4PI2A

Crystal structure of particulate methane monooxygenase from methylocystis sp. atcc 49242 (rockwell) soaked in zinc
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
390
structure length
390
Chain Sequence
HGEKSQQAFLRMRTLNWYDVQWSKTTVNVNEEMVLSGKVHVFSAWPQAVANPRVSFLNAGEPGPVLVRTAQFIGEQFAPRSVSLEIGKDYAFSINLRGRRAGRWHVHAQINVEGGGPIIGPGQWIEIKGDMKDFTDPVTLLDGSTVDLEHYGISRVYAWHLPWMAVGAAWIFFWFVRKGIITSYIRVAEGKADDVIGDDDRRIGAIVLALTILATIVGYAVTNSTFPRTIPLQAGLQKPLTPIETEGTVGVGKENVTTELNGGVYKVPGRELTINVKVKNNTSQPLRLGEYTAAGLRFLNPDVFTTKPDFPDYLLADRGLSVDATPIAPGEAKEIVVKIQDARWDIERLSDLAYDTDSQIGGLLFFFSPDGKRYASEIGGPVIPKFVAGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Effects of zinc on particulate methane monooxygenase activity and structure.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords unknown peptide
total genus 85
structure length 390
sequence length 390
chains with identical sequence E, I
ec nomenclature ec 1.14.18.3: Methane monooxygenase (particulate).
pdb deposition date 2014-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4pi2A02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 4pi2A03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 4pi2A01
4PHZA 3RFRA 1YEWA 4PI0A 4PI2A 3RGBA 3CHXA 4O65A
chains in the Genus database with same CATH superfamily
3ZMTA 3E89A 3IB3A 5JIPA 3AG3B 2DTWA 4YM1A 1UNBA 2CHDA 3ARWA 3KPSA 4JG5A 4UCFA 3U36B 1DVFD 3L71H 3OEEG 2UUCO 1YEEL 3ZR6A 1UU5A 3EDDA 2PW1B 5TISZ 2OMWA 2XZCH 1E0OB 4WUKH 1U93B 2OMYA 4ISQA 3NPSB 1QRND 1URIA 1HNZO 1LEDA 2CDFB 3APDA 1E5RA 3OEAA 3CFJA 4WF7A 4Z76A 3RYFA 5LY1A 4X4ZA 4TSFG 2W68A 2NY4C 3GI9L 2OMUA 4LF3B 2FD6H 4I01A 1GM9A 1JCVA 1BQHB 4DK3A 3WO4B 5DI8B 1W3XA 1A64A 4H8PA 5KZCD 1WA8B 4IIQC 4CP2A 5L6YH 5IFJA 4Y26A 2ICES 1QATA 1ZZBA 2EQDA 4WDIB 5JQ6L 5FZHA 4Z1MG 5DS8B 2B9VA 3VLBB 1XF2B 4LU5H 2FEEL 1H6EA 2FYUH 4FNRA 4N8VG 5LBGA 3RWIA 3I2KA 5DD5L 3E35A 3VD9A 4OGXH 4YSRA 2ROYA 5E6YA 1RIRA 4PJAB 2DBNA 3WL9B 1SJHA 2ZYRA 3VI3F 2KG7A 2AJXL 4RIRB 4XO5A 3DDGA 4F6RB 3C08L 5F89A 1Y18A 4Y2DD 5CISA 5TFSL 2CHZA 1YRZA 5CGYC 2IVJA 4D8PA 3FUOA 4OCSH 2Q7EA 2WQSA 3MA9H 3TIEA 2KM2A 5LASA 4AYGA 1XF1A 4P5TB 5FKBA 2OMXA 4NFDA 5E0FA 2FDFA 2HKOA 1D9KD 3P0VL 2E9QA 1P9MA 2OCCB 1LCLA 4JANB 1GR3A 3TBVA 1BAFH 1D5XA 2HFGH 4QT5A 5DFAA 2GC3A 3L3KA 4EDXB 3UCSC 3UDWC 4LHQB 1Q90A 1NBYB 2AZAA 3N3EA 2EILC 4PELA 3SKOB 1QMJA 1XNDA 4NJ4A 4UT7H 3DJ9A 4GQ9L 3MV9B 3OQRA 5E6HA 3VG9B 1NY71 2G3XA 4QRRE 5AQ0A 2N05A 4Q0XL 4GZRB 5CN3A 4G72B 3U2IA 5C0NC 1DZTA 3B02A 4M3CF 4L8SC 2DCZA 2CNZA 1JD7A 5JJJB 3GRGA 3P6BA 3GBLA 3CFEA 2Q9OA 2AFNA 1LENA 2E46A 2OYKA 4NXSA 1HJCA 3VTAA 3L95B 1E9QB 3VNZA 1AMXA 1SYSA 3EOAA 2ZXQA 4RGNC 4QX1A 3THML 2RS51 3HG1E 1K5NB 1JNNH 4YZ3A 3VSUA 2CJ3A 2VL4A 1M1KW 3WU2Z 4ARXA 2F18A 4KQ3L 2VO8A 2CNYA 1VA9A 5EU3A 3T0DA 1SBDA 2QZ2A 2I26N 1OP5H 3VWKD 5DJAB 1XHHA 3S3CB 1CAXB 1CUOA 1YO8A 3LSSA 5E51A 4H33A 4MT8A 1JZGA 2XXZA 4DXZA 3FF7A 1AR4A 2YSSB 2WIMA 4GBXC 2J22A 1FFXA 1CE6B 1YEEH 3DX9A 4JF3A 2O6PA 3CB2A 2OYZA 4Y9CA 5F6LB 4R7XA 1QWNA 2H8PB 3RKDD 2CDYA 1F90L 1K3IA 4EI5D 2RS53 3LDCA 1Z1WA 1JZDC 3PPEA 3FQ1A 5JLZA 4J80A 5JW4N 5L36A 2AVFA 5AFBA 3Q7JA 1T0PB 3VG0H 5FZDA 3QE5A 4JHWL 3T8MA 4YLCA 3VX1A 4GAAA 1A4AA 1KNOB 4IQPA 2ADGB 5D1ZB 4DV4B 4YDMA 1Q72L 2MOQA 3NZ8A 1SYVA 1J5EB 1Z6JT 3CZEA 3FN0L 3MGOA 1FZOB 1WLHA 3MV9E 3VH8A 1XGZA 2J42A 2LV4A 2EC9T 1RJLA 4XBPA 3WIFA 4WVWA 4FL4B 1J9QA 3TM6A 2NY7H 3KDMB 3UYPB 1XDCA 4UFZA 1JTPA 3H53A 1BDYA 3ZIYA 1PNMA 5KYNA 1M05B 2N7SA 3T3ME 3HNBM 4Z6AT 4PD4F 3ZFEA 2RDCA 5EEZA 4UI9L 1L3WA 2LM3A 2VAAA 4Q4V1 3BAIA 5K9KB 5JW4R 2FT7A 1G5GA 4NHUB 1LP9F 4K4KA 2GN7A 1MREL 2HKHH 1EK3A 2CE6A 1AZVA 1DLFL 2H3KA 2YLKA 4K7PY 3M99B 4NQEA 5CUSL 3U7YH 1FE8H 1Z2KA 2JI3A 4BFJA 4EIZC 1W2TA 2CYFA 2JGUA 1VRBA 4I09A 3WVJA 1WA1X 3VBUA 1QUNB 5ACA3 2VNVA 5A33A 3ESUF 2DDUA 5AC92 1ZLUK 4CDHA 1BQZA 3WDWA 4CADA 5BJTA 2PAEA 1Q5OA 3B9KC 2ATKC 5F1KC 1HI6B 1XH3B 4M1CC 1WGVA 3BD4A 4PU2A 4Q4IA 4ZQKB 2W46A 2HLFC 2IAMC 1QJEA 1RUE2 2IFRA 2WC2A 3I2HA 2ORBL 4FLYA 1AFVH 2ZSWA 3GYRA 4J3XA 4XNXL 1NGXB 3IKKA 3PL0A 5LBEA 5L2KA 2V7QG 1LO5B 3LB9A 3IPEA 4WM7A 2F2HA 4F2MB 3QZWB 1QR1B 4XP6H 1C8PA 1SACA 2PF4E 2ILLA 5DXDA 3E2HC 3K6SA 4XHBA 4Z7WB 3MF9A 4G7VH 3A6CH 2X4RB 1SZXA 1N4XL 4BYHA 3SGDH 1RKRA 1YAIA 2L7JA 1KXQA 2IBZX 3BU0A 4M7ZC 3ILFA 5CUSH 5JHDB 1CAWA 4AKOA 4BM7A 3U9PL 5E8AA 1IZ3A 2YGMA 5IR1B 5EIIG 2Q68A 1KLFB 2F7OA 2BOBB 4AQAB 1N3PA 1EP0A 1XU1A 1AAJA 3FO0L 3QJVB 4KDWA 1HSBB 3KPSE 5CEYB 5E70A 2BYVE 3K2UL 4AEDA 2AGJL 2GJ6B 3VDDB 4PRPB 3QJHA 5T1KA 1YJKA 4BU2A 1CIDA 1NCCL 1MRCL 3BO8A 1I1FA 4H8HA 4XNMB 3TN0C 4OFYA 5IFHH 3FW6A 2DVBA 2QNKA 4FG2A 4ABMA 3D8CA 4KI1A 4LARL 2HWB1 3ZHSA 2BH0A 4FXKB 2GYSA 1ND0A 3U10A 2X42A 5EUOF 1J10A 1Q8PA 4N9GB 2NXZB 4N43A 2CLRA 1ZLWK 5FYUA 2VERA 3N9PA 4U4BA 1VFBA 4AUUA 1OI6A 5FMDA 4DR6B 1VBC1 2XYCA 2AV1A 2ZG3A 5E6IC 3JZ7A 4K8RC 3ULUF 4OFGA 4N2AA 4I9QA 2BSKA 1EAPA 2ZCKH 3VBFB 1HNYA 3ABUA 4F7TB 4XILA 2F5BH 4KUCF 5FOBB 2OFQA 3T3MB 4XN5A 4JI8B 5D8AA 3CYOA 1MW3A 3QYCA 1VIWB 2CR6A 4XMZA 3T0ED 1V3JA 4GSQA 2NTSP 4LPXA 3VGAC 5KVDH 4I4WB 2VWEE 4HJ1A 4PGCA 3I50H 4R97B 3UPRB 1HHJB 3S6PA 1AYN3 1GNYA 