2RNBA

Solution structure of human cu(i)cox17
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
67
structure length
67
Chain Sequence
GSFTMPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Cytochrome c oxidase copper chaperone
publication title A structural-dynamical characterization of human cox17
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2007-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05051 COX17 Cytochrome C oxidase copper chaperone (COX17)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1130 Mainly Alpha Orthogonal Bundle Helix Hairpins CytochromE C oxidase copper chaperone 2rnbA00
1U97A 1HP8A 1U96A 1Z2GA 2RN9A 2LQTA 2HP8A 2RNBA 2LGQA
chains in the Genus database with same CATH superfamily
1BCCH 1VQNV 3CS5A 2DOSA 3MDSA 1Q6HA 2CAZC 2UXNA 4TV8A 4UVBA 5LBQA 2ATKC 1U96A 1L8DA 1SQBH 5EBWC 4WBNA 2LGWA 1G6UA 3H01A 2PUSA 1RM1B 1S77D 5B1BC 3JARA 4FFBA 3ETQA 3T1YB 3APOA 2UXCO 4FVMA 4JI7O 2V4DA 5IWAO 4JYBA 1F23A 4BW9A 5KUKA 4YY3B 3AG3C 5KA5A 1DF5A 4X64O 1BL8A 3SJCC 2P4VA 2RN9A 3DXRB 1KYOF 1WP8A 2B1GA 4FK5C 2BTQB 4PDMA 3WB2A 1IBMO 2ADQB 2Y4UA 4AQYO 4EFEA 1Y76A 2QM4A 1QNMA 5CBGA 4D7TA 1TAEA 1VF7A 4B7KA 1M56C 1TUEB 3CRQA 3PJSK 5F2VO 4R7CA 3DXRA 2BTQA 5IDJA 4TSFG 1IBKO 4EKWA 1YITV 3C3TA 1BHAA 2FL4A 4B3TO 2WLKA 4PJ0Z 1KQSU 1LUVA 3RYHB 2Q0AA 3CEIA 5IYDO 1M5IA 4CH5A 4K0KB 3ML0A 1AI5A 5E1AC 4CH3A 2OT5A 4O2AA 3ABTA 2F4VO 1CEZA 3HKEB 4CBCA 3K08A 1EZVH 1FFXB 1OCCB 4B3MB 4OX9B 2KQXA 4LC1A 5HFMA 5KHJA 4PA4A 5IYCO 2HP8A 2CTQA 3OR7C 1SA0B 3QO8A 2FB5A 2OCHA 3B8MA 1PM9A 3H1JH 2NN4A 3A0RA 2XAFA 3OFNG 3SDLA 1VQ6V 1H2LA 2ITDC 4X1YB 4RUEA 2QGNA 1SQVH 3ZJZA 4B3SO 4LFBB 4TV9B 2XT9A 4PDRA 1ZUQA 2X6CA 4QPJA 2CTWA 2V1DA 3HKEA 2CDYA 4YJ2B 4FLZA 1FFXA 4B7EA 2YS8A 4UB8Z 3T4ZA 2LW1A 1SA0A 3MD0A 4NR1A 3RYFA 4DV2B 3ETDA 2MK3A 4H44B 2GDSA 3RVYA 3STZC 2F93B 5H6QA 2WWWA 4X1YA 3H1LH 5LA6A 5CMUA 5KHGA 2JJ1G 3F5TA 4TV9A 2D3OW 2Q68A 1D2DA 1DF4A 1QVGU 1HDJA 4UB6Z 3LDCA 1GAXA 2OCCC 5LMNO 2P90A 3E86A 3APQA 4KXRA 2ZIMA 3G67A 4PA7A 3BRCA 4OPHA 1M90W 4NXNB 2DJVA 3BABA 2ZM6B 4I7ZB 1IBLB 3A0HZ 2NR5A 2OTJV 2RQ6A 2ZDIA 5J9PC 1URFA 4O4LA 4O4HA 4YHHB 3MHSC 2AGAA 3JAWA 3CCLV 5JCOC 3ZHSA 2Y4TA 1BT8A 3SJBC 5D5PA 5LMNB 1GN2A 1TGOA 2QM8A 1IXMA 1P7GA 2CGOA 5EYPB 5J2TB 3T1YO 2UXBB 1NS1A 3JAKB 1QHTA 1PL4A 5L3EA 4YY3O 1V9PA 2YSUB 2CK3G 1AP6A 3CRAA 3E8HA 2QWQB 2HVKC 4LBEC 4W4KA 3U10A 3UQ8A 1IZ3A 4U7NA 1WNSA 2DWDC 3KG2A 5EYPA 4FZ0A 5J2TA 1CXZB 3HPLC 1V55B 2HJDA 1LR1A 5EBLC 2Q7EA 5LHGA 4HZ3A 2E5LB 1E1QG 2QWOB 3W7UA 1Q81W 4XDKA 4U7OA 5L3FA 1M1KW 2A79B 1QLEB 4L87A 2Q6AA 4Z1MG 4H13B 1JR9A 4WFGA 4UFZA 3HKBB 3OEHG 5EC1C 2ZXWC 3K57A 4LWSB 1QQCA 1SQGA 3ZRXA 1KB9F 3CXCU 4NTXA 5DECA 3CCQV 2QKCA 4PDVA 4K0KO 3OT7A 4PI2A 2QSAA 3AG4B 4J9YB 3RYIB 3CRCA 2EIMB 4DR1B 1S5JA 4NVPA 1AR1B 1U97A 3JASA 3AK3A 3ZEDA 4B3MO 4OX9O 1M9NA 2ETNA 3RVZA 4LWSA 4P30A 2QWRB 1YVWA 1MMMA 3STLC 3CP1A 2F1MA 2Y69B 2N05A 2XAHA 3K0DA 5LGNA 1WAZA 2GV9A 4NB5A 1EN6A 1NVPB 3RYIA 4LFBO 1YDXA 1AB3A 4DUZB 1XMQB 1YCIA 1T5EA 4RO2A 1BQZA 3SYOA 3RN4A 2IJHA 5LGUA 1KMIZ 1ROPA 5KA6A 1TVKA 4DV2O 3OMNB 4F6RA 3ZMZA 3CC4V 1ZTEA 1TA8A 2YXYA 1K7DA 4QNHB 4R50A 3ZIAG 5B1NA 2O57A 2LO1A 4HNAB 3CXHF 2JS5A 4LCUC 2GUZA 2V7QG 3M8AA 4O4JB 1SQXH 2JS3A 3AG2B 3ZMSA 3CCSV 4B08A 5JJJB 1XREA 2ADPA 1PNLA 2H94A 3RW0A 2RJZA 5IJ9A 1XHXA 4DRXB 4NXNO 4DV4B 2ZM6O 1IBLO 5CA3A 1VARA 4YHHO 4FLWA 1XMOB 1AROP 3IAYA 4JV5B 3ABMB 2XOKG 5LHHA 3E22B 3TGUH 4I0XB 2UXCB 2ITCC 3A8TA 2UXBO 4ZIBA 1F7YA 5K1XA 5GTHZ 1Q3EA 1FXKB 1SESA 4DRXA 3GWKC 3T1CA 3CMAV 1MABG 4JZGA 4OGQB 3SPHA 5KMGA 2Q7HA 4Q20A 5LL6Y 3RFRA 4FLTA 1MZEA 4RWUA 4MSWC 1GMGA 2JEXA 5KAIZ 3E22A 1ZAUA 2YEVA 5JH7B 3K9AA 4I0XA 2UUAB 1QR9A 4LF7B 4IGGA 4OPAA 4DR7B 1GN6A 4TWKA 3WB0A 2E5LO 1YJNV 1OV9A 5C8YA 1X4TA 