4PI2A

Crystal structure of particulate methane monooxygenase from methylocystis sp. atcc 49242 (rockwell) soaked in zinc
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
390
structure length
390
Chain Sequence
b'HGEKSQQAFLRMRTLNWYDVQWSKTTVNVNEEMVLSGKVHVFSAWPQAVANPRVSFLNAGEPGPVLVRTAQFIGEQFAPRSVSLEIGKDYAFSINLRGRRAGRWHVHAQINVEGGGPIIGPGQWIEIKGDMKDFTDPVTLLDGSTVDLEHYGISRVYAWHLPWMAVGAAWIFFWFVRKGIITSYIRVAEGKADDVIGDDDRRIGAIVLALTILATIVGYAVTNSTFPRTIPLQAGLQKPLTPIETEGTVGVGKENVTTELNGGVYKVPGRELTINVKVKNNTSQPLRLGEYTAAGLRFLNPDVFTTKPDFPDYLLADRGLSVDATPIAPGEAKEIVVKIQDARWDIERLSDLAYDTDSQIGGLLFFFSPDGKRYASEIGGPVIPKFVAGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords unknown peptide
publication title Effects of zinc on particulate methane monooxygenase activity and structure.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 85
structure length 390
sequence length 390
chains with identical sequence E, I
ec nomenclature ec 1.14.18.3: Methane monooxygenase (particulate).
pdb deposition date 2014-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4pi2A02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 4pi2A03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 4pi2A01
3RFRA 3CHXA 1YEWA 3RGBA 4O65A 4PI0A 4PI2A 4PHZA
chains in the Genus database with same CATH superfamily
2C3GA 2J42A 1AFVH 2FSEA 2ADPA 2CLVA 3MACL 4H8QA 3H3LA 4L8BB 4I13B 3V4VH 4NZFA 3WJJA 2IFGA 1ENSA 1R0AL 1T22A 4QHZA 4OZFH 5A6XA 5C6WH 4WBNA 4BSVB 4EN2A 1FPTH 4IGOA 2HWE1 3DSFL 5EOCL 3SQOL 4PJ8A 4OLVL 4RAIA 3ZT5A 5FUCC 4XBPB 2ZNJA 4ZOLA 4NUGH 4UV4L 1M3IA 3QH6A 4DO0A 4KXRA 2EH8L 1WBFA 2R27A 4Q4X1 2VUKA 3IBOA 2ARJA 1BMWA 4QXCA 2YWZA 2NP0A 3CDYA 3HHRB 2NYYD 5IR1B 4E4EA 4DUZB 2X89A 3NQIA 5DJ0A 4R26L 1HIML 1R1A3 1WA2X 1RLWA 1KBBA 3GTNA 1JNJA 1GSLA 3IDBB 1W2UA 5JXHA 5DPNA 1VFOA 4CEWA 2XSKA 3DYOA 2ETEA 3HD8B 4GYCB 2R2HB 4J23A 3K46A 1RP3B 2EINB 2BMKB 3MROB 5AEAA 5DZGA 3KYKL 2VW4A 4IU3A 4PW9A 3VG0H 2EVIA 4QOKD 4AIZB 3BDBA 5PAZA 1XNAA 3K59A 1JBCA 2FL5A 4W4KA 2A3QA 3PU3A 4Z0BL 3D33A 5AB0A 2A70A 3QO0B 5A32A 3U0PB 3HZMA 5EDSA 3D85B 3LPPA 1IOAA 4NZUL 1KIRB 4KHXH 4P9HL 2Q6WB 5IJCC 2WFPA 4IDZA 4RR3C 2BQPA 2EYSB 3RWHA 1W8EA 5B1NA 3CNKA 3JTTA 1XGRB 4WFGD 3RQ3A 2PHLA 1HB4A 4CDGC 4DXRA 4P9HC 2J6EA 3QXDA 3RWFB 1VB4A 4ZDHB 4F7MB 4EJRA 2IGFL 5CSZB 2VZRA 4L29A 4MLIA 2OJEA 1NCIA 1OC1A 4RBPK 1KCVL 1FYTB 1Z0MA 2I69A 3I56V 1P9MA 4LE4A 2VXQL 3TN0A 5B38G 1ZS2A 5DUPL 1IFHH 4F9LA 3WV6A 2BJML 1SLXA 2DQFB 2CTQA 1FI2A 1MG1A 4XE9A 5L7OB 1QHDA 2HJFB 5FPRA 4DRRA 4BZ2H 1JOBA 4E9XA 3F5WB 2W6IG 2P4VA 2HKFL 4IOSD 4Y19A 4UT9H 5KS9A 4XCFL 3BYYA 1AJ7H 1SETA 4MTXA 2P5OA 5EIIG 4OIIH 4MG2A 4C8DA 3CVBA 3HVDA 2JS5A 1Q9OA 4DFIA 4W65A 3H0TB 3TC9A 1ODUA 5CB4A 5C8WA 2WOBA 4N21A 4FLYA 1RZIB 2G5RA 4TV8A 4J3BA 4TSAL 3W82A 2ITCB 2J72A 2NY4B 3P4LA 3VWKD 1U5XA 2RDRA 3EDJA 4I8DA 1OSZB 4YW3A 3KCCA 4QDSA 4MKMA 3AY4C 4X62O 4LF5B 2G3NA 4HAKA 4OLWH 5EOTA 1NR1A 1CTMA 1K9TA 2FT6A 5J13C 2CL2A 3SHRA 3L3IA 4WWID 4Z6AT 3ETTA 2ZCWA 2PYED 1YCSA 4BELD 2RTTA 5E03A 1T1XA 2WLLB 4F3FA 4AFCA 5D4HA 1CZTA 1JRHH 2HXAA 4HJSA 4HPYL 3UZVB 2VECA 5FV2A 3UPAA 3JBG1 4XFHA 3OGCB 3DMMA 3CN4A 4L8SB 4QHLB 3NCJL 4JQIH 3DTDA 1QR1A 1NT2B 2J88H 2ZG1A 4H8PA 4EI5C 1SBFA 4NUPA 4MGZE 3FB5B 2FH8A 5EWSA 4MCYB 3ZKUA 2WIIA 1IGIH 1UPGA 3IT8D 1RM1C 4YHHB 1XAKA 4JHAL 2KR2A 3FSWA 3P30H 2JCCF 4HQQH 4YGVA 1TEIA 3KG5A 1MCNA 1YEDA 4XHBA 4LO6B 3A6OA 4YN3A 4BQCA 3MBXL 5FOJA 1I53A 1KJRA 4X6DA 5FXVA 2ZT9C 3Q1SH 3TBSB 1XBFA 2PWEA 2XQBL 3ETSA 3POIA 4MSWA 4BB3A 5CZKA 1A6UH 3M7AA 1F58L 2VLRA 4Y4HA 1X9QA 3BSHA 3FLPA 3O1RA 4WM8B 4YEFA 2GK0B 4PREB 1LNUB 3CO2A 1XH0A 2ZGMA 1EFXD 3HFFA 4IEPA 1SN0A 1PSKL 1BJ1H 1VBA1 2Q8BL 1EWHA 5J5EA 1U8MA 3CIHA 3LV3A 3HVNA 1NCQB 3G08B 4R9HA 4MDIB 2AK4D 1LEIB 3J8F2 1RZJH 3RWGA 3CZFB 5JHDA 2R70A 1NAML 4NO0B 1UU4A 3NCEB 4FXKB 2LS6A 4GXUM 4NX0A 3NIGF 5IW6B 3JXSA 4HJEA 3LPFA 4KO6A 3WFEH 4O4YH 4CN4A 3FT9A 4WFGE 4YG3A 1M53A 2OR9L 3BAJA 4R84A 4ACPA 4RGNB 1FHNA 3L45A 4KVPA 4XXCA 3ZMRA 2VDQB 4N0CC 5FYTA 1MF2L 1HJBC 1SXBA 2VAJA 4YSSA 2CNZA 2WC2A 3ZYPA 5BVPH 1H8TC 3DL3A 4M7JH 4CPBD 1LOGA 3NAPC 4Y89A 4Z7UB 1J5EB 1DN2A 4BH7A 4OGXL 4KQ7A 5IVXA 1J9SA 2J71A 3NDYE 4LDCA 3VCLB 1VBE1 1T0NB 5B7MA 1CL7L 4UAOB 1WBXA 1D5BB 2HFTA 4DKAA 4WW2C 4W70A 3LB9A 4P2RA 1Y9GA 1Z7JA 4YAQB 4OI8A 4K9EH 1QVFU 5INDA 4EI5D 4J7ZA 3A4EA 4AI1A 2WO3A 3O6ML 1S7WB 1HOCB 3ZKSD 5LOVB 4O2BB 1HQ4A 4M9PA 2IPKA 3NRQA 3KCWA 4GRLB 3PP3K 1Q94B 3CG8A 3DXAB 2BSDA 2F68X 2XY2A 4G9FD 4JFDA 4ZMAT 2X3AA 3ULAB 1IC5L 1AZUA 4QR7A 5IFAL 1PNFA 2BWDA 4ZUUB 5J9PA 2LT9A 2ZXBA 3ULUH 1V54C 1DHKB 2JKWA 2BVOA 1V6KA 4ZW6A 3HPNA 4DS0A 4YSTA 3CQQA 4IE6A 1SBSH 1UYYA 1CAVA 5A7WA 4FA8A 4HNAB 3VGAC 4PG9A 1P7HL 3GINA 1N3PA 4B1MA 5K9OB 3T8XA 2PYEE 4J5VA 2YFOA 5CP3A 4JKKA 2ICWB 4MA7H 1XCQB 4M7LT 4GXFA 3TIDB 1AYN2 3P2DA 4KU7A 3SPCA 2VM9A 1DGLA 2FGWH 1LO4H 2XACC 3W1ZA 5LATA 4HUKB 5HGBB 3DJSA 3AEIA 2ATKB 1AO7A 4JFZH 4TSBH 5I6PA 1YEIL 1WPBA 2QM8A 4JI8B 1Q1PA 4LEOB 3J9SA 4AQ2A 1USZA 2CGRH 1F3JA 1VPOH 2L7UA 4KZEH 5KJRH 1AXYA 3QF7A 3KBEA 4JG5A 2WYIA 1M71A 3H3KA 4JB9L 2ARAA 2OUJA 1D5IL 4F57L 2FBRA 5SWZB 4LSTH 5IEHB 3BIWE 2YD0A 