4PI2A

Crystal structure of particulate methane monooxygenase from methylocystis sp. atcc 49242 (rockwell) soaked in zinc
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
390
structure length
390
Chain Sequence
HGEKSQQAFLRMRTLNWYDVQWSKTTVNVNEEMVLSGKVHVFSAWPQAVANPRVSFLNAGEPGPVLVRTAQFIGEQFAPRSVSLEIGKDYAFSINLRGRRAGRWHVHAQINVEGGGPIIGPGQWIEIKGDMKDFTDPVTLLDGSTVDLEHYGISRVYAWHLPWMAVGAAWIFFWFVRKGIITSYIRVAEGKADDVIGDDDRRIGAIVLALTILATIVGYAVTNSTFPRTIPLQAGLQKPLTPIETEGTVGVGKENVTTELNGGVYKVPGRELTINVKVKNNTSQPLRLGEYTAAGLRFLNPDVFTTKPDFPDYLLADRGLSVDATPIAPGEAKEIVVKIQDARWDIERLSDLAYDTDSQIGGLLFFFSPDGKRYASEIGGPVIPKFVAGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords unknown peptide
publication title Effects of zinc on particulate methane monooxygenase activity and structure.
pubmed doi rcsb
total genus 85
structure length 390
sequence length 390
chains with identical sequence E, I
ec nomenclature ec 1.14.18.3: Methane monooxygenase (particulate).
pdb deposition date 2014-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4pi2A02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 4pi2A03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 4pi2A01
4PI2A 4PHZA 3RFRA 3RGBA 4PI0A 4O65A 3CHXA 1YEWA
chains in the Genus database with same CATH superfamily
2UUAO 3CFIC 4LBEB 2W1QA 2NY2D 3D08A 3E0GA 5AVWB 3WE6A 1TSHA 1H3PH 4P4RA 5CB4A 4OFIA 4I2OA 1T0NA 1ZWIC 2R2HB 2NRDA 1E0OB 4N26A 4AW4A 5AEAA 1QWNA 3C87A 4GKSB 4KVNH 3T2PA 5EBWA 4QT5A 3VFOA 2D98A 1GV9A 4WO4A 3IU3B 4Q6IC 3B01A 1Q43A 1AHWC 5F6LB 2Q86B 2PR4L 3LRSA 4JK0D 3W11C 2RDRA 1VFBB 4FHKA 5A80A 1BD2E 1JD9A 4R4BA 3QEGL 3BSGA 3MRNB 5IJVA 5IVJA 4UILL 4PB0H 1OA2A 3V5DB 4F15B 2EVGA 2X12A 1FN4B 5DJZB 3IAYA 3QB7C 4PJ5B 1JPST 3BI3A 5ANMA 4FAGA 3IJ4A 1XL6A 1V6IA 1RSOA 3MRGB 4IESA 1F2QA 3S97C 4MGKE 5JPMA 5ERWA 1FFPB 1EBOA 2W38A 2CLZB 1ET5A 4PSRA 2VXQL 1N67A 4EQ3A 3SCGA 3I50L 2EDMA 2G9HB 2XWXA 1W8WA 3WDYA 2AFNA 3ZDYB 1Z5YD 2O6FA 3DHJA 4X4ME 3MF6A 2YUVA 1DUYA 4U6XB 3OF1A 3IN2A 1QHQA 2FBRA 1ZJAA 2WFPA 5DQ9B 3G08B 1OSPH 3EMRA 4WQOA 1E9PB 3IPVA 3ULUL 3P3RA 1A6ZB 4LCYA 3IPVB 4F3FB 4UQAA 1Y0LB 1EUUA 3M1CA 3QZNA 4XMKL 1XDCA 4ZPVB 1W2UA 3IIIA 3T6WA 4K1ZA 4Q29A 2FRGP 3D0LB 1JNHA 3L1GA 2EKJA 2A79B 3EFFB 2JD9A 5TSWA 4LWSA 1R3JB 1P4LB 1YRZA 5KSBB 1LR1A 1DBAH 4HKZB 1VADA 2CR0A 3PL6B 3QDJD 1USZA 4K0OA 2YUAA 2D03H 3KPOB 5DUVA 1JGEA 2FR4B 2V6HA 5DFVD 2VN6A 1E30A 1PK6A 4ZO6A 4HJGB 4DR6O 3RX7A 2BSRB 3PE9A 3SITA 1E8ZA 3DX0A 1MIML 3S4SG 3G67A 3ARFD 1QJZA 1JSYA 2D3PA 1F4NA 4F8PA 3FLTA 2Z4FA 1TZOA 4AAXA 2Y7LA 4CS2A 4LNRB 4PRNA 3P3UA 3RVXD 2EH7L 2VVEA 3DF0A 2UZYB 1ED3A 1G9DA 4AW7A 1KJ3L 2DMBA 2EXYC 5K39B 1CONA 2MKWA 4X1YA 2NR6C 2QHRL 3GS0A 3B7SA 3MLWH 4M4PA 2ZKNA 4FZ0A 1M7UA 2IWGA 3DVNA 3MLTA 5LDUA 4K94L 1PDKB 4LF5O 1KDJA 1M2VA 3MJ8A 1GKOA 4ONHB 1B4LA 1L4IA 3C5ZC 5E2JA 2YAHA 4DEWA 4LSDA 3DX9B 4WKXA 1U95A 5E1AA 2F53B 3GF8A 1C57A 1JGUL 1LOGA 4W50A 4Y1VA 5E8PA 1Z9OA 3VI4F 1HB3A 1D2SA 4NHLA 2C0ZA 3QOPA 3ECQA 2YJLA 3ECVA 3VQ2C 2VXQH 2C9VA 4M48L 3H6AA 2PP7A 5F5CA 1WAZA 2JK5B 3I2FA 5DDJ3 5HVHB 5I5RA 3GB7A 3REWB 3ZFGB 2XLAA 4QY8A 5ID1A 4X4YA 1MIEH 1YHQV 1I7UB 3I9IA 5AB2A 1AO7B 1HZHH 4B3MB 2R4SL 4MB1A 3S3PA 4F7TB 1QJEA 2A9NH 1LR5A 2Y6SC 1LL1A 3DI3B 4PJIE 1XQ8A 1OTSC 4M5YL 4XP1H 4TMPA 3VNZA 2BGCA 4PF5A 1D9KD 3BA8A 1AJQA 1AR63 1IGFL 1JNNL 1WIOA 8PAZA 1I4FB 4LGPB 4JQXA 3B2UD 3VI4E 5K1XA 2AVFA 5GJSH 2Q0AA 4FFZH 1A22B 5CEXA 4ODVH 4IOFD 5ENWB 3U0WH 2IXQB 1HCZA 1BHBA 2VDPB 4DV6B 1JGVL 2KC0A 5I23A 3GSOA 3WNMA 1BVKB 2JCCA 4WK4B 4M1CC 2AQSA 4PJAB 1XH0A 1PM4A 4OHYA 1LAJA 1CIYA 4RMVA 1KJ3H 3GXMA 4PJXE 3IU4H 4PBXA 4PGDA 1VFOA 5EC2B 4CVZB 1S4CA 4KJPC 4FLWA 4URTB 3P4OA 4TQPA 3F7LA 1SMAA 1YNTF 3B56A 3HZYA 4NQCB 1JUIA 4OCMC 1W6MA 3QEQE 4QYAA 4CA9A 3VZMA 1I8IB 1A1MA 1HRI3 3KCXA 2JGDA 4J39A 2Q8CA 3KHCA 4XF1A 1KCSL 1F3JB 1LD9A 1X9LA 2ZABA 1FE8L 3CCEV 1KBBA 2J8UB 3US9A 2EXJA 2XQBH 2XN1A 3HE7C 4EZKA 1HHJA 1DSFH 2W95A 1CWPA 5DD5L 4YDIL 1A5FL 2VUOA 3CFBA 4ISVA 5ELIA 2X6AA 2VLKB 3MMEB 4H8WC 1MS9A 2QKIB 4D94A 3WHUA 5F7DA 4LLDB 4P5KA 4IDJH 4LA3A 2CRIA 4HSCX 3I97A 3I3EA 5K7PA 1F4YH 1YTFB 2R4SH 4HA1A 4MAYB 4E9QA 4PP2A 5EU7E 3I6GB 1YLBB 3QNYB 4M1GL 1B3JA 1KEML 2X2IA 4M3CE 3CCJV 1S7WA 4R5XA 4PJCF 5EU3A 4YDLB 4EI6A 4HIHB 1A4BA 1Y1UA 3QZBA 1C8PA 1BAGA 2A3TA 3AXLB 3MV8B 3RBGA 4OCYH 4WZFA 4TNEA 5D96C 4QB2A 3U0TA 1IAIM 3SPVA 4C83A 3T3YA 1W28A 2JJ1G 5LBQA 3T1HO 1VQMV 5FGCE 2P4EA 2A1XA 4AIEA 2C9PA 1XDTT 1JXFA 2Z4QB 2WR9A 4M43L 4HBCL 3VQMA 3BHBB 4W4NA 3ZHFA 3RJRA 2GJZB 1GM7A 4NM4H 2F2HA 3I2JA 4DR5B 5F3BA 2P34A 2YSTA 1JGVH 1JI2A 3SCMB 1JXJA 1T5XA 4TTDC 1BGXH 1W8NA 1OCRB 1LO2H 3WCRA 2WCPA 1DBJH 1FORH 1QRND 3SE8H 3K03A 1J8KA 4FXGB 2BNMA 3CZEA 2ID5A 3QRLA 1HQ4A 4LBEC 4E2LA 1XTLA 4MCZA 1XYOA 5K0UB 3HHSA 1PKOA 4GG6E 1IGYA 3ZL1A 1N33O 2A6WA 5HDBB 1Q81W 2PYJA 2XTJC 1N36O 4PCKA 2ZX7A 3O6ML 2BMKA 1C16A 2YBRB 4PJCE 4B9IA 5LHGA 5IMLA 2W6JG 1VP7A 1HKDA 1A25A 3FUEA 2AC1A 2VW1A 4KDTA 4BPZA 1FE8H 3PGDB 4JB9L 3DUSA 3VH8G 1YFYA 4IMKC 4QX8A 3ZZLA 2W3JA 4S2FA 5FYZA 5IVVA 1P7BA 2HLFD 3VRIB 3ZYGA 4RH4A 2FTAA 1KB5H 4LBAA 3BSHA 5ISZA 4Q5OA 1G9FA 1CGTA 1PL0A 3T9WA 3ZBHA 