4PI2A

Crystal structure of particulate methane monooxygenase from methylocystis sp. atcc 49242 (rockwell) soaked in zinc
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
390
structure length
390
Chain Sequence
HGEKSQQAFLRMRTLNWYDVQWSKTTVNVNEEMVLSGKVHVFSAWPQAVANPRVSFLNAGEPGPVLVRTAQFIGEQFAPRSVSLEIGKDYAFSINLRGRRAGRWHVHAQINVEGGGPIIGPGQWIEIKGDMKDFTDPVTLLDGSTVDLEHYGISRVYAWHLPWMAVGAAWIFFWFVRKGIITSYIRVAEGKADDVIGDDDRRIGAIVLALTILATIVGYAVTNSTFPRTIPLQAGLQKPLTPIETEGTVGVGKENVTTELNGGVYKVPGRELTINVKVKNNTSQPLRLGEYTAAGLRFLNPDVFTTKPDFPDYLLADRGLSVDATPIAPGEAKEIVVKIQDARWDIERLSDLAYDTDSQIGGLLFFFSPDGKRYASEIGGPVIPKFVAGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords unknown peptide
publication title Effects of zinc on particulate methane monooxygenase activity and structure.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 85
structure length 390
sequence length 390
chains with identical sequence E, I
ec nomenclature ec 1.14.18.3: Methane monooxygenase (particulate).
pdb deposition date 2014-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4pi2A02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 4pi2A03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 4pi2A01
3CHXA 4O65A 4PI0A 3RFRA 4PI2A 1YEWA 3RGBA 4PHZA
chains in the Genus database with same CATH superfamily
1ODNA 4MDJB 4Y4KD 2HRPH 3TTSA 1SRDA 4O02H 2E7DA 1JNNL 3DPRB 5BV7H 5EIBC 4IW4C 3A21A 4HXCA 1BHAA 1OCOC 5LNGA 2I74A 2WSSG 3HOBA 3P1IA 1G7QA 4Z3FA 1ZVFA 1IURA 2AQ3A 4JTOA 1PVC3 2VDOB 1HN0A 4HCGA 1FG2B 5FZ4A 3FCSA 4Z7UF 1N2RB 2VXRA 4BFIB 4R9AA 2JD4A 2UZPA 1QFOA 5JMCA 2ZX5A 3GSNB 3NBNA 2HJKB 1MPXA 2ENQA 1BXHA 1HB1A 4KWLA 2CHDA 4GKZB 1GKOA 1QU0A 2YMXH 1FVEA 3TVMB 4OZFA 1UJ3B 1GPOL 4QUOA 1VFBB 5LVEA 1Y9GA 4EZ4A 1SUHA 3MN8A 4GRMA 5IY5B 1RHI2 3CNKA 1FWXA 5F1NB 1JHTA 1G7IA 5E8NB 2CV6A 5DWUH 2FEDC 3GBLA 1W9WA 3DYMA 2EZ0D 2WNUA 2OYKA 2HMIC 4DRXB 1A4CA 2AVGA 1BOGB 5LCWL 2HYMA 4X5WA 2WZPD 4RISH 4HQQH 3ZHTA 2ZSWB 2ATPA 3D9AL 5IQOA 4MGKE 1UB5A 2O6EA 4OFDA 4RS5C 3FOLA 5IF0A 4AUUA 5IFHL 3H3LA 1PDKA 4FG4A 4H2CA 1NFDA 1AQDA 4R9HA 5GGQL 5KVDL 2XIBA 3SZKC 3P2DA 1NI8A 4BE5A 1GZWA 1DLFH 4IEYA 3EFFK 5EF2A 4E27A 2H8PB 4J6RL 4XJ8A 4RFEB 1G86A 1JXGA 1K5NB 2PP9A 5L2KD 1V54B 5KX5B 2X1PA 2GCYA 4MZIA 5F0PB 5C0AE 1FNHA 3J26N 2KG7B 3UGXA 4KITB 4NQED 3RYIB 2VR7A 4UVBA 3MAWA 3X12A 4Y16D 1FJGB 4U7KA 1QX1A 3VXTA 1L4IA 3O3EB 4LKDA 1S5LZ 1WITA 3SPCA 4WV1B 4ZHQA 3SJVD 3ATBA 3VWKB 1K9TA 4Z76A 4PV1B 3GYRA 5A2BA 1I7RB 1VLXA 2BSDA 3I49A 4WSGA 3PQYD 4NO0D 1LEKA 4QEGA 5HGDA 2DWDC 1X5YA 1RUC2 4BWOA 5JCTA 2JE9A 4OKDA 4ZMXA 3HR6A 4EZJA 3C9NB 1E4KA 3IBEA 4X6EA 5J3UA 3H0TB 3P9MA 1H6UA 3MIFA 1UT2A 3N1GC 2J4WL 5DT1L 5CJ8A 3PV6A 1DCEA 4NWTH 1ZIAA 3BDYL 3BKML 4L1TA 1KV7A 1DO6A 5HYJB 2G60L 4GZ9A 3TH2T 2CK2A 3IU4H 2ZHKA 1JI1A 5AVSB 1YJWV 1MUJA 4Z9KB 2EC9T 2VXUH 3PWUA 1HXMB 4NHUA 4BSJA 3QLQA 2I9LA 3FJSA 2VDQL 2A77H 2BZCA 1N0LA 3DHPA 5BO1L 2ZXBA 3RVXC 1OFSA 5F96L 3ZRFC 1J5EB 3AMHA 4XFBA 3QK0A 4XW3A 4WFFA 4LT5A 3UTQA 4YGEA 1BMFG 4FA7B 4PJGF 5KYXB 4JRXA 4I1PA 3MLKA 3DUSA 4JI4O 3DARA 4FSJA 3FQ4A 3DX3A 4RQPC 4TUOB 5SWSB 3BAJA 5MI0B 2WINA 1A9BB 5ABAA 1C8M3 5IT6A 4HBQA 4Z23A 3MW4A 2VL5B 2KQXA 1KIQA 1C28A 2BVEA 1X3DA 4Q6IC 3MLSL 2BJMH 3PFUA 4ANVA 5JQHC 1MF2L 1HNWB 3WDIA 1U8NA 3ARGC 2GU9A 4FQQB 1CFQA 3OTOO 2GTAA 2ICCA 3RPBA 1A6TA 2EJRA 1FYTB 1UQXA 2CBOA 2FEEL 4OGAD 3FUQA 2ZKMX 3DROB 4XT1C 1T80A 2NX5E 5GONA 1MS3A 1O9HA 2B4CL 2A6IA 1O4TA 3MLTB 1VBC1 2DYCA 3HPLC 5C3TA 3VGGA 3M3CA 1B2WH 2YK1L 4HT1L 1P6WA 1WAAE 4FYSA 3V9CA 4OV6F 4EN6B 2AJYL 4HGKC 3WMQA 2ZXEB 2B46X 3UAJC 5DUXA 3RFZA 4PUBL 1HP8A 1JD7A 5LDSA 1S72V 3H7JA 5T3XD 5FZOB 4QXVA 2ICEC 4L97A 1LO0H 4OSUL 4XNZC 4B9ZA 3FTXA 4HIIB 1CZ8L 3AU0A 2CMRL 3FMGL 3GM0A 2CH7B 4DV5O 4M5ZL 5B4MD 3RYMA 3VRIB 3SCGA 2VRKA 5DZVA 3X29B 1AXYA 5CGYC 3UEZA 2JJSA 1NDGA 4ASMB 1SPDA 1KB9J 1TIUA 1NLDL 1IGFH 2XZQH 2IWFA 4JQVC 4NM8L 5E4AA 5HP5A 5LXGL 2B9VA 3HMYA 2E75C 1CD3G 4JDTL 4HJJL 1IGJA 4ZS7H 3S3JA 2PPFA 3BAEL 4BXSV 2ZS6B 4A3ZA 4LBQD 1GRWA 1AOHA 2NZIA 2GP5A 1NCHA 3C3VA 5ADOH 1FNZA 3WHUA 3PU7A 1U3HD 2F7IA 2O5XL 4N5ED 4P2QD 5BRZE 4Q8LA 4KNUA 5JQ6L 4PG9B 5FZMA 5CBLA 1VQLV 1F6AA 2YPJA 4QQLA 3EH2A 4B9CA 3LXBA 1EV11 3O8XA 3R06B 4NRMA 4TSCH 4GIPD 4HK0A 4QRUB 4WWPA 5B39A 3LA3A 1U8LB 4I87A 2DVDA 3Q4HB 3MUHL 2JWYA 3B2UC 1UVQB 5D7IE 2ZOLB 2ARJA 1W04A 2VOXA 1PSKH 3N1QC 4K8RC 3K0YA 1J5DA 3R18A 1I5XA 4U2YA 3GBFA 2P90A 3LSSA 2GAZA 3JV6A 4HV8B 4OCMC 4QLRA 1S2KA 2WVTA 3RYPA 1F23A 3LD8A 3LKQA 2HFEC 4JFYB 5C09B 4Z7WF 4FPYA 3ZKNC 4CDXA 4XWGL 2VXVH 1QUNB 2HPTA 3W81A 3ZKMD 5IVNA 3HRZC 4MCZA 4FXGB 3BZ4B 4XR8C 3UYPA 4UCSA 4GLRH 5CFDC 1S0VA 1KXTA 1JZEA 2ZXGA 4PG2C 1MZFA 3SH3A 5L3BA 3TJHC 4IRSB 1UM6L 3AMPA 3ZIWA 4OF3A 5AYQA 5E6HA 3ZYIA 5IQ9A 5ESQA 4N8UA 4Z1PA 1VQPV 1N34O 1Z9OA 4POYA 1Y6KR 5I6MA 4V1DD 1J59A 4AIZA 4N43C 4P5RA 1KKDA 3FUHA 3QARA 3IXTA 4JFZH 5LK7B 3T3PF 1KIPA 2J8UB 4IGBA 4Q4V2 2EILB 2OBGA 3UKVA 1X7QA 4MXVE 2AH2A 4LHLA 3L3GB 2DD8L 3VBRC 5T55A 4XE9A 3FN0H 2I7SA 5DHXB 3NK4A 4QHZA 5K0UA 1FNLA 1DF4A 2X6AA 3ZQ9A 4A6YL 5LKNA 1DUZA 1F3DH 2BK8A 3APCA 4QTHB 4F6RB 5BZZA 3TRSB 4YUEL 4Y2DB 2XASA 4R5TA 2EXKA 3TEYA 