1K8AW

Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1k8aW00
1VQPV 1VQ4V 3CCMV 1YJNV 3CC2V 3CD6V 3OW2U 1VQOV 1K73W 3CCSV 3CPWU 1YJ9V 1S72V 2QA4V 1VQKV 1YJWV 1K8AW 3I56V 1NJIW 3CC4V 5DM6V 3CCRV 1Q7YW 2QEXV 3CXCU 1N8RW 4WFAV 4WCEV 1YITV 1VQNV 3CCUV 1R73A 3CC7V 1W2BU 1VQ6V 3G6EV 3CCQV 3G71V 1VQ5V 1Q81W 1M1KW 1Q82W 4WF9V 1M90W 1VQ9V 2OTLV 1QVFU 3CCLV 1Q86W 1YIJV 1YHQV 1JJ2U 1QVGU 3CCEV 1VQMV 1K9MW 3G4SV 3CCJV 1YI2V 1VQLV 3CMAV 4WFBV 1KQSU 1VQ8V 2OTJV 1KC8W 3I55V 1KD1W 2D3OW 1VQ7V 3CCVV 3CMEV
chains in the Genus database with same CATH superfamily
5KHKA 1XEQA 5KX5A 2HG5C 3QO7A 2QWNB 2AXTZ 5B1AB 2YUAA 1ZL8B 5EK0A 5CBFA 5IE9A 2YIBD 3SYOA 1S76D 1XI1A 2DWDC 4JYBA 4JYYA 3ETEA 3E8FA 3JARA 4TT3G 5IYBO 4J7ZA 2ODMA 3O65A 3K5LA 1KC8W 1SETA 5EC2C 2IU0A 1GM7A 2BOBC 1KMIZ 5B1BB 3HPLC 2EIJC 3AG3C 2QWPB 4I4TB 4DK0A 1K7DA 1OCCB 3BRCA 4IIJA 4TWKA 2IBZH 2QKSA 4JI3B 1JFFB 4RWUA 2JS5A 3RYIA 2D3OW 4DO2A 3CD6V 3R66A 4TUYB 3EFFK 4JI5B 1X59A 3AG4B 4FLUA 5LMUO 4I9WA 4LFAB 2KG7A 2UXBB 1AJPA 1RSOA 5LHGA 5DN6G 1DF4A 1IBLB 2VQFB 1R3KC 5LBQA 3BCCH 1E79G 4YJ2A 1AJNA 2Q9LA 4FZ1A 4B3TO 1D5AA 4DV2B 3N27A 3L72H 2VQEB 5KAFZ 1PNMA 2ILMA 4BIUA 3JASA 4LNUA 4L8JA 1GN2A 3CC7V 4JI8O 4FLZA 1GN3A 3J80N 1Y74A 2UU9B 1SS3A 4J41A 5IYZB 4YHHB 3LDEA 3EVKA 4ZHQB 2ZDIA 4PDVA 1AJQA 3AK3A 1V54B 1AR4A 5ITZB 4LWSA 5JVDB 5L3FA 4X1YB 1GRJA 1HNZO 2AGAA 3D36C 5EYPB 2YIDA 4CH4A 1Q90D 4QPJA 3LDDA 3CCUV 3WFVA 2ZIOA 3ZRWA 2XAJA 5CA0B 3IAYA 1NVPD 2EILB 1GN4A 3R65A 3ZRSA 2Q68A 5LYJB 4JI4O 1XMQO 4KFMA 4LFBO 1OCOC 1AILA 4K0KO 2V1DA 1QHTA 2HKOA 3JALA 2EZOA 1YTFD 3ETGA 1XQ8A 1YZBA 3TJTA 2GBOA 2WLMA 1R73A 2GHYA 2ZCEA 3ASOB 2EIKB 2YICA 1O9GA 1BSMA 2JGDB 4DR6B 1U96A 4AHCA 2GDSA 3JSNA 2GUZB 3CCSV 2W6JG 4TV8A 1OZ0A 1TUBA 4A5UB 3OMAB 5FLXN 1CPYA 3TGUH 5E1AC 3STLC 4F6RB 2F43G 4O4LA 4OPAA 1AI6A 1XOUA 2Y69B 3BFRA 3K9SA 1S0VA 2QKCA 1N36B 3AK1A 1WAZA 4JAUA 5K1XA 1HNXO 4UCRA 3AG7A 1FYJA 3E83A 2ARHA 4IL6Z 1PL0A 1QR9A 3JATB 4JZGA 5FPRA 5LP6A 3CC2V 2JIZG 1D2DA 2CDYA 3KCYA 2UXXA 4KXRA 3VOUA 5LHIA 1YCIA 3P3PA 2IH1C 3HKCA 3BAAA 5GONB 4J42A 3ZHSA 5B66Z 4U3JB 4NXNO 4ZI7B 2R9RB 3JCUZ 1AVMA 4OPHA 4NYKA 1CP9A 3OUSA 2R70A 4LF5O 2QR4A 1K3EA 2E5LO 4BR6A 3DC6A 4JI6O 2BTOA 3C3SA 1SZXA 1K4DC 4GT1A 4UV8A 4MVSA 2AZ0A 1N0JA 4Q20A 2UUCO 3CRAA 1IZ3A 1SQPH 3MHHC 1BT8A 4C7UA 4DV0O 5GTIZ 1OV9A 1QQCA 2ZE5A 1UJWB 2F4VO 4ZKIA 1YITV 4JYAO 3LUTB 3U0ZA 4OGQB 1VQ6V 2ZINA 2PUSA 1THZA 3G71V 3ZMVA 4WF9V 5LMUB 1P49A 3JD2A 3CCEV 4E2LA 5DEDA 3L71H 3OGCC 4I7ZB 3N2KA 4YIOA 1TVKB 2EIMC 2ITCC 4UCUA 4NXMO 1P7GA 1SQQH 4E4EA 5JJEB 2ZE7A 2FTKA 4B3TB 5JCOC 3RYFB 5A2QN 1WPXA 3HKBB 3LSSA 1EN5A 4Z1VA 1VF7A 2L6LA 4JAVA 5H6QA 4JI8B 1MNGA 3UT5A 3CRQA 4WFEA 4QE9A 1VIBA 2ATKC 2JK5C 2QSAA 1Q6UA 1H2MA 4HYOA 4UXNA 4WFGA 1R6TA 3K5OA 3UKMA 1XNQO 3MAQA 2A9HA 1H8HG 5LMNB 4PDLA 3RGBA 3TXSA 3WB0A 4FZ0A 4PJ0Z 3IGAC 4LBEC 3DTUB 4GKKO 4I50A 3B8MA 3OUFA 1PNLA 1M57C 4J10A 3A0HZ 1K34A 2OWOA 1S5JA 1KP2A 3K5MA 4UVAA 4JI4B 2YXLA 4MSWC 4MW3A 4ZBMA 4LFBB 1JQ0A 4YJ3A 3RYHB 1V55C 4K0KB 3D8CA 3ABMB 3H1LH 4QNHB 1OCOB 1FFXB 3OGIB 4I9QA 5B1BC 4DV4O 2XAQA 1BL8A 2HHHO 3FYEB 2XAFA 4FLXA 2ITDC 4Q6GA 3AG2C 3FB6C 1XL4A 4ASUG 5LOVB 4QGPA 4X1IA 2XT9A 5EBWC 3G6EV 2YC0A 1KU9A 1YVWA 5IT9N 1RPOA 4FLVA 2Q73A 1VQ8V 3M99B 3RFRA 2ZXWB 1EZVH 2HEPA 2YS8A 2ZKOA 3AG1C 3CYOA 3SJQC 2VQFO 4GUNA 1OCRC 1MA1A 4PA3A 1ZSPA 1WLEA 2Q67A 5LA6A 1N33O 1HW7A 2P67A 5C8YA 1HNXB 4TV9B 4XDLA 2K1EA 4X8AA 2Y48A 1TUEB 1QR8A 3CPWU 1NU1H 4PA7A 4JI2B 1UPGA 4CH5A 1Q8IA 2WSSG 4YY3O 1GM9A 5EIBD 1VF6C 4O2BB 2LGQA 4XBFA 2DQ3A 3FB8C 1WA8B 4RUEA 2P06A 3SR2C 1M5IA 1IXMA 5C93A 2F66C 4NXNB 4G28B 3OD4A 1MZFA 4UCOA 3H01A 4DW1A 3T4DA 1HDJA 5LGNA 1FPOA 1D5NA 1VP7A 4LF5B 1KBHA 3KZIZ 3B8NA 2E5LB 1YF2A 1FFTB 3PJSK 2X6CA 4JI6B 3RN4A 4GX2A 2ETNA 4PA4A 2UUCB 3ZRXA 4I4TA 2L35A 4DV1O 4G27B 4MVMA 3K03A 4DV0B 2WLKA 4NB5A 1P84F 4O4IA 4TOIA 2F4VB 4DR6O 1VQ9V 3K0GA 4D6TH 1XHXA 2LO1A 4JYAB 5CA1A 1KUQA 4TUYA 4J7KA 1RFYA 2RCVA 4K8ZA 3OR6C 3ZCCA 2JJ2G 3J7AU 2XASA 2PYJA 2Q7GA 2CTWA 5H5NA 4R8CA 3SYQA 1NTMH 1WNSA 4HZ3A 4PA6A 4NXMB 3JSLA 4QPKA 3SJBC 1GK9A 5CBHA 2GV9A 3CCQV 4RAIA 5J9PC 2EIMB 3M8AA 4DR7O 1N36O 2LQTA 4BIOA 1N32O 3L75H 5DM6V 2WLJA 4TSFG 2X0LA 1EFRG 3B40A 3NR7A 1I5YA 4ZHQA 5IDJA 1PL4A 4DR1O 1I5XA 2JDIG 5J2UB 2DWEC 1NTZH 3KG2A 3RYCB 1XNQB 2QM7A 1L8DA 5EYPA 2MW2B 3TETA 2F95B 1SRYA 2XUMA 3FD9A 3ZX6A 1VQOV 2YIAA 1NTKH 3ABTA 2EBOA 1ROPA 2R9AA 4GKKB 4NTXA 1NVPB 3K0DA 4I55B 5L3CA 1KYOF 5LYJA 3S3WA 1M57B 3BY6A 3B2EE 3E86A 1ZAUA 2QWOB 2LFRA 5IWAO 3JAWB 4DV5B 4DV4B 1V55B 5L3DA 4CC6A 1YTFB 2HHHB 3ZRVA 3TCUA 5LL6Y 1Q7YW 1R3LC 3AK2A 4K8XA 4JV5O 1R3JC 3L9DA 4PI0A 1W2BU 3CRRA 1IXBA 3AG2B 1R1BA 5KA5A 4X20B 2UXDB 5D5PA 3OEEG 1AROP 4FLYA 4LCUC 4LF9O 5EBMC 5EZYB 4X9QA 2GUZA 3JAKB 2NR5A 1LR1A 2YEVA 5KHIA 4FK5C 3CCVV 3E22B 4JGSA 4FPPA 4HNAB 1JA8A 2HJDA 1I08A 3K79A 1K97A 4X1KA 1HWYA 4UB6Z 4O2AB 3ZN0A 4GLXA 4F6RA 4B3MO 4FFBA 4LF6O 4EFBA 4OX9O 1WN7A 3AG1B 2QDOA 3STZC 5A9GA 5D5QA 4B3SO 1OCRB 2HVKC 1N33B 3OW2U 1JPXA 1XMOO 2XTAA 2F23A 1PPJH 5KMGA 4UUJC 3UM7A 3UQ8A 2X6AA 4NKGB 3SDLA 1FXKA 3JATA 2ZQMA 2HFEC 4IT5A 4YY3B 4F6EA 4KP4A 2QM8A 2A7WA 3Q4HB 3OTFA 1N34O 1VEWA 1AI4A 1FXHA 5LMNO 2E75B 2HVJC 4U3JA 1M93A 1H2GA 2CUGA 3ZS8C 3K04A 4N23A 1YXBA 3X2QC 4I0XA 1M9NA 5BZBA 4CZZA 3ABMC 