G4SV 1ZWIC 3ABUA 3ABKB 4KFMA 5CBHA 4RUEA 1QLNA 2JDIG 4MTXA 3JD1A 3ZN0A 4UVBA 5B1AB 1YSCA 3OUFA 1FXKC 1H8HG 1FXVA 4EKWA 1F51A 4J9ZB 3OR7C 1VQ7V 5KA5A 2OCCB 3SJQC 1VQMV 1OCOB 1CPYA 1QLEC 3ZCCA 3PJSK 1K5QA 3K06A 3ABMC 2JK5C 3KG2A 2XNDG 3QNEA 4MT8A 5LHGA 1RM1B 2WLLB 4JASA 3T1CA 2A79B 5H6RA 1JQ0A 2M7WA 3ASNB 2ZDIC 1GM7A 4P9PA 4HYOA 3CCQV 4XDLA 3JCZA 3OE7G 3ZMSA 2H94A 2GSMB 2EIJB 3STLC 3CC4V 3ETDA 1M56C 4RQEA 3W7WA 3ZRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WFA V;  3CCE V;  1NJI W;  3OW2 U;  3CCJ V;  1VQ7 V;  1YIJ V;  3CCM V;  2D3O W;  1M90 W;  4WCE V;  1JJ2 U;  3CCR V;  1W2B U;  1KD1 W;  1VQM V;  1KC8 W;  1Q86 W;  1VQ9 V;  3CD6 V;  1Q82 W;  3CXC U;  1K8A W;  4WFB V;  1M1K W;  3CCS V;  1YJN V;  3CCV V;  2QEX V;  1YI2 V;  1VQ6 V;  1VQP V;  3G4S V;  1VQ5 V;  1QVF U;  1YIT V;  3G6E V;  1VQO V;  3I55 V;  1YJW V;  1K9M W;  3CMA V;  1VQ4 V;  3CME V;  3CC2 V;  2QA4 V;  5DM6 V;  1YHQ V;  3CCQ V;  1K73 W;  2OTJ V;  1YJ9 V;  1VQN V;  1R73 A;  3CCL V;  3CCU V;  1S72 V;  2OTL V;  1KQS U;  1Q7Y W;  1VQL V;  1VQ8 V;  3CC4 V;  1N8R W;  3CPW U;  1QVG U;  3G71 V;  1VQK V;  3CC7 V;  3I56 V;  4WF9 V;  1Q81 W; 
#chains in the Genus database with same CATH topology
 3JAL B;  5FPR A;  3EHB B;  3CCR V;  4G28 B;  1JA8 A;  4DR6 O;  4LF4 O;  2PTM A;  4FZ1 A;  2UXD B;  3FX7 A;  1TUB A;  3CCS V;  2UUA B;  4O2A B;  4X9Q A;  4DUY O;  2ZNJ A;  4FFB A;  5JJJ B;  3EFF K;  3T2M A;  1M93 A;  1WP8 A;  3ASO C;  4TQD A;  4B3M B;  2B9Z A;  4YJ2 A;  5CA1 A;  4JGS A;  4O2A A;  4I4T A;  1IX9 A;  4LH6 A;  2BSK B;  1SQQ H;  3KCX A;  1N36 O;  1TAE A;  4N21 A;  1AI7 A;  2E5L O;  4ZOL A;  1S77 D;  1YIT V;  5GW7 A;  2O57 A;  2BOB C;  2CGN A;  4FPP A;  3RVZ A;  2OIG A;  2E5L B;  4JI8 O;  4HNA B;  1PPJ H;  1M56 B;  2E3C A;  2W6J G;  3E83 A;  3FD9 A;  4DV3 O;  4CH5 A;  4G27 B;  5B3S C;  2Z3Y A;  4DR2 O;  1G1X B;  3ZMZ A;  1VF5 B;  2EIK C;  2R9R B;  4DUY B;  2Q68 A;  3H01 A;  2QM4 A;  2UUA O;  1BL8 A;  1CEZ A;  4UCR A;  4JV5 B;  3JAR A;  3UQ8 A;  1AR4 A;  1NTK H;  3CP1 A;  5LA6 A;  3N2K A;  1XOU A;  3FKS G;  2OYQ A;  3DXR A;  4UCO A;  5H6Q A;  4K8X A;  3FYE B;  4AQY O;  4DV3 B;  1XI1 A;  1P49 A;  1SS3 A;  1Y74 A;  5TIS Z;  1BZK A;  2QWQ B;  1AI4 A;  1BSM A;  1IBK B;  3I56 V;  4LFB B;  3TGU H;  4U7N A;  4O2B A;  1JPX A;  2QGN A;  4O4J A;  2F4V B;  1EM1 A;  3ETG A;  1LR1 A;  1FFX A;  1KB9 F;  1GM9 A;  3RYC B;  4FLV A;  4O4J B;  1XNQ B;  3OFN G;  3KKY A;  2PYL A;  4UVC A;  3FFQ A;  4JI0 B;  1NZ6 A;  3U10 A;  4KL1 A;  3RFR A;  2ZR3 A;  3ZRV A;  1FXK A;  5LHH A;  4IL6 Z;  2GV9 A;  3JAS A;  1Q82 W;  4I9Q A;  2BE3 A;  3R66 A;  1HR0 B;  1Y76 A;  4DV1 B;  2CH7 A;  2RQ6 A;  4MVO A;  2NN4 A;  5C93 A;  1JFF B;  3BVO A;  2DQ3 A;  1Q6H A;  4QIW F;  4CH6 A;  1U97 A;  4I55 B;  3CCE V;  1R3I C;  2DN9 A;  3C90 A;  4BIZ A;  2YI9 A;  3CRQ A;  1G8M A;  3BHP A;  3BRC A;  2E76 B;  4FK5 C;  2WLI A;  4LC1 A;  2ZE8 A;  2NR5 A;  4O4H B;  3K03 A;  2BTQ B;  4MW8 A;  5IY5 B;  4WFG A;  1Q7Y W;  4B3R O;  2EBO A;  2Y48 A;  4KHP O;  4QPK A;  1MSW D;  4PDV A;  3CWB H;  3HKB B;  5CB4 B;  1ZL8 A;  1V54 B;  2BOC C;  2QWN B;  2CTR A;  2JRI A;  1R3L C;  1B06 A;  2P22 C;  3K08 A;  2IW5 A;  