4PI2A

Crystal structure of particulate methane monooxygenase from methylocystis sp. atcc 49242 (rockwell) soaked in zinc
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
390
structure length
390
Chain Sequence
HGEKSQQAFLRMRTLNWYDVQWSKTTVNVNEEMVLSGKVHVFSAWPQAVANPRVSFLNAGEPGPVLVRTAQFIGEQFAPRSVSLEIGKDYAFSINLRGRRAGRWHVHAQINVEGGGPIIGPGQWIEIKGDMKDFTDPVTLLDGSTVDLEHYGISRVYAWHLPWMAVGAAWIFFWFVRKGIITSYIRVAEGKADDVIGDDDRRIGAIVLALTILATIVGYAVTNSTFPRTIPLQAGLQKPLTPIETEGTVGVGKENVTTELNGGVYKVPGRELTINVKVKNNTSQPLRLGEYTAAGLRFLNPDVFTTKPDFPDYLLADRGLSVDATPIAPGEAKEIVVKIQDARWDIERLSDLAYDTDSQIGGLLFFFSPDGKRYASEIGGPVIPKFVAGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Effects of zinc on particulate methane monooxygenase activity and structure.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords unknown peptide
total genus 85
structure length 390
sequence length 390
chains with identical sequence E, I
ec nomenclature ec 1.14.18.3: Methane monooxygenase (particulate).
pdb deposition date 2014-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4pi2A02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 4pi2A03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 4pi2A01
4O65A 4PI2A 4PI0A 3RGBA 3CHXA 3RFRA 4PHZA 1YEWA
chains in the Genus database with same CATH superfamily
1IFHH 1ZJBA 3NG5A 4FXKB 2LW7A 2VZTA 1OPGL 3WFCL 4AVAA 1PJWA 3E9UA 4NUGL 4JDEA 2J44A 2R23A 1X82A 4NO5A 5FWQA 4ZKTB 4MASA 2YBKA 1J7VR 1LO4H 3EGXB 2R1YB 1BXUA 3PWLB 2A2QT 5E94B 6PCYA 4P99A 3IN9A 4OR1A 2CLVA 2XQBH 4L4VB 1SDAB 1FT9A 3VGGA 1UO9A 4U3FH 1JWMA 3QEQB 3CLPA 3V52L 2JKNA 4K3DH 1TZAA 4IIQB 4LEXL 2CK3G 2YXMA 3U7WL 3TN92 1BCCH 3Q01A 1MFEH 2V3DA 3BKYL 4KBBA 4KXZH 4JFFE 5JMOC 5E1GA 5FKCA 1N2RA 3LWCA 1A7BA 1XAKA 4JPQA 1V5JA 5TQ0L 5LQBL 2H3XC 3L5XL 4JZNA 1AYN1 2D6NA 4LT5A 3U1QA 4NO4A 4GXUM 1WZXA 4BR6A 3DEMA 4P9HL 3QQNA 3KGLA 3WIHA 4ETQB 2EVHA 1M2VB 4I8DA 4JL1A 1BVP1 4EUPH 1NI8A 2J1XA 3RGVC 1LOEA 4J11A 4GXUN 3HJEA 3VFRA 5MEPB 1MCDA 4HF5L 2QTVA 2JTDA 1DQJB 4PB0H 4K8RH 1NLSA 3EJUA 3Q7JA 4P2RE 5GJTH 4PGEA 3CRAA 3LZFL 4PV8B 4UB0H 3W9EA 1XGPB 4LFBB 4OIAA 2WWUA 4QY8B 2QHRL 3AAZB 2C5DC 4X4MA 5FOJA 1D6VH 5J3HC 4HGWA 5CSBA 2JK5A 3HC3L 5JA9A 3C3SA 4X7SL 1QR1A 5D5PA 2HTLD 2OMUA 1V7NH 3GMLB 2ENYA 1OCRB 1FFNA 1N68A 2DMGA 1WS8A 4R7NA 2ZEWA 5C08B 2LALA 1Y6NR 3HMXH 1EZVY 2FB4L 4JKPL 5H8DA 5DD6B 3ZL4H 1YSCA 4BJLA 1WZMA 2YD9A 3RWCB 4M6AA 1QMJA 1R1ZA 4Y1XA 4KZDL 1AX2A 1ZHNA 1SQVH 5EBMC 3D85B 3PYCA 4J4PD 4J3TA 3NMEA 3P9MB 4HGWB 4Y4HB 5LAPA 3QHFH 4YHYC 4QM8A 3F6IA 4WU7A 3DTXB 3MGOA 2JCCB 3BN9C 4FMTA 4I2XB 1JRHH 1RMU3 3UKTA 2ICWI 4K7PH 4FPYA 1OTTC 4LK7A 1K5SA 3K6DA 2IAAC 5D7IE 1I3RB 2XWBA 4C8DA 2LFGA 3HC4H 4NIYE 4UQ3B 1QWNA 1ZHLA 4ZMVA 5FX3A 2L35A 3TO2A 3CLFH 4J4PA 4OJAA 1XF2B 5JXGA 1DVUA 3K03A 5AKSA 4IEQA 3TT1L 4HWEL 4U6HA 2C4FT 3L3JB 1ZIAA 3FSVA 5ALCH 5EG6C 6FABH 1CF1A 1E9OB 4WSGA 5CCKH 4YW7A 1HL5A 3VNYA 1T6VN 4I1PA 4CNIB 3KWVA 3MA7A 1HHKA 4N2BA 3TNMA 3AZWA 3W0WE 4XMUA 3RYKA 3TEUA 4K3HA 1JZ6A 1MHEA 2D6LX 3R4DB 3POYA 1I9IL 3JWNC 3FONB 4L9LA 1SXCA 4AGGA 1LP9B 2CQVA 4JI3O 5T1LD 3LZPA 1TJHH 4LFHG 2QR0B 3AREC 1O4TA 4ASKA 1DBAL 5SV3A 3I49A 3UJJL 2E76B 1CDJA 4LNRA 1D4M3 2WGXA 4MD4A 3MLKA 2H4EA 3OTTA 4IBTA 1ZHBB 4IEFB 5D7KD 1DZRA 4WTQA 4XB7A 5IMLA 5BNNA 5EUOB 1YC8A 1B4LA 1GS8A 4UM8B 2YD5A 2K6WA 3GLZA 1YC61 1COWG 4NAOA 2BVQB 3VBOB 3I6GA 3IFPB 4M1GH 1F6FB 1QRNB 2BSRB 2I07A 3SQRA 4AITA 1JYVA 2PMWB 4JFZL 4NB7A 3BI3A 3WN6A 1ZTXH 4PJ8B 4G6FD 3QH7A 5LXTB 4XWOD 4HJ0D 1JH5A 4DEQA 1ID2A 3RWGA 4CDUC 3MGOB 1Y74A 1S7RA 1VRSA 1P4UA 1VEWA 3WXVL 3PG2A 2LT9A 1E8YA 3OKKA 4DN3H 1UKGA 1JOIA 1C5BL 1SQFA 3P9MA 4J3OD 3CCVV 4Y2DB 3CVHL 2WTOA 4DWHA 1C8M2 4HJUA 3SLIA 4F8AA 1Z3GH 2R2HA 1KBGH 2VDQB 1T83C 5EC2C 1WFMA 4FDWA 5ID0B 2GP5A 4YRDA 2Y1YA 1JOBA 1AOHA 4O4HA 5E23A 3UEZA 3ZR5A 4J3OC 5TPWL 3OJ2C 3NOIA 1TO5A 2QGEA 2WKGA 3RRQA 1PL4A 2ZX7A 5DG1A 4AEKA 5SWZE 4H40A 4KXBA 5H94B 1ED3A 4X8GA 4CUCA 4GD4A 4LPWA 2WXPA 4JPIA 1J86A 2B8OT 1MHCA 3QJUB 2AAAA 3W57A 2H0EA 5EEYA 3B2DC 3BU0A 4FTBA 5EYYA 4YHKL 3HD8B 1SJEB 1JHTA 2VGDA 4IDZA 3ZN4A 1D5IH 1KJVA 4MGYE 4I3SL 4Y5SA 1INQA 3K6FA 4HCIA 2WBJD 1EMTH 1QJZA 4D6TH 1MAML 2R0LH 3NGBC 3RZKA 1VEPA 4X4XB 5JYLA 2CPUA 5IVFA 3MRQA 4BRJA 2Z4QB 2J1VA 1HILA 1KTRL 2TRYA 4U0QB 4OJFH 3EH4B 5IQLA 1OGAD 3VTAA 2RDSA 4QT6A 5FWEA 4N8VA 4BOWA 3HG4A 1JYCA 4P4RB 5IM7A 4JI4B 4L5FE 1QFWM 3EH5B 5CNAA 2QNKA 4L8JA 4HMCA 1JHLH 5FFLA 1LEIA 4M0HA 2VT0A 3ZFFB 3RILA 5JH7A 4LO6B 1WIPA 3GSXB 4Z3EA 2YJQA 5C93A 2DI9A 3D39D 4ATTA 4WDIA 1QPKA 4N8CH 4IRJC 4KAQH 2F53D 3FLTA 4PRHE 3OGGA 1NTKH 2VW1A 4NXSA 4OCXH 1RUH2 2Z5WA 4NN5C 3INUL 5DRXA 5E8DL 1QFHA 3QFJA 1UZ8B 5IT2L 1M3JA 2XY2A 1Q0YL 5GGTL 1H9WA 3VX1A 3G7DA 5FP9A 5A6XA 4I4TB 1ACYH 1MJ7H 1ORQA 3HR5A 1DVFC 4HCRL 4XC1H 3RY6A 2VQ1A 4JGZA 5FQ0A 1TOXA 3L2MA 1EVTC 1UACL 4A68A 1AR62 3UJIL 3FO0L 3MFFB 1RZKH 2IPTL 3LA7A 1U4FA 2R23B 2UWAA 4YZ4A 1IKPA 3U10A 4PS3A 1XCQA 5B2GB 3LRHA 1E5RA 1A0QH 3H7BA 3TBTA 1HEZB 4OT1H 4APQD 1QFWH 4CDQC 1T5XB 2BY0A 1KDMA 3WQ7A 3QAZC 5ERWB 4PJFB 5TH2B 4CMHB 3HQUA 5K0UB 5I9QB 3CZGA 5FV1L 1OGSA 5J3UA 4G28B 4EI0A 1E7UA 4PDMA 4CC4A 1DQ1A 2WZ6A 2H7WA 