4PI2A

Crystal structure of particulate methane monooxygenase from methylocystis sp. atcc 49242 (rockwell) soaked in zinc
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
390
structure length
390
Chain Sequence
HGEKSQQAFLRMRTLNWYDVQWSKTTVNVNEEMVLSGKVHVFSAWPQAVANPRVSFLNAGEPGPVLVRTAQFIGEQFAPRSVSLEIGKDYAFSINLRGRRAGRWHVHAQINVEGGGPIIGPGQWIEIKGDMKDFTDPVTLLDGSTVDLEHYGISRVYAWHLPWMAVGAAWIFFWFVRKGIITSYIRVAEGKADDVIGDDDRRIGAIVLALTILATIVGYAVTNSTFPRTIPLQAGLQKPLTPIETEGTVGVGKENVTTELNGGVYKVPGRELTINVKVKNNTSQPLRLGEYTAAGLRFLNPDVFTTKPDFPDYLLADRGLSVDATPIAPGEAKEIVVKIQDARWDIERLSDLAYDTDSQIGGLLFFFSPDGKRYASEIGGPVIPKFVAGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords unknown peptide
publication title Effects of zinc on particulate methane monooxygenase activity and structure.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 85
structure length 390
sequence length 390
chains with identical sequence E, I
ec nomenclature ec 1.14.18.3: Methane monooxygenase (particulate).
pdb deposition date 2014-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4pi2A02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 4pi2A03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 4pi2A01
4PI2A 3CHXA 4PI0A 4PHZA 3RGBA 3RFRA 4O65A 1YEWA
chains in the Genus database with same CATH superfamily
2BFUS 2A9MH 1ZXQA 3CHSA 4ADIA 3MHSC 1KCKA 1RJYA 3ULAB 5CEZD 1TKWB 1QLEH 1TEYA 4XNQB 1I8UA 5IIEB 4OZOA 3WR0A 3KL5A 4I13B 2YQ3A 5I15H 1QKQA 4COYA 5I1KL 1IBHA 1KGYA 3IMVA 3U6RB 1I1AC 1KBGH 4ANXA 5C0CE 2X1PA 1I3GH 2FX9H 4KNQA 1NGPL 4KGJA 1LU2A 1X8MA 4UVAA 3WB1A 4PJAA 3AG1C 4X6BA 1MS0A 4CXWA 4LKXA 1ACCA 3T0EA 3HS9A 1QTYT 1OOPA 1HL9A 1RUPL 4TUOA 3UL2A 5IFHH 3Q1SH 2NY0B 4P5HA 5KAFZ 4IE5A 3T2TA 2GHYA 4F2MA 3BMVA 5A1AA 5I73C 2PO6B 4Y4FD 4NLHA 4HD5A 3OAYH 2XR4A 5FIXA 3FB6C 3BESR 2WNGA 1BLZA 2MEV2 3VXUD 3QPKA 4LK7A 5FO8B 2SBAA 4J27A 5I91A 2Y7QB 5I1GL 4OVUA 4DR1O 2VIRA 5ADPL 1NAEA 4DR7B 3MRJB 4QXHA 2ZGKA 4KI5F 2HJLB 2YSTA 2BBAA 2WIMA 3QBQA 2VMJA 3WSOA 4JE0A 3BU0A 2WWMD 2AERT 2I07A 1UA3A 4HPYL 4RESB 3QT2A 5ICXB 3ZX6A 2BDRA 4Q1PA 3H0TB 4FOQA 3C6LA 1J0JA 4KXBA 3N9MA 4IV3B 3UJIH 3OC8A 3T3PB 1RZJH 4E9SA 1F1DA 1M9WA 4RMBA 5FQ0B 4HT1T 1YPZF 2YPKB 1FH2A 1QBBA 4OCYH 4Q0XL 4XE5B 3PCYA 4NPKA 4BHUI 1C8PA 1PIV1 1TU2B 5K0UA 4CDQA 2W9EL 3GGWA 3V0FA 3IMTA 3RWHA 1UWEH 3GD1C 3QI9B 4I0KA 4C47A 1B35B 1JR9A 2BNNA 3N2KB 5F72S 3MPBA 3ZJZA 4ARYA 2CPUA 1Z2KA 3EW3B 3N5AA 4LE8A 4MQTB 5FUOH 2XPGA 3UCQA 5I1EL 4U1KA 2Z69A 5C6CA 3X1FA 2GEEA 1Q90A 2B4CL 1GZQB 5CBGA 3Q44A 1E2ZA 4YDNA 1J8HE 5K93A 3FRPA 3TC9A 3LUTB 3TJTA 4LF3A 2WGNB 3PQYD 1J8KA 4LWSB 2Z7WA 3QJFB 2C7FA 5D1XE 3BPNB 3KV9A 4JI4O 3GRWH 3STZB 1DCLA 1A21A 5GIRB 1X9QA 3WFZA 1OKQA 2PPDA 3PABA 4D7YA 4B3MO 1J1TA 1YFXA 2ZACA 1HNFA 4YVNA 1HZKA 3F05A 3RYRA 2EDOA 3LPOA 1XNRO 1MHHA 1RZKC 3RNSA 4WTZG 1KC5L 1S8DB 4XVJH 3T4YB 2DQDH 5F1NB 1ND2A 1XXNA 2NYYA 1MS5A 4L4TA 5J9PC 1REEA 3AMQA 3ZDSA 5A7NA 2AXTZ 4KRPB 3EO1A 3DGEA 3RYHA 1BHGA 3PGCB 4L1SA 4ZU5A 5JH7B 5F7NC 1MNUH 4Q8BA 4YW4A 4MJ2A 4OYUA 2ZXWB 3FMGA 2D7QA 3VFSA 3DN7A 4O51B 1ET5A 4MO3M 4WO4C 5FXWA 2JS5A 4XVTH 5IT9N 4MX7B 1I94B 3S34H 3ALPA 5BNXD 5LBCA 1IBMB 1SS3A 1NCCL 3T65A 1DGRN 3U0TA 4HPHA 1WS7A 4FG4A 3FF7A 2JJSA 1W0WB 4XN5A 3L3IA 4TSCL 1S7VA 2WLLB 1KPVA 1LHZA 1N8OE 2N7BA 4X99B 3TIEB 1F11A 4CSZA 2R0HA 3MROA 3KWVA 4QPWA 2FX8H 1K8IA 4ZSOB 3FQUA 4FF9A 3E9TA 5FUCE 5HDBE 3WFDH 3WTSA 5FYYA 4OCSL 1BJMA 3H9AA 1PHMA 4NIYE 1BQLL 4D6QA 3B8NA 2EDMA 4NZFA 5TPWH 3RWIB 1T4KA 4GIOA 3CZUA 4OD3L 1B2WL 3AX4A 3LIUA 2A6DA 5L2KA 3RPIA 4S10A 4NI6A 3JD1A 1D2SA 3FRUB 1RM1B 4PTTB 3WL9B 1BMWA 5I82A 3O3UN 4G8IB 4NUPA 1FV1A 1LO2H 3BP6A 3ABLB 1RUJ2 4XPTH 1MCLA 5L8LB 3RFZC 5IVNA 4LVNB 4AI8A 1V6JA 4G1MB 4JANB 4UFLA 1OGSA 1TJMA 2OP4H 4LF4O 4WNQB 4CL7A 4KNUA 3RVTD 3ARFA 5I2IA 3AKQA 1UZZA 2EIDA 2AJYH 2NYYD 4HEPA 4FQLH 1QHQA 3LKSA 1F8VA 4O65A 5EULV 5EBWB 5EOQH 4NQDE 3LQAC 2R063 3E1F1 3IPEA 5FP3A 4D9LH 2Z4QA 3U79A 4N7UA 1YECL 2Z0AA 4YG3A 3UTTB 4E4EA 2UUBB 3UZQA 1UH4A 3L9RB 4WSJA 5FYKE 4MVTA 2DCTA 4I0XB 2VAJA 4PRHD 3MV11 2IANA 3WMSA 2NY2C 4PW9A 1BYOA 1IAII 3N1FC 1KTLA 3F58L 2XBTA 4OIAA 5D5MB 1F1GA 3LV3A 3KJ6L 5FGBC 3TCUA 4V2VA 3UYJA 1HTYA 1V0AA 3BRGC 3ZDZF 1XVSA 1IBGL 5B1NA 1I82A 1ZAGA 3L5XL 4QTHA 3V9CA 3MO1B 2XYCA 1EV13 4A2HA 2BY1A 4JM4L 4NNXA 1CESA 2X40A 1HT6A 3L3JA 5EIBC 4Y22A 5FMDA 4KUMA 5FO7A 2HG5A 1DGLA 3QNZB 4GAYB 3L9DA 1PO23 3I6GB 4KVNL 2XZQL 3VM5A 4LIUA 2IJJA 4KU1A 4QRUB 3SDAD 3VMOA 5T5PA 3Q6FB 2RHEA 1EPFA 3HZ3A 3ZT7A 1Q6HA 3U46A 1Z5YD 1NLDH 3MV9A 2JB6B 3QEQD 4OQTH 4Y2OB 2P6JA 1TZGH 4N2DA 4XT1C 5ITZA 2DYPD 5TQ2H 4EDWL 3I50H 3UT0A 2EXYD 1H3UA 1H0DB 4JHBA 3NIFB 5DFVD 1WD9A 5C3IA 2WXKA 1KYDA 1S78C 1OQXA 1SOXA 4FNQA 4H26A 1KKDA 4JKPL 4ODSH 3SE9H 3Q01A 3TO4C 4WF9V 1CDIA 5AOKA 1RIUL 1SZTA 2GJZA 3TT3L 2D3VA 1AYRA 3D85A 3B6SB 4JHTA 3FFCA 5I0UA 4HUXA 2A79B 5E5MA 3MGAA 3IBMA 4NPYA 5EDSA 1A6UH 1HILB 4OQ1A 4BCZA 1IGFL 3ARBA 3QO7A 2PPCA 4R3SB 3PY9A 3HBKA 5EU4B 4U6TA 2ZGTA 1LYQA 4D7PA 1FDLL 2YGVA 4GFXA 4TOIA 3BZ5A 2GJPA 1SOQA 4U2ZA 3X14A 5CEZE 3JD2A 2AQSA 3HBQA 1F4NA 4H20L 4XBNA 1R1CA 3N50A 1XEUA 2PF6A 1HEZA 5CM1A 1G6UA 1KNOA 1YY8A 