5H9CA

Crystal structure of the aslv fusion protein core
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
78
structure length
78
Chain Sequence
NLYFQGTANLTTSLLGDLLDDVTSIRHAVLQNRAAIDFLLLAHGHGCEDVAGMCSFNLSDQSESIQKKFQLMKEHVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Envelope glycoprotein gp95
publication title Structural characterization of a fusion glycoprotein from a retrovirus that undergoes a hybrid 2-step entry mechanism.
pubmed doi rcsb
source organism Avian leukosis virus rsa
molecule tags Viral protein
total genus 31
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2015-12-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5h9cA00
2EBOA 3B8NA 1K33A 3GWOA 1DF5A 1I5YA 1QCEA 4N23A 4G2KA 5KA5A 2M7WA 3B77A 2X7RB 1F23A 1DLBA 1QR8A 4JF3A 4FJCC 5H9CA 4E2LA 2P6JA 2EZPA 2EZOA 1JPXA 1I5XA 1QBZA 1Y4MA 4N21A 1MOFA 1QR9A 3B8MA 4FK5C 3K9AA 2MK3A 5CMUA 5HFMA 1SZTA 2LP7A 3P30A 1JQ0A 3M99B 4JGSA 4JPRA 1MG1A 1ENVA 2OT5A 5CN0A 5KA6A 1EBOA 3WFVA 5HFLA 3CYOA 3MHSC 3H01A 1DF4A 1K34A 1Y66A 3MHHC 3CP1A 4FIPC
chains in the Genus database with same CATH superfamily
2D2CB 5CA0A 1N36B 3JASB 1BHBA 2Q0AA 4DW1A 1AJNA 1FXVA 3JD0A 4I9QA 2P4VA 5DEDA 2IU3A 2UUBO 1O9HA 1AI4A 2NLJC 3DGEA 1VQPV 1R3KC 2Y4UA 1GH6A 2F43G 1HNXB 4GKJB 2Y4TA 1H2SB 5GONA 2ADQB 2ITDC 3FKSG 4U3JA 2QKSA 1J95A 2WLIA 4FM2A 1Z5VA 2MW2B 4JTDB 3STLC 3CXCU 1N4CA 3SPJA 4QPKA 3JD2A 3BY6A 4B3RB 2XAJA 1KYOF 3K03A 4O4HA 4DV7B 4PELA 3OUSA 3OE7G 4WFHA 3GVMA 4K35A 1DLBA 5FLXN 4FJCC 1OJHA 1X59A 4JV5O 3WG7C 1O9GA 1FFTB 1UJWB 2WA4A 2EIKC 5B1BC 5IY5C 2EILB 4I5SA 2CTQA 3CCEV 5KHJA 1OCRC 1ZAUA 1V55B 3B09A 4H37A 4IT5A 4OX9O 2JS3A 3CCRV 4JI0B 3JATA 4IL6Z 1BE3H 1KP2A 3GWOA 3ZRXA 3ZEDA 1Q43A 2NN4A 4DR4B 4PI0A 5KX5A 3ABUA 5L3EA 2X6BA 4D6TH 1XNQB 4FM1A 3ZBHA 2ZE5A 2JJ2G 4H0LB 1CP9A 3L9DA 3JARB 2ZIMA 3JALB 2WLHA 1TAEA 1EFRG 4YJ2B 2VQEO 4TUYB 3CCMV 2LFSA 4UVCA 1P7BA 1XMOB 4KHPO 4X89A 2YIBA 2Q4PA 5KMGA 1AR4A 1SRYA 4DR2O 5B3SB 1MMMA 5KMGB 1B04A 4J7JA 4UVAA 1IBLB 4J11A 1YTFB 1SA0A 4ASUG 5CB4A 2VQFO 3SYOA 3JAWB 3CWBH 1BQ0A 3L75H 3OGCC 2P5OA 3THOA 4YY3O 2UUBB 2FYUH 4ZI7B 3B2EE 1Z2GA 5L3CA 2W6JG 5H6RA 3F5WC 1FKAO 1F4MA 3RWRD 1NTMH 3JYCA 4I4TA 4F6RB 2YSUB 3CD6V 4I55B 2H3OA 3ETEA 4TV8B 2PGGA 4I4TB 1M5IA 1RSOA 3G71V 5F2VO 1GO3F 5LXTA 5LHIA 1PP9H 1L0NH 2CK3G 4O4LA 3ZHRA 5LP6B 4K0KO 2BE3A 1TUBB 1QHTA 1FFXA 2JK5C 5IYZB 4DK0A 4O4LB 4UUJC 4JAVA 1FFXB 3AG2C 2KSDA 1CXZB 2WLLB 1CEZA 3ABLB 3VQYA 4Z1MG 4BIZA 4G28B 1ZL8A 4JV5B 3LDDA 1F51A 3S3XA 1G8MA 2PI4A 2Q9LA 1H8EG 1IURA 5BMVB 3EXAA 1XHZA 2GDSA 4A5UB 4OX9B 2PUSA 4PDRA 3QF7A 1FYJA 4EEQA 2BSKB 3P3NA 2FTKA 1GMGA 2QM8A 5BZBA 3RGBA 4GZRB 4CH5A 4G2KA 4WBNA 4ZIBA 2VQEB 3ZHTA 4WBNB 1QBZA 4YIOA 1MZEA 1ZSPA 2K1EA 5IJ9A 2UXBO 3JAKB 2IJHA 4TV9A 3OTOO 4KFMA 1OCOB 2E76B 4KHPB 1R1BA 1QNMA 2X0LA 3OW2U 5EIBC 1P49A 1WAZA 3H01A 2HVJC 3UQ8A 2EBOA 3L70H 2OWOA 3IC7A 4DV4O 1E79G 1DGSA 1YSCA 3WB2A 3AG1B 1MA1A 3E8HA 3L74H 2WSSG 4TSFG 3ZMUA 2GV9A 2VQFB 2KKWA 2RJZA 4X88A 2JDIG 2F1MA 1OCCB 2BTQA 4PA7A 2DQ0A 4UXNA 5J2UA 3F7VC 3SYQA 5J2TA 3CRMA 4YXWG 1JJ2U 2X7RB 4YY3B 3R65A 2VWJA 2P6JA 1Q6UA 4LFAO 1Y4MA 2YI9A 2QEXV 5LGUA 3CCUV 4FLTA 2Q5ZA 4I0XA 4O4IA 4HNAA 1WP7A 4DV2O 4O4JB 1VQ8V 4PV1B 2GTSA 4W4LA 3SPHA 4K0KB 4DUZB 1YJNV 2VRZA 2PF4E 3I56V 1Z5WA 3SPCA 5IE9A 2KG7A 2M6YA 5JQGB 4U7NA 5B1NA 3E22B 3ML0A 4J80A 4WFBV 1QLNA 4Z2WA 2QGNA 3CP1A 3VBBA 1RM1B 2XT9A 4X64O 1GTOA 2EZPA 5KLVH 1NVPB 1PM9A 5AG2A 3K58A 4NXNO 4R50A 1K8AW 3E2EA 4LFBO 1AP6A 4JI3O 3W7UA 4P9OA 2IM9A 2ZE8A 3H9VA 2YS8A 2QJ1A 4FMTA 3FB7C 1V54B 3SYCA 1KMIZ 4MTGA 2PYJA 3GB7C 5LP6C 5DN6G 4ZBMA 4DR6O 4DV3O 1FXKB 3LDCA 3J80N 4K8XA 2ZDIC 2EIMB 2LQTA 4DO2A 1MNGA 3TXQA 5KUKA 5LL6Y 3OMAB 2P90A 2UXBB 3CCJV 3CX5F 4K3AA 1ORQC 3BPZA 3OTOB 4J7KA 2YXYA 4DUYO 4FLXA 5EBWC 3FAVB 2F66C 3H1LH 1KC8W 1QR9A 4CH6A 4DV4B 1XL6A 4GCZA 3G80A 4X1KA 4B7EA 3B4SA 4DV0O 2Q7HA 1VARA 2LGWA 3W7XA 4TT3G 1VMGA 4UVBA 2GSMB 3QO5A 2ZINA 2XTAA 1YDXA 2WLNA 2JEXA 4UCRA 2LO1A 4LNUA 1NS1A 3O65A 3RT3C 2R9RB 1F4NA 1WP8A 3ABMC 3HKCB 1Q5OA 1XNRO 4O2BB 3H1IH 2DYRC 2QM4A 1FD9A 1NZ6A 4TQDA 2YEVA 1OCOC 3OUFA 2CE4A 1VQ9V 4DV2B 1XHXA 5KUMA 1I08A 3OD4A 4JI2O 3OMIB 1PD3A 4TQFA 4NYKA 5LOVA 1NTZH 2ZE6A 2XNDG 1MSDA 4KXRA 2ILMA 4RQFA 1DTOA 3DXRA 4J9ZB 1N33O 2HR3A 4UV9A 4TWKA 4UCOA 1BS3A 3UT5A 2BTOA 5KAFZ 4IHJB 4YJ3B 3C3SA 5FPRA 1NKDA 4FK5C 4X64B 1AP5A 4NXMO 2XUMA 1G6UA 3FFQA 3BHPA 3TK1A 4NXNB 1GK9A 3EFFK 3ASOB 1Y66A 4LFBB 4JI3B 1EN5A 2ZE7A 1WNSA 4JTCB 4FVMA 2HFEC 1VQ7V 1VQ5V 4I50A 5KAIZ 3KKYA 3C90A 4JASA 2R72A 1Y76B 3HKEA 1VQNV 4I50B 4DR6B 3S3WA 4DV3B 1NTKH 3C3TA 3HKEB 3K0DA 1JJOA 4X65O 3L73H 5JVDA 4FLYA 1N0NA 4FM0A 2LFRA 2YDEA 2DOSA 4DR7O 1W2BU 2EX3A 3BA8A 4JF3A 3M8AA 4EB6A 1I0HA 2BOCC 2YI8A 4FFKA 3K5MA 2QTSA 4DR1O 4EB6B 1Q3EA 3K5OA 1VQKV 4DUYB 1IDSA 2O57A 1PNKA 1BSMA 4ZHQA 2ARHA 2BOBC 3E83A 1K5QA 3LSSA 1Q81W 3CB2A 1GN6A 1VF7A 4DV0B 2CH7A 3CMAV 3N2GB 1XREA 2OCHA 3U0ZA 2CH7B 5CA0B 4LH6A 3E89A 1J5EO 1FXKC 2UXCO 5CN0A 3ZMZA 1W0KG 2B1IA 4J9YB 2EIMC 3AG4C 3ABTA 5L3FA 5JCOC 2DE0X 4GUNA 3ZJZA 4QGPA 4O2AA 2ZR3A 3ABKB 1XNRB 3HKDA 4FLZA 5GONB 2PYLA 3HKDB 2NNUA 2EINB 2A06H 1GN3A 2FB5A 2A0LA 1NJIW 1N34B 1US6A 1YVWA 2OCCC 2V4DA 4U3JB 1VQOV 2WLIB 2BCCH 4JI2B 1BL8A 4X1IA 3FYEB 4N23A 2B9ZA 3K59A 1NQTA 4GX0A 1K5SA 1F23A 4O4HB 3JSLA 2VWKA 2E75B 1N33B 4MVQA 5JJJB 