1US6A

Crystal structure of the quorum-sensing protein tram from agrobacterium tumefaciens at 1.65 ang. resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
90
structure length
90
Chain Sequence
VELRPLIGLTRGLPPTDLETITIDAIRTHRRLVEKADELFQALPETYKTGQACGGPQHIRYIEASIEMHAQMSALNTLYSILGFIPKVVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription repressor
molecule keywords TRANSCRIPTIONAL REPRESSOR TRAM
publication title Crystal Structure of the Quorum-Sensing Protein Tram and its Interaction with the Transcriptional Regulator Trar
pubmed doi rcsb
source organism Agrobacterium tumefaciens
total genus 34
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09228 Prok-TraM Prokaryotic Transcriptional repressor TraM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.160 Mainly Alpha Orthogonal Bundle Helix Hairpins HR1 repeat 1us6A00
1US6A 2RMKB 1CXZB 1URFA 2Q0OC 4DYLA 1RFYA 2HJDA 4NB5A 1UPGA 4NKGB 4IGGA
chains in the Genus database with same CATH superfamily
4BW9A 1K34A 1SA0B 3P3NA 2JJ2G 4X66O 2KB1A 1NT2B 1TUEB 5KAIZ 4X64B 5EZYB 4B7EA 2ITDC 5KHKA 4UCTA 4R8CA 3AG3B 1VIBA 4IHJA 4TUYA 4JTDB 2YUAA 4J9YB 4MVSA 5B1NA 5BY1A 3CCVV 4BWAA 4P9PA 3FKSG 3CRQA 1M93A 1OCOC 3J7AU 4HNAB 5L3DA 3LNMB 4LWSA 2H3OA 3AK1A 2BE3A 4KHPB 4DUZB 4FM0A 4GX1A 3JATB 2PUSA 2VWJA 2HJDA 4DV5O 1XMQB 3UT5B 1FFXB 2XASA 2YEVB 2RJZA 2IBZH 1HNWO 5C8YB 3UCSC 2FYUH 1VQNV 1M57C 1CPYA 4NVPA 5GONB 3ZHTA 1AI4A 4UCSA 3SJQC 3SGIA 3CCLV 1VQ5V 5EK0A 1SQVH 3RW0A 2WLHA 4TWKA 1I94O 2QM8A 2UXDO 2DWEC 1F7YA 5LGTA 3SYCA 5J2UB 3AEIA 1RSOB 1B06A 2ZE6A 3MAQA 4B3SO 1XNQB 2RN9A 4O2BB 3M7MX 1K33A 4JYBA 5IYZA 2JS5A 1JCHA 5H2FZ 1XL4A 2ZNJA 1THZA 5ITZA 3FD9A 5B1AC 1PNMA 5JJNB 1FKAO 3RYHB 3APOA 4JI6O 3E35A 4PDLA 1M57B 4MVRA 4MS2A 1Y74A 3WU2Z 3CXHF 4UB6Z 5KAFZ 5FPRA 3CJHB 4MVMA 1PPJH 1EN5A 4KL1A 4J41A 2QEXV 5IWAB 1SQXH 1AJQA 3JAWA 4I5SA 5B1OA 3JD1A 4B3TB 4DUYO 1BGYH 1WN7A 3HKDA 4MTXA 4FFBB 3MD0A 3BVOA 3ZN1A 4IIJA 3CMEV 4UVBA 1NR7A 4ASUG 3ZHSA 2P90A 5B1AB 4YHHO 2Q67A 3W7SA 1VF7A 3OGCC 3DC5A 3E2EA 2A3QA 2CGNA 2E74B 3W7XA 3BFRA 2Q9LA 3ZMVA 4FZ0A 2WLLB 3OUSA 3AK3A 1GO3F 4JI4O 3STZC 2VRZA 3GWKC 4TQFA 5DEDA 2Q7HA 4Q20A 4CS4A 2V1DA 1GM7A 1WAZA 3VQVA 1WPBA 4I50B 5TISZ 2K9PA 1NS1A 1Q82W 3B8MA 2P4KA 1OCRC 5KHHA 1WA8B 1AILA 4PHZA 1HR0O 1BHBA 3CX5F 5LP6C 1YI2V 4JTAB 1OCZC 4P30A 1XUQA 4K8ZA 3OMNB 1FPOA 3LSSA 1Y66A 2A06H 3FYIB 1AI6A 3PN1A 4P9OA 4H13B 1S77D 1JJ2U 1RM1C 2IM9A 2WLIB 5J2TB 4WCEV 1GTOA 1RFYA 4LFCO 4YY3B 2Q0AA 3IFXA 4LF6O 1NI8A 1OCRB 2F43G 1QLNA 1YHQV 4O4JB 4WFHA 4B3MO 4FK5C 3C3SA 5KX5B 5LP6B 2YXLA 1OCZB 4QJFB 3HB3B 4DRXB 3ZHRA 5EZYA 4F4LA 5JQGB 2PGGA 1GK9A 4DR5B 2GTSA 5IYBO 3A2FA 1JQ0A 2GDSA 3ETEA 1FAFA 4PDRA 1RM1B 2AW9A 4GKKB 1MA1A 3OMIB 2EX3A 2CH7A 1V55C 3B09A 1FFTB 1VP7A 3JSNA 2ZT9B 2NNUA 4DK0A 3JATA 3U10A 4JYCA 3SJCC 4ICGA 1GN4A 3G4SV 2R72A 3DXRB 2V7QG 1WPXA 1FXKA 1QLEB 4DV1O 1R3KC 1Q43A 5GONA 4LF7B 2UXCB 3E86A 4LC1A 5LYJA 4CH3A 1VQ9V 3E8HA 2UU9O 1Y76A 5B1BC 1CP9A 3HKEA 1KB9F 2ZNIA 2ZCEA 1V55B 5J2UA 2HKOA 2N04A 2FKXA 3SYPA 5LHIA 3GVMA 3W7TA 1M9NA 5EYPB 4DR1O 4O2BA 3H1JH 5EBLC 4BIZA 4JI8O 5IJ0B 4FIPC 2QKSA 4X1IB 5CA0A 4CBCA 4HZ3A 1EZVH 2DYSB 4JYYA 3RYHA 2DW4A 4AILC 3JD4A 3HR0A 3T1CA 1ZL8B 1VMGA 4X88A 4LNUA 5BXZA 5CBHA 2VQFO 3CJHA 3ASNC 4DV7O 1GMGA 2QSAA 5B1BB 1YDXA 3K0DA 4JAVA 4X1KB 1H2NA 4DK1A 1SF9A 2F1MA 4FFBA 1XL6A 3M99B 3CCRV 4DXWA 2OTJV 2X6BA 1J5EB 1WJZA 2YDEA 4EFEA 2ARHA 2XTAA 2XNDG 1N0JA 5E79Z 1TAEA 1K9MW 1BE3H 1WB7A 3K03A 4CC6A 4BIUA 1TVKB 2IU3A 2D3OW 1MSDA 4J42A 3CCQV 1IBLO 4FVMA 4QPKA 2Y4TA 2Y0IA 4OGQB 4FLVA 4IHJB 4TUYB 2IH1C 2CE4A 2YI9A 1JPXA 3E8GA 1Y4MA 2YI8A 4JI7B 1TUBA 2XAQA 2F4VB 5LMNO 4PJ0Z 2EINC 1ZTEA 2X6AA 3JASB 4MSWC 1N32B 4NXMB 2DE0X 1K4CC 5JCOC 1F23A 4OX9O 1DTOA 2DOSA 3L70H 4GKJB 4RWUA 4LF8B 5LMUB 2CK3G 1DF5A 1US6A 