5H9CA

Crystal structure of the aslv fusion protein core
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
78
structure length
78
Chain Sequence
NLYFQGTANLTTSLLGDLLDDVTSIRHAVLQNRAAIDFLLLAHGHGCEDVAGMCSFNLSDQSESIQKKFQLMKEHVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural characterization of a fusion glycoprotein from a retrovirus that undergoes a hybrid 2-step entry mechanism.
pubmed doi rcsb
source organism Avian leukosis virus rsa
molecule tags Viral protein
molecule keywords Envelope glycoprotein gp95
total genus 31
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2015-12-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5h9cA00
1QR8A 2MK3A 1Y4MA 5HFLA 4JGSA 3P30A 1DLBA 1JQ0A 3WFVA 1EBOA 2X7RB 4FK5C 1DF4A 1QCEA 4G2KA 5CMUA 2EZOA 1DF5A 1F23A 2P6JA 3CYOA 4E2LA 1Y66A 3H01A 3B8MA 3B8NA 1K34A 3MHSC 1JPXA 4FJCC 5KA5A 1QBZA 4JF3A 1MG1A 2EBOA 2LP7A 1SZTA 2EZPA 3M99B 1I5XA 4JPRA 5H9CA 1K33A 3MHHC 1ENVA 2M7WA 4FIPC 5KA6A 5CN0A 5HFMA 3B77A 2OT5A 3GWOA 3CP1A 1MOFA 4N21A 1I5YA 1QR9A 4N23A 3K9AA
chains in the Genus database with same CATH superfamily
2RQ6A 3ZMUA 3APQA 1YZBA 4ASUG 4LF6B 1NTKH 3M8AA 2YIAA 2IJJA 1Y66A 1Q82W 4K3AA 4O4JB 1NT2B 3A8TA 1K34A 3F5WC 3AG4B 4QE9A 5ITZB 2CDYA 3RYIB 3K5OA 5H9CA 2FL4A 3ZN0A 5FPRA 5B1OA 1ORQC 3E83A 3ABTA 1N8RW 4O4IB 4PA4A 4UVAA 1RPOA 3H1JH 4DV7B 3CC7V 3Q4HB 3JCUZ 1OCCC 1VF7A 4CS3A 2WLKA 4TQDA 4Q6GA 3HKEA 2IU3A 2Q7EA 2E5LO 2PTMA 4FLWA 2R9RB 3BAAA 1E1RG 4O2AA 3OTOB 1YTFB 2DQ0A 5L3FA 4I4TA 1JMKC 1Q6IA 3RYHB 2QA4V 1D5AA 3F7YC 1B06A 3G4SV 5EC1C 4H44B 4FJCC 1Q3EA 2DQ3A 4ZBMA 2YSUB 1S72V 3SJCC 4WCEV 3X2QC 1XMQO 4B3RB 3AK1A 2KG7A 3CC4V 4L87A 2HHHB 2DWEC 3IJ4A 4GKJB 4MW3A 1OCZC 1SESA 3J81N 3H9VA 5J2TB 4WFAV 1K4DC 2ZR2A 1GN2A 4H37A 2RNBA 1B6QA 4RQFA 5IYBO 1YTFD 4PDVA 2XUMA 3UCSC 4AQYO 2JK5C 3TCUA 1BHAA 1GO3F 3MHSC 3ZRWA 1AJQA 2N04A 3K79A 3T4DA 4DV0O 2VQFB 5D5QA 1Y6XA 5KAFZ 3ZHRA 1O9GA 4OX9O 1GN6A 2JIZG 3K5LA 4B3RO 1Q86W 2QGNA 2ZKOA 4QE7A 2JEUA 4F6RB 4UCVA 2H3OA 2FTKA 3UO3A 2GBOA 1XNRO 5BMVB 5A2QN 1NBMG 4PELA 4B08A 3ABKC 1N4CA 1SZTA 5IJ0A 2Y69B 5FPOA 4ZHQB 1V9PA 2D2CB 2OCCC 3MAQA 2QWPB 3RN4A 5IYZA 4P30A 4UCUA 4BWAA 3ABUA 1FKAO 1H8HG 3M99B 4J42A 1LNQA 3ZCCA 3JATB 1N32B 2C2AA 4WFFA 1N32O 4LF7O 2JDIG 3CJHA 4B7EA 3SJQC 2EINC 4YJ3B 3LUTB 3KKYA 2P22C 2JS3A 5LHIA 2YUAA 4UUJC 5BMVA 5C8YA 2LO1A 5LGTA 3E89A 3GVMA 4UVBA 3HPLC 1I0HA 2LW7A 4O4LB 2ARHA 2Q68A 1MMMA 2QE7G 2EIJB 4DR1B 3E8HA 2QWOB 5KAIZ 3K0DA 3JASA 1N36B 3L72H 4LR3A 3ZRXA 2PI4A 5KA5A 1WLEA 4R50A 1Z2GA 3AG7A 3K03A 3K08A 4O4HB 1XUQA 4JZGA 1Y76A 3B77A 1TVKB 5H5NA 4DV3O 1KU9A 1QR8A 4OPHA 1Q5OA 4IYIA 5LYJA 1XI1A 3D36A 3IC9A 2GTSA 2EIMC 1GRJA 5B66Z 4AQYB 4X62O 2PI5A 1I7FA 1SZXA 2WLLA 3KCXA 2DJVA 5A9GA 5LGNA 5CB4B 3ETGA 4FLTA 2BOBC 3CCRV 2YEVB 3K3WA 4DV6B 1N33O 5B1BB 2JGDA 4WF9V 1Q90D 2R70A 1M93A 5LHHA 2UXBO 1W59A 2A7WA 1JR9A 5DEDA 1L0LH 2W0XA 1K92A 2EILB 4DV4O 2UU9B 5J2TA 3AK2A 3FAVB 3DGEA 1W0JG 1IXBA 2IW5A 3VQWA 2ZE7A 2H8PC 4K0KB 3W7TA 4WFEA 2GTAA 4TV8A 3WB0A 3FAVA 4R8CA 4PDRA 3VQVA 2F43G 3CCSV 1FFXA 3JD2A 3M7MX 1F4NA 2R9AA 1FFTB 1WAZA 3FKSG 1HNZB 1AVMA 2K9PA 3SR2C 1WB8A 1VQ8V 2DW4A 5JVDA 4LFCO 3RBZA 1DLBA 3N2GB 4JYYA 4X20B 1PKXA 2BTQA 4DR7B 2NLJC 2XOKG 1A32A 3JD3A 3G6BA 2NN4A 5CA1B 2DWDC 1VARA 4GCZA 1SRYA 1CPYA 1MSDA 3CPWU 3GWOA 1FXHA 3FB6C 1N34B 1TUBA 1IZ3A 2HKOA 2E74B 2MW2B 4TOIA 4E4EA 1JOYA 2WPDG 1IDSA 3OEHG 3HKCA 4LF5B 1M57C 2QWNB 2YC0A 1VQ7V 3EXAA 4I55B 5LOVA 4DV5B 5JH7B 4DK0A 1H38A 1L1FA 1R6NA 1R6TA 5KHHA 3T1HO 5JQGA 1G4YB 2ZT9B 4OPAA 5B1AC 1IX9A 2Q6AA 1BS3A 3QO8A 1XILA 4GX2A 3RWRD 4LF8B 3QG5A 4UB6Z 1TUEB 4FLYA 2ZD9A 3E22B 3I55V 5IJ9A 4K0KO 3E86A 5L3DA 2B5UA 3BHPA 2HVJC 5CA1A 5GTHZ 2OT5A 4JI7O 3TXQA 5KHJA 2DYSC 4DXWA 2EIKC 2XAFA 2JGDB 3ZJZA 5JCOC 1XDCA 5JCOA 5EBLC 1YJNV 3FX7A 1M57B 1JFFB 3LSSA 1K9MW 1XBLA 2XAHA 5JJNB 4FLUA 3MDSA 1F4MA 5F2VO 4W4LA 4TUYA 3ZX6A 1PNLA 4BIOA 4UV8A 1VQ9V 5KMGB 2HLDG 3ZMSA 5J2UA 4P9OA 3D36C 3CX5F 1SF9A 3F5TA 1HW7A 1P49A 1ZUQA 4CC5A 1WNSA 4JI3B 3RFRA 2YXLA 3MD0A 4DR2B 5KLVH 3BCCH 2Y0PA 1K7DA 3KCYA 3FYIB 3W7UA 3K59A 1MNGA 5KMGA 1VEWA 3RYCA 4FM1A 3OTFA 1VQMV 1N36O 4MVQA 4GZRB 4X64B 4MVZA 3HKBA 2X6BA 1IBMO 1XL6A 5CN0A 5L3GA 4G27B 5HFMA 2E75B 4FFBA 4IHJA 2O57A 2HJFC 4WFGA 5IYDO 3PN1A 4JYAB 1XEQA 1J5EO 2IU0A 3ZMTA 3N2KA 4ZI7A 4I9QA 2YXHA 2UXNA 4QIWF 2YIBA 4KUMA 1IBLB 1TVKA 3K5MA 3A0BZ 1K4CC 1EM1A 3ZHSA 5IYZB 3IFXA 2RDCA 3B2EE 2F4VO 4FM2A 1QU7A 2ZCEA 3WB2A 4DR6B 5LP6B 4KXRA 2E76B 1XHXA 3HKBB 4JASA 3JAMN 3K9AA 3SYQA 2KKWA 1SQXH 3ZRSA 5BR8O 5L3EA 2BCCH 1SQPH 1KP2A 1K5SA 2Q5ZA 3DSQA 3EVKA 3ABLB 1VQPV 4X65B 3S3XA 1KD1W 1KB9F 3ASNB 3T1YB 1S76D 3ZHUA 3JSNA 5LA6B 2IJHA 2N05A 3LDEA 3T2MA 2UUBB 3QVNA 2VS0A 4JI3O 4TWKA 4OX9B 1VP7A 3HR0A 2WSSG 3X2QB 4LFBO 4J7ZA 2Y4TA 2W0FC 3JASB 2ITDC 4K8ZA 4JI5B 5LA6A 3BABA 1WA8A 4BW9A 4B3TO 2ZNJA 1I5XA 2ETNA 5IWAB 4U7NA 4J9ZB 1CEZA 1V54B 3CRMA 1NS1A 5IY5B 3OFNG 4J9YB 3L9DA 4UVCA 2PY5A 4GKKO 4O4JA 5JVDB 1NKDA 2W6IG 2B9ZA 3RT3C 2R72A 2RMKB 4YXWG 2PUSA 3OMIB 1XNRB 4D6TH 1KC8W 3K0GA 1X4TA 1MABG 1L8DA 4JAUA 4DK1A 4FVMA 4KFMA 5DN6G 1NZ6A 4CH4A 1AI7A 4YHHB 3CB2A 4WBNA 1NVPD 2X7RB 4JI6O 2EJ7A 3CYOA 2QM8A 4X1YA 1FXVA 3ETEA 4EB6A 3R66A 3BPZA 4X1KB 3JD4A 3P32A 3AG1B 2A79B 1AI6A 2XHBA 4TT3G 4JI4O 3T1CA 4MT8A 4X1IA 1SA0B 2WLMA 4EFBA 4F6RA 3SPCA 3CP1A 1I94O 2E5LB 