2RNBA

Solution structure of human cu(i)cox17
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
67
structure length
67
Chain Sequence
GSFTMPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural-dynamical characterization of human cox17
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
molecule keywords Cytochrome c oxidase copper chaperone
total genus 15
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2007-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05051 COX17 Cytochrome C oxidase copper chaperone (COX17)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1130 Mainly Alpha Orthogonal Bundle Helix Hairpins CytochromE C oxidase copper chaperone 2rnbA00
2LQTA 2LGQA 2RNBA 2HP8A 2RN9A 1HP8A 1U96A 1U97A 1Z2GA
chains in the Genus database with same CATH superfamily
1W0JG 4LNUB 1DK1A 3HKEB 4J9ZB 4TWKA 5LP6A 4DV3O 4TQDA 3CMAV 1ZL8B 1P7GA 5KX5A 3IGAC 4LH7A 3OM3B 2LGQA 4GUNA 4P9PA 3J80N 2DWEC 1K34A 2F95B 4LF8O 2BTQB 1EM1A 2IH3C 2LO1A 1FYJA 1S5LZ 2YIBA 4DV4B 1BMFG 3SYQA 4X66O 4TV9A 1R3JC 1FS0G 5EC2C 2XHBA 4OXSA 2KQXA 3ZS8C 1AJNA 3EFFK 2A7WA 3ZHUA 5C93A 4QJFB 1WP7A 2OCCC 2QKSA 4DR3B 3JATB 3UO2A 3AG2B 5KUKA 5JH7B 4BW9A 4JYAO 4RQEA 2OCCB 3TXSA 3ZMUA 4FLWA 3SJAC 4KHPO 4AI8A 2XAJA 4GX0A 1IXMA 4DR3O 5IJ0A 4I4TA 4N23A 1XMOO 3OMNB 1W2BU 4JI4O 3UT5A 1KUQA 2JJ1G 1ZTEA 2KG7B 2IJKA 4PA6A 1K8AW 1B3QA 3LUTB 2EIMB 3E35A 3JSNA 3EXAA 3LNNA 2W0XA 1GK9A 2WLKA 2CTPA 3K08A 2EILC 2K1EA 4W4KA 1K5SA 4R6ZA 1NU1H 4FIPC 4GKJO 2JIZG 4B3SB 5LXTB 3CS5A 1NKDA 4OX9B 5DECA 1KYOF 1SERA 5KMGA 3N2GB 2QWOB 5JQGB 5JWPA 5IDJA 1XL6A 4NKGB 4FZ0A 4X9QA 4UB6Z 1NT2B 1WLEA 4X64O 1XUQA 1M9NA 3RYHA 3R65A 2P4VA 3ASNC 5AG2A 3P30A 4JI1B 4DO2A 2BSKA 1SF9A 2BTOA 3ABMC 3K5OA 3K04A 3N2KA 2UUCO 3H9VA 3KCXA 4LNUA 3CMEV 3E89A 4JZ2A 3JAKB 4WFAV 1F51A 5JJNB 3W7XA 4IIJB 3J7AU 3W7TA 4JTCB 4DV7O 5FLXN 3A2FA 1M57C 3S3WA 1V9PA 3ZHQA 4JI7B 4K8ZA 1DLBA 4LF5B 3T1YB 3E22A 5LA6A 5IJ9A 5JVDB 4RUEA 4YHHO 4EEQA 3OEEG 4I0XB 4MT8A 2CGNA 2ZIMA 4DUZB 4KFMA 2EINC 4TV9B 5JJEB 1LUWA 3LDEA 2XT9A 1TUEB 1SS3A 3AK1A 2B5UA 4NTYA 2RQ6A 1HW7A 1IBLB 2E75B 3F7VC 4E2LA 1Q8IA 3CRMA 1AR4A 4QIWF 3VQVA 2PYLA 4ZI7A 1BL8A 2JK5C 3LDCA 3LSQA 2GTSA 3ZN0A 2N05A 1KC8W 3HKBA 3JAWB 4WF9V 4DRXB 4R7CA 2F4VO 3OGCC 4G2KA 2W6IG 1NH2D 1QNMA 4HNAA 2RMKB 2DYSC 4BWAA 5IE9A 1B6QA 1MZEA 2Z5UA 2EIKB 3L73H 1MSDA 1FXKC 2EJ7A 2ZDIC 3SJCC 1A32A 1F4MA 2DMXA 1KP2A 1YF2A 1VQ5V 1OHHG 2WLMA 1H2LA 5HFLA 4DK1A 2Y0IA 4FM1A 2QTOA 1N0JA 2LGWA 4MVSA 2LFRA 1N34B 5ITZA 2QE7G 4JAAA 4NTWA 4J7ZA 3ZMSA 4JI1O 1TGOA 4LF7O 1Z5WA 1YZBA 3ZRWA 3JATA 4HBNA 1JOYA 5LP6C 3RYHB 5IY5B 4PDMA 2DYSB 2Q7GA 2VQFB 2Y69B 1RPOA 1WB7A 1YJWV 1J5EB 3ML0A 1BT8A 4Z1VA 3JASB 3QF7A 1Y76B 3BFRA 3DC6A 3K0GA 2DYRC 4F6RB 1K9MW 1Q6UA 4MTFA 4FVMA 1FFXA 3HKCA 1L8DA 4WFEA 2ADPA 3ASOC 2BCCH 5KLVH 1AJPA 5KHHA 3HKDA 1BQZA 1OCRB 2QWPB 3E22B 5IJ9B 4YJ2A 1Y4MA 2JEUA 4D7SA 1I5XA 2F43G 3KZIZ 4ASUG 2UXXA 5B1AB 5CB4A 5IY5C 5LYJA 4OPHA 4J7KA 1NS1A 1AP6A 3Q4HA 1J5EO 3JARA 5GTIZ 1P49A 4OX9O 3E8GA 5D5QA 4WBNB 4HYOA 1SKVA 1XBLA 4I9QA 1NTMH 4YIOA 2BSKB 2DQ3A 3ZCCA 3HKBB 3JAWA 1MMMA 4K35A 2WAMA 2YXLA 1YITV 4PDRA 2NLJC 1K92A 3N2KB 1K5QA 4LF4O 1QLEC 1US6A 1EBOA 3F5TA 2YI9A 2EJRA 1WJZA 4LFBB 4EKWA 1YHQV 3AG1C 4X1KB 1P4RA 3E8HA 4UCTA 4X62O 2JRIA 3JALB 3RGBA 1N32O 1R1BA 4UCOA 5JVDA 1N8RW 4I0XA 2ZM6B 2PZSA 3VQWA 4TOIA 4EB6B 2AHZA 4JASA 3ZX6A 4RUFA 1AR5A 2EILB 3CRCA 1F7YA 2N04A 1NR7A 2PTMA 3WG7C 4RO2A 3TETA 1N0NA 5CN0A 1KQSU 4DR5O 3QO8A 2ATKC 1KBHA 1SA0A 4FLUA 1D5AA 4O2BB 1JPXA 5CMUA 3TK1A 4LR3A 4DYLA 1Q43A 2ZNJA 4UCUA 4DR7B 4PA4A 5D5PA 1R6TA 1XNRO 4O4HA 4FLYA 4FM0A 1PNLA 3CYOA 4FZ1A 2R9RB 3K3WA 4X88A 1WPBA 4KL1A 2C2AA 4ZOLB 1H2KA 2ZD9A 3HB3B 1THZA 2PUSA 2EIJB 2WLIB 3CCMV 4J7JA 4H44B 2Q7EA 2QSAA 5IYDO 4UB8Z 1Q6HA 