2P4VA 3X2QC 5IYCO 3D36C 5LA6B 3T1HB 4JV5O 3QO5A 1S3JA 2LW1A 4GCZA 4KFMA 2UXBO 1K73W 2WLIA 5J2TA 2EINB 1QHTA 4JI5B 5CBGA 2F93B 4K3AA 1E1RG 4CH4A 3CC4V 4RQEA 1FJGO 4ZBMA 5B5EZ 2Q5ZA 1F51A 3ML0A 2LQTA 4FPPA 5IYZB 2CUGA 4UUJC 1Q6UA 4GX5A 1H2SB 3LNNA 1AR4A 4O4JA 4UCOA 5ITZB 4JYAB 4DW0A 1S76D 2WAMA 5LP6A 2HLDG 2HHHB 2HR3A 1Y74B 1N36O 3X2QB 1K97A 2R9AA 5CB4B 2EULA 3G71V 4L8JA 4YIPA 4WFEA 2VS0A 4QPJA 2L6LA 1NVPD 1VARA 2BOBC 4EFBA 4DR6O 1O9GA 3JAWB 5IDJA 3LDDA 4YJ3A 3FB5C 1BCCH 2AHZA 1H8EG 1PNKA 2JRIA 1PL0A 4PD4F 4PI2A 3DXRA 2X7RB 3K79A 3CS5A 1QNMA 1IBKB 2F23A 1FYJA 5L3CA 5H5NA 3CP1A 4PDVA 1YJWV 3LDEA 3ZJZA 4X89A 4DV6B 4NYKA 2QA4V 1TGOA 2LGQA 5LXTB 2PTMA 3I56V 3MHSC 5JJJB 4KHPO 4DUZO 2XAJA 1XMQO 2IJHA 1MZFA 1K7DA 1S5LZ 2ITCC 4DYLA 5FNVA 1IURA 5BR8B 4TV8B 2DYRC 1IXBA 5IJ0A 3ASOC 4XDLA 3ZMTA 5D5PA 3E8BA 4B3RB 3QO7A 1U96A 4H44B 4F6RA 3QF7A 3ZIAG 1L0LH 4JI1B 1YIJV 2DQ0A 1AJPA 1ZL8A 4MVUA 3S3WA 4DO2A 1K8AW 2JEUA 3EFFK 4DR3B 4RUFA 3WFVA 1AB3A 4RQFA 3CC7V 4MT8A 4DV0O 3H1LH 5L3FA 5L3BA 1MSWD 3W7WA 1QR8A 1JMKC 4X1KA 1K5QA 5JJEB 2QWRB 2DYRB 2ZIOA 3ASOB 1AP6A 4LF5O 1I08A 3DTUB 1D5NA 2JS3A 4KP4A 1FXKC 2DN9A 2M7WA 2FL4A 4L87A 4UV8A 3G67A 2PYLA 1RPOA 1JVMA 1KBHA 1SESA 1TVKA 3ABKC 2B1IA 1KP3A 1WLEA 3ABTA 1JJOA 2XAHA 3B40A 1OHHG 4FZ1A 5BMVA 4B3TO 1XNRO 3FX7A 1N33O 5LHGA 2CH7B 3CRAA 2DQ3A 5K1XA 5KHJA 2OCCC 3JASA 5E1AC 4LFBO 4NB5A 2Y0PA 3JARA 3OMAB 4J10A 1K5SA 2CTPA 1FXKB 2ZDIC 3SYQA 4FJCC 1BT8A 1W2BU 4FLTA 1R3JC 3ABKB 4NXNB 2IU0A 5J9PC 3ZN0A 4UCUA 3VOUA 3ABUA 5LYJB 3FYEB 5LA6A 5HFLA 2PI4A 4UFZA 3SJBC 2E76B 1RP3B 1Y76B 1SQBH 4X65B 3HKEB 3B77A 1SRYA 3K5LA 4DV2B 1OCOB 1F4NA 2OCCB 2B9ZA 4MVZA 5LHHA 3AG7A 3OTFA 2YIBA 4G2KA 4EKWA 4Z2WA 5JCOA 1X59A 1I5YA 5EIBD 5CA0B 1VQOV 1NZ6A 1KP2A 2BTOA 4WFAV 1SQQH 5B66Z 1AI5A 1G8MA 1HNZB 1OZ0A 2QJ1A 4K0KB 4E2LA 1ZX3A 1AROP 4FLUA 1NBMG 1D2DA 5CB4A 3D36A 4X9QA 4WF9V 4LNUB 1AR1B 3ABLC 5EBWC 1BHAA 2GV9A 5IE9A 3QVNA 4PI0A 1K92A 1SS3A 4YY3O 1SKVA 4I4TA 3C90A 2LGWA 2NN4A 1Y6XA 1PV0A 2Z3YA 3CWBH 4JI2O 1GM8A 3M8AA 2EZOA 2B1GA 1Q6IA 3ZRWA 4X66B 3ZMUA 3OTOO 1NU1H 2YIBD 4NKGB 4O4IA 2XAGA 1W59A 5L3GA 2UUCB 4GX0A 3H1HH 2JK5C 3JD3A 2NLJC 1N0NA 2WLJA 1KD1W 2UUBO 1N4CA 3ABLB 1RPRA 3STLC 4GKKO 3CSXA 5LXTA 4YXWG 3ABMC 4J7KA 1Q5OA 4DV5B 2GUZB 1TUBB 1PL4A 1SZTA 4WFBV 1T5EA 2OIEA 3KCYA 1HNWB 1SC5B 1FXHA 3K06A 4TV8A 2QE7G 1Q8IA 2E3CA 2N74A 5DECA 1VEWA 3A0HZ 3CC2V 3N27A 3F5TA 2UXCO 3OEEG 5CN0A 2BSKB 4NTXA 4D6TH 2UXDB 5KHGA 3BEHA 3T4DA 2AZ0A 1NVPB 4HAMA 1VF6A 3SDLA 1AJNA 2OCHA 1CXZB 2Q8VA 3ABMB 4B3SB 5DM6V 2WLNA 1LUWA 4TV9B 3ZHUA 4RO2A 5B3SC 4EEQA 2ZM6O 2ZINA 4K8XA 1H2GA 2ETNA 5A9GA 3P32A 3RGBA 3I5DA 1G6UA 2W6IG 1IBMO 4JI6B 3KKYA 4DV3O 4DR2B 2G38A 3K5NA 1Q86W 5H6QA 3SPCA 2EIMC 5D5QA 2VWKA 4UCVA 1PNLA 5EC1C 4MW3A 2YIDA 2PY5A 1XQ8A 4JI0B 3U11A 1O9HA 3BRCA 1ENVA 3OD4A 4DUYB 3OR7C 1GM9A 4IT5A 1IX9A 1BMFG 3CCUV 4WFFA 1XILA 5B3SB 1SERA 1G4YB 2CGOA 4YJ3B 1Y67A 4YHHB 2N05A 2ZE8A 2A0LA 4IYIA 3K0GA 4PV1B 5FLXN 3SR2C 2D2CB 4JPRA 3UO2A 3VQXA 2EIMB 3L74H 1P7GA 4GYCB 2UXNA 3QNEA 1U97A 3RN4A 1V9PA 4O4HA 3OUFA 2UUAO 3AK2A 2F66C 4JI4B 2DMXA 1NQTA 4JTCB 4XDKA 3L9DA 2KSDA 1Q6HA 2DWDC 2HJFC 2AHYA 4ZI7A 4JI3B 4FLXA 3AG1C 4RUEA 1ZAUA 1HR0B 4IGGA 5FNVB 3ZMZA 4FM2A 3TXQA 1P4RA 4QNHB 3ZEDA 1QVGU 4O2AB 2P6JA 4JZ2A 2GHYA 2BTQB 4F6RB 2ZDIA 1JOYA 2RDCA 3IGAC 3UKMA 2QR4A 2P7TC 3O9OA 4K35A 4LF4O 5JWPA 4MVQA 1YZBA 4LFCB 1P49A 4JI5O 4H37A 1L1FA 4P2ZA 4X1YB 3CRCA 3D3QA 4LF6B 2YXHA 3AG1B 2XT9A 1H8HG 2IH3C 1DGSA 1Z2GA 1WP7A 1Z5VA 3OGIB 5KA6A 1Q81W 1VQKV 4B3MB 5EIBC 2L35A 3CEIA 1PM9A 3F7VC 2RMKB 5KUMA 4LP8A 4DR7O 3RFRA 1YSCA 3ZBHA 1ZSPA 2Q7GA 3OM3B 2W0FC 1FXVA 2XHBA 4WBNB 4OPAA 4BW5A 5JVDA 3IJ4A 2WSSG 3ASNB 4JASA 3TGUH 1R6TA 4I55B 4U3JB 3W7UA 1VQ6V 3UQ8A 1ZLZA 1N34B 5LL6Y 5BMVB 2VQEO 3K57A 1KUQA 2WLMA 3UO3A 4LF9O 2GUZA 3CMAV 