1I9IH 3L9RA 2XVGA 4A67A 2AHIA 1AR82 1LHOA 4XC9A 5D7JA 3WW3A 3MRJB 5F1NA 2QTOA 4C55A 4JFEA 4LCVA 3KCWA 5E6YA 2D31A 5TE6L 1G7LB 3NZUA 4P3CL 2QV2A 1LODA 4P46B 2YPKB 1PNFA 5DUVA 3WDYA 4B7KA 1L0XA 5HYEA 2E6VA 3JQXA 2HFGL 4JHWH 5IP4A 1HX6A 5B1KA 4LRNL 3BGMB 3EDFA 3EJZC 3FRUB 4IV3B 4P14A 3SNMA 5I91A 3L9YA 3ABLC 1TU2B 1TQVA 4WQOA 1IT9H 1W03A 3AKPA 3MLTA 4AXWA 1SPPB 3V55A 3UGFA 1I94B 1PGL2 1CD1A 4A6OA 1SOQA 3L3HB 2RS31 2YAPA 2XC8A 3W0WB 2Z79A 4ARYA 4R0LA 2FNWA 5GHWL 4HAGA 1RUJ2 1K5QA 1IC0A 3NCBB 2CO1A 3T1LA 4M6OL 3RDTB 3O41B 3U83A 3C60C 2VQFO 4GRLB 3BP6A 1JPSH 2EDNA 3HPLA 4HWBA 4U33A 3VFMB 4MV2A 2VN7A 4C47A 2OT7A 4O4JA 1YEIH 3O45B 5LBCA 3RVVD 3BZ4B 1W05A 1I5XA 4HWZA 3STZB 1B2YA 4OLEA 2EIKB 3THCA 4A6SA 2ZWLT 3EGDA 2A1WH 4XPHL 4YFEA 3WP6A 1JRHI 4IOSD 2VSDA 3ZYFA 3PJYA 4HEMA 3DETC 1PDKA 3EBHA 5CGMA 3B9AA 3QC6X 5CR8A 4TTGA 4Y1AB 2ZAAA 4G11A 3UZVB 5GJTL 1YF2A 2QFRA 4CU8A 5DXDA 1DQ6A 1W0WA 2NW2B 1E5IA 4AIXA 2A3QA 3ESOA 2WXLA 4LHSA 3TURA 2OFQA 2MTPA 4POZD 5I6PA 3B2XA 1U8MA 1MCIA 4BZ2A 1VQ6V 5I1KH 5A2QN 5KYXA 4X1KA 1GYWA 1EN5A 1DQDH 1IGML 3U79A 4BFRA 4HH9B 5I1KL 2X6VA 1SOXA 2OM5A 2YQ3A 1E5UI 4GB9A 2XRAH 4OLWL 3OGCC 4CZZA 4CC0A 5ESVB 1JGLH 1AR1C 4Q4W3 4B7LA 3V4VA 1MKFA 1FG2A 2J4WL 3A22A 3CQFA 4R7DA 4AIOA 3FW6A 2O57A 5TF1H 4LNVA 4FPGA 3I6LE 1N4CA 4LSQH 2F5BL 4GXVL 3E2EA 5E4EC 1DGWA 1FPN3 4LF9O 1KXTA 5HYJD 4MJ4A 5LNGA 1LGCA 2F19H 3DGDA 4IW4C 1AO7B 4KZEL 3S3BB 2J6EA 2EIZA 2MFNA 1RZ7H 3AXDA 2O5ZH 4JAVA 2BRQA 3IDNA 1A6WH 5CIPA 4F83A 3V7AG 3EFFB 2ZKNA 4TQDA 3DARA 1E6OH 3EYFB 4TUOB 4MVUA 1CJDA 3PAZA 3LCPA 1SHMA 2AKRA 5JIAA 4D3CH 4LTAA 4O9HH 4UDTB 4PJCF 3I4IA 1Q0EA 4I7ZC 5INCB 2ERFA 3KWXA 3IJHB 5TE7H 4ERSH 4KPHH 2ATKC 4J1UB 3L5XH 2ZE8A 1P84F 1FORH 1M1XB 4KRLB 1JZ5A 4NKOA 3TVMA 3E22A 3VXSD 5J1TC 5SWQB 1NUGA 3OG2A 3RYPA 1WBLA 1JS4A 1XMQB 1S0JA 1S2KA 2FMDA 1J1LA 4MVRA 3VI4B 4B7EA 5LBSH 2Q69A 3A6CL 4UTAL 4BA6A 2NW3A 4E0RA 1NINA 1HNXB 4UQEA 3DLQR 4S1QL 4Y2OA 2WYTA 3T2OA 4ELKB 4B9PA 4XXPA 1DUYB 1K4DB 3EZJB 3DOSA 3QI9B 2BNQB 2GTZA 1VRH2 1UYWL 2QL1A 3EO9H 1HESA 3NYKA 2E74B 1K8DB 1ET8A 5E08L 2D2OA 3SO3B 3UT5A 1W39A 2B9VA 3GSWA 3MJ7B 4NZUL 2IZWA 4H7LA 2PWHA 1GH7A 1KTLB 2F54B 2IBGA 2LTNA 2F61A 1DF4A 2UZYB 4PDLA 1M06G 1T3FB 4UT6A 2GBAA 12E8L 2CJTA 2HVKB 3G5WA 4KKAD 3VWJD 4Y22B 4FL4B 4Y5YB 3MRCA 5IJDC 3U4SA 3WF4A 5KYYA 3ESPA 3P9LA 4P2QE 4GS7C 3RRDA 5F5QA 3NJXA 1ND2B 5AVAA 3N27A 4OGYH 4PJHA 1YEJH 5K5YA 2A5ZA 4JGMA 1WUVA 3M17B 4GAJH 5T3ZE 3T0DA 3S3XA 2B14A 3FPXA 1KLFA 3I75B 5GPRA 5FPIA 2GK2A 4AI8A 3PDGA 4QHPA 2W0XA 5GS1A 5ANMA 1KPRB 2QZ2A 4RFT0 3WW2A 4KL1A 1PL0A 4YW5A 4N25A 1CLOH 4Q89A 1XB9A 5FYVA 3AROA 3QXVA 4JI1B 2ATPA 1TUEB 2TUNA 4RQPB 3BSHA 4X66O 4I18B 5JZ7D 5J13B 4KTEH 4GWJA 1A6UH 2UYLA 3DO7A 1U91B 2DLGA 3GB7B 4JFFB 4QRBA 4AGQA 1JGDA 2VH5L 1P8JA 1QFUH 2EKSB 5KYUA 4NHCL 5J09A 1GTOA 2KR2A 5DQJA 1L7IH 1WFOA 4LSRH 4RR3B 4FG4A 2ZX6A 4FQ1L 2X8KA 1T03L 4ONUA 5I1DA 3QO7A 1SA0A 3TXSA 3ZW3A 2XBTA 2P90A 2CRYA 4YHOH 2HT3D 2XN0A 4PJYA 4PLKD 3QUXD 5DDHA 1PZ8A 1SN0A 1C1EL 2EBOA 2JI3A 2B9AA 1AIFA 2VKWA 5CA0A 3TVMD 1A6VL 1ZY9A 1OSZB 1A78A 5IF0B 1D2QA 1I0HA 3CSYA 3NR7A 3QLQA 1CO1A 3K6SB 1A14H 3WXWL 4YW4A 4AZZA 1JXKA 1HI6B 2PW1A 3T4DA 4HFUL 3NRUA 3JAKA 5BUGA 1AI1H 3VXTA 1JDAA 4LHJB 4OVVA 4WFBV 3JUZA 1EDYA 2P4AB 4YDVA 4QQ2A 4K3AA 2PCFB 3BCWA 1JZFA 1O7FA 4L8QA 2K7PA 2VDKL 5D7EA 2P6CA 1NLDH 2W1QA 2P3KA 2UWEF 2EICA 4XVJL 5I8SA 1HC1A 4KX7A 1VFAB 4F7PA 1RUOA 4X65O 4KGJA 3POBA 3UO1H 1ZYBA 2DVBA 4DZBA 2LQTA 3OBAA 4ZMLA 4BWAA 2CCLA 4U4IA 1OK0A 4XNQB 1YZZA 3VE0B 3T0EE 3C7OA 5ANNA 3ZRSA 1D9KA 1FI8C 4OZGB 5FF6A 4DV2B 1NCWH 1A7RL 4U1HA 3S36X 4L37A 1PG7H 5D7JC 5T1JA 3K5SA 2NCMA 4NIGA 1ETA1 1DANT 1O7SA 2NT1A 3FRPA 3FO2A 3BN3B 3MRHB 3WHUA 4HUWA 3SE3A 5CA1B 1EPFA 3I2DA 3VKMA 2HLFD 3BHBB 1ZS8A 4OSUL 2FWOA 5IB2B 3DV4A 3D4KA 1CIWA 1H6XA 1W8NA 2O6PA 4XXWC 1XL4A 2JDAA 4K5LA 3S5LA 5EFUA 2Y5EA 4JX0A 1K5WA 3C75A 1LUVA 3WDXA 1XF4A 2PHUA 1Q7YW 3FTXA 3TA3D 3BY6A 4W9ZA 2K3TA 4LBEB 3HQXA 4RUEA 1WCDJ 1T1YB 2GQHA 3QUYA 4JFYA 2EVGA 5IMKA 1INEH 3VWJB 4KZEH 4MD5A 4CC1A 4NB5A 2OZJA 2I9LA 3NZ8A 3DPBA 4Q6IA 5DLLA 2F74B 1GGIL 1KXQE 1XNQO 3G4SV 2RALA 3IPEA 4OCSH 3QZWA 3NCCB 4GAYB 3F3HA 2F8IA 2DEXX 3WS6C 5JOXA 3QO8A 1KB9K 1YUKB 3HMXL 1EFXD 1XF5B 3B5GA 3LNHA 4JFVA 3UKNA 2BQPA 2B4CC 2R073 2LU4A 1SVZA 2IDTA 3P3NA 2WBWB 4R90L 3WY2A 1JBCA 4CBZA 3LE0A 5FMBA 2CHXA 3LN5A 4UOJA 2AC1A 4L8BB 3ZQWA 4ZFGH 2P7TB 2UY7A 4XN5A 3GUFA 1G7JB 4NHKA 1NOAA 4JTCB 3D2UB 5EU7E 1BJQA 2I7SA 3IRCA 2CAKA 1WISA 3MFGB 3V4LA 1MCJA 1IX2A 4EF3A 2QHLA 2VQTA 1EEZA 3D3VB 3PU8A 4ISVB 3CZJA 4H1LG 2E76C 4U1SB 2WXMA 3CMGA 2BNUA 1G7IA 1YEHH 3NTCH 5HHQB 4ZX4A 3C5ZA 1HNYA 2COVD 4O51A 4GUOA 2C0ZA 5C4WB 1JGUH 2PAEA 4GOSA 5CNHA 5IFPA 4FLHA 4XCFL 1LK3H 1OAYL 3RZCA 2Y64A 3ARFA 3O4LD 1WW6A 5DZLA 1A6AB 2NLJB 3OR6A 5I17A 2WFF1 2XQXA 4JREB 4GMP0 2FJHB 5CBEB 2P43B 2CLZA 4FTVA 4PB9H 4PJ8C 2XI9A 4AQEA 3IDBB 3U0TB 4MDIB 3H2QA 4KQ4H 5BNXD 2D6KA 3ZO0B 1LD9A 1NGPL 1MCFA 4NOBA 2BK8A 2OYMA 4LLMA 4FZ1A 3ZKMD 4YX2H 4W4ZA 1PK6A 1FF5A 1OP4A 3HMWH 4RFOH 4HPHA 2BOIA 4Q4X1 2DKSA 5I17B 2DBNA 4MVSA 3SDDC 1CICD 4IEOA 4LBAA 4QTHB 4TQHA 3RI5F 3CB2A 1XBRA 3WR0A 1LEGA 