3VFOA 3ZMSA 1T1XA 2EQDA 5GRWA 1SC5B 1R3KA 4J3WA 1GYWA 4NJ9L 5FW8A 3V4PA 1BF5A 1BJQA 3MJ6A 4BQ3A 4BSWA 3W5NA 3IB4A 3ZTNH 2XG4A 2EDOA 4LE4A 3NSFA 3QZWB 1NSNH 3EHKA 1TJIH 2BHUA 2YMTA 3ETGA 3G7TA 4N53A 1EFXA 1KPRB 3GSVB 4G4FA 1ZZ6A 3WNIA 3OKNB 4M7LH 4P2ZA 4JVWA 4PJDA 4NHMA 2LE9A 3Q9PA 3UTPD 5A1LA 4GH4A 1NLRA 3ZTJH 3F7PC 2NNUA 4BFOA 2D73A 2CD0A 3O0RL 4RMRA 3T0XA 5DN2A 5GS1C 2EYRA 1FI8C 5HFMA 4P46A 1G7QB 4FHJA 4MNQA 1D6VL 2ZKWA 1D9KC 1PY0A 3PJNA 1XSIA 3US9A 2JLLA 1SLIA 3LSEA 2IC2A 2Q8BL 4J25A 1S0EA 2PAMA 4JCWA 1R3LC 2UZXA 4LRIA 4B3MO 4XPGL 3FCSB 1O75A 3TJEL 3V52L 1UIKA 4NGHH 1E90A 2NLJC 3FAWA 5JW5A 3WDUA 4O5LH 1Z9PA 4WM8A 5SWZE 3WJLA 5C08A 4NAJA 4DEUA 2I45A 3G6JB 1UOVA 4IKJA 4OZHA 1FVEB 2CKBL 4OZFB 4ZMOA 1T6GC 4OVEA 2ZMKA 3K46A 4GRMB 3V9FA 5EK0A 1KFGA 3I59A 3TNPB 1IZ3A 1VEWA 1JHTB 1G7IB 2E27H 2XCMC 3T5WA 1WF5A 5K4LA 4OHZA 4OLZL 4HJEA 1W9SA 4CEYC 3GNMH 1EHKB 2EXWD 4MQSB 1MW1A 3QIUD 4FL4B 2XT1B 4U1GB 2E26A 5CNHA 3MIGA 2GQHA 4C0HA 3OZ9L 1N36O 3QQNA 1PX3A 4X5WB 5J8OA 1H8TB 5I73B 4JG1H 2ATPB 2CG9X 4Y9CA 2WOBA 3BD3A 1I3RA 1UB5B 3LKPA 4GFXA 2XKPA 3ACIA 4QM8A 5IGXL 3FOLB 5IF0B 2WLKA 3ARBA 1TMF3 1Z7S2 3WTVA 4PJBA 4UWDA 3SEPA 1PDKB 2GHYA 4FN0A 4WU5A 1D4M2 1NFDB 1AQDB 4LB8A 1FOD1 4LO4B 2ITFA 4P4KC 1DJYA 1HAWA 2NY2C 2ZGUA 2QA4V 1IIKA 5IM7A 3VKLA 5IK5A 2NYKA 2JDHA 1E4WH 1YY8A 2R23A 1W0PA 1CXLA 2GCYB 4XHQA 4YVWA 2DYRC 3P40A 2DIEA 3MNWA 5LAPA 1ET7A 2Q0AA 3JD0A 3MDSA 5KHGA 4FFZH 3X12B 4G27B 4DP7X 2BGPA 2X4PA 1I7TA 2BZ7A 3VXTB 1Y07A 5E08H 4AHCA 1OURA 3ZO9A 2ODHA 4ZHQB 4X5XA 5HVHC 4XACA 1IGML 3BP6A 4FDWA 2QSQA 4Z76B 5LBGA 4YMPA 1LEKB 4F92B 5I75C 1ZBA2 3KPSD 3CMAV 5HGDB 3AG1C 3VG9C 2ZGPA 2XJPA 4E9VA 4U1KA 4AENA 1A6UL 3HBQA 4IV3A 4K21A 3SMHA 1TNFA 4I0PD 5TQ2H 4LP4A 3KYOA 3QIWA 1H1AA 4X6EB 5C71A 2WC2A 3S5LA 1EPFA 3G08A 3P9MB 1EZJA 2ZX0A 1HRV1 2DMXA 3PV6B 3F01A 2WNXA 1KB9K 2IH1A 3D0LA 5D93B 4AEEA 1GYAA 4RH4A 4JFOA 3WIHH 1TPXC 1WLDA 1AI6A 3IMBA 2RN9A 1WA2X 1MREH 2WPGA 1SQBH 4E0RA 1NFAA 1T4WA 3WN5A 1MUJB 1UYWH 3WO3B 3WFBL 4DPBX 2BOIA 3PWUB 1FV2A 5KBFA 4CJ0A 1AXKA 4OZIF 4NHUB 2ZXDA 4M3CE 4OB5H 2Q68A 2I9LB 4OD2A 4WO4D 4PJEE 5CU9A 3AY4A 1N0LB 4DIXA 5CJBA 5IFAL 1UOGA 3X11A 1GP5A 5C0CE 1GYUA 3DOSA 4HONA 2VZUA 4NXKA 3UTQB 2OTWA 4JRXB 3DUSB 4ASUG 1GYCA 4LSDA 4U1IA 3MLUL 5HGGS 2Z5WA 4UI9L 5ISZA 1LNQA 4AHXA 1MCIA 2E5LB 2BOBA 2WINB 2GNBA 5KXBA 3JZVA 1H3WM 3D5OA 3U6XA 4UW3A 3H1HH 4MJIA 4U0QB 4XP4H 3VXUA 3F7KA 3FPYA 1KIQB 4DEQA 4JY6A 5GS0L 4AVKA 4BFGA 2WLNA 3TX4A 3LRMA 4MBOA 1U8NB 4QI3A 4JO1H 4BZ1H 1CFQB 3NNFA 1A6TB 4XI5C 5ANHA 4E41D 3M8OH 3V64A 2FZ2A 1AL22 4YARA 3MUZ1 3KV6A 3S6PA 5GONB 3WUWG 2A6IB 3LCPA 3F7VC 1UKGA 4R4NC 2UYBA 2Z64C 2GK2A 1C1EH 2R69A 3DJSA 3H1ZA 5D96C 4YHYB 3O6KH 1I85A 1CE1H 3HI5H 1U8JA 3E3QC 3OHMB 3QQ9C 5DMGC 2DWSA 2TSAA 3P0VL 4LPUA 3GF6A 5JOPE 4BIKA 1JZDC 1PMHX 5A6IA 2PCXA 4QQPA 4OD3L 3U1SH 3RFZB 1O3TA 4ZTOH 3B9KC 1FD9A 3MICA 2BCCH 3N2GA 4HPOL 5FWQA 1IZKA 1A6AA 3NCYS 2LJ2A 2OSXA 2F68X 2IXHA 2UUAB 1ND0A 2HVBA 3ZMNA 5CVRA 3PJYA 5KVFH 3IWZA 4R97C 1XF1A 3RDTC 3CN1A 4EB6A 2E7TA 3RAJL 4YE4H 1TJGL 2GIXA 4FP2A 1P84J 4AFAA 1NDGB 4PBWD 4DKFL 1VJ2A 2XTSA 2XOMA 3IPBA 4ODTL 1S9XA 3FXIC 5FAAA 5EUOA 3L4UA 3JBG1 3F3HA 3OY8A 3BEWA 3IYLW 1IGJB 3U4BL 1KELH 3U9UA 4P0DA 1P4LA 2BVPA 4FMVA 3KS0J 4LBOA 4YM3A 4ELDA 5TISZ 3KKYA 4P5TC 3VFWA 3BSZA 3TPUB 4WTWA 4AGLA 4AM0A 4XAKE 2Y64A 2V5YA 1HB3A 2Q2EB 1J8HA 4PLNA 2MCMA 4ZFGH 4CS2A 1NAKL 1VGEH 3QCVH 1F6AB 1LU1A 2J6EH 4XC1L 1BE3H 2E8ZA 3CC5A 4CH5A 4FK5C 3LS4H 3O8XB 4YL9A 3GHPA 5C5UA 1K92A 2GUOA 2H32H 4HK0B 5B39B 2Q4PA 2YV8A 3U75A 3GXTA 3FB6C 1A1OA 3CEWA 2R29L 2ZOOA 5B7EA 4HT1T 2PYJA 4YFLF 2ARJB 3C5JA 5IT2H 2HRLA 4HKLA 3AXLA 3VSTA 1RUH1 2ZM6O 2GAZB 4Q97A 3JV6B 3L2MA 1KQSU 3LKQB 4H25A 1NC2D 4RA0C 4CDXB 3PPSA 1H5BA 4NFBA 1JPGA 4MCZB 1A22B 1OZTG 3T0EB 3UYPB 1KXTB 4QXBA 2RR13 1DQ5A 3FF8A 4L5FH 2QTWB 4HWBL 2E7LC 3KLDA 3D6GA 5CN3A 1G7HA 4PRNA 4XOBA 3VXRD 2VDKH 5ESQB 5IQ9B 2XL9A 5MENE 3BOPA 3ZYIB 4P08A 5DTFA 3BHBB 3UETA 5BNNC 2OSWA 2MFNA 4FFFA 5ANMA 4AIZB 4EKXA 3D8MA 5FHBL 4O58H 1GV9A 3QEHA 4HUUA 3IXTB 1XU1A 3EQEA 4P9YA 5EYXA 2XPJA 2BJSA 4ORZC 1KIPB 4IGBB 2GYSA 4NQCE 5C07A 5JW4M 3CU7A 5C6WH 1FJ1A 1RUQH 1X7QB 4IIZA 1G1OA 4KWKA 1B3JA 2ZR3A 1WFOA 4OCYL 3HN5A 4L8JA 5K0UB 1JGVL 3IPEA 1SFPA 3SOBH 4LF8O 2GJPA 1DUZB 3OEEG 2X10A 5LBSA 4CC0A 3K5NA 3NV1A 1E9QA 4JAUA 1SLXA 1REDA 5JMOA 4ZZKA 1JYXA 3ZKUA 2HKFH 4FZEL 4RRPA 2NXYC 3C5ZA 4KTYA 1T1XB 4P06A 5GRXG 1R3KB 1ZPUA 3V4PB 2HLFC 3ENEA 4HHAA 3B7SA 5FYKH 2DFBA 4FPEA 3VBFC 4BSWB 5L4FA 2OMNA 4Q1PA 2XG4B 3U4KA 5I19H 5ABJC 2YUWA 1RUI2 1IC5H 1QJX2 1SEQL 5B1NA 3EJCA 4N53B 2IJ0C 1EFXB 1Y74A 4YGDA 1DQQA 4MKMA 2YQGA 1A8ZA 2LLLA 4A41A 3GF8A 4PJDB 4AWJC 1G8MA 4GH4B 2N3JA 4FFYH 1L7LA 1NC4D 5IWLC 2FBJL 2EINB 4LFBO 1LO2H 5FY4A 2EYRB 4P46B 3D0SA 4O2FA 2YQ3A 2X4TA 4MNQB 4OLYL 1A8JH 3JT2A 3TOJA 2YBRA 3QO1A 1GMGA 1XOUA 4FT8A 3UERA 1CZSA 4CP9A 4OX9B 2CGNA 2UZXB 1Q1PA 4LK6A 4DUVA 2DU1A 2BVYA 4GEIA 2IVJA 1V0AA 4JG9A 5ICYA 3LZZA 3AS1A 2Y4UA 3TCUA 1ZTXL 4YBQC 5JW5B 2D2CB 2LHAA 3N41B 4LLWA 2HWF1 4WM8B 4F8NA 5C08B 1T7XA 5I6PA 2UWEA 3CH8A 3L45A 4GKNA 4N2BA 4OZHB 4PCSA 5CBEA 5LGYA 2XJTA 3M88A 5FM5M 