1US6A

Crystal structure of the quorum-sensing protein tram from agrobacterium tumefaciens at 1.65 ang. resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
90
structure length
90
Chain Sequence
VELRPLIGLTRGLPPTDLETITIDAIRTHRRLVEKADELFQALPETYKTGQACGGPQHIRYIEASIEMHAQMSALNTLYSILGFIPKVVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REPRESSOR TRAM
publication title Crystal Structure of the Quorum-Sensing Protein Tram and its Interaction with the Transcriptional Regulator Trar
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Transcription repressor
total genus 34
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09228 Prok-TraM Prokaryotic Transcriptional repressor TraM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.160 Mainly Alpha Orthogonal Bundle Helix Hairpins HR1 repeat 1us6A00
1RFYA 1US6A 2RMKB 1URFA 4DYLA 4NB5A 1CXZB 4IGGA 4NKGB 2HJDA 2Q0OC 1UPGA
chains in the Genus database with same CATH superfamily
4PJ0Z 4NTWA 1BZKA 5FPOA 1AROP 3HKCA 1WP8A 4OGQB 2NLJC 3MDSA 3SYCA 4YXWG 1YJWV 3H1LH 3ZRSA 1D5AA 2VWKA 2YS8A 1ZAUA 2NN4A 3E86A 2UXDB 2DE0X 4DUZO 2EIKC 2UU9B 2WPDG 3SGIA 4DR1O 3LSSA 5E79Z 2CGNA 2JDIG 1WB8A 3ETEA 1H8EG 5BR8O 3B8MA 1XEQA 4AHCA 5F2VO 4ZOLB 3JD3A 4LF5O 1H2SB 2IU3A 3WG7C 4JASA 3CRCA 4O4LB 4TV8A 4HAMA 2QTSA 2VQFB 3ZN0A 1JX9A 4R6ZA 5CMUA 2X6BA 4QNHB 1N32B 2Y48A 3LNNA 3A8TA 3QO8A 3HKBA 4GYCB 4MTXA 5TISZ 5JWPA 2UXBB 1Y4MA 4ZKIA 4UCOA 4U3FH 1M57B 4TWKA 2Q67A 5KMGB 3TCUA 5EBMC 1KQSU 4DV7B 2D2CB 2UUCO 1ENVA 3CCQV 3QTCA 4X65B 3TJTA 4YY3O 5IY5B 2HP8A 1K5QA 2CGOA 3OGCC 2YI8A 4O2BB 3AK1A 1B06A 3J81N 3JCZA 1WAZA 1E79G 1H2LA 2V1DA 5JVDA 4H33A 3AG3B 2Y0PA 4DRXA 4B3MO 3G4SV 4O4IB 4JI1O 4J7ZA 1J5EO 1F7YA 1M56B 1GK9A 4O4JA 1MZEA 4F6RB 2B1GA 4R8CA 5B1AB 4FLXA 5CBHA 4J9YB 4WFGA 1K4DC 1XHXA 2A3QA 2YICA 3R65A 4K0KO 2Q0AA 4DUYB 3UO3A 2PF4E 1P84F 1K5SA 1VF6C 1W0KG 1P4RA 3ZHSA 5B3SC 5LA6A 5GONA 4JI4B 3RBZA 2ADQB 1GM9A 2ETNA 4MVMA 2P7TC 3NXSA 3K58A 5LP6B 1N36B 1XNRB 3SPJA 1K4CC 4X1IB 4RQFA 3D8CA 1Q90D 4UB6Z 4Q20A 1HNZB 4K8XA 4FK5C 4DV3O 4N21A 3P32A 3CB2A 2ZR3A 2Q7GA 2RDCA 3AG1B 1P7GA 2V4DA 1GN3A 3JAMN 5J2TA 5LMNO 2YC0A 5C8YB 4KHPB 2HEPA 5B1OA 3FX7A 4DR3O 2LP7A 1GKFA 2V7QG 1M90W 4DR7B 1FKAO 1Y66A 2WA3A 1QVGU 2XAHA 2PYLA 2EULA 3L73H 4LF6O 4MS2A 1KECA 1V9PA 2AW9A 5BY1A 4DV4O 3LSQA 4U3JB 4XDJA 4NXNB 1JFFA 4X20B 2ZIOA 1ZLZA 3UO2A 4DV6O 2WLKA 3CCSV 3DXRB 3UKMA 3EFFK 3BCCH 2BE3A 1QLEB 3OAAG 4I0XA 3CWBH 4LF7B 4DV0O 3CRMA 3SPGA 2YIBD 4CZZA 5EIBC 1OCRC 3GVMA 2EJ7A 4E4EA 1OCOB 4GKKB 3STLC 1NBMG 3ABMC 2GBOA 5LYJB 1FPOA 3IJ4A 4TOIA 1AB3A 3M99B 5JQGB 4JI5O 1XDCA 4DV1O 2XASA 3B8NA 2XOKG 3CRAA 1HW7A 1ZX3A 5IYBO 2XT9A 3K9AA 2P5OA 4JPRA 1FYJA 2DJVA 3FYEB 4UVBA 4F6EA 1M1KW 1OZ0A 1SQGA 1L8DA 4MW8A 4JYAO 2EZOA 1EN6A 4GZRB 4J10A 1URFA 3CYOA 1JJOA 4BAYA 2HG5C 3T2MA 4GX0A 1NT2B 3W7TA 4P9PA 2KG7A 2ZQMA 5IWAB 2ZE7A 2ZXWB 5DN6G 5IYZB 4XBFA 2E5LB 3X2QC 3AK2A 3L74H 4J41A 2ZDIA 2DYSC 3E8GA 4BIZA 5L3GA 2WLLB 1TVKA 2XNDG 4LFAO 3VQXA 1K7DA 3D3QA 1Q86W 3RWRD 2ZR2A 2EINB 5ITZB 3OR6C 4N23A 3ABLC 3CPWU 1WA8B 4Z1VA 5K1PA 1KKCA 1AI7A 4PA3A 5BXZA 1RM1C 2Z3YA 4LFCB 1S5JA 4JI0B 1AJPA 4LF4B 1FD9A 2W0XA 3CXHF 2EIMB 2Q6AA 1YTFD 5KHHA 5J2UB 1FXKA 4WFFA 2QKSA 1SS3A 5IJ9B 1K34A 3HKEA 3ABKC 2RJZA 5BZBA 4ASUG 1I94B 4JI7O 1YZBA 1PM9A 4BIUA 2IM9A 4JTDB 2OTJV 1XREA 4WFAV 2CH7A 4NKGB 4X66O 2WLMA 1K73W 2UXXA 4DV3B 5EYPA 2VQEB 3FAVB 1OCZB 3T1YB 4GUNA 1OJHA 5IE9A 4JI2B 3ZMUA 3CC4V 2HHHB 1CXZB 2F93B 1XILA 3JSLA 1BSMA 3EXAA 2WLJA 1EBOA 1V54C 2JGDA 2E76B 4WFHA 3CCEV 5C93A 4LR3A 4B3TO 3KG2A 1SF9A 2YI9A 4FZ0A 4B3SO 1S0VA 1JMKC 4AI8A 1GMGA 3JD1A 2R70A 2GUZA 1SQVH 4BW5A 4X1YB 4UB8Z 1YJNV 4YJ2B 3N2GA 2UXDO 1TAEA 1M4UA 2UU9O 2Q9LA 2GV9A 3JAWB 5K1XA 4LNUB 3ABUA 5KUKA 2BTQB 3GWKC 2Z5UA 3EVKA 1JVMA 4DO2A 4FFBA 1L0LH 4O2AB 1QR8A 