4XAKD 5C8CC 1Q1PA 3BD4A 3CLEL 2ZF8A 2B42B 3HNYM 1X4XA 2KLRA 3UJJL 4DGWC 4N53A 4X6BA 1IPKA 1QCEA 2ILLA 3BH8B 4NZFA 5CISA 1SZNA 2DEYX 1T4KA 3EH1A 3KPSB 5GSVA 3GWKC 3WHE1 3I59B 1TU2A 2VW0A 4RFEB 1YUKB 4TOYL 1NCNA 3BD5A 1H8EG 3K2UH 1XNCA 1TJHL 4TM9A 1QQP3 2D6LX 3FZUD 1F35A 4IEYA 5I6KA 2FAUA 3QFJB 3H1JH 3SDCA 5DCCA 4DUZO 4OX9O 4LHSA 3JZYA 4IEWA 5JPNC 4HK3J 3RWEB 5FWJA 1BOGB 3CH1B 3A6BL 3L4TA 2ZUSA 4H8WL 5FYJE 4Y4FD 5FFOC 1C1FA 2WSUA 2Q0OC 3H3UA 1F8VA 5GSRB 4A7SA 1R3JC 2SBAA 1E5AA 4GW5B 4JRYD 4S1DD 4WK0B 4NI6A 3TA3A 3PL6C 3J7NA 4ZOLB 2XQYK 3ZYPA 1OTTD 1S9VA 2QFPA 2Q6WA 4Z77A 3FQ2A 4HL0A 3CC1A 1DQIA 3N04A 1ADQH 3PGCB 4Z7WF 4X9YA 1ALYA 3CJIC 2MEV2 4Y7OC 1PIFA 4TVPL 3DV8A 4BIFA 3QBQA 1VZGA 1VJ2A 1UWGL 1J5CA 3V4PH 1V54B 2NNAB 3OPUA 3MRHA 3USSA 2YXLA 3WGVB 4X1KA 1HXMB 3RUGF 3FQUA 4TRPL 1HSBB 1IKNC 5FCUH 3ROLB 3DROA 1EFXB 3NA9H 3QIBB 4H20H 3VMOA 4BEIA 4J25A 1X7SA 5E5MA 5DUUA 4FTEA 3ZQWA 4O4LA 5D7IF 3RZWA 5LQBL 5FY1A 1UASA 2EJ1A 2BW8A 2P3YA 5J98B 4M62H 2R2EB 1I1RA 2VDML 2ZX1A 1VQOV 3ZQXA 4YGVB 3B6SB 4PRPA 3ZL4L 3BPOB 1KWGA 1GNHA 3VZNA 4K8ZA 2H9GA 1I3RB 1ZUQA 3NRPA 3PFQA 4DQAA 5FZ1A 4Z7WE 1KIUB 4L0YA 1FL5B 2DYSC 3KGSA 3R65A 1BZ7A 3FHAA 1ZLWK 3QUZC 3WY1A 4QI3A 2GALA 2P8MA 2W0KA 3V4VA 2P5WA 4LCWA 1U8LA 5PAZA 4BZ4A 2NX5B 2OXBA 3MLXH 3WJJA 1FIGL 1T2QH 5FA3B 3U75A 2LV4A 5HVHC 3GGWA 2AEYA 3HN3A 3BN6A 5FZFA 5CADA 4JQTA 1J0JA 4MA3A 3CS5A 3HC0B 4KKAD 4NENA 3RPKA 3T6ZA 4YH6A 3N06B 2Z93B 5GTIZ 4Q1RA 1YYMH 1B6UA 3MODL 3FFDA 4EOWH 2PTVA 3S7GA 5A7OA 3ABTA 2RHEA 3VBSC 3ALPA 2XXFA 2WLIB 4U1JB 1RUPH 4Z0XA 5A2KH 3FRPA 3GQFA 2LGQA 3QBTB 5HJ3A 1CBJA 2AXFB 3DX2A 3O2DH 4EVNA 4AZ8B 4KWKA 2MTAA 3FRUA 4KMLB 5FYUA 3LNFA 3HRPA 4BKLA 1FATA 3HKDA 5DYOA 5HYQA 5D7KD 2IDUA 4YZ3A 3EYVA 1PMIA 4O61A 3HKEB 2WLQA 3MJ7B 3RL2B 2ZONA 1WB8A 2AGAA 4TLSA 4HQQH 2GT9B 4MVBD 5AW1B 2G3XA 1AQMA 3G6JB 1JYXA 2EUWA 2AZ0A 1JHKH 2LW8A 2YFNA 4I5SA 1NCHA 4K40A 3L9JT 1C08B 3QUYA 3QDGA 3WP5A 4I4TA 4BE3A 3AG4B 1E5UI 5KVFE 5C08A 4KV5E 5CCHE 1OQEA 3HCVA 5DUBB 4AE1A 1ULDA 3FT3B 3VSUA 4OGAD 3N7LA 3JVGA 3OGIB 3TJEH 2NY2C 3NAPB 1BLNB 2VDMH 3JZ7A 1TCRA 1U8CA 5L7OB 2YIBA 3ZL4H 3IFOA 1NA1C 2ZP0T 3E6CC 3R06A 2ADIA 3QFGA 2B1GA 3U2IA 3RWGA 1FRGH 2X53A 4IUGA 1O9ZA 5J5EA 3VBRC 2EKSB 1SVZA 4NT6B 5ID0A 4IRSB 1QBMH 2O5XL 4QX1A 4K73A 3JWOH 4DXWA 2C3VB 1MCFA 4NKOB 2MEV1 2QKIC 1DQQA 3EH3B 5DAPA 1FIGH 3NNFA 3OGCC 2VLRD 2FB4H 1WFJA 1JZDC 2DLIA 4ZS6D 1CD9B 3LN5B 4L1LA 3ARXA 5C0CB 1M7IB 2YWZA 4ESKA 3FQRA 4TTGA 1CU4L 3WNIA 2CD0A 2YMXH 3E8UL 4LDLB 3L4ZA 5F97E 4QE7A 4J9ZB 1XMEB 4MD5A 4LSRL 2APVA 3RY6C 5GRVK 2WSDA 1VPHA 1SF5A 1XNQB 1J5OH 1VF5B 4OCWL 4TLGA 3ZX6A 2XG5B 4XGZB 2XAQA 3ATFA 2H32B 5DMGD 2XBZA 4A2FA 3LF7A 4ISQA 5FC9A 1G5AA 1WTGT 5D5MB 1JD7A 4DKAA 5HSFA 1AZBA 4HPKA 2QKSA 5F7MC 3BAJA 4J3VA 1GZ9A 2MPAL 1RJZB 2J6EA 2UZPA 4XHQA 3D6GA 1X4TA 3CHPA 3OR7A 4KVCH 4NZUH 4CU9A 1GZWA 2Z8SA 4D6RA 2MOQA 4RQQA 1KDMA 2DLGA 2Z5UA 4YW2A 4AC4A 2PMZA 3T0EE 4RAUA 3HC4L 4N8VB 4JTDB 3A3YB 3C6SB 4MJHA 4F8AA 2VN4A 1MLCA 3D07A 4IV3A 2X0VA 1HQNA 1Z66A 3ZXKA 1Q72L 5DFVC 2Y6TE 4XNUH 3VXUB 3MYXA 5JSPA 1TKWB 5ITBH 4YNYA 5D93B 4MNQB 1TUBB 3T3ME 4BXSV 4HEPG 1BYPA 4NUGL 1E27B 3ARFC 3WCYA 3QUMA 1OLZA 2X44D 2R30A 2NNUA 1QOKA 1U3HB 1O5DT 3ARDD 5IQ9A 4URKA 1KY7A 2YGPA 3RVXC 3WQ1A 4BFIA 1RZ7H 2IQ9H 4AHYA 3SKOB 4U1KB 1EN4A 2UXDB 4BSVA 2R0KH 2VDPL 3CC5B 4LESA 4ZZFA 1AX0A 4BH7B 1DBKL 1LM8V 5C0AD 1N9PA 1FZKA 1JUHA 4Q26A 3HBQA 1EHAA 3M7AA 5J48A 1MJ7L 4LDOB 3QYCA 3FDWA 4QMEA 5D7HA 1F97A 4PRHA 4WSGA 4YLBA 5DRWA 2UZXA 2CM5A 4JASA 2ZNWA 5JA8B 1CU4H 5JQGB 3CX5J 3FMGA 3TESA 3IJSB 4W9GC 4HD9A 5AWNL 4CN4A 2VLJE 1T03L 5E03A 4QXTB 1TMF2 4ICXA 1J95A 5E6YA 4S2GA 4P23B 2A6YA 4A04A 2CHHA 4L18A 1OI6A 2OAAA 1UXMA 4H1LA 3IFPA 4OIBA 4AKQA 3ZDSA 2FB5A 4E4EA 1G9AA 1LHZA 3VXSB 4K3GA 1F90H 3N1FC 2XJSA 1K4CA 4UAOB 4W9KC 1COV2 3QZWB 3ZT6A 3P9LB 5CA3A 1R6NA 1IEAB 4MZUA 5HGDA 1QI4A 4MJJA 2OI9B 4PCSA 2EDDA 3TPUB 1PX3A 3FO0H 4OF8A 3LS4L 4J6RL 3RQ0A 4NBYB 3ZKUA 2IMNA 4I0WB 1V54C 3OTFA 3SOBL 4FLUA 2R49A 1BCXA 3RFRA 2AXHA 4IE6A 1YFXA 4DQOL 2B0SH 3CMEV 3LRGA 4MMXC 3B2UC 3EO0B 4QEGA 3ETQA 5TDNA 5IB5A 4J3SA 1GYAA 1XCWA 3EJZD 3T77A 3GO1L 1AJ7L 1TENA 4IOFC 4L4VD 3UMTA 2RS12 3QRGL 5E4OA 1J1TA 1UXWA 3NSXA 1QU0A 1Q5OA 3VBBA 3FU7B 4MGTA 4Z7OE 1Y43B 4Y1YA 1H2GA 1F6AB 3GXPA 2IVIB 1GZHC 4NSKB 4DP9X 5IEKA 5ALBH 1R33A 4XIOA 5G55A 3FH8A 1T4WA 3CH8A 3O8XB 1HIMH 1NFAA 2A77H 2AC0A 1CFSB 2VDPH 2W1NA 4YXLH 4K23H 1TCMA 4INDA 1BCCH 2A06H 4XO3A 2OMWB 4FQHA 2WO2A 3VXQA 3BPOC 4YW4A 1PMYA 3LNDA 3ULUE 4NR1A 4BUHA 1N5YH 1KKDA 1RL1A 4F2MA 1H0DA 1YZZA 5HHNA 5KVDL 5K1NA 4Y19B 3OXRA 3VFGL 1UY3A 5E70A 2FDIA 2VN7A 4Y4KD 2EEBA 1OALA 4QD2E 1ETA1 2F43G 5I8KH 2J88L 2FCUA 1GC1C 3LH8A 1A6AB 4X80L 4Q9BA 3V6ZB 2DVFA 3PV6A 1RJYB 4FQ1L 4PHXA 5DK0B 3LEMA 5CG8A 3IBEA 1NFDA 3AREB 3KCYA 5E0QA 1IDSA 4WV1B 5B39B 3SJVB 4MB3A 2R29A 4BKSC 1T7ZA 4K07A 4UI2A 2OL3H 2ZUUA 5ESAA 4AGOA 4UCUA 5J6HB 5D1XD 3OLGA 5BNQA 3VCLB 1UF2C 4B3MO 4P08A 2CJTA 4U3CA 1KUMA 3IGAA 3CZUB 2VTXA 4JHTA 4DV7O 3FU8A 4O2BB 2WVVB 2Q8BH 4NPJA 3JAKA 3NJJA 3U2JA 5FZAA 5AD0A 4P9ML 4WO4D 5DD0L 1F3DJ 2PO6A 1BZKA 1RPUA 4IW3A 1N12A 2DBJA 4K7PL 5DLML 5ANNA 5BV6A 