3K5LA 3K9AA 2Q5ZA 3FFQA 1XMQB 3UO3A 1FJGO 2ZXWC 1HNZB 4H33A 4FK5C 4JI4B 4MTGA 1W0KG 4I55B 3ZN1A 2LW7A 4D7TA 2Q7HA 1W59A 3BA8A 3ZIAG 4QGPA 5KAFZ 2AZ0A 2PF4E 2NN4A 3BABA 1SQBH 3HKEA 3THOA 4JI0B 1GM7A 1EN5A 4UVBA 2F93B 4P2ZA 4NXNB 3U11A 1FFXB 1GN4A 4FFKA 4F4LA 1YSCA 4W4LA 1Q6IA 4X64B 1GH6A 1MA1A 3CC7V 3X2QC 2HLDG 3CC4V 4HAMA 1B06A 3FYIB 4B3TB 2WA4A 4EB6A 1NJIW 5KHKA 4JF3A 1HDJA 2YC0A 1VQOV 2MW2B 2QKCA 1YEWA 2Y4TA 4BIUA 4FLVA 4LBEC 4JAUA 4DV2B 1XOUA 5B1OA 1VQ4V 1M57B 4EFBA 3ETDA 4PI0A 1M93A 1T5EA 4X1IA 5B1BC 1GMGA 1JX9A 1SC5B 3RFRA 4BW5A 1XNRB 4NYKA 3M7MX 4WFBV 1O9HA 1PL4A 2RNBA 4DV4O 4GLXA 3E2EA 1GRJA 5EYPB 5L3CA 5B66Z 3ZHTA 1OCOB 1M4UA 1MZFA 1N33O 4J42A 5LMNO 4O4HB 1IBLO 3CC2V 3ZBHA 3MHSC 2QM7A 3BAAA 3BRCA 4BIOA 1H2NA 1S77D 3MHHC 4GX2A 1ENVA 2CDYA 1D5NA 2VQEO 4ZOLA 4AQYB 3H01A 2E5LO 2UXNA 1JQ0A 3BHPA 1AI5A 1VQPV 4MTXA 3FB5C 5KAIZ 3CXCU 4KUMA 2UUAO 1XNQO 5H6RA 1S0VA 4B3MO 2QWNB 3CCSV 2E5LB 4L8JA 2A0LA 4GKKO 4I55A 4QE7A 3OE7G 3K06A 5H6QA 5GTHZ 1H2SB 3P3NA 2H8PC 1I94B 1V55B 2YUAA 3WFVA 5B3SB 2ODMA 3TCUA 1VF6C 1ZAUA 4GCZA 4U3JA 4TT3G 1N34O 1Q86W 3SGIA 4XBFA 4AHCA 5CBFA 1V54C 3K57A 2ZKOA 3ZEDA 2WSSG 2QR4A 4UV9A 1KB9F 2IW5A 4ZBMA 3MD0A 5IT9N 5CA1A 4HNAB 2A06H 2YXYA 2FB5A 5BXZA 3OAAG 1V54B 1JJOA 3CSXA 3CRAA 4O4LB 3UQ8A 4LF9B 3K9SA 2MK3A 4N21A 1HNWB 4QNHB 3SDLA 4O2AA 1JJ2U 1M90W 1Z5VA 3QG5A 1SQPH 2Q9LA 4TUYA 1DGSA 2EIMC 3B8MA 4X1IB 2HFEC 5EIBD 2HHHO 2YIAA 3RVZA 1FFTB 3AG7A 2A79B 1FXVA 3ABLC 2DW4A 5L3BA 3RYFA 1MG1A 2PY5A 2IM9A 2DJVA 3A0HZ 3RW0A 2XOKG 5IYCO 4LH6A 4LFAB 4FJCC 1SQGA 2Q68A 1QU7A 4P9OA 4QE9A 4UCRA 4BR6A 5IYZB 2EULA 3ASNB 4YHHB 1YIJV 4X1YB 4CH3A 2M6YA 3MAQA 1WB8A 2ZCEA 1XI1A 2FTKA 4MSWC 1FAFA 4YJ3B 2EZOA 4LFAO 3T1YO 5LHGA 2FMLA 4J11A 2JS3A 3JD4A 5LHHA 5K1XA 2XAFA 1M56C 1R73A 3WU2Z 1J95A 4YJ2B 3K03A 4WFHA 4ZHQB 4X62B 1K4CC 1E1QG 1XILA 4I50A 1FXKA 3RT3C 4DV0O 1K3EA 1QVFU 2PI5A 3QO5A 3AG1B 4MVQA 5JCOA 2OIEA 1PV0A 4UVCA 1NTZH 2D3OW 3CEIA 3B8NA 4C7UA 3VQXA 1N33B 4B3RO 1YJ9V 1P7BA 4JI5B 4DV1B 3CPWU 3CCJV 4PA9A 2EZPA 3O65A 1Y6XA 2XUMA 4WCEV 3CX5F 2P4KA 4H37A 4F6RA 3W7SA 4U3JB 3FB8C 3W7WA 1JA8A 3SPJA 3J81N 3RYIB 4F6EA 1WN7A 4JTDB 3UT5B 5K1PA 1AVMA 2OCHA 5KX5B 2XTAA 1YCIA 2YXHA 4KHPB 2LW1A 3NXSA 3I5DA 3OFNG 4X1KA 2Q69A 2RDCA 3ETEA 4JV5B 1COWG 3E86A 4FMTA 2Y48A 3A0BZ 5EZYB 4DR2O 4UCVA 1AJQA 4MVMA 3C3TA 4DR6O 5JJJB 2X6AA 3U10A 1L0LH 3K0DA 1PNMA 4LCUC 3IJ4A 4DR7O 1WPXA 2CH7B 3Q4HB 4UUJC 4B08A 1KKDA 3JARB 4CH6A 4B3MB 3T1HB 3H1LH 2UU9O 3CE2A 4CBCA 5KMGB 1H8HG 3A0RA 1HNZO 1TVKB 5LGTA 2Q8VA 2GHYA 3ZMZA 2QM4A 1AI7A 4MVOA 3IC7A 5IYZA 3CHXA 3AG4C 3PJSK 3LDDA 4YXWG 3KKYA 1Y67A 4DV7B 2V7QG 1SQFA 5IJ0B 5LMUB 5F2VO 4JI6B 3ZMTA 1QR8A 1QHTA 2DYRB 2KG7A 5CBGA 1S3JA 1XEQA 1QQCA 1VQ8V 1RM1C 2X6BA 2H94A 2YIDA 1GM8A 2KKWA 3HPLC 3CCEV 1ZLZA 3CCQV 1E1RG 1F4NA 3D8CA 1VQ9V 1LNQA 4GZRB 3S3XA 2UUBB 5EK0A 4TQFA 3L71H 3UKMA 1H2MA 2VWKA 1FXKB 1YJNV 3AEIA 1DF5A 2E74B 3G4SV 2Y0PA 1ROPA 2DQ0A 3N2GA 1K73W 4GKJB 2ZQMA 5KA5A 5H5NA 1GN6A 1H8EG 2ZM6O 3CRRA 3KG2A 3I56V 3B4SA 1EN6A 4DV2O 2ZE8A 1EFRG 3CB2A 4LFBO 3H1KH 3ABUA 1URFA 3DXRB 1RP3B 1PKXA 1UJWB 2JGDB 1N4CA 3IAYA 1AILA 3JAKA 2Q0AA 1I5YA 3H1HH 5C8YB 5LOVA 1M5IA 3L9DA 2UUBO 1K4DC 1RPRA 3QO7A 5LGNA 2P90A 2XNDG 1I0HA 5JCOC 3G80A 3CXHF 4NB5A 4B3RB 3EHBB 3SPHA 1GN2A 2AHYA 1QBZA 4LP8A 1GN3A 1FXHA 2UUAB 1OCCC 2OTLV 3C3SA 3QTCA 3ZMVA 2BE3A 2EINB 5B1AC 2CTWA 4X8AA 2VQEB 1QCEA 1G8MA 1SETA 1XNQB 3L74H 4XDKA 3UM7A 3E8BA 1KKCA 4NTXA 2IJIA 2F66C 5EYPA 5KUMA 4LC1A 3K59A 1I7FA 2Y69C 1ZSPA 3B77A 1AP5A 1JFFA 2GTAA 4TV8B 1FPOA 2P6JA 3P3PA 3FAVB 4YY3B 4E4EA 1Y66A 3K58A 2UXBO 1GAXA 1RSOB 4JI3B 3D3QA 3STZC 2ZE5A 1PL0A 3ZRSA 3T1HO 3SYPA 3L70H 2GSMB 3SPIA 1WAZA 2ZIOA 5FNVB 2H3OA 3F7YC 4JZGA 4CS2A 4X20A 2ITCC 1AI4A 3JD0A 4JPRA 2D2CB 3ETGA 4KXRA 1VQ6V 5L3DA 