3I59B 2C26A 4G1MB 4HK3J 4FYQA 4DV1B 1BZ9A 5DO8A 4RDQG 1F11A 4KO5A 1URXA 4PJ5E 2MQCA 1LEIA 1Q4NX 4K1YA 1ZV2A 2Y7SA 4G6JH 4PV9A 5IUSA 3GXUA 4LIUA 1ZAGA 2F5AL 1HZHL 4MVBC 4Z8FH 4R2GB 5T52A 3TK1A 3LKPB 1I3RB 3MLXH 2HKHH 5D71H 4LSQH 4MDIA 3FNKA 5BO0D 3ARBB 5KS9E 1U92A 4PJBB 5T3ZE 3QG7H 1FXKA 4WU5B 3BVTA 5EZLA 5DJZA 1G0DA 3QXTA 4ZOEA 4KKAC 4DGYH 3RE0A 3VG0L 3EHBB 1HR0O 1I8KA 4QPGC 5IM7B 1J7VR 3QT2A 1EXHA 1YY8B 2R23B 2OL3H 3KXFA 1DN0A 5LUMA 1FOD3 4YVWB 4Y3OA 4DQOH 1H3PH 5E7FA 3MNWB 2ZD9A 2IH8A 3WV6A 4XE0A 3V0AC 4I77L 4AQZA 1YI2V 3T4HB 3ZYGA 5CEZD 2X4PB 1N18A 1I7TB 1XIWA 2A74C 2J25A 4GUCA 4NQSA 4Y9EA 1UYXA 3BIWE 1JXJA 3QFDA 5CG8A 3LDBA 2IVIB 3NNMA 4JRYA 4X5XB 1BREA 3BP6B 2ADIA 2P4KA 2GC7C 5D5ME 4F1ZA 3CVHA 1KWKA 4OZGE 2W3JA 5A3MA 3WUDA 2WLHA 4JY5H 4U1KB 4AENB 1BD2A 4CC4C 1BPVA 4IV3B 1FDLL 1AJQA 3KYOB 3QIWB 1SEBA 1SM3H 2CAUA 4GB32 3S5LB 4BRJA 1JWUA 4B60A 3G08B 1ROPA 2J43A 4H7VA 2AEZA 5GGUA 1V55C 1P84K 4EPSA 5F9TA 5AWNH 2IH1B 4JN2B 1ZSPA 5JJNB 3D0LB 3L70H 4JFOB 1S0FA 1EN4A 1JV2A 4KHPB 1IFHL 1WAAF 1DBAL 3MMEA 4PJ7E 1INEL 3VA6A 3ZE0B 5IHLB 4E0RB 4BFBD 1ZX5A 4IE4A 3DO7A 3JV5A 3PWPE 1LNUA 4ZK8A 4XVHA 1QHQA 3BKCL 5EEYA 5JQGA 2BDRA 2JV6A 3L9YA 4OD2B 4G42A 2CTVA 2RDNA 4W6XA 3VXMA 1IC4H 3D3VA 3X11B 2UXGA 4ZQKA 1U4FA 3DOSB 3VACA 1NPJA 1SJMA 2D3SA 3SJBC 2OTWB 4P2RA 4CPBD 3UTOA 5JXED 3QEQE 1BEV2 4LITA 3OG2A 2QQWA 4U1IB 3HE6D 1BMV2 3CFDA 5ISZB 1Y76A 3G5WA 4BEIA 4OZ4A 1LWHA 2BOBB 4AW4A 1B35A 4R9DA 4XBEL 2A99A 2C5DA 1E9OA 2Y06L 2MTAA 4JB9H 4MJIB 3VXUB 3X3FL 5E9DA 2A75A 5DG2A 5KANI 2J55A 3CWBH 4JY6B 1FAYA 4L1LA 4KDTA 1IGTA 4E2GA 2BC4A 1OCZC 1JX9A 2WWSA 3J2PA 5FYMA 1I7UA 4TRPH 1DVSA 1UZ0A 3CXDL 2VDOL 1ZLZA 2ZUQB 3UTTE 4U3JA 1OCCC 1Z3GL 1BZQK 4DR6B 2AJVL 4CEWA 3GSNL 2PXYA 4XUOA 4ZOBA 1LGNA 2ATKC 1U8JB 3SBPA 4Z1VA 4QRRD 2RNBA 1TZ8A 1YEJH 1AVAA 4H8UA 4JHAL 4PJ8D 4F37K 1T6WA 1GIGH 3VFNA 2ZKOA 4FQCH 1JPSL 3NGBB 4X7DC 3IKKA 3VBOC 4AYUA 5JJJB 4PRPD 3N2GB 3JXAA 4ODHL 4HC1A 1U0AA 2EA7A 1A6AB 5DO2C 1B6UA 2K9PA 4N1HB 4ZPTA 1ND0B 3R1GL 5C0GB 4NO3A 1XO8A 4EB6B 5I8OL 5K9JH 1CD1A 4WEBH 1U8HA 1EUTA 2PETA 2DCZA 1ZMYA 1S9XB 2O6CA 2CUGA 5EUOB 5D1QD 3OY8B 1F6LL 3L71H 3BEWB 4Y5YC 3GNEA 2V9TA 3U9UB 5IFPA 1P4LB 2BVPB 3QRBA 2Y6SD 2ENPA 1HCVA 1S8DA 3KGSA 2L7QA 4JQIH 3VFWB 4BZ2A 4ARYA 4AM0B 2N7BA 3OJBA 4XP1H 1JRHH 1OAUH 1J8HB 2W95A 3TT1L 5C0EA 1FXHA 4MXVF 5CAYB 2WKGA 4FKHA 5DDJ1 3WOVA 3F7YC 4G6KH 3CC5B 1LO3L 4G7VL 3FFCE 4ZFOA 1RUF2 4ACPA 2GUOB 8FABA 3JUZA 2E6PA 3QHZH 4K7PL 3RTLA 4JO4H 4PJIA 4YHOH 3FUOA 3RJQB 1SESA 2EKJA 3UEQA 1WGPA 2CHHA 3C5JB 4JE4B 2HAZA 4FQXD 3MPBA 4AVBA 3AXLB 2JB8A 3K74B 4BJLA 1TG8A 2VSCA 2LW3A 1AYRA 4RRPG 4XB3A 4GMP3 3B77A 3UGEA 4RDBA 4H25B 3QUZC 1VQ5V 3EYQD 4UINH 1N6QL 1H5BB 1VESA 3ZHUA 1JPGB 2QKDA 4P3CH 4N2MA 4LKCA 4XPTL 1BL8A 5F1OB 2O5YH 4V1PA 2JECA 3PP4H 3FSAA 3KPRD 3H7BA 2GC3A 1BBDL 2R0WL 4H2AA 1G7HB 4MCYA 4K5PA 4PRNB 5DLML 2FAUA 3SDYH 1Y4WA 4OQ8A 3S88H 5DTFB 4K3JL 5FX3A 4YIOA 5FP8A 2HLEA 5HI4C 2HKAA 1C5CL 2J72A 5ANMB 4YK4C 4TVUA 5GLTA 5T5OA 3QEHB 4HUUB 4QY8A 2VMEA 4PQQA 3LGRA 5C33A 5C07B 3MJ9A 4UBHA 1FG9C 3GI9H 1FJ1B 4Y24A 1A3RH 2VDRB 1VQ9V 2XN9A 1CDGA 3F5TA 1SOSA 3BPNB 3HHMA 4TLKA 5E51A 5LCVL 4Z7OB 1ZBE1 3WB1A 2ZOWA 1GICA 1A3ZA 1SFHA 4XVJL 4JI8B 2ZX8A 2WVUA 3II3A 1E9QB 1P7KA 3ESNA 4F37F 2QKIC 4WJ5A 3U0WL 1FKAO 2YI8A 3C5ZB 4JRFA 3JAMN 4JV4A 5C8CA 3ZYJA 4X64B 3WDTA 4HHAB 2BRRH 5JXJA 5E8PA 2PR4H 4JJHA 5GLVA 1ZV5A 1IB5A 3BH9A 4E9WA 4I1RA 1HZLA 4DV4O 1O9VA 2H2SD 3I9GH 5GJSL 3UABA 3S8FB 1C8NA 2VLJD 5CKNA 4HEME 2YSUB 2P5WA 4LBKA 4G5ZL 1IDSA 3M99B 2I32A 2Y2TA 4BH9A 2CYFA 3FTWA 4WI2A 1OV9A 1Y74B 1DQQB 1JDAA 1I1AA 4FNLH 3DXAD 3J7LA 3GT6A 3RVWC 4FXLA 3ZSKA 4ZZ5A 3N4MA 1NCQC 2QM4A 1I9RH 2JELL 4LF9B 1XF5A 4HIJA 4NJAL 3SD5A 5FLHA 4LH6A 1D0HA 4G72B 4O2FB 1WW4A 2X4TB 5BNOC 2O14A 1RPRA 3X17A 4EF3A 5FMBA 2YBRB 5FXZA 2JEMA 1QFUH 3QO1B 1N3NA 3D39E 1YNTF 1KTCA 4R84A 3TS8A 4CP9B 3HC3H 3FU7A 3GB7A 4LCIL 1CICA 4U7NA 4GKYA 4NO4A 1IKNC 1PZBA 5ICYB 1SXBA 3L4WA 3RMXA 5J2TA 1NMBH 2VWEC 4LLWB 3P0YL 4XP5L 4DO4A 3ECBA 5HSFA 1JXFA 4XMAA 2ETWA 5LWYH 2CU5A 2UWEB 3FB8A 4GKNB 3LOBA 5CBEB 1J3QA 1UWGL 1A66A 2HP4A 4K7PX 4YSEA 3NSTA 3IXAA 4XXPA 1BZ9B 1PD1A 1ET8A 1F11B 2Z3FA 3WY6A 2CO1A 3L5XL 3L9EA 4WY7H 1LEIB 1LESA 3N7MA 3CD4A 5JYLA 1OD3A 4XPVA 3RG0A 4X7FC 1WCSA 1RUAH 3OR7A 1T6VN 4NFDA 4PV9B 3GXUB 4UTAH 3Q9OA 2R72A 3FH5A 4Z1MG 3FBMA 3GRWA 2EIEA 2VCOA 4BYYA 4KNTA 1EIBA 3QAZC 4H14A 4MDIB 5G2NA 1TDQA 3RZCD 1U92B 2ESVE 2WR9A 1FXKB 3MFAA 3UYOD 2WT1A 5EZLB 3D09A 4XDLA 2F1EA 5DJZB 3U7YL 1N1TA 4ZOAA 1POQA 1KUMA 2BVOA 4ZZ8A 2A3YA 4M3CF 1I8KB 2OSLA 4PJEF 4BH8A 5JHLA 1WIPA 1E4JA 1M56C 2DWYA 3KXFB 5TQ0L 1B0GA 1DN0B 4QX0A 3BUCA 1NCWH 2DURA 2WAOA 5LMNO 3P11H 4QAWA 4M7ZB 3S3SA 1J84A 2NY3C 5IE9A 1XIWB 4NQSB 4PGBB 1H3VA 4JMXA 2K4WA 3QFDB 1YEHH 1CG9A 3LDBB 4JCMA 5CILL 1QXPA 4IETA 4JRYB 2ADIB 1LJ7A 3BAWA 4LUMA 5C3PA 3NEEA 1FRGL 3HBPA 4H8WC 4OGAC 2PNDA 2B7DT 2CK0L 5FLUA 5DMIL 5ITFA 1IO4C 4FKKA 2GALA 5A1FA 1BD2B 1WWWX 1LNSA 4AI1A 4PWGA 1SEBB 2VZRA 1RZJL 1JWUB 4EBQL 2YRPA 2MQGA 4JREC 1TR7A 3N85L 3NIGE 3LH8A 4R0LC 2AMGA 4N90D 1RU9L 5GGUB 5ANQA 5F5QA 1FFNA 3U6XS 4MXWA 2FWLB 3KCWA 4ZMVA 3VL9A 