1US6A

Crystal structure of the quorum-sensing protein tram from agrobacterium tumefaciens at 1.65 ang. resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
90
structure length
90
Chain Sequence
b'VELRPLIGLTRGLPPTDLETITIDAIRTHRRLVEKADELFQALPETYKTGQACGGPQHIRYIEASIEMHAQMSALNTLYSILGFIPKVVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REPRESSOR TRAM
publication title Crystal Structure of the Quorum-Sensing Protein Tram and its Interaction with the Transcriptional Regulator Trar
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Transcription repressor
total genus 34
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09228 Prok-TraM Prokaryotic Transcriptional repressor TraM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.160 Mainly Alpha Orthogonal Bundle Helix Hairpins HR1 repeat 1us6A00
1US6A 2HJDA 4NKGB 4DYLA 1RFYA 2Q0OC 4NB5A 4IGGA 1UPGA 2RMKB 1URFA 1CXZB
chains in the Genus database with same CATH superfamily
3ZHTA 3TK1A 3UT5B 4X64O 4DR4B 5LXTA 5IJ9A 4H37A 3J81N 1PNKA 2Z3YA 1PL0A 5DECA 1P49A 1SQXH 1H38A 1SKVA 1XNRB 4MTXA 5KMGB 3DSQA 1E1QG 3SPCA 4QE7A 2VQEB 1IBMB 4LF6B 1Y76B 2ITDC 4X88A 1NKDA 3WB1A 4Z2WA 1AR5A 2ZKOA 4P9OA 5CBFA 4FFKA 1SA0A 1X59A 4BR6A 1I94O 4BWAA 2Y4UA 4J42A 3RW0A 2EJRA 1EM1A 4L87A 5JVDA 3CXCU 4FMTA 4J11A 1WPBA 2QWNB 2E74B 2JGDB 5TISZ 4GT1A 3SYQA 1N34O 1WJZA 5LMNB 5KX5A 4L8JA 3PN1A 4JI1B 3JD3A 5LOVA 2G38A 2PI4A 3W7UA 2CGOA 1ZWIC 4TWKA 2ZE5A 4B7KA 2LGWA 4JPRA 4E2LA 3THOA 2DQ3A 4O2AB 4WF9V 3E2EA 2QDOA 2DYSC 2ETNA 2Q67A 3E8BA 4ZI7A 4LF4B 3SYPA 1OCCB 4DR2O 1VP7A 1DK1A 2ZE6A 4JAUA 3QO7A 2A9HA 1WB7A 2WLLA 1AP5A 3SJQC 5L3FA 3H9VA 2XHBA 5DEDA 2EJ7A 3I56V 2ZDIA 4JI4O 1FAFA 3G80A 3RFRA 1OZ0A 2Q8VA 1VQ8V 1TGOA 1NS1A 1FFXA 3K5NA 3BCCH 1Q82W 4CBCA 1Q43A 1NI8A 3RVYA 1SA0B 3CX5F 1HNZO 4B3RB 2PTMA 4GYCB 1NQTA 5KAFZ 4Z1VA 2FL4A 1IDSA 2PYJA 3VBBA 2CTRA 2R9IA 5JVDB 5K1PA 4IYIA 2XUMA 1E79G 2A3QA 1URFA 3E22A 3ZBHA 2HR3A 3HKEB 3HKCA 4NTXA 5D5PA 3O65A 1YCIA 4GKJB 3A2FA 1X4TA 3LSUA 3ZN0A 4MVMA 4GKKB 2ZE7A 3C3TA 1W2BU 1NVPD 4U3JB 1FKAO 2EIKB 3E8HA 4LC1A 5C93A 1IZ3A 3B8MA 1OCCC 3W7SA 4ZI7B 1V55B 1Z2GA 3CRQA 4I0XA 3APOA 3WG7B 1AROP 1IXBA 1QQCA 5EZYB 1XBLA 2LO1A 3CWBH 1YDXA 1W59A 2QJ1A 3OTOO 3JSLA 1ZUQA 1YI2V 1FFXB 4I5SA 4JZ2A 2Y0IA 3UQ8A 4PD4F 2VWJA 2Q7GA 3ZMTA 2ZR2A 1RFYA 4TV9B 4EEQA 5HFMA 2V4DA 1RSOB 2Z0AA 3KZIZ 1XMQO 2BSKA 1F4NA 2OIEA 4DV5O 5B1BC 5IE9A 1I5YA 4LH6A 4H13B 1CEZA 1YJNV 4PDLA 2ADQB 4DUYO 3CCEV 1B3QA 1D5AA 1G4YB 5GONA 2LFRA 3FB8C 3G71V 4JV5B 4CC5A 3GB7C 3B09A 5J2UA 1TAEA 3QO8A 1KMIZ 3N2KA 5IWAB 1QCEA 3ML0A 1V55C 2UXXA 2ODMA 5BZBA 3BPZA 4PI0A 5EBMC 2WAMA 2ZDIC 1Q90D 1NTZH 2WPDG 1Y66A 3R65A 1SETA 1BHBA 3M7MX 1W0JG 2DWEC 1HR0B 1H2GA 3AG1C 2UUCB 1P84F 1U96A 3ZHQA 5IYDO 4LH7A 1HW7A 1NJIW 3CXHF 4X64B 4UVAA 3KKYA 3ZHRA 5KA6A 2ZM6O 2UU9O 3DTUB 4MTFA 2HHHO 1YTFB 3ABTA 4JYYA 5FNVA 5CA1B 4J41A 4CS3A 5CBGA 4KHPO 5LHIA 3CCQV 4IIJB 4HAMA 2BSKB 3OMAB 3T1HO 1V54B 2OT5A 2ZCEA 5J9PC 1AJPA 4I4TA 4O4IA 1K92A 1MMMA 1AI7A 4CH3A 4MS2A 1GN4A 4O4LB 1ZTEA 3CPWU 4K8ZA 1T5EA 4PJ0Z 1GKFA 1CXZB 1I94B 1R3LC 4DR5O 5LA6A 4RQFA 2W6JG 1M56B 3RYFB 4X65O 3N2KB 1MZFA 1OJHA 2HP8A 1XI1A 1R3KC 2JS3A 3JASA 2BTQA 4RO2A 3K9AA 1GN2A 3T2MA 1N34B 2BE3A 5KA5A 1PL4A 4DK0A 4J9ZB 2HKOA 1JA8A 2R9AA 4NVPA 3LDCA 1AR4A 1B06A 1JJ2U 2KKWA 4UVBA 2CGNA 4JYBA 5FPRA 3JD2A 2F4VO 5FPOA 3ZS8C 1B6QA 4PDMA 4H33A 4DR2B 2ZNJA 4AHCA 5FNVB 5BR8O 1H8HG 1NTKH 1V54C 1AR1B 2D3OW 1DTOA 4DV0O 4CH5A 3JAKB 1SF9A 4JI4B 1XOUA 2FB5A 1D2DA 4I4TB 1LNQA 3ASNB 4I55B 2Z5UA 4ZKIA 3FKSG 2R70A 1QVGU 2QGNA 1UFIA 3LUTB 1HNZB 1GN6A 5ITZB 3SPGA 3AEIA 2ZNIA 3H1JH 2ZXWB 3TXSA 1JOYA 2A06H 1RPOA 2E5LO 4TQDA 3CD6V 2JJ1G 2F43G 2B1IA 3K5MA 4B3TO 1L8DA 3ABLB 2EBOA 3DXRA 3U10A 1SRYA 4U3FH 3UCSC 2QA4V 2BOCC 3CRCA 4LFCO 4BIZA 2Y69B 1KP2A 3RYCA 