5H9CA

Crystal structure of the aslv fusion protein core
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
78
structure length
78
Chain Sequence
NLYFQGTANLTTSLLGDLLDDVTSIRHAVLQNRAAIDFLLLAHGHGCEDVAGMCSFNLSDQSESIQKKFQLMKEHVNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Envelope glycoprotein gp95
publication title Structural characterization of a fusion glycoprotein from a retrovirus that undergoes a hybrid 2-step entry mechanism.
pubmed doi rcsb
source organism Avian leukosis virus rsa
total genus 31
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2015-12-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5h9cA00
3B8MA 3K9AA 1EBOA 2EZPA 1Y4MA 1DLBA 5H9CA 3GWOA 5HFMA 1K34A 4N21A 4FIPC 2EZOA 5CMUA 1DF5A 4E2LA 2X7RB 1QR9A 1MG1A 1QBZA 3B8NA 1QR8A 3CYOA 5KA5A 2LP7A 1Y66A 3H01A 4FJCC 3CP1A 4JGSA 4JPRA 1ENVA 4JF3A 3WFVA 1I5XA 3M99B 1DF4A 1SZTA 2MK3A 1QCEA 2M7WA 5HFLA 4FK5C 1K33A 1I5YA 2EBOA 3MHHC 4G2KA 1JQ0A 1MOFA 2P6JA 2OT5A 3P30A 4N23A 3B77A 3MHSC 5KA6A 5CN0A 1JPXA 1F23A
chains in the Genus database with same CATH superfamily
4LR3A 2EIMB 4CS4A 1RFYA 3CPWU 3OEEG 1GM7A 4DRXB 4L87A 1AI4A 3ASNB 3PN1A 1JVMA 4EB6B 1BE3H 3M99B 1QLNA 4AQYB 3O9OA 2QWNB 4C7UA 2AZ2A 1K4CC 3WB0A 2QKSA 1M57B 1YVWA 3F5TA 5LP6B 1GN6A 4JYAB 1JJOA 1AP6A 3B8MA 4DR2B 5H9CA 3RYCA 4FFKA 2Q8VA 2QR4A 3KG2A 1XQ8A 4IL6Z 3RYIB 3ZMUA 2DN9A 3LSSA 1VF6A 3M7MX 4ZHQB 1D5NA 1L0NH 2VWJA 1S5HC 4LWSB 2A7WA 2YSUB 2ZXWB 4DV7B 2E5LO 4DV0B 3S3XA 4OPHA 1KB9F 3K5OA 2V7QG 1L1FA 1XMOO 2FB5A 1WP8A 3D36C 5H6RA 2WLIB 5IJ0B 1KC8W 4JASA 5IYZB 1N32O 3ZEDA 4CBCA 1K5QA 3CRQA 3DXRB 3G67A 3H1IH 5L3FA 3W7XA 1N34O 3CC7V 1GKFA 4FLWA 5GW7A 3AEIA 4YIOA 3S3WA 4QNHB 3ZHQA 5L3BA 2BCCH 3K79A 4LFBO 2JRIA 4NXNO 3SGIA 2OYQA 2X7RB 3KCXA 3JAWB 4D7SA 4JF3A 3J80N 1BSMA 3RBZA 2P4VA 2Y69B 5JH7A 4Z1VA 3IJ4A 2W6JG 1BHAA 1WA8B 2JEUA 4X62B 3D3IA 2LJ2A 4PDVA 1J5EO 4DYLA 1IBKB 1UFIA 2Q7GA 3LSUA 4GLXA 3SPJA 4RWUA 3ZS8C 2LFSA 5C93A 3W7UA 3FB8C 3ABTA 1AB3A 3FD9A 1TGOA 1GM9A 2XAQA 2QM7A 3W7TA 3TJTA 3X2QC 1SS3A 5JWPA 1NT2B 5B1AB 2BOBC 2UXBB 1YI2V 4GZRB 5L3GA 3BFRA 4UB8Z 2GUZB 3SDLA 5LOVA 4X20B 1MNGA 2VQEB 1KKDA 3U0ZA 1HR0O 1IDSA 3Q4HB 4WFFA 4LF6B 1XI1A 3JATA 3I55V 2BTQA 3OGCC 3SYQA 1T5EA 3DTUB 1NTMH 1HNXB 3B09A 3N27A 3AG1C 1COWG 1I94B 3QG5A 1N0NA 5K1PA 4KUMA 2YXLA 2L6LA 4P9PA 1QBZA 3K0DA 1KQSU 2WLNA 1S72V 1KUQA 2JS3A 3EFFK 2RCVA 4X88A 3MD0A 2CAZC 3CCRV 4JV5B 3FFQA 3K0GA 3L75H 2GV9A 3L72H 1B6QA 3BA8A 1OJHA 4F6RA 2JK5C 2QWPB 2ITDC 3OE7G 2UU9O 2JIZG 3ZN1A 1KKCA 2DOSA 4TQDA 5B1NA 3HKBA 1Q6UA 1IBLB 1X59A 4JI6O 1IXMA 4UVAA 2OIEA 3CMAV 1Z2GA 3ZX6A 2EJ7A 2XAHA 1BL8A 2K9PA 1S77D 3OR7C 1PKXA 1Z5WA 3B4SA 2P4KA 3CB2A 4GKJB 2B5UA 1Y74B 1XNQO 4DW1A 2R9AA 4MW3A 4I50A 3U10A 3SPIA 2ZE5A 2R70A 2EINC 1XL4A 2DQ0A 5CA1A 5FPRA 4NB5A 4JI4O 4X64B 4B3RB 2HHHO 3N2KA 4R7CA 2A9HA 3ABUA 1OHHG 3CRCA 4DR4O 1K92A 4XDKA 3LDCA 2YDEA 2CGOA 2JVDA 2Y4UA 5EBMC 1XNRB 1GN3A 1M56B 2Q69A 3BRCA 5IT9N 2EILB 1HDJA 4O4HB 2YXYA 2QM8A 1FS0G 4BAYA 1EBOA 3ETDA 2F4VO 2H3OA 3ZRVA 3ASNC 3CP1A 3ZHUA 2IH3C 5E79Z 5JVDA 1FXHA 1OCOB 4HNAB 2YICA 5FNVA 2Q5ZA 1XMQB 1JCHA 3IC9A 5FLXN 4J80A 2QM4A 1SQFA 4H0LB 2PYJA 3ZMVA 4LFAB 2UXCO 2GBOA 4TQFA 3LNNA 1I7FA 2ATKC 2XASA 3AG2C 3CJHA 3H1HH 4FM2A 1BMFG 1LUVA 4CC5A 1QNMA 4LF8B 2AXTZ 4FPPA 4ZI7B 4WBNA 5B66Z 4J10A 2ZQMA 1JPXA 3ZHTA 2Q73A 1RSOA 4PA3A 5LHIA 2GTAA 5LGTA 5BZBA 1ZLZA 1E1QG 4JI8B 3RVYA 4I55A 3TK1A 4CS3A 3IC7A 5KUMA 4MVSA 1SZTA 4DV2B 1K9MW 3FYIB 3BCCH 4DV7O 2UXXA 4R6ZA 4I50B 4DV0O 3AK3A 4QJFB 3OR6C 2B1GA 3TCUA 1Q3EA 1R73A 3AG7A 2YEVB 4JI7O 2ZCEA 2DW4A 5A2QN 2VQFO 3E89A 5ITZA 5B3SC 2IW5A 1V54B 4JI2B 2KB1A 1WN7A 3ETEA 3K59A 4OPAA 4AHCA 1OCCB 4YY3O 3I56V 2Y69C 1WB7A 1P7BA 5LA6A 1JQ0A 2VS0A 4O4JB 3RYHA 5LYJB 5EC2C 5B1BB 2DYRB 4KFMA 2CTWA 3K03A 3C3SA 4B7EA 2QTOA 3T2MA 1IZ3A 3WU2Z 1XHZA 4U7OA 5KHHA 1AI5A 1IBMB 4UV9A 4BIUA 2HG5C 2QDOA 2ZNIA 1I08A 1YXBA 4X62O 4ZIBA 2LW1A 5KUKA 1M9NA 5B1AC 3VQVA 4X1KB 3APQA 1LNQA 4B3SB 2ZM6B 3SJAC 1KBHA 3L74H 1AR4A 1TVKA 1R6KA 2UUBO 3P30A 1VF6C 2ZDIA 3C3TA 4TWKA 2WSSG 2UXBO 2AHZA 4XBFA 4JI5B 5KLVH 2PF4E 4WFAV 5CMUA 3CCVV 4I0XB 2VQEO 2KG7B 3FAVB 4LBEC 3E35A 4LF6O 1Q6HA 3QF7A 2HKOA 4GYCB 4WFEA 4U3JA 3AG4B 3CCLV 3NXSA 3G80A 4X1IA 1Q8IA 1JR9A 4DRXA 2AW9A 3UT5B 1WPBA 1PD3A 2HVJC 3BY6A 3B40A 3R65A 4HAMA 1Q7YW 4OX9B 2YI8A 4GX2A 1QLEC 4EB6A 5KAFZ 2ILMA 1YJ9V 3OTOO 1QR9A 1XL6A 3A0RA 3TGUH 4JPRA 1HP8A 2R9RB 1YJWV 5LP6A 2B1IA 3CXHF 4FMTA 4JV5O 5IWAB 1PNKA 4DV5O 4GX0A 4W4KA 3RYIA 4DUZO 4NKGB 3TETA 4RQFA 2OWOA 5LA6B 1N4CA 4ZHQA 5IE9A 1H38A 4LWSA 4KHPB 3RYHB 1YCIA 4AILC 1G1XB 5KA5A 1FXKB 4DXWA 4DV1O 2E3CA 2PI4A 2P67A 2B9ZA 5CB4B 3ABMB 5IYBO 1Q5OA 2Y0PA 3CD6V 4L8JA 1URFA 1VQ4V 4UCRA 3CS5A 3CC2V 5IJ0A 3K04A 5IYZA 1Q90D 1TUEB 3JAKB 4MVRA 1GH6A 3DXRA 3SR2C 4O2AB 3UKMA 3F7YC 2LW7A 4FZ1A 4FLZA 4X65O 4FVMA 4E4EA 2FMLA 3ASOB 4DO2A 1K4DC 2MW2B 4LF5B 5H5NA 2DWEC 3OUSA 3GVMA 1M56C 4JAVA 1KD1W 2EILC 3GWOA 4QPJA 3JAWA 2XHBA 2CH7A 3APOA 1BQZA 1MG1A 4YJ2B 4NTXA 1WA8A 2OCCB 2YI9A 3VQXA 1MSWD 2D3OW 3TXQA 1F4MA 2LFRA 1OCOC 4MSWC 2ZE8A 1J95A 1MSDA 1RPOA 3ZRWB 3D8CA 4PHZA 2UXDB 1H8HG 1XDCA 1K97A 1WPXA 1HW7A 1V55B 4X1IB 3JALB 3JD1A 2YXHA 4FLTA 4J41A 2YIBA 1BT8A 4Q20A 3JSNA 4JGSA 3UO2A 5BMVB 1GTOA 3RT3C 2ODMA 2A79B 2ADPA 4X8AA 2CGNA 2JJ2G 3QNEA 3SYOA 1NI8A 2F66C 2OT5A 2GUZA 3ABLB 