1U96 A;  5B1N A;  2YSU B;  5JVD B;  4MVQ A;  4FVM A;  4U7O A;  2H3O A;  4UVA A;  1DF4 A;  3ZRS A;  1NVP D;  5CBF A;  2B5U A;  1XDC A;  4RAI A;  4OX9 O;  4PA7 A;  3S3X A;  3JAT A;  2Y4U A;  2X7R B;  1SQV H;  1XEQ A;  5LMN B;  2Q8V A;  1B3Q A;  2EIN B;  2YS8 A;  2DE0 X;  3CMA V;  4NXN B;  4DV2 B;  3NXS A;  2LQT A;  4LWS B;  2B1I A;  1OZ0 A;  1K4D C;  1PNK A;  3H1I H;  4K35 A;  3T4D A;  4NXN O;  3CRA A;  2VQE O;  1F4N A;  4X65 O;  3AEI A;  2WAM A;  5JH7 A;  1VQO V;  3ZRW B;  2ZE5 A;  1VF6 A;  4NXM O;  3CCU V;  2V7Q G;  4LF9 O;  2Z0A A;  2HVK C;  5BZB A;  3SYQ A;  3AG4 C;  4GX1 A;  1KBH A;  5CBG A;  1VF6 C;  4PJ0 Z;  1N4C A;  1H38 A;  4XDJ A;  4FLX A;  1OCZ B;  3K04 A;  2DYS C;  5GTI Z;  4GT1 A;  3ZS8 C;  2AZ0 A;  3WG7 C;  4Z2W A;  3OTO B;  1H2N A;  4PDR A;  2MK3 A;  2YEV A;  1R6K A;  3GB7 C;  2XT9 A;  3ZED A;  4UXN A;  3E8G A;  3G71 V;  4ZIB A;  3DTU B;  1Z2G A;  2CH7 B;  3UO2 A;  1JFF A;  3OEH G;  4YY3 B;  2EIL B;  1HW7 A;  1D5A A;  1L0L H;  2LW1 A;  3G67 A;  3K3W A;  4MVR A;  2YEV B;  1RFY A;  4LF4 B;  1W59 A;  5L3G A;  4GZR B;  4PI0 A;  1VQP V;  2Q6A A;  4JI5 B;  3CME V;  4BIU A;  3CHX A;  3SJC C;  1JOY A;  4DK0 A;  4L8J A;  3F7V C;  3SYP A;  1NJI W;  3SYO A;  3MHS C;  4LP8 A;  4CC6 A;  2BTQ A;  1AJQ A;  2W6I G;  4LCU C;  4D7T A;  3L71 H;  4EEQ A;  1NU1 H;  5K1P A;  4KP4 A;  3ZHQ A;  2ZXW C;  5CB4 A;  2KB1 A;  1O9H A;  4F6R B;  1ZL8 B;  1VQL V;  1XMO O;  1PM9 A;  1N33 O;  1D5N A;  2YIB A;  3CPW U;  4FLT A;  5ITZ A;  4UFZ A;  2WLN A;  4X1K B;  1YF2 A;  3SPI A;  4EFE A;  3E89 A;  4ICG A;  4F6R A;  4DV5 B;  2ZR2 A;  4CS3 A;  1WA8 A;  1QVF U;  4X1K A;  3LSU A;  5KHG A;  1GMG A;  1XL4 A;  4X64 O;  5HFL A;  2R9A A;  2YIA A;  3APO A;  5A2Q N;  3JAT B;  4OGQ B;  4NKG B;  3WU2 Z;  3K5M A;  2DMX A;  1R3K C;  4MTG A;  2Z5U A;  5KHK A;  3A0H Z;  5JCO A;  2KSD A;  3DSQ A;  2GDS A;  2C2A A;  1M1K W;  4L87 A;  4TSF G;  4ASU G;  5IYD O;  4OPH A;  1YZB A;  2L6L A;  4NXM B;  3T1H O;  5KMG B;  4PHZ A;  1WN7 A;  5KHH A;  3ZN0 A;  1YSC A;  3ZHV A;  1H8H G;  1HP8 A;  4PV1 B;  1YDX A;  5CA0 A;  3OR7 C;  3JAK B;  3K5L A;  1VQM V;  4JI4 B;  1CPY A;  3D3Q A;  5LXT B;  3PJS K;  2Q73 A;  3ABM C;  3HKC B;  3KG2 A;  2XND G;  4MT8 A;  1RM1 B;  2GUZ A;  4JAS A;  1JQ0 A;  2ZDI C;  1SA0 B;  4HYO A;  4XDL A;  2YUA A;  3GVM A;  1I94 B;  3CX5 F;  4BWA A;  3STL C;  3W7W A;  3ZRX A;  1PV0 A;  3OMN B;  4DW0 A;  4U3F H;  4JI5 O;  3ZJZ A;  4DUZ O;  1L8D A;  1OHH G;  2LO1 A;  1RPR A;  4BIO A;  1WLE A;  1NTM H;  5KLV H;  2UXB B;  5EZY B;  2E75 B;  1V55 B;  3WB2 A;  2DWD C;  2LFR A;  2V1D A;  2P6J A;  1AP5 A;  1L0N H;  2WWW A;  5LP6 A;  1NT2 B;  3N2G B;  1KKC A;  1PNM A;  2PI5 A;  2GBO A;  5IY5 C;  2X6C A;  1FS0 G;  2WA4 A;  1VEW A;  1YCI A;  5J2U A;  4X20 B;  5KAF Z;  2OCC C;  3N2G A;  2E74 B;  2Q4P A;  1E1Q G;  3AK1 A;  5JJE B;  5D5Q A;  5IJ9 A;  4FLU A;  5LGT A;  4ZI7 A;  4JI8 B;  4EB6 A;  3MHH C;  4JAV A;  2UXX A;  4JI6 B;  3QTC A;  4DR6 B;  4LR3 A;  1OCZ C;  1MAB G;  4CZZ A;  1KP2 A;  1YIJ V;  1HNW B;  2IJH A;  2Y0I A;  2JS3 A;  3OEE G;  1I94 O;  4EB6 B;  4JTA B;  1DLB A;  2Q9L A;  3JAM N;  4X89 A;  3QO7 A;  1BHB A;  2ZT9 B;  3I55 V;  1RSO A;  