3MUJA 3GMNA 3FT9A 3OZLA 1IS4A 1PVXA 5D21A 1FFQA 3LDDA 1JV2B 3MMEB 1G0YR 2BSBA 4NQQA 4Y19A 5DD3L 5IK3A 2WCGA 4GEJA 5E8OA 3DO7B 1LNUB 3RTQA 4PDWA 2YD5A 4HUCA 5JQGB 3T6ZA 2KD7A 3P1VA 4G42B 5HBAA 4WWOA 4W6XB 3VXMB 1POV0 2L7EA 3D3VB 4H44C 2NMNA 3J8F7 1CVRA 4ZQKB 5D1XD 4WF7A 3WEXA 3CHQA 2ZOTA 4GQ9H 4CC1A 1EXUB 3HAGA 2OYPA 1R19A 3H0OA 4BHUI 4P2RB 1Q0XH 3O9WA 4I7ZC 5ALCL 1W0WA 1FUNA 3C6LA 4Z82A 1TQTA 5ACA3 3BWUC 4EN3C 3CFDB 5B21A 1Y76B 3N55A 1H9WA 2HUEA 1H3UA 2JKRM 4GJYA 2NYZA 1B35B 5CADA 4P23A 2HWC3 4APQA 1E9OB 2DLFH 1U3HC 2WUBH 1S7TA 5E9DB 2C9KA 5JW3L 2E53A 3EO1A 2ZNXA 4ELMA 3NABH 1IGTB 3B93A 3GZQA 3CIAA 2BC4B 3MUGA 1M2OA 3ZN5A 2BPBA 3UZEA 3AB0A 1I7UB 3BU7A 1LTXA 3GSUA 5KW9H 5TFSH 2PTUA 4NQDE 5E9AA 1WIOA 4PJAE 3FAVA 4U3JB 3CZKA 5DFAA 1UPGA 2XLGA 5HHXH 2QWPB 1XD0A 2DVGA 2ZUYA 3VFSA 2WLMA 4CEWB 3DURA 2PXYB 2LFEA 4YFDB 4TQDA 1XQNA 5I1GL 3BDBA 4M8VA 3VFNB 4QJ5B 4QRFA 3X14A 3ULUL 3KV5A 2ZUVA 3ABZA 4WUUE 1IBBA 5C93A 2XYBA 3O14A 3LEMA 3VHPA 2JB5H 4HH9A 3BVVA 4PWEA 4ZPTB 1O91A 1U5ZA 3FULA 4OMDA 4NO3B 3H2PA 2ZWNA 2CXGA 3E5UA 1BVZA 4GAJH 2F8IA 4OCTA 1OOPA 1NOLA 1CD1B 1WD3A 1U8HB 1UAIA 2NZ1A 4QLWA 4MOAA 1IGIL 1T7VA 5BQ7A 4O4YH 4WTZA 1GA2A 5EDXA 2JG9A 4M03A 1FMD1 2GP3A 1DVFD 1ZE3C 4JI0B 4GBXD 1GC1C 2AV1A 1YEEH 4KBPA 4URKA 3FTYA 3M3EA 2RJZA 4Y89A 1S8DB 2IAMD 1VBD2 3MLWL 2ZINA 3PHSA 4P9MH 4S1DC 5DHMC 1IKQA 1MNNA 1RIUH 4A7VA 3WF2A 4QPYA 2QQPA 5C0EB 1WMEA 3CH1A 3NSJA 1VALA 5LGUA 4ZFOB 2K6ZA 1KCLA 8FABB 5DD0H 1JNLH 2LABA 3A22A 3JYCA 4PJIB 2YD7A 1BCIA 1JZ7A 2EEDA 1BQLH 5E1GA 4RR3C 1UYPA 4UFJA 2H26A 2FIRT 4OQ9A 5C3OA 4NN6B 1ALYA 1NGYA 4R7LA 4GX1A 4LL9A 1JPST 5EU7C 2Q30A 2PKDA 1UHVA 2QQUA 2E9WA 2QL1A 3U9PH 4WFBV 5GZOC 1ZYBA 4LKCB 2BWIA 4BFKA 1Y4MA 5CKMA 4B0MB 1MCQA 2VDMH 4BZYA 3H7BB 2RTTA 2FBRA 4ODVH 5HTSA 4C4BA 4QXKA 1YPZE 2VN3A 2Y25A 4MCYB 3STLC 3MV9D 2BLFA 2WQUA 4FLTA 3O2WH 4R26H 4XJWA 3CZFA 3DRTA 4LCUB 3UTZA 5T3NA 3VBUA 3WW2A 2EDXA 2HLEB 3N44F 5D72H 5GTIZ 1AH1A 5BS0A 2XJUA 4W9FC 3CBJB 3K2UH 5HGBA 1WZ1L 1YEIH 1HNXB 1PNDA 3GTTA 4QY8B 4TS6A 4H13C 4W4OC 4KH2A 3AKSA 3N7KA 2YDEA 3TZVD 2R9AA 1IZJA 5IEKA 3VMPA 2EO7A 3N91A 1THCA 5FLIA 4DINB 3ZDYB 1I9JL 2XN9B 2A6DA 3BRDA 1RJ8A 3B7RL 1XNQO 3SR2C 1T83C 1MI5D 2R59A 1D5MA 2O6DA 1MFCH 3HKZA 4X9BA 3MCLL 4E4ZA 2WXLA 4WJ5B 5FK7A 1CXZB 1A7RL 4X9FA 1DANU 3UO2A 3P4NA 4HXBL 1SLCA 3ZYJB 4U4IA 2B4CC 1WZAA 2JQMA 3AWEA 3MKGA 1I0HA 4FCHA 5E8PB 2HMID 3BH9B 2FCUA 3AM2A 5CMAA 3HBKA 4HCRH 2GV9A 2VW6A 4MUVA 5EHFA 5BYNA 2P5WB 3ARFD 1RK1A 2JJWA 1WCUA 3KM5A 3CSPA 2UUDH 5BVJA 4L2LA 4G6FD 1DG6A 2I5YL 3ILEA 4G6MH 1I1AB 2J6WA 1JOBA 5A9GA 2QMJA 3A6CL 1QASA 1KJMA 2ZYSA 3QDJE 2IH3A 1IQDC 2N04A 1XF5B 4M7JH 4HIJB 5FYKU 1LEMA 4CP0A 1JDCA 3O1TA 5SX4I 4JYYA 5F2FA 4Y8AA 5CS7A 4MZUA 4ZPIA 1N3NB 1A6VL 4LOTA 1MAJA 1ZHLA 5CUSL 3KJ4B 3D34A 1WH0A 2FJGA 1VGKA 2GW5A 3FU7B 4H8QA 3GB7B 2R1XA 1CICB 4EI5D 2RQ8A 4JM2D 1W6QA 4XQWA 2HH9A 2AGAA 2DH2A 4HK3N 2JJ2G 5J2TB 4HSCX 1F4YL 4HWNA 4B9KC 3K9SA 3ECBB 2HSIA 3ARRA 1QNZH 2DBLL 4JDEA 3FB8B 1XNDA 1PAZA 4NCC1 2MMXA 4P9WA 2KA3A 4Q7DA 2X4RA 5D5MF 2WZ0A 5FZAA 4OZGF 3IXAB 1FGVL 1VLNA 4UMGA 5IUQA 3TF7C 4HHWA 2HEPA 1L7TH 2Y6HA 3FZ3A 4P9PA 4X4KA 3RHWK 4FNRA 3OTFA 1AKJD 3OR7B 1SETA 1A4JA 1JL8A 3KDMA 5JVDA 2LROA 4HLTA 4HU8A 3U30C 2AZ2A 4XPHL 4M7KL 1ZZCA 3QB7C 1PGL2 2QEXV 5AAWC 4HHGA 1PIV3 3PNAA 1AYN3 1BVVA 4WO4C 3F62A 3DBSA 4PJ7F 4PJFE 3FLTA 4HKXA 1G9EA 1ZUQA 1BPLB 1VCBC 4SLIA 2WM0A 2BVOB 2EEXA 3K2OA 2HKOA 5AFAA 2OSLB 3HB3D 1C8QA 4BH8B 1Z5VA 1JF1A 4TSBL 3ULVD 2WA3A 1B0GB 1IS6A 3MIDA 4FOYA 2X6BA 4LPCA 3BVDB 4HS8H 5DC2A 1IJ9A 5IVZA 1RUG1 2PCYA 1YJDH 2RMKB 3O4LD 3QPQC 4Z6AT 1Q9OA 1PO11 4UFLA 1SRYA 4ZNEE 2N7AA 1TZGL 3IDIA 1CG9B 3IJ4A 4J9ZB 3IJHA 1NANH 2OCJA 4GINA 4G71B 5BOPA 4LH7A 4P00B 5ITFB 1A3LL 3UL2A 1QYGH 2H2PD 1CLOL 1LDPH 2IPUK 4QF1A 4YH6A 2O6PA 5D2NE 5E95B 4BFRA 1DQ1A 2QDRA 4ZONA 1NAMA 5KN5A 5IBTH 1Q72L 5DD5H 3ZQXA 4WW2A 4NI6A 5A7NA 1XNRO 1FFNB 4Y5XC 1AF9A 4MXWB 5C3IA 5EYPA 2QADB 4IUGA 1HHJA 3GO1L 5H9SA 2EP6A 5F93C 2VABA 1FZKA 3GMNB 5KSAD 3SD2A 6PCYA 1O4YA 1HE7A 4QCIA 1VFMA 1FYJA 4Y19B 1JGLL 5IK3B 1IEAA 2N59A 3IT8D 5E8OB 3ZZSA 4H37A 2YD3A 4Z07A 4R5XA 4TUKH 3UJIH 2H47C 3RTQB 4PDWB 3KJ6H 2DQDL 3V4PL 3WN5C 1R081 3ZFEC 3CPUA 4LPYA 3T0WA 1XDCA 1NGXA 4O02B 3WEXB 2OW4A 5G04L 1RIHH 2YIBA 5DURB 2HFFA 3O9WB 4ZO7A 1W0WB 4P02B 3C6LB 3MRCA 3BUPA 5FF6A 3L2YA 2YUVA 2PHWA 5GZCA 1S7SA 1UY1A 5JA8B 4RHV1 1VZIA 5GPRA 3MBED 3OAAG 4HUWA 4P23B 4APQB 2OZ4H 4MX7A 3ML0A 1S7TB 2P47B 4AXOA 3EO1B 4M1GH 2FLBT 1QW9A 4ELMB 4IIJA 4OLLA 4PP1D 4XB8A 2VC2B 3MUGB 4MRCA 3RHWF 2E63A 4K71C 1KXVA 1SY6A 4I4TA 3AB0B 4C4KT 1OJHA 3GSUB 3KD4A 2QQJA 4OIIH 2WPDG 3FAVB 1NGQL 3U36A 1UPSA 1V9U3 3STZC 1JWSA 3BRFA 3NZHL 3VFSB 3CP1A 3ZYPA 5C9JA 1ODUA 2VM4A 3DURB 2XBDA 3ROLB 1JNJA 4X1KA 1S5HA 3LN5A 3IGKA 1S6NA 2BY1A 4BSVA 3ZJAA 4COWA 1RUD2 2QSCH 3UTSA 3SODB 3FYIB 5J57B 2ZPKL 1KT2A 3X14B 5CBFA 2RALA 3SE9L 3GVMA 1QJU3 5I93A 5CN1A 3RX9A 4B4PA 1M42A 1YIJV 2X88A 2E31A 2D9QB 4HH9B 1BIIA 1F97A 2VITA 1Z0HA 3UYRH 4KNCA 1UKTA 5CAZA 3QXWA 4GAFB 5IYCO 4NHKA 1OOPB 4YW7A 4N0UE 3WUZA 2WXOA 4IBWA 3I9PA 5HDLA 4PIXA 3CMOH 5BPPA 2P44B 5BQ7B 3QISA 4BQWA 5CF3A 3WTSA 4FFZA 