1TA8A 4O4HA 3SJCC 4F4LA 2GUZA 5H2FZ 3OMNB 3E8FA 2CK3G 3ZEDA 1XL4A 4K3AA 1PPJH 2LP7A 2KG7B 1NH2B 1Z5WA 2JJ2G 4HBNA 3AG4B 3STZC 3BAAA 3WU2Z 4ICGA 2P22C 2L35A 1NU1H 3JALA 4X66O 4PA6A 4JI0O 3G67A 4AQYO 5F2VO 4LNUA 3Q4HA 3TJTA 3K59A 2QKCA 2IW5A 4G27B 4KP4A 5IYCO 1OCZB 3ASNC 2CE4A 3OTOB 2H8PC 5CA0B 1G6UA 2UXNA 1EFRG 5BY1A 1Q8IA 1EN4A 3L75H 2E3CA 2MW2B 4JI5O 4N21A 2AHZA 2ZXWC 3H1KH 4DV3O 1BS3A 3I55V 4TUYB 2P06A 1YVWA 3ABLC 4DV5B 3I5DA 2OYQA 3J7AU 3DXRB 2H94A 2Y69C 3K3WA 1PNMA 3U11A 4LWSB 4DUYB 4G2KA 5LMUO 2PF4E 3LDDA 4DR7O 2QWQB 5KHGA 4A5UB 4LP8A 2FMLA 4W4KA 1DF4A 3AG4C 1F51A 3N2GA 3QF7A 3MHHC 1JX9A 2ZT9B 3JATA 4XDLA 4KL1A 1DLBA 2M7WA 1YXBA 4I50A 3K03A 1K33A 3T4ZA 1IURA 1S0VA 5B1NA 4LNUB 2HFEC 3CCRV 1OCZC 3QNEA 4YXWG 4LFBO 4PA4A 3FAVA 3RT3C 3ZMZA 1LR1A 2H3OA 4HYOA 1M9NA 4QPKA 1MA1A 2CH7B 2ZM6B 1U97A 5L3CA 2UU9B 1N33O 2HHHB 3EVKA 3ZHUA 3JYCA 5LBQA 5IYBO 2K9PA 4KHPB 3FB6C 3S3XA 3T1HB 1PD3A 3JCUZ 1MOFA 1VQ6V 1AI6A 2YS8A 2OTLV 1SQVH 1S5LZ 4FLVA 1UPGA 1Q3EA 1M5IA 3SPJA 2P67A 2WLHA 3W7XA 4MW8A 1K5SA 4FLWA 1IVSA 2IJJA 4FZ1A 2QTSA 3D3IA 4DR5B 4FFBA 1H8EG 1WA8A 4X65B 3SPIA 4YJ3A 2V7QG 2A79B 1BMFG 4NXNO 1JPXA 2KB1A 1K5QA 4MTGA 5JWPA 1KKDA 3JAMN 4JTDB 2QWPB 1KU9A 3IGAC 4LF9O 2EIMB 1AJQA 2BOBC 1PV0A 4F6EA 2W6IG 4JI2O 1IX9A 3BVOA 2F4VB 1N36O 2DYSB 1FXHA 4O4JA 3E83A 1NH2D 2E76B 3HPLC 5BR8B 3BA9A 4AI8A 4EB6A 2Q6AA 3CRRA 1G1XB 4DV0B 1IBLO 4B7EA 4RUEA 2D2CB 1WPXA 1Q6IA 2JVDA 4NXMO 1GO3F 4UVCA 4R8CA 3GWOA 5C8YB 1R3IC 4UUJC 1VF6C 2VS0A 1VMGA 1P7BA 1AP6A 5KLVH 4FFBB 4LF8B 1LUWA 1I7FA 5JJJB 5EK0A 3SJAC 2E5LB 4NTYA 4X1KB 3A0HZ 1F4MA 2C2AA 4B3TB 1AI5A 1GAXA 3ZRVA 4LFCB 2NN4A 2YIDA 2YC0A 3ZMVA 2EIMC 1HDJA 1VQPV 5IYZB 2WLIB 3OEEG 2UXBO 3C90A 3HKBA 5LXTB 5IJ9B 4UCRA 2VWKA 1N0JA 1FD9A 2WA3A 1DGSA 3F5TA 5H9CA 3N27A 3CC2V 1JFFA 5EIBD 1XQ8A 3OEHG 3ZRWA 4X66B 4BIOA 4JI0B 4AQYB 3OR7C 2JEUA 3F5WC 3SYOA 2JEXA 2YSUB 5D5QA 5BMVA 2GDSA 2CTPA 2IJKA 1BGYH 2NLJC 2NNUA 4FJCC 2YIBD 2EULA 4JI5B 2JS5A 2LW7A 5H5NA 1HNWO 4DV3B 1S3JA 5KAIZ 1L0NH 1VQKV 5LHHA 2XNDG 1QU7A 2RNBA 3BEHA 5B1BB 4D7TA 3OE7G 3IAYA 3D3QA 4LF7O 3IC9A 5CB4A 2ZD9A 3VQYA 5KX5B 5LMUB 5LOVB 4DR7B 2XASA 1B04A 1FPOA 3CE2A 3G6BA 1VIBA 4BIUA 1ZL8A 2F95B 3BY6A 2EZPA 2N05A 4P2ZA 1VQ9V 1SQBH 2JIZG 5GTHZ 2DJVA 1JJOA 1JFFB 2PUSA 4FPPA 4ZOLA 4JI6O 3S3WA 2WWWA 4QE9A 2WLLB 3CCMV 3ZRWB 3L9DA 2Q7HA 1FYJA 4P30A 1CPYA 4LFBB 3JD1A 1QVFU 1K4CC 4MW3A 2GHYA 4LFAO 2F93B 2IM9A 3AG1B 1FXKA 2B9ZA 4I7ZB 2PGGA 4PI2A 1XL6A 2F66C 4XBFA 2XAFA 2E75B 1N33B 5GW7A 5L3GA 1WNSA 1Y74A 1VEWA 2BTOA 3F7YC 4MVOA 2X6AA 3E22B 5CN0A 5EC2C 3P30A 3HKCB 1N0NA 3D8CA 5AG2A 3K06A 4DO2A 2K1EA 1F7YA 4PDVA 3SYAA 4N23A 4KXRA 2W0XA 3ZMSA 4DRXA 4B3MO 3ZHVA 2GTAA 1LUVA 1JMKC 5EBWC 2GTSA 1L0LH 2WLNA 5IY5C 3HKDA 3M8AA 2RQ6A 1SS3A 4FLXA 3FD9A 3A0RA 4ZOLB 3H1IH 1XNQO 3RWRD 4NXNB 4I0XB 2OCCB 2X0LA 1GH6A 3K5LA 4PHZA 3P32A 2IU3A 3TXQA 1HWYA 2QWOB 4IYHA 2LJ2A 1ENVA 1Q6UA 1YITV 4LF9B 1M90W 1GM8A 4Q6GA 4JI2B 3ABUA 3KCYA 1O9GA 1NZ6A 1N36B 2M6YA 2OCHA 3B77A 1TUBA 1Y74B 1AJNA 1PM9A 5JCOA 1IBLB 2YXHA 1RP3B 1HNXO 1YHQV 4NXMB 2P5OA 4DXWA 4PV1B 1IXMA 4DUZO 2F23A 3JAWA 1M57C 5GONB 2HG5C 2QKSA 2IH3C 3B2EE 4NKGB 4XDJA 5J2UB 2RN9A 1K34A 1W0KG 2FTKA 3HKDB 1FJGO 1WB8A 2OCCC 3A0BZ 1EZVH 2QR4A 4UB6Z 1V9PA 1XHXA 2LW1A 4RUFA 3APQA 4O2BA 3ETGA 3TETA 1XHZA 4DK1A 2CAZC 3VQXA 5DN6G 2UXBB 3UO3A 4PDRA 1G8MA 5EYPA 4F6RA 1WN7A 5B66Z 2ZIOA 2EILB 2FKXA 2Y4TA 2Q0OC 2HVKC 4JASA 3OTFA 3H1LH 4WFGA 3SYCA 2Q68A 3F7VC 4UV9A 1YF2A 3DC6A 3OGCC 4J7JA 4O4IB 3UKMA 3ABMC 5LGUA 1BQZA 3FX7A 1RM1C 2Y0PA 1MZEA 4UFZA 4MVZA 4TOIA 1PKXA 3K0GA 5KHHA 5LA6B 1VQOV 1GN3A 1KB9F 1HNWB 2IH1C 3O9OA 3K04A 1R1BA 1KC8W 1VF7A 3JCZA 3ZRSA 4U7OA 3JASB 4OX9O 2BTQB 5EC1C 3SDLA 4RQEA 4DW0A 4LF7B 5L3EA 3TGUH 1H2MA 1Q81W 4FK5C 4YIPA 4WFBV 4JAVA 1S77D 3EFFK 1AILA 2DOSA 3E35A 5IJ0A 4ABMA 