5H9CA

Crystal structure of the aslv fusion protein core
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
78
structure length
78
Chain Sequence
b'NLYFQGTANLTTSLLGDLLDDVTSIRHAVLQNRAAIDFLLLAHGHGCEDVAGMCSFNLSDQSESIQKKFQLMKEHVNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Envelope glycoprotein gp95
publication title Structural characterization of a fusion glycoprotein from a retrovirus that undergoes a hybrid 2-step entry mechanism.
pubmed doi rcsb
source organism Avian leukosis virus rsa
molecule tags Viral protein
total genus 31
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2015-12-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5h9cA00
2EZPA 4FK5C 5KA6A 1QR8A 3K9AA 5H9CA 4JGSA 1Y66A 3CYOA 1QCEA 3M99B 2EZOA 4FIPC 1SZTA 4JF3A 5KA5A 3P30A 4JPRA 1DLBA 1K33A 1JPXA 2LP7A 3CP1A 3H01A 3B8MA 1MOFA 3B77A 1F23A 2M7WA 4N23A 1Y4MA 1MG1A 3GWOA 3MHHC 3B8NA 2MK3A 4FJCC 1DF5A 1ENVA 3WFVA 1QR9A 2X7RB 5HFMA 1QBZA 3MHSC 4G2KA 5CMUA 1I5YA 2EBOA 1EBOA 1DF4A 1K34A 4N21A 5CN0A 5HFLA 2OT5A 4E2LA 1I5XA 1JQ0A 2P6JA
chains in the Genus database with same CATH superfamily
3PJSK 1QR8A 2ZE6A 5BZBA 1DGSA 3T2MA 1JVMA 5KMGB 4X1KB 4DV2O 1YDXA 1Q7YW 3CC2V 1NBMG 4JI2O 3E2EA 4MTGA 4MVMA 2GUZB 2KSDA 1WPXA 3CCUV 2A9HA 2P6JA 2BCCH 2F43G 4JI5O 3ABMB 4GT1A 3AK3A 2W6JG 3NXSA 1T5EA 3L74H 5J2TB 2F93B 1TUBB 5KUMA 1QLNA 1Q81W 3CJHB 2ZQMA 1BT8A 4LF7B 2EJRA 4UVCA 1HR0O 1AR4A 3ZHRA 1KBHA 4D7TA 3CRCA 2Q67A 3N2KA 3SPHA 2RDCA 5B1AC 4GKJO 1Q3EA 4IIJB 4X66B 1EN5A 3DC6A 3AG1C 4DW0A 2ITCC 4X20B 3CCLV 5FPRA 5BMVA 3OMIB 1K3EA 5D5QA 5KHJA 1GM9A 2QE7G 1Y76A 2M7WA 4J7JA 4KHPO 4JV5B 1K73W 4YY3O 3D3QA 1EFRG 2QM8A 2OT5A 1N36B 1QLEC 2F66C 2KKWA 3ZX6A 1Q90D 2Q0AA 1D5NA 2BE3A 1IBLB 3K5LA 4J11A 5D5PA 2YXHA 2WLIB 2AHYA 2P5OA 3N2GA 4WF9V 5K1XA 4BR6A 2LFSA 4JAVA 4X65O 5C8YB 3HR0A 4J41A 4D7SA 1K4DC 5L3CA 1BE3H 1PNLA 5BR8O 1WN7A 1GRJA 1IBMB 2CGOA 1HNXO 4JASA 5JQGA 4JI0B 4DV4O 2ITDC 4H33A 2BOBC 5CB4B 4JI1B 1EZVH 3SYAA 4JI3B 3A0RA 4GZRB 1YJWV 1O9HA 1ROPA 1E1QG 5CBHA 1LUVA 2LFRA 3W7TA 4LF8B 4OX9B 1BGYH 3ABKC 3FYEB 4BW9A 2BSKA 1SC5B 3RWRD 5LOVB 1VEWA 1JX9A 1S3JA 2EIJB 3TXQA 1XBLA 4IT5A 5H2FZ 4UVBA 1QBZA 5LP6B 3CC7V 5EIBD 2XAQA 4OPAA 1Y74A 1VQOV 1M4UA 2YSUB 4JYBA 4UCTA 3F5WC 4B3RO 4FIPC 4QIWF 1L1FA 2H3OA 4HZ3A 1LR1A 2XOKG 4TSFG 1IZ3A 1PL0A 1RM1C 4FPPA 3OT7A 4PI2A 2WA4A 2UXBO 3LSUA 2QWPB 1SQGA 5EZYA 3E89A 5IWAB 4JZGA 5IJ9B 2XT9A 5C93A 4LNUB 4MS2A 1JMKC 2CTRA 1YZBA 2ZE5A 4Z2WA 1N34O 1P4RA 4K8ZA 4X1KA 4B3TO 1FPOA 1VMGA 5JJNB 1VQ8V 3J80N 4GLXA 1Z5VA 2QWQB 5EYPA 4DV5B 2GBOA 4J9ZB 3K0GA 4GYCB 1UJWB 2VQEB 1WP7A 1TVKB 1AJPA 3F7VC 2MW2B 4JI4B 1I0HA 2VRZA 1XNRO 1URFA 5IJ0A 4DV3B 2DYRB 3P32A 1AI5A 3ICXA 4IIJA 5B1NA 3ZHVA 5H6QA 2ZNIA 3SYCA 3CCEV 1J95A 3ZMSA 4X20A 1SZXA 3RYIB 1XL6A 2NLJC 4X89A 2UUAO 4LF5O 2L35A 2Q9LA 5CMUA 3K5NA 5LMNO 4TUYB 5ITZA 4FLXA 1S72V 5DM6V 4JI6O 4JYYA 2LGWA 2UU9B 4P2ZA 3UT5B 3RYFB 4W4KA 1FJGB 1OCRC 1US6A 2UUBB 1PL4A 3BA9A 1NH2B 1I94B 4JF3A 2JS3A 4LCUC 5AG2A 1H2GA 1VP7A 3K57A 2DYSB 4X1IA 1YXBA 2B1IA 1TA8A 1R6KA 2JGUA 1SF9A 1K34A 2OTLV 5HFLA 3G80A 1I5XA 3A0HZ 2QR4A 3QTCA 4LC1A 4CC5A 4FK5C 4H44B 1R6NA 2JJ2G 4UV8A 5C8YA 4X64B 1RSOB 5CBGA 2YIDA 3ASNC 4O4IA 3X2QB 1QVFU 4U7OA 2ZT9B 4DR4B 4LFAB 3E8BA 5DN6G 1YHQV 3OMAB 3AG3C 2HLDG 5CB4A 3CHXA 4AILC 2EZPA 2CTQA 3ASOB 2F23A 1EM1A 3LUTB 3UKMA 1N4CA 5KAIZ 2Q69A 4FM2A 4K0KO 4YHHO 2E76B 3BEHA 3B8NA 2B1GA 1R3KC 2Q6AA 2N74A 4EEQA 1G8MA 2HFEC 1Z5WA 4WCEV 1KP2A 2IJJA 1OZ0A 5LP6A 1M56C 3RGBA 4I5SA 4R8CA 1BCCH 1P49A 4LWSA 1CXZB 5LMUO 1SQQH 3I5DA 3FX7A 1GN6A 1VARA 4NTXA 1NU1H 5FPOA 2V1DA 2Y0IA 2EULA 1X59A 3ZHTA 5K1PA 4NXNO 1AVMA 4PDLA 4I0XB 4CBCA 2L6LA 4X1YB 4LFCB 5CA3A 2ZKOA 1ORQC 3WB2A 5LYJA 1E1RG 4G28B 5KAFZ 4UFZA 3B77A 2WA3A 3G71V 4LP8A 3PN1A 1N33B 4FJCC 5KHIA 4J10A 1VQPV 5KX5B 4OPHA 5L3BA 4FLVA 2JEXA 3RT3C 4I7ZB 1AR1B 3SJQC 4BW5A 4RQFA 1M9NA 2LO1A 3ZMUA 1F7YA 2Q7GA 4O4LB 2XHBA 3OR7C 1AB3A 1GMGA 4DR2B 1WJZA 4I50A 1LNQA 4NKGB 3N2KB 4CZZA 4PA3A 2IU3A 4N23A 1U97A 2ZDIA 3AEIA 2GTSA 1TVKA 3ZCCA 1N32B 1PPJH 3ABTA 1R3JC 3CD6V 3M99B 4LF6B 4PA9A 2YXLA 1JJOA 2CAZC 2LW1A 1R1BA 1Y6XA 5LGTA 2YC0A 5B1AB 2P06A 1RPOA 1B6QA 2Z5UA 5B66Z 1UFIA 1YITV 4G2KA 3H1IH 3RYIA 5KLVH 1IX9A 2CH7B 4QPJA 3N27A 2EIKC 5E79Z 3WU2Z 3ZRVA 5DECA 3QO7A 4TUYA 3VBBA 3VQWA 3QF7A 5F2VO 3MAQA 1IBKO 3UT5A 3RYFA 3N2GB 3RYCA 1QLEB 1XMQB 3K0DA 3THOA 3BAAA 2A06H 2XASA 1ZL8A 4ZIBA 1NTZH 5FNVA 4JI2B 5JQGB 2ODMA 1J5EB 4PHZA 4B3SB 3DSQA 4DV0B 2IU0A 1S77D 2ZM6O 1RSOA 3SR2C 1AROP 3BPZA 1HR0B 2HP8A 1QVGU 2Y69C 5JVDA 3QNEA 1R73A 3HKDB 4PD4F 2GV9A 3F5TA 5TISZ 1NKDA 4ABMA 4ASUG 2Q5ZA 3SYOA 1BS3A 1WPBA 4TWKA 3ML0A 3P3NA 1WA8A 1V55C 3MHHC 1AR5A 1W0JG 1OCZC 3MHSC 3CXCU 4DYLA 1Y74B 3JYCA 3JD4A 3ABKB 4Q6GA 4KL1A 3RFRA 4OXSA 5KA6A 3DXRB 4YY3B 4DV6B 3KZIZ 1K5SA 5CA0A 2DOSA 4DUZO 2FMLA 1DK1A 2HHHO 4TV8A 1SERA 3SGIA 3CP1A 2V4DA 3E86A 3KKYA 1YI2V 3E8HA 1BMFG 1VQKV 1MABG 4J9YB 2XUMA 1NR7A 2NNUA 1VQNV 4LH7A 1VQ9V 2K1EA 2ZR2A 4X62O 1YJNV 1I7FA 4UV9A 4I0XA 3CXHF 4UCUA 4X1YA 1Q43A 1IXBA 2HJFC 1FKAO 2P67A 1HNXB 3LDEA 1ZLZA 1QNMA 5EYPB 3BABA 1HWYA 1NJIW 2RMKB 3K5OA 5L3FA 4K3AA 5KX5A 1N8RW 4GX0A 4O2BB 2UXXA 3KG2A 4NVPA 4U3JB 3UM7A 4O4LA 1YSCA 2RJZA 2ZINA 1OCOC 2QM4A 4BWAA 5IJ0B 2HVJC 1JOYA 2RN9A 2Z0AA 3SYQA 4O4JA 3S3WA 4WFGA 4JYAB 4TV9A 3C90A 1SQFA 4DV1B 2YDEA 