2H8P C;  4F6E A;  1H2G A;  4DR1 B;  2UU9 O;  5C8Y A;  1N8R W;  2LGW A;  1MZE A;  2RCV A;  3CC7 V;  4WFA V;  1IDS A;  1Y6X A;  2P5O A;  4K8Z A;  4GLX A;  4QJF B;  3OR6 C;  1M5I A;  1BE3 H;  5BR8 B;  5BXZ A;  2ZKO A;  1NR7 A;  2K9P A;  1M57 B;  1CP9 A;  1UJW B;  2HHH B;  3CYO A;  2AGA A;  5KHI A;  4LNU B;  1IUR A;  3J80 N;  2EIM B;  4TV8 A;  3CJH A;  4YXW G;  3CCM V;  4TOI A;  1O9G A;  1COW G;  1AR1 B;  4QE7 A;  1DK1 A;  2P7T C;  4WBN B;  4DXW A;  4LNU A;  2EZO A;  3JAK A;  4GX0 A;  4UB8 Z;  2WA3 A;  3LSS A;  3SYC A;  4D6T H;  4AIL C;  4JI2 O;  1IBM B;  3HKC A;  3TXQ A;  1SRY A;  3BAB A;  4O4L A;  4DRX B;  1SQX H;  2JEU A;  2XUM A;  4IT5 A;  1XMO B;  3Q4H A;  1Q6I A;  3ABL C;  4MVM A;  4B3T O;  1K34 A;  2EIL C;  3ABL B;  1HNX O;  1N34 O;  3W7T A;  1DGS A;  4DRX A;  3QVN A;  1SQP H;  3K57 A;  1M57 C;  4LF5 O;  2IJJ A;  4JYC A;  4HBN A;  4J41 A;  5EC1 C;  4Q6G A;  1S3J A;  3ZHU A;  3RYF B;  3B8M A;  2DYS B;  4X65 B;  4FLW A;  3AG4 B;  3B2E E;  3G80 A;  1JMK C;  1P84 F;  4YIP A;  5DED A;  3SGI A;  1K9M W;  1OJH A;  1K4C C;  4R6Z A;  3QO8 A;  3PN1 A;  4CC5 A;  1R73 A;  1IXB A;  1FPO A;  2HFE C;  3QF7 A;  2LW7 A;  4UV9 A;  4JF3 A;  5B1A C;  3H1K H;  1T5E A;  2HJF C;  5IJ9 B;  3ZX6 A;  4I0X B;  1R1B A;  2F4V O;  1N33 B;  4JZ2 A;  5H5N A;  5IT9 N;  2IJK A;  2ETN A;  2RDC A;  4QNH B;  5EC2 C;  2GTA A;  2RN9 A;  4J7Z A;  1S72 V;  4DV0 B;  2YDE A;  1M9N A;  2NLJ C;  1VP7 A;  2PUS A;  2IU0 A;  4DR4 O;  1JJ2 U;  1Q3E A;  2P67 A;  1FJG B;  4X1Y A;  4GKK O;  3B4S A;  2ZCE A;  4FZ0 A;  3W7X A;  4JI7 B;  1GO3 F;  1NR1 A;  4GX2 A;  5IYC O;  2A7W A;  4DR7 B;  3SPC A;  3FB5 C;  4MSW C;  5EIB C;  1TVK A;  1VQ4 V;  4JV5 O;  1JX9 A;  1HR0 O;  2M6Y A;  1XBL A;  3OTF A;  4IIJ A;  1H8E G;  3DGE A;  4FM1 A;  1I5Y A;  3ICX A;  4PA4 A;  3TET A;  3OW2 U;  3CCJ V;  1GM8 A;  4PA9 A;  4HAM A;  5EIB D;  5KA6 A;  2Y69 B;  2WLK A;  2IM9 A;  1I5X A;  5B1O A;  3E35 A;  1FD9 A;  3JYC A;  2L35 A;  5LMN O;  2WPD G;  4DV6 B;  3L72 H;  3RYH B;  4FFK A;  2QJ1 A;  3E8F A;  1V55 C;  2QTO A;  3F5T A;  2XAF A;  2ZIM A;  1VMG A;  1BQZ A;  3F7Y C;  1KUQ A;  4CH4 A;  3UO3 A;  3RYH A;  2ZM6 O;  4BW5 A;  2F23 A;  2KG7 A;  4P9O A;  3MDS A;  5JWP A;  5F2V O;  3J81 N;  1XNQ O;  1BCC H;  2AW9 A;  1EN4 A;  2A0L A;  4IYH A;  4B3S O;  2VQE B;  1YXB A;  4LF6 B;  1SES A;  2CAZ C;  4B3R B;  2HG5 C;  4IGG A;  1Y67 A;  3I5D A;  3CXC U;  1RM1 C;  4ZHQ A;  5IJ0 A;  4R8C A;  1HNZ B;  1VIB A;  1HWY A;  4JTC B;  2Y0P A;  3SPH A;  4LFA O;  1SZT A;  3E22 A;  4WFE A;  3K9A A;  2CK3 G;  1DTO A;  1GN6 A;  2UUC B;  2GHY A;  3OMI B;  4LF6 O;  1KKD A;  4FIP C;  2ARH A;  4GUN A;  5FLX N;  2WLJ A;  4NTX A;  4TUY A;  2DW4 A;  5L3D A;  5DM6 V;  2YI8 A;  1IBL B;  3DC5 A;  2XOK G;  3D36 A;  3UKM A;  4O4I B;  4X66 B;  4UV8 A;  1W0K G;  2ITC C;  4J9Y B;  3JD0 A;  5KX5 B;  4JI1 B;  4YHH B;  4PEL A;  3ETQ A;  3OGI B;  4DR3 O;  2GTS A;  2G38 A;  3VQX A;  1YJW V;  4LF7 B;  2CE4 A;  4JYA B;  2QSA A;  1YHQ V;  4K0K B;  1XHX A;  3GWO A;  1ROP A;  4GKK B;  5LA6 B;  4JTD B;  2EUL A;  1WNS A;  2KKW A;  1PD3 A;  4B3T B;  1TVK B;  1F4M A;  3K0G A;  3OUS A;  1VQ9 V;  5KUM A;  3TXS A;  1X59 A;  1Y74 B;  