1US6A

Crystal structure of the quorum-sensing protein tram from agrobacterium tumefaciens at 1.65 ang. resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
90
structure length
90
Chain Sequence
VELRPLIGLTRGLPPTDLETITIDAIRTHRRLVEKADELFQALPETYKTGQACGGPQHIRYIEASIEMHAQMSALNTLYSILGFIPKVVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REPRESSOR TRAM
publication title Crystal Structure of the Quorum-Sensing Protein Tram and its Interaction with the Transcriptional Regulator Trar
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Transcription repressor
total genus 34
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09228 Prok-TraM Prokaryotic Transcriptional repressor TraM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.160 Mainly Alpha Orthogonal Bundle Helix Hairpins HR1 repeat 1us6A00
1UPGA 1URFA 2Q0OC 4NKGB 4NB5A 1RFYA 2HJDA 2RMKB 4DYLA 1CXZB 1US6A 4IGGA
chains in the Genus database with same CATH superfamily
4TV8A 3NXSA 5FNVB 1XMQB 1BE3H 4LF4B 1XNRO 1FPOA 1CPYA 3G4SV 3MHSC 2QR4A 4UV8A 1BSMA 1VIBA 1R6KA 4DUZO 1HNWB 3JAKA 1ZX3A 2LP7A 4WFAV 3GWOA 4G28B 1I94B 4JTAB 3FB8C 5IY5B 2ETNA 3ZS8C 3CE2A 4LFCO 4OPAA 2IJKA 4X64O 2Y69C 3IFXA 5B3SC 3KZIZ 3KG2A 4PV1B 4QPKA 2YC0A 1TVKA 3I56V 2RQ6A 4RAIA 1EN6A 2ZT9B 4UCTA 1PNKA 2EZPA 4MS2A 2XAFA 1K73W 4LF7O 3APQA 1EZJA 3FAVB 3LNMB 4PA3A 3P3PA 4FFKA 2EILB 1SERA 2Z3YA 3SDLA 4YJ2A 2FB5A 2LFSA 2WLJA 4UV9A 4LF4O 2Y4TA 4O2BA 1IBLB 2YEVB 4DV6B 1OCCC 4ABMA 3GVMA 4H44B 2QWPB 1HNWO 4PELA 2HEPA 3WB0A 2R9RB 2YUAA 5C8YB 3JAMN 1R3IC 3ABMB 1UPGA 1NBMG 5C93A 1RPOA 2LO1A 3CRRA 4GX0A 3CP1A 2OWOA 5H6QA 1E1QG 2CTPA 2ZM6O 2P22C 2JGDA 4JI3B 3R65A 4PHZA 5L3EA 1KMIZ 1XMOB 5LA6B 4B3RB 1NJIW 2E75B 1FKAO 1S72V 5JJEB 1WNSA 3WB1A 3RW0A 4X1KB 5B1AB 4R6ZA 4D7TA 2EJ7A 2D3OW 2NR5A 4DV6O 3OUFA 4BAYA 2AGAA 2DYRC 3S3WA 3CCEV 1SZXA 4JV5O 4FMTA 4DV3B 4FM2A 5CMUA 3E22A 1QLEB 3E8HA 2Y0PA 5EZYB 4W4LA 1H2KA 3NR7A 2F95B 2Q67A 3EVKA 1JOYA 4L87A 5LYJA 1AR5A 3EXAA 2ADQB 2PZSA 1XMOO 4MTOA 4AILC 4B3RO 4GLXA 3ZMTA 3JCUZ 1SQVH 1VP7A 4O2AB 1EN5A 1KB9F 5JJNB 1N8RW 2Q7HA 4PDRA 3WG7C 4CBCA 2UXBB 4DRXA 2BTOA 1AR4A 5EBWC 1FFTB 3K0GA 3L74H 2UUBO 4PDVA 4TV9B 4JF3A 3U11A 3ABKB 2Q0AA 3P3NA 4X62B 3HB3B 5ITZB 2CUGA 2V1DA 3HKDA 3W7UA 5K1PA 2BCCH 4U7NA 3DTUB 3RYFB 3E89A 5FLXN 4LH6A 1VMGA 2H8PC 1YTFB 5JJJB 5BR8O 4TUYA 5BY1A 3B8MA 4MTXA 1TUBB 1VF6A 1SS3A 2LQTA 2XHBA 2JEUA 5FPOA 1HNZB 1DK1A 3K04A 5B5EZ 1B04A 1K92A 1PPJH 2V4DA 2EINC 2QWOB 4JI7B 4UCRA 3L75H 2R9IA 4UFZA 2A7WA 1V55C 1WAZA 5LOVB 3BCCH 1IVSA 2Y69B 2QTSA 5B3SB 4J9YB 2DMXA 4IHJA 3K03A 1YZBA 3OMNB 4X62O 4LF8B 2KKWA 1JJOA 4LF5B 2KG7A 1GN6A 4EB6B 2IJIA 2C2AA 4B3MB 2UU9O 1L1FA 2RNBA 1K97A 1OCZC 4KP4A 3A0HZ 1GN4A 1HNZO 1M57C 1Y67A 2JVDA 1HDJA 3R66A 4P9OA 2YIBA 4H37A 1VQPV 3HKBB 4YJ3B 2X6AA 2EZOA 3GWKC 4RQEA 2LGQA 5DM6V 2QKCA 1XEQA 4PA4A 1PKXA 4K35A 1SZTA 4DV7B 3ASNC 5JH7A 3E83A 3QO5A 3SPHA 2RN9A 2YS8A 2QTOA 2ZINA 3OAAG 2FMLA 4B3TB 4YY3O 2QM4A 1GRJA 2AHZA 2P90A 5CB4A 3CRAA 3I5DA 1G1XB 4NXNB 1MMMA 1RPRA 1P7GA 4LCUC 5DN6G 3JARA 1BCCH 3OUSA 2RJZA 4X1YA 5KLVH 2JIZG 1SA0A 3ZHQA 4LFBO 1Y66A 2DYRB 2NLJC 4FLWA 4I4TB 2LGWA 4GX5A 3UT5A 2ZIMA 1FXKA 2ITDC 2DE0X 4I0XA 3CCVV 4QE9A 1YF2A 1VF6C 4MVSA 1GMGA 4HNAA 1OCRC 4TV8B 5L3FA 4X1IA 4JI4B 3ZRSA 5HFMA 5IYZA 1K34A 1N0JA 1US6A 2YIDA 3WG7B 2HFEC 2G38A 4B3SB 2XUMA 4OX9B 1XQ8A 2B5UA 1NT2B 2DQ3A 4DV0B 4BW5A 2A79B 4FM0A 4AQYB 5CN0A 5D5QA 2VS0A 3SPCA 1Q86W 1OZ0A 2H94A 1R3LC 4FLZA 1XL4A 1R6TA 2RCVA 3FD9A 1XHZA 3RYIA 4TQFA 1QHTA 3ETQA 4YJ2B 1VF7A 1VQ8V 4IL6Z 4O2BB 1AJPA 1P49A 1NKDA 1VQMV 4JI4O 3E8BA 3E8GA 2EINB 4XBFA 2VRZA 4DV2B 4NTWA 5L3BA 2Y0IA 2W6JG 3B09A 3CJHA 1V55B 4B3SO 4R8CA 4RWUA 1R3KC 2NN4A 1YSCA 3SJAC 2ZE5A 1NU1H 4CH4A 2JGDB 3UO2A 1THZA 2FTKA 4FM1A 3BABA 2UUCB 4ZI7A 1AJNA 5IYDO 2N05A 2OCCC 3ZCCA 