2WLKA 4GUNA 1XMOO 2JEXA 3B2EE 4X62O 3L71H 3MDSA 2AZ2A 3IAYA 5FL7G 4DR4O 1E79G 1HWYA 2IJKA 3JARB 4DV1B 5EC2C 1KYOF 3L72H 4JF3A 2OTLV 4FLZA 1EZJA 2BSKA 4UVCA 2UU9B 3JALB 2KKWA 3T1YO 3QTCA 1UFIA 4J7JA 1KU9A 2HEPA 3JCZA 2JGDB 4TV9A 4JI8B 3JAMN 2X0LA 2JDIG 1QBZA 1EFRG 2ADPA 3H1IH 1HW7A 1YEWA 3OAAG 1Q7YW 4YJ2A 4UV9A 3OW2U 4DW1A 1MG1A 2VQFB 3RYIB 4ZKIA 4DV7B 4DR3O 4JGSA 4FLWA 4KXRA 5LGUA 3CYOA 1UJWB 3K5MA 3ZRVA 1BS3A 1YJ9V 4BAYA 2P06A 3MHHC 1YF2A 3SPIA 2C2AA 5IYDO 1SQFA 4I4TB 5A2QN 2MK3A 3O65A 3N2GB 2QM4A 3R65A 2WA3A 4LFAB 3IC7A 1HNXO 3KG2A 5BZBA 3FB8C 1M90W 3ZRWB 2EBOA 4KUMA 3CRRA 5KA5A 2E5LB 3LDCA 5KLVH 1NTMH 4OPHA 4I9WA 2UXXA 4X64O 1Q90D 3N2KA 4O4IB 1IBLB 3P30A 3ETGA 4HBNA 2QTSA 2K1EA 3CPWU 2V4DA 4JAUA 5KUKA 2QWPB 1VF6C 4LH7A 3CE2A 1I7FA 1M4UA 3LSQA 3VQYA 4DV4B 4H0LB 4R50A 2QKCA 1W0JG 4OX9B 3SPGA 1A32A 4AHCA 1COWG 2EILC 2HVJC 4PELA 3RT3C 1SQGA 3E8FA 3SPHA 5CMUA 4O2AA 4PA3A 4BIOA 3E22B 3TK1A 2BTQA 1S0VA 3HPLC 4PDMA 4U3FH 1M56C 4JV5B 3FB6C 4Z1MG 3SJAC 4PA9A 4X65O 2PI5A 3K08A 4ABMA 1VQPV 2PZSA 3K58A 1XOUA 4X1YA 2LJ2A 1XNQO 1FJGB 1JR9A 1KKCA 3Q4HB 1F4MA 2Q7EA 4MVOA 4TOIA 1MMMA 4R7CA 5AG2A 2EILB 4O4LA 3CXCU 4RAIA 1YJNV 1H2MA 1KC8W 3HKCA 2Q6AA 1GN3A 1N36B 5LGNA 1EBOA 1M56B 2ZR2A 1KECA 2M6YA 1KMIZ 4PA4A 4B08A 1ZUQA 4WBNA 2CTQA 3DC6A 5IWAO 4I55A 1UPGA 4U3JA 2LP7A 1XBLA 1WB8A 4MW8A 2QTOA 2RNBA 1B3QA 3HKBA 4D7TA 3CRMA 2KQXA 2BCCH 1VQLV 1XREA 3CD6V 2H94A 3ETQA 1PP9H 2RCVA 3FFQA 3SPJA 3U0ZA 1PD3A 4N21A 2HFEC 4QIWF 3CCEV 2UUCO 3ZCCA 2ZIMA 1KQSU 2ADQB 3F7YC 1N8RW 3OE7G 4TT3G 3SYOA 1NH2D 4O4HB 3JALA 1YVWA 1VQ7V 4JZGA 4AQYB 4YIOA 1AP5A 4W4KA 4X8AA 4GX2A 4ZI7B 2JGDA 1FS0G 4CZZA 1QQCA 1XHXA 2EIJC 5IJ9A 4MTGA 1P7BA 1Q3EA 5FPOA 1MZEA 4QE9A 1QU7A 3NR7A 3WB1A 1AI7A 3RYCA 2Q4PA 3H9VA 3RYIA 1S72V 4DV0B 3BA8A 4Z1VA 3L75H 2XOKG 1E1QG 1LR1A 4CC5A 3C3TA 2NR5A 3E89A 5EBMC 2EIJB 5H9CA 4LF5B 2R70A 4DR2O 4ZIBA 3N2GA 3GWOA 1P84F 1BQ0A 3G6BA 2P67A 2EZPA 1R6KA 5C93A 4JI0O 4CS3A 4UB8Z 1G1XB 2P22C 5K1PA 2YSUB 4DR5O 3WB0A 1HDJA 1XNRB 5JVDB 1N33B 4AI8A 5LBQA 5JH7B 3SYAA 2GSMB 1OV9A 4LFBB 1NTKH 1EN4A 2Y4UA 2WA4A 4HYOA 4ZOLA 4TSFG 2Y69C 1ZWIC 4W4LA 2QM7A 3K59A 1W0KG 2EIKC 1JFFA 3NXSA 3KZIZ 4A5UB 2PF4E 3E22A 4LF7O 3K3WA 3RBZA 1VQMV 4NTYA 1XI1A 3G80A 1I94B 3JAKB 4I7ZB 4CS2A 1PKXA 1OCCC 2WPDG 1HP8A 4JI3O 2Q0OC 3RYFB 2KG7B 1AVMA 1WNSA 3JSLA 2JIZG 3Q4HA 5HFMA 1VQ4V 3ZRXA 2Y69B 3G6EV 4J7ZA 2FMLA 1ROPA 4UXNA 4CH6A 2Z5UA 4FM1A 2EIKB 2F95B 2FTKA 2QWQB 4Q6GA 2YXYA 2Q73A 3VBBA 1CEZA 3F5WC 4YJ2B 3CCJV 4FFKA 2JJ1G 2H8PC 3K9SA 2BOCC 2IW5A 1GN6A 3J80N 2R9IA 1R3LC 1MNGA 1OCCB 4MTOA 4JI2B 4X20B 1TA8A 3S3XA 5CA1B 1YXBA 2ZQMA 2XUMA 2RQ6A 1JA8A 1SA0A 4J80A 1QLEC 4GT1A 3VQWA 3OTOB 3RVYA 3BY6A 1YCIA 2IJIA 1QVFU 2LO1A 1J5EO 2A7WA 3LUTB 2JVDA 2Q69A 5DN6G 1OJHA 1VQ8V 3D8CA 2UUBB 3CB2A 3N2KB 4U7NA 4OXSA 1IDSA 1H2LA 4HNAA 1N34O 1YTFB 3K5OA 4LCUC 1I0HA 4JI7O 2F4VO 4G28B 1Z5WA 3UT5A 1H38A 1FFXA 2YEVA 2ZD9A 2GBOA 5C8YA 2DYSC 4EB6B 5GTHZ 4J9ZB 4ZHQB 1N32O 4NXMO 3A8TA 3B8NA 3BA9A 3QO8A 2OT5A 3APQA 3P3PA 3J81N 2YICA 4GKJO 1XEQA 4LF8O 3ZHVA 5LMUO 3BHPA 4CH5A 1I5XA 2Q68A 3K04A 4PA7A 2ZE7A 5LOVB 2CAZC 1NR1A 3DGEA 1BQZA 4XBFA 3T1HO 1MOFA 3LSUA 1RSOA 1S5HC 3TCUA 5CBFA 2FB5A 4I0XB 1IZ3A 2MW2B 4QGPA 2ZM6B 3ZRSA 3CCMV 1DK1A 1R73A 1URFA 1IBMB 3T4ZA 4DV3B 3B4SA 1BL8A 2X6CA 1M1KW 4QE7A 4O4LB 5CA3A 4JYAO 3ZX6A 1MABG 1NH2B 1YITV 3HKCB 2HHHO 5IT9N 1K4DC 5GTIZ 3EVKA 2ZE5A 2OYQA 3ZHQA 5KMGB 3A0RA 1R3IC 1NJIW 5JH7A 2Y48A 2ZXWC 3RWRD 3FAVB 1XHZA 2E75B 3HKBB 4LFAO 2LFRA 3ZMSA 3H01A 3QG5A 4LR3A 4U7OA 3BABA 4IL6Z 4I9QA 1ORQC 1IXMA 2R9RB 2E5LO 5IY5C 1B04A 4FLYA 1IBKO 3H1KH 3T2MA 2A9HA 2HP8A 2OWOA 1K3EA 2WLLA 3K9AA 2UUAB 4DV6O 3WB2A 4B7KA 3OEHG 2CDYA 3CCSV 3KCXA 3JAKA 4LWSB 4C7UA 2ATKC 4I50A 3RVZA 2W0XA 4GZRB 3TXSA 1DLBA 4NR1A 4DV4O 2YC0A 2O57A 2ZXWB 1WA8A 2ZKOA 3RYFA 