4B7EA 3CSXA 1OCZB 2Z3YA 1MSDA 2QJ1A 2B1IA 4ICGA 2ADQB 1JMKC 3TXQA 3GWKC 5L3BA 3K3WA 4DXWA 2P6JA 5F2VO 5KUMA 5IJ0B 4FVMA 2BSKB 4DV1B 3SYCA 4MS2A 4U7OA 3PN1A 4CH6A 1VQLV 1NH2D 4ZOLB 1FKAO 2JVDA 3GWOA 1FS0G 1Z2GA 1BQZA 2OYQA 1G8MA 2ZXWC 1J95A 3JD4A 2XAGA 4LF8O 2WA3A 3TK1A 1U97A 4LH6A 4IYHA 2ZM6O 3CX5F 3SJAC 2WLHA 4BIZA 3RYIB 4DR7B 5L3GA 1URFA 3RYFA 3WG7C 3JD3A 4LC1A 3HKBA 2DOSA 5CB4B 1N32B 4X88A 2W0XA 3ZMZA 5BXZA 2KG7B 1RSOB 1Y4MA 3G4SV 4JI0O 4DR1B 4UCSA 1GAXA 1R3IC 2Q8VA 3K59A 4MTGA 4YJ2B 2CTQA 4JI2O 1SQVH 4KHPO 2Y4UA 2PY5A 1ZLZA 4LH7A 3VQWA 2OIEA 5IY5B 2H94A 3JASB 4LNUB 4JASA 4CS4A 3CJHB 3H9VA 3SPCA 1Q43A 3E8BA 2CAZC 4LWSB 4Z2WA 2ZIMA 5IWAB 2BOCC 1FFXA 2PI4A 2LGWA 3ICXA 4UCTA 4O4HA 1K33A 3T1YO 1XHZA 1N4CA 3H1KH 3E35A 2IJHA 4JV5B 5KHJA 2QWRB 1MOFA 1EN6A 3SYAA 4FLTA 5E79Z 4LF9B 1TGOA 3B4SA 4JYCA 3F5TA 5LOVA 1HR0O 4PI2A 1K8AW 3OMNB 1GM8A 4IGGA 4X64O 1BHAA 1SC5B 5J2TB 4JZ2A 2GTAA 2LW7A 1IURA 3RVZA 5FNVB 2G38A 2Q6AA 1US6A 3ZMUA 4B3MB 5JWPA 5HFLA 1QLEC 4J11A 4DR3O 4WBNB 4LF6B 2Q7EA 3CS5A 4OX9B 3A8TA 1S5LZ 3OMIB 4EKWA 3F7YC 2X7RB 1S72V 4GX5A 4B3SB 4JTCB 5JJJB 4TV8B 3ZEDA 4IHJB 4TV9A 1XMOB 4DR4O 5JH7B 5JQGB 1TUBB 1EM1A 5KUKA 2Y0PA 3CMAV 4AILC 5BY1A 5KHHA 1AP5A 1MZEA 2A3QA 1XBLA 4MTXA 4O2BA 5LGTA 1Q6IA 1N34B 4LP8A 1WA8A 4FM2A 1S5HC 1KECA 2EZPA 4N21A 1B04A 1PD3A 4P2ZA 1BCCH 5GTHZ 5B5EZ 2FB5A 4J9ZB 2N74A 2QA4V 2P90A 2VWJA 1OJHA 1PP9H 1FAFA 4DW0A 3X2QB 1A32A 1FJGO 2K9PA 3LNMB 2N04A 4DV5O 1LUWA 2JEUA 4LR3A 3F7VC 1F4NA 3DXRB 3ETQA 4PDRA 1AR1B 3M7MX 2XOKG 5BMVA 3FFQA 3EHBB 2UXDO 2CH7A 3KCXA 4BW9A 2PZSA 2OT5A 5GW7A 1AR5A 3WB1A 4NTYA 3FYIB 2IM9A 2LP7A 2JRIA 4DYLA 1R6NA 4LF8B 5AG2A 3E89A 1T5EA 2ZM6B 3S3XA 4HBNA 1GTOA 2YSUB 1YDXA 3LSUA 1H2NA 2QEXV 3CXCU 1WP7A 4DV3O 3OTOO 2YI8A 1XILA 4RUFA 1M90W 4J80A 5IJ9A 5JCOA 1YIJV 4W4LA 4HAMA 3WG7B 2HP8A 3CHXA 2YXYA 1I94O 4JF3A 4P30A 3CE2A 2VWKA 5FPOA 2OTLV 2HLDG 2R72A 1KKDA 4DR5O 4JI7O 3CCMV 2KQXA 1K73W 4JI0B 5BR8O 5JJNB 2ZE6A 1H2KA 3N2KB 3CXHF 2WLNA 4KHPB 1G4YB 2EJ7A 1AI5A 2VS0A 1EZJA 3RYCA 1RP3B 1AB3A 2IJJA 1IDSA 2CGOA 1GKFA 2A0LA 3I55V 3SGIA 3CWBH 2P4KA 2Q0AA 1GN6A 5DECA 1ZL8A 2CK3G 2Q7HA 2UUBO 1OCZC 1G1XB 4X62O 1F23A 4O4JB 3JD0A 1Y76B 3T1YB 1VARA 1QBZA 4D7SA 2WLIB 1SA0B 3W7SA 4EFEA 2AW9A 3F5WC 1HNWO 3MD0A 4I50B 3A2FA 1BHBA 1QLNA 4X20A 1HR0B 4R50A 5B3SC 3K58A 3B09A 1N0NA 4K3AA 1Q82W 1BGYH 1JFFA 4X64B 2E3CA 4UCVA 2QWQB 1XUQA 4PD4F 4HNAA 1H38A 1B6QA 1KD1W 2DYRC 2O57A 2FYUH 4CS2A 5IYCO 4DR3B 3I56V 4GX1A 4GYCB 3ZHQA 3APQA 3RVYA 4GKJB 4DV7O 1H2LA 1L0LH 1QLEB 3T1HO 2V7QG 4IYIA 3RT3C 4QJFB 2NN4A 2F93B 3LDCA 3CCLV 3UO2A 4JI1O 1NI8A 1J5EO 4DR4B 3D3IA 1ZTEA 2CE4A 3LNNA 2XAHA 3ASNC 1GO3F 1I0HA 1IVSA 3THOA 2KB1A 3HKEB 1NR1A 1Q6HA 5IYZA 1HP8A 1E1QG 3W7UA 1JOYA 4DK1A 1M1KW 1I7FA 5ITZA 5JVDA 4X1YA 3Q4HA 5H2FZ 3CRMA 5LA6B 3BA8A 2H3OA 2WLLB 3JAMN 5IY5C 2AHZA 1DF5A 5CBGA 2RN9A 3WB2A 3H1JH 3FAVB 5CA0A 2AHYA 4PV1B 1NS1A 2ZDIC 3IC9A 5LHHA 4FJCC 3FX7A 3SPIA 5CN0A 4J7JA 2LJ2A 2DE0X 5H9CA 4MVZA 1JJ2U 1FJGB 3HKDB 3ZMTA 3T2MA 1ORQC 3CRCA 3SPGA 5IJ0A 1PNKA 1NJIW 2BSKA 3VQYA 3UO3A 4WCEV 4GZRB 4KUMA 1DTOA 1F4MA 3BVOA 2H8PC 2ZD9A 4Z1MG 3UCSC 2JGDA 1SQXH 3D3QA 4ZOLA 1M56B 1Z5WA 2NLJC 1NH2B 3QNEA 1GH6A 3ZN1A 2IW5A 2PF4E 3L73H 2QGNA 4DV6O 2KKWA 1JVMA 1SKVA 3O9OA 1H2SB 1Y66A 5LXTB 1L1FA 4WFFA 4FM0A 1XREA 3ETDA 3VQXA 1ZUQA 1BS3A 1SQBH 1S3JA 1DK1A 1RPRA 4DV3B 4UB8Z 2JS3A 3GB7C 4O4IB 3OTOB 4WFBV 3JCZA 4BAYA 4FIPC 2ZR3A 3RBZA 5CA1B 5CB4A 2XHBA 1PM9A 4X65O 1I94B 1YJ9V 2RJZA 4PA9A 1VQKV 1YJWV 3CB2A 4LF7O 2M6YA 3ML0A 3GVMA 4DR5B 4JI7B 5BR8B 2BTQB 3HR0A 3N2GB 1X4TA 1AP6A 1DLBA 2E74B 2HJFC 4DRXB 4MTOA 1P7BA 1EBOA 3CCJV 5EIBC 2Q0OC 2JEXA 1CXZB 1R6KA 1JR9A 4EB6B 5B1OA 5KA6A 2WPDG 3CCRV 5GONA 3ZHRA 3C3TA 4R6ZA 3CJHA 5LP6C 4ZI7A 1K5QA 4MTFA 2UUBB 3G80A 1LUVA 1V9PA 2OTJV 4X62B 2JJ1G 3B77A 2RMKB 3APOA 1XL6A 1QCEA 3RWRD 1O9HA 3CP1A 5KX5B 4MVUA 4CBCA 1NZ6A 1SQFA 2D2CB 2Y0IA 1HNWB 1RM1C 4ABMA 4BW5A 3K57A 3DSQA 4LF4O 2DW4A 1IBMO 5B3SB 1P4RA 3JARB 4RQEA 3ZHTA 2Z0AA 4X89A 1G6UA 5J2TA 4DUZB 4U7NA 5FNVA 2Z5UA 2QTOA 3P3NA 2DYRB 2YDEA 2ADPA 4FFKA 4WBNA 4DV7B 4F4LA 2P4VA 4J9YB 3T1HB 1TVKA 4IIJB 3K06A 1BMFG 4NVPA 4JI1B 2ZT9B 1NBMG 1J5EB 4MVRA 4LFCO 2YEVB 3BPZA 4IHJA 1CEZA 1SQGA 5JH7A 5JQGA 4WFAV 1OHHG 3H1HH 5B1NA 4X1KB 1AI7A 2XNDG 3E2EA 4MT8A 3ASNB 1ENVA 4PHZA 3SPJA 4AI8A 3ABLC 4FFBB 5CMUA 2DYSC 3ZHUA 2AZ2A 2A06H 5IYDO 1MMMA 1NR7A 2OIGA 3SPHA 4B7KA 2CGNA 1Y6XA 1N8RW 1E1RG 2CTPA 2QTSA 3ABKC 3T1CA 3OAAG 2PTMA 1Q81W 3D36A 5EC1C 5KMGB 1WPBA 1QNMA 1Y74B 3OR7C 1FXKB 4H13B 3KKYA 2QKAA 1DGSA 2EINB 2R9IA 3OT7A 3C90A 3MHSC 4MVOA 3RYHA 4JPRA 2CTRA 2JGUA 4OXSA 4WFHA 3A0RA 3K9AA 2WWWA 3DXRA 3ZRWB 5L3EA 2EULA 2GSMB 1IBKO 1VF5B 4YIPA 3NXSA 4AQYO 1VQ5V 4EEQA 4PELA 5CA3A 1VQPV 4I0XB 3CEIA 3ZHVA 1TAEA 3QVNA 1ZWIC 4XDKA 2UUAO 1SESA 3K08A 4DV6B 3JALB 4DR2O 3H1IH 2OCCC 1KB9F 2EIJB 4DUYO 3AG3B 2C2AA 1XNRO 4B3RO 4I5SA 4GKJO 1B3QA 3QF7A 3JD1A 5H6RA 3G6BA 1MABG 4W4KA 3RW0A 2DJVA 4CC5A 4X65B 2LFSA 1GMGA 2OCHA 5KHGA 4LF7B 4L87A 3VQVA 4MVQA 1H8EG 5K1PA 1YSCA 3WU2Z 1F51A 4O4LB 2V4DA 2VRZA 2UXCO 1TA8A 4R7CA 1QU7A 2ZNIA 5TISZ 1BQ0A 1IX9A 4K35A 5KAIZ 1QVFU 1KP3A 2YXHA 2F1MA 3E8HA 1COWG 3P32A 3ABUA 2Q69A 3T4ZA 1K5SA 1L0NH 1WB8A 3FB7C 2B5UA 2P7TC 4X66O 5FL7G 4CS3A 2YIBA 4RQFA 5LP6B 2X6BA 4O4JA 