4PI2A

Crystal structure of particulate methane monooxygenase from methylocystis sp. atcc 49242 (rockwell) soaked in zinc
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
390
structure length
390
Chain Sequence
HGEKSQQAFLRMRTLNWYDVQWSKTTVNVNEEMVLSGKVHVFSAWPQAVANPRVSFLNAGEPGPVLVRTAQFIGEQFAPRSVSLEIGKDYAFSINLRGRRAGRWHVHAQINVEGGGPIIGPGQWIEIKGDMKDFTDPVTLLDGSTVDLEHYGISRVYAWHLPWMAVGAAWIFFWFVRKGIITSYIRVAEGKADDVIGDDDRRIGAIVLALTILATIVGYAVTNSTFPRTIPLQAGLQKPLTPIETEGTVGVGKENVTTELNGGVYKVPGRELTINVKVKNNTSQPLRLGEYTAAGLRFLNPDVFTTKPDFPDYLLADRGLSVDATPIAPGEAKEIVVKIQDARWDIERLSDLAYDTDSQIGGLLFFFSPDGKRYASEIGGPVIPKFVAGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Effects of zinc on particulate methane monooxygenase activity and structure.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords unknown peptide
total genus 85
structure length 390
sequence length 390
chains with identical sequence E, I
ec nomenclature ec 1.14.18.3: Methane monooxygenase (particulate).
pdb deposition date 2014-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4pi2A02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 4pi2A03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 4pi2A01
4PI0A 4PI2A 3RGBA 4PHZA 1YEWA 4O65A 3RFRA 3CHXA
chains in the Genus database with same CATH superfamily
2GSIA 3BPOB 4CAGA 1HDMA 3Q5OA 4OVUA 4FHKA 5BZDA 1LE9B 3J8F2 3OBAA 4XVHA 2EIZA 1DR9A 3EYSL 2XN9B 4XOEA 4YXHL 2WTOA 3MCG1 4FXLA 3GYDA 3D12B 2BO0A 4OX9O 2CPUA 1GV9A 1NPNA 5FZKA 1MRDH 4OSUL 4JPIA 1QNMA 2G60L 3IFPA 3LZRA 1ZWIC 5K9KB 2AC0A 3BC9A 3FOMA 5I0WA 3GHNA 3JCUZ 3BP4A 3C5ZD 5FQ0A 1YEDA 3EBIA 3IPVB 1I82A 1MOFA 5C3LD 1QSFE 3WP4A 2ARJB 4HS6A 1A2YB 1J3QA 5IF0A 3GCWA 4URTA 3ZYFA 3STZA 1LWHA 1F13A 2WYTA 3EHBB 3M1BA 5AW3B 5KJRH 1H9PA 4WLCA 1PIGA 3I6SA 1GRWA 5D9SA 4N0FB 2HWB2 3HC0A 5ITBL 4MS2A 3HKEB 1GHFH 3MO1A 3DV6B 3VXMB 4Q8KA 1A3RH 5FHBH 5HHOA 2XLLA 3L3HB 4S2HA 5FWEA 1H8NA 4O58L 4KVCL 4DXTA 5FJHA 4DQOH 1VQ4V 2HG0A 1T20B 1YYMH 3NUKA 2CLVA 5CJ5A 1WRFA 4MA3B 1IG0A 4H0LB 1PLAA 3QE5A 2EIZB 2TEPA 4QPIB 2CH7A 3MJ9A 3B02A 2XRAL 1KBKA 4RQPC 5C33A 4X66O 1K8AW 1SEQL 3T3PF 2EVFA 4XX5A 1FMD2 1YNAA 3AP6A 4I30A 3HD8B 4XUOA 3ZYHA 1A3RL 5I0VA 3UTTD 3T2NH 1HRV2 5FIEA 4JYBA 2W0KA 3RNQA 2QDVA 2XACC 3QDJE 1UY2A 4DQOL 2AITA 3CDGA 1VBE1 4OI1A 3CBJB 2AXGB 1SOXA 2GNMA 4DEVA 5EOTA 5PAZA 1K5QA 3SCHA 2G9ZA 5JVDB 4HUNB 1F02I 4H20H 5ENWB 3BPLB 4G7YL 4RZCB 4YSTA 4KY1H 3HKEA 3PHMA 1O8SA 3VFNB 4BM7A 4JN2B 1FG2A 2EE2A 3O2VH 4N2HA 1FH5H 1KGXA 3CFTA 3H56A 3H2PA 5D6CB 4TSCL 4PSRA 1ZS2A 3ZUCA 3UCQA 5C9JB 3TCUA 4MXWA 2WLYA 4U1GC 2GIMA 1RIVL 2XYCA 5JPNB 5DDJ2 2ARHA 4EFBA 3CFCL 4EUPB 1EXUB 4DRXB 4CS2A 2OL3H 2H9GB 4LCUA 4G5AA 4PBDA 5CJBA 3FHIB 3IFOB 1XOUA 3MRBB 4LSDA 4A2GA 2B4CL 5FO7A 4QRQA 3QH7A 4K7PY 4AIZA 2VWJA 2XWDA 4DVBB 5FDWA 1W3VA 3OKLB 5HJ3A 3VFTA 5FYJE 2EZPA 1RUF2 1R3HA 4DY5A 1HJFA 4AVKA 5JHBA 4KFMA 3CJIB 4NN0A 3IDCB 4QHBA 4D3WA 1QNYA 3ZMUA 2PUSA 4K3EL 2BNRE 2WAQA 3MUJA 5CMAB 1LU1A 7PCYA 3IMNA 3OE7G 4R0LC 4IV1C 1GW6A 2BNRB 1C5CL 3DWTA 4LF8B 1JOBA 2ODMA 1S0BA 2BPA2 3RWFB 4E9QA 4RLDA 2PYED 4TOYH 3KEHA 3A67L 3PP4H 5EEWA 4F8NA 2K9PA 4TSAH 4F6RB 1WGVA 3GSXA 2F4PA 4QX7A 5E2WL 1LHWA 1DVZA 1S4CA 1P1ZB 5CJOL 4APXB 1CIWA 2R29L 1M90W 1C08A 3MRNA 3SCMD 1Y4MA 1RZJC 5C0AB 4PV8A 1KXQE 5EK0A 1YQ5A 1CD8A 1XSQA 2YU1A 2P49B 1OOWA 1RHI2 3VE0B 5EOCL 3X2QB 1E9QB 3PJYA 3MUGA 5ACZB 1US2A 1WKYA 3AABA 4ZQKB 2P46B 1FYTB 3RWHA 2GNTA 4HGMA 4DSYA 3D87B 3AG4C 2XN0A 3LH9A 3Q3GA 5F44A 4OHVA 4P2QB 1UH2A 1UWYA 3NMEA 3STLC 5LGJA 4QHKJ 1FQ9C 4X6DA 4I85A 4NXNB 5LBQA 5DZAA 5BS0E 4WQOA 1LENA 1R9FA 3OM3B 1QEWA 1UIKA 1EAJA 1I9RL 1QR4A 4NNPL 2FATL 1FRGH 1JGDB 2HCZX 5KUMA 1K92A 4IT5A 4JCMA 4MAYA 4AOCA 5JUVA 1UWFA 4NUPA 4JX0A 5G2NA 3U4EB 4KI5C 3VL8A 3VXSD 3UOAB 2WCPA 5D4HA 3WMSA 1CPNA 4IYIA 2G9KA 2YI8A 5C0NC 2XQYK 1TEIA 4IE0A 1OCOB 2E76C 3HJ0A 3PF2A 4FI8A 1KJ2H 3VWJB 4WZFA 2WOYA 4NN6C 1QSFD 4IE6A 4G6FD 1SJVA 3JATB 4ZW3A 3B3QE 2AQPA 2O61B 4S0SD 2H1PL 1B3QA 1M3JA 2GP5A 4UQ3B 4CNIB 1AD9A 3RTQD 3T4VA 3ZMOA 4UW4A 1C5IA 3HZMA 4G6MH 2P17A 1KJ3H 3ML8A 3RYHB 2DWTA 1VMGA 3H9YA 4WCYL 4YDMA 2ZUUA 4WF7A 2HPOA 5J6SA 2V73A 4CDXB 4OAWB 4EN6B 1JN2P 2RE9A 2R69L 5DJZB 2UZIL 4P5TD 2WPGA 5HYJB 1CFTB 2EIMC 1SQQH 4BZ2L 3L16A 1KYUA 2RAMA 3V0DA 2VIRA 2Z42A 1MACA 2YBRB 1TZIB 4PFEA 2YD1A 4XNBA 1LILA 3K5LA 2Y1YA 4YN3A 1JZ7A 3KMHA 3MFFA 5D7JB 2XHNA 3K72B 4ZNEE 2XJSA 2EDMA 4LVNC 4L8BB 2YYOA 5JOZA 1B6UA 3A0BZ 2N3JA 2Y72A 3IJHB 2ESVD 3SGDI 2APBA 2BNRD 1KPUB 2M1KA 4TVUA 3ZR6A 2WT1A 1LK3H 3THTA 3WF0A 4PJFF 5FUZH 1ZEAH 3VVVA 3W9DA 3ZL4L 1LEIB 1KULA 5C9AB 3OXRA 3NA9H 1CFVH 1BAFL 3QJTB 3Q6FA 3GRWL 3TU6A 3UADA 4ZXBA 3DYPA 4ZKTB 1LMIA 1PP9H 1ASPA 1R24A 2JIXA 4BUHA 4AEMA 2XHBA 2RTTA 1DSWA 2A6DA 2PWGA 2V7NB 3KPLB 5JYLA 1B0IA 1ZLZA 4MNHB 3P77B 4ELKA 3IVKB 2WZR3 2I9TA 1BX2B 3AU1A 4JDEB 5EUKB 2ZR2A 3HNTH 1CAWB 4TV8A 3H9HA 4YHKH 1S7QB 5JIQA 2C0ZA 4R8CA 1YY8A 1YQ2A 3KH4A 4Y19D 2NR6D 5C09A 2ZONA 1BCXA 5F1RA 3HFML 4OUUA 5JOYA 1H3WM 1X6NA 1KTJA 4HSCX 2W9DL 4IOFD 4QNPF 4FNRA 4KTEH 4Y4RA 1I8MB 5GRJL 3PIQB 2I74A 4YHPB 5LQBL 1OZ0A 1CDIA 5H5NA 3UCSC 1YPZB 2DMBA 3D39B 4GXVL 1ZHBB 3S97C 