3FB8A 4ZOCA 1MEC2 4MCNA 5C09B 4N0CD 2E7AA 5I0XA 1AGEB 3CDZB 3IMBA 1CAWB 1W72A 1ZAGA 1ND3A 2W1QA 3C2AH 3E5XA 4YBHA 4A2HA 2A9AA 2Y7SA 4XJ8A 5I18H 1DVUA 2OMTA 1WMXA 5DABA 2RR3A 3CC5A 3M70A 4CBCA 4LF3B 1RUE2 2YKKA 3WJJC 2XZAH 4S1DC 5DUMH 5LGJB 1UZ6F 1W2AX 4QTIL 4LSQH 4PLJD 3WNJA 3GD1C 1EV2E 4LF8O 3JV4A 4X88A 3VNYA 1KWGA 4BZ1L 3D39B 4NQDA 5A6LA 3O41A 4PJ8C 1LMKA 3BDYH 3B00A 4FNQA 4N43B 2QTOA 3MCKB 2OSYA 5F0JB 3ZOAA 4LBJA 2AK4E 2XVKA 3TOPA 4E68A 3V0BA 1J83A 1T3FA 1HZKA 2XYCA 3ELQA 2ZHKA 1R5VA 4LIQE 3CCHB 1OLLA 2CUMA 4FG0A 5B3JF 5B1BC 3MBWA 1RURH 5E1AB 1UT1A 1A4JB 5CA0B 1UZWA 4U6YA 3KM1A 4MH0E 4XMAA 2LFRA 5C3RA 5ENWA 3VXSB 3U48A 4FHKA 4UM8B 1QSEB 1GS8A 2BY1A 3HKDB 1JZ3A 1YI2V 4S2SB 4GRWF 3RG1C 4CEWC 2COQA 5HHXH 5HYJB 4Y7MA 1ZSDA 2GG1A 4ZPVB 3BCWA 2ROXA 3CZUB 3V4PB 4CP9A 3T1HO 3OWEA 3GMMA 4IEZA 3C6SA 3DV6A 2OMNA 3F00A 2OTPA 1JNLL 2XQYK 4GKLA 1W8WA 2BS8A 1MZZA 5C7ZA 4JI1B 2YZ1A 1VFAB 3G6DL 5KHKA 4XVHA 4UCVA 3D0VA 3QDJA 4G6AC 3IFPB 3BPOC 4ZUTA 4ZAKA 3RYCA 3CC7V 4FZ0A 1EZLA 2ZWYA 4K3EH 4Y4FB 4Z0XA 43CAB 5AW8B 1L7TL 3WQ7A 4FAGA 1AI1L 5JW3L 2DZEA 3BAKA 2BINA 3F7VA 4NM8L 3VQXA 2O5ZH 3LQAL 2PHFA 1PZ8A 2RALA 1Q38A 2J6EL 3SKMB 1XB8A 4PP1D 2WMPB 1RU9H 2GJPA 2Z0AA 4ZX4A 2NSQA 3KE0A 3SYQA 3HEIB 4L4VA 2ZCLH 4G9FE 4LLQB 4NKDA 3SOTA 2DI9A 3V4UL 3MRFA 1IX9A 5GGSA 1NVPB 4YHKL 2Q2EB 4FNPA 3IDNB 2ZPKH 3HNBM 1TQTA 3QEUA 5AC91 2XUWA 1CG9B 4QDQA 1X59A 5ALBH 3LZQA 2XKNB 4CVZA 3E6BA 4QPYA 2PTVA 4Y5Z0 1P9MC 1MHPH 1MLBA 3Q13A 4EPSA 3TN0C 2VMCA 2X5IB 4S1DD 1N8ZB 3Q6FA 2XVLA 4F9LC 3FJSA 2W1UA 1IC4L 15C8L 1TVBA 2AJZB 5HHNB 4Q26A 2EO1A 4GMP3 4KGLA 1RZGB 1BT8A 5DJ2B 4J42A 4R7DB 1NJ9B 4K7FA 3R4SA 4JN2B 1D0GA 3KPOB 2BNUB 5CBLA 3I02A 1E9PB 2P2KA 2X38A 3HKZA 4HGWA 4HC1L 3LZPA 2FCTA 4A4AA 5BQ7A 1BMV1 2QM7A 4L3EB 1W91A 4BXSV 3E9UA 3OAAG 2Z92A 2ZF8A 5D72H 1X50A 3TJEH 1O3SA 2QHLA 2R30A 3DRQA 3WL9A 5H9QA 3TBVB 3VZKA 3ZPDA 1G7LA 4XPFH 3KPMA 1SDDB 3IM1A 1E50A 1HH6B 1AR71 2PW2B 2DQDH 3MOAH 3T09A 1Y9QA 4ASMB 2JB4A 4FFWD 4XVUC 2X6UA 1KELH 4FFZA 1HOEA 1QXRA 3QQ3B 2BVEA 3K5RA 1I82A 3PIJA 4AILC 1KN4H 5A3NA 4G6AD 1RUJ1 3RVXC 3DMMC 2XH6A 2BNRD 3EOTL 1I7RB 2P5WE 4Z5RB 3ILNA 5GGRB 2WW8A 3N9MA 3N2GA 4HEPA 4I89A 5LEJA 3V52H 4JRXB 1CGWA 2DICA 1JNHA 2NSMA 4Y5YA 3SDYL 1NQDA 3WDWA 1U8CB 1O3QA 2BS71 3L4CA 4UT6A 4X98B 3ME2A 1L9OA 2IUWA 3LOIA 1VGKA 3WP3A 1QBLL 1KT2A 1ZL8A 2YA0A 2ZKNA 3BKYH 5F3HB 5HYQB 2I9TA 4MSWC 2VBPA 1OARL 1MPAH 4YDKH 5D7JA 4Y4HC 3CSGA 5E8OB 3VTAA 2F4PA 3TN0D 2DU0A 5DMKA 2P5EA 4WCYH 2H45A 1WLDA 1S9XB 3UKTA 3C3VA 2BC4A 5FZ9A 4HMZA 5SX4H 1HX6A 1NFIA 1MNNA 1I1RA 3MRBB 2K8QA 4S10A 5HVGB 5HV0A 5F0PB 4JLRA 5CJXA 4Y19D 1DQQB 1P6FA 4DZ8B 3ZDWA 2YBPA 2N56A 4LF7B 2Q7AA 3EXLA 2DQCL 2A2QT 4XP1L 2Q8EA 3L70H 2IH1A 3CVHH 1OPGL 1PQZA 5FO8B 4PJXE 1IAKB 2F8IA 3BLKA 5GW7A 4D94A 1VFMA 1YWKA 2X42A 2JJUA 4AGRA 3REVA 3UFIA 4XXCC 4CCCA 2R071 5EULV 1KENL 1K42A 4OV5B 4WY7L 5FLVA 4PJAE 1Q3EA 1DLFL 4UT9A 4GW5A 1V6LA 4XVUD 1PO13 1CFTA 3P5BA 4J41A 3L3GA 5LUMA 1EZJA 4XAKD 3SBQA 3EJJX 4JYAB 3V6OA 4PI0A 3V5HB 2IALB 3CFQA 4IMLA 1HILB 1NEZG 5L4MA 4NXKA 4Z7NF 3ATGA 4IV3A 3ZXLA 4MGTA 2GKIA 4GG6A 3RVWC 2HVBA 3NAAH 3DMMD 4W6YA 2AQQA 3N3EA 3RWDA 2JJ1G 1NMCC 4NUMA 3TWYA 1D5AA 1FOD1 4X80L 2JMRA 4DR2O 1AJPA 5FHBH 4QGTA 5DT1L 4WBBA 3T2NH 4AR2A 4XMUA 1ECZA 4RH4A 1T5WB 2PPAA 2UUAB 4NZDA 1KXHA 4KTEH 5IV2B 2G1MA 2EILC 4FJZA 3ZYRA 5DO8A 3PVEA 3TETA 4POYA 1DVZA 2VAAA 3RYRA 3WB2A 1AGCA 4LVHB 5J9PC 2WPDG 4RQPA 4HS6A 1KTLB 2ZINA 1IDSA 3ETDA 4WU7A 5B38B 2EEDA 5C8CA 2CKBB 1ZANH 4NNYB 4PBXA 2VLRD 4JQIA 2HTLD 4Y4HD 3NZHH 4Z3JA 1JXKA 4LFBB 3MO4A 1ES0A 5FPUA 4QMEA 2QZ3A 3VFGH 1ENXA 4JFEB 3L9YA 1RKRA 1XR8B 3ES1A 1UQXA 1RUKH 4L97A 4NKIH 5EIIB 2CLZB 1TYRA 4E9VA 1TCRB 2WNUB 4UZUA 4XX1G 3OY8B 4DPNA 2EDOA 3QXTA 1M4KA 3HA0A 2FK9A 2BNRE 2XXCB 5H2FZ 3X2QC 2JH2A 1W8OA 3ARGD 3QK0A 1E9QA 5JHDD 5T5LA 1F6FB 1X5KA 2BDNL 2Q76A 1J0KA 2QDRA 4UCSA 2W0PA 4EI6B 3C8XA 4ZMPA 4I85A 3V0JA 4ABMA 2FBJH 4JZJB 5I6OA 1PZUB 1FATA 4MX7B 3OMZA 3O8XB 4CDUA 5ANHA 1R3LB 4QNHB 3GO1L 1W72L 4O00A 1F11B 5C0CB 3T2PA 1RI8A 1JK9B 3ET9F 4NNXB 1SXNA 1BEV2 1II4E 1RULH 1ND3C 4QRBA 3GBNH 1P49A 4JO4L 2HP4A 1R083 1IS5A 1VMHA 4YFDB 1GWMA 5CEZL 5FPXA 5D7IB 4ZUSB 3ZRFC 3RY4A 3ZRWA 5I1IL 5C9AA 2X7RB 4H14A 2EICA 1E42A 5T3XH 4WGWB 5DRZA 4X1YB 4P2RD 5DZPA 4NIAA 2ZCZA 4HPKB 1D6EA 4LSSH 1WGPA 1Q0YH 1G7HB 1IQWL 1RK0A 1WAAF 2QJDA 3O4LB 4L8DB 5E8EB 1ID2A 1U5IA 1W3XA 4MTMA 2CAZC 1NCAL 2EXJA 2G0KA 1OF4A 2X53S 5C7XL 1FO0H 1PAMA 2KS0A 4JFDD 4CMHC 2PWFA 1DVSA 4EB6B 1H0BA 4C59B 2GNMA 4ZHQB 5IVYA 3VSUA 4OZHB 1QVOB 2AI0H 4JJ5A 4X8XA 3GSRA 2WXJA 1K5MA 1DQ0A 2Y6JA 3ZPYA 4A6YA 3P9LB 6FABH 2AJVH 2WTOA 4BKLB 2D3RA 4XDKA 2AV7B 2E4TA 2JDKA 1JZIA 4YHMH 4PVMA 2Q4PA 4JCKA 3S3DB 2RV9A 1TMQA 3S5LA 4CCLA 4WVZA 1VHPA 1TTUA 5F71A 4OBSA 4IETA 1JWMB 4B9PA 3QJZA 4Q9QH 2EYRA 2VH5L 4GH4B 4J8RA 2VXUH 5B1OA 5EO1A 4ZAKC 2OV0A 1LRHA 3DA0A 3NNFA 2YI8A 4ZFOA 4PLOB 5J56B 4IL7A 4LLDB 1B0WA 3F7VC 1A5FH 2DW4A 3ZUCA 5JIQA 3CU1A 1SEQH 4AYMC 1ZOXA 3SQBA 3IFLL 3U6RB 3ZHRA 2KXLA 3VXRB 1SJVA 1JTZX 4G83A 3MUHL 1FORH 4ETQA 2WQ8A 1A6ZB 4W4OA 4YZWA 2QNKA 1A1NA 2Y4TA 3RDTB 3LXCA 1TR7A 3MRJA 4HKZB 1FZKB 4LEEA 1HWYA 2VDKB 