1SA0A 4FLTA 1WNSA 2VQFO 3GB7C 4TQDA 3K5MA 1N32O 5LGNA 4IHJB 2Z0AA 3ZCCA 2UXBO 1N34B 4JGSA 3A0BZ 3K5LA 3F5WC 4DV7O 1S72V 4I4TA 2DWEC 1Y76A 3JASA 2ITDC 1Q43A 2LJ2A 2Y69C 4X65O 1ZSPA 1JQ0A 2PGGA 1D5NA 2EZPA 2XHBA 3ZMSA 1BQZA 2P22C 1SQXH 3AG2C 4DV5B 4OPHA 1X59A 2P06A 2QE7G 1S77D 5CA1B 1V55B 5EK0A 2WLHA 3JD4A 4KFMA 2KB1A 1F4MA 2EILC 2QWNB 4EB6B 3SJAC 4CS3A 1AR5A 5EIBD 2K9PA 4BIOA 1M5IA 2X6CA 2OT5A 1Q6UA 1BGYH 1PNKA 1B6QA 3IGAC 5FPRA 4GT1A 5IJ0A 2ITCC 3F7VC 3M8AA 3JSNA 3AG1C 3SPIA 1H2MA 1UPGA 2XAQA 4QPKA 3LDDA 4DUYO 1FXHA 2F23A 4F4LA 1OCCB 2OTLV 4X1KA 4NTXA 2BSKB 3G6EV 2QSAA 3I5DA 3BA9A 3CSXA 4JI4O 1YI2V 4OXSA 3JD0A 3UCSC 4YJ3A 3MD0A 1N36O 1ROPA 3ZMTA 1XNRO 3STZC 2PI4A 2FTKA 5LGUA 3CJHB 1HNZO 2MK3A 3N2KB 1RSOA 1LR1A 5BMVA 1SC5B 3OMAB 3TXSA 1VIBA 3H1IH 4X64B 2ZDIC 3ASNB 1EM1A 3KCYA 2WLIB 1MABG 3OTOB 5FL7G 2QR4A 2IH3C 1GO3F 1AI6A 4LH7A 3CP1A 2AZ0A 4KHPO 2EIJB 3OM3B 4U7NA 5JJEB 1LUWA 3ETDA 4TUYB 1KP2A 1OCOC 2X0LA 3CCJV 3UT5B 4DR7O 1D2DA 4LWSA 5LOVA 1NU1H 4D7TA 5JH7B 1HNWB 2YXLA 3A0HZ 5CA3A 4CH4A 4NXNO 4FZ1A 4OX9B 4I9QA 4FLZA 1PL4A 1VF7A 5DM6V 2R9RB 1B3QA 4HNAA 1ZL8A 2PTMA 2YIDA 3JATB 1FXKC 2YXYA 4D6TH 4LF7O 1TUBA 4RUFA 1HP8A 4DXWA 1VQ9V 1N33B 2A0LA 1KP3A 2P4VA 1VP7A 4R7CA 5LL6Y 4GKKO 3F7YC 3HR0A 4FJCC 3RW0A 2K1EA 1K8AW 4JI3B 5L3FA 3K9SA 5DEDA 3OGIB 4X9QA 3E22A 4KXRA 2UXNA 2G38A 3JD2A 5DECA 5FLXN 2HKOA 2KKWA 3U0ZA 5FNVB 1NVPD 3C90A 3KKYA 2PZSA 2KSDA 3VQWA 4UV9A 1YCIA 3ZS8C 3N27A 3RYFB 1BE3H 2FKXA 1FFXB 3P3NA 4IYIA 1IBMB 2LW1A 1YIJV 2N04A 4DR4B 5IDJA 5IWAO 1Y74B 4MVSA 1RPOA 1GN2A 1XMOB 4H0LB 2E5LO 2P4KA 1DF4A 5LXTB 1VARA 1S5LZ 3L71H 3VQVA 4BWAA 2YEVB 4DW0A 4FFKA 4JYCA 5KHJA 2GTAA 2RNBA 4DV2B 3LNMB 3RYHB 5A9GA 3B2EE 1O9HA 2CTRA 4CS4A 5L3CA 2LO1A 2R72A 3OMNB 4PA6A 1S5HC 3FYIB 1UFIA 5L3DA 4LFCO 2QA4V 4JI0O 4ZOLA 2DYRC 1DK1A 1SQPH 4LF4O 4ZHQB 4E2LA 4O4LA 1LUVA 1EN4A 1GM8A 1G8MA 2R9IA 1R3IC 3BRCA 3K0GA 1Z2GA 2YIAA 4H37A 2Q5ZA 5KMGA 3KZIZ 4Q6GA 4HYOA 1MOFA 1I94O 1FFXA 1Q3EA 2Q0OC 3JCUZ 1YEWA 4UV8A 2RMKB 1YJ9V 1BHAA 4OPAA 4O2BA 1IXMA 5LHGA 2VQEO 5KHIA 3QVNA 5B1BB 2F1MA 3T1YO 2JRIA 3LDEA 1Q8IA 4RWUA 1DLBA 1WPXA 1K9MW 4BW9A 2YEVA 4JI2O 2HHHO 1IXBA 1QHTA 3ASOC 4ZBMA 3RN4A 2JIZG 4P2ZA 3UQ8A 2PY5A 2FMLA 3QO5A 3RYHA 4O4IA 3CRRA 1HNXB 5E1AC 3CCRV 3AG4B 4I7ZB 2CTWA 5H2FZ 4F6RA 4ZI7B 2ZT9B 5EC2C 4PA9A 1SZXA 3ZMZA 1RPRA 4ZHQA 3SJQC 2CDYA 3G67A 3OE7G 4CH6A 3JALB 2UXCB 4FVMA 2JS5A 2RN9A 1G1XB 2EBOA 4PA4A 1Q6IA 5L3BA 4KP4A 2AZ2A 3OW2U 3BABA 5LP6A 1VQOV 3IC7A 4X1IA 2OWOA 1QBZA 3CHXA 1VQ6V 1J95A 5D5PA 1BS3A 2PI5A 3H1HH 1IURA 2N74A 1U96A 5A2QN 4H44B 3RT3C 1JCHA 1R3JC 3L75H 5C8YA 1YITV 5JCOA 1N34O 4K3AA 5IYCO 3WB1A 3K03A 4ABMA 5KX5B 4IL6Z 1PNLA 3ZHVA 1JJ2U 3QF7A 4LH6A 4P9OA 3LSUA 4PDMA 2Q69A 2XTAA 4U3JA 1NJIW 3B40A 3Q4HB 4DV5O 4U7OA 3FB6C 4X20A 3ZRVA 1QLNA 2YIBA 1I7FA 3OEHG 3DXRA 1SQBH 3K0DA 3G80A 2YUAA 4MT8A 2EIKB 4IGGA 5EZYB 4CC5A 2ZM6B 2M6YA 2OCCC 4L87A 2IJJA 3OUFA 2QWQB 4DR6B 5LYJA 2XAGA 3M7MX 3WG7B 4IT5A 1YTFB 2PUSA 2ARHA 2HR3A 4PDRA 5JQGA 2HFEC 4WFEA 2VRZA 1QU7A 2X6AA 4YHHB 4LFBB 1EFRG 2Y4TA 5LHIA 5B66Z 4I50B 1KU9A 1N4CA 1XOUA 5LHHA 2F66C 1IBKB 4JI8B 1MA1A 4JTCB 3RYIB 1NZ6A 3FB8C 2IW5A 3S3WA 1VQ4V 2AHZA 1P49A 2ATKC 1PKXA 4R50A 3ZMVA 4GX1A 1XI1A 3T4ZA 4YIOA 3H1KH 1JR9A 2F95B 3D36A 1Z5VA 5EC1C 3EHBB 4X88A 2HLDG 2DMXA 1PL0A 3W7UA 3CC7V 2CUGA 4X64O 1NQTA 2LW7A 4PA7A 5IYZA 3OTOO 1XQ8A 4MVZA 3ZRXA 4PELA 4K35A 2WLLA 2RQ6A 5KUMA 4FM2A 1CP9A 5ITZA 1WA8A 4X89A 1I0HA 5L3EA 1HNWO 2JK5C 1GM7A 3ABTA 1HDJA 4IIJB 4PHZA 4TSFG 3ZX6A 4OX9O 1ZTEA 4WBNB 2QEXV 2AXTZ 3CS5A 4NYKA 2W0FC 1VQ8V 5B3SB 2OYQA 3FKSG 2A79B 1Q81W 4UCRA 3HKDB 1M57C 3K08A 1F51A 5J2UA 1AI4A 2O57A 2PYJA 1GN4A 5IJ9A 1N33O 5HFMA 2QM4A 4MVQA 2AGAA 3TK1A 4JZ2A 5IY5C 3SPCA 4PV1B 1WN7A 4JI3O 2NR5A 3JARB 3SPHA 2L6LA 4LP8A 1H2KA 3WU2Z 1MZFA 2WSSG 3FAVA 