4X20A 3K58A 5J2TA 3SPHA 3Q4HA 4NVPA 1FJGB 1N36B 3SYAA 1RM1B 1HNWO 1JJ2U 1W0JG 4O4IB 4JI0O 2Y0IA 5J2UB 2CUGA 2RDCA 3JD2A 4QGPA 3E86A 3ETGA 4RO2A 4HYOA 4PA6A 3JAMN 1S5LZ 1BS3A 2HEPA 3IGAC 4JI8O 2Q0AA 4FLUA 2IBZH 2WLMA 4TT3G 4MTGA 1MABG 1V54C 1Z5VA 4DV2O 3P32A 1IVSA 4JAUA 3A8TA 4DR3B 2EBOA 3CXCU 4DR1B 3B2EE 4K0KB 4LF9B 1W0KG 2P06A 4EFBA 3L71H 1ZL8A 3VQYA 1XOUA 2ZNJA 5B1BC 2DYRC 5KHIA 1CP9A 3QVNA 4NXMO 1JMKC 2CH7B 1H2GA 4GKKB 4ASUG 4I4TB 1ZSPA 1Y76A 1Y74A 4PA4A 1SQVH 2IJHA 4MVQA 5JCOC 4J7JA 4FIPC 1ZWIC 4YJ3A 3CCMV 3P3PA 4U3FH 1JFFB 4LFCO 1PV0A 1CPYA 4DV3B 2XTAA 1IBMO 3RFRA 5LL6Y 4MTXA 2YIAA 3ETQA 3OGIB 4J9YB 5JJEB 2NR5A 2UUCB 4IGGA 2YIDA 4UUJC 4O2BA 1NVPD 5GTIZ 3FYEB 2P5OA 3DC5A 2D2CB 3T1YB 4P2ZA 5J2TB 1SC5B 1SKVA 3ZMZA 3P3NA 2IU3A 3EXAA 1NBMG 3JCUZ 4O4HA 2P6JA 1VQOV 3G6EV 3DGEA 4MVOA 2P22C 5A9GA 3JD4A 4I5SA 2QGNA 3LSQA 4JI1O 2QEXV 2LQTA 2AGAA 2HVKC 1VQ7V 1F51A 1TUBB 4MVUA 4HNAA 3QTCA 5DM6V 4B3TB 1SRYA 1AP5A 4BIZA 4TUYB 2BOCC 4HBNA 1MOFA 2FTKA 4U7NA 4ZOLA 3IFXA 3RYFB 2XAFA 4UV8A 3FX7A 3ZCCA 2HR3A 1H2NA 2BSKB 4X66B 1UPGA 4ZI7A 1ZL8B 1N0JA 4OGQB 1D5AA 1I5XA 4FLXA 2IJJA 3OAAG 1FXKC 4UCOA 4FK5C 2WA4A 3ABMC 1U97A 2F23A 3THOA 2CTPA 3MHHC 1AILA 3OMIB 2JGDB 4CH5A 3CCJV 1OCZB 2PTMA 1Y76B 1SQGA 2P90A 2UUAO 1BZKA 1P84F 3L73H 1P49A 2MK3A 2WWWA 3UCSC 4YJ3B 4LF4O 2YEVA 5KHKA 3E2EA 2ZE6A 3AK1A 1NTKH 2UXNA 5CN0A 3EHBB 4I9WA 4WF9V 4DV6O 2OTLV 4IIJA 1PL4A 4BR6A 1IX9A 2RJZA 4CH3A 2ZDIC 3OM3B 2L35A 2WLLA 4TV9B 3G6BA 4O2BB 1QHTA 2F43G 3RW0A 1BGYH 4O4JA 5LYJA 3I5DA 2OCCC 4UCSA 1VQLV 5LMUO 1B3QA 3A2FA 3MHSC 1FYJA 1W2BU 2X6AA 3K9AA 4O4LB 2EIMC 4KP4A 3T1HB 4LNUB 1WJZA 1H2LA 2F1MA 4PJ0Z 4WFHA 4DV4B 5IJ9B 3CRAA 1IURA 5K1XA 5KHGA 5JCOA 4X1KA 5LHHA 1VQ9V 1M57C 1OZ0A 4GUNA 3ABLC 2ARHA 1VQPV 5LP6C 4IHJA 1R3JC 1EN4A 4F4LA 3JARA 4ZOLB 1DF5A 1GM8A 3JCZA 3SJBC 2QWRB 4AQYO 5L3EA 4WCEV 1OV9A 2A06H 5E1AC 1NZ6A 3ABKB 2CDYA 3JSLA 2ZXWC 4GX1A 2LO1A 2ZT9B 1JA8A 4JYAO 4I0XA 1S5JA 2KG7A 4DR2O 5GTHZ 3FAVA 3E8BA 4Z1MG 1Y6XA 3H1LH 3HB3B 1Q43A 1WB8A 2F93B 3JYCA 2E5LB 1WLEA 2VWKA 4OXSA 3UT5A 2X6CA 1I5YA 3BVOA 5LMNB 1ZUQA 2NNUA 2V1DA 1AVMA 3K9SA 1W59A 2JS5A 3CSXA 1XMOB 3DC6A 3ZRXA 3ZN0A 3OMNB 3ML0A 1N32B 5AG2A 1DF4A 4IIJB 5GONB 2IJKA 4DUYB 2YC0A 1N34B 2M7WA 5DECA 4BW9A 3ICXA 2WLLB 4DR1O 3K08A 2HLDG 3N2GA 3HKDB 3D3QA 1KP3A 5B5EZ 4JYCA 2ZD9A 1FXKA 3HKEB 1P7GA 2Z5UA 2GTSA 5CB4A 3CYOA 3J81N 2R9IA 4FFBB 2FL4A 3WFVA 4I7ZB 1FKAO 1NVPB 2DYSB 3SPGA 4DR7B 1EFRG 5EIBC 3JAKA 3L9DA 1X4TA 1J5EB 2FYUH 3M8AA 1K8AW 1Q6IA 1PPJH 1YZBA 4JYYA 1IBKO 4O2AA 2DE0X 3R66A 5IDJA 3ZIAG 3QO8A 4IHJB 1CEZA 3FB7C 1PNLA 3JARB 4EEQA 2WA3A 3GB7C 1BCCH 2P7TC 4QIWF 5KA6A 4UB6Z 2QKCA 1M1KW 4YJ2A 4J9ZB 2A3QA 3ZRSA 4CZZA 4KL1A 3F7VC 4A5UB 2IM9A 3ZRWA 2JGUA 1DGSA 1PP9H 2ZE7A 3X2QB 1RPRA 5EBWC 3CCQV 2Q9LA 3GWKC 1HNXO 4UVCA 3JALA 4UCTA 1VQ8V 1EN6A 3BHPA 1I94O 4FLVA 5DN6G 5BMVA 4DK0A 4RUFA 2ZR3A 4K8ZA 2CTQA 4YXWG 1NU1H 1KECA 4GX5A 3B77A 2Q7EA 1EZVH 3OTFA 4X89A 2RMKB 5IY5B 4O4IA 2HFEC 2EJRA 1OCZC 4X66O 5J2UA 2K1EA 3N2GB 4B3MB 4JI6B 1IBLO 3J7AU 3SYCA 1EZJA 2BTOA 4RQEA 5F2VO 3CMEV 5B1OA 1HWYA 2HJFC 1ROPA 2X0LA 2Q68A 3E22B 4GKJO 4X1YB 5LGNA 1R3IC 1XNQB 2HP8A 1NQTA 3H01A 2WAMA 1GN2A 4RUEA 3FB5C 4JI4B 3STZC 3WB1A 2LGQA 2HHHB 4X64O 2ZIMA 4B3RO 4WFBV 2PZSA 3HPLC 2OIGA 3HKCB 4JTAB 1H2MA 1ZTEA 2Q7HA 3JD3A 3G71V 4DR4B 4I4TA 5KHJA 2EINB 2W0XA 1R3LC 2QTSA 4P9OA 5LXTA 3OW2U 1TAEA 3ZJZA 1H2KA 3A0HZ 1QU7A 1XNRO 1N8RW 4MVZA 1WNSA 2QSAA 4MS2A 4UFZA 1JFFA 5LBQA 4JTDB 2ZINA 3T1HO 3HR0A 2JDIG 4UCVA 1QR8A 1QQCA 1AJPA 3VQWA 2ADQB 3E8HA 4FLYA 3ABKC 1N33B 1XMQO 1GAXA 4LC1A 4DR6B 1FFXB 1WP7A 4GCZA 4PA7A 3DSQA 3K06A 2UXCB 4LFAO 5EZYA 2QKAA 3E8FA 4ZBMA 1VEWA 4LF8O 1ZAUA 2M6YA 1YF2A 3OMAB 1YTFD 2QJ1A 1G8MA 4Q6GA 1F7YA 1YJNV 3QO5A 1TUBA 2DWDC 1YITV 5JQGB 1YEWA 4TOIA 3QO7A 3KKYA 4FZ0A 4MTOA 3AG2B 4TUYA 4CS2A 5IYDO 3CHXA 1SZXA 4RAIA 3UM7A 1HNZB 5EK0A 1QCEA 5CA3A 4DK1A 4DW0A 5KMGA 1OCCC 3MDSA 3RYFA 5LMNO 4ZKIA 5IYCO 1GK9A 2AHYA 1XILA 4JTCB 2BSKA 3MAQA 4NR1A 4JI7B 1Y4MA 4KXRA 2XOKG 3UO3A 1VQMV 4MT8A 2VQFB 1JOYA 3BPZA 2GDSA 4JI2O 1YSCA 1IXBA 4H37A 1S76D 2H94A 4YY3B 4DUYO 1NH2D 2DYSC 2JGDA 1VMGA 3T1CA 4DR5B 4J7KA 2C2AA 1L8DA 2V4DA 5LXTB 1SESA 3VOUA 2N74A 3EVKA 2AZ0A 5B3SB 2W6IG 1XEQA 4MW8A 5BXZA 3OFNG 1O9GA 1ORQC 1SQQH 4LCUC 4DR7O 2Z0AA 4K35A 2EIKB 2Q4PA 1M93A 1XUQA 2KKWA 1FAFA 1EN5A 2EX3A 1Q82W 1KYOF 2KSDA 1E1RG 2Q67A 3WG7B 4TV9A 1YIJV 4LH7A 4B3SO 2ZM6O 5CA0A 4FM0A 2PGGA 3CX5F 3T4DA 4IT5A 2WLHA 4NYKA 2UUBB 4O4LA 3OUFA 4EKWA 4F6EA 1WAZA 5EZYB 1MA1A 1SQBH 3AG4C 1VF5B 4LNUA 3K57A 3OD4A 1MZEA 5CBHA 1H8EG 2Y48A 4Z2WA 4JI5O 2XNDG 5IJ9A 3IAYA 3CE2A 4ABMA 1Q86W 2RQ6A 3RYCB 3BAAA 2LP7A 2E76B 2CK3G 4R50A 1LUWA 4YHHB 1SA0A 1MZFA 4N23A 2ZR2A 4UCUA 3ZHVA 4QE7A 4CC6A 5KMGB 1VQ6V 1AROP 3ZMTA 4OX9O 5BY1A 3OTOB 5IY5C 2IJIA 3WB2A 5JJNB 5IWAO 4DV5B 3H9VA 4DUZB 1SERA 1QLEB 1JX9A 2CTRA 5JJJB 1TA8A 3L70H 4HZ3A 3PJSK 3U11A 4KHPO 3B8NA 4PI0A 4B3MO 2CE4A 2YUAA 1ENVA 4DV1B 2R72A 2ETNA 1OCRB 1B04A 1NJIW 3W7WA 5HFLA 5BR8B 5H6QA 1V9PA 3ZBHA 4IYHA 1RP3B 2N05A 1U96A 2EIJB 3ASOC 5JH7B 1M5IA 1US6A 2EZPA 1K3EA 4PDRA 1VARA 2IH1C 2XAGA 3AG3B 5GONA 4B7KA 3LDDA 3CEIA 4D7TA 4NTWA 2F95B 4FJCC 4JI3B 1H2SB 5C8YA 5H2FZ 4X65B 3CWBH 3FB6C 5CA0B 1AR1B 1A32A 3HKDA 1GMGA 1GN4A 3D36A 4LF5O 3HKEA 1THZA 3JASA 1R6TA 4CH6A 5LGUA 4FFBA 1AI7A 1V55C 2ITCC 