4X66B 2F95B 2Y48A 1Y4MA 5IY5C 3LNNA 1HNWB 4Z1VA 4RQEA 4H13B 4DV2B 4GX1A 4JV5B 3ASOB 1BE3H 2B1IA 3SYPA 1L0NH 1YIJV 3SGIA 3AG2B 2AXTZ 2WA4A 4LF9O 2XTAA 2VQEO 1QLNA 4RUEA 1GKFA 5IJ9B 2WLHA 1PL0A 3OMAB 4PA6A 3LDDA 1K97A 3P3NA 3CS5A 2EULA 5CBHA 1VQOV 4MVRA 4IIJB 1WP7A 1NTZH 4X20A 2XAJA 5TISZ 2DE0X 4NR1A 3CCEV 1RSOA 3CXCU 1M56B 4DUYO 1LUVA 3N2KB 3STZC 3W7SA 3RYFA 3BY6A 1SC5B 3CXHF 1HNZO 4CH3A 4DR5O 2Q9LA 2DYSB 1GM7A 3OW2U 2WAMA 1OHHG 4BIUA 2PYLA 5LBQA 4DR6O 2WLNA 1Q43A 3P30A 1BT8A 4MTXA 1G8MA 1R6KA 2BTOA 3B8MA 4I0XB 4K35A 3E8BA 4YJ2B 2BSKA 1HR0B 3UM7A 1LUWA 1AI4A 4DV7O 4NYKA 3BRCA 1R73A 4BR6A 1AR5A 4YY3O 2ZNIA 1FPOA 5IT9N 2YI8A 5JQGB 1YJ9V 2X6AA 4CZZA 5J9PC 3EHBB 2GDSA 2UU9O 3LDCA 2Q69A 3EFFK 2JEXA 4I0XA 4FFKA 2CGOA 3ZMZA 1ZL8B 4PA3A 5E1AC 3D8CA 4CH6A 1XQ8A 1P7GA 3VQXA 3OAAG 4O4IA 5LXTA 4HAMA 1VQNV 3K58A 5IDJA 4FLZA 1XNQB 3H1HH 2V4DA 2ZM6O 3CE2A 3ASNC 4JI5O 2IM9A 2OCHA 1QLEB 2X0LA 4D7SA 4JAAA 1X59A 1K73W 3JATA 2EINB 4JI1B 4L8JA 1WA8B 5CBGA 5KA6A 3ZS8C 5LMNB 2EILC 4LF7B 1VF6C 2Q7GA 4R7CA 1S5LZ 1ZWIC 2NNUA 1LR1A 3HB3B 2ZDIC 1IBKO 1GMGA 3QO5A 3OMNB 3ZHQA 4GX0A 3RVZA 1RM1C 1YDXA 2CE4A 1YHQV 3JD0A 4NTXA 2UUCO 1H2KA 1KYOF 3HKEB 4DUZB 4BW5A 1N0NA 1N0JA 1KUQA 1VQ6V 5KUKA 2YICA 4WFBV 1FS0G 2EZOA 4GLXA 4E2LA 3CHXA 3UT5B 4X64O 3U10A 4UCOA 2ZE8A 1BQ0A 1FFXB 2CAZC 1O9HA 4I9WA 1VQ5V 3H1IH 1K3EA 1HDJA 4LP8A 3ZEDA 2BE3A 2CTRA 4YY3B 1GH6A 3ETQA 1GM8A 3L73H 2QM7A 4H33A 3U11A 4MVUA 2ZR3A 1FXKB 3H1LH 1M90W 3WB1A 1YVWA 4JTDB 3NR7A 1FJGB 4KHPB 5GONB 5B1BC 4LF8O 1OJHA 3AG4C 2OYQA 1S0VA 1KP3A 3TGUH 1Q7YW 2DOSA 3HKCB 2QKSA 2YIDA 2EJRA 4DO2A 1PV0A 4PJ0Z 4TQFA 3ZRVA 3ASOC 4NKGB 5EZYB 2QKAA 1UJWB 1EZJA 1AR4A 4A5UB 3RVYA 4JI7B 4N21A 1T5EA 1H8EG 1V55C 5C93A 4N23A 4GT1A 4CS4A 2VQFO 4PV1B 4I50A 4LWSA 2P7TC 1M1KW 4RWUA 2H94A 2EIKB 2OCCB 1XOUA 4X1YB 3RYHA 3ZIAG 1TAEA 4BIZA 5CB4A 1ZAUA 3G6EV 4B3SB 4H0LB 3CCJV 1WN7A 2CH7B 1NI8A 3LSUA 5DM6V 3ABMB 4LFAB 2HJDA 2YEVA 2LGQA 4X1IB 2UXCO 3L74H 4JTAB 4QNHB 2QSAA 2PF4E 1VQ4V 2A06H 1EBOA 4O2BB 4GKJO 2KG7B 3QNEA 5GW7A 3OR7C 5KHGA 2WLLB 2Y4UA 3L75H 4LC1A 4YHHO 2EZPA 5EIBC 2Z0AA 3UKMA 5ITZA 1Q6HA 1JX9A 4KP4A 1VMGA 5LL6Y 3ZBHA 1PD3A 1N34O 4TV8B 2AZ2A 2DMXA 4EFEA 1FXKA 3J80N 2B1GA 4Z1MG 3HKDB 2LFRA 2UUAO 4O4HA 2ZIMA 3E8GA 3L70H 5KX5A 4O4LA 4DR7O 3JSLA 1COWG 4LFCB 3RYFB 4K8XA 2JJ1G 2CH7A 3N2GA 1YITV 3TJTA 1I94B 3AG3B 3CRCA 4I5SA 4PA9A 3E22A 1DF4A 2WLIA 3W7WA 4I4TB 4JAVA 1ROPA 3CRRA 2ODMA 1K8AW 3F7VC 5L3CA 3G80A 2BSKB 4X1KA 3OR6C 4IL6Z 1OCRC 3ABKB 4DV3B 2F23A 3OM3B 3G67A 2P90A 5FLXN 3C3SA 5AG2A 3T1YO 4UV9A 4DV1B 4J11A 4DV4B 3T4ZA 5C8YB 3B8NA 3K57A 2HVKC 4QGPA 2UXBB 4RUFA 4CBCA 4GKKB 2JJ2G 2XAQA 1N33B 4GX5A 4BAYA 2L35A 1KMIZ 5H2FZ 3OTOO 1SETA 2XASA 1HP8A 1M9NA 4FZ0A 4LH6A 3AK3A 4LFAO 2LFSA 5BY1A 4B3SO 4KHPO 1UFIA 3CJHB 5JH7A 2F66C 3L71H 4G28B 3SYOA 4ABMA 1RP3B 3FB7C 2E3CA 3AG2C 1BL8A 4QPJA 3C90A 5CA3A 2P6JA 1VIBA 2JVDA 3BA9A 1AP5A 1BMFG 1S77D 5EYPA 2CTPA 4I7ZB 4HNAA 2BOCC 3DTUB 4QPKA 2ZIOA 1DK1A 3JYCA 1J95A 2QJ1A 5L3BA 3ZHVA 4DR3O 4DR4O 2RN9A 2IJKA 5J2UB 4EKWA 2QDOA 1F51A 4LF4B 3LSQA 3JARA 4HNAB 1JJOA 1CXZB 4TV9B 1IBKB 3K5NA 1NVPB 5LGUA 1FJGO 1ZL8A 4PA7A 2G38A 1AROP 5B1AB 2FMLA 2XT9A 1DTOA 1OCZB 1IBLO 4GYCB 5LMNO 3VBBA 4MS2A 2FB5A 5K1PA 4MTFA 3O65A 3FD9A 3SPJA 3JARB 5DECA 4DV0B 5B5EZ 1PNMA 1Z5WA 4XBFA 4LF4O 1P7BA 1HR0O 1H2GA 1MA1A 4FZ1A 4JYAO 5K1XA 3DXRB 1IXMA 1XHZA 2CUGA 4MVSA 1EN6A 3BFRA 4FFBB 4IHJB 2Y0IA 3GWKC 2Q0OC 1P84F 1XMOB 3GB7C 4NB5A 4ZHQA 5B3SB 4J10A 3OGIB 2UUCB 3H01A 3BA8A 2UUAB 1M56C 2F93B 1NR7A 1YF2A 2Y69C 3CWBH 2DN9A 1KKDA 4U3JA 3ICXA 2K1EA 3CCUV 1YXBA 3SYCA 5KX5B 1P4RA 4DV1O 4EEQA 2AGAA 1U97A 2Q0AA 4UCSA 5LMUB 2CTWA 1YEWA 2AW9A 1MZEA 3J7AU 3VOUA 1BCCH 2P5OA 2XNDG 4LCUC 4NTYA 4ZI7B 4CS2A 1NR1A 2Z3YA 3ZN1A 2FKXA 5H6QA 2GHYA 1JJ2U 1RPRA 4JTCB 4ZOLA 1PPJH 3K9SA 2ZXWC 3TK1A 1NH2B 1Q8IA 2ZE5A 4FM0A 2M6YA 4ICGA 1WB7A 4XDKA 3A0RA 4Z2WA 3LNMB 1AP6A 2ZE6A 1QHTA 4PI2A 3VQYA 3DC6A 2QKCA 4ZKIA 4JI6B 1NTMH 3R65A 5LOVB 4DW0A 4U3JB 2WWWA 1W0KG 2ILMA 4TSFG 2WLJA 1ZX3A 1B04A 4B7KA 1DGSA 3RYCB 3RW0A 1QLEC 2ZDIA 1DF5A 4NXMB 2P67A 1AJNA 2PGGA 2GV9A 2UXDB 2L6LA 5EZYA 1GTOA 3DXRA 3SPHA 1MZFA 1SQBH 4TUYB 1I5YA 1JA8A 1SQQH 3SPIA 3E2EA 4DR5B 2UXCB 1IURA 4J7KA 1S5HC 4QJFB 1SS3A 4JGSA 2PZSA 3ETDA 1H2SB 4I55A 4C7UA 4DUYB 4DV5O 4LNUB 3CC2V 5EIBD 5JJJB 4YJ3A 4LF5O 4UFZA 3QO7A 4NXMO 4NVPA 4FPPA 2QTOA 1XMQB 3MHHC 1OCOB 4HZ3A 3JD1A 3NXSA 3JAWA 2DYRC 1ZSPA 3FFQA 1QVGU 2IBZH 2R9IA 2GSMB 3U0ZA 4IT5A 5HFLA 1EN5A 1OCCB 1VF5B 1F23A 1VF6A 4W4KA 1RSOB 1YI2V 1I08A 1VQKV 4FLVA 1XREA 2A3QA 5IYCO 1CP9A 4DV6O 3TXSA 4YIOA 3DC5A 2LP7A 4U3FH 1HNWO 4HBNA 1R3JC 5EYPB 3FB5C 5BR8B 3AG1C 2EIJC 5IJ0B 1EZVH 3K06A 1BGYH 1URFA 1Z5VA 2QR4A 2Q4PA 1SQGA 5BXZA 3CCMV 3THOA 3IC7A 5JWPA 4LFBB 1M4UA 4FLXA 4F4LA 3CD6V 4DRXA 2IJIA 2M7WA 1SKVA 2HR3A 1XL4A 1NQTA 3SYAA 1BZKA 1OCOC 4ZOLB 2KSDA 2AHYA 3JALB 3JAWB 1QVFU 3SJBC 3OUSA 4HYOA 3WU2Z 1JPXA 1MSWD 4LF6O 5FL7G 2YS8A 1B3QA 3KZIZ 2ZM6B 1Y74A 2RJZA 5LXTB 4X66O 1XMOO 1JVMA 1XNQO 4J80A 4MVOA 3FYEB 1MOFA 2OIGA 4JI8B 2P4KA 1IBMB 4EB6B 2ZQMA 2NR5A 1QCEA 4DUZO 4OGQB 2YDEA 2W6JG 4X62B 2IH1C 4JI0B 2QEXV 4J7JA 3H1KH 4LNUA 1SA0A 5JJEB 4LBEC 2QWRB 1WJZA 1KBHA 1E79G 2A9HA 5CBFA 1Y76B 3JAKA 2ADQB 2P06A 4DYLA 1JQ0A 3OD4A 1TA8A 4JI1O 3CCQV 3IGAC 1JCHA 1HNXB 3OUFA 2OIEA 1E1QG 3BEHA 4J41A 2FYUH 1WPBA 