1XH0A 2EXHA 4O4IB 1KKDA 4CW1A 3O12A 4JRYB 3F7PC 4J6GA 1OPMA 2R042 1I5YA 4QHKJ 1CT8B 3Q2WA 4K15A 3GHBH 3OWEA 1U97A 4JDTL 4ODXA 2OMZB 3GZPA 3QJHB 4HUUB 1AQHA 3P11H 4WBNB 4TSAL 3X12B 1RK1B 1E5CA 2ZR2A 3CRRA 5EC1C 1MY5A 3HPLC 4XN8A 4X98B 5I28A 3AG2B 1PM4A 3FHIB 3PUQA 4WO0A 4IEUA 4P3DB 2QKCA 3D6GA 4MD0A 1OB1A 1U8IA 3HKFA 5AAMA 3ZHLA 4HLEA 3D82A 1DCSA 3CZKA 3ZXFA 1ZX5A 1GJIA 1ASJ1 4EN3B 3L2LA 2IV9A 1B2WL 3ZIAG 4DFIA 1CBVH 4B9ZA 3DIDA 2ED8A 1F58H 4FG0A 5L3FA 1QH7A 2FHRA 2XMLA 4XQ4A 5DHXB 3VBHA 2VMHA 2D0GA 2ZF9A 4O02H 2XQBL 1WW5A 1JP5A 3MAQA 1J48A 1TZGL 4QDQA 1OV9A 5I1CL 3JCZA 3BKML 4D6RA 3ARBC 1B4JH 4NPYA 2H2SC 1OKOA 2FO4B 3TA3B 4BFIA 1Z5VA 3DX9B 3BN6A 4A2UA 2GUOA 4IOIB 3TGUH 1FGNH 2DICA 1Y43B 4NCC1 2PLTA 4I77H 2XWJA 4OZFB 5AOMA 3DVIA 3BWSA 1KXVA 4JZRA 4ZI7A 4QHLB 5J2TA 3KMDA 4Z82A 3LQMA 2IV8A 4G1MB 4PA3A 1V05A 4V1DD 4XAKD 3I9GL 5C0RL 1UYWH 3EO9L 5IFJB 1BK1A 3S4SA 3PN1A 2GK0B 3AFLA 1F97A 3PQYB 3FKSG 3SCMD 3CF6E 4N3UA 2QTWB 5IQ7L 5BQ7A 4JI5O 2JQMA 4JMNA 5HYIA 4ONFL 3QDJA 4U1JB 4WTZG 4YZ2A 4KROC 4E36A 2VDMB 1IAKB 2DURA 3INOA 4HEME 3SEEA 5I1EH 1FNSL 1QA9B 1NWOA 4J9ZB 3VM5A 1SEQL 1SLXA 3WN5A 4ITCA 5GZFA 2DFBA 5JOWA 5LRRA 4ZSOE 4M3CE 4PJ7A 3BOWA 5TDNB 2Q9OA 4LDCA 3I9GH 5DUMH 3L5HA 4XVTH 3RG1C 4GG6B 2C26A 1JUHA 4JFOA 1PZ3A 4IDJL 4LVOC 1R17A 5FZIA 4P2OD 3WJMB 3KAAA 2KKWA 1POV1 4N8PA 3IDEA 1I1AB 4DW0A 3IBEA 1RUC1 2Q30A 4GAGH 5F7EL 4CDXB 4NIAA 4LMFA 2XR4A 1IEAA 4QPKA 3ARRA 4FFTA 4DH2A 1FS0G 3P0VH 4OI8A 4UYBA 3UYRH 5A2LH 4JVPA 1XMOB 3ABLB 3DRTB 4NNXA 4YDVB 2X6BA 4FFWD 4AQ1C 4RRPA 2J1KA 4W6XA 2DCJA 2ZTBA 2ZINA 4FXGB 1H0BA 5CD3B 3MA9L 2EXIA 4OI0A 1BECA 2J1SA 5EO1B 4I0WB 3WIIH 1WT5C 4DR1B 2WLIA 3KPNA 3BTZA 4JO1H 1WHOA 3CSYB 2OR7A 5E95B 3OC8A 1CVNA 1PV0A 3GXPA 1MWAH 4YLZA 2X9WA 3MV7B 4OQ1A 5F2VO 1IV8A 5F2SA 1KGYA 1REDA 4PJ5D 1QNWA 2D7MA 4NGHL 1BWWA 4UUJA 4QOKD 3EB7A 5EU5A 5C9KA 4MB1A 4RISL 2W9LA 5HYJE 4NYLA 4Q8LA 4BQ4A 4TL5A 2HTKD 5DMIL 1RL3A 3ASOC 4WFEA 2R9RB 3Q05A 1UTDA 1FKAO 3AU1B 4FKKA 1GU3A 1UY0A 2AS5M 1JGDB 5H6QA 3ZDXF 4HKBB 5KN5B 2P80A 1O9WA 5DJCB 1RUF3 5K39A 2FIKA 1UWXK 3FQ1A 4PRIE 5KHHA 1W8EA 4YSCA 1XHXA 1Y6KR 3UTOA 4BZ1A 4G7YL 1SERA 4JI8B 1TJMA 5ILTL 3NNMA 2EQDA 1KB5H 1TME3 1AXTL 2XXMB 4G8IA 1DVTA 4Y5VC 4J8QA 3WLWC 5CBAB 4OI9A 1GQHA 2CCWA 1UKRA 1SHWA 3T1FB 2MEV1 3DDFA 3RJRA 4HMEA 2EADA 1WFUA 1DJWA 4N0YH 5DFAA 2BDRA 2QQMA 4MGKE 4HSQA 4NO0D 5DWUL 4I50B 2GUZA 5I8OH 1AP6A 1M53A 2HWZH 3QEHB 4E9QA 1A4CA 3I75A 2IDSA 3TETA 2N7AA 3O2WL 3QNZA 3OHMB 4MA1C 5EO9A 5C9AA 3ZSMA 2QWRB 3MRKB 4PH8A 4G6AC 3G5YB 3O1VA 3C12A 1IBGL 4FRWA 1NE6A 1DK1A 4M8RA 2CH7A 4P4KC 4COVA 1YFXA 1FN4B 2BY3A 4UM9D 2BJML 5GS0D 4TOIA 3VW3L 2FUTA 4PJDF 3V4VH 4G7VH 2RCVA 1AANA 3MBWA 1OE2A 2IH9A 2VJ8A 4LO7A 1MCKA 3D69A 5FMOL 2W94A 3MUJA 5KSBB 4X5RA 3LEGA 1R3JA 4IS6A 4KMLB 1HIXA 3K5OA 2NY1D 1IG0A 1SCSA 1AZNA 5AZEL 1RUKH 2C7FA 2EZ0C 2HTLC 4ZS7L 2J88H 4HJJL 5AZ2H 1ZXQA 4FEIA 3VCLA 1QJY2 4WWKD 5ITFB 3PVEA 2Q87A 1KD7A 1U8KB 1GY1A 4C83B 5A7BA 4H7VA 4UFMA 2ICES 3FCBA 4OGXL 4H88H 4BK4A 3FLRA 3WN5C 1T5WA 3IC9A 3GJFB 4GKKB 1OGTB 2ZNXA 2F5AL 1MCPL 3QORB 2FR4A 1PM7A 4Y4KA 2YFNA 1XB8A 3KPPB 4J8RB 1XNQB 3ZMVA 1RPKA 3CN1A 4ZZKA 4HKOA 2XWTB 2DU0A 1UWXH 1ZT4B 5I71C 5DEFB 1SG3A 2R0ZH 3L1OH 1U6AH 1ZK5A 5T3ZD 5KA6A 3ZTJH 1IBMB 3HI5H 1M7DA 3QUHA 3W81A 4OZXA 2GJJA 3GQFA 3O4OC 3WTWA 4IBVA 2AEPH 2VM3A 3ULVC 1JPST 5F9JA 5ITFA 2NYKA 2JELL 4CILA 1AP5A 1JK9A 3HC3H 2YS8A 3Q8FA 4KK6C 4O5LL 3HWJA 3WG4A 4FLVA 2WQVA 4YIQB 2BVTA 2HWC1 1ZD6A 3QJSB 4XW3A 3VBUA 2CNZA 2M8XA 2FX8L 3X14A 4AYEC 1NXD1 2DW4A 4TSBH 4R50A 1FN4A 3WFEH 4PB0L 4GH4A 2CH7B 3LKQA 1PHMA 2Y1ZA 4EIZC 2OTWA 4CRQA 3ZXGA 1Q0YH 5GGTH 3FLPA 3G5YA 4C8XA 2DQJL 3LDRA 4XF0A 3KGZA 3CMOH 2X6UA 4MQXD 4Z7QB 1CPUA 1QD0A 3ZE2F 2RBLA 3LNEA 1JF1B 3NCJH 4NKGB 4HK0A 4BZ1H 4E42B 2BCCH 2QTEA 3LIUA 4JQXA 4P4KD 5ESVA 3OWRA 4BSJA 4X6RB 4DFSA 3BB6A 4DT2A 4Y4RA 4I1NB 4UM9A 2MNGA 5EP9A 2BPA2 2M6YA 1LO5A 1IBHA 3LKOA 3Q2NA 2QR4A 1KEML 3OLGA 1H6EA 5FW7A 1SCRA 1IKNA 4TQEL 1TNMA 2I5YL 2WUBH 4GXFA 3SY0A 2YXHA 3H9SB 3TAYA 5IUCA 1CQ9A 5ALBL 3ELNA 2XICA 1NBZB 1UXSA 4QMEA 2BIIA 2ODHA 2WMPB 4IRJA 4PW9A 5E70A 5AVSB 2VCAA 4OCLC 4CGTA 4MA7H 4YJ2A 3WE6A 4Z76A 4OCWH 4UUJB 2BSTA 2ZX5A 1DBML 4Z5RA 4KH9A 5FA4A 1UQSA 4UNTA 2V6HA 3H01A 2Y2TA 1IKFH 3J8F2 1MREH 4O4JB 4DETA 1DGSA 4DV0O 3QIBA 3RZCC 4XVTL 1YRKA 2XWDA 3VO0A 3QR1A 2YUAA 1YNKH 1AL22 4I9QA 2VRZA 3C5JB 3CZSA 4P5HA 1EHKB 1YTFB 2E4FA 4CVWA 2KD7A 1AD9B 2TRHA 4WWPA 2VQEB 3PVBB 3DX7B 1MSPA 3WW4A 5JI7A 1HIML 2WQSA 1PKQB 2ZMLA 5FZFA 3SKJE 1QW9A 1CLOL 1U8OA 2GMMA 2UUDH 4R0LB 4ODVH 4OI7A 3IGUA 2R1BA 1IEAB 4TZDA 1U3JA 3H4HA 1SN2A 5DD5L 4D0DB 4P9JA 3HIFA 1HB3A 5J6GB 4EVNA 4QPIA 5T1KA 3OF1A 3Q8EA 4I3PA 1WICA 4UAHA 1IAMA 3CHRA 4R8WH 2IBZH 4JQTA 1TQBB 4OCRH 3LUTB 3O6LH 3LQAL 4ENEC 4LWSB 2WNUC 1YEDA 4YM2A 4PLOB 4OKVB 2JJUA 4OLXL 4X5XB 1LOFA 4KU1A 4YHYB 1ZIBA 4TXWA 2AMUA 2MOQA 3AQYA 3BT0A 4KHTH 4N28A 3WSOA 3ZM8A 2CTQA 1ITBB 4MX7B 4FNPA 4HVQA 2Z8VC 4XETA 2V5MA 3HR0A 3VJ6B 4ABUA 4J3OG 3J07A 1F23A 1OI6A 1UM4H 4X99A 4XXDA 2Y6LA 1S9XB 4W1TA 3SY6A 2YROA 3CFIC 5F6HI 3VFOB 2EXJA 3GHEL 2IO5A 2K8QA 4PJFA 3S2AA 4H8VA 5BMFH 3N7MA 4LSUL 4F15C 3T6ZA 