3B4SA 5KHKA 5CA0B 1R3LC 3AG3C 1N0JA 2IJHA 2DQ3A 2UUAB 1WPBA 1M56C 3W7SA 2QWOB 4J42A 4WFBV 3ETGA 1M9NA 1IBMO 2OIGA 2UUBB 1COWG 2C2AA 3TXQA 2N05A 4CH5A 4MVUA 4PI0A 2IU0A 1KMIZ 5B1AC 4DR4O 3RFRA 4I55B 4WBNA 1Q5OA 5D5QA 3CX5F 1ZWIC 1XMOO 3RYCB 4RQEA 3JAKB 5H9CA 4JF3A 1OCRB 4MVRA 4X1YA 3L9DA 4RAIA 3OT7A 4DV2O 4FLUA 3CCMV 4YJ2A 1N0NA 4B3RB 5KLVH 3VOUA 4NB5A 1VQKV 5LP6C 3DC6A 1H2GA 1IBLB 1VQLV 1I5XA 3JAWA 1JPXA 4LNUA 1S76D 2BTQA 4UCUA 1SETA 1IVSA 1T5EA 4TV9B 1TGOA 3RGBA 4O2AA 4PI2A 4JI6B 3BAAA 4DW1A 5CBFA 4J11A 5JCOC 1L1FA 2ODMA 4XDLA 1SKVA 4IHJA 1RP3B 4PDLA 3ZHTA 4FLYA 4I5SA 3ZRWB 2CTPA 1XUQA 3OEEG 4AQYB 1AR4A 4JAAA 1PD3A 3A0RA 4LF8B 1QVFU 4B08A 3C3TA 5KA6A 4TQFA 5KAIZ 3BHPA 1H2NA 2DYSB 1QLEC 1THZA 1UJWB 4QPJA 5CA1A 2ZCEA 2A7WA 3IC9A 4EB6A 1EZJA 3ABLB 2A9HA 1HNXO 3WFVA 1EZVH 3W7WA 1RM1B 3ZHUA 3T1HB 1OHHG 1R1BA 3APOA 4TV8B 3E35A 3CD6V 1G6UA 1VQPV 5JJNB 4NXMB 1XL4A 5KAFZ 3HKBB 2Q4PA 2VWJA 1R3KC 4PD4F 5H5NA 3ZEDA 1HR0B 3K59A 1H38A 3SJCC 3CC2V 1QQCA 3ABKB 2UXCO 4AILC 3I56V 3E8FA 2BSKA 3CMEV 1N8RW 3ZN1A 2GTSA 1Q6HA 1PNMA 4J7JA 3D36C 1VMGA 3SYQA 1BHBA 2YSUB 2FB5A 3CMAV 4ICGA 2ZXWC 3BEHA 1NH2D 3CJHA 3N2KA 5JVDB 3THOA 3BPZA 4DRXB 1NVPB 4KL1A 4JTAB 4KUMA 5EBWC 2WLIA 3B09A 3LUTB 4BR6A 3PJSK 2ZNIA 1V54B 2CTQA 4Z2WA 4O4JB 2EINC 4TUYA 4P30A 3UT5A 4G28B 4GX5A 3K04A 4LC1A 5EBLC 2Q68A 4FM0A 1SQFA 2QGNA 1E1QG 3VQYA 5JH7A 4W4KA 2ZINA 3I55V 5H6RA 3RVYA 1H8HG 2EIMC 3P30A 5LA6B 5CBGA 5GONB 2GHYA 2VS0A 1VQ7V 3JATA 2EJRA 4GKJB 4QJFB 3P3PA 3MAQA 4DK0A 3E83A 1DGSA 4UVCA 2H8PC 1VQNV 3FB7C 2ZM6O 2ZKOA 2OCHA 5LMUB 2WWWA 2GDSA 3SYPA 1KD1W 2B1IA 1FJGB 4DR6O 1EN5A 4FMTA 5J2TB 2D3OW 3MHHC 2L35A 3C3SA 1OCZC 4J9ZB 4UXNA 3L70H 3ML0A 4YHHO 4LFBO 1IDSA 4JAUA 3CCUV 1SERA 1IBKO 5IYDO 3IFXA 1YF2A 5FNVA 4ZIBA 4JI8O 1NKDA 3DSQA 3AK3A 2Y69B 2DW4A 3E2EA 4A5UB 2WAMA 4DK1A 1AI5A 1JFFB 1S3JA 3RYFA 4GLXA 3SDLA 4D7SA 1W59A 2JS3A 2JGUA 1ZUQA 3S3XA 3AG2B 2W6IG 4W4LA 1BCCH 1NR7A 1XNQB 2P90A 4I0XB 3O65A 1Y6XA 1R6NA 4B7KA 4JAVA 1Y74A 2F4VB 1BL8A 5B1NA 3NR7A 1VQ5V 1XMQB 3FFQA 1US6A 4JV5B 2EILB 5LXTA 3TGUH 4DR5B 5H6QA 3MHSC 4Z1MG 1KC8W 3CXCU 2GSMB 1R6TA 3IAYA 1WLEA 2LQTA 2QM8A 1YSCA 2ZE8A 1KKDA 4NTYA 4QE9A 1BQ0A 1AP6A 3E89A 3BVOA 4FIPC 4X62B 2B9ZA 3ZIAG 2BOBC 4WCEV 1NS1A 1AVMA 4GCZA 1GAXA 3OFNG 2Y4UA 2P6JA 2MW2B 4LF9B 2DQ0A 1VQMV 5CN0A 4RO2A 4HZ3A 2BCCH 5AG2A 3BY6A 4NR1A 4DR2B 1VEWA 1ORQC 3G6BA 1X4TA 2KG7B 5J9PC 5CB4B 3CCVV 1I08A 4GX2A 4LBEC 1AP5A 1PV0A 4MTOA 3KCXA 1G4YB 5LBQA 1Y67A 2E75B 2XAFA 2ZE6A 4C7UA 4EEQA 3U11A 1CPYA 1TVKB 1V55C 1RFYA 4DYLA 3K06A 1KB9F 4X8AA 4DUZB 3APQA 2Q8VA 1SESA 3K79A 1NI8A 4DR1B 1FXVA 3R66A 2UUAO 5BR8B 2ZE5A 5LGTA 2H3OA 2QWRB 3E8BA 2NNUA 2QKAA 4LF5B 2UUBO 1MSWD 2JJ2G 1GTOA 4NVPA 4ZI7A 4QIWF 1TA8A 1FXKB 3HKEB 3OD4A 3B77A 1OCCC 5HFLA 1E1RG 2LFRA 1PPJH 2ILMA 4JYYA 2UUCB 2E74B 3JALA 3QNEA 1LNQA 4YY3B 2CAZC 2E3CA 3SJBC 2CH7B 4B3RO 2LFSA 5CB4A 1IBLO 2HVKC 3W7XA 2JVDA 5EYPB 1YHQV 3D3IA 1NTKH 3HPLC 4H13B 4YIPA 1TUEB 3WB0A 1MSDA 2FL4A 3OUSA 1AILA 3ASNC 4JI6O 4B3MB 3T1CA 2EIJC 4JI1B 1PP9H 2B5UA 2X7RB 2JGDB 1J5EB 4O4HB 4FLVA 2KQXA 3DGEA 4CS2A 2QJ1A 3J7AU 1AR1B 3WB2A 1F4NA 3ZJZA 1YVWA 2RCVA 1CEZA 4QGPA 4EFBA 3DTUB 2QTOA 5KX5A 3OR7C 3LDCA 2ZIMA 2XAJA 1BMFG 2LGQA 4UFZA 1WB7A 3ZHQA 1L0NH 2A06H 4AQYO 1GH6A 4K0KB 2GUZB 4LF8O 4K8ZA 2HJDA 2WA4A 1O9GA 5GTHZ 3Q4HA 3CEIA 1B04A 1NR1A 2JEUA 4IYHA 3TETA 2QWPB 3ZBHA 1Q7YW 3N2GB 1NTZH 3FD9A 4UCVA 2Y0IA 1JA8A 2HJFC 1K3EA 1W2BU 4CC6A 1XBLA 1MNGA 1FS0G 5EZYA 1AJQA 3E8HA 1XHZA 1MG1A 1HWYA 1BT8A 2R9AA 4FFBB 3T1HO 2P67A 1M93A 1SA0B 2M7WA 4UUJC 1K33A 2DYRB 4MTFA 2LGWA 2IH1C 4NXMO 5LMNB 3HB3B 4HBNA 2CK3G 4DR3B 1HR0O 4I4TB 1R6KA 1Y76B 3JASB 4I50A 4O4HA 3ICXA 2ZD9A 3U10A 1FAFA 1AJNA 2JJ1G 3T4DA 4LF6B 1W0JG 5GTIZ 3F5TA 3CCLV 1VF5B 3RYIA 1XL6A 4DV4B 1NTMH 2H94A 2W6JG 4DV6B 1GRJA 4UCSA 4MVOA 