2KG7A 4DR1B 2ZR3A 1JX9A 2B5UA 3ZS8C 5L3EA 4IYHA 4H33A 5BR8O 4J11A 3BAAA 3AG2C 5IJ9B 1GKFA 1XDCA 2HVKC 4WFGA 5IY5B 4B3RO 3GB7C 4JAAA 1IVSA 4LF4B 3JYCA 2Z0AA 3OR6C 4E4EA 4JI1O 2ODMA 1EM1A 2LW7A 3FB7C 1V54C 3E83A 3RYCB 2A79B 1QCEA 1VF5B 1NKDA 1J95A 3EXAA 3EHBB 2PYJA 3PJSK 1B6QA 2JGUA 2AXTZ 3AG4C 2XAFA 4X20A 5CA1A 2HG5C 5KX5A 1AR5A 1LUVA 1R1BA 3AG2B 1L8DA 4NTWA 1GAXA 1SZXA 4N23A 4DRXA 3A0BZ 2WWWA 1KKDA 4DR7B 3JD0A 2AGAA 3WG7C 3OT7A 5JQGA 3JCUZ 4PA6A 2GTAA 3UM7A 1FD9A 1GH6A 1V54B 3CHXA 4XDJA 4D7SA 1M5IA 2EJRA 1X4TA 2QWOB 2VQEB 4LF9B 3HKDB 1SETA 1XMOB 1DF4A 5LMNB 3AG4B 1BZKA 4X62B 4IIJB 3OFNG 4DR4B 4G27B 4GLXA 2CTWA 1QR9A 5F2VO 3R66A 4EB6A 4ZHQA 2QWNB 4ZOLB 3ETDA 3ICXA 1WP8A 4UCRA 4R6ZA 3WG7B 1D5AA 1JFFB 3TETA 1H2KA 2DJVA 3T1YB 5LOVA 4NXNO 2YIAA 4AQYO 3L73H 2YS8A 4MTFA 2LFSA 4FMTA 2UXBB 3JD2A 3I55V 5EYPA 4I0XA 1S5JA 2QGNA 4DV2O 1YTFD 1GRJA 4UVAA 3IC9A 4X1IA 1SQPH 2ILMA 1GN2A 3TJTA 3BCCH 4LH6A 2EJ7A 3BPZA 5H6RA 4LBEC 1BSMA 1HNZO 1EN6A 2OIGA 4K0KO 2P5OA 3AG3C 3D3IA 2CTRA 2QDOA 4TQDA 2W6JG 2QKAA 1L0NH 3THOA 1NTZH 5GW7A 5KMGA 2IJJA 1R6NA 5KHIA 3DSQA 4DR6B 1LNQA 4BR6A 4F6EA 3FAVA 1HNXB
chains in the Genus database with same CATH topology
1US6A 2RMKB 1CXZB 1URFA 2Q0OC 4DYLA 1RFYA 2HJDA 4NB5A 1UPGA 4NKGB 4IGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1US6 A;  2RMK B;  1CXZ B;  1URF A;  2Q0O C;  4DYL A;  1RFY A;  2HJD A;  4NB5 A;  1UPG A;  4NKG B;  4IGG A; 
#chains in the Genus database with same CATH topology
 4BW9 A;  1K34 A;  1SA0 B;  3P3N A;  2JJ2 G;  4X66 O;  2KB1 A;  1NT2 B;  1TUE B;  5KAI Z;  4X64 B;  5EZY B;  4B7E A;  2ITD C;  5KHK A;  4UCT A;  4R8C A;  3AG3 B;  1VIB A;  4IHJ A;  4TUY A;  4JTD B;  2YUA A;  4J9Y B;  4MVS A;  5B1N A;  5BY1 A;  3CCV V;  4BWA A;  4P9P A;  3FKS G;  3CRQ A;  1M93 A;  1OCO C;  3J7A U;  4HNA B;  5L3D A;  3LNM B;  4LWS A;  2H3O A;  3AK1 A;  2BE3 A;  4KHP B;  4DUZ B;  4FM0 A;  4GX1 A;  3JAT B;  2PUS A;  2VWJ A;  2HJD A;  4DV5 O;  1XMQ B;  3UT5 B;  1FFX B;  2XAS A;  2YEV B;  2RJZ A;  2IBZ H;  1HNW O;  5C8Y B;  3UCS C;  2FYU H;  1VQN V;  1M57 C;  1CPY A;  4NVP A;  5GON B;  3ZHT A;  1AI4 A;  4UCS A;  3SJQ C;  3SGI A;  3CCL V;  1VQ5 V;  5EK0 A;  1SQV H;  3RW0 A;  2WLH A;  4TWK A;  1I94 O;  2QM8 A;  2UXD O;  2DWE C;  1F7Y A;  5LGT A;  3SYC A;  5J2U B;  3AEI A;  1RSO B;  1B06 A;  2ZE6 A;  3MAQ A;  4B3S O;  1XNQ B;  2RN9 A;  4O2B B;  3M7M X;  1K33 A;  4JYB A;  5IYZ A;  2JS5 A;  1JCH A;  5H2F Z;  1XL4 A;  2ZNJ A;  1THZ A;  5ITZ A;  3FD9 A;  5B1A C;  1PNM A;  5JJN B;  1FKA O;  3RYH B;  3APO A;  4JI6 O;  3E35 A;  4PDL A;  1M57 B;  4MVR A;  4MS2 A;  1Y74 A;  3WU2 Z;  3CXH F;  4UB6 Z;  5KAF Z;  5FPR A;  3CJH B;  4MVM A;  1PPJ H;  1EN5 A;  4KL1 A;  4J41 A;  2QEX V;  5IWA B;  1SQX H;  1AJQ A;  3JAW A;  4I5S A;  5B1O A;  3JD1 A;  4B3T B;  4DUY O;  1BGY H;  1WN7 A;  3HKD A;  4MTX A;  4FFB B;  3MD0 A;  3BVO A;  3ZN1 A;  4IIJ A;  3CME V;  4UVB A;  1NR7 A;  4ASU G;  3ZHS A;  2P90 A;  5B1A B;  4YHH O;  2Q67 A;  3W7S A;  1VF7 A;  3OGC C;  3DC5 A;  3E2E A;  2A3Q A;  2CGN A;  2E74 B;  3W7X A;  3BFR A;  2Q9L A;  3ZMV A;  4FZ0 A;  2WLL B;  3OUS A;  3AK3 A;  1GO3 F;  4JI4 O;  3STZ C;  2VRZ A;  3GWK C;  4TQF A;  5DED A;  2Q7H A;  4Q20 A;  4CS4 A;  2V1D A;  1GM7 A;  1WAZ A;  3VQV A;  1WPB A;  4I50 B;  5TIS Z;  2K9P A;  1NS1 A;  1Q82 W;  3B8M A;  2P4K A;  1OCR C;  5KHH A;  1WA8 B;  1AIL A;  4PHZ A;  1HR0 O;  1BHB A;  3CX5 F;  5LP6 C;  1YI2 V;  4JTA B;  1OCZ C;  4P30 A;  1XUQ A;  4K8Z A;  3OMN B;  1FPO A;  3LSS A;  1Y66 A;  2A06 H;  3FYI B;  1AI6 A;  3PN1 A;  4P9O A;  4H13 B;  1S77 D;  1JJ2 U;  1RM1 C;  2IM9 A;  2WLI B;  5J2T B;  4WCE V;  1GTO A;  1RFY A;  4LFC O;  4YY3 B;  2Q0A A;  3IFX A;  4LF6 O;  1NI8 A;  1OCR B;  2F43 G;  1QLN A;  1YHQ V;  4O4J B;  4WFH A;  4B3M O;  