5IP4A 4Y20B 1EEZA 2EEAA 4NM4L 2HSIA 1P2CA 3C7GA 1J8HE 3MBXH 1ZLVK 5J3HC 2EXKA 5FCUL 3UEQA 2QPDB 5F0MB 4ELMF 5CLTA 2R042 2YO3A 2NQCA 4MHHG 4W93A 5KEZA 4MNQA 4NGHL 3SKMB 2PO6D 4K0OA 4F4LA 1FOD3 2ERFA 2BVPB 3JCZA 2MKLC 4HK3N 4ISRA 4KJPD 3DGGB 4RESB 4AYBA 1AZCA 1YIFA 2PNDA 4NRZB 1NY72 2IM9A 4Y4YA 5FJKA 3P0GB 4UYPA 1U8KA 1RFYA 1DO6A 3NJMA 4TTGA 2DH2A 4ZU4A 2WINA 2H6UA 2LQTA 2ARBA 4Q4V2 5F88B 5D7KE 4XC3L 4EQ3A 2WFPA 4AVJA 2MCPL 4K9EH 1XU2A 4PJFB 3S88L 1NPJA 3VV1A 3RYCA 3EUDA 4E2SA 1W8OA 4XNQA 5DFTA 3N55A 2X9WA 5D6CA 4P2RA 4PIYA 2JWPA 3GHPA 1S9YA 2WJSA 1Q5OA 2J8OA 4HIJB 5JXAL 2VDRL 4XP1L 5DAVA 4XPTH 5JW4R 1R081 5CXPA 2GTWB 5I8EA 3MV8E 2K78A 3SDLA 1L7IL 1IXBA 1VESA 2VLKE 2VQ1B 3EH2A 4EI0A 2NM1A 2FT8A 1AZVA 4ATFA 4X5WA 1W2UA 1BVKA 2JI1A 4OM0L 5AOMA 5DFVC 4A3XA 3VBSC 3BVNA 2IGFL 5EZIH 4XACA 4L29A 4JPVH 2ARJA 4HS6B 1WAEA 4XMKL 1E57A 4X6FB 1RVF3 4JGYC 1MDTA 3P4OB 4AEFA 1UHVA 2ZX3A 4CA9A 3IK2A 5BO0D 4GLRI 1MCBA 1LOEA 2NY5C 1BMZA 1AVAA 2VMDA 4EZLA 4N2IA 4DK3A 3PRZA 1G8MA 1WZMA 4O2AA 2GK2A 4PJIA 4F7CA 3HBPA 2EUVA 1VBD2 1W9SA 3AZYA 4Y1YA 3RSJA 3OKOA 4GJZA 4PA9A 4MYEA 3WEOA 4DK1A 3U7WH 2DIJA 1JERA 3ZMSA 1COWG 4Q14A 1BJ1J 2AQ2A 4R96B 2E9WA 2G4EA 1MZYA 1YWKA 4WVVA 5DRWB 4JM0A 5DABA 4RDQG 4ZAKC 2C8NA 5MEQA 3GB7A 4S1DC 2DDUA 1OL0A 2Q3AA 5ACA1 5GRXG 4PF5A 3EBGA 5C1MB 4UTCA 4JG1L 1NCDL 3VXPB 1YNKH 3LPWA 4BKSC 4YHOL 4F8QA 1I9JL 2VNOA 2R9IA 1T0PB 3SGJC 3D09A 4KGQA 4DV2O 5KR7A 4IW3A 5FXCH 1A7NL 1KB3A 4NRYA 4QRRD 3CVHB 2HWB1 2QTVA 3WP3A 3RL2B 3R8QA 3GZUC 1A34A 4BIKA 3VBSA 5JMRA 2NY3B 4DO2A 3BYWA 1EHNA 3BH8B 4ATTA 1WISA 1GPOH 2DQTH 4J2XA 2DM4A 5GIRB 4MMXB 4XMLH 2HWF1 3V52L 4OCYH 2YAMA 2B9AA 4PJ7F 4DHLA 5GZGA 1I3HA 5FMCA 3SDDB 2V9TA 2CZNA 2WBJB 5GGUA 4PWIA 4URKA 3J7NA 4Q9QL 1DJYA 4CZZA 3FX7A 3LV3B 3ATGA 4KU7A 1IE4A 1U8NB 3O0VA 3VDBA 2VZQA 3QWNA 2C5DC 2BNUA 3PQYE 4HWZB 4NP9A 3MNZB 4KDTC 3TNNA 3CLWA 4DP4X 4GRMB 3U0ZA 2H6OA 1U3ZA 5DAWA 4COVA 3PUHA 4C90A 3J8F1 1AO7B 2Z2SB 1AJ7H 1QR1A 4FXGA 1XNAA 4AVSA 4B1LA 3APBA 4JS7A 2GDFA 2NNXA 2PTMA 2ZHLA 2E7QA 3MAQA 2HKAA 4G27B 1ZREA 3IZOA 5I6NA 3USUB 2UXCO 2XFXA 4XO5A 2AEQL 2VLKD 3M8OL 1ZHNA 4WHCA 5T1KD 1YJDL 4KQ3L 5E8AA 5CJQL 5GLUA 1NC4B 2VE6A 4Q52A 3UDWA 3CVHL 3FCTB 2R23B 9CGTA 1D5MB 4LHQB 5A2FA 4XPAH 1BQ0A 4NQXA 5C8YA 3U36A 1RMFL 4MLIA 4A55A 5C7XH 5JPMC 1K5MC 2VJ8A 1WBLA 2YROA 1T22A 4FYSA 4CEWC 4G9DA 3WJJA 5BNOB 3PJQA 2XTAA 3O2DA 4QDSA 4RYDA 3POGA 4JCLA 5A80A 1LM8V 3TVMD 4XO3A 3RVWD 4JI8O 3N06B 3JD1A 3NP4A 3H3BC 4G2AA 4G8IB 5FMOL 4BDVB 3I6LD 3OEHG 1AVBA 4E9KA 4P9PA 3NFSH 2X9ZA 4U2YA 2NX5B 4XI5D 4I50A 2NQDA 4KHPB 4G7VL 1NI8A 4WF9V 4C4BA 3VW3L 2FQGA 1SACA 4QM9A 3R4DA 5IESL 4Y5SA 3WDYA 2OTUA 1CE1H 4WHYG 2UU8A 3T0WA 3TBVA 3LEKA 2ZTNA 1I7FA 2YJQA 3ZJZA 2Y6SD 5C9KA 2Q68A 3GUTA 4DGWC 3T4HB 2ATPA 1D5MA 3AACA 3D3VD 5AQ0A 1IFGA 1WAAF 4L37A 4A2EA 3D6EA 4XF4A 3APMA 5F1NB 5F96H 1ZGLA 4QX3A 5DUMH 3QXDB 1SQ4A 3ABLC 1GGCH 1OM9A 2J2ZA 1YN6A 1JYNA 3I9PA 2AGJL 1CAVA 4OULA 3O3BB 3CMAV 2JH2A 4IIQB 4RMQA 3ZFGB 3WG1A 1SA0B 2BY1A 1FBIH 2LW8A 4Z7VB 5FYMA 2AMUA 4PLKC 3BN3B 4P23A 4D0CB 4OF3A 1XNQB 2UU9B 5C93A 5DZOA 1IAIL 4YS4A 4NXNO 2XV0A 3S8WA 1YJKA 2R49A 5FYUA 3KT7A 1F5JA 1NFDA 1F6AA 1FJ1A 2DEWX 5E08L 4LOTA 4X99A 1AI4A 3WB1A 3X3FH 4U7NA 3HRZC 2NXYC 3RVZA 3N42B 5HVFB 4LF6O 2ZAIA 4PY8J 5J57B 1UD3A 3RJDA 3OPTA 3BW9B 1SQBH 4J3VA 3HPLC 4FP2A 4P9IA 1J84A 2PGGA 1HH9B 4OMDA 5AALA 4XN9A 1SOQA 1Z9SA 2ZJSL 4AZUA 1A7OH 3GBLA 2GAZB 3L1FA 1KBWA 2X1XR 3A47A 4QYOA 3U2JA 1NUFA 4PW3A 4C8DA 1VDGA 3MJ9L 4R7XA 3SKOA 4XZPA 2IAMD 3KXFA 2EYTA 5ALCH 3UTQB 3VBSB 1WA1X 1NPUA 2CE6A 5JDBA 5FRAA 4L1LA 4J80A 4GWNA 1BM7A 3O6MH 1AO7D 4YC2B 5F6KA 1UD8A 3MV11 4MMYB 4XPFL 3F7VA 2FBJH 4OFPA 1E4KA 1FIGL 2ICWB 2CHWA 2KG7B 5EYXA 4HVBA 1O6UA 1QSVA 5IWFA 1Z9NA 1LD9B 3ARTA 4ZXBD 1FNGA 3WFCH 4ZT1A 3SY0B 5FP7A 1IXMA 1TTGA 4LOUD 4HFUL 4XO4A 4TOIA 3EOTL 2QUOA 3C7EA 3LKSB 3QJRB 4CU8A 1DZBA 3BWAB 1UH4A 3KLDA 4U2AA 2DI7A 4FFYA 1RJZA 3F5WC 2W60A 3R1GL 4KDVA 1LHVA 5EJZB 2LGQA 1KZYA 4F83A 4OF8A 1QJY2 2VAAB 3R0MA 2Y23A 3L71H 2FGWL 3APOA 2VW4A 3FMGL 4X1KA 4NUGH 5FUCE 2R32A 1RXFA 4CA4A 1NFDF 1ULCA 1LQBC 2GC0A 4KROD 5I1EL 1WZKA 4AJ0A 5I75B 3W7UA 5C09E 1ZRRA 5EC1B 2V2TB 4O7XA 1K5WA 2ICWA 2E75B 4DKTA 2NY3C 4OLYL 1KYFA 3TNPB 2VBBA 4C83B 4XBFA 2J3SA 3MIEA 5TFSH 3O1TA 4BCXA 3TB0A 5L3DA 4Y3OA 4ELKB 1VZHA 4OUUB 4PIZA 2W68A 4GMSH 2CKBL 4NM8H 2ZOTA 4FM1A 4R97C 3SQOH 2X1WL 4TNVF 4XO8A 4IHJA 1SHWA 5LGTA 2OP4L 4U0RC 1J88A 5DXWA 5A7OA 1QWHA 3MDJA 3V0VA 1GZWA 3A0HZ 3G6JB 4MNQE 3VXNA 2O1QA 3KBPA 1IBDA 4RSUA 5HHXH 4YDNA 1CF1A 3SKNA 1O9WA 1QWUA 3DIVA 3SKJE 4EN8B 4Y5VA 4NKIL 4D6SA 1O7DE 1DLHA 4PVNA 4HJJL 5C07D 1U8MB 3QZOA 1YYCA 2R0KL 4FTDA 1HXS3 4I0CC 3UYRH 4PRIE 5MEPA 1KJ3L 1E5IA 3QC5X 2ZJCA 5CWSA 3O1VA 1G1YA 2ZG3A 1KB5H 1AR1D 4YY3O 4WCYH 3VBRB 1PMHX 1PZAA 2RFXB 4XBMA 3CFNA 1BQSA 4FL4C 4CDHA 3RI5K 1XIWA 1QKZL 5KSBE 5LG6A 3GXDA 1MR5A 1XZ0B 4I0PC 4K8RB 2XHKA 5AUMB 1EZJA 4JEGB 4X6RB 1RAMA 3O1UA 1XH1A 3QZWB 4FP3A 1DGSA 1PJ9A 3QISA 5I71C 3IU4H 4MHUA 3HE7B 3QGVA 1CZ8H 5DD0L 3U9PH 4QJ4B 3MV8A 1NX9A 4KMTH 1PVC2 4L9LA 5LRRA 4E42B 1MREL 4I7ZC 4DOHE 1ULFA 4J3OH 1KV3A 1GJIA 4OFVA 4XCNB 5ANMB 1Q1JH 