3L70H 4F4LA 3L72H 3SR2C 2IJKA 1VQMV 4GLXA 4UCTA 1CPYA 1YTFD 2UU9B 5JH7A 3NXSA 2LP7A 5JCOA 3P32A 3OR6C 4ICGA 4JPRA 2P06A 3OGCC 4IHJA 3OTOB 1KECA 4MVSA 1NH2D 1SRYA 4O4IA 2YIAA 1Y74A 2BCCH 2JEUA 3ZX6A 1V54C 1ORQC 3PN1A 4DR1O 4FM1A 4PA6A 3OUFA 4DV0B 3BFRA 1F4NA 4RQEA 1VQKV 4JTCB 4U3JB 1JX9A 2KB1A 3OUSA 4PHZA 5CBHA 3JAMN 4DW0A 2UXDB 4LP8A 3SYQA 4DV1B 4YIOA 3DC5A 2L6LA 3S3XA 3Q4HA 4DUZO 3M7MX 3P3NA 4DYLA 4ZKIA 1XMQO 2YI9A 2HFEC 3EFFK 2PYLA 4D6TH 4U3JA 4H37A 1MZFA 2YXLA 4TV8B 5LOVB 3CCUV 2VQEB 1SC5B 1OCRC 1QBZA 2DYRC 5EBMC 4LF9B 1VF6C 5LMUB 4FFBB 2JIZG 2EJRA 3SPJA 4WF9V 2ZCEA 4I55B 4TOIA 1B06A 2ZD9A 4CC6A 4FLVA 3RGBA 2CTRA 3I56V 2EINC 1PD3A 2GHYA 5LOVA 3O65A 4DV4O 1GN4A 3G6EV 1QCEA 2LQTA 4BR6A 3B40A 3D3QA 2JK5C 2AHZA 2M7WA 4IIJB 3AK1A 1XMOO 1B6QA 2L35A 3K5OA 5GW7A 1XOUA 4JV5O 3LDDA 4NTYA 2ZE5A 2FTKA 3RBZA 1Y76B 1XUQA 1JJ2U 4PA9A 2Q8VA 4I55A 4E4EA 5A2QN 4NKGB 4U3FH 4G27B 4X20B 4JI6B 3FB6C 1B3QA 3ABKB 3ZN1A 1AJNA 1YJ9V 4H33A 1I94B 2Q7GA 3UT5B 4K8XA 4MTXA 2P22C 3A0BZ 4IIJA 3SYPA 3W7TA 1W0JG 4JI8B 1QR8A 2UUAO 4LF7O 3FB5C 4DR7O 1HNZB 4JI3B 3BVOA 4X20A 4K3AA 3LNMB 1S3JA 1GM8A 2QKAA 5CA1A 1NTKH 1G4YB 2A9HA 2AZ2A 4TT3G 3UT5A 2M6YA 4RQFA 3QVNA 1JQ0A 1AP5A 4O2AB 1R3KC 1K4CC 4WCEV 4WFBV 4GX1A 4DR5B 1KD1W 3SGIA 2EILB 2UU9O 5BZBA 3T1HB 2AHYA 2ARHA 1MOFA 1WPBA 2EIKC 4UCOA 3IFXA 3OTOO 3ZHUA 2OIEA 2Q73A 2LFSA 1DTOA 3B77A 4JF3A 2WLJA 4UCRA 4DV3B 3ZHTA 3WFVA 3QF7A 1SZXA 1DLBA 4JYCA 4DV0O 3E8FA 1PPJH 2QTOA 1IDSA 5L3CA 4NXMB 3RYFB 2OYQA 4LH6A 2X7RB 1OHHG 4I9WA 3ZHQA 2UXDO 4XBFA 4X65B 3ASNC 3ZCCA 5LA6B 1NI8A 3K04A 3RYCB 4MTFA 4DV1O 1FYJA 1Q6IA 2X6AA 3E8GA 1S72V 4L8JA 1PNMA 3ZN0A 4LF6B 3ABUA 2ZT9B 1UPGA 3GWOA 1M57C 2K1EA 4QGPA 1NBMG 4LF8O 1Y4MA 2IH1C 5KUMA 1KUQA 4JYYA 2VQEO 2HHHB 3GVMA 4O4LB 4O4HB 2QTSA 3JAWB 1SKVA 3RYCA 5KAFZ 1NJIW 1G1XB 1R1BA 1EN5A 1YHQV 4LF9O 4ZI7B 4IYHA 1WJZA 5LMUO 1YXBA 4D7SA 1BSMA 4MW3A 1Q6UA 1O9HA 1J5EB 3SJQC 2UXXA 3ZRWA 3X2QB 3ASOC 3SPGA 3K79A 2E74B 5IYZB 1OCOC 1VIBA 2EIJB 2C2AA 4JGSA 4JI1B 2IW5A 3JD3A 1Q82W 2Q0OC 4ZI7A 2W6JG 4BW5A 1NTMH 4J41A 3T4DA 1K34A 1OCRB 4HYOA 1OCZB 2DYRB 3LUTB 3ETGA 3JD1A 3BA8A 5B1AB 1I08A 4JI6O 2WA3A 5LXTB 1KBHA 3FX7A 4I5SA 1WPXA 2ZE7A 1I94O 1YI2V 5IYZA 1I5XA 1PNKA 4LFCB 3A2FA 1YJWV 3MHHC 4KUMA 1NR7A 5EZYB 1IVSA 1GM9A 4JI8O 5A9GA 3JSLA 2D2CB 2W6IG 2OWOA 2VRZA 1HNZO 1Q8IA 1VF6A 5B1BB 3HR0A 4JI3O 1HR0B 2JGDB 1K8AW 4LF5B 4OXSA 5LXTA 4ZOLA 1MNGA 2Y0IA 3JSNA 2QM7A 4BAYA 2BTOA 1JOYA 1NZ6A 2WSSG 1YEWA 4NTWA 4BIUA 2H3OA 3AG3B 4X62B 1EBOA 2XUMA 4WFFA 5EZYA 3JASB 3K03A 4DR5O 4FIPC 1GM7A 3T1HO 1XQ8A 3JCUZ 3CRRA 1N4CA 2PY5A 1R6NA 1NTZH 4A5UB 2QA4V 2JGDA 4FMTA 1RSOA 1R73A 2X6BA 4DR6B 4MVMA 1VQ5V 1Q43A 1SQPH 4DV3O 3DSQA 2A7WA 4X88A 1K92A 1M56B 4JYAO 4ZHQB 3G6BA 3TCUA 2CH7A 3CCMV 2EZPA 4QIWF 1BZKA 1KP3A 3OTFA 1CP9A 3DC6A 3CB2A 4TUYA 2HLDG 4Q6GA 2MW2B 3CD6V 4GT1A 2BOCC 2W0FC 4DW1A 2WLMA 4NXMO 3F7VC 1TVKB 3HKDA 2DYSC 4F6RB 4X8AA 5JQGB 4X1IA 2GTSA 4X1KB 1SERA 1JFFA 4X65O 5D5QA 2PI5A 1K3EA 1J95A 2EIKB 4KL1A 4FM0A 3C3SA 3IC9A 3W7XA 4N23A 4ZHQA 3IC7A 2GUZB 1M4UA 3IGAC 2Y0PA 4LF6O 5H9CA 2CE4A 4GKKB 1IXBA 1ZLZA 5HFLA 2LFRA 1NT2B 4CH6A 1JA8A 1N0JA 3CHXA 1QLNA 5IJ9B 4DR3B 4MS2A 5JQGA 4JASA 4X1KA 1ZX3A 1GO3F 2LW7A 2HHHO 2QKSA 3ABLC 3D36C 2KSDA 4X9QA 3LSSA 3O9OA 3IJ4A 3R66A 5FL7G 4FFKA 3EHBB 5EIBD 2Q9LA 1ENVA 3K5MA 1RM1C 1J5EO 1GRJA 1H8EG 1HP8A 4H0LB 2Q5ZA 1M57B 1KKCA 3TETA 4LF4B 3J80N 1XI1A 4QE9A 5IYBO 4DR2B 5KMGB 2IBZH 2E75B 2BE3A 4JI1O 3K0GA 4JI5B 2EULA 2YEVB 2QWPB 1KU9A 3N27A 3TK1A 4FLXA 4PDLA 5C8YB 2OCCB 1JCHA 4P9PA 4EEQA 4FZ1A 3LSUA 3UO2A 1K5QA 1G8MA 2F43G 3SPCA 3VBBA 4LFCO 4Z2WA 3CJHB 3QTCA 3VQXA 2HR3A 2ZE8A 3AG7A 4UCUA 1DK1A 3JD4A 1WLEA 4GUNA 3AK2A 2YIDA 2E76B 1YF2A 2YICA 2EZOA 4IHJB 1NH2B 1D5AA 1R6TA 1HR0O 1XNQB 4J7JA 3OW2U 3ETEA 