3SJCC 5FL7G 1KU9A 4H44B 4IYIA 4LF7B 4WFGA 5LOVB 1F4NA 4PI2A 3KCYA 2DJVA 3E83A 2Y4TA 4G27B 2OTJV 1Q81W 4J11A 2DMXA 1QVFU 1P4RA 3JATB 4BIOA 2BTQB 1DLBA 2UXDO 1SA0B 3LDEA 1K34A 1XREA 1AJQA 2JJ1G 3TXSA 1YTFB 1S0VA 2EZOA 2WLJA 1VP7A 1EM1A 2N04A 1VQNV 1RM1C 1PL0A 2O57A 3CCEV 1BQ0A 4G28B 1O9HA 3T4ZA 1NR7A 3ZHSA 1VIBA 1N33O 2XUMA 1SQXH 5DEDA 4DR6O 2E75B 4I9QA 1K73W 4F6RB 1FJGO 1N36O 2X6BA 3H1JH 1HNWB 3F5WC 2WLKA 1B06A 4JI0B 4J42A 2XAJA 2Z3YA 4AI8A 4J7ZA 4LP8A 3HKBB 3BEHA 4K3AA 1DK1A 2PI5A 2LGWA 3FKSG 3CCUV 3UQ8A 4D6TH 4N21A 5J9PC 1NH2B 1R3KC 2Q0OC 3KZIZ 1Y66A 1ZX3A 3CCSV 1HNZO 4PA9A 2RNBA 3G4SV 5CBFA 5EC1C 4TV8A 4G2KA 4UVBA 4DR3O 4MVMA 1SETA 5C8YB 4K0KO 4QPKA 4ICGA 4LF9O 4LFBB 1VF7A 1AJNA 5CA1B 4NXMB 4NXNB 3BABA 2W0FC 3JASB 3H1KH 5D5PA 4XDLA 2Q6AA 3VBBA 3SYPA 3CRRA 3LUTB 3N2KB 2A0LA 4H13B 4H33A 3W7SA 4GKKO 5FPOA 3E22A 4DR5O 1GRJA 2EIKC 4X1YA 3K5MA 1S3JA 1YHQV 5HFMA 2HJDA 3WG7C 5CBGA 4JAAA 2G38A 4LFCB 3RWRD 5D5QA 1I0HA 1SQPH 4DV3O 3HKCA 1NS1A 4LH6A 3OEHG 5JVDB 2UUCO 1FPOA 2QE7G 2BE3A 5FNVB 2QWQB 5EYPA 4PD4F 2ZIOA 1CXZB 2PUSA 4YIPA 3T1YO 1PNMA 3AK2A 5L3CA 1HR0B 1XHXA 2EULA 3E8GA 2XT9A 4FM1A 4R8CA 4JZ2A 3CC4V 1AI6A 3CJHB 2RN9A 3ZMSA 4BWAA 1KMIZ 4XDJA 2NLJC 4B08A 4UXNA 4JZGA 4WBNB 1KP2A 4JI1B 2YIBD 5EIBD 5KX5A 1G4YB 1M90W 1SF9A 3LNMB 1AR5A 1RSOB 4PELA 2FKXA 2H8PC 4B3TO 3ZHRA 1R6NA 4YHHO 4I55B 1UJWB 1FFXA 2GSMB 1K33A 4GT1A 2IU0A 2QA4V 1GO3F 1NTZH 2QWOB 3STLC 1G6UA 3AG1B 5LHGA 2YS8A 1NKDA 2OCHA 1YDXA 3K5NA 3A0BZ 4X9QA 4TV8B 5EBLC 3JD0A 1MMMA 2UU9B 4EFEA 2JEXA 2PY5A 1FXVA 1FFTB 3O65A 5ITZB 1VQKV 1OCRC 5JQGA 1DTOA 3CRMA 4NTYA 4P30A 4W4LA 1F23A 2ZKOA 2EIJC 2NN4A 3BA9A 1QVGU 2UUAB 3AG3C 2E74B 2GHYA 2DQ3A 4K8XA 3RVZA 3K3WA 1L0LH 2VRZA 5BR8O 4LF4B 2WLIA 1PM9A 4DV6B 1E79G 4PDMA 3C90A 1M4UA 1K5SA 1LR1A 3OT7A 4BW5A 1NR1A 4JI3O 5EYPB 1K7DA 1FD9A 1R1BA 2PYLA 3SPCA 3SJQC 1TVKB 4MTFA 5LMUB 3K5LA 1Y67A 5TISZ 3RN4A 2F4VB 4CH4A 1BHBA 3NR7A 2KQXA 4E2LA 4JYBA 1XBLA 1VQ5V 4LF7O 4DV4O 5KX5B 4TSFG 4PV1B 4QE9A 4PDLA 1D2DA 5L3DA 2WPDG 5KAIZ 4U3JB 3RGBA
chains in the Genus database with same CATH topology
1OZ0A 2EIMB 3ABLC 1VQPV 5CBHA 3CPWU 1R3JC 1H8EG 2AHZA 2Y48A 4XBFA 3OEEG 4F4LA 1GM7A 2XNDG 4WFAV 5CMUA 4L87A 1DF5A 1AI4A 1GM8A 3CCVV 1Q86W 3ASNB 1JVMA 2LP7A 3E35A 4LBEC 3JCZA 3M99B 1QLNA 2CK3G 2HKOA 4R50A 4WFEA 5L3EA 4WCEV 5E1AC 1K4CC 3ABKB 3AG4B 3CCLV 2QKSA 1M57B 2ZXWC 3NXSA 4GX1A 4N23A 2ZR2A 3B8MA 4QE7A 1PD3A 2HVJC 5H9CA 1VQ6V 3BY6A 3R65A 1AROP 4HAMA 3ZMTA 1Q7YW 3E8BA 4GX2A 1QLEC 3KG2A 4Z1MG 1YJ9V 5IY5C 2IJIA 3ZMUA 3HB3B 1QR9A 3LSSA 1XL6A 3A0RA 4JPRA 2R9RB 1YJWV 1S5HC 3JYCA 2B1IA 1WLEA 2YSUB 2ZXWB 4FMTA 4OXSA 2X6CA 1I5YA 1PNKA 4GX0A 2NNUA 2V1DA 1SERA 1QLEB 2V7QG 3TETA 1JX9A 4RQFA 1L1FA 4HZ3A 1H38A 3PJSK 3ZRXA 3B8NA 5H6RA 3ZN0A 2WLIB 1KC8W 3OMNB 5KA5A 4JASA 3ML0A 1ENVA 1FXKB 1DF4A 4DXWA 4CBCA 1OCRB 1K5QA 2IJKA 2PI4A 1NJIW 3W7WA 2P67A 2M7WA 3ABMB 5HFLA 5L3FA 3W7XA 5IYBO 5H6QA 1GKFA 3CC7V 5GW7A 3AEIA 3CD6V 2WLLB 3K08A 4QNHB 1VQ4V 2EIJB 3ASOC 5L3BA 2HLDG 3K79A 3CC2V 2EZPA 1K3EA 1KP3A 4PDRA 3K04A 4JYCA 2IH1C 2ZD9A 1FXKA 1TUEB 4MVRA 2XAGA 3AG3B 2Z5UA 2X7RB 3LDDA 3CYOA 2R9IA 4FJCC 3WFVA 4JF3A 3UKMA 3F7YC 3FB6C 3RBZA 2Y69B 1AR1B 1NVPB 2DYSB 3SPGA 1EFRG 1GMGA 3ASOB 2W6JG 4DO2A 1K4DC 3D36A 1BHAA 2DWEC 3OUSA 2JEUA 1THZA 1M56C 4JAVA 5LGUA 1KD1W 3D3IA 2EILC 4PDVA 1K8AW 3GWOA 4QPJA 5IDJA 3SPJA 1AI7A 1MG1A 1V55C 2LFSA 3ZIAG 2ITCC 5FL7G 5C93A 3W7UA 3QO8A 3FB8C 3ABTA 4WFGA 1F4NA 1CEZA 3FB7C 1PNLA 1GM9A 2OCCB 2XAQA 1MSWD 3GB7C 2D3OW 1F4MA 2LFRA 3E83A 4G27B 1OCOC 2OTJV 1Q81W 2QM7A 4MSWC 3W7TA 1J95A 2P7TC 1RPOA 3X2QC 3ZRWB 1QVFU 1P4RA 4QIWF 5KA6A 5B1AB 2BOBC 1H8HG 1DLBA 1YI2V 1M1KW 1K97A 3LDEA 1WPXA 1K34A 5L3GA 1V55B 1AJQA 2JJ1G 4J9ZB 1YTFB 1S0VA 2EZOA 3JD1A 3ZRSA 4CZZA 3F7VC 2WLJA 1KKDA 4Q20A 1VQNV 4JGSA 4WFFA 1RM1C 1GTOA 1PL0A 3ZRWA 2A79B 3CCEV 4X8AA 4G28B 3T4ZA 3I55V 2JJ2G 1NR7A 3OGCC 3SYQA 3X2QB 1RPRA 5EBWC 3QNEA 3DTUB 3SYOA 3CCQV 2OT5A 3ABLB 4UVCA 3AG1C 1VQ8V 3SPHA 1COWG 4KUMA 5DN6G 1K73W 4RUFA 4P9PA 2ZR3A 2X6BA 3SYAA 1RM1B 1QBZA 3K0DA 3F5WC 2WLKA 1JJ2U 1W0JG 2WLNA 1KQSU 1S72V 2XAJA 3EFFK 4YXWG 4X88A 2Z3YA 3MD0A 3CCRV 4LP8A 1KECA 4GX5A 3BEHA 3K0GA 3JD2A 3E86A 3ETGA 4RO2A 1B6QA 3B77A 4HYOA 4PA6A 2PI5A 2JK5C 3FKSG 4X89A 3CCUV 2ITDC 5IY5B 5J9PC 4N21A 3OE7G 1NH2B 2HFEC 2EJRA 1R3KC 1OCZC 3IGAC 2JIZG 2K1EA 3ZN1A 2WLMA 5B1NA 1Y66A 4TT3G 4MTGA 1MABG 1V54C 3CCSV 4PA9A 3P32A 1IXMA 4UVAA 3SYCA 3G4SV 1EZJA 4JAUA 4RQEA 3CMAV 5CBFA 5EC1C 3CMEV 5B1OA 1HWYA 2HJFC 4G2KA 2EBOA 3CXCU 4UVBA 1ROPA 4MVMA 2X0LA 2XAHA 1BL8A 1SETA 2Q68A 1S77D 1W0KG 4QPKA 3OR7C 1PKXA 5B1BC 2DYRC 1AJNA 1CP9A 5LGNA 2B5UA 1R3IC 2W0FC 4MW3A 1NQTA 4XDLA 2Q6AA 3H01A 3VBBA 3SPIA 2WAMA 3SYPA 3LUTB 2A0LA 4H33A 1H2GA 3W7SA 4RUEA 1VQ9V 2EINC 4ASUG 1XL4A 3FB5C 2DQ0A 2EIKC 3STZC 4WFBV 3HPLC 4PA4A 1S3JA 1YHQV 4JTAB 5HFMA 3WG7C 2IJHA 4MVQA 5CBGA 4R7CA 4FIPC 1ZWIC 3CCMV 3JD3A 2A9HA 3ABUA 1OHHG 3G71V 1K92A 4XDKA 3LDCA 2EINB 1CPYA 1R3LC 4P9OA 5EBMC 3OW2U 3ZJZA 4MTXA 1M56B 2Q69A 1N8RW 2EILB 3OEHG 4J9YB 4MVZA 4BAYA 2QM8A 1FS0G 4UUJC 4MS2A 1EBOA 2QE7G 3ETDA 1NVPD 5LBQA 4JTDB 3FYEB 2JDIG 4P2ZA 1QR8A 3ZRVA 1PNMA 3ZMZA 5L3CA 3ASNC 3CP1A 2IU3A 1NBMG 1AJPA 2IH3C 3E8GA 1FXHA 1OCOB 3E8HA 4R8CA 3CC4V 1AI6A 3ABKC 2P6JA 1JCHA 4LC1A 1VQOV 3ZMSA 4XDJA 3G6EV 3DGEA 2NLJC 4MVOA 4UXNA 3JD4A 4GCZA 4I5SA 