5B7FA 3NTCH 3MXVH 4YZFF 3MODH 4DXRA 3KLLA 4KRPC 3QA3A 1EYBA 3QDGA 1JZ4A 1S0GA 2DEXX 3IS1X 1B2WL 4FZ1A 1MAJA 4YO0A 3I2KA 3W39A 4A38A 4JHAH 5LBFA 2PA7A 4L11A 5C86A 3T1FB 4HXAH 4J8RA 2FQFA 2ATKA 2X6MA 4HYTB 2GALA 4AVVA 1JVLA 1C1EL 1M2VB 3UZEC 2B4CC 1G86A 2AABH 3ZXEA 4Z7WB 1DVFD 3PE9A 4Q4V1 4XW3A 4NKMA 4G59C 1PCSA 5IVYA 1VF6C 3ZIXA 5ABJC 1KP3A 1KENH 2XT1B 3IFNL 4NBYB 3KE0A 1W90A 2R23A 2PPFA 1KMIZ 4PJAF 1FDLL 3D3AA 1AI7A 1DF4A 2NZIA 3SPCA 1WWAX 5GISH 1ITCA 1HYRC 1W0YT 4ZZFA 3MRQA 1NDGB 3TZVA 1LEGA 1W6WA 2QQLA 3PVEA 1SFDA 3K6FA 4Z3TA 2IBZY 4ONGL 2BCKB 4ODTH 2D31A 1QXJA 4YW3A 3CDZB 2A6XA 4IOFC 5CN0A 1KCRH 1QTSA 2GITB 3HPLB 5EEYA 2BOCB 4YO0B 4KOCA 3RIFK 2X12A 4MXVA 1K42A 4U6HB 4O4IA 1PHMA 4A63A 1JZIA 1JPGB 4LBEB 1JZHA 2F1BA 4F58L 3AS2A 3COOA 5CBAA 4LF7B 3P9LB 4NXMO 5LP6B 4B9GA 4JVPA 3TEZA 2XXFA 4HG6B 5DHEA 3JV6B 3MLXL 4QRPD 3MHHC 4PMFA 2O8OA 4MX3A 4KV5E 1OOPB 1GBGA 1OUSA 5K1VA 3T04D 3V5DB 3BD5A 3L95A 3U4AA 1A3LH 4FTSA 3ACHA 3AQYA 1N64L 1AZNA 2WO2B 3IDYC 3QFJD 4LF9O 3OGVA 3VBHA 1IKQA 4U6YB 5EZYB 1FMD3 2IC1A 3WEZA 1IGFH 5I0YA 4FAAB 4WVZA 4HUUA 3TP4A 4DUZB 3PJSK 3PUCA 1IBFA 1T1YA 1U8LB 3PNRB 1V9PA 4DR5O 1KGCD 3O41A 1A14H 3QJHB 3FUHA 5D2LB 5E8DH 1NICA 5E1AB 4U6TA 5I15H 4BUGA 3SEEA 5IROC 3F65A 3ECUA 1BFOA 4CPBD 2R59A 1QVOB 2GJZA 4CE8A 5FZ8A 4HWEH 5ECGA 4QHOA 3QIUA 4PJ9A 5E5UB 4YFLF 5EOQL 3ES6B 2IH3A 1Y9GA 2VLRE 2HKHH 3KLAB 3MBEB 3NCXA 2P06A 2QGBA 5LGYA 4AQZA 1P7HL 3JD73 4DUZO 1MHHB 4U1JA 5C3TA 1DO5A 3X12B 2I07A 4JM2B 1DE4B 3U7YH 4EAEA 4CW1A 4L99A 4NWTH 1F51A 2FO4A 3TTSA 3RW0A 3FLPA 1D5IH 3EYPA 1Z3GH 1K9TA 3FJSA 4RQQA 4QOKD 4NQDE 1HKFA 4LLVB 4KX9A 3S96B 1DL7L 3GPSA 3LN5B 4YLBA 4F8PA 1GGTA 2DQ0A 3E86A 2G5BA 4O51B 3TA3C 3I6KB 4Y4FA 3BIKB 1K45A 1UJ3C 1YRKA 4H0HB 4R97B 1V6IA 1AXIB 1BD2B 1RJLA 4Q9CA 2YXYA 1MIEL 4R5VA 1YY8B 2OZ4H 3GKZA 5DHDA 4Z3FA 4GKJB 3HJEA 4PTTA 5FZ9A 1UZZA 5DWUL 1BEXA 1IGCH 2GJ6B 2Y24A 1OAYH 4TNWK 4XODA 3TH4T 4M5ZH 5A3LA 4KPHL 1DANT 2CDGB 3LKPB 3PWPA 4WO4A 3PWJB 1UM4L 4H2AA 2X1QA 5DVMA 1M71A 4PRPA 1W8FA 6CGTA 3M99B 2JXMB 3EYUL 1UZ8A 2W92A 5IUCA 2HRGA 3NIDF 3IAGC 1W9WA 5D7SH 4PH8A 5CVRA 1A7NH 4G82A 3HPJB 4X4YB 3CCRV 5CU5A 5A2KH 3K75B 1V9U2 1QH6A 1WW6A 4BQ6A 1OXCA 1IGCL 5L2KD 1IBLB 3LKQA 1G0DA 1CDBA 5GGSB 1CPMA 2Q8AH 2VR4A 4UAOC 4ALAC 3FC0A 5CBEB 3ZIYA 1WCUA 4JG0L 5D7LB 3MOBH 3DSFH 5I8OL 2CBPA 1UTDA 4KHXL 2F54D 2J71A 1W6OA 1KT2A 3OEBA 2DWDC 2HRHA 3GIVA 4YSPA 1NGYB 5K39B 3EOYG 3FQTB 1Z9MA 1JI2A 1DQ6A 2W5FA 1OA2A 4K94H 1UJ3A 2EJ1A 5B39B 1DDLA 2FZ1A 2Q8CA 3PWPB 1IEBB 2OYQA 1UKTA 3H2WA 3M7OA 3UZQA 2RD0A 4L4VE 1DFQA 1RHI1 4LBQA 5LEJA 1FKAO 4OKVB 3T0AA 2JIJA 3FO0L 4QRUA 1E9QA 4KRPB 4AI8A 1A6WH 1SYVB 3Q4HA 4V2BA 5E1HB 3AMKA 3UT5B 4O4JA 3FU7B 2GUZB 5FTTC 4E5XA 4OLXH 3QNYB 1ZT7A 2EINC 2V5YA 2JDPA 1YEGL 2VQ1A 2AXGA 4OJEH 5ISZB 3SPVA 3NJHA 5D5MB 4AJYV 3TA4D 3O14A 1ZAGA 3IDJA 3SBPA 3FL7A 3WU2Z 2R51A 1SQMA 2EECA 1GN6A 5EU4B 5LCVA 4W9JC 4R5TA 1HX6A 1WD8A 2V17H 3CPLA 5C4WB 3EFOA 3QNEA 1QFWL 3BAKA 2C6SA 4OD2B 4FI6A 4G43A 1UKGA 2R70A 1FAIL 4M1DL 1W2TA 3ZN6B 1S9XB 1XFPA 4IDLA 4WWKB 2NNAA 4HEPG 1DHKA 3VFGL 2DM7A 5I0XA 3CRMA 1JNHA 1W99A 4IW4C 4HN0A 5C6CA 1BFOB 4JI5B 1HHHB 3MLYH 4NRXB 4RAUA 3GXFA 1UWEL 2X1PA 1MA1A 1WBZB 4WFHD 1V7MH 4XMIA 5IMOB 3DIDA 3RDTA 2XQXA 4LBMA 4JQVC 3APCA 3CSTA 3QUKA 4AGPA 3GJFB 1OK0A 1L9OA 4WW2B 3RGVB 3U30B 3GXUB 1RJ7A 1II4E 2JI3A 4TQEL 3RTLA 2HLFC 5BRQA 3EZJB 5DK2A 4B9ZA 1UA6H 2WSSG 1MVFA 2MFNA 5D71L 4NZDA 1KDMA 3LAGA 3IFPB 4FMFA 1REFA 3GMRA 5E1GA 1QKQA 3I9GH 3L9RB 3DGEA 1P7QA 3TGXA 3NNGA 5FM4A 2NX5D 1UD2A 4RGKA 4QQ2A 3JWDL 2DRUA 2DV6A 4RD7A 4Y2DA 5CJXA 4O4LB 4E2GA 3UABA 1F4XL 2JKIS 3EFFK 1S9XA 3H1IH 2YRPA 2Z4TA 4M1GL 4AGLA 4LO7A 3CWBH 1UFGA 2MNUA 1N32B 4IKNA 3QUMA 2OMWB 3ROLB 5DD1L 4LK4A 5CFDB 4J3OD 4YHOH 2VCCA 1B04A 3KKYA 4ZHQB 1CTOA 3B7SA 3HIZA 4IRJC 2EKSA 4XNMA 1UQXA 4P5TB 1L0PA 3M1HA 4UV7H 3ZKUA 1C5HA 3GCXA 5JSRA 1R5VB 2ZUSA 1EPFA 4HKXA 4MX7B 1JF6A 3A0KA 2Y7NA 3WLWC 2VGDA 3NIGE 4Y4KA 1U0AA 1X44A 1WA8B 2Y5TB 4N20A 3RJOA 3UZEA 3VRIA 3WDJA 1OALA 4XPBL 1CUOA 5C5TA 1P5UA 4K5LA 4FFZA 4Z7QF 3VGEA 3MUZ1 2DE0X 2HH0H 4J7KA 2CM6A 3P9MA 4XPFH 4LIQH 1JXNA 5CKQA 3ULUH 2VSKB 4Q6KA 4DO5A 4AYMC 1X5YA 2WLIA 3BMWA 1A6PA 1KIQB 3ILPB 1LD9A 2BCCH 4DV6O 4GRLC 3AP7A 3WW1A 5A3NA 4JRYD 1ULOA 1R5IA 4DR7O 2PP7A 5BRZE 5D2LF 1S0IA 1U3HD 3BPLC 4Q8LA 2X5IB 3L54A 4XB8A 4J2QA 5A16A 1VMJA 2AXTZ 2BCKA 2G9HA 3HS8A 4DIXA 5A3PA 1IM9D 3MLRL 3K8KA 2JJSC 3G5VA 3WL9B 3VDCA 4DFIA 3O1OA 5IOPB 1VBB1 1A6TB 3FMGH 4GKSA 4S1QL 5L36A 3CZUB 4PJCA 4LDCA 4N1CA 4UCRA 5DK0B 3MV7E 5EWIL 3NRUA 5C6TL 5KS9A 4GAJL 3UYJA 4GOSA 2Y2WA 1DANU 3RTQC 1TZAA 4RGAA 4DK5A 2B0SH 1WZLA 3G80A 1G9MH 4XPGL 4Q4X2 3HZKB 3VQLA 5IQ7L 3BTYA 3N40P 4OHZA 5DA4A 1R3JA 3SKVA 4DQAA 3F12A 1ZGLB 3WCRA 4I9QA 2EDFA 2WZ5A 4OQTH 1KCVL 4AQ8C 2UVEA 2BY3A 2W81C 2JV6A 3Q13A 2VRAA 4JY6B 3O9WC 4MKMA 4POUB 1GXEA 2HVKA 3FO1B 2OP4H 3CFEA 3OZLA 1ZLUK 4QGLA 3HNYM 5BR8B 4LZKA 4R0LB 4YYOA 3RB7A 1E67A 4XBEH 4XHQA 5IIEB 3LV3A 4O4YL 4UFMA 4NAJA 2Y7QA 3CCVV 3T3YA 3ELNA 15C8L 4JHWH 4LHJB 3C5ZB 3W0WE 3WR0A 2GTWA 3IB3A 4OQTL 2ZWLT 5E9DA 1TEFA 3EF7A 3CBNA 4OPHA 3BSZL 3S5YA 4GKNB 5K9QG 1S7UB 5E8EA 4AENB 1RHHA 