1JK9B 3EGXA 1N5AB 3NFNA 3LF7A 3E83A 2NLJC 1F90L 3RHWK 5FOJB 2QE7G 4OLXL 2Q10A 2E4FA 3RGVC 1JGDA 1OPGL 4LPCA 2GSMB 3S88H 4KG0A 1XZ0B 5ACZB 4OZIE 5KHJA 2HKFH 4DP2X 2HYXA 4QMAA 4DY5A 4MJ4A 3W7WA 2R0LL 1Y7BA 2PYJA 5GGQH 3RZWA 2DE0X 3RI9A 4WGWB 2WUCH 3VDDB 4JMNA 5TD4A 3TBTA 3HC4L 1CONA 3ZYHA 4G6FB 3SGJC 2FATH 2QE3A 4UCOA 2VR9A 1UURA 4HKBA 5T3XH 2OYPA 4H1LG 1YEEH 2ARCA 4Q6IA 2GI7A 3IGAA 2ZCWA 2EDBA 3QW9A 5LBGA 2X1WL 2P5WE 3RGHA 2MW2B 1VEOA 1EXHA 1KJLA 5B38B 4WWID 1NM4A 3GI9L 4HT1H 1POV0 3N7LA 5HYIA 5E94B 2WL1A 1L7QA 5HJDA 5DUUA 3E6BA 5CWSB 1X3DA 2BSSB 1WITA 1WBYA 1RPKA 1UKTA 4OGXH 4QGMA 2ZJSL 2EZ0C 4TLKA 1A1NB 1L0YA 4XXWC 4AMWA 4IBUA 1OPOA 4IEFA 2CNAA 3ACHA 5FPIA 2VDKL 3DV4A 4ZI7A 2WM0A 4ZU7A 1OAKL 4JG0L 5IVBA 3ARGD 4F58L 2RCSH 3FAXA 1HHKB 2A6JB 1G9MC 3IRCA 2OV0A 2X6CA 1CDJA 5DSCB 5LATA 2R0WL 2ZOKA 4I1RA 2FWOA 2YHGA 3CQQA 1RJZB 5SX5K 3K03A 2UXBO 4GPVA 2GY7B 4OJDH 4P4KD 3NJYA 4MGSA 1U91B 2D9QB 4CUBA 5CLZA 2OT7A 2NY1C 4ZS6D 4XCEA 3VCLB 2YDEA 3II3A 1RU9H 1TTGA 4JRYB 1UA6H 4FVMA 3OB0K 4OZFA 1CE6A 3S5LB 5F5IA 1RSYA 1OAJA 5E6HA 1CL7L 4UBDD 1MG2C 1ZDSA 3FUNA 3K6SA 2VWEC 5IMKA 1H2SB 4I50B 3BVVA 5C6TH 3X3GL 2LP7A 1SZXA 1SM3L 1U5XA 3IU4H 4YH6A 1JXFA 5JVDB 2G2RA 2AV7A 2VR4A 3JWOH 4K3JL 5DO8A 1IL1A 5J6GB 1PK6B 2VQTA 1MCIA 5I5IA 3ULSB 3MPCA 1IGIL 4YHKH 1IVSA 2XLAA 4YR6B 2QLYA 1UZGA 1ZE3H 1THZA 2YSSA 4F15B 1J3QA 1QSFB 1QQP2 2WNUC 1BZOA 1RK7A 2EA7A 4X6FA 1BQZA 1FFNB 2HPOA 2V1DA 2WZAA 4I18B 2XWXA 5IF0B 4Z6AT 1EBOA 3FQXB 5F96L 3ZMUA 3VD7A 3CB2A 1NDGB 3B3IB 4Q14A 2LVCA 4CVUA 4XF1A 1EO8L 4ES8A 4UV4H 2XIIA 5ELIA 1DQQA 1ES0B 2X2UA 3MIBA 1DF5A 4AVHA 3AP5A 3T0WA 3V5HA 1FPN3 1UTDA 1R3LA 3H1LH 5FB8A 4G5AA 1MLBB 4XP6L 4ZZKA 1U4FA 3P73B 3TF7C 1ZXKA 1HNYA 4ZTPL 4A5UB 2ZWYA 5CBFA 3I2FA 4ZUVB 3ZE1B 2PLTA 3AM8A 3HBGA 5F1IA 2NNAA 5D7JD 5E6ID 4IOSA 5LA9A 2W0FC 3K80A 2EZOA 1J95A 5J2UB 1MFEL 2ZKXA 3FB5B 3SJVB 2A70A 3OX8B 5LA2A 1CR9H 2I26N 2GT9A 3P9LB 2XKUA 1LEKA 1NCQA 3O6FD 2A6ZA 2XJPA 1NDMA 3A3YB 3DECA 5GSVB 1NQDA 2VSCA 1V54C 5IY5C 4OFKA 2D2OA 3SKNA 2XYBA 3KGTA 3RU8H 3LFMA 15C8H 5IQ9A 1HRI3 2HTKD 5FM4A 3KW8A 3LEIA 5EUOB 1TME1 2IFWA 4MXVA 4UMGA 1F4MA 1T0OA 4M6OH 3IDGA 3ZDXF 3RX8A 5D1IA 5LASA 5CGMA 1LGBA 1QVOB 4AAPA 1XMQO 4XCCL 1WAAA 4RQQA 3L5JA 1V7NH 2CO7A 2VU9A 2AK1H 3H0OA 1ZA3B 4PY8J 2R39A 3MRIA 2NY4D 5DFTA 2YPVL 3MA9H 1NE6A 3BPCB 4WI9A 5DS8A 5C93A 5GGSA 4HKZB 1D5MA 3CQOA 4TLGA 2Q7HA 4YLQT 4QRRA 3ULUF 1GO3F 3NFSH 2PCPB 4PWJA 1F5FA 1FAIH 1SF5A 3KPOA 5FV3A 5F3HA 4DUZO 2RDCA 4AG4A 2ZICA 4IEVA 4ZNEA 3MUGB 2X4OA 1I7ZA 3II1A 4ODVH 4ZPVB 2D9CA 3P0VH 4DEQA 2DTWA 2BPBA 2UWEA 4Y5VA 1UKRA 3I02A 3VX1A 3P3RA 4PRHE 4QX0A 1IE5A 5DEGA 4JQXC 5J2TA 3G5YA 1EJ8A 5D2NA 4ZX3A 4HUVA 3QUYB 1JWSA 4MA8L 1TUBB 5LWYL 3CSXA 2NY7H 4MJHA 4MTOA 2E5LO 5CA6A 3EVKA 4KRNA 3T1HB 4I48B 3T2LA 4DN3H 1HXKA 2B9ZA 3MLJA 3PWVA 2YAFA 4FPLA 5IK7A 3HG1A 2IH3C 3GXUA 4RZKA 3LZZA 1B9ZA 2JE9A 4ZO6A 5DQ0A 1HP8A 3DSFH 2R1WA 4HXBL 4ZNCD 3VBSB 3NEXA 4HH9B 2EXSA 4JPIA 3BPOB 2GFBB 4JJHA 4O5LL 4YDVB 5KSVA 5B2GB 3CMGA 5LCWL 4ZAKC 3U1QA 1IIKA 5IEKA 3W2DL 3B2EE 2DMGA 3KG5A 2ADFH 1D2PA 1D5RA 2Z7YA 4IHOA 4LAQL 4MJIA 5I66B 2BU9A 4QY8A 4PLJC 1FS0G 3UYOD 4AIZA 1O5LA 2FMDA 3BIEA 4FTEA 1B6DA 3ESVF 2XBZA 2UYLA 1NFDF 1T22A 3V0AA 4MNGA 2Q76A 1PKQB 5AB2A 2PUQT 4N86A 5F6IC 4WFHA 4HUKB 1BQHA 2VLKD 5HBAA 3WF0A 3VXMD 5CBEA 1MJJB 2DQHL 1L0XA 2CDEB 1V7ML 5IHLB 2AEOA 1GHFL 2P6CA 3SDXF 3WNIA 3JXSA 4FQ4A 2J22A 2X09A 3MJ6A 2CHXA 4YSFA 2L7JA 4OF7A 1S0GA 1X6NA 3CRRA 1BJ1J 3E5XA 3KYOB 4BQ5A 4AQ8C 5FYVA 2J2ZB 2G3ZA 2NSQA 1YN7A 2DCZA 2FZ3B 4PVMA 1PG7L 4PJIF 4XYXA 4G5ZH 4R4ZA 1K42A 2R062 1BA9A 4KJYA 2DB8A 1AGCB 5E4AA 4XFFA 1ACYL 3GM8A 3NJHA 1G7PB 4HWZA 5EC1B 5FR3A 4GW5A 3V0HA 3TESA 4LLFA 3PP4L 1PKXA 1WZ1L 3A6BH 4X0KA 4RGAA 4FJ6A 2A06H 1UY1A 2VXQL 5K59E 3OLDA 5JI7A 1VFOA 2EYRA 2ZYSA 4S1DC 3RWEB 1R33A 4TNGA 5KHIA 2MHAA 2IGFH 1POV3 2FIKB 1H6EA 2UXCB 4LF8B 3BP7A 5D71L 5CYYA 3O2VH 3PJSB 1MCPH 1EV12 1KJ2L 1RP8A 1ZHBA 3L7EA 4JRXD 5DMGD 4QF1A 2HH9A 3MFCA 1VFMA 1DVFB 2R59A 3HS0B 3CMOH 4NOFA 5L7OB 2VCCA 4V11A 4A67A 4OLWL 4B27A 4AVKA 5KMGA 3LEMA 1PO22 5BR8B 3H7BB 1M57B 4AWJC 3ALXA 1FZKB 1DQML 1HL4A 1OTSC 2PP9A 1NVPB 1DBNA 1BF2A 4KVCH 5DRNB 4DVRL 3DMMC 1JV5A 3KS7A 2RR12 5DJCA 1LP9E 1E90A 3ILPA 4AGNA 4BYHA 1RJYB 5DF0A 1V6IA 2APBA 4KI5D 4YQXL 3V10A 3Q43A 2HFEA 1OFNA 3JQXA 3EH4B 4F8TA 1O3RA 2ZP8A 1F6AA 43CAA 2YMTA 2UU8A 4PJ5A 3VGFA 1ADWA 3C3SA 4PJAB 4X6BB 4YC2C 3G04A 4C56D 5I17A 1NT0A 4LKXB 4V33A 3T0EB 4DXSA 5ABJC 2VN6A 5GLZA 5J36A 2PZSA 3ESOA 1Q81W 3GC3A 1OOPB 4TUOB 5DD3L 2M7WA 4M6NH 2JWPA 1TQCB 4K3DH 4KJQC 4F2MB 2FVNA 4UV7H 4PJ8C 1N33B 4EXKA 4BZ2H 1R3IL 4MAYA 4M4RA 4X4XA 2EVIA 1IEAA 5HVHC 1TCMA 2HJDA 2VCBA 4QHKJ 2ZQKA 4PA7A 1HB3A 3OY8A 5H9SA 1XEDA 5E88A 1SYSA 3BE1L 3NL1A 1AR71 1JFFB 5KAQF 1GR3A 1NBQA 1UF2C 4WFAV 3V0DA 4COWA 5A33A 1TVBA 5IWAO 4QXTA 1NAML 3FT1A 1YNKL 1GJUA 2XZCH 1GP6A 2D5HA 2GJJA 3NABL 4XMPH 4Q4X3 1MW0A 2ENJA 3E6HA 2JDPA 5I30H 2I07B 4XDQA 3FLTA 5A6LA 2E6VA 4Q6YA 3C6LB 2C4FT 2PYFA 4HS3A 1O9HA 3DHUA 5KYXA 3IDCB 3HWJA 2A0LD 3ZS8C 4GEJA 3D06A 3AYAA 3ECUA 4MSWA 1ZLEA 2PXYA 4Y1SA 1BECA 1IBBA 5K0UB 1MPAL 4KHPB 2OUHA 2EIGA 2AJZA 