4PA7A 1KP2A 3K06A 3LSQA 1M90W 1G4YB 2QEXV 3ZMVA 2HVKC 1VQ7V 1F51A 3LNMB 4MVUA 3AG2C 2ATKC 2XASA 5DM6V 4PELA 2H8PC 3E8FA 1BMFG 4ZBMA 1R6NA 1SRYA 4BIZA 4FPPA 2BOCC 1UJWB 2GSMB 1K33A 3OMAB 4GT1A 2IU0A 1GO3F 1MOFA 2QA4V 1YTFD 1G8MA 3STLC 3AG1B 5LHGA 2FTKA 4U7NA 2ZQMA 1NKDA 1JPXA 1YJNV 3IFXA 3QO5A 2DWDC 1YITV 2XAFA 5EBLC 3JD0A 3QO7A 4UV8A 4PA3A 2HR3A 4MTOA 3ZCCA 5LHIA 5LGTA 3AG2B 5BZBA 1E1QG 2JEXA 3RVYA 1FXVA 3TK1A 5IYDO 3IC7A 1FFTB 5KUMA 1I5XA 4MVSA 1SZTA 4RAIA 3UM7A 1K9MW 2IJJA 3FYIB 1QCEA 3OAAG 1FXKC 5EK0A 2UXXA 5CA3A 1VQKV 1OCRC 4FK5C 4R6ZA 1OCCC 3ABMC 4ZKIA 1DTOA 4QJFB 5IYCO 1GK9A 2AHYA 3OR6C 4JTCB 2B1GA 4P30A 1F23A 3MHHC 2EIJC 3TCUA 1R73A 1Y4MA 2YEVB 3OMIB 2XOKG 1VQMV 3CCJV 2DW4A 1OCZB 1QVGU 2P90A 4MT8A 1JOYA 3E89A 3AG3C 2GHYA 5B3SC 2IW5A 1V54B 2DQ3A 1YSCA 3RVZA 2KB1A 3K3WA 2MK3A 3ETEA 4H37A 1S76D 2H94A 1OCCB 2WWWA 3I56V 2Y69C 1NH2D 1P7BA 2DYSC 2YEVA 3T1CA 1JQ0A 3E2EA 2C2AA 2UXNA 5CN0A 5EC2C 5B1BB 2DYRB 4KFMA 2WLIA 3EHBB 4I9WA 4WF9V 1E79G 1SESA 3VOUA 4PDMA 3K03A 2OTLV 1K5SA 5B3SB 2W6IG 4BW5A 2ZDIC 4MW8A 3OM3B 1NR1A 2QTOA 2WLLA 3T2MA 1K7DA 3OFNG 2F43G 1ORQC 3RW0A 4U7OA 4LCUC 1AI5A 2EIKB 2OCCC 4UV9A 3SPCA 4BIUA 3SJQC 1VQLV 4MTFA 2HG5C 1Q82W 3MHSC 1W2BU 5KUKA 1E1RG 1M9NA 2X6AA 2Q67A 3K9AA 5B1AC 3WG7B 1LNQA 2EIMC 1BHBA 1YIJV 4KP4A 4E2LA 4JYBA 3T4DA 1VQ5V 2WLHA 4WFHA 4TSFG 1R6KA 4QE9A 3OUFA 4EKWA 4PDLA 5LHHA 5L3DA 3P30A 2ZDIA 3AG4C 2WPDG 4TWKA 2WSSG 1M57C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B8M A;  3K9A A;  1EBO A;  2EZP A;  1Y4M A;  1DLB A;  5H9C A;  3GWO A;  5HFM A;  1K34 A;  4N21 A;  4FIP C;  2EZO A;  5CMU A;  1DF5 A;  4E2L A;  2X7R B;  1QR9 A;  1MG1 A;  1QBZ A;  3B8N A;  1QR8 A;  3CYO A;  5KA5 A;  2LP7 A;  1Y66 A;  3H01 A;  4FJC C;  3CP1 A;  4JGS A;  4JPR A;  1ENV A;  4JF3 A;  3WFV A;  1I5X A;  3M99 B;  1DF4 A;  1SZT A;  2MK3 A;  1QCE A;  2M7W A;  5HFL A;  4FK5 C;  1K33 A;  1I5Y A;  2EBO A;  3MHH C;  4G2K A;  1JQ0 A;  1MOF A;  2P6J A;  2OT5 A;  3P30 A;  4N23 A;  3B77 A;  3MHS C;  5KA6 A;  5CN0 A;  1JPX A;  1F23 A; 
#chains in the Genus database with same CATH topology
 4LR3 A;  2EIM B;  4CS4 A;  1RFY A;  3CPW U;  3OEE G;  1GM7 A;  4DRX B;  4L87 A;  1AI4 A;  3ASN B;  3PN1 A;  1JVM A;  4EB6 B;  1BE3 H;  3M99 B;  1QLN A;  4AQY B;  3O9O A;  2QWN B;  4C7U A;  2AZ2 A;  1K4C C;  3WB0 A;  2QKS A;  1M57 B;  1YVW A;  3F5T A;  5LP6 B;  1GN6 A;  4JYA B;  1JJO A;  1AP6 A;  3B8M A;  4DR2 B;  5H9C A;  3RYC A;  4FFK A;  2Q8V A;  2QR4 A;  3KG2 A;  1XQ8 A;  4IL6 Z;  3RYI B;  3ZMU A;  2DN9 A;  3LSS A;  1VF6 A;  3M7M X;  4ZHQ B;  1D5N A;  1L0N H;  2VWJ A;  1S5H C;  4LWS B;  2A7W A;  2YSU B;  2ZXW B;  4DV7 B;  2E5L O;  4DV0 B;  3S3X A;  4OPH A;  1KB9 F;  3K5O A;  2V7Q G;  1L1F A;  1XMO O;  2FB5 A;  1WP8 A;  3D36 C;  5H6R A;  2WLI B;  5IJ0 B;  1KC8 W;  4JAS A;  5IYZ B;  1N32 O;  3ZED A;  4CBC A;  1K5Q A;  3CRQ A;  3DXR B;  3G67 A;  3H1I H;  5L3F A;  3W7X A;  1N34 O;  3CC7 V;  1GKF A;  4FLW A;  5GW7 A;  3AEI A;  4YIO A;  3S3W A;  4QNH B;  3ZHQ A;  5L3B A;  2BCC H;  3K79 A;  4LFB O;  2JRI A;  4NXN O;  3SGI A;  2OYQ A;  2X7R B;  3KCX A;  3JAW B;  4D7S A;  4JF3 A;  3J80 N;  1BSM A;  3RBZ A;  2P4V A;  2Y69 B;  5JH7 A;  4Z1V A;  3IJ4 A;  2W6J G;  1BHA A;  1WA8 B;  2JEU A;  4X62 B;  3D3I A;  2LJ2 A;  4PDV A;  1J5E O;  4DYL A;  1IBK B;  1UFI A;  2Q7G A;  3LSU A;  4GLX A;  3SPJ A;  4RWU A;  3ZS8 C;  2LFS A;  5C93 A;  3W7U A;  3FB8 C;  3ABT A;  1AB3 A;  3FD9 A;  1TGO A;  1GM9 A;  2XAQ A;  2QM7 A;  3W7T A;  3TJT A;  3X2Q C;  1SS3 A;  5JWP A;  1NT2 B;  5B1A B;  2BOB C;  2UXB B;  1YI2 V;  4GZR B;  5L3G A;  3BFR A;  4UB8 Z;  2GUZ B;  3SDL A;  5LOV A;  4X20 B;  1MNG A;  2VQE B;  1KKD A;  3U0Z A;  1HR0 O;  1IDS A;  3Q4H B;  4WFF A;  4LF6 B;  1XI1 A;  3JAT A;  3I55 V;  2BTQ A;  3OGC C;  3SYQ A;  1T5E A;  3DTU B;  1NTM H;  1HNX B;  3B09 A;  3N27 A;  3AG1 C;  1COW G;  1I94 B;  3QG5 A;  1N0N A;  5K1P A;  4KUM A;  2YXL A;  2L6L A;  4P9P A;  1QBZ A;  3K0D A;  1KQS U;  2WLN A;  1S72 V;  1KUQ A;  2JS3 A;  3EFF K;  2RCV A;  4X88 A;  3MD0 A;  2CAZ C;  3CCR V;  4JV5 B;  3FFQ A;  3K0G A;  3L75 H;  2GV9 A;  3L72 H;  1B6Q A;  3BA8 A;  1OJH A;  4F6R A;  2JK5 C;  2QWP B;  2ITD C;  3OE7 G;  2UU9 O;  2JIZ G;  3ZN1 A;  1KKC A;  2DOS A;  4TQD A;  5B1N A;  3HKB A;  1Q6U A;  1IBL B;  1X59 A;  4JI6 O;  1IXM A;  4UVA A;  2OIE A;  3CMA V;  1Z2G A;  3ZX6 A;  2EJ7 A;  2XAH A;  1BL8 A;  2K9P A;  1S77 D;  3OR7 C;  1PKX A;  1Z5W A;  3B4S A;  2P4K A;  3CB2 A;  4GKJ B;  2B5U A;  1Y74 B;  1XNQ O;  4DW1 A;  2R9A A;  4MW3 A;  4I50 A;  3U10 A;  3SPI A;  2ZE5 A;  2R70 A;  2EIN C;  1XL4 A;  2DQ0 A;  5CA1 A;  5FPR A;  4NB5 A;  4JI4 O;  4X64 B;  4B3R B;  2HHH O;  3N2K A;  4R7C A;  2A9H A;  3ABU A;  1OHH G;  3CRC A;  4DR4 O;  1K92 A;  4XDK A;  3LDC A;  2YDE A;  2CGO A;  2JVD A;  2Y4U A;  5EBM C;  1XNR B;  1GN3 A;  1M56 B;  2Q69 A;  3BRC A;  5IT9 N;  2EIL B;  1HDJ A;  4O4H B;  2YXY A;  2QM8 A;  1FS0 G;  4BAY A;  1EBO A;  3ETD A;  2F4V O;  2H3O A;  3ZRV A;  3ASN C;  3CP1 A;  3ZHU A;  2IH3 C;  5E79 Z;  5JVD A;  1FXH A;  1OCO B;  4HNA B;  2YIC A;  5FNV A;  2Q5Z A;  1XMQ B;  1JCH A;  3IC9 A;  5FLX N;  4J80 A;  2QM4 A;  1SQF A;  4H0L B;  2PYJ A;  3ZMV A;  4LFA B;  2UXC O;  2GBO A;  4TQF A;  3LNN A;  1I7F A;  2ATK C;  2XAS A;  3AG2 C;  