1IBKO 4U7OA 1EN4A 2RN9A 4MVUA 3RYCA 3OMIB 4K3AA 4P30A 2YEVA 3OTFA 4CC5A 4I7ZB 1G6UA 2VWJA 3OTOB 1IBKB 1BSMA 3VQYA 2QM8A 3K5MA 1S5JA 3RN4A 2HHHB 3SJBC 1R3LC 5KA6A 3T4DA 4DV6B 3OW2U 5C8YA 5LOVB 2LFSA 2UXCB 2Q0OC 1Q82W 5CA0B 2AXTZ 1VEWA 3DSQA 3RBZA 4DV5B 1IXBA 1YTFD 5HFMA 2LJ2A 4PDLA 2LP7A 5GONB 1NVPB 3HKDB 3D36C 3IFXA 4DUYB 3FD9A 3BEHA 5CA3A 1VMGA 1WA8B 3QNEA 1GKFA 3N27A 5FPOA 1OJHA 4GT1A 3OEHG 4GX1A 4OGQB 2CAZC 4MW8A 1EZJA 1CP9A 4FLTA 5H2FZ 1K7DA 3MDSA 4QPKA 4DR1B 4DUZO 2X7RB 4WBNA 5JH7A 3B2EE 3APOA 1PP9H 1OV9A 1I08A 3QVNA 1AI6A 4JI3O 4TV8A 1AR1B 3JCZA 1PD3A 3ICXA 1BE3H 4JI2B 1JFFB 5J9PC 4O4JA 3AG3C 4RAIA 2V4DA 1XL4A 3APQA 3WB0A 4PHZA 2Z0AA 1SESA 3T1CA 1CPYA 2LQTA 4YJ3A 1HP8A 2FL4A 2XAQA 4G28B 4UFZA 4IGGA 2XASA 2P67A 4NXMO 5LXTA 2QEXV 1BHBA 2F1MA 4GX5A 1Z2GA 1NH2B 5DM6V 4DR1O 3GB7C 2WLJA 4I50B 1VF7A 4XDLA 1VQNV 3LSUA 1F23A 5FL7G 4YIPA 3CCUV 2AZ2A 3A8TA 3ABMB 1SA0B 1QVGU 4ZKIA 3BY6A 5KHJA 1XMOB 5DN6G 4JI0O 1VIBA 2UU9B 4DR6B 2UXCO 1BHAA 3ZRXA 4O4IA 3PN1A 2IJJA 1JVMA 4EFEA 1HNWO 4DR2B 4RWUA 1H38A 4PD4F 5B3SC 5BR8B 1HNXB 2YS8A 4IT5A 2DE0X 4B3SO 1D2DA 4DXWA 4IIJA 1K33A 5EBLC 5L3EA 3D3IA 4IHJA 2A3QA 1BZKA 2UXBB 4B7EA 2QKAA 5FNVA 1WA8A 2ITDC 4DW1A 2WLIA 1GO3F 2ARHA 3FB6C 1XHZA 2R72A 5LA6B 5BZBA 4LF6B 2CGOA 1KP3A 5EBMC 1VARA 2WLLA 3RYCB 1VQKV 2QGNA 4FFBA 4IYIA 4ZI7B 3SYCA 4JYCA 4OPAA 3K5NA 1Q81W 1IX9A 4LFCB 2ILMA 4WFFA 2F23A 3OMAB 4DV0B 4MTOA 3K79A 2YI8A 3SJQC 5KHIA 1OZ0A 2YDEA 3L72H 1SZXA 4O4JB 4JI7O 2G38A 2RJZA 4LFCO 1P84F 4DV1O 2X6CA 2YICA 5J2TA 2UUCB 3TGUH 4MW3A 2VS0A 4NR1A 5A2QN 3ETQA 4KP4A 1S76D 3AG3B 2HJDA 5TISZ 1ZX3A 1Y74A 4J10A 1N36B 4DR5B 4U7NA 1JMKC 1R6KA 1HR0B 4JI8B 4LF5O 2ZE7A 4PELA 5KHGA 3JD2A 3ZRWB 2P06A 3FKSG 2HR3A 5EBWC 1YDXA 1QLEB 1YXBA 3OT7A 1V55C 4LF4B 3M8AA 1TVKA 2BOCC 1IVSA 1SRYA 1SQVH 1PM9A 4O4IB 2ZR2A 3G71V 1Y76A 3DC5A 1R6NA 1U97A 1QLNA 2Q6AA 3T2MA 1IURA 2Q4PA 1R3KC 3HKCB 3SPCA 3D36A 1N32B 2IH1C 1ZL8A 4LF9O 5CA1B 2PGGA 4J41A 4IHJB 1SQXH 3SR2C 1MABG 5FPRA 3F5WC 1OCCB 2QA4V 2CE4A 2EIKC 1YTFB 4J80A 4CZZA 2NNUA 1QR9A 2GUZA 4BAYA 3OR7C 4AQYO 4GYCB 1NI8A 4TUYB 4JI6O 4IL6Z 3G67A 5CB4B 1KD1W 2O57A 4JTAB 4D6TH 1L0NH 4TSFG 1OCOC 1FD9A 3VBBA 1TAEA 3B09A 1VQMV 4UXNA 1CXZB 1VQ7V 2L6LA 1XMQO 4AILC 1Q5OA 2QTSA 1S5HC 5LBQA 4LWSB 1L1FA 4ZIBA 2X0LA 2CTQA 2N74A 2OT5A 5LP6B 4CS3A 2B9ZA 1JR9A 1MSWD 2AGAA 2JJ2G 3AG4B 4XDJA 3LSSA 1I94O 3AK2A 3FAVA 5DEDA 3DTUB 4PDVA 4PA3A 1UFIA 3ABKC 1RSOA 4PI2A 4FM2A 4Q20A 2PYJA 4DV3B 3IC9A 2EBOA 4DV6O 3CCLV 1LUVA 4WFGA 2ZNIA 3O9OA 4HZ3A 5E79Z 1BS3A 4X89A 4X65B 4B3TO 4FFBB 4LF6O 1YVWA 3HR0A 1BGYH 1Q3EA 2KB1A 2ZINA 4DV5O 3JSLA 2OIGA 3KCYA 3ZJZA 1TUBB 3BVOA 1KMIZ 2PI4A 2ZR3A 3AG2C 2ZT9B 5IYBO 4DUYO 5B5EZ 1IBMB 3OUFA 3CCVV 2AW9A 1AROP 3WB1A 3ZHSA 1PPJH 3X2QB 4JV5O 3FB7C 3OR6C 3G6EV 3UCSC 2EIJC 2JEXA 1KU9A 1ZUQA 3G6BA 3GWOA 1ORQC 2W0FC 4GKKB 4J9YB 3FYEB 2R9IA 1Y74B 2E3CA 4X65O 4JYAB 2F4VB 2DOSA 1Q7YW 4BIZA 3CWBH 2Z3YA 3E83A 2EX3A 1IZ3A 2UXDO 2GUZB 2BOBC 4NXMB 1NZ6A 4JI2O 1ZWIC 5LHIA 4UCSA 2QJ1A 3GWKC 3L75H 4R50A 4LF7B 3JYCA 3BA9A 5L3FA 4CS4A 1E79G 2V1DA 4LWSA 4R8CA 3ASOB 3RYIA 4H13B 3STLC 2GV9A 5CA0A 2XAHA 2CK3G 2B1GA 3TXQA 4JYYA 2QWQB 3DGEA 2WPDG 2NR5A 5EC1C 3SYAA 1BQ0A 3JAMN 2Q67A 1M1KW 3WB2A 1RFYA 3CD6V 1FJGB 4DW0A 5BR8O 5EZYA 5J2UA 3EVKA 3AK3A 2JDIG 3OGIB 1Q90D 1AB3A 3CRQA 4NVPA 3B40A 4FPPA 4A5UB 2IU0A 4PA7A 2Q73A 2WLHA 4K0KO 2YSUB 3OUSA 2IU3A 5ITZB 5IWAO 1XREA 3RWRD 2CH7A 1OCZB 1VF6A 4FLXA 1OCRC 2HKOA 3ZHVA 1IBMO 5BY1A 4JGSA 2W6JG 3TJTA 4CC6A 3U0ZA 1TA8A 5H9CA 4DRXA 1K97A 1UPGA 2HVKC 3C90A 1FKAO 2CUGA 4MVRA 5A9GA 2Y4UA 2L35A 4Q6GA 2KSDA 4MVZA 2FKXA 3ABTA 1XHXA 3BPZA 2P22C 4RQFA 1R3IC 5LGUA 1X59A 2ZXWB 2HG5C 2ETNA 4JI5O 4FLZA 2OTJV 3BCCH 3SPGA 5BMVB 1MOFA 2WLNA 2R70A 3E8FA 4DR4O 2JS5A 1NVPD 1XDCA 1CEZA 2HVJC 4JI8O 