2IBZH 4EKWA 1QNMA 3H1JH 2QDOA 3A2FA 4DV0B 1QR9A 2QM7A 3ASOB 3QG5A 2XUMA 2ADPA 4PDVA 2EX3A 1WP7A 3BA8A 5IJ0B 1FFTB 1SZTA 4EFEA 4JI5B 4DV1B 1SRYA 1P7BA 1IX9A 2AHYA 2DN9A 5KA5A 5IT9N 1A32A 2YXHA 1GN6A 4IIJA 4WF9V 1KBHA 3ETQA 4X1KB 2FYUH 3O9OA 1K97A 3CRQA 1VF6A 3VBBA 2Q7HA 4GKJO 4JYAB 4YJ3B 3HKDA 3K5NA 1YXBA 1JOYA 3ABMB 2DOSA 3K3WA 2DWDC 1RSOB 2WLNA 1I5YA 3H01A 1K92A 5BMVB 5LMUO 1DTOA 1FJGO 3CE2A 4UVAA 1IZ3A 3K5OA 1KUQA 3JARA 4FM1A 3SR2C 5B1BC 2Q7EA 1F23A 3JYCA 4G2KA 1YDXA 4LFAB 3ZHRA 4CH3A 5CA0A 3AG7A 4LWSB 5KHGA 5LOVB 1R73A 3BFRA 4L8JA 4J80A 4LCUC 4TT3G 3RVZA 4RUEA 1WJZA 3AG4C 5GW7A 4B7EA 2IJIA 3PN1A 3G71V 2QKCA 3K57A 5JJJB 4HNAB 1ZL8B 2CE4A 1DF5A 1MMMA 4J7KA 4JYBA 4FPPA 3HKCB 1XNQO 3UM7A 3SYAA 1KYOF 1TUBB 4I55A 2F4VO 3X2QB 3OMIB 1XMQO 4JZGA 1QCEA 4JV5O 3RYCA 3JAKA 4DR5O 4MTGA 3J80N 3OTFA 4JI7B 4CBCA 2OCCB 2ZNJA 3SYOA 4XDKA 4X66B 3E22B 2OIEA 4MW3A 2IJKA 1SQQH 3GWOA 2YDEA 4X62O 2BOCC 4FLWA 4QE7A 3FB5C 4MSWC 4TV9A 2HVJC 2Q73A 3L72H 2BTOA 1Z5WA 3QO7A 1OV9A 4I9WA 5B5EZ 4LF9O 3H9VA 2JEXA 4DR2O 3AEIA 1Q82W 2F43G 1U97A 4B3TB 4G27B 3ZRWA 1NH2B 4UCTA 4B3SB 3DC5A
chains in the Genus database with same CATH topology
1RFYA 1US6A 2RMKB 1URFA 4DYLA 4NB5A 1CXZB 4IGGA 4NKGB 2HJDA 2Q0OC 1UPGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RFY A;  1US6 A;  2RMK B;  1URF A;  4DYL A;  4NB5 A;  1CXZ B;  4IGG A;  4NKG B;  2HJD A;  2Q0O C;  1UPG A; 
#chains in the Genus database with same CATH topology
 4PJ0 Z;  4NTW A;  1BZK A;  5FPO A;  1ARO P;  3HKC A;  1WP8 A;  4OGQ B;  2NLJ C;  3MDS A;  3SYC A;  4YXW G;  1YJW V;  3H1L H;  3ZRS A;  1D5A A;  2VWK A;  2YS8 A;  1ZAU A;  2NN4 A;  3E86 A;  2UXD B;  2DE0 X;  4DUZ O;  2EIK C;  2UU9 B;  2WPD G;  3SGI A;  4DR1 O;  3LSS A;  5E79 Z;  2CGN A;  2JDI G;  1WB8 A;  3ETE A;  1H8E G;  5BR8 O;  3B8M A;  1XEQ A;  4AHC A;  5F2V O;  4ZOL B;  3JD3 A;  4LF5 O;  1H2S B;  2IU3 A;  3WG7 C;  4JAS A;  3CRC A;  4O4L B;  4TV8 A;  4HAM A;  2QTS A;  2VQF B;  3ZN0 A;  1JX9 A;  4R6Z A;  5CMU A;  2X6B A;  4QNH B;  1N32 B;  2Y48 A;  3LNN A;  3A8T A;  3QO8 A;  3HKB A;  4GYC B;  4MTX A;  5TIS Z;  5JWP A;  2UXB B;  1Y4M A;  4ZKI A;  4UCO A;  4U3F H;  1M57 B;  4TWK A;  2Q67 A;  5KMG B;  3TCU A;  5EBM C;  1KQS U;  4DV7 B;  2D2C B;  2UUC O;  1ENV A;  3CCQ V;  3QTC A;  4X65 B;  3TJT A;  4YY3 O;  5IY5 B;  2HP8 A;  1K5Q A;  2CGO A;  3OGC C;  2YI8 A;  4O2B B;  3AK1 A;  1B06 A;  3J81 N;  3JCZ A;  1WAZ A;  1E79 G;  1H2L A;  2V1D A;  5JVD A;  4H33 A;  3AG3 B;  2Y0P A;  4DRX A;  4B3M O;  3G4S V;  4O4I B;  4JI1 O;  4J7Z A;  1J5E O;  1F7Y A;  1M56 B;  1GK9 A;  4O4J A;  1MZE A;  4F6R B;  2B1G A;  4R8C A;  5B1A B;  4FLX A;  5CBH A;  4J9Y B;  4WFG A;  1K4D C;  1XHX A;  2A3Q A;  2YIC A;  3R65 A;  4K0K O;  2Q0A A;  4DUY B;  3UO3 A;  2PF4 E;  1P84 F;  1K5S A;  1VF6 C;  1W0K G;  1P4R A;  3ZHS A;  5B3S C;  5LA6 A;  5GON A;  4JI4 B;  3RBZ A;  2ADQ B;  1GM9 A;  2ETN A;  4MVM A;  2P7T C;  3NXS A;  3K58 A;  5LP6 B;  1N36 B;  1XNR B;  3SPJ A;  1K4C C;  4X1I B;  4RQF A;  3D8C A;  1Q90 D;  4UB6 Z;  4Q20 A;  1HNZ B;  4K8X A;  4FK5 C;  4DV3 O;  4N21 A;  3P32 A;  3CB2 A;  2ZR3 A;  2Q7G A;  2RDC A;  3AG1 B;  1P7G A;  2V4D A;  1GN3 A;  3JAM N;  5J2T A;  5LMN O;  2YC0 A;  5C8Y B;  4KHP B;  2HEP A;  5B1O A;  3FX7 A;  4DR3 O;  2LP7 A;  1GKF A;  2V7Q G;  1M90 W;  4DR7 B;  1FKA O;  1Y66 A;  2WA3 A;  1QVG U;  2XAH A;  2PYL A;  2EUL A;  3L73 H;  4LF6 O;  4MS2 A;  1KEC A;  1V9P A;  2AW9 A;  5BY1 A;  4DV4 O;  3LSQ A;  4U3J B;  4XDJ A;  4NXN B;  1JFF A;  4X20 B;  2ZIO A;  1ZLZ A;  3UO2 A;  4DV6 O;  2WLK A;  3CCS V;  3DXR B;  3UKM A;  3EFF K;  3BCC H;  2BE3 A;  1QLE B;  3OAA G;  4I0X A;  3CWB H;  4LF7 B;  4DV0 O;  3CRM A;  3SPG A;  2YIB D;  4CZZ A;  5EIB C;  1OCR C;  3GVM A;  2EJ7 A;  4E4E A;  1OCO B;  4GKK B;  