2P3JA 2JG9B 2WXNA 2F53A 2AQ2A 3KHOA 3VQLA 2NPLX 2AV1B 1J5IA 2V3FA 3V5HA 1H6EA 4P2OD 5J2UA 1QWHA 5DABA 4J2QA 3T3YA 4QE9A 2ZG2A 2FECL 3WNKA 4POZD 5J1TC 1I3VA 3CH1B 4YDIL 3R7QA 4ZI7A 2IG2H 2F2HA 3DEMA 1P7QA 1X4ZA 5H37H 5FYLE 1UOWA 2XAFA 3NL1A 2VDNH 5E1AC 1DVZA 3INOA 5DZLA 4GSRA 2XI9A 5JR1L 2Y38A 2HJFC 4KROC 3HNYM 5FMDA 2H26B 3SIKA 1HXS1 2Q7HA 1YNLL 2APVA 2W68A 4UILL 3M7OA 4FERA 4XN9A 1NGYB 4WKXA 3EJYD 1SN5A 2ICWJ 4A2GA 1QFHA 5L3CA 2VDPB 5A3TA 1W0VA 4X8JA 2VQTA 5F9AC 2Z8VC 3L2NA 1H9PA 5F3BA 5AOMA 2RDQA 4DIQA 4JFEE 5F3EA 1AR2A 4OFYD 1OSGA 2WKOA 2QE7G 4ZG1A 2VB5A 5I8YA 1ZT4A 2ZWKA 1BEXA 1W2TA 1II4E 5IJDC 2UUCB 5B1BC 3EKCA 4ZAKC 2EXIA 4MMZC 1JZFA 3CZFB 3DRTB 3UTZB 3OGSA 4Z77A 3VBUB 3MBXH 2ITDA 3VZNA 1O8SA 1WLHA 5BS0B 1T20A 5HGBB 3U7AA 2X53S 1TME2 4OJDH 1AYOA 2PWEA 5F1RA 3DDGA 3VFPA 5IEKB 5LBVA 4PJHA 1MEXH 3SB3A 2VSMB 2A6DB 4C8XA 2YHGA 2ZONA 4YLQT 5GS0C 1OCWL 1PZ8A 1V00A 1KCSH 2XJLA 3L9JT 3K5RA 4PAZA 1D5MB 5F7LB 4JZRA 1YFYA 3BVXA 4HXAH 4N22A 4AVHA 1QEXA 3AKQA 2QR0A 3FO1A 4G8FA 3CVCA 2Z4QA 3P4NB 4LF7B 5FFOA 3VXOA 5GRJH 1B0WA 4WI0A 1JHLH 3EOYG 1RHI1 2KXLA 2VR9A 3MI8A 4GX2A 4H0LB 3E6FA 2YFNA 5CMAB 4EQ3A 4YHZL 1QMJA 2JJTA 1J5HA 2JDPA 3CF6E 3W58A 3WG4A 3PU3A 1RK1B 3UV9A 2RDCA 5BVJB 3FQ1A 2BV4A 3CCLV 3CFTA 4PI0A 2Y72A 2AQPA 2CR0A 3MACH 2H0BA 4BFEA 1VBE3 4WWKA 1KJMB 3BGFB 2FR4A 2F8VA 2IH3B 4MB4A 4QKBA 3FQNA 1L0XA 2W87A 3IFNH 1YEKL 4MYPA 3FSOA 2Y5QA 3EXJA 4JPRA 4MGSA 9PCYA 4V2WA 4NTWA 4B3SB 2XOTA 4C58B 4LARL 4G3YL 2XBO2 3RQ0A 1ZHLB 3DNKA 1U0QA 2FJGB 1VGKB 1S3JA 2R1XB 4TLSA 3PHQA 1W6QB 5D1ZD 2TUNA 3N9MA 2QFRA 1OOWA 1ANUA 4OUUA 1VPHA 1SMAA 4Y1VA 4DNLA 4JDEB 1ZT7A 1CFSA 3G5XA 5BNPA 5DGRA 1HYSD 2X4RB 2HX7A 3NJVA 3SOTA 3TO4A 2R0ZH 1V6OA 3GHBH 1HINH 3BTYA 3GS4A 3LUTB 2BY3A 3BAIA 1QPPA 2VCCA 4XPAL 5FPZA 4GXLA 2AXWA 3IDNA 3GSQA 5T5PA 1BFSA 1LK3L 5IBUB 2EUZA 1KITA 1RUC1 2KR2A 3S7EA 2NNAA 3BSZL 4X7SL 2ZQMA 5ERWA 4XFHA 1A0QH 1A4JB 1SMOA 1PZ3A 1P4BL 3KDMB 3QJQB 5JVDB 2UZIL 3RILA 4X88A 5HYJE 1BCXA 3QJRB 1S7XA 4KKLD 1L9OA 4KU1A 3SDLA 1W05A 1GGBL 5I6OA 2VXQH 1EHLL 3HQRA 2C3VA 1ITCA 5M0TA 4HKXB 3QH7A 2N1KA 2YIHA 4PJ9D 4YPGA 2D97A 2XWBA 2HT4C 4UFKA 4YVSA 5I1IH 3CBRA 4HWZA 3TIDA 4MQ7A 5JXEC 4DO6A 2VQ0A 2DQGH 1JF1B 3HE6C 3DN7A 4M5YL 2HT3C 5EU3A 1EZLA 3BZEA 4ZD3L 5FPVA 3VA2C 4OLUH 2IFWA 1FNGA 4DRRA 3JV0A 4MS6A 5IVZB 5J9PC 3L9RA 5SWSE 1N6VA 1Q9OB 5B4NA 1Q81W 1X4TA 3IDIB 2R1YA 4XOAA 1MJ8L 1QEWA 1ZS8A 3QNYA 4D8OA 1MS0A 2B8MA 2Y8KA 3IJHB 3PFQA 3AFKA 4LAJH 2DS4A 4RVBA 4NKIH 3QWRA 4B3EA 1JU4A 3AT9A 4DS0A 1N3QA 3AG2C 3OUIA 4DGIH 5KXDA 1DJWA 3HS0C 5L7OB 1O4ZA 2RS32 4QF1B 4J4PA 3ZSSA 2O8QA 2JE8A 3HNTH 1NAMB 3WHE0 5KN5B 4HIPA 2IFRA 3T6XA 1E5HA 5BUGA 1OANA 4PJAF 1LO5A 2MQ0A 1UJTA 4DR7O 2VDRL 4WW2B 2YS4A 4P59L 5CSGA 5EYPB 3A6BL 3SN6N 1HHJB 1NTMH 1INDL 2VABB 1FZKB 4HALA 1N3OA 1JHKL 3AUWB 4QCIB 2WNVC 4OGYH 4GULA 4NNYA 5LBSL 1S4CA 1ZRFA 1IEAB 1H6TA 3GJEA 4MVQA 1UFGA 3PIQA 2J1XA 4PJGA 1IBKB 4YXHH 1W03A 3GDCA 3UKNA 1MCRA 2XJSA 3I6LD 4GMSH 3PVEA 3A0BZ 2QDOA 1TENA 1UH3A 1NGXB 2CGRL 3NRQA 4IOFC 3GSOA 2V6HA 1HOEA 2QHLA 4QPKA 5BNQA 2GBUA 2H41A 2OTPA 2PCPA 2HFFB 2F54A 3N5AA 2DJSA 4OQTH 3QXVA 4PGDB 3U83A 3MRCB 3S7IA 4K23H 1YECH 1JU3A 2EXYD 5FGCB 5FF6B 4IESA 5KVGL 1S7SB 3UK9A 5IW0A 3MV7A 4ENEC 2Y6SC 2ZABA 3IDXH 2MWCA 4HUWB 3BT2L 2YLHA 1RCYA 3NCJH 1WGOA 2D0HA 4LGPB 2R56L 4MX7B 1P7GA 4OH2A 1DQLH 4KKRA 3LZQA 6FABL 5K9JL 1IKOP 1SBSL 5C0NC 3GKWL 4OI8A 4IIJB 1ZV9A 5IMMA 1CJPA 1QKQA 2VTXJ 4X6BA 4YDVA 3MW3A 4OZOA 3MJWA 2JLPA 3L3HA 4I4TB 4JK0D 2IU0A 1B06A 5A6QA 3U36B 3X1NA 2CAVA 1JWSB 4MAUL 3EFFA 2YC4A 4PIYA 2R8SL 5JAXA 1WAZA 3CJHA 5C9JB 1T22A 4EZMA 4O9GA 4X1KB 1S5HB 3CDFA 3V8CA 5A80A 3LN5B 3NJIA 1F4AA 2E7CA 4BSVB 2BO0A 1HX6A 4ET7A 3CXCU 3GBWA 3UTSB 1T2QL 5L4IA 5EZIL 5T3ZH 1KT2B 4KKZA 3THOA 1QLNA 3UG3A 5K9OA 2WLLA 1AY1L 4KAQL 3L5JA 4H0HB 4PVBA 3WP6A 2B1AL 5IWAB 1BIIB 2GKIA 3ECVA 1BGXH 2VITB 3HJ0A 1JZ8A 1AR73 2PP8A 3ATAA 4IEZA 4CGUB 3SDCC 2DQCL 2AJZA 4APXA 3PGDA 3LKRA 2XDHA 5I1JL 4DUZO 1YPZF 4GXVL 4X6FA 1HV1A 1MS9A 3DXTA 3JD2A 1QSFD 2GB2A 5D1ZI 3NJYA 5E6SB 3UJJL 1HIML 2F53B 2DYSB 4L3EE 4AYEC 4JJ5B 3RZHA 3V5HB 1W2OA 2Z69A 3TN93 5J2UB 4FP8H 1MZEA 4HUNB 4BW5A 1JP5A 4PD4J 4PQXA 2P6HA 2NY1C 3OUSA 4U7SA 4QOKD 4FZ0A 2BIMA 4ZOCA 4B96A 2BVQA 1WW5A 3KM1A 3IMMA 4TN9A 4ZI7B 1REIA 1N3PA 4XDPA 1P7QB 2EEFA 4UCOA 1PLCA 3VXSD 1G8WA 1TG7A 3C08H 3C8KA 3L3DA 2GC2A 4NUGH 5J48A 1FNAA 4LDEB 2PPCA 1JNNH 3OSDA 4Y4FA 1GSLA 1NA1A 4U49A 2QV2A 2YC0A 4XH2A 3NDZE 4JV5B 3CVHL 3B3IA 3B40A 4PS7A 4ZQTA 4CDWC 4NIYE 4F5CE 3HAEG 3LFIA 5CA0A 5KYWA 2NY4C 5IB1B 1GHFH 1PGRB 3EYVA 1IUZA 1W0VB 4X8JB 2HRHA 3SDDD 2H6BA 3B00A 1KCBA 3QZNA 3BVCA 5K69A 5F3BB 3APOA 4JPSA 1IKPA 2NY0B 2BX5A 1GRJA 1CFVH 1ZT4B 1OZ0A 2NMSA 3OWRA 3FO0L 4D0DA 3OQ3B 1GPOH 1MOEA 4L3AA 3ICXA 4NC0B 4CMHB 4WBBA 4Z77B 2ITDB 1PHMA 4OIAA 2Q10A 1NLBL 2GVYA 3E8UL 4OQ1A 1T20B 3AGVA 5JIIA 2F58L 5EWIH 4M3JA 2W9LA 4XYXA 2P9RA 4MGQA 3WLWC 5EB9A 1FZMA 1ENRA 2QTSA 3VFPB 4F2MA 4R4ZA 4FFVD 4PJHB 4N2AA 3QOPA 4GRLC 2CXKA 4EKJA 3PL0A 3D9AH 4M6ML 5D7JA 2PHRA 3E83A 3B4SA 4FAAB 1X5AA 1NCBH 4YGAB 4JI3B 1ET5A 3FUMA 5IFHH 4KXRA 1T0OA 1YRKA 4W68A 5A7EA 3ULUE 2FDIA 5GGQH 4TUYA 