4XUPA 2DD8L 5HCAA 2ERJB 1M1XA 2W5PA 2ZX1A 5EIYB 3NZUA 5EA0H 1BBT3 2VH9A 1V27A 3ERXA 3LRKA 2LAGB 2XQBL 3KPTA 3MRIB 5I19L 4OHXA 4QU1A 4HUWA 4BH9A 2A4ZA 4X8JA 1OEZW 4KKRA 2UWAA 2W52A 1UU6A 4R4BB 3KPMA 1H3UA 4X83A 2DWSA 3AKSA 5FPIA 3AQXA 2WVTA 1W6PA 5I6LA 2R39A 1N59A 1R6KA 1ID2A 9PCYA 2BMKA 4X64O 4YZWA 1LHZA 2ZBJA 3BSZH 1OFNA 4N5EC 4H40A 5I1AA 2LVEA 3EAKA 1V6OA 3I8TA 1CVRA 3KJ4C 4ZO8A 5KOMC 3I2CH 3CCUV 3SE8L 1FL3B 5EZYA 4K35A 4UCTA 3SPHA 1G6RH 1POV0 5G5DB 1Y1DA 3M3OA 1ZSDA 5GLTA 4YFDB 4X9QA 3QIBD 2BGCA 1OLLA 1Z5WA 1HC1A 1B2WH 2DV9A 1YEHH 2E46A 3JALA 5GGVY 1I85C 3VXTB 4N53B 4Y1AE 4P2OA 4ZQTA 3LSDA 4HXAL 2EDBA 4BW5A 1XHHA 4PGZA 2FTAA 1RUPL 4GW1A 3E8UH 5B1NA 1HH6B 4J1UA 3VUOA 4WZ9A 3P4MB 4KUZH 5J13B 2JKXA 2YBPA 3BIAX 1FPN3 5FZBA 4X6CA 3B5GA 1O9HA 3LSOA 3QNYA 5FO7B 1BZWA 3CFJA 2P3IA 1KZQA 4C0BA 1C5DB 3JV0A 3DUIA 3MRPB 4D7SA 5B4XA 4DV1O 2F19L 4HKJB 5F93C 2W9EH 3NVQA 3AJ7A 1DBAH 1FNLA 3VD2A 1KELH 3KWVA 1MAML 1FVEA 2Z0UA 4PG2C 5D1ZD 5SWSA 5JLZB 5J3HD 1G7LA 3J9SA 4I0AA 2FDBP 3VU1A 4XIKA 3BP6B 3C5SA 4NPKA 2LTNA 4HUKB 5F7KC 2R1WA 5C0BA 4KQ4H 4EF3A 1JZFA 1V7NH 5LGHL 1L9RA 5J11B 1G6RB 1D2SA 2RS33 1IURA 4AYUA 5B4NA 2H94A 4WEEA 3JAWB 4O9GA 3OKKA 4P9OA 1QR8A 2X2IA 1E5ZA 3MLVL 4PD4J 5D4JA 3RFZC 1EPZA 1MQTA 4ZHNA 3RDIA 5E00A 4GX1A 2GYSA 4OZHA 1T0MA 1YUKB 2GUOA 3DX4A 1O7FA 1XE7A 1Q0EA 3EXUA 1I1EA 4RGOL 4I18B 1ZHKB 3RWRD 5FY5A 1QOKA 2D9QB 1H8VA 2Z0AA 1G43A 2HMIC 3FBYA 2YR3A 3FU3A 1R3LC 2FNBA 1AI1L 2Z31C 1AGFA 3TBWA 1SETA 4QWWC 1UZGA 4L23A 4Q9RH 3ASIA 2DURA 1U5ZA 3E8VA 2PUQT 4Y1ZA 3IN9A 5K1PA 1A3LL 2P24B 5HYJE 2AANA 4IEVA 4N7IA 4MCMA 5KA5A 3SXWA 4YHML 4PV9A 4JHVA 5AG8A 3RZMA 3NIDE 5ITZA 1OB1A 1AG0A 3O3EB 4JN2A 5D1QD 3V5KA 1IPJA 2IW5A 4NTXA 4A37A 3E5XA 1CJPA 3T77A 1YEJH 2BWIA 4Z7NE 2QJ1A 3CLFL 1I53A 2V33A 2XDHA 1WTGT 2XY2A 4N9GA 1U5YA 3I3BA 5IAXA 5CP3A 2Z1PA 1W8UA 1FFXA 2H0PA 1FFTB 2A83B 4MXQD 4I50B 3E22A 4Q0SA 1AE6L 4WV1C 3SE3C 3H1HH 3GSQB 4U1SB 5IBUB 3UROR 4CDGC 1K5MA 4UQCA 4V2VA 3BTZA 1NCCH 3FKSG 4MD5B 3EO1B 5KVFH 3MEPA 5J37A 1NIFA 1QJX3 3T6ZA 1SZXA 4U6XB 1HW5A 1U8PB 2XTJB 2UUDK 5TQ0L 1L7QA 2WN2A 4B5EA 1OA4A 2CY6A 4QPIA 4W1TA 8FABB 1E9OA 3S57A 4A45A 1UZYA 4JJHA 2GU9A 4OJCA 3U4KA 3RBZA 3L72H 1R3KA 4DFHA 2W1QA 1WZ1L 2RS53 5ICYB 2F61A 3CX5K 4GUPA 1Q86W 1MREH 1ZIBA 2I5YH 1CWVA 1QPKA 3LHAA 4XP6H 5BS0B 4NRPA 3WHUA 4NLHA 3FH5A 4H5SB 1P5VA 1R6TA 2EIGA 4N0UE 1NCIA 4G3YC 2R9AA 3NEEA 2ZDIA 2A3QA 1NANI 2ZICA 4P2QE 2BNQA 4X0NA 2YPKB 2WNGA 1Z1WA 3P6BA 4Q9BA 2F95B 5J2UA 2FD6L 1TQSA 4GLRH 4OCXL 4DO0A 1TCRB 3U4SA 2F8IA 1BZ9A 2FB5A 3BD4A 4N2LA 1S2BA 1XNCA 4N8MA 5E1RA 5C8WA 1K5JA 1WZ1H 4PRDB 5LWBA 3D39A 1GAXA 1K3EA 1P7QD 4RAVB 3LH2H 5CIPA 2CJTA 2RHPA 4B4RA 3QLQA 1JU4A 3WG3A 5LUMA 4UV4L 1P2CB 4FS0A 1QLFA 1L9MA 4GSUA 1AZBA 5ERWA 3U2IA 4B3RB 5HHQB 3ACFA 4Q4Y3 4EWDA 4ZPIA 4TULL 2PP8A 5LMUB 3GNEA 1BSIA 3DMMC 4MW8A 3HQXA 3RPQA 1CX1A 3MCLH 2B1OA 4GKZA 1VCAA 1XV8A 5AB0A 1GNHA 4ZI7A 6FABL 3ULUE 3AXDA 2VZSA 1Q1PA 4AV4A 4D2NA 1VPHA 4JTNA 5E4IA 1TVGA 1N3QA 4QPJA 3NFNB 4FNLH 3ZSLA 3KJ4B 1THZA 3H6AA 3PCYA 2X3BA 3T8VA 3VXUD 4N0YH 1LKNA 2WO2A 4IUGA 4A41A 4PG9B 2NY0B 2EVIA 2G9FA 1OAXH 3LCYA 3LTVA 1Q8IA 5BJTA 1FMD1 2ZOUA 2GMEA 1F15A 1RU9H 1QMUA 1GVIA 4HGKC 4R96A 5TE6H 4CCLA 3KL3A 3DC5A 3PUIA 1J5EO 4N8VG 3MJ8A 5ILTH 3TYGH 2O1AA 3OMZA 3OKDA 4JGYA 1R75A 4WBNA 3QUYA 1E5UI 3L4XA 4W9LC 4HPOH 4C56E 1L6ZA 4PI0A 3OB8A 4UINH 5C0CB 5JXGA 3C2SA 4XETA 3Q8CA 3T1FA 3RVWC 2Q30A 3MFGB 1OAXL 3GSOB 4B60A 3KV4A 1ND2C 2DPKA 1I1AB 2CRIA 3RPKA 3UPRA 4KBZA 4PGCA 3T0VA 3ZMRA 3OKMB 5DEFB 4JGZC 2PYTA 2JB4A 1A14L 1S9WB 1QJX2 5FYVA 4U31A 4I1RA 3TTYA 1D9KA 4AEHH 5CSGA 2NYYD 2NY7H 2PW2B 1Q90A 1KRIA 1ESOA 4PG9A 4PWKA 4XZUB 4HWEL 3UBXA 3QFGA 1HRI1 3Q9PA 3MV7A 2JEXA 4CGTA 5T1DH 1FAYA 5J7MA 1K6QL 1UM5H 5ICZA 1NLBH 3ARZA 2FB4L 1JHTB 2XZAH 4H1LA 2ZINA 3UO1H 4G42B 1CIYA 2IXCA 1SOKA 1VKXB 3AFKA 3ZSJA 1T7ZA 1E5HA 4TQEH 4LLDA 4I18C 1X4ZA 1FLRH 3QHZL 1AR5A 3VWJA 2PELA 1XNRB 2IDCA 4ZMLA 1PO21 4TVPE 3X3GH 1RUAL 5IB4A 1JODA 5CBFA 2VQEO 3OR6A 4IRZA 4WAFA 4FFBA 1KYAA 1Q0YH 4J6IA 5MHSE 1P7QB 4R7DB 2YD9A 1BAGA 3M1OA 4Z5RB 3OAYK 4N2NA 1ZVHA 1RULH 4Y2DB 4Y2NA 4ZPTB 4HIEB 4F20A 1FO0B 5CA1B 3LMJL 3UGFA 1NLQA 2GBTA 2WIIB 3EW3B 3H9SD 4P3CL 3EYQC 5CFAA 4OI7A 5GS1B 3OG2A 2YIBD 2W8CA 1WB8A 4GG6F 3CBKB 3MNZA 3SJVA 4JTDB 1QG3A 3H1MA 3MA7B 4HAMA 1EEZB 3O2DL 4GXUM 5D7KD 2XN9E 1OT2A 5DECA 3ZGHA 3D18B 3B9CA 4GULA 3AYAA 3OL2A 1HDMB 4XXWA 3OUSA 3SJQC 3V10A 1AX1A 1DVSA 1RK1B 4OZGA 4G7YH 4IOIA 4WTWA 2VXQH 5LCVH 3LMJH 3VFVA 5KSAD 3HKBA 4UTBA 4NB5A 3CXHJ 1ET7A 5F9WC 1S9VA 4ZFQA 3CZFB 2FX7H 3OUIA 3QXUA 3V0WH 4CSWA 3W11C 3BYTA 4TLFA 1D2PA 1YCSA 1AYN2 5L3GA 1H2LA 5C0RL 4G9FD 3AM8C 3MVSA 1DVUA 2J43A 5H6RA 1BVZA 2ARCA 4BHPA 4CCMA 1CF8H 1SS3A 2BEOA 4AW7A 1QQDA 3DKHA 1RIUL 3MRQB 3FH8A 1OSPL 4LEOA 4M8QA 2HFGH 5SWZE 1WJZA 4IHJB 4FOYA 3LDCA 3VI4F 3FUJA 5FS5A 2JE8A 3B9KC 3D33A 4K2UL 4EN3D 2YBGA 3L5WA 2R1WB 4S10A 5C0BB 5DQ9B 5T5JA 1LQSR 4PRBA 4M4PA 4OLVL 5DVKA 4HWUA 4HUVA 4RRPA 4UWQB 3WELA 2R1DA 1EZLA 3K58A 5JUEL 4UB0L 2BINA 4DRXA 1G9CA 3HCVA 1TITA 5AVTB 4CN6A 2GT9B 3DUUA 3IWZA 3SC7X 3UT0A 4FQXD 4IMKA 4YZ2A 1UPGA 2FLMA 4LPTA 4XPGH 1KIRA 1SQGA 