2JGDA 1QLEB 3J81N 3I55V 1XBLA 2MK3A 5CMUA 2LP7A 4BR6A 3CYOA 4RQEA 2ZT9B 2OYQA 4NXMB 3GWKC 2HJDA 4LWSA 1RPOA 2WPDG 1FJGO 2CDYA 1K4CC 3JATB 4AQYO 4PDVA 5IWAO 4JYAO 3H1JH 4DV1O 3AG3C 5KX5B 3P30A 3TCUA 5KA6A 2Y0PA 2ZQMA 1Q86W 3ZS8C 3U11A 4CS2A 4JZGA 2Q7EA 3G4SV 2M7WA 2FMLA 4X65B 5H9CA 4DV6O 2IJJA 3ZHVA 3I5DA 4MVZA 4GX2A 4DR7B 1PPJH 3W7SA 3Q4HA 5H6QA 1M56C 4MVRA 1M93A 4MW8A 3CJHA 4DR1B 4WFEA 3T1HO 4JI6O 3OEEG 2F4VO 1KD1W 2N74A 2EULA 1HR0O 5EIBD 3ASOC 2Q8VA 5D5QA 1SA0B 5CB4B 5KHKA 1TVKA 1BHAA 2QWRB 3RW0A 4JGSA 2LW7A 3E8BA 1TVKB 2L6LA 1K3EA 1HDJA 2ADPA 3ZHSA 4XDKA 1VF6C 1JA8A 1EZVH 1J5EB 1EM1A 4FIPC 4J41A 1ZTEA 2PI5A 1BGYH 2QTOA 3ASNB 3RYCA 2CTPA 2EIJB 3BVOA 3W7WA 1IXMA 2ZD9A 3BABA 2QWOB 5IJ0A 3O9OA 3TGUH 1KP3A 2P4KA 3FX7A 1RSOB 4PD4F 5FL7G 4F6EA 1DK1A 5GTIZ 3N2KA 1K34A 5LXTB 1M57B 4OXSA 3K0GA 1Y6XA 1FXHA 1P84F 3UM7A 4LFCO 1V9PA 5LGTA 3KZIZ 2V7QG 2CGOA 4LH7A 3MAQA 4LF4O 2EJRA 3CCLV 2RQ6A 1R6TA 1EN6A 1ENVA 3ZHUA 1WPXA 2E5LO 2JGUA 1ZL8B 5CA1A 1YTFD 2DWEC 1WB7A 2UUAO 3MHHC 1SETA 4WFGA 1K33A 1GRJA 1DF5A 2RCVA 2ZNJA 2FKXA 2P06A 1QR8A 2R9IA 1JOYA 3BRCA 4JZ2A 4DR5O 1VQMV 1FJGB 4P9PA 2QWNB 2XAFA 4W4KA 2UXXA 5IWAB 2OIGA 4JYAB 4AI8A 4DV1B 3FYIB 1HWYA 1AILA 2KQXA 1H2MA 1QCEA 3L72H 1PNMA 1W0JG 4MT8A 4EFEA 5IT9N 1SZXA 3D36A 3N27A 1NR7A 1NBMG 2JJ1G 3T4DA 3JSNA 4IGGA 5JH7A 2WLKA 4DXWA 4DV6B 3OGIB 3D3IA 1EN4A 4XDJA 5IJ9B 1PL0A 5JH7B 1SQXH 4TV9B 4JI1O 3X2QB 3G6BA 1KKCA 4PA4A 2EILC 4BW9A 4DR2B 1V55C 3JCZA 3PN1A 3QO7A 2UU9O 5E79Z 1VEWA 3T1HB 3ZCCA 4AILC 1MSWD 1T5EA 5KHHA 1YIJV 2JEUA 4JI6B 2F4VB 4JI5O 3NR7A 3KCYA 4GT1A 2GUZA 2IJKA 1B6QA 2Y0IA 3APOA 5TISZ 1JCHA 4RWUA 3DSQA 3OEHG 1Q8IA 3F5TA 3OAAG 2BTQB 5BXZA 5J2UB 5D5PA 2QSAA 2QKAA 5J2TB 2RNBA 4LF6O 2LGQA 3RYFA 3HR0A 2C2AA 1SZTA 1U96A 1AJPA 2OTLV 3CRQA 1LR1A 4I0XB 4QE7A 4O4IB 2WA3A 4HNAB 4P30A 5B3SC 1H8HG 4R8CA 3BEHA 4Q6GA 4CS3A 1W59A 2JS5A 2Y69B 4G27B 4KUMA 3AEIA 3DC6A 4DRXA 1F7YA 2KG7B 4LF4B 4L8JA 2UXNA 3VQVA 4PA3A 4OGQB 2E5LB 3FD9A 1Q90D 3B40A 2UUAB 1YZBA 4N21A 4CC6A 4ABMA 4K8ZA 3BCCH 2PZSA 2A79B 3ASNC 2E3CA 3JD3A 1VP7A 1Y74A 1BZKA 4OPHA 4DR5B 2Q67A 5DM6V 1N32O 4FLWA 3E8GA 4XBFA 3F7YC 2QWQB 1A32A 2N05A 4FZ0A 1M57C 3ZMTA 1E1RG 3K79A 4X1YA 1S72V 2ZXWB 2P7TC 3LUTB 3K9AA 2IW5A 5CBGA 3HB3B 2L35A 2DW4A 3CS5A 2A3QA 2HEPA 5H2FZ 3TJTA 3ABLC 1U97A 5J9PC 5EBLC 5EC2C 2LW1A 1PKXA 1SS3A 1N8RW 3RBZA 3HKBA 4NVPA 5K1XA 4JI1B 1AI6A 3A8TA 2UXDO 3BAAA 2UU9B 5IYCO 5EC1C 1RFYA 2ITCC 5CA3A 3VQXA 1BQZA 1B3QA 4H13B 2DN9A 4X1KB 4JI5B 4BAYA 1AJQA 5LA6A 5FNVA 3CEIA 4HYOA 1HNZO 3ZMVA 5LA6B 1WA8A 2QE7G 2Y48A 1SQGA 5K1PA 1I5XA 4LC1A 3ETDA 3WB1A 5EK0A 2XAGA 4LNUB 3STZC 2QA4V 3CRRA 3CHXA 4FFBA 4LF6B 4LFAB 4DV5O 3CSXA 5LBQA 3WG7B 5LGNA 2IH1C 3ICXA 2W6IG 5B1BB 5IY5B 1YHQV 3ZRWA 2NR5A 2YEVB 2F95B 2Z3YA 3AK2A 2IU0A 4JI8O 1OCRB 4F4LA 2CUGA 1FPOA 2GBOA 4LF9O 4Q20A 4GKJO 3CCVV 1SKVA 3AG1C 1XOUA 3NXSA 1FS0G 5LOVB 4U7OA 1NH2D 5BR8O 2H8PC 4R6ZA 3CC2V 1GM8A 1LUVA 3ZX6A 1OCCC 1N0JA 3ZRSA 3DXRB 4B3MO 1H2LA 2DMXA 3UT5B 4RUEA 5EYPA 3IC9A 1XDCA 3SDLA 1YITV 1LNQA 1MG1A 5EZYA 2ATKC 2ZKOA 3CRAA 4JTAB 4YHHO 4MSWC 4H33A 1N32B 4PDMA 3K06A 1TA8A 4J10A 2AXTZ 1JVMA 2RMKB 1H2GA 3T2MA 3SYAA 2QDOA 5LHGA 1P4RA 4MTFA 5JVDB 1PL4A 1M90W 2JVDA 1S5JA 3T4ZA 1RM1C 3KG2A 4D7TA 1D5AA 4PI2A 5C8YA 4ZHQB 2UXDB 1X4TA 1B06A 1NU1H 2XOKG 5C8YB 1K73W 3ETQA 3CRCA 3SJCC 5FPOA 1V54C 2UUCO 2IJIA 1VF5B 1MZFA 3LSQA 1THZA 2LJ2A 4LCUC 1XILA 1KKDA 2F93B 1EBOA 1KECA 2ZXWC 4U3FH 2HLDG 3AG2B 4JYYA 3JASA 4CH4A 4E4EA 4Z1VA 4PA9A 4X9QA 4KP4A 3SGIA 1EZJA 4DV5B 4O2AB 2WLMA 3OTFA 2F23A 3K04A 2WLJA 4I9WA 4FZ1A 4NTWA 1QVFU 1ZUQA 4JI8B 4P2ZA 2CAZC 4LF9B 4ICGA 3QG5A 4IYHA 1I5YA 1AR1B 1R3JC 4LP8A 4X1IB 4WFFA 5BR8B 4IIJA 2QKCA 4EFBA 1H2NA 4QPJA 4DK1A 4IIJB 5BY1A 4B3MB 5CBHA 3ZIAG 3DC5A 2JRIA 2JGDB 3CCSV 5IYDO 4JI7O 4MVOA 2GTAA 2QR4A 2W0FC 3W7TA 2X6CA 2ZIOA 2ODMA 5KHIA 4LWSB 4YHHB 4UCUA 2ETNA 4QJFB 4NKGB 3E35A 3RVZA 5KHGA 2WAMA 3RVYA 1IVSA 1S5LZ 1KQSU 1CPYA 1AB3A 5B1OA 3L71H 3J7AU 1KBHA 1XL4A 4DW0A 5L3GA 1S0VA 3E8FA 4NTXA 3SR2C 1M4UA 2AW9A 1JPXA 3ZHQA 4X20A 3JARA 3JALA 2Z5UA 3RN4A 4X20B 2XHBA 4YJ2A 4TUYA 4MVMA 2DQ3A 1OV9A 4LF5O 2E74B 3Q4HB 5JJEB 3U10A 2YIAA 1I7FA 4MTXA 4B7KA 1H2KA 3B77A 3CJHB 1VQLV 4NTYA 1XUQA 1K4DC 3AG7A 3K9SA 4MW3A 1K7DA 2HKOA 2GHYA 1RP3B 3WFVA 2UUCB 2Q68A 4MTOA 4ZKIA 4X66O 4UV8A 3EVKA 4X62O 2RDCA 2IH3C 3LNNA 3JAWA 1ZWIC 1BMFG 4LR3A 2UXCB 3JCUZ 1Q82W 2HJFC 1AR5A 4NB5A 5A9GA 1URFA 4B3TO 2A7WA 4ZI7A 3RYCB 1NT2B 2Q7GA 1VQ4V 5IJ0B 5B5EZ 3OFNG 3MDSA 4QIWF 1R6KA 2W0XA 4F6RA 1SQPH 2CTWA 4I55A 5CBFA 1Q6IA 1Y67A 2HP8A 1WLEA 4TV8A 2HHHO 4UB8Z 3ZRVA 3JAMN 2YXLA 3N2KB 4RAIA 3SPIA 4TOIA 1YI2V 1OCZB 3JD1A 1GM7A 4MS2A 2EZOA 2PY5A 3LNMB 4JI4O 3ZN0A 5IYBO 2Q69A 4CBCA 2YIBD 2G38A 3EHBB 5LP6A 3ZMSA 1TUBA 4GLXA 5IYZA 1YXBA 4BIUA 1KU9A 2ZDIA 1JX9A 5L3DA 3MHSC 3SPGA 4DUZO 1D5NA 2WLLA 5CA1B 1L8DA 3FB6C 1WB8A 2AZ2A 1G1XB 2Q6AA 3VQWA 5B66Z 1YF2A 4JI7B 3ABKC 4QE9A 5GW7A 3RFRA 2QM7A 2XAQA 1ZX3A 4AQYB 3LDEA 2DYSB 2XAHA 2EINC 5BMVA 1UPGA 2A9HA 2DJVA 4RO2A 4GYCB 3M7MX 2BSKA 3ETGA 1GM9A 2Z0AA 4XDLA 1IBMO 4FLUA 1GAXA 4UB6Z 1KB9F 3BFRA 2HG5C 3WB0A 1R3IC 4WCEV 1XQ8A 2KB1A 4QNHB 1JFFA 1K92A 3OR7C 1QLEC 4H44B 4GKKO 5JJNB 2ZCEA 1YJWV 1JFFB 2YXHA 4YIPA 4RUFA 4J7ZA 3ABMB 4LF5B 1H38A 2WWWA 3JAKA 5LYJA 1SESA 3K5LA 3SJQC 5LYJB 2DYRB 4BIOA 1HR0B 4JPRA 1L0LH 2AHZA 5HFLA 4MVSA 