1YHQV

Crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
total genus 21
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1yhqV00
3CC4V 1K73W 1M90W 1K8AW 1M1KW 3CCLV 1YJ9V 2D3OW 1K9MW 1VQMV 1VQPV 2QEXV 1YITV 3CMAV 1N8RW 1KQSU 1R73A 3I55V 3CCVV 3CMEV 3CCJV 3CCMV 1JJ2U 1QVGU 3G71V 3I56V 3CXCU 3CCUV 4WFAV 3OW2U 1VQLV 1VQOV 3CCRV 1YHQV 1YIJV 5DM6V 1YJNV 1Q81W 1KD1W 1VQ4V 1VQKV 1VQ5V 3CCQV 4WCEV 1VQ9V 3CD6V 4WFBV 2OTJV 3G4SV 3CC2V 2QA4V 3CCSV 3CPWU 3CC7V 1W2BU 1YI2V 1Q7YW 2OTLV 1VQNV 4WF9V 1VQ8V 3G6EV 1NJIW 1VQ6V 3CCEV 1KC8W 1QVFU 1YJWV 1VQ7V 1Q82W 1S72V 1Q86W
chains in the Genus database with same CATH superfamily
1K8AW 2QR4A 3JD2A 1YDXA 1URFA 1OJHA 3VQWA 3H1LH 2NR5A 4UVBA 1VF5B 3T1YO 2YDEA 4FK5C 2EBOA 4B3RO 2GBOA 1LNQA 2Q4PA 2EX3A 4X66O 3LNNA 4PDRA 2DWEC 3TK1A 1KYOF 2QM7A 2R72A 3L75H 2ZXWB 3FYIB 4BWAA 3P30A 1H8HG 2IBZH 2EIKB 5GONA 1MABG 2WPDG 4AQYB 3O9OA 4BR6A 1FD9A 4AI8A 1YJNV 1GTOA 4JYBA 1VQKV 3HKDA 3RYCB 2EJRA 4F6RA 1SA0A 4DR3O 2VWKA 5EZYB 4X1IA 2UXXA 1NI8A 3JSNA 1K73W 3T1HB 3STLC 1AP6A 3HR0A 3SPJA 1K7DA 4PI2A 2EZOA 2IJKA 4UCUA 4DV4O 1FYJA 1X4TA 4YXWG 1LUVA 4FVMA 5J2TA 1EN6A 1DF5A 1BGYH 1QR8A 3CC7V 2E5LO 3K9SA 4BAYA 4UV8A 4MS2A 2Q7HA 4TV9A 5H5NA 2IJHA 4FLYA 1ROPA 3VOUA 3JASB 4KHPB 4LWSA 2W6JG 3BY6A 1FPOA 4LF8B 3B77A 4X89A 1BHBA 3A0RA 5C93A 1YHQV 4CH3A 4JPRA 2EIJB 5KLVH 1D5AA 4DV3O 1MZEA 2PYLA 4JI5O 4U3JB 3T4ZA 2DMXA 2CE4A 2NN4A 3D36C 3UO2A 2CTRA 3IC9A 1IX9A 1WB8A 4FFBB 2QEXV 1JA8A 4DV7O 1E79G 3JAMN 4J41A 3JAWA 4K0KB 1Y74A 5B1BB 1GN2A 1ENVA 4J7KA 5LP6C 1XNQO 2OTJV 1M5IA 4X1KA 4MTGA 2WLMA 4OPHA 3ZIAG 1VQ8V 2WLHA 4RO2A 3RVYA 1S72V 3BHPA 1IURA 2XOKG 4DV5O 4DRXB 1VEWA 2HHHO 1AVMA 3JATB 4DR6O 1AP5A 2JVDA 3N2KA 3CCVV 1HNZB 5B1OA 1EM1A 1N32B 3I56V 1JR9A 3CCQV 2CTWA 4B3MO 3SYPA 2ZDIA 3AG3C 3P3NA 2FL4A 4ZOLB 4HBNA 3G67A 3OTOB 1BSMA 2D3OW 3T1CA 4PA6A 3OGIB 1P4RA 4LFBO 4JI8O 3CCJV 4DW1A 1O9HA 5IYZB 4IYIA 2AHYA 4DV0B 3CRAA 3ABLC 5DEDA 5CB4A 2Y0IA 1I5YA 5JJEB 5FNVB 2HJFC 1KU9A 5IDJA 1QLEC 3STZC 2UU9B 2ILMA 3ZCCA 2UXBO 1KC8W 4KUMA 2JJ1G 2HEPA 2JEXA 4TV8A 4NXNO 2AZ0A 3T4DA 4I0XA 4I55B 3CMEV 1ZTEA 3CXCU 5IYDO 2XNDG 3OR6C 4PV1B 4GX1A 2A06H 3H1IH 1COWG 2R70A 2X6AA 3JALB 3L73H 3L70H 5KHJA 4X9QA 1HNWO 2ZE6A 5L3EA 4W4LA 1HNXB 1HR0O 4JI4O 5FPRA 1J5EB 3OUSA 1NZ6A 4MSWC 1KECA 1YTFB 2N04A 3KCXA 3ZRXA 5JQGA 4DV1B 1ZL8A 4J10A 4F4LA 4Z1MG 1UFIA 3I5DA 4WFEA 3WU2Z 3HKBA 3ZMUA 4WBNA 2LP7A 1I5XA 5ITZB 3JARB 2XUMA 1MMMA 2QKSA 1BE3H 5CBFA 4K8ZA 5IJ0B 2LJ2A 3O65A 2FB5A 4AILC 1CPYA 1Q6HA 2NLJC 2VWJA 3FAVA 1NH2B 4LF7O 2QWRB 5LGNA 2DYRC 2QM4A 2LW7A 2WLIA 1OCZC 5HFMA 1GMGA 4X62O 3UT5B 2HKOA 4JZ2A 4FMTA 1US6A 4IT5A 3OUFA 2YI8A 3JYCA 1JCHA 2W0XA 3WFVA 2VQEB 1PM9A 4FLUA 3C90A 4LR3A 3JSLA 4DUYO 3F5WC 3B2EE 2KSDA 4H0LB 3CCEV 2QWOB 4DR2O 1HDJA 3BVOA 1K97A 1QLEB 3UM7A 3CCLV 5EC1C 1GKFA 4UCSA 5GONB 3AK2A 1QVGU 1Y76B 2WSSG 1FXVA 1KB9F 3FD9A 4WCEV 2BCCH 2X0LA 4RUEA 2OIEA 1XBLA 4FIPC 1VARA 2CTQA 4F6RB 1SA0B 2H3OA 4YY3B 1I94O 2UUAB 4X1IB 3BEHA 1JVMA 3JD4A 1N34B 1FJGB 3HPLC 4KP4A 1L1FA 4JI2O 5B5EZ 1R3JC 4O4JA 5FPOA 3SPHA 5J2TB 2Q67A 4I7ZB 1JX9A 3IC7A 4Q20A 4NXMO 2KKWA 4XBFA 1Q82W 4TV9B 4FM2A 5K1XA 1S5LZ 4FFBA 4QE7A 1IBLO 5K1PA 1ZX3A 1MZFA 4MTOA 2CK3G 1PNKA 1Z5WA 2A3QA 1RSOA 1S5HC 1V55B 3TCUA 1GM7A 3CRRA 1BT8A 1F51A 2ZM6B 4LFCB 1X59A 3ZRWB 4X64B 3JATA 5LGUA 1H2SB 5LOVA 3K03A 4ZI7A 4CS2A 1OCZB 1Q43A 1XMOB 3E22B 2VS0A 1KKDA 1I08A 1Q3EA 2ADPA 1Z2GA 3L9DA 4P9OA 2QKAA 1Y74B 4O4IA 4ZOLA 2EZPA 4X1KB 1PNMA 3LDCA 1Y6XA 3AG4C 1RFYA 1SETA 2JK5C 1TAEA 4I4TB 2UXDO 1OV9A 2OCCB 3APOA 4D7TA 3DXRB 3ZMTA 1VMGA 4JASA 1THZA 3G6BA 1RM1B 5EBMC 4UB8Z 2PGGA 2RN9A 5C8YA 2MK3A 3ZEDA 2C2AA 5IWAB 2RMKB 1AILA 4MT8A 4PD4F 1KP3A 2R9AA 2QSAA 1FXHA 4WFGA 1WA8B 4CH4A 1YITV 3CS5A 5LA6A 2Q0OC 1WJZA 2YSUB 1V9PA 1RP3B 4FLVA 2OT5A 3ZMSA 3HKCA 1I7FA 3FB7C 2Q69A 1BQ0A 4NTXA 1K4CC 2DQ0A 2WAMA 4H44B 2ADQB 1JFFB 5CB4B 3QO8A 2RJZA 2UXNA 2IM9A 1WB7A 3CCMV 2JS3A 3K0DA 4KXRA 1JOYA 2QDOA 1NS1A 3A8TA 4ZIBA 1ZAUA 1PKXA 3D36A 3JALA 4A5UB 1NVPD 2F1MA 3RFRA 1M4UA 2K1EA 5CMUA 1N36B 4J9YB 2PI5A 2ZKOA 2DQ3A 5B3SB 3SYCA 3W7TA 5LP6A 1WNSA 1YEWA 3OGCC 4BW9A 2MW2B 3ZX6A 2LGWA 2E3CA 2CTPA 2QKCA 3E83A 1FKAO 2F93B 3LUTB 1JMKC 5LMNB 1W2BU 1SQXH 4DK0A 3AK3A 1O9GA 4XDLA 1P7GA 2YICA 4X20B 2EIMB 4JI0O 4LF9B 3M99B 2RDCA 3SPGA 2YEVA 3ZHUA 3T1YB 1M93A 4JI6B 2B1IA 4P2ZA 5JQGB 4B3RB 2JGDB 2LGQA 2CGNA 1ZL8B 5CA3A 4DUZO 3AG4B 3OTFA 4X66B 3HKBB 4WBNB 1KMIZ 4HAMA 1NT2B 2Y69C 4R50A 3QF7A 1XHXA 4YIOA 3A0BZ 4LNUB 2FMLA 1V54C 2ITCC 3FAVB 3R66A 2Q73A 3X2QC 4WFAV 4JAAA 3Q4HB 5J9PC 5LHGA 3H9VA 3KKYA 4J7ZA 2WLIB 1YI2V 3ASNC 2YIDA 3D8CA 4HYOA 3B4SA 4RQEA 1KD1W 2VQFO 2IJIA 4GKKO 5BR8O 4YJ2A 4E4EA 4D7SA 4U7OA 1Y76A 4OX9O 3BAAA 3G71V 3CX5F 4LBEC 2E5LB 5J2UA 2JJ2G 3ASOC 5L3FA 1R3KC 4W4KA 3SJCC 1XHZA 1JQ0A 4DR4O 1Y67A 1NU1H 3TETA 1Z5VA 1GH6A 