3CVDA 2QLVB 1WMXA 4GWIA 5HXVA 1FVEB 1LTXA 2YD2A 4AAPA 3OYWB 3KDPB 4I18C 3KVPA 2J8HA 5KXBA 1TJGL 5LHIA 4N2BA 5SV5A 5HVGB 3VBHB 1JMXA 4FG6C 1WC7A 4CDQC 3QCUH 1TNFA 2N7GA 3BCWA 3W0WA 5EO0B 2V17L 3Q3GB 3SE8L 2NNUA 3CXHJ 3P73B 4XN8A 3T2QA 1S5HA 1NYWA 4A7TA 3UJQA 2YD8A 4AGGA 3QQ3A 4DS0A 4GKNB 5DD5H 1RP3B 5AW3B 3QG7L 5FYKE 3UTPD 1ASJ2 2QKIA 4LHUG 3RPIA 5B38B 1FUNA 1ZHLB 1A6ZA 3RVXD 4L9DA 4G5ZL 4U6YB 4WI6A 3V6BR 5JVDB 5DU7A 2ZGOA 4XUOA 2F53B 4KI5F 4OCXL 4JI5O 3TK1A 4L4VA 3RGHA 4PDLA 3FFCE 1KB5B 3FTXA 3VTMA 4Z8FH 1I7ZB 1KDKA 4LSTH 2F8XC 3EJRA 4OH2A 4LF9O 3CU1A 2YU1A 3U1XA 5JR7B 1K5NA 2E9WA 4QGTA 3LCYA 5C0BD 3HN5A 4DAGH 4FQJH 1T0MB 2NT1A 1AR92 4ANXA 1Z0HA 4QDSA 3L95A 1UZ0A 1NCTA 4X1KB 4IE4A 4HSQA 5GZDA 2AK4D 1ZT7B 3AACA 4W93A 4CH3A 5IF0B 4XP1H 5D7JC 2VQFB 1FD9A 5DD1L 1E6JH 3IWUA 1QU7A 3T3YA 4XZPA 3NN8A 2IV9A 2A9ML 2B1AH 3CH8A 2W0LA 1P69B 2P5WA 5D7JA 5A7EA 1JS4A 3QUXA 5I1HL 2PHRA 5HDQH 3W9EB 2WK2A 2OR8A 1G0DA 3G04A 2GSMB 1QHTA 2BMKB 5TF1L 1JYCA 4GJZA 4CBCA 3MUUA 3NFNA 1X5XA 4HGMA 4JLRA 5CO1A 3FB8A 3QIWC 4LF8B 2VR4A 3ABGA 2AEQL 4JDEB 5LNEA 2BNRE 4ABVA 4DP9X 4Q4X3 1XVSA 4AVCA 4LP5A 4NTYA 4PDRA 3B2UC 4GP5B 4U2ZA 4OV5A 3CK0H 4TNWK 1MRDL 1IEAB 5C0FB 3FSAA 3ILDA 3WTSA 3HEIB 1ZLSH 3QUXB 3BAEH 1NKGA 2YXFA 3WAKA 1FXKA 4E41A 1G8WA 3ZPOA 2PI4A 5DD6B 1N8RW 3NRQA 2EZOA 3MRCA 2CALA 4V1DA 4YJ3B 3SJVE 3ULUL 3QRGL 3BSZA 3TZVD 2GUZA 4HT1T 1O6SA 1J8HB 1NZRA 5DEDA 3H9HB 1AY1H 1GIGL 3NP3A 4YHPA 4HBNA 3T4AA 3CZLA 4GW5A 1XNQO 3RX5A 4YXHH 1AJOA 3VDCA 2RE9A 3CXCU 4IEOA 2IEPA 2EDQA 3NZSA 4AJ0A 3MROA 2JG9A 1S4CA 2X5PA 3B1TA 1A9EB 1FG2A 3H7JA 1BJ1J 4IL7A 4NROA 3FBKA 1BG9A 2VUJA 1G4RA 2DQGH 3OAYH 2C3HA 3G6JE 3MRRA 2JK5C 4XX1E 5EDXA 1Z5LA 3VG0L 5LG6A 3RFZB 2LTNA 1LD9A 4HJGB 2WKLA 5J56B 1NCAH 1TQWA 4U6XA 5J36A 2EUXA 1AO7D 3MZHA 4YAQB 3BZDA 3BAAA 4DTGH 2B08A 3B83A 3HNTL 4MAYC 3ITQA 1S4IA 1U92B 3KPNA 4E4ZA 3V0AC 1D5RA 4MX7A 4X5WB 4IU2A 4AQTA 3IN9A 4AVAA 5J3UA 2ZNXA 3HC3H 2E7LC 2W87A 1IAKB 3NIFE 5HJGA 4NHKA 5I8YA 1B6QA 5EBWC 1UWGH 3E8BA 2JIXA 4OUUB 5I8EA 3WB1A 4IIQA 3SKJH 3TJEH 5EF0A 4DQOL 3F7YA 3JWNC 3EYSL 3U6RB 2H6CA 1LK2A 1V6KA 4ZUWA 4K3DH 1MWOA 4LFCB 4G8AC 1PFOA 3GHBH 5EC2A 1CK0L 1X6NA 3IDYC 1WW4A 1NCRA 5L3GA 2HWZL 3AP9A 4N2GA 5I1DA 2DLIA 1A6VL 5AG9A 4JI0O 2OS7A 3J07A 1N6VA 3ZK0A 2YIBA 2VVDA 4Q8LA 3RPBA 2NSXA 1B0GB 5EC2B 2I5YL 1EEYA 3IBEA 4CCLA 3DX6A 3C87A 4WJ5B 4QHLA 3ZGIA 4PN6A 5HD8C 4Y16D 3DOHA 1V9U2 2R9RB 2OVUA 3A4UA 3MIDA 5D6CA 4ZFQA 2FE0A 4U3SB 5CBAA 1SDAB 3X3FL 3N9QA 2R56H 3V6OE 4F15C 3W7UA 4PG9B 1DBML 2BP8B 1GWLA 4X7SH 4L05A 2ITDB 3ZTCC 4YHZL 1CWPA 4GIPD 1IKFH 4GX5A 4RCAA 3CCEV 5DQ9B 4EWDA 1PYWA 1Z3GL 1EDHA 1UD8A 2G9HA 1XSQA 5EK0A 4NEHB 4JI7O 2V7NA 2BY2A 1C5IA 4GH7B 2PCYA 5EPMA 4BXSV 5IVZA 4OHWA 1FL3B 5DDJ3 2D7FA 4GKKO 3GKWH 3WP6A 5TPWL 2VGDA 4KRNA 2IQAB 1XR9B 3B8MA 3HKBB 3CBKB 1GZTA 2WHVA 3AVEA 4H88H 2JG9B 5T3ZE 3KM5A 3ULSA 4PRHB 1EXUB 1U3ZA 4PLMA 1HSAB 1SQFA 4O2BA 4X4XA 2MHFA 3GINA 3V9FA 1XPWA 5G05L 1R73A 4OTXL 5IY5C 1FH2A 4AY0A 2FQFA 2ZAHA 2AXTZ 1PNGA 1N70A 1WCUA 3LCPA 1PKQE 5E8NB 1JE6A 4HS3A 2VT0A 3M45A 3FT3B 4CL7A 2QVSB 1SHSA 1I7TB 1Q8SA 2P1YA 2P1BA 2GNBA 3WDXA 2DTYA 3BGFC 2FWLB 4FAHA 2QGEA 1CX4A 1DHKA 1WBXB 1Y0LA 1QDCA 4NO3B 3K74B 5GGVH 2GC4C 1GBGA 1W6MA 4FLXA 2HT2C 5IYBO 2F17A 4LCVA 4UUJA 3FTVA 5CJOL 5DAWA 1T1XB 2YXSA 3FTSA 5D2NE 2I9TB 1DVUA 3KYOA 1AXZA 1QVOA 3TNMB 4M4PA 1KTLB 2P26A 1TZHB 1UCBL 3PUAA 2XN9A 3VCLB 4XMPL 3J8F3 1BW8A 2NW2B 3G6DH 4JRFA 5LBVA 2Q86B 5FYCA 3O9WC 4YW2A 2YPVL 4LLWA 4EI5C 1RUF2 4ETYA 2ZWYA 1DBKH 4MJ2A 3OAYK 3MJ8A 1CLOH 5KSAC 1MVEA 1PCSA 2YPLE 5JR1H 3LQAL 2DUOA 2YPDA 1ZE3H 3G6BA 2WQ8A 3MMEB 1ZHKB 1PNCA 4KMQA 4B27A 2YQ3A 1YEHL 3DVNA 1QEWA 2MOVA 2Y7MA 2FH8A 3IFOA 3HI1B 3NH7H 3I3EA 3PAUA 4Y5YB 4YHOH 2AJ3A 4AR2A 3Q8CA 5J1XA 1SXCA 4MMYA 4U6TA 1K4CC 2DYSB 4WI3A 3MF6A 3SBPA 2ZE0A 5C8JB 2QQQA 5FY1A 3UGHA 1WV7T 3ULUD 4H20L 4I7ZC 3THMH 1K4DA 5FHAL 3S5LB 5CG9A 4AQ8A 1EFRG 2VR6A 3OR6B 5D4IA 2IXCA 5LWBA 2HT3D 2YD1A 2CG9X 4KVCL 1AJ7H 1JF6A 4MAYA 1UZZA 3SE9H 4NIGA 3HLAB 2VZOA 3QAQA 1ZV2A 3T1CA 2XHNA 1IC4L 3IJHB 3CRAA 4E9XA 4J3TA 4R4ND 5DWUL 5BW7A 1ENSA 4K3AA 1WQVT 3LIZH 2PWDA 4M6ML 2BEOA 1MY5A 1WLTA 1BD2B 4BSWB 5KVFH 4JFXA 4B29A 1RUPH 2G9FA 5I8OH 1KBGL 1YEIH 4ZAKB 4PB0L 3DHUA 5JLZB 2AMUA 1CFSB 3CCHA 4YW5A 4YH6A 3AMLA 1GM8A 3JZYA 3QUMH 4K5MA 3PG2A 1I94O 2HLAA 1E27A 3FPYA 1OCWH 1RHHB 1P4BL 4IBUA 4RGNE 3C9NA 4M6OH 4AL9A 3BPNC 4G8GB 2J5WA 3IXTA 2CTPA 4XVSL 5DHEA 4XDOA 3LV3B 3SY0A 2Q69A 1RHI3 4TULL 1JZ3A 5DJZB 4QHKJ 3ULAB 2AZ0A 3WNPA 2PLV1 3UBXG 1N1VA 5B1AC 3SKJE 5E79Z 1KGXA 2I85A 2E8YA 5CGBA 4K9JA 4FNUA 5MI0B 4A2EA 2A6XA 1MZ6A 2PCPB 4XI5D 3WB2A 4OLUL 5J6SA 5L2JB 2JEXA 3DV4B 4WNSA 1N64L 4JGSA 2WO3A 5JDSB 2OM5A 3D50A 5LAXB 1MI5D 3JASB 1LDPH 4GMTL 4MVBD 1MCPL 5FZ9A 1ZREA 4XMLL 3ZIAG 2IPTH 3FB5B 3JD1A 3ZPYA 2CK2A 2LROA 3VA6A 4K71B 3TO4B 1VQNV 4W6WB 2FWUA 1KEML 1Q4NX 1HXS1 4ZS2A 1RFYA 3WKYA 5HHQB 4QB2A 2AAAA 5TTRA 4CU8A 4TSAL 5KYXA 4NX0A 1UUSA 1JH5A 1URXA 4NAOA 5BS0A 1XUQA 1WA2X 2WQ4A 3QRLA 4V1PA 3DXRA 1XGYL 4U3HA 1W8HA 1A02N 3U07A 4B97A 2DVDA 3K03A 4JRLA 2BW5A 5DRWA 1GKBA 2PR4H 1UHVA 1SEQH 3KT4A 3UO2A 3FO0H 3VUAA 1UADC 2BGPA 