4G2K A;  1S5L Z;  3RT3 C;  4DR1 O;  3ABK C;  3ABK B;  4KFM A;  4RUE A;  4H0L B;  2JDI G;  3JD1 A;  4B3S B;  1J5E O;  4JI7 O;  2OCC B;  3SJQ C;  4GKJ B;  4JI0 O;  1K5Q A;  3QNE A;  3O65 A;  4W4K A;  3T1C A;  1QHT A;  2JS5 A;  1Q5O A;  4J10 A;  3CS5 A;  1XMQ B;  4P9P A;  2PGG A;  2VS0 A;  2AZ2 A;  3JCZ A;  1TUB B;  3C3T A;  4JI1 O;  2ZNI A;  5BR8 O;  1SF9 A;  3LNM B;  2KG7 B;  3BY6 A;  4JAU A;  5AG2 A;  4LF5 B;  5H2F Z;  2A3Q A;  2QKC A;  2JGD A;  5IYZ A;  1ZX3 A;  4I4T B;  2WLH A;  4PDM A;  4I55 A;  4MVU A;  1YJ9 V;  1BS3 A;  2CTQ A;  5FNV A;  1N36 B;  3OM3 B;  1LNQ A;  2XAG A;  2A9H A;  1X4T A;  1QLE B;  3CRR A;  3JSN A;  1Q8I A;  4BW9 A;  2IH1 C;  4HNA A;  2CUG A;  5FNV B;  4DV4 B;  5CA1 B;  3A8T A;  4P2Z A;  4H37 A;  1K5S A;  4LBE C;  1S76 D;  4UUJ C;  2BSK A;  2Q69 A;  1R6N A;  2AHY A;  5CA3 A;  2PF4 E;  3OD4 A;  3SR2 C;  2D2C B;  2DJV A;  3E86 A;  4GYC B;  1NTZ H;  5JVD A;  1K8A W;  3AG7 A;  2IH3 C;  3CEI A;  4ZKI A;  1XNR B;  5A9G A;  1GAX A;  2VWK A;  4O4I A;  2FYU H;  2FL4 A;  1XQ8 A;  3RVY A;  3H9V A;  5LMU B;  1QNM A;  4I7Z B;  3NR7 A;  3AG3 B;  2YID A;  3A0B Z;  4TV9 B;  2XTA A;  1YEW A;  5IWA B;  2QM7 A;  5GTH Z;  2YIC A;  2QKS A;  4MTF A;  3ABM B;  2XAH A;  4O2B B;  3CC2 V;  3SDL A;  1ZAU A;  1L1F A;  4PA6 A;  1EBO A;  5L3F A;  1F7Y A;  1ARO P;  3B8N A;  3STZ C;  4GCZ A;  1N32 O;  2FKX A;  2Y4T A;  3RBZ A;  3RYC A;  3GWK C;  4NTY A;  4EFB A;  2XAJ A;  2QWP B;  1N32 B;  5JCO C;  1J5E B;  1FXK B;  4WFH A;  1QR9 A;  1TUE B;  1K33 A;  4LFC B;  3U0Z A;  2P4K A;  2YC0 A;  4MVS A;  2LGQ A;  3H1L H;  5EBL C;  1IBL O;  4RO2 A;  2HEP A;  1HDJ A;  1AI5 A;  1MMM A;  4I50 A;  3JAL A;  1LUV A;  3IFX A;  2QWR B;  2B1G A;  5L3C A;  3B09 A;  3APQ A;  2JGD B;  4FFB B;  4MS2 A;  1M90 W;  4E2L A;  1Y76 B;  4DR3 B;  3WG7 B;  4Z1V A;  5IDJ A;  3AG1 B;  3W7S A;  2AHZ A;  1IVS A;  2AXT Z;  1VF7 A;  1FFT B;  1WPX A;  3HKB A;  2Q7G A;  2IJI A;  3K79 A;  3HPL C;  1DF5 A;  1Y66 A;  1KD1 W;  2WLI B;  1SQB H;  1K92 A;  1XRE A;  4O4H A;  1F23 A;  4QE9 A;  1NH2 B;  2Q7H A;  1PL0 A;  3LDD A;  3LSQ A;  1Z5W A;  1GH6 A;  4DV7 B;  5JQG B;  1PNL A;  4J7K A;  1I0H A;  1WP7 A;  3K0D A;  1BMF G;  3RGB A;  1KC8 W;  3QG5 A;  1WA8 B;  3K58 A;  2YXY A;  4GX5 A;  4JYA O;  3HKD A;  4LWS A;  4QGP A;  3WFV A;  4LFC O;  1EFR G;  5BY1 A;  3CXH F;  2ITD C;  1YTF B;  5EBW C;  3OGC C;  1KP3 A;  3P3P A;  5K1X A;  2F93 B;  4JI3 O;  2IU3 A;  1KEC A;  3N27 A;  1VQN V;  2ILM A;  1ZUQ A;  4J42 A;  3DXR B;  4OX9 B;  4FLY A;  3AK3 A;  3TK1 A;  5JH7 B;  5LYJ A;  2DYR C;  1Q86 W;  3TJT A;  5KMG A;  1G4Y B;  4A5U B;  1NBM G;  1S5H C;  4LF9 B;  3ASN C;  5LGU A;  5JJN B;  2QM8 A;  3VOU A;  5HFM A;  3FB7 C;  2ZQM A;  3BPZ A;  3J7A U;  3IJ4 A;  4P30 A;  1FFX B;  4DO2 A;  2EIJ C;  2HJD A;  3VBB A;  5KUK A;  3AK2 A;  3ZRW A;  1HNX B;  2UUB B;  2QE7 G;  3CD6 V;  3F5W C;  1SZX A;  4MTO A;  5LOV B;  1OV9 A;  2YXL A;  3G6E V;  3L70 H;  1QR8 A;  2F1M A;  3CCL V;  3OAA G;  4NTW A;  4WFF A;  4I50 B;  5D5P A;  5LOV A;  4DR5 B;  1GK9 A;  3VQY A;  5GON A;  2Q67 A;  3ZHR A;  4K3A A;  4B08 A;  4I9W A;  1M4U A;  1EZJ A;  3IGA C;  4CS2 A;  1SC5 B;  4NR1 A;  5KAI Z;  3THO