4X66B 2E76B 2JVDA 2ZE6A 4H0LB 4CH4A 3ABLB 2RCVA 1TUBA 3JCUZ 3NR7A 1PNKA 1O9GA 1NR1A 3CJHB 4DR4B 2GDSA 1EZVH 3JASA 2HEPA 2A9HA 2OYQA 1DF4A 1IDSA 2P5OA 4JYBA 1BCCH 3DXRA 4Z2WA 1X4TA 2VRZA 1N36O 3W7UA 2JGDA 1NQTA 1GTOA 4I4TB 1M56B 1SQQH 4PJ0Z 1HR0O 1WP8A 3GVMA 2HP8A 2XAGA 4O4LA 4UVAA 2BTQA 1VF5B 5LMNB 3I55V 2UXDB 1G4YB 4K0KB 5J2UB 2HJFC 5B1NA 4JAVA 4I5SA 5IWAB 2QDOA 2DN9A 5LMUO 5L3GA 2GBOA 2P7TC 3WG7B 4MS2A 3ABKB 5B1BB 3LNMB 4DK0A 1JCHA 3CP1A 5LYJB 1NTKH 4O2AB 4LF8B 2CTRA 2WLLB 3VOUA 1HNXO 1B04A 2VQFO 1HWYA 3ZRVA 2IJHA 1DTOA 1WNSA 1NBMG 1GM9A 3RYFB 4CH5A 1H2GA 4O2BA 1SZTA 1KECA 2R9AA 4UV8A 3T4ZA 4X1YA 2ADQB 4K8XA 3P32A 3RVYA 4B7KA 3OD4A 4QPJA 5EIBC 4I9WA 2JGUA 2K9PA 2WA3A 5J2TB 2DWDC 3OTOO 3FX7A 2M7WA 4NXNO 2YIBD 3ZHRA 5LL6Y 2IBZH 1YI2V 3JALA 2QWRB 2B1IA 5CBHA 3CCRV 5GONA 5GW7A 3SYOA 4G27B 1XQ8A 4X20B 4YY3O 4Z1MG 5BMVA 3JD3A 4ZHQA 2ZDIA 4U3FH 4IYHA 3M99B 2OWOA 1MNGA 1RM1B 4ABMA 1VQLV 3R66A 1S72V 5E1AC 5JQGA 2WWWA 4L87A 4PV1B 2YEVB 1U96A 3H1JH 1VP7A 4ICGA 1OCZC 3H1IH 1G1XB 1LR1A 2FYUH 3JD1A 3CJHA
chains in the Genus database with same CATH topology
2LQTA 2LGQA 2RNBA 2HP8A 2RN9A 1HP8A 1U96A 1U97A 1Z2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LQT A;  2LGQ A;  2RNB A;  2HP8 A;  2RN9 A;  1HP8 A;  1U96 A;  1U97 A;  1Z2G A; 
#chains in the Genus database with same CATH topology
 1W0J G;  4LNU B;  1DK1 A;  3HKE B;  4J9Z B;  4TWK A;  5LP6 A;  4DV3 O;  4TQD A;  3CMA V;  1ZL8 B;  1P7G A;  5KX5 A;  3IGA C;  4LH7 A;  3OM3 B;  2LGQ A;  4GUN A;  4P9P A;  3J80 N;  2DWE C;  1K34 A;  2F95 B;  4LF8 O;  2BTQ B;  1EM1 A;  2IH3 C;  2LO1 A;  1FYJ A;  1S5L Z;  2YIB A;  4DV4 B;  1BMF G;  3SYQ A;  4X66 O;  4TV9 A;  1R3J C;  1FS0 G;  5EC2 C;  2XHB A;  4OXS A;  2KQX A;  3ZS8 C;  1AJN A;  3EFF K;  2A7W A;  3ZHU A;  5C93 A;  4QJF B;  1WP7 A;  2OCC C;  2QKS A;  4DR3 B;  3JAT B;  3UO2 A;  3AG2 B;  5KUK A;  5JH7 B;  4BW9 A;  4JYA O;  4RQE A;  2OCC B;  3TXS A;  3ZMU A;  4FLW A;  3SJA C;  4KHP O;  4AI8 A;  2XAJ A;  4GX0 A;  1IXM A;  4DR3 O;  5IJ0 A;  4I4T A;  4N23 A;  1XMO O;  3OMN B;  1W2B U;  4JI4 O;  3UT5 A;  1KUQ A;  2JJ1 G;  1ZTE A;  2KG7 B;  2IJK A;  4PA6 A;  1K8A W;  1B3Q A;  3LUT B;  2EIM B;  3E35 A;  3JSN A;  3EXA A;  3LNN A;  2W0X A;  1GK9 A;  2WLK A;  2CTP A;  3K08 A;  2EIL C;  2K1E A;  4W4K A;  1K5S A;  4R6Z A;  1NU1 H;  4FIP C;  4GKJ O;  2JIZ G;  4B3S B;  5LXT B;  3CS5 A;  1NKD A;  4OX9 B;  5DEC A;  1KYO F;  1SER A;  5KMG A;  3N2G B;  2QWO B;  5JQG B;  5JWP A;  5IDJ A;  1XL6 A;  4NKG B;  4FZ0 A;  4X9Q A;  4UB6 Z;  1NT2 B;  1WLE A;  4X64 O;  1XUQ A;  1M9N A;  3RYH A;  3R65 A;  2P4V A;  3ASN C;  5AG2 A;  3P30 A;  4JI1 B;  4DO2 A;  2BSK A;  1SF9 A;  2BTO A;  3ABM C;  3K5O A;  3K04 A;  3N2K A;  2UUC O;  3H9V A;  3KCX A;  4LNU A;  3CME V;  3E89 A;  4JZ2 A;  3JAK B;  4WFA V;  1F51 A;  5JJN B;  3W7X A;  4IIJ B;  3J7A U;  3W7T A;  4JTC B;  4DV7 O;  5FLX N;  3A2F A;  1M57 C;  3S3W A;  1V9P A;  3ZHQ A;  4JI7 B;  4K8Z A;  1DLB A;  4LF5 B;  3T1Y B;  3E22 A;  5LA6 A;  5IJ9 A;  5JVD B;  4RUE A;  4YHH O;  4EEQ A;  3OEE G;  4I0X B;  4MT8 A;  2CGN A;  2ZIM A;  4DUZ B;  4KFM A;  2EIN C;  4TV9 B;  5JJE B;  1LUW A;  3LDE A;  2XT9 A;  1TUE B;  1SS3 A;  3AK1 A;  2B5U A;  4NTY A;  2RQ6 A;  1HW7 A;  1IBL B;  2E75 B;  3F7V C;  4E2L A;  1Q8I A;  3CRM A;  1AR4 A;  4QIW F;  3VQV A;  2PYL A;  4ZI7 A;  1BL8 A;  2JK5 C;  3LDC A;  3LSQ A;  2GTS A;  3ZN0 A;  2N05 A;  1KC8 W;  3HKB A;  3JAW B;  4WF9 V;  4DRX B;  4R7C A;  2F4V O;  3OGC C;  4G2K A;  2W6I G;  1NH2 D;  1QNM A;  4HNA A;  2RMK B;  2DYS C;  4BWA A;  5IE9 A;  1B6Q A;  1MZE A;  2Z5U A;  2EIK B;  3L73 H;  1MSD A;  1FXK C;  2EJ7 A;  2ZDI C;  3SJC C;  1A32 A;  1F4M A;  2DMX A;  1KP2 A;  1YF2 A;  1VQ5 V;  1OHH G;  2WLM A;  1H2L A;  