2HVJC 2EILC 3SYQA 2OWOA 1NTMH 2ARHA 1GRJA 3DTUB 1BL8A 4EFEA 4P30A 2P06A 4I9WA 4DV3B 2ODMA 2YIBD 1AJNA 3QO5A 2FTKA 4JI5B 1K34A 2UUCB 4JV5B 3FX7A 2V4DA 3IJ4A 2EINB 4FLZA 3J81N 2EJ7A 1WP8A 4Z2WA 1PL0A 2ZE7A 3SDLA 4IYHA 1OCOC 2XASA 3ICXA 1IBKB 1DF4A 3G80A 3SYAA 2E76B 1SRYA 2CGOA 4G28B 4O4JB 4DV5B 3ZRWA 1F4MA 2QTSA 3E22A 1QCEA 5L3BA 1R6TA 3A0HZ 5FL7G 1GN3A 1AB3A 2X7RB 1Q6UA 5CBGA 3RYHB 2OTLV 1MOFA 1RSOB 3OFNG 5BY1A 1U97A 2RQ6A 3H01A 2GTSA 4I4TA 4PDLA 4QPJA 4JI8B 3DXRA 5GW7A 5LOVB 4ZI7B 2QM8A 5IJ9A 4GUNA 5LHHA 3CC2V 3K3WA 3E2EA 5IE9A 2AHZA 4O4IB 4X8AA 4G27B 1AROP 2ZE8A 3ZBHA 4JYAO 1B3QA 2CUGA 1WA8A 5L3DA 2YS8A 1SQVH 4U3FH 4BIOA 1AR1B 1N33O 5KUMA 4GX0A 1R1BA 3VQYA 5KAFZ 4TSFG 4CC6A 1BHAA 2HVKC 2XAGA 5C8YB 3LNMB 1JFFA 1M1KW 4R6ZA 3F7VC 1Q8IA 4HNAA 4B3TO 2YXYA 3JAKB 1HNWB 4JTCB 4DV2O 1N32O 4UB6Z 1ZUQA 5LA6B 4YHHO 4XDKA 1HR0B 4MVQA 3ABMC 4JI1B 4JI4B 4NR1A 1S0VA 2Y4TA 1IZ3A 4J42A 4OXSA 2ZNJA 3QNEA 3HKCB 1OCOB 3K5MA 1HW7A 4QE9A 4O2AA 3OTOO 3ZHVA 3BPZA 1QBZA 4UCTA 2N05A 4O2BA 3CD6V 4CH6A 3H1JH 2BE3A 4RWUA 1G6UA 2ZD9A 3W7XA 3AG1C 1AI5A 4K8XA 4PI0A 4PA9A 2Q7GA 3B40A 3GWOA 3AK1A 4X20A 5A2QN 2OYQA 2D2CB 3CC4V 1OZ0A 2H94A 1XMQO 1JJOA 5LP6B 1N0JA 2JGDA 1M56C 5H6QA 4KFMA 3ZMZA 2UU9O 1MG1A 2BTOA 1NVPB 5CA1A 3CWBH 3MD0A 1PPJH 3GB7C 4LNUA 3W7WA 5KA5A 2Y48A 1DK1A 1ORQC 1XL4A 3I55V 2WLLB 3AG3B 5KAIZ 4JAVA 2YEVB 4LCUC 4LF4O 3SYOA 4I9QA 3Q4HA 3OW2U 2BTQA 1YVWA 4DR1B 3JD0A 5LBQA 4DR2B 5LHIA 1CEZA 1EFRG 1G8MA 2EULA 1HNXO 1XI1A 2E74B 1B6QA 2UUBB 2AGAA 3PN1A 4DR7O 1XNRO 2F66C 3FKSG 1GO3F 1VQOV 2DE0X 3ABLB 5DM6V 1HP8A 4PA7A 4EB6A 1WLEA 1SF9A 1N4CA 3BA9A 1OCRC 3U10A 2GUZA 4DYLA 1DTOA 4BIUA 4JI2B 2PF4E 3OR7C 4EFBA 3PJSK 2Q6AA 3A2FA 1SQPH 4YJ2B 5BZBA 1R6NA 4CS3A 1H2NA 4NXMB 3RYIB 2PYJA 2YIAA 5J2UB 3SR2C 4LF6O 3ABUA 3ETQA 1IBLB 4WFHA 2YI9A 5AG2A 3MDSA 1AI4A 3AG1B 2CDYA 3RGBA 4IHJA 4LF5O 5TISZ 2YXLA 1WP7A 2VQEO 1AR5A 1VQ9V 3JD1A 1VF6C 5EYPA 3OM3B 1NQTA 4GX5A 1L8DA 2DN9A 4D6TH 3M8AA 1G1XB 3F7YC 1M56B 3CSXA 1E1QG 4PHZA 1P49A 2WWWA 3C3SA 1PV0A 2F4VO 3WG7C 3KZIZ 4DR5B 4DV6O 2JIZG 5KHIA 3RYHA 4RUFA 3CJHB 3RN4A 5KHHA 1NJIW 2UXCB 2DOSA 2UXDB 4JI7B 3ZMVA 1NBMG 1BQZA 2DYRB 1GM8A 5JCOC 3CRMA 1B06A 1D5NA 3FB8C 1TUEB 2JS5A 4PA3A 1N34O 1M57C 1MSDA 3WB2A 1RPRA 2CH7B 4J80A 2R9RB 4LH6A 1H2KA 1W0KG 3E8FA 3K0GA 4K3AA 2QE7G 1YJWV 3CP1A 2BOBC 4QJFB 1R3LC 3U0ZA 2Q7EA 2WA3A 3EHBB 4JGSA 1TUBA 5L3CA 1S77D 2PY5A 3LDDA 1PL4A 2JEUA 3JD3A 1Q7YW 1OCRB 1YCIA 1ZWIC 5IJ9B 1ZLZA 4LP8A 4GKJO 2RCVA 2IH1C 1L0LH 2IW5A 3K79A 1VQ7V 5JVDA 2ZNIA 4X65B 1KBHA 2WLKA 4PJ0Z 4LFCO 4MTFA 1NKDA 1H2GA 3NR7A 3JAKA 1UPGA 2ZCEA 2O57A 1XMOO 5KHKA 2LQTA 2ZE5A 1Q81W 2F23A 5H2FZ 2KG7B 2QA4V 1A32A 4OPAA 1VQ6V 3GVMA 3J7AU 2W6IG 3K58A 1VQMV 3CEIA 2PTMA 1IBMO 1FFTB 2OCHA 2ZXWC 3RBZA 4HNAB 4FJCC 1MNGA 1K5SA 3K04A 2XHBA 3K9AA 5KX5A 1YTFD 4JI0B 4B3SB 4JI3O 2H8PC 1NTZH 3ZN1A 5IWAO 2DJVA 1RPOA 3LSSA 4O2AB 4DUZB 1QHTA 2P5OA 1GK9A 5B1NA 1VF7A 3K5LA 4LFAO 2QWPB 4O2BB 3CHXA 3CPWU 5LMUO 5EBWC 1M57B 1NH2D 4X1YB 3ZRSA 2WLLA 4MVRA 4DW0A 2Z3YA 4R8CA 2V7QG 3P32A 1P84F 3E89A 3K08A 5DECA 4FZ0A 1R3IC 3NXSA 2M6YA 1S3JA 1H8EG 1VP7A 1KP2A 5JH7B 4GZRB 2VQFB 3ML0A 2AZ2A 4MVOA 4GKKB 3B8MA 3RWRD 4O4LA 4EKWA 1EZVH 5CA1B 3LSUA 3CMAV 4G2KA 3IAYA 1F23A 4GX2A 1OCCC 5IY5C 4DR3B 1D2DA 1XL6A 2E75B 4PDVA 4I50A 2BTQB 4MVUA 2KB1A 5B1BC 1PNLA 4J7JA 1JPXA 1SQGA 4H37A 1E1RG 1HWYA 1GAXA 3OMIB 4TUYA 4DV4B 5CBHA 1BS3A 4FZ1A 1DLBA 3VBBA 4LF9O 2NNUA 3L71H 1K4DC 5IYBO 5FLXN 1XOUA 3IGAC 4FLXA 1YSCA 4NKGB 5BMVA 4JI6O 3R65A 2ZR3A 3CXHF 2A7WA 1VIBA 1CP9A 3RYIA 2ZINA 4WF9V 4KL1A 1IXMA 4EB6B 4UXNA 3RYFA 3W7SA 1SKVA 4UCRA 2Q68A 4NB5A 2GUZB 1DGSA 2Z5UA 1OHHG 3RW0A 1FS0G 4TQDA 3CB2A 2HJDA 2ZIOA 1SERA 3HKEA 2RNBA 1LUWA 2P4KA 3QG5A 4O4HA 3QO7A 2QWQB 3E8BA 3UCSC 3IFXA 4DV7B 1IXBA 2YXHA 4NVPA 4YJ3A 1SQFA 3APQA 2P4VA 1WAZA 1XNQB 1WPBA 4PELA 1KKCA 4IHJB 1SQBH 1QU7A 3TGUH 1QR9A 3CJHA 4AQYO 4IIJB 3SGIA 4GYCB 2LO1A 2YIBA 5EYPB 4MVMA 2JRIA 2Q0AA 4ZHQA 2HHHB 4DR6B 1TGOA 4CBCA 3CE2A 3ABKC 3T1HO 3DGEA 4JYYA 2PZSA 4TOIA 2CH7A 3BFRA 2Y69B 4B3MB 3CRCA 4JF3A 1QQCA 3DC5A 4FLTA 5B1AC 3C3TA 4H33A 2A9HA 2YC0A 4JYAB 5KA6A 4FFKA 3ZHRA 3GWKC 2QTOA 1V54B 5E1AC 1QNMA 2UUCO 3AG7A 3BA8A 1FFXB 2P6JA 4R7CA 4JV5O 1OCCB 3OMNB 3X2QB 5IY5B 1N33B 2P90A 4KHPO 4LFBB 1FXKC 3ZN0A 2WLNA 5LYJB 4LF8O 1EBOA 3ASNB 4MW8A 2M7WA 3ETGA 1IBKO 3RT3C 1WPXA 4B08A 5KMGA 4NTWA 3OMAB 4B3TB 3H1KH 4UCVA 1TUBB 3ASOB 4DV2B 4YHHB 5JJJB 4UCOA 5JWPA 4FM1A 3ETDA 2KG7A 2UXBB 2ZIMA 4K0KO 3KG2A 2QGNA 1W0JG 1B04A 3D3IA 2EILB 5E79Z 2HR3A 4NXNB 2ATKC 4UUJC 5B66Z 2ITDC 5CA0A 4AHCA 2FKXA 5JVDB 1VF6A 2XAFA 1K9MW 2HLDG 3D3QA 4U7NA 3M7MX 1AI6A 4CH5A 3E8HA 1SZTA 1TVKB 1HNZO 3AEIA 1I0HA 3ETEA 1XUQA 5GTHZ 1PP9H 1WN7A 2AW9A 5D5PA 1XMQB 2IU3A 3SJBC 5LXTB 2N74A 4UV9A 2F43G 2Q9LA 5EK0A 1M90W 4B7KA 3SJAC 1N0NA 2W0FC 4IL6Z 2P22C 5A9GA 4L8JA 