3STL C;  1NBM G;  3ABM C;  2GBO A;  5LYJ B;  1FPO A;  3IJ4 A;  4TOI A;  1AB3 A;  3M99 B;  5JQG B;  4JI5 O;  1XDC A;  4DV1 O;  2XAS A;  3B8N A;  2XOK G;  3CRA A;  1HW7 A;  1ZX3 A;  5IYB O;  2XT9 A;  3K9A A;  2P5O A;  4JPR A;  1FYJ A;  2DJV A;  3FYE B;  4UVB A;  4F6E A;  1M1K W;  1OZ0 A;  1SQG A;  1L8D A;  4MW8 A;  4JYA O;  2EZO A;  1EN6 A;  4GZR B;  4J10 A;  1URF A;  3CYO A;  1JJO A;  4BAY A;  2HG5 C;  3T2M A;  4GX0 A;  1NT2 B;  3W7T A;  4P9P A;  2KG7 A;  2ZQM A;  5IWA B;  2ZE7 A;  2ZXW B;  5DN6 G;  5IYZ B;  4XBF A;  2E5L B;  3X2Q C;  3AK2 A;  3L74 H;  4J41 A;  2ZDI A;  2DYS C;  3E8G A;  4BIZ A;  5L3G A;  2WLL B;  1TVK A;  2XND G;  4LFA O;  3VQX A;  1K7D A;  3D3Q A;  1Q86 W;  3RWR D;  2ZR2 A;  2EIN B;  5ITZ B;  3OR6 C;  4N23 A;  3ABL C;  3CPW U;  1WA8 B;  4Z1V A;  5K1P A;  1KKC A;  1AI7 A;  4PA3 A;  5BXZ A;  1RM1 C;  2Z3Y A;  4LFC B;  1S5J A;  4JI0 B;  1AJP A;  4LF4 B;  1FD9 A;  2W0X A;  3CXH F;  2EIM B;  2Q6A A;  1YTF D;  5KHH A;  5J2U B;  1FXK A;  4WFF A;  2QKS A;  1SS3 A;  5IJ9 B;  1K34 A;  3HKE A;  3ABK C;  2RJZ A;  5BZB A;  4ASU G;  1I94 B;  4JI7 O;  1YZB A;  1PM9 A;  4BIU A;  2IM9 A;  4JTD B;  2OTJ V;  1XRE A;  4WFA V;  2CH7 A;  4NKG B;  4X66 O;  2WLM A;  1K73 W;  2UXX A;  4DV3 B;  5EYP A;  2VQE B;  3FAV B;  1OCZ B;  3T1Y B;  4GUN A;  1OJH A;  5IE9 A;  4JI2 B;  3ZMU A;  3CC4 V;  2HHH B;  1CXZ B;  2F93 B;  1XIL A;  3JSL A;  1BSM A;  3EXA A;  2WLJ A;  1EBO A;  1V54 C;  2JGD A;  2E76 B;  4WFH A;  3CCE V;  5C93 A;  4LR3 A;  4B3T O;  3KG2 A;  1SF9 A;  2YI9 A;  4FZ0 A;  4B3S O;  1S0V A;  1JMK C;  4AI8 A;  1GMG A;  3JD1 A;  2R70 A;  2GUZ A;  1SQV H;  4BW5 A;  4X1Y B;  4UB8 Z;  1YJN V;  4YJ2 B;  3N2G A;  2UXD O;  1TAE A;  1M4U A;  2UU9 O;  2Q9L A;  2GV9 A;  3JAW B;  5K1X A;  4LNU B;  3ABU A;  5KUK A;  2BTQ B;  3GWK C;  2Z5U A;  3EVK A;  1JVM A;  4DO2 A;  4FFB A;  1L0L H;  4O2A B;  1QR8 A;  1SA0 A;  4FLT A;  1WNS A;  2VQF O;  3GB7 C;  4TQD A;  3K5M A;  1N32 O;  5LGN A;  4IHJ B;  2Z0A A;  3ZCC A;  2UXB O;  1N34 B;  4JGS A;  3A0B Z;  3K5L A;  3F5W C;  4DV7 O;  1S72 V;  4I4T A;  2DWE C;  1Y76 A;  3JAS A;  2ITD C;  1Q43 A;  2LJ2 A;  2Y69 C;  4X65 O;  1ZSP A;  1JQ0 A;  2PGG A;  1D5N A;  2EZP A;  2XHB A;  3ZMS A;  1BQZ A;  2P22 C;  1SQX H;  3AG2 C;  4DV5 B;  4OPH A;  1X59 A;  2P06 A;  2QE7 G;  1S77 D;  5CA1 B;  1V55 B;  5EK0 A;  2WLH A;  3JD4 A;  4KFM A;  2KB1 A;  1F4M A;  2EIL C;  2QWN B;  4EB6 B;  3SJA C;  4CS3 A;  1AR5 A;  5EIB D;  2K9P A;  4BIO A;  1M5I A;  2X6C A;  2OT5 A;  1Q6U A;  1BGY H;  1PNK A;  1B6Q A;  3IGA C;  5FPR A;  4GT1 A;  5IJ0 A;  2ITC C;  3F7V C;  3M8A A;  3JSN A;  3AG1 C;  3SPI A;  1H2M A;  1UPG A;  2XAQ A;  4QPK A;  3LDD A;  4DUY O;  1FXH A;  2F23 A;  4F4L A;  1OCC B;  2OTL V;  4X1K A;  4NTX A;  2BSK B;  3G6E V;  2QSA A;  3I5D A;  3BA9 A;  3CSX A;  4JI4 O;  1YI2 V;  4OXS A;  3JD0 A;  3UCS C;  4YJ3 A;  3MD0 A;  1N36 O;  1ROP A;  3ZMT A;  1XNR O;  3STZ C;  2PI4 A;  2FTK A;  5LGU A;  3CJH B;  1HNZ O;  2MK3 A;  3N2K B;  1RSO A;  1LR1 A;  5BMV A;  1SC5 B;  3OMA B;  3TXS A;  1VIB A;  3H1I H;  4X64 B;  2ZDI C;  3ASN B;  1EM1 A;  3KCY A;  2WLI B;  1MAB G;  3OTO B;  5FL7 G;  2QR4 A;  2IH3 C;  1GO3 F;  1AI6 A;  4LH7 A;  3CP1 A;  2AZ0 A;  4KHP O;  2EIJ B;  3OM3 B;  4U7N A;  5JJE B;  1LUW A;  3ETD A;  4TUY B;  1KP2 A;  1OCO C;  2X0L A;  3CCJ V;  3UT5 B;  4DR7 O;  1D2D A;  4LWS A;  5LOV A;  1NU1 H;  4D7T A;  5JH7 B;  1HNW B;  2YXL A;  3A0H Z;  5CA3 A;  4CH4 A;  4NXN O;  4FZ1 A;  4OX9 B;  4I9Q A;  4FLZ A;  1PL4 A;  1VF7 A;  5DM6 V;  2R9R B;  1B3Q A;  4HNA A;  1ZL8 A;  2PTM A;  2YID A;  3JAT B;  1FXK C;  2YXY A;  4D6T H;  4LF7 O;  1TUB A;  4RUF A;  1HP8 A;  4DXW A;  1VQ9 V;  1N33 B;  2A0L A;  1KP3 A;  2P4V A;  1VP7 A;  4R7C A;  5LL6 Y;  4GKK O;  3F7Y C;  3HR0 A;  4FJC C;  