4LF5O 2RDCA 4O4IB 2XAGA 1SZTA 4LH7A 5GONA 1Y74B 4NYKA 4BIZA 5BMVB 3K5LA 1AR5A 5DN6G 3UM7A 5B3SC 3CJHA 4X62O 3P3PA 2QDOA 1XEQA 1SF9A 5BR8B 2QEXV 4DV5B 3OEEG 1XDCA 3UO3A 3SPIA 2DWEC 1BMFG 3W7SA 5FLXN 2CUGA 3RWRD 1OCCC 3VOUA 2RMKB 1FXVA 5H6RA 4DR6O 4DK1A 5BMVA 3S3WA 3CPWU 4UV9A 3Q4HB 5DM6V 1PP9H 2A3QA 2EX3A 2FMLA 3L9DA 3CSXA 4QE7A 2HG5C 5LYJA 4AILC 2PF4E 3KKYA 2ZXWB 2QE7G 1AVMA 2BSKA 3F7YC 2DQ0A 3I55V 1SETA 4IT5A 3ZMTA 3WU2Z 4GKJB 5DEDA 1VQ9V 4YJ3A 1K73W 1WB8A 3UCSC 3AG1C 1N8RW 4GKKO 2XAQA 4K35A 3U11A 3WB1A 4I9QA 4LF8B 5KX5B 3J7AU 1BS3A 4P9OA 2IJJA 4DR3O 3ZHVA 2Y48A 4MVQA 4XDLA 1THZA 3CMEV 4UCVA 4FLYA 1TUBB 2G38A 4TQDA 3E35A 5FNVB 2WLIA 2ILMA 2HVJC 3QO5A 1M93A 3ZMUA 3FB7C 2F66C 5B1OA 2N04A 3K58A 2WA4A 4KP4A 5KLVH 4I4TA 4RUFA 5KX5A 3SJAC 4UCSA 4JTAB 5IJ0B 1N33B 2AZ0A 2LJ2A 3QNEA 1Q5OA 4LF4O 2YIBD 1TUBA 1K9MW 1YSCA 3P30A 3K5NA 4DR2O 3G80A 3WG7C 5L3GA 2XNDG 4JI5O 1WB7A 5FNVA 1XHZA 2YXHA 3KZIZ 3OMIB 3ABLB 3QG5A 3RT3C 1H2SB 1XBLA 3BHPA 5CBFA 1BQ0A 5CA1B 3GB7C 1YIJV 3N2KA 4J9ZB 1FPOA 5IJ0A 2FYUH 1V55C 1R6KA 1K4DC 4W4LA 2WLLB 4E2LA 4UUJC 1YZBA 1AJQA 1MSDA 3OAAG 4DK0A 3B2EE 1WN7A 1KKDA 1R3LC 3E8BA 2W0XA 1Z5WA 1HNWB 3U0ZA 1QLEC 3VQVA 3D36A 3BAAA 4J42A 3DGEA 4KHPB 2PTMA 3BA9A 2NNUA 4DUYB 2ZKOA 1VEWA 5AG2A 3NR7A 5LGTA 4I50B 1VQLV 4MW8A 1XNQO 3K06A 2YI8A 3K9SA 4J10A 1FJGB 2WLLA 4KFMA 1I7FA 1P84F 1K97A 3TJTA 1AI7A 5IY5C 3SYCA 2RNBA 4UVCA 1W59A 3AG4C 4J7KA 2DN9A 2IH3C 5BR8O 3FFQA 2EIMC 4DV5O 5BXZA 1MG1A 1R3JC 1KC8W 4JAUA 1FFTB 4I50A 1RPOA 4IL6Z 4G28B 5E79Z 3MAQA 5L3BA 1LUWA 3CYOA 1AJPA 2Y69C 5EIBC 5FPRA 3L75H 4JYAB 4EB6B 2YDEA 4LFAB 1I5YA 1K5SA 2AXTZ 2F23A 3KCYA 4ASUG 3R65A 5B3SB 5EC2C 3KCXA 1ZWIC 1N32B 3L71H 2PZSA 2ODMA 2VWJA 2DQ3A 2WPDG 2N74A 3HB3B 2VQFB 5GTIZ 3ZHRA 1OJHA 4GKJO 3JALB 2B9ZA 3E89A 4EB6A 1COWG 1V54B 5L3DA 1Q7YW 3RYHA 1FKAO 2WLHA 2GBOA 3K3WA 2A0LA 1K33A 4HAMA 4YXWG 2R72A 2QWNB 3JD0A 1P4RA 1VMGA 2UUCB 3ZRWB 3JD2A 1L0LH 3AG2C 4HBNA 1EN4A 2PI4A 1JVMA 1BHBA 1H2GA 2HKOA 2LGQA 1FAFA 1E79G 3JALA 1X59A 2XTAA 1VP7A 1B04A 2JDIG 4PELA 4WFHA 1D5NA 1LNQA 3BCCH 1NKDA 1I0HA 3ABMC 2Q67A 4PD4F 3VQYA 1GK9A 1P49A 1S5LZ 2P4KA 3AG1B 1N33O 2YC0A 1GTOA 2P6JA 4GX5A 4GZRB 3JCZA 1FXKC 4YJ2A 2P7TC 1PL0A 2CTPA 4DO2A 5H5NA 5LP6C 4C7UA 4JI4B 4JI0B 1Y66A 4CS2A 2X0LA 2VWKA 3H1HH 2VS0A 3ICXA 4CC5A 4PA3A 3K59A 5CN0A 1W0KG 1HNXB 4ZOLB 4FPPA 2ZINA 3ZS8C 1N0NA 5KHIA 2Z3YA 2EINB 1JPXA 2Q69A 3OE7G 3H1KH 1AI4A 2Q4PA 3OM3B 4BWAA 1FD9A 4DV7B 1HNWO 2K9PA 2QR4A 2ZR2A 4MVZA 4KHPO 2XASA 4DUYO 3WG7B 2EBOA 2R9AA 2R70A 4AI8A 4JAVA 1HWYA 1N36B 1H2NA 3D8CA 2A06H 1RSOB 3VQWA 4QJFB 3ZRSA 1W2BU 5JVDB 2XHBA 1FJGO 3CE2A 4MVOA 2JJ2G 1AI6A 1XNRB 4LR3A 3JYCA 2P5OA 5J2UB 2BOBC 2CH7B 4R8CA 3JATB 4ZBMA 3J81N 1O9GA 4TUYB 1UJWB 3JAKA 2EJ7A 4RAIA 3T2MA 4UXNA 1EM1A 1E1RG 4J11A 3HKDB 1Q90D 3LNNA 4X1IB 1JFFB 4X66B 5JVDA 1DGSA 1Y6XA 1N34B 1RFYA 1L1FA 3TXQA 1S0VA 5IE9A 5J2UA 2R9IA 3FB8C 4LFAO 3JATA 3C90A 2ZR3A 5K1PA 1NU1H 2RCVA 5IY5B 1ZL8B 1XL6A 1JJOA 4EFBA 4JI2B 1R3IC 1N32O 4FM2A 1P7BA 4R6ZA 3CRMA 3HKBA 3CWBH 2VQFO 1H2MA 1UFIA 2GTAA 1Z5VA 2R9RB 3B4SA 5BY1A 1SQQH 1ZL8A 2UUCO 3E83A 1ZSPA 5TISZ 3FAVB 4TQFA 1IURA 1EFRG 5H2FZ 5JJEB 1KP2A 1IX9A 2XAJA 1H2KA 4DR4B 4LNUB 5ITZB 1GKFA 1PKXA 3DTUB 4DV6B 3ASNB 3FD9A 4WFEA 2UUBB 2ZE6A 4P2ZA 4QPKA 3BPZA 3AEIA 4B3RB 2GSMB 4AHCA 2ZNJA 1AILA 4JZ2A 4MVUA 2CGNA 1OZ0A 5KHHA 3OMAB 4GX0A 1US6A 1NVPD 5CA0B 3FAVA 1QVFU 4GX2A 4JAAA 3ZRVA 5EK0A 3ABKC 4LNUA 5ITZA 1WP7A 4PI0A 1MA1A 1VQ7V 4J7ZA 4F6EA 3I5DA 1Q86W 1H8HG 1FXHA 3CCEV 4JI4O 4JI0O 3FYEB 1GN3A 3UKMA 3EVKA 3FYIB 1RPRA 4K8ZA 4HNAA 5CA0A 1HNXO 3ZMVA 5GONB 5KHKA 3D3IA 1WA8B 3QO7A 4XDJA 1VQPV 4UVAA 2IU3A 3ASOB 2NLJC 3CC2V 4O4JA 2JVDA 1YTFB 4JI7B 3CX5F 5IWAB 2DMXA 1OCOB 1MSWD 1VQ4V 3W7WA 4DV7O 3OGIB 3G71V 4CZZA 4X64B 4BIOA 