1HNZB 1Y76A 2M7WA 2WLIA 4H0LB 3J81N 3HKCB 1SZTA 1SA0A 1W0JG 5B1AC 3OEHG 2DN9A 2FKXA 2E76B 1VQ7V 4P9OA 3BABA 4UVCA 1RM1B 2GTSA 1M56C 1XMQB 4LF4B 3SYPA 4NR1A 1IBMB 4H44B 3U11A 1JCHA 4O4HB 2RQ6A 3IC7A 3QTCA 4H37A 2Y4TA 1OCCC 4GCZA 2EJRA 4TQDA 3W7XA 2IJIA 1K92A 2DMXA 1UFIA 1SERA 4UVBA 2QM4A 4LFCB 4JI3O 4JTAB 2ZNJA 1S77D 3AG4C 2MK3A 2RNBA 1YHQV 1FD9A 1FXVA 3HB3B 3P30A 4RO2A 4JI5O 3SJCC 2KSDA 2Q5ZA 2WAMA 2ZR2A 4LFAO 3HKEA 1Q3EA 2BCCH 2WA4A 3EXAA 2UXBO 2ZE8A 2PI5A 3IJ4A 1IBLO 4YXWG 1NT2B 1PKXA 3ABLB 4U3FH 5J2UA 3BA9A 1SF9A 1WP8A 2DYSB 1NQTA 3OE7G 3FB5C 1XDCA 3ZJZA 2WLLA 3OFNG 4DV2O 4P9PA 2EX3A 1EN4A 2VQEO 1KQSU 5EBLC 4FM1A 3ABKB 1Z5VA 1Q5OA 3FAVA 1VQ4V 1YJNV 1MG1A 3UT5B 4D7TA 2P5OA 4I55A 2UU9O 1LNQA 4YHHO 1V54C 4TQFA 4JTDB 3QO5A 2IH3C 3HKDA 3BEHA 5HFMA 1M4UA 1BE3H 3JAWA 1K9MW 4MW8A 4FMTA 3OM3B 3QG5A 2FMLA 1YI2V 2PYLA 1K4CC 3AEIA 4KL1A 4UV9A 1KKCA 2EILC 3MDSA 4XDJA 1IBKB 3FKSG 3CC4V 4AQYB 3BHPA 1BZKA 3DGEA 5EZYA 1WJZA 3U10A 4YJ3B 2UUAB 2UXNA 3JAKA 3ZBHA 1W59A 3ZIAG 3ZMSA 4DR2B 4H33A 3E22A 5LXTA 1WB7A 4G2KA 4DUZO 3CMEV 1W0KG 2B1GA 2YI9A 4JAAA 3ASOC 2EIKC 4FLWA 3QO8A 4O2AA 4DUYB 3G67A 2OCCB 1XNRB 4B3RB 5BMVB 2DQ0A 4ZIBA 2FL4A 2CH7B 2HR3A 2IU3A 3DC5A 2Q4PA 4NTWA 1QVGU 3A0BZ 4X1IB 4UFZA 2N05A 1F7YA 2LW1A 1Q86W 3W7WA 3E8GA 2RDCA 4CH3A 4PDMA 2BTQA 1VMGA 3N2GA 1Y67A 2Y69C 1NKDA 3W7TA 4DRXA 5LGUA 1MSWD 3JYCA 2UXCB 2W0FC 3IFXA 2QE7G 1B06A 2PGGA 2BE3A 4EB6A 3I5DA 5IJ9B 1ZX3A 1VF6A 2W6IG 5C8YB 1PV0A 1YEWA 2IJKA 4QE7A 4X66B 1FXKC 2B9ZA 1VQNV 5KLVH 3L70H 2EINC 3VBBA 4GX0A 1JJOA 4B08A 2P22C 1JX9A 4BWAA 1VQMV 2NNUA 3K5NA 2A79B 3LSQA 4QIWF 3L74H
chains in the Genus database with same CATH topology
2DW4A 1QR8A 1P4RA 2HG5C 3QO7A 5B3SB 3OMIB 4RQEA 4EKWA 3F7YC 4X89A 2X7RB 3CPWU 1S72V 4GX5A 4JTCB 4PA7A 4U7NA 5B1AB 2Z5UA 5EK0A 2WSSG 5CBFA 2QTOA 1GM9A 2DYRB 3SYOA 1S76D 4XBFA 2DQ3A 2DWDC 4JYBA 3FB8C 4F4LA 3ETEA 3E8FA 4J9YB 5KUKA 4TT3G 3CMAV 4RUEA 5IYBO 3K06A 1BMFG 1KC8W 1SETA 5EC2C 1IXMA 2IU0A 1GM7A 1NBMG 5C93A 2BOBC 4MVRA 4G28B 2YEVB 5B1BB 3HPLC 1CEZA 3H01A 4MTXA 2EIJC 4WFAV 5LGTA 1OHHG 3T4DA 3AG3C 5B1NA 5LGNA 1AI7A 1K7DA 1OCCB 4LP8A 2XNDG 3E2EA 4MT8A 3ASNB 1S5HC 1ENVA 3B8NA 3SPJA 4TWKA 1KECA 2EZPA 2QKSA 4N21A 3ABLC 1FFTB 3PJSK 5CMUA 1PD3A 2X6CA 4P2ZA 2DYSC 5IYDO 2D3OW 4DO2A 4GX2A 3CD6V 4J9ZB 4PA4A 1NR7A 3SPHA 3ZRXA 2QA4V 2P90A 3EFFK 3AG4B 4G27B 1N8RW 4I9WA 4MVMA 3X2QB 3K03A 1AJPA 1E1RG 3ABKC 2WLKA 3LNMB 3T1CA 5LHGA 5DN6G 1DF4A 3OAAG 1Q81W 3D36A 5EC1C 1VQ9V 3K0GA 1R3KC 5LBQA 3OR7C 1E79G 1FXKB 1AJNA 2JEUA 3F7VC 1F4NA 2EINB 3OR6C 2R9IA 4PDRA 1AR1B 3ZCCA 3MHSC 2XOKG 4MVOA 2JJ2G 4JPRA 2XASA 1PNMA 4R8CA 3SYQA 3EHBB 4OXSA 4BIUA 4WFHA 3A0RA 4HZ3A 4PA6A 3CC7V 4QPKA 3K9AA 1GK9A 2OT5A 5GW7A 5CBHA 3CCQV 4RAIA 5J9PC 3FYIB 2EIMB 3LDEA 2LP7A 2WWWA 2ZDIA 4PDVA 3ZRWB 5L3EA 1R6NA 2GSMB 1AJQA 1V54B 3E89A 3NXSA 5L3FA 1VQ5V 4PELA 5CA3A 1VQPV 1GTOA 2YSUB 5DM6V 2WLJA 1ZWIC 2QEXV 4XDKA 3CXCU 4TSFG 1SESA 3K08A 2X0LA 1EFRG 4QPJA 1I5YA 3LDDA 3CCUV 3WFVA 5IDJA 4RUFA 3ZRWA 1I5XA 2XAJA 2JDIG 1NVPD 1M90W 2EILB 1YIJV 2OCCC 4HAMA 3R65A 3WG7B 2DWEC 3ZRSA 4JF3A 4P30A 3KG2A 2EIJB 2Q68A 2QM7A 2C2AA 3AG3B 4KFMA 1OCOC 2OTLV 2HLDG 3TETA 1KKDA 4I5SA 1SRYA 3CCMV 1VQOV 3JD1A 1K73W 2V1DA 5H6RA 2HKOA 1MABG 3ABTA 2EBOA 2EZOA 1ROPA 3RW0A 1YTFD 3ETGA 1NVPB 2WLNA 2WLMA 1G4YB 3K0DA 2LFSA 1GMGA 1R73A 1AI5A 1EZJA 5L3CA 4L87A 2GHYA 2IJJA 4MVQA 3ASOB 2EIKB 1M57B 3BY6A 1H8EG 3E86A 1GKFA 1YSCA 2LFRA 1F51A 2A0LA 3I55V 1V55B 5L3DA 1YTFB 3CCSV 3ZRVA 2CK3G 3TCUA 2W6JG 1Q7YW 1R3LC 4R7CA 1OZ0A 1R3JC 1W2BU 3OMAB 1CPYA 1OCZC 3AG2B 5KA5A 1QVFU 1F23A 3JD0A 5E1AC 1KP3A 3E8HA 1AROP 1COWG 3OEEG 3P32A 4LCUC 3STLC 3ABUA 2Q69A 5EBMC 2F43G 1K5SA 1QBZA 3T4ZA 1AI6A 2WLIB 3FB7C 2B5UA 2P7TC 2YEVA 4FK5C 3CCVV 3W7SA 2Y69B 4JGSA 5FL7G 4FPPA 3F5WC 1S0VA 3MD0A 4RQFA 3K79A 1BHBA 1K97A 2X6BA 1QLNA 1HWYA 4JAUA 3ZN0A 4R50A 5B3SC 3E83A 1Q82W 2M7WA 2WLIA 1SZTA 1W0JG 3AG1B 5B1AC 3OEHG 3STZC 1PL0A 1QR9A 1H38A 1B6QA 1KD1W 2DYRC 1OCRB 2JIZG 2HVKC 4P9OA 1VQ7V 3CC2V 4UVCA 2UXXA 3OW2U 1RM1B 3VOUA 1M56C 1JPXA 5IYCO 3I56V 4GX1A 5LHIA 3SYPA 3RVYA 4UUJC 2IH1C 3UM7A 1QLEB 2X6AA 2V7QG 4QJFB 1FXKA 3LDCA 3CCLV 1JCHA 2ZQMA 2HFEC 3IC7A 4KP4A 2QM8A 3D3IA 4H37A 2R9RB 1OCCC 4GCZA 2EJRA 2XAHA 1CP9A 3ASNC 3W7XA 3OUSA 1GO3F 2IJIA 1AI4A 1K92A 1SERA 1K3EA 2KB1A 1FXHA 1NR1A 4UVBA 2HVJC 1E1QG 3W7UA 1JOYA 4JTAB 1H2GA 1M1KW 1S77D 1K4DC 3AG4C 4GT1A 2MK3A 3K04A 4MVSA 4N23A 4UV8A 1YHQV 4Q20A 3X2QC 1FXVA 3HB3B 3P30A 1M9NA 4RO2A 5BZBA 3MHHC 4CZZA 2WLLB 3ABMC 2WAMA 2ZR2A 5IY5C 1OCZB 2AHZA 1DF5A 2Z3YA 5CBGA 2B1IA 1UJWB 2PI5A 4ZKIA 4YXWG 5L3BA 1PKXA 3ABLB 2AHYA 1YITV 3K3WA 2ZDIC 2P6JA 4DXWA 5LHHA 5KUMA 4FJCC 2DYSB 3LUTB 1VQ6V 1NQTA 1THZA 3OE7G 3FB5C 3SPIA 5CN0A 3SYCA 3ZMVA 4WF9V 3G71V 4MS2A 3ZJZA 2WLLA 3OFNG 5H9CA 4MVZA 1JJ2U 3JD2A 4U7OA 3CCEV 4E2LA 4P9PA 1VQLV 1KQSU 1NH2D 3ZMTA 3OGCC 5EBLC 3T2MA 3ABKB 1VQ4V 1ORQC 1YJNV 2EIMC 2ITCC 3GWOA 1FS0G 1MG1A 3SPGA 1PNKA 1NJIW 2FTKA 1LNQA 1V54C 4WCEV 4JTDB 1G8MA 2ZXWC 1J95A 3JD4A 3QO5A 4KUMA 1DTOA 1F4MA 2IH3C 1WPXA 2H8PC 2XAGA 2ZD9A 4Z1MG 3BEHA 3LSSA 5HFMA 3TK1A 1M56B 2NLJC 1NH2B 3QNEA 4JAVA 5H6QA 1K9MW 4MW8A 4FMTA 3OM3B 1YI2V 3ZN1A 2IW5A 4WFEA 1K4CC 2WLHA 4BIZA 3AEIA 4UV9A 2EILC 4QE9A 1JVMA 5L3GA 1Y66A 4XDJA 3FKSG 3JD3A 3WG7C 3CC4V 