3H7BB 2GITB 3TBTB 2O5YL 1UVQB 1U42A 4MMYA 4WCEV 5GW7A 4DP4X 5LK7B 3E5QA 5MI0B 1MNUL 4MMZA 4NP4L 2WYSA 4JZJB 1AHWA 5I1LA 3Q1EA 3N9MA 3OGRA 4BW5A 2Q5TA 2GSGA 2AVGA 3PUIA 1X8EA 1XRUA 4B3NA 3O4LE 2ZT9C 1PVHA 4HV8A 4I13B 5AZEH 1IAIH 2VMDA 2AK4A 4YW3A 3BA8A 4W81A 4YK4B 4L29B 3RPIB 2PLV2 5DMJB 1CXHA 5MP6L 2JJTC 4PWGA 2XT1B 2GW5A 2LV4A 4WDIB 4N7UA 4BCZA 1J0JA 4AHYA 4MNQE 1UXWB 4PJEA 5BRZB 5CB7A 3BAKA 1MN4A 1YRZA 4KJWC 3FOLA 4UF0B 4B3SB 3RKDD 2OS2A 4DGIH 3L3DA 2ZX3A 4ZPVA 3FU0A 1MRDH 4K7PY 4BAYA 3N91A 4A4AA 3EVKA 2E9BA 5EU6B 5C07A 5I1AB 3GI8H 1KJ2H 2HG5B 3UL2A 2E7DA 3MODL 5TF1L 4F6RA 3T4YA 3CEWA 4TVPD 1Q90A 4GRWE 4OM1H 4QX5A 2ZIDA 2P3IA 4Y2DC 4PSRA 1WF5A 2IH1A 1BMV1 3CMEV 2V2XB 2ZUUA 2B9UA 5F7HA 1A32A 1TVKA 1ED3B 1IB5A 5B1BC 3BOVA 3ZRWA 1JI2A 1LYQA 4S11A 3VQXA 1HOCB 2WTRA 4XP4L 4M1DH 1ZVSB 2A99A 3LZQA 2X7LA 4GRWF 4PS7A 1S9YB 2QPSA 3LXCA 1J18A 3P2BA 3TC9A 3T09A 4YHZL 4PV9B 1VMFA 2FJHA 1L5GA 2NZ9D 2G5RA 5D2NE 2QSQA 1AYN2 5BNQA 2B5IB 5C0JB 1HOEA 2XBZA 5TQ0H 1JZ7A 2P4EA 4Y16B 4YG3A 3WUDA 2R1XB 1A6PA 4UT5A 3FD9A 3QVAA 4LQFL 1B35A 3QOPA 4O51B 2BP5M 1Y74B 1DGRN 4P30A 4QGTA 4ODTL 2NXYC 3K7UA 1AXTH 4G42B 4F3FA 4UIMA 1SY6A 2YS4A 2ZDIA 4JPSA 4ABVA 3QDMA 1KBBA 4Z78B 4PD4F 1OSPH 1DBJH 1UUSA 1XBDA 2FRGP 4MA3A 5IROA 4BYYA 1SYSB 3D0VB 4L3ED 43C9A 5L9DH 2QBWA 2BIPA 1WP8A 3PGFL 3CO2A 4N2KA 4GIQA 3H0OA 4WJ5A 5I15L 5T1LB 3V9FA 2DM2A 5CGYD 5CU1A 3BP4A 3U37A 3U1SH 2DQEH 5FYKH 4X6CA 1XF5A 3E6FA 1IXBA 1GC1H 1KIUB 1SYVB 2Q73A 1HHIA 4Q0VA 2KQXA 1HNWO 1ODMA 5JMOA 1F6AB 1JCHA 1NKRA 2F5AH 2KH2B 1U0QA 5IYCO 1LP9A 4YDZA 1RUE1 1EGJH 2YRLA 4P5MA 4R4FL 3WFVA 4Q0XH 2AP2A 3ZR6A 3WG7C 3O1MA 5CJ8A 2ZZQA 2A74C 3TWYA 3LEMA 3SBWA 3TB0A 5BXFA 3D12B 1C28A 2GTAA 3JQOB 4OMCA 5CSGA 2W6IG 2WANA 1BGXH 5DQ9A 3WJJA 1EAH1 3LPWA 4KY2A 1XH2A 2OQJB 2V37A 3L1GA 4WVWA 5GIRB 3TIDB 3OEEG 1QBAA 2MJWA 2L7UA 2R70A 4FLWA 5HGHB 3BUQA 4ONGL 1MY7A 3RX7A 3SE6A 2YIDA 1L9NA 1UZ6F 3BISA 5EZPA 3APCA 2E7AA 2O0OA 4RS5B 2PPFA 1X9RA 3OAYH 1IAII 2ESVD 2IAND 2GT9A 4PIRF 5L88H 3PV6A 1FNEB 3RNKA 4XMLH 4XODA 4TYUA 3G04B 1FNHA 1O6VA 2JE8A 2VWJA 2EDOA 4X5WB 1CFQB 4A45A 4Q2ZA 2VUAA 4I0CC 4P2RB 3MW2A 4L37B 3BVNA 4NJAH 2PUSA 4K9EH 2E9QA 1JTPA 3HAEB 2WXRA 5EV7A 3MBED 3BDYL 1UGNA 1UQXA 3DTXA 2XSKA 4OD3L 5HVGB 4BCXA 1C5IA 3KHQA 4NQEA 1EZLA 4K94L 5JSRA 3MNDA 4LO9A 1WIOA 3V0VB 4GI8A 2BVOB 1IIIA 4KX9A 3VSUA 1F3DH 4O02L 2WO2B 5D2LF 1M42A 5JXEC 1OY3B 2IFWA 5F3GA 2HKHH 3RDIA 4M93C 1YEEH 3MROA 1DFQA 1PO21 3QDGE 4QX2A 4NN0A 4Q2FA 3WP4A 5DD6A 1KYOK 4GW4A 1QTYT 2HRGA 3WJLC 4Y2NA 3CCJV 3HG3A 1HRV1 4J6RH 5C08A 4N8MA 3F7VA 2VDRB 2JE9A 1ROPA 4HUXA 3BRCA 2OTUA 5T3XH 4LKDA 3PMSA 2QVKA 3PTYA 3ULUH 1NC2A 4H5SB 5KUKA 3K91A 3PP3K 4H8UA 5DJ0A 3STLA 3WNPA 1YMHB 3VHRA 4CDXC 4EKWA 1IZKA 2VE6B 3W9EB 1YEKL 4HPYL 4LVNC 4PFEA 1WBZB 1A14L 4YIPA 1I8UA 3WDVA 3FT9A 3ZE1F 1BK0A 2EXYD 1TJGH 2A79B 1A1MB 4GX5A 3HG1D 1U5YA 1RJYB 1W6PA 4L9DA 4HW6A 4A6YL 3GRGA 2ILLA 3L5WA 3K74B 2XKUA 2X4SA 2DD8H 3L3GB 4ODUA 5FLUA 3G80A 1FJGB 4Y9CA 1JI6A 2MCPL 3FT3B 4EAEA 4FN0A 1UM4L 1U3ZA 3UG3A 4IK7A 2GHZA 3L70H 4GRWH 3OJVC 3BPOB 2FCVA 1PSKL 1GRWA 1N2RB 3HNTH 3HZKA 1YO4A 1CTOA 3L1EA 1W0VB 5KAQF 2KLTA 4WEEA 5CFHA 2CKBL 3MLYL 1IMHC 3BSGA 1R092 3ATFA 4U49A 3WP5A 4W9HC 5FZAA 1S5HA 4ETYA 1XYNA 2DBJA 2WXJA 4BKLA 5IJVA 1PIFA 3ASOB 1NDGB 1DZQA 2E6PA 5LOVB 2G2RB 4G8EB 3FCTB 1RYYA 5BXXA 3MDSA 1FFPB 3WHE0 4NQQA 3LEVL 3R7RA 2ZMNA 3S8FB 3K04A 3UTZB 1ZZ6A 1UH4A 1AGEA 3ARDA 4HS3B 3P54A 3BUCA 5F3FA 3EFOA 3OGCB 1WH0A 2O93L 4OJCA 2QQUA 2ISDA 3S3PA 1YEWA 1WIUA 4A7UA 3TCLA 2V8LA 3P9LB 4AQZA 3EJQA 3R1GH 1G6NA 1POV3 3NN8B 4WFGD 4WGKA 2Z3FA 2IUWA 3SQBB 3A6CH 4UQ9A 4GS7B 4CE8A 1T2JA 1SLCA 2IDQA 5B3JF 5MENA 2N7SA 2HWF3 2H8PC 3P5BA 3DO3A 3MLVH 1IJNA 4Z7NE 3E38A 2RS11 3IXTB 4JG1H 4LP5A 3T6XA 4XO8A 5CJXA 3TL5A 4N3TA 4WO4D 3GDCA 3MV9D 2VR3A 2G9GA 4IJTA 2WAOA 1W9XA 1WS7A 4M29A 4XX5A 3DVNA 4N9OB 1K8DA 4RYDA 1D5MA 1JDDA 5EZYB 4XFAA 4MZRA 4YGBA 3R0MA 5HHXL 1K4DA 4Y0GA 1TQCC 2VMFA 3N9PA 4OX9B 5ETUA 3C8DA 3N1GC 2IWFA 4S1QH 4N2IA 2X2YA 3WB0A 4LBOA 2Q10A 2YPLE 1XE7A 2JENA 2P44B 2YD1A 4LFAO 1OARH 2CIKB 2Q2LA 3GMRB 3ZRCC 5AW8B 5J1SC 4R4FH 5JQHC 4GX0A 3VKNA 3FL7A 1VBD1 3J26N 4PG2C 2FWUA 2ZDIC 4R8CA 3KW8A 3U0PA 2W52A 3OEAA 3AG4C 3JSSA 4R6ZA 1N32O 5IMOB 4OZIE 1N3PA 4HLTA 4LKFA 3UADA 2C9RA 4B0MB 2D2CC 5C0BA 4EDWL 2JB6B 1FCCA 5JWPA 1DQ5A 1RUI3 2FX9H 4OCTA 3DX6B 4QRTB 2FT8A 1NG0A 4Z1VA 3PUHA 4Y89A 1FIGL 1A4BA 1YDPA 3BVXA 3N2GA 3GMMB 3EJKA 2UXCB 3IPFA 4U1KA 4QKDA 4CEYC 1KRIA 2X4PA 3VXSA 2QVFB 1VLNA 3GJBA 1QBBA 3JB4C 3NQKA 2DH2A 5KVFH 5MEOB 2YICA 1P2CB 2PHLA 3ZE2B 4K8XA 1JNJA 5F7MC 2FHCA 3N4MA 5F7DA 5A6IA 1G7PB 2B08A 1ZBE3 2IDCA 5JPNA 4JGUA 1YI7A 2BDNH 1GIGH 4FNLH 4HFUH 5LB1A 2VQAA 2PAKA 5DURD 4F7EB 1ZLUH 2W2IA 1XSIA 2Q3XA 2WPGA 3B3BA 4MGSA 4XZUB 4A7ZA 2VCOA 3KG5A 5J7MA 2MH4A 4YDKL 4P9MH 3BFRA 4YDNA 2A3YA 4H0HB 4U7MA 1A6VH 4DGIL 1AL0G 5FYIA 3RVHA 1XB3A 1SOSA 1H8NA 2EDXA 4FNSA 5DTFB 3UCSC 3ILEA 5FCSH 3MIBA 4YHZH 3F58H 3ZUNC 2L7JA 1QU0A 2B1IA 1KG0A 2F1AA 4POUB 4F7EA 1AL21 3K8MA 4QO1A 4IU2A 4TQIA 4G6KH 3HI1B 2OP4H 3KV4A 5B4XA 4B27A 1OP9A 2P5EE 2PHRA 2JGDB 2IWKA 3Q1SH 2IQAB 1JR9A 3BA9A 1GWLA 4CCCA 1OSGA 