4KUCD 4QKXB 4CRQA 1GN4A 2IG2H 3HI5H 2C3HA 1GQGA 3ARDA 2AMGA 1YMHB 5DXDA 5FYLH 4H0GA 1E2WA 5TGBA 2UYAA 1X7TA 4W6YB 1GWKA 4TQDA 1IM9B 5FYJH 4RCAA 3U07A 4I3PA 2YEVA 4YC2C 5IJVA 2D6NA 3IIAA 2V72A 2R7EA 3GMPA 4M6MH 3S36L 2CXKA 1X9RA 1YC7A 5DYFA 4P06A 5GONB 1FNGB 5E8OA 2R9RB 2W0PA 1NFDB 2MNWA 4E2QA 1PD6A 1I7RA 2JELL 5FPRA 3OKKB 1Q56A 2CH8A 4QQPA 3KWWA 2YGLA 3KG5A 3CLPA 3OAAG 1GMEA 3CZJA 5DJYB 4AQEB 3ZKYA 3U25A 1QJEA 3RWDB 4OHWA 5IJ0B 3UAAA 4P23D 2DL9A 3DURA 1RK7A 4NHUB 1XSRA 3BFQG 2DJVA 3CFDA 4F7ZA 4BQCA 2CUHA 4H26B 5IVCA 2P5WD 1QBLL 2AJZA 2A6JA 2ICEB 2WSUA 4X9HA 4ELMA 3PVNA 3T3PE 5FZOB 4JKPL 4DN3H 2J6EL 3DX1A 4LF3A 1TE1B 2VBDA 1GGUA 4JR9L 4QTIL 4JRFA 2NY4C 3QQ3B 4OJAA 2GC1A 4M01A 3H85A 3OMAB 4H33A 1HSBA 1O9GA 4JQIA 4PCSA 3GGLA 2TSBA 2R30A 1QO3B 1OB1B 4XFCA 3MROB 1TR7A 3MYZA 4LCIH 1JUIA 5EXOA 5BPPA 1W9TA 4HIPA 4NC1C 4PB9H 5E4EC 5F72S 4CCOA 5A2CA 1U12A 3JARA 4X9BA 4A04A 4JKPH 4DN3L 4EDWH 5HCBA 4CGUB 5HHME 2NCEA 3PABA 1TQBC 3CEIA 1HHJB 5C8CA 1M5IA 5DQ0A 1I7TA 2BVVA 4W6WB 2FECL 4AX3A 3AMLA 1QSEE 2P6CA 2P90A 4GQ9L 1PNCA 5DMGC 3GNMH 3LDDA 3AYDA 3OJBA 4FPOB 4XJ8A 3ABUA 3HE6B 4B3RO 5DDHA 3SKNB 1KLFB 5HVWA 4LLUA 4FLSA 1HB4A 3HS0C 1BF2A 3ZHRA 2ICWJ 1TNFA 3OOXA 3X1BA 4YDKH 1DDHB 4JFWA 5IVEA 2BVBA 4P2QA 2WQRA 4AK3A 5EZPA 1AAJA 3TLRA 1XE0A 4ZI7B 4DR1B 1L3WA 1ZHLB 3EF4A 4FFZH 3HNVL 1EJOH 5FY1A 4FFHA 1G9DA 2FVNA 5EEZA 4ZNCD 1ECYA 2FJHA 2C3VB 1X8EA 2FWLB 5E2TH 1VB4A 1LESA 4G6FB 3VZOA 1JDDA 3G9VA 1DEDA 2JD9A 4MDRA 3IJSA 3KPRD 5GS1C 3GYRA 3CIHA 3WS3B 4FFFA 4IGBB 3JD2A 3J27A 2CKNA 2IAMB 4OFYD 5T5PA 4K4KA 3SKJL 2HVJB 5GRUL 2WSVA 2ZCKL 1JRHI 2ZG2A 3D9AL 4WK0B 1ZZ6A 1TJHH 5DC0A 4AVIA 2GMPA 4FPFA 1F45A 3MV9E 3QAQA 5IVFA 3BISA 4L8SB 5T50A 1ND3A 2FBRA 5LRSA 4ARYA 4WBNB 3K2IA 3QUYB 5DK3A 5FYBA 1E9PA 5AVAA 2YPLA 1R6NA 4YXLL 2PCFB 5I18L 4XZ4A 2XJUA 3T8MA 4RQPA 4LLYA 3CMEV 2IXHA 1N18A 5CBHA 3DYOA 2MNGA 2Z1KA 3CQPA 5GRZA 4Z6AT 3Q0HA 1Y76B 2VM9A 5I6MA 3RZKA 1GRJA 1JL8A 2IV9A 4MWFA 5I74C 1RM1B 4WENB 4MD4B 3L3KA 4FVVA 3L1EA 5ABJB 3ESVF 3AZWA 4HJ0D 3AXLA 1HQRA 3LRHA 2ADGB 2QKIC 3PGCA 2ESVB 4S0TD 3WGVB 2P3KA 1A4KA 3SDDA 5B7MA 2IVJA 2FWOA 3EGSB 2PCYA 3BA8A 4GT1A 3MGTB 3GRGA 4GG8B 1OCWH 4MA8H 2YXLA 4MB1A 5AOIA 5IYDO 1BZ7B 2RACA 3AZUA 3MNVB 4YNYA 4A7GA 4PGBB 2QEXV 2BSED 3PWJA 5I1CL 3ELAT 3ZRCC 3IIIA 1ZNPA 3GXPA 5KVFL 1LK2B 3INOA 1N5AB 5EYPB 1MCLA 2RALA 3APDA 3C08L 3KWXA 4UT7L 1YEKL 43CAA 3OSDA 1EO8H 3ABMC 3J8F3 3AT9A 5T1LB 1BD2E 1OGAA 3CLEH 3HG3A 2OYKA 1T66D 5I76B 3GXNA 5KBMA 1AGBB 5FGBC 6PCYA 3V0AA 1RP3B 4DJMA 3VBFA 3DJZA 4IDJL 4NQDB 4U1GB 4DGYL 2P67A 3ZTCC 4G9SB 4AEKA 3D30A 3FTSA 1S72V 1FA4A 5LP6C 1C3HA 3TAYA 4JZOA 3BIEA 2QQMA 5CKNA 5GHWL 2EXIA 2ESVA 4FP8H 5CILL 1XZ0A 3VKFC 2J2ZB 1R19A 2FD6H 4G9DB 1UU4A 1UB5B 4YBLB 3ROLA 3CSGA 4JFXB 5BNOA 1PL0A 4HD5A 1LNSA 1IC5H 3E89A 3EJTA 4D8OA 2VDOH 3PUQA 4XFGA 2Q69A 4JAVA 3E8UL 5E6IA 2J1WA 3T65B 3ZHKA 4JPVL 4F1SA 5FK7A 1PZBA 2XG5A 2LLNA 2E5EA 3DGDA 4Y5YB 2XU9A 4I4WA 1K4DC 2BPBA 2Q8BH 4BSVB 1NYWA 5IMMB 4TT3G 1ULVA 4H25B 3US1A 4NO0B 3BEHA 1HOCB 2XCMC 2NZ9A 2WNUB 1ZV9A 3D2TA 3IGLA 2WABA 2IMMA 2CGRL 5ESVB 2OKXA 3NACL 2BU9A 1BSMA 2NY5H 2JQAA 3KLKA 2YIBA 5DD6B 4IBWA 2GEQA 1CBVH 2JDKA 4GWJA 3B9KD 2WJ7A 5BUPA 2JECA 1HRV3 4O02A 1DYKA 2WL1A 5CN3A 2PHLA 2I9LA 3GIZL 3D4GA 5FFLA 1IVTA 4KQ4L 4NROA 3BZFA 3OAWA 2NNCA 3RWIA 4PBXA 4QHKI 4TRPL 3T8XB 4GX0A 2LT9A 1A9EA 5F6HI 3V4PL 1YEWA 3N6YA 1NCDH 3BGAA 1CAUA 4INDA 2WKOA 1LOAA 1UQSA 1VLNA 1B35C 2IEPA 3RWFA 3QRGL 4IU3B 4PWGA 3N3HA 2HFFB 3ET9F 3W59A 4HPYL 2UY7A 4N2GA 3WFBL 1QHDA 3ZXGA 1L1FA 1S0CA 2XKUA 1W04A 3D3VE 4QEGA 2IANE 3HZYA 1T4WA 4AFCA 1ZSDB 4AZZA 2EJ7A 1A4AA 2AXHA 3L3GB 5E2UH 3WEBA 1U3HB 4BEIA 1JK8A 2BIHA 2OS7A 3QP3A 2C9RA 5DJCB 3CQQA 1FJGB 4FXGB 1UG9A 3KWUA 3ZFFB 1E6JL 1GZHC 3M45A 1R24B 3QEQD 4Q9QH 3N1MC 4PJDA 3NJVA 1G1CA 4PV1C 5D93C 2ZZUT 4NJ9L 3VXUB 4X5QA 3N41B 1KJMA 4NNYA 1IKOP 5I16B 3CCEV 4KNUA 2UWEE 2CJSA 3FKUS 3N85L 1ZLSH 3WFEH 5M0TA 5AYUH 1GM7A 4Q97A 5T1LD 1AE6H 4FLTA 2R16A 4UAOB 5LXVA 2FIKA 4R6UA 2W38A 3REWA 1SEFA 1CO1A 1JYCA 4DZGA 3QUZA 1UCXA 1YUHA 3IF1A 5IHZA 3Q1SL 3VFNA 3VFWB 4AQ2A 4JGZA 4PTTB 1MVQA 5H37G 5DZVA 3RWEB 5JOEA 5IBTL 1L9PA 3TN0D 4CDXC 1POQA 1VF7A 2R071 3OF6A 4PUBH 1K4CC 1RMFH 2H0EA 1R0AL 4QRRB 2N7GA 1LOCA 2BSDA 1QDOA 1T04A 2O5NA 5CF3A 2D2OA 3QUYC 3HN3A 2BP6A 5LAXA 4B4PA 4CDQA 3OR6B 3N50A 5T33L 4K7FA 2SEBB 4L3CA 8PAZA 3HPJA 3WVJA 4WU5A 2A0LD 2CTQA 3B09A 1J83A 2EBOA 2GHYA 2CIKA 1R1A1 1UWXK 4QCIA 5GGSA 5I8KL 3SCMB 4BAYA 4QTFA 5A2BA 1RZKH 3LKNB 3RLSA 4J3TA 4HLTA 2YFNA 2FX8L 4PY8I 5DT1H 3VBRA 2NMSA 2HWE1 1NM9A 4JDZA 4E4HA 4IIQA 2QSAA 5H9CA 3NJGA 1FHNA 5FHBL 1ZGLM 1MCWW 3T1WA 4AVAA 4JQXA 3P3SA 4GUCA 4DR3O 3DDFA 1BMWA 1YYML 4NN5B 2OMTA 3QFDA 2HTKD 4IBZA 5LMUO 2QHRL 3CX5F 4LEEA 4Y9FA 4KGGA 1FXHA 4QRRA 2O5XH 1U92A 1DQKA 2VLKB 1FNSL 4PA7A 3P11H 4XMVA 3MV8B 5HGHB 4R9BA 2ZUWA 2VXQL 1YIJV 1NKRA 3DMMA 3OXSA 3CG8A 5DPNA 2OFQA 4W4KA 1QR9A 4YDZA 1N5YL 4L92A 1B88A 4DP1X 5D2NA 1EXGA 1AR61 2PYEE 2R1XB 1AD9B 4LLMA 3WY1A 4FFGA 3VWKD 4JDMA 1BBJA 2QE3A 4DR3B 5IT2H 5KAQG 5JOXA 2QJDA 5LHIA 1E65A 1H8SA 3HMXA 4B29A 2YZ1A 4KUCF 1CESA 3EJYC 1VQ5V 2RS32 2BIIA 3AK1A 4PMEA 4PJHB 