A;  2DQ0 A;  5J2U B;  4X20 A;  1BQ0 A;  1XUQ A;  4DV7 O;  3FB6 C;  4YIO A;  1OCC B;  4YY3 O;  2BTO A;  2K1E A;  4UCU A;  4JI2 B;  4UCS A;  4KHP B;  3JD2 A;  1VQ5 V;  4UCV A;  4Q20 A;  3IAY A;  1GN3 A;  5LMU O;  2EIN C;  4DYL A;  1NQT A;  4NYK A;  3VQV A;  3K5O A;  1WPB A;  2WSS G;  1I7F A;  1EZV H;  5JQG A;  4JI3 B;  1RP3 B;  4JAA A;  4NVP A;  1Y4M A;  2UXC O;  2W0X A;  3HKE A;  4PA3 A;  5C8Y B;  3JSL A;  1VQ6 V;  5ITZ B;  3FAV A;  2Q0A A;  3HKD B;  3QO5 A;  1MNG A;  2UXN A;  2QWO B;  2VQF O;  2FB5 A;  3HKE B;  2XAQ A;  2ZD9 A;  4DV0 O;  2FTK A;  3L74 H;  2V4D A;  3FAV B;  3KZI Z;  2LFS A;  4DV4 O;  4X1I B;  4PI2 A;  2PI4 A;  5B1B C;  1SQG A;  4MVZ A;  2X6A A;  2F43 G;  5LYJ B;  3G4S V;  3CE2 A;  1ZWI C;  2YIB D;  4UVB A;  3OUF A;  1FXK C;  2GUZ B;  5IWA O;  3M7M X;  4EKW A;  1F51 A;  2PY5 A;  4J9Z B;  4DW1 A;  1VQ7 V;  4CS4 A;  1OCO B;  1AB3 A;  1QLE C;  5BMV A;  4JYY A;  3K06 A;  1AVM A;  3S3W A;  5LHG A;  3KCY A;  2WLL B;  1GN4 A;  4FM2 A;  1XHZ A;  5CA0 B;  5H6R A;  1EN5 A;  1GM7 A;  3CCQ V;  3OE7 G;  4DV5 O;  3ZMS A;  1N0N A;  3HR0 A;  4IHJ A;  1FYJ A;  2GSM B;  2EIJ B;  3CC4 V;  3SJA C;  1NI8 A;  5EZY A;  4AHC A;  2WLL A;  2A06 H;  3FB8 C;  5B3S B;  4UB6 Z;  3VQW A;  1SET A;  5LP6 B;  3L9D A;  2KQX A;  2VQF B;  3OMA B;  3ASO B;  1QQC A;  2F66 C;  1XIL A;  4DR5 O;  1R6T A;  3UM7 A;  4UCT A;  3U11 A;  3SJB C;  2R9I A;  3RYF A;  3A0R A;  5GON B;  1K3E A;  2UU9 B;  5LBQ A;  1QVG U;  5EYP B;  4F4L A;  4RWU A;  1NKD A;  1AJN A;  4J7J A;  2LJ2 A;  1NS1 A;  1AR5 A;  1Q43 A;  3K9S A;  3WB0 A;  1XNR O;  2QKA A;  1OCO C;  5B5E Z;  4OPA A;  4W4L A;  2OWO A;  2PYJ A;  1KYO F;  2CTW A;  4JI6 O;  3MAQ A;  1HNW O;  2HKO A;  4RUF A;  4I5S A;  2CGO A;  4D7S A;  4IYI A;  3E8B A;  4KUM A;  1JVM A;  3FYI B;  2ZDI A;  4K0K O;  1Q6U A;  1GTO A;  1P7G A;  3LUT B;  3SYA A;  3RN4 A;  3OT7 A;  1XMQ O;  1W0J G;  2JJ2 G;  4ZI7 B;  1ZLZ A;  1H2M A;  1MA1 A;  2EIK B;  4B3M O;  2PZS A;  2HVJ C;  3SPG A;  3ZBH A;  4TWK A;  4R7C A;  2R72 A;  2OTJ V;  5B66 Z;  4N23 A;  3ZMT A;  5EK0 A;  1PKX A;  3SPJ A;  4X88 A;  1UFI A;  3W7U A;  1BHA A;  2UXB O;  2W0F C;  1RSO B;  3T1H B;  2P90 A;  1RPO A;  2JJ1 G;  1OCR B;  2ADP A;  1V54 C;  2YXH A;  3ML0 A;  2EJR A;  5FPO A;  1URF A;  3ABT A;  2P4V A;  1QCE A;  2ADQ B;  1MG1 A;  1TGO A;  4FMT A;  2QA4 V;  1THZ A;  4LH7 A;  4X1I A;  1FKA O;  4B7E A;  2WLM A;  3H1H H;  1LUW A;  2D3O W;  4WCE V;  4XBF A;  1S5J A;  3BA9 A;  4FJC C;  4PDL A;  2N05 A;  1N34 B;  5IYB O;  3B40 A;  2LP7 A;  1ORQ C;  1K7D A;  4AI8 A;  3CJH B;  2CDY A;  2FML A;  5LXT A;  4YJ3 B;  1NH2 D;  5BMV B;  4MW3 A;  3B77 A;  3Q4H B;  2OTL V;  1S0V A;  2DWE C;  3UCS C;  1SA0 A;  3L75 H;  1Q90 D;  3K5N A;  4IHJ B;  2ATK C;  4HZ3 A;  1YJN V;  4TQF A;  1R3J C;  1E1R G;  2BCC H;  5E1A C;  1PP9 H;  4X8A A;  1GN2 A;  4DUZ B;  3A2F A;  1B6Q A;  3JD4 A;  1J95 A;  1I08 A;  4DV6 O;  2N74 A;  5IJ0 B;  2HHH O;  1WAZ A;  1FAF A;  2HP8 A;  1GKF A;  3LDE A;  3P30 A;  4RQF A;  3ZMV A;  5EYP A;  2QEX V;  3T4Z A;  5EBM C;  5B1B B;  3E22 B;  2VWJ A;  4GKJ O;  2XHB A;  4JI4 O;  3P3N A;  3AG3 C;  3E2E A;  2QR4 A;  2HLD G;  1US6 A;  1D2D A;  2MW2 B;  3BA8 