2ZE6A 1OHHG 1R3JC 1OCZB 2WA4A 3SJQC 2Q68A 5IJ0A 3CCJV 1HR0B 1GKFA 1YCIA 3RVZA 1K4CC 1IZ3A 1M57B 2F23A 1ORQC 3HR0A 4GKJB 1MA1A 5B1OA 4DXWA 3ZN0A 4WFHA 4DV2O 1BHBA 3CD6V 3E22B 3UCSC 1FXKC 1H2LA 4JI2B 2KQXA 2WLIA 2XNDG 3D3QA 3N2KA 1HNXO 1AJQA 3DC6A 2XAGA 3THOA 3RVYA 5LYJB 4EFEA 1KBHA 3ASNB 1JX9A 1BZKA 4PA7A 3LDEA 4N21A 1S5JA 3W7SA 1JMKC 2Q5ZA 4DV4B 3A0RA 3EFFK 3CEIA 3SPIA 3W7TA 2QWNB 1EFRG 1E1RG 3ZHRA 4DRXB 1NH2B 1PL0A 1J5EO 3FX7A 4MSWC 3H1HH 4GKJO 3X2QC 5LP6A 1Z5WA 2DYSC 2XTAA 1SC5B 1YVWA 1BHAA 2UXXA 3HKDB 3JYCA 1COWG 2W0XA 2HP8A 3DGEA 3CC2V 1AR1B 3K5MA 4FK5C 2DOSA 4TUYB 1VF5B 4X64B 1JVMA 2HVKC 3H9VA 1LUWA 3N2GA 1J95A 4YHHO 1OCRB 2GV9A 5CA0B 5JCOC 3L72H 3OMAB 4DV4O 2YXLA 4KL1A 1SQGA 2ZR3A 1URFA 4LF7B 4NB5A 5B1BC 1DLBA 2ZNIA 3ZHVA 1P4RA 3CRQA 4CS2A 2MK3A 4Z1MG 1VQKV 3H01A 5A2QN 5J2UA 3M7MX 4IHJB 2IBZH 2HJFC 2Q69A 4CC6A 3SYQA 5KA5A 3BVOA 1G6UA 3OTFA 2KG7B 3ETGA 4UXNA 2Q8VA 1BQ0A 4UCVA 4YIPA 1N36B 4DK0A 2B1IA 2ZM6B 2X7RB 1GN3A 4JTDB 4WBNA 4AHCA 1Q8IA 1XHXA 4TT3G 4FLVA 3T1HO 4EEQA 4O4JA 5KHGA 3CSXA 4ASUG 5IYCO 2M7WA 2EIMC 2QJ1A 3W7WA 2BTQA 3K5LA 1KD1W 2CTWA 3ZHTA 5JH7B 1Y76A 1U96A 3UQ8A 2ZDIA 1R73A 1XDCA 2PF4E 5CB4B 1PV0A 3CCRV 4JV5B 1OJHA 2UUAB 1F4MA 5KUMA 3JARB 4FVMA 1GM8A 3K08A 2OCCB 4X1YB 1MSWD 1Q5OA 2B9ZA 3F5TA 4I50A 3U0ZA 1N36O 3SJCC 3K06A 1GTOA 3CRMA 5LP6C 2F93B 5KX5A 5EYPA 4GKKO 5AG2A 3E35A 2JJ2G 4QNHB 3UT5B 2QEXV 3TXQA 5B66Z 1FXKB 2NNUA 1S0VA 4I0XB 5KHJA 4FLXA 4J10A 1M5IA 4LH7A 4TSFG 1TUEB 4FLYA 2ZQMA 5J2TA 1AVMA 3AK3A 5EIBD 1K4DC 4N23A 1WB8A 2UUBB 1W59A 5JQGA 4DR4O 4L8JA 4X1IB 3AG7A 4F6RA 2UUAO 1SQPH 5IYZB 4DW0A 5CBHA 1SESA 2GHYA 3IGAC 5BR8B 3AEIA 3PN1A 1GN2A 1OV9A 4NXMO 1ZAUA 5IJ9A 1KQSU 3AK1A 4IT5A 3RGBA 3RT3C 1BMFG 4UCOA 3X2QB 3JALA 2DYSB 1R6NA 2WLLB 2QWQB 4IGGA 5E79Z 2P7TC 3K5NA 4NKGB 1LNQA 3RWRD 2QKAA 3VQXA 2XAHA 3AG1C 4XDJA 1P84F 5E1AC 1FFXA 3ZHSA 1O9GA 3RYIB 2IJJA 4X88A 4U7OA 1TAEA 1H2SB 1AI4A 1Q43A 4GYCB 5LBQA 3AG2C 5H2FZ 3K3WA 1WA8A 2CAZC 4H0LB 1N4CA 2CE4A 2UU9B 4I55A 5B1BB 2PI4A 5K1XA 3CJHB 4NYKA 3JD3A 3P30A 2JJ1G 2YDEA 2Q9LA 4CC5A 4Z1VA 5LGTA 2ZDIC 1SF9A 3OTOB 1JR9A 5L3CA 2HJDA 4QIWF 2DWEC 4J11A 1OCOC 3G80A 4ZI7B 2W6IG 3MD0A 1KUQA 1LUVA 4DO2A 5LGNA 1WP8A 2QGNA 4F4LA 4FJCC 2QM8A 3OGIB 4ZOLB 2V7QG 4GZRB 4UB8Z 1FXHA 5IJ0B 2R9AA 4LF9O 1VQLV 4YY3B 3VBBA 4FPPA 5LHGA 4MVUA 4LFAB 1Q3EA 3FB7C 4D7SA 5CA3A 1SETA 4I9WA 5L3GA 1IX9A 2YI8A 4WFGA 2YI9A 5CA1A 4JI5O 3OGCC 2AHYA 5KHKA 4J7JA 2X6CA 1NVPD 4PDMA 2JRIA 3IJ4A 2WLIB 5EBLC 3T1CA 2EIMB 4ZBMA 4BR6A 2L6LA 4H33A 3OTOO 2JEXA 3CMAV 4LFBB 1OCCB 4CS4A 5KAIZ 1Y4MA 4LBEC 1F7YA 3P32A 1F51A 3B8NA 1MNGA 4JI0O 1N33B 4HYOA 3CHXA 3H1LH 4O4IA 4RQFA 2P4VA 4LC1A 5KUKA 2DWDC 1WLEA 2DW4A 4ZKIA 2CTRA 3DSQA 3BY6A 1D2DA 3OFNG 4DW1A 5D5PA 4A5UB 1PNLA 5LP6B 4LFAO 2WLKA 4MW3A 4ZIBA 3FAVA 3HPLC 3H1IH 3HKCA 1PP9H 2L35A 1Q6UA 1YJNV 4FLUA 2GBOA 1X4TA 3DXRA 4I5SA 2E3CA 3O9OA 1YHQV 1K33A 4Q6GA 1XILA 1WB7A 2ZXWC 3N2GB 4GT1A 4OGQB 3CC7V 3SYCA 2XOKG 5H5NA 3L73H 3SGIA 1N33O 2XASA 2UXNA 2B1GA 2DQ0A 3JAWA 5IT9N 2HHHB 2DJVA 1IDSA 4E2LA 2VWKA 2VQEB 1I5XA 3OEEG 4ICGA 1ENVA 1NTMH 1KKDA 4FFBA 2ILMA 1UFIA 3AG3C 4X9QA 4B08A 1N34B 5J2UB 3HKEA 4EFBA 2OTLV 2MW2B 3K9SA 2IW5A 4G27B 3JAKB 4RUEA 3FB5C 4X1KA 5DEDA 1K7DA 1DF5A 3AG1B 2OT5A 1F23A 2YXHA 5BMVA 1IBKB 1TA8A 2FL4A 1TVKB 1JCHA 1T5EA 3L70H 1YITV 1GO3F 2YIAA 4WBNB 1AP6A 2F66C 4JAUA 4MTFA 3AG2B 2HHHO 4O4JB 1UJWB 3ZX6A 4UVAA 4IIJA 4LP8A 2P6JA 3GB7C 4NTYA 2VQEO 4JAVA 4MVQA 3SYAA 2BTQB 1DGSA 4JYYA 1N34O 2OTJV 1R1BA 4LR3A 1Y76B 2BSKA 4GCZA 2EULA 4ZHQA 1K9MW 1RP3B 2GTSA 2OCHA 2CDYA 1ZUQA 3RYCA 2R72A 2WLHA 1HP8A 3VOUA 3ZJZA 2IH3C 1OCOB 4TOIA 2WA3A 3FFQA 3ZMZA 3G6EV 3RFRA 1M4UA 2Q6AA 4JI6B 3TCUA 1NQTA 1U97A 1XBLA 1IBKO 4I50B 1HNXB 2CH7A 1SQBH 4XDLA 1NS1A 3IC9A 1SRYA 4JYAO 5GW7A 5L3DA 5LMUB 4X65B 3RYFA 5KX5B 3CCMV 