1CXIA 5E03A 1S0BA 3WCSA 1D7PM 3AFKA 4QM9A 5D2AA 2IJJA 3NUKA 4UAOC 3T6XA 4XF0A 4S2DA 1KGCE 1YMMD 3QQDA 3KZIZ 2HT4D 2B15A 1S9KC 5F21B 3AG4C 1N5AB 2O26U 4P04A 2R6QA 3A5VA 2E4FA 5D55A 4Y1TA 4ZIBA 4F33A 4BK4A 4S1DD 1W0KG 3EYVA 4U3CA 3KCCA 5PAZA 3TOJA 1XDTT 3BRGC 4J2QA 1WS7A 2C1OB 4FLVA 4YIOA 4GQPH 2IPUG 2K0RA 4RBPH 5AW8B 1BGYH 1R0AL 4YW7A 3V6OA 3B7SA 1KDIA 3I9AA 5AOKA 3Q1SL 3GJFK 5JOPD 1PM7A 2V3EA 1ETA1 4L18A 4TXWA 4BFBD 1G4YB 2WQAA 1GVIA 3QG5A 5JOFA 1SESA 4IRSB 1MXGA 1PDKA 5EBGA 1TMF2 3TJHD 2W91A 2J88H 3D25B 3JT2A 4FFVC 3WW2A 3VHPA 4EN3A 2NPLX 4OT1H 1T4KB 4QJ5B 1COV1 4BUHA 2EZ0D 1QUNA 1X5JA 4G8IB 3QO5A 4QAWA 2DOSA 5E2TL 4P2ZA 3BEHA 5IG7B 3ZL4L 1VIBA 4KZEL 1M57C 2QKAA 1S7XA 1FNYA 1X82A 4JYAB 3O0WA 2V37A 3VQLA 1W03A 1NFDA 2ZWLT 4KC3B 1FMD1 2Z7YA 2OWOA 1MZYA 1UOBA 2OP4H 3HRZC 1SFHA 4K5PA 2C0ZA 2K3TA 4XCNB 1FJ1B 5KBDA 3QI9D 1U8MB 1YNLH 4LSSL 2J57A 4PJCF 1BAGA 1GKOA 3I6KB 2Y5EA 4LF5B 4MNQD 3F6JA 3P4NA 3TTSA 3VFRA 1UJ3C 4KHXL 1Q9WB 3UGXA 5L3FA 4KH9A 4Z23A 3WKMH 3QO7A 2QMJA 1KIQA 5EU7E 5GGUB 5F1OB 1H8HG 3ECVA 1KNOA 2PXJA 2ZKLA 3TCLA 3KGSA 3AM2A 5FECA 4Z92B 1NIAA 4IOIB 3IMUA 3VJ6A 2DAVA 4NP4H 5I8KL 4DPRA 1YMME 5C8CB 1LWJA 4FI6A 1R1A3 2RS52 2BNRB 5GLVA 3RSJA 3SDAC 3AG1B 1HCFX 3D2UB 3DBXA 4BDVB 2P17A 5LBCA 3RZMA 1XSJA 2B4CL 4HV8B 4FG0A 1USZA 3L4YA 5CLXA 1NTZH 3ASOC 4JAMA 4B53A 1K5SA 2AUYA 1FFNA 5D2NC 3FBYA 1HYRC 1MCEA 4R3SA 5I5MA 3K71B 1IS4A 4I0WB 4FKEA 4CC0A 2TAAA 2EUWA 1HXYA 3L8QA 3EGDB 4JY6A 2X1OA 4J3WA 5IJRA 2Z4TA 3OB0K 4QXUL 2QSQA 1BREA 1ZBE1 1S2BA 2DWEA 3ZVVA 4X9QA 4Q4Y1 3RL2B 3HZVA 2XTJC 3WNJA 4ZMVA 4QPIC 1NUFA 1CGYA 4E68A 3MV8B 5EU3B 3MYXA 3VXMB 3II1A 4XCCH 1CGPA 1KMIZ 3JV0A 5TK2A 3NCEB 2K7QA 1NC2A 1NEZG 2QSVA 4JI3B 4W81A 4AM0Q 5ICYB 1E9QA 1VACA 2ZX8A 5CZRA 5EZIL 4LKFA 3WW3A 1NFIA 1A65A 2E47A 1LU1A 3GBWA 9PCYA 5C7ZA 3JTBA 5AZEL 4OZHA 1FZMB 1HL8A 3JUZA 1JAEA 2R4SH 4PJXF 4U7MA 4BQ6A 4BQ3A 3WKPA 1LOCA 2NR6C 4Q4Y3 2FX7L 2G1MA 4AVBA 2ZX6A 5T33L 3OT7A 3DROB 4JJ5B 3UC0L 5C2UB 2HTKC 1M56B 5INCB 1FIGL 3KPQB 4OZHB 5TF1H 5TJWK 3V95A 3OPWA 2VDQL 2Y1YA 3VACA 2UZIH 3FOMB 4GBXD 4AMKL 5T3XL 3PVEA 5EO1B 4HCGA 1QNIA 3ZDZE 4GW4A 4HK3N 3LZNA 3TZVB 4K1YA 4OVEA 1CD9B 1S8DB 3ZKSD 4DERA 4XQWA 3C90A 5DRNA 2JX9A 3W38A 4KHPB 1DANT 1XTLA 3I2CL 1S3KL 3HG1A 5C0CD 2Y48A 5B1KA 4YG3A 1FCCA 3TONA 2UU9B 2CK0H 4G11A 3V10A 3RYIA 3HZVB 3OFNG 1VADA 3ETSA 3HPJA 4GO6B 4GNKB 4PB9H 2QGNA 5CN0A 1OE1A 3ZHVA 2W6JG 4BW9A 1DQDH 3DTUB 1NBVH 1URZA 3GXTA 4NUJA 5ELIA 1H3GA 1C5BL 3RGVB 5FB8B 3LD8C 1HXYB 3IWVA 1K3EA 2AGJH 3LY6A 3ENRA 1NANI 3PJSA 4HUUA 4XYXA 3OEHG 4O4YL 4CUCA 5A3TA 5DVOA 2XICA 1ZA6B 2VTXA 1U4FA 2KT6A 3FQUA 3R4SA 3EH4B 4QQHA 3TN92 1CD1A 3ILQC 4I0PA 4MWFB 4Z3JA 1FN4A 4XCEA 3GZAA 5KN5B 4N7IA 2YEQA 3B56A 4UTBA 4M43H 2OMUB 3CHQA 3HNSH 4ZHQB 3HNVL 4LF3A 2HB0A 5D5MB 1LESA 5DAXA 1ZTXE 3O2WH 1MCDA 2ZKHL 4Z76B 2P24A 3QLQA 3QORD 1QBML 2EVIA 2AHYA 2VDML 3BKML 2AXJA 3SPJA 4N8CH 4J41A 1XNTA 4A37A 2HYXA 1H8SA 4Z3GA 1XSRA 1NY72 1XMOO 1MEXH 4ADGA 5A2LH 4FOQA 4JCLA 3BIBX 2WUBH 4CDXC 2GBOA 1SHWA 3CFKB 4NPMA 3HJEA 4GI9A 2D3OW 1IBZA 1TVHA 4NIYE 4QRFA 5BNOB 5KVDL 4XCNA 4QU1A 3QHFH 4EOWH 3ZMRA 3MCKA 2TSBA 5IQ9B 3VFVA 5I17B 2DQIH 3BRFA 1KELH 5ABZA 5A3LA 3KLHD 1XGTA 1CE1L 4G1EA 4Z7WE 3VKMA 2OSYA 1NDTA 1VJ2A 1JZFA 4I5SA 3WP3A 3LEKA 5L3DA 5I0YA 4YXKH 1IVLA 3T1FB 2D3LA 2EX3A 4X8JB 2O8OA 4WWPA 2CH8A 1AR82 4XE5B 2R72A 4ISVA 2ARCA 3SDDC 2VL5B 4F7KA 1GTNA 3CVBA 3BIKA 4GAGH 3P9WB 2J12B 3G5ZA 2C2AA 2LRPA 4GH4B 5FPLA 1GGCL 1IV8A 3TO4D 3ML9A 3FN0H 5ACZB 3I6GB 4G71B 4N90E 5PCYA 4Z7OE 3S5YA 3EYVB 4YXWG 1M6OB 1TU2A 2O6FA 4E9VA 1TCMA 5TDNB 1WLWA 3E8FA 3HR5B 3IFXA 1COBA 1CU4H 5DJZA 3CC4V 2HX9A 1KPUA 2EXWC 3BLKA 1KEMH 2JD9A 2GI0A 4HISA 1OCRC 1KFGA 3B3IB 3HFMH 3U11A 4WV8A 3V8CA 1ZVHA 2IANB 2DYRC 5CA0B 5DRZB 4CDUC 2ZIMA 3MV01 5KYYB 4IGPA 4LEXL 5D5QA 4JKLA 3VGHA 3DX0A 3FFOA 4JAVA 4KPHH 1I85A 2XH6A 3NSCA 1QFWL 2ALAA 4WJKB 1HIMH 5C0ND 35C8H 4W4NA 1J5CA 1WISA 2BFUL 1JGDA 1QASA 1ES0B 4M0HA 4O9HH 3QEUB 1L9PA 3NAPB 4BCUA 2WUBL 3K5OA 3C09C 5FW7A 2Z4QB 1AF9A 1TCRA 2CSPA 2PN5A 5HI4C 1CYXA 2IXJA 1EEZB 4MXWL 4OLWL 5IOPB 4JC1A 2AHIA 2AEIT 4AIZA 1G7HB 4BUGA 4XBQA 2X4SA 1R083 1YEDA 1OXYA 5DUMH 2BGOA 4M00A 2R8SH 4LMQI 5LEKA 4KTGA 5IAXA 4M43L 4BB3A 2DH3A 1VF7A 1R3LB 2IF7A 3CSGA 3HLKA 4X5PA 5E4EC 2ID4A 3G80A 3H01A 3LDKA 2VVEA 3M8AA 2ZEWA 1IGJB 3F83A 3AG3C 1QR9A 4ADJA 2W9XA 3WDHA 2EVJA 1S2KA 2MTAA 4GRWE 3MXVH 4J7JA 5F9OL 2H47C 1K5JA 1N32O 3IFOB 3BPCB 3DK0A 4GUPA 1MIML 1UM6L 1L0PA 3NPSC 4K7FB 4DP4X 3W5MA 2ZZJA 1YMHA 4QR7A 4E9QA 2Y6LA 1ZM1A 2NX5B 2UUBB 5FM5O 1W6PB 5IW0A 2RCVA 4Y9GA 4EN3C 2P52A 4Q4W3 1F3RB 5JHDD 5T3NA 3BPOC 1Z9MA 4MXVE 5DJCA 2I7SA 5C92A 1U3HD 2A99A 2E51A 2XRAL 2GHWB 3GB7A 3US9A 4I0BA 4D8MA 1AR72 1U8PB 2FCBA 2C1FA 1NUKA 2ZNWA 3M1BB 4BIOA 1EPFA 4E2LA 4LUKA 1Q8OA 5I30H 1YNLL 4LSSH 1U8CA 4ZAKD 2A6DA 3AT0A 3HQUA 3GHMA 4JI1O 3M3OA 1M7IA 4Q6IA 4NQXA 1GICA 2PPEA 3KW7A 2BSBA 1CZSA 1FSKC 4JQIL 3G9VA 3MDSA 3DI2B 3ZYZA 4YUEH 2B46X 4P4KB 5JMRA 4N5ED 5JI7A 3TC9A 2VDOH 4QTIL 1QJU3 5F7DA 5MHSE 4TQ8A 2PHUA 1PMYA 1IKNC 3RBGA 3ARBC 1UZ8A 5GRYA 2R062 2FEEI 2AENA 2ICWA 4K3JH 4ONFH 3DO7B 3ILNA 3BLPX 4NQDD 1V55B 4E5XB 