2DCYA 2V3EA 3A67H 3J81N 2BERA 3RNQB 3VM7A 1ML0A 3OUSA 4JYBA 3GO1H 5GGSA 3LIZL 2XACC 1D5ZB 4AUYA 4L0ZA 3NP3A 3ARBB 4YR6A 4XZ4A 3KYMA 1OKQA 1UZWA 4G72B 1WLTA 3LZRA 4P2QA 1CLOL 1VEOA 4GEIA 4DV6O 4YDVA 1JMUB 1TMF1 4BK5C 5FYTA 4G42A 5EF0A 5I9QB 1DF5A 2FD8A 3JSSA 3TEYA 3ZO0A 3EHBB 3NAPC 2NTFB 1FV1A 1NAEA 4X1IB 4UF0B 3IGUA 5EUOA 1XO8A 3N2GA 2F54E 4L3EA 3QWRD 5SWQA 4KG0A 1I3VA 2YK1L 4R8CA 3I56V 2E7QA 1KXGA 5JSOA 2VECA 4GPVA 1COV1 5E88A 2QL1A 1M71B 2ZMLA 4YSOA 3SDDB 1D0HA 4F5CA 5LBCA 3NP4A 2W9LA 1CEZA 5KVDH 1LCLA 5K59F 5T5OA 2G9KA 5GRUL 1YY9D 5D2NA 2N1TE 2ADQB 3ZGIA 3OXSB 1YJLA 1MZZA 2BE3A 1DLFH 2FO4B 2HLFC 4NUMA 4XO5A 2J88H 3RA7L 2OM5A 3TNNB 4CU6A 2I9TA 1EV12 1PVC3 4F7ZA 3HRZA 4BIZA 4AE2A 5GGQH 3HHMA 2R9HD 2FE0A 1MWOA 2ITCA 1K8IA 3JWNC 3RIFF 2J2ZB 5C09E 4YBLC 2K6YA 3WTSA 2RS11 1ND2C 3OJDB 1YEEL 3CCSV 1LO5B 4NZTL 3WIHL 4DFIA 4KWLA 4MHUA 2KT6A 2DVGA 4LL9A 4LCCA 3EOAA 5DRZB 3KWXA 4L97A 2WNGA 4PY8I 2XRAL 3P3PA 1CBVH 4QRBA 1JVOA 3FB5B 1DBML 1GUIA 1GKEA 2WSVA 4LBQD 1P5UB 3O11B 1J59A 3FZUC 5IT2H 1QLEC 4WW1A 4B3VA 2QTEA 3BDYH 2JKNA 2ZGNA 5EOCJ 4IXLA 3MOAL 1GC1L 4G59C 5LNDA 4XBEL 5K59E 3BYWA 4WWKD 3VBFA 3AG1C 3PIQB 2GBVA 1FXVA 1TETH 2PR9A 1YQVL 4Y4FC 5DLMH 3V8OA 4CNIA 2RJLA 2BFVH 1SLWA 3GIZH 1AZDA 5EYYA 4S1DC 3NSTA 4JC1A 1BF8A 3DPRC 2YBPA 4WCYH 3WXPA 1OTTC 3PJSB 2AABL 3UO8B 1BFTA 1SLTA 3UADA 1DQKA 3OAZH 1K2DB 2IDFA 1VEMA 1HAWA 2GI7A 2Z9TA 2O5ZH 3OKOB 2KL6A 3WMSA 1TZHA 3QZMA 1REFA 4JGJA 3VBOB 4G9FA 5KBLA 1AE6L 3ULSB 3VHNA 4FQXA 3UAJA 3EGSB 3WKQA 3JSNA 1O4TA 1YDXA 3WHXA 1MXGA 1AVAA 3MV7E 3K2KA 3O3AB 4TSBL 4JLRB 5FK9A 3TO2B 2J1TA 5HHVH 3VGGA 1G9MC 3U1SH 1I3UA 3LSUA 3GJFA 1U8IA 3LKSA 4QAMB 1ZLZA 4MDRA 1HXS1 3L3HA 2XWTA 5GRUH 3BP7A 3H8NA 3EXJA 3V0EA 4EDWL 1ZAGA 3MAQA 3I6LE 3M7OA 2APBA 1S8DA 4Q20A 2QKCA 5DR5H 1VEPA 1C1EL 1OTUD 4HK0B 1KENL 4RMUA 1SEBA 3DK2A 1W0VB 2A9ML 5JO5B 3EB7A 4PWFA 3STLC 4JFDB 2F5BH 2XTAA 1TDQA 1ZT4B 2KPWA 1C5BL 5FR3A 1IVSA 3HG1B 1NGYA 1X7QB 4JQRA 4DKDC 1RSYA 2DYRB 3V5HB 2VJ0A 1M3IA 4FFBA 2X4PB 5EMYA 5KW9L 1SLCA 4BFJA 4NQVA 1VZIA 1DK1A 1KCRL 3PAYA 2FHRA 2XASA 1KCLA 1GKBA 5CBGA 2OSLA 1W05A 1GVIA 2P6CA 1DBMH 4P05A 3L3IB 1LO3L 2ALAA 3CCUV 3AB0C 2IWGB 4GLRH 4KKAC 5AZ2H 2APFA 4UAOC 3ZDYF 1OGPA 1A8JH 3GBEA 4GH4A 3RIFK 4YX2L 3MOAH 4IOSD 4Y5Z0 2BSKB 4XBEH 4QOKA 1YY8B 1MSWD 4WWID 3NABL 3MLSH 1A34A 4K35A 5TPWL 3ZRCC 5IJ0B 5JIMA 5CLWA 2C9AA 4U7KA 4AMXA 1LP9E 1PKXA 2BSDA 1DVSA 3F7YA 4WVRA 1XFPA 3ZEDA 2H3KA 3V5KA 1KJ2A 5A2CA 2QCSB 4GWNA 2LFEA 5JIDA 2F4LA 5F88A 4MKMA 4UT6L 5EBWB 4ABMA 3DBSA 2DLTA 5DZLA 2LU4A 3J7AU 1DYZA 2G75A 1R5VA 2H4EA 4GI6A 3EJPA 3RWJB 1D6EB 4JM2F 3T6VA 4YFEA 3RDJA 2VQAA 3FCTA 2YKLL 2DBLL 4Y8DC 4Z95L 4Y4HB 2X2YA 4GLXA 1FG9C 1UB5B 4MVBC 4QO1B 4R4BB 5IJVB 2VOXA 4TSBH 1MI5E 4BISA 2D3LA 1I7TA 2RV9A 2X7LA 2LE9A 4IBSA 3SJCC 4MNHB 2OR8A 4PJDA 2PQQA 3PVOA 1LOCA 4NRQA 2EE2A 1B04A 3Q1EA 5FPVA 3VZLA 1N4XH 2AZUA 5LWYH 4OGAC 2AJ3B 5D1QA 5ERWB 3OSKA 3L95B 2QVMA 3L2HA 1QLNA 2I07A 1XB8A 1JL8A 3KBHE 3ZRFC 1IGOA 1UD4A 3PHQB 4KPHH 5L88L 3ILQD 4WI0A 4YWAA 4J80A 3ZSTA 1MRFL 3BH9A 1NQBA 3TA4D 4CAGA 2QM4A 2YIAA 1CD1A 2NY6D 1Q6HA 3E6FA 1JA8A 2AZAA 1AXZA 2JG8B 2JX9A 3VBUC 4LCYB 1X3DA 2F9BT 2P47B 1XE8A 4MJID 1S9YA 3OWEA 3TB0A 2RS51 5FP3A 4M4RA 1JNHB 1G9ML 3D2TA 2KKWA 2PABA 3DK0A 1TVHB 4GRWB 4OZIB 1LULA 2CBTA 3DTUB 1LO3H 4LWSB 4WV1C 4XN7A 5JDSA 2WXRA 3UT5A 2W6IG 3P2DA 1GK9A 1CD0A 4A7VA 4YGEA 4XPFL 4MJ6B 4UT7L 1NCAL 4Y2LA 2R69L 4Q8LA 2H8PC 1AAJA 1WVZA 1WLCA 3BPZA 1UFGA 4IBVA 2Y6GA 4OLEA 4WVZA 5E6IA 2HKHL 3MQIA 3UJQA 3BUYA 4E41E 3CFDB 5LXTB 5DMGC 3RU8H 3WLBB 5AVXB 5F3EA 3QH3B 4PRNB 5FUZH 3WMQA 1M90W 1ED3B 3OOXA 4UT6H 2ICCA 3CZNA 2H32H 4FNUA 5IHUH 2P37A 4B3RB 2PW2B 1PEZA 2OQJA 4I0PD 5ISZD 4P5RA 1FA4A 2QZ2A 1W0WB 5AC92 2J71A 3IWVA 4FG6D 1KN4L 1PKQA 2PXYB 5A7WB 1I85A 3MJ8B 1L7IH 2XTJE 4Y5VB 2BBAA 4RQPA 4MB5A 2ZCKL 4AOCA 1BPLB 3L74H 1MCLA 1DN2A 1U36A 1U95B 1RULL 4S1RH 4MLIA 5FYLD 5KBMA 4A7GA 3IMVA 1MS5A 4JN1H 2CJUL 4QPGB 2BC4A 2G2PA 4MQTB 4XFFA 1RIUL 4ENED 3MJ6A 4RCAA 4FQ2L 4KXRA 1DQ0A 1SMVA 4CP1A 4F1SA 3RJDA 2X3CA 1SDYA 4YSSA 3H9YA 3SDCD 3IFNH 5KSBF 5L4JA 2WKKA 3SDDC 2XG3A 4AR2A 4ZOCA 4L8BB 3OTOB 4QHNB 3F58L 3ZHQA 2K1MA 3ARDC 4PJ5E 4QY8B 5CWSA 3CE1A 4YE4L 2GNTA 5DUJA 3VD1A 2FZ1A 1NLBL 1NGPL 5C6TL 5F7EL 1TMF3 4ZTOL 4M00A 4KXAA 1SZTA 3MNZA 1N32B 2AW9A 25C8H 4U1LB 3ZDYE 5HYIA 1OKOA 4NNXA 3O41B 3S5YA 1XCQA 3HKCA 2ROXA 3WQ7A 1YEDA 4RFNC 5ACZB 2CA4A 1D5NA 3SLIA 2D7FA 3EUUA 2FX9H 1PZBA 1CIDA 2VXSL 2R69H 4A66A 1REEA 1COV3 4GKZA 3LCYA 3WNOA 1QI3A 2EE6A 2WOYA 4PJYA 5IAVA 1CF1A 2QGCA 4RGOH 4HU8A 4DZ8B 1FAYA 4MMZC 3CCMV 5KSBE 5ADOL 2AEOA 2K4WA 2GJPA 2ADPA 3EYSH 4OFVA 1QJU2 4HANA 5TGBB 4XP4L 3FO2B 3GSOB 2J3SA 3QORA 2JCCB 1HJBC 5GLTA 1KCUL 4KUZH 2Q10A 2R4RL 5EEUA 5I1AA 4QQ2A 4FI8A 2Q67A 3O3BB 5BNXD 5IOKA 2X3BA 1RSFA 5IJ9B 4WWPA 4PRPD 4Z7VA 5BZBA 3P4OB 4HAMA 4I88A 5F6HJ 3V4UL 2VQ4A 3N50A 3O65A 2PW1A 4BM7A 2CU5A 2RS13 1K73W 4Z7AA 5A9GA 1MJJA 5C0BA 2ZHNA 3VBOC 1HEZA 4IHOA 1NS1A 3L9BA 1K5MB 4FHJA 4UQCA 1LD9B 2ZGPA 3PAUA 1SRDA 3TASA 3LEKA 1RIUH 3T8VA 4BAYA 1K5SA 1TNFA 3ZYIB 1L9PA 3EJZC 3QNEA 2NY5H 5KMGB 32C2A 3CFBB 4ISVB 4NCC2 4WHYH 5FXCH 4CXWA 