3CJH A;  3H1H H;  4FM2 A;  1BMF G;  1LUV A;  4CC5 A;  1QNM A;  4LF8 B;  2AXT Z;  4FPP A;  4ZI7 B;  4WBN A;  5B66 Z;  4J10 A;  2ZQM A;  1JPX A;  3ZHT A;  2Q73 A;  1RSO A;  4PA3 A;  5LHI A;  2GTA A;  5LGT A;  5BZB A;  1ZLZ A;  1E1Q G;  4JI8 B;  3RVY A;  4I55 A;  3TK1 A;  4CS3 A;  3IC7 A;  5KUM A;  4MVS A;  1SZT A;  4DV2 B;  1K9M W;  3FYI B;  3BCC H;  4DV7 O;  2UXX A;  4R6Z A;  4I50 B;  4DV0 O;  3AK3 A;  4QJF B;  3OR6 C;  2B1G A;  3TCU A;  1Q3E A;  1R73 A;  3AG7 A;  2YEV B;  4JI7 O;  2ZCE A;  2DW4 A;  5A2Q N;  2VQF O;  3E89 A;  5ITZ A;  5B3S C;  2IW5 A;  1V54 B;  4JI2 B;  2KB1 A;  1WN7 A;  3ETE A;  3K59 A;  4OPA A;  4AHC A;  1OCC B;  4YY3 O;  3I56 V;  2Y69 C;  1WB7 A;  1P7B A;  5LA6 A;  1JQ0 A;  2VS0 A;  4O4J B;  3RYH A;  5LYJ B;  5EC2 C;  5B1B B;  2DYR B;  4KFM A;  2CTW A;  3K03 A;  3C3S A;  4B7E A;  2QTO A;  3T2M A;  1IZ3 A;  3WU2 Z;  1XHZ A;  4U7O A;  5KHH A;  1AI5 A;  1IBM B;  4UV9 A;  4BIU A;  2HG5 C;  2QDO A;  2ZNI A;  1I08 A;  1YXB A;  4X62 O;  4ZIB A;  2LW1 A;  5KUK A;  1M9N A;  5B1A C;  3VQV A;  4X1K B;  3APQ A;  1LNQ A;  4B3S B;  2ZM6 B;  3SJA C;  1KBH A;  3L74 H;  1AR4 A;  1TVK A;  1R6K A;  2UUB O;  3P30 A;  1VF6 C;  2ZDI A;  3C3T A;  4TWK A;  2WSS G;  2UXB O;  2AHZ A;  4XBF A;  4JI5 B;  5KLV H;  2PF4 E;  4WFA V;  5CMU A;  3CCV V;  4I0X B;  2VQE O;  2KG7 B;  3FAV B;  4LBE C;  3E35 A;  4LF6 O;  1Q6H A;  3QF7 A;  2HKO A;  4GYC B;  4WFE A;  4U3J A;  3AG4 B;  3CCL V;  3NXS A;  3G80 A;  4X1I A;  1Q8I A;  1JR9 A;  4DRX A;  2AW9 A;  3UT5 B;  1WPB A;  1PD3 A;  2HVJ C;  3BY6 A;  3B40 A;  3R65 A;  4HAM A;  1Q7Y W;  4OX9 B;  2YI8 A;  4GX2 A;  1QLE C;  4EB6 A;  5KAF Z;  2ILM A;  1YJ9 V;  3OTO O;  1QR9 A;  1XL6 A;  3A0R A;  3TGU H;  4JPR A;  1HP8 A;  2R9R B;  1YJW V;  5LP6 A;  2B1I A;  3CXH F;  4FMT A;  4JV5 O;  5IWA B;  1PNK A;  4DV5 O;  4GX0 A;  4W4K A;  3RYI A;  4DUZ O;  4NKG B;  3TET A;  4RQF A;  2OWO A;  5LA6 B;  1N4C A;  4ZHQ A;  5IE9 A;  1H38 A;  4LWS A;  4KHP B;  3RYH B;  1YCI A;  4AIL C;  1G1X B;  5KA5 A;  1FXK B;  4DXW A;  4DV1 O;  2E3C A;  2PI4 A;  2P67 A;  2B9Z A;  5CB4 B;  3ABM B;  5IYB O;  1Q5O A;  2Y0P A;  3CD6 V;  4L8J A;  1URF A;  1VQ4 V;  4UCR A;  3CS5 A;  3CC2 V;  5IJ0 A;  3K04 A;  5IYZ A;  1Q90 D;  1TUE B;  3JAK B;  4MVR A;  1GH6 A;  3DXR A;  3SR2 C;  4O2A B;  3UKM A;  3F7Y C;  2LW7 A;  4FZ1 A;  4FLZ A;  4X65 O;  4FVM A;  4E4E A;  2FML A;  3ASO B;  4DO2 A;  1K4D C;  2MW2 B;  4LF5 B;  5H5N A;  2DWE C;  3OUS A;  3GVM A;  1M56 C;  4JAV A;  1KD1 W;  2EIL C;  3GWO A;  4QPJ A;  3JAW A;  2XHB A;  2CH7 A;  3APO A;  1BQZ A;  1MG1 A;  4YJ2 B;  4NTX A;  1WA8 A;  2OCC B;  2YI9 A;  3VQX A;  1MSW D;  2D3O W;  3TXQ A;  1F4M A;  2LFR A;  1OCO C;  4MSW C;  2ZE8 A;  1J95 A;  1MSD A;  1RPO A;  3ZRW B;  3D8C A;  4PHZ A;  2UXD B;  1H8H G;  1XDC A;  1K97 A;  1WPX A;  1HW7 A;  1V55 B;  4X1I B;  3JAL B;  3JD1 A;  2YXH A;  4FLT A;  4J41 A;  2YIB A;  1BT8 A;  4Q20 A;  3JSN A;  4JGS A;  3UO2 A;  5BMV B;  1GTO A;  3RT3 C;  2ODM A;  2A79 B;  2ADP A;  4X8A A;  2CGN A;  2JJ2 G;  3QNE A;  3SYO A;  1NI8 A;  2F66 C;  2OT5 A;  2GUZ A;  3ABL B;  4X20 A;  3K58 A;  5J2T A;  3SPH A;  3Q4H A;  4NVP A;  1FJG B;  1N36 B;  3SYA A;  1RM1 B;  1HNW O;  1JJ2 U;  1W0J G;  4O4I B;  4JI0 O;  2Y0I A;  5J2U B;  2CUG A;  2RDC A;  3JD2 A;  4QGP A;  3E86 A;  3ETG A;  4RO2 A;  4HYO A;  4PA6 A;  3JAM N;  1S5L Z;  1BS3 A;  2HEP A;  3IGA C;  4JI8 O;  2Q0A A;  4FLU A;  2IBZ H;  2WLM A;  4TT3 G;  4MTG A;  1MAB G;  1V54 C;  1Z5V A;  4DV2 O;  3P32 A;  1IVS A;  4JAU A;  3A8T A;  4DR3 B;  2EBO A;  3CXC U;  4DR1 B;  3B2E E;  4K0K B;  4LF9 B;  1W0K G;  2P06 A;  4EFB A;  3L71 H;  1ZL8 A;  3VQY A;  1XOU A;  2ZNJ A;  5B1B C;  2DYR C;  5KHI A;  1CP9 A;  3QVN A;  4NXM O;  1JMK C;  2CH7 B;  1H2G A;  4GKK B;  4ASU G;  4I4T B;  1ZSP A;  1Y76 A;  1Y74 A;  4PA4 A;  1SQV H;  2IJH A;  4MVQ A;  5JCO C;  4J7J A;  4FIP C;  1ZWI C;  4YJ3 A;  3CCM V;  3P3P A;  4U3F H;  1JFF B;  4LFC O;  1PV0 A;  1CPY A;  4DV3 B;  2XTA A;  1IBM O;  3RFR A;  5LL6 Y;  4MTX A;  2YIA A;  3ETQ A;  3OGI B;  4J9Y B;  5JJE B;  2NR5 A;  2UUC B;  4IGG A;  2YID A;  4UUJ C;  4O2B A;  1NVP D;  5GTI Z;  3FYE B;  2P5O A;  3DC5 A;  2D2C B;  3T1Y B;  4P2Z A;  5J2T B;  1SC5 B;  1SKV A;  3ZMZ A;  3P3N A;  2IU3 A;  3EXA A;  1NBM G;  3JCU Z;  4O4H A;  2P6J A;  1VQO V;  3G6E V;  3DGE A;  4MVO A;  2P22 C;  5A9G A;  3JD4 A;  4I5S A;  2QGN A;  3LSQ A;  4JI1 O;  2QEX V;  2LQT A;  2AGA A;  2HVK C;  1VQ7 V;  1F51 A;  1TUB B;  4MVU A;  4HNA A;  3QTC A;  5DM6 V;  4B3T B;  1SRY A;  1AP5 A;  4BIZ A;  4TUY B;  2BOC C;  4HBN A;  1MOF A;  2FTK A;  4U7N A;  4ZOL A;  3IFX A;  3RYF B;  2XAF A;  4UV8 A;  3FX7 A;  3ZCC A;  2HR3 A;  1H2N A;  2BSK B;  4X66 B;  1UPG A;  4ZI7 A;  1ZL8 B;  1N0J A;  4OGQ B;  1D5A A;  1I5X A;  4FLX A;  2IJJ A;  3OAA G;  1FXK C;  4UCO A;  4FK5 C;  2WA4 A;  3ABM C;  1U97 A;  2F23 A;  3THO A;  2CTP A;  3MHH C;  1AIL A;  3OMI B;  2JGD B;  4CH5 A;  3CCJ V;  1OCZ B;  2PTM A;  1Y76 B;  1SQG A;  2P90 A;  2UUA O;  1BZK A;  1P84 F;  3L73 H;  1P49 A;  2MK3 A;  2WWW A;  3UCS C;  4YJ3 B;  4LF4 O;  2YEV A;  5KHK A;  3E2E A;  2ZE6 A;  3AK1 A;  1NTK H;  2UXN A;  5CN0 A;  3EHB B;  4I9W A;  4WF9 V;  4DV6 O;  2OTL V;  4IIJ A;  1PL4 A;  4BR6 A;  1IX9 A;  2RJZ A;  4CH3 A;  2ZDI C;  3OM3 B;  