3AK3A 1ROPA 4DR3O 1GKFA 2GUZB 1GN2A 1SERA 1SQVH 1R6NA 4JYBA 4X66B 4X62B 4FPPA 3IGAC 2P67A 3P3PA 1SQFA 3RYFB 4HZ3A 1IZ3A 4UFZA 1IXBA 4J42A 5B1AB 4B3TB 3A0BZ 3A0RA 3FB8C 1IBKO 2YUAA 3K3WA 3CC4V 3T1CA 4L87A 4JYCA 5H5NA 1YCIA 5E1AC 1AROP 1G4YB 2HHHB 3B8MA 1IX9A 1XI1A 2N04A 1VQ6V 4CZZA 4LFCB 2CTRA 4O4JA 1K97A 1PV0A 4JI4B 3APQA 1QQCA 4OPAA 4LF8O 2AHYA 3JD4A 4DRXB 5LMUO 2YICA 2R9AA 5JQGA 3E86A 3E22A 3H1KH 1I94O 1JR9A 2EIJC 4LF7O 5DECA 3D3QA 1XMQO 3QTCA 4PDLA 1SQBH 1Y74B 2B1GA 3IJ4A 3K5NA 1S3JA 3K08A 2AGAA 3ZN1A 2Q0OC 1OCZC 4X1YB 4UCTA 1TUEB 1IBMB 3OT7A 3TETA 4B08A 3CPWU 1VIBA 1LUWA 1HNWO 1NR1A 1FXKA 5JWPA 2V1DA 3CE2A 3T1YO 1NI8A 3TXSA 4E2LA 5JCOA 4GKKB 4JAUA 2YIDA 2YC0A 1S5HC 3HKBB 3WU2Z 3AG4B 2HVKC 1QU7A 1OHHG 3UCSC 1JQ0A 5LHHA 3OR6C 4CC5A 4BW5A 4CS4A 1ZLZA 2ZM6O 4FLVA 4GX5A 2CGNA 2D3OW 3PJSK 2OIEA 4B3SO 4UCSA 1BT8A 1NH2B 5KA5A 3FAVA 2DYSC 2Q73A 1NVPD 5LMNO 2P22C 4PHZA 5FNVB 2OCCB 4DR3B 1S76D 2RN9A 1WA8B 2B5UA 5HFMA 4GX1A 3P32A 1N36O 1AI5A 3MD0A 3D36C 1M9NA 3G6EV 5C93A 3H1HH 3B8NA 4FFBB 3K57A 4PJ0Z 2X6AA 4R7CA 2EIKB 1YJ9V 2VS0A 1IBKB 3HKCA 3X2QC 5A2QN 1HNXO 4I7ZB 4O2BA 3ZRWB 3QVNA 5ITZA 4UCVA 1UFIA 4HAMA 5ITZB 1S77D 3A2FA 3QNEA 3UKMA 1L1FA 1SC5B 1E1QG 3LSUA 3DTUB 3UO2A 1D2DA 3AG3B 1N34O 1BCCH 1PNLA 3CXHF 2EJ7A 4LF8B 1WN7A 1XEQA 4BWAA 4AHCA 3R66A 4B3RO 5LMUB 2PTMA 1M1KW 5EYPB 4DV7O 2AZ0A 1RPRA 2JIZG 3SJBC 4IYIA 3KCXA 1I94B 4IHJA 1P7GA 5EZYB 3VOUA 4YJ3A 1R3LC 4LF7B 1Q6HA 3UO3A 1K9MW 3A0HZ 3D8CA 3G67A 5B1AC 1COWG 1XMQB 1M56B 3OM3B 1R73A 1JMKC 4PA6A 4HBNA 3IFXA 1WPBA 1KUQA 1Q7YW 4DYLA 2DWDC 4JI0O 3M99B 3RYHA 2FL4A 2Y69C 4DR4O 3RYHB 1YEWA 5L3BA 3CCQV 2ZNIA 1XNQO 2H94A 1MABG 1OZ0A 5EBMC 2ZR2A 4D7SA 2K9PA 1VF6A 3OMNB 1Y76A 3RYIA 1FAFA 4WF9V 1HNWB 1AVMA 4EKWA 3RYIB 3T1YB 3AK1A 1WJZA 1HP8A 3SYPA 5IDJA 1HW7A 3CMEV 1AI7A 1SQQH 1XMOO 3IAYA 4JAAA 4CH3A 4WFAV 5GTHZ 2ZM6B 3HPLC 4B3SB 4KL1A 3QO8A 1MOFA 1SF9A 1GN4A 2R70A 1HNZB 2XASA 4ZOLA 4MVUA 5LMNB 1IBLO 2IBZH 2OTJV 2OT5A 2QWPB 4NR1A 3SJAC 1TGOA 4ZOLB 4LBEC 4C7UA 1DF4A 4X8AA 3FB5C 1QVGU 3BA9A 3CC7V 3N2GA
chains in the Genus database with same CATH topology
3OAAG 3QO5A 1ZWIC 1BMFG 1Q82W 2WLNA 2HJFC 1BHBA 2JEXA 1AJNA 1FXVA 3JD0A 2IU3A 2C2AA 1AI4A 2R9RB 1F4NA 1SZTA 2NLJC 3ABMC 3DGEA 1VQPV 1AJPA 1R3KC 1VQ4V 2OTLV 3OFNG 2F43G 4QIWF 1R6KA 2DYRC 4QE7A 5CBFA 2YEVA 1WLEA 1OCOC 4P30A 3OUFA 3ZRVA 5B3SC 1H8HG 4R8CA 4RAIA 1YI2V 3SPIA 3BEHA 1VQ9V 2ITDC 1OCZB 3JD1A 1GM7A 4MS2A 3FKSG 2EZOA 5KUMA 3LNMB 2Y69B 3ZN0A 2QKSA 1J95A 3OMIB 1PD3A 2WLIA 5IYBO 2Q69A 4CBCA 4JTDB 3EHBB 3STLC 3ZMSA 4G27B 4KUMA 3AEIA 3CXCU 3SPJA 4QPKA 4BIUA 2XNDG 2ZDIA 1JX9A 5L3DA 3JD2A 3MHSC 3SPGA 4RQFA 1DTOA 3BY6A 2XAJA 4J9ZB 2UXNA 3K03A 2HR3A 2WLLA 4UV9A 4PELA 4PA3A 4TWKA 3OUSA 3FB6C 3OE7G 4WFHA 1DLBA 4FJCC 2Q6AA 3WG7C 1FFTB 4N21A 1UJWB 1NKDA 3ABKC 4QE9A 2EIKC 4FK5C 5B1BC 5IY5C 2A79B 2EILB 3ASNC 4I5SA 5GW7A 2QM7A 3JD3A 3CCEV 2XAQA 1OCRC 2Q67A 1V55B 3LDEA 4H37A 5DM6V 2DYSB 3TK1A 2XAHA 2EINC 1GK9A 3EFFK 3E8GA 3CCRV 3ASOB 1Y66A 2A9HA 1KP2A 3GWOA 4XBFA 3ZRXA 3F7YC 4RO2A 4JTCB 1M57C 3ZMTA 3ABUA 3ETGA 1GM9A 5L3EA 1E1RG 2HFEC 3K79A 2X6BA 4XDLA 1VQ7V 1S72V 1VQ5V 2ZXWB 2P7TC 3LUTB 3K9AA 2IW5A 5CBGA 4JASA 2HG5C 3HB3B 1VQNV 2JJ2G 1R3IC 2DW4A 4WCEV 2KB1A 4QNHB 3ABLC 1K92A 1CP9A 3K0DA 3OR7C 1QLEC 5J9PC 5EBLC 2WLHA 5EC2C 1PKXA 1EFRG 1YJWV 1N8RW 3CCMV 2LFRA 4RUFA 2LFSA 1W2BU 3RBZA 3ABMB 1H38A 4JF3A 2WWWA 4UVCA 2BOCC 1P7BA 1SESA 1AI6A 4X89A 3SJQC 2DYRB 1VQKV 1SRYA 5IYCO 1PNKA 5EC1C 4JPRA 2AHZA 5B3SB 2ITCC 5HFLA 5CA3A 2BOBC 4MVSA 1ROPA 3E83A 1K5QA 3LSSA 4BAYA 1Q81W 1GKFA 1AJQA 4UVAA 4HYOA 1YTFB 3ZMVA 4ASUG 1SERA 1R6NA 4JYBA 3CMAV 2QE7G 3SYOA 2Y48A 4FPPA 1I5XA 3IGAC 3OGCC 4LC1A 2P67A 3ETDA 3E89A 5EK0A 2XAGA 1FXKC 5CN0A 3STZC 2QA4V 4HZ3A 3ZMZA 1W0KG 2B1IA 4J9YB 2EIMC 3AG4C 3ABTA 5L3FA 5B1AB 5L3CA 2W6JG 3A0RA 3FB8C 5H6RA 5LBQA 3F5WC 3ZJZA 3WG7B 5LGNA 1F4MA 2IH1C 2ZR3A 3ABKB 3JYCA 2W6IG 3K3WA 5B1BB 5IY5B 1YHQV 2YSUB 3T1CA 3CC4V 3CD6V 3ETEA 3ZRWA 4L87A 4JYCA 2YEVB 2Z3YA 2IU0A 1OCRB 5E1AC 4F4LA 1AROP 1G4YB 2NNUA 2EINB 3G71V 3B8MA 4Q20A 2A0LA 4CZZA 1VQ6V 1GO3F 1NJIW 3CCVV 3AG1C 2OCCC 5LHIA 1K97A 2WLIB 3NXSA 1VQOV 2CK3G 1FS0G 1BL8A 4U7OA 1NH2D 2H8PC 4R6ZA 3CC2V 1GM8A 2AHYA 2JK5C 3FYEB 3JD4A 4N23A 1OCCC 1NQTA 4GX0A 4JAVA 4UUJC 3ZRSA 1K5SA 1F23A 3AG2C 2WLLB 3E86A 1CEZA 3ABLB 4Z1MG 4RUEA 4MVQA 4BIZA 1QLEB 4G28B 3I55V 2MK3A 5CMUA 2LP7A 1YITV 1LNQA 1MG1A 2EIJC 3CYOA 4RQEA 3LDDA 1F51A 2ATKC 1G8MA 2PI4A 4PDLA 4JTAB 1H8EG 4MSWC 2B1GA 1RPOA 2WPDG 1K4CC 1S3JA 4H33A 4PDVA 3K08A 4PDMA 3K06A 4PDRA 3AG3C 3ZN1A 1OCZC 3P30A 3TCUA 1JVMA 5KA6A 1TUEB 2FTKA 2ZQMA 1GMGA 2QM8A 1H2GA 3T2MA 3TETA 5BZBA 3CPWU 1Q86W 3G4SV 1NR1A 3SYAA 1FXKA 2V1DA 4G2KA 5LHGA 1P4RA 4MTFA 2M7WA 4E2LA 5H9CA 1M90W 2IJJA 4JAUA 1S5HC 1QBZA 3T4ZA 1RM1C 4MVZA 4GX2A 3AG4B 2HVKC 2K1EA 1OHHG 2IJHA 3W7SA 1JQ0A 4KFMA 5H6QA 5LHHA 1M56C 3OR6C 4MVRA 1OCOB 4BW5A 4MW8A 2X0LA 3KG2A 3OW2U 4GX5A 2D3OW 3H01A 3PJSK 2HVJC 4WFEA 2EBOA 3IC7A 1NH2B 2XOKG 5KA5A 3OEEG 1K73W 2DYSC 1KD1W 1E79G 1NVPD 1YSCA 3AG1B 3ASOC 2OCCB 1V54C 2IJIA 3E8HA 2WSSG 1S76D 4TSFG 3ZMUA 1BHAA 3LSQA 2B5UA 1THZA 5HFMA 4LCUC 3RW0A 4X88A 4GX1A 4JGSA 2JDIG 3E8BA 1KKDA 1EBOA 3P32A 1OCCB 1KECA 1K3EA 4PA7A 2DQ0A 1AI5A 2ZXWC 3MD0A 4UXNA 3F7VC 2HLDG 3AG2B 4XDKA 1M9NA 3G6EV 5C93A 4FIPC 3B8NA 3SYQA 2PI5A 2X6AA 4PA9A 4YXWG 