1COWG 1WNSA 4XDKA 3ZN1A 3VQXA 4WBNB 4LF9O 5IE9A 4ICGA 3JALB 4J7ZA 3H1HH 4B3MO 5ITZB 1KC8W 3T4DA 4UVAA 4B3RB 4FZ0A 5HFMA 1R6TA 3RYHA 4NR1A 4AQYO 4FLWA 2UUCB 2FYUH 2VWJA 5KUKA 3OEHG 4BIZA 4MSWC 2CH7A 4DR5O 3OGCC 1OJHA 2Y4TA 2AZ2A 4X1IB 3D36C 3ETQA 2UXCB 1KECA 1XMOO 3OTOO 1LUWA 4LFBO 5EBWC 3ZRXA 3BFRA 3CRRA 4PELA 3ZMTA 1OCRB 4CS3A 1YF2A 2XTAA 1SA0A 3RVZA 2OCCC 1XNQO 1H8HG 2HVKC 4CH4A 3VQVA 4O4IB 3HB3B 3JCZA 4DXWA 2UXDO 1GN2A 1IXMA 3WFVA 3SPGA 5IDJA 1PP9H 2HJDA 1SQBH 3HKCA 2Q4PA 3L72H 4U7NA 2UXNA 5GW7A 2ZXWC 1W2BU 5IY5C 2WAMA 1HNWB 3DTUB 3B2EE 4DR6B 3G67A 1TGOA 2P22C 1HP8A 3AG3B 3HKDA 1FXKC 3ETDA 4JTAB 3B40A 2E75B 4B7KA 1FXVA 1M1KW 2FTKA 1F4MA 1HNZB 1ZTEA 2C2AA 4DK1A 2E5LB 4LF7O 3ZHSA 2F4VB 4CH5A 2EX3A 4LWSB 5LMNB 1NQTA 3TXSA 3BRCA 1Q82W 1M57C 2JJ1G 1FXKA 4PDVA 3DXRA 4DV7B 3LSSA 2OYQA 1JPXA 4X66O 3DGEA 2MK3A 2EILC 1M56B 5LHIA 2K9PA 1A32A 1EN6A 3FFQA 3HKEA 1VQ7V 4MVQA 3OE7G 5LYJB 5L3GA 2CUGA 1KP3A 4OGQB 2KG7B 1QQCA 1NT2B 5E1AC 1DLBA 2CK3G 4ZKIA 1N36O 1KQSU 1MOFA 4GCZA 2W6IG 1XUQA 4RAIA 2LJ2A 3OUSA 2WSSG 4UB8Z 1IBLO 3K79A 2NR5A 1VF6C 4IYIA 4I50B 3W7XA 1OCCC 2P90A 3CE2A 1DTOA 1PM9A 4JI8B 1AP6A 4O2BA 4DR1B 4U3JA 1SQVH 1EZJA 4PA6A 4AHCA 1IBMO 1KB9F 2YIBD 3KCXA 4E2LA 3E83A 2QM7A 2ETNA 2GTAA 2VQFB 3IFXA 4XDLA 4JI0O 3ZRSA 1W0KG 2ZE7A 2D3OW 4JI3O 1VQ4V 5JWPA 4JPRA 1AI7A 1N0JA 4WBNA 3I55V 5GONB 3CCQV 4YJ2B 3JALA 2IJIA 2HR3A 4FLUA 1KU9A 1PNMA 3EHBB 4MTFA 4Z1MG 1WB7A 4LF8O 4OX9O 3WG7C 3ZS8C 2YIAA 4X8AA 2R9RB 1Q6UA 4AI8A 1HDJA 3RYCB 2QA4V 2R70A 2CGNA 1L0NH 2DW4A 3OW2U 2EIKB 1QU7A 2YEVA 4B7EA 3LNMB 4XBFA 4B08A 2Q7EA 1ZL8B 1E79G 1V9PA 4PDMA 5FNVB 4DR7B 3O9OA 2P4KA 2WLMA 1FAFA 2VS0A 5EIBC 5CBFA 5EC2C 3BCCH 3FD9A 1Z2GA 5L3EA 1WB8A 3B09A 4QJFB 1TUEB 3JASB 2PGGA 5J2UA 2AGAA 2RQ6A 5JVDB 5IWAO 4WFAV 2JRIA 4TT3G 2EIMC 1NVPB 1H2NA 2BOCC 3L9DA 4EB6A 1Y66A 5EC1C 1WA8B 1K8AW 3P30A 1GM8A 3SPJA 1NH2D 5JH7A 2DMXA 4DV5O 4GX1A 3AG4C 3IC7A 4ZBMA 2VWKA 2VQEO 5CA0B 4CS4A 4XDJA 3G4SV 1D5AA 4TQDA 4TV8B 1XQ8A 5LA6A 1GO3F 1V55B 2E3CA 2ZIOA 4JI4O 1OCZB 3SJCC 1K5QA 2DJVA 3T1HB 3CCJV 3LNNA 4FLZA 4DV3O 5B3SB 1NI8A 3JD0A 3GWKC 2FKXA 3A2FA 3ZHUA 1HW7A 4NXMB 3LDCA 5A2QN 2YIBA 2PYJA 3HKBB 3HPLC 3K9AA 4LF4B 1NVPD 2YUAA 3OGIB 5H5NA 2GSMB 1O9GA 3AG2B 4I4TA 2WLNA 1H8EG 3MDSA 4GX2A 2QTSA 5LBQA 3E8FA 2KG7A 2UU9O 3GWOA 4IHJB 1FJGO 2UUBO 4CS2A 2XNDG 3ZN0A 1I94O 2KQXA 3RN4A 1K4CC 3R66A 1BHBA 3H1KH 3SPIA 4X88A 1QCEA 4DK0A 3C3SA 3CC4V 1GN4A 3UQ8A 4GKKB 1K92A 1KYOF 4MVRA 4P30A 4O4JB 1AILA 1Q6HA 1SKVA 1G1XB 4TV9B 3ZRWA 4FM0A 2ZIMA 1G4YB 3L70H 4X64O 2YS8A 1B06A 3JSNA 1VQ5V 1OCOB 4DUYB 3AK2A 3F7YC 1L8DA 1JJ2U 4LFAO 5FLXN 3T1YO 2PTMA 2OIEA 3RYHB 2X6BA 1YTFB 2HHHB 3AG1B 3BHPA 4FM1A 4PA4A 4DR3O 2P7TC 3CS5A 2AXTZ 5CN0A 3U11A 3JCUZ 5GONA 4YJ2A 3OAAG 3WB1A 5DEDA 3CRMA 1KKCA 3JD3A 4O2AA 2ZR3A 4P9PA 2GDSA 4UUJC 1S5JA 3FKSG 1SA0B 1MA1A 4U3FH 2IH3C 2R72A 3M8AA 3E8GA 3ZHQA 4HAMA 3FAVB 2DYSC 4DV2B 1Q6IA 4MVZA 1XL4A 2OCHA 1KD1W 5H9CA 4JTCB 2DQ3A 2ARHA 2JEUA 3CMEV 4BIUA 4JI5B 2OCCB 5JCOC 1S5LZ 2DE0X 2HG5C 1YTFD 3O65A 3HKCB 1GN3A 2E74B 4LFCO 3JASA 3OEEG 3OUFA 1FFXB 1WLEA 4L87A 4GKJB 4H0LB 1N33O 5JCOA 4A5UB 1IDSA 3CWBH 5IYBO 1RPRA 4QGPA 3H9VA 2QDOA 3FB5C 5KHKA 2ZXWB 5IY5B 1EBOA 4DR2O 4TOIA 1L0LH 3CEIA 2PY5A 1FXKB 2QSAA 4KHPB 1BQZA 2A0LA 4PA7A 2Q0OC 1NR1A 4J42A 2ZNJA 2EINC 3ZBHA 4WFBV 1SRYA 4DRXB 3MD0A 1VIBA 2QWNB 1F4NA 4FZ1A 2Y0PA 5BXZA 1MSDA 4LF6O 3HKEB 1GAXA 1M57B 2Z3YA 2JIZG 1XMOB 4JI7O 3ZIAG 1K9MW 2WLLB 2KB1A 1KUQA 1PV0A 1BQ0A 3EXAA 2EILB 4H37A 4X65B 4K8XA 3HKBA 1RM1B 2LGQA 5BR8B 4LH6A 1YVWA 3JARA 1FD9A 1DF5A 2UXDB 4DV4B 1YJ9V 1NZ6A 1ZX3A 1ZAUA 2IJKA 4IHJA 1XHZA 4O4HA 2JGDB 3J7AU 1XMQO 5LHGA 2RCVA 1M93A 2IH1C 1K7DA 1SZTA 4GX5A 4R7CA 3JATA 3G6EV 1ENVA 1AI6A 1OCCB 2N05A 1RFYA 1VQ6V 3ZMVA 1J5EO 1MZEA 1BZKA 3H1JH 1AJQA 1IVSA 4D6TH 4B3SO 1GTOA 1WP8A 4MVUA 4DV0O 1XI1A 2QKCA 4FMTA 3D8CA 4MW8A 4NYKA 4RUEA 3TCUA 4L8JA 2Q68A 3JAWB 3K08A 2P4VA 4J7KA 4UCRA 2FB5A 3RVYA 2Y4UA 1H2LA 1EN4A 2WLKA 2Y48A 1QHTA 3STZC 5IYZA 4HNAA 1F51A 4C7UA 3IGAC 1SQXH 1JCHA 2CDYA 4MT8A 4ZHQB 2UXBB 3GVMA 1MMMA 2YEVB 3T4ZA 3I56V 3CCRV 1N0NA 3WG7B 2IW5A 4DV6O 3QVNA 4P9OA 2EJ7A 3JAMN 5KHHA 1SETA 1KKDA 3DC5A 4G27B 1N34B 2X0LA 1NTKH 3ETGA 3FB6C 4X9QA 1SESA 5B5EZ 4B3TB 1M90W 3FAVA 3D36A 1JA8A 3CB2A 3QO5A 5A9GA 4LBEC 5J2UB 3T1CA 2DWDC 1NS1A 2X6CA 3SDLA 3SJBC 1I08A 1AP5A 4FFBB 1VF5B 3CSXA 1DF4A 1FS0G 2R9IA 3ABLC 1V54C 3ASNB 3Q4HB 4EB6B 3K03A 3CX5F 1B3QA 1XNRB 4EFBA 5JH7B 3TGUH 3ZMZA 1FFXA 3RBZA 3A8TA 3TK1A 3APQA 2EIMB 2HEPA 1ZSPA 3L71H 5IT9N 1R3IC 4IYHA 5LGNA 1CPYA 1BHAA 2ADQB 1FFTB 3FB7C 5LA6B 3EFFK 2UUAB 1PKXA 4LF5B 3E22A 1XEQA 4TQFA 4HYOA 3JSLA 4JI6B 3BY6A 3AG4B 1YEWA 2XAHA 2O57A 4JYAO 1XOUA 4MW3A 4DV1O 4UCVA 1JFFB 4YXWG 4ZI7B 4DRXA 1MSWD 1RP3B 3D3IA 4WFFA 5B1BC 4WFHA 4I4TB 2ILMA 3CYOA 3J81N 2WLLA 3TJTA 1FXHA 4JV5O 2BTOA 4ZOLB 2PUSA 4PDRA 5JJEB 5B1OA 4I55A 2UUCO 4PJ0Z 3K06A 1XHXA 2RNBA 1XREA 2UXCO 3JAKA 4JGSA 1XDCA 5EBLC 3CPWU 2A3QA 2JGDA 3BA8A 3W7UA 3ZRWB 3W7SA 3ABMC 2YXYA 4FFKA 1IURA 5KMGA 4BIOA 1Q5OA 1VF6A 2PF4E 4DO2A 2Q73A 4BAYA 4K0KB 4YHHB 1H2KA 2QJ1A 1GKFA 2GUZA 1OHHG 4R50A 2ZE8A 4EKWA 4JI1O 2EZOA 1PNKA 5J2TA 4NTYA 2QKAA 4HBNA 4F6RB 1TUBA 3B8MA 3CJHA 2W0XA 4UB6Z 3ZJZA 3G6BA 5LMUB 1OV9A 3L73H 1HNWO 3L75H 4DR6O 2ZCEA 3JAWA 1BSMA 4O2AB 4KUMA 4FVMA 2A7WA 4F6EA 4H13B 3FB8C 3H1LH 4MVSA 1K97A 