2L35 A;  2WLL A;  4TV9 B;  3G6B A;  4O2B B;  1QHT A;  2F43 G;  3RW0 A;  1BGY H;  4O4J A;  5LYJ A;  3I5D A;  2OCC C;  4UCS A;  1VQL V;  5LMU O;  1B3Q A;  3A2F A;  3MHS C;  1FYJ A;  1W2B U;  2X6A A;  3K9A A;  4O4L B;  2EIM C;  4KP4 A;  3T1H B;  4LNU B;  1WJZ A;  1H2L A;  2F1M A;  4PJ0 Z;  4WFH A;  4DV4 B;  5IJ9 B;  3CRA A;  1IUR A;  5K1X A;  5KHG A;  5JCO A;  4X1K A;  5LHH A;  1VQ9 V;  1M57 C;  1OZ0 A;  4GUN A;  3ABL C;  2ARH A;  1VQP V;  5LP6 C;  4IHJ A;  1R3J C;  1EN4 A;  4F4L A;  3JAR A;  4ZOL B;  1DF5 A;  1GM8 A;  3JCZ A;  3SJB C;  2QWR B;  4AQY O;  5L3E A;  4WCE V;  1OV9 A;  2A06 H;  5E1A C;  1NZ6 A;  3ABK B;  2CDY A;  3JSL A;  2ZXW C;  4GX1 A;  2LO1 A;  2ZT9 B;  1JA8 A;  4JYA O;  4I0X A;  1S5J A;  2KG7 A;  4DR2 O;  5GTH Z;  3FAV A;  3E8B A;  4Z1M G;  1Y6X A;  3H1L H;  3HB3 B;  1Q43 A;  1WB8 A;  2F93 B;  3JYC A;  2E5L B;  1WLE A;  2VWK A;  4OXS A;  3UT5 A;  2X6C A;  1I5Y A;  3BVO A;  5LMN B;  1ZUQ A;  2NNU A;  2V1D A;  1AVM A;  3K9S A;  1W59 A;  2JS5 A;  3CSX A;  1XMO B;  3DC6 A;  3ZRX A;  3ZN0 A;  3OMN B;  3ML0 A;  1N32 B;  5AG2 A;  1DF4 A;  4IIJ B;  5GON B;  2IJK A;  4DUY B;  2YC0 A;  1N34 B;  2M7W A;  5DEC A;  4BW9 A;  3ICX A;  2WLL B;  4DR1 O;  3K08 A;  2HLD G;  3N2G A;  3HKD B;  3D3Q A;  1KP3 A;  5B5E Z;  4JYC A;  2ZD9 A;  1FXK A;  3HKE B;  1P7G A;  2Z5U A;  2GTS A;  5CB4 A;  3CYO A;  3J81 N;  2R9I A;  4FFB B;  2FL4 A;  3WFV A;  4I7Z B;  1FKA O;  1NVP B;  2DYS B;  3SPG A;  4DR7 B;  1EFR G;  5EIB C;  3JAK A;  3L9D A;  1X4T A;  1J5E B;  2FYU H;  3M8A A;  1K8A W;  1Q6I A;  1PPJ H;  1YZB A;  4JYY A;  1IBK O;  4O2A A;  2DE0 X;  3R66 A;  5IDJ A;  3ZIA G;  3QO8 A;  4IHJ B;  1CEZ A;  3FB7 C;  1PNL A;  3JAR B;  4EEQ A;  2WA3 A;  3GB7 C;  1BCC H;  2P7T C;  4QIW F;  5KA6 A;  4UB6 Z;  2QKC A;  1M1K W;  4YJ2 A;  4J9Z B;  2A3Q A;  3ZRS A;  4CZZ A;  4KL1 A;  3F7V C;  4A5U B;  2IM9 A;  3ZRW A;  2JGU A;  1DGS A;  1PP9 H;  2ZE7 A;  3X2Q B;  1RPR A;  5EBW C;  3CCQ V;  2Q9L A;  3GWK C;  1HNX O;  4UVC A;  3JAL A;  4UCT A;  1VQ8 V;  1EN6 A;  3BHP A;  1I94 O;  4FLV A;  5DN6 G;  5BMV A;  4DK0 A;  4RUF A;  2ZR3 A;  4K8Z A;  2CTQ A;  4YXW G;  1NU1 H;  1KEC A;  4GX5 A;  3B77 A;  2Q7E A;  1EZV H;  3OTF A;  4X89 A;  2RMK B;  5IY5 B;  4O4I A;  2HFE C;  2EJR A;  1OCZ C;  4X66 O;  5J2U A;  2K1E A;  3N2G B;  4B3M B;  4JI6 B;  1IBL O;  3J7A U;  3SYC A;  1EZJ A;  2BTO A;  4RQE A;  5F2V O;  3CME V;  5B1O A;  1HWY A;  2HJF C;  1ROP A;  2X0L A;  2Q68 A;  3E22 B;  4GKJ O;  4X1Y B;  5LGN A;  1R3I C;  1XNQ B;  2HP8 A;  1NQT A;  3H01 A;  2WAM A;  1GN2 A;  4RUE A;  3FB5 C;  4JI4 B;  3STZ C;  3WB1 A;  2LGQ A;  2HHH B;  4X64 O;  2ZIM A;  4B3R O;  4WFB V;  2PZS A;  3HPL C;  2OIG A;  3HKC B;  4JTA B;  1H2M A;  1ZTE A;  2Q7H A;  3JD3 A;  3G71 V;  4DR4 B;  4I4T A;  5KHJ A;  2EIN B;  2W0X A;  1R3L C;  2QTS A;  4P9O A;  5LXT A;  3OW2 U;  1TAE A;  3ZJZ A;  1H2K A;  3A0H Z;  1QU7 A;  1XNR O;  1N8R W;  4MVZ A;  1WNS A;  2QSA A;  4MS2 A;  4UFZ A;  1JFF A;  5LBQ A;  4JTD B;  2ZIN A;  3T1H O;  3HR0 A;  2JDI G;  4UCV A;  1QR8 A;  1QQC A;  1AJP A;  3VQW A;  2ADQ B;  3E8H A;  4FLY A;  3ABK C;  1N33 B;  1XMQ O;  1GAX A;  4LC1 A;  4DR6 B;  1FFX B;  1WP7 A;  4GCZ A;  4PA7 A;  3DSQ A;  3K06 A;  2UXC B;  4LFA O;  5EZY A;  2QKA A;  3E8F A;  4ZBM A;  1VEW A;  4LF8 O;  1ZAU A;  2M6Y A;  1YF2 A;  3OMA B;  1YTF D;  2QJ1 A;  1G8M A;  4Q6G A;  1F7Y A;  1YJN V;  3QO5 A;  1TUB A;  2DWD C;  1YIT V;  5JQG B;  1YEW A;  4TOI A;  3QO7 A;  3KKY A;  4FZ0 A;  4MTO A;  3AG2 B;  4TUY A;  4CS2 A;  5IYD O;  3CHX A;  1SZX A;  4RAI A;  3UM7 A;  1HNZ B;  5EK0 A;  1QCE A;  5CA3 A;  4DK1 A;  4DW0 A;  5KMG A;  1OCC C;  3MDS A;  3RYF A;  5LMN O;  4ZKI A;  5IYC O;  1GK9 A;  2AHY A;  1XIL A;  4JTC B;  2BSK A;  3MAQ A;  4NR1 A;  4JI7 B;  1Y4M A;  4KXR A;  2XOK G;  3UO3 A;  1VQM V;  4MT8 A;  2VQF B;  1JOY A;  3BPZ A;  2GDS A;  4JI2 O;  1YSC A;  1IXB A;  4H37 A;  1S76 D;  2H94 A;  4YY3 B;  4DUY O;  1NH2 D;  2DYS C;  2JGD A;  1VMG A;  3T1C A;  4DR5 B;  4J7K A;  2C2A A;  1L8D A;  2V4D A;  5LXT B;  1SES A;  3VOU A;  2N74 A;  3EVK A;  2AZ0 A;  5B3S B;  2W6I G;  1XEQ A;  4MW8 A;  5BXZ A;  3OFN G;  1O9G A;  1ORQ C;  1SQQ H;  4LCU C;  4DR7 O;  2Z0A A;  4K35 A;  2EIK B;  2Q4P A;  1M93 A;  1XUQ A;  2KKW A;  1FAF A;  1EN5 A;  2EX3 A;  1Q82 W;  1KYO F;  2KSD A;  1E1R G;  2Q67 A;  3WG7 B;  4TV9 A;  1YIJ V;  4LH7 A;  4B3S O;  2ZM6 O;  5CA0 A;  4FM0 A;  2PGG A;  3CX5 F;  3T4D A;  4IT5 A;  2WLH A;  4NYK A;  2UUB B;  4O4L A;  3OUF A;  4EKW A;  4F6E A;  1WAZ A;  5EZY B;  1MA1 A;  1SQB H;  3AG4 C;  1VF5 B;  4LNU A;  3K57 A;  3OD4 A;  1MZE A;  5CBH A;  1H8E G;  2Y48 A;  4Z2W A;  4JI5 O;  2XND G;  5IJ9 A;  3IAY A;  3CE2 A;  4ABM A;  1Q86 W;  2RQ6 A;  3RYC B;  3BAA A;  2LP7 A;  2E76 B;  2CK3 G;  4R50 A;  1LUW A;  4YHH B;  1SA0 A;  1MZF A;  4N23 A;  2ZR2 A;  4UCU A;  3ZHV A;  4QE7 A;  4CC6 A;  5KMG B;  1VQ6 V;  1ARO P;  3ZMT A;  4OX9 O;  5BY1 A;  3OTO B;  5IY5 C;  2IJI A;  3WB2 A;  5JJN B;  5IWA O;  4DV5 B;  3H9V A;  4DUZ B;  1SER A;  1QLE B;  1JX9 A;  2CTR A;  5JJJ B;  1TA8 A;  3L70 H;  4HZ3 A;  3PJS K;  3U11 A;  4KHP O;  3B8N A;  4PI0 A;  4B3M O;  2CE4 A;  2YUA A;  1ENV A;  4DV1 B;  2R72 A;  2ETN A;  1OCR B;  1B04 A;  1NJI W;  3W7W A;  5HFL A;  5BR8 B;  5H6Q A;  1V9P A;  3ZBH A;  