A;  4DK1 A;  2NNU A;  2IBZ H;  2Y69 C;  3EXA A;  5E79 Z;  2DYR B;  4DR7 O;  5LHI A;  1AI6 A;  3HB3 B;  5H9C A;  1IZ3 A;  2VRZ A;  1ENV A;  3D36 C;  3T1Y B;  3P32 A;  4FLZ A;  4ZBM A;  4B7K A;  1FXH A;  2ZIO A;  2RJZ A;  1TA8 A;  3RWR D;  4I0X A;  5KX5 A;  3UT5 B;  2DOS A;  1SKV A;  2EJ7 A;  2HR3 A;  2Q7E A;  3BEH A;  1HNZ O;  1YTF D;  3DC6 A;  3E8H A;  4IIJ B;  3IC9 A;  4WFB V;  2JVD A;  1IBM O;  3UT5 A;  4LFA B;  2Q0O C;  4X62 B;  2ZIN A;  4DV2 O;  1H2K A;  2Q5Z A;  3M99 B;  1G6U A;  2XAS A;  1MSD A;  3ZHT A;  3D3I A;  1P4R A;  4JYB A;  5IE9 A;  1KQS U;  1AP6 A;  1VAR A;  2JGU A;  3BFR A;  5CN0 A;  1H2L A;  4H44 B;  4BAY A;  3ZN1 A;  2QTS A;  1Z5V A;  1A32 A;  2QDO A;  1YI2 V;  5FL7 G;  4TV8 B;  2UXD O;  1YVW A;  3CRC A;  2UUC O;  1K97 A;  4AQY B;  3ZHS A;  1GRJ A;  3R65 A;  3O9O A;  3TCU A;  4WBN A;  1WJZ A;  1VQ8 V;  3AG1 C;  3G6B A;  5J9P C;  3JD3 A;  1FJG O;  1E79 G;  2UXC B;  2UUB O;  1JR9 A;  4Z1M G;  4QPJ A;  4YJ3 A;  1KU9 A;  3JCU Z;  2JEX A;  3H1J H;  2X0L A;  4PD4 F;  3CCV V;  4R50 A;  5CMU A;  4O4L B;  4OXS A;  5LGN A;  4LF8 B;  5LP6 C;  3ZIA G;  3AG2 C;  4FM0 A;  3JAW B;  4DR2 B;  3D8C A;  2OT5 A;  1NVP B;  1SER A;  4ZHQ B;  4YHH O;  4X62 O;  1IXM A;  1AJP A;  3ETE A;  1VQK V;  3K59 A;  1KMI Z;  1WB8 A;  1UPG A;  1JCH A;  2OCH A;  3JAW A;  2JIZ G;  4J11 A;  2ZM6 B;  4X66 O;  3C3S A;  1SQF A;  1BT8 A;  4YJ2 B;  3BCC H;  5KHJ A;  4DR4 B;  3X2Q B;  5L3E A;  1WB7 A;  4LFB O;  1K73 W;  2ZE7 A;  4TT3 G;  2RNB A;  3M8A A;  2EX3 A;  3L73 H;  2R70 A;  5DN6 G;  4WF9 V;  4XDK A;  4ZOL B;  2X6B A;  2EIM C;  1W2B U;  4ABM A;  3AG2 B;  4CH3 A;  1MZF A;  3RYI B;  1XL6 A;  4CBC A;  5DEC A;  2EZP A;  1P7B A;  2RMK B;  3IC7 A;  1EN6 A;  3EVK A;  3MD0 A;  5J2T B;  3RYI A;  1Q81 W;  1MOF A;  2ZXW B;  3BAA A;  2OIE A;  4TUY B;  1OCR C;  2ZE6 A;  3LDC A;  5J2T A;  1ZSP A;  3ZMU A;  4X1Y B;  4H33 A;  3JAR B;  3X2Q C;  4TV9 A;  1V9P A;  5L3B A;  3OTO O;  2N04 A;  3N2K B;  4JPR A;  1AIL A;  1QBZ A;  4U3J B;  3CSX A;  1QU7 A;  4C7U A;  4DV1 O;  4LF7 O;  1CXZ B;  2CTP A;  5LL6 Y;  3RW0 A;  4JZG A;  3T1Y O;  4H13 B;  4U3J A;  4E4E A;  1OCC C;  1ZTE A;  3CB2 A;  3ABU A;  5CBH A;  1QLN A;  4MTX A;  1B04 A;  5B1A B;  1PL4 A;  4J80 A;  3LNN A;  1FXV A;  4BR6 A;  1JJO A;  5KA5 A;  3WB1 A;  1H2S B;  3ZCC A;  4LF8 O;  1BGY H;  2JK5 C;  1IBK O;  4X64 B;  2ODM A;  2A79 B;  2F95 B;  2M7W A;  3ASN B;  2P06 A;  3JAS B;  2H94 A;  3CRM A;  5IYZ B;  3ETD A;  4NB5 A;  1M56 C;  4RQE A;  1N0J A;  4KXR A; 
#chains in the Genus database with same CATH homology
 3OMN B;  2WLL A;  3EHB B;  3ZJZ A;  3LNM B;  3FB8 C;  3CCR V;  3BY6 A;  4G28 B;  5B3S B;  4JAU A;  1OHH G;  1SET A;  1RPR A;  1WLE A;  3CCS V;  3OMA B;  3ASO B;  2WLH A;  4PDM A;  1V55 B;  3EFF K;  3T2M A;  2DWD C;  3UM7 A;  2LFR A;  2V1D A;  3ASO C;  2P6J A;  2R9I A;  4MVU A;  1YJ9 V;  3A0R A;  2WWW A;  1K3E A;  5LBQ A;  1PNM A;  4JGS A;  1QVG U;  3OM3 B;  4F4L A;  2PI5 A;  5IY5 C;  2X6C A;  1FS0 G;  1NKD A;  1AJN A;  1LNQ A;  2XAG A;  2A9H A;  1QLE B;  1OCO C;  2IH1 C;  2OCC C;  4N21 A;  1E1Q G;  1AI7 A;  1S77 D;  4P2Z A;  1YIT V;  2HKO A;  4H37 A;  4RUF A;  4I5S A;  1K5S A;  5GW7 