3AG7A 2UXDO 3M99B 3BFRA 3CCUV 2EILC 4JI6B 5LP6A 3CJHA 1MSWD 5LGTA 3UM7A 4IHJA 4DYLA 5JCOC 4YY3O 4WFEA 3HB3B 4YHHO 3OD4A 1K97A 3ZHSA 5KUKA 4DV6O 1VQLV 4LFAB 4FIPC 1OCOC 2N04A 1DF5A 2LQTA 3NXSA 2QWRB 2JK5C 3NR7A 3SGIA 5A2QN 1XMQB 2IBZH 2Q4PA 1R6TA 3C3SA 1YTFD 1XREA 5FLXN 4TQFA 3P3NA 5DM6V 2VRZA 3CHXA 4GCZA 1US6A 4WFHA 1JVMA 4X8AA 3VQWA 3RYCB 4H44B 4O4HB 3CCSV 1EN5A 4DV7O 3CS5A 2GUZB 5LGNA 1P4RA 1QNMA 3MD0A 2BCCH 4B3MB 5IJ0B 1WAZA 1SQPH 5JH7A 1XILA 4CH4A 3JD4A 4ZHQA 4X89A 1XNQB 3JALB 5LP6B 4CS4A 2P4VA 1H2SB 3D36A 3ZX6A 1VF5B 3Q4HB 2Q5ZA 1WLEA 3T1YO 1R3JC 1KKCA 1Q6HA 4GX1A 2OIGA 3ASOC 4RWUA 2CUGA 4R6ZA 5JQGA 4HNAA 4NTWA 3PJSK 1BL8A 3G6EV 1VQ5V 4PA9A 3FYEB 3X2QC 1ORQC 5EBLC 2ARHA 3AK1A 3LNNA 1HNXB 1HP8A 5B5EZ 2YEVA 4DUZB 2RMKB 1J95A 1QHTA 5KMGA 1KBHA 1JCHA 4NYKA 2DN9A 3B8NA 1QLNA 2YUAA 2EINB 3N2GB 2GV9A 3RYHA 4UB8Z 3ZRXA 4XDKA 2X6BA 3JATB 1PP9H 3FFQA 1K9MW 1FJGB 5LP6C 4ZIBA 3H1HH 4JI3O 4I50B 3CB2A 3FYIB 4PA3A 3QVNA 4YJ2A 4B3SO 2PY5A 2QE7G 3FAVB 2OTJV 4UCTA 5CBHA 1QR8A 4FLZA 3L74H 1QLEB 2ILMA 5J2TA 4J9YB 4TT3G 4LF5O 1OCRC 2EIJC 4CC6A 3RBZA 4MVRA 4JYCA 2RDCA 3T4DA 4U7NA 4X20A 2QKAA 3OT7A 1QR9A 2PZSA 3OMIB 2KQXA 4O2AA 1ROPA 4JI8O 3W7WA 1S76D 3UO2A 2YEVB 3BHPA 3OR6C 3L72H 5K1XA 2PYLA 1XMOO 3QTCA 2AZ2A 2EINC 3GVMA 5B1AC 1WA8B 3G4SV 2HJFC 2Q9LA 1A32A 5CMUA 3RYHB 4YJ3B 5L3BA 3MHSC 2RJZA 4DV4O 2GBOA 1YSCA 2X6CA 4CZZA 3DGEA 4JI7O 4OX9B 4J7ZA 3D36C 1I5XA 3IFXA 3CRMA 4YJ2B 2HJDA 1S72V 1SQFA 4DV2O 4X62O 4DR1O 3KG2A 4UCSA 1ZAUA 1QLEC 3VOUA 1FFTB 1K4DC 4PELA 3HKEA 3CEIA 2UXDB 5J2TB 3CSXA 4K0KO 4O4JB 4JYAO 2UUAO 2Q0AA 2WSSG 4EB6B 4EFEA 4UV8A 2XOKG 3FB5C 4X20B 4YY3B 4U3JA 4YHHB 3EXAA 5GTIZ 3ETQA 4DV6B 3H01A 1XDCA 1YEWA 1SERA 4W4LA 1Z5VA 5EZYA 4X1YA 3L71H 4TV8A 5A9GA 3CCJV 1BSMA 1H2KA 3JSNA 4MVUA 4CH6A 1K7DA 3OFNG 1M4UA 4TV9A 1FS0G 1YJ9V 4UCVA 1RSOA 1FXVA 1N8RW 2ZQMA 2ADPA 4IL6Z 4DV7B 1NR1A 4MVSA 3J80N 5CA3A 3HKBB 1UJWB 2IU0A 3ZIAG 4OXSA 3CCVV 3QO5A 5IY5B 2A7WA 3ZJZA 4QNHB 4FLYA 1I0HA 1Q5OA 4TSFG 2QTOA 3TCUA 5L3DA 1EZJA 2XAGA 1S5JA 3L73H 2P4KA 3T1YB 3U0ZA 1N32O 5HFLA 4D7SA 1I08A 2XT9A 5BMVB 4MVQA 3QG5A 4MT8A 1J5EO 3OGIB 2OWOA 4LCUC 1Y67A 4OPAA 4X1YB 4ZBMA 3CMEV 1H2LA 4TV8B 2AZ0A 4IT5A 3E8GA 2XAHA 3W7TA 3E89A 4I9QA 2PI5A 1VQNV 2A0LA 2R72A 3WB0A 1BQ0A 5CB4B 5CA1A 2YI9A 3K79A 2ZINA 4IIJA 1M1KW 5JJEB 3BA8A 1M57B 3AK3A 1F23A 4RAIA 1ZL8B 4QPJA 3ZMUA 1MSDA 2JGUA 1Y6XA 1AB3A 1K8AW 2L6LA 2DYRB 4O4LA 4FM2A 5LYJA 3ICXA 4GX0A 4JI3B 2WLKA 4DR6O 2EIKC 4DW1A 3RYFA 4B3SB 5E1AC 4EFBA 3AG3B 2DWDC 2YICA 3JD0A 1YJWV 1FXKB 4R7CA 3WG7C 5LL6Y 1EBOA 1L1FA 4YIOA 4BW5A 1Y4MA 4LF5B 2UUBO 4WBNA 4UXNA 1NBMG 3E86A 3ZCCA 1VQ7V 5H6RA 2W0FC 4UCUA 1Q7YW 4MTOA 2WLJA 3CMAV 2CTQA 2Y48A 5KHIA 3SPHA 3R66A 1QBZA 1THZA 4J7KA 3A8TA 4JI8B 1BZKA 3K08A 1GMGA 5IT9N 4FLUA 3STLC 3ABMB 3JAKA 4KUMA 1XMOB 4DV1O 1RM1B 1PNLA 4DRXB 4JAAA 2CTWA 4DR3O 3FB7C 5E79Z 3RN4A 2UXCO 3WB2A 2DYRC 4JZGA 4I55A 2DQ0A 4MSWC 4C7UA 5B1OA 2YXLA 4DV4B 2CDYA 4P9PA 3ABKB 1COWG 5LYJB 2DMXA 4JI7B 3ETDA 1GRJA 5ITZA 3DC5A 3KCXA 3AG3C 4BW9A 2XTAA 5LHGA 4DV2B 4X62B 3LSSA 4DR1B 4AILC 4FLTA 1FXKC 3IJ4A 1K3EA 1JQ0A 4K0KB 1BCCH 3B40A 4WBNB 4JYAB 3K58A 2UUAB 2YI8A 1IBKO 1TUBB 2VQFO 3RVZA 4DR4O 1SESA 4NB5A 2KG7A 2HVJC 3LDEA 2B1GA 1GM9A 4CS2A 3T1CA 4GZRB 1XNRO 2IJHA 3JAWB 1WP8A 2DW4A 3RYIA 5BXZA 2JDIG 1OCOB 3CCLV 2AHYA 2VQEO 1IBMO 4LF6O 2GSMB 3OM3B 5CA0A 1H2NA 3B4SA 4R50A 1S5HC 3ABKC 1K73W 2JRIA 3SR2C 2QM8A 1OV9A 1ZLZA 4O2BB 2HEPA 1M56C 3LNMB 4H0LB 4LF8O 4QJFB 4TUYA 4K35A 1SQGA 4G28B 2N74A 2MK3A 4GX2A 3AK2A 1NT2B 1TUEB 5EYPB 4F6RB 3SJBC 5LMNO 1N4CA 4LWSA 4JI1O 2ZR3A 1EN6A 1GK9A 2ZIMA 4B08A 4D6TH 1AI4A 2X7RB 3AG2B 1R73A 3CRAA 3IC7A 3MDSA 4FZ0A 2B5UA 2DE0X 3P3PA 1KQSU 4E4EA 4FM1A 4LF4O 1N32B 4WFAV 5B3SB 1O9HA 2EZOA 3ASOB 5FL7G 2XAJA 3RYIB 1J5EB 3K9SA 1VQMV 3ETEA 2XAQA 2ZE8A 