1KGCE 2MRYA 5DZAA 1WWWX 5EOQH 4LVHC 5F7DB 3NCWA 3F58H 5I73C 1EJOL 3VB9A 1GSKA 3BQVA 4DKTA 3W7SA 5E08L 1QKZL 4ODXB 3AP9A 3C7OA 5F1IA 3QH7A 2WXOA 3SE4A 5IK3A 5JWPA 4XE5B 4G27B 1Q82W 1HXKA 3S2CA 5H9SA 1U33A 1VAMA 1ECZA 2WSSG 2WXNA 3D18B 3MGTA 4PP2B 4F7PA 4DGVL 3EFFK 2VQEB 5LBSA 1ACXA 1S7WB 4BIOA 2BZDA 5EU3B 3HUJF 4YG3A 1BVP1 2DYRC 2QQNA 5AC91 2ZDIA 4PS4H 4DEPB 2E8ZA 4KRNA 4ZFOL 2DWRA 2E56A 1HWYA 3OAUL 3U0TB 1PFCA 1FYTA 4C83B 5H35A 5KVEL 3LUTB 1AO7E 3MRMA 2VXSH 1NDMA 4FXKC 5F6IB 1RUI2 5J3HD 1P7KA 3J7HA 2DU1A 5EO9A 1CT8A 1I9JL 3FQWA 5T54A 3C9NB 4DERA 4W4LA 1CAXA 1AR83 4BJLA 3QDGD 2PY5A 3P0YH 4ZOBA 5I75B 2IBBA 2LLGA 4K9EC 1T5XB 5C08D 3KEDA 1H6TA 3AXEA 2Y4UA 2UU9B 3GZKA 5GRXG 1OA4A 1UIJA 3QARA 1S7QB 2FWSA 4YY3O 5ETUB 2R1XA 4ORZC 3HHSB 3NCYS 4GAFB 4K3EH 5ESQB 4ABVA 3MBXH 1DJWA 2JDNA 1AANA 4NX0A 1CX1A 2DQTH 2YIBD 4L8SC 5KS9A 4JHUA 4JEGB 3V4UH 1MHEA 5JOFA 1V6MA 3ZN4A 1SQPH 5IHRA 1COBA 4MQSB 1ZZ7A 1YVWA 3SYQA 1QY4A 3V7AE 1C16B 1PFOA 1QBZA 3W56A 5EF1A 4G3YC 1M2OA 3IXTB 4PJAE 2FBOJ 4WO4C 5DXDA 3BEVA 1AJNA 1PS3A 2WLMA 2BP3A 3DUSB 4B27A 2BUKA 3L5HA 3SHRA 1HKLH 4ZXEA 2AK4A 4KK5C 1P53A 3IMUA 4J4PA 1DVTA 4MTOA 4MGIE 4ZK8A 3FAWA 2ZM6B 3O2WH 3SD2A 1E8YA 4WW2B 2IXKA 2QKAA 2OLDA 5F5AA 3K5SA 1KB9F 2Y26A 2J8UE 5JPMC 4MXWB 4G7YH 3PG2A 2X42A 1NZCA 1QJU1 5JTWA 2DLFH 1QASA 4NC2B 1EV13 5IIEA 1E4WL 1TU2B 2HT4D 1BDYA 4LRIA 2VLKE 1H8LA 3VRJB 5BMVA 3K3WA 4ANXA 1Q0EA 4UYQA 1R1A1 4IL6Z 3S8FB 1UU5A 5DI8A 2Y2WA 3JXSA 4JGZB 4JO5A 2GYSA 3TS8A 1YEJH 1I53A 3GK8H 3OAUH 2ZX4A 2QQJA 1YY9C 3L9YA 4HIQA 1ZHBA 4UCVA 1YC61 1NPUA 2VC2H 3OY8B 4CDUB 5HDBF 1CE6A 4KXDA 5L9DH 1TJIL 4R6UA 4XPBL 3TA3B 1CQ9A 2YAOA 3BC9A 1YECH 3GPEA 3QO0A 4OBSA 2R9HC 4U1SB 1S9VB 3KYOB 3TYFA 5GISH 4Z77B 1ASJ2 12E8H 4LFHG 1SCRA 3MV8E 1UOBA 4AYID 4FLVA 2WZEA 1MEXH 1JV5B 4LSPH 3LSQA 4NCC1 1PK6C 1A6TA 4UOW1 1CLZL 2IC2A 4NB5A 4N2MA 4MH0E 1IFGA 2B3IA 1UC6A 4XCCH 1B88A 5C07D 4BUGA 3ZKQD 4QGYA 2X5IA 3AT9A 3VB8A 3ECBA 4GAZA 4AEDA 2ZAAA 1IGCL 1K8AW 3ARSA 3OE7G 4V1DD 4MX3A 5J1XA 2GSMB 1KJVA 4R0LB 4UU9A 4YSQA 4XVHA 4ZG1A 1WE5A 1XZ0B 2VW6A 3BFWA 1Y18B 4HS3A 4WSKA 4Z92B 1IM3A 5JORA 2DKUA 2X2HA 5F7LB 2PWEA 3GBNL 3VFRB 2W5PA 3ESPA 4K3DL 4UXNA 1GAXA 3KPNB 4PRHD 3U30C 3FQTB 4K9EL 5KVDE 3POIA 4HG6B 1ND3A 3J26N 4A7KA 4JR9H 3ESMA 4LITA 1O5UA 4N90D 1RUI1 2UXVA 5E1AC 2WOBA 2OYPA 5B7FA 5AVAA 3BRDA 2A5ZA 2EVFA 1T7VA 4YFDB 5E2VH 4DV2B 4HCRA 4NTYA 4YK4B 5DJ2A 4P9HC 2UXBB 1Q9OA 2P5WB 4LCWB 1XJAA 1ZA4A 2WYFA 4XCYB 2HWD1 1E4WH 3QJHA 1AI5A 2ZR3A 1BP3B 3LHAA 4G3YL 1AGDB 2XJVA 4CCEA 2IFWA 3GB7C 2R15A 5DHYA 3ZDWA 5KYYA 3LDRA 4MA3B 1OM3H 3GJBA 5I1IL 4QKBA 4NENB 1UYWL 4ALAC 3B94A 5DA4A 2P4VA 3J07A 4NKIH 2VMJA 2RACA 4KJWD 2ZQMA 2WZAA 1KB9K 3FFDB 3O4OB 5AQ0A 5JDJA 5KBNC 1MW2A 1W2TA 3M86A 4ZMOA 1DSYA 2E9WA 1VQNV 5DYFA 1OTUC 4Z0XB 5IP4A 5FYKD 2GC1A 2YU1A 3FRPB 3NMBA 1JGDB 3QFJE 5J96B 4GLRI 1R082 4EVNB 2ZIOA 2CO6A 4XHXA 4ORFA 1LJMA 4YHNB 1SOKA 4Y2DB 5A3WA 1LEGB 3AXIA 1S0IA 3HKDB 4JQXC 1R4XA 4H13B 5KLVH 1TO4A 4KZDL 1MG1A 2V5RA 4ACTA 3CL1A 3RY4A 1PO12 5A6LA 4Q9QH 2FUQA 4W9IC 4XNXL 4JFXA 5DAVA 1KG0B 1C5DA 4OZGE 4PCYA 1W9YA 1LECA 1RQ5A 4G5ZH 3FX3A 1G7JA 4LAQL 4KY1L 3CVIH 1HQWA 1MS0A 1PO22 1G4YB 4JI8O 3QUYB 2Q87A 4GA9A 1N8ZA 3UBFA 2VG9A 1OP9A 1B06A 2IH1A 3GBNH 3KWUA 1TFHA 3VG9C 2GH8A 4WEEA 4YFZA 1BQLL 2CHZA 3BUQA 5D1ZA 4CSTA 5I8YA 5IJKA 2RFXB 4Q74A 2Y1YA 3R06B 2ADIB 4GRLB 1W8HA 3RWGB 1BYHA 2UYLB 3IDJA 4G8IA 5CINL 3TNMA 1NUDA 3KB5A 2IXLA 5DUXA 3BPCA 1KELH 1TQUA 3K71A 2JWYA 1D4M2 4IE4A 4ET7A 3AZUA 4U0RB 4RGMC 2WUCL 4XCNA 5EOCL 4BUQA 3WTUA 1DQQB 4XMIA 5J09A 4XBGA 4MXQC 4FPCA 2PN5A 3FLRA 2YU2A 3W1ZA 3LH9A 4LASH 4Q6KA 1XNRO 2JIXA 3IDNA 1FZOA 1K6QL 3D39D 3F5WA 5A32A 2CTQA 1I9IH 1I5PA 3E6BA 4AF9A 3GSRB 5KJRH 2ZXGA 4DFHA 3IVKA 4AEJA 1GGCL 3CDGB 1KT2A 2ZOUA 3VE0B 1QR1B 1OD7A 1VMGA 3OAZK 3G6JF 3TN91 1QQDB 2I5YL 3EAKA 2XETA 2VTXJ 2YD4A 3L75H 3ILQC 2H1XA 3KGRA 2BM3A 5ESVB 2PO6D 4HPKB 1DHKA 4MXVE 5I16A 2NY6C 4HLTA 4LBLA 4F7MA 3D12B 2QGDA 5JHLA 1RUG1 1M53A 2V5DA 5CU9A 1P9MA 3OR7B 4BCUA 2UXTA 1R091 5DK2B 3VXRA 1U2HA 2JXMB 4UNVA 4NRZA 4XWGL 3B9KB 1E2ZA 3CHXA 4GQ9H 1AKJA 1OP3H 3N41B 4BIUA 4GRWH 4WFGE 1MLCB 1U12A 4IV3B 3IIAA 4L3ED 5AW9B 5AC93 4YNYB 3M2MA 5CU1A 4CW1A 3N42B 5GLVA 3QUMB 3G6JE 4YSUA 4IEQA 5B22A 4CMHB 1QZNA 4GSRA 2G0LA 4OQTH 4KDTC 3R8QA 5BMFH 5FP4A 4EN0A 1Z32X 3U2SB 3KVQA 3D3VA 4APQD 5KJ7E 2P5ED 5DMYA 1QRNE 3MRIB 4XP9H 5TQ0L 1EXHA 4M02A 3EYUH 4L1SA 1R081 3E89A 4K0KO 4B3TB 1RUKL 4FG6C 4I4WB 3D0JA 3H9ZA 4WLCA 2A38A 5AB1A 3QQDB 5D5MF 4QRRA 4N53C 2N0MA 2ZJCA 3OG4B 1PO11 2CKNA 2NUPB 3ZL2A 1ONAA 5DQJA 3HAGA 1BG1A 1A65A 3F6IA 2B7DT 3GIVA 3T6XA 1EFRG 5C92A 1CESA 5A3UA 5FB8B 4NKDB 1R0AL 3DPBA 1DQDH 5F2SA 3PWNA 2XZQH 4B9KC 1H4HA 4AQYO 2GSGA 1NLSA 1RZIB 1PO21 1Y3TA 1HR0O 1CG9B 3SDCC 5C0CE 4H1LB 2NW2B 1MXDA 4XAKE 3RX8A 4NOBA 5C2BH 4PDLA 3IMWA 4CC6A 1GH7A 3QXUA 4OIIH 5TK2A 4ZUTB 4MD4A 1IKQA 3HI5H 1RUJ2 2LT9A 4JFHD 5LAPA 1K4CB 4XPVA 2ORBL 3GS4A 1ODAA 3GLAA 5DXWA 3HQXA 1LK3H 2EO9A 1E9QB 1LK2A 3K58A 1D4M1 4AGGA 2PP8A 1BKZA 5D5ME 4IETA 4WEBL 1QJU3 3LDEA 3B3QE 4NWUH 1B09A 2V2WB 4G9FD 2WWKO 5CO1A 1QJX2 5JJJB 1O5PA 2EC8A 3QO8A 1UD3A 2F5AH 3UAJD 