1Y74B 2CK3G 3ABMC 4UXNA 2PYJA 3CCVV 5EC2C 2ZXWB 2MK3A 3OT7A 3WFVA 1D5NA 5B1NA 1W2BU 2V1DA 3FB8C 2CGNA 5EBMC 2KB1A 1HWYA 3IAYA 2V7QG 4X88A 4XDJA 3CMEV 4U7OA 3CEIA 5KHKA 4WBNB 2YI9A 1D2DA 4IIJA 4LF9B 4IGGA 3JALA 4YIPA 1US6A 1G6UA 2ITCC 5GONA 2QTSA 2AHZA 1PNKA 4PI0A 4PDLA 2RCVA 1FYJA 5LP6A 4DRXB 2OWOA 3AEIA 2LQTA 4LH7A 3CSXA 4JI4B 3HKDA 3APOA 1AJPA 3CRQA 4CH5A 2P4VA 4YJ2A 2HFEC 3ZMVA 4B3MO 2Q73A 2GUZB 4DW1A 1S3JA 2ZINA 4JI2B 1TGOA 4NTWA 4KL1A 1AI5A 2QWQB 5BZBA 1QQCA 3E8FA 3S3WA 1NU1H 1KQSU 1M5IA 3N27A 4AHCA 1H2LA 4MSWC 3G71V 4NXNB 4JI2O 3D3QA 3SPGA 5FNVB 2X6CA 4B3MB 5IE9A 1QBZA 4UCTA 4DV2O 4JV5O 3K04A 2D3OW 4X89A 4Q20A 1Y67A 1H2MA 3CMAV 4UCRA 3UO2A 3UQ8A 5FNVA 1BSMA 4PDMA 1U96A 4XDLA 4X8AA 2UXDO 4PD4F 1RM1B 5LP6C 3TETA 1G1XB 1VQLV 1FD9A 2JGUA 2EIMB 3B4SA 4MW8A 2HHHO 4MTGA 1ENVA 4NXNO 4F6EA 1QNMA 3KG2A 1FAFA 3Q4HA 2VQEB 1ZLZA 1ZTEA 4FK5C 4X65O 2JRIA 1WP8A 3A0HZ 2BTQB 3AG3C 2EX3A 3O9OA 4WFHA 5KHIA 1K5QA 2HP8A 2UXXA 3B40A 4O2AB 2ADPA 2XAGA 1NH2D 1JFFA 2IH3C 1AB3A 3SDLA 4JYCA 1IVSA 3P3PA 5IWAO 1PM9A 4B3TB 3WG7C 1HNXO 2LGWA 1GM9A 1SERA 1AR1B 1EN4A 3C3TA 1S5JA 4MVMA 2WA3A 4AILC 2OTJV 1Q6UA 2QM4A 3OGCC 4X9QA 2UUBO 3STLC 4RO2A 2Q8VA 4JYBA 4GUNA 1V54C 1R3IC 4TV9A 4AI8A 3I56V 4OXSA 3OEEG 1EFRG 3B09A 3ML0A 2AZ0A 2Z5UA 3PJSK 4DR3B 4DR4B 2N74A 4FIPC 2A0LA 1WPXA 2LJ2A 2Q67A 1R3KC 3WG7B 1UPGA 1YSCA 3CCLV 4R6ZA 3ZHTA 1SQVH 5H6RA 2F1MA 3ABLC 1V55B 2F4VB 1F7YA 1R3LC 3QTCA 1GAXA 4IYHA 4DR2O 1GN4A 5LMUO 4JZ2A 5KUMA 3A2FA 1Q81W 4O2BA 3JAKB 4P2ZA 4G2KA 4D7TA 2DYRB 2ATKC 3CRAA 1OZ0A 4RAIA 3ZRWB 3RGBA 1BQZA 5D5PA 3SJAC 2YXYA 1AILA 1BHBA 1KKCA 2GUZA 3BVOA 2VWJA 1MG1A 4DR1O 2CTQA 2VWKA 3D3IA 1YJWV 2JS5A 2LW1A 4JI8O 1OV9A 5GTIZ 1YCIA 3I5DA 1PL4A 4P9PA 5CMUA 1FXKC 3W7XA 5LHGA 3OE7G 3RYIA 3JCZA 4JF3A 1RFYA 4ZIBA 5EK0A 5CA0A 1GN3A 2HEPA 5B3SC 4I50B 4LWSB 5LYJB 4PHZA 2WLIB 5E79Z 3QF7A 1THZA 3UT5A 1R1BA 1H2NA 1J5EB 1OCRB 1KECA 4JI0O 4FMTA 5EBWC 4MTOA 2VRZA 5CA0B 3E35A 1PP9H 4UB8Z 2EBOA 2Q7HA 4JPRA 1K33A 2OTLV 1SQFA 1NJIW 1TUBB 1GK9A 2KQXA 2HG5C 4CC6A 3T1HB 1QR9A 2YIBD
chains in the Genus database with same CATH topology
3ZMUA 1KP3A 1PNLA 4ASUG 4UV8A 3CCMV 1Q7YW 2IJJA 1Y66A 2QKSA 1Q82W 3IC7A 1VQ9V 2HLDG 2EJRA 1K34A 3ZMSA 4DO2A 3F5WC 3AG4B 4P9OA 3ZRVA 4QE9A 3ASOC 4F4LA 3CD6V 2IJIA 1UJWB 1EZJA 5H9CA 2M7WA 2HR3A 3ZN0A 1XL4A 5B1OA 1ORQC 1NQTA 3E83A 3RVYA 3MD0A 3ABTA 4N21A 1H8EG 1K7DA 1V55C 3SYAA 4N23A 1OCOC 4GT1A 5C93A 1N8RW 3FYIB 2AHYA 3W7UA 4PA4A 4UVAA 1RPOA 1QVFU 2P7TC 3OUSA 3CC7V 4HYOA 1M1KW 2H94A 1OCCC 2EIKB 2OCCB 1VQMV 1JPXA 4MVQA 2WLKA 3ZIAG 1MSWD 5FL7G 4BIZA 4MVZA 3G6EV 3CCJV 2X6BA 1JVMA 3ABMB 5DM6V 2IU3A 1XL6A 5CN0A 2YEVA 4G27B 5L3GA 5HFMA 4MVOA 3FYEB 1MOFA 4JTAB 4QNHB 2R9RB 1E1RG 1YTFB 1VQ4V 2DQ0A 5L3FA 2ZQMA 1EBOA 2HJFC 1QCEA 4WFGA 5IYDO 2QA4V 2W6JG 3F7YC 3QNEA 2IH1C 5GW7A 3G4SV 3OR7C 5EC1C 2QEXV 2IU0A 3ZMTA 2WLLB 4FJCC 2UXNA 4LBEC 4LC1A 2EZPA 2DQ3A 4QIWF 4ZBMA 3UKMA 2YSUB 1S72V 1E79G 4WCEV 2A9HA 4KUMA 1JX9A 4KP4A 5CBFA 3X2QC 1PD3A 1JQ0A 1FXKA 3CC4V 4L87A 2B1GA 3CCQV 1K4CC 4Z1MG 2DWEC 2LFRA 3IGAC 3IFXA 1JCHA 3E8GA 3OUFA 4MW3A 1OCZC 1SESA 1E1QG 4WFAV 1K4DC 2ZR2A 3BEHA 1COWG 4H37A 1B6QA 2CK3G 2JJ1G 3ABMC 4JASA 4RQFA 1YITV 4UXNA 3CCVV 3K9AA 5IYBO 3AG3B 5EC2C 2ZXWB 2MK3A 3SYQA 1YTFD 4PDVA 3ZRSA 4I5SA 4PA9A 3WFVA 1DF4A 5L3EA 5B1NA 2WLIA 2JK5C 1W2BU 3TCUA 1KP2A 1BHAA 1GO3F 3W7WA 1K5SA 2V1DA 3FB8C 4JAVA 1ROPA 2KB1A 1HWYA 3ABLB 3MHSC 5EBMC 3F7VC 3ZRWA 5L3CA 1VQPV 1K8AW 1AJQA 3K79A 3T4DA 2V7QG 4X88A 1KD1W 4XDJA 3OR6C 3ASNB 3CMEV 1OCRC 1S76D 3ABKB 4U7OA 2IJHA 2JIZG 3LDEA 3OM3B 3T2MA 2P90A 1Q86W 4TWKA 4QE7A 2JEUA 2FTKA 2WSSG 4UV9A 3X2QB 3T4ZA 2ITCC 1NBMG 2W0FC 2ITDC 4PELA 3B8NA 2AHZA 2HVKC 1PNKA 3ABKC 4RUFA 4PDLA 1SZTA 1I5XA 4CBCA 2JJ2G 2XAQA 4GX5A 4U7NA 2Y69B 4J9ZB 4BAYA 1CEZA 1SETA 1V54B 3AEIA 2XASA 5IY5B 2OCCC 1M9NA 3OFNG 4J9YB 4UVCA 2LFSA 1NKDA 1AJPA 2W6IG 2HFEC 4P30A 3ZMVA 4YXWG 1S3JA 3ABUA 4G28B 3SYOA 3OMIB 1AI5A 1H8HG 3M99B 1LNQA 1KC8W 3ZCCA 3K0GA 5BZBA 1MABG 3FB7C 3E8FA 4JAUA 3AG2C 4KFMA 2C2AA 5DN6G 1KQSU 4WFFA 1BL8A 4QPJA 1AI7A 5CA3A 2JDIG 4MSWC 3G71V 1NVPD 2X7RB 3CYOA 2P6JA 3SJQC 2QM8A 2EINC 3SPGA 2X6CA 1FXVA 3LUTB 3ETEA 5LHIA 1BMFG 4UUJC 1S77D 3JD4A 1QBZA 3P32A 3K04A 5LGTA 3AG1B 3E89A 4X89A 2D3OW 2A79B 2BOCC 3DTUB 4Q20A 1AI6A 3HPLC 4QPKA 4TT3G 4UVBA 3T1CA 4MT8A 2WLMA 3JYCA 1J95A 2Q68A 3CMAV 3SPCA 3CP1A 2QE7G 2EIJB 2Y48A 4PDMA 5L3BA 1Y4MA 3E8HA 4XDLA 4X8AA 3K0DA 5IY5C 1RM1B 2IJKA 4EKWA 3TETA 4RQEA 1F51A 3LSQA 4GX1A 3ASOB 2B1IA 3SYPA 3ZRXA 1VQLV 2PI4A 1YIJV 2EIMB 4MW8A 5KA5A 3AG2B 1WLEA 5LGUA 1NVPB 4R50A 3K03A 3K08A 4PA7A 1AROP 1QLNA 4MTGA 4RUEA 5B1AB 1GKFA 1ENVA 2WLHA 1PL0A 1DTOA 3OMAB 3B77A 3LDDA 1OCZB 4PA6A 1K97A 3KG2A 3VBBA 4MS2A 4MTFA 1QR8A 3SPJA 3D36A 5CBHA 1VQOV 4MVRA 4FK5C 1PNMA 2EIMC 4XBFA 1P7BA 3AG3C 2XAJA 1H2GA 4WFHA 3CCEV 1K5QA 3CXCU 2PI5A 1M56B 1IXMA 2UXXA 2WLLA 3STZC 3W7SA 4MVSA 3BY6A 5LGNA 2XAGA 1NH2D 2IH3C 4WFBV 2DYSB 3ETGA 1GM7A 2BOBC 3CCRV 2YEVB 4JYCA 2WAMA 1OHHG 3GB7C 4BIUA 3OW2U 3K3WA 5LBQA 2WLNA 3P30A 4MTXA 5B1BB 4WF9V 1G8MA 1R6KA 5B3SB 5LHHA 3WG7C 3H01A 1M56C 3B8MA 1GM9A 1SERA 1NR7A 3E8BA 2Y69C 1AR1B 3UM7A 1KKDA 1AI4A 1K92A 2EILB 2K1EA 3CCUV 3SYCA 4MVMA 1P4RA 1R73A 2OTJV 3DGEA 1W0JG 2IW5A 1YJ9V 3OGCC 2X6AA 4CZZA 5J9PC 3EHBB 2H8PC 3STLC 3W7TA 3VOUA 3LDCA 2Q69A 3EFFK 2JEXA 4RO2A 2XNDG 