2WPDG 3B4SA 1K33A 2CTWA 1HNZO 4NXNB 4MTOA 2E5LO 4ZHQA 5EBMC 1Y4MA 2F4VO 2BTQB 3LSQA 2IBZH 3QG5A 3EVKA 4FLYA 2OIGA 4DV7O 2LW7A 2F1MA 1CEZA 4FLTA 5IYDO 1YIJV 1KMIZ 1PD3A 3K59A 4MTXA 2PZSA 1ZUQA 2WLIA 3CMAV 1VQLV 1BL8A 3K9SA 3BVOA 1M5IA 2YICA 4FFBA 4PV1B 1GH6A 1P7BA 3OM3B 2JVDA 4JTDB 4E4EA 3Q4HA 5BY1A 2Q7HA 5CA1B 4LR3A 3UO2A 4UCSA 2Y69B 3T1YB 4JAAA 2JDIG 3U10A 1W59A 4CH6A 4NB5A 2AZ0A 4JAUA 3JD2A 3K58A 2M6YA 3IAYA 3SYPA 4JI8O 4DR3B 2EIJC 2B9ZA 2AW9A 4MVOA 2Q8VA 5LP6C 3ETEA 5J9PC 4DR1O 2ADPA 3OTFA 3SPCA 1S76D 2ATKC 2QGNA 3VOUA 3AG7A 4KXRA 4YJ3B 3NR7A 2VQFO 1MG1A 2QWRB 5LOVA 2QEXV 1QR9A 1IBKB 1I5YA 4YIPA 5LL6Y 2EINB 1JFFA 1JQ0A 2QWOB 3M7MX 4ZI7A 2YI9A 1ZWIC 3RW0A 3E35A 5LXTB 2DN9A 3JARB 3CCMV 2R9AA 2PI4A 4RO2A 5LHHA 1GM7A 2V7QG 2QTOA 4K35A 4ZOLA 2OWOA 5JJJB 3UO3A 4O4HB 2HKOA 2G38A 2XAFA 3JD1A 2ZM6B 1MZFA 3STLC 2A79B 3UCSC 2XAJA 1GK9A 1R3LC 3SJAC 3IC9A 3K5MA 3R65A 2NN4A 3JATB 5L3DA 2YI8A 3ABUA 4DR7O 5IJ9A 4I9WA 4LNUA 4EFEA 3P3PA 2AHZA 5H6RA 4KFMA 1NTMH 2DQ0A 2EBOA 2ZDIC 3CCVV 2IJHA 4IL6Z 4PI0A 1XILA 5LGUA 1WAZA 1G6UA 1JR9A 2OTJV 4QE7A 3U0ZA 1CP9A 3LDDA 4DR4O 2DYRC 2DWEC 1D2DA 1S5HC 2JS5A 4Q20A 4DUZB 3AK1A 2X7RB 4F6RA 2CE4A 5IYZB 1YCIA 4HNAB 5BMVB 4WFEA 1MNGA 1SS3A 2WLJA 4Z1VA 4JI7B 1Y76B 4JZ2A 4F4LA 3H01A 1TAEA 1THZA 1H2SB 2X6AA 4X62B 4KP4A 3WB0A 4IGGA 3OFNG 1Y67A 2FL4A 1AI4A 3T1HO 2BTQA 3TETA 1P7GA 1Q8IA 4J80A 5GTIZ 4CH3A 4NXMO 1VQMV 2LP7A 3KCYA 1U96A 4QE9A 3FYIB 1X4TA 4LF4O 3X2QC 4UXNA 4CC6A 2B5UA 1VF7A 2F95B 2WLHA 2N04A 4YIOA 3K3WA 1H38A 2W0FC 3ABLB 3OMNB 1V54B 4LF9B 3ASOC 3A0BZ 2D2CB 4JYCA 2IM9A 5CA1A 1UPGA 3E22B 4NTWA 4B3MB 1FYJA 1B04A 5FL7G 4I9QA 4GKKO 3GB7C 2BSKB 3ZEDA 3OD4A 5KHGA 3CRAA 4AQYB 1N32O 5EK0A 1F23A 2H94A 2JK5C 3S3XA 4DW1A 4DR5B 2QKSA 4R6ZA 2XAGA 1H2MA 3APOA 4W4LA 3CCSV 2PYLA 3CRQA 4DUYO 4N21A 4YJ3A 4GUNA 4QPKA 3OTOB 2GHYA 5B3SC 2WWWA 4RUFA 4LFBB 3W7WA 3QO8A 3VQYA 2LQTA 2H8PC 4I55B 3OR6C 5KA5A 2PI5A 1XNQB 3IJ4A 5IYCO 5LXTA 5B1BB 1Q86W 4RQEA 2CTPA 2ZD9A 4RWUA 1S0VA 3AG2C 3K04A 4UCOA 1SQPH 3JAKB 3C3TA 5EZYB 1P84F 5GTHZ 4QNHB 1AJNA
chains in the Genus database with same CATH topology
1PKXA 3PJSK 1QR8A 4PA9A 5BZBA 5CBFA 5EC2C 3T2MA 4HYOA 1JVMA 5L3EA 5LGTA 3BY6A 3AG4B 5B1AB 4QJFB 2XAHA 1TUEB 4MW3A 1Q7YW 1RPOA 1B6QA 3CC2V 2Z5UA 1NBMG 4YXWG 3E2EA 4MTGA 4MVMA 4G2KA 1YITV 4WFAV 1WPXA 1MSWD 3D3IA 3CCUV 4QPJA 2A9HA 4WFFA 4TT3G 5B1BC 2P6JA 2F43G 2EIMC 2EIKC 3ZRVA 3ABMB 4GT1A 1NVPB 4WFHA 3QO7A 2W6JG 3NXSA 3VBBA 2BOCC 1Y66A 3CYOA 5EC1C 2WLLA 5KUMA 1QLNA 1Q81W 1K8AW 2ZQMA 1FXHA 3P30A 1GM8A 2EJRA 4UVCA 3SPJA 4PDRA 1NH2D 1QLEB 5B1OA 4GX1A 2Q67A 3K06A 3K0DA 3SPHA 3AG4C 5B1AC 3IC7A 4ZBMA 2XASA 3AG1C 4XDJA 3G4SV 2ITCC 1GO3F 3CCLV 1V55B 4JGSA 1OCZB 3OMIB 5EBLC 3CPWU 1K5QA 1K3EA 3W7UA 3CCJV 3ZRWB 3W7SA 3ABMC 2IU0A 5B3SB 1S77D 3JD0A 1GM9A 2QE7G 2M7WA 1K73W 1AROP 4DO2A 1EFRG 4BAYA 2QM8A 1QVGU 2OT5A 1GKFA 3LDCA 1QLEC 2Y69C 3HPLC 3QNEA 1OHHG 4R50A 3K9AA 1R73A 1NVPD 4EKWA 1NKDA 2GSMB 2EZOA 4ASUG 3AG2B 3SYOA 1PNKA 2WLNA 1H8EG 4GX2A 4TWKA 3ML0A 2WLIB 5LBQA 3B8MA 3E8FA 2AHYA 1V55C 3GWOA 3MHHC 1W0JG 1OCZC 4WF9V 3MHSC 3CXCU 3ZJZA 2XNDG 2LFSA 3JYCA 3JD4A 4JAVA 3ZN0A 3ABKB 1K4CC 4OXSA 1K4DC 5L3CA 1BHBA 5KA6A 3SPIA 1K5SA 1PNLA 4X88A 4KUMA 1QCEA 3FB8C 4JASA 4MVSA 1K97A 1SERA 2WPDG 1K33A 3CC4V 3CP1A 1K92A 4MTOA 2ITDC 4MVRA 4P30A 5EBMC 3E86A 1Y4MA 4H33A 2BOBC 1YI2V 3E8HA 3SYAA 1BMFG 3ZRWA 3A0RA 1VQKV 1MABG 3LSQA 4J9YB 1G4YB 1NR7A 2NNUA 1YJWV 1VQNV 1ROPA 1E1QG 1VQ9V 2K1EA 1VQ5V 5CBHA 1CEZA 2ZR2A 1OCOB 3F7YC 2LFRA 3W7TA 1JJ2U 1YJNV 4UV9A 5IYDO 3ABKC 3FYEB 1YIJV 2X6BA 1YTFB 1PD3A 1JX9A 2HJFC 4MTXA 1S3JA 2EIJB 2P67A 3AG1B 4PA4A 4UVBA 2P7TC 1QBZA 2WLIA 3LDEA 3CMAV 3CC7V 1VQLV 5CN0A 1BL8A 3OAAG 1HWYA 1NJIW 2XAQA 5L3FA 1VQOV 1P7BA 2YSUB 3OM3B 4JYBA 3F5WC 4JTDB 1N8RW 4GX0A 3JD3A 4FIPC 2UXXA 3KG2A 4QIWF 2ZR3A 3UM7A 4P9PA 4UUJC 1L1FA 3FKSG 1YSCA 1OCOC 2Y69B 2JDIG 4HZ3A 2HVJC 2XOKG 1JOYA 4TSFG 2IH3C 1PL0A 3E8GA 3SYQA 4FPPA 1RM1C 4HAMA 4WFGA 2DYSC 4JAUA 4MVZA 3JD2A 1COWG 3SYPA 2EIJC 4XDKA 1XL4A 3ZN1A 3E89A 1KD1W 4MVOA 5H9CA 3ETEA 5J9PC 4JTCB 2DQ3A 2JEUA 3SPCA 5C93A 1S76D 2ATKC 3CMEV 4MS2A 3VOUA 4BIUA 2OCCB 1KC8W 1P4RA 3T4DA 2HG5C 1MG1A 4UVAA 1YTFD 5HFMA 2QEXV 1QR9A 1I5YA 1VQ8V 2EINB 1JQ0A 3OEEG 3OUFA 4J9ZB 5KUKA 3OEHG 1WLEA 4L87A 3K0GA 4BIZA 4MSWC 1ZWIC 3RW0A 3E35A 3OGCC 1UJWB 3CCMV 1KECA 2PI4A 4RO2A 5IYBO 1RPRA 1GM7A 5LHHA 1AJPA 5EBWC 3F7VC 3ZRXA 3FB5C 2V7QG 2QTOA 4PELA 3ZMTA 1OCRB 2ZXWB 5IY5B 1EBOA 2HKOA 3JD1A 2XAFA 3RVZA 2DYRB 2OCCC 1H8HG 2HVKC 3STLC 1FXKB 2A79B 3P32A 2XAJA 1AI5A 2A0LA 1GK9A 4PA7A 5B1NA 1R3LC 5H6QA 3R65A 5L3DA 1NR1A 3HB3B 3SYCA 3ABUA 2EINC 3JCZA 4DXWA 4WFBV 3CCEV 1J95A 1SRYA 3ZMSA 3MD0A 1XL6A 2NLJC 4X89A 1F4NA 4I9WA 1IXMA 2AHZA 5H6RA 4KFMA 3WFVA 2DQ0A 5CMUA 3SPGA 5IDJA 1M57B 2EBOA 2JIZG 2ZDIC 2Z3YA 3CCVV 2IJHA 5DM6V 1S72V 3ZIAG 1K9MW 2WLLB 2KB1A 5LGUA 4P2ZA 4U7NA 2UXNA 1OCRC 5GW7A 2ZXWC 1W2BU 2OTJV 4QE7A 5IY5C 2EILB 2WAMA 4H37A 1CP9A 3LDDA 1NH2B 3DTUB 4JF3A 2DYRC 4LCUC 2DWEC 1H2GA 1RM1B 3AG3B 1S5HC 1FXKC 3ETDA 2DYSB 2B1IA 4JTAB 4Q20A 1DF5A 1R6KA 2X7RB 1FXVA 1M1KW 2FTKA 1K34A 1F4MA 2OTLV 1YJ9V 5HFLA 2C2AA 1I5XA 2IJKA 4LC1A 4WFEA 4FK5C 2WLJA 1R6NA 2JJ2G 1NQTA 5LHGA 1Q82W 4UV8A 1M57C 2JJ1G 2IH1C 1FXKA 4PDVA 1K7DA 5CBGA 1SZTA 3ASNC 3LSSA 4GX5A 1JPXA 3X2QB 1QVFU 4U7OA 4F4LA 3H01A 4R7CA 3G6EV 1THZA 