2DS4A 4I88A 1RUAL 2NT0A 3WUWB 5AC91 4IRZH 1L3JA 3VBRC 4YSAA 1IE5A 3BE1L 4ICWA 4RCAA 3T65B 1E5BA 2VTFA 4HVRA 3WFHA 2FO1A 4KUZH 4Q58C 5GGUA 7FABH 2D6OX 3MZTA 3PNWA 4O2CA 4KK6D 3RVZA 5HFMA 1F90L 4L4TA 5DJDA 1CLZH 5EOQH 2YD4A 3W58A 2QZQA 4YSRA 1JGVL 2WGNB 5I0ZA 4JI1O 1VQPV 2EXSA 1PCSA 5JYMA 3DN7A 3UBXI 3CC5B 1ET5A 2VW4A 3HQRA 5DAXA 4PQQA 2EP6A 5ESAA 4CADB 1HXYA 2R59A 4HT1H 2E7LA 2FZ3B 2YC4A 1RUF2 2IFFH 3CDGA 2FEEL 4A38A 3J8F3 3BQUC 2BVBA 3O3UN 3LPPA 3PNWB 4I89A 4O2CB 4R26L 5CN1A 1TU2A 3GVMA 3ETSA 3OSKA 4TV3A 3ZE0F 4BRVA 1ZZ9A 4GYCB 2ET7A 2JECA 1S7XA 3OKOA 2YAHA 2CDPA 3D3VE 1LLAA 1Y1UA 5IJ9A 2AJ3A 5F9AC 4PW3A 1REEA 5FAXA 5AB2A 3F7YC 4MJ5B 1IFRA 3VNZA 3RWIA 3JSLA 2UV3A 1WA2X 1V0AA 1O9ZA 2EIDA 5IB1A 4KRMB 4NXKA 2X1WL 3INUH 5E8DH 3FRPG 1K42A 5DYOB 2I32A 2YUEA 2X0UA 4IU2B 2PMZA 3A0RA 4QO1B 1KUQA 3MRBB 3NPZB 1NIAA 5ERWA 4XDJA 5JXAH 5KBDA 1YIFA 2OVUA 4N90E 4PJ0Z 1E4WH 1QWHA 1J5DA 3O9WD 4Z3JA 5FJKA 1FXKA 2K70A 2AJVH 5DTFA 3LRLA 4G7SB 2BTVC 2AHYA 3GMPA 4YO0A 1MS9A 1MWAL 4XCYA 1RPRA 4GIOA 2AJSL 4U3SB 2J1AA 4UFHA 4UNVA 5BPPA 4LLDA 3SKNB 3LS4L 4D3CL 4S1DD 1ZUQA 4IKJA 2CGRH 4IHJA 4M62L 5E9DE 1NDGA 2GU9A 3USUA 2HR3A 2ICWB 3CHQA 4PP2B 2OPWA 4YVSA 3VHPA 3DSFH 4WKXA 1DR9A 1C5HA 1UPSA 3QP3A 4PGCA 1E8WA 1IAOB 1CC3A 4JFDB 5MHSE 1OHHG 3OD4A 3UETA 4MVBC 3EOBB 4U1KB 1A5FH 1AQDB 4OJYA 5A1LA 3SN6N 5A3MA 5J11C 5EIIB 1OA3A 4MXWA 1MCOL 2ZD9A 2VNRA 4P4RA 5IM7B 5L2KD 4YHHO 5KVFE 2X4SB 2JSFA 5IW6A 4JI4O 2OX0A 5CIPH 4ZZFA 1IS3A 4AMXA 2P6JA 2PPDA 1FV3A 5ACZA 2A9NL 1FPN1 2UU9B 3SGKC 1SEQH 4ZHQA 2FLRT 4UTBA 2E7QA 4K7PX 2P17A 4XMVA 4Y26A 4QB1A 4Q5OA 5FB8B 4JGYC 2E6QA 3OAZK 3TA3C 3EFDH 4L9BA 1XGQA 4TLUA 1W9WA 1GAFL 4XPFL 2X6MA 4POZC 1XYPA 1JHTB 1AH1A 3L3KA 3MC0A 4QHBA 3GWJA 1FXZA 1N19A 4UDUA 4CP9A 2BCKB 2R4SH 1VB2A 4BLJA 3MBXL 2ZM6O 4JQRA 5AFEA 1UJTA 4DGVH 1ZXKA 4ODSL 4MVQA 5DHVA 1V9U3 3PHQA 2ADJA 4TTDD 4CXYA 2OMYB 5LCVL 1U5ZA 1ERNA 4Q6YA 1FGNL 3RIKA 1Q3EA 1GZHA 2IGTA 3TX4A 3EXUA 3OYWB 2CUMA 3TYGL 2EDQA 3NNLA 5EA0H 3KM5A 5E4AA 3ZDWA 2Q1FA 5CJQH 4BFKA 2BVOA 3WNJA 1XEUA 2M1KA 2LGNA 1I9RA 1S0DA 4NQEB 3FC0A 3QFDB 2YA2A 3NCJL 4HS8L 4KDWA 4LLWA 2VDQH 5DMGD 1SJVA 4Y2LA 4QUOA 1VFBA 4IBSA 4JO3L 1SMAA 4WSJA 3FKUS 1JGVH 5EC2A 2OXBA 3RFRA 2P5WE 4AFDA 1NY72 4LF6B 4XJUA 2X4QB 1QASA 1BEV1 2R2EB 4ZUWA 4ZMPA 2CDEA 4AGVA 3HN3A 2WVTA 1KIPB 5K9KB 4QJFB 4HJGA 1SACA 2QT6A 1HH6A 3FHAA 2IANE 3GTTA 4F92B 1IDSA 4DY5A 1R5VB 4COYA 3B7TA 4FXGC 1A1OB 4JHZA 2VDLH 3KLQA 3SDCB 1K5MC 1T7ZA 1TME2 2TEPA 3FUQA 4ICXA 3WFZA 1H1IA 5EUKB 4JDNA 3MBEB 1HHHB 1DJSA 2BIHA 3FONA 4L9LB 1JWSA 3QG7L 4JPVH 2JK5C 2CTVA 5IWFA 3F00A 4P9WA 1OD9A 4OCYL 4U7KA 3CC2V 1K2DB 4RMVA 4XAAA 3EZ8A 4I5BB 1RUE3 1YYLH 1S7UA 2W1UA 1HHIB 3MLSH 1SZBA 3UGHA 1PD1A 3BWAB 1NFIA 3CNKA 3EH1A 2Y6FA 1SF9A 3FT3A 3RG0A 3UJOA 2VQUA 2Y7QB 5H5NA 2FB4H 4LSSH 2V4VA 1US2A 5BS0D 5KVGE 5JXED 4J9YB 3KS0J 1WNSA 1B9ZA 5AUMA 1F02I 3WY3A 3E8BA 1SYSA 3D0VA 4X6EA 1UOKA 3Q2VA 1MFNA 1ZLEA 3UAJD 4DV4B 3G6BA 1PY0A 5JLZB 3LKPA 1DLLA 3H9ZA 4X7CC 1X8MA 4M3CF 4Q74A 1SMDA 1E1QG 1VQNV 4IOFC 3HG1B 5GGVY 1RJLB 4Z9KB 5J06A 1JYNA 3AVEA 3HG1E 5KVFL 3ULVD 3FFDA 4NWWA 2G4GA 3CN0A 2AENA 4CCMA 1HDJA 1WGVA 1ZVYA 1Z32X 3QXUA 2PPCA 4QEGA 4AVCA 4F8QA 1O3QA 5FYLH 1L5GB 4YG6A 5FYTA 1EO5A 1HHGA 5D1XA 3TN93 1FG9C 2YXWA 3O7OA 1YJNV 1ZM1A 2Z7WA 2DDUA 1G86A 1G6RH 4N8CL 4PA9A 2WTRB 4F8OA 3V64A 4WEBL 2YUZA 1JSYA 2GG1A 1V9U1 4ZHNA 4HG6B 4W4NA 5SV4A 2WO2A 2A75A 1S7QB 4FTVE 1HRV3 1V7MH 2D7NA 4Y5VA 5EO0A 3H3BC 1I7UB 4OLUL 1ULCA 1CLCA 4L1LA 1N33O 3ZKSD 3SOBL 5J9PC 1U5IA 3RZLA 5JAXA 2VJ0A 2W0LA 5A1AA 1JZHA 1RZKL 1M71A 1Q8MA 4RWYL 1F2QA 1TZOA 4AJVA 5C8CA 5FHAL 4H26B 3I2CL 4PJCB 2L0DA 3PV6B 3BZ5A 4Y19D 3BU7A 3US0A 2C5DA 3RYCB 2QBXA 3RQ0A 3MRLB 2KDYA 3IK2A 4M62H 2X6AA 4OZFH 4LCCA 3DSQA 3IWUA 4FLQA 4HD5A 5FKPB 5BVJB 4Z7IA 5JR1L 1VQLV 1N8OE 4PJEB 5DJ8B 1MCBA 3J81N 4N0UE 5BRZA 5E2WL 4HJEA 4FFIA 5LA1A 3UPRB 2N0KA 4DW2L 3JVGC 4XZUG 4YVNA 3MJGX 2BHFA 3CUPB 1GL4B 5LQBH 1QNYA 1EGJA 2XBO3 1WLWA 2X9ZA 4JGJA 1U8PB 1W2BU 4L29A 2FL5B 3TEXA 1A6ZA 5T55A 2AV1B 2ZCKL 3QDHA 4DEPB 3KS7A 4ZXEA 1HAWA 4I0KA 4C4KO 5BMVB 1CXKA 1MW3A 4A3ZA 5F7LB 1IM9D 4QU2A 4HJ0C 1F4XL 1ADQH 2VXUH 4HUCA 3PVOA 3HB3B 5JHBA 3N0PB 3NJMA 1ASOA 4L8SC 1XV8A 3VFUA 1XBFA 1A6TA 2LU7A 2F2HA 4FKEA 5LDUA 1CN4A 2XTJB 4G8AC 3JBG7 4PUBL 1UAIA 1YPZF 4P05A 1N70A 4N0FB 2ZIOA 1WG3A 2YMTA 4Z7UF 3UC0H 3UTSA 2BMKB 4BKSC 2PWGA 1MQTB 2HEWF 3GLEA 4HBCH 3MV8D 2X38A 4MA3B 2CR3A 3MR9A 4XNBA 3SO5A 3N43B 2XZCL 2VPVA 1SDDA 4HBCL 2N0MA 1DE4A 3PL0A 1QEXA 4UIMB 5A7PA 3FK3A 1OQXA 1UXMA 4PGDA 3AGVA 2GBOA 2XG4B 4XMKH 4BIKA 1IC4H 2OZ4L 4OFPA 5DLMH 1ZE3C 3MRDA 4Z7WA 2G9FA 3ULVL 3ARBA 4N53C 4DPCX 1X7QB 5IJBC 1X6NA 2FDGA 5JOPD 2N01B 2H8PB 4LWSA 4U6XB 3B1UA 5FHBL 5IJKA 2EIEA 5LHGA 3L3IA 4HKWA 5A7SA 3RI8A 5IQ7H 1QPPA 1XEQA 4M6NH 3FU7B 4FQCH 4LSVH 3ARSA 1CI3M 5H37A 4K21A 4OZOA 3ZRWB 4OLLA 2VUDA 4KGLA 4TRPL 4G27B 5KEZA 1DYOA 4XZ4A 1SQQH 3ABTA 2WKOA 3DMMB 4JM2C 3LEVH 4TVUA 1WC7B 5FGCE 4NQCA 3ML8A 3ZHDA 4F8TA 3ZS8C 4JLRB 3RTQB 3AUVA 3PABB 1AGDA 3MV8A 4YBHA 1B6UA 4C54A 1J58A 4CU9A 2IGFL 2JI2A 4A3XA 2FEDD 4FFVD 5B22A 2HWC3 4YUEH 2XNDG 3DX7A 5EYPA 1E5AA 4P2OC 5F39A 1AQMA 