4LC1A 2ATKC 2JK5C 1L1FA 4WFFA 3ETDA 4HYOA 4UXNA 4WFGA 4X88A 3DGEA 3UKMA 1S3JA 3ZMZA 2A9HA 1RPRA 1H8HG 2UXNA 4PDLA 3GB7C 3ZIAG 3ZMSA 1Y4MA 3G4SV 4H33A 4WFBV 3IGAC 4LBEC 3DTUB 3JCZA 4BAYA 4FIPC 2ZR3A 1R3IC 3RBZA 4G2KA 3B8MA 3CMEV 1W0KG 4MTGA 2B1GA 3OUFA 3ASOC 1PNLA 1M57C 2EIKC 1K34A 3QO8A 1KP2A 1YJ9V 4PA9A 4UVAA 1VQKV 1YJWV 4MSWC 4MW3A 3ML0A 4ZBMA 2OCCB 1JQ0A 1V55C 3ABMB 4QNHB 2DQ0A 1OCOB 5IY5B 2H94A 2HR3A 2IU3A 5B1BC 2XAQA 1DLBA 1QVGU 1BL8A 2HJFC 4MTOA 1P7BA 1EBOA 4JASA 3CCJV 3FYEB 2JEXA 2XAFA 2ITDC 1R6KA 3SPCA 1Q86W 3AG2C 3E8GA 3W7WA 3FB6C 1XL4A 5B1OA 3E8BA 5KA6A 2WPDG 4PDMA 3CCRV 2BOCC 2PI4A 4ASUG 2Y69C 1K33A 1NKDA 5EBWC 3W7TA 5LGUA 3G6EV 1MSWD 4R6ZA 3JYCA 3E35A 2W0FC 2IJHA 1K5QA 3IFXA 1RPOA 2QE7G 4MTFA 1MOFA 3SYAA 1VQ8V 2OTJV 3M99B 2ZXWB 2W6IG 2JJ1G 3B77A 4JYCA 1XL6A 2IJKA 1K8AW 3AG1C 3CYOA 1QCEA 4QE7A 3OMNB 1GM8A 3CP1A 1FXKC 3SJQC 4MVUA 1BHAA 4CBCA 1OCRC 1VQNV 4PA3A 2EINC 3VBBA 1RM1C 4GX0A 1WLEA 3RVZA 2Q67A 4BW5A 1JX9A 2P67A 2Q6AA 3ZMUA 2NNUA 1VQMV 2A79B 3LSQA 4QIWF 4XDLA 2K1EA 5HFLA 1QLEC 4X8AA 2Y48A 1TUEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQP V;  1VQ4 V;  3CCM V;  1YJN V;  3CC2 V;  3CD6 V;  3OW2 U;  1VQO V;  1K73 W;  3CCS V;  3CPW U;  1YJ9 V;  1S72 V;  2QA4 V;  1VQK V;  1YJW V;  1K8A W;  3I56 V;  1NJI W;  3CC4 V;  5DM6 V;  3CCR V;  1Q7Y W;  2QEX V;  3CXC U;  1N8R W;  4WFA V;  4WCE V;  1YIT V;  1VQN V;  3CCU V;  1R73 A;  3CC7 V;  1W2B U;  1VQ6 V;  3G6E V;  3CCQ V;  3G71 V;  1VQ5 V;  1Q81 W;  1M1K W;  1Q82 W;  4WF9 V;  1M90 W;  1VQ9 V;  2OTL V;  1QVF U;  3CCL V;  1Q86 W;  1YIJ V;  1YHQ V;  1JJ2 U;  1QVG U;  3CCE V;  1VQM V;  1K9M W;  3G4S V;  3CCJ V;  1YI2 V;  1VQL V;  3CMA V;  4WFB V;  1KQS U;  1VQ8 V;  2OTJ V;  1KC8 W;  3I55 V;  1KD1 W;  2D3O W;  1VQ7 V;  3CCV V;  3CME V; 
#chains in the Genus database with same CATH topology
 5KHK A;  1XEQ A;  5KX5 A;  2HG5 C;  3QO7 A;  2QWN B;  2AXT Z;  5B1A B;  2YUA A;  1ZL8 B;  5EK0 A;  5CBF A;  5IE9 A;  2YIB D;  3SYO A;  1S76 D;  1XI1 A;  2DWD C;  4JYB A;  4JYY A;  3ETE A;  3E8F A;  3JAR A;  4TT3 G;  5IYB O;  4J7Z A;  2ODM A;  3O65 A;  3K5L A;  1KC8 W;  1SET A;  5EC2 C;  2IU0 A;  1GM7 A;  2BOB C;  1KMI Z;  5B1B B;  3HPL C;  2EIJ C;  3AG3 C;  2QWP B;  4I4T B;  4DK0 A;  1K7D A;  1OCC B;  3BRC A;  4IIJ A;  4TWK A;  2IBZ H;  2QKS A;  4JI3 B;  1JFF B;  4RWU A;  2JS5 A;  3RYI A;  2D3O W;  4DO2 A;  3CD6 V;  3R66 A;  4TUY B;  3EFF K;  4JI5 B;  1X59 A;  3AG4 B;  4FLU A;  5LMU O;  4I9W A;  4LFA B;  2KG7 A;  2UXB B;  1AJP A;  1RSO A;  5LHG A;  5DN6 G;  1DF4 A;  1IBL B;  2VQF B;  1R3K C;  5LBQ A;  3BCC H;  1E79 G;  4YJ2 A;  1AJN A;  2Q9L A;  4FZ1 A;  4B3T O;  1D5A A;  4DV2 B;  3N27 A;  3L72 H;  2VQE B;  5KAF Z;  1PNM A;  2ILM A;  4BIU A;  3JAS A;  4LNU A;  4L8J A;  1GN2 A;  3CC7 V;  4JI8 O;  4FLZ A;  1GN3 A;  3J80 N;  1Y74 A;  2UU9 B;  1SS3 A;  4J41 A;  5IYZ B;  4YHH B;  3LDE A;  3EVK A;  4ZHQ B;  2ZDI A;  4PDV A;  1AJQ A;  3AK3 A;  1V54 B;  1AR4 A;  5ITZ B;  4LWS A;  5JVD B;  5L3F A;  4X1Y B;  1GRJ A;  1HNZ O;  2AGA A;  3D36 C;  5EYP B;  2YID A;  4CH4 A;  1Q90 D;  4QPJ A;  3LDD A;  3CCU V;  3WFV A;  2ZIO A;  3ZRW A;  2XAJ A;  5CA0 B;  3IAY A;  1NVP D;  2EIL B;  1GN4 A;  3R65 A;  3ZRS A;  2Q68 A;  5LYJ B;  4JI4 O;  1XMQ O;  4KFM A;  4LFB O;  1OCO C;  1AIL A;  4K0K O;  2V1D A;  1QHT A;  2HKO A;  3JAL A;  2EZO A;  1YTF D;  3ETG A;  1XQ8 A;  1YZB A;  3TJT A;  2GBO A;  2WLM A;  1R73 A;  2GHY A;  2ZCE A;  3ASO B;  2EIK B;  2YIC A;  1O9G A;  1BSM A;  2JGD B;  4DR6 B;  1U96 A;  4AHC A;  2GDS A;  3JSN A;  2GUZ B;  3CCS V;  2W6J G;  4TV8 A;  1OZ0 A;  1TUB A;  4A5U B;  3OMA B;  5FLX N;  1CPY A;  3TGU H;  5E1A C;  3STL C;  4F6R B;  2F43 G;  4O4L A;  4OPA A;  1AI6 A;  1XOU A;  2Y69 B;  3BFR A;  3K9S A;  1S0V A;  2QKC A;  1N36 B;  3AK1 A;  1WAZ A;  4JAU A;  5K1X A;  1HNX O;  4UCR A;  3AG7 A;  1FYJ A;  3E83 A;  2ARH A;  4IL6 Z;  1PL0 A;  1QR9 A;  3JAT B;  4JZG A;  5FPR A;  5LP6 A;  3CC2 V;  2JIZ G;  1D2D A;  2CDY A;  3KCY A;  2UXX A;  4KXR A;  3VOU A;  5LHI A;  1YCI A;  3P3P A;  2IH1 C;  3HKC A;  3BAA A;  5GON B;  4J42 A;  3ZHS A;  5B66 Z;  4U3J B;  4NXN O;  4ZI7 B;  2R9R B;  3JCU Z;  1AVM A;  4OPH A;  4NYK A;  1CP9 A;  3OUS A;  2R70 A;  4LF5 O;  2QR4 A;  1K3E A;  2E5L O;  4BR6 A;  3DC6 A;  4JI6 O;  2BTO A;  3C3S A;  1SZX A;  1K4D C;  4GT1 A;  4UV8 A;  4MVS A;  2AZ0 A;  1N0J A;  4Q20 A;  2UUC O;  3CRA A;  1IZ3 A;  1SQP H;  3MHH C;  1BT8 A;  4C7U A;  4DV0 O;  5GTI Z;  1OV9 A;  1QQC A;  2ZE5 A;  1UJW B;  2F4V O;  4ZKI A;  1YIT V;  4JYA O;  3LUT B;  3U0Z A;  4OGQ B;  1VQ6 V;  2ZIN A;  2PUS A;  1THZ A;  3G71 V;  3ZMV A;  4WF9 V;  5LMU B;  1P49 A;  3JD2 A;  3CCE V;  4E2L A;  5DED A;  3L71 H;  3OGC C;  4I7Z B;  3N2K A;  4YIO A;  1TVK B;  2EIM C;  2ITC C;  4UCU A;  4NXM O;  1P7G A;  1SQQ H;  4E4E A;  5JJE B;  2ZE7 A;  2FTK A;  4B3T B;  5JCO C;  3RYF B;  5A2Q N;  1WPX A;  3HKB B;  3LSS A;  1EN5 A;  4Z1V A;  1VF7 A;  2L6L A;  4JAV A;  5H6Q A;  4JI8 B;  1MNG A;  3UT5 A;  3CRQ A;  4WFE A;  4QE9 A;  1VIB A;  2ATK C;  2JK5 C;  2QSA A;  1Q6U A;  1H2M A;  4HYO A;  4UXN A;  4WFG A;  1R6T A;  3K5O A;  3UKM A;  1XNQ O;  3MAQ A;  2A9H A;  1H8H G;  5LMN B;  4PDL A;  3RGB A;  3TXS A;  3WB0 A;  4FZ0 A;  4PJ0 Z;  