3DGEA 2X6AA 2MK3A 4KP4A 2EILC 1ENVA 1M56B 3E8BA 1AI6A 1OCCB 5DN6G 1YHQV 5LHIA 3OMAB 1VQ6V 3OFNG 3ZMVA 3AG3C 2HLDG 1AJQA 1GTOA 4MVUA 1AI4A 2EZPA 1VQ7V 3TETA 4MVQA 3ASOB 3OE7G 5L3GA 4FMTA 1KP3A 3LUTB 4MW8A 3UKMA 2Q69A 5E1AC 1DLBA 1VQMV 2CK3G 4RUEA 2LP7A 4ZKIA 3TCUA 1KQSU 1MOFA 4GCZA 3BEHA 2W6IG 4QE9A 3B8NA 2Q68A 4RAIA 3FYIB 2B1GA 1R3KC 3K08A 2Q6AA 3OUSA 2WSSG 3K79A 3X2QC 4UXNA 1G8MA 2HFEC 3RVYA 2B5UA 2Y48A 2WLKA 2WLHA 4WCEV 1KP2A 3STZC 3K3WA 2IJJA 1OZ0A 1M56C 3W7XA 1F51A 1OCCC 1H38A 2W0FC 3IGAC 1JCHA 4MT8A 4I5SA 4R8CA 3I56V 3T4ZA 2P90A 2YEVB 1DTOA 3CCRV 3ABLB 3OMNB 3WG7B 1V54B 2IW5A 3ASOC 4JYCA 4P9OA 1SETA 1KKDA 1EZJA 4PA6A 4G27B 5FL7G 4E2LA 3E83A 2QM7A 2V1DA 3IFXA 2X0LA 4XDLA 3ZRSA 3ETGA 4PDLA 3FB6C 1W0KG 1SESA 3GB7C 4CBCA 1M90W 3D36A 5CA3A 2D3OW 1VQ4V 3QO5A 1ORQC 4LBEC 4JPRA 1AI7A 1E1RG 4G28B 2DWDC 3T1CA 3I55V 3B77A 1F23A 2H94A 2JK5C 4LP8A 5EK0A 2IJIA 3G71V 3CCQV 2HR3A 2X6CA 2QKSA 4FJCC 2XAGA 4R6ZA 1PNMA 3CCSV 3EHBB 4N21A 1DF4A 4MTFA 1FS0G 4QPKA 2R9IA 4Z1MG 1VQPV 2GHYA 3ABLC 2WWWA 5B3SC 4RUFA 3WG7C 5L3BA 1V54C 3W7WA 3ASNB 3QO8A 2JEXA 4X8AA 3K03A 1AR1B 3SJQC 4BW5A 4RQFA 1M9NA 2H8PC 3ZMUA 2R9RB 3OR7C 1GMGA 3OR6C 3ZMZA 5KA5A 2QA4V 2PI5A 1LNQA 3RBZA 5IYCO 3TK1A 2DW4A 4CZZA 4PA3A 5B1BB 4RQEA 3OW2U 1Q86W 2EIMB 2EIKB 2IU3A 2YEVA 4N23A 2ZD9A 2ZDIA 1R3IC 1S0VA 3AG2C 3AEIA 1CPYA 3K04A 3LNMB 4XBFA 5LGNA 1BHAA 1E79G 4PDMA 3ZCCA 1FFTB 4QNHB 2WLMA 3FB7C 3ABTA 3EFFK 1R3JC 3CD6V 3M99B 1AJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EZP A;  4FK5 C;  5KA6 A;  1QR8 A;  3K9A A;  5H9C A;  4JGS A;  1Y66 A;  3CYO A;  1QCE A;  3M99 B;  2EZO A;  4FIP C;  1SZT A;  4JF3 A;  5KA5 A;  3P30 A;  4JPR A;  1DLB A;  1K33 A;  1JPX A;  2LP7 A;  3CP1 A;  3H01 A;  3B8M A;  1MOF A;  3B77 A;  1F23 A;  2M7W A;  4N23 A;  1Y4M A;  1MG1 A;  3GWO A;  3MHH C;  3B8N A;  2MK3 A;  4FJC C;  1DF5 A;  1ENV A;  3WFV A;  1QR9 A;  2X7R B;  5HFM A;  1QBZ A;  3MHS C;  4G2K A;  5CMU A;  1I5Y A;  2EBO A;  1EBO A;  1DF4 A;  1K34 A;  4N21 A;  5CN0 A;  5HFL A;  2OT5 A;  4E2L A;  1I5X A;  1JQ0 A;  2P6J A; 
#chains in the Genus database with same CATH topology
 3PJS K;  1QR8 A;  2ZE6 A;  5BZB A;  1DGS A;  3T2M A;  1JVM A;  5KMG B;  4X1K B;  4DV2 O;  1YDX A;  1Q7Y W;  3CC2 V;  1NBM G;  4JI2 O;  3E2E A;  4MTG A;  4MVM A;  2GUZ B;  2KSD A;  1WPX A;  3CCU V;  2A9H A;  2P6J A;  2BCC H;  2F43 G;  4JI5 O;  3ABM B;  4GT1 A;  3AK3 A;  2W6J G;  3NXS A;  1T5E A;  3L74 H;  5J2T B;  2F93 B;  1TUB B;  5KUM A;  1QLN A;  1Q81 W;  3CJH B;  2ZQM A;  1BT8 A;  4LF7 B;  2EJR A;  4UVC A;  1HR0 O;  1AR4 A;  3ZHR A;  1KBH A;  4D7T A;  3CRC A;  2Q67 A;  3N2K A;  3SPH A;  2RDC A;  5B1A C;  4GKJ O;  1Q3E A;  4IIJ B;  4X66 B;  1EN5 A;  3DC6 A;  3AG1 C;  4DW0 A;  2ITC C;  4X20 B;  3CCL V;  5FPR A;  5BMV A;  3OMI B;  1K3E A;  5D5Q A;  5KHJ A;  1GM9 A;  2QE7 G;  1Y76 A;  2M7W A;  4J7J A;  4KHP O;  4JV5 B;  1K73 W;  4YY3 O;  3D3Q A;  1EFR G;  2QM8 A;  2OT5 A;  1N36 B;  1QLE C;  2F66 C;  2KKW A;  3ZX6 A;  1Q90 D;  2Q0A A;  1D5N A;  2BE3 A;  1IBL B;  3K5L A;  4J11 A;  5D5P A;  2YXH A;  2WLI B;  2AHY A;  2P5O A;  3N2G A;  4WF9 V;  5K1X A;  4BR6 A;  2LFS A;  4JAV A;  4X65 O;  5C8Y B;  3HR0 A;  4J41 A;  4D7S A;  1K4D C;  5L3C A;  1BE3 H;  1PNL A;  5BR8 O;  1WN7 A;  1GRJ A;  1IBM B;  2CGO A;  1HNX O;  4JAS A;  5JQG A;  4JI0 B;  4DV4 O;  2ITD C;  4H33 A;  2BOB C;  5CB4 B;  4JI1 B;  1EZV H;  3SYA A;  4JI3 B;  3A0R A;  4GZR B;  1YJW V;  1O9H A;  1ROP A;  1E1Q G;  5CBH A;  1LUV A;  2LFR A;  3W7T A;  4LF8 B;  4OX9 B;  1BGY H;  3ABK C;  3FYE B;  4BW9 A;  2BSK A;  1SC5 B;  3RWR D;  5LOV B;  1VEW A;  1JX9 A;  1S3J A;  2EIJ B;  3TXQ A;  1XBL A;  4IT5 A;  5H2F Z;  4UVB A;  1QBZ A;  5LP6 B;  3CC7 V;  5EIB D;  2XAQ A;  4OPA A;  1Y74 A;  1VQO V;  1M4U A;  2YSU B;  4JYB A;  4UCT A;  3F5W C;  4B3R O;  4FIP C;  4QIW F;  1L1F A;  2H3O A;  4HZ3 A;  1LR1 A;  2XOK G;  4TSF G;  1IZ3 A;  1PL0 A;  1RM1 C;  4FPP A;  3OT7 A;  4PI2 A;  2WA4 A;  2UXB O;  3LSU A;  2QWP B;  1SQG A;  5EZY A;  3E89 A;  5IWA B;  4JZG A;  5IJ9 B;  2XT9 A;  5C93 A;  4LNU B;  4MS2 A;  1JMK C;  2CTR A;  1YZB A;  2ZE5 A;  4Z2W A;  1N34 O;  1P4R A;  4K8Z A;  4X1K A;  4B3T O;  1FPO A;  1VMG A;  5JJN B;  1VQ8 V;  3J80 N;  4GLX A;  1Z5V A;  2QWQ B;  5EYP A;  4DV5 B;  2GBO A;  4J9Z B;  3K0G A;  4GYC B;  1UJW B;  2VQE B;  1WP7 A;  1TVK B;  1AJP A;  3F7V C;  2MW2 B;  4JI4 B;  1I0H A;  2VRZ A;  1XNR O;  1URF A;  5IJ0 A;  4DV3 B;  2DYR B;  3P32 A;  1AI5 A;  3ICX A;  4IIJ A;  5B1N A;  3ZHV A;  5H6Q A;  2ZNI A;  3SYC A;  3CCE V;  1J95 A;  3ZMS A;  4X20 A;  1SZX A;  3RYI B;  1XL6 A;  2NLJ C;  4X89 A;  2UUA O;  4LF5 O;  2L35 A;  2Q9L A;  5CMU A;  3K5N A;  5LMN O;  4TUY B;  5ITZ A;  4FLX A;  1S72 V;  5DM6 V;  4JI6 O;  4JYY A;  2LGW A;  2UU9 B;  4P2Z A;  3UT5 B;  3RYF B;  4W4K A;  1FJG B;  1OCR C;  1US6 A;  2UUB B;  1PL4 A;  3BA9 A;  1NH2 B;  1I94 B;  4JF3 A;  2JS3 A;  4LCU C;  5AG2 A;  1H2G A;  1VP7 A;  3K57 A;  2DYS B;  4X1I A;  1YXB A;  2B1I A;  1TA8 A;  1R6K A;  2JGU A;  1SF9 A;  1K34 A;  2OTL V;  5HFL A;  3G80 A;  1I5X A;  3A0H Z;  2QR4 A;  3QTC A;  4LC1 A;  4CC5 A;  4FK5 C;  4H44 B;  1R6N A;  2JJ2 G;  4UV8 A;  5C8Y A;  4X64 B;  1RSO B;  5CBG A;  2YID A;  3ASN C;  4O4I A;  3X2Q B;  1QVF U;  4U7O A;  2ZT9 B;  4DR4 B;  4LFA B;  3E8B