5CBGA 3SJVB 5DC9B 3C5JA 5EMYA 1NA1B 3Q5YA 4LVHB 1JF6A 2AGJL 2OR9L 4U4BA 4WW2A 5EBWB 1GP4A 1NC4A 4MNHB 5IEKA 2OSLA 4CSWA 3S3JA 2Z1KA 2E56A 2APVA 4JN2B 1C5CL 1LK2A 1GGCL 4JO8A 4MS6A 1N0XH 2JFCA 3IJ8A 3TVMC 2BZCA 4L2NA 4OFVA 1ZBE2 4LIUA 4LP8A 1KP3A 3SCFA 4QPJA 1QLNA 1UXWA 1EDQA 4Z76B 4FOVA 2CIIA 3BD4A 4IT5A 1ASQA 4WWKC 4E5XB 5KG9A 1Q8PA 4JZ2A 2OSXA 4MG2A 1VJSA 1UD4A 2KMWA 2KYIA 1DLHB 2VKXA 1YCIA 5H9CA 1ADQA 1NA8A 3M7FB 4XBGB 1RIUL 1N12A 2G3ZA 5IEHB 1UYZA 4AHWA 3O1PA 3UDWA 5KUMA 3QULA 1GZTA 1CDGA 2EDTA 3OPZH 4XMLL 2Y5QA 2J57A 3ARFC 8FABB 1PYWB 3DBSA 4EJ1C 4D7TA 2BH0A 4E4DX 3HFFA 5D71L 3LB6C 3MCKA 4OIIH 2VAUA 2A0LC 5DHMC 3GSOA 5IBUG 3ZN5A 3H2WA 2GITA 1KELH 1J10A 5DD1L 4I4WA 2CBTA 4JO4H 4DN3L 1OUSA 4HKZA 1RP8A 2H0JA 2ZKLA 1RMFH 2VOWA 3SQOA 2W80C 3O5SA 4DV3B 1VGKA 1C8PA 3DPRB 1VAVA 1ZRCA 2IG2L 3MI6A 1NTMH 4WFHD 1BMGA 1RUH1 4X99B 5F72S 5FLVA 3A0OA 4YGEA 2DQGH 4CS3A 1W91A 2OTWB 3HNVL 3QPKA 1LOAA 2QQKA 4XCEB 5DFVC 4LPLA 5FZMA 3WLWD 2NQ3A 5IB4A 3PHAA 4IEXA 1SZNA 4MX7A 1AZRA 4Z7UE 3V8CA 2YIBD 3X14B 1NA1A 3RZGA 4QGNA 4Y1AE 4RGMC 5TE7L 5D1XD 5AOZA 3V6ZA 4M7JL 1AR73 3IMVA 3RWFB 1FSKC 4UINH 4J7JA 1HS6A 1V6LA 1WJ3A 1MW1A 5T3ZH 4OHYA 1TCRB 4QXCA 3D3VD 1HQ4A 1WC7A 3IDIA 1TEYA 1NQBA 1THAA 4KK9D 1TMQA 4M43L 4MLSA 4NZJA 2Z4FA 1MZ6A 4QPIB 4QWNA 3SH3A 5BNPB 4F9PA 4JV5O 1AR2A 2AH2A 2YI8A 4UXNA 4PVLA 4FP3A 1HDMB 1KPVA 4Y4FD 4DR5O 3ZL1A 1Z7JA 5KHGA 4LF8O 3LMJH 1WZKA 3MSPA 4PJGB 4EZLA 4PI2A 1KLUA 4OI2A 5FZ0A 1JVKA 2JKSA 4N90D 4J8RA 4W70A 5HDRA 2LJ2A 3FH8A 3MRDB 1V3MA 5HJBA 5DXWA 3ZJAA 1JUFB 2VABA 1NVPB 1F4HA 3LDBC 2DQGL 3QUXC 4P5TC 1CN1A 1NS1A 1T5WB 1UWGL 3ARDD 3MRNA 1F4AA 2N56A 4UT7L 3ULSA 1RUD1 2R2BA 3QJFA 3QJTB 4LBQB 2A06H 2UXTA 1MUJB 4DP8X 1HSBB 1UM5L 2Z31B 3S5LG 4AI2A 4QD2E 3MR9B 3DIFB 1XQ8A 1I8LC 4W4LA 3E8FA 4YSQA 4Z5RB 3ITQA 4NUQA 5BVPL 2X3CA 4JJHA 3U7AA 4RGOH 4O4LA 4YHLH 2R2CA 4OZFG 4FM1A 3V0EA 4PJ9D 3ATAA 2C8NA 2QE3A 3IN2A 5BZWA 5HYSA 5KS9E 5CJOL 2AJZB 4XCNB 4OFGA 2GEQA 5MHSD 4AWJC 1C08B 2R83A 2XJQA 5EZWA 4ZU4A 3ZE2E 1XX9C 1BBJB 3K2MC 1XUQA 5IK3B 5F71A 5DT1L 1NEUA 1B4RA 2W0PA 4N2AA 1COBA 4GRWB 3SPVB 1KYUA 4HGKC 3NFNB 5C3TA 3TIEA 4LSSL 2Q3AA 1ZPUA 2RQ8A 3CFNA 4WWID 4LPVA 3SBQA 1QBZA 4RAHA 5HPMA 1A6CA 1R1A3 5GZGA 2GUZB 3G67A 5IQ9B 2NMSA 4Z1MG 1HJCA 1DU3D 2QQOA 1FVDB 1JF1A 4HK0B 5IAXA 1F0LA 1JK8B 2HT4D 5D5ME 2HEVF 5BVJA 4YEEA 4WHYH 3ECBA 5MI0C 2G38A 1UJ3C 2CUHA 3B34A 1EBOA 2OXGB 2Y06H 4K5NA 4J41A 3DXAE 4DR7O 2A4ZA 4JRXA 4W4KA 1DEEA 1HW7A 1KOAA 3AQZA 2XFGB 3EF7A 4A7GF 3SDXB 5FYLD 1AGBB 4ODWA 3OPZL 4W9IC 3MREA 1TTCA 3FBYA 3OTOB 1C08A 2W60A 3BIKA 3NCXA 4ENED 4ZQTA 2RDNA 2XONA 4E8CA 1FAKT 1RIUH 2WYZA 3BEHA 2UZPA 2VLRE 3TXAA 1VIBA 1S0BA 2XH6A 4R4XA 2OKXA 3L9EA 4WFFE 1H5BB 2A6KA 1GYUA 2IBBA 3LRMA 1FJ1B 1G8MA 5EO0B 4B9IA 2GAZB 4RZCA 5FBZA 1G1OA 5E6ID 3DIFA 1YJ9V 3WI9A 2VDNH 2GMPA 2ZPKL 3ZMUA 3FQ4A 3BKJH 3D0LB 5AWNH 3VI3F 2YXLA 1A25A 1MW2A 4GAJL 4Y4YA 1DDLA 1FFOA 3DROB 4Y1VA 3MRNB 3GWOA 4N2HA 1J59A 4CEWA 1HB2A 2ZSWB 3KCPA 4FQHB 5I76B 5FY9A 5E88A 1YEGH 2YBSA 1NQDA 1ZLUK 1JPTH 4HG4K 5IR1B 1H8TB 3AKQA 1BXVA 1OO2A 3ULVF 2FJFB 1DFBL 2A1XA 4FNTA 5E03A 3S3SA 3VXUE 3ACLA 5ID1A 1RPOA 4YHPB 1H15B 5I8CA 4XTPA 3MYJA 1DVQA 4ORZC 1UMIA 2JDYA 5JTWA 4GX2A 2G3NA 3C2AH 1QLEB 4OF0A 2FK9A 1DLFL 3D51A 3HHRB 4JFQB 4F58L 4CPBD 2ROYA 3VACA 4XZPA 3WKNA 3CIHA 1XMQO 3IYLW 3Q5OA 4J3UA 1T6BX 4R5VA 3WJMA 5JQIB 4Y8AA 2KZBA 2W95A 3CSFA 2WD0A 1QSEA 1M56B 3COOA 4HIEB 4IRSB 4ONGH 5AW3B 5TDOB 4BFEA 4XI5C 2DCZA 1AF9A 2YXYA 4JHTA 3FCGA 1R082 4Y16C 3UQ8A 1IGFL 1NCBL 1SESA 2OLDA 2VR9A 4XXAA 5DRNA 2D93A 2UUCB 3B2UC 3KGUA 3MLRL 2BOBC 1FJGO 1QSFA 3NJIA 5IB4B 3S3CB 2NY5H 2A9NH 3S5AA 5JNYA 2E75B 1YY9D 1IC4L 2VRKA 1SF5A 1PIV3 5E6IA 1WCQA 4P9YA 1H0DB 3BDYH 2YEQA 1RFYA 3MRKA 1IO4C 5DUUA 4B9KC 1DTUA 4PBPA 1A7OH 3A23A 1U3HD 3QJQB 2JKRM 2FBOJ 5HJ3B 1PNGA 2BGPA 5GJ6A 4W9LC 3BYYA 2EILB 1T20A 2IXLA 3H3LA 1BQLH 1WA6X 3D07A 5HDQH 3GMQB 5DD0L 5HD8D 4IQHA 2RMU3 3E80A 2HAZA 2YFUA 1G9NC 2A4EA 1S7VA 3S96A 1VENA 3JTBA 1UOLA 5K9KA 7FABL 4TSFG 3ZIWA 5K1PA 3QULB 3ZYHA 3R06A 4XN4A 4Z92B 1P1ZB 4NPMA 2FQPA 5FDWA 1A7QH 2FD6L 1DLHA 3C90A 1T5EA 1L9PA 2QQLH 3GPEA 4JRYE 5JQGB 3LKSA 2VWKA 1KCSL 2A74B 4E5XA 4NYLB 4Q9RH 3K5MA 5E2UL 3K0WA 2Y2WA 5LG6A 3RZZA 3RBZA 4ZNCD 4QIWF 1E8XA 4FKHA 4UT9A 2L4OA 5HHOE 2CAUA 4GKXA 4P3DA 3U0ZA 5JVDA 4X66B 2BPBA 1TZHA 2PXYD 3MV7A 1LK2B 1MFAL 3CHOA 1CQYA 3QO0A 4HS6A 5H2BB 3IS0X 3LRGA 1LNQA 4L4TD 4PJXA 5FK9A 3PWPE 1KYAA 3TESA 1TZIA 2YC1A 3K9AA 1OAUL 1BFSA 2G3XA 4RDQG 5DHVB 4I0XA 3QCWA 4Y19E 1OXYA 4RRPG 4YSOA 5ACMA 2ETWA 1VRH3 4FXGA 1QI4A 2FEEI 3RWKX 2ARXA 1QGLA 1AP2B 2H26A 3CDFA 3FUJA 4YX2L 3ZXAC 2HWE3 4LQRA 4RGNE 2ZXGA 4GKJB 2W0FA 3MNWB 3KZIZ 3PIQB 4ZI8A 2WNVA 1N1YA 2FDHA 2ARJQ 5KANI 3LIZH 4M3JA 1ZGLM 1I1AA 3SPIA 1AD0B 3M45A 1QJU3 1OHFA 2VQ0A 3DUHA 1CXEA 5J1XA 1T22B 5I18L 4OUOA 2QDNA 4KI5F 2E3CA 4TV8B 1S78C 4R6UA 3T4AB 5KSBF 2WSVA 4EEEA 1HB1A 3ETEA 1P84J 2V17H 3V0GA 5IVXB 1I5PA 1J1OL 1XPWA 2MSPA 3IFXA 4Z7WB 2VTXJ 2BIOA 4BHPA 1AQDA 3TV8A 5GXBB 2IJIA 5IOPA 1EJFA 1NR7A 3HKCA 4G59C 1U0AA 2YC2A 2XG4A 3BUTA 3IPBA 5FUIA 4AFCA 3DJZA 4FQIH 4RH4A 2UXCO 5F6IC 5C0AB 5J9PB 5K1NA 4YVSB 