1IPKA 4CDQB 2JK5A 2ZNXA 1JZ4A 3GGWB 4LQRA 4JKMA 3RWHB 3RDJA 3PWPD 1USQA 2Y06H 4Q74A 1LHNA 1EHNA 4R5TA 1T66D 4ETYA 2AAVA 5EZOH 2XPGB 5SV8A 1JD9A 2Q0ZX 4U1KB 1BZ9A 3VBOC 2H0VA 1T7ZA 3FRPB 2J7MA 3GO1H 4QT5A 4JDOA 2FECL 4LF3B 5C0IA 4LSSL 5D6CA 1PGL1 1OGPA 1EO7A 5H37H 4X8JA 4NERA 3F7QA 3GBNL 2Y0OA 1ZVNA 1DQDL 4J3OF 4KO6A 2IWEA 1M5IA 4YIOA 1COV3 1MIML 3A0HZ 4KL1A 1I9IH 1QBMH 1ZVYA 4TS6A 2C7UA 1TPXB 4WV1A 5FYMA 3H4FA 1W6QA 4MTFA 1MHHB 4K3EL 4N90A 5F71A 4D0QA 3DUSA 1ND2B 2J6EA 1LOBA 1M7IA 1ZD6A 4L4TB 4LC1A 2RS13 1WLDA 3GWJA 4J6RH 1KCVH 4EZKA 2VH9A 3AWEA 5DDHA 3QWRD 1E28A 4QNPF 4D2NA 4OGQB 1EQWA 2JKNA 1BIIA 1NCBH 3EO1B 4HC1A 3RYHB 4K2UH 4BSJA 5KS9E 1PIV2 1S6NA 2BJMH 3CRAA 2BRTA 4IGPA 1CWPA 3IFNH 1DSFL 3AG4B 3LPPA 3X1BA 2XWCA 2E9GA 2FWSA 3LRKA 4E0RA 1DJSA 4ONFH 4HHAB 3VFSB 2ED6A 1NYWA 5A2BA 3U7AA 4EB6A 3MI6A 4QXVA 2ZPXA 3QZWG 1AZUA 1FXVA 1ZLDA 4PR5A 2AKRA 2O6PA 4TT3G 2BY3A 3SE8H 3C60C 5IFPA 3T65B 3U0TB 3K5MA 3HUJE 4HCRA 2AEYA 4M8RA 4GLRH 4XX1E 3O4LD 2IBZH 2LABA 4DR6B 1S7VB 3L3IB 1KPVB 1MQKH 2PMZA 3WDIA 5BRPA 5JI9A 3MSPA 1F11B 2ATKC 1VQNV 3MROB 5IROD 1K8IB 3GXFA 3FQUB 1UY3A 3PGFH 4XUOA 5CA1A 1OCCB 2QKAA 2VW6A 4YSUA 5LLIC 2XIDA 4D3CH 2CM6A 1TETL 2E6QA 1QOTA 4Z5RA 1T4KB 2VW4A 3CZUB 3KWXA 4FKKA 3GK8H 2IJ0C 4M1GL 2ARWA 1Q3EA 2A6DB 3KLQA 4YZFF 1MAML 2Y4TA 1ZJAA 3RPIB 5L2KB 3DHPA 1FPN2 2G19A 2C24A 2K0RA 4NM8H 4LE4A 3FUDA 1MW3A 1KFAL 2LAGB 3T3MB 1PVC3 3N36A 1DN2A 1FV1B 3B1TA 3BP6B 1FNFA 4GKOA 4OFVA 2RN9A 5GHWH 5CD5C 5AW3B 4IEXA 3SHRA 1NTKH 4Q52A 1AYM3 1BQPA 2ZP9A 3BDYH 2WN2A 4AXOA 4Q2ZA 4P02B 2PUSA 4PELA 3KLDA 4N3UA 3JBG1 3KR3H 2X4TA 1PZDA 3ARFB 5LMNB 2IG2L 4AYID 2FT7A 1IXMA 5AG2A 5I2IB 2WFF1 2M6YA 4AL8H 3RZLA 3NAAL 5JW3L 3VUAA 3Q06A 2P9RA 3LKSB 4LFBO 3AXHA 3IDMB 4L4VD 4AYSA 5BOJA 5IP4A 2QZ5A 4NAQA 2N0MA 2CXKA 4DNLA 2Z4QB 4X9IA 3NNFA 4NWUH 1X5HA 1HRI2 4EMZA 1OCRC 2IAMC 3DOIA 3UZQB 1RUML 2VLKE 2DIAA 2ZMKA 1YHFA 1AO7D 4XF3A 1JAEA 4X20A 1NCNA 3L70H 2E9JA 4AC2A 1S2EA 2NNUA 1UKQA 3ASWA 5FCUL 4F7MA 4N53C 1KTLB 4DHLA 3LV3B 3WUWA 3W58A 4M7ZB 4GKSA 5FZMA 1XB8A 1MCQA 1W8EA 4QTHB 1T1WA 4OX9B 4D0CA 1DVZA 3M8AA 1RZ7L 4NNXB 3ZE0F 3KNBA 4Y2DC 1S7UA 3KVAA 3L3JB 5D1XC 1FFPA 1T2QL 4DV5O 2XZAL 3BD3A 4Y22B 5FO7B 2HG5B 1UXZA 1HW7A 4Z7OF 2QGEA 2R9AA 5AVWB 1AQMA 4I5SA 3SIKA 3POHA 5HPMA 2R043 3PWUA 4JO8A 3U46B 5H5NA 3MV9B 1X5MA 2MJWA 5B3JE 3L4UA 4OVVA 4J23A 2C4XA 5ITZB 4U1IA 5GRYA 2P8PA 1C1FA 2PLV3 4HX1A 4WM7C 4F8PA 2D93A 4KNTA 2WVSA 4J39A 4HOZA 3FHAA 4H26B 2VQEO 5LGTA 1FYTA 1NS1A 3RIFF 4GAFB 1XF5A 1MHCA 1U0AA 4JRXE 4OB5L 1KV7A 1GLHA 2GJZB 3H9ZA 2VUOA 3D85B 3NTCH 3FFCB 4HUXB 5E5MB 4BGLA 2FT8A 3FQ1A 4NPYB 3L17A 3X2QC 1YYLL 2YKLL 1GW6A 1UWGL 2EE3A 3B7RL 2X29A 2B46X 4NPLA 3ARBB 3ARWA 4R97B 2DQGL 3VHRA 4HN1A 3SE3C 2G3XA 2ETWA 2FQPA 3U1SH 3X14B 3HMYA 5LMUO 1ODAA 3SODB 1MH5A 3IDIA 3X3FH 4TVPL 1HIML 4LSPL 3ZMVA 4LF9B 4Y89A 1HEZB 3ULVF 3H7YA 4HS6A 1KNOB 1YY8B 4WUKH 4BXSV 3EGXB 3DGTA 1IM3A 3GBEA 3NFNB 4OFYD 4U49A 4YDZA 5FUCC 3VQWA 4RHV3 1UWXH 5C5UA 2X4RA 2CIIA 2E7BA 3INOA 4CSTA 5KSBA 4LE3A 3FYIB 1YFUA 1JGDB 4C56E 2I69A 2ZUUA 2H3XC 3IDNA 2WKLA 4L2NA 5JSPA 1K3ZA 1NJIW 2QWRB 3THML 4KQ3H 3ZHTA 1AS8A 4DIXA 3BVCA 4I3PA 4UAPA 3TBTB 4JFDE 5ICYA 1XMOB 3WXVH 1IQAA 3H1MA 3BT2L 2MIZA 1H2LA 2CKBL 2H9GA 3EBGA 3TXQA 4HKBB 4X5LA 2ZUTA 2XJQA 1L0QA 1WDAA 5C8JA 3U07A 4CDGC 4CCJA 3OJVC 2EIKB 3IGAB 4Q6IB 5IUSA 2DVFA 3VGDA 4MS2A 2CDFA 4QPYA 4P9ML 1FORH 1LDPL 5D7EA 1MFUA 1KJ3L 2WP3T 1XF2A 3GSRA 4YZ2A 4OV6F 3K8KA 4KMTL 5IW6A 3MA7A 2HX7A 4IXLA 4NMIA 2HFFA 2F08A 5I1CL 5AAPA 2JRIA 4PB9L 3N91A 1WBYB 2JJ6A 4DR2O 4XBPA 2BX5A 1D4M3 3DJRA 1G9AA 2XX0A 3H9SD 4LDEB 1AQ8A 3ZMOA 4IEFB 3HN1A 3PJQA 2DH3A 4PJYA 3LPWA 2P5ED 3DV4B 1R19A 4ZI7B 2OR9H 3EFOA 1JERA 3SKJH 5FGCE 3T8XA 4OT1H 1RGSA 1TFHA 4W9JC 2V7HA 5CILL 1JVLA 2ZOKB 5CLYA 4ZKTB 2FWOB 2IMMA 4H13B 3X1GA 1FIGL 2DAVA 4ZS7H 5EZLA 1A7PH 1L7RA 3B8MA 4IIQB 1OY3B 3MIHA 4XCEB 1MHPL 4DUWA 3BKML 4OZFB 3ARDD 3SDLA 1HCZA 1CDUA 1OAUH 1MQTC 2XOMA 4TUKL 3QWQB 3RG1C 4UAOB 4WW2F 1T04A 1NOVA 4AQZA 4PS4H 5IJBC 3K6SB 5IMKB 1TQSA 2A6XA 3QARA 2F6BA 3IJ7A 2NY6D 4F8QA 2NDGA 1ZL8A 2WWOA 2XA8H 2W46A 1BMV2 2H26A 5JXHA 3S3WA 2G2RB 3HB3C 2AV7B 1QQP1 2ZYIA 3N42F 5CINH 1IL1B 3ISYA 4D0BA 1JGIA 5FFOA 2YSUB 4YHML 1XYPA 4GRWF 2H32A 4I2XA 2YSSB 1CVRA 1TVHA 3VZKA 2PXJA 4I01A 3BUQA 4MKMA 4X6FB 1NI8A 4NWTL 1ZTXH 1RK1A 1WUZA 3MOAL 3MRKA 1P7BA 1Z9PA 1RIVL 4LEOA 4B9JA 1J83A 4L23A 1PZ5A 3TFBA 4FT8A 1G4MA 2OX0A 5HD8C 2ADPA 3S8FB 4U2AA 4XC1L 3V4VA 4XCYA 2FEDD 4OI2A 1DQQB 4INDA 4LCUC 2WXNA 3VNZA 2FAUA 4JAUA 4FFFA 4Q4X2 1WCBA 3CMEV 3FU9A 3V5HB 4XRCA 3VD3A 1BD2A 1R3LB 1N4XL 1QSVA 1R17A 4YFLI 1NIDA 3LKNA 2HB0A 3LDRA 3EHBB 3B8SA 2ZA9A 4FS0A 1BV8A 3X12A 4IJTA 4BINA 1OE3A 3O4LE 1OAQH 4N8UA 3TJEL 1YFWA 1O6TA 3VBRC 1NM9A 5F1IB 2NNAB 2OMTA 3K2KA 1U0QA 5B1JC 3ZPOA 5J8OA 1WCKA 4MLIA 1OURA 4URKA 4JQTA 1PLBA 2GT9B 5GZFA 1FHGA 5IUQA 3N27A 5D72H 1NCQB 1LEKB 4WGVB 5IFTA 3E8UH 5EU3A 5IHRA 1NDMB 2VDNB 2I5YL 3QNXA 1YUDA 3VGAB 4XE0A 4Y4FC 3SKNB 3LFIA 1NCTA 5EF2A 1IC4H 3AMPA 5IQ9B 4LBQD 3ZTNH 1F86A 4PT6A 2BHYA 4MTMA 3UG5A 5A2CA 4KAQH 1NFAA 3IDGB 4XI5C 1AZZC 3C6SA 1U3ZA 4ZO7A 4L0YA 1DLHA 1IS6A 4RQQB 2CO7B 