4FK5 C;  3C3S A;  5KX5 B;  5LP6 B;  2YXL A;  1OCZ B;  4QJF B;  3HB3 B;  4DRX B;  3ZHR A;  5EZY A;  4F4L A;  5JQG B;  2PGG A;  1GK9 A;  4DR5 B;  2GTS A;  5IYB O;  3A2F A;  1JQ0 A;  2GDS A;  3ETE A;  1FAF A;  4PDR A;  1RM1 B;  2AW9 A;  4GKK B;  1MA1 A;  3OMI B;  2EX3 A;  2CH7 A;  1V55 C;  3B09 A;  1FFT B;  1VP7 A;  3JSN A;  2ZT9 B;  2NNU A;  4DK0 A;  3JAT A;  3U10 A;  4JYC A;  3SJC C;  4ICG A;  1GN4 A;  3G4S V;  2R72 A;  3DXR B;  2V7Q G;  1WPX A;  1FXK A;  1QLE B;  4DV1 O;  1R3K C;  1Q43 A;  5GON A;  4LF7 B;  2UXC B;  3E86 A;  4LC1 A;  5LYJ A;  4CH3 A;  1VQ9 V;  3E8H A;  2UU9 O;  1Y76 A;  5B1B C;  1CP9 A;  3HKE A;  1KB9 F;  2ZNI A;  2ZCE A;  1V55 B;  5J2U A;  2HKO A;  2N04 A;  2FKX A;  3SYP A;  5LHI A;  3GVM A;  3W7T A;  1M9N A;  5EYP B;  4DR1 O;  4O2B A;  3H1J H;  5EBL C;  4BIZ A;  4JI8 O;  5IJ0 B;  4FIP C;  2QKS A;  4X1I B;  5CA0 A;  4CBC A;  4HZ3 A;  1EZV H;  2DYS B;  4JYY A;  3RYH A;  2DW4 A;  4AIL C;  3JD4 A;  3HR0 A;  3T1C A;  1ZL8 B;  1VMG A;  4X88 A;  4LNU A;  5BXZ A;  5CBH A;  2VQF O;  3CJH A;  3ASN C;  4DV7 O;  1GMG A;  2QSA A;  5B1B B;  1YDX A;  3K0D A;  4JAV A;  4X1K B;  1H2N A;  4DK1 A;  1SF9 A;  2F1M A;  4FFB A;  1XL6 A;  3M99 B;  3CCR V;  4DXW A;  2OTJ V;  2X6B A;  1J5E B;  1WJZ A;  2YDE A;  4EFE A;  2ARH A;  2XTA A;  2XND G;  1N0J A;  5E79 Z;  1TAE A;  1K9M W;  1BE3 H;  1WB7 A;  3K03 A;  4CC6 A;  4BIU A;  1TVK B;  2IU3 A;  2D3O W;  1MSD A;  4J42 A;  3CCQ V;  1IBL O;  4FVM A;  4QPK A;  2Y4T A;  2Y0I A;  4OGQ B;  4FLV A;  4IHJ B;  4TUY B;  2IH1 C;  2CE4 A;  2YI9 A;  1JPX A;  3E8G A;  1Y4M A;  2YI8 A;  4JI7 B;  1TUB A;  2XAQ A;  2F4V B;  5LMN O;  4PJ0 Z;  2EIN C;  1ZTE A;  2X6A A;  3JAS B;  4MSW C;  1N32 B;  4NXM B;  2DE0 X;  1K4C C;  5JCO C;  1F23 A;  4OX9 O;  1DTO A;  2DOS A;  3L70 H;  4GKJ B;  4RWU A;  4LF8 B;  5LMU B;  2CK3 G;  1DF5 A;  1US6 A;  2P4V A;  3X2Q C;  5IYC O;  3D36 C;  5LA6 B;  3T1H B;  4JV5 O;  3QO5 A;  1S3J A;  2LW1 A;  4GCZ A;  4KFM A;  2UXB O;  1K73 W;  2WLI A;  5J2T A;  2EIN B;  1QHT A;  4JI5 B;  5CBG A;  2F93 B;  4K3A A;  1E1R G;  4CH4 A;  3CC4 V;  4RQE A;  1FJG O;  4ZBM A;  5B5E Z;  2Q5Z A;  1F51 A;  3ML0 A;  2LQT A;  4FPP A;  5IYZ B;  2CUG A;  4UUJ C;  1Q6U A;  4GX5 A;  1H2S B;  3LNN A;  1AR4 A;  4O4J A;  4UCO A;  5ITZ B;  4JYA B;  4DW0 A;  1S76 D;  2WAM A;  5LP6 A;  2HLD G;  2HHH B;  2HR3 A;  1Y74 B;  1N36 O;  3X2Q B;  1K97 A;  2R9A A;  5CB4 B;  2EUL A;  3G71 V;  4L8J A;  4YIP A;  4WFE A;  2VS0 A;  4QPJ A;  2L6L A;  1NVP D;  1VAR A;  2BOB C;  4EFB A;  4DR6 O;  1O9G A;  3JAW B;  5IDJ A;  3LDD A;  4YJ3 A;  3FB5 C;  1BCC H;  2AHZ A;  1H8E G;  1PNK A;  2JRI A;  1PL0 A;  4PD4 F;  4PI2 A;  3DXR A;  2X7R B;  3K79 A;  3CS5 A;  1QNM A;  1IBK B;  2F23 A;  1FYJ A;  5L3C A;  5H5N A;  3CP1 A;  4PDV A;  1YJW V;  3LDE A;  3ZJZ A;  4X89 A;  4DV6 B;  4NYK A;  2QA4 V;  1TGO A;  2LGQ A;  5LXT B;  2PTM A;  3I56 V;  3MHS C;  5JJJ B;  4KHP O;  4DUZ O;  2XAJ A;  1XMQ O;  2IJH A;  1MZF A;  1K7D A;  1S5L Z;  2ITC C;  4DYL A;  5FNV A;  1IUR A;  5BR8 B;  4TV8 B;  2DYR C;  1IXB A;  5IJ0 A;  3ASO C;  4XDL A;  3ZMT A;  5D5P A;  3E8B A;  4B3R B;  3QO7 A;  1U96 A;  4H44 B;  4F6R A;  3QF7 A;  3ZIA G;  1L0L H;  4JI1 B;  1YIJ V;  2DQ0 A;  1AJP A;  1ZL8 A;  4MVU A;  3S3W A;  4DO2 A;  1K8A W;  2JEU A;  3EFF K;  4DR3 B;  4RUF A;  3WFV A;  1AB3 A;  4RQF A;  3CC7 V;  4MT8 A;  4DV0 O;  3H1L H;  5L3F A;  5L3B A;  1MSW D;  3W7W A;  1QR8 A;  1JMK C;  4X1K A;  1K5Q A;  5JJE B;  2QWR B;  2DYR B;  2ZIO A;  3ASO B;  1AP6 A;  4LF5 O;  1I08 A;  3DTU B;  1D5N A;  2JS3 A;  4KP4 A;  1FXK C;  2DN9 A;  2M7W A;  2FL4 A;  4L87 A;  4UV8 A;  3G67 A;  2PYL A;  1RPO A;  1JVM A;  1KBH A;  1SES A;  1TVK A;  3ABK C;  2B1I A;  1KP3 A;  1WLE A;  3ABT A;  1JJO A;  2XAH A;  3B40 A;  1OHH G;  4FZ1 A;  5BMV