5HFL A;  4DK1 A;  2Y0I A;  4FM1 A;  2QTO A;  1N0J A;  2LGW A;  4MVS A;  2LFR A;  1N34 B;  5ITZ A;  2QE7 G;  4JAA A;  4NTW A;  4J7Z A;  3ZMS A;  4JI1 O;  1TGO A;  4LF7 O;  1Z5W A;  1YZB A;  3ZRW A;  3JAT A;  4HBN A;  1JOY A;  5LP6 C;  3RYH B;  5IY5 B;  4PDM A;  2DYS B;  2Q7G A;  2VQF B;  2Y69 B;  1RPO A;  1WB7 A;  1YJW V;  1J5E B;  3ML0 A;  1BT8 A;  4Z1V A;  3JAS B;  3QF7 A;  1Y76 B;  3BFR A;  3DC6 A;  3K0G A;  2DYR C;  4F6R B;  1K9M W;  1Q6U A;  4MTF A;  4FVM A;  1FFX A;  3HKC A;  1L8D A;  4WFE A;  2ADP A;  3ASO C;  2BCC H;  5KLV H;  1AJP A;  5KHH A;  3HKD A;  1BQZ A;  1OCR B;  2QWP B;  3E22 B;  5IJ9 B;  4YJ2 A;  1Y4M A;  2JEU A;  4D7S A;  1I5X A;  2F43 G;  3KZI Z;  4ASU G;  2UXX A;  5B1A B;  5CB4 A;  5IY5 C;  5LYJ A;  4OPH A;  4J7K A;  1NS1 A;  1AP6 A;  3Q4H A;  1J5E O;  3JAR A;  5GTI Z;  1P49 A;  4OX9 O;  3E8G A;  5D5Q A;  4WBN B;  4HYO A;  1SKV A;  1XBL A;  4I9Q A;  1NTM H;  4YIO A;  2BSK B;  2DQ3 A;  3ZCC A;  3HKB B;  3JAW A;  1MMM A;  4K35 A;  2WAM A;  2YXL A;  1YIT V;  4PDR A;  2NLJ C;  1K92 A;  3N2K B;  1K5Q A;  4LF4 O;  1QLE C;  1US6 A;  1EBO A;  3F5T A;  2YI9 A;  2EJR A;  1WJZ A;  4LFB B;  4EKW A;  1YHQ V;  3AG1 C;  4X1K B;  1P4R A;  3E8H A;  4UCT A;  4X62 O;  2JRI A;  3JAL B;  3RGB A;  1N32 O;  1R1B A;  4UCO A;  5JVD A;  1N8R W;  4I0X A;  2ZM6 B;  2PZS A;  3VQW A;  4TOI A;  4EB6 B;  2AHZ A;  4JAS A;  3ZX6 A;  4RUF A;  1AR5 A;  2EIL B;  3CRC A;  1F7Y A;  2N04 A;  1NR7 A;  2PTM A;  3WG7 C;  4RO2 A;  3TET A;  1N0N A;  5CN0 A;  1KQS U;  4DR5 O;  3QO8 A;  2ATK C;  1KBH A;  1SA0 A;  4FLU A;  1D5A A;  4O2B B;  1JPX A;  5CMU A;  3TK1 A;  4LR3 A;  4DYL A;  1Q43 A;  2ZNJ A;  4UCU A;  4DR7 B;  4PA4 A;  5D5P A;  1R6T A;  1XNR O;  4O4H A;  4FLY A;  4FM0 A;  1PNL A;  3CYO A;  4FZ1 A;  2R9R B;  3K3W A;  4X88 A;  1WPB A;  4KL1 A;  2C2A A;  4ZOL B;  1H2K A;  2ZD9 A;  3HB3 B;  1THZ A;  2PUS A;  2EIJ B;  2WLI B;  3CCM V;  4J7J A;  4H44 B;  2Q7E A;  2QSA A;  5IYD O;  4UB8 Z;  1Q6H A;  3K5L A;  3K9A A;  2Q5Z A;  3FFQ A;  1XMQ B;  3UO3 A;  1FJG O;  2ZXW C;  1HNZ B;  4H33 A;  4FK5 C;  4JI4 B;  4MTG A;  1W0K G;  4I55 B;  3ZN1 A;  2LW7 A;  4D7T A;  2Q7H A;  1W59 A;  3BA8 A;  3ZIA G;  4QGP A;  5KAF Z;  2AZ0 A;  2PF4 E;  2NN4 A;  3BAB A;  1SQB H;  3HKE A;  3THO A;  4JI0 B;  1GM7 A;  1EN5 A;  4UVB A;  2F93 B;  4P2Z A;  4NXN B;  3U11 A;  1FFX B;  1GN4 A;  4FFK A;  4F4L A;  1YSC A;  4W4L A;  1Q6I A;  4X64 B;  1GH6 A;  1MA1 A;  3CC7 V;  3X2Q C;  2HLD G;  3CC4 V;  4HAM A;  1B06 A;  3FYI B;  4B3T B;  2WA4 A;  4EB6 A;  1NJI W;  5KHK A;  4JF3 A;  1HDJ A;  2YC0 A;  1VQO V;  2MW2 B;  2QKC A;  1YEW A;  2Y4T A;  4BIU A;  4FLV A;  4LBE C;  4JAU A;  4DV2 B;  1XOU A;  5B1O A;  1VQ4 V;  1M57 B;  4EFB A;  3ETD A;  4PI0 A;  1M93 A;  1T5E A;  4X1I A;  5B1B C;  1GMG A;  1JX9 A;  1SC5 B;  3RFR A;  4BW5 A;  1XNR B;  4NYK A;  3M7M X;  4WFB V;  1O9H A;  1PL4 A;  2RNB A;  4DV4 O;  4GLX A;  3E2E A;  1GRJ A;  5EYP B;  5L3C A;  5B66 Z;  3ZHT A;  1OCO B;  1M4U A;  1MZF A;  1N33 O;  4J42 A;  5LMN O;  4O4H B;  1IBL O;  3CC2 V;  3ZBH A;  3MHS C;  2QM7 A;  3BAA A;  3BRC A;  4BIO A;  1H2N A;  1S77 D;  3MHH C;  4GX2 A;  1ENV A;  2CDY A;  1D5N A;  2VQE O;  4ZOL A;  4AQY B;  3H01 A;  2E5L O;  2UXN A;  1JQ0 A;  3BHP A;  1AI5 A;  1VQP V;  4MTX A;  3FB5 C;  5KAI Z;  3CXC U;  4KUM A;  2UUA O;  1XNQ O;  5H6R A;  1S0V A;  4B3M O;  2QWN B;  3CCS V;  2E5L B;  4L8J A;  2A0L A;  4GKK O;  4I55 A;  4QE7 A;  3OE7 G;  3K06 A;  5H6Q A;  5GTH Z;  1H2S B;  3P3N A;  2H8P C;  1I94 B;  1V55 B;  2YUA A;  3WFV A;  5B3S B;  2ODM A;  3TCU A;  1VF6 C;  1ZAU A;  4GCZ A;  4U3J A;  4TT3 G;  1N34 O;  1Q86 W;  3SGI A;  4XBF A;  4AHC A;  5CBF A;  1V54 C;  3K57 A;  2ZKO A;  3ZED A;  2WSS G;  2QR4 A;  4UV9 A;  1KB9 F;  2IW5 A;  