3CC7V 1BT8A 4EKWA 1ZSPA 5KUMA 3WFVA 1R6KA 3RGBA 2F1MA 2QEXV 3OUSA 4X1IA 3X2QB 2YIBA 4KFMA 1VARA 5H6QA 1OHHG 3VQVA 4JTCB 2YIAA 4B3RO 2CH7A 1TVKA 2YXYA 4PA7A 3GWKC 2Q73A 4QGPA 2HLDG 3ZN1A 2AXTZ 1E1RG 2YDEA 4Z1MG 1KECA 1GM7A 1MG1A 2ITCC 4GUNA 1GTOA 4WCEV 4QIWF 1P7GA 2KSDA 4LBEC 4GKJO 1MABG 3LSQA 4GKKO 3AG2C 3CJHB 1KUQA 1VF6A 2WA4A 4HZ3A 4IHJB 1NTMH 2FYUH 2ATKC 3JARA 1VQ4V 4DR6B 1BHAA 3OAAG 3K5OA 4GX5A 5B3SC 4X9QA 1R6NA 1JR9A 3K57A 3CP1A 3BRCA 1D5NA 2Q7EA 4J10A 4WFFA 2R9RB 3K0DA 2UUBB 1OCRB 1RPRA 2EIJB 1KYOF 3L70H 2NR5A 4JGSA 2EX3A 4IGGA 2Q69A 5IDJA 2P90A 4X1IB 3OUFA 4FVMA 3UT5A 4NR1A 1CP9A 4OPHA 3MAQA 5JJNB 4I9WA 2LFSA 1TVKB 1KP3A 1YIJV 4OGQB 5KHKA 2QM4A 2O57A 1M93A 1YZBA 2P6JA 1XUQA 4BAYA 1SZTA 3CYOA 1WP7A 3EHBB 4DV1B 4UCOA 2LGQA 4DR3B 1Y76A 4K8XA 4ASUG 2IJIA 2UXCB 5B1AB 5C8YA 1Q86W 1NVPB 1KD1W 5JH7B 2QM7A 4ZHQB 3HR0A 1BE3H 4JTAB 2QSAA 2V1DA 1NR7A 3OW2U 1SC5B 4JV5O 5EIBC 3JARB 1AVMA 1ZX3A 5IWAO 2WLMA 2AW9A 4Q20A 4GLXA 4FM0A 1SQQH 4X1KA 2JGDA 2RCVA 1MNGA 5KHJA 5JQGB 2P7TC 4HNAB 2AGAA 3CC4V 1SZXA 4JF3A 4J80A 1XEQA 4LR3A 1IBKB 3BABA 5IYZA 2UUCO 1HR0O 2WLIA 2VQFB
chains in the Genus database with same CATH topology
1US6A 2HJDA 4NKGB 4DYLA 1RFYA 2Q0OC 4NB5A 4IGGA 1UPGA 2RMKB 1URFA 1CXZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1US6 A;  2HJD A;  4NKG B;  4DYL A;  1RFY A;  2Q0O C;  4NB5 A;  4IGG A;  1UPG A;  2RMK B;  1URF A;  1CXZ B; 
#chains in the Genus database with same CATH topology
 3ZHT A;  3TK1 A;  3UT5 B;  4X64 O;  4DR4 B;  5LXT A;  5IJ9 A;  4H37 A;  3J81 N;  1PNK A;  2Z3Y A;  1PL0 A;  5DEC A;  1P49 A;  1SQX H;  1H38 A;  1SKV A;  1XNR B;  4MTX A;  5KMG B;  3DSQ A;  1E1Q G;  3SPC A;  4QE7 A;  2VQE B;  1IBM B;  4LF6 B;  1Y76 B;  2ITD C;  4X88 A;  1NKD A;  3WB1 A;  4Z2W A;  1AR5 A;  2ZKO A;  4P9O A;  5CBF A;  4FFK A;  1SA0 A;  1X59 A;  4BR6 A;  1I94 O;  4BWA A;  2Y4U A;  4J42 A;  3RW0 A;  2EJR A;  1EM1 A;  4L87 A;  5JVD A;  3CXC U;  4FMT A;  4J11 A;  1WPB A;  2QWN B;  2E74 B;  2JGD B;  5TIS Z;  4GT1 A;  3SYQ A;  1N34 O;  1WJZ A;  5LMN B;  5KX5 A;  4L8J A;  3PN1 A;  4JI1 B;  3JD3 A;  5LOV A;  2G38 A;  2PI4 A;  3W7U A;  2CGO A;  1ZWI C;  4TWK A;  2ZE5 A;  4B7K A;  2LGW A;  4JPR A;  4E2L A;  3THO A;  2DQ3 A;  4O2A B;  4WF9 V;  3E2E A;  2QDO A;  2DYS C;  2ETN A;  2Q67 A;  3E8B A;  4ZI7 A;  4LF4 B;  3SYP A;  1OCC B;  4DR2 O;  1VP7 A;  1DK1 A;  2ZE6 A;  4JAU A;  3QO7 A;  2A9H A;  1WB7 A;  2WLL A;  1AP5 A;  3SJQ C;  5L3F A;  3H9V A;  2XHB A;  5DED A;  2EJ7 A;  3I56 V;  2ZDI A;  4JI4 O;  1FAF A;  3G80 A;  3RFR A;  1OZ0 A;  2Q8V A;  1VQ8 V;  1TGO A;  1NS1 A;  1FFX A;  3K5N A;  3BCC H;  1Q82 W;  4CBC A;  1Q43 A;  1NI8 A;  3RVY A;  1SA0 B;  3CX5 F;  1HNZ O;  4B3R B;  2PTM A;  4GYC B;  1NQT A;  5KAF Z;  4Z1V A;  2FL4 A;  1IDS A;  2PYJ A;  3VBB A;  2CTR A;  2R9I A;  5JVD B;  5K1P A;  4IYI A;  2XUM A;  1E79 G;  2A3Q A;  1URF A;  3E22 A;  3ZBH A;  2HR3 A;  3HKE B;  3HKC A;  4NTX A;  5D5P A;  3O65 A;  1YCI A;  4GKJ B;  3A2F A;  1X4T A;  3LSU A;  3ZN0 A;  4MVM A;  4GKK B;  2ZE7 A;  3C3T A;  1W2B U;  1NVP D;  4U3J B;  1FKA O;  2EIK B;  3E8H A;  4LC1 A;  5C93 A;  1IZ3 A;  3B8M A;  1OCC C;  3W7S A;  4ZI7 B;  1V55 B;  1Z2G A;  3CRQ A;  4I0X A;  3APO A;  3WG7 B;  1ARO P;  1IXB A;  1QQC A;  5EZY B;  1XBL A;  2LO1 A;  3CWB H;  1YDX A;  1W59 A;  2QJ1 A;  3OTO O;  3JSL A;  1ZUQ A;  1YI2 V;  1FFX B;  4I5S A;  4JZ2 A;  2Y0I A;  3UQ8 A;  4PD4 F;  2VWJ A;  2Q7G A;  3ZMT A;  2ZR2 A;  1RFY A;  4TV9 B;  4EEQ A;  5HFM A;  2V4D A;  1RSO B;  2Z0A A;  3KZI Z;  1XMQ O;  2BSK A;  1F4N A;  2OIE A;  4DV5 O;  5B1B C;  5IE9 A;  1I5Y A;  4LH6 A;  4H13 B;  1CEZ A;  1YJN V;  4PDL A;  2ADQ B;  4DUY O;  3CCE V;  1B3Q A;  1D5A A;  1G4Y B;  5GON A;  2LFR A;  3FB8 C;  3G71 V;  4JV5 B;  4CC5 A;  3GB7 C;  3B09 A;  