2X6CA 3VQVA 1GM9A 3JCUZ 1XQ8A 4H13B 2PI4A 1IDSA 2B5UA 3N2GA 5JCOA 2OIGA 4TQFA 3ABKB 3ZHQA 3N27A 4QPKA 2JGUA 5KX5B 4DV0O 4X1YA 4MVSA 4IGGA 1YJ9V 5B1AB 4LF7B 4LF4B 3SJQC 1KQSU 1TA8A 5EIBD 5CN0A 3UKMA 1XILA 1BZKA 4X62B 4HZ3A 5KUKA 2XAJA 5JH7A 3HB3B 4UVCA 3CCSV 4MTXA 2HP8A 1VQNV 3H1HH 1EN5A 1FXKB 5LGTA 4GCZA 4I5SA 3K5OA 4JI1O 1SESA 3K57A 3U11A 5LL6Y 2IJJA 4WFFA 2BSKA 5D5QA 4DR7B 1XNRB 1CXZB 2YUAA 4FLWA 2LFRA 1UJWB 4CS4A 3WB1A 4QGPA 1K33A 3QVNA 1SZXA 2XTAA 3LDEA 4DUYB 1YIJV 1IVSA 1MA1A 1W59A 2X6BA 4UVAA 2XT9A 2FYUH 3DSQA 2R9IA 1V55C 1SC5B 3FB6C 4DXWA 5KHGA 4O4LB 1GN6A 1J5EO 2WA4A 2DYSC 2HG5C 2PUSA 2QWNB 5GTIZ 3K5NA 2IH3C 4DV1O 3E86A 4PDMA 1KUQA 2LFSA 4LF6B 1L0NH 2F95B 1I94B 4I50B 2L35A 3L72H 1P7BA 4MW3A 5EBLC 2Y4UA 2VRZA 3JCZA 4LF5B 1VQPV 4TUYB 3OEHG 2ETNA 3ABMB 1YXBA 3FB5C 4ABMA 1VQLV 4L87A 2OCCC 3RYCA 2P7TC 5BMVB 1Q5OA 5EZYA 4JAUA 1RM1C 4BIZA 4DR1O 4P9PA 4RAIA 3B09A 4QNHB 3RYFB 3CRQA 4C7UA 2F4VB 1MSWD 1F7YA 2ZDIC 4DV6B 1S76D 2GHYA 5EC2C 2UUBO 4TT3G 2BOCC 1SS3A 2GV9A 3E8GA 1LR1A 4IIJA 2P67A 1VQ4V 4JZGA 3HKDB 3ZJZA 3JASA 3BCCH 3HKEB 4GLXA 4UFZA 5HFLA 2A0LA 4E2LA 3MHHC 3MAQA 2ZR2A 2Y0PA 5H9CA 3WB0A 4O4HB 1SQQH 1K5QA 4LC1A 1U96A 3K06A 4YJ3B 4EEQA 2DWDC 5DN6G 2G38A 1Y66A 3ZHTA 2LW1A 1BMFG 1ZSPA 1QVFU 4U3JA 1YZBA 2GTAA 1FFXA 1Q86W 4ZHQB 3EXAA 4J9ZB 3L74H 5BXZA 4LWSB 4YY3O 1J95A 3SPCA 2UUAO 3QTCA 5LYJA 4OGQB 5B3SC 4FM0A 4DO2A 1F4NA 1FJGO 3OD4A 4GKJB 2ZT9B 2JDIG 4DK1A 3DC6A 4FPPA 2Z0AA 3BABA 1AJPA 3MHSC 2XAQA 3CYOA 4XDJA 4ASUG 3S3XA 4DRXA 2QJ1A 2B9ZA 2DYSB 1AI7A 3RVZA 1GN4A 3BRCA 1QLNA 1XDCA 2V1DA 1JJ2U 2EIMC 3B8NA 1H2MA 3JAWB 4CC5A 2A79B 4NTYA 4DR5O 3ZHSA 4K35A 4YIPA 1T5EA 4WFBV 1H38A 2WLJA 5JJNB 3OEEG 3FFQA 4Z1VA 2B1GA 5EIBC 4TWKA 3ZS8C 2UXCO 1IBMB 4N21A 4JI7O 2ZM6O 1FAFA 5KMGB 2DW4A 4X64O 1EN4A 2Q8VA 3AG2C 3OE7G 1R73A 3ZRVA 3N2KB 1TVKA 5IYZA 1S5JA 3VQXA 3G4SV 4JI3B 1NR7A 4ZBMA 3G6EV 5LXTA 4JTAB 5FNVA 4NYKA 5CA0B 3UQ8A 2IU0A 5H6RA 4LFAB 3KCYA 3J80N 3CCRV 3THOA 4RQFA 2EIKC 5LMUB 1Q6IA 2GDSA 4MVZA 3LSQA 3K59A 3WG7B 1H2LA 2HFEC 4ZKIA 4X65O 1NTKH 4I55A 1PD3A 1YF2A 1N8RW 3T2MA 1XEQA 3ABTA 3CCUV 3W7UA 4Q6GA 1Q90D 2AXTZ 2K9PA 2GSMB 2XAHA 3TXSA 1FXKA 1K3EA 3N2GB 1XREA 4GT1A 1M9NA 5IYCO 1NR1A 4JTDB 1R6KA 4TV8B 5IT9N 1EZJA 2Q5ZA 1G4YB 4I0XB 3SPIA 2CAZC 4ICGA 5ITZA 3TXQA 2EINC 4BW5A 3JARA 3F5TA 4CZZA 3S3WA 4J11A 3EVKA 2L6LA 1K92A 5L3GA 5F2VO 5IJ0A 4LH7A 3E35A 1BCCH 3FYEB 4B3SO 1N36O 1Y4MA 2EIJC 5BR8B 4JYCA 4N23A 2BSKB 1AR4A 4OX9B 3OT7A 4PA4A 3UO3A 4F6EA 4B7EA 3TJTA 2KQXA 3UT5A 2ZQMA 3OAAG 1VQ5V 3EFFK 3P3PA 1AJQA 3AG2B 4DR4B 4X88A 4QIWF 5LMNO
chains in the Genus database with same CATH topology
1WPXA 3AG4C 1K8AW 3OMAB 1SETA 2JK5C 1B6QA 2OCCB 3ZMTA 3JD2A 4JASA 3ASOB 1THZA 3FKSG 4UVBA 1RM1B 5EBMC 1GO3F 1VQOV 3ABLB 3ETDA 5DM6V 4FK5C 2EBOA 4PA7A 1LNQA 2MK3A 3KG2A 3D3IA 1W0JG 2EILB 1WLEA 2HR3A 2C2AA 4PDRA 2DWEC 2ATKC 1OCRC 4UUJC 4MT8A 3TK1A 2ITDC 1KP3A 2QM7A 2ZXWB 3FYIB 1DTOA 3P30A 2XAFA 4BIUA 1K9MW 1FXHA 1H8HG 4WFGA 2EIKB 2HLDG 4U7NA 3OR7C 1YITV 1AI6A 1MABG 2WPDG 3PJSK 2Q6AA 3E8HA 1SZTA 1YJNV 5BZBA 1GTOA 4JYBA 1R6NA 1VQKV 3AEIA 2YSUB 3ETEA 2EJRA 2OT5A 3ZMSA 3ABUA 2IU3A 2UXXA 3FB7C 2Q69A 1K73W 4WFHA 4UV9A 2F43G 5EK0A 1M90W 1K4CC 2DQ0A 3STLC 2WAMA 1AI4A 3SPJA 1K7DA 2W0FC 2EZOA 3QO8A 2X6CA 2IJKA 2UXNA 3AG1B 1GM9A 3CCMV 4YXWG 2PI4A 3K0DA 1JOYA 1VQ9V 1DF5A 1PKXA 2B5UA 3D36A 3JD1A 1QR8A 1NVPD 3OM3B 3CC7V 1NQTA 4GX5A 2K1EA 4BAYA 5CMUA 4UV8A 3ABKB 4MS2A 4QPKA 2IJHA 4J9YB 1ROPA 2PI5A 3VOUA 2DQ3A 3F7YC 4MVSA 1M56B 3SYCA 5B3SB 3W7TA 2W6JG 1E1QG 3BY6A 1YJ9V 5B1AB 3B77A 2WWWA 4X89A 3OGCC 3SJQC 1KQSU 5CN0A 3WG7C 1BHBA 3A0RA 3UKMA 2JIZG 5C93A 1YHQV 4HZ3A 5KUKA 2XAJA 4JPRA 3E83A 3LUTB 3HB3B 2EIJB 4UVCA 4RUFA 3CCSV 1W2BU 4MTXA 1VQNV 1FXKB 5LGTA 1NJIW 4GCZA 4I5SA 4XDLA 1SESA 3ZMVA 1NBMG 2EIMB 2IJJA 4WFFA 3T4ZA 2DYRB 3M99B 1GM8A 2QEXV 3SPGA 2YEVA 2LFRA 1UJWB 1E79G 3FB8C 2B1IA 4P2ZA 1TUEB 4PA3A 5B1BB 1M57C 1K33A 3LDEA 1ENVA 5CA3A 1YIJV 1RPRA 2OTJV 3AG4B 2R9RB 4MTGA 3E8FA 1W0KG 2WLMA 2X6BA 4UVAA 3ZIAG 1VQ8V 3K0GA 4HAMA 2WLHA 2QE7G 2Y69C 4RO2A 4R50A 1YJWV 3RVYA 1S72V 2R9IA 3CP1A 2XOKG 2BOBC 4QJFB 1V55C 3FB6C 4DXWA 1R3LC 3EHBB 4JGSA 5L3CA 1S77D 3LDDA 1V54C 2ITCC 3CCVV 2DYSC 2HG5C 5B1OA 2JEUA 3JD3A 3I56V 2IH3C 3E86A 3X2QC 1OCRB 4WFAV 1ZWIC 1Q7YW 4PDMA 5J9PC 5LHGA 3CCQV 2LFSA 3SYPA 4LP8A 2WLIB 2ZDIA 3AG3C 1YI2V 3ASNC 2IH1C 4HYOA 2IW5A 4RQEA 3K79A 1VQ7V 1P7BA 1KD1W 4MW3A 5EBLC 2WLKA 2D3OW 2IJIA 4MTFA 3JCZA 3T1CA 4PA6A 1NKDA 1VQPV 1H2GA 1P4RA 4U7OA 3OEHG 3CCJV 3ABMB 3G71V 3FB5C 1VQLV 4L87A 1Q81W 4LBEC 2OCCC 2P7TC 2QA4V 2JJ2G 3ASOC 4JAUA 5L3FA 1R3KC 2AHYA 1VQ6V 1RM1C 1JQ0A 4BIZA 3ABLC 4P9PA 2W6IG 4RAIA 4QNHB 3TETA 2HVJC 3SYQA 1I5YA 2EILC 1VQMV 1MSWD 2ZDIC 2HJFC 1S76D 2GHYA 5EC2C 1FFTB 4TT3G 5IDJA 2BOCC 3DTUB 1BL8A 2ZXWC 3RBZA 4P30A 4FJCC 1QLEC 3E8GA 3STZC 4I9WA 