1YRZA 3V4LA 2RQ8A 3QCTH 3VXMB 3EJZC 5J12B 3LRGA 3KM2A 4XHXA 2LW1A 3MRIB 3H3ZA 3HZYA 3E2HB 3WTYA 2WWMC 4OJFL 2WLNA 5DS8B 5GGSB 4DEPC 2ZEXA 5JWPA 3ZXLA 1MJ7H 1EO5A 4QRRB 3IDJA 4PJEA 4L4VE 5C8CA 3KPOB 1BPLB 5F3HB 3CLEL 1ONQA 5I18L 4OF5A 1RMU3 4ZS3A 1MWAA 2RS12 5B4NA 2X4OB 1I7ZB 5ESQA 1B0RB 3ZMEA 2UWEB 5KVGH 2Z93A 4Y5VB 3V52L 3ZUCA 1RUQL 1HXS3 2XFXA 1QPPA 3I02B 3B94A 5JLZA 3BAEL 1JOPA 5DEGB 1BXHA 4Y8DC 4J1XA 2D6NA 5J2TB 3JARA 2KT6A 3G5YB 1F58H 5D2NB 2X1OA 4QHNA 4HUVB 1JWSB 3EDFA 1Q0YL 2ZKYA 2ZGRA 5L7XL 3TEWA 4P14A 2CJUL 2N56A 1YVLA 3OTTA 4JYAO 4UDUA 1YY9C 2YD1A 4K73A 2JDMA 1VACA 2XG4A 3PWVB 4WIQA 1DDHA 1WS8A 3HG1B 1IS3A 3GXUB 4PDLA 5ADOL 3B2VH 3QJHA 1UL9A 2NXZD 2EE0A 1A8MA 2R1WB 1DE4A 4JPIB 1QX1A 3UAEA 3TEYA 2OYZA 4EN3D 4R9DA 5KSVB 3QFJD 1WA6X 4AVIA 1WBZA 5IEKB 3D05A 1BJQA 1OLQA 4H8VA 4PVLA 5TQ0H 1FAYA 4IHOB 5BCAA 4MJIB 5E6ZA 3NAPA 4EBQH 3BKJL 2PCFA 2QQKL 4NC2B 4QY8B 4QXWA 4AIZB 2EABA 1ODNA 1G9DA 4RX4A 4LUKA 2UYLB 4B8EA 3NJGA 5JIUA 1T22B 3RQ3A 4MNGB 1P84K 2Q76B 3V0AB 3SH5A 1HX6A 2P3YA 1PVC2 5CBEB 4J3XA 5CNHA 1RUE2 2JGUA 1REIA 4G27B 2GH8A 3QF7A 1YTFD 2AMGA 5A2IH 2ZIMA 1BQRA 1YEDA 2EDFA 2D03H 2VM9A 4JN1H 4LCWA 4A1RA 2HWF3 2R061 1G9EA 4NENA 2W1WA 3I7DA 5E16A 2WIIA 3A4EA 1ILSA 1K8AW 4ZK8A 3O8XA 1U3NA 4ZUSA 4XP1L 5EU6E 4QU2A 3IZOA 4IRJA 1YPZB 3HNTL 4KFZC 1GZTA 1GWMA 1R9FA 2MCPL 3MV8A 3VU1A 4KJYB 4TPRL 4CMHB 5L6YL 3HFML 4PJ7A 4QQ2A 1ZVFA 2W5FA 3F7LA 5JJNB 5IJDC 2WY3B 4HWZB 3P4NA 4GW5B 3B56A 4LHUG 2X7RB 4X0KB 3ZYPA 4CC0A 4ET7A 3I6LE 2H1PH 3MNVA 4OMDA 1FNYA 2EYRB 4DEUA 1EV11 2AJUL 2IC2A 4HWBL 3PWJA 2PQSA 3ZRFC 1MG3C 2MHAB 2ICWB 3KYMA 4PWFA 1I5YA 1KXQE 4X64O 3DX6A 4DCQA 2P37A 3BP7B 1KDKA 4B3MB 3U0ZA 1NGZA 5ISZD 3AVEA 1ZHBB 2MOVA 3L7EB 3O11B 4QF1B 3GMLA 1LUWA 3OMZA 3EH2A 3TCLA 1B0IA 2X0UA 2RGSA 3LS4H 3AGWA 1XNRB 3V4PL 3ZOAA 2RR11 1JFQL 5KMGB 1DEDA 1QR4A 2BSRA 3SH4A 3AVRA 2OXHA 3MACL 1EZUA 3RVTC 1B90A 2YRLA 1W15A 4DETA 1XIWD 1JV5B 4O4IA 1NMCB 3BZ4A 3ILPB 5DJCB 1DFXA 1ULFA 3MRFA 2PLV2 2HFEB 3ILQD 1QDOA 4JX0A 3W3BA 3HAGA 1KYUA 3WNJA 2CR0A 3H9SE 3WN5C 2BOJA 3QDMA 5KBNC 3K0WA 1MSDA 5A16A 1F6AB 3QDJD 1T1ZA 4YX2L 43CAB 1DVQA 2IVJA 4PJ5B 5E9DA 4LKCA 4MTXA 2P5EE 1D5IH 2LGWA 4XBQA 3D69A 4MVRA 3G04B 4M9PA 4YE4L 4YXLL 5I17B 2APFA 4FX5A 2XTLA 4PLOA 2VDNH 3TN93 5CN3A 2V2TA 2W5PA 1S7XA 5BS0D 5ALBL 1HYRC 5GS0D 1VCBC 1CU4H 5I19L 1ENRA 3EKCA 2ZWNA 4MAYB 4X4XB 4M4RB 4X7EC 3HG2A 1IEAB 3W81A 2XG5A 3PREA 5C9KA 2WC2A 3OGIB 1J1XH 1NBMG 3AADB 4K7JA 4XILA 1H6TA 5K4LA 1BZQK 1SVZA 4RQFA 1SXAA 7TAAA 1SYSB 2WJSA 3RTQD 5I5MA 1IS5A 3OY8B 4RHV2 2QM7A 3MLUH 1AAJA 1TVBB 4QXTB 3C08L 5JDJA 3AFLA 4GMP1 1H2MA 4DFSA 3E6HB 3SCFA 2EXYC 1PD3A 4CSSA 1GK9A 3AY4C 1MXGA 3GBML 3P2TA 5HHVH 4AG4H 4DKFL 2ARAA 4WM8C 4Y4KD 1REFA 4HS3B 3FQYA 2E9WA 3ABZA 1KBHA 1D3CA 4J3OD 4NGHH 3V0EA 1YQ8A 3C3TA 5IK3A 5KYXB 4FP8L 1W0NA 4PJXF 4ATFA 1U58A 3TA3A 4J1WA 4MSWB 2PXYB 1E3ZA 1OARL 3SOTA 3IFOA 2FSEA 2V5RA 4KO5A 1AP5A 2AJZB 3L54A 1K5SA 2JK5B 3WENA 1ULEA 3MW4A 4XBFA 3OZ9H 4PRIA 1E8XA 1K5MC 4XUNA 2GQHA 3K2UH 1SQBH 5I6XC 1QJU2 5DQJA 4CP2A 5J1AA 5CCKH 3NACL 1LODA 4P9HC 3WKQA 3T1MA 1BZ9B 2NY3D 4AQYO 1HHGA 1RZPA 5JIHA 1DBMH 3RAJL 2EKSA 2G75A 4QT5B 1FSKB 1M7XA 3T08A 5C0IB 5MP6L 4R0LA 2DQJL 1MS9A 2B20A 5D6CB 1XCQA 4OIBA 1RIHL 4CN6A 1NUKA 2WBJC 2DI9A 5GALA 2WUBH 3E8GA 4X8JB 3INUH 3ZDZB 3EQEA 2AGAA 1OCOB 1WGOA 4QHPA 2VZSA 3DO3A 4WK4B 5DD0L 1YEFL 3HI6L 4CH3A 5DJ6A 3ARPA 4WV1B 2Q1ZB 1H8EG 2C7UB 4P3DA 4PG2C 4AYGA 4UILL 1JZ2A 4O4HA 3T3PE 1PO11 1W6QB 2WANA 1YLBB 4ISRA 1OHHG 4D0DA 2R72A 3OAAG 2ALAA 2B7DT 3DUSB 3OJMB 4N8VG 5LXGL 1RHI3 1FZJA 1M7IB 1T2JA 1WF5A 2YD4A 2F43G 3WXWL 4J1UA 1I1CA 5DDHB 1UAIA 1F45A 1E28B 3JVGC 4DP0X 1MN4A 1WLHA 3AL5A 2OKXA 1BIIB 3SNMA 3QDGA 3HCVA 2RQ6A 5F9OH 4Y5TA 4YZ4A 5I71C 2BPA2 3ES1A 3KVQA 1DQJA 4B9IA 5C3SA 4DO5A 1FUNA 1XDCA 2HKXA 4E0RB 2BVPA 4EB6B 1RPRA 4HDIA 3RI8A 4PR5B 4XNBA 2AKRB 1K33A 5EBMA 5L88H 1DU3D 2VVFA 2BCMA 2ENPA 1BBJA 3RPKA 2K6ZA 1XSQA 3D6EA 2ZWLT 3LNEA 3HKCA 3VDBA 2YN3A 1ZT4A 4ADGA 4W9IC 1OQEA 1Y9GA 4YIQA 2F4PA 4F9LA 1L4IA 1WA4A 3ARGC 2W0LA 1P1ZA 2WQRA 3DXAD 2B5IC 4CU6A 2P7TC 2QSAA 2IXHA 5CA1B 1HRV3 1DLFL 1NFIA 1HQWA 3UBXA 3AJYA 3BI3A 1HE7A 1NBVH 3GUTA 2C34A 3FSOA 1DZRA 4HXCA 2FGZA 4P4KC 4Z5RB 2W94A 2BTQA 2HHHO 2JB5H 4YDKL 1IZ3A 1IAOA 4ZS6C 5BMFL 4BE3A 3SDXE 2D0FA 3RWGA 5C4WC 4ODWA 3O6ML 3U10A 4L48A 4MBOA 4WNJA 4R9BA 2W87A 4JM2F 2X6AA 1I8IA 4UBDC 3ZKMD 5TE4L 3S6PA 4COVA 3I3BA 4E27A 1SA0A 3HR0A 1GGBL 2VLLA 4K8RC 2YN5A 3GRGA 4OPHA 2EEDA 4PJIE 4H0LB 3ML9A 4LLDA 1SUJA 3OKNA 3QFJE 4Q2ZB 4W9DC 1GKBA 3FT0A 4MB4A 2X4TB 2BFVH 2CTQA 3WZ1A 2GMMA 5AVUB 2WOYA 2V9TA 3HZVA 1CK0L 2AS5M 1R1A3 4AVAA 1FI8C 2WO2A 2QVTA 1DGSA 4RDQG 2HWC3 1L0NH 4GAJH 1R1BA 4NZTH 4EZHA 3BH8A 4G3YH 5EEWA 3Q8EA 2DV6A 2GTAA 2N05A 3CZJA 2AENA 5HI0A 4X20B 1IEBA 2VL5B 4BMBA 4NROA 4R4BA 3TWCH 4NEHB 3CJXA 3L4XA 3UROR 9PCYA 3QUZD 4F7MB 4Y5YC 1HH9A 5KYYA 3BRFA 1FXZA 1N1SA 1IBFA 3AZUA 2BWDA 3WUWB 4F5CA 4W4NA 3M7AA 4DN4L 4WFFD 4GKSB 1OKEA 3T6VA 3UGEA 3MZGB 2L6LA 1BVLA 1T1WB 2GC4C 1BEYH 4D0CB 4PDWA 3Q2NA 5KBDA 4EN9B 1Q72L 3KNBB 1S7UB 2C26A 4RGNB 1FFPB 3IE9A 3BLPX 1RMU2 2BP3A 2JQAA 5D7JC 5E6IC 5EIVA 5FUZL 2CHDA 