4LCUC 4WFEA 4JYBA 1V54C 1R3IC 3I56V 1NR1A 4OXSA 3ZMZA 2Z3YA 3ZN1A 4PA3A 3OEEG 5E1AC 5H6QA 1EFRG 2GHYA 4R8CA 1JJ2U 1RPRA 3ML0A 2Z5UA 3PJSK 4PDRA 2F43G 4JTCB 3CCSV 3JD2A 4FIPC 1F4NA 1FFTB 3OAAG 2A0LA 1WPXA 3FKSG 4HAMA 2Q67A 1VQNV 5IDJA 1R3KC 2ZXWC 3TK1A 3WG7B 1NH2B 4XDKA 1VQ8V 2DW4A 1YSCA 3A0RA 3CCLV 3RBZA 4R6ZA 1DLBA 5H6RA 1PKXA 3LNMB 3ABLC 2NLJC 3ASNC 2XOKG 1V55B 1QLEB 2X0LA 3JD3A 1R3LC 1K73W 4ZKIA 2DWDC 2EINB 4GCZA 3R65A 5CBGA 1SRYA 1CPYA 5KA6A 2EILC 3CPWU 2WWWA 3GWOA 1FXHA 3FB6C 1W0KG 4TSFG 2WLJA 4R7CA 5KUMA 1ZWIC 2HKOA 2NNUA 1Q81W 3RW0A 3HB3B 2ZDIC 4P2ZA 4G2KA 1QLEC 2ZDIA 1DF5A 2DYRB 1GMGA 3QO5A 3OMNB 2ATKC 1JOYA 2WPDG 1OZ0A 2P67A 3OEHG 4GX0A 4RAIA 3ZRWB 3RVZA 1AJNA 1RM1C 1M57C 1YHQV 3JD0A 1VQ7V 1BHBA 1MG1A 1H38A 1L1FA 4BW5A 1GTOA 3SPHA 1R6NA 3D3IA 1YJWV 1G4YB 5B1AC 2Q6AA 1I5YA 3SPIA 3E2EA 3QO8A 1VQ6V 1S5HC 5KUKA 4QJFB 4JGSA 4GX2A 1TUEB 4P9PA 5CMUA 1FXKC 1FS0G 2EZOA 2ZD9A 3ETDA 3OE7G 5LHGA 3W7XA 4E2LA 3I55V 3CC2V 3JCZA 4JF3A 3QO7A 4I9WA 3E86A 1VQ5V 1K3EA 5L3DA 2B5UA 2QTOA 4FPPA 5EK0A 3MHHC 2HVJC 4LP8A 1OCOB 2OT5A 4HZ3A 5B3SC 3JD1A 3NXSA 2DYRC 1QVGU 1GM8A 2QM7A 4H33A 4MVUA 2R9IA 2WLIB 2ZR3A 1FXKB 2GSMB 2DYSC 1THZA 5HFLA 4DXWA 1M90W 1OCCB 2EIKC 4JTDB 1F23A 2XAFA 1OCRB 1KECA 4FMTA 1YI2V 1VQKV 3ZJZA 5EBWC 4MTOA 5EBLC 5B1BC 3E35A 1YJNV 5IYCO 1CP9A 1M57B 2EBOA 2LP7A 3AG4C 4JPRA 3LSSA 1K9MW 1K33A 2OTLV 1R3JC 2XAHA 3FB5C 3AG1C 2EIJC 1NJIW 1GK9A 1F4MA 3K06A 2HG5C 1QR9A 1S0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QR8 A;  2MK3 A;  1Y4M A;  5HFL A;  4JGS A;  3P30 A;  1DLB A;  1JQ0 A;  3WFV A;  1EBO A;  2X7R B;  4FK5 C;  1DF4 A;  1QCE A;  4G2K A;  5CMU A;  2EZO A;  1DF5 A;  1F23 A;  2P6J A;  3CYO A;  4E2L A;  1Y66 A;  3H01 A;  3B8M A;  3B8N A;  1K34 A;  3MHS C;  1JPX A;  4FJC C;  5KA5 A;  1QBZ A;  4JF3 A;  1MG1 A;  2EBO A;  2LP7 A;  1SZT A;  2EZP A;  3M99 B;  1I5X A;  4JPR A;  5H9C A;  1K33 A;  3MHH C;  1ENV A;  2M7W A;  4FIP C;  5KA6 A;  5CN0 A;  5HFM A;  3B77 A;  2OT5 A;  3GWO A;  3CP1 A;  1MOF A;  4N21 A;  1I5Y A;  1QR9 A;  4N23 A;  3K9A A; 
#chains in the Genus database with same CATH topology
 2RQ6 A;  3ZMU A;  3APQ A;  1YZB A;  4ASU G;  4LF6 B;  1NTK H;  3M8A A;  2YIA A;  2IJJ A;  1Y66 A;  1Q82 W;  4K3A A;  4O4J B;  1NT2 B;  3A8T A;  1K34 A;  3F5W C;  3AG4 B;  4QE9 A;  5ITZ B;  2CDY A;  3RYI B;  3K5O A;  5H9C A;  2FL4 A;  3ZN0 A;  5FPR A;  5B1O A;  1ORQ C;  3E83 A;  3ABT A;  1N8R W;  4O4I B;  4PA4 A;  4UVA A;  1RPO A;  3H1J H;  4DV7 B;  3CC7 V;  3Q4H B;  3JCU Z;  1OCC C;  1VF7 A;  4CS3 A;  2WLK A;  4TQD A;  4Q6G A;  3HKE A;  2IU3 A;  2Q7E A;  2E5L O;  2PTM A;  4FLW A;  2R9R B;  3BAA A;  1E1R G;  4O2A A;  3OTO B;  1YTF B;  2DQ0 A;  5L3F A;  4I4T A;  1JMK C;  1Q6I A;  3RYH B;  2QA4 V;  1D5A A;  3F7Y C;  1B06 A;  3G4S V;  5EC1 C;  4H44 B;  4FJC C;  1Q3E A;  2DQ3 A;  4ZBM A;  2YSU B;  1S72 V;  3SJC C;  4WCE V;  3X2Q C;  1XMQ O;  4B3R B;  3AK1 A;  2KG7 A;  3CC4 V;  4L87 A;  2HHH B;  2DWE C;  3IJ4 A;  4GKJ B;  4MW3 A;  1OCZ C;  1SES A;  3J81 N;  3H9V A;  5J2T B;  4WFA V;  1K4D C;  2ZR2 A;  1GN2 A;  4H37 A;  2RNB A;  1B6Q A;  4RQF A;  5IYB O;  1YTF D;  4PDV A;  2XUM A;  3UCS C;  4AQY O;  2JK5 C;  3TCU A;  1BHA A;  1GO3 F;  3MHS C;  3ZRW A;  1AJQ A;  2N04 A;  3K79 A;  3T4D A;  4DV0 O;  2VQF B;  5D5Q A;  1Y6X A;  5KAF Z;  3ZHR A;  1O9G A;  4OX9 O;  1GN6 A;  2JIZ G;  3K5L A;  4B3R O;  1Q86 W;  2QGN A;  2ZKO A;  4QE7 A;  2JEU A;  4F6R B;  4UCV A;  2H3O A;  2FTK A;  3UO3 A;  2GBO A;  1XNR O;  5BMV B;  5A2Q N;  1NBM G;  4PEL A;  4B08 A;  3ABK C;  1N4C A;  1SZT A;  5IJ0 A;  2Y69 B;  5FPO A;  4ZHQ B;  1V9P A;  2D2C B;  2OCC C;  3MAQ A;  2QWP B;  3RN4 A;  5IYZ A;  4P30 A;  4UCU A;  4BWA A;  3ABU A;  1FKA O;  1H8H G;  3M99 B;  4J42 A;  1LNQ A;  3ZCC A;  3JAT B;  1N32 B;  2C2A A;  4WFF A;  1N32 O;  4LF7 O;  2JDI G;  3CJH A;  4B7E A;  3SJQ C;  2EIN C;  4YJ3 B;  3LUT B;  3KKY A;  2P22 C;  2JS3 A;  5LHI A;  2YUA A;  4UUJ C;  5BMV A;  5C8Y A;  2LO1 A;  5LGT A;  3E89 A;  3GVM A;  4UVB A;  3HPL C;  1I0H A;  2LW7 A;  4O4L B;  2ARH A;  2Q68 A;  1MMM A;  2QE7 G;  2EIJ B;  4DR1 B;  3E8H A;  2QWO B;  5KAI Z;  3K0D A;  3JAS A;  1N36 B;  3L72 H;  4LR3 A;  3ZRX A;  2PI4 A;  5KA5 A;  1WLE A;  4R50 A;  1Z2G A;  3AG7 A;  3K03 A;  3K08 A;  4O4H B;  1XUQ A;  4JZG A;  1Y76 A;  3B77 A;  1TVK B;  5H5N A;  4DV3 O;  1KU9 A;  1QR8 A;  4OPH A;  1Q5O A;  4IYI A;  5LYJ A;  1XI1 A;  3D36 A;  3IC9 A;  2GTS A;  2EIM C;  1GRJ A;  5B66 Z;  4AQY B;  4X62 O;  2PI5 A;  1I7F A;  1SZX A;  2WLL A;  3KCX A;  2DJV A;  5A9G A;  5LGN A;  5CB4 B;  3ETG A;  4FLT A;  2BOB C;  3CCR V;  2YEV B;  3K3W A;  4DV6 B;  1N33 O;  5B1B B;  2JGD A;  4WF9 V;  1Q90 D;  2R70 A;  1M93 A;  5LHH A;  2UXB O;  1W59 A;  2A7W A;  1JR9 A;  5DED A;  1L0L H;  2W0X A;  1K92 A;  2EIL B;  4DV4 O;  2UU9 B;  5J2T A;  3AK2 A;  3FAV B;  3DGE A;  1W0J G;  1IXB A;  2IW5 A;  3VQW A;  2ZE7 A;  2H8P C;  4K0K B;  3W7T A;  4WFE A;  2GTA A;  4TV8 A;  3WB0 A;  3FAV A;  4R8C A;  4PDR A;  3VQV A;  2F43 G;  3CCS V;  1FFX A;  3JD2 A;  3M7M X;  1F4N A;  2R9A A;  1FFT B;  1WAZ A;  3FKS G;  1HNZ B;  1AVM A;  2K9P A;  3SR2 C;  1WB8 A;  1VQ8 V;  2DW4 A;  5JVD A;  4LFC O;  3RBZ A;  1DLB A;  3N2G B;  4JYY A;  4X20 B;  1PKX A;  2BTQ A;  4DR7 B;  2NLJ C;  2XOK G;  1A32 A;  3JD3 A;  