3RW0 A;  2K1E A;  1K8A W;  4JI3 B;  5L3F A;  3K9S A;  5DED A;  3OGI B;  4X9Q A;  3E22 A;  4KXR A;  2UXN A;  2G38 A;  3JD2 A;  5DEC A;  5FLX N;  2HKO A;  2KKW A;  3U0Z A;  5FNV B;  1NVP D;  3C90 A;  3KKY A;  2PZS A;  2KSD A;  3VQW A;  4UV9 A;  1YCI A;  3ZS8 C;  3N27 A;  3RYF B;  1BE3 H;  2FKX A;  1FFX B;  3P3N A;  4IYI A;  1IBM B;  2LW1 A;  1YIJ V;  2N04 A;  4DR4 B;  5IDJ A;  5IWA O;  1Y74 B;  4MVS A;  1RPO A;  1GN2 A;  1XMO B;  4H0L B;  2E5L O;  2P4K A;  1DF4 A;  5LXT B;  1VAR A;  1S5L Z;  3L71 H;  3VQV A;  4BWA A;  2YEV B;  4DW0 A;  4FFK A;  4JYC A;  5KHJ A;  2GTA A;  2RNB A;  4DV2 B;  3LNM B;  3RYH B;  5A9G A;  3B2E E;  1O9H A;  2CTR A;  4CS4 A;  5L3C A;  2LO1 A;  2R72 A;  3OMN B;  4PA6 A;  1S5H C;  3FYI B;  1UFI A;  5L3D A;  4LFC O;  2QA4 V;  4JI0 O;  4ZOL A;  2DYR C;  1DK1 A;  1SQP H;  4LF4 O;  4ZHQ B;  4E2L A;  4O4L A;  1LUV A;  1EN4 A;  1GM8 A;  1G8M A;  2R9I A;  1R3I C;  3BRC A;  3K0G A;  1Z2G A;  2YIA A;  4H37 A;  2Q5Z A;  5KMG A;  3KZI Z;  4Q6G A;  4HYO A;  1MOF A;  1I94 O;  1FFX A;  1Q3E A;  2Q0O C;  3JCU Z;  1YEW A;  4UV8 A;  2RMK B;  1YJ9 V;  1BHA A;  4OPA A;  4O2B A;  1IXM A;  5LHG A;  2VQE O;  5KHI A;  3QVN A;  5B1B B;  2F1M A;  3T1Y O;  2JRI A;  3LDE A;  1Q8I A;  4RWU A;  1DLB A;  1WPX A;  1K9M W;  4BW9 A;  2YEV A;  4JI2 O;  2HHH O;  1IXB A;  1QHT A;  3ASO C;  4ZBM A;  3RN4 A;  2JIZ G;  4P2Z A;  3UQ8 A;  2PY5 A;  2FML A;  3QO5 A;  3RYH A;  4O4I A;  3CRR A;  1HNX B;  5E1A C;  3CCR V;  3AG4 B;  4I7Z B;  2CTW A;  5H2F Z;  4F6R A;  4ZI7 B;  2ZT9 B;  5EC2 C;  4PA9 A;  1SZX A;  3ZMZ A;  1RPR A;  4ZHQ A;  3SJQ C;  2CDY A;  3G67 A;  3OE7 G;  4CH6 A;  3JAL B;  2UXC B;  4FVM A;  2JS5 A;  2RN9 A;  1G1X B;  2EBO A;  4PA4 A;  1Q6I A;  5L3B A;  4KP4 A;  2AZ2 A;  3OW2 U;  3BAB A;  5LP6 A;  1VQO V;  3IC7 A;  4X1I A;  2OWO A;  1QBZ A;  3CHX A;  1VQ6 V;  1J95 A;  5D5P A;  1BS3 A;  2PI5 A;  3H1H H;  1IUR A;  2N74 A;  1U96 A;  5A2Q N;  4H44 B;  3RT3 C;  1JCH A;  1R3J C;  3L75 H;  5C8Y A;  1YIT V;  5JCO A;  1N34 O;  4K3A A;  5IYC O;  3WB1 A;  3K03 A;  4ABM A;  5KX5 B;  4IL6 Z;  1PNL A;  3ZHV A;  1JJ2 U;  3QF7 A;  4LH6 A;  4P9O A;  3LSU A;  4PDM A;  2Q69 A;  2XTA A;  4U3J A;  1NJI W;  3B40 A;  3Q4H B;  4DV5 O;  4U7O A;  3FB6 C;  4X20 A;  3ZRV A;  1QLN A;  2YIB A;  1I7F A;  3OEH G;  3DXR A;  1SQB H;  3K0D A;  3G80 A;  2YUA A;  4MT8 A;  2EIK B;  4IGG A;  5EZY B;  4CC5 A;  2ZM6 B;  2M6Y A;  2OCC C;  4L87 A;  2IJJ A;  3OUF A;  2QWQ B;  4DR6 B;  5LYJ A;  2XAG A;  3M7M X;  3WG7 B;  4IT5 A;  1YTF B;  2PUS A;  2ARH A;  2HR3 A;  4PDR A;  5JQG A;  2HFE C;  4WFE A;  2VRZ A;  1QU7 A;  2X6A A;  4YHH B;  4LFB B;  1EFR G;  2Y4T A;  5LHI A;  5B66 Z;  4I50 B;  1KU9 A;  1N4C A;  1XOU A;  5LHH A;  2F66 C;  1IBK B;  4JI8 B;  1MA1 A;  4JTC B;  3RYI B;  1NZ6 A;  3FB8 C;  2IW5 A;  3S3W A;  1VQ4 V;  2AHZ A;  1P49 A;  2ATK C;  1PKX A;  4R50 A;  3ZMV A;  4GX1 A;  1XI1 A;  3T4Z A;  4YIO A;  3H1K H;  1JR9 A;  2F95 B;  3D36 A;  1Z5V A;  5EC1 C;  3EHB B;  4X88 A;  2HLD G;  2DMX A;  1PL0 A;  3W7U A;  3CC7 V;  2CUG A;  4X64 O;  1NQT A;  2LW7 A;  4PA7 A;  5IYZ A;  3OTO O;  1XQ8 A;  4MVZ A;  3ZRX A;  4PEL A;  4K35 A;  2WLL A;  2RQ6 A;  5KUM A;  4FM2 A;  1CP9 A;  5ITZ A;  1WA8 A;  4X89 A;  1I0H A;  5L3E A;  1HNW O;  2JK5 C;  1GM7 A;  3ABT A;  1HDJ A;  4IIJ B;  4PHZ A;  4TSF G;  3ZX6 A;  4OX9 O;  1ZTE A;  4WBN B;  2QEX V;  2AXT Z;  3CS5 A;  4NYK A;  2W0F C;  1VQ8 V;  5B3S B;  2OYQ A;  3FKS G;  2A79 B;  1Q81 W;  4UCR A;  3HKD B;  1M57 C;  3K08 A;  1F51 A;  5J2U A;  1AI4 A;  2O57 A;  2PYJ A;  1GN4 A;  5IJ9 A;  1N33 O;  5HFM A;  2QM4 A;  4MVQ A;  2AGA A;  3TK1 A;  4JZ2 A;  5IY5 C;  3SPC A;  4PV1 B;  1WN7 A;  4JI3 O;  2NR5 A;  3JAR B;  3SPH A;  2L6L A;  4LP8 A;  1H2K A;  3WU2 Z;  1MZF A;  2WSS G;  3FAV A;  3B4S