5J2U A;  1TAE A;  3QO8 A;  1KMI Z;  3N2K A;  5IWA B;  1QCE A;  3ML0 A;  1V55 C;  2UXX A;  2ODM A;  5BZB A;  3BPZ A;  4PI0 A;  5EBM C;  2WAM A;  2ZDI C;  1Q90 D;  1NTZ H;  2WPD G;  1Y66 A;  3R65 A;  1SET A;  1BHB A;  3M7M X;  1W0J G;  2DWE C;  1HR0 B;  1H2G A;  3AG1 C;  2UUC B;  1P84 F;  1U96 A;  3ZHQ A;  5IYD O;  4LH7 A;  1HW7 A;  1NJI W;  3CXH F;  4X64 B;  4UVA A;  3KKY A;  3ZHR A;  5KA6 A;  2ZM6 O;  2UU9 O;  3DTU B;  4MTF A;  2HHH O;  1YTF B;  3ABT A;  4JYY A;  5FNV A;  5CA1 B;  4J41 A;  4CS3 A;  5CBG A;  4KHP O;  5LHI A;  3CCQ V;  4IIJ B;  4HAM A;  2BSK B;  3OMA B;  3T1H O;  1V54 B;  2OT5 A;  2ZCE A;  5J9P C;  1AJP A;  4I4T A;  4O4I A;  1K92 A;  1MMM A;  1AI7 A;  4CH3 A;  4MS2 A;  1GN4 A;  4O4L B;  1ZTE A;  3CPW U;  4K8Z A;  1T5E A;  4PJ0 Z;  1GKF A;  1CXZ B;  1I94 B;  1R3L C;  4DR5 O;  5LA6 A;  4RQF A;  2W6J G;  1M56 B;  3RYF B;  4X65 O;  3N2K B;  1MZF A;  1OJH A;  2HP8 A;  1XI1 A;  1R3K C;  2JS3 A;  3JAS A;  2BTQ A;  4RO2 A;  3K9A A;  1GN2 A;  3T2M A;  1N34 B;  2BE3 A;  5KA5 A;  1PL4 A;  4DK0 A;  4J9Z B;  2HKO A;  1JA8 A;  2R9A A;  4NVP A;  3LDC A;  1AR4 A;  1B06 A;  1JJ2 U;  2KKW A;  4UVB A;  2CGN A;  4JYB A;  5FPR A;  3JD2 A;  2F4V O;  5FPO A;  3ZS8 C;  1B6Q A;  4PDM A;  4H33 A;  4DR2 B;  2ZNJ A;  4AHC A;  5FNV B;  5BR8 O;  1H8H G;  1NTK H;  1V54 C;  1AR1 B;  2D3O W;  1DTO A;  4DV0 O;  4CH5 A;  3JAK B;  1SF9 A;  4JI4 B;  1XOU A;  2FB5 A;  1D2D A;  4I4T B;  1LNQ A;  3ASN B;  4I55 B;  2Z5U A;  4ZKI A;  3FKS G;  2R70 A;  1QVG U;  2QGN A;  1UFI A;  3LUT B;  1HNZ B;  1GN6 A;  5ITZ B;  3SPG A;  3AEI A;  2ZNI A;  3H1J H;  2ZXW B;  3TXS A;  1JOY A;  2A06 H;  1RPO A;  2E5L O;  4TQD A;  3CD6 V;  2JJ1 G;  2F43 G;  2B1I A;  3K5M A;  4B3T O;  1L8D A;  3ABL B;  2EBO A;  3DXR A;  3U10 A;  1SRY A;  4U3F H;  3UCS C;  2QA4 V;  2BOC C;  3CRC A;  4LFC O;  4BIZ A;  2Y69 B;  1KP2 A;  3RYC A;  1TA8 A;  4O4H A;  3SJC C;  4F4L A;  2GUZ A;  5H2F Z;  3OMN B;  3E8F A;  2CK3 G;  3ZED A;  1XL4 A;  4K3A A;  1PPJ H;  2LP7 A;  2KG7 B;  1NH2 B;  1Z5W A;  2JJ2 G;  4HBN A;  3AG4 B;  3STZ C;  3BAA A;  3WU2 Z;  4ICG A;  2P22 C;  2L35 A;  1NU1 H;  3JAL A;  4X66 O;  4PA6 A;  4JI0 O;  3G67 A;  4AQY O;  5F2V O;  4LNU A;  3Q4H A;  3TJT A;  3K59 A;  2QKC A;  2IW5 A;  4G27 B;  4KP4 A;  5IYC O;  1OCZ B;  3ASN C;  2CE4 A;  3OTO B;  2H8P C;  5CA0 B;  1G6U A;  2UXN A;  1EFR G;  5BY1 A;  1Q8I A;  1EN4 A;  3L75 H;  2E3C A;  2MW2 B;  4JI5 O;  4N21 A;  2AHZ A;  2ZXW C;  3H1K H;  4DV3 O;  1BS3 A;  3I55 V;  4TUY B;  2P06 A;  1YVW A;  3ABL C;  4DV5 B;  3I5D A;  2OYQ A;  3J7A U;  3DXR B;  2H94 A;  2Y69 C;  3K3W A;  1PNM A;  3U11 A;  4LWS B;  4DUY B;  4G2K A;  5LMU O;  2PF4 E;  3LDD A;  4DR7 O;  2QWQ B;  5KHG A;  4A5U B;  4LP8 A;  2FML A;  4W4K A;  1DF4 A;  3AG4 C;  1F51 A;  3N2G A;  3QF7 A;  3MHH C;  1JX9 A;  2ZT9 B;  3JAT A;  4XDL A;  4KL1 A;  1DLB A;  2M7W A;  1YXB A;  4I50 A;  3K03 A;  1K33 A;  3T4Z A;  1IUR A;  1S0V A;  5B1N A;  4LNU B;  2HFE C;  3CCR V;  1OCZ C;  3QNE A;  4YXW G;  4LFB O;  4PA4 A;  3FAV A;  3RT3 C;  3ZMZ A;  1LR1 A;  2H3O A;  4HYO A;  1M9N A;  4QPK A;  1MA1 A;  2CH7 B;  2ZM6 B;  1U97 A;  5L3C A;  2UU9 B;  1N33 O;  2HHH B;  3EVK A;  3ZHU A;  3JYC A;  5LBQ A;  5IYB O;  2K9P A;  4KHP B;  3FB6 C;  3S3X A;  3T1H B;  1PD3 A;  3JCU Z;  1MOF A;  1VQ6 V;  1AI6 A;  2YS8 A;  2OTL V;  1SQV H;  1S5L Z;  4FLV A;  1UPG A;  1Q3E A;  1M5I A;  3SPJ A;  2P67 A;  2WLH A;  3W7X A;  4MW8 A;  1K5S A;  4FLW A;  1IVS A;  2IJJ A;  4FZ1 A;  2QTS A;  3D3I A;  4DR5 B;  4FFB A;  1H8E G;  1WA8 A;  4X65 B;  3SPI A;  4YJ3 A;  2V7Q G;  2A79 B;  1BMF G;  4NXN O;  1JPX A;  2KB1 A;  1K5Q A;  4MTG A;  5JWP A;  1KKD A;  3JAM N;  4JTD B;  2QWP B;  1KU9 A;  3IGA C;  4LF9 O;  2EIM B;  1AJQ A;  2BOB C;  1PV0 A;  4F6E A;  2W6I G;  4JI2 