4GINA 1EEZB 3D3VA 4PP2A 3POWA 1SQBH 1SQMA 1AVAA 3MV8E 5I1GL 3FZ3A 5FZ9A 5KSVA 5LMNO 1ZGLP 2VLKB 3ZDZB 3FO9A 2UY7B 4KKLC 3SE4A 1ORQC 1ONQB 3AWFA 5GGQL 1XEDA 4U3SA 4Y8DC 2OJEB 1F8TL 4NRPA 3DX9A 4Q4W2 4UBDC 3WG1A 5H9RA 2DWEC 4WHDA 3SKOA 1BFOB 4GUPB 4PRAA 5F70A 1VGEH 2EDFA 4FFGA 4NERA 2ITCA 4PA6A 1GW6A 1W9YA 1TPXC 3NJGA 2AV1A 2FT6A 3T2LA 3AK0A 4UFKA 4K5OA 1V3KA 2DN7A 1DSWA 3ZGIA 4DQOL 2ARBA 3VBHB 5JIUA 4QRPD 1UD3A 4M5ZL 3FMGL 4Q56A 3CUPA 4DEPC 1T1YA 1GN4A 2XPJA 4A7QA 3UPRA 1H6TA 4DKEL 3ZHTA 5K9OB 4BSVB 1F9KA 2AABH 5FKPA 4A2DA 2YPVH 1MCQA 5FYUA 3GD1C 3VA2C 1OTUC 1ZS8B 3QG6A 1NEZB 2IJ0C 2WZ5A 1XF3A 3SCGA 3EJCA 4ODXB 3VZMA 3EOAB 5AB1A 4A04A 2R061 3NT0A 3UMNA 3QEGH 4L3FA 1JMZA 3APMA 5CHNB 1MQ8A 4QQLA 4QTHA 1ACYL 4JDMA 2QKDA 2EYSA 3X2QC 3W5MA 4Y5XC 1GNHA 3UZQB 1JYTA 5H9PA 1DVFA 1K3IA 1AI6A 4JCLA 4IGQA 4NQDA 4DZBB 4LCUB 1HNFA 2Y0PA 1B6DA 1S7QA 4GEJA 4JHUA 2RH0A 1MXGA 3TEYA 1MZEA 4XFFA 1XF1A 4G9FB 4EKJA 4YEFA 3C7HA 4JGYA 4JEGB 3FNKA 3JWDL 1K6QH 1TQCB 2VL5A 3NRFA 3KB5A 3MHSC 3LNDA 3LIZA 2ZWSA 2OTPA 4QAMB 3U9PL 4WFGA 1FDLL 4O9EA 3KHBA 2ZZJA 4NXNO 2QMJA 1P9MA 5EIIG 3GXUB 4P07A 3AVRA 1N9PA 4FMKA 5LZ6A 2VXVH 4KDVA 3TJTA 1R091 1U2YA 5C8YA 2QDOA 3BKCH 3TNNA 3THOA 4WHCA 2F8OA 2CKBA 1OSZA 2BOCB 2QA4V 3LAFA 4X9IA 4IIJB 2D2CB 4H20L 1CL7H 1H1AA 3AREA 5EEVA 4XPAH 1HVXA 3ZSTA 3WTVA 3K3WA 2ZD0A 5FZ8A 2V5YA 3H85A 1OGPA 4UYPA 5D7LE 1BQKA 3TA4D 1GZWB 35C8H 1FV2A 1BZEA 4TNFA 4GZRB 4F57H 1H4HA 3LNMB 3J7HA 2APWA 2CGNA 5DQJB 3EYPA 4NLAA 1NFIB 5LG1A 3TGXA 5EPAA 2BNQD 3JZ7A 5JXAL 2WLZA 4EEQA 2WVSA 3A47A 3DO7B 5D1XE 4UIKL 4R2GB 3LAGA 1OE3A 2NRDA 1AZUA 1CL7L 1HH9B 2K7QA 3P4OB 4K3JH 4L4VE 1JVMA 2W65A 3BXNB 1ZANH 2G3MA 4G8GB 4FLTA 2F54D 3AMLA 1F4MA 1Q8SA 1HQRB 2ZGTA 2Y6TE 4WWKB 4YY3B 2CK0H 1KIQA 4YWGH 3ZEDA 5AYTA 4Z7OF 3OGSA 1QLRA 1YN7B 3T1HO 1HRI2 3F7YB 3TS8A 3MRMA 1Q0XL 3ZDYE 1IM9A 2K1MA 4O5LH 1KEXA 1TF4A 3FUEA 1NC2D 2YBGA 4XRCB 5I2IA 3KZ8A 5IB2A 5E2TL 4G82A 2B59B 4P2QA 2CH8A 1RJZB 2KS0A 3S88L 3KMHA 3CHSA 4JHBA 1AKJD 2OIGA 1G5GA 4HT1L 4MGZE 4D8MA 4ZMXA 3ZPDA 1TQWA 3G6JF 1PZ5A 4V2WA 4U1HB 3RVWD 4GSQA 2WC2A 1YG9A 1KCVL 3HR6A 5ACLA 1VFBB 4LLUB 2SLIA 2WR9A 3SJBC 4AL8H 4GJZA 1V70A 1U3HA 3DURA 4FQQA 1SEBA 1K7DA 4FI8A 4QRAA 4TUJA 4WHTB 1WLTA 1KTLA 5E08H 3QACA 4DN4H 4RL7A 5GLUA 3RNSA 3N9QA 3DYMA 2CR6A 1XNKA 5EIBC 1CL7I 1GJUA 2APTA 5IIEA 1AO7D 1SNRA 4RGMB 1QSFD 3HJ0A 5ETUB 3RB5A 1TVGA 2M7WA 1P7HL 3ARYA 3D39E 1FSKB 2IJKA 3L3OB 2B1HL 3PXLA 2AQ1A 1FZOB 1V54B 1KTKE 4OULA 2YPVL 2DWYA 3AMKA 1RERA 4XP9H 2ZKHL 2CTRA 2A83A 4P04A 5AW6B 1DDHB 2VC2L 3IWVA 3WNXA 4PTUA 4M00A 1TJHL 3VZOA 4R83A 2AEZA 3MIHA 1CF8H 5EZIL 1SEBB 4FX5A 2C9XA 4K3GA 3TYFA 1R3KC 1J3PA 2Q4PA 5SWQA 1XGQB 2WO7A 3VHNA 4H55A 1EZVX 3O8XD 2R9IA 1AIFB 1MZZA 4LQ1A 3Q06A 5C9AC 3P1VA 5EQUA 1PGW1 3UTQA 1OCOC 1YEEL 5G04L 5IVCA 4MXVF 4MNQB 2YWZA 2FBRA 2NN4A 3FT2B 3R4UA 4HDIA 2DIBA 4ZFOL 1NAKH 3IAQA 1Y18B 1JV2B 5EOTB 3UGGA 3BPLC 1TFHA 2Y6GA 3FBQA 4CP2A 4RR3A 4N0UB 3O0XA 3DVFA 2BM3A 1DANU 4HJ1A 5I8OL 2HFFB 4DV6O 2GAUA 3H53A 2F7IA 1XOUA 2C1PB 4RETB 1V7NL 2HVBA 3F7YA 5JDSB 3EJZD 3FSOA 1LTXA 4AF9A 4GWIA 4ZU5A 5CFCB 3D0JA 2FO8A 4YL4A 1DQQA 1L3NA 3THML 4RD7A 3U9WA 4WK4B 3EYOA 3FWEA 1WBYA 2D03L 4IYHA 3BGFB 1KJ3L 4FNQA 3JATB 1JPFA 4OZ4B 1S5HB 1Q9LB 3FQTB 1JPFB 2UX7A 1RUC2 2HWD2 3E5XA 1WYJA 1AJNA 1W0VA 2ZCZA 4R9CA 3E8UL 4LOFA 5A70A 2RMU2 3WF1A 7PAZA 1HNXO 2E7TA 2IXIA 5D6DA 1IHMA 1KLFB 1TMF2 5FZ7A 3OHXA 3ZGHA 2HFFA 1MFAH 3HAGA 1LO2L 3T77A 3KQ4B 4B4QA 4N2CA 5E99H 4BELD 3BUBA 2DVDA 2ZJSH 1BVZA 2HJFB 4OCMC 3PL6B 4EDWH 1UY2A 3V4UL 4DJMA 4RSVA 5KYYB 4DB5A 5J98B 2NW2A 4AC4A 4LT7A 5E2UH 4K5MA 3UZVA 2MW2B 1W2KT 1YMME 2XXFA 3M86A 4KMTL 1SHSA 3VWKC 2CKBB 3L4VA 3VD3A 3MV01 1QXPA 1ZA7A 3CJHB 1QKZH 2MIZA 3TYFB 4OD2B 5IMMA 3TZVD 3RYHA 3OKNA 1EAPA 4V1DE 4XAKE 4H5SA 3STLB 4DFHA 5JMRA 3MYXA 2W91A 3HMXA 2VECA 3QIWA 3E1F1 4HIPA 2YZ4A 3HR9A 4HUXB 3WNNA 3VXQB 3UM7A 3JWNH 1CGSH 1EH9A 2EC9T 4Z8FL 4LO5B 4AG4A 4NUGH 3Q4HA 3D4YA 4QKFA 3CFJA 1YNTB 4Y2OB 3B83A 2WNGA 4GW4B 3JSNA 2HG0A 4GRLA 3ROUA 3A0HZ 4PYGA 4E0RB 1EHXA 2EH7H 4JGYB 2B1GA 3K58A 3QHZH 5FKAA 4DR4O 2WKOF 4CXWA 2Y24A 3NH7H 5AVXB 4LCUA 1EJOH 1GR7A 1QG3A 3CC5A 2WV3A 4F37F 4FLXA 1S3RA 4MJ2A 1R75A 5CILH 3FBMA 2VY0A 5CU9A 3S57A 1EO8L 3FO1B 4D8PA 3AYEA 4XP1L 4H1LB 4Y20A 5FW6A 4A7VA 3WG3A 4K35A 1K33A 1Q9WB 3RMXA 4CDUB 4X8PA 1AYM2 3NSDA 3NIGB 1WMXA 4C4KT 1UFGA 3NSCA 3EJSA 5E00A 5J6SA 5ITBH 4DV7O 2EVIA 1UADC 2QQWA 3O0WA 3BAJA 3MACL 1ZLVH 4AV4A 2DH3A 4L99A 1LEKB 2VW6A 4P46A 5GZNC 4YW6A 3KDMB 4UW3A 1UCBH 5IVZA 3RNQB 1O8SA 3T8VA 3FBKA 4J3OH 1S9VA 4JPWL 4UNIA 4IRSC 1UHVA 2XIBA 1WFIA 3CVBA 1IGJB 1XTMA 5F1SA 3RWDB 1CMOA 4P5MB 3HKZA 1IBYA 1VPOH 1OGAB 2CY6A 3NJLA 1D2SA 4OI1A 2DQ6A 5L2KA 3FZUC 3P4OA 4TQPA 2AGAA 1D4VB 1B04A 3K6OA 3HZYB 3NGBB 2E7BA 4RAUB 5HHME 4NXMB 4AJWA 5DZEA 2JKWA 4XVJH 4B8EA 2D73A 5ICXB 5I6MA 1PZ2A 4L4TE 3PIJA 3ZKUA 2NY2D 3DC0A 4X1KB 2WHVA 4YXWG 3QBQA 1L7TH 5FM5O 3RUGF 1INDH 4MQTB 1YJDH 1MEC2 5DJ6A 4PQ9A 1KJLA 2EDJA 2YGOA 4PDVA 4ODBD 4PRID 4XVUC 3PDOB 4JGZB 1NXMA 3IDYC 3PU3A 3ZLIA 5JPNB 3MLZH 1FL3A 4QIRA 1AZCA 3RBSA 2YQBA 3C2AL 4RGND 2EUVA 2FTKA 2K46A 1BF2A 3P2DA 5C0AA 3DKQA 1PDKB 