3IGA C;  4LBE C;  3DTU B;  4GKK O;  4I50 A;  3B8M A;  3OUF A;  1PNL A;  1M57 C;  4J10 A;  3A0H Z;  1K34 A;  2OWO A;  1S5J A;  1KP2 A;  3K5M A;  4UVA A;  4JI4 B;  2YXL A;  4MSW C;  4MW3 A;  4ZBM A;  4LFB B;  1JQ0 A;  4YJ3 A;  3RYH B;  1V55 C;  4K0K B;  3D8C A;  3ABM B;  3H1L H;  4QNH B;  1OCO B;  1FFX B;  3OGI B;  4I9Q A;  5B1B C;  4DV4 O;  2XAQ A;  1BL8 A;  2HHH O;  3FYE B;  2XAF A;  4FLX A;  2ITD C;  4Q6G A;  3AG2 C;  3FB6 C;  1XL4 A;  4ASU G;  5LOV B;  4QGP A;  4X1I A;  2XT9 A;  5EBW C;  3G6E V;  2YC0 A;  1KU9 A;  1YVW A;  5IT9 N;  1RPO A;  4FLV A;  2Q73 A;  1VQ8 V;  3M99 B;  3RFR A;  2ZXW B;  1EZV H;  2HEP A;  2YS8 A;  2ZKO A;  3AG1 C;  3CYO A;  3SJQ C;  2VQF O;  4GUN A;  1OCR C;  1MA1 A;  4PA3 A;  1ZSP A;  1WLE A;  2Q67 A;  5LA6 A;  1N33 O;  1HW7 A;  2P67 A;  5C8Y A;  1HNX B;  4TV9 B;  4XDL A;  2K1E A;  4X8A A;  2Y48 A;  1TUE B;  1QR8 A;  3CPW U;  1NU1 H;  4PA7 A;  4JI2 B;  1UPG A;  4CH5 A;  1Q8I A;  2WSS G;  4YY3 O;  1GM9 A;  5EIB D;  1VF6 C;  4O2B B;  2LGQ A;  4XBF A;  2DQ3 A;  3FB8 C;  1WA8 B;  4RUE A;  2P06 A;  3SR2 C;  1M5I A;  1IXM A;  5C93 A;  2F66 C;  4NXN B;  4G28 B;  3OD4 A;  1MZF A;  4UCO A;  3H01 A;  4DW1 A;  3T4D A;  1HDJ A;  5LGN A;  1FPO A;  1D5N A;  1VP7 A;  4LF5 B;  1KBH A;  3KZI Z;  3B8N A;  2E5L B;  1YF2 A;  1FFT B;  3PJS K;  2X6C A;  4JI6 B;  3RN4 A;  4GX2 A;  2ETN A;  4PA4 A;  2UUC B;  3ZRX A;  4I4T A;  2L35 A;  4DV1 O;  4G27 B;  4MVM A;  3K03 A;  4DV0 B;  2WLK A;  4NB5 A;  1P84 F;  4O4I A;  4TOI A;  2F4V B;  4DR6 O;  1VQ9 V;  3K0G A;  4D6T H;  1XHX A;  2LO1 A;  4JYA B;  5CA1 A;  1KUQ A;  4TUY A;  4J7K A;  1RFY A;  2RCV A;  4K8Z A;  3OR6 C;  3ZCC A;  2JJ2 G;  3J7A U;  2XAS A;  2PYJ A;  2Q7G A;  2CTW A;  5H5N A;  4R8C A;  3SYQ A;  1NTM H;  1WNS A;  4HZ3 A;  4PA6 A;  4NXM B;  3JSL A;  4QPK A;  3SJB C;  1GK9 A;  5CBH A;  2GV9 A;  3CCQ V;  4RAI A;  5J9P C;  2EIM B;  3M8A A;  4DR7 O;  1N36 O;  2LQT A;  4BIO A;  1N32 O;  3L75 H;  5DM6 V;  2WLJ A;  4TSF G;  2X0L A;  1EFR G;  3B40 A;  3NR7 A;  1I5Y A;  4ZHQ A;  5IDJ A;  1PL4 A;  4DR1 O;  1I5X A;  2JDI G;  5J2U B;  2DWE C;  1NTZ H;  3KG2 A;  3RYC B;  1XNQ B;  2QM7 A;  1L8D A;  5EYP A;  2MW2 B;  3TET A;  2F95 B;  1SRY A;  2XUM A;  3FD9 A;  3ZX6 A;  1VQO V;  2YIA A;  1NTK H;  3ABT A;  2EBO A;  1ROP A;  2R9A A;  4GKK B;  4NTX A;  1NVP B;  3K0D A;  4I55 B;  5L3C A;  1KYO F;  5LYJ A;  3S3W A;  1M57 B;  3BY6 A;  3B2E E;  3E86 A;  1ZAU A;  2QWO B;  2LFR A;  5IWA O;  3JAW B;  4DV5 B;  4DV4 B;  1V55 B;  5L3D A;  4CC6 A;  1YTF B;  2HHH B;  3ZRV A;  3TCU A;  5LL6 Y;  1Q7Y W;  1R3L C;  3AK2 A;  4K8X A;  4JV5 O;  1R3J C;  3L9D A;  4PI0 A;  1W2B U;  3CRR A;  1IXB A;  3AG2 B;  1R1B A;  5KA5 A;  4X20 B;  2UXD B;  5D5P A;  3OEE G;  1ARO P;  4FLY A;  4LCU C;  4LF9 O;  5EBM C;  5EZY B;  4X9Q A;  2GUZ A;  3JAK B;  2NR5 A;  1LR1 A;  2YEV A;  5KHI A;  4FK5 C;  3CCV V;  3E22 B;  4JGS A;  4FPP A;  4HNA B;  1JA8 A;  2HJD A;  1I08 A;  3K79 A;  1K97 A;  4X1K A;  1HWY A;  4UB6 Z;  4O2A B;  3ZN0 A;  4GLX A;  4F6R A;  4B3M O;  4FFB A;  4LF6 O;  4EFB A;  4OX9 O;  1WN7 A;  3AG1 B;  2QDO A;  3STZ C;  5A9G A;  5D5Q A;  4B3S O;  1OCR B;  2HVK C;  1N33 B;  3OW2 U;  1JPX A;  1XMO O;  2XTA A;  2F23 A;  1PPJ H;  5KMG A;  4UUJ C;  3UM7 A;  3UQ8 A;  2X6A A;  4NKG B;  3SDL A;  1FXK A;  3JAT A;  2ZQM A;  2HFE C;  4IT5 A;  4YY3 B;  4F6E A;  4KP4 A;  2QM8 A;  2A7W A;  3Q4H B;  3OTF A;  1N34 O;  1VEW A;  1AI4 A;  1FXH A;  5LMN O;  2E75 B;  2HVJ C;  4U3J A;  1M93 A;  1H2G A;  2CUG A;  3ZS8 C;  3K04 A;  4N23 A;  1YXB A;  3X2Q C;  4I0X A;  1M9N A;  5BZB A;  4CZZ A;  3ABM C;  4B7E A;  3CSX A;  1OCZ B;  2Z3Y A;  1MSD A;  2QJ1 A;  2B1I A;  4ICG A;  2ADQ B;  1JMK C;  3TXQ A;  3GWK C;  5L3B A;  3K3W A;  4DXW A;  2P6J A;  5F2V O;  5KUM A;  5IJ0 B;  4FVM A;  2BSK B;  4DV1 B;  3SYC A;  4MS2 A;  4U7O A;  3PN1 A;  4CH6 A;  1VQL V;  1NH2 D;  4ZOL B;  1FKA O;  2JVD A;  3GWO A;  1FS0 G;  1Z2G A;  1BQZ A;  2OYQ A;  1G8M A;  2ZXW C;  1J95 A;  3JD4 A;  2XAG A;  4LF8 O;  2WA3 A;  3TK1 A;  1U97 A;  4LH6 A;  4IYH A;  2ZM6 O;  3CX5 F;  3SJA C;  2WLH A;  4BIZ A;  3RYI B;  4DR7 B;  5L3G A;  1URF A;  3RYF A;  3WG7 C;  3JD3 A;  4LC1 A;  3HKB A;  2DOS A;  5CB4 B;  1N32 B;  4X88 A;  2W0X A;  3ZMZ A;  5BXZ A;  2KG7 B;  1RSO B;  1Y4M A;  3G4S V;  4JI0 O;  4DR1 B;  4UCS A;  1GAX A;  1R3I C;  2Q8V A;  3K59 A;  4MTG A;  4YJ2 B;  2CTQ A;  4JI2 O;  1SQV H;  4KHP O;  2Y4U A;  2PY5 A;  1ZLZ A;  4LH7 A;  3VQW A;  2OIE A;  5IY5 B;  2H94 A;  3JAS B;  4LNU B;  4JAS A;  4CS4 A;  3CJH B;  3H9V A;  3SPC A;  1Q43 A;  3E8B A;  2CAZ C;  4LWS B;  4Z2W A;  2ZIM A;  5IWA B;  2BOC C;  1FFX A;  2PI4 A;  2LGW A;  3ICX A;  4UCT A;  4O4H A;  1K33 A;  3T1Y O;  1XHZ A;  1N4C A;  3H1K H;  3E35 A;  2IJH A;  4JV5 B;  5KHJ A;  2QWR B;  1MOF A;  1EN6 A;  3SYA A;  4FLT A;  5E79 Z;  4LF9 B;  1TGO A;  3B4S A;  4JYC A;  3F5T A;  5LOV A;  1HR0 O;  4PI2 A;  1K8A W;  3OMN B;  1GM8 A;  4IGG A;  4X64 O;  1BHA A;  1SC5 B;  5J2T B;  4JZ2 A;  2GTA A;  2LW7 A;  1IUR A;  3RVZ A;  5FNV B;  2G38 A;  2Q6A A;  1US6 A;  3ZMU A;  4B3M B;  5JWP A;  5HFL A;  1QLE C;  4J11 A;  4DR3 O;  4WBN B;  4LF6 B;  2Q7E A;  3CS5 A;  4OX9 B;  3A8T A;  1S5L Z;  3OMI B;  4EKW A;  3F7Y C;  2X7R B;  1S72 