3ZBHA 4DYLA 1FD9A 1W0JG 4FIPC 1QQCA 2IJHA 2WPDG 3JCZA 2GDSA 2P4KA 3T4ZA 4DK1A 4NR1A 2O57A 5HFLA 1ZTEA 3AG4C 4X20A 5EC1C 5J2TB 4J9ZB 2Z0AA 4G2KA 1J5EB 4JI8O 3LDCA 5JQGB 2ZE8A 2PTMA 1ZL8A 1YTFD 2QKSA 4F6RB 1NI8A 1K3EA 3AK2A 4JI6O 3OR6C 3L71H 3J80N 5DECA 2F4VB 3SPGA 1Q81W 4HZ3A 3ZMVA 3BA9A 4JASA 5IJ9B 3TETA 3K79A 2WSSG 5LMUO 4HAMA 4X65O 4YHHB 4DR5O 5B1NA 1KYOF 3B2EE 3JALB 2PYJA 2GSMB 4AI8A 1QVFU 2ARHA 1NTZH 5GTIZ 4DR2O 2JGUA 3CXCU 4J80A 1WPBA 1M9NA 1IXMA 3D3IA 4GUNA 1FFXB 1XL6A 3OD4A 1YIJV 1WP7A 3ZRWA 4DV5O 2ZXWB 3OMIB 4CS3A 3HKBA 2ZNJA 4YJ3A 2UXDB 1MOFA 2HVJC 1NTKH 3OM3B 4CH3A 2QA4V 3JD0A 1WA8B 1XNQO 2F4VO 2K9PA 3G67A 2HG5C 3LUTB 3AG3B 3PJSK 1MABG 1Z5VA 2ZE7A 1VEWA 3BFRA 4U3JA 1B3QA 1N32O 3D36A 3E2EA 2LFRA 4KXRA 3FKSG 3T1HB 1JJ2U 4LNUA 3F7YC 3OW2U 1PNMA 2QM7A 3C3TA 1DF4A 4MT8A 3RYHA 3KCXA 4BIOA 2VWJA 5FPRA 4NTXA 1EBOA 1CP9A 1AROP 1H2MA 4QPJA 3LDDA 1NR1A 4J7ZA 2UXDO 4O4HA 2N04A 3TJTA 4DUYO 1ROPA 4LWSA 1W0KG 2AZ0A 4WFEA 2Q7EA 3ZRVA 1RSOA 3LSUA 4JGSA 1S77D 1XREA 3K57A 2IU3A 4X66B 1RFYA 1JPXA 1XI1A 5JVDA 3J81N 1K5QA 2FKXA 1E79G 3A0BZ 5BZBA 1VQ5V 4GKKB 3B40A 1YEWA 1FYJA 4GX1A 1KU9A 5GONA 5LGUA 2KSDA 2EIKC 4O4IB 2HR3A 3CCUV 2ZKOA 1IBMO 2ADPA 2OIEA 2K1EA 2WWWA 2CTQA 3JASA 1S5HC 2A9HA 3OR7C 3VQVA 3ICXA 2EBOA 3CXHF 4DR4B 3QO8A 4Z2WA 3LNNA 3HKCB 3JATA 4QE7A 4EKWA 4W4KA 2N74A 5EC2C 1M90W 1YJWV 2P67A 4JI1B 3QG5A 4PI2A 3DXRB 1XMQO 1D5NA 4X66O 1SA0B 5BXZA 1JFFA 4NXMB 2KB1A 2E5LB 3AG4B 4YXWG 1Z2GA 1TGOA 3Q4HA 3TK1A 5GTHZ 1I94O 1D5AA 3DC5A 2EIJC 4DV1B 1Q7YW 3ML0A 3JAWB 1L0LH 1AILA 1NZ6A 3JD4A 1VQNV 4K8ZA 4BIZA 2F43G 4FFBB 3STZC 2H3OA 4HNAB 1SKVA 2P5OA 3QVNA 1I5YA 3HKEB 5KHIA 1SQFA 3BRCA 1BS3A 2JS5A 3D36C 5IDJA 1L8DA 5KA6A 4J41A 1VQ9V 1H2NA 1H2GA 4JZGA 2CGNA 3ZRXA 3IAYA 1KP2A 2D2CB 4JI1O 1I7FA 5LHHA 1IBLO 2RMKB 5KMGA 2LW7A 3VQWA 2E5LO 4FZ0A 5BMVB 4LF6B 3UKMA 1KKCA 3VQYA 1HW7A 4DV1O 3ZMUA 3K59A 3CS5A 4JPRA 1SQXH 3ABLC 3ABTA 1B6QA 3JSNA 4UVCA 4DR1B 4IIJB 1BQZA 4P30A 4JI3O 4MVMA 3EHBB 1V54C 4CH6A 1MZFA 3OE7G 3K0DA 4LF9B 4CZZA 2BSKB 2YICA 4ZHQB 3RYCB 4OPHA 2OIGA 1H8HG 4J7KA 4JI5B 4Q20A 1Y74A 1QVGU 4LF6O 2CH7B 1BL8A 3K58A 5LXTA 4DV3O 2F1MA 5CBGA 1GH6A 4K0KB 2FYUH 4BWAA 1EM1A 4O4LA 4DR1O 2CGOA 2Q0OC 1VQ4V 4JI0B 1G8MA 2A06H 1NH2D 5IYBO 2QSAA 1AP5A 5CA0A 4KFMA 4JTCB 1FXVA 5EIBC 2RDCA 4X20B 3N27A 3C90A 4DR6B 3ZMSA 2GUZA 1AI7A 1LR1A 1ZL8B 3CRCA 1CEZA 4J42A 2UXBO 4P9PA 3FYEB 3I55V 1KC8W 2EIKB 1A32A 1YJ9V 2UXCB 2W0FC 3N2KB 2Y48A 3QO7A 5FNVA 2EJRA 4PJ0Z 1S76D 4HBNA 4JYCA 4UB6Z 3CMEV 1M56C 2PGGA 4WFBV 4K0KO 3IC7A 1JQ0A 1K5SA 4PA6A 3QTCA 2WLMA 3E86A 4QJFB 1JA8A 2JDIG 5TISZ 4RO2A 1QNMA 3FYIB 4R7CA 1QBZA 1ZWIC 4IYHA 4CH5A 4R50A 2LJ2A 3H1JH 4JI7O 3ZRWB 3JD1A 4DR6O 3ZEDA 3F7VC 1MZEA 2A0LA 3T2MA 1X59A 5LL6Y 2EIJB 1Q90D 4WF9V 2JK5C 1PM9A 4DR3B 1CXZB 4UCSA 3L9DA 2JS3A 2UXCO 4FLTA 3MAQA 4K8XA 4IYIA 4LF8O 1XUQA 5LMNB 2YEVA 2BOBC 4BW9A 4KUMA 3CB2A 1Q82W 4U3FH 4I7ZB 3CC4V 4B7EA 2YIBD 4RUFA 4LF5O 3ASOC 3QNEA 5C8YA 4U3JB 4WCEV 1MSDA 4B3MO 3H1KH 1AI5A 4UUJC 2IH1C 2ITCC 4PDLA 2HLDG 1GAXA 4MW8A 2AW9A 1GK9A 4LNUB 3BPZA 3T4DA 2PYLA 5H9CA 3RYHB 3WU2Z 5LHIA 3U10A 5LA6A 2ZCEA 4XDKA 4NVPA 4JZ2A 3G6BA 5JWPA 4MVRA 4O4HB 1VARA 4MVZA 4LWSB 2X6BA 3LSQA 4P2ZA 3WB2A 2E76B 5A9GA 3ETDA 4DR3O 1RM1C 4UCUA 2BOCC 1H38A 3ABLB 4DV7O 2ZR2A 1AB3A 2CK3G 2PUSA 1GM9A 1RSOB 5LMNO 1V9PA 4B3TO 3BA8A 3S3XA 4QGPA 4PI0A 1I0HA 3OEHG 1V54B 2XAQA 2Y4UA 3A8TA 2AXTZ 4MTGA 2YSUB 2PY5A 2OYQA 1I08A 4NXNO 3LSSA 5JVDB 4JYAB 2YXYA 3UO3A 2WAMA 3RN4A 1FJGB 3C3SA 1YDXA 2QWRB 1WPXA 5EZYA 1PL4A 4F6EA 5CBFA 2Q4PA 3CPWU 5GONB 2R70A 1B06A 3STLC 1DTOA 1Q6IA 2A3QA 3APOA 3JASB 3QF7A 1YI2V 2WLLA 4YIOA 1Q6HA 1S5LZ 2VQFB 3CCQV 3SYOA 3T1YB 4JI8B 4O2AA 1EZVH 1PD3A 5IY5C 2IM9A 2HKOA 2LW1A 1EN4A 1BT8A 3JATB 5EK0A 5IWAB 4TWKA 2QE7G 4TV9A 3CYOA 1ZLZA 3K5OA 5ITZA 1JFFB 4BIUA 