1JGDA 3E1F1 4LLWA 4OKVB 2Q8CA 1DZRA 1UXWB 3KPRA 2DV9A 1CT8A 1BZ7B 2JCCE 3CSYA 4X7TB 1BF2A 2E7LA 1FGNH 2QM4A 1A6PA 2ZSVB 1FG2B 4YVWA 3UADA 2W0LA 3S2CA 3BPLB 5CEZD 3AADB 3TCTA 5FZ8A 4PRHA 4NQDD 4Q4Y2 3ISYA 3N43F 1K5QA 2VDRL 4W9IC 1TZ8A 2X88A 2ZEWA 3T3YA 2PYJA 3WHXB 1JFFA 3E6FA 1NWOA 2JB8A 5F1IA 2R59A 4LOUD 5EF3A 2ODIA 1HX0A 4YX2H 3V6BR 3ITQA 3C3TA 2NXZB 2BSTA 3W21A 4PJHF 1NGPL 4Z1PA 1S5HB 1Z3GL 5J4MA 3EYFB 2IJKA 5CSBA 2V4VA 3IFOB 4ZXBA 1TVKB 1GNYA 3APOA 1RC6A 5FZHA 2XETA 4RRPM 2OUHA 3PP4L 4LEXL 3P3SA 5DYOB 5FB8A 1TME2 4FFZL 1VQKV 4EN6B 1VDGA 1GYAA 1OFNA 4DY5A 5LA6A 2DLFL 5KW9L 3D2UB 3L7EA 1A4AA 3E6HB 2WR9A 3KCPA 3CRMA 3MXVH 1ZV2A 4ZW3A 4JO1H 1VIWA 4OFQA 3ARXA 4Y1UA 1BX2B 4CH6A 2PWHA 4MA3B 2DQ3A 1IBBA 3BRGC 1C8M2 3QDJD 3PTYA 3B09A 1FZMB 2BNQB 4M4RA 1W6NB 1AI6A 3FU5A 2EX3A 1R17A 3HZKB 4DY3A 4IM8A 2EXHA 4HS3B 2EXWC 4NQSB 4UT6L 2V7NA 2Y06H 1ONQB 2WCSA 4XHQA 2BZCA 3D3VD 4Y5YC 5FYKH 4DKFL 5AYQA 5C6TL 2EALA 4JO3L 3WDXA 4L4VD 2FKXA 5ANMA 4M3HA 1JYVA 4G1MB 5F2SA 1RUD3 5I1KH 3RNSA 2VSCA 1SMVA 2HFFB 3ZQXA 4N8VG 4BCZA 1KDJA 2YS4A 4U31A 3ZKXC 4BAYA 3TBWA 5IFJB 4MA8L 2B4CH 5FUOL 1AR81 1NG0A 1MQKL 4PJBF 3OJ2C 2H2PC 5D7JC 2N74A 5DJDA 2EA7A 5FEBA 4NFDA 4ZFFA 2ZOOA 1ZE3C 2OR7A 3HC2A 3CRQA 3L4TA 2DQIL 4LKSA 1AGBB 4FKEA 4YSRA 1OTUC 4HV8A 1XILA 5F96L 3JTSA 3CBNA 3W9AA 2BSKA 3VDDB 1CDJA 5CJXC 1HCYA 4MVSA 1QWUA 1YMMB 5BZZA 2OMXB 4RWHA 3UBXI 1H30A 1TMF3 2ZGNA 2DBIA 1XF1A 1JQ0A 2DI8A 3FU9A 5DGQA 1INEL 4PT6A 3KYOB 4A44A 1U8NB 2IH1C 2BFUS 1DYOA 1LDPH 4FS0A 1ULPA 2Z34A 3JARA 3VJ6B 4C55A 3RZKA 2JIGA 5HFLA 2DWYA 1BOGB 3PGFL 2IV9A 2PI5A 3C5XA 3DPRA 3MW3A 3RE0A 3FQWA 5DFTA 4OZXA 4JBSA 3BLBA 5LGHH 4X62B 1CE6A 2NY1D 4LCWD 4NXMO 1LEKB 2OIEA 1XMOB 2B2XH 5IQ7H 2I07B 5AKSA 3W2DL 5IMLB 2A83B 4NUJA 3W56A 2RNBA 3V6OC 3U2SB 3TWCL 4QRUA 3P69A 3U07A 1I8IB 5HYFA 5I76A 4FNTA 4YY3O 4HLZG 1MI5E 4L37B 3AWFA 4I1PA 4IV3C 4E4HA 1JWSB 4IU2A 1N59A 1WG3A 2WKOA 4PUBH 1CLYL 4IGBB 3K3WA 3L2YA 3LQZB 5C2UB 4N2AA 4ZOBA 5KBMA 2EXWD 3NTCL 2H1LM 3L74H 1YRKA 4LVNC 2X09A 4H88L 5IK3A 4JGUA 5D8AA 2CR0A 1G9NH 5CAZA 1UENA 2ISDA 4AJWA 2JEMA 4J3TA 1U2YA 3L2LA 5D7SH 3RFZA 3TYFA 1QFOA 3MRMB 3OKKB 4XUPA 5A3OA 5I0SA 4E9YA 2BXZA 3IJEA 2PELA 3BKCH 25C8H 3IPFA 3VFNA 4RQPC 4UOW1 2Q5BA 1CEZA 3SO5A 1JOPA 4IV1B 2OW6A 3U4EA 2FJUB 2VWEC 5C8CC 5D7JD 4J6RH 4O2CA 3BWAB 4PWGA 1HZHH 4ZUWB 3ZLIA 1XSIA 2Z0BA 2P5ED 4XCCH 1JZ5A 1MG2C 3UO2A 1G84A 3RYKA 3UPRB 4BQ4A 1IGJA 4DR4B 1WFJA 2Y1VA 1UFIA 2BFVL 3GZEA 3GSQA 2JJWA 1CC3A 3MI6A 4GRWE 4AEDB 4P4KD 2ZXEB 2Z4TA 4XN2A 4ZRGA 2IJIA 2VDOH 3DUSB 3CK0L 4EQ2A 1IGYB 3QWOB 3T2QA 4EZHA 5MERA 1BJ1J 4XDQA 2CE4A 1N0LA 4QNPE 4PV1B 1IBKB 1SBBA 2XI9A 4PS4H 1VESA 3D3VE 2A9HA 1F23A 5SWQB 2AXGA 3NABL 4Q89A 3BTAA 3DCQA 3APMA 1RXLA 5D71L 3SSGA 4XUQA 4CDUC 2WINA 5G5DB 2PFWA 1C12A 1PKXA 3HNSL 1INQB 3IDGA 3Q7JA 3S36X 1ETJA 1GP5A 4IE7A 3UZEC 3W7UA 2R0HA 2RAMA 3JSNA 1DYPA 2N04A 1EBAA 2EDWA 5EOQL 2HWE2 2OZJA 1XB3A 1RZJC 4FP3A 4SBVA 5GGVL 3W81A 1QPXA 3CU7A 2R8SH 4XFGA 2NXYB 4XIKA 1O9VA 5FCUL 1S9YB 5LHDA 4KRPC 1EPWA 5C9AC 1XE8A 2HH0L 2H9GB 7FABH 1B06A 2XZCL 1EEZA 1OCZB 4Q4X2 4KXBA 1SZBA 1SUJA 1U8IB 4TNWF 1COBA 1LP9F 3QJHA 4YIQA 4DUYB 2AJSL 5I17A 4RISL 3OT7A 4XC3H 3LSOA 4JGYB 2WXIA 1DQJB 2AQSA 2PHWA 1UB5A 3ZKQD 1A6VH 1FL6A 3RL2B 2ZHMA 2D3VA 3ULSB 4FXLA 4RSVA 3LSSA 5TD4A 5EJZB 4A6YL 2XWDA 5JDSB 3TZVB 4BM8A 2BOCA 5T1KA 3VUAA 3GGLA 2ID5A 1BF5A 1G8WA 2P26A 1CXIA 2WBKA 1K5MC 1N67A 4Y24A 3K80A 1W0PA 2FB4H 4OZGA 1HNGA 3NSXA 3FMGA 4LCWE 1GOFA 1PO23 3ZXKA 3IJSA 4Q4V3 4COVA 3Q3GB 5I15H 1DJHA 1FFNA 5EU4A 2PZSA 4V2VA 3WQBA 1E5IA 5CIRA 5E7BA 2P8PA 3RU8L 4F6RA 1Q9WB 3ARSA 3P9WB 5DZJA 4MXVA 5C0AA 3CYOA 1RK7A 4Y9EA 3M86A 2WAQA 5CM1A 4QB2A 3V5KA 4XJWA 3BXNB 3GJFH 4Y5VB 4YDZA 3D25A 1RJYA 1OW0A 2D3LA 5FYLE 1OKQA 2FTKA 5H35B 2IDFA 5DD3H 3O2VH 2IV8A 3D4CA 1P84K 2YBGA 4XP9H 3ZQ9A 2ZNWA 1OQDA 1X82A 2ZGOA 2BY3A 3DX0A 1IB5A 1S7UB 4AMWA 4NI3A 4Z9KB 5FYJL 5DUVA 5F3GA 1AXTL 4W4OC 5ITBL 1FJ1B 1HHKA 1IM9B 3MXWH 4XMKL 1U8LB 3WD5H 2J7MA 3UMTA 5FZDA 3PUAA 1NGZA 2KLSA 1NEZB 4JGNA 4HJTA 2BBAA 3TH4T 4KXAA 3ARZA 2E7LC 1EIBA 1B2WL 5B39G 4KRPD 1SHSA 4MMXA 4YVWC 2UWBA 1QFPA 2ZXWB 1MCDA 1Z5YD 3KDMA 5KVFL 5A6QA 2R29L 1BZKA 3KLDA 3BZFB 3FU0A 4G2AA 4LCYA 3I74A 1FLRL 3M99B 3ABMC 1HNXB 4ARYA 3IGAA 3JWOL 2AKRB 1NQTA 1M4UA 5DYFA 1PFCA 2VW1A 5L9VA 1XGYH 2CXGA 3ZTJH 2UXDB 4HUVA 2P24A 4P9ML 4UAHA 3B7SA 4WO4B 4C4KO 4XBMA 4K07A 3JWOC 4N2LA 2NY2C 5E8PB 1VPHA 3U10A 4ZXBC 1HNZO 1IZJA 1ZXQA 2WO4A 2R0WL 3HE6B 4FDWA 4IKKA 1A6TA 1IVLA 3S35H 4CJ0A 4JRYB 1E40A 1BQLL 1ML0A 4LR3A 4NUQA 4J4PA 4R97B 5TTRA 1UD5A 1J3QA 1NL0H 4QY8A 2VQAA 3MRPB 3JBG2 3KKYA 5L0QC 1CGPA 3NMEA 4Z7OF 4I30A 3EDEA 4QKDA 5F7NC 4S1QL 1FS0G 2QKCA 3CPLB 4EXKA 2AJYH 3V6OE 1QHTA 2NT0A 3UYPA 4MNHA 3GSOA 1RZPA 3KVQA 4HUNB 5LCVH 4Z7VA 4LQRA 5IJ0B 5TDOB 1BHGA 1FFPB 5C2BL 3LNIA 4GG6E 5J57B 4NKOB 4AWJC 2BWCA 4M9OA 4MGYE 1DBJL 2X2UA 4LMQE 1N7MH 1DUYB 2UUCO 4NO2B 1A4BA 3FU7B 2ZD0A 5CLYA 1QQP3 4PGJA 3MV9E 2DTYA 3AP5A 4UIMB 3LQCA 3NK4A 1NOVA 2A4EA 3VXMB 3DTXA 1AZBA 1WWBX 2FDGA 5IDJA 5IGXH 3V0AB 2VCMA 3QCTH 3CHXA 1OP3H 3M3CA 4X0KA 1IQDB 4EN0A 3GKWL 1RHFA 1XL4A 1GK9A 2RDNA 4IESA 1S7VA 3UG5A 