V;  4GX5 A;  4B3S B;  4JTC B;  5JJJ B;  4TV8 B;  3ZED A;  4IHJ B;  4TV9 A;  1XMO B;  4DR4 O;  5JH7 B;  5JQG B;  1TUB B;  1EM1 A;  5KUK A;  2Y0P A;  3CMA V;  4AIL C;  5BY1 A;  5KHH A;  1AP5 A;  1MZE A;  2A3Q A;  1XBL A;  4MTX A;  4O2B A;  5LGT A;  1Q6I A;  1N34 B;  4LP8 A;  1WA8 A;  4FM2 A;  1S5H C;  1KEC A;  2EZP A;  4N21 A;  1B04 A;  1PD3 A;  4P2Z A;  1BCC H;  5GTH Z;  5B5E Z;  2FB5 A;  4J9Z B;  2N74 A;  2QA4 V;  2P90 A;  2VWJ A;  1OJH A;  1PP9 H;  1FAF A;  4DW0 A;  3X2Q B;  1A32 A;  1FJG O;  2K9P A;  3LNM B;  2N04 A;  4DV5 O;  1LUW A;  2JEU A;  4LR3 A;  3F7V C;  1F4N A;  3DXR B;  3ETQ A;  4PDR A;  1AR1 B;  3M7M X;  2XOK G;  5BMV A;  3FFQ A;  3EHB B;  2UXD O;  2CH7 A;  3KCX A;  4BW9 A;  2PZS A;  2OT5 A;  5GW7 A;  1AR5 A;  3WB1 A;  4NTY A;  3FYI B;  2IM9 A;  2LP7 A;  2JRI A;  4DYL A;  1R6N A;  4LF8 B;  5AG2 A;  3E89 A;  1T5E A;  2ZM6 B;  3S3X A;  4HBN A;  1GTO A;  2YSU B;  1YDX A;  3LSU A;  1H2N A;  2QEX V;  3CXC U;  1WP7 A;  4DV3 O;  3OTO O;  2YI8 A;  1XIL A;  4RUF A;  1M90 W;  4J80 A;  5IJ9 A;  5JCO A;  1YIJ V;  4W4L A;  4HAM A;  3WG7 B;  2HP8 A;  3CHX A;  2YXY A;  1I94 O;  4JF3 A;  4P30 A;  3CE2 A;  2VWK A;  5FPO A;  2OTL V;  2HLD G;  2R72 A;  1KKD A;  4DR5 O;  4JI7 O;  3CCM V;  2KQX A;  1K73 W;  4JI0 B;  5BR8 O;  5JJN B;  2ZE6 A;  1H2K A;  3N2K B;  3CXH F;  2WLN A;  4KHP B;  1G4Y B;  2EJ7 A;  1AI5 A;  2VS0 A;  1EZJ A;  3RYC A;  1RP3 B;  1AB3 A;  2IJJ A;  1IDS A;  2CGO A;  1GKF A;  2A0L A;  3I55 V;  3SGI A;  3CWB H;  2P4K A;  2Q0A A;  1GN6 A;  5DEC A;  1ZL8 A;  2CK3 G;  2Q7H A;  2UUB O;  1OCZ C;  1G1X B;  4X62 O;  1F23 A;  4O4J B;  3JD0 A;  1Y76 B;  3T1Y B;  1VAR A;  1QBZ A;  4D7S A;  2WLI B;  1SA0 B;  3W7S A;  4EFE A;  2AW9 A;  3F5W C;  1HNW O;  3MD0 A;  4I50 B;  3A2F A;  1BHB A;  1QLN A;  4X20 A;  1HR0 B;  4R50 A;  5B3S C;  3K58 A;  3B09 A;  1N0N A;  4K3A A;  1Q82 W;  1BGY H;  1JFF A;  4X64 B;  2E3C A;  4UCV A;  2QWQ B;  1XUQ A;  4PD4 F;  4HNA A;  1H38 A;  1B6Q A;  1KD1 W;  2DYR C;  2O57 A;  2FYU H;  4CS2 A;  5IYC O;  4DR3 B;  3I56 V;  4GX1 A;  4GYC B;  3ZHQ A;  3APQ A;  3RVY A;  4GKJ B;  4DV7 O;  1H2L A;  1L0L H;  1QLE B;  3T1H O;  2V7Q G;  4IYI A;  3RT3 C;  4QJF B;  2NN4 A;  2F93 B;  3LDC A;  3CCL V;  3UO2 A;  4JI1 O;  1NI8 A;  1J5E O;  4DR4 B;  3D3I A;  1ZTE A;  2CE4 A;  3LNN A;  2XAH A;  3ASN C;  1GO3 F;  1I0H A;  1IVS A;  3THO A;  2KB1 A;  3HKE B;  1NR1 A;  1Q6H A;  5IYZ A;  1HP8 A;  1E1Q G;  3W7U A;  1JOY A;  4DK1 A;  1M1K W;  1I7F A;  5ITZ A;  5JVD A;  4X1Y A;  3Q4H A;  5H2F Z;  3CRM A;  5LA6 B;  3BA8 A;  2H3O A;  2WLL B;  3JAM N;  5IY5 C;  2AHZ A;  1DF5 A;  5CBG A;  2RN9 A;  3WB2 A;  3H1J H;  3FAV B;  5CA0 A;  2AHY A;  4PV1 B;  1NS1 A;  2ZDI C;  3IC9 A;  5LHH A;  4FJC C;  3FX7 A;  3SPI A;  5CN0 A;  4J7J A;  2LJ2 A;  2DE0 X;  5H9C A;  4MVZ A;  1JJ2 U;  1FJG B;  3HKD B;  3ZMT A;  3T2M A;  1ORQ C;  3CRC A;  3SPG A;  5IJ0 A;  1PNK A;  1NJI W;  2BSK A;  3VQY A;  3UO3 A;  4WCE V;  4GZR B;  4KUM A;  1DTO A;  1F4M A;  3BVO A;  2H8P C;  2ZD9 A;  4Z1M G;  3UCS C;  2JGD A;  1SQX H;  3D3Q A;  4ZOL A;  1M56 B;  1Z5W A;  2NLJ C;  1NH2 B;  3QNE A;  1GH6 A;  3ZN1 A;  2IW5 A;  2PF4 E;  3L73 H;  2QGN A;  4DV6 O;  2KKW A;  1JVM A;  1SKV A;  3O9O A;  1H2S B;  1Y66 A;  5LXT B;  1L1F A;  4WFF A;  4FM0 A;  1XRE A;  3ETD A;  3VQX A;  1ZUQ A;  1BS3 A;  1SQB H;  1S3J A;  1DK1 A;  1RPR A;  4DV3 B;  4UB8 Z;  2JS3 A;  3GB7 C;  4O4I B;  3OTO B;  4WFB V;  3JCZ A;  4BAY A;  4FIP C;  2ZR3 A;  3RBZ A;  5CA1 B;  5CB4 A;  2XHB A;  1PM9 A;  4X65 O;  1I94 B;  1YJ9 V;  2RJZ A;  4PA9 A;  1VQK V;  1YJW V;  3CB2 A;  4LF7 O;  2M6Y A;  3ML0 A;  3GVM A;  4DR5 B;  4JI7 B;  5BR8 B;  2BTQ B;  3HR0 A;  3N2G B;  1X4T A;  1AP6 A;  1DLB A;  2E74 B;  2HJF C;  4DRX B;  4MTO A;  1P7B A;  1EBO A;  3CCJ V;  5EIB C;  2Q0O C;  2JEX A;  1CXZ B;  1R6K A;  1JR9 A;  4EB6 B;  5B1O A;  5KA6 A;  2WPD G;  3CCR V;  5GON A;  3ZHR A;  3C3T A;  4R6Z A;  3CJH A;  5LP6 C;  4ZI7 A;  1K5Q A;  4MTF A;  2UUB B;  3G80 A;  1LUV A;  1V9P A;  2OTJ V;  4X62 B;  2JJ1 G;  3B77 A;  2RMK B;  3APO A;  1XL6 A;  1QCE A;  3RWR D;  1O9H A;  3CP1 A;  5KX5 B;  4MVU A;  4CBC A;  1NZ6 A;  1SQF A;  2D2C B;  2Y0I A;  1HNW B;  1RM1 C;  4ABM A;  4BW5 A;  3K57 A;  3DSQ A;  4LF4 O;  2DW4 A;  1IBM O;  5B3S B;  1P4R A;  3JAR B;  4RQE A;  3ZHT A;  2Z0A A;  4X89 A;  1G6U A;  5J2T A;  4DUZ B;  4U7N A;  5FNV A;  2Z5U A;  2QTO A;  3P3N A;  2DYR B;  2YDE A;  2ADP A;  4FFK A;  4WBN A;  4DV7 B;  4F4L A;  2P4V A;  4J9Y B;  3T1H B;  1TVK A;  4IIJ B;  3K06 A;  1BMF G;  4NVP A;  4JI1 B;  2ZT9 B;  1NBM G;  1J5E B;  4MVR A;  4LFC O;  2YEV B;  3BPZ A;  4IHJ A;  1CEZ A;  1SQG A;  5JH7 A;  5JQG A;  4WFA V;  1OHH G;  3H1H H;  5B1N A;  4X1K B;  1AI7 A;  2XND G;  3E2E A;  4MT8 A;  3ASN B;  1ENV A;  4PHZ A;  3SPJ A;  4AI8 A;  3ABL C;  4FFB B;  5CMU A;  2DYS C;  3ZHU A;  2AZ2 A;  2A06 H;  5IYD O;  1MMM A;  1NR7 A;  2OIG A;  3SPH A;  4B7K A;  2CGN A;  1Y6X A;  1N8R W;  1E1R G;  2CTP A;  2QTS A;  3ABK C;  3T1C A;  3OAA G;  2PTM A;  1Q81 W;  3D36 A;  5EC1 C;  5KMG B;  1WPB A;  1QNM A;  1Y74 B;  3OR7 C;  1FXK B;  4H13 B;  3KKY A;  2QKA A;  1DGS A;  2EIN B;  2R9I A;  3OT7 A;  3C90 A;  3MHS C;  4MVO A;  3RYH A;  4JPR A;  2CTR A;  2JGU A;  