A;  5DN6 G;  1YHQ V;  3OMA B;  3AG3 C;  2HLD G;  5CB4 A;  3CHX A;  4AIL C;  2EZP A;  2CTQ A;  3ASO B;  2F23 A;  1EM1 A;  3LUT B;  3UKM A;  1N4C A;  5KAI Z;  2Q69 A;  4FM2 A;  4K0K O;  4YHH O;  2E76 B;  3BEH A;  3B8N A;  2B1G A;  1R3K C;  2Q6A A;  2N74 A;  4EEQ A;  1G8M A;  2HFE C;  1Z5W A;  4WCE V;  1KP2 A;  2IJJ A;  1OZ0 A;  5LP6 A;  1M56 C;  3RGB A;  4I5S A;  4R8C A;  1BCC H;  1P49 A;  4LWS A;  1CXZ B;  5LMU O;  1SQQ H;  3I5D A;  3FX7 A;  1GN6 A;  1VAR A;  4NTX A;  1NU1 H;  5FPO A;  2V1D A;  2Y0I A;  2EUL A;  1X59 A;  3ZHT A;  5K1P A;  4NXN O;  1AVM A;  4PDL A;  4I0X B;  4CBC A;  2L6L A;  4X1Y B;  4LFC B;  5CA3 A;  2ZKO A;  1ORQ C;  3WB2 A;  5LYJ A;  1E1R G;  4G28 B;  5KAF Z;  4UFZ A;  3B77 A;  2WA3 A;  3G71 V;  4LP8 A;  3PN1 A;  1N33 B;  4FJC C;  5KHI A;  4J10 A;  1VQP V;  5KX5 B;  4OPH A;  5L3B A;  4FLV A;  2JEX A;  3RT3 C;  4I7Z B;  1AR1 B;  3SJQ C;  4BW5 A;  4RQF A;  1M9N A;  2LO1 A;  3ZMU A;  1F7Y A;  2Q7G A;  4O4L B;  2XHB A;  3OR7 C;  1AB3 A;  1GMG A;  4DR2 B;  1WJZ A;  4I50 A;  1LNQ A;  4NKG B;  3N2K B;  4CZZ A;  4PA3 A;  2IU3 A;  4N23 A;  1U97 A;  2ZDI A;  3AEI A;  2GTS A;  1TVK A;  3ZCC A;  1N32 B;  1PPJ H;  3ABT A;  1R3J C;  3CD6 V;  3M99 B;  4LF6 B;  4PA9 A;  2YXL A;  1JJO A;  2CAZ C;  2LW1 A;  1R1B A;  1Y6X A;  5LGT A;  2YC0 A;  5B1A B;  2P06 A;  1RPO A;  1B6Q A;  2Z5U A;  5B66 Z;  1UFI A;  1YIT V;  4G2K A;  3H1I H;  3RYI A;  5KLV H;  1IX9 A;  2CH7 B;  4QPJ A;  3N27 A;  2EIK C;  5E79 Z;  3WU2 Z;  3ZRV A;  5DEC A;  3QO7 A;  4TUY A;  3VBB A;  3VQW A;  3QF7 A;  5F2V O;  3MAQ A;  1IBK O;  3UT5 A;  3RYF A;  3N2G B;  3RYC A;  1QLE B;  1XMQ B;  3K0D A;  3THO A;  3BAA A;  2A06 H;  2XAS A;  1ZL8 A;  4ZIB A;  1NTZ H;  5FNV A;  4JI2 B;  5JQG B;  2ODM A;  1J5E B;  4PHZ A;  4B3S B;  3DSQ A;  4DV0 B;  2IU0 A;  1S77 D;  2ZM6 O;  1RSO A;  3SR2 C;  1ARO P;  3BPZ A;  1HR0 B;  2HP8 A;  1QVG U;  2Y69 C;  5JVD A;  3QNE A;  1R73 A;  3HKD B;  4PD4 F;  2GV9 A;  3F5T A;  5TIS Z;  1NKD A;  4ABM A;  4ASU G;  2Q5Z A;  3SYO A;  1BS3 A;  1WPB A;  4TWK A;  3ML0 A;  3P3N A;  1WA8 A;  1V55 C;  3MHH C;  1AR5 A;  1W0J G;  1OCZ C;  3MHS C;  3CXC U;  4DYL A;  1Y74 B;  3JYC A;  3JD4 A;  3ABK B;  4Q6G A;  4KL1 A;  3RFR A;  4OXS A;  5KA6 A;  3DXR B;  4YY3 B;  4DV6 B;  3KZI Z;  1K5S A;  5CA0 A;  2DOS A;  4DUZ O;  2FML A;  1DK1 A;  2HHH O;  4TV8 A;  1SER A;  3SGI A;  3CP1 A;  2V4D A;  3E86 A;  3KKY A;  1YI2 V;  3E8H A;  1BMF G;  1VQK V;  1MAB G;  4J9Y B;  2XUM A;  1NR7 A;  2NNU A;  1VQN V;  4LH7 A;  1VQ9 V;  2K1E A;  2ZR2 A;  4X62 O;  1YJN V;  1I7F A;  4UV9 A;  4I0X A;  3CXH F;  4UCU A;  4X1Y A;  1Q43 A;  1IXB A;  2HJF C;  1FKA O;  2P67 A;  1HNX B;  3LDE A;  1ZLZ A;  1QNM A;  5EYP B;  3BAB A;  1HWY A;  1NJI W;  2RMK B;  3K5O A;  5L3F A;  4K3A A;  5KX5 A;  1N8R W;  4GX0 A;  4O2B B;  2UXX A;  3KG2 A;  4NVP A;  4U3J B;  3UM7 A;  4O4L A;  1YSC A;  2RJZ A;  2ZIN A;  1OCO C;  2QM4 A;  4BWA A;  5IJ0 B;  2HVJ C;  1JOY A;  2RN9 A;  2Z0A A;  3SYQ A;  4O4J A;  3S3W A;  4WFG A;  4JYA B;  4TV9 A;  3C90 A;  1SQF A;  4DV1 B;  2YDE A;  1COW G;  1WNS A;  4XDK A;  3ZN1 A;  3VQX A;  4WBN B;  4LF9 O;  5IE9 A;  4ICG A;  3JAL B;  4J7Z A;  3H1H H;  4B3M O;  5ITZ B;  1KC8 W;  3T4D A;  4UVA A;  4B3R B;  4FZ0 A;  5HFM A;  1R6T A;  3RYH A;  4NR1 A;  4AQY O;  4FLW A;  2UUC B;  2FYU H;  2VWJ A;  5KUK A;  3OEH G;  4BIZ A;  4MSW C;  2CH7 A;  4DR5 O;  3OGC C;  1OJH A;  2Y4T A;  2AZ2 A;  4X1I B;  3D36 C;  3ETQ A;  2UXC B;  1KEC A;  1XMO O;  3OTO O;  1LUW A;  4LFB O;  5EBW C;  3ZRX A;  3BFR A;  3CRR A;  4PEL A;  3ZMT A;  1OCR B;  4CS3 A;  1YF2 A;  2XTA A;  1SA0 A;  3RVZ A;  2OCC C;  1XNQ O;  1H8H G;  2HVK C;  4CH4 A;  3VQV A;  4O4I B;  3HB3 B;  3JCZ A;  4DXW A;  2UXD O;  1GN2 A;  1IXM A;  3WFV A;  3SPG A;  5IDJ A;  1PP9 H;  2HJD A;  1SQB H;  3HKC A;  2Q4P A;  3L72 H;  4U7N A;  2UXN A;  5GW7 A;  2ZXW C;  1W2B U;  5IY5 C;  2WAM A;  1HNW B;  3DTU B;  3B2E E;  4DR6 B;  3G67 A;  1TGO A;  2P22 C;  1HP8 A;  3AG3 B;  3HKD A;  1FXK C;  3ETD A;  4JTA B;  3B40 A;  2E75 B;  4B7K A;  1FXV A;  1M1K W;  2FTK A;  1F4M A;  1HNZ B;  1ZTE A;  2C2A A;  4DK1 A;  2E5L B;  4LF7 O;  3ZHS A;  2F4V B;  4CH5 A;  2EX3 A;  4LWS B;  5LMN B;  1NQT A;  3TXS A;  3BRC A;  1Q82 W;  1M57 C;  2JJ1 G;  1FXK A;  4PDV A;  3DXR A;  4DV7 B;  3LSS A;  2OYQ A;  1JPX A;  4X66 O;  3DGE A;  2MK3 A;  2EIL C;  1M56 B;  5LHI A;  2K9P A;  1A32 A;  1EN6 A;  3FFQ A;  3HKE A;  1VQ7 V;  4MVQ A;  3OE7 G;  5LYJ B;  5L3G A;  2CUG A;  1KP3 A;  4OGQ B;  2KG7 B;  1QQC A;  1NT2 B;  5E1A C;  1DLB A;  2CK3 G;  4ZKI A;  1N36 O;  1KQS U;  1MOF A;  4GCZ A;  2W6I G;  1XUQ A;  4RAI A;  2LJ2 A;  3OUS A;  2WSS G;  4UB8 Z;  1IBL O;  3K79 A;  2NR5 A;  1VF6 C;  4IYI A;  4I50 B;  3W7X A;  1OCC C;  2P90 A;  3CE2 A;  1DTO A;  1PM9 A;  4JI8 B;  1AP6 A;  4O2B A;  4DR1 B;  4U3J A;  1SQV H;  1EZJ A;  4PA6 A;  4AHC A;  1IBM O;  1KB9 F;  2YIB D;  3KCX A;  4E2L A;  3E83 A;  2QM7 A;  2ETN A;  2GTA A;  2VQF B;  3IFX A;  4XDL A;  4JI0 O;  3ZRS A;  1W0K G;  2ZE7 A;  2D3O W;  4JI3 O;  1VQ4 V;  5JWP A;  4JPR A;  1AI7 A;  1N0J A;  4WBN A;  3I55 V;  5GON B;  3CCQ V;  4YJ2 B;  3JAL A;  2IJI A;  2HR3 A;  4FLU A;  1KU9 A;  1PNM A;  3EHB B;  4MTF A;  4Z1M G;  1WB7 A;  4LF8 O;  4OX9 O;  3WG7 C;  3ZS8 C;  2YIA A;  4X8A A;  2R9R B;  