1SS3A 3B8NA 5LP6B 2EILC 1BE3H 2KG7B 2JGUA 1N36O 1IBMB 3HKCB 3TXSA 1WA8A 2ZIOA 4AQYB 4GCZA 4J80A 1GH6A 4X89A 5B66Z 1XNRO 2IJIA 3BEHA 2QJ1A 4YIPA 4MVRA 1FXKA 2PGGA 1F4MA 1Y67A 4GYCB 2WLNA 5LYJB 5LP6A 3CCJV 1H38A 2KKWA 2KG7A 2YUAA 1FS0G 5JWPA 2BSKB 3HKCA 4X66O 3L73H 4MT8A 1IBKB 1NQTA 1N34O 2WAMA 1L0NH 4FJCC 4O2BB 2B5UA 2HJFC 3N2GB 4B3TB 1S5HC 2B1IA 4ABMA 4CS4A 4YJ3B 3G4SV 1PV0A 2F95B 4PV1B 2Z0AA 1S76D 1VQ8V 2DW4A 3FKSG 1XILA 5CB4B 1EZJA 2AW9A 1XL4A 3E2EA 4JI2O 1VF5B 2F4VB 1VQOV 1AR4A 2OTLV 3CC7V 2ZNIA 3BY6A 2Z5UA 3H9VA 4IYIA 4O2BA 4CS3A 3N2GA 2ZQMA 2ZDIC 2WLIB 4FLUA 5IT9N 4WFAV 2PYJA 5C93A 1A32A 5B5EZ 4UV8A 2IU0A 2P67A 4MTGA 5CB4A 4JTDB 3LDEA 1QU7A 4I4TB 4B3SB 4Z1VA 1JMKC 1RP3B 3THOA 3H1IH 4G2KA 2E3CA 3OD4A 3F5WC 3ZBHA 2IM9A 4CH4A 1HW7A 4MTOA 5JJNB 3SYAA 5LHIA 3CCVV 1F51A 2OIGA 3L74H 3X2QC 2DYSB 3CCRV 4DR4O 2DE0X 4DV6O 2JRIA 2UUBO 1NR1A 3EXAA 2EIJC 1BGYH 4B3RO 2H8PC 2HEPA 3M99B 1Z2GA 3N2KB 3B09A 4WBNB 2YIBA 1OCZC 3LSQA 1SQFA 5B1AC 2FKXA 3JARB 4N21A 4DXWA 5FPOA
chains in the Genus database with same CATH topology
1U97A 1HP8A 1U96A 1Z2GA 2RN9A 2LQTA 2HP8A 2RNBA 2LGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U97 A;  1HP8 A;  1U96 A;  1Z2G A;  2RN9 A;  2LQT A;  2HP8 A;  2RNB A;  2LGQ A; 
#chains in the Genus database with same CATH topology
 1BCC H;  1VQN V;  3CS5 A;  2DOS A;  3MDS A;  1Q6H A;  2CAZ C;  2UXN A;  4TV8 A;  4UVB A;  5LBQ A;  2ATK C;  1U96 A;  1L8D A;  1SQB H;  5EBW C;  4WBN A;  2LGW A;  1G6U A;  3H01 A;  2PUS A;  1RM1 B;  1S77 D;  5B1B C;  3JAR A;  4FFB A;  3ETQ A;  3T1Y B;  3APO A;  2UXC O;  4FVM A;  4JI7 O;  2V4D A;  5IWA O;  4JYB A;  1F23 A;  4BW9 A;  5KUK A;  4YY3 B;  3AG3 C;  5KA5 A;  1DF5 A;  4X64 O;  1BL8 A;  3SJC C;  2P4V A;  2RN9 A;  3DXR B;  1KYO F;  1WP8 A;  2B1G A;  4FK5 C;  2BTQ B;  4PDM A;  3WB2 A;  1IBM O;  2ADQ B;  2Y4U A;  4AQY O;  4EFE A;  1Y76 A;  2QM4 A;  1QNM A;  5CBG A;  4D7T A;  1TAE A;  1VF7 A;  4B7K A;  1M56 C;  1TUE B;  3CRQ A;  3PJS K;  5F2V O;  4R7C A;  3DXR A;  2BTQ A;  5IDJ A;  4TSF G;  1IBK O;  4EKW A;  1YIT V;  3C3T A;  1BHA A;  2FL4 A;  4B3T O;  2WLK A;  4PJ0 Z;  1KQS U;  1LUV A;  3RYH B;  2Q0A A;  3CEI A;  5IYD O;  1M5I A;  4CH5 A;  4K0K B;  3ML0 A;  1AI5 A;  5E1A C;  4CH3 A;  2OT5 A;  4O2A A;  3ABT A;  2F4V O;  1CEZ A;  3HKE B;  4CBC A;  3K08 A;  1EZV H;  1FFX B;  1OCC B;  4B3M B;  4OX9 B;  2KQX A;  4LC1 A;  5HFM A;  5KHJ A;  4PA4 A;  5IYC O;  2HP8 A;  2CTQ A;  3OR7 C;  1SA0 B;  3QO8 A;  2FB5 A;  2OCH A;  3B8M A;  1PM9 A;  3H1J H;  2NN4 A;  3A0R A;  2XAF A;  3OFN G;  3SDL A;  1VQ6 V;  1H2L A;  2ITD C;  4X1Y B;  4RUE A;  2QGN A;  1SQV H;  3ZJZ A;  4B3S O;  4LFB B;  4TV9 B;  2XT9 A;  4PDR A;  1ZUQ A;  2X6C A;  4QPJ A;  2CTW A;  2V1D A;  3HKE A;  2CDY A;  4YJ2 B;  4FLZ A;  1FFX A;  4B7E A;  2YS8 A;  4UB8 Z;  3T4Z A;  2LW1 A;  1SA0 A;  3MD0 A;  4NR1 A;  3RYF A;  4DV2 B;  3ETD A;  2MK3 A;  4H44 B;  2GDS A;  3RVY A;  3STZ C;  2F93 B;  5H6Q A;  2WWW A;  4X1Y A;  3H1L H;  5LA6 A;  5CMU A;  5KHG A;  2JJ1 G;  3F5T A;  4TV9 A;  2D3O W;  2Q68 A;  1D2D A;  1DF4 A;  1QVG U;  1HDJ A;  4UB6 Z;  3LDC A;  1GAX A;  2OCC C;  5LMN O;  2P90 A;  3E86 A;  3APQ A;  4KXR A;  2ZIM A;  3G67 A;  4PA7 A;  3BRC A;  4OPH A;  1M90 W;  4NXN B;  2DJV A;  3BAB A;  2ZM6 B;  4I7Z B;  1IBL B;  3A0H Z;  2NR5 A;  2OTJ V;  2RQ6 A;  2ZDI A;  5J9P C;  1URF A;  4O4L A;  4O4H A;  4YHH B;  3MHS C;  2AGA A;  3JAW A;  3CCL V;  5JCO C;  3ZHS A;  2Y4T A;  1BT8 A;  3SJB C;  5D5P A;  5LMN B;  1GN2 A;  1TGO A;  2QM8 A;  1IXM A;  1P7G A;  2CGO A;  5EYP B;  5J2T B;  3T1Y O;  2UXB B;  1NS1 A;  3JAK B;  1QHT A;  1PL4 A;  5L3E A;  4YY3 O;  1V9P A;  2YSU B;  2CK3 G;  1AP6 A;  3CRA A;  3E8H A;  2QWQ B;  2HVK C;  4LBE C;  4W4K A;  3U10 A;  3UQ8 