4QRPA 4APQC 3O1VA 4CCOA 3BAJA 5D2LA 1G0YR 1J1PL 3H7BB 4M03A 1V6OA 5JOYA 5F3FA 2AK4E 2YJLA 2J7MA 4N8MA 2QMKA 1BM3L 1ML0A 3NFSL 2G9HB 35C8L 5HDBE 1QZNA 5A3NA 1NH2D 4M7KH 5T1LA 4A7GF 2JEMA 4ANUA 1HILA 2IOIA 2W0KA 1LEIB 5DC2A 5EN2B 1YECL 1LMKA 3KBEA 4FE9A 1HWHB 3PFQA 1SF5A 4A5UB 3S8FB 3LYRA 1AL22 1WD3A 3D05A 3U2SB 2PHWA 2APBA 2BWQA 3QIWA 5C93A 3JAMN 3GBML 1JXFA 4MAUL 1HKLL 1T03H 4ZPTB 1XB3A 5BQDA 3ZMEA 3HR0A 4K40A 3JVGC 1YIPA 3D0JA 4F3FA 3T8VA 3UXFA 1BFVL 2VRZA 1JWSB 4N3TA 1DFQA 4WZ9A 2GT9A 2EDHA 5FUCE 1J84A 1EY2A 2QQPA 4Y1SA 2FATH 4KTEL 1TVGA 3VFTA 4GBXB 3LQCA 2AMGA 2Z64C 4LP8A 4XRCB 3G67A 2PTTA 1D7BA 2CH7A 1UKQA 1E9PB 3PWLA 1DQ4A 1LK2B 5LB6A 5C3TA 2YPJA 3W7WA 3MRNA 4DR5B 5LL6Y 1E79G 2H94A 1RUMH 1W0JG 3MODL 4LLDA 4BGDA 4OCXH 2Z79A 3ZYHA 1L8DA 2G5BA 4LCIH 5BZWA 3WEBA 4X5WA 1REIA 2FT6A 3CLPA 1MIEH 4QJ4B 3JD4A 3NDZE 2UWCA 1UXWA 2LQRA 4HFSA 4QX2A 1U8IA 1IARB 1JPSL 2EE2A 1V7ML 5JJNB 3NCYS 3KWWB 4NNYA 5E94B 3ZXDA 1MLBB 3HR6A 1DTUA 2WOBA 3ZL4H 4XJUA 4FQPA 3R1GL 1AGFA 1JMKC 2B5IC 4HBCL 1XMQB 2ZR2A 4ZD3L 1JI6A 1IBLO 4Q5OA 1NQTA 4F6EA 2MIZA 3FCUB 4HKOA 2BP8A 2G2NA 2G5BB 1BEYL 3X2QB 1EANA 5DD1H 5FYLD 4ZTOH 1OE2A 3ZE1F 5F3BB 3K2OA 2E7CA 1OW0A 3OVUB 1UY0A 2QQMA 5FUPA 3K59A 3SQOA 1KWGA 3ABLB 1BMGA 1NMCC 2EXTA 1V6IA 4JI4O 4B9KC 5MEPB 1ZVSB 2V2TB 2ZGKA 4OHXA 5IHWA 5FZGA 3MDJA 4HWNA 3N1QC 5F1IB 1BGXL 4GBXA 1BFSA 1VGEH 4XDPA 3KPRA 4JV5O 4N2MA 1UZ6F 2JWPA 1V6MA 4GP8B 1PJWA 4J7KA 5JPNA 2X12A 3CV5A 4MHHG 4P9GA 5I8SA 2CJSA 1CD8A 3U30C 2WJSA 5BV7H 1F4YL 4ZUWB 4RRPA 4ZPTA 5FYLL 2BSSB 5FLXN 5ENWB 1OSGA 3IGUA 4IIQB 4J5VA 1RUH3 4YDKH 2MW2B 2YARA 5I8EB 1X9PA 1O7SA 5HVHB 3O14A 1I53A 3FQRB 1B04A 3TLRA 3ULUH 1NSNL 1R75A 4WGVB 1AZDA 2VBPA 5GISL 1P5UC 4OM1H 5JQGA 4R4FL 4BQ1A 1JCHA 1YIFA 3QPXL 1CFVL 4JKPL 1FPOA 3M7AA 4BBWA 4MLSA 1W0PA 5IAVA 4I0AA 4Y4KB 1YHPA 4EAEA 1CICC 5LMNB 3D39E 3MUZ1 4G70B 5FYKU 3V6FA 1RUG3 2BRQA 4JYYA 5FZ6A 4WNQB 3W0WD 1BOGA 2GY7B 3SKNA 3D0LB 4CVXB 3VI4F 5DN6G 2AGAA 1J8SA 3FXIC 4ZUVA 3MFFA 5IBLD 2XFXB 3ZE2E 4A68A 3S4SG 2XFXA 4PW3A 4C58B 4LVEA 2XV3A 2PAMA 1DN0A 3PIQB 3TETA 2R073 3ULVD 2JE7A 4HN1A 3E80A 3T3MF 3V0HA 5FZLA 3SLIA 1A3ZA 2BNUA 4DGYH 3VDDC 2K1EA 3DEMA 3UBXI 4NN5B 5KXEA 4LEBA 1S5JA 2EILB 3WG7C 4P9OA 3M1OA 5KOMC 1CU4L 3LRMA 3MRCB 5E5MA 4DUWA 4P9HL 3L5HA 4U6YA 2D5HA 1IHMA 2LT9A 3RPIB 2WZR3 1MJJA 3G7TA 3PY9A 5LLIC 4AQ2A 1QLEC 3HKCB 1OPGH 3QUYA 4EN3D 5JXED 1A22B 4DP0X 5DJYA 1NDMA 1SEBA 4FX5A 4Q2ZA 4K8RB 5EBMA 1QEXA 1MQKH 2WNVA 3OJDA 5HHPB 4Z5RB 1UJTA 3RG0A 1CZVA 1L7IH 1OGSA 4NTWA 2JJTA 2DVFA 3KQ4B 3EO0B 2B45X 4O2AB 3PU3A 2X28A 1O9WA 3K2UH 4XGZB 1FQ9C 2EUVA 4BZ4A 4CSPA 4R97C 3IJ4A 3GJFA 4K5OA 4RISL 4E0RA 4QRRD 3KYMB 3KVAA 3D51A 4Z7QE 2YPLD 2CMRL 3M70A 2RA1A 2YS4A 3TBDA 3L3DA 1AR93 3UGFA 1QIQA 3DYMA 1HC1A 1JSYA 3FUFA 1MCCA 1NBZA 5F88A 2WZ6A 4DO4A 2OPWA 3MIHA 1NIDA 2UYAA 5CFHA 4Z7OB 4MV2A 2QBWA 4JHTA 2CJTA 5DURD 5FOBA 1Z3GH 3RGVD 1ZGLM 1GYCA 2KL6A 2G4GA 3PWPE 4LNUA 2MSPA 4Y1AB 5AL8A 4RUEA 3TH2T 1FOD2 1CF8H 2K78A 1CI3M 3RHWK 4HANA 3X14A 4RSUA 4YLBA 3SH4A 2F54B 1WUZA 1W3VA 4K7PH 5CILH 5KHKA 2RS33 3GZTB 1QRKA 2ZGLA 1J11A 3ZGHA 4O4LA 3AY4A 3AG2C 3NOIA 1ONQA 1J1XH 2R2EA 4G9DA 1IPJA 3LSDA 3DL3A 4H5SA 5IVOA 2DJSA 5DR5L 3UO8B 3IDBB 3ETPA 3N43B 4G6FD 4GB9A 2WLNA 1A7OL 3T2NL 4PD4J 3UTSD 4XVHA 1IS6A 4DGYL 2WABA 2WVUA 2R2CA 4LCYB 5DG2A 4OJYA 5BOPA 2UWEE 2A71A 4X6DF 1OHQA 1HSBA 3MR9B 3QDMD 3JBG7 2O5YL 5E2JA 3K5LA 5C0AA 4E9YA 2X8KA 3TYJA 3SE6A 3IK2A 4YY3B 1LILA 2NY3B 3K7UA 4LF7O 1I8MB 2VO5A 3PHOA 4C56A 5ISZD 2PFWA 2VRAA 1CE1H 4IK7A 5BPPA 1WYJA 3QH3B 4NKMA 5DRZA 1GTFA 1EZVY 1LO2H 1UY1A 3MLKA 4KXBA 3B8SA 4YPGA 1Y74A 1ZXQA 4R5VA 3SH3A 3HT1A 2YB7A 1KLUB 5BRPA 2UXTA 2Q30A 4YBLC 3DX2A 4RNRA 2IJIA 4ZU7A 2X44D 5BO1H 4X0NA 3D9AH 4QRPD 4F91B 3ACLA 2YJQA 3ALQA 3TL5A 4HKBA 1MS3A 3QIWB 1CL7H 2HJLA 4FZEL 5JORA 1B0IA 1KCSH 3FRUB 5I6KA 4KX8A 4M1DL 3ZTJG 5SV8A 4LKEA 1KG0B 1U8QA 3BIKB 1EVTC 3GBNH 5MEOA 1NCQB 4FM0A 2UY6B 2IAMB 1G9AA 4XNUH 2WCGA 4XNZB 2XXCB 1CL7I 4ISVB 4LSVH 3RWFA 2RMU1 1JHTA 4JM2C 1W2BU 4JI2O 2GNDA 3QRBA 5CIPH 2J8UA 4LZKA 1KECA 1MHEB 4BWTA 5FYJU 3MLVH 2Z69A 2Z1KA 2XT1B 1JCKA 4N0CD 1HTYA 2BNMA 4R7DB 5F8PA 4WFGA 1US6A 2NQ3A 5K9KA 1QSVA 2PUQT 3GDCA 4YFLI 5HHMB 1KS4A 1UL9A 3VDDA 3ZYIB 3QO8A 1M7DB 1N2RB 1QABA 1XIWD 1HW5A 4IUGA 4M8RA 2BOBA 4M7ZB 4WUUD 5ESAB 5GS2D 4AQAA 4C4KO 3KZ8A 1H2MA 4Y24A 3ZDZB 3KDMA 2DCYA 3SPGA 1SFPA 2J20A 1O4TA 4NZRH 1QNZL 2VLKA 2X70B 2K4AA 2Z93A 3DHMA 5KHHA 2F53D 2XV0A 3O65A 4NJ9H 4ZPVA 4GLXA 5DD3H 4EUPB 3D06A 3IPBA 4D9QE 1QHOA 4B9IA 1V0AA 4P2CG 2P24B 1PZAA 3KLSA 4X98A 1MS5A 3HBZA 3V0AB 3WD5A 2JEUA 2XETA 3PAZA 4R6UA 2WYSA 3POSA 1I9EA 4LRNL 4Y5VB 4Z7AA 5FK9A 1TMF1 5EBWB 5E9NA 7FABL 2WS93 3AZUA 5IJ0B 3IF1A 4FPLA 1JV5A 5GS0D 5AW0B 4JFDD 5I2IA 2Y72A 3ARBA 2GK0A 1XH3A 4JZRA 4KNQA 3VBRA 2F8VA 4JM2D 1G0XA 3H42H 4WU7B 5K93A 5F0MB 1XE8A 1QXRA 1TITA 1W2AX 4J8QA 4A7GA 3NKTA 4Q4Y2 5T50A 2VXVH 2FJFA 4FMVA 3CMOL 4MJJA 4BFRA 5BMFL 5ITBH 5EHDA 5A32B 5IHRA 2XBO2 4TUJA 2QQKA 3QUML 4HWEH 4B60A 3N9MA 4RGAA 4K7FA 1SJEA 5EC2C 2OQJB 3M17A 3X11B 4BA0A 1V9PA 3APBA 5FMBA 4MUVA 5I0SA 1JODA 1BXXA 1R3HA 5FCUL 3LSOA 1JPFB 2A1WL 3TBSA 1IS5A 1F11A 