1YNLH 1HDKA 4PBVC 3UTSA 1WCDJ 1NX9A 2C3XA 2Q3XA 1S0DA 3VZOA 3L3JA 1HB1A 5LY1A 4F6RA 5AVSB 2H0EA 3CWBH 3IS0X 4O51A 1LWHA 5D70H 5SWSA 4XPTL 2I74A 3U9PH 4DPAX 3JV4B 2VQ1B 4G82A 1JZIA 2FMLA 4HUXA 1OGTA 1BQKA 4MZIA 3GM8A 3FH7A 4LF8B 4DRVA 3UGEA 1VZHA 2YIDA 1X5GA 3VXUE 1IBKB 4D6QA 1NLRA 2P6JA 3K06A 3T1WA 3LRHA 4MNQE 2B59A 5CXPA 5F1OB 4FQHB 2V0AA 3VXQB 4CUGA 4ONFL 3WXWH 2NYYA 5G4OA 4AYMC 1OF2A 5HDQL 4TXVB 5DT1H 5CCKH 2J42A 3FBYA 4XETA 4E4DX 3WIIH 2D97A 4Y24A 3B93A 1HDMB 5EQUA 5B3SB 2FJFA 3ES4A 4F1ZA 5LP6A 4YFWA 4CCOA 3QULA 3IKCA 4C4BA 4XUTA 4K8RH 4UIKL 4YO0A 1XBRA 3WJJC 3FZ3A 4EUPB 3ZSSA 2IPKA 2DTSA 1IBYA 1CGPA 4HXAL 1PBYA 4PJHA 5DHMC 4QRTB 2WYSA 3NTCL 3I3MA 4R26H 2YV8A 2DMGA 2B1OA 3DWTA 4K4KA 3N85L 1GGBL 3CRAA 4HEME 2BNQA 2G38A 4LVNC 4QOKD 4YGAB 1KOAA 5F0JB 4A2GA 2NP0A 2AEQH 3PY9A 3K6IA 2OIIA 1GJWA 1DU3D 5AZEL 5DZ9A 5BNPA 2HFEA 2HT2D 4FFYH 1S55A 1X7TA 4L4TB 4NLHA 2EILC 1N32O 4MXWL 5C71A 1RZKC 5FYLL 1LNSA 3NIGB 1ENQA 4WDIA 4TQEH 4FNTA 3JAKB 4QGTA 3N1MC 1U3YA 2K3TA 4LLAA 5CEZD 3G6DL 1L8DA 3NJFA 1FJGB 2P52A 4GIPD 1BM3L 3EOTH 4O4YL 4J3TA 3ILPA 4Z78A 1FH2A 2WNUA 2ILMA 1RVFH 1RGSA 2QKDA 4JPQA 1XNAA 4KTEL 1JN6A 1ZZ8A 3DXAA 3EO1A 4MJ5B 5GGSB 1OK0A 2WNWA 4ZZ8A 3KYMB 5GONA 4PVNA 2ARWA 3QUYC 4P2QB 3ZK0A 2D2CB 1Z9SA 1G8WA 4JO3H 3KPMA 1W90A 1FUNA 2B9AA 1VGEH 3P54A 4JX0A 3US0A 1D2QA 2IF7A 2RQ6A 3JVGC 3AS1A 3E6HB 4ELKA 1JQ0A 3AKPA 2IOIA 1QUPA 2G2NA 4BW9A 4LOFA 3EFDH 4X5WA 5EUOB 5EU5B 3RWRD 2KZBA 4P59H 3AWFA 3P11L 3ZTNH 4C56D 5SWQB 1RHI2 4FM0A 3S37X 1RUJ1 1SPPA 4A2LA 4ANUA 4HUMB 2V4VA 3GCWA 1KD7A 1HOCA 1FYUA 4OXSA 1H6UA 1RINA 3JT2A 2RM22 4HZ1A 1JODA 5GHWL 4MZ2A 1Q8QA 5IBTH 4KXBA 2A6DA 3PWLA 4RAIA 1FNGB 4GQZA 4N0UE 5HHQA 3A6OA 4OB5L 2XZZA 4XE0A 1QJX1 3ZFEB 2YGNA 1J1XL 2HFTA 2CGNA 3ETTA 4CPBA 4ARYA 1DQLL 4QPWA 5FXXA 4YHHB 4AQAA 4F7EA 4QHZA 1H2SB 4Y19E 5DJCB 2P24A 1MUJA 4QRAA 4EDXA 4LQRA 5FZLA 1NUKA 3QCTL 2B1HL 1HXYA 4LCCB 2K2SA 1AZVA 4TUYB 1ULGA 5EIIA 4MXWH 4D7PA 4PJ6A 2VLRE 2YSSA 2EIBA 5HYJD 1ASJ3 5I0VA 2K6ZA 5GZNA 4WW1B 4PRIA 3SJVE 3WFDH 4QXKA 3IMMA 3OR7C 3FNKA 4R50A 4PA6A 3H9SA 2ZSVB 4RGND 2YFUA 3VBFB 1BM3H 3TRSB 3C2UA 1MREH 4RGKA 4DOUA 1TEIA 1SHXA 1J0HA 4YFLI 3DJZA 2RJKA 3OG6B 4UB6Z 5DA0B 5GRWA 5H37G 4ZKIA 3TBSA 3TZVD 4O65A 3HNVL 2EJRA 4DV5B 7TAAA 4IV3C 1H30A 4FBFA 3UBXB 1ASPA 1QMUA 3HG4A 3I02B 1APNA 2E7TA 3MRRB 3DUUA 4JDVB 2WQVA 1T1WB 5EZPA 2IPUG 3QO1B 5FYYA 2NYZA 1MFAL 1ZGLP 4IJTA 3ASOB 4FQXB 3X12A 3P11H 1YNAA 3IKWA 2BYVE 4IBQA 1JGLH 4CMMA 1YO4A 1UT1A 1SLXA 1DJHA 4YFLF 4C1WA 1UKGA 5CSZB 4N8UA 5I6XB 4FPOB 1L0NH 3LKSB 3WG4A 3U79A 1G5GA 4M3JA 4CDGC 1J9TA 1DVXA 2WC2A 5LZ6A 3H9VA 1NQJA 1MCIA 4NRYA 4WM8A 3VQLA 2R072 2D3JA 2UZIL 5D4JA 1J0IA 1YZBA 5D7SH 1M06G 1J1XH 4TL5A 3U37A 5KVEE 1R5IA 1YPZA 1ZM1A 1DQLH 4BSWA 3STZB 4TUOB 5ANQA 1NMAL 3QWOB 1RIRA 1NGYB 4MS2A 2BXZA 2NXZB 1HNGA 3GNML 1TYEB 2WXMA 4GX0A 3OC8A 3ZPDA 5CHNB 1IOAA 3BPSA 3H1LH 2R23B 4WFHD 1N1TA 2VCMA 4NQVB 3QJVB 2YO3A 4A3ZA 3QQXA 1Y4MA 1QNZH 2CCVA 1I1AB 3G5VA 1DG6A 3NFNA 3SOTA 3ZKXC 1TA8A 5KG9A 5L3FA 1R083 3PUHA 3IC9A 4EIZC 2WO4A 2UWEB 1MF2H 1P84F 4KKCD 1RHI1 4GH4B 2XAFA 2A4ZA 5FJKA 4UVAA 2WY3B 3C5JB 4J10A 4KJWC 2AENA 2VY0A 2W65A 2PF4E 5FECA 5LKNA 1QMJA 3MAWA 4J41A 1FNSH 3BVDB 4APXB 1PO13 3WVJA 1I7ZB 4FKKA 3FO1B 2RTTA 4KJQD 4AQEB 2RM21 2X4OA 4KKLC 5C0BD 3AK3A 1FBIL 3G9VA 1D0GA 3PIGA 3ZZSA 2OMVA 1ONQA 1JRHL 5TDOB 4F9PA 2ATPA 1KJ2B 3W7TA 1CJPA 5FTTC 1PO23 5I6NA 2Z0UA 3G5WA 3GSWA 3POCA 2X1XR 5BOPA 1PZ8A 4FPHA 3LOBA 4ATWA 5KANG 4B60A 1VB4A 5CGMA 5MHSD 3CXDH 3FU0A 4UTAH 1HJFA 4AUJA 5DSCA 1FXZA 3MIDA 2AJXH 1MN4A 4GJTB 3T2QA 3ZTJG 1O3QA 2K7PA 1IURA 2Q4PA 2D6PA 2X7LB 3KPRA 4PJDB 4ELMA 1UWEL 3LQCA 1JXKA 1D4M3 5KXDA 2XB6C 3D34A 1W03A 1R19A 1PW3A 5D1QB 3FU3A 2DMHA 2IFFL 5IBUB 2I07B 5FW6A 4ATFA 1HL8A 2Z8VC 3BZFA 1JI1A 3L7FA 3HG3A 2ID4A 3BALA 2C9UA 5EZLA 2QQUA 1TG7A 2BP0B 4A44A 3ISRA 1M57B 4WI0B 1PVHA 5GW7A 2EDBA 5CZVH 3ACFA 3BH9B 1FYTD 4NO0A 5JYMA 4UFHA 1CD1B 3E6FB 4J3OC 3QUML 5MI0C 1PIV2 1J3PA 1YSOA 3EGDA 1QWHA 3MRPA 3L16A 5DJDA 5HJDA 4FPGA 4JF3A 1NMBL 4TNGA 1PGL2 1S9YB 4FP3A 2L4OA 3ASWA 4M4RB 5IFAL 4PLJD 1QSEA 4YW6A 1KEXA 3A0HZ 2D5HA 5JI7A 4X7CC 4QPJA 2DIJA 3WP6A 3U1QA 1XBLA 5CEYB 3WKPA 4HIXL 3HG1E 2Y5TA 4FLZA 1JZJA 5F0PB 4YVSB 4KNSA 3BJLA 1VSCA 5IOPA 1VPOL 4ERSL 3IDYC 4HXCA 1YC8A 2VOTA 3IGAC 3NV3A 4YHOL 4W6YA 3FMGL 5E6IB 1ZXKA 1WP6A 1IBHA 4PJ8A 3LPOA 2JIZG 1LNUB 3PJSK 3V7AG 1S0VA 3AUVA 3AS0A 4RDQG 5FPBA 4B8EA 4M7LH 3ZRVA 4B4RA 2PO6C 4GQPH 3CIQA 3T8XB 2R071 2XFGB 3CRQA 4OBRA 2VUDA 3IDEA 3KSCA 1Y6MR 4LT7A 4G7QB 3V6FB 1EGJL 4ZX5A 5JOPE 4ODTL 4F9LA 2JB6A 3KMDA 2AK4D 3PHAA 4NZRH 2OMZA 3ZSKA 4J4PD 5JMOA 3DIDA 4QHKJ 5G5DA 4BB3A 1YQ2A 1PKQB 2A6XA 2UXXA 3FUDA 5I5JA 2XXZA 3MXVH 2WWWA 4TSFG 4FP8H 3NZSA 1ZLUK 2E7LA 5A7PA 3AG2B 3GMOA 1C7SA 3A0NA 4FQQA 3LMJH 3SE9L 3CCQV 2JKWA 3WTVA 1KV3A 4X7EC 5LGKA 1T20A 2BC4B 3IBOA 3X1NA 4IE7A 5FYKL 4OZIF 4GKKB 2FEDD 4X6DA 4GRWF 5FMBA 4TQ8A 3A0BZ 4KU7A 1NUNB 3O1PA 2IXIA 4MW3A 4J9YB 1NQTA 1V8HA 3WKMH 5I0WA 4PV1C 2W92A 3QJXA 4XTPA 4B1LA 5D2NC 1G9EA 5CWSB 5EWIL 3INOA 1UG9A 3V2AR 4APQC 1V70A 1F42A 2FATL 2VQUA 1T3FA 1O7FA 4D8MA 2E75C 3O81A 5I71C 1OH3A 4LR4A 1WW6A 