A;  4LBE C;  1S76 D;  4UUJ C;  5LGT A;  2BOB C;  2Q69 A;  3E8B A;  3MHH C;  4FPP A;  3RVZ A;  4KUM A;  4JAV A;  1JVM A;  2UXX A;  1R6N A;  3FYI B;  2ZDI A;  1OCZ C;  1M56 B;  1MAB G;  1GTO A;  2AHY A;  1KP2 A;  3LUT B;  3SYA A;  4CZZ A;  5CA3 A;  1YIJ V;  2IJH A;  1W0J G;  2JJ2 G;  3E86 A;  3OEE G;  2W6J G;  3E83 A;  1K8A W;  4JTA B;  2IH3 C;  4G27 B;  1DLB A;  4ZKI A;  5B3S C;  4X89 A;  2Z3Y A;  3QO7 A;  2EIK B;  1BHB A;  3I55 V;  2HVJ C;  3SPG A;  4TWK A;  2H8P C;  3ZMZ A;  4R7C A;  1H2G A;  2OTJ V;  3RVY A;  4N23 A;  3ZMT A;  2EIK C;  2R9R B;  5EK0 A;  1PKX A;  2Q68 A;  3SPJ A;  1N8R W;  3H01 A;  3CC7 V;  4X88 A;  1BL8 A;  4WFA V;  3W7U A;  3AG3 B;  1CEZ A;  1BHA A;  2W0F C;  4QJF B;  2P90 A;  3OR6 C;  1RPO A;  3CP1 A;  2QM7 A;  2JJ1 G;  2QKS A;  1OCR B;  1V54 C;  3FKS G;  2EJR A;  3ML0 A;  5H6Q A;  4MTF A;  3FYE B;  1NR7 A;  3ABM B;  2XAH A;  3ABT A;  1M57 B;  3CC2 V;  1QCE A;  1CP9 A;  1MG1 A;  1UJW B;  1L1F A;  4FMT A;  2QA4 V;  4PA6 A;  1EBO A;  1THZ A;  3CYO A;  5L3F A;  1ARO P;  2WLM A;  3B8N A;  3STZ C;  4GCZ A;  1AI4 A;  3I56 V;  2EIM B;  3RBZ A;  4U7N A;  4YXW G;  3CCM V;  2D3O W;  4WCE V;  1JPX A;  4XBF A;  1COW G;  2XAJ A;  1AR1 B;  4QE7 A;  4FJC C;  2P7T C;  4PDL A;  3ETG A;  5IYB O;  4DXW A;  2LP7 A;  1ORQ C;  1K7D A;  2EZO A;  4GX0 A;  1FXK B;  4WFH A;  1QR9 A;  1GM9 A;  1TUE B;  3LSS A;  3SYC A;  1NH2 D;  3OFN G;  4MW3 A;  3B77 A;  2OTL V;  1K33 A;  1S0V A;  2DWE C;  4UVC A;  1SRY A;  4MVS A;  2ZR3 A;  5EBL C;  3ZRV A;  2JEU A;  4RO2 A;  1FXK A;  5LHH A;  1Q82 W;  4MVM A;  2ATK C;  3ABL C;  4HZ3 A;  1K34 A;  1YJN V;  1AI5 A;  2EIL C;  3ABL B;  1R3J C;  3W7T A;  1E1R G;  5E1A C;  4MVO A;  5C93 A;  3IFX A;  1M57 C;  2B1G A;  2DQ3 A;  4X8A A;  5L3C A;  2IJJ A;  4JYC A;  4QIW F;  1B6Q A;  3JD4 A;  1J95 A;  5EC1 C;  4MS2 A;  3CCE V;  1M90 W;  1S3J A;  4E2L A;  1R3I C;  3WG7 B;  5IDJ A;  3B8M A;  3AG1 B;  2DYS B;  4BIZ A;  1GKF A;  3LDE A;  3P30 A;  4RQF A;  3W7S A;  3AG4 B;  1G8M A;  2AHZ A;  3ZMV A;  2QEX V;  3T4Z A;  5EBM C;  5B1B B;  1FFT B;  4FK5 C;  1K9M W;  2WLI A;  4LC1 A;  1WPX A;  3K03 A;  1K4C C;  4R6Z A;  3QO8 A;  4MW8 A;  5IY5 B;  1R73 A;  3AG3 C;  4WFG A;  1Q7Y W;  3E2E A;  2IJI A;  2HFE C;  2HLD G;  4UV9 A;  2EBO A;  2Y48 A;  4QPK A;  3K79 A;  4JF3 A;  1MSW D;  4PDV A;  2NNU A;  3HPL C;  1DF5 A;  5B1A C;  2HJF C;  1Y66 A;  1KD1 W;  2WLI B;  2Y69 C;  1K92 A;  4QE9 A;  1F23 A;  2DYR B;  5LHI A;  1NH2 B;  1AI6 A;  1PL0 A;  3HB3 B;  1V54 B;  5H9C A;  2BOC C;  3LDD A;  1ENV A;  3LSQ A;  3P32 A;  2IJK A;  1R3L C;  4ZBM A;  1PNL A;  1FXH A;  4QNH B;  3K08 A;  5EC2 C;  2IW5 A;  5B1N A;  2YSU B;  4MVQ A;  4U7O A;  1S72 V;  3K0D A;  1M9N A;  2NLJ C;  1BMF G;  1KC8 W;  2HR3 A;  4UVA A;  1DF4 A;  2IU0 A;  3ZRS A;  3BEH A;  1JJ2 U;  1YTF D;  2P67 A;  1NVP D;  5CBF A;  4GX5 A;  2B5U A;  3E8H A;  4RAI A;  3WFV A;  3W7X A;  4PA7 A;  4WFB V;  1EFR G;  1GO3 F;  1NR1 A;  4GX2 A;  5IYC O;  2X7R B;  3SPC A;  3FB5 C;  4MSW C;  2ITD C;  1YTF B;  5EBW C;  2EIN B;  3OGC C;  1KP3 A;  1VQ4 V;  3CMA V;  3M99 B;  1JX9 A;  2XAS A;  2IU3 A;  1KEC A;  3D3I A;  3NXS A;  1VQN V;  1P4R A;  4JYB A;  1H8E G;  1KQS