A;  4B3T O;  1XNR O;  3FX7 A;  1N33 O;  5LHG A;  2CH7 B;  3CRA A;  2DQ3 A;  5K1X A;  5KHJ A;  2OCC C;  3JAS A;  5E1A C;  4LFB O;  4NB5 A;  2Y0P A;  3JAR A;  3OMA B;  4J10 A;  1K5S A;  2CTP A;  1FXK B;  2ZDI C;  3SYQ A;  4FJC C;  1BT8 A;  1W2B U;  4FLT A;  1R3J C;  3ABK B;  4NXN B;  2IU0 A;  5J9P C;  3ZN0 A;  4UCU A;  3VOU A;  3ABU A;  5LYJ B;  3FYE B;  5LA6 A;  5HFL A;  2PI4 A;  4UFZ A;  3SJB C;  2E76 B;  1RP3 B;  1Y76 B;  1SQB H;  4X65 B;  3HKE B;  3B77 A;  1SRY A;  3K5L A;  4DV2 B;  1OCO B;  1F4N A;  2OCC B;  2B9Z A;  4MVZ A;  5LHH A;  3AG7 A;  3OTF A;  2YIB A;  4G2K A;  4EKW A;  4Z2W A;  5JCO A;  1X59 A;  1I5Y A;  5EIB D;  5CA0 B;  1VQO V;  1NZ6 A;  1KP2 A;  2BTO A;  4WFA V;  1SQQ H;  5B66 Z;  1AI5 A;  1G8M A;  1HNZ B;  1OZ0 A;  2QJ1 A;  4K0K B;  4E2L A;  1ZX3 A;  1ARO P;  4FLU A;  1NBM G;  1D2D A;  5CB4 A;  3D36 A;  4X9Q A;  4WF9 V;  4LNU B;  1AR1 B;  3ABL C;  5EBW C;  1BHA A;  2GV9 A;  5IE9 A;  3QVN A;  4PI0 A;  1K92 A;  1SS3 A;  4YY3 O;  1SKV A;  4I4T A;  3C90 A;  2LGW A;  2NN4 A;  1Y6X A;  1PV0 A;  2Z3Y A;  3CWB H;  4JI2 O;  1GM8 A;  3M8A A;  2EZO A;  2B1G A;  1Q6I A;  3ZRW A;  4X66 B;  3ZMU A;  3OTO O;  1NU1 H;  2YIB D;  4NKG B;  4O4I A;  2XAG A;  1W59 A;  5L3G A;  2UUC B;  4GX0 A;  3H1H H;  2JK5 C;  3JD3 A;  2NLJ C;  1N0N A;  2WLJ A;  1KD1 W;  2UUB O;  1N4C A;  3ABL B;  1RPR A;  3STL C;  4GKK O;  3CSX A;  5LXT A;  4YXW G;  3ABM C;  4J7K A;  1Q5O A;  4DV5 B;  2GUZ B;  1TUB B;  1PL4 A;  1SZT A;  4WFB V;  1T5E A;  2OIE A;  3KCY A;  1HNW B;  1SC5 B;  1FXH A;  3K06 A;  4TV8 A;  2QE7 G;  1Q8I A;  2E3C A;  2N74 A;  5DEC A;  1VEW A;  3A0H Z;  3CC2 V;  3N27 A;  3F5T A;  2UXC O;  3OEE G;  5CN0 A;  2BSK B;  4NTX A;  4D6T H;  2UXD B;  5KHG A;  3BEH A;  3T4D A;  2AZ0 A;  1NVP B;  4HAM A;  1VF6 A;  3SDL A;  1AJN A;  2OCH A;  1CXZ B;  2Q8V A;  3ABM B;  4B3S B;  5DM6 V;  2WLN A;  1LUW A;  4TV9 B;  3ZHU A;  4RO2 A;  5B3S C;  4EEQ A;  2ZM6 O;  2ZIN A;  4K8X A;  1H2G A;  2ETN A;  5A9G A;  3P32 A;  3RGB A;  3I5D A;  1G6U A;  2W6I G;  1IBM O;  4JI6 B;  3KKY A;  4DV3 O;  4DR2 B;  2G38 A;  3K5N A;  1Q86 W;  5H6Q A;  3SPC A;  2EIM C;  5D5Q A;  2VWK A;  4UCV A;  1PNL A;  5EC1 C;  4MW3 A;  2YID A;  2PY5 A;  1XQ8 A;  4JI0 B;  3U11 A;  1O9H A;  3BRC A;  1ENV A;  3OD4 A;  4DUY B;  3OR7 C;  1GM9 A;  4IT5 A;  1IX9 A;  1BMF G;  3CCU V;  4WFF A;  1XIL A;  5B3S B;  1SER A;  1G4Y B;  2CGO A;  4YJ3 B;  1Y67 A;  4YHH B;  2N05 A;  2ZE8 A;  2A0L A;  4IYI A;  3K0G A;  4PV1 B;  5FLX N;  3SR2 C;  2D2C B;  4JPR A;  3UO2 A;  3VQX A;  2EIM B;  3L74 H;  1P7G A;  4GYC B;  2UXN A;  3QNE A;  1U97 A;  3RN4 A;  1V9P A;  4O4H A;  3OUF A;  2UUA O;  3AK2 A;  2F66 C;  4JI4 B;  2DMX A;  1NQT A;  4JTC B;  4XDK A;  3L9D A;  2KSD A;  1Q6H A;  2DWD C;  2HJF C;  2AHY A;  4ZI7 A;  4JI3 B;  4FLX A;  3AG1 C;  4RUE A;  1ZAU A;  1HR0 B;  4IGG A;  5FNV B;  3ZMZ A;  4FM2 A;  3TXQ A;  1P4R A;  4QNH B;  3ZED A;  1QVG U;  4O2A B;  2P6J A;  4JZ2 A;  2GHY A;  2BTQ B;  4F6R B;  2ZDI A;  1JOY A;  2RDC A;  3IGA C;  3UKM A;  2QR4 A;  2P7T C;  3O9O A;  4K35 A;  4LF4 O;  5JWP A;  4MVQ A;  1YZB A;  4LFC B;  1P49 A;  4JI5 O;  4H37 A;  1L1F A;  4P2Z A;  4X1Y B;  3CRC A;  3D3Q A;  4LF6 B;  2YXH A;  3AG1 B;  2XT9 A;  1H8H G;  2IH3 C;  1DGS A;  1Z2G A;  1WP7 A;  1Z5V A;  3OGI B;  5KA6 A;  1Q81 W;  1VQK V;  4B3M B;  5EIB C;  2L35 A;  3CEI A;  1PM9 A;  3F7V C;  2RMK B;  5KUM A;  4LP8 A;  4DR7 O;  3RFR A;  1YSC A;  3ZBH A;  1ZSP A;  2Q7G A;  3OM3 B;  2W0F C;  1FXV A;  2XHB A;  4WBN B;  4OPA A;  4BW5 A;  5JVD A;  3IJ4 A;  2WSS G;  3ASN B;  4JAS A;  3TGU H;  1R6T A;  4I55 B;  4U3J B;  3W7U A;  1VQ6 V;  3UQ8 A;  1ZLZ A;  1N34 B;  5LL6 Y;  5BMV B;  2VQE O;  3K57 A;  1KUQ A;  2WLM A;  3UO3 A;  4LF9 O;  2GUZ A;  3CMA V;  2WLK A;  4GUN A;  1XMO O;  2JEX