1JJ2U 2X7RB 2EIKB 4R7CA 4KP4A 1YJ9V 2QTOA 3R65A 1EZJA 2WLMA 2P6JA 3ASNB 2EIJB 3X2QC 3K04A 1IXMA 3W7WA 2ZD9A 1Y4MA 2WLJA 3ZRWB 4I9WA 2QEXV 5LGUA 1KP3A 3CCUV 1QVFU 4P2ZA 5FL7G 4HAMA 1S77D 3QNEA 1K34A 1M57B 3UKMA 4OXSA 1E1QG 3K0GA 1L1FA 3DTUB 1VQ8V 1FXHA 1I5YA 1AR1B 3UM7A 3AG3B 1R3JC 4LP8A 1PNLA 5LGTA 4WFFA 3SPHA 1YJNV 2V7QG 3I56V 3SPCA 4QPJA 2EJRA 3CCLV 5CBHA 3ZIAG 1ENVA 4U7NA 5B1NA 1M1KW 1WPXA 3ML0A 1RPRA 4WFBV 2JIZG 3CCSV 1YTFD 2DWEC 1QLNA 3MHHC 3CP1A 1SETA 4WFGA 1K33A 3VOUA 3VBBA 5IYDO 1RM1B 1DF5A 4MVOA 1R3LC 2W0FC 3W7TA 1K9MW 2X6CA 5B1AC 1COWG 1QR8A 2R9IA 1M56B 1GTOA 3OM3B 1JOYA 1R73A 2EZPA 1VQMV 4PA6A 1NVPB 4QJFB 4P9PA 3IFXA 3E35A 1Q7YW 4R50A 2DWDC 1K8AW 3E2EA 3W7UA 3M99B 2XAFA 4P9OA 3RVZA 2UXXA 2WAMA 3RVYA 2Y69C 1KQSU 1CPYA 3FYIB 1HWYA 5L3BA 4FMTA 5B1OA 3FB7C 1V54B 3CCQV 3SYCA 1XL4A 1QCEA 2H94A 1MABG 4MTGA 1PNMA 1OZ0A 5EBMC 2ZR2A 1W0JG 3GB7C 5L3GA 1S0VA 3E8FA 4MT8A 5DN6G 4ZBMA 3D36A 1FXKB 3OMNB 3LDCA 1NR7A 1JPXA 1NBMG 2JJ1G 2ZDIC 4WF9V 3T4DA 4EKWA 2EIMB 2WLKA 4DXWA 2Z5UA 3D3IA 4DO2A 4XDJA 5KUKA 3SYPA 5IDJA 4MVMA 1PL0A 2DQ3A 3OMAB 3CMEV 2P90A 3CCJV 1AI7A 1ORQC 3X2QB 4PA4A 2EILC 4MTXA 4WFAV 1V55C 3B77A 3JCZA 3QO7A 1VQLV 3HPLC 5EBWC 1K4DC 3QO8A 3ZCCA 1MSWD 1YIJV 2JEUA 1MOFA 1QR9A 1KC8W 1XL6A 2XASA 4GCZA 4MW3A 1K7DA 4MVUA 2HKOA 2OTJV 2GHYA 2OT5A 4GT1A 3WFVA 2IJKA 2Q68A 4MTOA 4TT3G 1B6QA 4ZKIA 3W7XA 4LBEC 4UVBA 1JCHA 1DF4A 4X8AA 3FB5C 1QVGU 4UV8A 3OEHG 3CC7V 2GSMB 2IH3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EBO A;  3B8N A;  1K33 A;  3GWO A;  1DF5 A;  1I5Y A;  1QCE A;  4N23 A;  4G2K A;  5KA5 A;  2M7W A;  3B77 A;  2X7R B;  1F23 A;  1DLB A;  1QR8 A;  4JF3 A;  4FJC C;  5H9C A;  4E2L A;  2P6J A;  2EZP A;  2EZO A;  1JPX A;  1I5X A;  1QBZ A;  1Y4M A;  4N21 A;  1MOF A;  1QR9 A;  3B8M A;  4FK5 C;  3K9A A;  2MK3 A;  5CMU A;  5HFM A;  1SZT A;  2LP7 A;  3P30 A;  1JQ0 A;  3M99 B;  4JGS A;  4JPR A;  1MG1 A;  1ENV A;  2OT5 A;  5CN0 A;  5KA6 A;  1EBO A;  3WFV A;  5HFL A;  3CYO A;  3MHS C;  3H01 A;  1DF4 A;  1K34 A;  1Y66 A;  3MHH C;  3CP1 A;  4FIP C; 
#chains in the Genus database with same CATH topology
 2D2C B;  5CA0 A;  1N36 B;  3JAS B;  1BHB A;  2Q0A A;  4DW1 A;  1AJN A;  1FXV A;  3JD0 A;  4I9Q A;  2P4V A;  5DED A;  2IU3 A;  2UUB O;  1O9H A;  1AI4 A;  2NLJ C;  3DGE A;  1VQP V;  1R3K C;  2Y4U A;  1GH6 A;  2F43 G;  1HNX B;  4GKJ B;  2Y4T A;  1H2S B;  5GON A;  2ADQ B;  2ITD C;  3FKS G;  4U3J A;  2QKS A;  1J95 A;  2WLI A;  4FM2 A;  1Z5V A;  2MW2 B;  4JTD B;  3STL C;  3CXC U;  1N4C A;  3SPJ A;  4QPK A;  3JD2 A;  3BY6 A;  4B3R B;  2XAJ A;  1KYO F;  3K03 A;  4O4H A;  4DV7 B;  4PEL A;  3OUS A;  3OE7 G;  4WFH A;  3GVM A;  4K35 A;  1DLB A;  5FLX N;  4FJC C;  1OJH A;  1X59 A;  4JV5 O;  3WG7 C;  1O9G A;  1FFT B;  1UJW B;  2WA4 A;  2EIK C;  5B1B C;  5IY5 C;  2EIL B;  4I5S A;  2CTQ A;  3CCE V;  5KHJ A;  1OCR C;  1ZAU A;  1V55 B;  3B09 A;  4H37 A;  4IT5 A;  4OX9 O;  2JS3 A;  3CCR V;  4JI0 B;  3JAT A;  4IL6 Z;  1BE3 H;  1KP2 A;  3GWO A;  3ZRX A;  3ZED A;  1Q43 A;  2NN4 A;  4DR4 B;  4PI0 A;  5KX5 A;  3ABU A;  5L3E A;  2X6B A;  4D6T H;  1XNQ B;  4FM1 A;  3ZBH A;  2ZE5 A;  2JJ2 G;  4H0L B;  1CP9 A;  3L9D A;  3JAR B;  2ZIM A;  3JAL B;  2WLH A;  1TAE A;  1EFR G;  4YJ2 B;  2VQE O;  4TUY B;  3CCM V;  2LFS A;  4UVC A;  1P7B A;  1XMO B;  4KHP O;  4X89 A;  2YIB A;  2Q4P A;  5KMG A;  1AR4 A;  1SRY A;  4DR2 O;  5B3S B;  1MMM A;  5KMG B;  1B04 A;  4J7J A;  4UVA A;  1IBL B;  4J11 A;  1YTF B;  1SA0 A;  4ASU G;  5CB4 A;  2VQF O;  3SYO A;  3JAW B;  3CWB H;  1BQ0 A;  3L75 H;  3OGC C;  2P5O A;  3THO A;  4YY3 O;  2UUB B;  2FYU H;  4ZI7 B;  3B2E E;  1Z2G A;  5L3C A;  2W6J G;  5H6R A;  3F5W C;  1FKA O;  1F4M A;  3RWR D;  1NTM H;  3JYC A;  4I4T A;  4F6R B;  2YSU B;  3CD6 V;  4I55 B;  2H3O A;  3ETE A;  4TV8 B;  2PGG A;  4I4T B;  1M5I A;  1RSO A;  3G71 V;  5F2V O;  1GO3 F;  5LXT A;  5LHI A;  1PP9 H;  1L0N H;  2CK3 G;  4O4L A;  3ZHR A;  5LP6 B;  4K0K O;  2BE3 A;  1TUB B;  1QHT A;  1FFX A;  2JK5 C;  5IYZ B;  4DK0 A;  4O4L B;  4UUJ C;  4JAV A;  1FFX B;  3AG2 C;  2KSD A;  1CXZ B;  2WLL B;  1CEZ A;  3ABL B;  3VQY A;  4Z1M G;  4BIZ A;  4G28 B;  1ZL8 A;  4JV5 B;  3LDD A;  1F51 A;  3S3X A;  1G8M A;  2PI4 A;  2Q9L A;  1H8E G;  1IUR A;  5BMV B;  3EXA A;  1XHZ A;  2GDS A;  4A5U B;  4OX9 B;  2PUS A;  4PDR A;  3QF7 A;  1FYJ A;  4EEQ A;  2BSK B;  3P3N A;  2FTK A;  1GMG A;  2QM8 A;  5BZB A;  3RGB A;  4GZR B;  4CH5 A;  4G2K A;  4WBN A;  4ZIB A;  2VQE B;  3ZHT A;  4WBN B;  1QBZ A;  4YIO A;  1MZE A;  1ZSP A;  2K1E A;  5IJ9 A;  2UXB O;  3JAK B;  2IJH A;  4TV9 A;  3OTO O;  4KFM A;  1OCO B;  2E76 B;  4KHP B;  1R1B A;  1QNM A;  2X0L A;  3OW2 U;  5EIB C;  1P49 A;  1WAZ A;  3H01 A;  2HVJ C;  3UQ8 A;  2EBO A;  3L70 H;  2OWO A;  3IC7 A;  4DV4 O;  1E79 G;  1DGS A;  1YSC A;  3WB2 A;  3AG1 B;  1MA1 A;  3E8H A;  3L74 H;  2WSS G;  4TSF G;  3ZMU A;  2GV9 A;  2VQF B;  2KKW A;  2RJZ A;  4X88 A;  2JDI G;  2F1M A;  1OCC B;  2BTQ A;  4PA7 A;  2DQ0 A;  4UXN A;  5J2U A;  3F7V C;  3SYQ A;  5J2T A;  3CRM A;  4YXW G;  1JJ2 U;  2X7R B;  4YY3 B;  3R65 A;  2VWJ A;  2P6J A;  1Q6U A;  4LFA O;  1Y4M A;  2YI9 A;  2QEX V;  5LGU A;  3CCU V;  4FLT A;  2Q5Z A;  4I0X A;  4O4I A;  4HNA A;  1WP7 A;  4DV2 O;  4O4J B;  1VQ8 V;  4PV1 B;  2GTS A;  4W4L A;  3SPH A;  4K0K