O;  1IX9 A;  3BVO A;  2F4V B;  1N36 O;  2DYS B;  1FXH A;  4O4J A;  3E83 A;  1NH2 D;  2E76 B;  3HPL C;  5BR8 B;  3BA9 A;  4AI8 A;  4EB6 A;  2Q6A A;  3CRR A;  1G1X B;  4DV0 B;  1IBL O;  4B7E A;  4RUE A;  2D2C B;  1WPX A;  1Q6I A;  2JVD A;  4NXM O;  1GO3 F;  4UVC A;  4R8C A;  3GWO A;  5C8Y B;  1R3I C;  4UUJ C;  1VF6 C;  2VS0 A;  1VMG A;  1P7B A;  1AP6 A;  5KLV H;  4FFB B;  4LF8 B;  1LUW A;  1I7F A;  5JJJ B;  5EK0 A;  3SJA C;  2E5L B;  4NTY A;  4X1K B;  3A0H Z;  1F4M A;  2C2A A;  4B3T B;  1AI5 A;  1GAX A;  3ZRV A;  4LFC B;  2NN4 A;  2YID A;  2YC0 A;  3ZMV A;  2EIM C;  1HDJ A;  1VQP V;  5IYZ B;  2WLI B;  3OEE G;  2UXB O;  3C90 A;  3HKB A;  5LXT B;  5IJ9 B;  4UCR A;  2VWK A;  1N0J A;  1FD9 A;  2WA3 A;  1DGS A;  3F5T A;  5H9C A;  3N27 A;  3CC2 V;  1JFF A;  5EIB D;  1XQ8 A;  3OEH G;  3ZRW A;  4X66 B;  4BIO A;  4JI0 B;  4AQY B;  3OR7 C;  2JEU A;  3F5W C;  3SYO A;  2JEX A;  2YSU B;  5D5Q A;  5BMV A;  2GDS A;  2CTP A;  2IJK A;  1BGY H;  2NLJ C;  2NNU A;  4FJC C;  2YIB D;  2EUL A;  4JI5 B;  2JS5 A;  2LW7 A;  5H5N A;  1HNW O;  4DV3 B;  1S3J A;  5KAI Z;  1L0N H;  1VQK V;  5LHH A;  2XND G;  1QU7 A;  2RNB A;  3BEH A;  5B1B B;  4D7T A;  3OE7 G;  3IAY A;  3D3Q A;  4LF7 O;  3IC9 A;  5CB4 A;  2ZD9 A;  3VQY A;  5KX5 B;  5LMU B;  5LOV B;  4DR7 B;  2XAS A;  1B04 A;  1FPO A;  3CE2 A;  3G6B A;  1VIB A;  4BIU A;  1ZL8 A;  2F95 B;  3BY6 A;  2EZP A;  2N05 A;  4P2Z A;  1VQ9 V;  1SQB H;  2JIZ G;  5GTH Z;  2DJV A;  1JJO A;  1JFF B;  2PUS A;  4FPP A;  4ZOL A;  4JI6 O;  3S3W A;  2WWW A;  4QE9 A;  2WLL B;  3CCM V;  3ZRW B;  3L9D A;  2Q7H A;  1FYJ A;  4P30 A;  1CPY A;  4LFB B;  3JD1 A;  1QVF U;  1K4C C;  4MW3 A;  2GHY A;  4LFA O;  2F93 B;  2IM9 A;  3AG1 B;  1FXK A;  2B9Z A;  4I7Z B;  2PGG A;  4PI2 A;  1XL6 A;  2F66 C;  4XBF A;  2XAF A;  2E75 B;  1N33 B;  5GW7 A;  5L3G A;  1WNS A;  1Y74 A;  1VEW A;  2BTO A;  3F7Y C;  4MVO A;  2X6A A;  3E22 B;  5CN0 A;  5EC2 C;  3P30 A;  3HKC B;  1N0N A;  3D8C A;  5AG2 A;  3K06 A;  4DO2 A;  2K1E A;  1F7Y A;  4PDV A;  3SYA A;  4N23 A;  4KXR A;  2W0X A;  3ZMS A;  4DRX A;  4B3M O;  3ZHV A;  2GTA A;  1LUV A;  1JMK C;  5EBW C;  2GTS A;  1L0L H;  2WLN A;  5IY5 C;  3HKD A;  3M8A A;  2RQ6 A;  1SS3 A;  4FLX A;  3FD9 A;  3A0R A;  4ZOL B;  3H1I H;  1XNQ O;  3RWR D;  4NXN B;  4I0X B;  2OCC B;  2X0L A;  1GH6 A;  3K5L A;  4PHZ A;  3P32 A;  2IU3 A;  3TXQ A;  1HWY A;  2QWO B;  4IYH A;  2LJ2 A;  1ENV A;  1Q6U A;  1YIT V;  4LF9 B;  1M90 W;  1GM8 A;  4Q6G A;  4JI2 B;  3ABU A;  3KCY A;  1O9G A;  1NZ6 A;  1N36 B;  2M6Y A;  2OCH A;  3B77 A;  1TUB A;  1Y74 B;  1AJN A;  1PM9 A;  5JCO A;  1IBL B;  2YXH A;  1RP3 B;  1HNX O;  1YHQ V;  4NXM B;  2P5O A;  4DXW A;  4PV1 B;  1IXM A;  4DUZ O;  2F23 A;  3JAW A;  1M57 C;  5GON B;  2HG5 C;  2QKS A;  2IH3 C;  3B2E E;  4NKG B;  4XDJ A;  5J2U B;  2RN9 A;  1K34 A;  1W0K G;  2FTK A;  3HKD B;  1FJG O;  1WB8 A;  2OCC C;  3A0B Z;  1EZV H;  2QR4 A;  4UB6 Z;  1V9P A;  1XHX A;  2LW1 A;  4RUF A;  3APQ A;  4O2B A;  3ETG A;  3TET A;  1XHZ A;  4DK1 A;  2CAZ C;  3VQX A;  5DN6 G;  2UXB B;  3UO3 A;  4PDR A;  1G8M A;  5EYP A;  4F6R A;  1WN7 A;  5B66 Z;  2ZIO A;  2EIL B;  2FKX A;  2Y4T A;  2Q0O C;  2HVK C;  4JAS A;  3OTF A;  3H1L H;  4WFG A;  3SYC A;  2Q68 A;  3F7V C;  4UV9 A;  1YF2 A;  3DC6 A;  3OGC C;  4J7J A;  4O4I B;  3UKM A;  3ABM C;  5LGU A;  1BQZ A;  3FX7 A;  1RM1 C;  2Y0P A;  1MZE A;  4UFZ A;  4MVZ A;  4TOI A;  1PKX A;  3K0G A;  5KHH A;  5LA6 B;  1VQO V;  1GN3 A;  1KB9 F;  1HNW B;  2IH1 C;  3O9O A;  3K04 A;  1R1B A;  1KC8 W;  1VF7 A;  3JCZ A;  3ZRS A;  4U7O A;  3JAS B;  4OX9 O;  2BTQ B;  5EC1 C;  3SDL A;  4RQE A;  4DW0 A;  4LF7 B;  5L3E A;  3TGU H;  1H2M A;  1Q81 W;  4FK5 C;  4YIP A;  4WFB V;  4JAV A;  1S77 D;  3EFF K;  1AIL A;  2DOS A;  3E35 A;  5IJ0 A;  4ABM A;  3AG7 