2FNWA 1D5XB 2CL2A 3LZZA 4NKOB 1N32O 3D8MA 3T8XA 2BWAA 1EFXA 3W0WD 1Z0HA 2WTRB 2WZR1 1EO5A 1JGUL 5FYJD 3IGAA 5CCJA 2E5LB 2VDQH 3GMOB 4O9HH 4F8LA 5CA6A 3QCUH 5B3SC 4TOYL 3VXUE 4JJ5A 4OV5A 3NCYS 1YRZA 3ARSA 4I89A 2WNOA 3TASA 1QLRB 5T8IA 4RUEA 1AGEB 1JWSB 3L4YA 4APQA 2L8AA 1AILA 4M8VA 3L73H 4YDJB 1ACCA 1J58A 3H3PL 2CDEA 2ZAGA 3J26N 1A7PH 1L3JA 5ERLA 3V55A 4QXCA 3MLSL 2JSFA 1Q94B 4UQDA 1JGUH 4HZ3A 3UBHA 3EOAB 1DTUA 3DK2A 1T3FA 3QJXA 2PHUA 4A44A 3FU5A 5C9AA 2IADB 1H1IA 4HK0B 4XAEA 2DVBA 5M95B 4V2WA 4M6OL 4YFLI 5ANHA 2DBJA 5J3UA 2VH5L 3QQDB 3W9EB 4PGEA 3QQ4A 2PKDA 7TAAA 2A0LC 4M56A 2XJTA 2CPCA 1N26A 4L1HA 4LBEA 4JRXD 3ZE2E 3KQ4B 4F3FA 2N7AA 4U1HA 4GAYA 2YICA 2XJKA 1ZCRA 2G5BB 4O51A 2C3VA 2QQLL 2H2PC 4L8DA 1CXLA 2FECI 2WAMA 4JDEA 5EUKA 4X6BB 1M05A 3DUSB 5T1MA 4YMPA 3SJBC 3E38A 1N33B 1OPOA 2LLGA 4OJFL 4RVBA 4XGZA 5DJZA 4FA6A 3I02B 1EHLL 2XLFA 3LEIA 1YF2A 1HCYA 4F6EA 1A1NB 2VDPH 3EH3B 3B9AA 1KOAA 5C07E 3F05A 1YJWV 1MS9A 4QI3A 4Q5OA 1J0ZA 5FYIA 4C91A 4XCFH 1A6UH 1JK9B 1QZNA 2JJUA 3HB3D 3LQAH 5I1DB 2XXZA 1YI7A 4IGPA 5BV7L 5DZFA 1CK0H 2A75A 1B06A 4NO2B 1M6OA 1M7XA 4LQFL 4WI6A 2K9ZA 4H26A 4K7PH 4P08A 1CVSC 1PKQE 5KJ4A 1R082 1R092 2V1DA 2G3NA 2IDTA 4K0KB 1E9OB 4H7LA 2R0ZH 3VBOB 2UZXA 1IFHL 3K6DA 1LYQA 3MYJA 2KB1A 1ZA3A 1XTMA 3JSLA 3H6JA 2MCG1 3QHFH 4LSVH 1NGWB 4UF0A 4P3CH 1C5BH 1N0XL 4PCKA 4YIQA 1U8JB 3O9OA 4BELD 3HAGA 1KFAH 5DEZA 2XKNB 1Y76A 1JGDA 3ETBJ 4MAYB 1LP9F 4ODBD 3V5DA 3AWGA 4HZLB 4F24A 2FWUA 5IJCC 4EI5A 4BIUA 1QTYT 4NDMA 1UB6B 4OIAA 1ZWIB 3S0MA 5F7MC 4RQEA 1KCBA 2ZX7A 7CGTA 4EI6A 1SEQH 3GGWB 1IILE 1OD7A 1A47A 3ZO0A 1MVEA 3CX2A 1KFGA 1WAAA 5TF0A 3SE4A 2NTSP 4KROB 1S9YB 2NX5E 4XRCB 3SQBB 1K4CB 1TVBA 1D0GA 3BCDA 4WO0A 4AFAA 2CKBA 2DDQH 3JASA 2BTQA 4META 3BH4A 4NCC2 2WBJC 3MA9L 5C0IA 3WJLA 5I93A 4JVWA 3BHBB 1ECZA 5FUIA 4ORGA 3HCVB 1WP8A 2ESVE 1VRH1 3KR3L 4OH2A 5D1ZC 4ALAH 1OH3A 4JDVA 1WFIA 3H9VA 4R7LA 2WOBA 1PZ5A 1BVLB 3SCMC 2APXA 4I3RL 2D3VA 3CHPA 4GUNA 3MODL 3NRPA 1ZBA1 3ZY7A 3QZNA 5FZEA 4JYYA 2AEWA 1ADQH 2HT3C 2DJ4A 2VR8A 3WFDL 2JVDA 3OGRA 5TQ2L 1WGPA 4GRWB 2GIXA 5HGDA 1W6NA 4IOSA 5I0UA 2V37A 1I8IB 3V6ZA 1LWJA 4RFEA 5GRUH 1FYHB 5C07B 5TPWH 5BQDA 4W70A 2JD4A 2HFFA 2W9LA 3H53A 2PETA 4IBTA 1W2OA 3P3RA 1FPTH 3KS0H 3BQUC 4U1SA 3OKEA 2V7QG 1KCKA 1XH3A 3NSCA 1XB6A 3JWOC 3QC6X 3OBZA 4K40A 4DRRA 2DS4A 3IDMA 4G80A 1NAMA 5IW1A 3QDGB 1PGW2 2P4EA 1XILA 2OJZH 4PDWA 1FCGA 3CCHB 3EHBD 4HIXL 4XP5L 4F9LC 3R4SA 4FPJA 4IOIB 4J1XA 1HP8A 3H1JH 2DN7A 4G3YH 2VCBA 1C5CH 3EGDA 3ORJA 1CL7I 4GSDL 5DAPA 3U4BH 4HJ1A 5JPNC 4AW4A 4JFFB 1AS6A 3P77A 1WBXB 2DB8A 3BZFB 1NC4A 1VGEL 2UXDO 4LHUD 4NKQB 5LN8A 4LUMA 3T2MA 3IPFA 4NHXA 1ZZ8A 3HQRA 5C0DB 5FOJB 4U1IB 1UYWL 1J7VR 3AVRA 2WNKA 1KUMA 5JO5A 4E0RA 3VI3A 4HGWB 3LKSA 4L3EA 3W7SA 2QA4V 2LFGA 3AB0C 5DI8B 5A1AA 5I5RA 1BK0A 3H4HA 3OYWA 1VCBC 4GSDH 5E6SB 2FR4B 1QBBA 4EJRA 1XZWA 4FLHA 3WKML 4PJDE 2Z69A 4Y24A 2W0FC 1I8LC 2CUAA 2BSRB 2XA3A 1JS4A 4XP4H 5GSRA 1JZ3A 3FFCB 2Y34A 1NZIA 4XPTL 3V8CA 4QPYA 1SN2A 5E1AA 1OTSC 2E33A 1EO8L 4RL7A 3REVB 1GJUA 5JHDB 4DF9A 5HHMB 2DKSA 2UWEA 2QWQB 1XGPA 3GLEA 5EN2B 5T5FA 4BGDA 1ZE3C 3VXRD 3FS9A 3MYJB 2JLLA 3IJHA 3ATAA 1QUNA 2ZXGA 2M8XA 3VFSA 4JFSA 1XBRA 3CN3A 2RH0A 5TD4A 2PCPA 5ABDE 3B69A 3OTOO 2VUYA 3HRZB 3MRGA 3QS2A 3PLQA 1S0EA 5D21A 3NPSB 2G9GA 2KZBA 1V3KA 1UFIA 2WZ6A 3DX6B 4K3HA 3ZKNC 1H8OA 3QUMH 1RUD1 3OF6D 1EMTH 1EEYA 3RX7A 4HSLA 4POZC 1HEZA 2HLAA 4IV3A 1AJKA 1FWXA 2RR3A 4LSRL 5MP6H 4JFDE 3H42B 3WLBA 4NDMB 1OANA 2EYRA 1SDAB 2Q87A 3WG4A 1R1ZA 1Y67A 4OIIL 5C0AD 4IEFB 3L5XH 1IC5L 4BZ2A 5CEXB 3O0WA 4K7JA 1SERA 4UAHA 3GGWA 4Y16B 3BAEH 4I55B 1DN0B 3ZM8A 3WE6B 3WKQA 1SMAA 4K3JL 2L9LA 3MIBA 4HBCL 3QCWA 2BOCA 1DLBA 2Q8BL 4HIJA 2WYIA 3VFWA 5AAWA 3GSNH 4O00A 1YNTF 3RZZA 4BQXA 5CN2A 1D5IL 4YSSA 4YM1A 4LSRH 4WEMB 2VISB 4ZUSA 5I30L 3MF9A 2DBLL 4YG0A 1CFNB 1ZS8A 2O5ZH 3KPPA 1DL7H 3K2OA 2WLJA 5FZMA 4U3FH 2ZMNA 5DJ6A 2UUCB 1RUJ3 1MNUH 1YY9C 2C9QA 2IGFH 1D0HA 4G5ZH 5JWPA 3B2UD 3MUY1 3CB2A 3QFJB 4HK0A 4WW1A 2JIGA 4AE2A 2RJZA 2RHEA 2X4SA 2XPJA 2KPWA 5HBAA 1AFVH 4TSFG 1BAWA 1CLOH 3FUEA 1KXGA 2XBDA 4CS3A 2XZCL 4NHLA 2QHLA 4QRRE 2UWEF 1Z32X 2VUAA 1JNLL 4AYDC 2EVHA 3NCWA 4AT6A 3U11A 1VPOL 4JASA 4PJEA 1UADC 1U2CA 2WCSA 4QRSB 5AVUB 3TESA 3N7MA 5DEGA 4CVXB 1W91A 2N0MA 3D3VB 3IDXH 5L6YH 4D8PB 1TCMA 1F97A 1J8HB 3GRWH 3FN9A 5DUJA 5FZ7A 3FT3A 1XMEB 3SISA 4YY3B 3MKGA 1O6VA 1BZ7A 1JTPA 2MQCA 4G8IA 4JVUA 1Y3TA 1I1RA 2X4QB 3QWQB 4U05A 4YEEA 5JQHC 4XNDA 2WQWA 2EIMB 2FSDA 3BKMH 4RA3A 4Z7UF 3UPAA 3VE0A 1VE0A 4KO5A 4RS5A 5E70A 1CLVA 3B34A 3C2AL 3PREA 2WLLB 4IJ3C 5FLHA 2Z4QA 1L7TH 2Q7NA 5MI0B 3ABTA 1PZ8A 3NRQA 1H2GA 1LVEA 1MFDL 2ZP0T 3UTOA 2EDRA 4AQYO 4YG6A 4HULB 5L7OB 1D5ZB 2UUAB 1E4WL 5J4MA 3IBOA 5EEUA 4J11A 5GRJH 5E5RB 3ZX6A 5A6YA 2JDUA 4PWHA 1VRBA 5HI0A 3HZKA 4MXVF 4I0XB 2Y25A 1CAVB 3HUJF 5BMFL 3FB7A 1HWGB 3R0RA 1X9LA 2CDEB 3QORA 2JG9A 1WMFA 2E59A 4FQLL 2H26B 4NQCD 1MFDH 3ZE0F 1AO7A 3FQ1A 5KVDE 1PZUB 4UIMB 3X29B 2VQFO 1LDSA 4J4PD 1A9VA 1IJ9A 1S5JA 2O6EA 4I0PB 4ZZKA 1OAKH 5K33A 3JXSA 4YZ5A 5D1QE 4Q74A 1BXHA 5ERWB 2D0GA 1AQMA 4IGGA 4PELA 5J9PA 3VBBA 3ZE0E 3BXNA 1NE4A 1ZL8B 1YPZF 1P69B 2A77L 4MD5A 