A;  1IZ3 A;  4U7N A;  1WNS A;  2DWD C;  3KG2 A;  5EYP A;  4FZ0 A;  5J2T A;  1CXZ B;  3HPL C;  1V55 B;  2HJD A;  1LR1 A;  5EBL C;  2Q7E A;  5LHG A;  4HZ3 A;  2E5L B;  1E1Q G;  2QWO B;  3W7U A;  1Q81 W;  4XDK A;  4U7O A;  5L3F A;  1M1K W;  2A79 B;  1QLE B;  4L87 A;  2Q6A A;  4Z1M G;  4H13 B;  1JR9 A;  4WFG A;  4UFZ A;  3HKB B;  3OEH G;  5EC1 C;  2ZXW C;  3K57 A;  4LWS B;  1QQC A;  1SQG A;  3ZRX A;  1KB9 F;  3CXC U;  4NTX A;  5DEC A;  3CCQ V;  2QKC A;  4PDV A;  4K0K O;  3OT7 A;  4PI2 A;  2QSA A;  3AG4 B;  4J9Y B;  3RYI B;  3CRC A;  2EIM B;  4DR1 B;  1S5J A;  4NVP A;  1AR1 B;  1U97 A;  3JAS A;  3AK3 A;  3ZED A;  4B3M O;  4OX9 O;  1M9N A;  2ETN A;  3RVZ A;  4LWS A;  4P30 A;  2QWR B;  1YVW A;  1MMM A;  3STL C;  3CP1 A;  2F1M A;  2Y69 B;  2N05 A;  2XAH A;  3K0D A;  5LGN A;  1WAZ A;  2GV9 A;  4NB5 A;  1EN6 A;  1NVP B;  3RYI A;  4LFB O;  1YDX A;  1AB3 A;  4DUZ B;  1XMQ B;  1YCI A;  1T5E A;  4RO2 A;  1BQZ A;  3SYO A;  3RN4 A;  2IJH A;  5LGU A;  1KMI Z;  1ROP A;  5KA6 A;  1TVK A;  4DV2 O;  3OMN B;  4F6R A;  3ZMZ A;  3CC4 V;  1ZTE A;  1TA8 A;  2YXY A;  1K7D A;  4QNH B;  4R50 A;  3ZIA G;  5B1N A;  2O57 A;  2LO1 A;  4HNA B;  3CXH F;  2JS5 A;  4LCU C;  2GUZ A;  2V7Q G;  3M8A A;  4O4J B;  1SQX H;  2JS3 A;  3AG2 B;  3ZMS A;  3CCS V;  4B08 A;  5JJJ B;  1XRE A;  2ADP A;  1PNL A;  2H94 A;  3RW0 A;  2RJZ A;  5IJ9 A;  1XHX A;  4DRX B;  4NXN O;  4DV4 B;  2ZM6 O;  1IBL O;  5CA3 A;  1VAR A;  4YHH O;  4FLW A;  1XMO B;  1ARO P;  3IAY A;  4JV5 B;  3ABM B;  2XOK G;  5LHH A;  3E22 B;  3TGU H;  4I0X B;  2UXC B;  2ITC C;  3A8T A;  2UXB O;  4ZIB A;  1F7Y A;  5K1X A;  5GTH Z;  1Q3E A;  1FXK B;  1SES A;  4DRX A;  3GWK C;  3T1C A;  3CMA V;  1MAB G;  4JZG A;  4OGQ B;  3SPH A;  5KMG A;  2Q7H A;  4Q20 A;  5LL6 Y;  3RFR A;  4FLT A;  1MZE A;  4RWU A;  4MSW C;  1GMG A;  2JEX A;  5KAI Z;  3E22 A;  1ZAU A;  2YEV A;  5JH7 B;  3K9A A;  4I0X A;  2UUA B;  1QR9 A;  4LF7 B;  4IGG A;  4OPA A;  4DR7 B;  1GN6 A;  4TWK A;  3WB0 A;  2E5L O;  1YJN V;  1OV9 A;  5C8Y A;  1X4T A;  3L70 H;  4F4L A;  3L72 H;  3SR2 C;  2IJK A;  1VQM V;  4GLX A;  4UCT A;  1CPY A;  1YTF D;  2UU9 B;  5JH7 A;  3NXS A;  2LP7 A;  5JCO A;  3P32 A;  3OR6 C;  4ICG A;  4JPR A;  2P06 A;  3OGC C;  4IHJ A;  3OTO B;  1KEC A;  4MVS A;  1NH2 D;  1SRY A;  4O4I A;  2YIA A;  1Y74 A;  2BCC H;  2JEU A;  3ZX6 A;  1V54 C;  1ORQ C;  3PN1 A;  4DR1 O;  4FM1 A;  4PA6 A;  3OUF A;  4DV0 B;  3BFR A;  1F4N A;  4RQE A;  1VQK V;  4JTC B;  4U3J B;  1JX9 A;  2KB1 A;  3OUS A;  4PHZ A;  5CBH A;  3JAM N;  4DW0 A;  2UXD B;  4LP8 A;  3SYQ A;  4DV1 B;  4YIO A;  3DC5 A;  2L6L A;  3S3X A;  3Q4H A;  4DUZ O;  3M7M X;  3P3N A;  4DYL A;  4ZKI A;  1XMQ O;  2YI9 A;  2HFE C;  3EFF K;  2PYL A;  4D6T H;  4U3J A;  4H37 A;  1MZF A;  2YXL A;  4TV8 B;  5LOV B;  3CCU V;  2VQE B;  1SC5 B;  1OCR C;  1QBZ A;  2DYR C;  5EBM C;  4LF9 B;  1VF6 C;  5LMU B;  4FFB B;  2JIZ G;  2EJR A;  3SPJ A;  4WF9 V;  2ZCE A;  4I55 B;  4TOI A;  1B06 A;  2ZD9 A;  4CC6 A;  4FLV A;  3RGB A;  2CTR A;  3I56 V;  2EIN C;  1PD3 A;  2GHY A;  5LOV A;  3O65 A;  4DV4 O;  1GN4 A;  3G6E V;  1QCE A;  2LQT A;  4BR6 A;  3B40 A;  3D3Q A;  2JK5 C;  2AHZ A;  2M7W A;  4IIJ B;  3AK1 A;  1XMO O;  1B6Q A;  2L35 A;  3K5O A;  5GW7 A;  1XOU A;  4JV5 O;  3LDD A;  4NTY A;  2ZE5 A;  2FTK A;  3RBZ A;  1Y76 B;  1XUQ A;  1JJ2 U;  4PA9 A;  2Q8V A;  4I55 A;  4E4E A;  5A2Q N;  4NKG B;  4U3F H;  4G27 B;  4X20 B;  4JI6 B;  3FB6 C;  1B3Q A;  3ABK B;  3ZN1 A;  1AJN A;  1YJ9 V;  4H33 A;  1I94 B;  2Q7G A;  3UT5 B;  4K8X A;  4MTX A;  2P22 C;  3A0B Z;  4IIJ A;  3SYP A;  3W7T A;  1W0J G;  4JI8 B;  1QR8 A;  2UUA O;  4LF7 O;  3FB5 C;  4DR7 O;  1HNZ B;  4JI3 B;  3BVO A;  4X20 A;  4K3A A;  3LNM B;  1S3J A;  1GM8 A;  2QKA A;  5CA1 A;  1NTK