5JCOA 2ZD9A 1HWYA 3Q4HB 1QR9A 1BGYH 1KECA 5J9PC 3KKYA 5EYPB 3UM7A 4DR5B 1FJGO 4DR2B 2EILC 1KP3A 2XT9A 3ZHUA 3E8FA 1TUBA 4UVBA 4OX9O 4E4EA 3KCYA 4DV0O 4H13B 2DN9A 1XOUA 1YXBA 1O9HA 4AQYO 3W7XA 2WLNA 2VQFO 3F5WC 3T1YO 4DV5B 1M56B 3SR2C 1QCEA 3M8AA 3ETEA 3BHPA 2X0LA 1IURA 2PI5A 3ABMC 2EX3A 4GX2A 3J7AU 3CWBH 3RBZA 2GTAA 3K9AA 5LOVA 5IWAO 2QDOA 4ZOLA 1W2BU 5IE9A 1Y6XA 5EBMC 1XNQB 3WFVA 3TXSA 4WFFA 3MDSA 5KAFZ 2Q73A 1K8AW 5KMGB 3B4SA 3B77A 4C7UA 2ATKC 3JSLA 4DR7B 4EB6A 1N32B 2AZ2A 4X89A 3G71V 1ZSPA 5B1AC 4PA9A 4PD4F 1IXBA 3SJBC 2ZIOA 4B7KA 4JYBA 3M99B 4TQDA 1WN7A 1WJZA 1L0NH 1MG1A 4MVOA 2UUCO 1QLNA 2P06A 3SPJA 2M6YA 4DUYB 2BE3A 3ASOB 1VQOV 1QLEC 5H6RA 4OXSA 2Q7GA 4KHPB 3SYPA 3FB6C 2IU0A 1HR0O 2E74B 4I55B 1SQQH 2ODMA 4D6TH 1Y74B 3A2FA 1FS0G 4I9QA 4X8AA 1GM7A 5FL7G 1XNRB 4DR7O 3TGUH 1M1KW 5LXTB 1NR7A 4JAAA 1S3JA 4DUZB 1P7BA 3BEHA 3D8CA 4FZ1A 1VQ6V 4JI2O 1F4NA 3BAAA 4O4LB 1RM1B 1M93A 4LFCB 1N0NA 1NVPB 3ABUA 3ZIAG 3CCSV 3ABKC 2XAJA 3CCLV 1IBMB 3MHHC 2Z5UA 1VQ7V 4I4TA 5KHHA 3O65A 1FAFA 1AI6A 3ZN1A 3JD2A 4K3AA 2GUZB 3OT7A 4KHPO 1QR8A 3CX5F 1H8EG 1QU7A 5CA1B 5F2VO 1G4YB
chains in the Genus database with same CATH topology
1UPGA 1URFA 2Q0OC 4NKGB 4NB5A 1RFYA 2HJDA 2RMKB 4DYLA 1CXZB 1US6A 4IGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UPG A;  1URF A;  2Q0O C;  4NKG B;  4NB5 A;  1RFY A;  2HJD A;  2RMK B;  4DYL A;  1CXZ B;  1US6 A;  4IGG A; 
#chains in the Genus database with same CATH topology
 4TV8 A;  3NXS A;  5FNV B;  1XMQ B;  1BE3 H;  4LF4 B;  1XNR O;  1FPO A;  1CPY A;  3G4S V;  3MHS C;  2QR4 A;  4UV8 A;  1BSM A;  1VIB A;  1R6K A;  4DUZ O;  1HNW B;  3JAK A;  1ZX3 A;  2LP7 A;  4WFA V;  3GWO A;  4G28 B;  1I94 B;  4JTA B;  3FB8 C;  5IY5 B;  2ETN A;  3ZS8 C;  3CE2 A;  4LFC O;  4OPA A;  2IJK A;  4X64 O;  2Y69 C;  3IFX A;  5B3S C;  3KZI Z;  3KG2 A;  4PV1 B;  4QPK A;  2YC0 A;  1TVK A;  3I56 V;  2RQ6 A;  4RAI A;  1EN6 A;  2ZT9 B;  4UCT A;  1PNK A;  2EZP A;  4MS2 A;  2XAF A;  1K73 W;  4LF7 O;  3APQ A;  1EZJ A;  3FAV B;  3LNM B;  4PA3 A;  3P3P A;  4FFK A;  2EIL B;  1SER A;  2Z3Y A;  3SDL A;  4YJ2 A;  2FB5 A;  2LFS A;  2WLJ A;  4UV9 A;  4LF4 O;  2Y4T A;  4O2B A;  1IBL B;  2YEV B;  4DV6 B;  1OCC C;  4ABM A;  3GVM A;  4H44 B;  2QWP B;  1HNW O;  4PEL A;  2HEP A;  3WB0 A;  2R9R B;  2YUA A;  5C8Y B;  3JAM N;  1R3I C;  3ABM B;  1UPG A;  1NBM G;  5C93 A;  1RPO A;  2LO1 A;  3CRR A;  4GX0 A;  3CP1 A;  2OWO A;  5H6Q A;  1E1Q G;  2CTP A;  2ZM6 O;  2P22 C;  2JGD A;  4JI3 B;  3R65 A;  4PHZ A;  5L3E A;  1KMI Z;  1XMO B;  5LA6 B;  4B3R B;  1NJI W;  2E75 B;  1FKA O;  1S72 V;  5JJE B;  1WNS A;  3WB1 A;  3RW0 A;  4X1K B;  5B1A B;  4R6Z A;  4D7T A;  2EJ7 A;  2D3O W;  2NR5 A;  4DV6 O;  3OUF A;  4BAY A;  2AGA A;  2DYR C;  3S3W A;  3CCE V;  1SZX A;  4JV5 O;  4FMT A;  4DV3 B;  4FM2 A;  5CMU A;  3E22 A;  1QLE B;  3E8H A;  2Y0P A;  5EZY B;  4W4L A;  1H2K A;  3NR7 A;  2F95 B;  2Q67 A;  3EVK A;  1JOY A;  4L87 A;  5LYJ A;  1AR5 A;  3EXA A;  2ADQ B;  2PZS A;  1XMO O;  4MTO A;  4AIL C;  4B3R O;  4GLX A;  3ZMT A;  3JCU Z;  1SQV H;  1VP7 A;  4O2A B;  1EN5 A;  1KB9 F;  5JJN B;  1N8R W;  2Q7H A;  4PDR A;  3WG7 C;  4CBC A;  2UXB B;  4DRX A;  2BTO A;  1AR4 A;  5EBW C;  1FFT B;  3K0G A;  3L74 H;  2UUB O;  4PDV A;  4TV9 B;  4JF3 A;  3U11 A;  3ABK B;  2Q0A A;  3P3N A;  4X62 B;  3HB3 B;  5ITZ B;  2CUG A;  2V1D A;  3HKD A;  3W7U A;  5K1P A;  2BCC H;  4U7N A;  3DTU B;  3RYF B;  3E89 A;  5FLX N;  4LH6 A;  1VMG A;  2H8P C;  1YTF B;  5JJJ B;  5BR8 O;  4TUY A;  5BY1 A;  3B8M A;  4MTX A;  1TUB B;  1VF6 A;  1SS3 A;  2LQT A;  2XHB A;  2JEU A;  5FPO A;  1HNZ B;  1DK1 A;  3K04 A;  5B5E Z;  1B04 A;  1K92 A;  1PPJ H;  2V4D A;  2EIN C;  2QWO B;  4JI7 B;  4UCR A;  3L75 H;  2R9I A;  4UFZ A;  2A7W A;  1V55 C;  1WAZ A;  5LOV B;  3BCC H;  