1Q6U A;  4AI8 A;  1HDJ A;  3RYC B;  2QA4 V;  2R70 A;  2CGN A;  1L0N H;  2DW4 A;  3OW2 U;  2EIK B;  1QU7 A;  2YEV A;  4B7E A;  3LNM B;  4XBF A;  4B08 A;  2Q7E A;  1ZL8 B;  1E79 G;  1V9P A;  4PDM A;  5FNV B;  4DR7 B;  3O9O A;  2P4K A;  2WLM A;  1FAF A;  2VS0 A;  5EIB C;  5CBF A;  5EC2 C;  3BCC H;  3FD9 A;  1Z2G A;  5L3E A;  1WB8 A;  3B09 A;  4QJF B;  1TUE B;  3JAS B;  2PGG A;  5J2U A;  2AGA A;  2RQ6 A;  5JVD B;  5IWA O;  4WFA V;  2JRI A;  4TT3 G;  2EIM C;  1NVP B;  1H2N A;  2BOC C;  3L9D A;  4EB6 A;  1Y66 A;  5EC1 C;  1WA8 B;  1K8A W;  3P30 A;  1GM8 A;  3SPJ A;  1NH2 D;  5JH7 A;  2DMX A;  4DV5 O;  4GX1 A;  3AG4 C;  3IC7 A;  4ZBM A;  2VWK A;  2VQE O;  5CA0 B;  4CS4 A;  4XDJ A;  3G4S V;  1D5A A;  4TQD A;  4TV8 B;  1XQ8 A;  5LA6 A;  1GO3 F;  1V55 B;  2E3C A;  2ZIO A;  4JI4 O;  1OCZ B;  3SJC C;  1K5Q A;  2DJV A;  3T1H B;  3CCJ V;  3LNN A;  4FLZ A;  4DV3 O;  5B3S B;  1NI8 A;  3JD0 A;  3GWK C;  2FKX A;  3A2F A;  3ZHU A;  1HW7 A;  4NXM B;  3LDC A;  5A2Q N;  2YIB A;  2PYJ A;  3HKB B;  3HPL C;  3K9A A;  4LF4 B;  1NVP D;  2YUA A;  3OGI B;  5H5N A;  2GSM B;  1O9G A;  3AG2 B;  4I4T A;  2WLN A;  1H8E G;  3MDS A;  4GX2 A;  2QTS A;  5LBQ A;  3E8F A;  2KG7 A;  2UU9 O;  3GWO A;  4IHJ B;  1FJG O;  2UUB O;  4CS2 A;  2XND G;  3ZN0 A;  1I94 O;  2KQX A;  3RN4 A;  1K4C C;  3R66 A;  1BHB A;  3H1K H;  3SPI A;  4X88 A;  1QCE A;  4DK0 A;  3C3S A;  3CC4 V;  1GN4 A;  3UQ8 A;  4GKK B;  1K92 A;  1KYO F;  4MVR A;  4P30 A;  4O4J B;  1AIL A;  1Q6H A;  1SKV A;  1G1X B;  4TV9 B;  3ZRW A;  4FM0 A;  2ZIM A;  1G4Y B;  3L70 H;  4X64 O;  2YS8 A;  1B06 A;  3JSN A;  1VQ5 V;  1OCO B;  4DUY B;  3AK2 A;  3F7Y C;  1L8D A;  1JJ2 U;  4LFA O;  5FLX N;  3T1Y O;  2PTM A;  2OIE A;  3RYH B;  2X6B A;  1YTF B;  2HHH B;  3AG1 B;  3BHP A;  4FM1 A;  4PA4 A;  4DR3 O;  2P7T C;  3CS5 A;  2AXT Z;  5CN0 A;  3U11 A;  3JCU Z;  5GON A;  4YJ2 A;  3OAA G;  3WB1 A;  5DED A;  3CRM A;  1KKC A;  3JD3 A;  4O2A A;  2ZR3 A;  4P9P A;  2GDS A;  4UUJ C;  1S5J A;  3FKS G;  1SA0 B;  1MA1 A;  4U3F H;  2IH3 C;  2R72 A;  3M8A A;  3E8G A;  3ZHQ A;  4HAM A;  3FAV B;  2DYS C;  4DV2 B;  1Q6I A;  4MVZ A;  1XL4 A;  2OCH A;  1KD1 W;  5H9C A;  4JTC B;  2DQ3 A;  2ARH A;  2JEU A;  3CME V;  4BIU A;  4JI5 B;  2OCC B;  5JCO C;  1S5L Z;  2DE0 X;  2HG5 C;  1YTF D;  3O65 A;  3HKC B;  1GN3 A;  2E74 B;  4LFC O;  3JAS A;  3OEE G;  3OUF A;  1FFX B;  1WLE A;  4L87 A;  4GKJ B;  4H0L B;  1N33 O;  5JCO A;  4A5U B;  1IDS A;  3CWB H;  5IYB O;  1RPR A;  4QGP A;  3H9V A;  2QDO A;  3FB5 C;  5KHK A;  2ZXW B;  5IY5 B;  1EBO A;  4DR2 O;  4TOI A;  1L0L H;  3CEI A;  2PY5 A;  1FXK B;  2QSA A;  4KHP B;  1BQZ A;  2A0L A;  4PA7 A;  2Q0O C;  1NR1 A;  4J42 A;  2ZNJ A;  2EIN C;  3ZBH A;  4WFB V;  1SRY A;  4DRX B;  3MD0 A;  1VIB A;  2QWN B;  1F4N A;  4FZ1 A;  2Y0P A;  5BXZ A;  1MSD A;  4LF6 O;  3HKE B;  1GAX A;  1M57 B;  2Z3Y A;  2JIZ G;  1XMO B;  4JI7 O;  3ZIA G;  1K9M W;  2WLL B;  2KB1 A;  1KUQ A;  1PV0 A;  1BQ0 A;  3EXA A;  2EIL B;  4H37 A;  4X65 B;  4K8X A;  3HKB A;  1RM1 B;  2LGQ A;  5BR8 B;  4LH6 A;  1YVW A;  3JAR A;  1FD9 A;  1DF5 A;  2UXD B;  4DV4 B;  1YJ9 V;  1NZ6 A;  1ZX3 A;  1ZAU A;  2IJK A;  4IHJ A;  1XHZ A;  4O4H A;  2JGD B;  3J7A U;  1XMQ O;  5LHG A;  2RCV A;  1M93 A;  2IH1 C;  1K7D A;  1SZT A;  4GX5 A;  4R7C A;  3JAT A;  3G6E V;  1ENV A;  1AI6 A;  1OCC B;  2N05 A;  1RFY A;  1VQ6 V;  3ZMV A;  1J5E O;  1MZE A;  1BZK A;  3H1J H;  1AJQ A;  1IVS A;  4D6T H;  4B3S O;  1GTO A;  1WP8 A;  4MVU A;  4DV0 O;  1XI1 A;  2QKC A;  4FMT A;  3D8C A;  4MW8 A;  4NYK A;  4RUE A;  3TCU A;  4L8J A;  2Q68 A;  3JAW B;  3K08 A;  2P4V A;  4J7K A;  4UCR A;  2FB5 A;  3RVY A;  2Y4U A;  1H2L A;  1EN4 A;  2WLK A;  2Y48 A;  1QHT A;  3STZ C;  5IYZ A;  4HNA A;  1F51 A;  4C7U A;  3IGA C;  1SQX H;  1JCH A;  2CDY A;  4MT8 A;  4ZHQ B;  2UXB B;  3GVM A;  1MMM A;  2YEV B;  3T4Z A;  3I56 V;  3CCR V;  1N0N A;  3WG7 B;  2IW5 A;  4DV6 O;  3QVN A;  4P9O A;  2EJ7 A;  3JAM N;  5KHH A;  1SET A;  1KKD A;  3DC5 A;  4G27 B;  1N34 B;  2X0L A;  1NTK H;  3ETG A;  3FB6 C;  4X9Q A;  1SES A;  5B5E Z;  4B3T B;  1M90 W;  3FAV A;  3D36 A;  1JA8 A;  3CB2 A;  3QO5 A;  5A9G A;  4LBE C;  5J2U B;  3T1C A;  2DWD C;  1NS1 A;  2X6C A;  3SDL A;  3SJB C;  1I08 A;  1AP5 A;  4FFB B;  1VF5 B;  3CSX A;  1DF4 A;  1FS0 G;  2R9I A;  3ABL C;  1V54 C;  3ASN B;  3Q4H B;  4EB6 B;  3K03 A;  3CX5 F;  1B3Q A;  1XNR B;  4EFB A;  5JH7 B;  3TGU H;  3ZMZ A;  1FFX A;  3RBZ A;  3A8T A;  3TK1 A;  3APQ A;  2EIM B;  2HEP A;  1ZSP A;  3L71 H;  5IT9 N;  1R3I C;  4IYH A;  5LGN A;  1CPY A;  1BHA A;  2ADQ B;  1FFT B;  3FB7 C;  5LA6 B;  3EFF K;  2UUA B;  1PKX A;  4LF5 B;  3E22 A;  1XEQ A;  4TQF A;  4HYO A;  3JSL A;  4JI6 B;  3BY6 A;  3AG4 B;  1YEW A;  2XAH A;  2O57 A;  4JYA O;  1XOU A;  4MW3 A;  4DV1 O;  4UCV A;  1JFF B;  4YXW G;  4ZI7 B;  4DRX A;  1MSW D;  1RP3 B;  3D3I A;  4WFF A;  5B1B C;  4WFH A;  4I4T B;  2ILM A;  3CYO A;  3J81 N;  2WLL A;  3TJT A;  1FXH A;  4JV5 O;  2BTO A;  4ZOL B;  2PUS A;  4PDR A;  5JJE B;  5B1O A;  4I55 A;  2UUC O;  4PJ0 Z;  3K06 A;  1XHX A;  2RNB A;  1XRE A;  2UXC O;  3JAK A;  4JGS A;  1XDC A;  5EBL C;  3CPW U;  2A3Q A;  2JGD A;  3BA8 A;  3W7U A;  3ZRW B;  3W7S A;  3ABM C;  2YXY A;  4FFK A;  1IUR A;  5KMG A;  4BIO A;  1Q5O A;  1VF6 A;  2PF4 E;  4DO2 A;  