3V8CA 1A7RH 3HRZC 1HL4A 2ZOLA 2CUAA 4ETQB 5IFAH 1M1SA 2ITCC 2XXGA 3AVEA 3IPEA 4NNXB 1XCQB 3B8YA 4PUBH 4LUKA 1R17A 3D8MA 3LB6C 1A6WH 3K1DA 4KOCA 4XP6H 4FI7A 4JFPA 2GUZB 5FPRA 1ZT7A 4IEXA 3VD0A 1R3LB 3LSOA 5I0SA 1UY2A 1EO8L 4MBOA 4GRWE 1EVUA 1E50A 5SV4A 3RFZA 3F00A 2W5FA 2Y6KA 1Q9LB 4PRDA 2WB7A 5ICUA 3OC5A 2LALA 1FC2D 5L3GA 2JI3A 3KT1A 2R062 2IH3A 1IM3D 1VENA 3FL7A 1IBGL 3VBFC 2MCPL 4F27A 1OHFA 3QORB 1FGVL 2AMUA 3TBYB 3LRKA 5E4EC 1QJX3 4JPWL 4HOMA 5HGHA 2VDOB 1EGJH 5F7UA 4PIBA 3BISA 4ZNEA 5B1OA 5I1AB 2BVUA 4FQCL 2ARJQ 4GKOA 4JQIH 3MJ9A 4JG0H 1KGYA 3O9WA 2X0WA 4RETB 1SOSA 2IV8A 5IYDO 2R29L 4Z7VB 1CGVA 1SFHA 3N44F 2PW1B 4D0DB 3AABA 1OP4A 1PIV1 4DKFH 1U5XA 2G4IA 3U0PA 2PHWA 3CDYA 1PGL1 3RZGA 4IHOB 1T22B 3NG5A 1M4UA 2JQMA 3ZX7A 2TBVA 2B5IB 1A7BA 1SN2A 2HUHA 4PGCA 3CLFL 4FQXC 3UAJC 4XHBA 4UDUB 5TE6H 2WC7A 3NQHA 5I66A 1QKQA 4LKXA 4IHJB 1WZKA 2VCOA 32C2B 1W39A 1NGQL 2AQTA 4JRLA 5L3EA 1AD9B 1ETZA 3LZPA 1W59A 5CEZL 4X4ZA 3TBVA 2WL1A 4WUUB 2EDKA 5EWIH 4R7LA 1SJXA 3K5RA 3A2FA 2F7RA 5D72H 4U1GB 1LDSA 4BFKA 4WKZA 5F1IB 4F37K 4O7XA 5KC5A 5IK3B 3BLPX 3F7PC 1X9UA 3APCA 1CAUA 1XSQA 5EU4A 3LKQB 1AXYA 3A8TA 2WNEA 4Y2NA 3MGTB 4KITB 1FI8C 2I69A 4PG2A 3QVAA 2CHWA 2JCCF 1DVYA 2JELL 3ELAT 3MRBB 5IK8A 3OSDA 1ZSPA 4U05A 4XF3A 1SDWA 3PMEA 3QO7A 1WKYA 4OHXA 2WN3A 3CBRA 3EDKA 1CT8B 2QSCL 3FQWB 3JAMN 4MA1B 5BVPL 1RITA 1AMYA 1FGNL 2LQRA 2X53S 3I85A 3PP3H 1CAXB 2VO8A 4JUSA 3VD5A 5AW0B 1MZYA 4EUPH 3OEAA 3HAEH 1IBGH 3UJTL 4KQ3L 2MCPH 3TBTA 4G6FB 3HBZA 4B9PA 1DVFA 3X2QB 4MHHI 3N9QA 3E8HA 5D1ZD 4L9BA 1UGKA 4D8PA 4A2EA 1QHOA 4CE8A 2MK3A 1OZ0A 1OA3A 3F7YC 2DICA 5JOFB 3AMKA 1BX2A 4O4IA 5IJCC 4JY5H 1EXGA 3LZZA 4Q2FA 3NSJA 4PD4F 2YUXA 1OGAA 2A73A 2CLRA 5DJXA 1X5LA 1SY6L 2X9YA 3WOVA 2VL5B 2JCCE 2WXIA 4IEFA 2Y7QA 3VGBA 4F33A 2MNJB 4X9FA 3IC7A 4IS6A 1A4KA 3UP1A 4JDTH 4JI5B 4P9LA 2OX5A 2Q8VA 1YIPA 4ZI8A 4NQDA 2JVDA 5KA5A 1IM9A 1H3TA 1CXIA 3NSDA 4M9PA 3OB0H 3OKKA 1CFQA 4H8VA 4NB7A 2A9CA 1RHI3 5CEZH 4HJJH 3B9CA 4JZNA 4HK3N 3L5XH 2Y1VA 3KVDD 3OLIA 4I9QA 3OGGA 4EI5A 2RM23 4JN2A 3RL1B 4BZ1A 3FCSA 5D1QC 1Q0YH 2XNAA 5EBLB 3Q3GB 4EIUA 5CA0B 2JDKA 4G7VL 1AXTH 3QAZC 4H40A 2A71A 2WQZC 1M57C 4C54A 1XGQB 1KWKA 5A7EA 4TSVA 3DSQA 1UCXA 5C0FA 5B8CB 4U1IB 3SD5A 4B9YA 3H8RA 4QCIB 4LOEA 3RP1A 2ADDA 2VZRA 3DCQA 2EEXA 1L7LA 1N7ML 4LEOA 1IGIL 1QFOA 2XG4A 1KB3A 1QPXA 3D85D 4PRBB 1ZHBB 4YAQB 5FBJA 3VXRD 4AMKL 4ABUA 2EINC 3AK0A 2R0ZH 3U9WA 5L3CA 3CXFA 1H9VA 3RZCA 3II1A 4HXBH 1AL22 1AKJD 3QO0B 4X4XA 1WD4A 3NFSL 4OCXL 5KAQG 4EN3D 1AG0A 3GHEL 1CXHA 3UIZA 4FABL 4KQ3H 4LO8A 4K5PA 3WAKA 1A6TB 1CGSH 1UYPA 3DKHA 3G3LA 4ZFFA 2Z7WA 1EN5A 3ESOA 5E6IC 1W9TA 4R7CA 3FTXA 4Y9CA 5BUAA 2X5IB 3TT3H 2VC9A 1NCWH 1YG9A 2BK8A 3I8TA 5ES4B 3IMNA 3HPLA 5FA4A 1CK0H 4DW2L 3TP4A 2WLKA 4WW2F 1KJVB 4LSUH 4PJGA 3D3VD 4UU9B 3HNTL 3MX0A 4UFMA 2XMLA 4YUEL 4J42A 3I75A 1FCGA 3OJMB 2ICEA 3UMNA 1H8TA 4I55A 4O4JB 5I1HL 5JORB 5KHIA 3WDWA 1XRUA 5TE7H 2F1AA 5HXMA 3FOLA 1E79G 1I85C 2WVTA 4QRRD 5BO1H 5CBHA 1J83A 5EIBD 3L1OL 1K8DA 3MLYH 4RQPC 2VR8A 4HWEL 1X9QA 3AG2C 1IZ3A 4FNLH 1PMHX 2WJSA 2KD7A 5JQ6L 1S2BA 2N4IA 3B8SA 1GXEA 3TH4T 1YCSA 4BSJA 3HT2A 4IK7A 3SB3A 1QHDA 3NIDB 3ZN6A 3DUHA 5K9OA 2ATKA 3UNPA 5DJ2B 1GW6A 4JHBA 4JFQA 2B15A 1YA5A 1W0KG 1KJ2L 1WUNT 3P3SA 1OCOB 4XMPH 4CN1A 5ISZE 5DJYA 3QJHB 4EZMA 3VFMA 3CC2V 3UAEA 5CJOH 5KYYB 4JMNA 1S5IL 1LDPL 4PJ9D 4OM1L 1OAKL 1XOYA 4FKHA 4RMSA 3WV0A 3BLKA 3VFVA 5K1JA 2BS9A 1I8KA 2YLKA 1T6WA 1NOAA 2ZUXA 1W15A 3H3LA 3MSPA 3QE5A 3SE3A 5KYXA 2QQWA 4Z2WA 3M70A 1PM9A 4OCXH 5KZCD 3VKNA 2CO6B 2XFXB 2ZOKA 5I5IA 3TEWA 3ELNA 2XTSA 3MRQB 3BUTA 5IGXL 1AZRA 3UTSD 3M7FB 5AG2A 1WCUA 1TNNA 1OJHA 3TLRA 5SWSD 2ZWLT 3OBRA 4LT5A 4ZO7A 4QGPA 2X70A 3IFLL 3S37H 4IV1B 3JASB 1EDQA 1FL3A 1IVLA 1KCVL 1U3JA 2VDNL 2ZF9A 3GI8H 4OF5A 1V3LA 4FQZA 4TWTA 1SEQH 1C5DB 4ZUUA 1NBMG 2E7DA 4ZKTB 3QORC 4JPIA 3NN8B 4LNUB 4RAVB 4U2ZA 2VXUL 1G7JB 1L7TH 2VAAA 1NEUA 2A2QT 4KKCC 5EU6A 5CLYA 5J89A 1N8ZB 1MLBA 4LLUB 3WFEH 3ZJZA 2IH1B 4G9DA 5DC9B 3GSQA 2FO1A 3USUB 4NPMA 4LHNA 1I94O 2GUOB 4KJQC 4B41A 1QWUA 2DQUL 4KBPA 3K5LA 1F1AA 4HWEH 3I74A 3F12B 2JH2A 1JZ8A 2EJ7A 4XXDB 5JQ6H 3UO3A 4DMIA 4FAAB 4A5UB 5CZRA 5T5PA 1JPFB 2R83A 3TNMB 4FOQA 1OT1A 1AL21 3BPCB 3ZLQC 1KXHA 3K71B 1KGIA 2Y2TA 4P2OA 3BKCL 3ZDXB 5C4WB 4L5FL 2F66C 1INDL 3INUL 2NY7L 5I1DB 4A7ZA 3L13A 1HESA 1U96A 4XBGB 1YQ6A 2KH2B 1MAMH 4QXCA 1OLLA 1F4MA 2X10A 1R6TA 3WF2A 1LDPH 3IDNB 2JIXB 3KYKH 2P43B 3PNWA 3SE4C 1JFFA 5LO7A 5A32B 5I1JH 3MUGB 3LDBB 1G6RA 2P5WE 4LCWE 1VP6A 3FSAA 5DQ0A 3UAFA 1REDA 1GWMA 4PA4A 3GMQA 3BW9B 4FERA 1KT2B 4BD4A 4KK8D 4L2LA 2VNOA 1IAOA 1X8MA 4NQUA 3F7VA 3HVNA 4OU3A 3RNKA 2ZDIC 2XJLA 4F8LA 3S36X 4KKNA 3HR5A 4E9VA 2VKXA 2IG2L 1BWMA 5FIEA 1DHKB 5E2UL 2HWB2 2Q7AA 4BQ1A 5ITZB 5TJWK 3VFTA 3WXVL 3JD3A 3ZRWB 4F7MB 5HVWA 1GR7A 4OGQB 5EC1B 4DT2A 4G6MH 1M05A 3BODA 1NCRC 1DN0A 1A0QH 4PLJC 5DHEA 1E5SA 4NRZB 2XQ0A 4I3SL 4YIOA 1JRHI 4XVTL 2A6JA 3CWGA 4FG4A 2GITB 2YC2A 3ILDA 3U7YH 4K7FA 1LU2A 1AGBB 4APQA 5T1JA 4DV3O 4K15A 3O9OA 3T65A 4BGDA 3NRUA 4NUJA 4COZA 4HNAA 1DBBL 2CE4A 1WYJA 2JLLA 5L4IA 5I19H 2TSBA 3QXWA 4S0SD 1JYNA 4NWVA 3LXUX 1NTMH 1AGEB 2BOJA 3OW2U 5D5PA 