5A3ID 3SKVA 2XI9A 5GZND 3E1ZA 2JTDA 4AGVA 3ZKXB 2WXGA 5GPRA 2AANA 2DQ6A 4MYWB 2GY5A 4PY8I 1HXS2 1KXGA 2FX7L 5HPMB 3ULVD 1W2NA 3IJEA 3PWUB 1IGMH 1WD3A 1F42A 1CD0A 1WPCA 1F0LA 1IAIL 1PBYA 1RULH 2IPUG 3O6FC 2UZYA 1HJFA 4JRFA 1S7WA 3RHWF 3ZE2B 1A3QA 4XN4A 4U1IB 4H33A 4QPJA 2ARJQ 2P8PB 4HX1B 3B2PA 3UAFA 3OOXA 3UTTE 3N40P 3CU7A 2HTKC 4BWWA 1EN4A 2PYTA 1FYTB 1XF5B 3VBFC 1RZKL 1MHCB 4N6QA 5D5ME 3TTYA 1D5ZA 2LUWA 2JWYA 4RMUA 3JZ7A 4JQIL 2I32A 3L1EA 1GC1H 4F7KA 3D4YA 3GLZA 1UXLA 4NHCL 2ENSA 1JU4A 2NY4C 5ESVA 4FM1A 3T1YO 2QVFB 2XJVA 1HINL 3AXDA 4Q20A 4OM1H 1N4CA 4BPZA 4GRLC 3FONA 3MR9A 1OAXH 4MFHA 2WWSA 3P9MA 2F1EA 2AABL 5CFDA 1MH5B 2DW5A 2DTMH 3IDIB 4ZW7A 3RZJA 4J12A 5IJRA 5GRWA 1Q8OA 4AEJA 4HS6B 2MCG1 2IDSA 5EZIH 4YVUA 3ZQ9A 1IM3B 3QDJE 3U7WL 4MB3A 2X4RB 2CIIB 5KSBB 2CLZA 2X5IA 2VDQB 1U8MA 5DZFA 2GEQA 2F8VA 4Z7NF 2KDYA 1EN5A 3IDNB 1NCRB 2XV2A 1RUD3 2EIBA 5AZ2L 1FNAA 5BS0E 4XB3A 1F4YH 2J6EH 1IMHC 1S55A 2Q5TA 3ALQA 2AH2A 2R69L 4BK5A 5E2TL 4K94C 5ICYB 5F3GA 2WAAA 1MAKA 1NC2D 3QDHA 4LNRA 1W0JG 1XOUA 1IT9L 1K5NA 2H9GB 2LFEA 3FTYA 4HC1H 4PTUA 4WLCA 5DTFA 1UOBA 2PYLA 1QBLL 1TJGH 4HFWA 3TBYA 3F5WC 5C8JB 1ZPUA 3KLLA 4U1NA 1Q9WA 1KCSL 2CDFB 1WYJA 2J1AA 4NHLA 4YHPA 2B08A 4YBLB 3I2CH 4YWGH 1JZ3A 3MLWH 2AMUA 1AJKA 1XF2B 1VEWA 2C9AA 3GSRB 1C9SA 3EJKA 5IW6B 3MA7B 5C2BL 2BZCA 3QYNA 2HFFB 5F6LB 1XMQB 4HCRH 2YBKA 2WXRA 3CN4A 4L8CA 5DXDA 4XAWL 4XBPB 5GZOD 3ZGIA 3VBSA 4IK7A 2BVEA 5KW9L 2E7LA 2AI0H 3GXDA 4HSQA 1A6AA 2ZCLH 1QNZH 3RX7A 3LQAL 3OAUL 3UO1L 3VKOA 5C0GA 5JR1H 1X9UA 3EFOB 4U31A 3UZEC 4GKYA 4P2RD 3T8XB 1RUF3 4XCFL 2DF7A 2AC1A 4DUZB 3ZXEA 4FOVA 4P05A 5ANHA 2Q3XA 2V7HB 4G82A 4AGRA 1I8AA 4GMP0 2Z3FA 5IM7A 2ZX0A 3QHFL 4B7KA 4JI1B 2CHNA 1WA1X 4XMUA 4BFIA 3GVMA 2PWDA 5K9JH 3JWDC 3D52A 5EZLB 4QKNA 1JJ2U 1MFDH 2Z8WC 4HH8A 2VC9A 1FJ1A 2HT2C 3UQ8A 1A7OL 2YARA 3CZFA 6PAZA 4IUGA 3S3XA 1T04B 3QRGH 3CRCA 4EIGB 4DK3A 1CQ9A 3FE5A 1DR9A 1QPXA 3LDBA 3FMGL 2IQAA 1WK0A 4J2QA 1JTPA 4ZFOA 4KK8D 1ZL8B 2QVKA 2A74C 3AQDA 3FFQA 1C57A 3OPTA 2H26B 1W8HA 3TN92 3H3PL 4EI5D 5LK5A 3BUTA 4WENB 3CC4V 4FYSA 5AW5B 5LDUA 1AG6A 1E4KA 4U3HA 4D0BB 5A7BA 2ZHKA 4JVWA 4JZJA 4GWMA 4KU8A 3FQ2A 5DMGC 2H32B 3BISA 4I2XB 3CC1A 1TVHB 3EYVA 3MBWA 3I2KA 4XFCA 2AQPA 3CC7V 4HPKA 3GZQA 3WNLA 4N43A 1DF4A 1CLZL 2KI6A 2UX6A 2AJSL 2RE9A 2M1KA 3QEGH 1RK1B 3ETSA 3MRKB 1F3JA 4YM0A 4LEOB 4A2MA 1PZ5B 1ZSHA 2AJ3A 2VDOB 4NCC2 4MA3A 4XCYB 5HI4D 3V4VB 2VN3A 4W9CC 2GNBA 1A9EA 3GDCA 3VKLA 1PZ7A 4XPGL 2QDOA 1FO0L 5FK9A 1WCBB 3VVWA 2PPFA 4OU3A 4KI5C 4QXUH 2ATPA 1BD2B 2GTZA 4XRCB 5JIIA 1RUI3 4AK3A 4B1LA 2PTVA 3LKNB 4GO9A 5IK8A 1SCSA 4FKEA 3X12B 4QHKI 3UOAB 4CS3A 3D09A 5AZUA 1QJY3 5D7SL 1QFUL 3EYSH 2OMTB 1K4CC 4X98A 2WSKA 2C9PA 1UB6A 1GAFL 1NOAA 3DXAE 3AG7A 5BNPC 1ZOXA 2E76B 2HTLD 3K6FA 1A4CA 4ITCA 4RMWA 1TEIA 3K04A 1P4BH 1CGVA 4EN3B 2DLIA 5EU3B 4JO3H 4P23A 3QNXB 4FJCC 2L3BA 3WQBA 3SBWA 3I8TA 5AVZB 4N8CL 3SJAC 5FHBL 2EO9A 5C8WA 4KITB 2D0HA 4PEEA 5LXTA 7CGTA 4UOQA 5KSAD 4PD4J 1XU1A 1CZ8H 1KCUL 3D39E 3C6SB 2QKIA 3SE4C 5FY0A 4OLUL 3RL1A 1DLHB 1DBKL 3ZE0E 1SG3A 1XMEB 4PJCE 2VXJA 3HZYB 5FYBA 1NC4A 3ASNB 4Z7OE 3CFBA 4FQCH 3PMEA 2RS11 2GSGA 1VADA 1KMIZ 4J9YB 3HNSL 5DR5L 4H4NA 2A6YA 4N0UB 3IDJB 5K9YA 3I2OA 5SWSA 5C8CB 1X5FA 2K4AA 4KO9A 3HJ0A 3O2WH 2ZPKH 4W70A 2DN9A 1HH6A 1ONQB 4XF9A 3AL6A 1MWAB 2DJUA 5TF1H 3I49A 1SQGA 1A6ZA 5ESQB 1J0KA 2VDQH 3RDTA 5FTTC 3VWKC 2Z93B 4UQ2A 2COQA 2XFXB 4ZOAA 4EFBA 1CGWA 2Y1ZA 3B5HA 2ZAGA 3MREA 5JLZB 4XJWA 3JARB 1MCBA 2WAOA 4QHNB 3WHXA 4PV1B 1T66C 4YZ3A 4LASH 1EAPA 1G9ML 3CNKA 3AB0A 3CXDH 4C8XA 2FBJH 2JQZA 4WFFE 1BCXA 1W9SA 4G9SB 5EUOE 4UFHA 4UDUB 4W8JA 1I5XA 4IBTA 3ZFEC 5E2WH 3T1FA 1VACB 1MJ8H 2XG4B 3LKPA 2CALA 1DDHB 1XGYH 2R1XB 3FU8A 3ILDA 5ISZB 4MYPA 1DUZA 1MDTA 3QJHB 3RLSA 4A63A 4AYMC 1QH7A 5I0RA 1DE4B 4LBAA 1YQ5A 2AYHA 1UZ8B 2HVJA 4QRPA 5C08A 3MJ9A 2ROYA 4DGIL 2WNVC 1G1CA 4LGPB 4QD2E 1S4CA 1W9WA 5I1JL 1WBZB 2IFRA 1IQWH 2PKDA 5BPPA 1HRV2 1PSKL 3U48A 4ODHH 2Q8AH 3MF9A 3NAPB 4RWYL 4WFGA 2PCFB 4WBBA 1VPHA 3F7YC 3DYOA 1VIBA 1ENSA 5IWAB 1BG9A 2Y0PA 1KXVC 4AEDC 1RUE1 3VE0A 2D7OA 4JLRA 1CUOA 4NSKB 2XWBA 2WNEA 3G7TA 3QIWA 4OFQA 1UKGA 2WYHA 4JFFA 3ULUH 4W6WA 4DQOL 4N0RA 4HETA 5DQDH 1YEDB 4LCWB 4UQDA 1YMMD 2A1WH 4ONHA 1JPTH 2WIIB 3RZCA 3O8XB 4M3HA 4ZUSB 4FFHA 1WWYA 3GBFA 1S5HC 3A4FA 3AU0A 4IRJB 3X17A 2C9VA 1ZGLP 3ILFA 5IWLC 2A9BA 3MV8B 4B3NA 1N70A 2CAZC 2PWHA 3G6JA 4O4LA 1JHKL 3JT2A 4PJ7B 4YSPA 4RO2A 2HWC2 2XGXA 3GGLA 1QOKA 3QQXA 4X5WA 4DKDC 3P4NB 1H6XA 3RE0A 1MZZA 2ZOWA 2CXGA 3D3QA 1T6BX 4QX1A 2H6BA 5FZOA 2IDQA 1HV0A 4IGQA 4PGJA 4FFVD 1YCSA 2VXSH 3MNVB 1JCHA 4Z2WA 1NLBL 4JS7A 4NZRL 4YE0A 1T7VA 1Z3GL 3WLWC 2Q86A 1IIIA 2X53A 2OYKA 3QO5A 3AKSA 3P77A 3PWJB 4NPRA 4UVCA 1PKQE 3KYMB 3OT7A 1Y6KR 2H32H 1CGPA 3DX6B 2V17H 4DCQB 3U0PA 5FZHA 3Q2LA 4JPVH 3SEPA 1NGZB 1QRND 4MW8A 1A14H 5FY5A 5DD5H 4WU7A 3TCLB 4MJJA 3GMLB 2CIKA 4P59H 3UTSA 1JYWA 2ZJCA 2C5DA 1WP7A 3CWBH 1JS4A 1VLXA 4EO5A 3KLHC 4NP4L 1N34O 1N0XH 5FYJH 2FJHA 2VDOH 2BSRB 3PP3K 3V4VH 1R6TA 2WD0A 3GHEH 4Q5OA 3K74B 5MHSD 4DV6O 3HE6A 5EOCH 4P2AA 4FQ2L 5JHAA 5DDJ2 5FXXA 1QLEC 1SDAB 3BQUD 5GS3A 3WI9A 4FTDA 2QQIA 4O4IB 3BZ4B 4M7KH 3RN4A 4JFUA 