4IYH A;  1RP3 B;  2N05 A;  1U96 A;  2EIJ B;  3ASO C;  5JH7 B;  1M5I A;  1US6 A;  2EZP A;  1K3E A;  4PDR A;  1VAR A;  2IH1 C;  2XAG A;  3AG3 B;  5GON A;  4B7K A;  3LDD A;  3CEI A;  4D7T A;  4NTW A;  2F95 B;  4FJC C;  4JI3 B;  1H2S B;  5C8Y A;  5H2F Z;  4X65 B;  3CWB H;  3FB6 C;  5CA0 B;  1AR1 B;  1A32 A;  3HKD A;  1GMG A;  1GN4 A;  3D36 A;  4LF5 O;  3HKE A;  1THZ A;  3JAS A;  1R6T A;  4CH6 A;  5LGU A;  4FFB A;  1AI7 A;  1V55 C;  2ITC C;  3SJC C;  5FL7 G;  1KU9 A;  4H44 B;  4IYI A;  4LF7 B;  4WFG A;  5LOV B;  1F4N A;  4PI2 A;  3KCY A;  2DJV A;  3E83 A;  2Y4T A;  4G27 B;  2OTJ V;  1Q81 W;  4J11 A;  2DMX A;  1QVF U;  1P4R A;  3JAT B;  4BIO A;  2BTQ B;  1DLB A;  2UXD O;  1SA0 B;  3LDE A;  1K34 A;  1XRE A;  1AJQ A;  2JJ1 G;  3TXS A;  1YTF B;  1S0V A;  2EZO A;  2WLJ A;  1VP7 A;  1EM1 A;  2N04 A;  1VQN V;  1RM1 C;  1PL0 A;  2O57 A;  3CCE V;  1BQ0 A;  4G28 B;  1O9H A;  3T4Z A;  1NR7 A;  3ZHS A;  1VIB A;  1N33 O;  2XUM A;  1SQX H;  5DED A;  4DR6 O;  2E75 B;  4I9Q A;  1K73 W;  4F6R B;  1FJG O;  1N36 O;  2X6B A;  3H1J H;  1HNW B;  3F5W C;  2WLK A;  1B06 A;  4JI0 B;  4J42 A;  2XAJ A;  2Z3Y A;  4AI8 A;  4J7Z A;  4LP8 A;  3HKB B;  3BEH A;  4K3A A;  1DK1 A;  2PI5 A;  2LGW A;  3FKS G;  3CCU V;  3UQ8 A;  4D6T H;  4N21 A;  5J9P C;  1NH2 B;  1R3K C;  2Q0O C;  3KZI Z;  1Y66 A;  1ZX3 A;  3CCS V;  1HNZ O;  4PA9 A;  2RNB A;  3G4S V;  5CBF A;  5EC1 C;  4TV8 A;  4G2K A;  4UVB A;  4DR3 O;  4MVM A;  1SET A;  5C8Y B;  4K0K O;  4QPK A;  4ICG A;  4LF9 O;  4LFB B;  1VF7 A;  1AJN A;  5CA1 B;  4NXM B;  4NXN B;  3BAB A;  2W0F C;  3JAS B;  3H1K H;  5D5P A;  4XDL A;  2Q6A A;  3VBB A;  3SYP A;  3CRR A;  3LUT B;  3N2K B;  2A0L A;  4H13 B;  4H33 A;  3W7S A;  4GKK O;  5FPO A;  3E22 A;  4DR5 O;  1GRJ A;  2EIK C;  4X1Y A;  3K5M A;  1S3J A;  1YHQ V;  5HFM A;  2HJD A;  3WG7 C;  5CBG A;  4JAA A;  2G38 A;  4LFC B;  3RWR D;  5D5Q A;  1I0H A;  1SQP H;  4DV3 O;  3HKC A;  1NS1 A;  4LH6 A;  3OEH G;  5JVD B;  2UUC O;  1FPO A;  2QE7 G;  2BE3 A;  5FNV B;  2QWQ B;  5EYP A;  4PD4 F;  2ZIO A;  1CXZ B;  2PUS A;  4YIP A;  3T1Y O;  1PNM A;  3AK2 A;  5L3C A;  1HR0 B;  1XHX A;  2EUL A;  3E8G A;  2XT9 A;  4FM1 A;  4R8C A;  4JZ2 A;  3CC4 V;  1AI6 A;  3CJH B;  2RN9 A;  3ZMS A;  4BWA A;  1KMI Z;  4XDJ A;  2NLJ C;  4B08 A;  4UXN A;  4JZG A;  4WBN B;  1KP2 A;  4JI1 B;  2YIB D;  5EIB D;  5KX5 A;  1G4Y B;  1M90 W;  1SF9 A;  3LNM B;  1AR5 A;  1RSO B;  4PEL A;  2FKX A;  2H8P C;  4B3T O;  3ZHR A;  1R6N A;  4YHH O;  4I55 B;  1UJW B;  1FFX A;  2GSM B;  1K33 A;  4GT1 A;  2IU0 A;  2QA4 V;  1GO3 F;  1NTZ H;  2QWO B;  3STL C;  1G6U A;  3AG1 B;  5LHG A;  2YS8 A;  1NKD A;  2OCH A;  1YDX A;  3K5N A;  3A0B Z;  4X9Q A;  4TV8 B;  5EBL C;  3JD0 A;  1MMM A;  2UU9 B;  4EFE A;  2JEX A;  2PY5 A;  1FXV A;  1FFT B;  3O65 A;  5ITZ B;  1VQK V;  1OCR C;  5JQG A;  1DTO A;  3CRM A;  4NTY A;  4P30 A;  4W4L A;  1F23 A;  2ZKO A;  2EIJ C;  2NN4 A;  3BA9 A;  1QVG U;  2UUA B;  3AG3 C;  2E74 B;  2GHY A;  2DQ3 A;  4K8X A;  3RVZ A;  3K3W A;  1L0L H;  2VRZ A;  5BR8 O;  4LF4 B;  2WLI A;  1PM9 A;  4DV6 B;  1E79 G;  4PDM A;  3C90 A;  1M4U A;  1K5S A;  1LR1 A;  3OT7 A;  4BW5 A;  1NR1 A;  4JI3 O;  5EYP B;  1K7D A;  1FD9 A;  1R1B A;  2PYL A;  3SPC A;  3SJQ C;  1TVK B;  4MTF A;  5LMU B;  3K5L A;  1Y67 A;  5TIS Z;  3RN4 A;  2F4V B;  4CH4 A;  1BHB A;  3NR7 A;  2KQX A;  4E2L A;  4JYB A;  1XBL A;  1VQ5 V;  4LF7 O;  4DV4 O;  5KX5 B;  4TSF G;  4PV1 B;  4QE9 A;  4PDL A;  1D2D A;  5L3D A;  2WPD G;  5KAI Z;  4U3J B;  3RGB A; 
#chains in the Genus database with same CATH homology
 1OZ0 A;  2EIM B;  3ABL C;  1VQP V;  5CBH A;  3CPW U;  1R3J C;  1H8E G;  2AHZ A;  2Y48 A;  4XBF A;  3OEE G;  4F4L A;  1GM7 A;  2XND G;  4WFA V;  5CMU A;  4L87 A;  1DF5 A;  1AI4 A;  1GM8 A;  3CCV V;  1Q86 W;  3ASN B;  1JVM A;  2LP7 A;  3E35 A;  4LBE C;  3JCZ A;  3M99 B;  1QLN A;  2CK3 G;  2HKO A;  4R50 A;  4WFE A;  5L3E A;  4WCE V;  5E1A C;  1K4C C;  3ABK B;  3AG4 B;  3CCL V;  2QKS A;  1M57 B;  2ZXW C;  3NXS A;  4GX1 A;  4N23 A;  2ZR2 A;  3B8M A;  4QE7 A;  1PD3 A;  2HVJ C;  5H9C A;  1VQ6 V;  3BY6 A;  3R65 A;  1ARO P;  4HAM A;  3ZMT A;  1Q7Y W;  3E8B A;  4GX2 A;  1QLE C;  3KG2 A;  4Z1M G;  1YJ9 V;  5IY5 C;  2IJI A;  3ZMU A;  3HB3 B;  1QR9 A;  3LSS A;  1XL6 A;  3A0R A;  4JPR A;  2R9R B;  1YJW V;  1S5H C;  3JYC A;  2B1I A;  1WLE A;  2YSU B;  2ZXW B;  4FMT A;  4OXS A;  2X6C A;  1I5Y A;  1PNK A;  4GX0 A;  2NNU A;  2V1D A;  1SER A;  1QLE B;  2V7Q G;  3TET A;  1JX9 A;  4RQF A;  1L1F A;  4HZ3 A;  1H38 A;  3PJS K;  3ZRX A;  3B8N A;  5H6R A;  3ZN0 A;  2WLI B;  1KC8 W;  3OMN B;  5KA5 A;  4JAS A;  3ML0 A;  1ENV A;  1FXK B;  1DF4 A;  4DXW A;  4CBC A;  1OCR B;  1K5Q A;  2IJK A;  2PI4 A;  1NJI W;  3W7W A;  2P67 A;  2M7W A;  3ABM B;  5HFL A;  5L3F A;  3W7X A;  5IYB O;  5H6Q A;  1GKF A;  3CC7 V;  5GW7 A;  3AEI A;  3CD6 V;  2WLL B;  3K08 A;  4QNH B;  1VQ4 V;  2EIJ B;  3ASO C;  5L3B A;  2HLD G;  3K79 A;  3CC2 V;  2EZP A;  1K3E A;  1KP3 A;  4PDR A;  3K04 A;  4JYC A;  2IH1 C;  2ZD9 A;  1FXK A;  1TUE B;  4MVR A;  2XAG A;  3AG3 B;  2Z5U A;  2X7R B;  3LDD A;  3CYO A;  2R9I A;  4FJC C;  3WFV A;  4JF3 A;  3UKM A;  3F7Y C;  3FB6 C;  3RBZ A;  2Y69 B;  1AR1 B;  1NVP B;  2DYS B;  3SPG A;  1EFR G;  1GMG A;  3ASO B;  2W6J G;  4DO2 A;  1K4D C;  3D36 A;  