3ZN5A 2VNRA 2GDFA 4DWHA 1L9RA 4MNGB 3C7FA 3QDGE 5E2WH 2DFCA 5FYSA 5KR7A 1JU3A 1OCCB 4MAUL 3C3SA 2L6LA 3OJ2C 5B1KA 2IWKA 2IO5A 4K20A 2HBUA 4J4PC 5I8EB 5IF0A 3GMRA 4MFHA 4OVUA 4YDJA 4N85A 2BHUA 3QDHA 2HG5A 2ZWYA 1BJ1H 1CVRA 1EAJA 5DQJB 4KX7A 1S3KH 2XLGA 3GIVB 4BZ2L 2W87A 1ORQA 2H2PD 2NCMA 5FUCC 3PQYA 3HC3H 4R97C 4LRIC 2FEDC 2N0KA 2GSGB 7PCYA 3MLZL 3TBWA 3ZYJA 3K6DA 2VW4A 2XN0A 3B2MA 3GTVA 4KQ4L 2Z31B 4NI3A 4PRID 4NZ8A 5GZND 3BABA 2XJPA 3V0BB 4DR4O 2YEQA 3N41F 1WICA 2HJKB 3H9SD 1SXBA 1AX2A 2YD8A 3H1ZA 2GBTA 3HR9A 5E2UH 4ZD3L 1JNLL 4MD4B 1DVUA 1T80A 4U7MA 3IEAA 4AFMA 3OPZH 2CH8A 3SPCA 2WKOF 3VBUB 1F4WH 2WTRB 1GW0A 1URIA 1D3CA 3N42F 3W81A 3ZSMA 1CXFA 1E5CA 5J57B 1AVMA 3RPIA 1LK2B 1PG7W 3NBNA 3KBPA 1HU8A 5HGBA 5IVFA 3RY5A 2J5WA 3D4YA 4DR2O 2R063 4WNQB 1YF2A 4M7JH 5LBSL 4JNXA 2VM9A 1K12A 3LAGA 2X5IC 4MSVA 1AX1A 4AEDC 2AJUH 5BUPA 4DNLA 3HMXA 4PEEA 5CP3H 5HHMB 4AI1A 3JUUA 4OULA 2YJQA 3PGFH 2QQKH 4QJ4B 2ARXA 3BZ4A 2ADFL 2YD1A 3BA9A 4XAEA 2R9AA 1DQ1A 3DOIA 3E3QC 4HUXB 5F6KA 5EOTB 1YI2V 3DURB 4F3JA 4PT6A 1Y76A 2N59A 1V9U2 1NC4B 3BHPA 1TFPA 4DYLA 2CO7B 1IKFL 4YQXH 5I18L 1S9WB 1XSKA 2FL5A 3EBAA 3F05A 2ZYRA 2V17L 4NUQA 3S4SB 1TTRA 3QS2A 4LIVA 1ND3C 1KCKA 2B59B 3VWKA 2HWB1 4CEYA 4X9BA 1HNXO 1CD8A 1QFWH 5IVXB 1OOPB 2VDOH 5IHHA 1M6OB 1S7XB 2HX7A 3FW6A 4GI9A 4KK9D 5I30L 4JY4A 5JHDB 3G6EV 2EUVA 1BBT1 1WEJL 5EA0H 4DXRA 1N18A 1XV8A 3ARGA 3C8KB 3GSXA 5GXBB 5LP6B 1A14H 2XNDG 1ZIBA 4I77H 4P5MB 3H6JA 4AI3A 4YO0B 1WQVT 2K0RA 3CN4A 1EEQA 3GSVA 1FPTL 1B4JL 2IPKB 4GKKO 3RLSA 3ZHNA 5LMUB 4BQ8A 4IGPA 1I1YB 4PJHB 2F58L 4PRHE 5DZFA 3VVVA 1PIGA 1NSNL 4X89A 5FOJA 2CBQA 1R34A 1BAFH 2BNQB 2R39A 5E6ZA 5ISLA 4N9HA 1CTOA 1V6JA 5HDOA 2JE9A 5E99H 4XI5D 4L0PA 4S1SL 3R4DB 2RS32 4QU2A 4FMVA 2HFEB 4HV8A 1Z9PA 2X4QA 3PXHA 2EECA 4K8RD 4B9ZA 4X8JA 2E27H 4MRCA 2F95B 3H0TB 3LQZB 1YYLL 3D3AA 4UFLA 1ZRCA 2VDKB 3GBMH 3OKEA 1XF2A 4WDIB 3N3HA 4HVQA 1DCEA 4BOWA 1KNOB 4M6NL 1CFNA 3GXUA 4G83A 2RALA 4LXLA 3II2A 2WNVB 5C0JA 4AQZA 1WG3A 5C0ND 1OLMA 2QQOA 2WNUB 3ILPB 2YXMA 3RVUD 2ITFA 1HV0A 3O12A 2XX0A 3LSSA 4CDXB 3DXAB 3EO1B 4GAAA 3KD4A 2HRLA 2KZWA 5D7LA 3KPLA 3MYZA 5CS7A 3HT1A 5FYKE 4GS7B 1RYYA 3CVDA 3A6CL 1BHGA 2H0FA 3HNSL 5DQDL 2IH1C 3HS9A 2Q7GA 1T6GC 2KQXA 2R56H 3L3GA 4R4FH 1ZL8A 5LA6A 3UPAA 3VUOA 1YMHB 5D1ZC 2QADD 3P4NA 3PAVA 4URAA 2EYRA 5IYCO 4LSTH 4Z3GA 5F9JB 3ZKMC 2JGUA 5IJKC 1BZ8A 5LBBA 4U3HA 2C1OB 5INCB 1HEJC 4CCDA 3U4BL 3FFQA 3QEUA 4TUJB 4IMLA 1HOCB 1S7RB 5A16B 1BG9A 1IC7L 5F2FA 5DGRA 5LRSA 1NE6A 3FUOA 4NXKA 3OAAG 2A75A 3Q13A 1MFEL 3OMNB 3MV01 4NFBA 4ONGL 4GMTL 1FSKB 3UBHA 4OH2A 1QSED 4AYFA 3MLRL 4L9LB 2RR11 5FPXA 3ME0A 1JVKA 2VXVH 3CJXA 4O2CA 1P7QD 1GH6A 5DDHA 3W0WA 1M6UA 3QZOA 5H9PA 3F5WC 5DWUH 5D55A 3THMH 1NSNH 4F7EB 4JPSA 1WP7A 1EHXA 3T4VA 3IPBA 3FTSA 4A68A 2MJWA 4LHUA 3TWYA 5GS0L 3L3DA 2UWBA 4QHUB 2CTWA 1HXYB 2QA4V 3WN6A 5I15H 3FULA 3HKZA 1M93A 1UXSA 1YDPB 2VR4A 2F4PA 1V9U1 3HLAB 5J1SC 4HCRL 5HHXL 1YXBA 3R66A 2BSSA 2K45A 1NFDE 5ACMA 1AL23 2WB1A 3EJTA 2XZAH 2LS6A 3QCVL 3M1BA 4L23A 5SWZA 2Q7EA 1O7SA 4CYDA 1P9MC 1XQ4A 2CHNA 2H1LM 4WGVB 3NIFB 5EUOF 5ACA2 5BZDA 5DC4B 1LWRA 4LFAB 3C5SA 4P46A 5FPZA 2CIIA 5EIVA 4K21A 3TBSB 1WSST 3NIGE 1WCBA 1G84A 1FV3A 3AWGA 5BR8B 2P7TB 2VE6B 3T2LA 1WBZA 2J73A 5BQ7A 5F3HB 3A6CH 3OR6C 3HNSH 3LZFL 2AV1B 3KYAA 4IOIB 5DQDH 2HJLA 1X6LA 3RWDA 3MBEA 2ESVB 5CEZE 4XNDA 5ILTH 2Y38A 1RUNA 4BFBD 5KSAD 2GJ6A 5DHVA 1WGVA 2J8HA 3W5NA 2Z91A 4J6IA 4TQFA 1BF2A 4P2QE 5I0TA 1NGZA 5AG9A 2RS31 2COVD 1U8OA 2XN9A 3MLUH 4R3SB 2O72A 4UM9D 5I0UA 3SQBA 2NY1D 4QRUA 5FWEA 3NJLA 1I8LA 3BP4A 4JE0A 3U83A 3BVVA 5JXJA 3EH2A 4FMKA 5EUOE 2P44B 3SGJC 3K6NA 3FB7B 4L3EE 3L5WA 1PZSA 3MLRH 5AVQB 2O6PA 3UBXI 5EIBC 5J2UA 4NN6B 4W70A 4HG4K 2E31A 1WZ1L 1FFXB 1YPZB 1FXKB 3C75A 4BSWB 4NXNO 1ZS8A 3VH8B 2R0LH 1ZS2A 3Q2LA 5DFTA 4TS6A 3KCPA 4AWJC 3DGTA 4YSPA 5D2NE 5T3ZH 3T09A 5KBPA 1MACA 4NC0B 4U2YA 1PZUB 2XA8L 5GS0H 5FYHA 3IDBB 3ZR5A 1JDCA 3WDVA 1XVSA 3ZHUA 4LE3A 5I1CH 3K48A 4BU2A 3G5VB 1ZRIA 4I18B 5DJ8A 5EULV 4GUOA 5KG9B 1HINL 2XQRA 4Y5SA 3MACL 1FFRA 5CU5A 2JEUA 1VACB 1LJ7A 4AHZA 2LABA 2J44A 1XH1A 4DGYH 2PCXA 4BCZA 1X5IA 3DGEA 1KTJA 2NMSA 3P3NA 2NYKA 2WNKA 3UTPE 4F20A 2R8SH 1RJ7A 4A42A 1P4BH 5BW7A 3C6LB 3O3DB 3DMMA 3GHBL 4X8XA 1VLNA 4NIAA 2FTKA 2NQDA 4I30A 1TQBC 4M56A 2BJMH 3BP6A 1JZ5A 2W9DH 1CDGA 1AJOA 1OUXA 5CLXA 2UY7A 2OPWA 1AIFA 2LU7A 3MO1B 5BY5A 3GC3A 1LE9B 3HBGA 4FMFA 4IRZA 3MBWA 1WFIA 2XVLA 4GYCB 4HZLB 2ODMA 1FFQA 2W08A 1F8TL 2PP9A 4RGGA 4Y22A 3NZHL 5J36A 1B35A 3AVSA 3WSQL 5DMIH 1XIWA 4CDHA 1QUNA 1J1PL 2HN7A 2Z35B 3G71V 1J86A 2BVOB 4S2SA 5DSCB 5JR1L 3B5HA 5JHLL 1HN0A 2VZPA 4YGCA 3ABKB 3JV6A 1N1YA 4HKOA 3KH4A 1VFUA 1P7GA 3KPRB 4HPOH 4AH2A 1OC1A 1M9NA 4CC1A 1MWAB 1NIBA 4BQYA 1FMD3 4IGBB 1LEMA 2WQSA 3RI5F 1INEL 3EO9H 3SDAA 1Q8SA 4HGMA 3I2CH 1E6JL 5C0RH 3FT1A 3T2NH 2ED7A 5EZLB 1CLCA 5FDYA 3WS3A 4P2AA 5ACA1 4XBLA 2UWEF 4OSUL 4TL4A 3B1UA 1J8HA 5LP6C 5CM1A 2RJ2A 4NO0B 1F00I 2D3VA 1BZ9A 1KGUA 2AQ3A 1AFVH 1J87A 2ADJA 1U42A 2DWYA 1M7DB 1HRV3 5KSUB 1UX6A 2ZBJA 2UX6A 4MJ4A 4DOHB 2OT5A 4WWOA 1RUML 1AGFA 2UXCB 3WFZA 4HK8A 3UG3A 1XCTB 1U2CA 4LQFL 4BXFA 4FTVD 1XSJA 5D6CA 4EQVA 