H;  1G4Y B;  2A9H A;  2AZ2 A;  4TT3 G;  3UT5 A;  2M6Y A;  4RQF A;  3QVN A;  1JQ0 A;  1AP5 A;  4O2A B;  1R3K C;  1K4C C;  4WCE V;  4WFB V;  4GX1 A;  4DR5 B;  1KD1 W;  3SGI A;  2EIL B;  2UU9 O;  5BZB A;  3T1H B;  2AHY A;  2ARH A;  1MOF A;  1WPB A;  2EIK C;  4UCO A;  3IFX A;  3OTO O;  3ZHU A;  2OIE A;  2Q73 A;  2LFS A;  1DTO A;  3B77 A;  4JF3 A;  2WLJ A;  4UCR A;  4DV3 B;  3ZHT A;  3WFV A;  3QF7 A;  1SZX A;  1DLB A;  4JYC A;  4DV0 O;  3E8F A;  1PPJ H;  2QTO A;  1IDS A;  5L3C A;  4NXM B;  3RYF B;  2OYQ A;  4LH6 A;  2X7R B;  1OHH G;  4I9W A;  3ZHQ A;  2UXD O;  4XBF A;  4X65 B;  3ASN C;  3ZCC A;  5LA6 B;  1NI8 A;  3K04 A;  3RYC B;  4MTF A;  4DV1 O;  1FYJ A;  1Q6I A;  2X6A A;  3E8G A;  1S72 V;  4L8J A;  1PNM A;  3ZN0 A;  4LF6 B;  3ABU A;  2ZT9 B;  1UPG A;  3GWO A;  1M57 C;  2K1E A;  4QGP A;  1NBM G;  4LF8 O;  1Y4M A;  2IH1 C;  5KUM A;  1KUQ A;  4JYY A;  2VQE O;  2HHH B;  3GVM A;  4O4L B;  4O4H B;  2QTS A;  3JAW B;  1SKV A;  3RYC A;  5KAF Z;  1NJI W;  1G1X B;  1R1B A;  1EN5 A;  1YHQ V;  4LF9 O;  4ZI7 B;  4IYH A;  1WJZ A;  5LMU O;  1YXB A;  4D7S A;  1BSM A;  4MW3 A;  1Q6U A;  1O9H A;  1J5E B;  3SJQ C;  2UXX A;  3ZRW A;  3X2Q B;  3ASO C;  3SPG A;  3K79 A;  2E74 B;  5IYZ B;  1OCO C;  1VIB A;  2EIJ B;  2C2A A;  4JGS A;  4JI1 B;  2IW5 A;  3JD3 A;  1Q82 W;  2Q0O C;  4ZI7 A;  2W6J G;  4BW5 A;  1NTM H;  4J41 A;  3T4D A;  1K34 A;  1OCR B;  4HYO A;  1OCZ B;  2DYR B;  3LUT B;  3ETG A;  3JD1 A;  3BA8 A;  5B1A B;  1I08 A;  4JI6 O;  2WA3 A;  5LXT B;  1KBH A;  3FX7 A;  4I5S A;  1WPX A;  2ZE7 A;  1I94 O;  1YI2 V;  5IYZ A;  1I5X A;  1PNK A;  4LFC B;  3A2F A;  1YJW V;  3MHH C;  4KUM A;  1NR7 A;  5EZY B;  1IVS A;  1GM9 A;  4JI8 O;  5A9G A;  3JSL A;  2D2C B;  2W6I G;  2OWO A;  2VRZ A;  1HNZ O;  1Q8I A;  1VF6 A;  5B1B B;  3HR0 A;  4JI3 O;  1HR0 B;  2JGD B;  1K8A W;  4LF5 B;  4OXS A;  5LXT A;  4ZOL A;  1MNG A;  2Y0I A;  3JSN A;  2QM7 A;  4BAY A;  2BTO A;  1JOY A;  1NZ6 A;  2WSS G;  1YEW A;  4NTW A;  4BIU A;  2H3O A;  3AG3 B;  4X62 B;  1EBO A;  2XUM A;  4WFF A;  5EZY A;  3JAS B;  3K03 A;  4DR5 O;  4FIP C;  1GM7 A;  3T1H O;  1XQ8 A;  3JCU Z;  3CRR A;  1N4C A;  2PY5 A;  1R6N A;  1NTZ H;  4A5U B;  2QA4 V;  2JGD A;  4FMT A;  1RSO A;  1R73 A;  2X6B A;  4DR6 B;  4MVM A;  1VQ5 V;  1Q43 A;  1SQP H;  4DV3 O;  3DSQ A;  2A7W A;  4X88 A;  1K92 A;  1M56 B;  4JYA O;  4ZHQ B;  3G6B A;  3TCU A;  2CH7 A;  3CCM V;  2EZP A;  4QIW F;  1BZK A;  1KP3 A;  3OTF A;  1CP9 A;  3DC6 A;  3CB2 A;  4TUY A;  2HLD G;  4Q6G A;  2MW2 B;  3CD6 V;  4GT1 A;  2BOC C;  2W0F C;  4DW1 A;  2WLM A;  4NXM O;  3F7V C;  1TVK B;  3HKD A;  2DYS C;  4F6R B;  4X8A A;  5JQG B;  4X1I A;  2GTS A;  4X1K B;  1SER A;  1JFF A;  4X65 O;  5D5Q A;  2PI5 A;  1K3E A;  1J95 A;  2EIK B;  4KL1 A;  4FM0 A;  3C3S A;  3IC9 A;  3W7X A;  4N23 A;  4ZHQ A;  3IC7 A;  2GUZ B;  1M4U A;  3IGA C;  2Y0P A;  4LF6 O;  5H9C A;  2CE4 A;  4GKK B;  1IXB A;  1ZLZ A;  5HFL A;  2LFR A;  1NT2 B;  4CH6 A;  1JA8 A;  1N0J A;  3CHX A;  1QLN A;  5IJ9 B;  4DR3 B;  4MS2 A;  5JQG A;  4JAS A;  4X1K A;  1ZX3 A;  1GO3 F;  2LW7 A;  2HHH O;  2QKS A;  3ABL C;  3D36 C;  2KSD A;  4X9Q A;  3LSS A;  3O9O A;  3IJ4 A;  3R66 A;  5FL7 G;  4FFK A;  3EHB B;  5EIB D;  2Q9L A;  1ENV A;  3K5M A;  1RM1 C;  1J5E O;  1GRJ A;  1H8E G;  1HP8 A;  4H0L B;  2Q5Z A;  1M57 B;  1KKC A;  3TET A;  4LF4 B;  3J80 N;  1XI1 A;  4QE9 A;  5IYB O;  4DR2 B;  5KMG B;  2IBZ H;  2E75 B;  2BE3 A;  4JI1 O;  3K0G A;  4JI5 B;  2EUL A;  2YEV B;  2QWP B;  1KU9 A;  3N27 A;  3TK1 A;  4FLX A;  4PDL A;  5C8Y B;  2OCC B;  1JCH A;  4P9P A;  4EEQ A;  4FZ1 A;  3LSU A;  3UO2 A;  1K5Q A;  1G8M A;  2F43 G;  3SPC A;  3VBB A;  4LFC O;  4Z2W A;  3CJH B;  3QTC A;  3VQX A;  2HR3 A;  2ZE8 A;  3AG7 A;  4UCU A;  1DK1 A;  