4ZBM A;  3MD0 A;  5IT9 N;  5CA1 A;  4HNA B;  2A06 H;  2YXY A;  2FB5 A;  5BXZ A;  3OAA G;  1V54 B;  1JJO A;  3CSX A;  3CRA A;  4O4L B;  3UQ8 A;  4LF9 B;  3K9S A;  2MK3 A;  4N21 A;  1HNW B;  4QNH B;  3SDL A;  4O2A A;  1JJ2 U;  1M90 W;  1Z5V A;  3QG5 A;  1SQP H;  2Q9L A;  4TUY A;  1DGS A;  2EIM C;  3B8M A;  4X1I B;  2HFE C;  5EIB D;  2HHH O;  2YIA A;  3RVZ A;  1FFT B;  3AG7 A;  2A79 B;  1FXV A;  3ABL C;  2DW4 A;  5L3B A;  3RYF A;  1MG1 A;  2PY5 A;  2IM9 A;  2DJV A;  3A0H Z;  3RW0 A;  2XOK G;  5IYC O;  4LH6 A;  4LFA B;  4FJC C;  1SQG A;  2Q68 A;  1QU7 A;  4P9O A;  4QE9 A;  4UCR A;  4BR6 A;  5IYZ B;  2EUL A;  3ASN B;  4YHH B;  1YIJ V;  4X1Y B;  4CH3 A;  2M6Y A;  3MAQ A;  1WB8 A;  2ZCE A;  1XI1 A;  2FTK A;  4MSW C;  1FAF A;  4YJ3 B;  2EZO A;  4LFA O;  3T1Y O;  5LHG A;  2FML A;  4J11 A;  2JS3 A;  3JD4 A;  5LHH A;  5K1X A;  2XAF A;  1M56 C;  1R73 A;  3WU2 Z;  1J95 A;  4YJ2 B;  3K03 A;  4WFH A;  4ZHQ B;  4X62 B;  1K4C C;  1E1Q G;  1XIL A;  4I50 A;  1FXK A;  3RT3 C;  4DV0 O;  1K3E A;  1QVF U;  2PI5 A;  3QO5 A;  3AG1 B;  4MVQ A;  5JCO A;  2OIE A;  1PV0 A;  4UVC A;  1NTZ H;  2D3O W;  3CEI A;  3B8N A;  4C7U A;  3VQX A;  1N33 B;  4B3R O;  1YJ9 V;  1P7B A;  4JI5 B;  4DV1 B;  3CPW U;  3CCJ V;  4PA9 A;  2EZP A;  3O65 A;  1Y6X A;  2XUM A;  4WCE V;  3CX5 F;  2P4K A;  4H37 A;  4F6R A;  3W7S A;  4U3J B;  3FB8 C;  3W7W A;  1JA8 A;  3SPJ A;  3J81 N;  3RYI B;  4F6E A;  1WN7 A;  4JTD B;  3UT5 B;  5K1P A;  1AVM A;  2OCH A;  5KX5 B;  2XTA A;  1YCI A;  2YXH A;  4KHP B;  2LW1 A;  3NXS A;  3I5D A;  3OFN G;  4X1K A;  2Q69 A;  2RDC A;  3ETE A;  4JV5 B;  1COW G;  3E86 A;  4FMT A;  2Y48 A;  3A0B Z;  5EZY B;  4DR2 O;  4UCV A;  1AJQ A;  4MVM A;  3C3T A;  4DR6 O;  5JJJ B;  2X6A A;  3U10 A;  1L0L H;  3K0D A;  1PNM A;  4LCU C;  3IJ4 A;  4DR7 O;  1WPX A;  2CH7 B;  3Q4H B;  4UUJ C;  4B08 A;  1KKD A;  3JAR B;  4CH6 A;  4B3M B;  3T1H B;  3H1L H;  2UU9 O;  3CE2 A;  4CBC A;  5KMG B;  1H8H G;  3A0R A;  1HNZ O;  1TVK B;  5LGT A;  2Q8V A;  2GHY A;  3ZMZ A;  2QM4 A;  1AI7 A;  4MVO A;  3IC7 A;  5IYZ A;  3CHX A;  3AG4 C;  3PJS K;  3LDD A;  4YXW G;  3KKY A;  1Y67 A;  4DV7 B;  2V7Q G;  1SQF A;  5IJ0 B;  5LMU B;  5F2V O;  4JI6 B;  3ZMT A;  1QR8 A;  1QHT A;  2DYR B;  2KG7 A;  5CBG A;  1S3J A;  1XEQ A;  1QQC A;  1VQ8 V;  1RM1 C;  2X6B A;  2H94 A;  2YID A;  1GM8 A;  2KKW A;  3HPL C;  3CCE V;  1ZLZ A;  3CCQ V;  1E1R G;  1F4N A;  3D8C A;  1VQ9 V;  1LNQ A;  4GZR B;  3S3X A;  2UUB B;  5EK0 A;  4TQF A;  3L71 H;  3UKM A;  1H2M A;  2VWK A;  1FXK B;  1YJN V;  3AEI A;  1DF5 A;  2E74 B;  3G4S V;  2Y0P A;  1ROP A;  2DQ0 A;  3N2G A;  1K73 W;  4GKJ B;  2ZQM A;  5KA5 A;  5H5N A;  1GN6 A;  1H8E G;  2ZM6 O;  3CRR A;  3KG2 A;  3I56 V;  3B4S A;  1EN6 A;  4DV2 O;  2ZE8 A;  1EFR G;  3CB2 A;  4LFB O;  3H1K H;  3ABU A;  1URF A;  3DXR B;  1RP3 B;  1PKX A;  1UJW B;  2JGD B;  1N4C A;  3IAY A;  1AIL A;  3JAK A;  2Q0A A;  1I5Y A;  3H1H H;  5C8Y B;  5LOV A;  1M5I A;  3L9D A;  2UUB O;  1K4D C;  1RPR A;  3QO7 A;  5LGN A;  2P90 A;  2XND G;  1I0H A;  5JCO C;  3G80 A;  3CXH F;  4NB5 A;  4B3R B;  3EHB B;  3SPH A;  1GN2 A;  2AHY A;  1QBZ A;  4LP8 A;  1GN3 A;  1FXH A;  2UUA B;  1OCC C;  2OTL V;  3C3S A;  3QTC A;  3ZMV A;  2BE3 A;  2EIN B;  5B1A C;  2CTW A;  4X8A A;  2VQE B;  1QCE A;  1G8M A;  1SET A;  1XNQ B;  3L74 H;  4XDK A;  3UM7 A;  3E8B A;  1KKC A;  4NTX A;  2IJI A;  2F66 C;  5EYP A;  5KUM A;  4LC1 A;  3K59 A;  1I7F A;  2Y69 C;  1ZSP A;  3B77 A;  1AP5 A;  1JFF A;  2GTA A;  4TV8 B;  1FPO A;  2P6J A;  3P3P A;  3FAV B;  4YY3 B;  4E4E A;  1Y66 A;  3K58 A;  2UXB O;  1GAX A;  1RSO B;  4JI3 B;  3D3Q A;  3STZ C;  2ZE5 A;  1PL0 A;  3ZRS A;  3T1H O;  3SYP A;  3L70 H;  2GSM B;  3SPI A;  1WAZ A;  2ZIO A;  5FNV B;  2H3O A;  3F7Y C;  4JZG