2Q73 A;  4BAY A;  4K0K B;  4YHH B;  1H2K A;  2QJ1 A;  1GKF A;  2GUZ A;  1OHH G;  4R50 A;  2ZE8 A;  4EKW A;  4JI1 O;  2EZO A;  1PNK A;  5J2T A;  4NTY A;  2QKA A;  4HBN A;  4F6R B;  1TUB A;  3B8M A;  3CJH A;  2W0X A;  4UB6 Z;  3ZJZ A;  3G6B A;  5LMU B;  1OV9 A;  3L73 H;  1HNW O;  3L75 H;  4DR6 O;  2ZCE A;  3JAW A;  1BSM A;  4O2A B;  4KUM A;  4FVM A;  2A7W A;  4F6E A;  4H13 B;  3FB8 C;  3H1L H;  4MVS A;  1K97 A;  2WPD G;  3B4S A;  1K33 A;  2CTW A;  1HNZ O;  4NXN B;  4MTO A;  2E5L O;  4ZHQ A;  5EBM C;  1Y4M A;  2F4V O;  2BTQ B;  3LSQ A;  2IBZ H;  3QG5 A;  3EVK A;  4FLY A;  2OIG A;  4DV7 O;  2LW7 A;  2F1M A;  1CEZ A;  4FLT A;  5IYD O;  1YIJ V;  1KMI Z;  1PD3 A;  3K59 A;  4MTX A;  2PZS A;  1ZUQ A;  2WLI A;  3CMA V;  1VQL V;  1BL8 A;  3K9S A;  3BVO A;  1M5I A;  2YIC A;  4FFB A;  4PV1 B;  1GH6 A;  1P7B A;  3OM3 B;  2JVD A;  4JTD B;  4E4E A;  3Q4H A;  5BY1 A;  2Q7H A;  5CA1 B;  4LR3 A;  3UO2 A;  4UCS A;  2Y69 B;  3T1Y B;  4JAA A;  2JDI G;  3U10 A;  1W59 A;  4CH6 A;  4NB5 A;  2AZ0 A;  4JAU A;  3JD2 A;  3K58 A;  2M6Y A;  3IAY A;  3SYP A;  4JI8 O;  4DR3 B;  2EIJ C;  2B9Z A;  2AW9 A;  4MVO A;  2Q8V A;  5LP6 C;  3ETE A;  5J9P C;  4DR1 O;  2ADP A;  3OTF A;  3SPC A;  1S76 D;  2ATK C;  2QGN A;  3VOU A;  3AG7 A;  4KXR A;  4YJ3 B;  3NR7 A;  2VQF O;  1MG1 A;  2QWR B;  5LOV A;  2QEX V;  1QR9 A;  1IBK B;  1I5Y A;  4YIP A;  5LL6 Y;  2EIN B;  1JFF A;  1JQ0 A;  2QWO B;  3M7M X;  4ZI7 A;  2YI9 A;  1ZWI C;  3RW0 A;  3E35 A;  5LXT B;  2DN9 A;  3JAR B;  3CCM V;  2R9A A;  2PI4 A;  4RO2 A;  5LHH A;  1GM7 A;  2V7Q G;  2QTO A;  4K35 A;  4ZOL A;  2OWO A;  5JJJ B;  3UO3 A;  4O4H B;  2HKO A;  2G38 A;  2XAF A;  3JD1 A;  2ZM6 B;  1MZF A;  3STL C;  2A79 B;  3UCS C;  2XAJ A;  1GK9 A;  1R3L C;  3SJA C;  3IC9 A;  3K5M A;  3R65 A;  2NN4 A;  3JAT B;  5L3D A;  2YI8 A;  3ABU A;  4DR7 O;  5IJ9 A;  4I9W A;  4LNU A;  4EFE A;  3P3P A;  2AHZ A;  5H6R A;  4KFM A;  1NTM H;  2DQ0 A;  2EBO A;  2ZDI C;  3CCV V;  2IJH A;  4IL6 Z;  4PI0 A;  1XIL A;  5LGU A;  1WAZ A;  1G6U A;  1JR9 A;  2OTJ V;  4QE7 A;  3U0Z A;  1CP9 A;  3LDD A;  4DR4 O;  2DYR C;  2DWE C;  1D2D A;  1S5H C;  2JS5 A;  4Q20 A;  4DUZ B;  3AK1 A;  2X7R B;  4F6R A;  2CE4 A;  5IYZ B;  1YCI A;  4HNA B;  5BMV B;  4WFE A;  1MNG A;  1SS3 A;  2WLJ A;  4Z1V A;  4JI7 B;  1Y76 B;  4JZ2 A;  4F4L A;  3H01 A;  1TAE A;  1THZ A;  1H2S B;  2X6A A;  4X62 B;  4KP4 A;  3WB0 A;  4IGG A;  3OFN G;  1Y67 A;  2FL4 A;  1AI4 A;  3T1H O;  2BTQ A;  3TET A;  1P7G A;  1Q8I A;  4J80 A;  5GTI Z;  4CH3 A;  4NXM O;  1VQM V;  2LP7 A;  3KCY A;  1U96 A;  4QE9 A;  3FYI B;  1X4T A;  4LF4 O;  3X2Q C;  4UXN A;  4CC6 A;  2B5U A;  1VF7 A;  2F95 B;  2WLH A;  2N04 A;  4YIO A;  3K3W A;  1H38 A;  2W0F C;  3ABL B;  3OMN B;  1V54 B;  4LF9 B;  3ASO C;  3A0B Z;  2D2C B;  4JYC A;  2IM9 A;  5CA1 A;  1UPG A;  3E22 B;  4NTW A;  4B3M B;  1FYJ A;  1B04 A;  5FL7 G;  4I9Q A;  4GKK O;  3GB7 C;  2BSK B;  3ZED A;  3OD4 A;  5KHG A;  3CRA A;  4AQY B;  1N32 O;  5EK0 A;  1F23 A;  2H94 A;  2JK5 C;  3S3X A;  4DW1 A;  4DR5 B;  2QKS A;  4R6Z A;  2XAG A;  1H2M A;  3APO A;  4W4L A;  3CCS V;  2PYL A;  3CRQ A;  4DUY O;  4N21 A;  4YJ3 A;  4GUN A;  4QPK A;  3OTO B;  2GHY A;  5B3S C;  2WWW A;  4RUF A;  4LFB B;  3W7W A;  3QO8 A;  3VQY A;  2LQT A;  2H8P C;  4I55 B;  3OR6 C;  5KA5 A;  2PI5 A;  1XNQ B;  3IJ4 A;  5IYC O;  5LXT A;  5B1B B;  1Q86 W;  4RQE A;  2CTP A;  2ZD9 A;  4RWU A;  1S0V A;  3AG2 C;  3K04 A;  4UCO A;  1SQP H;  3JAK B;  3C3T A;  5EZY B;  1P84 F;  5GTH Z;  4QNH B;  1AJN A; 
#chains in the Genus database with same CATH homology
 1PKX A;  3PJS K;  1QR8 A;  4PA9 A;  5BZB A;  5CBF A;  5EC2 C;  3T2M A;  4HYO A;  1JVM A;  5L3E A;  5LGT A;  3BY6 A;  3AG4 B;  5B1A B;  4QJF B;  2XAH A;  1TUE B;  4MW3 A;  1Q7Y W;  1RPO A;  1B6Q A;  3CC2 V;  2Z5U A;  1NBM G;  4YXW G;  3E2E A;  4MTG A;  4MVM A;  4G2K A;  1YIT V;  4WFA V;  1WPX A;  1MSW D;  3D3I A;  3CCU V;  4QPJ A;  2A9H A;  4WFF A;  4TT3 G;  5B1B C;  2P6J A;  2F43 G;  2EIM C;  2EIK C;  3ZRV A;  3ABM B;  4GT1 A;  1NVP B;  4WFH A;  3QO7 A;  2W6J G;  3NXS A;  3VBB A;  2BOC C;  1Y66 A;  3CYO A;  5EC1 C;  2WLL A;  5KUM A;  1QLN A;  1Q81 W;  1K8A W;  2ZQM A;  1FXH A;  3P30 A;  1GM8 A;  2EJR A;  4UVC A;  3SPJ A;  4PDR A;  1NH2 D;  1QLE B;  5B1O A;  4GX1 A;  2Q67 A;  3K06 A;  3K0D A;  3SPH A;  3AG4 C;  5B1A C;  3IC7 A;  4ZBM A;  2XAS A;  3AG1 C;  4XDJ A;  3G4S V;  2ITC C;  1GO3 F;  3CCL V;  1V55 B;  4JGS A;  1OCZ B;  3OMI B;  5EBL C;  3CPW U;  1K5Q A;  1K3E A;  3W7U A;  3CCJ V;  3ZRW B;  3W7S A;  3ABM C;  2IU0 A;  5B3S B;  1S77 D;  3JD0 A;  1GM9 A;  2QE7 G;  2M7W A;  1K73 W;  1ARO P;  4DO2 A;  1EFR G;  4BAY A;  2QM8 A;  1QVG U;  2OT5 A;  1GKF A;  3LDC A;  1QLE C;  2Y69 C;  3HPL C;  3QNE A;  1OHH G;  4R50 A;  3K9A A;  1R73 A;  1NVP D;  4EKW A;  1NKD A;  2GSM B;  2EZO A;  4ASU G;  3AG2 B;  3SYO A;  1PNK A;  2WLN A;  1H8E G;  4GX2 A;  4TWK A;  3ML0 A;  2WLI B;  5LBQ A;  3B8M A;  3E8F A;  2AHY A;  1V55 C;  3GWO A;  3MHH C;  1W0J G;  1OCZ C;  4WF9 V;  3MHS C;  3CXC U;  3ZJZ A;  2XND G;  2LFS A;  3JYC A;  3JD4 A;  4JAV A;  3ZN0 A;  3ABK B;  1K4C C;  4OXS A;  1K4D C;  5L3C A;  1BHB A;  5KA6 A;  3SPI A;  1K5S A;  1PNL A;  4X88 A;  4KUM A;  1QCE A;  3FB8 C;  4JAS A;  4MVS A;  1K97 A;  1SER A;  2WPD G;  1K33 A;  3CC4 