1VQ4V 2P67A 1K5SA 3K04A 3K9AA 3ZJZA 3ZCCA 1AJNA 3QO5A 2FTKA 1K34A 1KC8W 1YTFD 4KUMA 2JJ1G 2H8PC 2A0LA 5HFLA 4E2LA 3MHHC 2JEXA 3ZN1A 2ZR2A 3T4DA 5H9CA 1RPOA 2EINB 3LSSA 1K5QA 4LC1A 3K06A 3CMEV 1PL0A 1GK9A 5B1NA 2DWDC 1OCOC 2XASA 5IYDO 5DN6G 2XNDG 3CXCU 3OR6C 1DF4A 4GX1A 1Y66A 1COWG 1BMFG 2X6AA 3SYAA 3CPWU 1SRYA 4G28B 5L3EA 1QVFU 3ZRWA 5EBWC 1F4MA 1Q86W 3OUSA 1M57B 4J9ZB 4MSWC 1NH2D 1KECA 1YTFB 1J95A 3SPCA 3ZRSA 1QCEA 3ZRXA 2WLLA 4MVRA 5L3BA 2Z3YA 5FL7G 4R8CA 2X7RB 2V7QG 3P32A 5B3SC 4F4LA 4DO2A 4Z1MG 1F4NA 3E89A 3K08A 4WFEA 5CBGA 1R3IC 3NXSA 2JDIG 3ZMUA 2LP7A 1S3JA 1H8EG 1I5XA 1KP2A 4FPPA 2OTLV 1MOFA 1AJPA 3MHSC 3ML0A 2XAQA 3CYOA 4XDJA 3OFNG 4ASUG 2QKSA 4MVOA 2DYSB 3B8MA 4EKWA 3H01A 5CBFA 1AI7A 3RVZA 4PDLA 4QPJA 1QLNA 1CPYA 5GW7A 2V1DA 2NLJC 3CMAV 1NH2B 4G2KA 1JJ2U 2EIMC 2QM8A 1F23A 3B8NA 5LGNA 2DYRC 2A79B 4GX2A 1OCCC 5LHHA 5IY5C 3CC2V 2WLIA 1OCZC 3K3WA 5HFMA 3E2EA 1XL6A 4WFBV 1GMGA 4PDVA 2AHZA 2HKOA 2KB1A 4MVUA 1H38A 2WLJA 5B1BC 3OEEG 4X8AA 1PNLA 2B1GA 1JPXA 4G27B 1AROP 4TWKA 4FMTA 3OUFA 4N21A 3JYCA 1E1RG 1HWYA 1JCHA 4H37A 3OMIB 5L3DA 5CBHA 2DW4A 3WFVA 1DLBA 3VBBA 3AG2C 3OE7G 1R73A 3ZRVA 1AR1B 2NNUA 1K4DC 5IYBO 3IGAC 5KUMA 4GX0A 1YSCA 3R65A 2ZR3A 4TSFG 1CP9A 3G4SV 3F5WC 1BHAA 1NR7A 4ZBMA 4WF9V 2HVKC 2XAGA 3LNMB 3G6EV 3CCEV 1IXMA 4UXNA 3W7SA 4JTAB 2Q68A 1K97A 1QLEB 4R6ZA 3UM7A 3CCLV 1M1KW 2Z5UA 3F7VC 1OHHG 5EC1C 3RW0A 2IU0A 1FS0G 1GKFA 5H6RA 1QVGU 2WSSG 1FXVA 3CCRV 1SERA 4JTCB 4RQFA 4WCEV 2EIKC 2X0LA 4RUEA 4XDKA 4FIPC 3ABMC 4MVQA 4MVZA 1S0VA 3LSQA 4OXSA 3WG7B 3QO7A 3E8BA 3QNEA 3BEHA 2HFEC 1OCOB 1JVMA 3IFXA 4QE9A 4ZKIA 3JD4A 1PD3A 1N8RW 3HPLC 4KP4A 3T2MA 1QBZA 1L1FA 3ABTA 4PELA 3CCUV 3W7UA 1QR9A 1R3JC 3CD6V 3SPHA 2GSMB 2XAHA 2Q67A 2ZD9A 1FXKA 1K3EA 3AG1C 3W7XA 1AI5A 1JX9A 3IC7A 4MVMA 4PA9A 3GWOA 4Q20A 4GT1A 4XBFA 1M9NA 5IYCO 1Q82W 1NR1A 3CC4V 1OZ0A 2H94A 4JTDB 1R6KA 4QE7A 4CBCA 3ABKC 3DGEA 1EZJA 1G4YB 3SPIA 4MTOA 2CK3G 1M56C 1PNKA 2Y69B 4JF3A 2EINC 5H6QA 5B1AC 4H33A 4BW5A 2A9HA 4KFMA 3ZMZA 4CZZA 1MG1A 1S5HC 1V55B 3TCUA 5KA6A 1NVPB 1GM7A 1F51A 1K92A 2QTOA 1V54B 5L3GA 5E1AC 3ZRWB 3E35A 3MD0A 5LGUA 3FYEB 2P6JA 3GB7C 1Y4MA 4R7CA 1OCCB 2EIJC 3OMNB 3X2QB 3K03A 5IY5B 3W7WA 1OCZB 4JYCA 4N23A 5KA5A 2Y48A 2P90A 1FXKC 1ORQC 1XL4A 3ZN0A 4PA4A 3I55V 2WLLB 2WLNA 3AG3B 1EBOA 2YEVB 3ASNB 4JAVA 4LCUC 4MW8A 3SYOA 1KKDA 4P9OA 3OW2U 2M7WA 2ZQMA 3OAAG 1VQ5V 3ETGA 3EFFK 2EZPA 1AJQA 3JD0A 5LBQA 3AG2B 5LHIA 1PNMA 3LDCA 4X88A 1EFRG 1G8MA 4QIWF 1CEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC4 V;  1K73 W;  1M90 W;  1K8A W;  1M1K W;  3CCL V;  1YJ9 V;  2D3O W;  1K9M W;  1VQM V;  1VQP V;  2QEX V;  1YIT V;  3CMA V;  1N8R W;  1KQS U;  1R73 A;  3I55 V;  3CCV V;  3CME V;  3CCJ V;  3CCM V;  1JJ2 U;  1QVG U;  3G71 V;  3I56 V;  3CXC U;  3CCU V;  4WFA V;  3OW2 U;  1VQL V;  1VQO V;  3CCR V;  1YHQ V;  1YIJ V;  5DM6 V;  1YJN V;  1Q81 W;  1KD1 W;  1VQ4 V;  1VQK V;  1VQ5 V;  3CCQ V;  4WCE V;  1VQ9 V;  3CD6 V;  4WFB V;  2OTJ V;  3G4S V;  3CC2 V;  2QA4 V;  3CCS V;  3CPW U;  3CC7 V;  1W2B U;  1YI2 V;  1Q7Y W;  2OTL V;  1VQN V;  4WF9 V;  1VQ8 V;  3G6E V;  1NJI W;  1VQ6 V;  3CCE V;  1KC8 W;  1QVF U;  1YJW V;  1VQ7 V;  1Q82 W;  1S72 V;  1Q86 W; 
#chains in the Genus database with same CATH topology
 1K8A W;  2QR4 A;  3JD2 A;  1YDX A;  1URF A;  1OJH A;  3VQW A;  3H1L H;  2NR5 A;  4UVB A;  1VF5 B;  3T1Y O;  2YDE A;  4FK5 C;  2EBO A;  4B3R O;  2GBO A;  1LNQ A;  2Q4P A;  2EX3 A;  4X66 O;  3LNN A;  4PDR A;  2DWE C;  3TK1 A;  1KYO F;  2QM7 A;  2R72 A;  3L75 H;  2ZXW B;  3FYI B;  4BWA A;  3P30 A;  1H8H G;  2IBZ H;  2EIK B;  5GON A;  1MAB G;  2WPD G;  4AQY B;  3O9O A;  4BR6 A;  1FD9 A;  4AI8 A;  1YJN V;  1GTO A;  4JYB A;  1VQK V;  3HKD A;  3RYC B;  2EJR A;  4F6R A;  1SA0 A;  4DR3 O;  2VWK A;  5EZY B;  4X1I A;  2UXX A;  1NI8 A;  3JSN A;  1K73 W;  3T1H B;  3STL C;  1AP6 A;  3HR0 A;  3SPJ A;  1K7D A;  4PI2 A;  2EZO A;  2IJK A;  4UCU A;  4DV4 O;  1FYJ A;  1X4T A;  4YXW G;  1LUV A;  4FVM A;  5J2T A;  1EN6 A;  1DF5 A;  1BGY H;  1QR8 A;  3CC7 V;  2E5L O;  3K9S A;  4BAY A;  4UV8 A;  4MS2 A;  2Q7H A;  4TV9 A;  5H5N A;  2IJH A;  4FLY A;  1ROP A;  3VOU A;  3JAS B;  4KHP B;  4LWS A;  2W6J G;  3BY6 A;  1FPO A;  4LF8 B;  3B77 A;  4X89 A;  1BHB A;  3A0R A;  5C93 A;  1YHQ V;  4CH3 A;  4JPR A;  2EIJ B;  5KLV H;  1D5A A;  4DV3 O;  1MZE A;  2PYL A;  4JI5 O;  4U3J B;  3T4Z A;  2DMX A;  2CE4 A;  2NN4 A;  3D36 C;  3UO2 A;  2CTR A;  3IC9 A;  1IX9 A;  1WB8 A;  4FFB B;  2QEX V;  1JA8 A;  4DV7 O;  1E79 G;  3JAM N;  4J41 A;  3JAW A;  4K0K B;  1Y74 A;  5B1B B;  1GN2 A;  1ENV A;  4J7K A;  5LP6 C;  1XNQ O;  2OTJ V;  1M5I A;  4X1K A;  4MTG A;  2WLM A;  4OPH A;  3ZIA G;  1VQ8 V;  2WLH A;  4RO2 A;  3RVY A;  1S72 V;  3BHP A;  1IUR A;  2XOK G;  4DV5 O;  4DRX B;  1VEW A;  2HHH O;  1AVM A;  