1FV2A 1TETL 3REWB 2Y60A 3BKZA 1HOEA 5GGSY 3QDMA 1DP0A 1BFTA 1W72H 4D2NA 4TSBH 4ELKA 2ITDC 2ARBA 2I60L 3IKWA 5CJXA 1XR8B 1YMMB 4YLQT 1DVSA 3QNZB 3I97A 3K4AA 1LO4L 2A9DA 3CX5J 3ZBMA 5JZGB 3LVEA 2P45B 4O4YH 1XXDC 4HZAA 1RFDL 4HOZA 4DRVA 1NLBH 1IM9B 2HAZA 4BWOA 5JWPA 1AL0G 1U4EA 4DKEL 2YAHA 2NNXA 5T5NG 5EQUA 1Q0XL 4J39A 1ND3C 2JG9C 4UFJA 4R52A 3ZEDA 1SFDA 3NZHH 3D4KA 4E8CA 5DFVC 3USSA 1A25A 3SITA 4N53C 4YR6A 1KXTA 2DIBA 4V11A 4Y16A 3CFBA 4FQ2H 3ZTDC 3BHPA 3F7RA 3WV6A 2ZX1A 2WA3A 3EO1A 4IE0A 2KH2B 3IJEB 2A4ZA 4FFYH 5T3XH 5DGQA 4HIXL 4B9YA 4N2HA 4A7UA 3OMNB 4JFDE 3EXLA 4RIRA 4CNIB 1CAXA 3HZ3A 2A38A 2WXGA 2BIOA 2GW5A 3UTPE 4XW3A 1WEJL 2GAUA 3IJ8A 4YW1A 3L75H 1M2VB 1JRHL 3ZDXB 1Y9QA 1IC1A 3MQIA 4ZX6A 4IDZA 4UM9D 1ND2A 3I6SA 3NJVA 3CCQV 4ZUVB 5JHLH 2X0LA 3FB8C 3AYAA 4XP5H 5C0EA 1LEGA 2VW2A 1GL4B 4WNQA 1JHNA 4B6ZA 2YRBA 5GLZA 5C8CA 5IMMB 3O9WB 2ZCHH 3VXSD 1P84K 1U42A 4FKHA 1R34A 1U58B 4M5YL 3ZE1E 1P7HL 2DWXA 1F4XH 3E9TA 2FO1A 1XE0A 5J96B 4NUGL 3Q1SH 4XDLA 4EUPG 4X9FA 3ZYOA 3CTTA 4Y89A 5HV0A 2P5OA 3IMWA 2IWKA 3MIEA 5I1AA 2GC0A 1UATA 1WUNT 5LA6B 3OE7G 1LHZA 3E22A 1IJNA 1DVQA 1OP4A 4R7NB 2JB6B 2DYSC 5FKAA 3RQ3A 3IDGA 2AREA 3EJZD 5C0AE 3ZW3A 4RDQF 1AQDA 1R24A 1X8EA 3Q0HA 3H7LA 4Q9CA 4EDWH 3GLAA 5B3NA 2VDRH 5I18H 2ZM6B 1YDPB 3QVNA 1HOCB 1HZHH 5J6GA 3MW4A 4TLKA 4JS7A 3IGKA 4K7PL 1Q0YH 4OFPA 5CILL 5C0AD 1N47A 5FUNA 1UFGA 3OTTA 4YLZA 4DV1B 3RRQA 4HULB 3DVGB 1TUBB 4TOIA 1OAUL 1MRFL 3BD3A 5F89B 5EEVA 2WWNA 4X9YA 3LKPB 3ULUE 2UZYB 3STZB 3BVWA 3BCDA 1B4RA 4MTXA 4PCRA 2XWZA 3LB6C 4ODUB 3WI9A 1AHWA 1OAZL 3ZMZA 1PK6C 4RQQA 2AW9A 3K2IA 5I8OL 2XVKA 2UY7B 2O93L 1A66A 3E6CC 3CS5A 3A47A 1AD9A 4W9KC 1EV12 2EDBA 5EZLB 4NQEE 5SWQB 1AHWB 4CEYB 4L8QA 5DFTA 1FYHB 4HEME 3VRIB 5CCGE 3K4DA 5JXEA 5BVJB 3L1OL 3PU7A 1OK0A 4ANVA 1Q1JH 4HD9A 2ZHLA 3LOWA 3NV1A 2FYVA 2XAQA 4AG4H 3AZZA 1N5AA 4RVBA 2MQGA 1DQML 5JQ6H 5J11B 2X4OA 1UXWB 3VXRB 1E90A 4YZ1A 4OI0A 1LR1A 2UUCB 5C6TL 3OOXA 3FU7A 1KULA 15C8L 3HJ0A 2VMHA 1AVMA 3EG9A 1BVOA 5FZCA 3ZTJH 3P02A 4Z3HA 2P42B 2P3IA 5I0VA 2X1WL 4LASL 4JO1L 2IFGA 5AC93 3UTZB 1R24B 1SXZA 1Q82W 1P2CA 3FT2A 5HHOA 3OKNB 1HINH 2WSDA 4PA6A 3BU7A 5FFLA 3VBFA 1W0YT 4QRSB 2P5EA 1KJRA 2WLQA 1C1LA 4LO8A 4BRJA 4YBHA 1HRI2 5DJ6B 3C5ZD 4PRIA 5AVUB 2GT9B 3PGCB 3GBFA 5CCKL 1IC0A 1HIML 5EIYB 1WIOA 2ISDA 3TBWA 1W9SA 3VFSA 1XX9C 4DGVL 1ORQA 5C0JA 4LBMA 4PWJA 3Q2WA 3C2UA 2P7TB 4IYKA 1RZFL 4JFQA 1JFHA 4MZ2A 4PS8A 2H6PA 1CVRA 2BNQD 5ICYA 2YD5A 3DX8A 4YO0A 3SJVD 5ID1B 4O02H 4Z7UA 2WP3T 4SBVA 1XF3A 4IETA 1VFAA 3ABKB 3STLC 1MFUA 4KL1A 2QR0A 3Q6FA 1O9GA 3I75B 4R4FH 5FY8A 4L0PA 1KLGA 1EHAA 5D1XE 2W65A 2IQ9H 5EC1B 2BHFA 3WFBL 1ZGLB 1QR4A 1U8LA 3GF6A 3T30A 3MUY1 5F7HA 1FAIL 2RQ8A 1LOAA 5I18L 3ELAT 5J09A 1KJ2H 3O11B 4DRXA 1CFNA 2OTWA 4UXAA 4AL8L 3ZDSA 2XN0A 3C9NB 1FT9A 1YXBA 4MTOA 3NV4A 1RHHA 1YN7A 1JI1A 4AUYA 2HWF3 5DUXA 4D9RE 3K51A 1IUZA 3LE0A 5FUIA 3IB4A 4F27A 4BDVA 3L5IA 5DK2A 2C7FA 4WY7H 2BNRA 3EUUA 5ANNA 1ZWIA 2YZ1A 4X6FA 1EO5A 1K2DA 3DXAD 3KPOB 2D4FA 4TTDC 2Q20A 5DJ8A 5LBSA 5TF0A 2FVNA 2XMLA 3JU9A 5L8LB 3ALWA 3BISA 1IXMA 3PQYE 4RL7A 2WLJA 4FTVA 3ULUC 5FAAA 1MQTC 2XRAH 1HQ4A 1GZ9A 1RUI3 3WY3A 1XGRA 1AILA 1NGPH 1BX2B 2COVD 2XA8H 3F5WB 2BOCB 5FXCH 4DAGL 1KJLA 5T5OA 1PKQB 5KXCA 3GEWB 5KSAB 2D6PA 1JUFB 4HUCA 5A70A 3UT5B 1C5DB 4FLOA 1NC4A 1AYN2 3M3CA 3G6JF 5BXFA 3H3UA 1HHIB 5IYDO 2ZX5A 3EW3B 4NN6C 3PUCA 3T0AA 1QJFA 4UFKA 3LZLA 5T55A 1MH5A 2HH0L 2X7LA 3RNQA 1JF1B 3F65A 1U21A 4G6KH 4OGZA 3SDAA 1NA1B 4XHXA 1AR2A 1QSEE 3Q6GL 3RVWD 4OF8A 4PRID 4XP9H 3ZSKA 1AIFA 3VXUB 5ITZB 2WT2A 1R3IH 5J8OA 2CMRH 2WTOA 1D2PA 2FTAA 1CQKA 1U6AL 3WY6A 3ASWA 2FEDC 2FMLA 1X33A 4W9IC 4X99B 5IREA 2EC9U 2XN9B 1I1AA 3RNQB 4DV4O 3SDAB 2D73A 2VZSA 1Q9LB 1TQCC 3AREC 4MS2A 4N5EC 4TUKL 1IGJA 5C70A 1OD5A 2F95B 1BCXA 4LH6A 2R0ZL 3IFLH 4OFYD 1ZLSL 1GZWB 3ROOA 3O0XA 3BZ5A 2XUWA 4TYSA 2JDAA 4LWSB 4KXCA 3V0EA 4QWWC 4UILH 1TVKA 4JPRA 4EFEA 4HZLB 5I0XA 1IAIL 3AWEA 5EA0H 4JQRA 4FO9A 1QJU1 1H2NA 2QE7G 4WK2B 1F4AA 3VGFA 1QQP1 1BZ9B 1E3XA 2Q8AH 3NABL 3BPNB 2UYLB 4ZMPA 5LDSA 2XACC 2UWEA 1G7LB 1WSST 4G8EA 1HKLH 2MKWA 1T03L 5L4IA 2F7IA 3KLHC 2BSTA 4CN1A 4DOHB 4N0UA 3MHSC 1KBPA 4YHIA 4PJBB 3ZQ9A 1JHKL 1KCSL 3O4LE 1GGYA 4LSUH 5BNPC 1LO3L 3MAWA 3OTOO 4O4HA 4ZXBD 5GZNC 4IOFC 3L2HA 4JM0A 4Y4FC 4ACPA 2HFGL 2FZ1A 4YIPA 5IHUL 1J5OL 4URTA 5DYOB 3CSFA 3I3BA 3LKJA 4QPKA 1SLAA 2XKSA 2O61B 1CDCA 1PNKA 4TUKH 4MDIA 3OJBA 1P53A 4FSJA 4N53A 5HHQA 3OD0A 5GTIZ 1CGVA 1IB5A 4K71C 4JRYB 1XL4A 5AVQB 1ZS2A 2ZOWA 5BXFB 3GLEA 3SKJL 4WIQA 1YYNA 3WHTA 1G43A 1VQKV 3P3UA 5T5FL 2VZQA 4AKPA 3NJGA 5HGHA 3MLWH 2VNCA 2D4DA 2OCCC 1NSNH 4GSRA 4O2FA 4XCCL 3UJJL 4GUOA 2ZCEA 3O1MA 3IT8D 2BSCA 3QCVH 4HEPA 4JPSA 4UNUA 3TZVC 2F1AA 4YL4A 5LN4A 4JQIH 5A6ZA 4HXBH 2OXGB 4U1NA 4IRJA 4MCYA 4X99A 1WNSA 4JPWL 1QRNB 1DVZA 1IBFA 1J8HE 5HI5C 1TQBC 3DHPA 4ESKA 1PY9A 2Q67A 3T1FA 3NJXA 4LO7A 1ITCA 3MRPA 2O4EA 1COWG 1ZV5A 1RYYA 1JZJA 2IH1C 4JFEA 3V9CA 4R83A 4DQOH 4YSEA 2JLPA 1G7QA 1DE4B 2V7HA 2VDNL 1T1ZA 4AYBA 4C56B 4L11A 3FTGA 3IETB 1UWXH 4PJ7F 2QWRB 2CXKA 2GIXA 5LXTB 3PUUA 1PPIA 2ARJQ 2AANA 2LOEA 2K46A 4LBOA 3VUOA 1GV9A 1ED3A 5ES4B 3RWDA 3BUDA 3S7EA 1QBLL 