3D06A 4CKVX 2IVFC 1DYKA 3GSXB 4FIPC 4JASA 1UASA 2VWEE 3MLVL 4FCAA 4KO7A 2IDSA 4L5FL 5F9JA 1VBA2 1BVLB 4XNZC 5GGQH 1HJCA 2HFEA 3U7AA 4FCHA 3SKOB 3FT4A 1CPMA 5EEXA 2XOMA 4XFAA 4KVNH 4NHUB 2P80D 3ZDZF 4J3VA 1I8LA 3SR2C 3OR6B 3UTSB 4JI3B 4O65A 1JI6A 2F8OA 1ROWA 4MNGE 1OCRB 2WSSG 3GUTB 2XFXA 3EYSL 3MRDA 3WINE 3G5ZA 4K8XA 4P5KB 5CFHA 2G75B 1E43A 2VQ1A 1L7IH 1QLRA 5HHVL 2APVA 4O5LL 1T83A 3QFDB 4GP8B 2NY2D 1OQ1A 4QRRB 4AKPA 3W58A 1PJWA 4JZOA 5AL0A 1BQ0A 3FBYA 1OF0A 4IRSB 2C9AA 1RUG3 5DS8B 5F9OL 2OYPA 2YLHA 4I55A 4PJGB 3UP6A 1A7QH 5A6IA 5J1AA 2CO2A 1Z66A 3NFPA 4EN3B 3WTVA 1VBE2 1BJ8A 1OAUH 1SMDA 5I2IB 2G2RA 4P08A 1WNSA 5GS0C 3DBXA 4M6NL 1YJDC 5GSRA 4CP1A 1KKCA 3I2CL 1U58A 4M6OL 1KP2A 4JQVA 2W0KA 1YY9C 2ZOUA 3Q01A 4XCEB 5L2KB 3ACFA 5I73B 3DX8B 2YQ2A 5JPNA 3NV1A 5F37A 2LLNA 3CHPA 4RGOH 1OVSA 4FZ8H 4ODUA 3N9LA 2C3VA 3ZFEB 3Q6GL 4KZDH 1RUMH 1AQ8A 1UY0A 3HN8A 4MTGA 5C1MB 3H9SA 2HWD1 3VFRB 3TT1L 3V2AR 5D8AC 3WOGA 2KKQA 4Q6IB 2IF7A 3TIEA 3OG2A 2A9NL 1K72A 1U0AA 4PJDF 3X13A 2IQ9H 3VH8G 3IBEA 1B0GA 5FJHA 4XAWH 4EAEA 3ARDB 4EUPH 4TVUA 4FQJL 1RSOA 1NS1A 3ARYA 2VDNL 3HS0B 5TE7L 1XNTA 2RVAA 7PAZA 1VQ9V 4JREC 5EV7A 3AS3A 1ENQA 4G8EA 3LSEA 4X1IB 3FHIB 1DBMH 3EIFA 5CUSL 4D8OA 4M8UA 3QRLA 3NJNA 2D5FA 3L4UA 3MNVB 4FZ1A 1J1PH 2Q73A 1SYVB 4OD1L 3QB7C 1K3ZA 2XC8A 1P7KB 5C0DA 1V7MH 4AIXA 1I9EA 2H6PB 2GTSA 2BWQA 2WXRA 4BQ8A 1KBHA 2OJZH 4GKSA 3QO5A 4PVNA 5EC1B 5BV7L 1O5LA 1IBMO 1AHSA 3LDKA 3FOMA 1K6QH 3RTQA 4RQFA 3N9OA 3W0WB 2VNCA 4JHWH 5BV7C 1DE4A 5G4OA 3CWBH 1JWUB 1NEUA 1MS4A 4YHZL 3RL1B 1E5CA 1QVGU 3GMOA 3OYWB 1BZQK 5JH7A 3OJDB 3UIYA 1YEGL 2B9VA 2VDPH 1QDCA 4P00B 4NQEA 4XCAA 2PAEA 3O1UA 3GM0A 2YFZA 1DYZA 4KRLB 1I1YB 1BG9A 3FH8A 2EC8A 3L4VA 2A99A 4DV3B 5GS0D 1PZ7A 2FJFA 5BR8O 4PRAA 2HH9A 4V1PA 1DUZA 3L9BA 2A73A 1F6LL 5IB1A 3V95A 2O93L 3L2HA 3LGRA 5IAXA 1IS6A 3BMWA 3FTGA 2F2HA 3IGUA 1F4YL 1T5XA 4O2FA 5D2NE 2QQIA 2W9DH 4Q8KA 1JI2A 4FMFA 5K5YA 3MIDA 5KVFE 4A7GA 1BEYH 2FDKA 2RJZA 2EDRA 1XO8A 4JGZB 5FQ0A 4URTA 1D7CA 1XGQA 2XJKA 3VGDA 3SLIA 3M8OL 4YVSB 2ADFH 3ETPA 1SRDA 3T3MF 2BOCC 5HJ3A 4M5TA 4O4HA 3OX8B 5CNHA 3FMGL 4G9SB 1CE1L 4GI6A 3GSUB 3WXWL 4KV5E 1DEDA 4DP7X 1GAFL 5FF6A 3PHOA 4PJHE 4UT5A 1IEAB 1VGEH 4B9IA 1WV7T 2ZE5A 1PLGH 2WP3T 4OGYL 3VBHA 2WXLA 2ZUUA 3D8MA 3S5ZA 1M90W 2YQBA 3I9IA 1NA1A 1NY71 2BV4A 3WNOA 1CJPA 2MH4A 1Z5WA 2AV1A 1XOUA 2ZIMA 1D5MA 2PABA 1DFBL 4JFOB 1OW0C 2PO6A 3TOJA 3VQ2C 1CICA 3B9VA 3HMXL 1ETA1 2DDQH 1H2NA 4R83A 5F39A 3F7QA 2QQQA 3DOIA 1NKRA 5F89A 3V6ZA 3G04B 3MRKB 2UXTA 1D2OA 5AC92 5LAPA 2Y33A 2DLHA 4NWUL 2IFFL 5AAPA 4MADA 4E9WA 1UJTA 1OM3L 2I45A 4YM1A 1GZQA 4LU5H 2YMZA 1A7NH 1JHLL 5JOWA 2WUHA 3ILEA 4KDTA 1F2XK 3GHEH 1THCA 4Z7NB 1ADWA 4XHJC 3H3PH 1YI7A 4R5TA 2DBLH 4ZTPL 4M8QB 3QSKB 1G5AA 1SF9A 2MK3A 4HH9B 2C4XA 2C7FA 4CSPA 1MNGA 1QBMH 5E89A 43C9A 3B02A 3H9ZA 4QPGB 2OYQA 3IMNA 4MMXC 1XF5B 3IU3A 1MJ7H 3QT2A 4GOSA 3DV4A 3VXPB 1RZ8B 2EEAA 2HX9A 4FG2A 3UV9A 1AZCA 4DV1B 2OTUA 2VXSH 5TDPB 4AZ8B 1BMV2 4JDVA 4LWSB 2EDHA 4Y88A 5TE4L 3HIFA 3IGAC 1SYSB 1WN7A 1MRFL 4QU1A 2IJJA 1KBKA 3I9AA 4CGTA 3FNKA 4P99A 4NN7B 5JQIB 3WCSA 1AR72 1Z5HA 2AMUA 1DBAL 2CGYA 3LB6D 5T1KD 3QUKB 3I8TA 3T2MA 4C57C 1RHI1 2HLEB 1YIPA 4MJHA 4N6RA 4OAWA 2VNRA 3H55A 3I6GB 4XPHH 2CDEA 5TFSH 2QKDA 4L1HA 5FUZL 5K9JL 1NBYB 4J4PC 1V3KA 4YFLI 3ZMVA 1E3ZA 2MCPL 1YSOA 1RUJ2 4I0XB 4I50B 5DD6B 3F65A 3OE7G 5E2VL 4IHOA 4ITCA 3N9GH 4QQPA 1S0VA 5DAQA 1XXNA 1ILSA 1SA0B 1MW3A 1WHPA 1JW6A 1BWWA 2RA1A 5C0AD 3O0VA 1CAUA 3QIBD 1WZKA 5JHBA 1LEMA 3JAKA 4K3HA 2AH2A 2CTVA 1UC6A 1X6NA 4O9HH 5DC4B 1ZRFA 5AW7B 5A2QN 4K5MA 1JGUH 2JCWA 2BCMA 4AZZA 1BJMA 2A9BA 2YOCA 4A2MA 2VDML 2DMCA 5A33B 4KI5F 3AWGA 4CBZA 1QSFA 2R23A 3DTUB 4QJ5B 2WUCH 4QYOA 1HTYA 4G42B 4H8WH 1Y6MR 1UGKA 5IVEA 5A7BA 2I7OA 4KK5C 1XRUA 3B8YA 4LKXB 2UZXB 5FZMA 3QIWB 4HLTA 4JMXA 1AX2A 1ITCA 3BPNB 4XHJD 5KVEH 1PD1A 3BPCB 3BVWA 1BVOA 2W08A 3NVCA 1LNQA 2HP8A 3P77A 1J0YA 2GUOA 3K72B 1S9WA 3V65A 1WPCA 3QRBA 3DGGB 3FFCB 4LLYB 4JDTH 3X12A 2HFEC 1CPUA 1HXKA 2XQRA 1C7TA 1AQDB 3ATDA 1W6OB 4F7PB 1I8LC 1YYNA 1BBDH 3O14A 3MLYH 3PHQA 4GKYA 1ST8A 3ZXGA 5E5MB 2R49A 1QR8A 3QO8A 5IESL 2WZ5A 4M1CD 4OI2A 1ASJ3 3WXPA 1FA4A 1QRNB 2X4NA 2XFGB 1E90A 4MJ6B 3VI4B 3ZLQC 4F1SA 3FFDA 3RJRA 1F00I 2DKUA 5E0QA 4K7PH 3HUJF 5K9QG 4P8QA 4MBOA 4JDZB 1HH9A 2R072 1NPUA 1T83C 1QFUL 4WTQA 1PNDA 3UAAA 4YNYB 3WFHB 4ELMF 4I09A 4IRJB 4D6QA 1H3GA 4LHJB 3MA7B 2XBZA 3GSNB 3UO3A 1F4AA 3GMNB 5DA0B 5TGBA 1PM4A 3ABTA 4PV9A 1JV5B 2PTUA 1FYUA 2NY6D 4J4PD 4NBXB 2VDQH 3FKSG 4J7JA 5ESAB 5FZKA 2ICEB 4YZFF 2DRUA 2JK5A 4AV0A 1BD2B 1CTNA 3UGEA 3QNZB 3S7IA 1HYRC 4ZZKA 1FOD2 2UXBO 1KLFA 3EYQC 4JQVC 4JS7A 3VB8A 1CGYA 1J3RA 1GP6A 4XVJL 4XJZA 2HJDA 3B4NA 3MV8A 3NZSA 1BW8A 4WI6A 4DW2H 4HFWA 3T4YB 1CX4A 3ZFGA 5KANG 3EJCA 1Q82W 2YGOA 5IOPA 5TH2B 5E70A 4AVTA 3CQOA 4L87A 4WKXA 4BINA 4WLCA 1A0QL 5CGMA 3NL1A 3WF2A 4PY7B 4XMZA 5KSUB 4WW2F 4TXVB 3ULVC 2N0MA 1RZKH 3W5NA 5F3CA 4GKZA 2V9TA 4KK5D 1T03H 4X9YA 4XFCA 4G59C 4H20H 1KY6A 1LP9E 4I0PA 4JV4A 1GL4B 4MVBC 3ZFFC 4X6CF 3DO3A 3M8LA 1SLIA 4YPGA 1W80A 3F01A 3NH7L 4B7LA 1YJ9V 4MMYB 1IKFL 2OQJB 2WBXA 3P1IA 3TNQA 1QHQA 5E94B 3CFJA 4V1DA 3RIAF 2WAMA 3EOAA 