A;  5KHK A;  5CA0 B;  1R3L C;  3AG3 C;  1N0J A;  2IJH A;  2DQ3 A;  2UUA B;  1WPB A;  1M56 C;  3W7S A;  2QWO B;  4J42 A;  4WFB V;  3ETG A;  1M9N A;  1IBM O;  2OIG A;  2UUB B;  1COW G;  2C2A A;  3TXQ A;  2N05 A;  4CH5 A;  4MVU A;  4PI0 A;  2IU0 A;  1KMI Z;  5B1A C;  4DR4 O;  3RFR A;  4I55 B;  4WBN A;  1Q5O A;  5D5Q A;  3CX5 F;  1ZWI C;  1XMO O;  3RYC B;  4RQE A;  3JAK B;  5H9C A;  4JF3 A;  1OCR B;  4MVR A;  4X1Y A;  3L9D A;  4RAI A;  3OT7 A;  4DV2 O;  4FLU A;  3CCM V;  4YJ2 A;  1N0N A;  4B3R B;  5KLV H;  3VOU A;  4NB5 A;  1VQK V;  5LP6 C;  3DC6 A;  1H2G A;  1IBL B;  1VQL V;  1I5X A;  3JAW A;  1JPX A;  4LNU A;  1S76 D;  2BTQ A;  4UCU A;  1SET A;  1IVS A;  1T5E A;  4TV9 B;  1TGO A;  3RGB A;  4O2A A;  4PI2 A;  4JI6 B;  3BAA A;  4DW1 A;  5CBF A;  4J11 A;  5JCO C;  1L1F A;  2ODM A;  4XDL A;  1SKV A;  4IHJ A;  1RP3 B;  4PDL A;  3ZHT A;  4FLY A;  4I5S A;  3ZRW B;  2CTP A;  1XUQ A;  3OEE G;  4AQY B;  1AR4 A;  4JAA A;  1PD3 A;  3A0R A;  4LF8 B;  1QVF U;  4B08 A;  3C3T A;  5KA6 A;  4TQF A;  5KAI Z;  3BHP A;  1H2N A;  2DYS B;  1QLE C;  1THZ A;  1UJW B;  4QPJ A;  5CA1 A;  2ZCE A;  2A7W A;  3IC9 A;  4EB6 A;  1EZJ A;  3ABL B;  2A9H A;  1HNX O;  3WFV A;  1EZV H;  3W7W A;  1RM1 B;  3ZHU A;  3T1H B;  1OHH G;  1R1B A;  3APO A;  4TV8 B;  3E35 A;  3CD6 V;  1G6U A;  1VQP V;  5JJN B;  4NXM B;  1XL4 A;  5KAF Z;  3HKB B;  2Q4P A;  2VWJ A;  1R3K C;  4PD4 F;  5H5N A;  3ZED A;  1HR0 B;  3K59 A;  1H38 A;  3SJC C;  3CC2 V;  1QQC A;  3ABK B;  2UXC O;  4AIL C;  3I56 V;  3E8F A;  2BSK A;  3CME V;  1N8R W;  3ZN1 A;  2GTS A;  1Q6H A;  1PNM A;  4J7J A;  3D36 C;  1VMG A;  3SYQ A;  1BHB A;  2YSU B;  2FB5 A;  3CMA V;  4ICG A;  2ZXW C;  3BEH A;  1NH2 D;  3CJH A;  3N2K A;  5JVD B;  3THO A;  3BPZ A;  4DRX B;  1NVP B;  4KL1 A;  4JTA B;  4KUM A;  5EBW C;  2WLI A;  3B09 A;  3LUT B;  4BR6 A;  3PJS K;  2ZNI A;  1V54 B;  2CTQ A;  4Z2W A;  4O4J B;  2EIN C;  4TUY A;  4P30 A;  3UT5 A;  4G28 B;  4GX5 A;  3K04 A;  4LC1 A;  5EBL C;  2Q68 A;  4FM0 A;  1SQF A;  2QGN A;  1E1Q G;  3VQY A;  5JH7 A;  4W4K A;  2ZIN A;  3I55 V;  5H6R A;  3RVY A;  1H8H G;  2EIM C;  3P30 A;  5LA6 B;  5CBG A;  5GON B;  2GHY A;  2VS0 A;  1VQ7 V;  3JAT A;  2EJR A;  4GKJ B;  4QJF B;  3P3P A;  3MAQ A;  4DK0 A;  3E83 A;  1DGS A;  4UVC A;  2H8P C;  1VQN V;  3FB7 C;  2ZM6 O;  2ZKO A;  2OCH A;  5LMU B;  2WWW A;  2GDS A;  3SYP A;  1KD1 W;  2B1I A;  1FJG B;  4DR6 O;  1EN5 A;  4FMT A;  5J2T B;  2D3O W;  3MHH C;  2L35 A;  3C3S A;  1OCZ C;  4J9Z B;  4UXN A;  3L70 H;  3ML0 A;  4YHH O;  4LFB O;  1IDS A;  4JAU A;  3CCU V;  1SER A;  1IBK O;  5IYD O;  3IFX A;  1YF2 A;  5FNV A;  4ZIB A;  4JI8 O;  1NKD A;  3DSQ A;  3AK3 A;  2Y69 B;  2DW4 A;  3E2E A;  4A5U B;  2WAM A;  4DK1 A;  1AI5 A;  1JFF B;  1S3J A;  3RYF A;  4GLX A;  3SDL A;  4D7S A;  1W59 A;  2JS3 A;  2JGU A;  1ZUQ A;  3S3X A;  3AG2 B;  2W6I G;  4W4L A;  1BCC H;  1NR7 A;  1XNQ B;  2P90 A;  4I0X B;  3O65 A;  1Y6X A;  1R6N A;  4B7K A;  4JAV A;  1Y74 A;  2F4V B;  1BL8 A;  5B1N A;  3NR7 A;  1VQ5 V;  1XMQ B;  3FFQ A;  1US6 A;  4JV5 B;  2EIL B;  5LXT A;  3TGU H;  4DR5 B;  5H6Q A;  3MHS C;  4Z1M G;  1KC8 W;  3CXC U;  2GSM B;  1R6T A;  3IAY A;  1WLE A;  2LQT A;  2QM8 A;  1YSC A;  2ZE8 A;  1KKD A;  4NTY A;  4QE9 A;  1BQ0 A;  1AP6 A;  3E89 A;  3BVO A;  4FIP C;  4X62 B;  2B9Z A;  3ZIA G;  2BOB C;  4WCE V;  1NS1 A;  1AVM A;  4GCZ A;  1GAX A;  3OFN G;  2Y4U A;  2P6J A;  2MW2 B;  4LF9 B;  2DQ0 A;  1VQM V;  5CN0 A;  4RO2 A;  4HZ3 A;  2BCC H;  5AG2 A;  3BY6 A;  4NR1 A;  4DR2 B;  1VEW A;  1ORQ C;  3G6B A;  1X4T A;  2KG7 B;  5J9P C;  5CB4 B;  3CCV V;  1I08 A;  4GX2 A;  4LBE C;  1AP5 A;  1PV0 A;  4MTO A;  3KCX A;  1G4Y B;  5LBQ A;  1Y67 A;  2E75 B;  2XAF A;  2ZE6 A;  4C7U A;  4EEQ A;  3U11 A;  1CPY A;  1TVK B;  1V55 C;  1RFY A;  