2IWGA 2Q76A 2BSTB 4FULA 3S97C 4ONOA 2DH2A 3VWJA 4IJ3B 3U48A 1MEC2 1HH9B 4LSTL 4EZMA 5I1EL 1U92A 3S3XA 1BHGA 2AQ1A 2BJMH 2X4OB 3QEQA 3S6CA 4K0KB 5CZVL 4PJXE 2WXIA 3AXIA 5D7KD 1Z9PA 2J1RA 5IJCC 2KKQA 1OZTG 4JHBA 3RU8L 4JPWH 4PVLA 4RWYL 2VE1A 2C24A 2X4PA 1FVCA 2H4EA 3GM8A 4CDXB 1J0YA 3QG7H 4NFCA 1YEFH 4WFFE 4RMRA 4WF9V 4F7CB 1RPQA 5INDB 4JVUA 1TNRA 5HHVH 3BQVA 3GJBA 1AE6H 4ODXA 2VDLH 3C60D 5EU5B 1PBYA 4B3EA 5KW9L 2R83A 4GRLC 3EYFB 4RQPA 2EZPA 4HK3J 3DGCR 4KO5A 4ODUA 3ROLB 4CCDA 3LNDA 5ANHA 2E4TA 4KRMB 1Q9KB 3LXBA 2BVBA 3CJHB 2JRIA 3DI3B 4W65A 1E4WH 4FPKA 3BDYL 2YROA 3IPVA 5EFIB 5IVCA 2LR4A 2VM4A 4FQJL 1H9DA 3ICXA 4B9JA 2H6UA 2FYYA 4GRMB 5IHUH 5IFAH 3K75B 3SMHA 3DUIA 3ZXFA 4JFTA 1RMU3 3HG1B 2IMMA 4P08A 1GZPB 5F44A 1QFPA 2A77L 3TH4T 4YIQA 3DX8B 4YO0B 2VZ3A 2DLFH 4XMPH 3RY4A 3TNMA 2DQJL 1DUZA 1NCAL 3K4ZA 5DDJ1 7CGTA 1NAKL 3OAWA 3HOGA 3ETBJ 2BTQA 3CC7V 1FYTE 3C5ZB 1NDMB 1HINL 3NIDF 4Q2ZB 5T5NF 1ZVFA 2DQTL 4P2RB 4EWEA 2GVYA 4WO4C 4M1GH 2D7OA 4PQ9A 3TV3L 1DO5A 5F8QC 3IVKB 1P5UA 3AJ7A 3RY6C 1O5PA 3ZHUA 2QR4A 3EFFA 2IDFA 1GK9A 2UV3A 5DJ6A 4GB32 4QU2A 1FAIH 3J7MA 4HIIA 5DS2A 4M8QB 3FT4B 4N0YH 2ADJA 1VJSA 3V55A 4CDUB 3UG3A 2FL5A 5FYJH 5C0CA 4FTEA 3B9KB 4MVBC 5HHXL 4X4XB 4KK8D 5DHYA 4L8DA 2P5WD 1PZUB 2ZKNA 2B39A 3BFRA 2LAGB 1KYFA 3WXPA 1LO2L 1M9WA 1G1XB 1R5IB 4HG4J 4KUZL 3QXUA 1QX1A 2MRYA 4LCWD 5AZ2H 2CBPA 2W8CA 3Q8FA 3MCLL 4WFED 4ZSOB 4B50A 1AS6A 1AHMA 5IVZB 3SHRA 1IC4H 5IW6A 1SXAA 2YIBD 4YNYB 2YXWA 2OTJV 3FB6B 3I9PA 1NKDA 4LF8O 1WBYB 3N6YA 2V7NB 3QUZC 3TFKC 3WYRA 2Y7LA 4DW2H 4QX5A 3MJWA 2BJSA 5EU6D 4HFUL 1AR73 5C0RL 2LU5A 3SBRA 2VRQA 4XP6L 4QD2A 3Q6FB 3BWUC 1YJDL 4DP5X 1GU3A 4B4PA 5DUML 2KZKA 2LW1A 3KJ6H 1LTEA 3SJQC 1VEWA 5ID1A 2Y8KA 2VC2B 5KJRL 1YNAA 1J1XL 4PJDE 4JE4B 5D1QE 4PTTA 1BVLA 1RUKL 5D6CB 2DVGA 3RDJA 2OQ6A 1IT9L 3R4UA 3O0RL 4K8RL 1JS9A 1L9SA 2BVPA 3SDCC 5EFUA 1DJGA 1NL0H 2X7RB 3L3OB 4NNXB 3DWTA 2MCAA 1PZ7A 4KNCA 2YAEA 1OV8A 1IEHA 4WGWB 3L4UA 5T1DL 4FXKC 1RIUL 2OW4A 4F1ZA 4I55A 2HT3C 1NWOA 1PP9H 4DR1O 1RZQA 4JM4H 1KB9F 4QRSA 5CGYD 3VFWA 5IBUB 2QQKH 3WS6A 3HC4H 1F8TL 2JE8A 4MDJA 2YKKA 3O4LA 3GHBL 2X87A 3OKNA 4ZO9A 2ADPA 1SN5A 1ZA4A 4CPBD 2OX5B 1N3OA 1REFA 3WS6C 2GK2A 4DPBX 4UW4A 2HUHA 2NUTB 3U1QA 2NCMA 5D1IA 1NCIA 2NRDA 2HR3A 3DSNA 4HKZA 1AXSA 1U30A 5HHXH 4PHZA 4TOYL 2PCXA 2VCCA 5TE6H 3TYGL 2JCCE 2KBGA 4YAQA 4NWWA 1M90W 4O51B 2OZJA 2QCSB 3VBSC 5GW7A 1I7RB 3DJRA 3FHAA 3QJQB 4GOSA 4HJGA 4PCYA 2ADIA 4XC3L 4AQEB 5C0IA 4LFCO 2Y0IA 4G2KA 1A8MA 4CILA 3CJIA 3DCQA 1X5GA 4PTUA 4HSJA 5HPMB 3ARBB 5B39B 3ZJZA 5H9RA 4LLDB 3EJQA 4NBYB 1V55C 2EYTB 5H5NA 3W9DA 4APQB 4MB3A 2ZCWA 5DRXB 2XG4A 3DURA 1GNZA 3NJLA 1N0XL 2CO6A 5ADPL 1MS9A 4QCIB 5FYLE 2PHTA 4RFT0 2Q6WA 4GRWF 4JKNA 2NY6D 4JY4B 5EU6E 1YEJL 3SCMA 5A1LA 3ARRA 5L3EA 5F3CA 3KYNA 4IGBB 5FHBH 2WWUA 2VR8A 5FYIA 4BHUA 3IDMB 3Q8EA 1DUYB 4ZPVB 4N8CL 4MCZB 4UNVA 5J6GB 4XBEL 5C3PA 4U1LB 5H9SA 2GJZA 3VFUB 1PY4A 4G42A 2ILMA 4GKJB 2HWC3 1Q94B 3HZYB 5DZLA 1RINA 2IVIB 4CN4A 1NCUA 2AJZA 4JI7B 3AG7A 4K94H 4E9RA 3J7HA 3RLSA 1GGCH 1M7DA 2BHUA 4OZGE 4AHXA 1XV8A 5JIDA 2AEQH 3OKOA 5GZFA 1JP5A 2ODMA 3KBHE 1XNCA 2H3XC 4NXMO 2NY4D 4PRIE 3BZEA 3MLJA 4DK1A 4FJYA 4PQXA 1UOKA 4U1IB 3GQFA 5BV7B 1N5YH 3QZPA 5BZDA 3SN6N 4F5CE 1JX9A 3B7TA 3NR7A 4QRUA 3WTWA 1X7SA 4AMWA 1CFMA 1LWHA 5JIIA 2VULA 3SDYL 4Y9EA 1BMWA 2XU9A 1T0MA 3P0YL 2R1XA 3OBRA 4LBEB 1OANA 2G75B 3EJCA 3MO1A 5AOMA 2QQIA 3PDDA 2BS71 1OD7A 3WKML 2Z91A 1EXHA 1XF4B 4LHKA 1R5WA 4MO3M 2EE6A 4EFBA 3D0VB 3HHSB 4RESB 5F7EH 4L4TD 1YVWA 2YIAA 1HESA 1VBB2 5E1AC 4CNIA 5DEFB 3AK0A 1ENVA 3QO1A 3QUXC 1DZRA 3K80A 2EXYC 1FXZA 2DQEH 4GRLA 3NZ8B 4N8VB 4G8GA 3TBTA 5TDOB 2OP4L 2ADGA 5D1ZA 2EH8H 3J7LA 5IWAB 3ZM8A 5SX5K 3B2VH 4DNYA 5GONB 4M3JA 4NQDB 4Z8BA 1Y76B 1SMAA 3P73A 1BZDA 5EO0A 4OGXL 5HBAA 1QWRA 2I9LA 4WFFD 1WN7A 3NJFA 3O1SA 2QHRL 1SDYA 4OBSA 1RP8A 4UM9A 3B6SB 4GS7B 5E4EB 1MJ8H 4YGAB 1GNHA 1QF3A 3PQYA 2BNOA 5GSRB 4EIGB 4X98B 5GJSL 1JZ6A 3RFZC 1QKQA 4WBNA 1VALA 5CA3A 4BZ2A 3WG1A 1DQLH 3WEAA 3TT1L 1RVF1 1ACCA 4FQQB 2D5FA 2A0LD 1WP7A 1EGJL 2FD8A 4YL9A 2OYPA 4IV1C 1MAML 5BV6A 3ARDD 2WS92 4TV8A 2AF2A 1KFUL 3DRTB 2JWYA 3LXAA 4XP5L 1DQQB 5HHMD 4EZ4A 5A7QA 2CNAA 5GXBB 3RJQB 4UAHA 1SPPA 3I2CH 2X6CA 3SGKA 4E2QA 3BPOB 3TEUA 5A3UA 1R1A1 5KVFE 4UCUA 3R19A 2JSFA 3T4YB 4TLFA 1R3LA 3VVWA 1VB2A 3WNOA 3ZHQA 1W8OA 3X11A 1QOTA 4N2IA 5G2NA 4Q8BA 2XY2A 4PGBA 5C0BB 3WHE0 3WN5A 1BEV1 5KC5A 4L5FH 1LP9A 3UJTH 1G7HA 1JGLL 4Y4KC 3KYMA 5DGRA 2YQ2A 2X9XA 1CICB 3RI8A 4DESA 1H6TA 3CRMA 4ZW6A 1PIGA 1ZBE3 1KGUA 3E5UA 5F9DC 4UW6A 3QS2A 1J48A 3GS0A 1MJ7L 1ULEA 4AI7A 1BK1A 2EVXA 5D8AC 2WVVA 1BQHG 5IB5A 4P4KC 3C8HA 1BZEA 1WICA 3MRLB 2I9TA 5FNVB 4OT1L 2VDKB 3N9NA 4DFHA 5DN2A 3MUJA 4JZJB 1MDAA 4LORA 3WGUB 2AQRA 4ELMB 3I6LD 2NMNA 1KGYE 2H0PA 4IDJL 1I5PA 2FRGP 2K2SA 3AZXA 4Z7VE 4PJGF 1XGPB 2VN6A 4A7VA 4UOZA 1N33O 1XILA 4Z95H 5E23A 1DGWA 4RGKA 2HLEB 3RTQB 3CD4A 1HDMA 4Y2DA 3KJ4B 1N0LB 2X70A 4X5QA 5IM7B 4BQCA 4B7EA 1NFKA 1M6OA 3EDEA 3CX5F 1WCBA 4PV8A 3CCUV 1XNBA 3QWOB 3GGWA 2GQHA 2H3NA 2D0GA 3BHBA 1NMBH 5A16B 1TYJA 3RWIB 4ZMXA 1DN0B 3CWGA 3PIQA 2GAZA 2RG4A 3OUHA 3BZ4B 2V09A 3OUIA 4EZHA 4E9SA 1PGL1 