3DX8A 1LO4L 3MRFB 1T21A 1U8IA 4HZLB 3GT6A 4KOCA 1W06A 3QD6A 1EPZA 1GXEA 3A4DA 3ZZLA 4JCMA 5ABDE 4TQHA 2X53S 1FXHA 2FQEA 1LNQA 3QDMB 2F66C 2L7QA 4PRAA 5GGVH 5A16B 1T1ZB 4FPYA 2WSPA 4UUJC 2VJ0A 1E65A 5E9DB 4JHUA 4GRMA 5I28A 5EIYB 1F41A 4B60A 2Z4FA 3D69B 1SXNA 4S1QH 3C2SA 1C5DA 4P2RE 3FW6A 5DVMA 3TBWA 1QOOA 4R9CA 2FD6H 4PLOB 3IBOA 1AI4A 1S5IH 3QTCA 4Z3FA 3RVWD 4EUPG 1Y07A 3ARSA 2V2TB 1URXA 4BIZA 1S7XB 3VJ6A 1KCRH 4PJHF 5HVFB 2K9FB 3T1WA 1SBSH 4WZFA 1JK8A 3C2UA 3P32A 4X6CF 3V5DA 3U75A 3VZMA 4RHV1 5C0JA 3NSDA 1CLYH 3GHBH 2XG5B 2ERFA 1X33A 5EH1A 1I5PA 4HGWB 4RFNB 3RVVC 3BTAA 3QBTB 1KEXA 4PGDA 1KBBA 2AQNA 1B06A 2QVIA 5BUAA 3VL8A 1Z9SA 1QNWA 5EC2C 1IAKA 3RL2B 1V55B 4WFEA 1SLCA 1V3KA 1XE7A 3V0IA 6CGTA 2FCTA 4J5VA 2IUWA 3PJYA 3T6QC 1BMGA 4QKBA 1BPVA 4KDWA 1XRUA 4RL7A 3NGBC 5GRUL 2EF6A 1LQBC 3OG4B 3OMNB 4GXVH 1RUD2 4P5TC 2VXUH 2R4SH 3UTSD 1T7WA 3WS6C 4EROA 1MWAH 4AFDA 3JBG7 1E7UA 5IK3B 1AIFA 1SYVA 2X9YA 4B3SO 1BAFH 1U58B 2DWXA 3C5ZD 4ILDA 5GQBA 3TA3B 2X9ZA 4AIXA 5HHQA 4MYEA 4XC9A 3NCJL 4G6KH 4GS7C 3IFOB 3EYOA 1QJU1 4GIQA 4KKAC 2FSEB 1N5YL 2BQPA 1QXRA 4QM8A 3MRNB 2Z35A 3MNZA 4PRIB 1IHMA 4HXAH 2EDQA 4LA3A 1C5BL 4HPOL 3VWJC 5KOVC 4FIPC 5DQJB 5J1AB 2NMSA 5DRXA 5MEND 1H8TC 1MEC1 1LE9A 3AACA 1Z9OA 3M8OH 1MI5D 4W4ZA 1J87A 1G0XA 2IH8A 5EN3A 3TV8A 1HHGB 4BU2A 4G7VL 2G75B 1VZIA 3NP4A 4LVHC 4R0LB 1U5ZA 5EORH 2WCSA 4MASA 1XCQB 4OSUL 4PAZA 2VO8A 3BUYA 1IOAA 2BP8A 3E89A 1GZHA 1HSBA 1MCOH 2N7AA 3BMWA 2X6UA 5B22A 4CYDA 5F5QA 2AEPL 1D2DA 1FMD3 1RUF2 1H3VA 3G9AB 4GW1B 4AQOA 2B4KA 5ICZA 3CFMA 3SDDA 1OALA 2H2SD 5DJ6B 5F1RA 1VGEL 4P3DB 4DGYH 4O4HB 1SOSA 3KJ4B 5B39G 1E4XH 2UUDK 3IWVA 4FNLH 4D0DB 1OLME 4NAMA 1IX2A 5EWIL 3T04D 2P17A 5C0NC 1FZJB 3B5LB 1FA4A 3RDIA 4J1UB 2WA4A 1L7IH 4LVEA 3FUOA 1Z1WA 1UM5H 2G30A 1E1RG 3ZSEA 3QDGB 3HCVB 4MMZA 3LH8A 5JHMA 3FS9A 1FJGO 3CS5A 2XWTA 4QRAA 3V9EA 1DQJB 1TZIA 4N25A 3MN8A 4QWNA 1Z32X 4MAUL 4JM2D 1WZKA 2GJ6A 1LEIA 2BVPB 4B1MA 5DJ0A 1KS4A 3UKMA 1B4JL 1VENA 1DYPA 1Y1DA 1XNAA 1A0QH 4A3XA 4HDIB 1H2KA 2A5UA 4RR3B 5EBMB 4ZPIA 1M6OA 2VXQA 4ELDA 1BBJB 4CDWA 3M7FB 3QUMA 5F0PB 2VGLM 3HKCB 2B9BA 4LT7A 5IK4A 1ZT4B 4RCAA 1WLTA 3KYKH 4YIQB 3KWWA 4FFWD 2D73A 5EU7E 5HHNA 1NWOA 3IGFA 3UXFA 1H15A 4X7CC 3WP6A 1JXGA 1P1ZB 3B02A 4KZDL 1QTSA 2NTSP 1KJ2A 4JHWL 2NUPA 3SZ6A 1NFIB 2F7OA 3UBXB 3GUTB 4XJ8A 4N8PA 3TNQA 1G0DA 2YWYA 2JDNA 1X8EA 1WFNA 2BTQB 1I4FA 1NGWA 2X2JA 2ZAHA 4MD4B 1E9QA 1UENA 5CEYA 3CX5K 3CZGA 1IAOB 1PP9H 1KLGA 2XHNA 1YI2V 2GIYA 4PBDA 1TVKA 3KHCA 5KUKA 3RWGB 1OV8A 3VFRA 3ARDC 1KIUA 4ODWB 3C09C 4F3JA 3S0MA 4OGAD 1I8IB 1Z5LA 1TZAA 2B1AH 4RZCA 1QJY2 3RRDA 1SA0B 1Q6IA 2VLLB 3HE7A 2HFGH 2OK0H 4NQCD 2EDDA 3OGOE 4LLDB 3OKNB 5LB1A 4FPPA 2D4FA 4JRWA 3CCUV 5B7FA 5B8CC 1M2VA 3WKYA 5L0QC 3K2OA 5M0TA 4OKDA 2VISA 3SQBA 1JZ5A 1VQMV 5JJEB 3HZVB 2XH6A 2Z0UA 1JG9A 1QDCA 3MW3A 5F7DA 5F7YC 4PRPD 1U5YA 4Y33A 1BK1A 5F3CA 5DO2D 4JGJA 1UG9A 1Y1UA 2WO2B 3VG0L 3H8RA 4D7TA 2BCKA 4DKEH 2YMXH 4XN7A 1F13A 2HSIA 4LPVA 2D3PA 4ACTA 1M2OA 5I8EA 2BOCC 1CFVH 1YYCA 3BH8B 3THDA 1OP5K 3N41F 1FXKA 4O2BA 4HBCH 4XDJA 3CDYA 2VDLL 2W08A 2L0DA 1IEBB 5C3OA 4R4BB 3WKMH 4ZOEA 5IFJA 5KYYB 3MXWL 2FEDC 3RUGF 1HH9B 3OPZL 3R0NA 2AGJL 1XSOA 1HZHL 1YMME 2BNRD 2X28A 1S7TA 4R7DA 4HOWA 3ZIMA 1QJX3 2O5XL 1BX2A 1P2CA 3H1HH 3KH3A 3T3ME 4OLYH 1BVLB 3DX7A 4PDWB 4GKKO 1YNLL 2CO1A 3T1LA 3G4SV 4UB0H 5DURB 1GFF2 3MRLA 5CG9A 2PR4H 2VC2L 4DV1O 3B2DC 2CLVA 4W9KC 1QHOA 2BSCA 4Z7UF 4A39A 2P4AB 2A5ZA 3LSSA 4DFHA 2GSIA 1Q9KA 5E8NA 3T1CA 3ZIAG 1K73W 3IJEB 4PB0H 2EILB 2QUOA 1Q43A 1CF1A 3G6DL 4Z95H 3U82B 2BXZA 3D36C 2LVEA 2UZYB 1VGKB 2Y3AA 2EEAA 1S7WB 3HC3L 5L3BA 2W81C 5D8AA 1GR7A 4WI4A 4WRLA 2DQCL 2ZX5A 1G6VK 5AB9A 3EAKA 2RDSA 4NUGL 4GXUN 5I0VA 4AYBA 4FXGA 5T1LB 1QRNE 5DI8A 3CXHF 1ZTXE 3J7MA 2IANE 1UM6L 3QI9C 1O9GA 1C16A 1KJMA 2E4TA 2JFCA 3D0VA 3KL0A 3OKYA 1D5ZB 4HIPA 3BSHA 4HSAC 2X87A 1QSEA 1W72A 2N4IA 5DMKA 1SXCA 1ZM1A 3GBWA 2JDAA 4R26L 3S3PA 5MHSE 1FPTH 5ESVB 2O8QA 3SYCA 5FGRA 4GRWB 3EOBA 1XFPA 4DYLA 1HV1A 1LESA 1CFMA 3FONB 3MR9B 1YAZA 1UU5A 4Z1VA 2C3WA 3APNA 1U8NA 1IEHA 3UGGA 1T80A 5HHMD 5E95B 3U0WH 1XX9C 5CFDB 5EU5A 5JMRA 1RINA 3FQTA 1CURA 1IRAY 2BM3A 2JCCE 1BWWA 4F9PA 5LXVA 2QR4A 2WTRA 3HRZA 4MMYA 5K9OA 3POWA 2DDQL 5GLUA 5HCHA 3NSYA 2CLZB 2X5IB 1U8MB 4PS7A 1W6NA 4YHHB 1GMIA 3V0BA 4P9IA 5C9AC 3K58A 2HLAA 4MGZE 4O4YL 4AFMA 4NO0A 1TTAA 3D5OF 3EGSA 4KRPC 5CHNA 2GBTA 2O6DA 2XN9A 5GTHZ 2AHZA 3FFCE 4UM8A 3OUIA 3HPJA 4M1DH 4Y4YA 4LNRB 1JUHA 1K5NB 5IBUB 4PTUB 5TGBA 3SPGA 5FWJA 1W91A 2NXZC 3AAZA 4HFWB 3TBYB 5J5EA 1UXXX 4U1NB 5B1BC 1BOGA 1INEH 2HJFA 2MOQA 1Q9WB 1GANA 2DUQA 4QKDA 4I9QA 1JE6A 5F7WC 2BH0A 4HVRA 3WXPA 2F58L 2Z8SA 4X65O 4LO5B 1WJZA 4YHPB 1P6AB 1KMGA 4M56A 2XN2A 1NPNA 4QRBA 5DQ9A 3D4KA 2BSEA 2Q9OA 3GS0A 1XCTA 1WN7A 3EFFA 3OPWA 2B1HH 3CHOA 4NC0B 1B6UA 1SCRA 2QNKA 3GRBA 3IT8A 5FRAA 4L8CB 1W9YA 2PP8A 2YGPA 3FKSG 2KQNA 2CKNA 1VBA3 3AXEA 3B37A 3Q13A 4RSYA 4DW1A 3FO2B 4W9FC 5KTEH 2R8SH 2UXTA 2W1SA 2YC4A 1A6AB 5HFMA 2A2QT 3B7UX 4OZGA 1ZEAL 5AW8B 5KVGE 2RJ2A 2DWYA 5C0GB 1MREL 3EH3B 4KHXL 4PWKA 5TDNA 2BVOA 3M3CA 2Z42A 2DQIL 4HJTA 2E7MA 5HVWA 1GY2A 5TTRA 2J1RA 1RSFA 3CZKA 3KHQA 1Z78A 2B9UA 