A;  2UXD O;  3M99 B;  3BFR A;  3CCU V;  2EIL C;  4JI6 B;  5LP6 A;  3CJH A;  1MSW D;  5LGT A;  3UM7 A;  4IHJ A;  4DYL A;  5JCO C;  4YY3 O;  4WFE A;  3HB3 B;  4YHH O;  3OD4 A;  1K97 A;  3ZHS A;  5KUK A;  4DV6 O;  1VQL V;  4LFA B;  4FIP C;  1OCO C;  2N04 A;  1DF5 A;  2LQT A;  3NXS A;  2QWR B;  2JK5 C;  3NR7 A;  3SGI A;  5A2Q N;  1XMQ B;  2IBZ H;  2Q4P A;  1R6T A;  3C3S A;  1YTF D;  1XRE A;  5FLX N;  4TQF A;  3P3N A;  5DM6 V;  2VRZ A;  3CHX A;  4GCZ A;  1US6 A;  4WFH A;  1JVM A;  4X8A A;  3VQW A;  3RYC B;  4H44 B;  4O4H B;  3CCS V;  1EN5 A;  4DV7 O;  3CS5 A;  2GUZ B;  5LGN A;  1P4R A;  1QNM A;  3MD0 A;  2BCC H;  4B3M B;  5IJ0 B;  1WAZ A;  1SQP H;  5JH7 A;  1XIL A;  4CH4 A;  3JD4 A;  4ZHQ A;  4X89 A;  1XNQ B;  3JAL B;  5LP6 B;  4CS4 A;  2P4V A;  1H2S B;  3D36 A;  3ZX6 A;  1VF5 B;  3Q4H B;  2Q5Z A;  1WLE A;  3T1Y O;  1R3J C;  1KKC A;  1Q6H A;  4GX1 A;  2OIG A;  3ASO C;  4RWU A;  2CUG A;  4R6Z A;  5JQG A;  4HNA A;  4NTW A;  3PJS K;  1BL8 A;  3G6E V;  1VQ5 V;  4PA9 A;  3FYE B;  3X2Q C;  1ORQ C;  5EBL C;  2ARH A;  3AK1 A;  3LNN A;  1HNX B;  1HP8 A;  5B5E Z;  2YEV A;  4DUZ B;  2RMK B;  1J95 A;  1QHT A;  5KMG A;  1KBH A;  1JCH A;  4NYK A;  2DN9 A;  3B8N A;  1QLN A;  2YUA A;  2EIN B;  3N2G B;  2GV9 A;  3RYH A;  4UB8 Z;  3ZRX A;  4XDK A;  2X6B A;  3JAT B;  1PP9 H;  3FFQ A;  1K9M W;  1FJG B;  5LP6 C;  4ZIB A;  3H1H H;  4JI3 O;  4I50 B;  3CB2 A;  3FYI B;  4PA3 A;  3QVN A;  4YJ2 A;  4B3S O;  2PY5 A;  2QE7 G;  3FAV B;  2OTJ V;  4UCT A;  5CBH A;  1QR8 A;  4FLZ A;  3L74 H;  1QLE B;  2ILM A;  5J2T A;  4J9Y B;  4TT3 G;  4LF5 O;  1OCR C;  2EIJ C;  4CC6 A;  3RBZ A;  4MVR A;  4JYC A;  2RDC A;  3T4D A;  4U7N A;  4X20 A;  2QKA A;  3OT7 A;  1QR9 A;  2PZS A;  3OMI B;  2KQX A;  4O2A A;  1ROP A;  4JI8 O;  3W7W A;  1S76 D;  3UO2 A;  2YEV B;  3BHP A;  3OR6 C;  3L72 H;  5K1X A;  2PYL A;  1XMO O;  3QTC A;  2AZ2 A;  2EIN C;  3GVM A;  5B1A C;  1WA8 B;  3G4S V;  2HJF C;  2Q9L A;  1A32 A;  5CMU A;  3RYH B;  4YJ3 B;  5L3B A;  3MHS C;  2RJZ A;  4DV4 O;  2GBO A;  1YSC A;  2X6C A;  4CZZ A;  3DGE A;  4JI7 O;  4OX9 B;  4J7Z A;  3D36 C;  1I5X A;  3IFX A;  3CRM A;  4YJ2 B;  2HJD A;  1S72 V;  1SQF A;  4DV2 O;  4X62 O;  4DR1 O;  3KG2 A;  4UCS A;  1ZAU A;  1QLE C;  3VOU A;  1FFT B;  1K4D C;  4PEL A;  3HKE A;  3CEI A;  2UXD B;  5J2T B;  3CSX A;  4K0K O;  4O4J B;  4JYA O;  2UUA O;  2Q0A A;  2WSS G;  4EB6 B;  4EFE A;  4UV8 A;  2XOK G;  3FB5 C;  4X20 B;  4YY3 B;  4U3J A;  4YHH B;  3EXA A;  5GTI Z;  3ETQ A;  4DV6 B;  3H01 A;  1XDC A;  1YEW A;  1SER A;  4W4L A;  1Z5V A;  5EZY A;  4X1Y A;  3L71 H;  4TV8 A;  5A9G A;  3CCJ V;  1BSM A;  1H2K A;  3JSN A;  4MVU A;  4CH6 A;  1K7D A;  3OFN G;  1M4U A;  4TV9 A;  1FS0 G;  1YJ9 V;  4UCV A;  1RSO A;  1FXV A;  1N8R W;  2ZQM A;  2ADP A;  4IL6 Z;  4DV7 B;  1NR1 A;  4MVS A;  3J80 N;  5CA3 A;  3HKB B;  1UJW B;  2IU0 A;  3ZIA G;  4OXS A;  3CCV V;  3QO5 A;  5IY5 B;  2A7W A;  3ZJZ A;  4QNH B;  4FLY A;  1I0H A;  1Q5O A;  4TSF G;  2QTO A;  3TCU A;  5L3D A;  1EZJ A;  2XAG A;  1S5J A;  3L73 H;  2P4K A;  3T1Y B;  3U0Z A;  1N32 O;  5HFL A;  4D7S A;  1I08 A;  2XT9 A;  5BMV B;  4MVQ A;  3QG5 A;  4MT8 A;  1J5E O;  3OGI B;  2OWO A;  4LCU C;  1Y67 A;  4OPA A;  4X1Y B;  4ZBM A;  3CME V;  1H2L A;  4TV8 B;  2AZ0 A;  4IT5 A;  3E8G A;  2XAH A;  3W7T A;  3E89 A;  4I9Q A;  2PI5 A;  1VQN V;  2A0L A;  2R72 A;  3WB0 A;  1BQ0 A;  5CB4 B;  5CA1 A;  2YI9 A;  3K79 A;  2ZIN A;  4IIJ A;  1M1K W;  5JJE B;  3BA8 A;  1M57 B;  3AK3 A;  1F23 A;  4RAI A;  1ZL8 B;  4QPJ A;  3ZMU A;  1MSD A;  2JGU A;  1Y6X A;  1AB3 A;  1K8A W;  2L6L A;  2DYR B;  4O4L A;  4FM2 A;  5LYJ A;  3ICX A;  4GX0 A;  4JI3 B;  2WLK A;  4DR6 O;  2EIK C;  4DW1 A;  3RYF A;  4B3S B;  5E1A C;  4EFB A;  3AG3 B;  2DWD C;  2YIC A;  3JD0 A;  1YJW V;  1FXK B;  