3NCCB 4N2NA 2DPKA 2CNZA 4M6NL 4EQ2A 2QR0B 3FO1B 4G8FB 3SKMA 2Z4QB 2GI7A 4J6RH 4XCYA 4XHJD 4AYSA 4WI0B 2Q8OA 3K9AA 2FCBA 4HS3A 5KUKA 5FYSA 3POYA 3W57A 1HYRC 3E6FB 3L3OA 2R1WA 4NB7A 2EALA 2QFEA 2WFF2 4DV2O 2YGMA 4DV7B 4CDQA 2YXSA 4A42A 2VLRA 1IBDA 1UJ3C 2CDPA 4JRWA 2FHRA 1FYUA 5IY5C 3GZPA 1NFDE 4E9RA 2I2SA 5HCHA 3AG4B 4FJ6A 4PJFF 3C2AH 4WWKB 2VAAA 2FR4B 2VS0A 3LMJL 5FGBC 2FD6L 3FQNB 3CSYA 5I91A 1Z7S1 3SJAC 4XOEA 4Z7UB 4M9PA 1D4M1 3UAAA 1U2HA 4LBNA 5I1HL 1Q38A 5FIXA 4HC1L 1P8JA 3Q5OA 2KM2A 5DT1H 3PHQB 3ST7A 1XSKA 3BKMH 3GMMA 2ZUXA 4RBPH 1BM3L 4X6CE 5JPNA 2G60H 2YPVA 4OUUB 4YLBA 3VYNA 4MFHA 2QSVA 1TCRA 2V4LA 3ZMUA 3O7OA 1ZT7B 1CFSB 1GGUA 4O2AA 3G5XB 5BNPB 2BVUA 3Q44A 3TO4B 1WS7A 2BY2A 3INUL 1QQP3 1TNNA 1NIDA 2C9VA 2VDQH 2PO6A 1MFMA 3IDNB 2VBBA 1A4BA 3DMMD 1TAEA 3GSQB 1ZSDA 5F96H 3UBFA 3ZR5A 3N2KA 5F7NC 1ZBA1 1XF4A 1ZEAL 2NNAB 4BZ2L 5ERWB 3SQOA 2G9KA 4IBQA 4JI1O 4WV1C 1T3FA 3GCWA 3VWKC 6TAAA 2D7PA 2P6JA 4HX1A 4HJTA 2XFXA 4PV1C 1S7XB 4W9EC 3PUSA 3RVUD 4QDQA 4KP4A 4ZFOL 2W65A 4ACTA 3AITA 1G9DA 2R063 2C3VB 1QCEA 1OTUD 1K3EA 1Z9LA 2VO8A 3FC8A 4KK6C 3IDYB 2YEVA 4YPGB 5A3IC 1GLHA 4PRHA 1O5LA 1PZCA 2XWBB 1N8ZA 3MLSH 4LQ1A 4AFDA 2P3YA 4YVSB 1MF2H 3EFDH 2PAKA 3TIDB 4HWZB 3EJZD 4MQ7B 3MUUA 4X0NA 4J6GA 1MHEA 4WFFE 2VDKB 3LKNA 3BZEB 1DBKL 5EU3B 4JRXE 1NBQA 1CF1A 2AHZA 2EAEA 4LLYA 2RV9A 4GWJA 4QT6A 1H3TA 1WISA 1FNGB 4R8CA 3L9RB 4OCRH 3MLLA 2YK1H 4R4FL 4HT1H 4YX2L 4AY0A 4B9PA 1DFBL 2R1YB 1ZGLM 1QEWB 1ZS8B 3QNYB 4RYDA 2AJYH 2W0XA 1MR5A 2VOKA 3CU1A 2BNRE 1RFDH 2GTSA 2UUBB 4PUBH 3INAA 3U1XA 3PJLA 3QEGL 4GXUN 3C7FA 2DLHA 2VKWA 2WQZC 3EIFA 4OSUH 3AWGA 4X5QA 2AQNA 4Y5TA 1BBJA 1XGUA 4BQ2A 1CZ8H 3FMGH 3BSGA 4M5ZH 3MJ9L 3ZKYA 2ENJA 1LO5B 3KEHA 2YAQA 4FG6C 1IE4A 4JAVA 4WFEE 1AL21 4OZIA 1W9YA 2ED7A 4AM0Q 2ZHNA 3ILPA 1M06G 3DF0A 3KBHE 1AR92 1NLDH 4NM8H 4BIUA 3DC0A 4F6EA 4NXMO 1Q90A 2D3LA 2XETA 2XTJC 2FL4A 4NNYB 1H15A 4G8AC 2UURA 1A1MA 3GJEB 3BAEH 3PIQB 3RP1A 1MNUH 4PJGB 2VLKA 1Q5OA 4MJHA 4PD4K 4F7TA 1YMMA 5FY7A 2VOTA 4FOWA 2WXJA 3N50A 4N0CD 3NIDF 3OV6A 3AK1A 5GRYA 5JQ6H 1PIGA 3GSOB 2VMCA 1JFFA 4FRWA 2PCPB 2X2IA 4DN3L 2F54B 1DN2A 1HHIA 1BZWA 3MYXA 4A7YA 4KRPD 1UKSA 1S5IL 2J1WA 4YHKL 3UPCA 1OLME 2WFPA 1CJYA 3BAAA 4FFKA 1UOJA 5LMUB 3PUCA 3JWNE 3MV7B 2OPWA 3QVNA 3B7YA 5J13B 1Q8MA 4ZS6C 2OW6A 5B3JF 4KK5D 4JLRA 4LMFA 1CL7I 4OM1L 3PURA 2E7BA 4G7SB 5ESAA 1CGXA 5IMMB 2WBKA 2UX6A 4E8CA 4FYTA 4X6BB 4YDVB 1OGAD 5CP3H 4WVWA 2GUYA 4HJGA 4KX7A 4CN1A 2V73A 4D3CL 3L3HB 1BDYA 3TYGL 3UJTH 3VRLE 2WBXA 1CURA 5ICZA 3TXSA 1DP0A 3HVDA 1MVFA 4IBZA 4NHCL 5EA0L 2OQ6A 2RH0A 3EFFB 4TVPD 2EE3A 2PLV3 1UM6H 3CJHB 3RGVD 1IT9L 1T22B 4FM0A 3LYRA 2BIOA 1V6NA 4PDVA 5I1EL 4YJZL 1KGYA 3WOGA 1EBAA 2XNDG 4K3AA 3NPSB 5K9YA 5HYSG 1UA7A 2B7YA 5K9OB 5IHUL 3TEZA 2WLLB 3RYRA 5J96B 1PFOA 3IFXA 3WF3A 1KRIA 4IE7A 2DD8H 4WI5A 2QUOA 1QWRA 2WXPA 3L08A 5F0JB 5JOEA 4MV2A 2ZGRA 1RVFL 1VZHA 4R90L 3GRWL 4A6YH 3PGDB 4APXB 3LKRB 1R092 3FQRA 2QDNA 2DH3A 2RIKA 5EIIA 4C0BA 4X6FB 1OOAA 4MBRA 4KMTL 4YUEH 5FZ3A 2B39A 1AI7A 1FH5L 4CMMA 2CM6A 4NJ9H 3ZPYA 1CGYA 1IQWH 5A70A 3LNGA 5A2KH 1RXGA 3QI9D 4IQPA 3R0NA 4FXGC 4DP0X 2VCBA 1MXGA 1LK2A 4HOWA 4GW1A 5JHLL 3L9DA 2GPZA 1IRAY 4IRSC 2BVQB 4RMTA 2H1XA 3LH2L 5I8KL 3KZ4C 1S5JA 1K73W 4PLJD 1ETJA 2RS52 1CLYL 3BEVA 3C8KB 3L3DB 5FBZA 2ZOUA 2DBNA 2WZ5A 4P99A 4Y4FB 3O0RH 1NA1B 4UAOB 1QRKA 5E6IA 1US3A 3NWKA 4XH2B 2FDGA 3GUTA 3B3IB 3FRUB 2EILC 3FTZA 2H0FA 1D6VH 3JVGC 5CZVL 5CA0B 5KYWB 1QW8A 1TE1B 4MVZA 1AHKA 2Q8BH 3EYVB 2NZ9C 3JV4A 4XPGH 3H8RA 2OV0A 4LVEA 2E32A 5FFLA 3TJEH 1ZCRA 3V52H 1OP3H 1ZRDA 4OGQC 4AH2A 1RUI1 4Y2DC 4AE1A 3RA7L 1AZVA 2YKLL 3ZRSA 1QJX1 4D0DB 1UCXA 4JDMA 4NP9A 4N53C 1BVNT 3BTAA 2CKBH 5EFUA 3ME2A 3B01A 1WAEA 1WEJH 3T3PB 2ZAIA 4JM4H 1S0IA 2DLGA 3WG7B 4MNQE 1WW7A 4ZUUA 4DVBA 2D93A 3KF5A 3LF7A 4OLZH 4GG6F 1AR1B 4EI5C 5ADPL 4HS6A 4JM2C 5ILTL 3O4OB 4YDKL 1HJFA 2H0VA 3ABMC 1FZMB 3UPRA 1CYGA 1CPUA 4F2MB 4MVTA 1AJNA 1CCZA 2UXXA 2D5FA 4XF3A 5L2KE 1YQ8A 3T1HO 1D5AA 1KYFA 1OP4A 2GEEA 2ZTNA 1VJSA 1S9WA 1NBMG 1BXVA 5D7JB 1XNAA 1TCMA 1X44A 3RY4A 4DOHB 2A2QT 4LOFA 3T1YB 4NQEE 5IGXH 2QTEA 3GIZH 2WWWA 5HHNA 3LRGA 1YQVH 1SEFA 5FYTA 1BZEA 3TV3L 4I0KA 3VH8G 5FFGA 4TUYB 5CB4A 4LKXA 4BH7A 3Q5TA 5DMJB 4TOYL 2XN0A 4KY1L 1CESA 2DTYA 4X8NA 2C0ZA 4I3SL 2WXRA 3SKMB 4XCYB 1QTSA 4JGYA 4CA9A 1YMHA 1EHNA 3PQYE 3X13B 4NPYA 4HS3B 3ZRVA 4PWFA 1J1OL 4HFUL 1MRFL 2D4DA 2VC2L 3L3OB 2R1WB 5GS2D 5EF0A 4CDQB 4Z8BA 1MJJA 3AZWA 5DAQA 2VLRB 2CUAA 1AILA 2DIAA 5C3QA 3PVOA 3ZDVA 1LHZA 3ULUC 1XL4A 3GC3A 1W8EA 1IGMH 2BSED 4LEXL 5C1MB 4LIQL 1E57A 1KFXL 1B0RA 1GGIL 2VAAB 3CYOA 1MCHA 2UUDK 5C0AA 4KG0A 4FL4C 1XHHA 3CSYB 3QNXA 3R4SA 3F05A 4HQQL 4XETA 1A6UH 5HVWA 1IGYA 4YGBA 5D8AC 4BU2A 1H8TC 1MS8A 1NCTA 1AYM3 5I73C 2J1RA 5L3DA 3LHPL 4N2GA 3TIEA 5AG8A 5IB3A 1NUNB 4OUMA 4ZJ9A 1OPOA 2JTDA 1DQMH 1AR83 1SFYA 2W1QA 1DLFL 1GMMA 1U12A 3GMMB 2V4AA 4MCNA 5JPNB 1VE0A 2CR6A 4PCYA 5J1SC 1HL4A 2V3EA 1TCRB 2OZJA 1W8ZA 3MO1A 4O2AB 3WFBH 4OJAA 2ZGTA 4FC3E 3KYNA 2CO7A 4UCVA 2PO6B 2L7UA 4C56D 3H9ZA 1ZSDB 2O5NA 2RJLA 3N2KB 2R9HC 1XF4B 2X3CA 4ANXA 3AP5A 3JATA 1TSHA 3CZGA 4L37A 2K8MA 4BKLA 5ABZA 4D3WA 3IMUA 1IGCH 1T3FB 1U2CA 