3G6B A;  2NN4 A;  5CA1 B;  2DWD C;  1VAR A;  4GCZ A;  1SRY A;  1CPY A;  1MSD A;  3CPW U;  3GWO A;  1FXH A;  3FB6 C;  1N34 B;  1TUB A;  1IZ3 A;  2HKO A;  2E74 B;  2MW2 B;  4TOI A;  4E4E A;  1JOY A;  2WPD G;  1IDS A;  3OEH G;  3HKC A;  4LF5 B;  1M57 C;  2QWN B;  2YC0 A;  1VQ7 V;  3EXA A;  4I55 B;  5LOV A;  4DV5 B;  5JH7 B;  4DK0 A;  1H38 A;  1L1F A;  1R6N A;  1R6T A;  5KHH A;  3T1H O;  5JQG A;  1G4Y B;  2ZT9 B;  4OPA A;  5B1A C;  1IX9 A;  2Q6A A;  1BS3 A;  3QO8 A;  1XIL A;  4GX2 A;  3RWR D;  4LF8 B;  3QG5 A;  4UB6 Z;  1TUE B;  4FLY A;  2ZD9 A;  3E22 B;  3I55 V;  5IJ9 A;  4K0K O;  3E86 A;  5L3D A;  2B5U A;  3BHP A;  2HVJ C;  5CA1 A;  5GTH Z;  2OT5 A;  4JI7 O;  3TXQ A;  5KHJ A;  2DYS C;  4DXW A;  2EIK C;  2XAF A;  2JGD B;  3ZJZ A;  5JCO C;  1XDC A;  5JCO A;  5EBL C;  1YJN V;  3FX7 A;  1M57 B;  1JFF B;  3LSS A;  1K9M W;  1XBL A;  2XAH A;  5JJN B;  4FLU A;  3MDS A;  1F4M A;  5F2V O;  4W4L A;  4TUY A;  3ZX6 A;  1PNL A;  4BIO A;  4UV8 A;  1VQ9 V;  5KMG B;  2HLD G;  3ZMS A;  5J2U A;  4P9O A;  3D36 C;  3CX5 F;  1SF9 A;  3F5T A;  1HW7 A;  1P49 A;  1ZUQ A;  4CC5 A;  1WNS A;  4JI3 B;  3RFR A;  2YXL A;  3MD0 A;  4DR2 B;  5KLV H;  3BCC H;  2Y0P A;  1K7D A;  3KCY A;  3FYI B;  3W7U A;  3K59 A;  1MNG A;  5KMG A;  1VEW A;  3RYC A;  4FM1 A;  3OTF A;  1VQM V;  1N36 O;  4MVQ A;  4GZR B;  4X64 B;  4MVZ A;  3HKB A;  2X6B A;  1IBM O;  1XL6 A;  5CN0 A;  5L3G A;  4G27 B;  5HFM A;  2E75 B;  4FFB A;  4IHJ A;  2O57 A;  2HJF C;  4WFG A;  5IYD O;  3PN1 A;  4JYA B;  1XEQ A;  1J5E O;  2IU0 A;  3ZMT A;  3N2K A;  4ZI7 A;  4I9Q A;  2YXH A;  2UXN A;  4QIW F;  2YIB A;  4KUM A;  1IBL B;  1TVK A;  3K5M A;  3A0B Z;  1K4C C;  1EM1 A;  3ZHS A;  5IYZ B;  3IFX A;  2RDC A;  3B2E E;  2F4V O;  4FM2 A;  1QU7 A;  2ZCE A;  3WB2 A;  4DR6 B;  5LP6 B;  4KXR A;  2E76 B;  1XHX A;  3HKB B;  4JAS A;  3JAM N;  3K9A A;  3SYQ A;  2KKW A;  1SQX H;  3ZRS A;  5BR8 O;  5L3E A;  2BCC H;  1SQP H;  1KP2 A;  1K5S A;  2Q5Z A;  3DSQ A;  3EVK A;  3ABL B;  1VQP V;  4X65 B;  3S3X A;  1KD1 W;  1KB9 F;  3ASN B;  3T1Y B;  1S76 D;  3ZHU A;  3JSN A;  5LA6 B;  2IJH A;  2N05 A;  3LDE A;  3T2M A;  2UUB B;  3QVN A;  2VS0 A;  4JI3 O;  4TWK A;  4OX9 B;  1VP7 A;  3HR0 A;  2WSS G;  3X2Q B;  4LFB O;  4J7Z A;  2Y4T A;  2W0F C;  3JAS B;  2ITD C;  4K8Z A;  4JI5 B;  5LA6 A;  3BAB A;  1WA8 A;  4BW9 A;  4B3T O;  2ZNJ A;  1I5X A;  2ETN A;  5IWA B;  4U7N A;  4J9Z B;  1CEZ A;  1V54 B;  3CRM A;  1NS1 A;  5IY5 B;  3OFN G;  4J9Y B;  3L9D A;  4UVC A;  2PY5 A;  4GKK O;  4O4J A;  5JVD B;  1NKD A;  2W6I G;  2B9Z A;  3RT3 C;  2R72 A;  2RMK B;  4YXW G;  2PUS A;  3OMI B;  1XNR B;  4D6T H;  1KC8 W;  3K0G A;  1X4T A;  1MAB G;  1L8D A;  4JAU A;  4DK1 A;  4FVM A;  4KFM A;  5DN6 G;  1NZ6 A;  4CH4 A;  1AI7 A;  4YHH B;  3CB2 A;  4WBN A;  1NVP D;  2X7R B;  4JI6 O;  2EJ7 A;  3CYO A;  2QM8 A;  4X1Y A;  1FXV A;  3ETE A;  4EB6 A;  3R66 A;  3BPZ A;  4X1K B;  3JD4 A;  3P32 A;  3AG1 B;  2A79 B;  1AI6 A;  2XHB A;  4TT3 G;  4JI4 O;  3T1C A;  4MT8 A;  4X1I A;  1SA0 B;  2WLM A;  4EFB A;  4F6R A;  3SPC A;  3CP1 A;  1I94 O;  2E5L B;  4X66 B;  2F95 B;  2Y48 A;  1Y4M A;  5IY5 C;  3LNN A;  1HNW B;  4Z1V A;  4RQE A;  4H13 B;  4DV2 B;  4GX1 A;  4JV5 B;  3ASO B;  1BE3 H;  2B1I A;  3SYP A;  1L0N H;  1YIJ V;  3SGI A;  3AG2 B;  2AXT Z;  2WA4 A;  4LF9 O;  2XTA A;  2VQE O;  1QLN A;  4RUE A;  1GKF A;  5IJ9 B;  2WLH A;  1PL0 A;  3OMA B;  4PA6 A;  3LDD A;  1K97 A;  3P3N A;  3CS5 A;  2EUL A;  5CBH A;  1VQO V;  4MVR A;  4IIJ B;  1WP7 A;  1NTZ H;  4X20 A;  2XAJ A;  5TIS Z;  2DE0 X;  4NR1 A;  3CCE V;  1RSO A;  3CXC U;  1M56 B;  4DUY O;  1LUV A;  3N2K B;  3STZ C;  3W7S A;  3RYF A;  3BY6 A;  1SC5 B;  3CXH F;  1HNZ O;  4CH3 A;  4DR5 O;  2Q9L A;  2DYS B;  1GM7 A;  3OW2 U;  2WAM A;  1OHH G;  4BIU A;  2PYL A;  5LBQ A;  4DR6 O;  2WLN A;  1Q43 A;  3P30 A;  1BT8 A;  4MTX A;  1G8M A;  1R6K A;  2BTO A;  3B8M A;  4I0X B;  4K35 A;  3E8B A;  4YJ2 B;  2BSK A;  1HR0 B;  3UM7 A;  1LUW A;  1AI4 A;  4DV7 O;  4NYK A;  3BRC A;  1R73 A;  4BR6 A;  1AR5 A;  4YY3 O;  2ZNI A;  1FPO A;  5IT9 N;  2YI8 A;  5JQG B;  1YJ9 V;  2X6A A;  4CZZ A;  5J9P C;  3EHB B;  2GDS A;  2UU9 O;  3LDC A;  2Q69 A;  3EFF K;  2JEX A;  4I0X A;  4FFK A;  2CGO A;  3ZMZ A;  1ZL8 B;  4PA3 A;  5E1A C;  3D8C A;  4CH6 A;  1XQ8 A;  1P7G A;  3VQX A;  3OAA G;  4O4I A;  5LXT A;  4HAM A;  1VQN V;  3K58 A;  5IDJ A;  4FLZ A;  1XNQ B;  3H1H H;  2V4D A;  2ZM6 O;  3CE2 A;  3ASN C;  4JI5 O;  2IM9 A;  2OCH A;  1QLE B;  2X0L A;  4D7S A;  4JAA A;  1X59 A;  1K73 W;  3JAT A;  2EIN B;  4JI1 B;  4L8J A;  1WA8 B;  5CBG A;  5KA6 A;  3ZS8 C;  5LMN B;  2EIL C;  4LF7 B;  1VF6 C;  2Q7G A;  4R7C A;  1S5L Z;  1ZWI C;  2NNU A;  1LR1 A;  3HB3 B;  2ZDI C;  1IBK O;  1GMG A;  3QO5 A;  3OMN B;  3ZHQ A;  4GX0 A;  3RVZ A;  1RM1 C;  1YDX A;  2CE4 A;  1YHQ V;  3JD0 A;  4NTX A;  2UUC O;  1H2K A;  1KYO F;  3HKE B;  4DUZ B;  4BW5 A;  1N0N A;  1N0J A;  1KUQ A;  1VQ6 V;  5KUK A;  2YIC A;  4WFB V;  1FS0 G;  2EZO A;  4GLX A;  4E2L A;  3CHX A;  3UT5 B;  4X64 O;  3U10 A;  4UCO A;  2ZE8 A;  1BQ0 A;  1FFX B;  2CAZ C;  1O9H A;  4I9W A;  1VQ5 V;  3H1I H;  1K3E A;  1HDJ A;  4LP8 A;  3ZED A;  2BE3 A;  2CTR A;  4YY3 B;  1GH6 A;  3ETQ A;  1GM8 A;  3L73 H;  2QM7 A;  4H33 A;  3U11 A;  4MVU A;  2ZR3 A;  1FXK B;  3H1L H;  1M90 W;  