1IVS A;  2Y69 B;  2QTS A;  5B3S B;  4J9Y B;  2DMX A;  4IHJ A;  3K03 A;  1YZB A;  3OMN B;  4X62 O;  4LF8 B;  2KKW A;  1JJO A;  4LF5 B;  2KG7 A;  1GN6 A;  4EB6 B;  2IJI A;  2C2A A;  4B3M B;  2UU9 O;  1L1F A;  2RNB A;  1K97 A;  1OCZ C;  4KP4 A;  3A0H Z;  1GN4 A;  1HNZ O;  1M57 C;  1Y67 A;  2JVD A;  1HDJ A;  3R66 A;  4P9O A;  2YIB A;  4H37 A;  1VQP V;  3HKB B;  4YJ3 B;  2X6A A;  2EZO A;  3GWK C;  4RQE A;  2LGQ A;  5DM6 V;  2QKC A;  1XEQ A;  4PA4 A;  1PKX A;  4K35 A;  1SZT A;  4DV7 B;  3ASN C;  5JH7 A;  3E83 A;  3QO5 A;  3SPH A;  2RN9 A;  2YS8 A;  2QTO A;  2ZIN A;  3OAA G;  2FML A;  4B3T B;  4YY3 O;  2QM4 A;  1GRJ A;  2AHZ A;  2P90 A;  5CB4 A;  3CRA A;  3I5D A;  1G1X B;  4NXN B;  1MMM A;  1RPR A;  1P7G A;  4LCU C;  5DN6 G;  3JAR A;  1BCC H;  3OUS A;  2RJZ A;  4X1Y A;  5KLV H;  2JIZ G;  1SA0 A;  3ZHQ A;  4LFB O;  1Y66 A;  2DYR B;  2NLJ C;  4FLW A;  4I4T B;  2LGW A;  4GX5 A;  3UT5 A;  2ZIM A;  1FXK A;  2ITD C;  2DE0 X;  4I0X A;  3CCV V;  4QE9 A;  1YF2 A;  1VF6 C;  4MVS A;  1GMG A;  4HNA A;  1OCR C;  4TV8 B;  5L3F A;  4X1I A;  4JI4 B;  3ZRS A;  5HFM A;  5IYZ A;  1K34 A;  1N0J A;  1US6 A;  2YID A;  3WG7 B;  2HFE C;  2G38 A;  4B3S B;  2XUM A;  4OX9 B;  1XQ8 A;  2B5U A;  1NT2 B;  2DQ3 A;  4DV0 B;  4BW5 A;  2A79 B;  4FM0 A;  4AQY B;  5CN0 A;  5D5Q A;  2VS0 A;  3SPC A;  1Q86 W;  1OZ0 A;  2H94 A;  1R3L C;  4FLZ A;  1XL4 A;  1R6T A;  2RCV A;  3FD9 A;  1XHZ A;  3RYI A;  4TQF A;  1QHT A;  3ETQ A;  4YJ2 B;  1VF7 A;  1VQ8 V;  4IL6 Z;  4O2B B;  1AJP A;  1P49 A;  1NKD A;  1VQM V;  4JI4 O;  3E8B A;  3E8G A;  2EIN B;  4XBF A;  2VRZ A;  4DV2 B;  4NTW A;  5L3B A;  2Y0I A;  2W6J G;  3B09 A;  3CJH A;  1V55 B;  4B3S O;  4R8C A;  4RWU A;  1R3K C;  2NN4 A;  1YSC A;  3SJA C;  2ZE5 A;  1NU1 H;  4CH4 A;  2JGD B;  3UO2 A;  1THZ A;  2FTK A;  4FM1 A;  3BAB A;  2UUC B;  4ZI7 A;  1AJN A;  5IYD O;  2N05 A;  2OCC C;  3ZCC A;  2ZE6 A;  1OHH G;  1R3J C;  1OCZ B;  2WA4 A;  3SJQ C;  2Q68 A;  5IJ0 A;  3CCJ V;  1HR0 B;  1GKF A;  1YCI A;  3RVZ A;  1K4C C;  1IZ3 A;  1M57 B;  2F23 A;  1ORQ C;  3HR0 A;  4GKJ B;  1MA1 A;  5B1O A;  4DXW A;  3ZN0 A;  4WFH A;  4DV2 O;  1BHB A;  3CD6 V;  3E22 B;  3UCS C;  1FXK C;  1H2L A;  4JI2 B;  2KQX A;  2WLI A;  2XND G;  3D3Q A;  3N2K A;  1HNX O;  1AJQ A;  3DC6 A;  2XAG A;  3THO A;  3RVY A;  5LYJ B;  4EFE A;  1KBH A;  3ASN B;  1JX9 A;  1BZK A;  4PA7 A;  3LDE A;  4N21 A;  1S5J A;  3W7S A;  1JMK C;  2Q5Z A;  4DV4 B;  3A0R A;  3EFF K;  3CEI A;  3SPI A;  3W7T A;  2QWN B;  1EFR G;  1E1R G;  3ZHR A;  4DRX B;  1NH2 B;  1PL0 A;  1J5E O;  3FX7 A;  4MSW C;  3H1H H;  4GKJ O;  3X2Q C;  5LP6 A;  1Z5W A;  2DYS C;  2XTA A;  1SC5 B;  1YVW A;  1BHA A;  2UXX A;  3HKD B;  3JYC A;  1COW G;  2W0X A;  2HP8 A;  3DGE A;  3CC2 V;  1AR1 B;  3K5M A;  4FK5 C;  2DOS A;  4TUY B;  1VF5 B;  4X64 B;  1JVM A;  2HVK C;  3H9V A;  1LUW A;  3N2G A;  1J95 A;  4YHH O;  1OCR B;  2GV9 A;  5CA0 B;  5JCO C;  3L72 H;  3OMA B;  4DV4 O;  2YXL A;  4KL1 A;  1SQG A;  2ZR3 A;  1URF A;  4LF7 B;  4NB5 A;  5B1B C;  1DLB A;  2ZNI A;  3ZHV A;  1P4R A;  3CRQ A;  4CS2 A;  2MK3 A;  4Z1M G;  1VQK V;  3H01 A;  5A2Q N;  5J2U A;  3M7M X;  4IHJ B;  2IBZ H;  2HJF C;  2Q69 A;  4CC6 A;  3SYQ A;  5KA5 A;  3BVO A;  1G6U A;  3OTF A;  2KG7 B;  3ETG A;  4UXN A;  2Q8V A;  1BQ0 A;  4UCV A;  4YIP A;  1N36 B;  4DK0 A;  2B1I A;  2ZM6 B;  2X7R B;  1GN3 A;  4JTD B;  4WBN A;  4AHC A;  1Q8I A;  1XHX A;  4TT3 G;  4FLV A;  3T1H O;  4EEQ A;  4O4J A;  5KHG A;  3CSX A;  4ASU G;  5IYC O;  2M7W A;  2EIM C;  2QJ1 A;  3W7W A;  2BTQ A;  3K5L A;  1KD1 W;  2CTW A;  3ZHT A;  5JH7 B;  1Y76 A;  1U96 A;  3UQ8 A;  2ZDI A;  1R73 A;  1XDC A;  2PF4 E;  5CB4 B;  1PV0 A;  3CCR V;  4JV5 B;  1OJH A;  2UUA B;  1F4M A;  5KUM A;  3JAR B;  4FVM A;  1GM8 A;  3K08 A;  2OCC B;  4X1Y B;  1MSW D;  