3GIVA 4BQ3A 4BFIB 2VTXA 4U2YA 3KCWA 4W4OA 1YNAA 1FJ1B 2JKSA 4KP4A 3EB7A 1O6SA 4JV4A 3DPRC 3X13A 3DUIA 3CZFB 2O1QA 1JWUA 2J1YA 5I1KH 2WVTA 1MSWD 3HMXA 4G6MH 3WEOA 4JRAA 3L45A 1GP4A 1XF3B 4XURA 3LDBB 3JWOC 3PDQA 2IQAB 4ZFOB 3ZN4A 4G43A 4IRSA 4RQEA 4C57C 3PHOA 4Z7VF 4FYTA 5HDOA 4F24A 3TVMA 1FD9A 1IKOP 4LARL 1W05A 1PJWA 5E6RB 4GQPH 4S11A 2CV6A 1Y18A 2WWWA 1WGVA 1OTUD 4JZJB 1FKAO 1BREA 2CO3A 3GDBA 2C1OA 1BVOA 4NUMA 4RFEA 3MBWB 4UQBA 3EYVB 3GI8L 3L9EA 5DZPA 4NZDA 1JHNA 4HPKB 2A4ZA 3NNLA 5D7LA 3L4WA 4N43B 3GLEA 5IBTL 3H2QA 4AHCA 2PW1A 4NCC1 3VQ2C 5HVGB 1VRH3 3AZVA 2DYCA 2IXLA 3C5XA 1OBNA 1S0DA 1QFWM 1FCGA 3T0BA 1F3JB 4YMPA 3O1MA 4KZEL 3L9JT 1KBPA 4BKLA 2AJ3B 1ZZ6A 2YIDA 4MA3B 1QP1A 1U3HA 3OR7C 1TJIL 1XIWC 2Z31A 1A9EB 3SKUD 2NP0A 2YC0A 2ALWA 5AKSA 1TO5A 3BPLB 3N04A 5FK9B 3R18A 2ATPB 4PBOA 2R70A 1RUKL 3U83A 4M5SA 1CYGA 4AK1A 3FLPA 1O7DE 3O5SA 4XIOA 4QOKA 2ZDIC 5E1AC 2ZOUA 1YJLA 3WOGA 3JD4A 5L3FA 1NGXA 3T2QA 2R0ZL 2A9HA 3GJEA 4Z92B 1XDTT 2OZ6A 4JZOA 2ZCEA 4X98B 5J1SC 2LJ2A 5FAAA 4A7QA 1UB6B 2V4LA 3PHQA 1GYAA 1XOYA 3KCPA 1LTEA 2BP6A 4IGOA 5CP7A 3TH2T 5AOZA 2IBZX 1JMKC 2W9EH 1XREA 4N28A 4P23B 1Q0XL 1N3QA 3K5LA 2HWE3 4M6AA 4S0TD 2GG1A 2Q20A 1JYXA 1SHWB 1ZZ8A 2EXKA 2K9ZA 4P0DA 5DLMH 3NSTA 4BFKA 4FPCA 3COOA 1Q82W 5JOZA 5LXTB 4ZW6A 4ZW8A 5HFLA 5ES4B 4HS8L 4IE7A 3U30B 3RTQC 1OD9A 4LIQH 1Q8PA 2QKIB 4J28A 4B0MM 2NNFA 1W3XA 3RL1B 1S3KH 4H8WL 1NCAH 1A6VH 4GRWH 1SLAA 2VNCA 2V3FA 4LOVA 2CM5A 2ZXCA 3FU5A 2W68A 4MXWL 5AW0B 4WVWA 4M5YL 3VN4A 1W2KT 4QRQA 4N2LA 3ESUF 2AW2A 3AS0A 3DX2A 1NC4B 1MRFL 2ED8A 4PJFF 1MQ8A 3CFBB 1NIEA 3N43F 3OKOA 1VADB 1B4TA 4Y4KC 3O1SA 5E0FA 2E5EA 4J3OC 1J1PL 5KYNA 2JKRM 5SWSB 2MQCA 2J8UE 4M93C 3EYPA 4L99A 1HH6B 1UIJA 1PGW1 3QUXA 3CVIH 1KC5H 2BLFA 2D31A 1A6ZB 4P5SA 3ROOA 4TULH 3U4AA 4LKSA 3MZHA 3RDTB 4PS3A 5CEHA 1M56B 1SDYA 2WWKO 3QYCA 4UQ2B 3EDJA 1P84F 3L75H 1M9NA 2JIXA 1PD1A 4M62L 3MREB 3ASOC 4R2GB 4UWQB 5DGRA 4EQ2A 4CGTA 3O0XA 2EDNA 4B29A 3Q48A 2PWFA 3HZMA 1GMGA 4JFQA 4OTXH 3WHXB 1DGWX 3O6KH 1UT1A 5E9NA 1EAPB 1BYHA 4XQ4A 3AB0B 2WW8A 1RP3B 1TEFA 1X44A 2NY3C 5T1LA 4DAGL 4PW3A 4EN6B 3UJTL 1P8JA 4I5BA 2BY2A 3T1FB 4IKJA 3LKPB 4WY7L 4CEWC 4PG9A 4IBWA 2FMYA 2DS4A 3MUHL 3U7YL 5CIRA 1DUZB 2MKWA 3KPSA 5EUKA 4JFTA 5CCHE 3QVNA 3OB8A 2OZ4A 3CFCL 1JNNL 2F1AA 2HVJB 4QRPB 5C08B 5JR2A 4X6CA 4M8QA 5TE7L 2H8PA 3U36A 3VBUC 1U6AH 2VDKB 3D2UD 4N87A 5F2SA 4OCWL 4CP0A 4N68A 4PWHA 1QU0A 2DMBA 4TQEH 4DK5A 4Z7NE 2JVDA 1HEHC 2WQ4A 4SLIA 4TLUA 1B2WH 1SY6A 3C8DA 3VE0B 1SVBA 3IDYB 4ZS2A 1TQBC 1L6PA 2CD0A 4JLRB 1OF2B 3VI4E 2XWBB 5J13C 3QIWB 3BSZL 4TVPD 2QJDA 3BZEB 2ISDA 4JFFB 5EZJA 3TT1L 2Z1PA 3NKTA 1R3KC 4IGBD 1NKDA 4AVCA 1D7PM 2K3TA 4JM0A 1DF0A 1HOCA 2Q8CA 4U7SA 3BGMB 5T1DL 2DQTH 3BKYL 5CFHA 2N7GA 2ZZJA 3MI8A 2WCPA 3RZCB 3M45A 4KJPD 5F0LB 4LCVA 3BH4A 1CE1L 4PP2A 2QHRL 1XCXA 5DD1L 5HHME 5CEZL 3L4YA 1T0MA 3W9AA 4O4LB 2WXFA 2IWFA 5DZ9A 5IT2H 4QM9A 2QSQA 2UV3A 4X5WB 2VMFA 2XTJD 4OH2A 4MA7H 1U30A 4K4KA 3CN3A 4IEQA 4MJIE 1S7SA 4JREB 4KQ4L 4Y19D 3BAKA 4MA1B 2WNWA 2Q8OA 4TQ8A 4BUQA 4J4PD 4E41B 1MCKA 3KCXA 1G43A 1OF0A 2Q86B 3P77B 4AYEC 4YHZL 4YSRA 4I18C 2G4IA 1NZ6A 4X5PA 2JENA 2FO8A 3KJ6H 3U0PB 2HKHL 5I6NA 5F9JA 5F7UA 3ZZSA 5AC93 2EIJB 5IW1A 2D97A 5T50A 1U8PA 4WU7B 4JPQA 4ZRGA 3UTSB 2CIKB 5DDJ1 4MNQD 4YFWA 5FPBA 4JFZL 4QRFA 2NCEA 3ZTDC 2F7RA 2FJHB 4K1ZA 1DUYA 2CGPA 3NOIA 2NX5A 3HE6B 1G6RA 1HXYA 1AXYA 5IYCO 2D7TL 4UF0A 4EKXA 1FPOA 3FULA 4KVNH 1KF9B 1DLCA 2H1XA 1VQLV 2QKCA 2E8ZA 4NN6B 4IL6Z 2EACA 4MB1A 3FQ4A 3DX8B 2FB5A 1T21B 1U8IB 3WJJC 3POFA 3FB5C 4MTGA 4EDWH 5B38G 1YAIA 4KOBA 2X05A 2E32A 3QZOA 1BGXL 4PRAB 1XUQA 1BBT2 4NKDA 2A71A 5ERWA 4GRMB 3JQOB 3CNAA 3P3YA 1RIUH 1N12A 4MZIA 1T6WA 1C5DB 1TTUA 4PS8A 5I26A 3TBWB 3A4AA 2IPUK 1C5HA 2W88A 1JYIA 4JI2B 3JTSA 4R7CA 2V9RA 4GBXA 5LXGH 3GBGA 3VJ6B 4WUUD 2DTYA 1JK8B 1WPBA 4LEBA 3V5DB 4JTNA 2WKOA 2XL9A 3JSNA 3DEMA 5C0JB 1C8M3 3UGHA 1YYNA 2RM23 3NH7H 1Q1JH 5GLWA 4CBPA 4Z8FL 1FYJA 5GZNC 3DVNA 1XB6A 3OV6A 3GB7A 4H20H 4PGDB 4UQIM 1BF5A 3CFEA 1Z9SB 5IWFA 1IAKB 3WEBA 1UEMA 3L74H 1ZZCA 1UACL 3PWLA 2ZT9C 3S5LG 1DJZA 3LX9A 2CWMA 3CK0L 3SLIA 4HJUA 3USSA 5IR1A 1MFAH 1MVFA 1MFNA 1S0IA 5A3PA 1XHXA 1DYKA 2YAOA 4H88L 4AGLA 1LCLA 5FCCA 1I1RA 3Q6GH 2DBIA 2E75B 4P2QA 1FGNH 1QACA 2EC9U 5KVEL 3GWOA 3QO8A 5IK5A 2R0LH 3S97C 2AUYA 3U11A 4LU5L 1WD8A 1R34A 1W6WA 2OYLA 4K8ZA 3GSVA 1AIFB 1SYVB 1LGCA 3QUYC 3GHMA 3RVUD 2WB7A 5ACMA 4QHBA 4L8JA 5HHQB 2BUKA 3OAZK 4XQDA 4XNZB 3EYOB 3VTAA 2NPIA 1FG9C 1F7YA 4GEIA 4UINL 5AWNL 3NSFA 1IC1A 3B5GA 5HGBA 3CJHA 1ZTMA 2Z35B 2QQJA 3MNZB 2NNXA 5I1DA 2W9XA 3FAVA 3RYPA 4CH4A 3O6LL 1G4YB 3L9BA 1JI6A 5FZCA 5DABA 3KBHE 4O9HH 1V3MA 2G2NA 4GMSH 5HI3C 5DRXB 3FD9A 3WV0A 2OAAA 1LE9B 1EHLH 4AK2A 2RS33 3PUHA 3WW1A 4KHTH 4HVBA 2ZIOA 1IKNC 2D8KA 2PR9A 3MCG1 4H0GA 3IM0A 1RUF1 4GIPD 4NFCA 2QQKA 3W20A 1A22B 3MJ9H 3BUYB 4UB8Z 2BP8B 3EBHA 1HSBB 5IGXL 4WVMA 2BVVA 4B3RB 2VDKH 1PMIA 2OZJA 1FLTX 1KQSU 1LMKA 3NIDF 4JG0H 5ICZB 2EVJA 1UD1A 3UAJC 3SDDB 2KHAA 1Y74A 1ERNA 3EXJA 2YBGA 3AXLA 1FC2D 3LOIA 3CCLV 4CUAA 1ZLWK 1SUHA 4Z7UA 3S37L 3TNMA 4I7ZB 4KO7A 4GWJA 5FYLL 3FBYA 3WFBL 1GPOL 2GI0A 7PAZA 1Q38A 2VAAA 1YRKA 2J3SA 3WG3A 