3JAT B;  4DR6 O;  1AP5 A;  2JVD A;  3N2K A;  3CCV V;  1HNZ B;  5B1O A;  1EM1 A;  1N32 B;  3I56 V;  1JR9 A;  3CCQ V;  2CTW A;  4B3M O;  3SYP A;  2ZDI A;  3AG3 C;  3P3N A;  2FL4 A;  4ZOL B;  4HBN A;  3G67 A;  3OTO B;  1BSM A;  2D3O W;  3T1C A;  4PA6 A;  3OGI B;  1P4R A;  4LFB O;  4JI8 O;  3CCJ V;  4DW1 A;  1O9H A;  5IYZ B;  4IYI A;  2AHY A;  4DV0 B;  3CRA A;  3ABL C;  5DED A;  5CB4 A;  2Y0I A;  1I5Y A;  5JJE B;  5FNV B;  2HJF C;  1KU9 A;  5IDJ A;  1QLE C;  3STZ C;  2UU9 B;  2ILM A;  3ZCC A;  2UXB O;  1KC8 W;  4KUM A;  2JJ1 G;  2HEP A;  2JEX A;  4TV8 A;  4NXN O;  2AZ0 A;  3T4D A;  4I0X A;  4I55 B;  3CME V;  1ZTE A;  3CXC U;  5IYD O;  2XND G;  3OR6 C;  4PV1 B;  4GX1 A;  2A06 H;  3H1I H;  1COW G;  2R70 A;  2X6A A;  3JAL B;  3L73 H;  3L70 H;  5KHJ A;  4X9Q A;  1HNW O;  2ZE6 A;  5L3E A;  4W4L A;  1HNX B;  1HR0 O;  4JI4 O;  5FPR A;  1J5E B;  3OUS A;  1NZ6 A;  4MSW C;  1KEC A;  1YTF B;  2N04 A;  3KCX A;  3ZRX A;  5JQG A;  4DV1 B;  1ZL8 A;  4J10 A;  4F4L A;  4Z1M G;  1UFI A;  3I5D A;  4WFE A;  3WU2 Z;  3HKB A;  3ZMU A;  4WBN A;  2LP7 A;  1I5X A;  5ITZ B;  3JAR B;  2XUM A;  1MMM A;  2QKS A;  1BE3 H;  5CBF A;  4K8Z A;  5IJ0 B;  2LJ2 A;  3O65 A;  2FB5 A;  4AIL C;  1CPY A;  1Q6H A;  2NLJ C;  2VWJ A;  3FAV A;  1NH2 B;  4LF7 O;  2QWR B;  5LGN A;  2DYR C;  2QM4 A;  2LW7 A;  2WLI A;  1OCZ C;  5HFM A;  1GMG A;  4X62 O;  3UT5 B;  2HKO A;  4JZ2 A;  4FMT A;  1US6 A;  4IT5 A;  3OUF A;  2YI8 A;  3JYC A;  1JCH A;  2W0X A;  3WFV A;  2VQE B;  1PM9 A;  4FLU A;  3C90 A;  4LR3 A;  3JSL A;  4DUY O;  3F5W C;  3B2E E;  2KSD A;  4H0L B;  3CCE V;  2QWO B;  4DR2 O;  1HDJ A;  3BVO A;  1K97 A;  1QLE B;  3UM7 A;  3CCL V;  5EC1 C;  1GKF A;  4UCS A;  5GON B;  3AK2 A;  1QVG U;  1Y76 B;  2WSS G;  1FXV A;  1KB9 F;  3FD9 A;  4WCE V;  2BCC H;  2X0L A;  4RUE A;  2OIE A;  1XBL A;  4FIP C;  1VAR A;  2CTQ A;  4F6R B;  1SA0 B;  2H3O A;  4YY3 B;  1I94 O;  2UUA B;  4X1I B;  3BEH A;  1JVM A;  3JD4 A;  1N34 B;  1FJG B;  3HPL C;  4KP4 A;  1L1F A;  4JI2 O;  5B5E Z;  1R3J C;  4O4J A;  5FPO A;  3SPH A;  5J2T B;  2Q67 A;  4I7Z B;  1JX9 A;  3IC7 A;  4Q20 A;  4NXM O;  2KKW A;  4XBF A;  1Q82 W;  4TV9 B;  4FM2 A;  5K1X A;  1S5L Z;  4FFB A;  4QE7 A;  1IBL O;  5K1P A;  1ZX3 A;  1MZF A;  4MTO A;  2CK3 G;  1PNK A;  1Z5W A;  2A3Q A;  1RSO A;  1S5H C;  1V55 B;  3TCU A;  1GM7 A;  3CRR A;  1BT8 A;  1F51 A;  2ZM6 B;  4LFC B;  1X59 A;  3ZRW B;  4X64 B;  3JAT A;  5LGU A;  1H2S B;  5LOV A;  3K03 A;  4ZI7 A;  4CS2 A;  1OCZ B;  1Q43 A;  1XMO B;  3E22 B;  2VS0 A;  1KKD A;  1I08 A;  1Q3E A;  2ADP A;  1Z2G A;  3L9D A;  4P9O A;  2QKA A;  1Y74 B;  4O4I A;  4ZOL A;  2EZP A;  4X1K B;  1PNM A;  3LDC A;  1Y6X A;  3AG4 C;  1RFY A;  1SET A;  2JK5 C;  1TAE A;  4I4T B;  2UXD O;  1OV9 A;  2OCC B;  3APO A;  4D7T A;  3DXR B;  3ZMT A;  1VMG A;  4JAS A;  1THZ A;  3G6B A;  1RM1 B;  5EBM C;  4UB8 Z;  2PGG A;  2RN9 A;  5C8Y A;  2MK3 A;  3ZED A;  2C2A A;  5IWA B;  2RMK B;  1AIL A;  4MT8 A;  4PD4 F;  1KP3 A;  2R9A A;  2QSA A;  1FXH A;  4WFG A;  1WA8 B;  4CH4 A;  1YIT V;  3CS5 A;  5LA6 A;  2Q0O C;  1WJZ A;  2YSU B;  1V9P A;  1RP3 B;  4FLV A;  2OT5 A;  3ZMS A;  3HKC A;  1I7F A;  3FB7 C;  2Q69 A;  1BQ0 A;  4NTX A;  1K4C C;  2DQ0 A;  2WAM A;  4H44 B;  2ADQ B;  1JFF B;  5CB4 B;  3QO8 A;  2RJZ A;  2UXN A;  2IM9 A;  1WB7 A;  3CCM V;  2JS3 A;  3K0D A;  4KXR A;  1JOY A;  2QDO A;  1NS1 A;  3A8T A;  4ZIB A;  1ZAU A;  1PKX A;  3D36 A;  3JAL A;  4A5U B;  1NVP D;  2F1M A;  3RFR A;  1M4U A;  2K1E A;  5CMU A;  1N36 B;  4J9Y B;  2PI5 A;  2ZKO A;  2DQ3 A;  5B3S B;  3SYC A;  3W7T A;  5LP6 A;  1WNS A;  1YEW A;  3OGC C;  4BW9 A;  2MW2 B;  3ZX6 A;  2LGW A;  2E3C A;  2CTP A;  2QKC A;  3E83 A;  1FKA O;  2F93 B;  3LUT B;  1JMK C;  5LMN B;  1W2B U;  1SQX H;  4DK0 A;  3AK3 A;  1O9G A;  4XDL A;  1P7G A;  2YIC A;  4X20 B;  2EIM B;  4JI0 O;  4LF9 B;  3M99 B;  2RDC A;  3SPG A;  2YEV A;  3ZHU A;  3T1Y B;  1M93 A;  4JI6 B;  2B1I A;  4P2Z A;  5JQG B;  4B3R B;  2JGD B;  2LGQ A;  2CGN A;  1ZL8 B;  5CA3 A;  4DUZ O;  3AG4 B;  3OTF A;  4X66 B;  3HKB B;  4WBN B;  1KMI Z;  4HAM A;  1NT2 B;  2Y69 C;  4R50 A;  3QF7 A;  1XHX A;  4YIO A;  3A0B Z;  4LNU B;  2FML A;  1V54 C;  2ITC C;  3FAV B;  3R66 A;  2Q73 A;  3X2Q C;  4WFA V;  4JAA A;  3Q4H B;  5J9P C;  5LHG A;  3H9V A;  3KKY A;  4J7Z A;  2WLI B;  1YI2 V;  3ASN C;  2YID A;  3D8C A;  4HYO A;  3B4S A;  4RQE A;  1KD1 W;  2VQF O;  2IJI A;  4GKK O;  5BR8 O;  4YJ2 A;  4E4E A;  4D7S A;  4U7O A;  1Y76 A;  4OX9 O;  3BAA A;  3G71 V;  3CX5 F;  4LBE C;  2E5L B;  5J2U A;  2JJ2 G;  3ASO C;  5L3F A;  1R3K C;  4W4K A;  3SJC C;  1XHZ A;  1JQ0 A;  4DR4 O;  1Y67 A;  1NU1 H;  3TET A;  1Z5V A;  1GH6 A;  2HVJ C;  2EIL C;  3SYQ A;  2OWO A;  1NTM H;  2ARH A;  1GRJ A;  3DTU B;  1BL8 A;  4EFE A;  4P30 A;  2P06 A;  4I9W A;  4DV3 