1Q5O A;  2B9Z A;  3F5T A;  4I50 A;  3U0Z A;  1N36 O;  3SJC C;  3K06 A;  1GTO A;  3CRM A;  5LP6 C;  2F93 B;  5KX5 A;  5EYP A;  4GKK O;  5AG2 A;  3E35 A;  2JJ2 G;  4QNH B;  3UT5 B;  2QEX V;  3TXQ A;  5B66 Z;  1FXK B;  2NNU A;  1S0V A;  4I0X B;  5KHJ A;  4FLX A;  4J10 A;  1M5I A;  4LH7 A;  4TSF G;  1TUE B;  4FLY A;  2ZQM A;  5J2T A;  1AVM A;  3AK3 A;  5EIB D;  1K4D C;  4N23 A;  1WB8 A;  2UUB B;  1W59 A;  5JQG A;  4DR4 O;  4L8J A;  4X1I B;  3AG7 A;  4F6R A;  2UUA O;  1SQP H;  5IYZ B;  4DW0 A;  5CBH A;  1SES A;  2GHY A;  3IGA C;  5BR8 B;  3AEI A;  3PN1 A;  1GN2 A;  1OV9 A;  4NXM O;  1ZAU A;  5IJ9 A;  1KQS U;  3AK1 A;  4IT5 A;  3RGB A;  3RT3 C;  1BMF G;  4UCO A;  3X2Q B;  3JAL A;  2DYS B;  1R6N A;  2WLL B;  2QWQ B;  4IGG A;  5E79 Z;  2P7T C;  3K5N A;  4NKG B;  1LNQ A;  3RWR D;  2QKA A;  3VQX A;  2XAH A;  3AG1 C;  4XDJ A;  1P84 F;  5E1A C;  1FFX A;  3ZHS A;  1O9G A;  3RYI B;  2IJJ A;  4X88 A;  4U7O A;  1TAE A;  1H2S B;  1AI4 A;  1Q43 A;  4GYC B;  5LBQ A;  3AG2 C;  5H2F Z;  3K3W A;  1WA8 A;  2CAZ C;  4H0L B;  1N4C A;  2CE4 A;  2UU9 B;  4I55 A;  5B1B B;  2PI4 A;  5K1X A;  3CJH B;  4NYK A;  3JD3 A;  3P30 A;  2JJ1 G;  2YDE A;  2Q9L A;  4CC5 A;  4Z1V A;  5LGT A;  2ZDI C;  1SF9 A;  3OTO B;  1JR9 A;  5L3C A;  2HJD A;  4QIW F;  2DWE C;  4J11 A;  1OCO C;  3G80 A;  4ZI7 B;  2W6I G;  3MD0 A;  1KUQ A;  1LUV A;  4DO2 A;  5LGN A;  1WP8 A;  2QGN A;  4F4L A;  4FJC C;  2QM8 A;  3OGI B;  4ZOL B;  2V7Q G;  4GZR B;  4UB8 Z;  1FXH A;  5IJ0 B;  2R9A A;  4LF9 O;  1VQL V;  4YY3 B;  3VBB A;  4FPP A;  5LHG A;  4MVU A;  4LFA B;  1Q3E A;  3FB7 C;  4D7S A;  5CA3 A;  1SET A;  4I9W A;  5L3G A;  1IX9 A;  2YI8 A;  4WFG A;  2YI9 A;  5CA1 A;  4JI5 O;  3OGC C;  2AHY A;  5KHK A;  4J7J A;  2X6C A;  1NVP D;  4PDM A;  2JRI A;  3IJ4 A;  2WLI B;  5EBL C;  3T1C A;  2EIM B;  4ZBM A;  4BR6 A;  2L6L A;  4H33 A;  3OTO O;  2JEX A;  3CMA V;  4LFB B;  1OCC B;  4CS4 A;  5KAI Z;  1Y4M A;  4LBE C;  1F7Y A;  3P32 A;  1F51 A;  3B8N A;  1MNG A;  4JI0 O;  1N33 B;  4HYO A;  3CHX A;  3H1L H;  4O4I A;  4RQF A;  2P4V A;  4LC1 A;  5KUK A;  2DWD C;  1WLE A;  2DW4 A;  4ZKI A;  2CTR A;  3DSQ A;  3BY6 A;  1D2D A;  3OFN G;  4DW1 A;  5D5P A;  4A5U B;  1PNL A;  5LP6 B;  4LFA O;  2WLK A;  4MW3 A;  4ZIB A;  3FAV A;  3HPL C;  3H1I H;  3HKC A;  1PP9 H;  2L35 A;  1Q6U A;  1YJN V;  4FLU A;  2GBO A;  1X4T A;  3DXR A;  4I5S A;  2E3C A;  3O9O A;  1YHQ V;  1K33 A;  4Q6G A;  1XIL A;  1WB7 A;  2ZXW C;  3N2G B;  4GT1 A;  4OGQ B;  3CC7 V;  3SYC A;  2XOK G;  5H5N A;  3L73 H;  3SGI A;  1N33 O;  2XAS A;  2UXN A;  2B1G A;  2DQ0 A;  3JAW A;  5IT9 N;  2HHH B;  2DJV A;  1IDS A;  4E2L A;  2VWK A;  2VQE B;  1I5X A;  3OEE G;  4ICG A;  1ENV A;  1NTM H;  1KKD A;  4FFB A;  2ILM A;  1UFI A;  3AG3 C;  4X9Q A;  4B08 A;  1N34 B;  5J2U B;  3HKE A;  4EFB A;  2OTL V;  2MW2 B;  3K9S A;  2IW5 A;  4G27 B;  3JAK B;  4RUE A;  3FB5 C;  4X1K A;  5DED A;  1K7D A;  1DF5 A;  3AG1 B;  2OT5 A;  1F23 A;  2YXH A;  5BMV A;  1IBK B;  1TA8 A;  2FL4 A;  1TVK B;  1JCH A;  1T5E A;  3L70 H;  1YIT V;  1GO3 F;  2YIA A;  4WBN B;  1AP6 A;  2F66 C;  4JAU A;  4MTF A;  3AG2 B;  2HHH O;  4O4J B;  1UJW B;  3ZX6 A;  4UVA A;  4IIJ A;  4LP8 A;  2P6J A;  3GB7 C;  4NTY A;  2VQE O;  4JAV A;  4MVQ A;  3SYA A;  2BTQ B;  1DGS A;  4JYY A;  1N34 O;  2OTJ V;  1R1B A;  4LR3 A;  1Y76 B;  2BSK A;  4GCZ A;  2EUL A;  4ZHQ A;  1K9M W;  1RP3 B;  2GTS A;  2OCH A;  2CDY A;  1ZUQ A;  3RYC A;  2R72 A;  2WLH A;  1HP8 A;  3VOU A;  3ZJZ A;  2IH3 C;  1OCO B;  4TOI A;  2WA3 A;  3FFQ A;  3ZMZ A;  3G6E V;  3RFR A;  1M4U A;  2Q6A A;  4JI6 B;  3TCU A;  1NQT A;  1U97 A;  1XBL A;  1IBK O;  4I50 B;  1HNX B;  2CH7 A;  1SQB H;  4XDL A;  1NS1 A;  3IC9 A;  1SRY A;  4JYA O;  5GW7 A;  5L3D A;  5LMU B;  4X65 B;  3RYF A;  5KX5 B;  3CCM V;  3ZBH