2YD9A 1PZ7A 4HX1B 3CPLA 1I1RA 2WLZA 2XFXB 3MLUH 4GB31 4GT7A 3ZE0E 5IB2A 1MCSA 3RVYA 4YW6A 2W65B 1XPWA 1BYOA 1IV8A 1AO7A 3MGAA 2DI9A 4FJZA 3W82A 3I5DA 2GIMA 1QLEC 2BTOA 2ZWZA 4YSRA 3VM7A 1FPN2 2JWPA 2P17A 2YEVB 1UZVA 4PRHB 2CRYA 3RUGA 1N8ZB 1YO4A 4EDWL 2FYYA 5F7DA 5H4YA 4ATEA 5CGTA 1YTFD 1E6OL 1FIGL 1PYWA 1YYCA 2ZYRA 1MHEB 3UBXG 2CPUA 3LKNB 4KGJA 2RJ2A 1LDSA 4IEQA 5D93C 3LEKA 4CRQA 3SE8L 4LLYB 2VDPL 4U1NA 5FWEA 4QIRA 5EBMA 2BNUA 2ZE0A 2NCEA 4FM1A 3HBGA 4P9HH 4X7TA 3S36L 3VSUA 2AK4A 3ILRA 3G4SV 4PB0H 1PMJX 3AKRA 3OC5A 3SDXF 1FFTB 4MJIE 1ENQA 1BEV1 3VXUE 5K1XA 1BMV1 4LCCA 1SCSA 3H4FA 4OD3H 1K6QH 5G5DA 1JVOA 3ZXKA 5JORA 1BA9A 1CR7A 4FVVA 4AV0A 3R8QA 4KDWA 2DYPD 3GLAA 5DFTA 5I0UA 1XGUB 1BBJB 1WAAA 4JKNA 5EZPA 4L87A 4J3BA 3RAJH 1TJGH 4P2QE 3L17A 4OZIB 3UGUA 4JYCA 5IYDO 3ILPB 3V0GA 4DKFH 1GSMA 1HRI3 4ODTH 8CGTA 4BCXA 1JUFA 3J4UH 2P3IA 2QKSA 1H15B 3OEAA 1HAUA 1A1MB 5CIPH 1DHKA 3U4BH 3RNSA 5BRPA 2IPKA 2QGCA 4URTA 2EDTA 2VLKB 1F1DA 4F7TB 1NA8A 1YMMB 4Y5VA 2Y1ZA 1J0YA 3TEXA 4ICWA 4DR3B 2NR6A 1W16A 1G6UA 5C8YA 5JI9A 3I75A 3MX0A 1JFFB 2YD1A 4XC1H 4XX1G 4BA0A 3MHZA 1HHIB 4YHYC 4NM4L 1W39A 3IIAA 2ZKLA 2GEQA 3TT3L 2E3CA 2J3SA 3EZJB 1HESA 5FUPA 5EUOE 1KBBA 5E89A 4Q4X2 2WGNB 5AW5B 2R29H 1WFNA 4AUJA 2JKSA 4U6HA 1I94B 1QTYT 2C7UA 3RFZC 1LO0L 1M71A 4LOUC 1Y1UA 3S5YA 4JLRB 5J4MA 3VFGL 1WS8A 5ESAB 3LZOA 2YZ4A 1J8HE 1NVPD 3H8NA 5EBLC 4HJGB 2LAGB 2HLDG 1BAGA 2X9XA 1IGFL 3WNPA 4NRPA 4GAZA 1XGRA 2JJSC 5KS9B 5ICZB 1ULEA 3FU0A 3RDJA 2FYUH 3GBEA 3RY5A 1BBT3 4RGNB 4EUPG 4HWBH 2VY0A 4ZU4A 5ADOL 5E0FA 1HOCA 4AMKL 8PAZA 2EVGA 4CH4A 1YN7A 1SOXA 3EJQA 4OF0A 1ZT1A 2UXCB 1JOYA 3SE3C 4EEEA 3EJYC 1H6XA 1RUF1 2QZ3A 4NPLA 3CLPA 1MNGA 1QJY2 2WWKT 5EF1A 3NQIA 2BEOA 4KFMA 4L8BA 3ZZQA 3BP4A 5FHBH 1J0IA 3ARDD 4TSCL 3ACHA 3ES1A 2ZGKA 3T9WA 2AHIA 1G7LA 1DZQA 4LLOA 3O8XC 4NZDA 5F7WC 4I3PA 4AEDA 2GUZA 4O2BA 1M7XA 1PP9H 1OC1A 1C12A 3TXQA 4OCYH 4PVLA 5E56A 3GJFK 4I88A 2E86A 4L1DA 2FSEA 4L8QA 1L9NA 2AEWA 2CAKA 4FPLA 3FQRB 5JNYA 5EIIB 3ZE2F 2XZAH 5H35A 1ONAA 3MRGA 2PQSA 1J9CT 3S36X 5ANME 1IVSA 4FZEH 3SEEA 4M1CD 4CMMB 3DV8A 4CDXC 1JJ2U 1AR63 4MXVA 5GLWA 3FT3A 3QJFA 2FSDA 4Q2ZA 1C1LA 1JMKC 2FT7A 4OBRA 1AG6A 3T0EC 4GP5B 1V3MA 1LK2B 3MFGB 2OTJV 4GW1B 4JTCB 5J1AA 5I6XB 1CBJA 4GFTB 3SY0A 2BXYA 4BCUA 1ZLSH 3SDAD 1GW6A 4ZT1A 1EM1A 3A4UA 1RVF3 3CN4A 4BQBA 1C5IA 1FE8L 4LFAB 3BEVB 4MAYD 3WCYA 1MY7A 2Z8RA 3E2HC 3HT2A 3N35A 4BHPA 1O5PA 4DXTA 2FBJH 4NN0A 4OCNC 4G9FA 5E6IB 2D8KA 3GUTB 2X6CA 4JHZA 4OLYH 3UKTA 3S0MA 3B9AA 5T50A 3J8F3 1OK8A 3ILFA 1QSED 3GMQA 3JV4B 4FTSA 4OLWL 1KYUA 1MELA 3ECQA 5K0UC 1KBPA 3IC7A 1NAML 2NT0A 2WXFA 2Z1PA 4TL4A 2IALA 2FBEA 4L8DA 1GJUA 4AH2B 1SNRA 1LTEA 3PWVA 1KY7A 3WBDA 3HKBA 1IAII 4DR4O 3WHTA 4YBLC 1R3KC 3ZDZE 1ILSA 1LGVA 1JPXA 4CUCA 4HLZG 1GTFA 3L16A 1NSNL 3ZT6A 4ZUUB 4DVBB 3N7LA 1RP3B 2BOCA 5C8JA 1Y7BA 4YXWG 2EDRA 5C0JA 4FFWC 4HS6B 1G9AA 4LXFA 5D1ZC 5A3WA 3KVAA 5SWZA 4R7NA 3UPRB 4LC1A 2JSFA 2B9BA 3B9VA 2F5AH 1HZHH 4K73A 5LBQA 4QXWA 5EOCH 5DZOA 4A66A 1HYSC 1KCKA 1S9WB 3SH4A 4X6CF 3QCWA 1UY2A 1YNKH 3CSGA 1HHGA 3FQWA 3I85A 2R2EA 5HHNB 4YQXL 4A7SA 5J12B 3LQAC 4P46C 1NXMA 4KXCA 2DUPA 2Z31A 2EXTA 4BH7B 5CB4B 4LKXB 4N2IA 4ZW3A 3CHRA 1IBLB 5C9KA 1P6AB 4NGHL 3VG0H 4LRIC 4JGYB 2VLME 1YMHB 4FPJA 1JWMA 4H1LH 3MKKA 4NPYB 1KEGL 2AS5M 3FBQA 1GR3A 5IVBA 1JCHA 2D2CC 2R072 3WJLC 4I77H 1SY6L 3UFIA 3BD4A 4RRPM 1MJJB 2E27L 2JVUA 3NAPC 3ZFEA 1LB2A 3T3MF 4AGGA 1C9SA 4AI7A 4GAYA 2FTKA 3D2UA 3DV4A 3IAPA 3U0ZA 2R83A 2IJHA 2YIAA 2QDWA 1B0RB 1YNTA 1ROWA 2CBQA 5C0AB 5GZFA 4TYUA 4HKOA 1HU8A 3QNXB 5ALBL 3KXFE 2G3XA 1IGYB 1X5HA 1FDLH 3LV3A 3NT0A 4H40A 5DR5L 4XMWA 4EWEA 3MNMA 4WI4A 4W6YA 4I3RH 2BFVH 4R2GC 3CTTA 4LPWA 3TIEB 2YARA 5IB3B 1CQ9A 3H8OA 2BHFA 1SLBA 2XTLA 4B9JA 2CE4A 2WBJA 2CWSA 3IC9A 1XHXA 4JPKH 1AQ8A 5IR1A 4J1UA 1DBAH 1E4WL 1FFPA 2OYQA 5GQBA 2L0DA 3RPIA 5FYLH 2QWRB 3MO1B 3EHBC 1NR1A 5JH7A 4MB3A 2QGBA 1JZ5A 1BD2E 1N67A 3KYNB 4DVRL 3BKCH 4FFZL 4YVWC 1QPKA 2CO7B 4TQFA 1UASA 5EORL 4XIOA 4B3TB 2B45X 3U9WA 3R4RA 4D0CA 5FPRA 2LP7A 1UADC 3ATFA 1Q8VA 3HHSA 2X7RB 3JD3A 3D08A 3JATB 4L37B 4BKLB 1IC7H 1JYCA 1UWFA 3N9GL 4HIEA 1QGLA 3EAKA 2EDJA 3CPLB 1UKQA 2NYYD 1B3QA 3IFOA 5I0TA 5IB2B 4Y4HD 4M3CA 5B22A 2AJXL 3RJOA 1B4LA 3CVIL 2QELA 5TQ2L 1AO7B 2XUWA 3BXNA 4XBEH 3JQXA 2X0UA 2VZPA 3ZHLA 3RRDA 2FO1A 4WNSA 3U4SA 4IV3C 2Y0PA 5C0CA 5KLVH 3QIWC 3RUGB 1OT4A 5G4NA 3VE0A 3GFUA 3D3VE 2FYYB 5F7DB 4N8CL 1UN1A 3TJPA 1KLGA 1PYWB 4H8PA 2Z0AA 3SKVA 4F57L 2EXYC 2F7PA 1TEYA 1AVMA 2G5UA 1RZFL 2IH1C 2DY2A 5HI5C 4MB5A 4E2LA 4WKZA 1XGQA 4U1NB 3SZ6A 5EBMB 4DGVH 2BNUB 5J6HA 1Z3GH 3US1A 3OZKA 4PY8J 4X7TB 2AK4B 4AQOA 1GQGA 2AJVH 1MQ8A 4NX0A 4Q4Y3 3ZSJA 3CRCA 3GSNH 3QPKA 3WKQA 2YYOA 1M6OA 1UO9A 1WRFA 4E4DX 5DD1L 2MIZA 3AY4C 4JHAH 4LCCB 5KG9A 1R1A2 2O0OA 2R32A 3MRLA 5DDHA 4QU2A 2XLFA 3MV01 1JPSH 1D2OA 4KI5D 3BQUA 5G5DB 3WDWA 5JSOA 1BMGA 3L4YA 4W93A 4QKNA 5JORB 5JDBA 2XQRA 4ODHH 1QI3A 4U3XA 4GO9A 2ZWSA 3TA3D 3R1GH 4XP4L 2QBXA 2BS8A 2GMPA 3G6BA 2V0AA 3VRLF 3M1BA 2ADPA 2VW0A 3O5SA 2A83A 3P2TA 2Y6GA 3ZM8A 4B29A 1IILE 3TBSA 3R4UA 1J11A 1J8SA 1NBVL 1ZLVK 3ZDXF 2ZCWA 3ZDWA 3NV3A 1BVOA 1JUFB 4POUB 2B9ZA 1XE0A 3NQKA 