U;  2B1I A;  3DGE A;  1I5Y A;  5CN0 A;  4PA4 A;  1OZ0 A;  1K4D C;  3TK1 A;  3TET A;  1PNK A;  3CCJ V;  3OW2 U;  4BAY A;  1GM8 A;  2DYR C;  4PA9 A;  1Q86 W;  4HAM A;  3T4D A;  5KA6 A;  3ZN1 A;  2Y69 B;  1G4Y B;  2WLK A;  1F4N A;  3AEI A;  1I5X A;  5B1O A;  3E35 A;  1YI2 V;  1NBM G;  1S5H C;  5FL7 G;  2WAM A;  3ASN C;  3JYC A;  1VQO V;  5LGU A;  3ZRW B;  1K97 A;  2QM8 A;  3VOU A;  5HFM A;  2WPD G;  3FB7 C;  2ZQM A;  3R65 A;  3TCU A;  3CCU V;  2V7Q G;  4P30 A;  1VQ8 V;  4DO2 A;  3AG1 C;  2EIJ C;  5J9P C;  3JD3 A;  3VBB A;  2HVK C;  1E79 G;  5BZB A;  3SYQ A;  3AG4 C;  4GX1 A;  5KUK A;  3ZRW A;  5CBG A;  4Z1M G;  4QPJ A;  1H38 A;  3E8F A;  4XDJ A;  2JEX A;  2QE7 G;  1V55 C;  3CD6 V;  2QTO A;  1OCZ B;  3K04 A;  2DYS C;  3F5W C;  4GT1 A;  2X0L A;  2XAF A;  3CCV V;  4R50 A;  4MTO A;  5CMU A;  3F7Y C;  3WG7 C;  4OXS A;  5LGN A;  3ZIA G;  3AG2 C;  3G6E V;  4BW5 A;  1QR8 A;  4P9O A;  4PDR A;  2OT5 A;  2MK3 A;  1NVP B;  1SER A;  3CCL V;  2YEV A;  1R6K A;  3GB7 C;  3OAA G;  4UXN A;  4WFF A;  1IXM A;  1AJP A;  3E8G A;  3G71 V;  2A0L A;  3ETE A;  1VQK V;  3DTU B;  1GK9 A;  3OEH G;  1JCH A;  2EIL B;  1SES A;  2JIZ G;  2HG5 C;  3CXC U;  2Q67 A;  3K3W A;  4MVR A;  1RM1 C;  2YEV B;  5L3G A;  4I9W A;  2Q6A A;  1VQP V;  4R8C A;  3X2Q B;  1HWY A;  5L3E A;  1EZJ A;  4JTC B;  3IGA C;  3CME V;  4BIU A;  1K73 W;  2DQ0 A;  4TT3 G;  3SPH A;  1SZT A;  1JOY A;  5DN6 G;  3F7V C;  3SYP A;  4WF9 V;  4XDK A;  4WFE A;  1NJI W;  3SYO A;  2X6B A;  3K9A A;  3MHS C;  2EIM C;  2CK3 G;  3FB6 C;  1W2B U;  4LP8 A;  1DTO A;  1OCC B;  2GHY A;  3OMI B;  1KKD A;  3AG2 B;  4FIP C;  1AJQ A;  2W6I G;  4LCU C;  1XL6 A;  2K1E A;  2WLJ A;  3JD2 A;  4CBC A;  1VQ5 V;  5L3D A;  2DW4 A;  2EZP A;  1P7B A;  3IC7 A;  4Q20 A;  4KP4 A;  5DM6 V;  3MD0 A;  2ZXW C;  2KB1 A;  2EIN C;  2XOK G;  1NQT A;  1VQL V;  3D36 A;  3CPW U;  3UKM A;  1Q81 W;  1MOF A;  2WLN A;  2WSS G;  2ZXW B;  3SPI A;  4UV8 A;  1W0K G;  2ITC C;  4J9Y B;  1OCR C;  3JD0 A;  1Y4M A;  3LDC A;  3E89 A;  4PA3 A;  2ZR2 A;  4PEL A;  1VQ6 V;  1QVF U;  3ZMU A;  1YJW V;  4H33 A;  1GMG A;  1XL4 A;  3X2Q C;  3QO5 A;  1YHQ V;  5HFL A;  3GWO A;  1ROP A;  2UXN A;  5L3B A;  4JTD B;  4JPR A;  1QBZ A;  1PD3 A;  2XAQ A;  2ZD9 A;  1R3K C;  2FTK A;  4MTG A;  2Z5U A;  1F4M A;  3K0G A;  3OUS A;  1VQ9 V;  5KUM A;  3RW0 A;  2C2A A;  2LFS A;  1M1K W;  4L87 A;  4TSF G;  4ASU G;  5IYD O;  5B1B C;  2PI4 A;  4G2K A;  4MVZ A;  2X6A A;  1OCC C;  2F43 G;  3ABK C;  3G4S V;  1ZWI C;  3ABU A;  3ABK B;  4KFM A;  5CBH A;  4RUE A;  1QLN A;  2JDI G;  4MTX A;  3JD1 A;  3ZN0 A;  4UVB A;  5B1A B;  1YSC A;  3OUF A;  1FXK C;  1H8H G;  1FXV A;  4EKW A;  1F51 A;  4J9Z B;  3OR7 C;  1VQ7 V;  5KA5 A;  2OCC B;  3SJQ C;  1VQM V;  1OCO B;  1CPY A;  1QLE C;  3ZCC A;  3PJS K;  1K5Q A;  3K06 A;  3ABM C;  2JK5 C;  3KG2 A;  2XND G;  3QNE A;  4MT8 A;  5LHG A;  1RM1 B;  2WLL B;  4JAS A;  3T1C A;  2A79 B;  5H6R A;  1JQ0 A;  2M7W A;  3ASN B;  2ZDI C;  1GM7 A;  4P9P A;  4HYO A;  3CCQ V;  4XDL A;  3JCZ A;  3OE7 G;  3ZMS A;  2H94 A;  2GSM B;  2EIJ B;  3STL C;  3CC4 V;  3ETD A;  1M56 C;  4RQE A;  3W7W A;  3ZRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...