4OXS A;  4WFH A;  3A0R A;  3K9A A;  2WWW A;  3DXR A;  3ZRW B;  5L3E A;  2EUL A;  2GSM B;  1IBK O;  1VF5 B;  4YIP A;  3NXS A;  4AQY O;  1VQ5 V;  4EEQ A;  4PEL A;  5CA3 A;  1VQP V;  4I0X B;  3CEI A;  3ZHV A;  1TAE A;  3QVN A;  1ZWI C;  4XDK A;  2UUA O;  1SES A;  3K08 A;  4DV6 B;  3JAL B;  4DR2 O;  3H1I H;  2OCC C;  1KB9 F;  2EIJ B;  4DUY O;  3AG3 B;  2C2A A;  1XNR O;  4B3R O;  4I5S A;  4GKJ O;  1B3Q A;  3QF7 A;  3JD1 A;  5H6R A;  3G6B A;  1MAB G;  4W4K A;  3RW0 A;  2DJV A;  4CC5 A;  4X65 B;  2LFS A;  1GMG A;  2OCH A;  5KHG A;  4LF7 B;  4L87 A;  3VQV A;  4MVQ A;  1H8E G;  5K1P A;  1YSC A;  3WU2 Z;  1F51 A;  4O4L B;  2V4D A;  2VRZ A;  2UXC O;  1TA8 A;  4R7C A;  1QU7 A;  2ZNI A;  5TIS Z;  1BQ0 A;  1IX9 A;  4K35 A;  5KAI Z;  1QVF U;  1KP3 A;  2YXH A;  2F1M A;  3E8H A;  1COW G;  3P32 A;  3ABU A;  2Q69 A;  3T4Z A;  1K5S A;  1L0N H;  1WB8 A;  3FB7 C;  2B5U A;  2P7T C;  4X66 O;  5FL7 G;  4CS3 A;  2YIB A;  4RQF A;  5LP6 B;  2X6B A;  4O4J A;  1HNZ B;  1Y76 A;  2M7W A;  2WLI A;  4H0L B;  3J81 N;  3HKC B;  1SZT A;  1SA0 A;  1W0J G;  5B1A C;  3OEH G;  2DN9 A;  2FKX A;  2E76 B;  1VQ7 V;  4P9O A;  3BAB A;  4UVC A;  1RM1 B;  2GTS A;  1M56 C;  1XMQ B;  4LF4 B;  3SYP A;  4NR1 A;  1IBM B;  4H44 B;  3U11 A;  1JCH A;  4O4H B;  2RQ6 A;  3IC7 A;  3QTC A;  4H37 A;  2Y4T A;  1OCC C;  4GCZ A;  2EJR A;  4TQD A;  3W7X A;  2IJI A;  1K92 A;  2DMX A;  1UFI A;  1SER A;  4UVB A;  2QM4 A;  4LFC B;  4JI3 O;  4JTA B;  2ZNJ A;  1S77 D;  3AG4 C;  2MK3 A;  2RNB A;  1YHQ V;  1FD9 A;  1FXV A;  3HB3 B;  3P30 A;  4RO2 A;  4JI5 O;  3SJC C;  2KSD A;  2Q5Z A;  2WAM A;  2ZR2 A;  4LFA O;  3HKE A;  1Q3E A;  2BCC H;  2WA4 A;  3EXA A;  2UXB O;  2ZE8 A;  2PI5 A;  3IJ4 A;  1IBL O;  4YXW G;  1NT2 B;  1PKX A;  3ABL B;  4U3F H;  5J2U A;  3BA9 A;  1SF9 A;  1WP8 A;  2DYS B;  1NQT A;  3OE7 G;  3FB5 C;  1XDC A;  3ZJZ A;  2WLL A;  3OFN G;  4DV2 O;  4P9P A;  2EX3 A;  1EN4 A;  2VQE O;  1KQS U;  5EBL C;  4FM1 A;  3ABK B;  1Z5V A;  1Q5O A;  3FAV A;  1VQ4 V;  1YJN V;  1MG1 A;  3UT5 B;  4D7T A;  2P5O A;  4I55 A;  2UU9 O;  1LNQ A;  4YHH O;  1V54 C;  4TQF A;  4JTD B;  3QO5 A;  2IH3 C;  3HKD A;  3BEH A;  5HFM A;  1M4U A;  1BE3 H;  3JAW A;  1K9M W;  4MW8 A;  4FMT A;  3OM3 B;  3QG5 A;  2FML A;  1YI2 V;  2PYL A;  1K4C C;  3AEI A;  4KL1 A;  4UV9 A;  1KKC A;  2EIL C;  3MDS A;  4XDJ A;  1IBK B;  3FKS G;  3CC4 V;  4AQY B;  3BHP A;  1BZK A;  3DGE A;  5EZY A;  1WJZ A;  3U10 A;  4YJ3 B;  2UUA B;  2UXN A;  3JAK A;  3ZBH A;  1W59 A;  3ZIA G;  3ZMS A;  4DR2 B;  4H33 A;  3E22 A;  5LXT A;  1WB7 A;  4G2K A;  4DUZ O;  3CME V;  1W0K G;  2B1G A;  2YI9 A;  4JAA A;  3ASO C;  2EIK C;  4FLW A;  3QO8 A;  4O2A A;  4DUY B;  3G67 A;  2OCC B;  1XNR B;  4B3R B;  5BMV B;  2DQ0 A;  4ZIB A;  2FL4 A;  2CH7 B;  2HR3 A;  2IU3 A;  3DC5 A;  2Q4P A;  4NTW A;  1QVG U;  3A0B Z;  4X1I B;  4UFZ A;  2N05 A;  1F7Y A;  2LW1 A;  1Q86 W;  3W7W A;  3E8G A;  2RDC A;  4CH3 A;  4PDM A;  2BTQ A;  1VMG A;  3N2G A;  1Y67 A;  2Y69 C;  1NKD A;  3W7T A;  4DRX A;  5LGU A;  1MSW D;  3JYC A;  2UXC B;  2W0F C;  3IFX A;  2QE7 G;  1B06 A;  2PGG A;  2BE3 A;  4EB6 A;  3I5D A;  5IJ9 B;  1ZX3 A;  1VF6 A;  2W6I G;  5C8Y B;  1PV0 A;  1YEW A;  2IJK A;  4QE7 A;  4X66 B;  1FXK C;  2B9Z A;  1VQN V;  5KLV H;  3L70 H;  2EIN C;  3VBB A;  4GX0 A;  1JJO A;  4B08 A;  2P22 C;  1JX9 A;  4BWA A;  1VQM V;  2NNU A;  3K5N A;  2A79 B;  3LSQ A;  4QIW F;  3L74 H; 
#chains in the Genus database with same CATH homology
 2DW4 A;  1QR8 A;  1P4R A;  2HG5 C;  3QO7 A;  5B3S B;  3OMI B;  4RQE A;  4EKW A;  3F7Y C;  4X89 A;  2X7R B;  3CPW U;  1S72 V;  4GX5 A;  4JTC B;  4PA7 A;  4U7N A;  5B1A B;  2Z5U A;  5EK0 A;  2WSS G;  5CBF A;  2QTO A;  1GM9 A;  2DYR B;  3SYO A;  1S76 D;  4XBF A;  2DQ3 A;  2DWD C;  4JYB A;  3FB8 C;  4F4L A;  3ETE A;  3E8F A;  4J9Y B;  5KUK A;  4TT3 G;  3CMA V;  4RUE A;  5IYB O;  3K06 A;  1BMF G;  1KC8 W;  1SET A;  5EC2 C;  1IXM A;  2IU0 A;  1GM7 A;  1NBM G;  5C93 A;  2BOB C;  4MVR A;  4G28 B;  2YEV B;  5B1B B;  3HPL C;  1CEZ A;  3H01 A;  4MTX A;  2EIJ C;  4WFA V;  5LGT A;  1OHH G;  3T4D A;  3AG3 C;  5B1N A;  5LGN A;  1AI7 A;  1K7D A;  1OCC B;  4LP8 A;  2XND G;  3E2E A;  4MT8 A;  3ASN B;  1S5H C;  1ENV A;  3B8N A;  3SPJ A;  4TWK A;  1KEC A;  2EZP A;  2QKS A;  4N21 A;  3ABL C;  1FFT B;  3PJS K;  5CMU A;  1PD3 A;  2X6C A;  4P2Z A;  2DYS C;  5IYD O;  2D3O W;  4DO2 A;  4GX2 A;  3CD6 V;  4J9Z B;  4PA4 A;  1NR7 A;  3SPH A;  3ZRX A;  2QA4 V;  2P90 A;  3EFF K;  3AG4 B;  4G27 B;  1N8R W;  4I9W A;  4MVM A;  3X2Q B;  3K03 A;  1AJP A;  1E1R G;  3ABK C;  2WLK A;  3LNM B;  3T1C A;  5LHG A;  5DN6 G;  1DF4 A;  3OAA G;  1Q81 W;  3D36 A;  5EC1 C;  1VQ9 V;  3K0G A;  1R3K C;  5LBQ A;  3OR7 C;  1E79 G;  1FXK B;  1AJN A;  2JEU A;  3F7V C;  1F4N A;  2EIN B;  3OR6 C;  2R9I A;  4PDR A;  1AR1 B;  3ZCC A;  3MHS C;  2XOK G;  4MVO A;  2JJ2 G;  4JPR A;  2XAS A;  1PNM A;  4R8C A;  3SYQ A;  3EHB B;  4OXS A;  4BIU A;  4WFH A;  3A0R A;  4HZ3 A;  4PA6 A;  3CC7 V;  4QPK A;  3K9A A;  1GK9 A;  2OT5 A;  5GW7 A;  5CBH A;  3CCQ V;  4RAI A;  5J9P C;  3FYI B;  2EIM B;  3LDE A;  2LP7 A;  2WWW A;  2ZDI A;  4PDV A;  3ZRW B;  5L3E A;  1R6N A;  2GSM B;  1AJQ A;  1V54 B;  3E89 A;  3NXS A;  5L3F A;  1VQ5 V;  4PEL A;  