3WB1 A;  1YVW A;  4JTD B;  3NR7 A;  1FJG B;  4KHP B;  5GON B;  5B1B C;  4LF8 O;  1OJH A;  3AG4 C;  2OYQ A;  1S0V A;  1KP3 A;  3TGU H;  1Q7Y W;  2DOS A;  3HKC B;  2QKS A;  2YID A;  2EJR A;  4DO2 A;  1PV0 A;  4PJ0 Z;  4TQF A;  3ZRV A;  3ASO C;  4NKG B;  5EZY B;  2QKA A;  1UJW B;  1EZJ A;  1AR4 A;  4A5U B;  3RVY A;  4JI7 B;  4N21 A;  1T5E A;  1H8E G;  1V55 C;  5C93 A;  4N23 A;  4GT1 A;  4CS4 A;  2VQF O;  4PV1 B;  4I50 A;  4LWS A;  2P7T C;  1M1K W;  4RWU A;  2H94 A;  2EIK B;  2OCC B;  1XOU A;  4X1Y B;  3RYH A;  3ZIA G;  1TAE A;  4BIZ A;  5CB4 A;  1ZAU A;  3G6E V;  4B3S B;  4H0L B;  3CCJ V;  1WN7 A;  2CH7 B;  1NI8 A;  3LSU A;  5DM6 V;  3ABM B;  4LFA B;  2HJD A;  2YEV A;  2LGQ A;  4X1I B;  2UXC O;  3L74 H;  4JTA B;  4QNH B;  2QSA A;  2PF4 E;  1VQ4 V;  2A06 H;  1EBO A;  4O2B B;  4GKJ O;  2KG7 B;  3QNE A;  5GW7 A;  3OR7 C;  5KHG A;  2WLL B;  2Y4U A;  3L75 H;  4LC1 A;  4YHH O;  2EZP A;  5EIB C;  2Z0A A;  3UKM A;  5ITZ A;  1Q6H A;  1JX9 A;  4KP4 A;  1VMG A;  5LL6 Y;  3ZBH A;  1PD3 A;  1N34 O;  4TV8 B;  2AZ2 A;  2DMX A;  4EFE A;  1FXK A;  3J80 N;  2B1G A;  4Z1M G;  3HKD B;  2LFR A;  2UUA O;  4O4H A;  2ZIM A;  3E8G A;  3L70 H;  5KX5 A;  4O4L A;  4DR7 O;  3JSL A;  1COW G;  4LFC B;  3RYF B;  4K8X A;  2JJ1 G;  2CH7 A;  3N2G A;  1YIT V;  3TJT A;  1I94 B;  3AG3 B;  3CRC A;  4I5S A;  4PA9 A;  3E22 A;  1DF4 A;  2WLI A;  3W7W A;  4I4T B;  4JAV A;  1ROP A;  3CRR A;  2ODM A;  1K8A W;  3F7V C;  5L3C A;  3G80 A;  2BSK B;  4X1K A;  3OR6 C;  4IL6 Z;  1OCR C;  3ABK B;  4DV3 B;  2F23 A;  3OM3 B;  3G67 A;  2P90 A;  5FLX N;  3C3S A;  5AG2 A;  3T1Y O;  4UV9 A;  4DV1 B;  4J11 A;  4DV4 B;  3T4Z A;  5C8Y B;  3B8N A;  3K57 A;  2HVK C;  4QGP A;  2UXB B;  4RUF A;  4CBC A;  4GKK B;  2JJ2 G;  2XAQ A;  1N33 B;  4GX5 A;  4BAY A;  2L35 A;  1KMI Z;  5H2F Z;  3OTO O;  1SET A;  2XAS A;  1HP8 A;  1M9N A;  4FZ0 A;  4LH6 A;  3AK3 A;  4LFA O;  2LFS A;  5BY1 A;  4B3S O;  4KHP O;  1UFI A;  3CJH B;  5JH7 A;  2F66 C;  3L71 H;  4G28 B;  3SYO A;  4ABM A;  1RP3 B;  3FB7 C;  2E3C A;  3AG2 C;  1BL8 A;  4QPJ A;  3C90 A;  5CA3 A;  2P6J A;  1VIB A;  2JVD A;  3BA9 A;  1AP5 A;  1BMF G;  1S77 D;  5EYP A;  2CTP A;  4I7Z B;  4HNA A;  2BOC C;  3DTU B;  4QPK A;  2ZIO A;  1DK1 A;  3JYC A;  1J95 A;  2QJ1 A;  5L3B A;  3ZHV A;  4DR3 O;  4DR4 O;  2RN9 A;  2IJK A;  5J2U B;  4EKW A;  2QDO A;  1F51 A;  4LF4 B;  3LSQ A;  3JAR A;  4HNA B;  1JJO A;  1CXZ B;  4TV9 B;  1IBK B;  3K5N A;  1NVP B;  5LGU A;  1FJG O;  1ZL8 A;  4PA7 A;  2G38 A;  1ARO P;  5B1A B;  2FML A;  2XT9 A;  1DTO A;  1OCZ B;  1IBL O;  4GYC B;  5LMN O;  3VBB A;  4MS2 A;  2FB5 A;  5K1P A;  4MTF A;  3O65 A;  3FD9 A;  3SPJ A;  3JAR B;  5DEC A;  4DV0 B;  5B5E Z;  1PNM A;  1Z5W A;  4XBF A;  4LF4 O;  1P7B A;  1HR0 O;  1H2G A;  1MA1 A;  4FZ1 A;  4JYA O;  5K1X A;  3DXR B;  1IXM A;  1XHZ A;  2CUG A;  4MVS A;  1EN6 A;  3BFR A;  4FFB B;  4IHJ B;  2Y0I A;  3GWK C;  2Q0O C;  1P84 F;  1XMO B;  3GB7 C;  4NB5 A;  4ZHQ A;  5B3S B;  4J10 A;  3OGI B;  2UUC B;  3H01 A;  3BA8 A;  2UUA B;  1M56 C;  2F93 B;  1NR7 A;  1YF2 A;  2Y69 C;  3CWB H;  2DN9 A;  1KKD A;  4U3J A;  3ICX A;  2K1E A;  3CCU V;  1YXB A;  3SYC A;  5KX5 B;  1P4R A;  4DV1 O;  4EEQ A;  2AGA A;  1U97 A;  2Q0A A;  4UCS A;  5LMU B;  2CTW A;  1YEW A;  2AW9 A;  1MZE A;  3J7A U;  3VOU A;  1BCC H;  2P5O A;  2XND G;  4LCU C;  4NTY A;  4ZI7 B;  4CS2 A;  1NR1 A;  2Z3Y A;  3ZN1 A;  2FKX A;  5H6Q A;  2GHY A;  1JJ2 U;  1RPR A;  4JTC B;  4ZOL A;  1PPJ H;  3K9S A;  2ZXW C;  3TK1 A;  1NH2 B;  1Q8I A;  2ZE5 A;  4FM0 A;  2M6Y A;  4ICG A;  1WB7 A;  4XDK A;  3A0R A;  4Z2W A;  3LNM B;  1AP6 A;  2ZE6 A;  1QHT A;  4PI2 A;  3VQY A;  3DC6 A;  2QKC A;  4ZKI A;  4JI6 B;  1NTM H;  3R65 A;  5LOV B;  4DW0 A;  4U3J B;  2WWW A;  1W0K G;  2ILM A;  4TSF G;  2WLJ A;  1ZX3 A;  1B04 A;  4B7K A;  1DGS A;  3RYC B;  3RW0 A;  1QLE C;  2ZDI A;  1DF5 A;  4NXM B;  2P67 A;  1AJN A;  2PGG A;  2GV9 A;  2UXD B;  2L6L A;  5EZY A;  1GTO A;  3DXR A;  3SPH A;  1MZF A;  1SQB H;  4TUY B;  1I5Y A;  1JA8 A;  1SQQ H;  3SPI A;  3E2E A;  4DR5 B;  2UXC B;  1IUR A;  4J7K A;  1S5H C;  4QJF B;  1SS3 A;  4JGS A;  2PZS A;  3ETD A;  1H2S B;  4I55 A;  4C7U A;  4DUY B;  4DV5 O;  4LNU B;  3CC2 V;  5EIB D;  5JJJ B;  4YJ3 A;  4LF5 O;  4UFZ A;  3QO7 A;  4NXM O;  4NVP A;  4FPP A;  2QTO A;  1XMQ B;  3MHH C;  1OCO B;  4HZ3 A;  3JD1 A;  3NXS A;  3JAW A;  2DYR C;  1ZSP A;  3FFQ A;  1QVG U;  2IBZ H;  2R9I A;  2GSM B;  3U0Z A;  4IT5 A;  5HFL A;  1EN5 A;  1OCC B;  1VF5 B;  1F23 A;  1VF6 A;  4W4K A;  1RSO B;  1YI2 V;  1I08 A;  1VQK V;  4FLV A;  1XRE A;  2A3Q A;  5IYC O;  1CP9 A;  4DV6 O;  3TXS A;  4YIO A;  3DC5 A;  2LP7 A;  4U3F H;  1HNW O;  4HBN A;  1R3J C;  5EYP B;  3FB5 C;  5BR8 B;  3AG1 C;  2EIJ C;  5IJ0 B;  1EZV H;  3K06 A;  1BGY H;  1URF A;  1Z5V A;  2QR4 A;  2Q4P A;  1SQG A;  5BXZ A;  3CCM V;  3THO A;  3IC7 A;  5JWP A;  4LFB B;  1M4U A;  4FLX A;  4F4L A;  3CD6 V;  4DRX A;  2IJI A;  2M7W A;  1SKV A;  2HR3 A;  1XL4 A;  1NQT A;  3SYA A;  1BZK A;  1OCO C;  4ZOL B;  2KSD A;  2AHY A;  3JAL B;  3JAW B;  1QVF U;  3SJB C;  3OUS A;  4HYO A;  3WU2 Z;  1JPX A;  1MSW D;  4LF6 O;  5FL7 G;  2YS8 A;  1B3Q A;  3KZI Z;  2ZM6 B;  1Y74 A;  2RJZ A;  5LXT B;  4X66 O;  1XMO O;  1JVM A;  1XNQ O;  4J80 A;  4MVO A;  3FYE B;  1MOF A;  2OIG A;  4JI8 