4M61B 1OF2A 1RCYA 3FK3A 2QWNB 4QIWF 2Y23A 5C8YA 3M1HA 5I16A 4JG1L 4YHHO 5IY5B 4TQEH 4AI3A 3BKMH 3SO3C 1HE8A 4G6AC 1I3RB 3CFCL 3ETGA 1LP9B 4MJ5B 5BZDB 3H8NA 4PGBB 1FATA 4FNSA 3DLQR 1UQXA 1IM9D 4HK9A 1KJVA 3PN1A 3RQ0A 1AX0A 1J1OH 1NIBA 4IERA 5JPNC 4IEXA 3LZFL 4KY2A 2B2XH 4LITA 5IVVA 4UU9A 4UB0H 5LWYH 3RWGB 4LNUB 2NUTA 4J6RH 1PMIA 1RUJ1 1PQZA 5IB2B 3DSFH 3MV11 5FS5A 4UI2A 3SXWA 3RAJH 1RUC3 1AOZA 3EYUL 1SHWB 1SM3L 1R3KC 4IV3C 1DBBL 3TN93 2GBAA 3KYAA 5FWEA 2ATKA 4K55A 2VIRB 2X6UA 4OGQC 3NJMA 3OF6D 3AG2B 2VXQL 2JENA 2P6CA 5E5RB 1FZOA 2NOYA 2DI9A 1KGJA 2WAOA 4BISA 3FFZA 2IDTA 4I50A 4GXUN 3D5OF 3F58H 3CPLB 1AJ7L 4EBQH 4XO3A 4ALAC 3CJJA 5GRZA 5DUBB 1ASJ3 2H9GA 4JO2H 2HT2D 2PYEE 4O02L 5B1JC 1UZYA 3BSZL 4ZOLA 1G6RH 2NY0D 2I9LB 4KJWC 1YEHH 4IEZA 3T2LA 5HYSG 2DYPA 5CCJA 1E7UA 4KI5E 1N1TA 3D3IA 1ZA6A 1V7NL 1CONA 4UB8Z 4IU2B 2OMZA 2JB5L 1P7KA 4JFFE 3JV4B 3RWJB 4MBOA 2EAEA 2RM22 3M88A 3U6XS 4NQSB 2YXYA 3OR7B 3QQ9C 1ZE3C 2BS8A 3W81A 3ZKNC 3IAYA 1EDYA 2QKIC 5CBHA 3GD1C 2UXBB 4CS3A 1MWAB 1M4WA 3EYPA 3E3QE 4G7SB 4DR2O 5T5PA 4ZSOA 3I9GH 4OZOA 1P9MC 3QUKB 2ZP8A 4ZAKC 4AYMC 1D2SA 1JQ0A 1WBFA 1Z5HA 2B3RA 3EGSB 3AWFA 4OM0L 4HZFA 2R15A 4JO2L 4M8UA 2YA0A 3CDZA 4JCKA 3THPA 1MNUL 2F1EA 3M46A 2YPLB 2CM5A 4XVJL 4YJ3A 3T8XB 5CEHA 2EIEA 3T1YO 3E6FB 2H2SD 1MUJB 2XJPA 3CCMV 1BZ7B 3S35L 4DFIA 5AC91 2GTZB 3H0TA 2X9ZA 3IU4L 4YDIL 3SE3A 1YEGL 4IBYA 1HN0A 4XF9A 5IB1A 1S72V 4JMXA 5EB9A 4GAJH 3B5GA 3BIWE 5FO7B 4DT2A 2V2XB 1N59B 1WPCA 2F6AA 3SYOA 1J0KA 3PHSA 1P7GA 2DQJH 1H8LA 3MBWA 2AXGA 3BY6A 4QIRA 2JGDB 4UT5A 1D5XB 3GVMA 4QT5B 3V52H 1RPUA 2FJUB 5GLUA 2E86A 4PB9L 4YIQB 1KYOK 1W80A 2R7EA 3AM8C 2JB4A 1HJFA 3CQFA 1UOVA 5FF6B 4NOBA 4IGBA 1HIXA 5DMGC 1UJ3A 3R0MA 5LXGL 1OT4A 2I25N 2OK0H 4FLZA 3N2GA 4MVOA 3AZYA 5SWSD 4PG2A 4RH4A 5KS9B 4ODSL 4NN5C 4RAVA 3WE1A 2QKSA 4AZ8B 2HVKC 2C26A 3VFGH 3EYFA 4QGLA 3KJ6L 5E6RB 2QTWB 1RSOB 1UD5A 4U05A 2JCCF 3JALA 1YZZA 4JTAB 1P4LB 1QLEB 3LRSB 4PRDB 5T3XD 5CVRA 4DXRA 1HEZA 2A3TA 4F7CA 5LZ6A 4HT1H 2ICWB 2Q7NA 2ZWKA 2JJSC 5IFJB 4XDJA 3HKFA 5CD3A 4TN9A 4BXVA 2YAQA 1UWWA 3HE7D 3CLFH 1H19A 2WLKA 1GN3A 2YS8A 1N36O 4NZRL 5T5FH 4FQLL 3FB7A 1KBWA 5J2TA 4NNYB 3TV8A 3UAAA 3W82A 5KVMC 1JZ4A 1IVSA 1WWAX 2FHCA 3ARVA 1QJY1 1TJGH 5B38A 3OSVA 4E9KA 4ET7A 2VDKH 3T3PF 3RP1A 5L7OC 3ZCCA 3U1SL 3VM7A 1A7RL 2R0HA 4U1HA 1DTOA 2UU9O 1L7RA 4FNPA 4N6RA 3GRBA 2F8IA 3IM0A 3VBOC 4AH2A 3MBEB 5KSBB 1W04A 3KL5A 1OAYL 4PSPA 3Q01A 1DUZB 4FLHA 4LSRL 5B3JF 1TQTA 2ZXCA 3K08A 1Q72H 3T1MA 3EOBA 3KPTA 2CKBL 2PTMA 5L9BA 3VFWB 4EWAA 3LB6D 1S78C 1EZVH 5EZOH 3BH9A 2ADDA 3PJNA 4XFGA 1S9YB 2X4UA 3Q5YA 5FWQA 1LOBA 4DV5B 1CR9H 3S3PA 1FV3A 1GYUA 2WIIA 4O7XA 2X3BA 1WMEA 4ORFA 2FL4A 4FQ1L 2AQ3A 1CLOL 1ZVSA 3VXQB 2CM6A 1J9TA 2WO2B 2WD0A 5L9DL 3IC9A 2R39A 3R65A 3SGEI 5A6YA 1P5VA 2OR7A 4K15A 2VSCA 1YFUA 1PDKB 3U0ZA 2D44A 4COVA 3ML8A 2A6YA 1FO0H 2XPGA 1BJMA 4LCIL 3TPUB 1VRSA 3AGWA 1IZKA 3L81A 4XFHA 5EN2A 4DZGA 5C97A 1YPZF 3R6SA 1N3NB 1IBBA 2WLYA 4KVNL 2CO3A 5DJ2A 5GQBA 3U1SH 1QJU2 4CDXA 2WGXA 4NSKB 4QXKA 1DZ0A 3IDEA 1W8WA 2NY1D 5KMGA 2NY3C 3I6LE 1AR1D 3RDTD 3VI4B 4KWUA 1LO4H 4K94C 5CKNA 1TNMA 2Q73A 1UKTA 3WT3A 1IL1A 1EEZA 3NJZA 2Q1ZB 2C1PB 1GYKA 5LOVA 1MFEL 5F1NB 4RFOH 1SQ4A 3KLAB 4HHGA 5AZUA 1W99A 4CU6A 3HKEB 1ENRA 3Q6GH 4YBLB 1Q7YW 2OJEB 2GC2A 4AI2A 1UYXA 3AG1C 2Q87A 4FQ1H 3G9AB 4LDLB 1WCSA 5JOWA 2YEVB 3UOAB 2UURA 1SDDB 2DWEC 4N0CC 1UEYA 4QPIA 1T04B 3FTGB 5E2UL 5T5JA 2JJ1G 2J1ZA 4H14A 1JPGB 5ICXB 4M0NA 4WFAV 3L3JA 3NA9H 1PJ9A 4PBWD 4NM4H 3S9DB 5FZFA 3MJ7A 4J7RA 3FSVA 3QZWA 1AY1L 1QR1A 2CBTA 2GJPA 2GSGA 1OTSD 2ZP9A 4R8CA 2XTJB 4WUKL 1AI1H 1PGW2 4ONHB 3JD73 1ACYH 2JELH 4HK0B 2D2CC 4B3MB 4W6YB 3GIZL 1K5QA 1KSRA 4LLUA 1F86A 3J80N 3BT2L 4MFHA 3CHXA 4F9PA 2ENYA 1KXHA 4N6QA 3B2XA 3NTCL 4AE1A 4POYA 5IROD 1OVPA 3GBNL 2DTSA 1T5XB 2ENJA 3K0WA 3R1GH 4H8UA 4K9EH 5JOEA 1IS3A 4OIAA 4XBFA 2NY2D 3Q9QA 1XU2A 1JRHI 3LHAA 3ARFD 1AGBA 2OMVB 1TME1 2EAKA 4YK4C 2FDJA 4JRXB 4KWJA 1XGQB 2H1PL 2ZJCA 5GJ6A 5HGBB 3R4DA 1EHLL 4L4TB 2IXIA 2GDSA 3ML0A 2EH8L 2BP6A 4MD5B 2DI7A 4GINA 2EIGA 1B9ZA 2L7UA 3MIGA 2HWD1 2QPDB 3Q13A 4CVWA 1XCTB 2BHZA 3A4AA 4FK5C 3V7AG 1UD1A 3QDJA 5DK0B 3FONB 5ICZA 1HHIA 4XI5C 1FNHA 4ASKA 1OD9A 4N90D 4XP1L 3O0VA 2L0DA 1DVXA 1G94A 4S1SL 1R0AH 3N1FC 5KJ7E 1IIIA 1R17A 1VKXA 1JR9A 1U6AH 5KSBE 4CEYC 3VW3H 2DCJA 1SJXA 3SGDI 1DJXA 1L0LH 2OULB 3L5WB 4DUXA 2X2YA 1KYUA 1S7VA 2YQBA 4QOKE 3S7GA 5D7LE 2DEXX 3A6OA 2DLFL 4G8FA 4PRAB 2DQCL 4LNVA 5J11C 3QEQE 4P5KB 4BD4A 3RGVC 4CCJA 1U2YA 5KLVH 1MHHB 4U1JA 4PP1D 4HZLA 2HJKA 2YWZA 4LOFA 2OSLB 4UM9B 2Q76B 1O5UA 3G5YA 2IWGB 4OIIL 1QNMA 3CO2A 4LLMB 2ZONA 2ICCA 1TG8A 3BN9C 5K39A 1G7MA 3TWCL 4A45A 4WWOA 4NZ8A 1GZWA 1UYYA 5LXTA 2O6EA 1CLYL 3OKEA 4NQDA 4Q9QL 2BIPA 5MERA 2WINB 4MMYB 1Y4MA 1ZTXH 4HGWA 1GZHA 3C5JB 3HI1A 4OGAD 5A2KH 1MNUH 4FFZL 1RZIA 1W6PA 4U49A 3RY6A 4JRXA 1ID2A 3N85H 3QFJB 4YWGL 1KENH 3IPFA 4YM2A 3WDTA 1E28B 1YMHB 3UL4A 1A4JA 4R2GB 5EBLB 5TDNA 2OJ1A 3OZ9H 1GYWA 4GUPB 5AW5B 4DIXA 5A3ID 1S0EA 2WNUB 3CEWA 4OZFA 3I3MA 4XCYB 3FNKA 1XF4A 3SQOH 5EIIB 5AG2A 3I6GA 3L1GA 3II2A 1E4KC 3HFFA 3MUGA 1E9OA 4KU8A 2BXYA 5F72S 5FP3A 1B0RA 4GD4A 1UA6L 1IFHL 5I71C 