4GCZA 5FO8A 3KBEA 5EV7A 4RAIA 1N33B 2EIZA 1DHKB 2HEYF 5ID0A 2IPKB 2EH8H 1BW8A 4URTB 5IFJA 3APBA 4PSPA 1C1EL 4Y5VB 2ZUQC 1CE1L 3GWOA 2P7TA 4R3SA 5C8YB 2AJSL 3P3NA 1WG3A 4YZFE 4XF9A 2ATFA 3I75B 3MX0B 4MS8D 4E4HA 4G7VH 1LO3H 3HRPA 2JKNA 2JGUA 4JZOA 2WO1A 3J7AU 4KU8A 4K7PH 5E99L 2K6WA 4LDLB 4ZTOL 2K46A 1BQKA 3HI1A 4YNIA 4U6HB 4R7CA 4WF9V 1HS6A 1M71B 1U41A 4X83A 1MEC2 4G3YC 3GINA 4PS3A 3VWJA 3S57A 1UUSA 4UI2A 2JS5A 3VXRE 2R7EA 3V0WL 1U91A 2WZR3 4XPBL 3S48A 1N6QH 3NA4A 1QP1A 1JXDA 4TULL 5DEDA 2ERJB 3OR6A 4E5XA 2PYLA 1UMZA 2ZGMA 4FPGA 4QQOA 1CGVA 1XGRB 5JR7B 4XPTH 1VBD1 4WNJA 1NKRA 5HXMA 4DKAA 4MZ3A 1F4WL 2E76C 2JXAA 2R0WH 2Y36L 4RWYL 1HOCB 4IU3A 1YN7B 1OY3B 4XNUH 1HEJC 3CCUV 1MCWM 1ZT1B 3HOGA 5DLMH 4H7LA 3QNFA 4W4NA 4ZMAT 3KQ4B 4K3JH 4YGCA 3CFQA 1VGEL 4U1MA 3FU6A 3QR1A 4L8BB 1GOGA 4HP5A 3BP4B 4QM9A 2UXVA 3AM8A 3JZ7A 4PLNC 2MJWA 3BUBA 5I24A 3QGVA 4F1SA 1YXWA 2O1QA 1DDHA 1G7LB 1PNCA 1RV6X 4FTVD 4MGXA 3BDXA 1DL7H 1NCRC 4K3UA 2GC0A 3K51A 4LP5A 4AEDB 2GUZB 4O2BB 2ZEZA 2E47A 4H88L 5IT2L 3VD4A 5DS1A 2JRIA 1M1XB 2PHLA 1C12B 5E70A 3DKWA 1R24A 5T1MA 1AQKH 4F3FA 3CJIA 1GN2A 4L1SA 3OYWA 2NOYA 3CX5K 2FSEB 3RWIA 2YD0A 1HILA 5JNYB 5H35B 3PUHA 2X4QA 3MRGB 2WD0A 3G71V 3C2SA 3BN3B 1H2KA 4E9SA 5C5TA 1H5BC 1ORQA 3I9AA 3FT3B 3MNZA 3QJFB 4YBHA 4N2HA 4Q2ZB 2OMYA 4WFHD 4QKDA 4WM7A 3NMEA 1URIA 1VEOA 1A3KA 1J0ZA 5GJSH 3DOIA 3ZDYE 4K5MA 2VDKL 5J1AB 3UGGA 5FYJL 2PF4E 4G5ZH 1IS3A 3SY0B 1ZA3A 1CX1A 3VGEA 1AKPA 1XNCA 1T0MA 2DBIA 4L11A 3A3YB 3CHSA 2VMHA 5I15L 1DLLA 5MEOA 3VD0A 3GLZA 4KZEL 2NXZD 3NP4A 2JELH 4JHUA 4NJAH 2EDLA 3KBFA 5FIEA 2UVFA 1H6FA 4G9FB 2MEV3 5A7BA 4IEXA 1BAFL 1WMDA 3CEIA 3ISRA 2HG5C 3SOBL 3F6JA 3AK2A 3GMQB 1E3ZA 4X9HA 3BPNC 1O7DC 1ASPA 2OT7A 1EDYA 4AOCA 4LCIH 1T7WA 5CCHE 2VR8A 2YA1A 1IOAA 1OPMA 4LO6B 2IALB 4P9LA 4L8DB 2LTQB 2HWD3 5JMOC 5J09A 3P0YH 4K55A 4WWNA 5FYKL 3ETEA 3PWVB 3HKBB 1I3UA 1LHNA 1UWGH 5L0QC 1XB3A 2XWCA 4KHTL 1NZCA 1ZK5A 2YICA 1U8CA 1UY3A 2BOCB 3LTVA 4B0MM 2VH5H 5C8JB 4UOJA 3DX9A 2A9HA 3L5XH 5C0JB 2WOYA 2IMNA 3NDYE 5SWZB 3W56A 3VQYA 1AP5A 4R7NB 4GLRI 3ETQA 4W9KC 1S77D 1MSWD 1DYZA 3VGDA 1OAKL 1J1TA 2H1PH 4WLCA 1K45A 3IRPX 4O00A 2GC1A 2DL9A 3QUXA 1YUDA 3AMKA 2BSTA 5IIEA 1BQ0A 5AOJA 4UQ9A 1OHFA 1HHGB 3FQWB 4YHIA 2R2EB 5CEZE 2VJ8A 3DC5A 2WN3A 4RDQF 2Y33A 3FT4A 2Z31B 3COOA 3DX1A 2I24N 5M7QA 4ZHNA 5DZGA 2DQTL 3UC0H 4JL1A 4UYBA 1RUKH 3MRIA 1TTFA 1WHOA 2CY6A 3MOQA 1BSMA 1CK0L 1JWMB 1N9PA 5TQ0H 3FTSA 4GQQA 1ZVYA 3W7WA 2ZG3A 3KCPA 4IRJD 4JKWA 4RGMB 1UL9A 1H3XA 3G6DL 3VFVA 2M7WA 3NA9L 4BIFA 3CX5F 2DKUA 4MTGA 2EE9A 5A3NA 5A6LA 5CILH 1LO4L 1PU0A 2AZUA 4GAYB 2CU9A 1A14H 3D2UB 4RSYA 5IW6A 3WGVB 1XBRA 1AVBA 1PGL1 1YNTB 2PTVA 4G6JL 2J12B 3ABKB 1FRGH 3AG7A 3HE7D 4ABUA 4MX3A 1CDIA 5DMIH 4D94A 4OMCA 4C4UA 3A47A 2LW7A 3FUNA 1KYOJ 3LV3B 2HKHL 4PQ9A 2A6VA 1RUPH 4W6YB 1RZJH 1A6WL 1BK0A 1CD9B 4EBQH 4F24A 3QG7L 4PRID 3N85H 3DGDA 5J7MA 4J3OH 4FKEA 4IEOA 3OGCA 3SGJA 2CGPA 2A9DA 2CLZA 4BIZA 2EDQA 5D5MA 4CILA 4OZGA 2WBJB 3IDUA 4NC1C 3RIAK 4D9QD 3Q8AA 4IDLA 1KMGA 2XX0A 3DI3B 5E8EA 3W11D 3WGUB 4J1UB 5IR1B 1FFPB 3AVEA 1IM9A 3QXAA 5DD3H 1OAJA 5GJTL 3RPIB 4LKFA 3VV1A 5JH7B 1TJXA 5L88L 4NKGB 2EEBA 5EEWA 1QY4A 4K20A 5FLXN 1CDJA 3VBSC 2A0LA 5IYBO 4LSTL 1F35A 2P2KA 4D0CB 4LK4A 4XN4A 2VNGA 4XQ4A 1QOKA 3HHSB 1XIWC 4D2NA 2I9TA 1SF9A 4PJ7A 1TVBA 4ZKTB 4HIEB 2XG3A 4MGTA 5ALCH 4HBNA 2ZX4A 1ZLWK 4AI8A 1E40A 3ZIYA 2KKWA 3O1SA 3IFOB 2BIHA 2BP3A 5DZJA 4M3CB 5L7XL 1FNYA 4PT6A 3K3WA 3VTAA 2Q9LA 3BXNB 1E30A 4UVCA 2BNQA 4DV0O 4M0HA 1ETA1 5FM4A 2XN1A 5C0CB 5JW3H 1JZ3A 3PIJA 3VE0B 2A1XA 4J3UA 4LGRB 2Z35A 1YIPA 1KLGB 2FH6A 1XGPA 3ZHQA 5E5LA 5AKSA 3D51A 5CD3A 5I0XA 3UGFA 4WKZB 1XGQB 4QTIL 1GSKA 5DK2A 1TZAA 5J6HB 3S2AA 4KK5C 4QXUH 4GWMA 1FP5A 1TVKA 2R9RB 3G80A 3BPSA 5DYOA 5AB2A 5CEXA 2F19L 1M6OB 2BMKA 2BTQA 5IMOA 2A9BA 5FKAA 3QF7A 5KG9B 2EIDA 3MRLB 5DDHB 2BNNA 3ULUH 3F5WC 4QHUA 3BQUB 5L3GA 1EBPA 3UTTA 5D1QE 3A23A 4BQ8A 5JW4N 2Z4FA 3GYDA 2A9AA 4N2KA 1PPIA 5JXAL 4B9IA 2XLLA 2BCKA 3DHJA 5ECGA 1KBKA 5FKBA 2H3NA 5BUPA 3NJJA 3ARWA 1G9NL 2FT8A 3M1BB 4LIQE 2A83B 5DSCA 2C5DC 2WNGA 3QG6A 2YD8A 3HZVA 3IMSA 4LSSL 1ZRUA 2EIBA 5T5NG 3TBSB 5K5YA 5J37A 4N26A 4K07A 4JF3A 2X4SA 35C8L 1CONA 3ETPA 1UG9A 1SVZA 4KDTC 4JYAB 2BW5A 5F3IA 3O6FD 5FO8B 1PCXA 1M1SA 1PQZA 3R65A 2EIZB 1BZ7A 5IQNA 5ID0B 1YEFL 5IFJB 1WVZA 2Y24A 3I8TA 2ALWA 4KK9D 1X5GA 1RUD1 3P2BA 3FONA 2P7TB 2LO1A 2X12A 3EZ8A 1OLRA 3K0WA 3AP9A 4GA9A 1A4AA 3CZNA 3FT2A 5I8SA 1YEJL 4N1EA 2PXYC 4KVNL 2W0KA 4J41A 4JZOB 2ADQB 2YOAA 1UC6A 2BTVC 3AK3A 4XWOC 3HI1B 3QI9C 1TZOA 2YXVA 3F7RA 3EOAB 3KPRE 4U1JA 2B5HA 3BKZA 1W8TA 1NE6A 5GZND 5F7EL 3VWJB 4AE2A 4UOQA 2NY6D 2R7EB 1U91B 4TNVK 3VI3E 5E16A 2IFFH 2MKLC 3FFCA 1ULDA 5E2TL 3WDHA 4E5XB 4N1CA 2VXJA 3OR6B 2YFUA 5HD8D 1XF3A 1ZGLP 5H6RA 3NJMA 5BZXA 4KX8A 2ZZJA 3E80A 3SSGA 2VCMA 4WFHA 3N06B 4HJIA 4WBNA 3E9UA 4UQAA 3EXAA 2VAUA 3L54A 2Y3AA 4IU3B 4WNQA 1CF8L 3ECWA 2YPVL 2JI3A 1OV8A 3DECA 3KVBA 5A7OA 3VGFA 1G5GA 5F71A 4BQ1A 4U1MB 3ZVVA 4LCWD 4G6KL 2D3JA 1OSEA 5C3SA 4JFPA 1UA3A 4J7JA 3NJNA 1RULL 1DDHB 4JO4L 1U96A 5C7ZA 1R47A 1VF5C 3N9OA 1I9JH 4OJCA 5A2QN 4TTDC 1MVQA 3SQOL 2VDLH 4YZ4A 1LYQA 3KNBA 4L3CA