B;  4DUZ B;  1YJN V;  2VRZ A;  2PF4 E;  3I56 V;  1Z5W A;  3SPC A;  5IE9 A;  2KG7 A;  2M6Y A;  5JQG B;  4U7N A;  5B1N A;  3E22 B;  3ML0 A;  4J80 A;  4WFB V;  1QLN A;  4Z2W A;  2QGN A;  3CP1 A;  3VBB A;  1RM1 B;  2XT9 A;  4X64 O;  1GTO A;  2EZP A;  5KLV H;  1NVP B;  1PM9 A;  5AG2 A;  3K58 A;  4NXN O;  4R50 A;  1K8A W;  3E2E A;  4LFB O;  1AP6 A;  4JI3 O;  3W7U A;  4P9O A;  2IM9 A;  2ZE8 A;  3H9V A;  2YS8 A;  2QJ1 A;  4FMT A;  3FB7 C;  1V54 B;  3SYC A;  1KMI Z;  4MTG A;  2PYJ A;  3GB7 C;  5LP6 C;  5DN6 G;  4ZBM A;  4DR6 O;  4DV3 O;  1FXK B;  3LDC A;  3J80 N;  4K8X A;  2ZDI C;  2EIM B;  2LQT A;  4DO2 A;  1MNG A;  3TXQ A;  5KUK A;  5LL6 Y;  3OMA B;  2P90 A;  2UXB B;  3CCJ V;  3CX5 F;  4K3A A;  1ORQ C;  3BPZ A;  3OTO B;  4J7K A;  2YXY A;  4DUY O;  4FLX A;  5EBW C;  3FAV B;  2F66 C;  3H1L H;  1KC8 W;  1QR9 A;  4CH6 A;  4DV4 B;  1XL6 A;  4GCZ A;  3G80 A;  4X1K A;  4B7E A;  3B4S A;  4DV0 O;  2Q7H A;  1VAR A;  2LGW A;  3W7X A;  4TT3 G;  1VMG A;  4UVB A;  2GSM B;  3QO5 A;  2ZIN A;  2XTA A;  1YDX A;  2WLN A;  2JEX A;  4UCR A;  2LO1 A;  4LNU A;  1NS1 A;  3O65 A;  3RT3 C;  2R9R B;  1F4N A;  1WP8 A;  3ABM C;  3HKC B;  1Q5O A;  1XNR O;  4O2B B;  3H1I H;  2DYR C;  2QM4 A;  1FD9 A;  1NZ6 A;  4TQD A;  2YEV A;  1OCO C;  3OUF A;  2CE4 A;  1VQ9 V;  4DV2 B;  1XHX A;  5KUM A;  1I08 A;  3OD4 A;  4JI2 O;  3OMI B;  1PD3 A;  4TQF A;  4NYK A;  5LOV A;  1NTZ H;  2ZE6 A;  2XND G;  1MSD A;  4KXR A;  2ILM A;  4RQF A;  1DTO A;  3DXR A;  4J9Z B;  1N33 O;  2HR3 A;  4UV9 A;  4TWK A;  4UCO A;  1BS3 A;  3UT5 A;  2BTO A;  5KAF Z;  4IHJ B;  4YJ3 B;  3C3S A;  5FPR A;  1NKD A;  4FK5 C;  4X64 B;  1AP5 A;  4NXM O;  2XUM A;  1G6U A;  3FFQ A;  3BHP A;  3TK1 A;  4NXN B;  1GK9 A;  3EFF K;  3ASO B;  1Y66 A;  4LFB B;  4JI3 B;  1EN5 A;  2ZE7 A;  1WNS A;  4JTC B;  4FVM A;  2HFE C;  1VQ7 V;  1VQ5 V;  4I50 A;  5KAI Z;  3KKY A;  3C90 A;  4JAS A;  2R72 A;  1Y76 B;  3HKE A;  1VQN V;  4I50 B;  4DR6 B;  3S3W A;  4DV3 B;  1NTK H;  3C3T A;  3HKE B;  3K0D A;  1JJO A;  4X65 O;  3L73 H;  5JVD A;  4FLY A;  1N0N A;  4FM0 A;  2LFR A;  2YDE A;  2DOS A;  4DR7 O;  1W2B U;  2EX3 A;  3BA8 A;  4JF3 A;  3M8A A;  4EB6 A;  1I0H A;  2BOC C;  2YI8 A;  4FFK A;  3K5M A;  2QTS A;  4DR1 O;  4EB6 B;  1Q3E A;  3K5O A;  1VQK V;  4DUY B;  1IDS A;  2O57 A;  1PNK A;  1BSM A;  4ZHQ A;  2ARH A;  2BOB C;  3E83 A;  1K5Q A;  3LSS A;  1Q81 W;  3CB2 A;  1GN6 A;  1VF7 A;  4DV0 B;  2CH7 A;  3CMA V;  3N2G B;  1XRE A;  2OCH A;  3U0Z A;  2CH7 B;  5CA0 B;  4LH6 A;  3E89 A;  1J5E O;  1FXK C;  2UXC O;  5CN0 A;  3ZMZ A;  1W0K G;  2B1I A;  4J9Y B;  2EIM C;  3AG4 C;  3ABT A;  5L3F A;  5JCO C;  2DE0 X;  4GUN A;  3ZJZ A;  4QGP A;  4O2A A;  2ZR3 A;  3ABK B;  1XNR B;  3HKD A;  4FLZ A;  5GON B;  2PYL A;  3HKD B;  2NNU A;  2EIN B;  2A06 H;  1GN3 A;  2FB5 A;  2A0L A;  1NJI W;  1N34 B;  1US6 A;  1YVW A;  2OCC C;  2V4D A;  4U3J B;  1VQO V;  2WLI B;  2BCC H;  4JI2 B;  1BL8 A;  4X1I A;  3FYE B;  4N23 A;  2B9Z A;  3K59 A;  1NQT A;  4GX0 A;  1K5S A;  1F23 A;  4O4H B;  3JSL A;  2VWK A;  2E75 B;  1N33 B;  4MVQ A;  5JJJ B;  2JGD A;  1QLE B;  3J81 N;  3I55 V;  1XBL A;  2MK3 A;  5CMU A;  2LP7 A;  4BR6 A;  3CYO A;  4RQE A;  2ZT9 B;  2OYQ A;  4NXM B;  3GWK C;  2HJD A;  4LWS A;  1RPO A;  2WPD G;  1FJG O;  2CDY A;  1K4C C;  3JAT B;  4AQY O;  4PDV A;  5IWA O;  4JYA O;  3H1J H;  4DV1 O;  3AG3 C;  5KX5 B;  3P30 A;  3TCU A;  5KA6 A;  2Y0P A;  2ZQM A;  1Q86 W;  3ZS8 C;  3U11 A;  4CS2 A;  4JZG A;  2Q7E A;  3G4S V;  2M7W A;  2FML A;  4X65 B;  5H9C A;  4DV6 O;  2IJJ A;  3ZHV A;  3I5D A;  4MVZ A;  4GX2 A;  4DR7 B;  1PPJ H;  3W7S A;  3Q4H A;  5H6Q A;  1M56 C;  4MVR A;  1M93 A;  4MW8 A;  3CJH A;  4DR1 B;  4WFE A;  3T1H O;  4JI6 O;  3OEE G;  2F4V O;  1KD1 W;  2N74 A;  2EUL A;  1HR0 O;  5EIB D;  3ASO C;  2Q8V A;  5D5Q A;  1SA0 B;  5CB4 B;  5KHK A;  1TVK A;  1BHA A;  2QWR B;  3RW0 A;  4JGS A;  2LW7 A;  3E8B A;  1TVK B;  2L6L A;  1K3E A;  1HDJ A;  2ADP A;  3ZHS A;  4XDK A;  1VF6 C;  1JA8 A;  1EZV H;  1J5E B;  1EM1 A;  4FIP C;  4J41 A;  1ZTE A;  2PI5 A;  1BGY H;  2QTO A;  3ASN B;  3RYC A;  2CTP A;  2EIJ B;  3BVO A;  3W7W A;  1IXM A;  2ZD9 A;  3BAB A;  2QWO B;  5IJ0 A;  3O9O A;  3TGU H;  1KP3 A;  2P4K A;  3FX7 A;  1RSO B;  4PD4 F;  5FL7 G;  4F6E A;  1DK1 A;  5GTI Z;  3N2K A;  1K34 A;  5LXT B;  1M57 B;  4OXS A;  3K0G A;  1Y6X A;  1FXH A;  1P84 F;  3UM7 A;  4LFC O;  1V9P A;  5LGT A;  3KZI Z;  2V7Q G;  2CGO A;  4LH7 A;  3MAQ A;  4LF4 O;  2EJR A;  3CCL V;  2RQ6 A;  1R6T A;  1EN6 A;  1ENV A;  3ZHU A;  1WPX A;  2E5L O;  2JGU A;  1ZL8 B;  5CA1 A;  1YTF D;  2DWE C;  1WB7 A;  2UUA O;  3MHH C;  1SET A;  4WFG A;  1K33 A;  1GRJ A;  1DF5 A;  2RCV A;  2ZNJ A;  2FKX A;  2P06 A;  1QR8 A;  2R9I A;  1JOY A;  3BRC A;  4JZ2 A;  4DR5 O;  1VQM V;  1FJG B;  4P9P A;  2QWN B;  2XAF A;  4W4K A;  2UXX A;  5IWA B;  2OIG A;  4JYA B;  4AI8 A;  4DV1 B;  3FYI B;  1HWY A;  1AIL A;  2KQX A;  1H2M A;  1QCE A;  3L72 H;  1PNM A;  1W0J G;  4MT8 A;  4EFE A;  5IT9 N;  1SZX A;  3D36 A;  3N27 A;  1NR7 A;  1NBM G;  2JJ1 G;  3T4D A;  3JSN A;  4IGG A;  5JH7 A;  2WLK A;  4DXW A;  4DV6 B;  3OGI B;  3D3I A;  1EN4 A;  4XDJ A;  5IJ9 B;  1PL0 A;  5JH7 B;  1SQX H;  4TV9 B;  4JI1 O;  3X2Q B;  3G6B A;  1KKC A;  4PA4 A;  2EIL C;  4BW9 A;  4DR2 B;  1V55 C;  3JCZ A;  3PN1 A;  