5B39B 4OZIB 2DCYA 2OCJA 2WFF1 5I8EA 4LHKA 1D6VL 3J4UH 1M5IA 1S7XB 1MJ8H 2BM3A 1DO6A 2WLKA 2R32A 4ZO6A 2OX0A 3GJBA 2ED8A 3GWOA 3UYRH 2VKXA 4F2FA 1NT0A 2Z7YA 1R3IH 5IB4A 2JKLA 3TGUH 1KN2L 3OXRA 2YD4A 4OQ9A 5DXDA 3RTQC 2B4CC 3JD4A 5C93A 4M1DH 2K0RA 5FKAB 3K6NA 3BJ91 4XO4A 5HYSA 1XNCA 2YPJA 3MRGB 5I6XC 1VBB1 2G3MA 2YMXL 3D9AH 1WW5A 2E9GA 4JFXA 2DFCA 3COOA 4B95C 4CMMA 4U1GB 1ZWIB 4PN6A 4ZODA 4DO4A 2ZKOA 4NXMB 2DF7A 4R5VA 3CLFL 5ITFB 1MVUB 3DSQA 1PAZA 4XETA 4RMQA 3J8F3 4DV7O 4AEKA 4JAVA 4C56E 2LFGA 2D0GA 4AQEB 2WWWA 3MU3A 4PWEA 5D2LF 3EYQD 3O3BA 1MKFA 1WMEA 3T0EB 1NDTA 1S0IA 2QSCH 1DDHA 4YW5A 3HG4A 1CPYA 4WVMB 3C7HA 1PTZA 1QJX1 3UNPA 5GGRY 3H9SD 1A7OL 4JO2L 1OHZA 1DLLA 4K8RB 5GHWL 4BUHA 4F8QA 3P3PA 5JHLA 4XCNB 2R2CA 2LJ2A 4BUQA 1OE2A 4PJBB 4N25A 4Y20B 2E9WA 5KC6A 3MGUA 1WBYA 5FP9A 1MJUH 2N05A 4MVBD 1EJOL 1KJ2A 3NT0A 1FAYA 3AJZA 2ZNIA 4J1UB 4MMZB 2NNUA 3M6DA 3S3BB 3H7YA 2GCYB 1M42A 2ZAHA 3PWVB 3DOHA 4BFRA 1XMQO 3GI8L 3NFNA 1BP3B 5ALCH 4I2XE 2UU9O 4GLRH 3V4PH 1OLME 1G6RL 3EZJB 3LN5A 3PAVA 1J7VR 3GSWB 3N44F 4IIQA 2BP0A 4WWKA 4ZFZA 3VBHC 1Q8OA 4M61B 3HPJB 3MCLH 1XE7A 3LD8A 4KGQA 3RUGA 3FO9A 4Y16A 4B3EA 3MIFA 4BRVA 1EERB 1NA1C 2DMHA 4TSCH 3K71A 1LO2H 2PHTA 1IAII 1T4KB 3SDDA 4X66B 3MDSA 1GC1H 2KBGA 3LA2A 4FAHA 5ABZA 1JCHA 3A0BZ 2PO6C 4N86A 4Z7OE 5IHZA 1XNRB 1CICC 4XNBA 3RTQD 1OKEA 2OZ6A 5M95B 1IBZA 1QJY1 1ZS8B 2D3NA 3V0VA 4XZUA 4E8DA 2XAFA 2IWFA 3DURA 4KMTH 1G7QA 1PZ3A 3O0RH 1QO3B 4ODXB 4UDUA 1TITA 4JUSA 1VRH1 1ECYA 1U21A 1IGFL 3ZXDA 2OXGA 2Y1AA 1VR3A 3DV8A 1W0JG 3QEGH 4TQEH 5D7KD 5C0GA 3K3QA 5CCHE 4KDTC 2KL6A 2QWNB 2IPUK 1ZAUA 4LH7A 3GALA 3FHEA 1ZK9A 3CEWA 2HJKA 3EGDA 2YD6A 4HOZA 3RIAK 1EYBA 3LEMA 5C5UA 3NJVA 2IJHA 1IAIM 3L1GA 3O45A 4HKJB 1NGWB 3TXSA 3MLKA 2C9VA 1W0VB 4PJ0Z 2OKXA 4KXZI 3BVDB 1Y74B 2D3JA 1YEEH 3C5JB 1P7BA 3LEGA 2HR3A 4PRBA 4W68A 4RFT0 5T5OA 5F6LB 1FNGB 4FOVA 3JWDH 1MEC3 1URXA 1MVFA 1ZHNB 2QVFB 3VH8B 3ZDZE 1AX0A 5JMCA 3TBTA 1K4CA 2BGCA 5KS9F 4KKNA 4KUMA 2HWZH 2F95B 2X0LA 5F7DA 4PJ7F 4UDTA 2VJ0A 4YDLB 5E99H 3QQNA 2BUKA 3VBOB 5A7NA 5K1JA 1WF5A 3AT8A 4H1LG 4PCYA 2PP9A 4LLMB 4PD4J 5GSVA 5TQ2H 2DURA 3PMSA 4HVOA 2OMBA 3WG3A 1B4JH 1XDCA 1BYPA 3QPXL 1DQDH 4OJAA 5A43C 5F1NA 1J5HA 2P5PA 3CQPA 1W8TA 1RJZA 4NP4H 2LU4A 3BUBA 2RS31 5IQMA 3FCTA 2V3DA 4YWGL 2QHRH 2CAUA 3T0WA 4E4DX 3AG1B 1S5IL 4Y5XA 1JH5A 3NPSC 1QLFA 4XVOA 1CICD 1MXGA 2C24A 3USUB 3VFUA 2EKSB 4EIGB 4R7NA 2WVUA 2XXMB 3B9KB 1FIEA 1RY7B 3DOSB 3ZGIA 3WEMA 5T33H 1AR82 2ZD9A 3WFDL 1EEYB 3ECUA 4HIHB 4OY9A 4MXQD 4XPGH 2DQHH 1E4XL 2X87A 4Z3TA 1CDBA 4KY1L 2CDOA 5IK5A 2X53A 1HQWA 1KB5B 5LGYA 2BVBA 4X6EA 2BNMA 3L5WA 2K9FB 3QJSB 3SCHA 5D70H 3SE9H 3E8HA 1NBVH 4A63A 5ADPH 3KR3L 2MCG1 5CEXA 4X6DF 4PJDE 2VNGA 1HHJA 1SPPA 5DGRA 4CRQA 3OPTA 5DLML 4BDVB 2BSBA 3S4SA 3GQFA 1K5JA 3G6JA 2D2CC 4MJIE 2RM21 3WS3A 3WKNA 4BH8B 5C97A 5I8CA 1UYWH 4TQPA 3D4YA 4Q52A 4X4XA 1CQYA 4ZONA 3BCFA 2WZEA 1LENA 2E76C 5IMKB 1AJQA 3KHQA 5B1CA 2MEV1 2ZTNA 2TSAA 5CILL 1E8XA 3I49A 4HSLA 1US2A 3OM3B 3UERA 5FR3A 3ZDYF 5FDWB 3PHAA 5IY5B 4KKPA 1J18A 2MQ0A 4KQ3H 1KSRA 4G27B 5J2TB 2QEXV 1QHPA 3C8KB 3VYNA 3FQYA 1H6EA 1X5YA 4WI0A 4LSRL 1U3HA 1VJSA 3BP4A 1HDJA 1AD0A 3WBDA 1ND0B 2OP4H 2DIBA 3MRNA 2JK5C 3BGMB 3PWNA 4HUWA 4YSCA 5MEOA 5HYEA 4UFLA 2J8UE 4YK4C 3IFXA 1S78C 2SEBB 3VFOA 2HVKA 1MHCA 4P59H 4CDWB 5LZ6A 4TUKH 1ZLWH 3ELAT 3BVTA 1L7RA 5DAXA 5A9GA 1TQCC 3E22B 1QP1A 1GRJA 3C6LB 4ODHH 1CZVA 3VFPA 4Y3OA 4HEMA 3SGEI 4FOWA 5GM0A 3ZFGC 3LOBA 3THMH 1ASQA 2P44B 3W9DA 3OR7A 1EGJL 3I3QA 3ZE1F 5F7WC 1QSFD 4F33A 4ZMZA 4NPLA 2C4FU 2XZQH 1BREA 4UILL 1OCWL 3QDME 2PGGA 1C28A 4AK3A 3L95B 5DUUA 2YXFA 4XE5B 2TBVA 2FO4A 2Y34A 3N91A 1XHHA 4I0PC 3VDCA 1HRV1 4LARH 1X7SA 5FZ0A 2CBOA 2IU3A 2GP3A 1YQ8A 1XNQO 3H9YA 2GT9A 1QACA 2W0FA 5IJ9B 1VF5B 2CKBH 3H1YA 2F9BT 3GMLA 3OKEA 5C0NC 2Y7LA 3AJYA 2CJUL 3GNEA 2WRAA 1Q86W 2BP5M 2O6FA 1BHAA 3EQEA 3S37L 4YRDA 5D7LA 4G8GB 1SQ2N 2X7LB 5DVNA 1UMZA 5F3EA 5I0RA 5KZCB 4LL9A 4U0RB 5DHVB 4PJEA 2GJ6A 3KZ8A 4BQXA 2A77L 2X4SB 2ORBL 4X99B 2XZZA 3P40A 4X4ZA 3QH3B 2DVDA 3JUUA 5DJ8A 1G9FA 3RZCB 5JOFB 3K06A 3IJHA 1MA1A 1JNNL 4O4LB 1ACXA 4XAEA 4W9EC 5KA6A 3KLQA 1QEWA 4WFHA 4AT6B 4PIZA 4MD5B 4FQ4A 2J1WA 3KWWA 2F93B 3OAZH 1DCEA 4LSVL 4N2CA 3E6CC 3UJTH 1RVFL 1LEGB 4FNLH 3D30A 4JM0A 4B60A 4JPWH 2JIXB 2ZOKA 5JQGA 3ARBB 3JV6A 3I6SA 2NZ9A 5BMVB 5FYZA 1S5LZ 1XIWB 1KXTB 1NBMG 3ASOC 1KQSU 4QXBA 1AB3A 1S78D 2HVJB 3OB8A 1CXKA 4LFCB 1PCSA 3PGCB 1DSFL 4YJ3A 3QULA 3VO0A 1AHKA 3ZTNH 2WZAA 4ZZFA 1F35A 2JKBA 1Q6IA 1B6UA 2NMNA 3N85H 3DROB 4AVBA 1FL3B 2DD8H 4U1JB 1WCBB 2PPDA 3MV8D 4QHUB 5KSBF 1UJ3A 2W65A 5EZYB 1W0KG 2UWEE 1ZK5A 3PWUB 5JHLL 3K74B 2Z91A 1QJFA 1AR1B 2CG9X 3K1KC 2CD0A 4WNQA 2WVSA 3NJJA 1CD1B 4TV9A 3MFFA 1AL21 2YZ4A 4B5EA 4M5YL 1WW4A 1KJ2L 2LU3A 4PJ9A 5BZWB 3U46A 2XY1A 4OMCA 1GTFA 3RY5A 2NLJB 4M1GH 3VL8A 4I0PD 1NC4B 5BY1A 5BOZG 3PWPB 1NAEA 4DCQB 4ERSL 1AI5A 1D9KA 1OP4A 3GI9L 3OZ9H 3W37A 5EO0A 1FXKC 1FH2A 1ZTXH 4JDEA 4ZI8A 3MRCB 4WEUD 1X44A 1IG3A 4V1DD 5C0ND 2A74A 3CHSA 5JMRA 2H3NB 4LEJA 5CG8A 1SCRA 4FTBA 4APXB 3CZLA 4UBDC 4IIQC 4WWKC 3ZHTA 4X6BA 1TTCA 1AXSB 2DWDA 3EG9A 3GMQA 3LD8C 1RVF1 3QDAA 4Q7DA 4Y16C 2YROA 3NJYA 