4DYL A;  3K06 A;  1KB9 F;  4X8A A;  4DUZ B;  3APQ A;  2Q8V A;  1SES A;  3K79 A;  1NI8 A;  4DR1 B;  1FXV A;  3R66 A;  2UUA O;  5BR8 B;  2ZE5 A;  5LGT A;  2H3O A;  2QWR B;  3E8B A;  2NNU A;  2QKA A;  4LF5 B;  2UUB O;  1MSW D;  2JJ2 G;  1GTO A;  4NVP A;  4ZI7 A;  4QIW F;  1TA8 A;  1FXK B;  3HKE B;  3OD4 A;  3B77 A;  1OCC C;  5HFL A;  1E1R G;  2LFR A;  1PPJ H;  2ILM A;  4JYY A;  2UUC B;  2E74 B;  3JAL A;  3QNE A;  1LNQ A;  4YY3 B;  2CAZ C;  2E3C A;  3SJB C;  2CH7 B;  4B3R O;  2LFS A;  5CB4 A;  1IBL O;  2HVK C;  3W7X A;  2JVD A;  5EYP B;  1YHQ V;  3D3I A;  1NTK H;  3HPL C;  4H13 B;  4YIP A;  1TUE B;  3WB0 A;  1MSD A;  2FL4 A;  3OUS A;  1AIL A;  3ASN C;  4JI6 O;  4B3M B;  3T1C A;  2EIJ C;  4JI1 B;  1PP9 H;  2B5U A;  2X7R B;  2JGD B;  1J5E B;  4O4H B;  4FLV A;  2KQX A;  3DGE A;  4CS2 A;  2QJ1 A;  3J7A U;  1AR1 B;  3WB2 A;  1F4N A;  3ZJZ A;  1YVW A;  2RCV A;  1CEZ A;  4QGP A;  4EFB A;  3DTU B;  2QTO A;  5KX5 A;  3OR7 C;  3LDC A;  2ZIM A;  2XAJ A;  1BMF G;  2LGQ A;  4UFZ A;  1WB7 A;  3ZHQ A;  1L0N H;  2A06 H;  4AQY O;  1GH6 A;  4K0K B;  2GUZ B;  4LF8 O;  4K8Z A;  2HJD A;  2WA4 A;  1O9G A;  5GTH Z;  3Q4H A;  3CEI A;  1B04 A;  1NR1 A;  2JEU A;  4IYH A;  3TET A;  2QWP B;  3ZBH A;  1Q7Y W;  3N2G B;  1NTZ H;  3FD9 A;  4UCV A;  2Y0I A;  1JA8 A;  2HJF C;  1K3E A;  1W2B U;  4CC6 A;  1XBL A;  1MNG A;  1FS0 G;  5EZY A;  1AJQ A;  3E8H A;  1XHZ A;  1MG1 A;  1HWY A;  1BT8 A;  2R9A A;  4FFB B;  3T1H O;  2P67 A;  1M93 A;  1SA0 B;  2M7W A;  4UUJ C;  1K33 A;  2DYR B;  4MTF A;  2LGW A;  2IH1 C;  4NXM O;  5LMN B;  3HB3 B;  4HBN A;  2CK3 G;  4DR3 B;  1HR0 O;  4I4T B;  1R6K A;  1Y76 B;  3JAS B;  4I50 A;  4O4H A;  3ICX A;  2ZD9 A;  3U10 A;  1FAF A;  1AJN A;  2JJ1 G;  3T4D A;  4LF6 B;  1W0J G;  5GTI Z;  3F5T A;  3CCL V;  1VF5 B;  3RYI A;  1XL6 A;  4DV4 B;  1NTM H;  2H94 A;  2W6J G;  4DV6 B;  1GRJ A;  4UCS A;  4MVO A;  2IBZ H;  4EKW A;  1QNM A;  3H1J H;  2QDO A;  3A2F A;  4DV0 B;  1QR9 A;  2QM7 A;  3ASO B;  3QG5 A;  2XUM A;  2ADP A;  4PDV A;  2EX3 A;  1WP7 A;  3BA8 A;  5IJ0 B;  1FFT B;  1SZT A;  4EFE A;  4JI5 B;  4DV1 B;  1SRY A;  1P7B A;  1IX9 A;  2AHY A;  2DN9 A;  5KA5 A;  5IT9 N;  1A32 A;  2YXH A;  1GN6 A;  4IIJ A;  4WF9 V;  1KBH A;  3ETQ A;  4X1K B;  2FYU H;  3O9O A;  1K97 A;  3CRQ A;  1VF6 A;  3VBB A;  2Q7H A;  4GKJ O;  4JYA B;  4YJ3 B;  3HKD A;  3K5N A;  1YXB A;  1JOY A;  3ABM B;  2DOS A;  3K3W A;  2DWD C;  1RSO B;  2WLN A;  1I5Y A;  3H01 A;  1K92 A;  5BMV B;  5LMU O;  1DTO A;  1FJG O;  3CE2 A;  4UVA A;  1IZ3 A;  3K5O A;  1KUQ A;  3JAR A;  4FM1 A;  3SR2 C;  5B1B C;  2Q7E A;  1F23 A;  3JYC A;  4G2K A;  1YDX A;  4LFA B;  3ZHR A;  4CH3 A;  5CA0 A;  3AG7 A;  4LWS B;  5KHG A;  5LOV B;  1R73 A;  3BFR A;  4L8J A;  4J80 A;  4LCU C;  4TT3 G;  3RVZ A;  4RUE A;  1WJZ A;  3AG4 C;  5GW7 A;  4B7E A;  2IJI A;  3PN1 A;  3G71 V;  2QKC A;  3K57 A;  5JJJ B;  4HNA B;  1ZL8 B;  2CE4 A;  1DF5 A;  1MMM A;  4J7K A;  4JYB A;  4FPP A;  3HKC B;  1XNQ O;  3UM7 A;  3SYA A;  1KYO F;  1TUB B;  4I55 A;  2F4V O;  3X2Q B;  3OMI B;  1XMQ O;  4JZG A;  1QCE A;  4JV5 O;  3RYC A;  3JAK A;  4DR5 O;  4MTG A;  3J80 N;  3OTF A;  4JI7 B;  4CBC A;  2OCC B;  2ZNJ A;  3SYO A;  4XDK A;  4X66 B;  3E22 B;  2OIE A;  4MW3 A;  2IJK A;  1SQQ H;  3GWO A;  2YDE A;  4X62 O;  2BOC C;  4FLW A;  4QE7 A;  3FB5 C;  4MSW C;  4TV9 A;  2HVJ C;  2Q73 A;  3L72 H;  2BTO A;  1Z5W A;  3QO7 A;  1OV9 A;  4I9W A;  5B5E Z;  4LF9 O;  3H9V A;  2JEX A;  4DR2 O;  3AEI A;  1Q82 W;  2F43 G;  1U97 A;  4B3T B;  4G27 B;  3ZRW A;  1NH2 B;  4UCT A;  4B3S B;  3DC5 A; 
#chains in the Genus database with same CATH homology
 1RFY A;  1US6 A;  2RMK B;  1URF A;  4DYL A;  4NB5 A;  1CXZ B;  4IGG A;  4NKG B;  2HJD A;  2Q0O C;  1UPG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...