1HZKA 2LU5A 1BSMA 4F3FB 1SC5B 4UI2A 4OLZL 4GRLC 1S1AA 1DFBH 1R64A 5I73B 4YMPA 1V6IA 3CQQA 4K3UA 1LEIB 1YY9C 1G9ML 3TV3L 2F58H 4RFOL 1I82A 1QR8A 1MHPL 5F3BB 3HKDB 4O2FA 3L71H 4OGYL 1XB6A 2RJKA 2DTSA 5D70H 2YSSA 2Z4QA 2HJLB 3C6LD 5IW0A 4MW3A 3OC5A 3MRQB 1L7IL 5IHBA 2KZ1B 2R56L 5IMOA 5LA6B 2GJ6B 2UYBA 2BW8A 4FP8L 2VZOA 1FOD3 2FKXA 2WBKA 5DEJA 3U0PB 3VDAA 5CKAA 4LH7A 2JEXA 1INQB 3DGTA 3RIFF 5D1ZB 3JD73 12E8H 2HPOA 3E6HA 4NIIA 2QQNL 3ZQ9A 1E27B 2DLTA 4OLXH 4NQDE 3V4PL 5ISZB 2DQCH 3S3WA 2CUAA 2NR6D 2VSCA 4X5PA 3T4YB 3KYNB 4DO6A 4ZAKB 5C0CB 1G1YA 1JGUL 4E4HA 5DSCA 5A6ZA 5EIQA 4ELMA 4NRMA 4CDWC 5F32A 5L9RA 1YUDA 2Y48A 4LL1A 3JD72 3ZX7A 3OF6A 5DYFA 2ZNWA 2BSEA 5KAIZ 4M5SA 1E4WL 2APFA 3GBDA 4PYHA 1HDKA 1P6FA 1QNZH 3LZRA 4YSFA 4X6QB 1YEJL 4C56B 1HE8A 1S46A 4ZXBA 3IFNH 5IKCB 1MVYA 1U58A 4Y2DA 5FHBH 2ETNA 5FYHA 1E0OB 1HNZB 2ZE5A 1J0YA 4N53B 3OBTA 4NRZA 1ZRDA 3RWGB 1AZDA 5CILL 4QRPE 2KC0A 5JUEH 2EH8L 1CGVA 5T50A 4DXTA 3EOTH 3TBSA 3REWB 4CBCA 3H6JA 4RWHA 3QGVA 3J8F1 4OIBA 3CJIC 4F7TA 1GC1C 1GTFA 3DUSA 3P6BA 3TN0A 4RMWA 4HPOL 5TH2A 4QNPE 2RV9A 4INDA 5K0UA 4MAUL 5E5LA 2X40A 1UWYA 2GSGB 5F1OB 3V4PB 2IAMA 1S7VB 3S96B 5L6YL 1A4KB 5B1CA 1CXIA 3D4GA 4CTEA 4Q4V2 1TTAA 2VIRA 2GC0A 2LHAA 1JNNH 1WLDA 1BG9A 2RCSL 4E4SA 1QKZL 2R29A 4MRCA 5A16A 1X50A 4LF7O 2OW4A 4B97A 3O65A 1ORQB 1D0GA 1S9XA 4Q52A 4LBJA 3T2TA 3MIDA 4Y9FA 4OV5B 2CO7B 3VZKA 1N5AA 5DRXB 3AP4A 4BK8A 3WDTA 1G9BA 1F90H 4MB5A 4CCNA 3DK0A 3HZKB 4I2XE 3VRLE 4CNIA 2AJYH 2ZUQB 4AKOA 1PX8A 4S2SB 3B8NA 4LHLA 4N22A 1APNA 5LGHL 4W9KC 4BZ1L 4K9EC 3L3JA 3AK2A 1TSHA 5F8QC 5MENE 4IBWA 4MHUA 2KKQA 4XMTA 4UFIA 1J1OH 5JORA 3OUSA 1LWRA 3OL2A 4LIQL 3KR3H 1MQTC 2XLFA 4OLYL 4Z7VF 2ITFA 1MJ8L 4UQ3A 3H1JH 4DV6B 3IJSB 4QXBA 1T80A 5T1KB 2TBVA 4URTA 1QJU1 2HLAB 3CU7A 5G2NA 1ZLWK 4N9GA 3UFIA 3ASNC 4WI3A 4AV5A 2DDQH 3PIQA 5I0RA 3IS1X 4ELME 3F5WC 3DX3A 4X89A 2OI9C 4PJIB 1CGYA 1QIQA 4YR6A 4XMZA 5DUBB 1JHKL 4J2XA 3NMBA 4LEEA 2ZXWB 3ZHVA 3EH3B 1TVHA 1L6PA 2WQWA 5D7LD 1ADWA 1BS3A 4I0XB 1AJKA 1ZZCA 1JCVA 2G60H 4ALAC 4ELMF 1E57A 2FDJA 1EFRG 3LY6A 2ZSWA 4JL2A 5CN2A 4JG1L 3ROOA 3PPSA 2MCG1 4E9VA 1P53A 3DGCR 3I02A 3ZPOA 2AXTZ 4AI9A 4AHXA 2UUCO 4GKOA 4ORGB 5ID0A 3WELA 1NYWA 3WCRA 2K9FB 2A5UA 3V0VA 5JPMA 3K48A 4EMZA 1SXBA 3E6DA 4GMP1 4PF5A 3QJXA 2F54E 3VFGH 1EN4A 1S7RB 4GKLA 2FBEA 3RDTD 2WKKA 4DUYB 3HPNA 2VLJE 1XIWD 1ETZB 5CZKA 1I9RH 4JE4B 3GB7C 1UW8A 3N42F 3SKMA 4BH8A 3AZXA 4MB3A 3H9SA 2UXBB 3I6GB 4X5WA 1J5EB 2F95B 5JLVA 3LRKA 1FIGH 3VFRB 3T04D 4RR3C 5FKBA 3LDEA 2Z7YA 4W4OC 1ZV9A 4LBKA 1ES0A 5F9OL 1CLYH 4N23A 1Q38A 4RS5A 5JHLL 1DYPA 4JRXB 2CKBH 3MLYH 1QPXA 4H44C 1BPLB 1XT5A 5CFDA 5GGVL 5HGHA 3TIDA 2L6LA 1ZV5A 3I54A 2VCMA 2YZ8A 1CPMA 2QR0A 3B43A 1LGBA 2Z69A 1BQSA 1T20B 5DD0H 5HDBB 5HDBE 2IWGB 2FSDA 2NY3D 2XX1A 4OTXL 3UAAA 1T03H 1ZHKA 3R4DA 2GKIA 4KJQC 5LXGH 5BW7A 1V9U2 2OYQA 3VVWA 4WW1B 4GQ7A 4D9LH 2IPKB 2PQQA 3QEQA 2XYCA 3FCUB 2Q8OA 5LWBA 4XE0A 5EWSA 5LEJA 2CLVB 2QKIA 2UZIL 1FOD2 4JMXA 1XSQA 1ZLDA 4Y5YC 1R3IH 5BOZG 2AJZA 4XCNA 3SDAD 4B5ZA 4WZCA 4RMQA 2YAEA 2YD6A 4WJG3 5IW1B 1C4RA 3C5SB 3P30A 3FN0L 4FXKA 5GS2D 4ATWA 5JW4Q 1V6KA 2JIJA 1QLFB 1QR4A 3ZMRA 2XL7A 3DPRC 4CRPA 1CFBA 1Y6MR 4B5EA 4DGVL 1GNZA 4PIXA 4P02B 1KTCA 3CPWU 2CR0A 3AC0A 4Y5XA 4QPGA 4KKZA 4Q4Y1 3GHEH 3RE0A 3VB9A 4C7UA 5B3SC 5CEHA 2HHHO 1P5UB 5IYZA 3B7RL 5EPMA 4DPBX 1RM1B 1CYGA 1U41A 1M7IB 1R47A 3EFDL 4OCXL 4BJ0A 1EM1A 1IGYA 4UMGA 4P2OA 1TE1B 2WO3A 5FRAA 4D9RD 4OHWA 4Y4HA 5A2KH 3GUTA 4HS8H 4W50A 1PO23 1VE0A 4IHBA 4X64B 1SJHA 5GS0H 5JHMA 2BFUL 1J0HA 1XGYL 3E1ZA 4G6MH 4F2MB 2ADEA 4AFAA 1ZLZA 1FFNB 4DO0A 3WX5A 2VCBA 4GX1A 4FQXD 1O3RA 1RZJC 4G9SB 3FU5A 1BAFL 1U8KA 2PYFB 3GT6A 25C8L 1EFQA 1U30A 3MA9H 3QFGA 1LENA 3WT3A 2EZPA 4QKNA 1JZDC 2PYEE 5FOJB 1TCRA 5HGDA 1RTVA 2A6KB 5CISA 1BPVA 5GRVK 4OFDA 2OMBA 4EI5A 1S7SB 5AW7B 5KOVC 1KB9F 1F86A 4PGEB 5D8JL 3M3EA 2JQZA 1OSYA 3MRIA 1BVKA 2IQ9H 4HOXA 4S2FA 3VAEA 3IT8D 3NXSA 1AGBA 3FU8A 5T5FA 3HC2A 2Q7NA 3NZHH 3UAJC 3RL1A 3U9PH 2ARCA 3FSZA 2BP6A 4MJ6A 1PLCA 4QRRD 3NCYS 4MKTA 1TEGA 2CCVA 2G19A 2X0LA 5J2UB 1KN4H 2PW2A 4X6DF 4KXRA 2QQQA 3MRRB 2W92A 2ZXQA 3GJFK 5GLWA 3QNZB 5C9AB 5FZ6A 4K55A 5JIPA 1DQLL 3P9WB 4F9LC 3WDHA 3VG0L 1EV11 2CU9A 2E26A 4J7KA 3CMOL 3D33A 2NY6C 3EHBD 2DRUA 4X83A 4HLZH 3VD0A 1SHWB 4IOSA 3MCKB 1ZEAH 5HYSG 5CBAA 2DUPA 1Y4MA 1NGYB 3L5JA 1X7NA 5I93A 1QLEC 3J7MA 4PMFA 2E5EA 5B8CC 4X7EC 3V56A 1AFVH 3BRGC 3C3TA 3X3FL 1RZJL 2DM4A 5FHAH 4CAGA 2Y69B 2VDOH 4UQDA 2HJIA 4M5YL 4FOQA 4E41B 4PHZA 1OSPL 3II3A 1W2OA 1NCAH 2NY2C 3X17A 1G4RA 2VDOB 1L9OA 2DJ4A 2EIJC 3C8HA 3MOBH 1L4IA 5A2JH 4GQZA 4PBVC 4K8RB 3K6NA 1GPOL 2F5BH 1VADA 3BGFC 4GXVH 5EN2B 1PFCA 3MRGB 3OJDB 5KG9B 4Y88A 1EXGA 3KLKA 3B01A 2AJVL 4OD3H 1BM7A 2OKMA 4PA4A 3H7JA 1A4JB 4XACA 3O9OA 3FTSA 3CSXA 2E86A 3WDJA 2ENSA 3QYMA 4XXDB 2B4KA 1UB6A 3P30H 5CP3A 5BNOA 1BAWA 1YEFL 4HZ3A 3GXIA 3F12B 5HGBB 5C0IA 1FXKC 4N2NA 4OTXH 1PZDA 3AWGA 5KX5B 4QE7A 4YJ3B 4LE8A 1UN1A 4PRPA 1EUTA 2W9EH 5L7OC 2RN9A 3KWWB 3O9WA 4XN9A 4D94A 5EC1B 3CZUB 1A02N 1H5BC 4L1HA 4PJ5E 2WLNA 1J8HE 2XWCA 3D2TA 5LYJB 3RLSA 1QJU2 2ESVE 3FS9A 3FN0H 3JASB 3U4AA 2P5BA 3RTQA 5IROD 1T7VA 4PRPD 5C0ND 2GB2A