2EVXA 4F4LA 3ZVXA 4RMTA 5GJTL 2ILMA 5HHOE 2J1ZA 3SDDC 4HSJA 1M6OA 1PG7H 2ZKYA 1PL4A 2IAAC 1ZLSL 3GXDA 5CKNA 2EIEA 4RWUA 4Q9RH 3EB7A 5IB3B 5DMIL 1JYTA 4Q20A 2GEEA 1ZBA2 2X1PA 4OVVA 5JO5B 1T21A 2YEVB 2MIZA 3CZSA 3KPPA 4H0GA 4NN5C 3MDJA 1U8HA 1MS5A 4Y1TA 1A4CA 1FFOB 3R18A 2JELH 3GK8H 3GLZA 3C5SA 4OB5L 1JVKA 5D1QA 1EAH3 3DX6B 1WTGT 1U8QB 5FYHA 3WUDA 4U3JA 3BIKA 3HI5H 4GXLA 5I93A 4Y1YA 2VDKH 4YDVB 4J7KA 1A8DA 3IPBA 3QZWA 2VO8A 4DV5B 5KYXA 5JJJB 4WZCA 3NCXA 4XCYB 1HL5A 3QAZC 4J3OF 3ILRA 1SHXA 1PMJX 2CH7A 3DYMA 1WISA 1PEZA 1P1ZA 3TS8A 2OZ4H 1JPTH 3CFBB 3OKYA 5FHAH 4KH9A 1AKJB 1KC5H 3R06B 4XQWA 1JOIA 2R061 3HLKA 2DM7A 4PRPE 5DEGA 4DR3O 1VQLV 4DK6A 3Q2LA 2X2YA 3N0AA 4OJDH 3O2DH 3LXBA 4M3JA 1GGIH 4OTXL 1BEV3 1C7SA 4OI4A 3IE4A 1K4CC 1FIGL 4Q6GA 1QNZH 1U91B 3DK0A 4AH2A 2IDTA 3DO7B 1NLDH 4DOHE 1D4VB 2PWDA 2JXAA 3ZYIB 2I9LB 3U36A 1CVRA 3T4DA 4L1SA 2OXHB 4P2OA 4FFBB 1MCSA 3Q2CA 3HUJE 4LCUB 3ZO9A 1PHMA 1POV0 2O72A 1UZYA 1KJ3H 5H2BB 1WEJH 4WWKD 4ODVH 5CS7A 4WFEA 4QOKB 4ANWA 5LDUA 4CE8A 3N41F 3EFDL 1KP3A 1R3HA 2W81C 2RD0A 5IQNA 3FJTA 2LALA 1SLWA 2NY5L 4PJ5A 12E8H 2QR0B 2WYZA 5J96B 3CEIA 1FRGH 2MHAB 1TFHA 2PF6A 3IAYA 1BIIA 5GJSL 4ZD3L 3K2UH 4Y5XC 4FFIA 4NPMA 3M1CA 4KRNA 5LLIC 4OPAA 2NY5C 2VZ1A 5D8JH 5F32A 1AQKL 1HV0A 2CUGA 3WG2A 1EUUA 4AEIL 1GGUA 3FS9A 5C3OA 3WTSA 4HK8A 3FTWA 4JEGB 1XV8A 3DPBB 1MH5B 2WZR1 2WS91 4M62H 1OPMA 1C1EH 4XWGH 4MT8A 2IBGA 3DPRC 3WNIA 3TH2T 5KAQF 1TJIL 1PJ9A 3K2OA 3HCVA 5TDNA 5DD0L 3L7FB 3QG7L 1E5HA 4EWDA 2VE1A 5I75B 5BO0D 4K71C 3IDMB 2O5YH 2VN5A 4NQCA 4P2QA 3RG0A 1J1LA 4V1DE 4QUOA 4MRBA 5K1VA 4JM4L 2JB6A 3BW9B 5AVPA 5DK3A 1L3JA 2QL1A 2GTZA 3EDFA 3ENEA 3JD3A 2A1WL 4X5XA 2EH7H 5F7YC 5FC9A 4D3WA 4X6CE 3VBUA 5JJEB 1FJGO 2LP7A 5F6IC 5T5NG 5F0MB 1R091 4GW1B 5CBGA 4YDIH 4CDQA 3T3MB 3S5YA 2B3RA 2V9QA 3WUWA 2P4EA 3WDJA 1BOYA 1RIHL 2GSMB 1J1XL 5A7OA 5D4QA 4LK4A 4TRPL 4YO0B 4KBBA 2M2DA 4Q0XL 1O3TA 2Z3YA 4Y0GA 1HJGA 2D7TL 1AMXA 1TTGA 2DWXA 3TNNB 2O61B 2HEWF 3HQUA 2APFA 5F21B 3WNKA 5LYJA 2A6IA 2EDBA 3DECA 2CPCA 4HN1A 2ZG2A 2A6JB 4AL8L 4OQ8A 2WXQA 4N4YB 5L9DH 2Z79A 4X4YA 4E0RA 4FQZA 1I7FA 1UIKA 4OYUA 3ME0A 5DZAA 1U3HC 4Q4Y3 5A6ZA 4OCMC 1VKXA 4AL8C 3EFFK 2W6JG 4XQDA 4RAVB 3ECBB 1OT2A 2Z35A 4PM1A 3ZDXF 5DR5L 2EIZB 4R4BA 5AQ0A 5TPWL 4KTGA 3H3BC 2HVKC 4HHAB 3LIGA 1AC0A 2Z4QB 5BNQA 4MJ5B 3OW2U 2D03H 3KPSE 4QEGA 5F97E 3U4BL 1YEHL 1SFPA 2HWD2 5CLXA 2WWKT 3IB4A 4L0PB 1JK8B 1OHHG 5CMUA 2GEQA 1W2TA 2IXLA 3K5OA 1OJHA 5FLXN 5AYUL 4ADGA 3QWQB 1JN6A 5J6HA 1G86A 1JU4A 1TNRA 2M8XA 4QCIB 5E4IA 4IK6A 3E38A 3AUVA 4OCYH 5IHRA 1YN6A 3OR7C 1Q7YW 1H3UA 4A7QA 1TME3 4WU5B 3RGVA 3GYDA 2L6LA 4RR3B 5E1RA 5D2LE 5I0WA 1K5SA 1EHKB 2DQJL 5D96C 4M56A 4GS7C 5C0FA 2PQQA 4KQ0A 2HRPH 3GF8A 2OMYA 1AANA 4U1HA 2Q86A 1CVSC 2ITDA 2JXMA 2XV2A 4CU8A 4EDXA 3K4DA 2G9HB 4KPHH 3GCWA 2W0FC 2E7HA 4L8SC 1T1WB 5KVGH 4HKBA 1HL8A 4TUJA 3VVVA 3QHZH 4NHXA 1K8IB 2Z5UA 3OHXB 1F4WH 4ZKIA 1VADB 1ZA3A 3E8BA 2EDEA 4K3AA 4HWEL 3JV0A 4JPKL 5FW6A 3WIIH 4F2MA 1EFXB 2NUPB 3LKNA 5LWBA 3CC1A 3HAGA 3RFRA 2CHDA 4H8WC 4RA3A 1NAKL 3LHPH 5TISZ 3HBQA 4UNVA 2Y60A 2DPKA 1KGYA 1XX9C 3US9A 4PLMA 1VALA 1SFNA 3BVNB 1YYML 1JIBA 4PR5A 3O3AA 4I0CC 4TLKA 3B7TA 3HG1E 3NN8A 4U1NB 5J12C 4ZW8A 3ZE2E 1WO2A 4HKOA 2GY7B 4NYLB 1J5OL 1NIFA 1WS8A 4MXWB 2E46A 1JGEB 3OLDA 1JHTB 3UTTA 4A68A 2ZJSH 3MCYA 5LBVA 1BAWA 4QLWA 1PKQE 3R4DA 1VB2A 1MMMA 2UXCO 1ETZA 1XU2A 3Q5YA 2X6CA 4H1LB 1QKZL 3OTOB 3BI3A 5HJGA 2NZ9C 5CWSA 3LF7A 5GLUA 5J13B 5DURD 4CS2A 3TPKA 5AFAA 1XTLA 2B1HL 2VQFB 3NJLA 5J2UA 2NPIA 1UM4L 2Q68A 1WMFA 2W07A 4Y26A 1YNTF 2CRMA 1OAJA 1NC2A 4XVSL 1Z5VA 1NGXB 2HWB1 1XJAA 2DMXA 4BW5A 4EFBA 6PCYA 2UXBB 1PGW1 3L3KB 1KZYA 1KEML 2R9AA 4JAMA 1BFVL 4PF5A 1PEWA 4YGEA 3ARVA 1I94B 3QS3A 4UYBA 1UJ3C 4UAPA 3MYJB 4O2AB 3D0LA 2ZWZA 4M5ZL 3FQ1A 3Q8EA 5EA0L 2OK0H 4EI5B 4EZKA 5IUCA 1YEFL 3E80A 4DGIH 6CGTA 1OD3A 3HKCA 2AEQH 3KCXA 1RM1B 4DAGH 3MFAA 5ACA1 1O7DE 3B9IA 1JA8A 3JUYA 4BK5C 5LG6A 2V7HB 2BFUL 1LILA 3BE1L 4HSCX 4PJ9C 3O6KL 1EHAA 1RUI1 4LXFA 1LHZA 4F3JA 4GQ9H 3U9PL 1AZRA 1J5IA 1NOAA 4LP5A 4A2DA 1RXFA 3TURA 2ZT9B 1ACYH 2P3JA 1D9KC 4KHPB 5E00B 2AXJA 2BCKA 3K4ZA 5CU9A 2H6CA 5CBAB 3H2WA 5C0IB 3EMRA 2A74C 4ZT1A 3N50A 4ATFA 4LKDA 5EWIH 1BDYA 1M6UA 2DWDC 4QHBA 4AI3A 2N1KA 3IDXL 4YYOA 3TCLB 3MLLA 4LIVA 1RZKC 3FH7A 4ELMB 4KHTH 1AXIB 3MVSA 1FLTX 2K7QA 1NANI 1SJHB 1N70A 4IJ3C 2XWTB 5I1HH 2BNOA 1NGYB 1KCLA 2FATL 1P53A 1AYRA 2ICWJ 2VXVL 3PDOA 4H8HA 3ZO0A 2G38A 1GGBH 5IROA 2GBOA 4LO8A 2KYIA 4FADA 2DMBA 2QQLH 4XPTL 2ZUYA 1NUFA 3E5QA 4ONGL 4WFHD 3RNQB 1HW7A 1PD3A 2V4LA 1RJCA 5GGUB 2YD9A 1XXFC 1GW0A 5D1QC 1NCCL 2CIIA 1X5AA 1US6A 2GBUA 2NZ9D 1KTRL 4HJ0C 1DVFA 2OTJV 4BQ6A 5A70A 1JP5A 4UQ3A 1FFXA 1HU8A 3NJKA 1H8TB 4N68A 3LDEA 3MLUL 2OIIA 3NAPB 3KM2A 3IDEA 3VFVA 3V55A 4DV7B 2JKXA 4XTRC 1WLCA 1KCKA 2BP8A 3BESR 3WE6A 1CF8H 1LMIA 1JBJA 2K9ZA 1EN5A 4NIGA 3VKOA 1CLCA 1FGVH 1DJSA 5ITZB 1JF5A 3MKGA 4Y1AE 1G9MC 3PQYE 3R7RA 3ZTEA 4MB5A 2H5UA 3FYIB 4WW2B 5J8OA 3O9OA 4UQ9A 5KJ4A 4L4JA 1A8MA 2GU9A 5HBAA 3C09C 4MS8C 4C91A 3PRZA 4LASH 3JATA 1CXLA 1WZ1L 1RHI2 2DIAA 5MP6L 4TMPA 5EMYA 2EDQA 4HCRA 1Q8SA 5KOMC 4DKDC 1RTVA 2CYFA 1BBJB 4QPWA 2C4FT 1AZDA 4PJ9D 