4MMZB 3WU1A 2XWTB 3OSKA 1TZIB 2X4UA 4RMRA 2ZEYA 3OGCA 4PY7A 1WKYA 4UOJA 2A6WA 2GJ6B 1LEIB 2YIBA 5DJ0B 2QVMA 3X3GH 5I1HL 5TDOA 5KX5A 1A6PA 2IOOA 5EC1C 1BWMA 2JMRA 1M6OB 1BIHA 2CK2A 3QUMB 5E2VL 4Q4W2 3T1YB 2B4CC 5ACLA 4HWBA 1IGIH 2VJXA 4M01A 3KWWB 5HHNB 5FL7G 4Z3IA 2JB4A 3Q5YA 1G94A 5F44A 1VRH2 1H15B 4YK4B 4HYOA 3ARED 3N1MC 2ZHLA 2F5BH 1AZRA 2KQXA 3TS8A 4MV2A 1KJ2B 5HP5A 1SEQH 4FC3E 5IUCA 5LY2A 3RY6A 2NUPB 5BNNA 4P99A 2DQ0A 3FFOA 4HU8A 2F8XC 2E63A 3MBED 5SWZD 5I8OH 1CICA 1DVFC 1I4FB 1JWMA 1NGWB 5CEYB 5CISA 5L7OC 1E9QB 4MDIA 3O0VA 2Y7NA 1KLGB 5KOMC 1GQGA 1VFBA 2IXJA 3VFRB 1KIUB 3DRQA 4R9HA 3CBRA 5D6DA 1LO0L 4Y1VA 5FYJD 1YA5A 4WWPA 2OSWA 1EEZB 1Z5LB 4XP6H 5IE9A 3BVWA 3NZHL 4ZTPH 4RZCB 3FT2A 2GCYB 2ZP0T 3HE7B 4FQZA 5IMOA 4DPBX 1ZYBA 4XN8A 2RA1A 3D5OA 4KK8C 5BUGA 4LMFA 4DZBA 5I9QC 2KLRA 3EF4A 3HPLA 3S6CA 4YW7A 1M2VB 4GALA 2JKLA 4PJ9A 4CU8A 2VISB 3SQBB 4IEZA 1EH9A 4OKVA 3N9QA 1D2OA 3KE0A 5H37G 2Q69A 5F7DB 1D6VL 4MMXA 2DCKA 4OIFA 5DUBA 2L04A 4J11A 4PIBA 5AKVA 5GGTL 2LOEA 5I8EB 5E70A 3U2SA 4YIPA 3ZVVA 4C4UA 1OOPC 4HIXL 3JALA 2XJKA 1FXKB 4O2BB 5C8YA 2A4EA 2H1LM 1U8CA 3FTWA 3V0JA 3QIBD 3AWGA 3IFLL 3EJYD 4AGQA 2YIBD 5I8KH 2RCVA 2CSPA 4BM7A 4X7SH 3IETA 3PYCA 5AQ0A 4AILC 4K5PA 5IFJB 1ACZA 2IXIA 4XCCH 1DVUA 4R7DB 1S7TB 3W0WA 1C8QA 3LH9A 3UBFA 2OTJV 1BX2B 1P2CB 5DUPH 2W9DH 1T7XA 5E4OA 4R8HA 2L8AA 1KDIA 3DX7B 5F2FA 2D44A 3UESA 3VVVA 2NDFA 2JIGA 3MRLB 1LULA 1UPIA 4P9HL 3S3CB 1BEV2 2P90A 2IZWA 3WN6A 2CLVB 2QTEA 2FHFA 1X6LA 4WTWA 3MC0A 2XTJE 3Q7JA 3WHE1 5JXIA 3TRSB 2VQ1A 2GSIB 2HTLC 1Q9KB 1SDDA 4L5FH 4Y19E 2J42A 3IFPA 5I8SA 4YDLC 3H55A 3JVFC 4MZ2A 3I3DA 5LCVL 3V7AE 2TEPA 2H0JA 4NRQA 5D8AB 4ZZ8A 4ZXBA 4MA8H 5K0UC 2HJIA 4CDQC 4FXGB 1A32A 1MLCA 1CYXA 5DI8B 5FWQA 2Y6GA 4CS2A 2NY5H 2IALA 2DDUA 1C16B 1KJMB 2HKOA 2A4CA 2X7LA 3D0VB 5DMKB 4UM9A 1Q94A 1I3VA 4OCRH 1QSEB 1W72B 4PQXA 3A6CL 4AM0A 1RJ8A 4IETA 5JZGC 1MVUA 2FDIA 2GTWA 3MLZH 2BZ7A 5CR8A 2V7NB 3EOBB 3WF4A 5KVFH 5AZEH 1IB5A 4QX7A 5HXVA 4FQIH 1JGLL 4WV8A 2K8MA 3UL4A 1U8NB 4PCTA 3W2DH 1X4YA 5AVTB 5LUMA 2P28B 3GMQA 3RBZA 3FN9A 4FHBD 3SYAA 4XNUH 5EU5B 3FQTB 5KEZA 2Y5TA 5EU7C 3WTWA 1G8WA 3AK3A 2F7IA 2DVGA 2RS51 3GYRA 3V0GA 5IVCA 5IQ7L 1DJGA 2Q73A 2WTRB 2NN4A 1D9KD 3E8VA 1TPXC 3HRZB 4MMYB 5K9OB 1J86A 3SOBH 3IMWA 2E6PA 3F6JA 2E74C 5C5TA 4Q4Y1 3WO4B 4IHJA 1W6NB 5J1XA 5KZCB 3GWKC 3V0BB 5TFSH 1ZANH 5FLHA 2EC8A 1HB1A 2HLAB 4LCIL 5F7HA 1KZYA 1EDHA 4AHWA 1W2BU 4NO0B 4FPGA 1PV0A 3EGSB 4WUUE 5CHNB 3BWUC 4V2WA 2ZR3A 3L5IA 1CXHA 2XN9B 2QQLA 3WUCA 1KY6A 3MMEA 5C07D 3LN4A 3RI5K 3AG4C 1YCIA 3HPJB 4UM8B 2TSAA 3QEHA 2Q1FA 5TGBB 1K9TA 2R56L 3AAZB 3IWZA 2QZ3A 3ELNA 1IG0A 4LPLA 3MYJA 4OZ4A 1BOGB 2HJFB 3B7TA 1EHKB 4WGKA 2RMU3 4FKHA 5GGSY 4YWAA 4K20A 5EOCJ 1VDGA 1IS4A 1L6ZA 3FC0A 2WTOA 4K8RL 1WZ1H 4XTPA 5DQ9B 2JJSC 4GG6F 2NTFA 5LL6Y 1J7VR 2VXQH 4L3FA 2XXZA 1I1AA 3QUMH 3EFFB 5FEBA 4X80L 4A55A 3BODA 2ZE5A 4UTCA 1EAH1 5D71H 2R0KL 3CVHH 4IMKC 2PHUA 4OZGB 1K5QA 2DJVA 1KJ2H 3CDCA 4B9ZA 5KBLA 4HG6B 1H6UA 2WQVA 5TDNB 5FXZA 2R32A 2BVOB 4NQVA 1DANT 5C0BD 5MI0C 1VHPA 4OLWH 1CD3G 1Z0MA 4FFZA 3V8OA 3GIVB 3FB6A 1OK8A 5ILTL 5T3ZH 1DQMH 4N9GA 4AW7A 4P2OD 5CP3A 2YGNA 4ELKA 1FZMA 4ZFGH 2YRBA 3OTOB 2KZKA 1RZFL 1O6SB 1OP3H 5LHHA 3X13B 2K9UA 3IXAA 3NV2A 1C5CL 2J57A 3ARFC 1JWUB 2VRQA 3KGUA 1AJ7L 4U3SA 2QQOA 1QWUA 4XXCC 5CLXA 3H85A 3C2AH 3FRPG 2VCAA 4M6ML 3SQRA 4X8AA 4FFVC 2DBJA 5E1GA 2WNOA 4E9YA 5FREA 5K1XA 3OXRA 2NXYB 4G43B 4IRSB 4PA9A 2ICCA 3PHOB 5C6WH 4UQAA 2ARXA 4N5ED 4CH6A 5GKAC 3P2DA 2CK3G 3NMEA 1ZX3A 3TVMB 4IE4A 2QZ2A 2HT4D 2LTQB 3JYCA 1QLNA 1Y18B 5DD3H 4DP5X 2C1OB 3RVYA 3DHMA 1X5GA 1C8M2 5KWYC 3UFIA 1RPOA 5D7LB 2RM22 4NHMA 1YUHA 1A4AA 2PW1B 3GXTA 3IEAA 4EZJA 5LGNA 1MRCL 4DW2H 2FKXA 4F1ZA 2VN4A 4X6EA 5C6PB 4CVZA 2JCWA 2HX9A 1XGRB 2P5PA 4BKLB 1AOZA 4PH8A 5E56A 3BE1H 3BQUC 4XH2A 4BWTA 1GBGA 4OUSA 2E9BA 1U3HB 1U3JA 2Z31B 3TIDA 4A2UA 3VD0A 4X8NA 2N01B 1XTMA 4H8PA 3ACLA 1YEJH 2CBQA 3CFNA 5LBSA 3PURA 4H5SA 1DO5A 4X1IA 2Y7SA 5B7EA 3VG9C 4LHQB 4QOKB 2BS8A 2YQBA 3DVFA 4TXWA 3B3QE 4YSCA 1NGXB 2QGBA 3GJEB 4XMKL 1E6OL 2QVSB 1LWJA 1U12A 2YOAA 4JZOB 4PIZA 2PWEA 5DEFA 3LEYL 5J56B 3OBTA 2QADD 3KCPB 2VYRE 4N0YH 4GOSA 4C55A 1KD7A 1SQPH 3GM0A 4LQFL 5JPMA 5CP7B 3OLIA 3RVWC 1XB9A 3MIDA 2JTYA 4OCTA 1NEPA 4Z2AA 2CBTA 3R1GL 5D93B 5SWZE 1A7NL 5J9PA 4BQXA 1TTRA 1IC5L 4JQIA 4U4BA 3P9WB 4OLZL 3MXVL 1XGTA 3MLKA 1AD9A 1G5AA 5ITFA 5GS2H 2ZQMA 1K92A 3RUGE 3ZKSD 2RS32 4UI9L 4GSXA 1PZ2A 2AHYA 1E67A 4Y9FA 5F70A 5FYJE 1W72H 1WMFA 4XDPA 4K94L 4A6YL 1X9PA 3WQ1A 4L1TA 1TSRA 3TL5A 4LSSH 3W1ZA 4WO4A 2VVDA 3Q8BA 4N2IA 3EBRA 1P7HL 2FD8A 5APAA 1BD2E 5EYYA 2DU1A 3JATA 4QRQB 4LHKA 3E6DA 4LP8A 2AVGA 1N34B 2NSMA 2R15A 2EXIA 3OKOB 1YC61 1DQDH 4UBGA 3H3BC 1IXBA 1U5IA 1BGYH 4F93B 1H30A 4JUTA 3K3NA 1ORQC 3SCGA 4DV6B 2O5YL 4HMEA 4R8CA 1VLNA 5F0JB 3MF6A 5E1RA 5AVPA 4K3EH 3C5ZC 5EK0A 4HEPG 4J3VA 3MDJA 4CN1A 3QUXB 5JIAA 4RAUA 4U6VL 2D31B 3ROOB 2J55A 2R69A 4RSUA 2W60A 2WXHA 3RNQA 4WU5A 5GZCA 3HKBA 2JIXB 5IVXF 4UW5A 4FPKA 5EEYA 5A80A 1XF4A 4JFQB 3HZMB 5JOFB 1BE3H 1CPNA 5FYZA 3V64A 3AVSA 1AGBA 2CGRL 2DBLL 2X4NA 3LKQA 1W8OA 2A3TA 1LD9A 2R2BA 4MT8A 3BT0A 3CZLA 4I5BB 4JY5L 4Q6IC