A;  3B2E E;  4X62 O;  3L71 H;  3MDS A;  2AZ2 A;  3IAY A;  5FL7 G;  4DR4 O;  1E79 G;  1HWY A;  2IJK A;  3JAR B;  4DV1 B;  5EC2 C;  1KYO F;  3L72 H;  4JF3 A;  2OTL V;  4FLZ A;  1EZJ A;  2BSK A;  4UVC A;  2UU9 B;  3JAL B;  2KKW A;  3T1Y O;  3QTC A;  1UFI A;  4J7J A;  1KU9 A;  2HEP A;  3JCZ A;  2JGD B;  4TV9 A;  4JI8 B;  3JAM N;  2X0L A;  2JDI G;  1QBZ A;  1EFR G;  2ADP A;  3H1I H;  1HW7 A;  1YEW A;  3OAA G;  1Q7Y W;  4YJ2 A;  4UV9 A;  3OW2 U;  4DW1 A;  1MG1 A;  2VQF B;  3RYI B;  4ZKI A;  4DV7 B;  4DR3 O;  4JGS A;  4FLW A;  4KXR A;  5LGU A;  3CYO A;  1UJW B;  3K5M A;  3ZRV A;  1BS3 A;  1YJ9 V;  4BAY A;  2P06 A;  3MHH C;  1YF2 A;  3SPI A;  2C2A A;  5IYD O;  1SQF A;  4I4T B;  5A2Q N;  2MK3 A;  3O65 A;  3N2G B;  2QM4 A;  3R65 A;  2WA3 A;  4LFA B;  3IC7 A;  1HNX O;  3KG2 A;  5BZB A;  3FB8 C;  1M90 W;  3ZRW B;  2EBO A;  4KUM A;  3CRR A;  5KA5 A;  2E5L B;  3LDC A;  5KLV H;  1NTM H;  4OPH A;  4I9W A;  2UXX A;  4X64 O;  1Q90 D;  3N2K A;  4O4I B;  1IBL B;  3P30 A;  3ETG A;  4HBN A;  2QTS A;  2K1E A;  3CPW U;  2V4D A;  4JAU A;  5KUK A;  2QWP B;  1VF6 C;  4LH7 A;  3CE2 A;  1I7F A;  1M4U A;  3LSQ A;  3VQY A;  4DV4 B;  4H0L B;  4R50 A;  2QKC A;  1W0J G;  4OX9 B;  3SPG A;  1A32 A;  4AHC A;  1COW G;  2EIL C;  2HVJ C;  4PEL A;  3RT3 C;  1SQG A;  3E8F A;  3SPH A;  5CMU A;  4O2A A;  4PA3 A;  4BIO A;  3E22 B;  3TK1 A;  2BTQ A;  1S0V A;  3HPL C;  4PDM A;  4U3F H;  1M56 C;  4JV5 B;  3FB6 C;  4Z1M G;  3SJA C;  4PA9 A;  4X65 O;  2PI5 A;  3K08 A;  4ABM A;  1VQP V;  2PZS A;  3K58 A;  1XOU A;  4X1Y A;  2LJ2 A;  1XNQ O;  1FJG B;  1JR9 A;  1KKC A;  3Q4H B;  1F4M A;  2Q7E A;  4MVO A;  4TOI A;  1MMM A;  4R7C A;  5AG2 A;  2EIL B;  4O4L A;  3CXC U;  4RAI A;  1YJN V;  1H2M A;  1KC8 W;  3HKC A;  2Q6A A;  1GN3 A;  1N36 B;  5LGN A;  1EBO A;  1M56 B;  2ZR2 A;  1KEC A;  2M6Y A;  1KMI Z;  4PA4 A;  4B08 A;  1ZUQ A;  4WBN A;  2CTQ A;  3DC6 A;  5IWA O;  4I55 A;  1UPG A;  4U3J A;  2LP7 A;  1XBL A;  1WB8 A;  4MW8 A;  2QTO A;  2RNB A;  1B3Q A;  3HKB A;  4D7T A;  3CRM A;  2KQX A;  2BCC H;  1VQL V;  1XRE A;  3CD6 V;  2H94 A;  3ETQ A;  1PP9 H;  2RCV A;  3FFQ A;  3SPJ A;  3U0Z A;  1PD3 A;  4N21 A;  2HFE C;  4QIW F;  3CCE V;  2UUC O;  3ZCC A;  2ZIM A;  1KQS U;  2ADQ B;  3F7Y C;  1N8R W;  3OE7 G;  4TT3 G;  3SYO A;  1NH2 D;  4O4H B;  3JAL A;  1YVW A;  1VQ7 V;  4JZG A;  4AQY B;  4YIO A;  1AP5 A;  4W4K A;  4X8A A;  4GX2 A;  4ZI7 B;  2JGD A;  1FS0 G;  4CZZ A;  1QQC A;  1XHX A;  2EIJ C;  5IJ9 A;  4MTG A;  1P7B A;  1Q3E A;  5FPO A;  1MZE A;  4QE9 A;  1QU7 A;  3NR7 A;  3WB1 A;  1AI7 A;  3RYC A;  2Q4P A;  3H9V A;  3RYI A;  1S72 V;  4DV0 B;  3BA8 A;  4Z1V A;  3L75 H;  2XOK G;  1E1Q G;  1LR1 A;  4CC5 A;  3C3T A;  2NR5 A;  3E89 A;  5EBM C;  2EIJ B;  5H9C A;  4LF5 B;  2R70 A;  4DR2 O;  4ZIB A;  3N2G A;  3GWO A;  1P84 F;  1BQ0 A;  3G6B A;  2P67 A;  2EZP A;  1R6K A;  5C93 A;  4JI0 O;  4CS3 A;  4UB8 Z;  1G1X B;  2P22 C;  5K1P A;  2YSU B;  4DR5 O;  3WB0 A;  1HDJ A;  1XNR B;  5JVD B;  1N33 B;  4AI8 A;  5LBQ A;  5JH7 B;  3SYA A;  2GSM B;  1OV9 A;  4LFB B;  1NTK H;  1EN4 A;  2Y4U A;  2WA4 A;  4HYO A;  4ZOL A;  4TSF G;  2Y69 C;  1ZWI C;  4W4L A;  2QM7 A;  3K59 A;  1W0K G;  2EIK C;  1JFF A;  3NXS A;  3KZI Z;  4A5U B;  2PF4 E;  3E22 A;  4LF7 O;  3K3W A;  3RBZ A;  1VQM V;  4NTY A;  1XI1 A;  3G80 A;  1I94 B;  3JAK B;  4I7Z B;  4CS2 A;  1PKX A;  1OCC C;  2WPD G;  1HP8 A;  4JI3 O;  2Q0O C;  3RYF B;  2KG7 B;  1AVM A;  1WNS A;  3JSL A;  2JIZ G;  3Q4H A;  5HFM A;  1VQ4 V;  3ZRX A;  2Y69 B;  3G6E V;  4J7Z A;  2FML A;  1ROP A;  4UXN A;  4CH6 A;  2Z5U A;  4FM1 A;  2EIK B;  2F95 B;  2FTK A;  2QWQ B;  4Q6G A;  2YXY A;  2Q73 A;  3VBB A;  1CEZ A;  3F5W C;  4YJ2 B;  3CCJ V;  4FFK A;  2JJ1 G;  2H8P C;  3K9S A;  2BOC C;  2IW5 A;  1GN6 A;  3J80 N;  2R9I A;  1R3L