V;  3CP1 A;  1K92 A;  4MTO A;  2ITD C;  4MVR A;  4P30 A;  5EBM C;  3E86 A;  1Y4M A;  4H33 A;  2BOB C;  1YI2 V;  3E8H A;  3SYA A;  1BMF G;  3ZRW A;  3A0R A;  1VQK V;  1MAB G;  3LSQ A;  4J9Y B;  1G4Y B;  1NR7 A;  2NNU A;  1YJW V;  1VQN V;  1ROP A;  1E1Q G;  1VQ9 V;  2K1E A;  1VQ5 V;  5CBH A;  1CEZ A;  2ZR2 A;  1OCO B;  3F7Y C;  2LFR A;  3W7T A;  1JJ2 U;  1YJN V;  4UV9 A;  5IYD O;  3ABK C;  3FYE B;  1YIJ V;  2X6B A;  1YTF B;  1PD3 A;  1JX9 A;  2HJF C;  4MTX A;  1S3J A;  2EIJ B;  2P67 A;  3AG1 B;  4PA4 A;  4UVB A;  2P7T C;  1QBZ A;  2WLI A;  3LDE A;  3CMA V;  3CC7 V;  1VQL V;  5CN0 A;  1BL8 A;  3OAA G;  1HWY A;  1NJI W;  2XAQ A;  5L3F A;  1VQO V;  1P7B A;  2YSU B;  3OM3 B;  4JYB A;  3F5W C;  4JTD B;  1N8R W;  4GX0 A;  3JD3 A;  4FIP C;  2UXX A;  3KG2 A;  4QIW F;  2ZR3 A;  3UM7 A;  4P9P A;  4UUJ C;  1L1F A;  3FKS G;  1YSC A;  1OCO C;  2Y69 B;  2JDI G;  4HZ3 A;  2HVJ C;  2XOK G;  1JOY A;  4TSF G;  2IH3 C;  1PL0 A;  3E8G A;  3SYQ A;  4FPP A;  1RM1 C;  4HAM A;  4WFG A;  2DYS C;  4JAU A;  4MVZ A;  3JD2 A;  1COW G;  3SYP A;  2EIJ C;  4XDK A;  1XL4 A;  3ZN1 A;  3E89 A;  1KD1 W;  4MVO A;  5H9C A;  3ETE A;  5J9P C;  4JTC B;  2DQ3 A;  2JEU A;  3SPC A;  5C93 A;  1S76 D;  2ATK C;  3CME V;  4MS2 A;  3VOU A;  4BIU A;  2OCC B;  1KC8 W;  1P4R A;  3T4D A;  2HG5 C;  1MG1 A;  4UVA A;  1YTF D;  5HFM A;  2QEX V;  1QR9 A;  1I5Y A;  1VQ8 V;  2EIN B;  1JQ0 A;  3OEE G;  3OUF A;  4J9Z B;  5KUK A;  3OEH G;  1WLE A;  4L87 A;  3K0G A;  4BIZ A;  4MSW C;  1ZWI C;  3RW0 A;  3E35 A;  3OGC C;  1UJW B;  3CCM V;  1KEC A;  2PI4 A;  4RO2 A;  5IYB O;  1RPR A;  1GM7 A;  5LHH A;  1AJP A;  5EBW C;  3F7V C;  3ZRX A;  3FB5 C;  2V7Q G;  2QTO A;  4PEL A;  3ZMT A;  1OCR B;  2ZXW B;  5IY5 B;  1EBO A;  2HKO A;  3JD1 A;  2XAF A;  3RVZ A;  2DYR B;  2OCC C;  1H8H G;  2HVK C;  3STL C;  1FXK B;  2A79 B;  3P32 A;  2XAJ A;  1AI5 A;  2A0L A;  1GK9 A;  4PA7 A;  5B1N A;  1R3L C;  5H6Q A;  3R65 A;  5L3D A;  1NR1 A;  3HB3 B;  3SYC A;  3ABU A;  2EIN C;  3JCZ A;  4DXW A;  4WFB V;  3CCE V;  1J95 A;  1SRY A;  3ZMS A;  3MD0 A;  1XL6 A;  2NLJ C;  4X89 A;  1F4N A;  4I9W A;  1IXM A;  2AHZ A;  5H6R A;  4KFM A;  3WFV A;  2DQ0 A;  5CMU A;  3SPG A;  5IDJ A;  1M57 B;  2EBO A;  2JIZ G;  2ZDI C;  2Z3Y A;  3CCV V;  2IJH A;  5DM6 V;  1S72 V;  3ZIA G;  1K9M W;  2WLL B;  2KB1 A;  5LGU A;  4P2Z A;  4U7N A;  2UXN A;  1OCR C;  5GW7 A;  2ZXW C;  1W2B U;  2OTJ V;  4QE7 A;  5IY5 C;  2EIL B;  2WAM A;  4H37 A;  1CP9 A;  3LDD A;  1NH2 B;  3DTU B;  4JF3 A;  2DYR C;  4LCU C;  2DWE C;  1H2G A;  1RM1 B;  3AG3 B;  1S5H C;  1FXK C;  3ETD A;  2DYS B;  2B1I A;  4JTA B;  4Q20 A;  1DF5 A;  1R6K A;  2X7R B;  1FXV A;  1M1K W;  2FTK A;  1K34 A;  1F4M A;  2OTL V;  1YJ9 V;  5HFL A;  2C2A A;  1I5X A;  2IJK A;  4LC1 A;  4WFE A;  4FK5 C;  2WLJ A;  1R6N A;  2JJ2 G;  1NQT A;  5LHG A;  1Q82 W;  4UV8 A;  1M57 C;  2JJ1 G;  2IH1 C;  1FXK A;  4PDV A;  1K7D A;  5CBG A;  1SZT A;  3ASN C;  3LSS A;  4GX5 A;  1JPX A;  3X2Q B;  1QVF U;  4U7O A;  4F4L A;  3H01 A;  4R7C A;  3G6E V;  1THZ A;  3DGE A;  2X6A A;  2MK3 A;  4KP4 A;  2EIL C;  1ENV A;  1M56 B;  3E8B A;  1AI6 A;  1OCC B;  5DN6 G;  1YHQ V;  5LHI A;  3OMA B;  1VQ6 V;  3OFN G;  3ZMV A;  3AG3 C;  2HLD G;  1AJQ A;  1GTO A;  4MVU A;  1AI4 A;  2EZP A;  1VQ7 V;  3TET A;  4MVQ A;  3ASO B;  3OE7 G;  5L3G A;  4FMT A;  1KP3 A;  3LUT B;  4MW8 A;  3UKM A;  2Q69 A;  5E1A C;  1DLB A;  1VQM V;  2CK3 G;  4RUE A;  2LP7 A;  4ZKI A;  3TCU A;  1KQS U;  1MOF A;  4GCZ A;  3BEH A;  2W6I G;  4QE9 A;  3B8N A;  2Q68 A;  4RAI A;  3FYI B;  2B1G A;  1R3K C;  3K08 A;  2Q6A A;  3OUS A;  2WSS G;  3K79 A;  3X2Q C;  4UXN A;  1G8M A;  2HFE C;  3RVY A;  2B5U A;  2Y48 A;  2WLK A;  2WLH A;  4WCE V;  1KP2 A;  3STZ C;  3K3W A;  2IJJ A;  1OZ0 A;  1M56 C;  3W7X A;  1F51 A;  1OCC C;  1H38 A;  2W0F C;  3IGA C;  1JCH A;  4MT8 A;  4I5S A;  4R8C A;  3I56 V;  3T4Z A;  2P90 A;  2YEV B;  1DTO A;  3CCR V;  3ABL B;  3OMN B;  3WG7 B;  1V54 B;  2IW5 A;  3ASO C;  4JYC A;  4P9O A;  1SET A;  1KKD A;  1EZJ A;  4PA6 A;  4G27 B;  5FL7 G;  4E2L A;  3E83 A;  2QM7 A;  2V1D A;  3IFX A;  2X0L A;  4XDL A;  3ZRS A;  3ETG A;  4PDL A;  3FB6 C;  1W0K G;  1SES A;  3GB7 C;  4CBC A;  1M90 W;  3D36 A;  5CA3 A;  2D3O W;  1VQ4 V;  3QO5 A;  1ORQ C;  4LBE C;  4JPR A;  1AI7 A;  1E1R G;  4G28 B;  2DWD C;  3T1C A;  3I55 V;  3B77 A;  1F23 A;  2H94 A;  2JK5 C;  4LP8 A;  5EK0 A;  2IJI A;  3G71 V;  3CCQ V;  2HR3 A;  2X6C A;  2QKS A;  4FJC C;  2XAG A;  4R6Z A;  1PNM A;  3CCS V;  3EHB B;  4N21 A;  1DF4 A;  4MTF A;  1FS0 G;  4QPK A;  2R9I A;  4Z1M G;  1VQP V;  2GHY A;  3ABL C;  2WWW A;  5B3S C;  4RUF A;  3WG7 C;  5L3B A;  1V54 C;  3W7W A;  3ASN B;  3QO8 A;  2JEX A;  4X8A A;  3K03 A;  1AR1 B;  3SJQ C;  4BW5 A;  4RQF A;  1M9N A;  2H8P C;  3ZMU A;  2R9R B;  3OR7 C;  1GMG A;  3OR6 C;  3ZMZ A;  5KA5 A;  2QA4 V;  2PI5 A;  1LNQ A;  3RBZ A;  5IYC O;  3TK1 A;  2DW4 A;  4CZZ A;  4PA3 A;  5B1B B;  4RQE A;  3OW2 U;  1Q86 W;  2EIM B;  2EIK B;  2IU3 A;  2YEV A;  4N23 A;  2ZD9 A;  2ZDI A;  1R3I C;  1S0V A;  3AG2 C;  3AEI A;  1CPY A;  3K04 A;  3LNM B;  4XBF A;  5LGN A;  1BHA A;  1E79 G;  4PDM A;  3ZCC A;  1FFT B;  4QNH B;  2WLM A;  3FB7 C;  3ABT A;  3EFF K;  1R3J C;  3CD6 V;  3M99 B;  1AJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...