B;  2P4K A;  1IBM B;  4EB6 B;  2ZQM A;  2NR5 A;  1QCE A;  4DUZ O;  4OGQ B;  2YDE A;  2W6J G;  4X62 B;  2IH1 C;  4JI0 B;  2QEX V;  4J7J A;  3H1K H;  4LNU A;  1SA0 A;  5JJE B;  4LBE C;  2QWR B;  1WJZ A;  1KBH A;  1E79 G;  2A9H A;  5CBF A;  1Y76 B;  3JAK A;  2ADQ B;  2P06 A;  4DYL A;  1JQ0 A;  3OD4 A;  1TA8 A;  4JI1 O;  3CCQ V;  3IGA C;  1JCH A;  1HNX B;  3OUF A;  2OIE A;  1E1Q G;  3BEH A;  4J41 A;  2FYU H;  1WPB A;  1Y74 B;  2CK3 G;  3ABM C;  4UXN A;  2PYJ A;  3CCV V;  5EC2 C;  2ZXW B;  2MK3 A;  3OT7 A;  3WFV A;  1D5N A;  5B1N A;  1W2B U;  2V1D A;  3FB8 C;  2CGN A;  5EBM C;  2KB1 A;  1HWY A;  3IAY A;  2V7Q G;  4X88 A;  4XDJ A;  3CME V;  4U7O A;  3CEI A;  5KHK A;  4WBN B;  2YI9 A;  1D2D A;  4IIJ A;  4LF9 B;  4IGG A;  3JAL A;  4YIP A;  1US6 A;  1G6U A;  2ITC C;  5GON A;  2QTS A;  2AHZ A;  1PNK A;  4PI0 A;  4PDL A;  2RCV A;  1FYJ A;  5LP6 A;  4DRX B;  2OWO A;  3AEI A;  2LQT A;  4LH7 A;  3CSX A;  4JI4 B;  3HKD A;  3APO A;  1AJP A;  3CRQ A;  4CH5 A;  2P4V A;  4YJ2 A;  2HFE C;  3ZMV A;  4B3M O;  2Q73 A;  2GUZ B;  4DW1 A;  1S3J A;  2ZIN A;  4JI2 B;  1TGO A;  4NTW A;  4KL1 A;  1AI5 A;  2QWQ B;  5BZB A;  1QQC A;  3E8F A;  3S3W A;  1NU1 H;  1KQS U;  1M5I A;  3N27 A;  4AHC A;  1H2L A;  4MSW C;  3G71 V;  4NXN B;  4JI2 O;  3D3Q A;  3SPG A;  5FNV B;  2X6C A;  4B3M B;  5IE9 A;  1QBZ A;  4UCT A;  4DV2 O;  4JV5 O;  3K04 A;  2D3O W;  4X89 A;  4Q20 A;  1Y67 A;  1H2M A;  3CMA V;  4UCR A;  3UO2 A;  3UQ8 A;  5FNV A;  1BSM A;  4PDM A;  1U96 A;  4XDL A;  4X8A A;  2UXD O;  4PD4 F;  1RM1 B;  5LP6 C;  3TET A;  1G1X B;  1VQL V;  1FD9 A;  2JGU A;  2EIM B;  3B4S A;  4MW8 A;  2HHH O;  4MTG A;  1ENV A;  4NXN O;  4F6E A;  1QNM A;  3KG2 A;  1FAF A;  3Q4H A;  2VQE B;  1ZLZ A;  1ZTE A;  4FK5 C;  4X65 O;  2JRI A;  1WP8 A;  3A0H Z;  2BTQ B;  3AG3 C;  2EX3 A;  3O9O A;  4WFH A;  5KHI A;  1K5Q A;  2HP8 A;  2UXX A;  3B40 A;  4O2A B;  2ADP A;  2XAG A;  1NH2 D;  1JFF A;  2IH3 C;  1AB3 A;  3SDL A;  4JYC A;  1IVS A;  3P3P A;  5IWA O;  1PM9 A;  4B3T B;  3WG7 C;  1HNX O;  2LGW A;  1GM9 A;  1SER A;  1AR1 B;  1EN4 A;  3C3T A;  1S5J A;  4MVM A;  2WA3 A;  4AIL C;  2OTJ V;  1Q6U A;  2QM4 A;  3OGC C;  4X9Q A;  2UUB O;  3STL C;  4RO2 A;  2Q8V A;  4JYB A;  4GUN A;  1V54 C;  1R3I C;  4TV9 A;  4AI8 A;  3I56 V;  4OXS A;  3OEE G;  1EFR G;  3B09 A;  3ML0 A;  2AZ0 A;  2Z5U A;  3PJS K;  4DR3 B;  4DR4 B;  2N74 A;  4FIP C;  2A0L A;  1WPX A;  2LJ2 A;  2Q67 A;  1R3K C;  3WG7 B;  1UPG A;  1YSC A;  3CCL V;  4R6Z A;  3ZHT A;  1SQV H;  5H6R A;  2F1M A;  3ABL C;  1V55 B;  2F4V B;  1F7Y A;  1R3L C;  3QTC A;  1GAX A;  4IYH A;  4DR2 O;  1GN4 A;  5LMU O;  4JZ2 A;  5KUM A;  3A2F A;  1Q81 W;  4O2B A;  3JAK B;  4P2Z A;  4G2K A;  4D7T A;  2DYR B;  2ATK C;  3CRA A;  1OZ0 A;  4RAI A;  3ZRW B;  3RGB A;  1BQZ A;  5D5P A;  3SJA C;  2YXY A;  1AIL A;  1BHB A;  1KKC A;  2GUZ A;  3BVO A;  2VWJ A;  1MG1 A;  4DR1 O;  2CTQ A;  2VWK A;  3D3I A;  1YJW V;  2JS5 A;  2LW1 A;  4JI8 O;  1OV9 A;  5GTI Z;  1YCI A;  3I5D A;  1PL4 A;  4P9P A;  5CMU A;  1FXK C;  3W7X A;  5LHG A;  3OE7 G;  3RYI A;  3JCZ A;  4JF3 A;  1RFY A;  4ZIB A;  5EK0 A;  5CA0 A;  1GN3 A;  2HEP A;  5B3S C;  4I50 B;  4LWS B;  5LYJ B;  4PHZ A;  2WLI B;  5E79 Z;  3QF7 A;  1THZ A;  3UT5 A;  1R1B A;  1H2N A;  1J5E B;  1OCR B;  1KEC A;  4JI0 O;  4FMT A;  5EBW C;  4MTO A;  2VRZ A;  5CA0 B;  3E35 A;  1PP9 H;  4UB8 Z;  2EBO A;  2Q7H A;  4JPR A;  1K33 A;  2OTL V;  1SQF A;  1NJI W;  1TUB B;  1GK9 A;  2KQX A;  2HG5 C;  4CC6 A;  3T1H B;  1QR9 A;  2YIB D; 
#chains in the Genus database with same CATH homology
 3ZMU A;  1KP3 A;  1PNL A;  4ASU G;  4UV8 A;  3CCM V;  1Q7Y W;  2IJJ A;  1Y66 A;  2QKS A;  1Q82 W;  3IC7 A;  1VQ9 V;  2HLD G;  2EJR A;  1K34 A;  3ZMS A;  4DO2 A;  3F5W C;  3AG4 B;  4P9O A;  3ZRV A;  4QE9 A;  3ASO C;  4F4L A;  3CD6 V;  2IJI A;  1UJW B;  1EZJ A;  5H9C A;  2M7W A;  2HR3 A;  3ZN0 A;  1XL4 A;  5B1O A;  1ORQ C;  1NQT A;  3E83 A;  3RVY A;  3MD0 A;  3ABT A;  4N21 A;  1H8E G;  1K7D A;  1V55 C;  3SYA A;  4N23 A;  1OCO C;  4GT1 A;  5C93 A;  1N8R W;  3FYI B;  2AHY A;  3W7U A;  4PA4 A;  4UVA A;  1RPO A;  1QVF U;  2P7T C;  3OUS A;  3CC7 V;  4HYO A;  1M1K W;  2H94 A;  1OCC C;  2EIK B;  2OCC B;  1VQM V;  1JPX A;  4MVQ A;  2WLK A;  3ZIA G;  1MSW D;  5FL7 G;  4BIZ A;  4MVZ A;  3G6E V;  3CCJ V;  2X6B A;  1JVM A;  3ABM B;  5DM6 V;  2IU3 A;  1XL6 A;  5CN0 A;  2YEV A;  4G27 B;  5L3G A;  5HFM A;  4MVO A;  3FYE B;  1MOF A;  4JTA B;  4QNH B;  2R9R B;  1E1R G;  1YTF B;  1VQ4 V;  2DQ0 A;  5L3F A;  2ZQM A;  1EBO A;  2HJF C;  1QCE A;  4WFG A;  5IYD O;  2QA4 V;  2W6J G;  3F7Y C;  3QNE A;  2IH1 C;  5GW7 A;  3G4S V;  3OR7 C;  5EC1 C;  2QEX V;  2IU0 A;  3ZMT A;  2WLL B;  4FJC C;  2UXN A;  4LBE C;  4LC1 A;  2EZP A;  2DQ3 A;  4QIW F;  4ZBM A;  3UKM A;  2YSU B;  1S72 V;  1E79 G;  4WCE V;  2A9H A;  4KUM A;  1JX9 A;  4KP4 A;  5CBF A;  3X2Q C;  1PD3 A;  1JQ0 A;  1FXK A;  3CC4 V;  4L87 A;  2B1G A;  3CCQ V;  1K4C C;  4Z1M G;  2DWE C;  2LFR A;  3IGA C;  3IFX A;  1JCH A;  3E8G A;  3OUF A;  4MW3 A;  1OCZ C;  1SES A;  1E1Q G;  4WFA V;  1K4D C;  2ZR2 A;  3BEH A;  1COW G;  4H37 A;  1B6Q A;  2CK3 G;  2JJ1 G;  3ABM C;  4JAS A;  4RQF A;  1YIT V;  4UXN A;  3CCV V;  3K9A A;  5IYB O;  3AG3 B;  5EC2 C;  2ZXW B;  2MK3 A;  3SYQ A;  1YTF D;  4PDV A;  3ZRS