A;  4CS2 A;  4X20 A;  2ITC C;  1AI4 A;  3JD0 A;  4JPR A;  2D2C B;  3ETG A;  4KXR A;  1VQ6 V;  5L3D A;  1IBK O;  4U7O A;  1EN4 A;  2RN9 A;  4MVU A;  3RYC A;  3OMI B;  4K3A A;  4P30 A;  2YEV A;  3OTF A;  4CC5 A;  4I7Z B;  1G6U A;  2VWJ A;  3OTO B;  1IBK B;  1BSM A;  3VQY A;  2QM8 A;  3K5M A;  1S5J A;  3RN4 A;  2HHH B;  3SJB C;  1R3L C;  5KA6 A;  3T4D A;  4DV6 B;  3OW2 U;  5C8Y A;  5LOV B;  2LFS A;  2UXC B;  2Q0O C;  1Q82 W;  5CA0 B;  2AXT Z;  1VEW A;  3DSQ A;  3RBZ A;  4DV5 B;  1IXB A;  1YTF D;  5HFM A;  2LJ2 A;  4PDL A;  2LP7 A;  5GON B;  1NVP B;  3HKD B;  3D36 C;  3IFX A;  4DUY B;  3FD9 A;  3BEH A;  5CA3 A;  1VMG A;  1WA8 B;  3QNE A;  1GKF A;  3N27 A;  5FPO A;  1OJH A;  4GT1 A;  3OEH G;  4GX1 A;  4OGQ B;  2CAZ C;  4MW8 A;  1EZJ A;  1CP9 A;  4FLT A;  5H2F Z;  1K7D A;  3MDS A;  4QPK A;  4DR1 B;  4DUZ O;  2X7R B;  4WBN A;  5JH7 A;  3B2E E;  3APO A;  1PP9 H;  1OV9 A;  1I08 A;  3QVN A;  1AI6 A;  4JI3 O;  4TV8 A;  1AR1 B;  3JCZ A;  1PD3 A;  3ICX A;  1BE3 H;  4JI2 B;  1JFF B;  5J9P C;  4O4J A;  3AG3 C;  4RAI A;  2V4D A;  1XL4 A;  3APQ A;  3WB0 A;  4PHZ A;  2Z0A A;  1SES A;  3T1C A;  1CPY A;  2LQT A;  4YJ3 A;  1HP8 A;  2FL4 A;  2XAQ A;  4G28 B;  4UFZ A;  4IGG A;  2XAS A;  2P67 A;  4NXM O;  5LXT A;  2QEX V;  1BHB A;  2F1M A;  4GX5 A;  1Z2G A;  1NH2 B;  5DM6 V;  4DR1 O;  3GB7 C;  2WLJ A;  4I50 B;  1VF7 A;  4XDL A;  1VQN V;  3LSU A;  1F23 A;  5FL7 G;  4YIP A;  3CCU V;  2AZ2 A;  3A8T A;  3ABM B;  1SA0 B;  1QVG U;  4ZKI A;  3BY6 A;  5KHJ A;  1XMO B;  5DN6 G;  4JI0 O;  1VIB A;  2UU9 B;  4DR6 B;  2UXC O;  1BHA A;  3ZRX A;  4O4I A;  3PN1 A;  2IJJ A;  1JVM A;  4EFE A;  1HNW O;  4DR2 B;  4RWU A;  1H38 A;  4PD4 F;  5B3S C;  5BR8 B;  1HNX B;  2YS8 A;  4IT5 A;  2DE0 X;  4B3S O;  1D2D A;  4DXW A;  4IIJ A;  1K33 A;  5EBL C;  5L3E A;  3D3I A;  4IHJ A;  2A3Q A;  1BZK A;  2UXB B;  4B7E A;  2QKA A;  5FNV A;  1WA8 A;  2ITD C;  4DW1 A;  2WLI A;  1GO3 F;  2ARH A;  3FB6 C;  1XHZ A;  2R72 A;  5LA6 B;  5BZB A;  4LF6 B;  2CGO A;  1KP3 A;  5EBM C;  1VAR A;  2WLL A;  3RYC B;  1VQK V;  2QGN A;  4FFB A;  4IYI A;  4ZI7 B;  3SYC A;  4JYC A;  4OPA A;  3K5N A;  1Q81 W;  1IX9 A;  4LFC B;  2ILM A;  4WFF A;  2F23 A;  3OMA B;  4DV0 B;  4MTO A;  3K79 A;  2YI8 A;  3SJQ C;  5KHI A;  1OZ0 A;  2YDE A;  3L72 H;  1SZX A;  4O4J B;  4JI7 O;  2G38 A;  2RJZ A;  4LFC O;  1P84 F;  4DV1 O;  2X6C A;  2YIC A;  5J2T A;  2UUC B;  3TGU H;  4MW3 A;  2VS0 A;  4NR1 A;  5A2Q N;  3ETQ A;  4KP4 A;  1S76 D;  3AG3 B;  2HJD A;  5TIS Z;  1ZX3 A;  1Y74 A;  4J10 A;  1N36 B;  4DR5 B;  4U7N A;  1JMK C;  1R6K A;  1HR0 B;  4JI8 B;  4LF5 O;  2ZE7 A;  4PEL A;  5KHG A;  3JD2 A;  3ZRW B;  2P06 A;  3FKS G;  2HR3 A;  5EBW C;  1YDX A;  1QLE B;  1YXB A;  3OT7 A;  1V55 C;  4LF4 B;  3M8A A;  1TVK A;  2BOC C;  1IVS A;  1SRY A;  1SQV H;  1PM9 A;  4O4I B;  2ZR2 A;  3G71 V;  1Y76 A;  3DC5 A;  1R6N A;  1U97 A;  1QLN A;  2Q6A A;  3T2M A;  1IUR A;  2Q4P A;  1R3K C;  3HKC B;  3SPC A;  3D36 A;  1N32 B;  2IH1 C;  1ZL8 A;  4LF9 O;  5CA1 B;  2PGG A;  4J41 A;  4IHJ B;  1SQX H;  3SR2 C;  1MAB G;  5FPR A;  3F5W C;  1OCC B;  2QA4 V;  2CE4 A;  2EIK C;  1YTF B;  4J80 A;  4CZZ A;  2NNU A;  1QR9 A;  2GUZ A;  4BAY A;  3OR7 C;  4AQY O;  4GYC B;  1NI8 A;  4TUY B;  4JI6 O;  4IL6 Z;  3G67 A;  5CB4 B;  1KD1 W;  2O57 A;  4JTA B;  4D6T H;  1L0N H;  4TSF G;  1OCO C;  1FD9 A;  3VBB A;  1TAE A;  3B09 A;  1VQM V;  4UXN A;  1CXZ B;  1VQ7 V;  2L6L A;  1XMQ O;  4AIL C;  1Q5O A;  2QTS A;  1S5H C;  5LBQ A;  4LWS B;  1L1F A;  4ZIB A;  2X0L A;  2CTQ A;  2N74 A;  2OT5 A;  5LP6 B;  4CS3 A;  2B9Z A;  1JR9 A;  1MSW D;  2AGA A;  2JJ2 G;  3AG4 B;  4XDJ A;  3LSS A;  1I94 O;  3AK2 A;  3FAV A;  5DED A;  3DTU B;  4PDV A;  4PA3 A;  1UFI A;  3ABK C;  1RSO A;  4PI2 A;  4FM2 A;  