1BHA A;  2DWE C;  3OUS A;  2JEU A;  1THZ A;  1M56 C;  4JAV A;  5LGU A;  1KD1 W;  3D3I A;  2EIL C;  4PDV A;  1K8A W;  3GWO A;  4QPJ A;  5IDJ A;  3SPJ A;  1AI7 A;  1MG1 A;  1V55 C;  2LFS A;  3ZIA G;  2ITC C;  5FL7 G;  5C93 A;  3W7U A;  3QO8 A;  3FB8 C;  3ABT A;  4WFG A;  1F4N A;  1CEZ A;  3FB7 C;  1PNL A;  1GM9 A;  2OCC B;  2XAQ A;  1MSW D;  3GB7 C;  2D3O W;  1F4M A;  2LFR A;  3E83 A;  4G27 B;  1OCO C;  2OTJ V;  1Q81 W;  2QM7 A;  4MSW C;  3W7T A;  1J95 A;  2P7T C;  1RPO A;  3X2Q C;  3ZRW B;  1QVF U;  1P4R A;  4QIW F;  5KA6 A;  5B1A B;  2BOB C;  1H8H G;  1DLB A;  1YI2 V;  1M1K W;  1K97 A;  3LDE A;  1WPX A;  1K34 A;  5L3G A;  1V55 B;  1AJQ A;  2JJ1 G;  4J9Z B;  1YTF B;  1S0V A;  2EZO A;  3JD1 A;  3ZRS A;  4CZZ A;  3F7V C;  2WLJ A;  1KKD A;  4Q20 A;  1VQN V;  4JGS A;  4WFF A;  1RM1 C;  1GTO A;  1PL0 A;  3ZRW A;  2A79 B;  3CCE V;  4X8A A;  4G28 B;  3T4Z A;  3I55 V;  2JJ2 G;  1NR7 A;  3OGC C;  3SYQ A;  3X2Q B;  1RPR A;  5EBW C;  3QNE A;  3DTU B;  3SYO A;  3CCQ V;  2OT5 A;  3ABL B;  4UVC A;  3AG1 C;  1VQ8 V;  3SPH A;  1COW G;  4KUM A;  5DN6 G;  1K73 W;  4RUF A;  4P9P A;  2ZR3 A;  2X6B A;  3SYA A;  1RM1 B;  1QBZ A;  3K0D A;  3F5W C;  2WLK A;  1JJ2 U;  1W0J G;  2WLN A;  1KQS U;  1S72 V;  2XAJ A;  3EFF K;  4YXW G;  4X88 A;  2Z3Y A;  3MD0 A;  3CCR V;  4LP8 A;  1KEC A;  4GX5 A;  3BEH A;  3K0G A;  3JD2 A;  3E86 A;  3ETG A;  4RO2 A;  1B6Q A;  3B77 A;  4HYO A;  4PA6 A;  2PI5 A;  2JK5 C;  3FKS G;  4X89 A;  3CCU V;  2ITD C;  5IY5 B;  5J9P C;  4N21 A;  3OE7 G;  1NH2 B;  2HFE C;  2EJR A;  1R3K C;  1OCZ C;  3IGA C;  2JIZ G;  2K1E A;  3ZN1 A;  2WLM A;  5B1N A;  1Y66 A;  4TT3 G;  4MTG A;  1MAB G;  1V54 C;  3CCS V;  4PA9 A;  3P32 A;  1IXM A;  4UVA A;  3SYC A;  3G4S V;  1EZJ A;  4JAU A;  4RQE A;  3CMA V;  5CBF A;  5EC1 C;  3CME V;  5B1O A;  1HWY A;  2HJF C;  4G2K A;  2EBO A;  3CXC U;  4UVB A;  1ROP A;  4MVM A;  2X0L A;  2XAH A;  1BL8 A;  1SET A;  2Q68 A;  1S77 D;  1W0K G;  4QPK A;  3OR7 C;  1PKX A;  5B1B C;  2DYR C;  1AJN A;  1CP9 A;  5LGN A;  2B5U A;  1R3I C;  2W0F C;  4MW3 A;  1NQT A;  4XDL A;  2Q6A A;  3H01 A;  3VBB A;  3SPI A;  2WAM A;  3SYP A;  3LUT B;  2A0L A;  4H33 A;  1H2G A;  3W7S A;  4RUE A;  1VQ9 V;  2EIN C;  4ASU G;  1XL4 A;  3FB5 C;  2DQ0 A;  2EIK C;  3STZ C;  4WFB V;  3HPL C;  4PA4 A;  1S3J A;  1YHQ V;  4JTA B;  5HFM A;  3WG7 C;  2IJH A;  4MVQ A;  5CBG A;  4R7C A;  4FIP C;  1ZWI C;  3CCM V;  3JD3 A;  2A9H A;  3ABU A;  1OHH G;  3G71 V;  1K92 A;  4XDK A;  3LDC A;  2EIN B;  1CPY A;  1R3L C;  4P9O A;  5EBM C;  3OW2 U;  3ZJZ A;  4MTX A;  1M56 B;  2Q69 A;  1N8R W;  2EIL B;  3OEH G;  4J9Y B;  4MVZ A;  4BAY A;  2QM8 A;  1FS0 G;  4UUJ C;  4MS2 A;  1EBO A;  2QE7 G;  3ETD A;  1NVP D;  5LBQ A;  4JTD B;  3FYE B;  2JDI G;  4P2Z A;  1QR8 A;  3ZRV A;  1PNM A;  3ZMZ A;  5L3C A;  3ASN C;  3CP1 A;  2IU3 A;  1NBM G;  1AJP A;  2IH3 C;  3E8G A;  1FXH A;  1OCO B;  3E8H A;  4R8C A;  3CC4 V;  1AI6 A;  3ABK C;  2P6J A;  1JCH A;  4LC1 A;  1VQO V;  3ZMS A;  4XDJ A;  3G6E V;  3DGE A;  2NLJ C;  4MVO A;  4UXN A;  3JD4 A;  4GCZ A;  4I5S A;  4PA7 A;  1KP2 A;  3K06 A;  3LSQ A;  1M90 W;  1G4Y B;  2QEX V;  3ZMV A;  2HVK C;  1VQ7 V;  1F51 A;  3LNM B;  4MVU A;  3AG2 C;  2ATK C;  2XAS A;  5DM6 V;  4PEL A;  2H8P C;  3E8F A;  1BMF G;  4ZBM A;  1R6N A;  1SRY A;  4BIZ A;  4FPP A;  2BOC C;  1UJW B;  2GSM B;  1K33 A;  3OMA B;  4GT1 A;  2IU0 A;  1GO3 F;  1MOF A;  2QA4 V;  1YTF D;  1G8M A;  3STL C;  3AG1 B;  5LHG A;  2FTK A;  4U7N A;  2ZQM A;  1NKD A;  1JPX A;  1YJN V;  3IFX A;  3QO5 A;  2DWD C;  1YIT V;  2XAF A;  5EBL C;  3JD0 A;  3QO7 A;  4UV8 A;  4PA3 A;  2HR3 A;  4MTO A;  3ZCC A;  5LHI A;  5LGT A;  3AG2 B;  5BZB A;  1E1Q G;  2JEX A;  3RVY A;  1FXV A;  3TK1 A;  5IYD O;  3IC7 A;  1FFT B;  5KUM A;  1I5X A;  4MVS A;  1SZT A;  4RAI A;  3UM7 A;  1K9M W;  2IJJ A;  3FYI B;  1QCE A;  3OAA G;  1FXK C;  5EK0 A;  2UXX A;  5CA3 A;  1VQK V;  1OCR C;  4FK5 C;  4R6Z A;  1OCC C;  3ABM C;  4ZKI A;  1DTO A;  4QJF B;  5IYC O;  1GK9 A;  2AHY A;  3OR6 C;  4JTC B;  2B1G A;  4P30 A;  1F23 A;  3MHH C;  2EIJ C;  3TCU A;  1R73 A;  1Y4M A;  2YEV B;  3OMI B;  2XOK G;  1VQM V;  3CCJ V;  2DW4 A;  1OCZ B;  1QVG U;  2P90 A;  4MT8 A;  1JOY A;  3E89 A;  3AG3 C;  2GHY A;  5B3S C;  2IW5 A;  1V54 B;  2DQ3 A;  1YSC A;  3RVZ A;  2KB1 A;  3K3W A;  2MK3 A;  3ETE A;  4H37 A;  1S76 D;  2H94 A;  1OCC B;  2WWW A;  3I56 V;  2Y69 C;  1NH2 D;  1P7B A;  2DYS C;  2YEV A;  3T1C A;  1JQ0 A;  3E2E A;  2C2A A;  2UXN A;  5CN0 A;  5EC2 C;  5B1B B;  2DYR B;  4KFM A;  2WLI A;  3EHB B;  4I9W A;  4WF9 V;  1E79 G;  1SES A;  3VOU A;  4PDM A;  3K03 A;  2OTL V;  1K5S A;  5B3S B;  2W6I G;  4BW5 A;  2ZDI C;  4MW8 A;  3OM3 B;  1NR1 A;  2QTO A;  2WLL A;  3T2M A;  1K7D A;  3OFN G;  2F43 G;  1ORQ C;  3RW0 A;  4U7O A;  4LCU C;  1AI5 A;  2EIK B;  2OCC C;  4UV9 A;  3SPC A;  4BIU A;  3SJQ C;  1VQL V;  4MTF A;  2HG5 C;  1Q82 W;  3MHS C;  1W2B U;  5KUK A;  1E1R G;  1M9N A;  2X6A A;  2Q67 A;  3K9A A;  5B1A C;  3WG7 B;  1LNQ A;  2EIM C;  1BHB A;  1YIJ V;  4KP4 A;  4E2L A;  4JYB A;  3T4D A;  1VQ5 V;  2WLH A;  4WFH A;  4TSF G;  1R6K A;  4QE9 A;  3OUF A;  4EKW A;  4PDL A;  5LHH A;  5L3D A;  3P30 A;  2ZDI A;  3AG4 C;  2WPD G;  4TWK A;  2WSS G;  1M57 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...