3QO7 A;  2UU9 O;  5E79 Z;  1VEW A;  3T1H B;  3ZCC A;  4AIL C;  1MSW D;  1T5E A;  5KHH A;  1YIJ V;  2JEU A;  4JI6 B;  2F4V B;  4JI5 O;  3NR7 A;  3KCY A;  4GT1 A;  2GUZ A;  2IJK A;  1B6Q A;  2Y0I A;  3APO A;  5TIS Z;  1JCH A;  4RWU A;  3DSQ A;  3OEH G;  1Q8I A;  3F5T A;  3OAA G;  2BTQ B;  5BXZ A;  5J2U B;  5D5P A;  2QSA A;  2QKA A;  5J2T B;  2RNB A;  4LF6 O;  2LGQ A;  3RYF A;  3HR0 A;  2C2A A;  1SZT A;  1U96 A;  1AJP A;  2OTL V;  3CRQ A;  1LR1 A;  4I0X B;  4QE7 A;  4O4I B;  2WA3 A;  4HNA B;  4P30 A;  5B3S C;  1H8H G;  4R8C A;  3BEH A;  4Q6G A;  4CS3 A;  1W59 A;  2JS5 A;  2Y69 B;  4G27 B;  4KUM A;  3AEI A;  3DC6 A;  4DRX A;  1F7Y A;  2KG7 B;  4LF4 B;  4L8J A;  2UXN A;  3VQV A;  4PA3 A;  4OGQ B;  2E5L B;  3FD9 A;  1Q90 D;  3B40 A;  2UUA B;  1YZB A;  4N21 A;  4CC6 A;  4ABM A;  4K8Z A;  3BCC H;  2PZS A;  2A79 B;  3ASN C;  2E3C A;  3JD3 A;  1VP7 A;  1Y74 A;  1BZK A;  4OPH A;  4DR5 B;  2Q67 A;  5DM6 V;  1N32 O;  4FLW A;  3E8G A;  4XBF A;  3F7Y C;  2QWQ B;  1A32 A;  2N05 A;  4FZ0 A;  1M57 C;  3ZMT A;  1E1R G;  3K79 A;  4X1Y A;  1S72 V;  2ZXW B;  2P7T C;  3LUT B;  3K9A A;  2IW5 A;  5CBG A;  3HB3 B;  2L35 A;  2DW4 A;  3CS5 A;  2A3Q A;  2HEP A;  5H2F Z;  3TJT A;  3ABL C;  1U97 A;  5J9P C;  5EBL C;  5EC2 C;  2LW1 A;  1PKX A;  1SS3 A;  1N8R W;  3RBZ A;  3HKB A;  4NVP A;  5K1X A;  4JI1 B;  1AI6 A;  3A8T A;  2UXD O;  3BAA A;  2UU9 B;  5IYC O;  5EC1 C;  1RFY A;  2ITC C;  5CA3 A;  3VQX A;  1BQZ A;  1B3Q A;  4H13 B;  2DN9 A;  4X1K B;  4JI5 B;  4BAY A;  1AJQ A;  5LA6 A;  5FNV A;  3CEI A;  4HYO A;  1HNZ O;  3ZMV A;  5LA6 B;  1WA8 A;  2QE7 G;  2Y48 A;  1SQG A;  5K1P A;  1I5X A;  4LC1 A;  3ETD A;  3WB1 A;  5EK0 A;  2XAG A;  4LNU B;  3STZ C;  2QA4 V;  3CRR A;  3CHX A;  4FFB A;  4LF6 B;  4LFA B;  4DV5 O;  3CSX A;  5LBQ A;  3WG7 B;  5LGN A;  2IH1 C;  3ICX A;  2W6I G;  5B1B B;  5IY5 B;  1YHQ V;  3ZRW A;  2NR5 A;  2YEV B;  2F95 B;  2Z3Y A;  3AK2 A;  2IU0 A;  4JI8 O;  1OCR B;  4F4L A;  2CUG A;  1FPO A;  2GBO A;  4LF9 O;  4Q20 A;  4GKJ O;  3CCV V;  1SKV A;  3AG1 C;  1XOU A;  3NXS A;  1FS0 G;  5LOV B;  4U7O A;  1NH2 D;  5BR8 O;  2H8P C;  4R6Z A;  3CC2 V;  1GM8 A;  1LUV A;  3ZX6 A;  1OCC C;  1N0J A;  3ZRS A;  3DXR B;  4B3M O;  1H2L A;  2DMX A;  3UT5 B;  4RUE A;  5EYP A;  3IC9 A;  1XDC A;  3SDL A;  1YIT V;  1LNQ A;  1MG1 A;  5EZY A;  2ATK C;  2ZKO A;  3CRA A;  4JTA B;  4YHH O;  4MSW C;  4H33 A;  1N32 B;  4PDM A;  3K06 A;  1TA8 A;  4J10 A;  2AXT Z;  1JVM A;  2RMK B;  1H2G A;  3T2M A;  3SYA A;  2QDO A;  5LHG A;  1P4R A;  4MTF A;  5JVD B;  1PL4 A;  1M90 W;  2JVD A;  1S5J A;  3T4Z A;  1RM1 C;  3KG2 A;  4D7T A;  1D5A A;  4PI2 A;  5C8Y A;  4ZHQ B;  2UXD B;  1X4T A;  1B06 A;  1NU1 H;  2XOK G;  5C8Y B;  1K73 W;  3ETQ A;  3CRC A;  3SJC C;  5FPO A;  1V54 C;  2UUC O;  2IJI A;  1VF5 B;  1MZF A;  3LSQ A;  1THZ A;  2LJ2 A;  4LCU C;  1XIL A;  1KKD A;  2F93 B;  1EBO A;  1KEC A;  2ZXW C;  4U3F H;  2HLD G;  3AG2 B;  4JYY A;  3JAS A;  4CH4 A;  4E4E A;  4Z1V A;  4PA9 A;  4X9Q A;  4KP4 A;  3SGI A;  1EZJ A;  4DV5 B;  4O2A B;  2WLM A;  3OTF A;  2F23 A;  3K04 A;  2WLJ A;  4I9W A;  4FZ1 A;  4NTW A;  1QVF U;  1ZUQ A;  4JI8 B;  4P2Z A;  2CAZ C;  4LF9 B;  4ICG A;  3QG5 A;  4IYH A;  1I5Y A;  1AR1 B;  1R3J C;  4LP8 A;  4X1I B;  4WFF A;  5BR8 B;  4IIJ A;  2QKC A;  4EFB A;  1H2N A;  4QPJ A;  4DK1 A;  4IIJ B;  5BY1 A;  4B3M B;  5CBH A;  3ZIA G;  3DC5 A;  2JRI A;  2JGD B;  3CCS V;  5IYD O;  4JI7 O;  4MVO A;  2GTA A;  2QR4 A;  2W0F C;  3W7T A;  2X6C A;  2ZIO A;  2ODM A;  5KHI A;  4LWS B;  4YHH B;  4UCU A;  2ETN A;  4QJF B;  4NKG B;  3E35 A;  3RVZ A;  5KHG A;  2WAM A;  3RVY A;  1IVS A;  1S5L Z;  1KQS U;  1CPY A;  1AB3 A;  5B1O A;  3L71 H;  3J7A U;  1KBH A;  1XL4 A;  4DW0 A;  5L3G A;  1S0V A;  3E8F A;  4NTX A;  3SR2 C;  1M4U A;  2AW9 A;  1JPX A;  3ZHQ A;  4X20 A;  3JAR A;  3JAL A;  2Z5U A;  3RN4 A;  4X20 B;  2XHB A;  4YJ2 A;  4TUY A;  4MVM A;  2DQ3 A;  1OV9 A;  4LF5 O;  2E74 B;  3Q4H B;  5JJE B;  3U10 A;  2YIA A;  1I7F A;  4MTX A;  4B7K A;  1H2K A;  3B77 A;  3CJH B;  1VQL V;  4NTY A;  1XUQ A;  1K4D C;  3AG7 A;  3K9S A;  4MW3 A;  1K7D A;  2HKO A;  2GHY A;  1RP3 B;  3WFV A;  2UUC B;  2Q68 A;  4MTO A;  4ZKI A;  4X66 O;  4UV8 A;  3EVK A;  4X62 O;  2RDC A;  2IH3 C;  3LNN A;  3JAW A;  1ZWI C;  1BMF G;  4LR3 A;  2UXC B;  3JCU Z;  1Q82 W;  2HJF C;  1AR5 A;  4NB5 A;  5A9G A;  1URF A;  4B3T O;  2A7W A;  4ZI7 A;  3RYC B;  1NT2 B;  2Q7G A;  1VQ4 V;  5IJ0 B;  5B5E Z;  3OFN G;  3MDS A;  4QIW F;  1R6K A;  2W0X A;  4F6R A;  1SQP H;  2CTW A;  4I55 A;  5CBF A;  1Q6I A;  1Y67 A;  2HP8 A;  1WLE A;  4TV8 A;  2HHH O;  4UB8 Z;  3ZRV A;  3JAM N;  2YXL A;  3N2K B;  4RAI A;  3SPI A;  4TOI A;  1YI2 V;  1OCZ B;  3JD1 A;  1GM7 A;  4MS2 A;  2EZO A;  2PY5 A;  3LNM B;  4JI4 O;  3ZN0 A;  5IYB O;  2Q69 A;  4CBC A;  2YIB D;  2G38 A;  3EHB B;  5LP6 A;  3ZMS A;  1TUB A;  4GLX A;  5IYZ A;  1YXB A;  4BIU A;  1KU9 A;  2ZDI A;  1JX9 A;  5L3D A;  3MHS C;  3SPG A;  4DUZ O;  1D5N A;  2WLL A;  5CA1 B;  1L8D A;  3FB6 C;  1WB8 A;  2AZ2 A;  1G1X B;  2Q6A A;  3VQW A;  5B66 Z;  1YF2 A;  4JI7 B;  3ABK C;  4QE9 A;  5GW7 A;  3RFR A;  2QM7 A;  2XAQ A;  1ZX3 A;  4AQY B;  3LDE A;  2DYS B;  2XAH A;  2EIN C;  5BMV A;  1UPG A;  2A9H A;  2DJV A;  4RO2 A;  4GYC B;  3M7M X;  2BSK A;  3ETG A;  1GM9 A;  