4ZW5A 5IROA 2F43G 3HHMA 4RX4A 5F71A 4XXAA 3MZTA 3NVCA 2IH3C 1YQ5A 2I7OA 2DQ6A 3ABKC 3MRKA 3D4YA 2IU3A 3STLB 2VXRA 4OR1A 1UA3A 4NO3A 3VFSB 2Y9RT 3DV8A 5FKPB 3MFCA 4WTQA 4AYDC 2ZNJA 1T3FB 3BB6A 4BH9A 5AVRB 3DROA 5KUKA 4N53B 3ULVC 4RS5C 1P1VA 2I27N 5F6IC 2IQ9L 3BUQA 3LKSA 3O3BB 5JPMB 1NLQA 5C2BH 3O6LH 3QUZD 5E8NA 4G6AD 5HHOB 5J1SC 3LTVA 4LSDA 5I17A 5FIXA 1JGDB 4ATTA 1N12A 4ONGL 4X0KA 2WXFA 3RTQD 1NBYA 5C0CE 4GUQA 5DYFA 2QDWA 3VQ2C 2CGNA 1QLRA 1WW7A 2OJEA 2VUAA 2XJLA 1UF2C 2YZ8A 3W11C 1DBKL 1NA8A 5F9AC 1LAJA 3DJTA 1E30A 1NC2B 3FU7B 4FXLA 5FC9A 1OVZA 2YGPA 4DJMA 2ZTNA 3HG2A 3C75A 2O30A 3MV8A 1NS1A 5C09E 3O11A 1QPXA 1PIFA 2D3VA 1LLAA 3V4PH 1MAJA 5F93C 2HRLA 1UIJA 1RUPL 1J9RA 2NTFB 4CBZA 5A2BA 2J8UE 3BDBA 5KN5A 3AMKA 4RETB 1T83A 3KZ4C 2Y7QB 5C5TA 4LSPL 4MWFA 3POBA 1WAPA 4KKRA 2WDBA 3DX7B 3L3IA 4AVKA 2ZOLB 3HTLX 1AP2A 1BQLL 1KIPB 4BOWA 4JDVB 3AKPA 4F8AA 4K3EH 4PTUB 3ZDYE 1HB3A 3M7MX 4P57B 1MCJA 4XXWC 3PU8A 4XE9A 3WQBA 4XHJC 2ORBH 1DCSA 2ITEA 2N7BA 5FK8A 5A3MA 3B69A 4DR5O 2VITA 3NVQA 2W38A 4XXCC 2X38A 3D52A 4BIFA 3BESR 1DF5A 4AEIL 1U8JB 1BLNA 1JGUH 3HE7A 4R96A 1KN2L 5FO9A 3DSNB 5LGUA 3PWVA 2C7UA 2ZEXA 5ADPH 1KXQE 3CXHK 4MRCA 3V0JA 4WQOA 5LBSL 3Q44A 3TOPA 3UJOA 2IBGA 5E8PB 4BRVA 4LCWB 4OUUA 4KMTH 1RUQH 1XMQO 1TSRA 1ZRUA 4IOSA 3T2OA 4PJ9A 3PWVB 1B09A 4U1KA 4WK4B 1X5HA 4OUEA 2R23B 4EQVA 3PGDB 4EI5A 1B4TA 4R96B 4BE6A 4H0IA 5D1XD 3ZKYA 5FCSH 3GXFA 5FQ0B 4G8IA 4NRMA 3RVZA 1IAIM 4EN3B 4NIHA 2W3JA 2QHRH 4JI4B 4QPGA 4S2HA 1ZRFA 4S1QL 1NFIB 3ZYJA 3HCVB 3JD3A 1NGYB 1A1NA 1RZ8B 3TV3H 5CU9A 3T1WA 1AP2B 3LKQB 4QAMB 4Y4HA 4CSSA 4HCRL 2OTLV 2AEYA 3H2QA 1INQA 3SPVA 4Y4FB 2Y7QA 3UP1A 1FZKA 3BH8B 3ULVE 5FPBA 4AHYA 3R06A 3IEAA 2OTUA 3HC4L 1A14L 2JVDA 1KB5L 3B9AA 1HKFA 3AW5A 4FQXC 2QPEB 2R69A 4GPVA 4UIMA 3WCYA 1U0AA 2P80A 3PDGA 5H94A 2HWC1 2PABA 4Z78A 4NB7A 2K6ZA 1NZ6A 3QXAB 4M6AA 3LMJH 1AI1L 3JVFC 5EZPA 4Z3EA 4YVWB 1O9HA 1ONAA 4Z7UB 3FAVA 4C59B 4JDTH 2QEXV 1ENXA 3IXAA 1MHPL 3UK9A 1S3JA 1MJUH 3WF2A 2O57A 2OJZL 4L8DB 4P46B 2WBJD 1RI8A 4L5FL 2P7TC 4YBQC 1WMFA 1TEGA 3N35A 4YFLF 4K0OA 3OAUH 2C5DC 3LOBA 5FFOA 2QSAA 4X65B 3W9EA 2JDMA 4E2GA 4W9LC 3O8XD 4EVNB 4Z0XB 3H0TB 2V4DA 2Y1ZA 2A7WA 3FS9A 4D9LH 4DEVA 2GSIA 1TTCA 5EC1C 2MOGA 5CA1B 2BSDA 3QK0A 1SNRA 2MKLC 4OZHF 5KVGL 3QA3B 4P05A 4QRBA 4JFDA 5FGSA 1RZGA 1LEKA 5I8CB 1OF4A 4S2SA 2FGWL 5IMMA 4C54A 1RUD2 3WUCA 5C8WA 2WNOA 3CUPB 3PHQB 3QDMB 4CC5A 5I15H 2AJYH 2NN8A 3IDNB 5CEZH 1PLGH 3RZCA 1YITV 4LPUA 1EGJH 5ABJB 1LK3L 4GYCB 2PXYB 2XWBB 2Y5QA 1QBLH 4DW1A 3HG3A 4HWEL 1I7ZA 2R69L 1CAVA 3P30L 3JB8A 1SF9A 2Y36H 3L13A 5EBLA 3RL2A 1L5GB 4WRLA 2D43A 1I8UA 1N6UA 3SY0B 3HNYM 4KMTL 2DDQH 4Q29A 3THTA 4KROD 4IRSD 4PLKD 5K4LA 3R06B 5B7MA 4HGWB 5D8JH 4MXQC 3SPVB 4WI9A 4FFWD 5JQHC 1WW5A 2HWE3 5EUOA 3F5WC 1T21A 2ARWA 1UY3A 3O1OA 1CXFA 4NXKA 4POZC 3QDME 1KCUL 4A44A 2BIQA 4OB5L 4RQQB 3J81N 1LDSA 1N5YL 2WWSA 5FK9B 5EDSA 4HZ3A 4N43C 4Q6YA 4XX1G 4QXHA 4P06A 4BQ5A 4YXHL 1F6LL 4E4HA 2YGVA 1AIZA 3KPSD 2IAAC 3BP6A 4QM8A 2GITB 3N5AA 3PQYD 3C5SA 1PO11 4OD2B 4X9IA 4WO0A 3LEVL 1LEMA 4CH5A 3MC0A 3T0BA 1L7LA 1NBCA 4NZDA 2K6YA 1Q9WA 3L4CA 4DH2A 5CD5D 4P5HA 2Y0SA 3P4NB 1Q0XH 3Q5OA 3WS3A 3WP4A 3SJAC 5JOXA 1W8NA 2VOVA 3P30H 1FV1A 1U91A 5EZIH 3CN2A 3OX8B 2PYJA 4RGND 2AJVH 4KZCA 4UQ3A 5FA3B 1DBAL 5K59F 3FMGH 3L3HB 3KV4A 5GZGA 4Y7MA 3CDFA 3WZ1A 3ABLC 1FNAA 1G7QB 1NMCB 3IS1X 1OXCA 5I6PA 1VFBB 2C3GA 3DUUA 4YDKL 4B0MM 5D4HA 2OL3H 2ICEA 5FLUA 3ZL2A 4BHUI 5IEKA 3B5HA 2XG5B 1KACB 1U3JA 4OB5H 3VYNA 1OZ0A 4F7PA 1JHTB 3TA3D 4F8OA 1VBB1 2G60H 2WN2A 3NABH 4LLWB 4I87A 1CDBA 4XUTA 2HJFB 4Q89A 4YYOA 1DF0A 3FQ2A 5F7EL 3U30B 4OF5A 1IX9A 1T5WB 2Z5UA 1TZHA 1X44A 2O1AA 4NO2B 5JDSA 4ZMNA 2WFF3 4ZZKA 2YDEA 3K6NA 1TZAA 3D85A 3FJTA 1SVZA 2GAZB 1UU6A 1Q0YL 2G4IA 2RDNA 4YZ2A 5A16A 3D69B 2ZXDA 5EBWA 2Q8VA 2C1OA 4WCYH 2XCMC 4MTFA 1E4XL 2PNDA 5D4QA 3O6KH 4D0CA 3SCFA 1CBJA 2LU7A 1TTAA 1V6JA 3USUA 1PCXA 3U4KA 5L2KE 3EBIA 5CD5C 1ZBE2 1M1XA 3QUZB 3GC3A 3P9LB 2XUMA 3SKUD 3DC0A 5JLVA 5EF1A 2KDYA 1G6RA 4H1LB 3QJXA 1TIUA 5AW7B 3VD2A 4J4PD 5B4MC 2QQLL 1G9DA 4J11A 1S0DA 4DR3B 4NKMB 1BXHA 4Q8KA 4W4LA 1U8KA 4AENB 1D5IL 1KXTB 3OAZK 1H8VA 1T04A 4XPTH 1PGL2 2BWAA 3APQA 4UT6A 1AACA 4NWTL 2W39A 3ZRWB 3EXUA 1MR5A 2EIZA 4X8CA 5CINH 4ZMOA 1OJHA 1MPAH 3JATA 4XF4A 4LTAA 1AZUA 4UT6H 5B1JA 1ZK5A 3PVOA 3L3OC 2NP0A 4YGEA 1GJWA 2DOCA 1VBE2 2X09A 2A0LA 2Y6SC 4YHNB 3FOLA 4IS6A 3QDGE 3BKCH 4UOW0 4O4LB 4CS2A 5E7BA 5FY5A 2DQDL 1TKWB 2E7BA 1RK1A 2IWEA 5E8OB 1CFBA 5JR1L 1CIWA 1QHDA 1WLDA 4HU2A 4F2EA 1JDCA 3EH5B 3GSUA 4HH8A 5AAPA 4G28B 3FFDB 2W94A 5KBPA 1E5IA 2B7YA 3B34A 4XPVA 1JPFA 1MAKA 3UJTL 2OSXA 5AD0A 4Q4W2 4XOGA 2RDSA 2VQ1B 3UYPA 1PLCA 1MVUB 2VISA 3GBMH 1H6YA 1FGNL 1GJUA 1RVFH 3RNKB 2EYSB 3II3A 3K72A 4IBVA 5FWRA 1QPPA 4NIAA 1M9NA 2CJUH 4GUNA 4HGKC 5A7NA 5D4JA 5A40E 1KLUA 1EV13 4IJ3C 2QZQA 3HA0A 1BF8A 1NTKH 2B14A 1K4DC 3C8KA 4V2VA 4CPBA 3S3SA 4BFOA 4ZDHA 3JT0A 5GRVK 4B3SB 1TZIB 2BO0A 2UUDH 3NA4A 2IG2H 3GIVA 3JWDH 1NWPA 1CX1A 2G5UA 3D85D 3PL6D 2XI9A 4R26H 1B6DA 3NCBB 4RGGA 4RR3B 1EJ8A 1FG9C 2P34A 4YM0A 3CHSA 5FV2A 1QR8A 4ZMWA 4N6RB 3O2DH 2JG8A 1RPOA 2H8PA 4XDKA 4FFKA 4WFBV 1HVXA 2YHGA 4ITCA