C;  1MNG A;  1OCC B;  4MTO A;  4JI2 B;  4X20 B;  1TA8 A;  3S3X A;  5CA1 B;  1YXB A;  2ZQM A;  2XUM A;  2RQ6 A;  1JA8 A;  1SA0 A;  4J80 A;  1QLE C;  4GT1 A;  3VQW A;  3OTO B;  3RVY A;  3BY6 A;  1YCI A;  2IJI A;  1QVF U;  2LO1 A;  1J5E O;  2A7W A;  3LUT B;  2JVD A;  2Q69 A;  5DN6 G;  1OJH A;  1VQ8 V;  3D8C A;  2UUB B;  3CB2 A;  3N2K B;  4U7N A;  4OXS A;  1IDS A;  1H2L A;  4HNA A;  1N34 O;  1YTF B;  3K5O A;  4LCU C;  1I0H A;  4JI7 O;  2F4V O;  4G28 B;  1Z5W A;  3UT5 A;  1H38 A;  1FFX A;  2YEV A;  2ZD9 A;  2GBO A;  5C8Y A;  2DYS C;  4EB6 B;  5GTH Z;  4J9Z B;  4ZHQ B;  1N32 O;  4NXM O;  3A8T A;  3B8N A;  3BA9 A;  3QO8 A;  2OT5 A;  3APQ A;  3P3P A;  3J81 N;  2YIC A;  4GKJ O;  1XEQ A;  4LF8 O;  3ZHV A;  5LMU O;  3BHP A;  4CH5 A;  1I5X A;  2Q68 A;  3K04 A;  4PA7 A;  2ZE7 A;  5LOV B;  2CAZ C;  1NR1 A;  3DGE A;  1BQZ A;  4XBF A;  3T1H O;  1MOF A;  3LSU A;  1RSO A;  1S5H C;  3TCU A;  5CBF A;  2FB5 A;  4I0X B;  1IZ3 A;  2MW2 B;  4QGP A;  2ZM6 B;  3ZRS A;  3CCM V;  1DK1 A;  1R73 A;  1URF A;  1IBM B;  3T4Z A;  4DV3 B;  3B4S A;  1BL8 A;  2X6C A;  1M1K W;  4QE7 A;  4O4L B;  5CA3 A;  4JYA O;  3ZX6 A;  1MAB G;  1NH2 B;  1YIT V;  3HKC B;  2HHH O;  5IT9 N;  1K4D C;  5GTI Z;  3EVK A;  2ZE5 A;  2OYQ A;  3ZHQ A;  5KMG B;  3A0R A;  1R3I C;  1NJI W;  5JH7 A;  2Y48 A;  2ZXW C;  3RWR D;  3FAV B;  1XHZ A;  2E75 B;  3HKB B;  4LFA O;  2LFR A;  3ZMS A;  3H01 A;  3QG5 A;  4LR3 A;  4U7O A;  3BAB A;  4IL6 Z;  4I9Q A;  1ORQ C;  1IXM A;  2R9R B;  2E5L O;  5IY5 C;  1B04 A;  4FLY A;  1IBK O;  3H1K H;  3T2M A;  2A9H A;  2HP8 A;  2OWO A;  1K3E A;  2WLL A;  3K9A A;  2UUA B;  4DV6 O;  3WB2 A;  4B7K A;  3OEH G;  2CDY A;  3CCS V;  3KCX A;  3JAK A;  4LWS B;  4C7U A;  2ATK C;  4I50 A;  3RVZ A;  2W0X A;  4GZR B;  3TXS A;  1DLB A;  4NR1 A;  4DV4 O;  2YC0 A;  2O57 A;  2ZXW B;  1WA8 A;  2ZKO A;  3RYF A;  2KG7 A;  4DR1 B;  2ZR3 A;  1JX9 A;  2B5U A;  3ZS8 C;  5L3E A;  4IYH A;  4H33 A;  5BR8 O;  4J11 A;  3BAA A;  3AG2 C;  5IJ9 B;  1GKF A;  1XDC A;  2HVK C;  4WFG A;  5IY5 B;  4B3R O;  3GB7 C;  4JAA A;  1IVS A;  4LF4 B;  3JYC A;  2Z0A A;  3OR6 C;  4E4E A;  4JI1 O;  2ODM A;  1EM1 A;  2LW7 A;  3FB7 C;  1V54 C;  3E83 A;  3RYC B;  2A79 B;  1QCE A;  1VF5 B;  1NKD A;  1J95 A;  3EXA A;  3EHB B;  2PYJ A;  3PJS K;  1B6Q A;  2JGU A;  2AXT Z;  3AG4 C;  2XAF A;  4X20 A;  5CA1 A;  2HG5 C;  5KX5 A;  1AR5 A;  1LUV A;  1R1B A;  3AG2 B;  1L8D A;  4NTW A;  1GAX A;  1SZX A;  4N23 A;  4DRX A;  3A0B Z;  2WWW A;  1KKD A;  4DR7 B;  3JD0 A;  2AGA A;  3WG7 C;  3OT7 A;  5JQG A;  3JCU Z;  4PA6 A;  2GTA A;  3UM7 A;  1FD9 A;  1GH6 A;  1V54 B;  3CHX A;  4XDJ A;  4D7S A;  1M5I A;  2EJR A;  1X4T A;  2QWO B;  2VQE B;  4LF9 B;  3HKD B;  1SET A;  1XMO B;  1DF4 A;  5LMN B;  3AG4 B;  1BZK A;  4X62 B;  4IIJ B;  3OFN G;  4DR4 B;  4G27 B;  4GLX A;  2CTW A;  1QR9 A;  5F2V O;  3R66 A;  4EB6 A;  4ZHQ A;  2QWN B;  4ZOL B;  3ETD A;  3ICX A;  1WP8 A;  4UCR A;  4R6Z A;  3WG7 B;  1D5A A;  1JFF B;  3TET A;  1H2K A;  2DJV A;  3T1Y B;  5LOV A;  4NXN O;  2YIA A;  4AQY O;  3L73 H;  2YS8 A;  4MTF A;  2LFS A;  4FMT A;  2UXB B;  3JD2 A;  3I55 V;  5EYP A;  4I0X A;  1S5J A;  2QGN A;  4DV2 O;  1YTF D;  1GRJ A;  4UVA A;  3IC9 A;  4X1I A;  1SQP H;  2ILM A;  1GN2 A;  3TJT A;  3BCC H;  4LH6 A;  2EJ7 A;  3BPZ A;  5H6R A;  4LBE C;  1BSM A;  1HNZ O;  1EN6 A;  2OIG A;  4K0K O;  2P5O A;  3AG3 C;  3D3I A;  2CTR A;  2QDO A;  4TQD A;  2W6J G;  2QKA A;  1L0N H;  3THO A;  1NTZ H;  5GW7 A;  5KMG A;  2IJJ A;  1R6N A;  5KHI A;  3DSQ A;  4DR6 B;  1LNQ A;  4BR6 A;  4F6E A;  3FAV A;  1HNX B; 
#chains in the Genus database with same CATH homology
 1US6 A;  2RMK B;  1CXZ B;  1URF A;  2Q0O C;  4DYL A;  1RFY A;  2HJD A;  4NB5 A;  1UPG A;  4NKG B;  4IGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...