2Z0A A;  4XDL A;  1IBM O;  4FLU A;  1GAX A;  4UB6 Z;  1KB9 F;  3BFR A;  2HG5 C;  3WB0 A;  1R3I C;  4WCE V;  1XQ8 A;  2KB1 A;  4QNH B;  1JFF A;  1K92 A;  3OR7 C;  1QLE C;  4H44 B;  4GKK O;  5JJN B;  2ZCE A;  1YJW V;  1JFF B;  2YXH A;  4YIP A;  4RUF A;  4J7Z A;  3ABM B;  4LF5 B;  1H38 A;  2WWW A;  3JAK A;  5LYJ A;  1SES A;  3K5L A;  3SJQ C;  5LYJ B;  2DYR B;  4BIO A;  1HR0 B;  4JPR A;  1L0L H;  2AHZ A;  5HFL A;  4MVS A;  3AK3 A;  1ROP A;  4DR3 O;  1GKF A;  2GUZ B;  1GN2 A;  1SER A;  1SQV H;  1R6N A;  4JYB A;  4X66 B;  4X62 B;  4FPP A;  3IGA C;  2P67 A;  3P3P A;  1SQF A;  3RYF B;  4HZ3 A;  1IZ3 A;  4UFZ A;  1IXB A;  4J42 A;  5B1A B;  4B3T B;  3A0B Z;  3A0R A;  3FB8 C;  1IBK O;  2YUA A;  3K3W A;  3CC4 V;  3T1C A;  4L87 A;  4JYC A;  5H5N A;  1YCI A;  5E1A C;  1ARO P;  1G4Y B;  2HHH B;  3B8M A;  1IX9 A;  1XI1 A;  2N04 A;  1VQ6 V;  4CZZ A;  4LFC B;  2CTR A;  4O4J A;  1K97 A;  1PV0 A;  4JI4 B;  3APQ A;  1QQC A;  4OPA A;  4LF8 O;  2AHY A;  3JD4 A;  4DRX B;  5LMU O;  2YIC A;  2R9A A;  5JQG A;  3E86 A;  3E22 A;  3H1K H;  1I94 O;  1JR9 A;  2EIJ C;  4LF7 O;  5DEC A;  3D3Q A;  1XMQ O;  3QTC A;  4PDL A;  1SQB H;  1Y74 B;  2B1G A;  3IJ4 A;  3K5N A;  1S3J A;  3K08 A;  2AGA A;  3ZN1 A;  2Q0O C;  1OCZ C;  4X1Y B;  4UCT A;  1TUE B;  1IBM B;  3OT7 A;  3TET A;  4B08 A;  3CPW U;  1VIB A;  1LUW A;  1HNW O;  1NR1 A;  1FXK A;  5JWP A;  2V1D A;  3CE2 A;  3T1Y O;  1NI8 A;  3TXS A;  4E2L A;  5JCO A;  4GKK B;  4JAU A;  2YID A;  2YC0 A;  1S5H C;  3HKB B;  3WU2 Z;  3AG4 B;  2HVK C;  1QU7 A;  1OHH G;  3UCS C;  1JQ0 A;  5LHH A;  3OR6 C;  4CC5 A;  4BW5 A;  4CS4 A;  1ZLZ A;  2ZM6 O;  4FLV A;  4GX5 A;  2CGN A;  2D3O W;  3PJS K;  2OIE A;  4B3S O;  4UCS A;  1BT8 A;  1NH2 B;  5KA5 A;  3FAV A;  2DYS C;  2Q73 A;  1NVP D;  5LMN O;  2P22 C;  4PHZ A;  5FNV B;  2OCC B;  4DR3 B;  1S76 D;  2RN9 A;  1WA8 B;  2B5U A;  5HFM A;  4GX1 A;  3P32 A;  1N36 O;  1AI5 A;  3MD0 A;  3D36 C;  1M9N A;  3G6E V;  5C93 A;  3H1H H;  3B8N A;  4FFB B;  3K57 A;  4PJ0 Z;  2X6A A;  4R7C A;  2EIK B;  1YJ9 V;  2VS0 A;  1IBK B;  3HKC A;  3X2Q C;  5A2Q N;  1HNX O;  4I7Z B;  4O2B A;  3ZRW B;  3QVN A;  5ITZ A;  4UCV A;  1UFI A;  4HAM A;  5ITZ B;  1S77 D;  3A2F A;  3QNE A;  3UKM A;  1L1F A;  1SC5 B;  1E1Q G;  3LSU A;  3DTU B;  3UO2 A;  1D2D A;  3AG3 B;  1N34 O;  1BCC H;  1PNL A;  3CXH F;  2EJ7 A;  4LF8 B;  1WN7 A;  1XEQ A;  4BWA A;  4AHC A;  3R66 A;  4B3R O;  5LMU B;  2PTM A;  1M1K W;  5EYP B;  4DV7 O;  2AZ0 A;  1RPR A;  2JIZ G;  3SJB C;  4IYI A;  3KCX A;  1I94 B;  4IHJ A;  1P7G A;  5EZY B;  3VOU A;  4YJ3 A;  1R3L C;  4LF7 B;  1Q6H A;  3UO3 A;  1K9M W;  3A0H Z;  3D8C A;  3G67 A;  5B1A C;  1COW G;  1XMQ B;  1M56 B;  3OM3 B;  1R73 A;  1JMK C;  4PA6 A;  4HBN A;  3IFX A;  1WPB A;  1KUQ A;  1Q7Y W;  4DYL A;  2DWD C;  4JI0 O;  3M99 B;  3RYH A;  2FL4 A;  2Y69 C;  4DR4 O;  3RYH B;  1YEW A;  5L3B A;  3CCQ V;  2ZNI A;  1XNQ O;  2H94 A;  1MAB G;  1OZ0 A;  5EBM C;  2ZR2 A;  4D7S A;  2K9P A;  1VF6 A;  3OMN B;  1Y76 A;  3RYI A;  1FAF A;  4WF9 V;  1HNW B;  1AVM A;  4EKW A;  3RYI B;  3T1Y B;  3AK1 A;  1WJZ A;  1HP8 A;  3SYP A;  5IDJ A;  1HW7 A;  3CME V;  1AI7 A;  1SQQ H;  1XMO O;  3IAY A;  4JAA A;  4CH3 A;  4WFA V;  5GTH Z;  2ZM6 B;  3HPL C;  4B3S B;  4KL1 A;  3QO8 A;  1MOF A;  1SF9 A;  1GN4 A;  2R70 A;  1HNZ B;  2XAS A;  4ZOL A;  4MVU A;  5LMN B;  1IBL O;  2IBZ H;  2OTJ V;  2OT5 A;  2QWP B;  4NR1 A;  3SJA C;  1TGO A;  4ZOL B;  4LBE C;  4C7U A;  1DF4 A;  4X8A A;  3FB5 C;  1QVG U;  3BA9 A;  3CC7 V;  3N2G A; 
#chains in the Genus database with same CATH homology
 3OAA G;  3QO5 A;  1ZWI C;  1BMF G;  1Q82 W;  2WLN A;  2HJF C;  1BHB A;  2JEX A;  1AJN A;  1FXV A;  3JD0 A;  2IU3 A;  2C2A A;  1AI4 A;  2R9R B;  1F4N A;  1SZT A;  2NLJ C;  3ABM C;  3DGE A;  1VQP V;  1AJP A;  1R3K C;  1VQ4 V;  2OTL V;  3OFN G;  2F43 G;  4QIW F;  1R6K A;  2DYR C;  4QE7 A;  5CBF A;  2YEV A;  1WLE A;  1OCO C;  4P30 A;  3OUF A;  3ZRV A;  5B3S C;  1H8H G;  4R8C A;  4RAI A;  1YI2 V;  3SPI A;  3BEH A;  1VQ9 V;  2ITD C;  1OCZ B;  3JD1 A;  1GM7 A;  4MS2 A;  3FKS G;  2EZO A;  5KUM A;  3LNM B;  2Y69 B;  3ZN0 A;  2QKS A;  1J95 A;  3OMI B;  1PD3 A;  2WLI A;  5IYB O;  2Q69 A;  4CBC A;  4JTD B;  3EHB B;  3STL C;  3ZMS A;  4G27 B;  4KUM A;  3AEI A;  3CXC U;  3SPJ A;  4QPK A;  4BIU A;  2XND G;  2ZDI A;  1JX9 A;  5L3D A;  3JD2 A;  3MHS C;  3SPG A;  4RQF A;  1DTO A;  3BY6 A;  2XAJ A;  4J9Z B;  2UXN A;  3K03 A;  2HR3 A;  2WLL A;  4UV9 A;  4PEL A;  4PA3 A;  4TWK A;  3OUS A;  3FB6 C;  3OE7 G;  4WFH A;  1DLB A;  4FJC C;  2Q6A A;  3WG7 C;  1FFT B;  4N21 A;  1UJW B;  1NKD A;  3ABK C;  4QE9 A;  2EIK C;  4FK5 C;  5B1B C;  5IY5 C;  2A79 B;  2EIL B;  3ASN C;  4I5S A;  5GW7 A;  2QM7 A;  3JD3 A;  3CCE V;  2XAQ A;  1OCR C;  2Q67 A;  1V55 B;  3LDE A;  4H37 A;  5DM6 V;  2DYS B;  3TK1 A;  2XAH A;  2EIN C;  1GK9 A;  3EFF K;  3E8G A;  3CCR V;  3ASO B;  1Y66 A;  2A9H A;  1KP2 A;  3GWO A;  4XBF A;  3ZRX A;  3F7Y C;  4RO2 A;  4JTC B;  1M57 C;  3ZMT A;  3ABU A;  3ETG A;  1GM9 A;  5L3E A;  1E1R G;  2HFE C;  3K79 A;  2X6B A;  4XDL A;  1VQ7 V;  1S72 V;  1VQ5 V;  2ZXW B;  2P7T C;  3LUT B;  3K9A A;  2IW5 A;  5CBG A;  4JAS A;  2HG5 C;  3HB3 B;  1VQN V;  2JJ2 G;  1R3I C;  2DW4 A;  4WCE V;  2KB1 A;  4QNH B;  3ABL C;  1K92 A;  1CP9 A;  3K0D A;  3OR7 