4R7C A;  3WG7 C;  5LL6 Y;  1EBO A;  1L1F A;  4YIO A;  4BW5 A;  1Y4M A;  4LF5 B;  2UUB O;  4WBN A;  4UXN A;  1NBM G;  3E86 A;  3ZCC A;  1VQ7 V;  5H6R A;  2W0F C;  4UCU A;  1Q7Y W;  4MTO A;  2WLJ A;  3CMA V;  2CTQ A;  2Y48 A;  5KHI A;  3SPH A;  3R66 A;  1QBZ A;  1THZ A;  4J7K A;  3A8T A;  4JI8 B;  1BZK A;  3K08 A;  1GMG A;  5IT9 N;  4FLU A;  3STL C;  3ABM B;  3JAK A;  4KUM A;  1XMO B;  4DV1 O;  1RM1 B;  1PNL A;  4DRX B;  4JAA A;  2CTW A;  4DR3 O;  3FB7 C;  5E79 Z;  3RN4 A;  2UXC O;  3WB2 A;  2DYR C;  4JZG A;  4I55 A;  2DQ0 A;  4MSW C;  4C7U A;  5B1O A;  2YXL A;  4DV4 B;  2CDY A;  4P9P A;  3ABK B;  1COW G;  5LYJ B;  2DMX A;  4JI7 B;  3ETD A;  1GRJ A;  5ITZ A;  3DC5 A;  3KCX A;  3AG3 C;  4BW9 A;  2XTA A;  5LHG A;  4DV2 B;  4X62 B;  3LSS A;  4DR1 B;  4AIL C;  4FLT A;  1FXK C;  3IJ4 A;  1K3E A;  1JQ0 A;  4K0K B;  1BCC H;  3B40 A;  4WBN B;  4JYA B;  3K58 A;  2UUA B;  2YI8 A;  1IBK O;  1TUB B;  2VQF O;  3RVZ A;  4DR4 O;  1SES A;  4NB5 A;  2KG7 A;  2HVJ C;  3LDE A;  2B1G A;  1GM9 A;  4CS2 A;  3T1C A;  4GZR B;  1XNR O;  2IJH A;  3JAW B;  1WP8 A;  2DW4 A;  3RYI A;  5BXZ A;  2JDI G;  1OCO B;  3CCL V;  2AHY A;  2VQE O;  1IBM O;  4LF6 O;  2GSM B;  3OM3 B;  5CA0 A;  1H2N A;  3B4S A;  4R50 A;  1S5H C;  3ABK C;  1K73 W;  2JRI A;  3SR2 C;  2QM8 A;  1OV9 A;  1ZLZ A;  4O2B B;  2HEP A;  1M56 C;  3LNM B;  4H0L B;  4LF8 O;  4QJF B;  4TUY A;  4K35 A;  1SQG A;  4G28 B;  2N74 A;  2MK3 A;  4GX2 A;  3AK2 A;  1NT2 B;  1TUE B;  5EYP B;  4F6R B;  3SJB C;  5LMN O;  1N4C A;  4LWS A;  4JI1 O;  2ZR3 A;  1EN6 A;  1GK9 A;  2ZIM A;  4B08 A;  4D6T H;  1AI4 A;  2X7R B;  3AG2 B;  1R73 A;  3CRA A;  3IC7 A;  3MDS A;  4FZ0 A;  2B5U A;  2DE0 X;  3P3P A;  1KQS U;  4E4E A;  4FM1 A;  4LF4 O;  1N32 B;  4WFA V;  5B3S B;  1O9H A;  2EZO A;  3ASO B;  5FL7 G;  2XAJ A;  3RYI B;  1J5E B;  3K9S A;  1VQM V;  3ETE A;  2XAQ A;  2ZE8 A;  3CC7 V;  1BT8 A;  4EKW A;  1ZSP A;  5KUM A;  3WFV A;  1R6K A;  3RGB A;  2F1M A;  2QEX V;  3OUS A;  4X1I A;  3X2Q B;  2YIB A;  4KFM A;  1VAR A;  5H6Q A;  1OHH G;  3VQV A;  4JTC B;  2YIA A;  4B3R O;  2CH7 A;  1TVK A;  2YXY A;  4PA7 A;  3GWK C;  2Q73 A;  4QGP A;  2HLD G;  3ZN1 A;  2AXT Z;  1E1R G;  2YDE A;  4Z1M G;  1KEC A;  1GM7 A;  1MG1 A;  2ITC C;  4GUN A;  1GTO A;  4WCE V;  4QIW F;  1P7G A;  2KSD A;  4LBE C;  4GKJ O;  1MAB G;  3LSQ A;  4GKK O;  3AG2 C;  3CJH B;  1KUQ A;  1VF6 A;  2WA4 A;  4HZ3 A;  4IHJ B;  1NTM H;  2FYU H;  2ATK C;  3JAR A;  1VQ4 V;  4DR6 B;  1BHA A;  3OAA G;  3K5O A;  4GX5 A;  5B3S C;  4X9Q A;  1R6N A;  1JR9 A;  3K57 A;  3CP1 A;  3BRC A;  1D5N A;  2Q7E A;  4J10 A;  4WFF A;  2R9R B;  3K0D A;  2UUB B;  1OCR B;  1RPR A;  2EIJ B;  1KYO F;  3L70 H;  2NR5 A;  4JGS A;  2EX3 A;  4IGG A;  2Q69 A;  5IDJ A;  2P90 A;  4X1I B;  3OUF A;  4FVM A;  3UT5 A;  4NR1 A;  1CP9 A;  4OPH A;  3MAQ A;  5JJN B;  4I9W A;  2LFS A;  1TVK B;  1KP3 A;  1YIJ V;  4OGQ B;  5KHK A;  2QM4 A;  2O57 A;  1M93 A;  1YZB A;  2P6J A;  1XUQ A;  4BAY A;  1SZT A;  3CYO A;  1WP7 A;  3EHB B;  4DV1 B;  4UCO A;  2LGQ A;  4DR3 B;  1Y76 A;  4K8X A;  4ASU G;  2IJI A;  2UXC B;  5B1A B;  5C8Y A;  1Q86 W;  1NVP B;  1KD1 W;  5JH7 B;  2QM7 A;  4ZHQ B;  3HR0 A;  1BE3 H;  4JTA B;  2QSA A;  2V1D A;  1NR7 A;  3OW2 U;  1SC5 B;  4JV5 O;  5EIB C;  3JAR B;  1AVM A;  1ZX3 A;  5IWA O;  2WLM A;  2AW9 A;  4Q20 A;  4GLX A;  4FM0 A;  1SQQ H;  4X1K A;  2JGD A;  2RCV A;  1MNG A;  5KHJ A;  5JQG B;  2P7T C;  4HNA B;  2AGA A;  3CC4 V;  1SZX A;  4JF3 A;  4J80 A;  1XEQ A;  4LR3 A;  1IBK B;  3BAB A;  5IYZ A;  2UUC O;  1HR0 O;  2WLI A;  2VQF B; 
#chains in the Genus database with same CATH homology
 1US6 A;  2HJD A;  4NKG B;  4DYL A;  1RFY A;  2Q0O C;  4NB5 A;  4IGG A;  1UPG A;  2RMK B;  1URF A;  1CXZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...