A;  4DYL A;  1FD9 A;  1W0J G;  4FIP C;  1QQC A;  2IJH A;  2WPD G;  3JCZ A;  2GDS A;  2P4K A;  3T4Z A;  4DK1 A;  4NR1 A;  2O57 A;  5HFL A;  1ZTE A;  3AG4 C;  4X20 A;  5EC1 C;  5J2T B;  4J9Z B;  2Z0A A;  4G2K A;  1J5E B;  4JI8 O;  3LDC A;  5JQG B;  2ZE8 A;  2PTM A;  1ZL8 A;  1YTF D;  2QKS A;  4F6R B;  1NI8 A;  1K3E A;  3AK2 A;  4JI6 O;  3OR6 C;  3L71 H;  3J80 N;  5DEC A;  2F4V B;  3SPG A;  1Q81 W;  4HZ3 A;  3ZMV A;  3BA9 A;  4JAS A;  5IJ9 B;  3TET A;  3K79 A;  2WSS G;  5LMU O;  4HAM A;  4X65 O;  4YHH B;  4DR5 O;  5B1N A;  1KYO F;  3B2E E;  3JAL B;  2PYJ A;  2GSM B;  4AI8 A;  1QVF U;  2ARH A;  1NTZ H;  5GTI Z;  4DR2 O;  2JGU A;  3CXC U;  4J80 A;  1WPB A;  1M9N A;  1IXM A;  3D3I A;  4GUN A;  1FFX B;  1XL6 A;  3OD4 A;  1YIJ V;  1WP7 A;  3ZRW A;  4DV5 O;  2ZXW B;  3OMI B;  4CS3 A;  3HKB A;  2ZNJ A;  4YJ3 A;  2UXD B;  1MOF A;  2HVJ C;  1NTK H;  3OM3 B;  4CH3 A;  2QA4 V;  3JD0 A;  1WA8 B;  1XNQ O;  2F4V O;  2K9P A;  3G67 A;  2HG5 C;  3LUT B;  3AG3 B;  3PJS K;  1MAB G;  1Z5V A;  2ZE7 A;  1VEW A;  3BFR A;  4U3J A;  1B3Q A;  1N32 O;  3D36 A;  3E2E A;  2LFR A;  4KXR A;  3FKS G;  3T1H B;  1JJ2 U;  4LNU A;  3F7Y C;  3OW2 U;  1PNM A;  2QM7 A;  3C3T A;  1DF4 A;  4MT8 A;  3RYH A;  3KCX A;  4BIO A;  2VWJ A;  5FPR A;  4NTX A;  1EBO A;  1CP9 A;  1ARO P;  1H2M A;  4QPJ A;  3LDD A;  1NR1 A;  4J7Z A;  2UXD O;  4O4H A;  2N04 A;  3TJT A;  4DUY O;  1ROP A;  4LWS A;  1W0K G;  2AZ0 A;  4WFE A;  2Q7E A;  3ZRV A;  1RSO A;  3LSU A;  4JGS A;  1S77 D;  1XRE A;  3K57 A;  2IU3 A;  4X66 B;  1RFY A;  1JPX A;  1XI1 A;  5JVD A;  3J81 N;  1K5Q A;  2FKX A;  1E79 G;  3A0B Z;  5BZB A;  1VQ5 V;  4GKK B;  3B40 A;  1YEW A;  1FYJ A;  4GX1 A;  1KU9 A;  5GON A;  5LGU A;  2KSD A;  2EIK C;  4O4I B;  2HR3 A;  3CCU V;  2ZKO A;  1IBM O;  2ADP A;  2OIE A;  2K1E A;  2WWW A;  2CTQ A;  3JAS A;  1S5H C;  2A9H A;  3OR7 C;  3VQV A;  3ICX A;  2EBO A;  3CXH F;  4DR4 B;  3QO8 A;  4Z2W A;  3LNN A;  3HKC B;  3JAT A;  4QE7 A;  4EKW A;  4W4K A;  2N74 A;  5EC2 C;  1M90 W;  1YJW V;  2P67 A;  4JI1 B;  3QG5 A;  4PI2 A;  3DXR B;  1XMQ O;  1D5N A;  4X66 O;  1SA0 B;  5BXZ A;  1JFF A;  4NXM B;  2KB1 A;  2E5L B;  3AG4 B;  4YXW G;  1Z2G A;  1TGO A;  3Q4H A;  3TK1 A;  5GTH Z;  1I94 O;  1D5A A;  3DC5 A;  2EIJ C;  4DV1 B;  1Q7Y W;  3ML0 A;  3JAW B;  1L0L H;  1AIL A;  1NZ6 A;  3JD4 A;  1VQN V;  4K8Z A;  4BIZ A;  2F43 G;  4FFB B;  3STZ C;  2H3O A;  4HNA B;  1SKV A;  2P5O A;  3QVN A;  1I5Y A;  3HKE B;  5KHI A;  1SQF A;  3BRC A;  1BS3 A;  2JS5 A;  3D36 C;  5IDJ A;  1L8D A;  5KA6 A;  4J41 A;  1VQ9 V;  1H2N A;  1H2G A;  4JZG A;  2CGN A;  3ZRX A;  3IAY A;  1KP2 A;  2D2C B;  4JI1 O;  1I7F A;  5LHH A;  1IBL O;  2RMK B;  5KMG A;  2LW7 A;  3VQW A;  2E5L O;  4FZ0 A;  5BMV B;  4LF6 B;  3UKM A;  1KKC A;  3VQY A;  1HW7 A;  4DV1 O;  3ZMU A;  3K59 A;  3CS5 A;  4JPR A;  1SQX H;  3ABL C;  3ABT A;  1B6Q A;  3JSN A;  4UVC A;  4DR1 B;  4IIJ B;  1BQZ A;  4P30 A;  4JI3 O;  4MVM A;  3EHB B;  1V54 C;  4CH6 A;  1MZF A;  3OE7 G;  3K0D A;  4LF9 B;  4CZZ A;  2BSK B;  2YIC A;  4ZHQ B;  3RYC B;  4OPH A;  2OIG A;  1H8H G;  4J7K A;  4JI5 B;  4Q20 A;  1Y74 A;  1QVG U;  4LF6 O;  2CH7 B;  1BL8 A;  3K58 A;  5LXT A;  4DV3 O;  2F1M A;  5CBG A;  1GH6 A;  4K0K B;  2FYU H;  4BWA A;  1EM1 A;  4O4L A;  4DR1 O;  2CGO A;  2Q0O C;  1VQ4 V;  4JI0 B;  1G8M A;  2A06 H;  1NH2 D;  5IYB O;  2QSA A;  1AP5 A;  5CA0 A;  4KFM A;  4JTC B;  1FXV A;  5EIB C;  2RDC A;  4X20 B;  3N27 A;  3C90 A;  4DR6 B;  3ZMS A;  2GUZ A;  1AI7 A;  1LR1 A;  1ZL8 B;  3CRC A;  1CEZ A;  4J42 A;  2UXB O;  4P9P A;  3FYE B;  3I55 V;  1KC8 W;  2EIK B;  1A32 A;  1YJ9 V;  2UXC B;  2W0F C;  3N2K B;  2Y48 A;  3QO7 A;  5FNV A;  2EJR A;  4PJ0 Z;  1S76 D;  4HBN A;  4JYC A;  4UB6 Z;  3CME V;  1M56 C;  2PGG A;  4WFB V;  4K0K O;  3IC7 A;  