3ZN5A 5D5MF 3HRPA 4BQ2A 2HWE3 3TBYA 4F8OA 2QFRA 2NNAA 5EC2A 4AITA 4NT6B 3N1GC 3U30C 1HDKA 1V54B 1D9KD 4RCAA 1KCSL 5C07A 5FBZA 4BJLA 4Z3HA 3DXRA 1G7IA 4P2OC 4Q4X3 3E3QC 1GMGA 2AZAA 2CK0L 5JLZA 3WAJA 3VGAB 3MRHA 1TZOA 1MSPA 5LA9A 3ZDYE 3EJPA 1UMIA 5B4XA 2O61A 5FOBB 2I2SA 5K39B 3WUCA 3V6FB 5FPOA 3VU1A 5ID0B 3S57A 4QXUL 1GN4A 2XAJA 3D87B 3QZLA 3ZR5A 5J0BA 5E9DA 4OIFA 4WUKH 3REWA 3WJMB 4B3MB 1I4FA 1KXQE 1QFWH 3K0WA 4ODBD 5C8JA 1S0BA 1KYOF 2AAAA 3N2KA 3NW4A 4QRTA 5F5CA 3K5SA 2Q7EA 3U7YH 1WP6A 3O3DB 3CX5J 5GRVL 3RDJA 5KAQG 2Z42A 4NGHL 5KWYC 2UUBB 3NIFB 4HEPG 2SODB 2VNVA 2AZUA 3IIAA 2WO2A 2QGCA 5A40E 1BYNA 2VN6A 5J09A 4HJ0D 2Q0ZX 4XMPH 2WB1A 2VXTL 1GGCL 1FAFA 2B45X 3F7YA 1GIGH 2FSEB 3GXMA 2BU9A 2CLVB 2PR4H 5C0JA 1VQ5V 4XTRD 1YYLH 1OAZL 1NUNB 1T22B 3NDZE 3QIUA 4YC2C 1VLNA 5TF0A 3BIEA 3II3A 4G6ML 3STZA 4WBNB 4ABVA 4D3CH 1FNZA 1QF3A 3Q8CA 4AQAA 3VBUC 1N1YA 4PJ8B 4C0HA 4N8PA 5CLZA 4I2OA 4CDQC 3HFML 2O6CA 5DMGD 3VFWA 4ZOLB 3I6LE 2JDZA 3FTSA 3T65A 5I8OH 3OPWA 4LRNL 1K5WA 2Q2LA 2ARJB 2FYYA 4Y2NA 1CJDA 2FBOJ 1HR0B 3ZXFA 3B34A 5DJ0B 5B1BB 4AUYA 5I0ZA 3U7WH 4UBGA 1K4DA 5HI5D 3G5VA 4QRPB 3J7LA 3RQ0A 4CEWB 4P2OD 4LR4A 2ZONA 2RR11 2EDNA 5JOZA 4TVPH 2GC2A 3HI6L 2R0FA 1BA9A 5DJYA 2LW1A 2NW3A 4IU3B 2EECA 4JFHE 4WFED 3TO4A 1E8YA 4XMIA 3DUHA 3V7AG 1N34O 1N0NA 4P46A 3BN6A 4PJ5D 2FQDA 3POGA 5LNEA 2FL5B 2E59A 4XPAL 2WZ6A 4YQXL 1SVCP 3HT1A 3BPOB 5MENE 1P2CA 3VRIA 3GZUC 1DQ4A 1Z5LA 1H9PA 4OCWL 2NQCA 3O3UN 1E27A 3KF5A 5A32B 3HZMB 4NCDA 1AJ7L 4JR9L 4GQ7A 2G5BA 4XNMA 4MGSA 3RGVC 3JBG3 3KL5A 4PIXA 3RWHB 2N1TE 3HE7A 2WKOF 1AVAA 3JTTB 3NA9L 3WENA 3VHNA 1INDL 5KSBE 4G7VH 1ZRUA 3QXDB 4CUCA 4YM2A 5JXJA 2WFF2 2PAKA 2ITDC 3CBKB 4K1YA 3GXTA 4L29B 4KX9A 2OJEB 1R1BA 4NQCD 4P2QD 3MLPA 3RVUC 4NQUA 3L3DA 4PQQA 4I18A 3TN0B 1PZBA 5BUPA 1PW3A 2ZUQC 5HVWA 3CXHF 2MCMA 2WZ0A 4LLFA 5C5TA 1NU1H 1M2VA 1VERA 2V9UA 2MPAL 4DVBA 4HUMB 2IGLA 8CGTA 4PRIA 4I77H 4JCWA 1U97A 2XMLA 3OOXA 5GZDA 5KS9B 2MNWA 4Y19B 4CXXA 4MAUL 3P4MA 3KB5A 4NDMA 1PNLA 1VBB2 4P3CH 3TEYA 4AHWA 5KXEA 4LLUA 2VMHA 2B1IA 4D0QA 1Q9OB 4RGAA 4MD4A 1KYOK 3AC0A 3MNWA 5CB4B 4JE0A 4HULB 1UU6A 2SBAA 2BTOA 1MQ8A 4JMNA 4TV8B 2P9RA 3H1IH 4FMKA 5ANQA 1BQRA 2QZ5A 3MHHC 1N33O 1HHGA 4U1KA 5FXCH 1I85A 1IIKA 5L8KB 4UBHA 3K5NA 2KDYA 2XJUA 3NRPA 1DVYA 3CZGA 3IMRA 1W8NA 5EOTB 3AYDA 3GBDA 3L3IB 3ZDVA 2J1TA 2FWUA 4JY6A 5FM8A 1T1XB 4JY4A 4F3FB 1UL9A 1JHKL 3KD4A 1QJX2 1IAIL 3LNFA 2GYSA 4JRWA 3W9EA 2D8KA 4BWTA 3PMEA 3DMMB 2C1PA 3I5DA 4GEIA 4L92A 1R3JC 1QR1B 5FO2A 3J07A 1WA6X 5C0BA 5EHFA 1XYNA 5AUMA 2WIIB 4XFFA 3ES6A 3RGVD 4IUGA 3ILFA 3O0WA 1JVLA 1J1TA 4YGVB 1VBE3 1NM9A 1YEDB 3GMRA 4OLZL 4AM0Q 1L9RA 5BXFB 2WXMA 3OUIA 4UIKH 5FOJB 4LO4B 2D73A 5I1GL 4X6DB 2ZNXA 5T5FA 2DAVA 1M4WA 5E8DH 2BH0A 3ETEA 1BZ9A 1AP6A 2VN7A 1OGPA 4JJHA 4MSWB 3LNHA 3VD4A 2VLRB 4Y4HB 5HP5A 5FK7A 3EYUL 1S5JA 4TT3G 4LBAA 4NZJA 5BVPL 3PNAA 2AEIT 2VS0A 2FHBA 3FDWA 4WFEE 2DM2A 4E5XA 2AQNA 5KR7A 1WK0A 3IN2A 1KU9A 3V10A 4O4IA 3S5LG 2MOQA 2AEPH 1CGTA 5IE9A 4OZGF 1QJY2 1VJ2A 4OFYD 4H0IA 1T0MA 3QHFH 1U8MB 4QHKI 1N26A 1OQOA 3HC4H 3LV3B 2WT2A 4PAZA 4ZMVA 4D8MA 1BMGA 4R4XA 2Q8DA 4NZ8A 1VRH2 3RWGB 3EOYG 5JHDB 3BCDA 4GH7B 5IROC 3MDPA 4AL9A 4MXVF 1KEXA 4FM2A 4GXVH 3ZL4H 5L3DA 1OF2A 3UTTD 2KERA 5DC0A 1WJ3A 4A2LA 3DIFA 4A39A 3S98A 4P5HA 5AFBA 4N0FA 3MR9A 5ADOH 5AZEL 1OIOA 4FABL 4I1RA 3VQVA 2B5HA 3TA4D 3PURA 4NAJA 4MUVA 3HNVH 4KQ4H 1DVFC 1UT9A 4AZUA 3J2PA 4A04A 1U92A 3T6VA 4YHOH 5LWYH 2LUWA 4I0BA 5EN2A 4C7UA 1NC2D 2C1OA 2D7OA 2XJLA 3BQUA 3MMEA 4ETYA 5TSWA 4Y4KA 4BH7B 5IVFA 3TFKC 5IVXB 4RGMC 3L3JA 1JYNA 3H50A 5I0TA 4XMWA 2JEXA 1C5DA 3CXHK 3RHWF 3ZE1B 5D7EA 1MVYA 1XGPA 3N42F 1WBXB 4NSKA 1T04A 1WSST 4GBXA 1JVOA 5FW7A 1NMCB 2JKSA 4HCRL 2IANE 2H32A 3L1OH 3O8XC 4P2RB 3ZJAA 4AI7A 5INDB 2ZABA 5FYIA 1AGDA 4UV9A 2WO3B 3F2ZA 4U3HA 2DMKA 1HQ4B 3K7UA 4JFZL 5JZGA 4V2CB 2E6QA 4JFDB 2E9BA 4M6ML 2EILB 2C8NA 2DY2A 3B5HA 4B41A 3DF0A 5EC2C 4D7BA 2J6WA 5J9PB 5CU1A 1BLNA 2JI2A 2BVOB 4TF4A 2CGPA 2J21A 4BFKA 3WP4A 2ZM6B 1CAVB 5A7WB 4PG9B 5LBGA 3B2VH 1UFUA 2XN9E 4GKJO 5ISZA 3T8XB 1R1ZA 2ZGKA 2ZMNA 3JD71 3RPIA 5F88B 3WMSA 4META 4N0YL 3DVIA 5K33A 4Q6YA 4L18A 4LSQL 2WKKA 3HR5A 2CU9A 4FYRA 4KNUA 1G1YA 2JSFA 2TAAA 3X2QB 1AO7B 4BWWA 5JQHC 4H2AA 1G1XB 3ZDXE 4Z7VF 5IROD 4F20A 2XQ0A 4R6ZA 1DSWA 2BTQA 3AS0A 1F3JB 1GHFL 1UMHA 1AJOA 3RW0A 3ML9A 2CBMA 4J8QA 1DFQA 1M71B 3LFMA 3C7GA 4COUA 3ML8A 3FCUB 3BABA 5SV5A 1W72B 1ND3B 3SZ6A 1NGQH 3GIZH 3F7YC 1FBIH 1MFEH 2RM22 3AL5A 4Y4RA 1E67A 2OMTB 3CJXA 3CC5B 4M0HA 3KVDD 5EYPA 3ZTDC 3TFKD 3QIUC 3ON7A 4W9KC 2OYZA 3G9VA 4LA2A 5BNOA 1RB8G 4ZFQA 3RJOA 3STZC 3JV4B 4M93C 5EU6A 1KQRA 4UYPA 2YPLE 4NQDB 2AEWA 2G3XA 3O41B 5AC93 2DJ4A 1KGYE 3SODB 3L3HA 3QRFM 2FD6L 2DYSC 3V0BB 4AEFA 4F37K 1T3FB 4AGLA 3ESOA 1ZRRA 3FAWA 1KV3A 1QI3A 1R5VB 3ATFA 4IEWA 1PGRB 5KYWA 1RPKA 2ZXCA 3MBWB 1LK2A 4CMHB 1OGAE 3JWNC 4F7KA 5LY2A 1PD0A 5FLIA 4U6YB 5C08E 2AANA 2I60L 1K4DC 1RIRA 1R1CA 5E2WL 3GSNH 3KL0A 2K6YA 4KXCA 5ENWB 5C07D 1MCJA 4FEMA 4NO5A 4FPYA 1JCKA 2YN5A 3ERXA 1W16A 1NLRA 2VBBA 5DZFA 5GZFA 1ZSDB 2ZPKL 4HJJH 4CP9B 3K5MA 1DVXA 4XMLL 1HCZA 4YR6A 3GMMB 3WO4C 4ODTH 3C6SB 5CCGE 1TG7A 3DV6B 3TO4C 2R16A 