C;  1QLE C;  5J9P C;  5EBL C;  2WLH A;  5EC2 C;  1PKX A;  1EFR G;  1YJW V;  1N8R W;  3CCM V;  2LFR A;  4RUF A;  2LFS A;  1W2B U;  3RBZ A;  3ABM B;  1H38 A;  4JF3 A;  2WWW A;  4UVC A;  2BOC C;  1P7B A;  1SES A;  1AI6 A;  4X89 A;  3SJQ C;  2DYR B;  1VQK V;  1SRY A;  5IYC O;  1PNK A;  5EC1 C;  4JPR A;  2AHZ A;  5B3S B;  2ITC C;  5HFL A;  5CA3 A;  2BOB C;  4MVS A;  1ROP A;  3E83 A;  1K5Q A;  3LSS A;  4BAY A;  1Q81 W;  1GKF A;  1AJQ A;  4UVA A;  4HYO A;  1YTF B;  3ZMV A;  4ASU G;  1SER A;  1R6N A;  4JYB A;  3CMA V;  2QE7 G;  3SYO A;  2Y48 A;  4FPP A;  1I5X A;  3IGA C;  3OGC C;  4LC1 A;  2P67 A;  3ETD A;  3E89 A;  5EK0 A;  2XAG A;  1FXK C;  5CN0 A;  3STZ C;  2QA4 V;  4HZ3 A;  3ZMZ A;  1W0K G;  2B1I A;  4J9Y B;  2EIM C;  3AG4 C;  3ABT A;  5L3F A;  5B1A B;  5L3C A;  2W6J G;  3A0R A;  3FB8 C;  5H6R A;  5LBQ A;  3F5W C;  3ZJZ A;  3WG7 B;  5LGN A;  1F4M A;  2IH1 C;  2ZR3 A;  3ABK B;  3JYC A;  2W6I G;  3K3W A;  5B1B B;  5IY5 B;  1YHQ V;  2YSU B;  3T1C A;  3CC4 V;  3CD6 V;  3ETE A;  3ZRW A;  4L87 A;  4JYC A;  2YEV B;  2Z3Y A;  2IU0 A;  1OCR B;  5E1A C;  4F4L A;  1ARO P;  1G4Y B;  2NNU A;  2EIN B;  3G71 V;  3B8M A;  4Q20 A;  2A0L A;  4CZZ A;  1VQ6 V;  1GO3 F;  1NJI W;  3CCV V;  3AG1 C;  2OCC C;  5LHI A;  1K97 A;  2WLI B;  3NXS A;  1VQO V;  2CK3 G;  1FS0 G;  1BL8 A;  4U7O A;  1NH2 D;  2H8P C;  4R6Z A;  3CC2 V;  1GM8 A;  2AHY A;  2JK5 C;  3FYE B;  3JD4 A;  4N23 A;  1OCC C;  1NQT A;  4GX0 A;  4JAV A;  4UUJ C;  3ZRS A;  1K5S A;  1F23 A;  3AG2 C;  2WLL B;  3E86 A;  1CEZ A;  3ABL B;  4Z1M G;  4RUE A;  4MVQ A;  4BIZ A;  1QLE B;  4G28 B;  3I55 V;  2MK3 A;  5CMU A;  2LP7 A;  1YIT V;  1LNQ A;  1MG1 A;  2EIJ C;  3CYO A;  4RQE A;  3LDD A;  1F51 A;  2ATK C;  1G8M A;  2PI4 A;  4PDL A;  4JTA B;  1H8E G;  4MSW C;  2B1G A;  1RPO A;  2WPD G;  1K4C C;  1S3J A;  4H33 A;  4PDV A;  3K08 A;  4PDM A;  3K06 A;  4PDR A;  3AG3 C;  3ZN1 A;  1OCZ C;  3P30 A;  3TCU A;  1JVM A;  5KA6 A;  1TUE B;  2FTK A;  2ZQM A;  1GMG A;  2QM8 A;  1H2G A;  3T2M A;  3TET A;  5BZB A;  3CPW U;  1Q86 W;  3G4S V;  1NR1 A;  3SYA A;  1FXK A;  2V1D A;  4G2K A;  5LHG A;  1P4R A;  4MTF A;  2M7W A;  4E2L A;  5H9C A;  1M90 W;  2IJJ A;  4JAU A;  1S5H C;  1QBZ A;  3T4Z A;  1RM1 C;  4MVZ A;  4GX2 A;  3AG4 B;  2HVK C;  2K1E A;  1OHH G;  2IJH A;  3W7S A;  1JQ0 A;  4KFM A;  5H6Q A;  5LHH A;  1M56 C;  3OR6 C;  4MVR A;  1OCO B;  4BW5 A;  4MW8 A;  2X0L A;  3KG2 A;  3OW2 U;  4GX5 A;  2D3O W;  3H01 A;  3PJS K;  2HVJ C;  4WFE A;  2EBO A;  3IC7 A;  1NH2 B;  2XOK G;  5KA5 A;  3OEE G;  1K73 W;  2DYS C;  1KD1 W;  1E79 G;  1NVP D;  1YSC A;  3AG1 B;  3ASO C;  2OCC B;  1V54 C;  2IJI A;  3E8H A;  2WSS G;  1S76 D;  4TSF G;  3ZMU A;  1BHA A;  3LSQ A;  2B5U A;  1THZ A;  5HFM A;  4LCU C;  3RW0 A;  4X88 A;  4GX1 A;  4JGS A;  2JDI G;  3E8B A;  1KKD A;  1EBO A;  3P32 A;  1OCC B;  1KEC A;  1K3E A;  4PA7 A;  2DQ0 A;  1AI5 A;  2ZXW C;  3MD0 A;  4UXN A;  3F7V C;  2HLD G;  3AG2 B;  4XDK A;  1M9N A;  3G6E V;  5C93 A;  4FIP C;  3B8N A;  3SYQ A;  2PI5 A;  2X6A A;  4PA9 A;  4YXW G;  1JJ2 U;  2X7R B;  2EIK B;  4R7C A;  4KP4 A;  1YJ9 V;  2QTO A;  3R65 A;  1EZJ A;  2WLM A;  2P6J A;  3ASN B;  2EIJ B;  3X2Q C;  3K04 A;  1IXM A;  3W7W A;  2ZD9 A;  1Y4M A;  2WLJ A;  3ZRW B;  4I9W A;  2QEX V;  5LGU A;  1KP3 A;  3CCU V;  1QVF U;  4P2Z A;  5FL7 G;  4HAM A;  1S77 D;  3QNE A;  1K34 A;  1M57 B;  3UKM A;  4OXS A;  1E1Q G;  3K0G A;  1L1F A;  3DTU B;  1VQ8 V;  1FXH A;  1I5Y A;  1AR1 B;  3UM7 A;  3AG3 B;  1R3J C;  4LP8 A;  1PNL A;  5LGT A;  4WFF A;  3SPH A;  1YJN V;  2V7Q G;  3I56 V;  3SPC A;  4QPJ A;  2EJR A;  3CCL V;  5CBH A;  3ZIA G;  1ENV A;  4U7N A;  5B1N A;  1M1K W;  1WPX A;  3ML0 A;  1RPR A;  4WFB V;  2JIZ G;  3CCS V;  1YTF D;  2DWE C;  1QLN A;  3MHH C;  3CP1 A;  1SET A;  4WFG A;  1K33 A;  3VOU A;  3VBB A;  5IYD O;  1RM1 B;  1DF5 A;  4MVO A;  1R3L C;  2W0F C;  3W7T A;  1K9M W;  2X6C A;  5B1A C;  1COW G;  1QR8 A;  2R9I A;  1M56 B;  1GTO A;  3OM3 B;  1JOY A;  1R73 A;  2EZP A;  1VQM V;  4PA6 A;  1NVP B;  4QJF B;  4P9P A;  3IFX A;  3E35 A;  1Q7Y W;  4R50 A;  2DWD C;  1K8A W;  3E2E A;  3W7U A;  3M99 B;  2XAF A;  4P9O A;  3RVZ A;  2UXX A;  2WAM A;  3RVY A;  2Y69 C;  1KQS U;  1CPY A;  3FYI B;  1HWY A;  5L3B A;  4FMT A;  5B1O A;  3FB7 C;  1V54 B;  3CCQ V;  3SYC A;  1XL4 A;  1QCE A;  2H94 A;  1MAB G;  4MTG A;  1PNM A;  1OZ0 A;  5EBM C;  2ZR2 A;  1W0J G;  3GB7 C;  5L3G A;  1S0V A;  3E8F A;  4MT8 A;  5DN6 G;  4ZBM A;  3D36 A;  1FXK B;  3OMN B;  3LDC A;  1NR7 A;  1JPX A;  1NBM G;  2JJ1 G;  2ZDI C;  4WF9 V;  3T4D A;  4EKW A;  2EIM B;  2WLK A;  4DXW A;  2Z5U A;  3D3I A;  4DO2 A;  4XDJ A;  5KUK A;  3SYP A;  5IDJ A;  4MVM A;  1PL0 A;  2DQ3 A;  3OMA B;  3CME V;  2P90 A;  3CCJ V;  1AI7 A;  1ORQ C;  3X2Q B;  4PA4 A;  2EIL C;  4MTX A;  4WFA V;  1V55 C;  3B77 A;  3JCZ A;  3QO7 A;  1VQL V;  3HPL C;  5EBW C;  1K4D C;  3QO8 A;  3ZCC A;  1MSW D;  1YIJ V;  2JEU A;  1MOF A;  1QR9 A;  1KC8 W;  1XL6 A;  2XAS A;  4GCZ A;  4MW3 A;  1K7D A;  4MVU A;  2HKO A;  2OTJ V;  2GHY A;  2OT5 A;  4GT1 A;  3WFV A;  2IJK A;  2Q68 A;  4MTO A;  4TT3 G;  1B6Q A;  4ZKI A;  3W7X A;  4LBE C;  4UVB A;  1JCH A;  1DF4 A;  4X8A A;  3FB5 C;  1QVG U;  4UV8 A;  3OEH G;  3CC7 V;  2GSM B;  2IH3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...