1JQ0 A;  1K5S A;  4PA6 A;  3QTC A;  2WLM A;  3E86 A;  4QJF B;  1JA8 A;  2JDI G;  5TIS Z;  4RO2 A;  1QNM A;  3FYI B;  4R7C A;  1QBZ A;  1ZWI C;  4IYH A;  4CH5 A;  4R50 A;  2LJ2 A;  3H1J H;  4JI7 O;  3ZRW B;  3JD1 A;  4DR6 O;  3ZED A;  3F7V C;  1MZE A;  2A0L A;  3T2M A;  1X59 A;  5LL6 Y;  2EIJ B;  1Q90 D;  4WF9 V;  2JK5 C;  1PM9 A;  4DR3 B;  1CXZ B;  4UCS A;  3L9D A;  2JS3 A;  2UXC O;  4FLT A;  3MAQ A;  4K8X A;  4IYI A;  4LF8 O;  1XUQ A;  5LMN B;  2YEV A;  2BOB C;  4BW9 A;  4KUM A;  3CB2 A;  1Q82 W;  4U3F H;  4I7Z B;  3CC4 V;  4B7E A;  2YIB D;  4RUF A;  4LF5 O;  3ASO C;  3QNE A;  5C8Y A;  4U3J B;  4WCE V;  1MSD A;  4B3M O;  3H1K H;  1AI5 A;  4UUJ C;  2IH1 C;  2ITC C;  4PDL A;  2HLD G;  1GAX A;  4MW8 A;  2AW9 A;  1GK9 A;  4LNU B;  3BPZ A;  3T4D A;  2PYL A;  5H9C A;  3RYH B;  3WU2 Z;  5LHI A;  3U10 A;  5LA6 A;  2ZCE A;  4XDK A;  4NVP A;  4JZ2 A;  3G6B A;  5JWP A;  4MVR A;  4O4H B;  1VAR A;  4MVZ A;  4LWS B;  2X6B A;  3LSQ A;  4P2Z A;  3WB2 A;  2E76 B;  5A9G A;  3ETD A;  4DR3 O;  1RM1 C;  4UCU A;  2BOC C;  1H38 A;  3ABL B;  4DV7 O;  2ZR2 A;  1AB3 A;  2CK3 G;  2PUS A;  1GM9 A;  1RSO B;  5LMN O;  1V9P A;  4B3T O;  3BA8 A;  3S3X A;  4QGP A;  4PI0 A;  1I0H A;  3OEH G;  1V54 B;  2XAQ A;  2Y4U A;  3A8T A;  2AXT Z;  4MTG A;  2YSU B;  2PY5 A;  2OYQ A;  1I08 A;  4NXN O;  3LSS A;  5JVD B;  4JYA B;  2YXY A;  3UO3 A;  2WAM A;  3RN4 A;  1FJG B;  3C3S A;  1YDX A;  2QWR B;  1WPX A;  5EZY A;  1PL4 A;  4F6E A;  5CBF A;  2Q4P A;  3CPW U;  5GON B;  2R70 A;  1B06 A;  3STL C;  1DTO A;  1Q6I A;  2A3Q A;  3APO A;  3JAS B;  3QF7 A;  1YI2 V;  2WLL A;  4YIO A;  1Q6H A;  1S5L Z;  2VQF B;  3CCQ V;  3SYO A;  3T1Y B;  4JI8 B;  4O2A A;  1EZV H;  1PD3 A;  5IY5 C;  2IM9 A;  2HKO A;  2LW1 A;  1EN4 A;  1BT8 A;  3JAT B;  5EK0 A;  5IWA B;  4TWK A;  2QE7 G;  4TV9 A;  3CYO A;  1ZLZ A;  3K5O A;  5ITZ A;  1JFF B;  4BIU A;  5JCO A;  2ZD9 A;  1HWY A;  3Q4H B;  1QR9 A;  1BGY H;  1KEC A;  5J9P C;  3KKY A;  5EYP B;  3UM7 A;  4DR5 B;  1FJG O;  4DR2 B;  2EIL C;  1KP3 A;  2XT9 A;  3ZHU A;  3E8F A;  1TUB A;  4UVB A;  4OX9 O;  4E4E A;  3KCY A;  4DV0 O;  4H13 B;  2DN9 A;  1XOU A;  1YXB A;  1O9H A;  4AQY O;  3W7X A;  2WLN A;  2VQF O;  3F5W C;  3T1Y O;  4DV5 B;  1M56 B;  3SR2 C;  1QCE A;  3M8A A;  3ETE A;  3BHP A;  2X0L A;  1IUR A;  2PI5 A;  3ABM C;  2EX3 A;  4GX2 A;  3J7A U;  3CWB H;  3RBZ A;  2GTA A;  3K9A A;  5LOV A;  5IWA O;  2QDO A;  4ZOL A;  1W2B U;  5IE9 A;  1Y6X A;  5EBM C;  1XNQ B;  3WFV A;  3TXS A;  4WFF A;  3MDS A;  5KAF Z;  2Q73 A;  1K8A W;  5KMG B;  3B4S A;  3B77 A;  4C7U A;  2ATK C;  3JSL A;  4DR7 B;  4EB6 A;  1N32 B;  2AZ2 A;  4X89 A;  3G71 V;  1ZSP A;  5B1A C;  4PA9 A;  4PD4 F;  1IXB A;  3SJB C;  2ZIO A;  4B7K A;  4JYB A;  3M99 B;  4TQD A;  1WN7 A;  1WJZ A;  1L0N H;  1MG1 A;  4MVO A;  2UUC O;  1QLN A;  2P06 A;  3SPJ A;  2M6Y A;  4DUY B;  2BE3 A;  3ASO B;  1VQO V;  1QLE C;  5H6R A;  4OXS A;  2Q7G A;  4KHP B;  3SYP A;  3FB6 C;  2IU0 A;  1HR0 O;  2E74 B;  4I55 B;  1SQQ H;  2ODM A;  4D6T H;  1Y74 B;  3A2F A;  1FS0 G;  4I9Q A;  4X8A A;  1GM7 A;  5FL7 G;  1XNR B;  4DR7 O;  3TGU H;  1M1K W;  5LXT B;  1NR7 A;  4JAA A;  1S3J A;  4DUZ B;  1P7B A;  3BEH A;  3D8C A;  4FZ1 A;  1VQ6 V;  4JI2 O;  1F4N A;  3BAA A;  4O4L B;  1RM1 B;  1M93 A;  4LFC B;  1N0N A;  1NVP B;  3ABU A;  3ZIA G;  3CCS V;  3ABK C;  2XAJ A;  3CCL V;  1IBM B;  3MHH C;  2Z5U A;  1VQ7 V;  4I4T A;  5KHH A;  3O65 A;  1FAF A;  1AI6 A;  3ZN1 A;  3JD2 A;  4K3A A;  2GUZ B;  3OT7 A;  4KHP O;  1QR8 A;  3CX5 F;  1H8E G;  1QU7 A;  5CA1 B;  5F2V O;  1G4Y B; 
#chains in the Genus database with same CATH homology
 1UPG A;  1URF A;  2Q0O C;  4NKG B;  4NB5 A;  1RFY A;  2HJD A;  2RMK B;  4DYL A;  1CXZ B;  1US6 A;  4IGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...