5C3QA 3MC0A 4DW0A 1LDSA 1A7PH 1LWJA 4P46C 2Q67A 4FZEL 4JV5B 4UTBH 5GRXG 1UY1A 4XFIA 4FFVC 5JIDA 4E27A 2QJ1A 4O2EA 3RHWK 3D0VB 3QDJB 1A9EA 4ZUTB 3Q05A 1WD3A 4ZAKB 3RYCB 1CGSL 2YEZA 3H53A 4H26A 5E9DD 4Z0XB 3OG4B 3X3GH 2ESVE 1O5UA 3VG9C 4PA3A 2XPZA 3F7VB 4C4UA 1BKZA 1D4M1 4JYBA 4IRZA 5GIRA 1HRV2 4TULL 3TH3T 3AVEA 1REIA 3LS5H 4B3TO 4JFPA 4G3YH 3HE7C 1HS6A 1TEGA 3I6KA 3CMOH 4L4VB 4APQA 1RUJ3 4U1SA 3WFBL 3GHNA 4NKDB 4PJCF 3VYOA 1LO3H 5GGSB 9CGTA 1K2DA 4Z7IA 3Q06A 1Q8QA 3RIFK 2M26A 2BVTA 3GZOA 4HWZA 3GHBH 2DYRC 4PP2A 3QEUB 4ZMWA 4DPCX 3ULVF 4COZA 5IG7A 3Q5OA 4CVZB 1LYQA 4QJFB 1AKPA 5IYYA 1MLBB 4Y2DA 4I18C 5CGYC 2ZR3A 4E41B 3Q6FB 4FN0A 3A4UA 4IKNA 1N6UA 1W05A 1TVBB 4UI2A 4AJVA 2VTXA 3OPZA 1GCYA 3F83A 3AXDA 4NNPH 3LH2H 4YSFA 5KTEL 1T7VA 4K7FB 4R90H 3CBJB 1YNAA 2Y4SA 3R1GH 2QQKA 3I2HA 1AH1A 3ZYHA 2OMUA 3I02B 5EZIH 5T1DL 2YSSA 4WUUA 4AHZA 1GKEA 1CAXA 4HGWB 1QBZA 1XFPA 2SLIA 3AB0A 1D2DA 1G9BA 5BQ7B 4NHCL 4AQ1A 4GD4A 3V4VB 2FNBA 4LQ1A 5E8NA 2Z92B 4XZ4A 3ZK0A 3EH3B 3S3XA 1I85C 3DRQB 4R6UA 3U1SL 4YHNA 3WIFA 3WL9B 4BFNA 2CDFA 1G7LB 3JCZA 4CADA 4EKWA 3KPMB 5L6YH 4I4TA 1I9JL 1Y6KR 2YUWA 3PJSA 1Z32X 4ENZA 2AABH 4W9FC 5GONA 3D0JA 3U78A 4NXNB 1UATA 1XWVA 4WJG3 1T7ZA 3RBSA 1S2BA 1BQSA 2Y7NA 1GJIA 3TO4D 2VRZA 2CWRA 1G9HA 4AV5A 3ULUE 3VI3A 4HZAA 2EF6A 3M3OA 2VDLL 2WNVA 4P46D 1K33A 1WW7A 5TF1L 3FE5A 5KXCA 1TZGL 2ET1A 4LK7A 4FFVD 4AQYB 2R073 1EQWA 2GC7C 4K5PA 4WK0B 3SDXA 3CFIC 3U0WL 3FUHA 3BAEH 1AL22 4FLXA 1YPZA 1B0IA 3CSFA 3T3PF 4LOEA 1A3RL 4X8JA 2Q5ZA 3N2GB 1UOJA 4GJZA 5M7QA 1WFIA 2ZXQA 1F97A 1BQKA 1MCOH 1JNHB 1UA6L 2KQNA 2H1PH 2VM4A 4K8RH 4HSQA 4Y5YB 3HE7D 5T5FL 3ZKYA 1E5RA 2DTSA 2BO0A 1UD4A 5CR1A 5AOZA 3WEZA 1VGKB 2BVUA 5GZOC 2DM4A 3MHZA 4A7GF 1KT2B 1ZL8B 3FQNA 5KEZA 4YZ2A 3ZKXB 3SJVA 3WEBA 3PF2A 3RZGA 2OSLA 2VC2B 2I9TB 1Y9MA 4FLQA 4NIHA 2QMJA 4FQCH 4PS7A 4RGGA 5D7JB 2PUQT 3AABA 2GH8A 5F1OB 4OUUA 4P5MA 5CGYD 4LO5B 2Z7WA 5D5ME 3VD7A 2P5EB 5DMKB 1HRI1 1QXPA 2QGBA 2WNXA 2BC4B 1KBPA 3IMUA 1CVNA 4QD2A 2JDIG 5INCA 3Q4HA 4PRID 3KGTA 4G6FD 3VBFA 4JLRB 3MF9A 4XJ9A 1SEBA 2HT2C 1HE7A 2CA4A 5KA5A 3L1FA 3LSUA 3APBA 3ZRVA 2AS5M 5D7HA 2X4OA 4MAZA 1IU1A 1I9IL 5FAAA 2IH1B 4F8TA 1PQZB 3L9EA 4Z7QE 5BNXD 3INAA 1XBDA 1MG3C 4TM9A 1LUWA 3LN4A 4KGGA 2FO1A 2B0SH 2P34A 3REVB 2BSEA 2GK2A 1K3IA 2X3BA 5KXDA 2C6SA 1WCQA 5DZ9A 1AROP 5HDBF 4N53A 2C9PA 1JTTA 3C3SA 4RFEB 4GW5B 5BMFL 1CFTB 1AIFA 3L3GB 1I8MA 3BQUC 2UXGA 5I1AA 1LD9A 4DO6A 4Y4KC 5FGCE 4IMLB 2R062 3MRRA 3VFGL 2YB7A 4QKFA 1Y67A 4IV3B 4QF1A 5HFMA 4GLXA 5LXGH 1QTSA 4W6YB 3V0FA 1JGIA 4LAQH 4GG6B 3SCGA 3RVTC 3VLBB 3RWDB 1QNWA 4GBXC 1MRCL 3GBMH 5C0BD 5TQ0H 1KJVA 4QO1A 1FAKT 4A66A 2XKPA 1PY4A 4LVNB 2XHNA 5JZGC 2VSMB 4DR5O 3CHRA 4JVPA 1AR91 5LW9A 4NWVA 4P14A 4LPYA 1JGVH 1MFUA 5KX5A 3GLAA 4IOFC 2VAAB 4KTDH 4RDQF 1AGCB 4ASKA 3HR6A 1LUVA 4RQPB 4HS6B 4GQZA 5EZOH 2WSKA 2OULB 4KDVA 1YA5A 3O11A 4WU7B 5C8CB 2WSVA 4FHBD 2HHHB 1ZSHA 2F7IA 3IMSA 3SE3A 1C5HA 1ES0B 5FYSA 1OAYH 3GBNL 2GC4C 2YG0A 1J8KA 3SH3A 1XHXA 1XQ8A 3FOLA 5T52A 4F6EA 3I3MA 4EN7B 2AGSA 1T20A 1NXMA 2HT2D 4OD3L 1UO9A 2WZR2 2WS92 1LWRA 4P9PA 2ZICA 3BWSA 3H1ZA 3I50H 5IKCB 1E9QB 3W39A 4LSSL 1CR9H 3NNGA 3O0LA 2H8PA 4NLHA 3LIHA 4DIQA 2Q76B 1UD8A 4GYBA 5J11C 2FMYA 3J27A 1FKAO 1NCJA 4PD4F 3DX4A 3MJGX 4TXWA 4PEEA 2V8LA 1KBWA 4CDUB 2F53D 1X6LA 5HD8C 3UJJH 2P43B 1L1FA 4OF3A 4CTEA 1LTXA 5JUEL 1KB5H 2ZX7A 1HL9A 3DVGA 1N32B 2FCBA 1RGSA 5IFHH 3BTXA 4DK5A 2VLKA 1SM3L 1ZHKA 3BUIA 5FV1L 1B88A 2AJVL 6FABL 2ETWA 5CJBA 4WI4A 4EBQL 1R092 4TLGA 3BQUD 4DO5A 4OHYA 3O1TA 2XTLA 4Y4KD 4BQYA 4A3ZA 5L7XH 2CLRA 3ZRWB 3SO3C 5C9AB 4KRPB 5BNOC 1IIIA 1N10A 5DRZB 4GBXD 2P45B 4U6HA 5E4EC 3IDIA 2EVGA 3CS5A 4N2IA 1D6EB 5CKQA 1F3RB 4QXWA 3ZT6A 4WVWA 1PY9A 3ARQA 1ORQA 2PW1A 3ZJZA 1WQVT 1RK0B 1N4XH 1C16A 2FH6A 3WUZA 1A5FL 4BA6A 1TUPA 5IVNA 4N1EA 3A4AA 3C9NA 3VDAA 3EJYC 4B9FA 5DQ0A 1UD6A 2PLV1 3WY3A 2NX5E 4IOFD 3H1JH 5EUKA 1D0HA 1AC6A 1D7DA 3UK9A 4JJ5B 3GSRB 2AEOA 4WGVB 1K5MB 3FXIC 4A6YB 2X4PA 3I9GH 5FYJH 1DQMH 3T1YB 1IJNA 4H7MA 1UB6A 4ICGA 4WRLA 1B4RA 3FU3A 2GHWB 5BRZA 5CLTA 2UXNA 4L9BA 5ISZD 3S5LB 1NCBH 4PS3A 1MUJA 2XX1A 2YD8A 2A9DA 4GFXA 4GP5B 3AZXA 4M3CF 5I0UA 4K5LA 5DK2A 1UAIA 2IG2L 2EYRB 1DBBH 3KG2A 1E4WH 1SRYA 1UWFA 4J8RB 2VISA 2RMNA 4MDRA 4FQ1L 5CFAA 5EO1B 2AUYA 4NTYA 3DI2B 4U3SA 3BHBA 4Z7WE 4ZFOB 2AK1H 2WBJC 4DQAA 3G6AA 3LZFH 3JZ7A 1Q81W 1ZX3A 3SQBB 4DGVL 4APQC 4XBFA 1B2YA 2R51A 3ATBA 3LFIA 2RMU1 5APAA 3SOBH 5HD8D 4MLSA 1G0XA 2IMMA 3UPCA 1L7LA 4ETQB 3LDBA 3CFDA 3OTFA 4FG6C 1A1NB 1EJ8A 4LZKA 3VMNA 4RSYA 2B5IC 3MRJB 2IPTH 1OAKH 1TU2A 3POHA 4FFYH 1JGDB 3FL7A 3MKKA 4LLWB 2VQ4A 4OCXH 2BHZA 4FHJA 3KPRB 2ZX4A 3OPZL 1CT8B 4QHMB 3CSYB 5CA3A 1W0WA 4Y2DC 2VMGA 4AVJA 3ZEDA 2ZA9A 2G9GA 4YVWB 1UWEH 4CEYA 2KDGA 3DUUA 1KLUA 4A7SA 5EU6D 1JF1A 4PRHB 3K75B 1OD9A 1AR83 2EAEA 4MNQE 4XP5H 5DHVH 5DAPA 2F7PA 4AGVA 1U12A 2B4KA 1JFFB 3L13A 1E8WA 3ABMB 3S97C 3KBFA 5F1IB 5AZ2H 1QLEL 2GMPA 4N5EC 2EUWA 4RMVA 1NPNA 2BSTB 3AB0C 3H7BA 3KPNA 1RMFH 4EO5A 1MAMH 2O1QA 3BI9X 2CUAA 1E5BA 3M7FB 4AQ1C 3EJYD 1QLEC 3NJXA 1F31A 2NY2B 3EUUA 2GAZA 1XREA 4XP4H 4ZXBB 5F8PA 3EBIA 4PD4K 1N8RW 5T3ZL 3ROLA 2HUHA 4DEWA 5IVBA 4HAGA 4FTEA