B;  2ODM A;  2YIB D;  1AJN A;  3QO5 A;  2FTK A;  4JI5 B;  1K34 A;  2UUC B;  4JV5 B;  3FX7 A;  2V4D A;  3IJ4 A;  2EIN B;  4FLZ A;  3J81 N;  2EJ7 A;  1WP8 A;  4Z2W A;  1PL0 A;  2ZE7 A;  3SDL A;  4IYH A;  1OCO C;  2XAS A;  3ICX A;  1IBK B;  1DF4 A;  3G80 A;  3SYA A;  2E76 B;  1SRY A;  2CGO A;  4G28 B;  4O4J B;  4DV5 B;  3ZRW A;  1F4M A;  2QTS A;  3E22 A;  1QCE A;  5L3B A;  1R6T A;  3A0H Z;  5FL7 G;  1GN3 A;  1AB3 A;  2X7R B;  1Q6U A;  5CBG A;  3RYH B;  2OTL V;  1MOF A;  1RSO B;  3OFN G;  5BY1 A;  1U97 A;  2RQ6 A;  3H01 A;  2GTS A;  4I4T A;  4PDL A;  4QPJ A;  4JI8 B;  3DXR A;  5GW7 A;  5LOV B;  4ZI7 B;  2QM8 A;  5IJ9 A;  4GUN A;  5LHH A;  3CC2 V;  3K3W A;  3E2E A;  5IE9 A;  2AHZ A;  4O4I B;  4X8A A;  4G27 B;  1ARO P;  2ZE8 A;  3ZBH A;  4JYA O;  1B3Q A;  2CUG A;  1WA8 A;  5L3D A;  2YS8 A;  1SQV H;  4U3F H;  4BIO A;  1AR1 B;  1N33 O;  5KUM A;  4GX0 A;  1R1B A;  3VQY A;  5KAF Z;  4TSF G;  4CC6 A;  1BHA A;  2HVK C;  2XAG A;  5C8Y B;  3LNM B;  1JFF A;  1M1K W;  4R6Z A;  3F7V C;  1Q8I A;  4HNA A;  4B3T O;  2YXY A;  3JAK B;  1HNW B;  4JTC B;  4DV2 O;  1N32 O;  4UB6 Z;  1ZUQ A;  5LA6 B;  4YHH O;  4XDK A;  1HR0 B;  4MVQ A;  3ABM C;  4JI1 B;  4JI4 B;  4NR1 A;  1S0V A;  2Y4T A;  1IZ3 A;  4J42 A;  4OXS A;  2ZNJ A;  3QNE A;  3HKC B;  1OCO B;  3K5M A;  1HW7 A;  4QE9 A;  4O2A A;  3OTO O;  3ZHV A;  3BPZ A;  1QBZ A;  4UCT A;  2N05 A;  4O2B A;  3CD6 V;  4CH6 A;  3H1J H;  2BE3 A;  4RWU A;  1G6U A;  2ZD9 A;  3W7X A;  3AG1 C;  1AI5 A;  4K8X A;  4PI0 A;  4PA9 A;  2Q7G A;  3B40 A;  3GWO A;  3AK1 A;  4X20 A;  5A2Q N;  2OYQ A;  2D2C B;  3CC4 V;  1OZ0 A;  2H94 A;  1XMQ O;  1JJO A;  5LP6 B;  1N0J A;  2JGD A;  1M56 C;  5H6Q A;  4KFM A;  3ZMZ A;  2UU9 O;  1MG1 A;  2BTO A;  1NVP B;  5CA1 A;  3CWB H;  3MD0 A;  1PPJ H;  3GB7 C;  4LNU A;  3W7W A;  5KA5 A;  2Y48 A;  1DK1 A;  1ORQ C;  1XL4 A;  3I55 V;  2WLL B;  3AG3 B;  5KAI Z;  4JAV A;  2YEV B;  4LCU C;  4LF4 O;  3SYO A;  4I9Q A;  3Q4H A;  3OW2 U;  2BTQ A;  1YVW A;  4DR1 B;  3JD0 A;  5LBQ A;  4DR2 B;  5LHI A;  1CEZ A;  1EFR G;  1G8M A;  2EUL A;  1HNX O;  1XI1 A;  2E74 B;  1B6Q A;  2UUB B;  2AGA A;  3PN1 A;  4DR7 O;  1XNR O;  2F66 C;  3FKS G;  1GO3 F;  1VQO V;  2DE0 X;  3ABL B;  5DM6 V;  1HP8 A;  4PA7 A;  4EB6 A;  1WLE A;  1SF9 A;  1N4C A;  3BA9 A;  1OCR C;  3U10 A;  2GUZ A;  4DYL A;  1DTO A;  4BIU A;  4JI2 B;  2PF4 E;  3OR7 C;  4EFB A;  3PJS K;  2Q6A A;  3A2F A;  1SQP H;  4YJ2 B;  5BZB A;  1R6N A;  4CS3 A;  1H2N A;  4NXM B;  3RYI B;  2PYJ A;  2YIA A;  5J2U B;  3SR2 C;  4LF6 O;  3ABU A;  3ETQ A;  1IBL B;  4WFH A;  2YI9 A;  5AG2 A;  3MDS A;  1AI4 A;  3AG1 B;  2CDY A;  3RGB A;  4IHJ A;  4LF5 O;  5TIS Z;  2YXL A;  1WP7 A;  2VQE O;  1AR5 A;  1VQ9 V;  3JD1 A;  1VF6 C;  5EYP A;  3OM3 B;  1NQT A;  4GX5 A;  1L8D A;  2DN9 A;  4D6T H;  3M8A A;  1G1X B;  3F7Y C;  1M56 B;  3CSX A;  1E1Q G;  4PHZ A;  1P49 A;  2WWW A;  3C3S A;  1PV0 A;  2F4V O;  3WG7 C;  3KZI Z;  4DR5 B;  4DV6 O;  2JIZ G;  5KHI A;  3RYH A;  4RUF A;  3CJH B;  3RN4 A;  5KHH A;  1NJI W;  2UXC B;  2DOS A;  2UXD B;  4JI7 B;  3ZMV A;  1NBM G;  1BQZ A;  2DYR B;  1GM8 A;  5JCO C;  3CRM A;  1B06 A;  1D5N A;  3FB8 C;  1TUE B;  2JS5 A;  4PA3 A;  1N34 O;  1M57 C;  1MSD A;  3WB2 A;  1RPR A;  2CH7 B;  4J80 A;  2R9R B;  4LH6 A;  1H2K A;  1W0K G;  3E8F A;  3K0G A;  4K3A A;  2QE7 G;  1YJW V;  3CP1 A;  2BOB C;  4QJF B;  1R3L C;  3U0Z A;  2Q7E A;  2WA3 A;  3EHB B;  4JGS A;  1TUB A;  5L3C A;  1S77 D;  2PY5 A;  3LDD A;  1PL4 A;  2JEU A;  3JD3 A;  1Q7Y W;  1OCR B;  1YCI A;  1ZWI C;  5IJ9 B;  1ZLZ A;  4LP8 A;  4GKJ O;  2RCV A;  2IH1 C;  1L0L H;  2IW5 A;  3K79 A;  1VQ7 V;  5JVD A;  2ZNI A;  4X65 B;  1KBH A;  2WLK A;  4PJ0 Z;  4LFC O;  4MTF A;  1NKD A;  1H2G A;  3NR7 A;  3JAK A;  1UPG A;  2ZCE A;  2O57 A;  1XMO O;  5KHK A;  2LQT A;  2ZE5 A;  1Q81 W;  2F23 A;  5H2F Z;  2KG7 B;  2QA4 V;  1A32 A;  4OPA A;  1VQ6 V;  3GVM A;  3J7A U;  2W6I G;  3K58 A;  1VQM V;  3CEI A;  2PTM A;  1IBM O;  1FFT B;  2OCH A;  2ZXW C;  3RBZ A;  4HNA B;  4FJC C;  1MNG A;  1K5S A;  3K04 A;  2XHB A;  3K9A A;  5KX5 A;  1YTF D;  4JI0 B;  4B3S B;  4JI3 O;  2H8P C;  1NTZ H;  3ZN1 A;  5IWA O;  2DJV A;  1RPO A;  3LSS A;  4O2A B;  4DUZ B;  1QHT A;  2P5O A;  1GK9 A;  5B1N A;  1VF7 A;  3K5L A;  4LFA O;  2QWP B;  4O2B B;  3CHX A;  3CPW U;  5LMU O;  5EBW C;  1M57 B;  1NH2 D;  4X1Y B;  3ZRS A;  2WLL A;  4MVR A;  4DW0 A;  2Z3Y A;  4R8C A;  2V7Q G;  3P32 A;  1P84 F;  3E89 A;  3K08 A;  5DEC A;  4FZ0 A;  1R3I C;  3NXS A;  2M6Y A;  1S3J A;  1H8E G;  1VP7 A;  1KP2 A;  5JH7 B;  4GZR B;  2VQF B;  3ML0 A;  2AZ2 A;  4MVO A;  4GKK B;  3B8M A;  3RWR D;  4O4L A;  4EKW A;  1EZV H;  5CA1 B;  3LSU A;  3CMA V;  4G2K A;  3IAY A;  1F23 A;  4GX2 A;  1OCC C;  5IY5 C;  4DR3 B;  1D2D A;  1XL6 A;  2E75 B;  4PDV A;  4I50 A;  2BTQ B;  