5DWPA 5HYJD 1XQ8A 3VKNA 5CILH 4IRSA 3GXUA 5FO9A 3MHSC 2JF1A 3SKOB 3VZNA 1KXTB 3BABA 5FZAA 2IFGA 1ZVNA 1WWWX 4NQTA 3MROA 3K1KC 1G7YA 3VZMA 4R8HA 2D5FA 1AZDA 4JFZL 1COV1 2ZKOA 2WGNB 1T5WA 4HMEA 1V7ML 3V4LA 4OZXA 3U48A 3ZN5A 2DWDA 2Z7ZA 4LQ1A 5ALBL 1WP6A 2J5LB 3K5MA 3DV8A 3SCGA 1BMV1 5GRYA 3OGCC 4EI5B 5KX5B 1AD0B 2A77H 4JY6A 2IAND 1UPSA 3BVDB 1R1A2 2A38A 2XTJD 2R063 4ZUUB 4ODXB 3GTVA 1XMOO 1XR9B 1UWWA 3OT7A 5FYSA 3K72A 3MPBA 1O6TA 4Q1RA 5DO2D 2IBGA 3A5VA 5ISZD 1N5YH 2Y3NA 2OQJB 3SEPA 2OMBA 1GYKA 4NAQA 5KVGE 4K3DH 1NCGA 1FNEA 4YDLC 5C0IB 3CNAA 4NQEA 5J48A 4B7KA 4AV0A 1F4AA 3IETB 1MVYA 4GKKO 2K6WA 3H54A 5IQOA 1PMJX 4J27A 2QCSB 1RURH 4L37B 4W9CC 1H8LA 4M9PA 2X53S 3AX4A 2VMHA 1GGCL 2Q5TA 3QULB 1KN2L 1VQ9V 2X89D 4RO2A 1LULA 1VBC3 1WCSA 2YEVB 1U9KA 4JO3H 2E4TA 4HPYH 3W81A 4AYSA 3O3EA 4HCGA 1DUZB 4QXWA 3N2GA 4B3MO 1BS3A 1BPLB 3D50A 5DUVA 5C0GA 5A40E 3CKHA 3S6PA 3MBWB 1H8TB 1FPOA 2WKLA 1EZVX 5EO9B 1R3IL 3N44B 1A7PL 1KB9J 2DAVA 4G7RB 4NENA 4D9QE 3FW6A 5KBPA 5JQGA 3OC8A 1TG7A 1VIWB 1Q0XH 4GMTL 4WUUD 1GMMA 5A6ZA 3QDMB 4PV8B 1OOPC 4LFCB 4ZOCA 1AQKH 4E68A 4KP4A 4EROA 2W3JA 1J8SA 3SBRA 3V0AB 2QTOA 4PJ0Z 3C8XA 2IH3C 1N3NA 1A1OB 3MJ9H 2H8PB 3WFEL 2Y6SC 3BCFA 3RIAK 3H3UA 2DBIA 4KHPO 2PCFA 1KJLA 1P7GA 3WKPA 2OQ6A 2DWRA 3V8OA 4I4TA 1U91B 3KT4A 1EFRG 3ARYA 2HN7B 4LF9B 2ITDA 3AADB 1PX3A 2G60H 4QGTA 5EU6D 1XYOA 2RS12 3QPXH 1N1TA 2YAEA 4LCYB 4PJXA 3O1RA 3L08A 4H8WH 3AG2B 4S1QH 1QCEA 4UT5A 3TXSA 1EEQA 2LW1A 3P2DA 1QRNE 1YCIA 4HKJA 3LDRA 1WGOA 2VM3A 4PS8A 4U3JA 5EF2A 1ZTMA 3M8AA 3OTOB 2NW2A 4ISVA 4CXXA 3I2OA 4XJAA 4J41A 4FIPC 5C8CB 1KJ2A 1E5AA 2W6JG 4AI1A 1CI3M 3TPUA 1XMQB 3G5ZA 3QARA 4G80B 4EN2A 2VWEC 1Y9QA 4GAGH 3CF6E 2FATH 1KG0B 2AERT 2WHVA 2AK4E 1YMMB 2HX8A 4HCRH 3U9WA 3DUHA 1IFRA 5DQDH 2WLPA 1RZ8B 4RMUA 3MF6A 1ZL8A 5I6XC 3FQWA 3QNZA 1M56B 1PY4A 2WLZA 3BT2L 1XAKA 4NUQA 1XT5A 3TJHC 3RZHA 3WFHA 1J9QA 4GKNA 3ZSKA 4KXBA 1FFQA 1JZ5A 4M0HA 4MMZC 2DMKA 1YNTA 1NCRA 1TQCC 3VKLA 4K3UA 1I4FA 2YD8A 2LGNA 1MS4A 3P2TA 1XMWA 4WI9A 3IPBA 2QSCL 1JSYA 2IDUA 5EJ3A 5IM7B 3ZHNA 4TQFA 2BOBB 3SOBH 1QFHA 3TZVC 1JBCA 1JYTA 3FB6C 1UB5A 4JO5A 3SDXA 4QXKA 1SXCA 2E7MA 2HVKB 5A3OA 1M7IB 1DVFA 3CFKA 4GFTB 4YHLL 2VWKA 5ADOL 5LWYL 1COV3 1JX9A 4HVRA 4CXWA 3IMSA 2DU1A 1U33A 2AQSA 4QX8A 5C7GA 4YE4H 4ODUB 1VJSA 2OR7A 2Q6AA 3GBML 2FUQA 4BFJA 5IQNA 3U46A 1UACH 3CVIH 5EQUA 3Q2LA 1VR3A 4YDVB 5DUML 2C1FA 4OZIE 1NS1A 4Y2DD 5KS9B 4PAZA 5ETUA 3D6GA 2IWGA 4G9FE 4M29A 3LRLA 2L3BA 1FORH 4E2OA 2QQNA 4AYFB 3GKWH 4WY7L 3FAVA 2DY2A 3QCUL 1TDQA 2WQAA 3DVGB 2YUEA 2W94A 3SO5A 5A6MA 5A7PA 4YUEH 3HA0A 2AVFA 3MRDB 4ZOLA 2AZ5A 2JKRM 3ZL4H 4N90E 4OXSA 2QQKL 2YMXL 1ZAUA 2QWOB 2A6KB 3HUJB 4KVNH 2AEZA 1CAWA 1DJHA 2NY4B 4BFKA 1XEDA 4XPHH 5EHFA 4DV5B 1HHKA 4GWIA 2CHXA 3ETSA 4G1MB 4BHUI 2WBWB 3CN2A 2PI4A 1BVOA 5JYMA 2RS13 1VRSA 4TXVB 2HT3D 1F1GA 2JKWA 5LHGA 2QWNB 3EADA 2EEDA 3VM5A 4NXSA 3QJSB 1TYJA 1QWRA 1RZPA 4TKWA 1UC6A 4W9IC 1AR83 2YGVA 3ZYJB 2X05A 3G3LA 4HHWA 1A4CA 1IBMO 2YXWA 2Z9TA 1ENRA 1VEWA 3VDAA 1OW0C 2JXMA 5DM6V 4XCEA 5D70L 3OKYA 5EMYA 3L7FB 5AVQB 1BWWA 4Y5VC 3RWHB 1ZA7A 5HP5A 4PJEE 5FXXA 3IPVA 1VGEH 1KENL 2F7QA 3IFNH 5DRNA 1BLNB 1J1LA 2OJEB 3WNLA 2NP0A 4J8QA 3V6OA 4C55A 3MMEA 5D1XA 5ITFB 2NY2D 2P48B 3B7UX 2F4VB 4G8GE 4OAWA 2OX5A 4ODSL 1SLTA 2KL6A 3L2MA 4JKKA 2FJHB 4LQFH 3ZPDA 4QXTA 3NNLA 3VBUC 2JKLA 1AR1C 4GUQA 1JGEB 2AHIA 1VRH2 2YHJA 1KTLB 3U75A 3DX7B 3POJA 5DSCA 1MLCA 4YVWC 5IQMA 5JW3L 2R073 3GSXB 5LVEA 4C54A 1A6ZA 3ZYGA 3I75B 4DZ8A 5HDOA 4NO3B 4MVMA 1KWKA 2H8PC 5E16A 4LLUB 3ULVC 2WAAA 3PLYA 4HWBL 4JRXE 1ZBE2 2YGMA 2ZGKA 2YAHA 3KWTA 1R1BA 4HQQL 1WB7A 1AB3A 3JD3A 5HDBB 5I1KL 5CFDC 1M53A 1OY3B 5JXAH 1NBVH 3F5WB 4IETA 2VABB 3SODB 4OFGA 3WHXB 1RUQH 4Q6IB 4R4FH 4MJIB 5SX5K 3KVDD 4CCDA 3OBRA 2VDML 3IEAA 2W80C 4P9WA 3U6XA 1YEIL 3N0PB 1CQKA 2X7LB 1CE6A 4U6YA 1XDCA 4ZMNA 4X6DB 4XOGA 1INDH 4M7ZC 5HI5C 4MQTB 4N2KA 2ETWA 3SDAA 2D40A 4FO9A 3A0RA 3GJFH 3CVCA 5E4AA 4JHTA 5K7PA 2IXQA 4QT5B 5FV2A 4XAWL 3ZJAA 3T4YA 3F7VC 4QE7A 3PDQA 4MJJA 1YTFB 1EZVH 2GG1A 4JM4L 2WC2A 1YJLA 1MMMA 4L1DA 3VFOA 3TBYB 5EOQH 1J18A 1W6QB 3ZMVA 1NZRA 2CXGA 4AI7A 5A2AA 4BQ2A 2E47A 3VA2C 1OZTG 1XGUA 4N8CL 3WOVA 3IETA 2EACA 4OM1L 4HIIB 1AS8A 1R34A 3Q4HB 1Z9LA 1W9YA 3OUJA 4JI2O 1AROP 3A4AA 2BVYA 4WWKD 5F1IB 2J88L 3VQ2C 1MFBH 3MV8D 3HLKA 5KAQF 2DVAA 1LXMA 4FFIA 1U8HA 3RWJB 2BOBC 1S5HA 3MLUH 2WY3B 4ZPVB 4BZYA 1VPOH 1KIQA 4AXWA 1LGNA 1R5WB 2EKJA 4CEYA 3PG2A 4TUKH 3G6AA 1MS3A 4UBDD 4KK6D 2H3XC 2JB5L 4QUOA 1IOAA 5IK8A 1V05A 5BOZG 5DQJA 2A7AA 1WFJA 4NQEE 4X8NA 2DQUH 1UENA 2PMZA 1HJCA 3BZEB 4NJAL 3BUDA 4QGPA 4AY0A 5HPMB 5LGJB 3ZHDA 1Z2KA 4EVNA 3L9YA 2WQVA 3IE4A 5CD5C 4F57L 3WNIA 1FG9C 4L48A 3QO5A 5KYWA 1SVCP 3DETC 1FL6B 3I6GA 4XNYH 1LECA 1AR92 4XHJD 4X4XA 5BW7A 5FAXA 1K73W 5FKCA 4QMEA 3EUUA 2R072 2VDNB 4IRJD 3VXMD 3FBMA 4IGBD 4XVUC 5EUOB 1HQ4A 4NJAH 5J12C 3EHKA 1SFNA 2VZ3A 1ZZ9A 4HX1A 3TFKD 4R8WL 1H5BC 4L8DB 3RZWA 2VULA 4IV3C 1CYXA 3S98A 4ONGH 4X6FA 2V17L 4W9ZA 2FKXA 3UEZA 5E24E 5EO0B 3IXAB 5CAZA 1C12B 2HA1A 3L9RA 1BG1A 1KCRL 1IBYA 2AKRA 4Z18A 4WI0B 4PHXA 4U3JB 4M8QB 3GK8H 3GHMA 4BBWA 1OAZH 1SG3A 4DAGL 2NW3A 4DW2L 2HUHA 4LF5O 1U8IA 