3JD4 A;  1WLE A;  4GUN A;  3AK2 A;  2YID A;  2E76 B;  1YF2 A;  2YIC A;  2EZO A;  4IHJ B;  1NH2 B;  1D5A A;  1R6T A;  1HR0 O;  1XNQ B;  4J7J A;  3OW2 U;  3ETE A;  4LF5 O;  2RDC A;  4O4I B;  2XAG A;  1SZT A;  4LH7 A;  5GON A;  1Y74 B;  4NYK A;  4BIZ A;  5BMV B;  3K5L A;  1AR5 A;  5DN6 G;  3UM7 A;  5B3S C;  3CJH A;  4X62 O;  3P3P A;  2QDO A;  1XEQ A;  1SF9 A;  5BR8 B;  2QEX V;  4DV5 B;  3OEE G;  1XDC A;  3UO3 A;  3SPI A;  2DWE C;  1BMF G;  3W7S A;  5FLX N;  2CUG A;  3RWR D;  1OCC C;  3VOU A;  2RMK B;  1FXV A;  5H6R A;  4DR6 O;  4DK1 A;  5BMV A;  3S3W A;  3CPW U;  4UV9 A;  3Q4H B;  5DM6 V;  1PP9 H;  2A3Q A;  2EX3 A;  2FML A;  3L9D A;  3CSX A;  4QE7 A;  2HG5 C;  5LYJ A;  4AIL C;  2PF4 E;  3KKY A;  2ZXW B;  2QE7 G;  1AVM A;  2BSK A;  3F7Y C;  2DQ0 A;  3I55 V;  1SET A;  4IT5 A;  3ZMT A;  3WU2 Z;  4GKJ B;  5DED A;  1VQ9 V;  4YJ3 A;  1K73 W;  1WB8 A;  3UCS C;  3AG1 C;  1N8R W;  4GKK O;  2XAQ A;  4K35 A;  3U11 A;  3WB1 A;  4I9Q A;  4LF8 B;  5KX5 B;  3J7A U;  1BS3 A;  4P9O A;  2IJJ A;  4DR3 O;  3ZHV A;  2Y48 A;  4MVQ A;  4XDL A;  1THZ A;  3CME V;  4UCV A;  4FLY A;  1TUB B;  2G38 A;  4TQD A;  3E35 A;  5FNV B;  2WLI A;  2ILM A;  2HVJ C;  3QO5 A;  1M93 A;  3ZMU A;  3FB7 C;  2F66 C;  5B1O A;  2N04 A;  3K58 A;  2WA4 A;  4KP4 A;  5KLV H;  4I4T A;  4RUF A;  5KX5 A;  3SJA C;  4UCS A;  4JTA B;  5IJ0 B;  1N33 B;  2AZ0 A;  2LJ2 A;  3QNE A;  1Q5O A;  4LF4 O;  2YIB D;  1TUB A;  1K9M W;  1YSC A;  3P30 A;  3K5N A;  4DR2 O;  3G80 A;  3WG7 C;  5L3G A;  2XND G;  4JI5 O;  1WB7 A;  5FNV A;  1XHZ A;  2YXH A;  3KZI Z;  3OMI B;  3ABL B;  3QG5 A;  3RT3 C;  1H2S B;  1XBL A;  3BHP A;  5CBF A;  1BQ0 A;  5CA1 B;  3GB7 C;  1YIJ V;  3N2K A;  4J9Z B;  1FPO A;  5IJ0 A;  2FYU H;  1V55 C;  1R6K A;  1K4D C;  4W4L A;  2WLL B;  4E2L A;  4UUJ C;  1YZB A;  1AJQ A;  1MSD A;  3OAA G;  4DK0 A;  3B2E E;  1WN7 A;  1KKD A;  1R3L C;  3E8B A;  2W0X A;  1Z5W A;  1HNW B;  3U0Z A;  1QLE C;  3VQV A;  3D36 A;  3BAA A;  4J42 A;  3DGE A;  4KHP B;  2PTM A;  3BA9 A;  2NNU A;  4DUY B;  2ZKO A;  1VEW A;  5AG2 A;  3NR7 A;  5LGT A;  4I50 B;  1VQL V;  4MW8 A;  1XNQ O;  3K06 A;  2YI8 A;  3K9S A;  4J10 A;  1FJG B;  2WLL A;  4KFM A;  1I7F A;  1P84 F;  1K97 A;  3TJT A;  1AI7 A;  5IY5 C;  3SYC A;  2RNB A;  4UVC A;  1W59 A;  3AG4 C;  4J7K A;  2DN9 A;  2IH3 C;  5BR8 O;  3FFQ A;  2EIM C;  4DV5 O;  5BXZ A;  1MG1 A;  1R3J C;  1KC8 W;  4JAU A;  1FFT B;  4I50 A;  1RPO A;  4IL6 Z;  4G28 B;  5E79 Z;  3MAQ A;  5L3B A;  1LUW A;  3CYO A;  1AJP A;  2Y69 C;  5EIB C;  5FPR A;  3L75 H;  4JYA B;  4EB6 B;  2YDE A;  4LFA B;  1I5Y A;  1K5S A;  2AXT Z;  2F23 A;  3KCY A;  4ASU G;  3R65 A;  5B3S B;  5EC2 C;  3KCX A;  1ZWI C;  1N32 B;  3L71 H;  2PZS A;  2ODM A;  2VWJ A;  2DQ3 A;  2WPD G;  2N74 A;  3HB3 B;  2VQF B;  5GTI Z;  3ZHR A;  1OJH A;  4GKJ O;  3JAL B;  2B9Z A;  3E89 A;  4EB6 A;  1COW G;  1V54 B;  5L3D A;  1Q7Y W;  3RYH A;  1FKA O;  2WLH A;  2GBO A;  3K3W A;  2A0L A;  1K33 A;  4HAM A;  4YXW G;  2R72 A;  2QWN B;  3JD0 A;  1P4R A;  1VMG A;  2UUC B;  3ZRW B;  3JD2 A;  1L0L H;  3AG2 C;  4HBN A;  1EN4 A;  2PI4 A;  1JVM A;  1BHB A;  1H2G A;  2HKO A;  2LGQ A;  1FAF A;  1E79 G;  3JAL A;  1X59 A;  2XTA A;  1VP7 A;  1B04 A;  2JDI G;  4PEL A;  4WFH A;  1D5N A;  1LNQ A;  3BCC H;  1NKD A;  1I0H A;  3ABM C;  2Q67 A;  4PD4 F;  3VQY A;  1GK9 A;  1P49 A;  1S5L Z;  2P4K A;  3AG1 B;  1N33 O;  2YC0 A;  1GTO A;  2P6J A;  4GX5 A;  4GZR B;  3JCZ A;  1FXK C;  4YJ2 A;  2P7T C;  1PL0 A;  2CTP A;  4DO2 A;  5H5N A;  5LP6 C;  4C7U A;  4JI4 B;  4JI0 B;  1Y66 A;  4CS2 A;  2X0L A;  2VWK A;  3H1H H;  2VS0 A;  3ICX A;  4CC5 A;  4PA3 A;  3K59 A;  5CN0 A;  1W0K G;  1HNX B;  4ZOL B;  4FPP A;  2ZIN A;  3ZS8 C;  1N0N A;  5KHI A;  2Z3Y A;  2EIN B;  1JPX A;  2Q69 A;  