4MVU A;  2KB1 A;  5B1B C;  1PNL A;  4J7J A;  1JPX A;  1SQG A;  4H37 A;  1E1R G;  1HWY A;  1GAX A;  3OMI B;  4TUY A;  4DV4 B;  5CBH A;  1BS3 A;  4FZ1 A;  1DLB A;  3VBB A;  4LF9 O;  2NNU A;  3L71 H;  1K4D C;  5IYB O;  5FLX N;  1XOU A;  3IGA C;  4FLX A;  1YSC A;  4NKG B;  5BMV A;  4JI6 O;  3R65 A;  2ZR3 A;  3CXH F;  2A7W A;  1VIB A;  1CP9 A;  3RYI A;  2ZIN A;  4WF9 V;  4KL1 A;  1IXM A;  4EB6 B;  4UXN A;  3RYF A;  3W7S A;  1SKV A;  4UCR A;  2Q68 A;  4NB5 A;  2GUZ B;  1DGS A;  2Z5U A;  1OHH G;  3RW0 A;  1FS0 G;  4TQD A;  3CB2 A;  2HJD A;  2ZIO A;  1SER A;  3HKE A;  2RNB A;  1LUW A;  2P4K A;  3QG5 A;  4O4H A;  3QO7 A;  2QWQ B;  3E8B A;  3UCS C;  3IFX A;  4DV7 B;  1IXB A;  2YXH A;  4NVP A;  4YJ3 A;  1SQF A;  3APQ A;  2P4V A;  1WAZ A;  1XNQ B;  1WPB A;  4PEL A;  1KKC A;  4IHJ B;  1SQB H;  1QU7 A;  3TGU H;  1QR9 A;  3CJH A;  4AQY O;  4IIJ B;  3SGI A;  4GYC B;  2LO1 A;  2YIB A;  5EYP B;  4MVM A;  2JRI A;  2Q0A A;  4ZHQ A;  2HHH B;  4DR6 B;  1TGO A;  4CBC A;  3CE2 A;  3ABK C;  3T1H O;  3DGE A;  4JYY A;  2PZS A;  4TOI A;  2CH7 A;  3BFR A;  2Y69 B;  4B3M B;  3CRC A;  4JF3 A;  1QQC A;  3DC5 A;  4FLT A;  5B1A C;  3C3T A;  4H33 A;  2A9H A;  2YC0 A;  4JYA B;  5KA6 A;  4FFK A;  3ZHR A;  3GWK C;  2QTO A;  1V54 B;  5E1A C;  1QNM A;  2UUC O;  3AG7 A;  3BA8 A;  1FFX B;  2P6J A;  4R7C A;  4JV5 O;  1OCC B;  3OMN B;  3X2Q B;  5IY5 B;  1N33 B;  2P90 A;  4KHP O;  4LFB B;  1FXK C;  3ZN0 A;  2WLN A;  5LYJ B;  4LF8 O;  1EBO A;  3ASN B;  4MW8 A;  2M7W A;  3ETG A;  1IBK O;  3RT3 C;  1WPX A;  4B08 A;  5KMG A;  4NTW A;  3OMA B;  4B3T B;  3H1K H;  4UCV A;  1TUB B;  3ASO B;  4DV2 B;  4YHH B;  5JJJ B;  4UCO A;  5JWP A;  4FM1 A;  3ETD A;  2KG7 A;  2UXB B;  2ZIM A;  4K0K O;  3KG2 A;  2QGN A;  1W0J G;  1B04 A;  3D3I A;  2EIL B;  5E79 Z;  2HR3 A;  4NXN B;  2ATK C;  4UUJ C;  5B66 Z;  2ITD C;  5CA0 A;  4AHC A;  2FKX A;  5JVD B;  1VF6 A;  2XAF A;  1K9M W;  2HLD G;  3D3Q A;  4U7N A;  3M7M X;  1AI6 A;  4CH5 A;  3E8H A;  1SZT A;  1TVK B;  1HNZ O;  3AEI A;  1I0H A;  3ETE A;  1XUQ A;  5GTH Z;  1PP9 H;  1WN7 A;  2AW9 A;  5D5P A;  1XMQ B;  2IU3 A;  3SJB C;  5LXT B;  2N74 A;  4UV9 A;  2F43 G;  2Q9L A;  5EK0 A;  1M90 W;  4B7K A;  3SJA C;  1N0N A;  2W0F C;  4IL6 Z;  2P22 C;  5A9G A;  4L8J A;  2X6C A;  3VQV A;  1GM9 A;  3JCU Z;  1XQ8 A;  4H13 B;  2PI4 A;  1IDS A;  2B5U A;  3N2G A;  5JCO A;  2OIG A;  4TQF A;  3ABK B;  3ZHQ A;  3N27 A;  4QPK A;  2JGU A;  5KX5 B;  4DV0 O;  4X1Y A;  4MVS A;  4IGG A;  1YJ9 V;  5B1A B;  4LF7 B;  4LF4 B;  3SJQ C;  1KQS U;  1TA8 A;  5EIB D;  5CN0 A;  3UKM A;  1XIL A;  1BZK A;  4X62 B;  4HZ3 A;  5KUK A;  2XAJ A;  5JH7 A;  3HB3 B;  4UVC A;  3CCS V;  4MTX A;  2HP8 A;  1VQN V;  3H1H H;  1EN5 A;  1FXK B;  5LGT A;  4GCZ A;  4I5S A;  3K5O A;  4JI1 O;  1SES A;  3K57 A;  3U11 A;  5LL6 Y;  2IJJ A;  4WFF A;  2BSK A;  5D5Q A;  4DR7 B;  1XNR B;  1CXZ B;  2YUA A;  4FLW A;  2LFR A;  1UJW B;  4CS4 A;  3WB1 A;  4QGP A;  1K33 A;  3QVN A;  1SZX A;  2XTA A;  3LDE A;  4DUY B;  1YIJ V;  1IVS A;  1MA1 A;  1W59 A;  2X6B A;  4UVA A;  2XT9 A;  2FYU H;  3DSQ A;  2R9I A;  1V55 C;  1SC5 B;  3FB6 C;  4DXW A;  5KHG A;  4O4L B;  1GN6 A;  1J5E O;  2WA4 A;  2DYS C;  2HG5 C;  2PUS A;  2QWN B;  5GTI Z;  3K5N A;  2IH3 C;  4DV1 O;  3E86 A;  4PDM A;  1KUQ A;  2LFS A;  4LF6 B;  1L0N H;  2F95 B;  1I94 B;  4I50 B;  2L35 A;  3L72 H;  1P7B A;  4MW3 A;  5EBL C;  2Y4U A;  2VRZ A;  3JCZ A;  4LF5 B;  1VQP V;  4TUY B;  3OEH G;  2ETN A;  3ABM B;  1YXB A;  3FB5 C;  4ABM A;  1VQL V;  4L87 A;  2OCC C;  3RYC A;  2P7T C;  5BMV B;  1Q5O A;  5EZY A;  4JAU A;  1RM1 C;  4BIZ A;  4DR1 O;  4P9P A;  4RAI A;  3B09 A;  4QNH B;  3RYF B;  3CRQ A;  4C7U A;  2F4V B;  1MSW D;  1F7Y A;  2ZDI C;  4DV6 B;  1S76 D;  2GHY A;  5EC2 C;  2UUB O;  4TT3 G;  2BOC C;  1SS3 A;  2GV9 A;  3E8G A;  1LR1 A;  4IIJ A;  2P67 A;  1VQ4 V;  4JZG A;  3HKD B;  3ZJZ A;  3JAS A;  3BCC H;  3HKE B;  4GLX A;  4UFZ A;  5HFL A;  2A0L A;  4E2L A;  3MHH C;  3MAQ A;  2ZR2 A;  2Y0P A;  5H9C A;  3WB0 A;  4O4H B;  1SQQ H;  1K5Q A;  4LC1 A;  1U96 A;  3K06 A;  4YJ3 B;  4EEQ A;  2DWD C;  5DN6 G;  2G38 A;  1Y66 A;  3ZHT A;  2LW1 A;  1BMF G;  1ZSP A;  1QVF U;  4U3J A;  1YZB A;  2GTA A;  1FFX A;  1Q86 W;  4ZHQ B;  3EXA A;  4J9Z B;  3L74 H;  5BXZ A;  4LWS B;  4YY3 O;  1J95 A;  3SPC A;  2UUA O;  3QTC A;  5LYJ A;  4OGQ B;  5B3S C;  4FM0 A;  4DO2 A;  1F4N A;  1FJG O;  3OD4 A;  4GKJ B;  2ZT9 B;  2JDI G;  4DK1 A;  3DC6 A;  4FPP A;  2Z0A A;  3BAB A;  1AJP A;  3MHS C;  2XAQ A;  3CYO A;  4XDJ A;  4ASU G;  3S3X A;  4DRX A;  2QJ1 A;  2B9Z A;  2DYS B;  1AI7 A;  3RVZ A;  1GN4 A;  3BRC A;  1QLN A;  1XDC A;  2V1D A;  1JJ2 U;  2EIM C;  3B8N A;  1H2M A;  3JAW B;  4CC5 A;  2A79 B;  4NTY A;  4DR5 O;  3ZHS A;  4K35 A;  4YIP A;  1T5E A;  4WFB V;  1H38 A;  2WLJ A;  5JJN