A;  4I5S A;  4PA9 A;  3WFV A;  1DF4 A;  5L3E A;  5B1N A;  2WLI A;  2JK5 C;  1W2B U;  3TCU A;  1KP2 A;  1BHA A;  1GO3 F;  3W7W A;  1K5S A;  2V1D A;  3FB8 C;  4JAV A;  1ROP A;  2KB1 A;  1HWY A;  3ABL B;  3MHS C;  5EBM C;  3F7V C;  3ZRW A;  5L3C A;  1VQP V;  1K8A W;  1AJQ A;  3K79 A;  3T4D A;  2V7Q G;  4X88 A;  1KD1 W;  4XDJ A;  3OR6 C;  3ASN B;  3CME V;  1OCR C;  1S76 D;  3ABK B;  4U7O A;  2IJH A;  2JIZ G;  3LDE A;  3OM3 B;  3T2M A;  2P90 A;  1Q86 W;  4TWK A;  4QE7 A;  2JEU A;  2FTK A;  2WSS G;  4UV9 A;  3X2Q B;  3T4Z A;  2ITC C;  1NBM G;  2W0F C;  2ITD C;  4PEL A;  3B8N A;  2AHZ A;  2HVK C;  1PNK A;  3ABK C;  4RUF A;  4PDL A;  1SZT A;  1I5X A;  4CBC A;  2JJ2 G;  2XAQ A;  4GX5 A;  4U7N A;  2Y69 B;  4J9Z B;  4BAY A;  1CEZ A;  1SET A;  1V54 B;  3AEI A;  2XAS A;  5IY5 B;  2OCC C;  1M9N A;  3OFN G;  4J9Y B;  4UVC A;  2LFS A;  1NKD A;  1AJP A;  2W6I G;  2HFE C;  4P30 A;  3ZMV A;  4YXW G;  1S3J A;  3ABU A;  4G28 B;  3SYO A;  3OMI B;  1AI5 A;  1H8H G;  3M99 B;  1LNQ A;  1KC8 W;  3ZCC A;  3K0G A;  5BZB A;  1MAB G;  3FB7 C;  3E8F A;  4JAU A;  3AG2 C;  4KFM A;  2C2A A;  5DN6 G;  1KQS U;  4WFF A;  1BL8 A;  4QPJ A;  1AI7 A;  5CA3 A;  2JDI G;  4MSW C;  3G71 V;  1NVP D;  2X7R B;  3CYO A;  2P6J A;  3SJQ C;  2QM8 A;  2EIN C;  3SPG A;  2X6C A;  1FXV A;  3LUT B;  3ETE A;  5LHI A;  1BMF G;  4UUJ C;  1S77 D;  3JD4 A;  1QBZ A;  3P32 A;  3K04 A;  5LGT A;  3AG1 B;  3E89 A;  4X89 A;  2D3O W;  2A79 B;  2BOC C;  3DTU B;  4Q20 A;  1AI6 A;  3HPL C;  4QPK A;  4TT3 G;  4UVB A;  3T1C A;  4MT8 A;  2WLM A;  3JYC A;  1J95 A;  2Q68 A;  3CMA V;  3SPC A;  3CP1 A;  2QE7 G;  2EIJ B;  2Y48 A;  4PDM A;  5L3B A;  1Y4M A;  3E8H A;  4XDL A;  4X8A A;  3K0D A;  5IY5 C;  1RM1 B;  2IJK A;  4EKW A;  3TET A;  4RQE A;  1F51 A;  3LSQ A;  4GX1 A;  3ASO B;  2B1I A;  3SYP A;  3ZRX A;  1VQL V;  2PI4 A;  1YIJ V;  2EIM B;  4MW8 A;  5KA5 A;  3AG2 B;  1WLE A;  5LGU A;  1NVP B;  4R50 A;  3K03 A;  3K08 A;  4PA7 A;  1ARO P;  1QLN A;  4MTG A;  4RUE A;  5B1A B;  1GKF A;  1ENV A;  2WLH A;  1PL0 A;  1DTO A;  3OMA B;  3B77 A;  3LDD A;  1OCZ B;  4PA6 A;  1K97 A;  3KG2 A;  3VBB A;  4MS2 A;  4MTF A;  1QR8 A;  3SPJ A;  3D36 A;  5CBH A;  1VQO V;  4MVR A;  4FK5 C;  1PNM A;  2EIM C;  4XBF A;  1P7B A;  3AG3 C;  2XAJ A;  1H2G A;  4WFH A;  3CCE V;  1K5Q A;  3CXC U;  2PI5 A;  1M56 B;  1IXM A;  2UXX A;  2WLL A;  3STZ C;  3W7S A;  4MVS A;  3BY6 A;  5LGN A;  2XAG A;  1NH2 D;  2IH3 C;  4WFB V;  2DYS B;  3ETG A;  1GM7 A;  2BOB C;  3CCR V;  2YEV B;  4JYC A;  2WAM A;  1OHH G;  3GB7 C;  4BIU A;  3OW2 U;  3K3W A;  5LBQ A;  2WLN A;  3P30 A;  4MTX A;  5B1B B;  4WF9 V;  1G8M A;  1R6K A;  5B3S B;  5LHH A;  3WG7 C;  3H01 A;  1M56 C;  3B8M A;  1GM9 A;  1SER A;  1NR7 A;  3E8B A;  2Y69 C;  1AR1 B;  3UM7 A;  1KKD A;  1AI4 A;  1K92 A;  2EIL B;  2K1E A;  3CCU V;  3SYC A;  4MVM A;  1P4R A;  1R73 A;  2OTJ V;  3DGE A;  1W0J G;  2IW5 A;  1YJ9 V;  3OGC C;  2X6A A;  4CZZ A;  5J9P C;  3EHB B;  2H8P C;  3STL C;  3W7T A;  3VOU A;  3LDC A;  2Q69 A;  3EFF K;  2JEX A;  4RO2 A;  2XND G;  4LCU C;  4WFE A;  4JYB A;  1V54 C;  1R3I C;  3I56 V;  1NR1 A;  4OXS A;  3ZMZ A;  2Z3Y A;  3ZN1 A;  4PA3 A;  3OEE G;  5E1A C;  5H6Q A;  1EFR G;  2GHY A;  4R8C A;  1JJ2 U;  1RPR A;  3ML0 A;  2Z5U A;  3PJS K;  4PDR A;  2F43 G;  4JTC B;  3CCS V;  3JD2 A;  4FIP C;  1F4N A;  1FFT B;  3OAA G;  2A0L A;  1WPX A;  3FKS G;  4HAM A;  2Q67 A;  1VQN V;  5IDJ A;  1R3K C;  2ZXW C;  3TK1 A;  3WG7 B;  1NH2 B;  4XDK A;  1VQ8 V;  2DW4 A;  1YSC A;  3A0R A;  3CCL V;  3RBZ A;  4R6Z A;  1DLB A;  5H6R A;  1PKX A;  3LNM B;  3ABL C;  2NLJ C;  3ASN C;  2XOK G;  1V55 B;  1QLE B;  2X0L A;  3JD3 A;  1R3L C;  1K73 W;  4ZKI A;  2DWD C;  2EIN B;  4GCZ A;  3R65 A;  5CBG A;  1SRY A;  1CPY A;  5KA6 A;  2EIL C;  3CPW U;  2WWW A;  3GWO A;  1FXH A;  3FB6 C;  1W0K G;  4TSF G;  2WLJ A;  4R7C A;  5KUM A;  1ZWI C;  2HKO A;  2NNU A;  1Q81 W;  3RW0 A;  3HB3 B;  2ZDI C;  4P2Z A;  4G2K A;  1QLE C;  2ZDI A;  1DF5 A;  2DYR B;  1GMG A;  3QO5 A;  3OMN B;  2ATK C;  1JOY A;  2WPD G;  1OZ0 A;  2P67 A;  3OEH G;  4GX0 A;  4RAI A;  3ZRW B;  3RVZ A;  1AJN A;  1RM1 C;  1M57 C;  1YHQ V;  3JD0 A;  1VQ7 V;  1BHB A;  1MG1 A;  1H38 A;  1L1F A;  4BW5 A;  1GTO A;  3SPH A;  1R6N A;  3D3I A;  1YJW V;  1G4Y B;  5B1A C;  2Q6A A;  1I5Y A;  3SPI A;  3E2E A;  3QO8 A;  1VQ6 V;  1S5H C;  5KUK A;  4QJF B;  4JGS A;  4GX2 A;  1TUE B;  4P9P A;  5CMU A;  1FXK C;  1FS0 G;  2EZO A;  2ZD9 A;  3ETD A;  3OE7 G;  5LHG A;  3W7X A;  4E2L A;  3I55 V;  3CC2 V;  3JCZ A;  4JF3 A;  3QO7 A;  4I9W A;  3E86 A;  1VQ5 V;  1K3E A;  5L3D A;  2B5U A;  2QTO A;  4FPP A;  5EK0 A;  3MHH C;  2HVJ C;  4LP8 A;  1OCO B;  2OT5 A;  4HZ3 A;  5B3S C;  3JD1 A;  3NXS A;  2DYR C;  1QVG U;  1GM8 A;  2QM7 A;  4H33 A;  4MVU A;  2R9I A;  2WLI B;  2ZR3 A;  1FXK B;  2GSM B;  2DYS C;  1THZ A;  5HFL A;  4DXW A;  1M90 W;  1OCC B;  2EIK C;  4JTD B;  1F23 A;  2XAF A;  1OCR B;  1KEC A;  4FMT A;  1YI2 V;  1VQK V;  3ZJZ A;  5EBW C;  4MTO A;  5EBL C;  5B1B C;  3E35 A;  1YJN V;  5IYC O;  1CP9 A;  1M57 B;  2EBO A;  2LP7 A;  3AG4 C;  4JPR A;  3LSS A;  1K9M W;  1K33 A;  2OTL V;  1R3J C;  2XAH A;  3FB5 C;  3AG1 C;  2EIJ C;  1NJI W;  1GK9 A;  1F4M A;  3K06 A;  2HG5 C;  1QR9 A;  1S0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...