3UTTA 3JWDC 3BRDA 4Y2LA 5GLVA 4B1MA 1JE6A 4L0ZA 1R4XA 1VF5C 1STMA 3QJOA 5HGBB 3ZQWA 2IBBA 5C3PA 1T2QL 2RV9A 3MGAA 3K6OA 4FMVA 1MELA 3U0TA 5T52A 3RPIA 5J6HB 4P9MH 1ZJAA 3GSNA 1U8MA 1DVQA 3OXRB 2ZIMA 1J9RA 5A7EA 3K46A 4FKKA 1MJUH 3WI9A 4WKXA 5FXZA 2JK5C 4FXGC 1Q3EA 5HYSB 3RUGB 4WWNA 4MJIA 3CPWU 5AVRB 3C8KA 3IKCB 1UY4A 2NY2C 2GC2A 2BWDA 2FEDD 4NHCH 1TF4A 3ZW3A 2DQ3A 3RZCD 2HP8A 25C8H 4W9DC 3RJ2X 2C5DA 3TBSB 4OIFA 5JHLL 2HKXA 1S78D 2JS5A 4W4ZA 4UUJC 1BQHG 3GMQB 3QEHA 3FT4B 3H8UA 3T1YB 4M1DH 1MPAH 5F9AC 4BZ1A 2XWTB 5IEHA 2CWRA 1IQAA 4DB5A 4XZUA 2H1XA 4LU5H 4KXDA 3UBXB 1KTDA 3HAEG 5FECA 2WPDG 4DUXA 4MB5A 2VVEA 1PDKB 2VLRD 2HKHL 3CIAA 3WJMA 2ZNJA 5H6QA 4QD2A 5T5FH 3UCRA 4JG5A 3CMOL 1YITV 4RFOL 3NFPA 1Z2GA 3RUGE 1NVPB 3LX9A 4YDVA 2P5PA 4QRPB 5IK3A 2ZX9A 4E41E 5JW4Q 1JF5A 5FX3A 3E6BA 3TVMB 1EV13 5DU7A 4DV0B 4U2ZA 4AKQA 4EI5D 3WW2A 3GB7C 4ZOBA 4XCEB 5DUUA 2VB5A 3D69B 3PHQB 5J11C 1NGZB 3LHPH 4S1SL 3C6SB 1I3VA 2JTYA 5GGRB 1WLWA 2WZPP 1GFF2 2CDOA 4CKQA 1XHZA 2MQ3A 1BMFG 2JKSA 3CMOH 3CZKA 4Z76A 2E63A 3RWKX 3BA9A 3WS6A 3SCMA 1SY6H 5LMNO 4YW1A 2VJ0A 3CZNA 5F1NA 4NPLA 1F3DH 5KSUB 2A9BA 3U0PB 1KLGA 4OIBA 3BGMA 1RUF1 3LIHA 5L9BA 3NIGF 1ZT4B 4HMCA 2EYRB 1QHTA 3BKML 4YVUA 3IBMA 2VXTL 2GDSA 3RDJA 3QDMA 1A5FL 3H7YA 3LHPL 4MRCA 4UNTA 1JP5A 4UV7L 4LRIA 1LK2A 1RGSA 2LW3A 1MUJA 5IB2A 2Y7QB 2APVA 4A7TA 4P2QD 2EIKB 2PYJA 3ARFD 4Y1VA 2OMXB 3O4LE 4BPZA 3CFIC 2E9BA 3N40F 5IVXB 4N90A 4JI5O 3QQ9D 4KTDL 4X4XB 3O3UN 4X7EC 3UTSD 1VBB2 1XMOB 1ACYH 1NBZA 2PY5A 3PDOB 4G2KA 5DD3H 5J9PB 5FCCA 2BRTA 4JV5O 5I8OH 5B38A 3DJTA 3OR7A 2E7LC 4OGAD 4HCFA 1SJEA 4QKFA 4FA8A 4OLVH 1P49A 3DTUB 4NUGL 1JXDA 5ECJE 4DV3O 4UBDC 4WVRA 1AYM3 2J1YA 2YEZB 4JHZA 4GB32 2GJ6D 4UANA 5JUEH 3KCCA 5TH2B 2O0OA 4LLYB 4LSSL 3HG1B 3EDKA 4NUMA 4L3EB 2ZKYA 2C7FA 4FQHB 4Y1AB 1HZKA 1RZGA 1EAQA 1CD3G 2WLKA 1TUPA 2BNRA 2YA1A 3L70H 3ATBA 3MX0A 3F7QA 4O4YH 4XBPB 5HYIA 2BFVL 4LPXA 4B53A 3ZBMA 2D3OW 1Z6JT 2XQRA 3VL9A 3ARRA 3FF8A 2X42A 3ILQC 4B7IA 4JHWL 4YE0A 4Z78B 2PAMA 3N9QA 1TNRA 1W0KG 2Z7YA 4HCRL 1YEGH 2UWCA 2IJHA 1FVDB 4LARL 4GWMA 2CKBH 4DV0O 4NM8L 2DOSA 2NN4A 2GJZB 3SGEH 2QZ5A 1N2RB 3KGTA 2F0CA 3TT1L 5EBGA 5JOPE 3IFOA 5SWSD 3RPBA 3ULVH 1T04B 5TTRA 2B0SL 4OZ4B 4LPUA 4AHCA 2DIAA 1W8EA 3H9SA 3O3AB 4RBPH 1RZFH 3ZTNL 2HH9A 4Y19A 5KC5A 1DQ4A 3KCWA 3ALQA 5FK8A 4IV3B 1T83C 4YSQA 1JHJA 1NR7A 3E6HA 1VFOA 4LARH 3S7IA 1SVBA 2Y36H 3L4VA 3K6SB 4TL4A 1JYXA 2Q5ZA 4NKGB 5D72L 3VXQA 3WE1A 2OI9C 3T1YO 5DHVA 5DMKA 1FHGA 5AB2A 5HGDB 1W6NB 2EINB 5CAYB 2A0LA 2QPSA 2YMZA 1TVDA 1VP7A 3VWKA 1DSYA 1KTLA 5BNNC 3INUH 4H5SA 4O2FA 4X6DE 3ZN4A 4EWEA 3DGCR 3B9DA 3EFDL 3U9UA 2I27N 3LDBA 2RJKA 1ROWA 3R19A 4JR9H 1VP6A 1RUMH 4IIJB 3GT6A 2H26A 5J1AA 1WHPA 1E1QG 2OMTB 3D1MC 3QFDB 3RY6C 5MEQB 4DYLA 2N01B 2EZOA 1CD1B 4GIOA 4R3SB 1EZSA 1I1FA 2P5WE 2XNAB 5D72H 1ZLVH 3T5WA 1QMJA 3B01A 2CDPA 2G19A 4FT8A 4NO4A 2X9XA 4XVTL 1FORL 4Y33A 2F15A 4L2NA 2PWEA 1TVKB 2CBQA 3D07A 4P5MB 5FO2A 3R8BB 4OCRH 5DS8A 1PD3A 2E7HA 3V79C 1IPSA 5EORL 3MXVL 2VMIA 3ZXJA 5EN3A 5IBLC 3E1ZA 4H0IA 4UILL 4BOWA 3DKWA 5F2FA 1GZCA 3JV4B 1PF3A 5CA1A 1BQLL 4X6EB 2K8QA 1IAKB 1N3PA 4X8PA 1U0QA 1EBOA 4LH6A 3BH9B 3F01A 2G3MA 4ZIBA 1JGIA 2A99A 2CJUL 2Q5BA 2R0LH 3FU8A 1YEFH 5FHAL 3T0EC 3CC7V 4ZJ9A 3HEIA 4M3CA 3QO8A 1H6EA 3ZTJH 1BZ8A 1AYM2 2CGNA 1VZGA 2PO6A 4GB33 4W65A 3L7EB 2MRYA 5TE7L 1DLFH 3RBGA 2YUAA 3RWDA 3VH8B 4CVWA 5CNAA 5EBWA 1ULPA 1JZ8A 3HG1D 3DOHA 5D5PA 3ZDZE 1DEEB 1PQZB 3O4LB 3MJ7A 1IGMH 1SXAA 2D4DA 3I6GB 1RJ8A 1POV3 4JQXC 4YSOA 3HAEA 5IB1B 4M62H 3GB7B 3GJEA 4FZ0A 1FGNH 2L7QA 5FWRA 3BALA 2DLIA 3GBWA 1MJ7H 1ASOA 3BTXA 4GYCB 4P5TC 3KVBA 1NCNA 1JXKA 1G7QA 4WFBV 1J5DA 4LRNL 3GMNA 5D5MA 2NZ1A 2X2YA 4XBGB 1JPTH 3ARBD 3UYPB 3PJSA 4JI6B 3BQVA 5TFSL 5SWSB 2P4KA 4L0PB 2BSCA 1W0VB 4HHAB 4N85A 4PRAB 5JLZA 4UCVA 2XWXA 1I3RA 3HHRB 3VACA 4DP7X 4ODVH 2CIIB 4B9JA 3DX2A 1TUBB 1PIV2 1DVFB 3STLA 5B1AB 2VO8A 3HR5A 3HUJE 4A7KA 3DVIA 3LIZH 3UL2A 2WV3A 2X4RA 5L2KA 5A32B 4WSGA 2EIKC 1K4CA 3QUXA 4CP2A 3CVDA 4IJTA 4NO5A 4Y20A 3VKOA 1ZBE1 3C6LC 2QDWA 2UUBB 1AQDA 2HYXA 4E36A 2OQ7A 3QD6A 3ARPA 1CVNA 5JCOA 3G5WA 4OCWH 3HT2A 4DRVA 1BOYA 3EJJX 1HZHL 2BXYA 1FNFA 1E2VA 1GZPA 4NS0A 1UXWB 4OZFB 4LKFA 3LGRA 4DP6X 5LBEA 1X7QB 1KB5L 3BD3A 3LIZL 3AAZA 5KSBB 2JQZA 1N34O 3ABGA 4V2CB 3MGOB 4OLUL 3C87A 3QZBA 4M4RA 4WRLA 2OT7A 1LLAA 1WCBA 2BGPA 3BI9X 1CFQA 4ZMWA 4HV8A 2IQAB 1E3XA 1NSNH 1XR9A 3QZMA 5B38G 4B9KC 1T03L 1TPXC 3KYAA 4N5UA 4OU3A 4Z7AA 3POHA 1CZ8L 1KJVB 1SLCA 1UXSA 2GW5A 2H6PB 3VRLF 3T0DA 2DCTA 1BT8A 3F83A 3IDUA 1MI5D 4H14A 4TNFA 3GSNB 5DMIL 5AVZB 4E8CA 4FTVE 3MDSA 4OLUH 4CZSA 1WLTA 3ZFEC 1R083 1E9PB 2AZUA 4BFFA 4NR1A 1K3IA 1GZTA 2WO3B 2WW8A 4AKPA 2HHHB 1XD1A 2DWEA 3G5YA 4PJ5D 2JKJA 3R7RA 3O45A 3OXSB 1S3RA 1DYOA 2D44A 5IHUL 1KEGH 2PF6A 5ISZE 2YBKA 3DC0A 1F6FB 1J0KA 2VDKH 3H2QA 4E9LA 2FMDA 1H8HG 4Z5RA 2E3VA 4YK4C 4BWOA 3RYIA 4R50A 1I1YB 1SFYA 4DO4A 4WM7A 4OD1H 2CDFB 1QBZA 3FO2B 4CC1A 1GTNA 2G3ZA 3OPZH 3TO2A 3D0LB 3BRCA 3FRPB 4JDZB 5C08E 1UXSB 4HCIA 4FQ2H 5AB9A 1SQ2N 4HBNA 2AC1A 1IEBA 3JU9A 4XFIA 1KDIA 1UXLA 1T5EA 1PG7L 2X0WA 1Y07A 4Y16C 4Y1SA 2DYPD 5KOVC 2PHTA 4QHZA 1T66C 3FRPG 5D2LA 5K9OB 1KS4A