5CA3 A;  1VQP V;  1GTO A;  2YSU B;  5DM6 V;  2WLJ A;  1ZWI C;  2QEX V;  4XDK A;  3CXC U;  4TSF G;  1SES A;  3K08 A;  2X0L A;  1EFR G;  4QPJ A;  1I5Y A;  3LDD A;  3CCU V;  3WFV A;  5IDJ A;  4RUF A;  3ZRW A;  1I5X A;  2XAJ A;  2JDI G;  1NVP D;  1M90 W;  2EIL B;  1YIJ V;  2OCC C;  4HAM A;  3R65 A;  3WG7 B;  2DWE C;  3ZRS A;  4JF3 A;  4P30 A;  3KG2 A;  2EIJ B;  2Q68 A;  2QM7 A;  2C2A A;  3AG3 B;  4KFM A;  1OCO C;  2OTL V;  2HLD G;  3TET A;  1KKD A;  4I5S A;  1SRY A;  3CCM V;  1VQO V;  3JD1 A;  1K73 W;  2V1D A;  5H6R A;  2HKO A;  1MAB G;  3ABT A;  2EBO A;  2EZO A;  1ROP A;  3RW0 A;  1YTF D;  3ETG A;  1NVP B;  2WLN A;  2WLM A;  1G4Y B;  3K0D A;  2LFS A;  1GMG A;  1R73 A;  1AI5 A;  1EZJ A;  5L3C A;  4L87 A;  2GHY A;  2IJJ A;  4MVQ A;  3ASO B;  2EIK B;  1M57 B;  3BY6 A;  1H8E G;  3E86 A;  1GKF A;  1YSC A;  2LFR A;  1F51 A;  2A0L A;  3I55 V;  1V55 B;  5L3D A;  1YTF B;  3CCS V;  3ZRV A;  2CK3 G;  3TCU A;  2W6J G;  1Q7Y W;  1R3L C;  4R7C A;  1OZ0 A;  1R3J C;  1W2B U;  3OMA B;  1CPY A;  1OCZ C;  3AG2 B;  5KA5 A;  1QVF U;  1F23 A;  3JD0 A;  5E1A C;  1KP3 A;  3E8H A;  1ARO P;  1COW G;  3OEE G;  3P32 A;  4LCU C;  3STL C;  3ABU A;  2Q69 A;  5EBM C;  2F43 G;  1K5S A;  1QBZ A;  3T4Z A;  1AI6 A;  2WLI B;  3FB7 C;  2B5U A;  2P7T C;  2YEV A;  4FK5 C;  3CCV V;  3W7S A;  2Y69 B;  4JGS A;  5FL7 G;  4FPP A;  3F5W C;  1S0V A;  3MD0 A;  4RQF A;  3K79 A;  1BHB A;  1K97 A;  2X6B A;  1QLN A;  1HWY A;  4JAU A;  3ZN0 A;  4R50 A;  5B3S C;  3E83 A;  1Q82 W;  2M7W A;  2WLI A;  1SZT A;  1W0J G;  3AG1 B;  5B1A C;  3OEH G;  3STZ C;  1PL0 A;  1QR9 A;  1H38 A;  1B6Q A;  1KD1 W;  2DYR C;  1OCR B;  2JIZ G;  2HVK C;  4P9O A;  1VQ7 V;  3CC2 V;  4UVC A;  2UXX A;  3OW2 U;  1RM1 B;  3VOU A;  1M56 C;  1JPX A;  5IYC O;  3I56 V;  4GX1 A;  5LHI A;  3SYP A;  3RVY A;  4UUJ C;  2IH1 C;  3UM7 A;  1QLE B;  2X6A A;  2V7Q G;  4QJF B;  1FXK A;  3LDC A;  3CCL V;  1JCH A;  2ZQM A;  2HFE C;  3IC7 A;  4KP4 A;  2QM8 A;  3D3I A;  4H37 A;  2R9R B;  1OCC C;  4GCZ A;  2EJR A;  2XAH A;  1CP9 A;  3ASN C;  3W7X A;  3OUS A;  1GO3 F;  2IJI A;  1AI4 A;  1K92 A;  1SER A;  1K3E A;  2KB1 A;  1FXH A;  1NR1 A;  4UVB A;  2HVJ C;  1E1Q G;  3W7U A;  1JOY A;  4JTA B;  1H2G A;  1M1K W;  1S77 D;  1K4D C;  3AG4 C;  4GT1 A;  2MK3 A;  3K04 A;  4MVS A;  4N23 A;  4UV8 A;  1YHQ V;  4Q20 A;  3X2Q C;  1FXV A;  3HB3 B;  3P30 A;  1M9N A;  4RO2 A;  5BZB A;  3MHH C;  4CZZ A;  2WLL B;  3ABM C;  2WAM A;  2ZR2 A;  5IY5 C;  1OCZ B;  2AHZ A;  1DF5 A;  2Z3Y A;  5CBG A;  2B1I A;  1UJW B;  2PI5 A;  4ZKI A;  4YXW G;  5L3B A;  1PKX A;  3ABL B;  2AHY A;  1YIT V;  3K3W A;  2ZDI C;  2P6J A;  4DXW A;  5LHH A;  5KUM A;  4FJC C;  2DYS B;  3LUT B;  1VQ6 V;  1NQT A;  1THZ A;  3OE7 G;  3FB5 C;  3SPI A;  5CN0 A;  3SYC A;  3ZMV A;  4WF9 V;  3G71 V;  4MS2 A;  3ZJZ A;  2WLL A;  3OFN G;  5H9C A;  4MVZ A;  1JJ2 U;  3JD2 A;  4U7O A;  3CCE V;  4E2L A;  4P9P A;  1VQL V;  1KQS U;  1NH2 D;  3ZMT A;  3OGC C;  5EBL C;  3T2M A;  3ABK B;  1VQ4 V;  1ORQ C;  1YJN V;  2EIM C;  2ITC C;  3GWO A;  1FS0 G;  1MG1 A;  3SPG A;  1PNK A;  1NJI W;  2FTK A;  1LNQ A;  1V54 C;  4WCE V;  4JTD B;  1G8M A;  2ZXW C;  1J95 A;  3JD4 A;  3QO5 A;  4KUM A;  1DTO A;  1F4M A;  2IH3 C;  1WPX A;  2H8P C;  2XAG A;  2ZD9 A;  4Z1M G;  3BEH A;  3LSS A;  5HFM A;  3TK1 A;  1M56 B;  2NLJ C;  1NH2 B;  3QNE A;  4JAV A;  5H6Q A;  1K9M W;  4MW8 A;  4FMT A;  3OM3 B;  1YI2 V;  3ZN1 A;  2IW5 A;  4WFE A;  1K4C C;  2WLH A;  4BIZ A;  3AEI A;  4UV9 A;  2EIL C;  4QE9 A;  1JVM A;  5L3G A;  1Y66 A;  4XDJ A;  3FKS G;  3JD3 A;  3WG7 C;  3CC4 V;  4LC1 A;  2ATK C;  2JK5 C;  1L1F A;  4WFF A;  3ETD A;  4HYO A;  4UXN A;  4WFG A;  4X88 A;  3DGE A;  3UKM A;  1S3J A;  3ZMZ A;  2A9H A;  1RPR A;  1H8H G;  2UXN A;  4PDL A;  3GB7 C;  3ZIA G;  3ZMS A;  1Y4M A;  3G4S V;  4H33 A;  4WFB V;  3IGA C;  4LBE C;  3DTU B;  3JCZ A;  4BAY A;  4FIP C;  2ZR3 A;  1R3I C;  3RBZ A;  4G2K A;  3B8M A;  3CME V;  1W0K G;  4MTG A;  2B1G A;  3OUF A;  3ASO C;  1PNL A;  1M57 C;  2EIK C;  1K34 A;  3QO8 A;  1KP2 A;  1YJ9 V;  4PA9 A;  4UVA A;  1VQK V;  1YJW V;  4MSW C;  4MW3 A;  3ML0 A;  4ZBM A;  2OCC B;  1JQ0 A;  1V55 C;  3ABM B;  4QNH B;  2DQ0 A;  1OCO B;  5IY5 B;  2H94 A;  2HR3 A;  2IU3 A;  5B1B C;  2XAQ A;  1DLB A;  1QVG U;  1BL8 A;  2HJF C;  4MTO A;  1P7B A;  1EBO A;  4JAS A;  3CCJ V;  3FYE B;  2JEX A;  2XAF A;  2ITD C;  1R6K A;  3SPC A;  1Q86 W;  3AG2 C;  3E8G A;  3W7W A;  3FB6 C;  1XL4 A;  5B1O A;  3E8B A;  5KA6 A;  2WPD G;  4PDM A;  3CCR V;  2BOC C;  2PI4 A;  4ASU G;  2Y69 C;  1K33 A;  1NKD A;  5EBW C;  3W7T A;  5LGU A;  3G6E V;  1MSW D;  4R6Z A;  3JYC A;  3E35 A;  2W0F C;  2IJH A;  1K5Q A;  3IFX A;  1RPO A;  2QE7 G;  4MTF A;  1MOF A;  3SYA A;  1VQ8 V;  2OTJ V;  3M99 B;  2ZXW B;  2W6I G;  2JJ1 G;  3B77 A;  4JYC A;  1XL6 A;  2IJK A;  1K8A W;  3AG1 C;  3CYO A;  1QCE A;  4QE7 A;  3OMN B;  1GM8 A;  3CP1 A;  1FXK C;  3SJQ C;  4MVU A;  1BHA A;  4CBC A;  1OCR C;  1VQN V;  4PA3 A;  2EIN C;  3VBB A;  1RM1 C;  4GX0 A;  1WLE A;  3RVZ A;  2Q67 A;  4BW5 A;  1JX9 A;  2P67 A;  2Q6A A;  3ZMU A;  2NNU A;  1VQM V;  2A79 B;  3LSQ A;  4QIW F;  4XDL A;  2K1E A;  5HFL A;  1QLE C;  4X8A A;  2Y48 A;  1TUE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...