4CSSA 3DJSA 4KHPO 3VAEA 1KC8W 3VD4A 3QR0A 2Y5TB 3BAWA 2PAMA 4D9QD 4OZHB 2HWB3 3DC0A 3DKQA 3SEEA 5BNPC 5E1QA 4L1DA 3S34H 5B38A 4HS8H 4FQJL 1BLZA 3AZXA 2EDFA 2YEZA 4GXFA 4KK8C 4W6YB 4MHRA 1WZLA 4XBFA 2DQGL 3CFCL 4PJ8B 3CXHK 4KTGA 3S5ZA 3U14A 3TF4A 2ZICA 4QJFB 3AQXA 4J3XA 4KMQA 4PIYA 3PWPB 5BNNA 3AU1A 5T5FH 4JDNA 2EDHA 2UWEE 1ZZCA 2WNVC 2ZE7A 3L81A 5APAA 4KX9A 5KBFA 4OCRL 4XFBA 1F8TH 4IKNA 4NQDD 4HF5H 5LAXB 3QIWA 2GBOA 4KKRA 5FY0A 5LGJB 4CUAA 1WJ3A 1IM9D 3LKRB 3PP4H 4NJAL 5HHOD 5EHDA 3SH4A 3J9SA 3WOGA 1L3WA 2KQNA 5DVPA 1Z0HA 4RGAA 1VHPA 1ILSA 1ZT1A 4OF6A 1JIBA 5G4MA 4QXHA 2HXAA 1HFUA 2E9IA 2ZUQB 3O1VA 1G1KA 4EI5D 1RZJC 2PCPB 1GP5A 1KQRA 3BT0A 5B1CA 5EDSA 2FGWH 3BGMA 3EDDA 3GJFK 1W2NA 5J11B 5EBMA 3BUIA 3F83A 2J21A 4PB9H 4XYXA 2DYPA 1Q94A 3RWHA 5ADPH 1TTUA 1V3JA 1INEH 4JZJA 1HAUA 3R0NA 4BELD 2OXHA 3I2DA 4HIIB 4JFFA 3K2IA 4JHAL 5AL0A 2HVJB 1A7NL 2LTQC 1VARA 2DQIL 1ZGLA 4PJDE 1DTOA 4TSCH 4UINL 3E5QA 4BMBA 3NCJL 2IJKA 4LLYA 1OQXA 3PHOA 3R1GH 2GTAA 4UUJA 1N0XL 4LCIL 2RGSA 5D1QE 2WSKA 5E2TH 3IM0A 3NEEA 4X6CA 4N2BA 3O2VL 3RILA 5DUMH 5A40E 4L99A 2ZOLB 2HP4A 1KXVA 1Q8IA 4LQFH 3WG3A 2I7SA 1J5EO 1TAEA 2VJXA 1M1XA 35C8L 4POZC 2ZINA 3I2KA 2HJFA 4PG9B 2VABA 1KIRA 2H2PC 4ZSOA 3DGGB 2PCFB 1QFPA 2C7UA 1JYTA 1X9RA 5JIPA 4AVSA 2Q76B 3LSOB 4GBXA 2EO7A 3CQPA 3D36C 2PYED 3KW8A 3U25A 1LEIA 3GF6A 3QUKA 1FLRH 4AEMA 5BV7B 5GZNC 4PRDB 1YHPA 4G4FA 2EIJC 3SKJH 2KS0A 2VWJA 3MKGA 2K78A 5T3XL 3VGIA 4UT5A 3VXTB 1Y9GA 4MS6A 5H94A 3BQUA 5LGYA 1WWYA 3WU2Z 5HGHB 1VF6A 2HWE1 2A1WH 1A8DA 1G7PA 1SYSB 1TZGH 1Z6JT 5E1HB 3K9AA 2C3WA 2XV0A 4KHTH 3CIAA 3D3QA 4L11A 2IDSA 3DPDA 3O9WB 5DVKA 5ANHA 1HILB 3GJEA 1NIEA 1ZLVK 1SACA 1XF4A 3FU9A 2P4KA 2IJHA 4COWA 3O1SA 1V6LA 2NQCA 4FPLA 1FNEA 4DV4O 2X3AA 3IDGB 2CAZC 1IXBA 2XAJA 1BHAA 4PGBB 3QQNA 4ILDA 1V9U3 2ZWKA 2NLJC 2VDKL 3D25A 1SKVA 3QJFA 4OZFB 4N20A 4YN3A 1UPIA 3QUXA 1DFBH 1G9NC 1KJMA 5FHAL 1DGSA 2AHYA 3V0VA 2DBIA 5EJZB 1PKQE 4ZZ5A 4CH5A 4M7LT 4OLYL 1YMMD 3OKDA 4QNPF 3S36H 2EZPA 4Z7NB 3AZVA 2Q9LA 3L9DA 1ETZB 1GHFH 1AL0G 3PRZA 1NANH 3NJHA 3TBVB 3KPPB 1MCWW 5IFJA 4DUVA 2IXCA 2FT8A 2X4SB 4XZUA 1OF4A 4HOOA 4AGRA 4CU7A 4WM8C 3I49A 3IJHB 4WKZB 1GZCA 3F5TA 4GZRB 3SKMA 2HWZH 4ZI7A 5A2QN 4K71B 4JGSA 4KJYB 3SISA 3W7WA 1RZJL 2QZQA 4XX1E 4HIEA 4CVWA 1FPN2 2RMU2 3VG0L 1XGPA 1XHZA 3EIFA 3LV3A 3H8OA 1U8QB 2CDGA 1E6OL 4G71B 5EZJA 2DURA 1SXCA 2V3FA 5LYJB 2VZ1A 1MJUL 1VMFA 3GSNB 3OAYH 4NZDA 1LO4L 1TUPA 3FT4A 1GU3A 4AJ0A 2DUPA 1U8MA 2RS33 4K7JA 3S96A 1S5HA 2C9RA 4AXWB 4XN4A 1W8ZA 2ZGRA 3R7QA 2UYBA 3AP6A 1GYUA 1NCDL 3MW2A 3T4HB 3HZVA 4B9CA 4JZOA 4Y1AD 2QHLA 4ACPA 1LGBA 1LUWA 2EIGA 4XUNA 5HCFA 1RV6X 3TBTB 3FWEA 4FT8A 2ARJA 5E6SB 1V6OA 2CKBH 1DVFB 4XI5C 2XOKG 3ABZA 5LGHL 4D8PB 4LC1A 2L04A 3HOGA 5KSVB 3KGUA 2EADA 2JJUA 4OD2B 3VSVA 4O4IB 2AGJL 3WTWA 4JAUA 1QBLH 2IALA 1OGAB 2A73B 2GK0B 5DJXB 3TPKA 2V5SA 4F33B 4QF1B 3QG6A 4P2OD 2F8VA 4IKIA 4JPVH 4IS6B 2AGSA 1WLHA 5TDPB 3AMPA 3BP5A 4I13B 5F70A 2OX5B 4Z7UA 3KR3L 4W9EC 4JRXA 3RVUC 2ORZA 4FN0A 5FHAH 3MLVL 4Z7VE 4NYLB 3GUTB 3X1EA 1O3TA 5I1KL 4DKEL 1CFQB 1EZVX 1F6FB 3CDCA 1ND0B 1GN4A 2HWF2 2X28A 3MOBH 5C0BE 4D3WA 2BVBA 2ZD9A 2HCZX 3P4LA 4JZNB 1IU1A 4I0CC 5M95B 1IC4L 3LKNA 2NR6A 4Z3JA 1QVOB 2AMGA 4JN2B 4E5XA 4Q6GA 3FCSB 3V52L 2XBO2 1CGYA 2HJIA 1RVF2 4QKDA 2QADC 2BOCA 3CSYA 2NLRA 1CICD 5JXIA 1TZIA 2C9SA 5MHSE 3JARB 1BL8A 4IEOA 3S0MA 2OMBA 2VTFA 3K57A 1W6QA 3FTGB 2JIJA 3BTXA 4CS3A 1YJDC 3RAJH 1SF3A 1PLGL 1TME2 5JXAL 1BEYL 1A6PA 1L6ZA 1MSPA 1G9NL 4ZOEA 2GJJA 4H25B 1VBB2 1OHQA 1YLLA 5IW0A 4B4PA 1SS3A 4LEOB 1JZ6A 4JRAA 3PCYA 1NICA 4E4ZA 1PNKA 4EZ4A 4L3CA 3WB2A 5JHAA 2D7NA 1K4DB 2DDQH 1UADC 3FRPG 4XO9A 1S9XB 5A3OA 1NT2B 4ZFGL 2NN8A 3RZCB 2LLNA 3B8MA 4HAFA 1T0MB 1XTMA 3T3PE 1KRIA 3ICXA 4RRPA 1SF9A 2OMXA 4PYHA 3C5XA 4DH2A 1FYTE 4ZXBD 4E9YA 1U8JA 4XH2B 43C9A 4ZFFB 3AKTA 4BW5A 4LKFA 5LGHH 1W3XA 5H4YA 2DDUA 3DVFA 2E6JA 4M8UA 1A6VL 2PTUA 5LK7B 5J9PC 4NBXB 2QVSB 3WO4C 2JE8A 5FA4B 4AI0A 1Z0NA 2BW4A 3DSFH 4KUCF 4FPPA 4HC1A 4PJGB 5DEGA 1QJY1 3CHQA 4TLUA 3I75B 4F9LC 5TK4A 1FPN1 1DJGA 2RMU1 1H2MA 4I55B 2CIKA 2WLZA 3W39B 3GZEA 5JMOC 2P1YA 3KXFA 3SE6A 5B7MA 3DLQR 3OEBA 2VLME 2JDYA 3FOLB 4Y9FA 3OFNG 3MLVH 4W9LC 3ZYZA 4GAJL 4HUVA 2BEOA 1Z2KA 1K8DB 8FABA 4UM8B 1THCA 3ZT5A 1WIUA 5DEFA 2E7LC 4XJWA 3RZLA 3HKBB 4A37A 1RJLA 3LDKA 5J11C 3CZFA 4FM1A 1JERA 5B1NA 3FT2A 3PQYD 4ONUA 3WNPA 2L7EA 3ZN6B 2G60H 3ULVH 1BD2B 4PPTA 4QRSB 5CFAA 3OHXB 5KAFZ 4ZBJA 3V0AC 4H88H 4HETA 5DD6A 2LW1A 4QDSA 3UT0A 5KSAC 2FX8H 4KI5D 2P17A 5E0FA 3VFMB 2Y7MA 1LRHA 1DANT 1IX2A 2BINA 1UJWB 1ZV5A 1A02N 4J1XA 4JI2B 2DV6A 2XKSA 3ROOB 5GS2H 1PLGH 3JV5A 1XSIA 1WJZA 4LFBB 1BEYH 3CD4A 3N1GC 2NY1C 5L9RA 3VFVB 3CFKA 5IQ7H 1JI6A 3CSFA 2JG9A 3P30A 3NT0A 3DYPA 1LE5B 3GDBA 4R4NC 3ULAB 3HFFA 3DXRB 1G7QA 3LPFA 4RMWA 3VGAC 4XQWA 1IZJA 1TZ8A 3IM1A 4J1UA 3M3OA 4KI5M 2YPKA 5TE4L 4HVRA 4ODUB 1AOHA 2H6BA 1QR8A 2KMWA 2JKXA 5LCVA 2HWF1 3MHZA 3RFZC 4I50B 3S98A 1HCVA 4ZX6A 5BV7C 1OCWH 5FZOB 1YJDL 5IHWA 4JFYA 2F7OA 1YEKL 4KZCA 2IH3C 4O5LL 4XBPB 2XBO1 1Q0XL 4NM8H 2IXHA 4GULA 4JPIB 1RVF1 5LL6Y 3QHFH 4HH9A 5LNEA 1Q56A 1MMMA 5GKAC 3VBHC 5BS0D 3RN4A 4HWBL 5EU6B 1IAKB 1Z3GH 2FDJA