4Q20 A;  2PYJ A;  4DV3 B;  3IC9 A;  2EBO A;  4DV6 O;  3CCL V;  1LUV A;  4WFG A;  2ZNI A;  3O9O A;  4HZ3 A;  5E79 Z;  1BS3 A;  4X89 A;  4X65 B;  4B3T O;  4FFB B;  4LF6 O;  1YVW A;  3HR0 A;  1BGY H;  1Q3E A;  2KB1 A;  2ZIN A;  4DV5 O;  3JSL A;  2OIG A;  3KCY A;  3ZJZ A;  1TUB B;  3BVO A;  1KMI Z;  2PI4 A;  2ZR3 A;  3AG2 C;  2ZT9 B;  5IYB O;  4DUY O;  5B5E Z;  1IBM B;  3OUF A;  3CCV V;  2AW9 A;  1ARO P;  3WB1 A;  3ZHS A;  1PPJ H;  3X2Q B;  4JV5 O;  3FB7 C;  3OR6 C;  3G6E V;  3UCS C;  2EIJ C;  2JEX A;  1KU9 A;  1ZUQ A;  3G6B A;  3GWO A;  1ORQ C;  2W0F C;  4GKK B;  4J9Y B;  3FYE B;  2R9I A;  1Y74 B;  2E3C A;  4X65 O;  4JYA B;  2F4V B;  2DOS A;  1Q7Y W;  4BIZ A;  3CWB H;  2Z3Y A;  3E83 A;  2EX3 A;  1IZ3 A;  2UXD O;  2GUZ B;  2BOB C;  4NXM B;  1NZ6 A;  4JI2 O;  1ZWI C;  5LHI A;  4UCS A;  2QJ1 A;  3GWK C;  3L75 H;  4R50 A;  4LF7 B;  3JYC A;  3BA9 A;  5L3F A;  4CS4 A;  1E79 G;  2V1D A;  4LWS A;  4R8C A;  3ASO B;  3RYI A;  4H13 B;  3STL C;  2GV9 A;  5CA0 A;  2XAH A;  2CK3 G;  2B1G A;  3TXQ A;  4JYY A;  2QWQ B;  3DGE A;  2WPD G;  2NR5 A;  5EC1 C;  3SYA A;  1BQ0 A;  3JAM N;  2Q67 A;  1M1K W;  3WB2 A;  1RFY A;  3CD6 V;  1FJG B;  4DW0 A;  5BR8 O;  5EZY A;  5J2U A;  3EVK A;  3AK3 A;  2JDI G;  3OGI B;  1Q90 D;  1AB3 A;  3CRQ A;  4NVP A;  3B40 A;  4FPP A;  4A5U B;  2IU0 A;  4PA7 A;  2Q73 A;  2WLH A;  4K0K O;  2YSU B;  3OUS A;  2IU3 A;  5ITZ B;  5IWA O;  1XRE A;  3RWR D;  2CH7 A;  1OCZ B;  1VF6 A;  4FLX A;  1OCR C;  2HKO A;  3ZHV A;  1IBM O;  5BY1 A;  4JGS A;  2W6J G;  3TJT A;  4CC6 A;  3U0Z A;  1TA8 A;  5H9C A;  4DRX A;  1K97 A;  1UPG A;  2HVK C;  3C90 A;  1FKA O;  2CUG A;  4MVR A;  5A9G A;  2Y4U A;  2L35 A;  4Q6G A;  2KSD A;  4MVZ A;  2FKX A;  3ABT A;  1XHX A;  3BPZ A;  2P22 C;  4RQF A;  1R3I C;  5LGU A;  1X59 A;  2ZXW B;  2HG5 C;  2ETN A;  4JI5 O;  4FLZ A;  2OTJ V;  3BCC H;  3SPG A;  5BMV B;  1MOF A;  2WLN A;  2R70 A;  3E8F A;  4DR4 O;  2JS5 A;  1NVP D;  1XDC A;  1CEZ A;  2HVJ C;  4JI8 O;  4X66 B;  2E76 B;  2JVD A;  2ZE6 A;  4H0L B;  4CH4 A;  3ABL B;  2RCV A;  1TUB A;  3JCU Z;  3NR7 A;  1PNK A;  1O9G A;  1NR1 A;  3CJH B;  4DR4 B;  2GDS A;  1EZV H;  3JAS A;  2HEP A;  2A9H A;  2OYQ A;  1DF4 A;  1IDS A;  2P5O A;  4JYB A;  1BCC H;  3DXR A;  4Z2W A;  1X4T A;  2VRZ A;  1N36 O;  3W7U A;  2JGD A;  1NQT A;  1GTO A;  4I4T B;  1M56 B;  1SQQ H;  4PJ0 Z;  1HR0 O;  1WP8 A;  3GVM A;  2HP8 A;  2XAG A;  4O4L A;  4UVA A;  2BTQ A;  1VF5 B;  5LMN B;  3I55 V;  2UXD B;  1G4Y B;  4K0K B;  5J2U B;  2HJF C;  5B1N A;  4JAV A;  4I5S A;  5IWA B;  2QDO A;  2DN9 A;  5LMU O;  5L3G A;  2GBO A;  2P7T C;  3WG7 B;  4MS2 A;  3ABK B;  5B1B B;  3LNM B;  4DK0 A;  1JCH A;  3CP1 A;  5LYJ B;  1NTK H;  4O2A B;  4LF8 B;  2CTR A;  2WLL B;  3VOU A;  1HNX O;  1B04 A;  2VQF O;  1HWY A;  3ZRV A;  2IJH A;  1DTO A;  1WNS A;  1NBM G;  1GM9 A;  3RYF B;  4CH5 A;  1H2G A;  4O2B A;  1SZT A;  1KEC A;  2R9A A;  4UV8 A;  3T4Z A;  4X1Y A;  2ADQ B;  4K8X A;  3P32 A;  3RVY A;  4B7K A;  3OD4 A;  4QPJ A;  5EIB C;  4I9W A;  2JGU A;  2K9P A;  2WA3 A;  5J2T B;  2DWD C;  3OTO O;  3FX7 A;  2M7W A;  4NXN O;  2YIB D;  3ZHR A;  5LL6 Y;  2IBZ H;  1YI2 V;  3JAL A;  2QWR B;  2B1I A;  5CBH A;  3CCR V;  5GON A;  5GW7 A;  3SYO A;  4G27 B;  1XQ8 A;  4X20 B;  4YY3 O;  4Z1M G;  5BMV A;  3JD3 A;  4ZHQ A;  2ZDI A;  4U3F H;  4IYH A;  3M99 B;  2OWO A;  1MNG A;  1RM1 B;  4ABM A;  1VQL V;  3R66 A;  1S72 V;  5E1A C;  5JQG A;  2WWW A;  4L87 A;  4PV1 B;  2YEV B;  1U96 A;  3H1J H;  1VP7 A;  4ICG A;  1OCZ C;  3H1I H;  1G1X B;  1LR1 A;  2FYU H;  3JD1 A;  3CJH A; 
#chains in the Genus database with same CATH homology
 2LQT A;  2LGQ A;  2RNB A;  2HP8 A;  2RN9 A;  1HP8 A;  1U96 A;  1U97 A;  1Z2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...