3OE7 G;  3H1K H;  1AI4 A;  2Q4P A;  3OM3 B;  4BWA A;  1FD9 A;  4DV7 B;  1HNW O;  2K9P A;  2QR4 A;  2ZR2 A;  4MVZ A;  4KHP O;  2XAS A;  4DUY O;  3WG7 B;  2EBO A;  2R9A A;  2R70 A;  4AI8 A;  4JAV A;  1HWY A;  1N36 B;  1H2N A;  3D8C A;  2A06 H;  1RSO B;  3VQW A;  4QJF B;  3ZRS A;  1W2B U;  5JVD B;  2XHB A;  1FJG O;  3CE2 A;  4MVO A;  2JJ2 G;  1AI6 A;  1XNR B;  4LR3 A;  3JYC A;  2P5O A;  5J2U B;  2BOB C;  2CH7 B;  4R8C A;  3JAT B;  4ZBM A;  3J81 N;  1O9G A;  4TUY B;  1UJW B;  3JAK A;  2EJ7 A;  4RAI A;  3T2M A;  4UXN A;  1EM1 A;  1E1R G;  4J11 A;  3HKD B;  1Q90 D;  3LNN A;  4X1I B;  1JFF B;  4X66 B;  5JVD A;  1DGS A;  1Y6X A;  1N34 B;  1RFY A;  1L1F A;  3TXQ A;  1S0V A;  5IE9 A;  5J2U A;  2R9I A;  3FB8 C;  4LFA O;  3JAT A;  3C90 A;  2ZR3 A;  5K1P A;  1NU1 H;  2RCV A;  5IY5 B;  1ZL8 B;  1XL6 A;  1JJO A;  4EFB A;  4JI2 B;  1R3I C;  1N32 O;  4FM2 A;  1P7B A;  4R6Z A;  3CRM A;  3HKB A;  3CWB H;  2VQF O;  1H2M A;  1UFI A;  2GTA A;  1Z5V A;  2R9R B;  3B4S A;  5BY1 A;  1SQQ H;  1ZL8 A;  2UUC O;  3E83 A;  1ZSP A;  5TIS Z;  3FAV B;  4TQF A;  1IUR A;  1EFR G;  5H2F Z;  5JJE B;  1KP2 A;  1IX9 A;  2XAJ A;  1H2K A;  4DR4 B;  4LNU B;  5ITZ B;  1GKF A;  1PKX A;  3DTU B;  4DV6 B;  3ASN B;  3FD9 A;  4WFE A;  2UUB B;  2ZE6 A;  4P2Z A;  4QPK A;  3BPZ A;  3AEI A;  4B3R B;  2GSM B;  4AHC A;  2ZNJ A;  1AIL A;  4JZ2 A;  4MVU A;  2CGN A;  1OZ0 A;  5KHH A;  3OMA B;  4GX0 A;  1US6 A;  1NVP D;  5CA0 B;  3FAV A;  1QVF U;  4GX2 A;  4JAA A;  3ZRV A;  5EK0 A;  3ABK C;  4LNU A;  5ITZ A;  1WP7 A;  4PI0 A;  1MA1 A;  1VQ7 V;  4J7Z A;  4F6E A;  3I5D A;  1Q86 W;  1H8H G;  1FXH A;  3CCE V;  4JI4 O;  4JI0 O;  3FYE B;  1GN3 A;  3UKM A;  3EVK A;  3FYI B;  1RPR A;  4K8Z A;  4HNA A;  5CA0 A;  1HNX O;  3ZMV A;  5GON B;  5KHK A;  3D3I A;  1WA8 B;  3QO7 A;  4XDJ A;  1VQP V;  4UVA A;  2IU3 A;  3ASO B;  2NLJ C;  3CC2 V;  4O4J A;  2JVD A;  1YTF B;  4JI7 B;  3CX5 F;  5IWA B;  2DMX A;  1OCO B;  1MSW D;  1VQ4 V;  3W7W A;  4DV7 O;  3OGI B;  3G71 V;  4CZZ A;  4X64 B;  4BIO A;  1SS3 A;  3B8N A;  5LP6 B;  2EIL C;  1BE3 H;  2KG7 B;  2JGU A;  1N36 O;  1IBM B;  3HKC B;  3TXS A;  1WA8 A;  2ZIO A;  4AQY B;  4GCZ A;  4J80 A;  1GH6 A;  4X89 A;  5B66 Z;  1XNR O;  2IJI A;  3BEH A;  2QJ1 A;  4YIP A;  4MVR A;  1FXK A;  2PGG A;  1F4M A;  1Y67 A;  4GYC B;  2WLN A;  5LYJ B;  5LP6 A;  3CCJ V;  1H38 A;  2KKW A;  2KG7 A;  2YUA A;  1FS0 G;  5JWP A;  2BSK B;  3HKC A;  4X66 O;  3L73 H;  4MT8 A;  1IBK B;  1NQT A;  1N34 O;  2WAM A;  1L0N H;  4FJC C;  4O2B B;  2B5U A;  2HJF C;  3N2G B;  4B3T B;  1S5H C;  2B1I A;  4ABM A;  4CS4 A;  4YJ3 B;  3G4S V;  1PV0 A;  2F95 B;  4PV1 B;  2Z0A A;  1S76 D;  1VQ8 V;  2DW4 A;  3FKS G;  1XIL A;  5CB4 B;  1EZJ A;  2AW9 A;  1XL4 A;  3E2E A;  4JI2 O;  1VF5 B;  2F4V B;  1VQO V;  1AR4 A;  2OTL V;  3CC7 V;  2ZNI A;  3BY6 A;  2Z5U A;  3H9V A;  4IYI A;  4O2B A;  4CS3 A;  3N2G A;  2ZQM A;  2ZDI C;  2WLI B;  4FLU A;  5IT9 N;  4WFA V;  2PYJ A;  5C93 A;  1A32 A;  5B5E Z;  4UV8 A;  2IU0 A;  2P67 A;  4MTG A;  5CB4 A;  4JTD B;  3LDE A;  1QU7 A;  4I4T B;  4B3S B;  4Z1V A;  1JMK C;  1RP3 B;  3THO A;  3H1I H;  4G2K A;  2E3C A;  3OD4 A;  3F5W C;  3ZBH A;  2IM9 A;  4CH4 A;  1HW7 A;  4MTO A;  5JJN B;  3SYA A;  5LHI A;  3CCV V;  1F51 A;  2OIG A;  3L74 H;  3X2Q C;  2DYS B;  3CCR V;  4DR4 O;  2DE0 X;  4DV6 O;  2JRI A;  2UUB O;  1NR1 A;  3EXA A;  2EIJ C;  1BGY H;  4B3R O;  2H8P C;  2HEP A;  3M99 B;  1Z2G A;  3N2K B;  3B09 A;  4WBN B;  2YIB A;  1OCZ C;  3LSQ A;  1SQF A;  5B1A C;  2FKX A;  3JAR B;  4N21 A;  4DXW A;  5FPO A; 
#chains in the Genus database with same CATH homology
 1U97 A;  1HP8 A;  1U96 A;  1Z2G A;  2RN9 A;  2LQT A;  2HP8 A;  2RNB A;  2LGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...