B;  3OEE G;  3FFQ A;  4Z1V A;  2B1G A;  5EIB C;  4TWK A;  3ZS8 C;  2UXC O;  1IBM B;  4N21 A;  4JI7 O;  2ZM6 O;  1FAF A;  5KMG B;  2DW4 A;  4X64 O;  1EN4 A;  2Q8V A;  3AG2 C;  3OE7 G;  1R73 A;  3ZRV A;  3N2K B;  1TVK A;  5IYZ A;  1S5J A;  3VQX A;  3G4S V;  4JI3 B;  1NR7 A;  4ZBM A;  3G6E V;  5LXT A;  4JTA B;  5FNV A;  4NYK A;  5CA0 B;  3UQ8 A;  2IU0 A;  5H6R A;  4LFA B;  3KCY A;  3J80 N;  3CCR V;  3THO A;  4RQF A;  2EIK C;  5LMU B;  1Q6I A;  2GDS A;  4MVZ A;  3LSQ A;  3K59 A;  3WG7 B;  1H2L A;  2HFE C;  4ZKI A;  4X65 O;  1NTK H;  4I55 A;  1PD3 A;  1YF2 A;  1N8R W;  3T2M A;  1XEQ A;  3ABT A;  3CCU V;  3W7U A;  4Q6G A;  1Q90 D;  2AXT Z;  2K9P A;  2GSM B;  2XAH A;  3TXS A;  1FXK A;  1K3E A;  3N2G B;  1XRE A;  4GT1 A;  1M9N A;  5IYC O;  1NR1 A;  4JTD B;  1R6K A;  4TV8 B;  5IT9 N;  1EZJ A;  2Q5Z A;  1G4Y B;  4I0X B;  3SPI A;  2CAZ C;  4ICG A;  5ITZ A;  3TXQ A;  2EIN C;  4BW5 A;  3JAR A;  3F5T A;  4CZZ A;  3S3W A;  4J11 A;  3EVK A;  2L6L A;  1K92 A;  5L3G A;  5F2V O;  5IJ0 A;  4LH7 A;  3E35 A;  1BCC H;  3FYE B;  4B3S O;  1N36 O;  1Y4M A;  2EIJ C;  5BR8 B;  4JYC A;  4N23 A;  2BSK B;  1AR4 A;  4OX9 B;  3OT7 A;  4PA4 A;  3UO3 A;  4F6E A;  4B7E A;  3TJT A;  2KQX A;  3UT5 A;  2ZQM A;  3OAA G;  1VQ5 V;  3EFF K;  3P3P A;  1AJQ A;  3AG2 B;  4DR4 B;  4X88 A;  4QIW F;  5LMN O; 
#chains in the Genus database with same CATH homology
 1WPX A;  3AG4 C;  1K8A W;  3OMA B;  1SET A;  2JK5 C;  1B6Q A;  2OCC B;  3ZMT A;  3JD2 A;  4JAS A;  3ASO B;  1THZ A;  3FKS G;  4UVB A;  1RM1 B;  5EBM C;  1GO3 F;  1VQO V;  3ABL B;  3ETD A;  5DM6 V;  4FK5 C;  2EBO A;  4PA7 A;  1LNQ A;  2MK3 A;  3KG2 A;  3D3I A;  1W0J G;  2EIL B;  1WLE A;  2HR3 A;  2C2A A;  4PDR A;  2DWE C;  2ATK C;  1OCR C;  4UUJ C;  4MT8 A;  3TK1 A;  2ITD C;  1KP3 A;  2QM7 A;  2ZXW B;  3FYI B;  1DTO A;  3P30 A;  2XAF A;  4BIU A;  1K9M W;  1FXH A;  1H8H G;  4WFG A;  2EIK B;  2HLD G;  4U7N A;  3OR7 C;  1YIT V;  1AI6 A;  1MAB G;  2WPD G;  3PJS K;  2Q6A A;  3E8H A;  1SZT A;  1YJN V;  5BZB A;  1GTO A;  4JYB A;  1R6N A;  1VQK V;  3AEI A;  2YSU B;  3ETE A;  2EJR A;  2OT5 A;  3ZMS A;  3ABU A;  2IU3 A;  2UXX A;  3FB7 C;  2Q69 A;  1K73 W;  4WFH A;  4UV9 A;  2F43 G;  5EK0 A;  1M90 W;  1K4C C;  2DQ0 A;  3STL C;  2WAM A;  1AI4 A;  3SPJ A;  1K7D A;  2W0F C;  2EZO A;  3QO8 A;  2X6C A;  2IJK A;  2UXN A;  3AG1 B;  1GM9 A;  3CCM V;  4YXW G;  2PI4 A;  3K0D A;  1JOY A;  1VQ9 V;  1DF5 A;  1PKX A;  2B5U A;  3D36 A;  3JD1 A;  1QR8 A;  1NVP D;  3OM3 B;  3CC7 V;  1NQT A;  4GX5 A;  2K1E A;  4BAY A;  5CMU A;  4UV8 A;  3ABK B;  4MS2 A;  4QPK A;  2IJH A;  4J9Y B;  1ROP A;  2PI5 A;  3VOU A;  2DQ3 A;  3F7Y C;  4MVS A;  1M56 B;  3SYC A;  5B3S B;  3W7T A;  2W6J G;  1E1Q G;  3BY6 A;  1YJ9 V;  5B1A B;  3B77 A;  2WWW A;  4X89 A;  3OGC C;  3SJQ C;  1KQS U;  5CN0 A;  3WG7 C;  1BHB A;  3A0R A;  3UKM A;  2JIZ G;  5C93 A;  1YHQ V;  4HZ3 A;  5KUK A;  2XAJ A;  4JPR A;  3E83 A;  3LUT B;  3HB3 B;  2EIJ B;  4UVC A;  4RUF A;  3CCS V;  1W2B U;  4MTX A;  1VQN V;  1FXK B;  5LGT A;  1NJI W;  4GCZ A;  4I5S A;  4XDL A;  1SES A;  3ZMV A;  1NBM G;  2EIM B;  2IJJ A;  4WFF A;  3T4Z A;  2DYR B;  3M99 B;  1GM8 A;  2QEX V;  3SPG A;  2YEV A;  2LFR A;  1UJW B;  1E79 G;  3FB8 C;  2B1I A;  4P2Z A;  1TUE B;  4PA3 A;  5B1B B;  1M57 C;  1K33 A;  3LDE A;  1ENV A;  5CA3 A;  1YIJ V;  1RPR A;  2OTJ V;  3AG4 B;  2R9R B;  4MTG A;  3E8F A;  1W0K G;  2WLM A;  2X6B A;  4UVA A;  3ZIA G;  1VQ8 V;  3K0G A;  4HAM A;  2WLH A;  2QE7 G;  2Y69 C;  4RO2 A;  4R50 A;  1YJW V;  3RVY A;  1S72 V;  2R9I A;  3CP1 A;  2XOK G;  2BOB C;  4QJF B;  1V55 C;  3FB6 C;  4DXW A;  1R3L C;  3EHB B;  4JGS A;  5L3C A;  1S77 D;  3LDD A;  1V54 C;  2ITC C;  3CCV V;  2DYS C;  2HG5 C;  5B1O A;  2JEU A;  3JD3 A;  3I56 V;  2IH3 C;  3E86 A;  3X2Q C;  1OCR B;  4WFA V;  1ZWI C;  1Q7Y W;  4PDM A;  5J9P C;  5LHG A;  3CCQ V;  2LFS A;  3SYP A;  4LP8 A;  2WLI B;  2ZDI A;  3AG3 C;  1YI2 V;  3ASN C;  2IH1 C;  4HYO A;  2IW5 A;  4RQE A;  3K79 A;  1VQ7 V;  1P7B A;  1KD1 W;  4MW3 A;  5EBL C;  2WLK A;  2D3O W;  2IJI A;  4MTF A;  3JCZ A;  3T1C A;  4PA6 A;  1NKD A;  1VQP V;  1H2G A;  1P4R A;  4U7O A;  3OEH G;  3CCJ V;  3ABM B;  3G71 V;  3FB5 C;  1VQL V;  4L87 A;  1Q81 W;  4LBE C;  2OCC C;  2P7T C;  2QA4 V;  2JJ2 G;  3ASO C;  4JAU A;  5L3F A;  1R3K C;  2AHY A;  1VQ6 V;  1RM1 C;  1JQ0 A;  4BIZ A;  3ABL C;  4P9P A;  2W6I G;  4RAI A;  4QNH B;  3TET A;  2HVJ C;  3SYQ A;  1I5Y A;  2EIL C;  1VQM V;  1MSW D;  2ZDI C;  2HJF C;  1S76 D;  2GHY A;  5EC2 C;  1FFT B;  4TT3 G;  5IDJ A;  2BOC C;  3DTU B;  1BL8 A;  2ZXW C;  3RBZ A;  4P30 A;  4FJC C;  1QLE C;  3E8G A;  3STZ C;  4I9W A;  1VQ4 V;  2P67 A;  1K5S A;  3K04 A;  3K9A A;  3ZJZ A;  3ZCC A;  1AJN A;  3QO5 A;  2FTK A;  1K34 A;  1KC8 W;  1YTF D;  4KUM A;  2JJ1 G;  2H8P C;  2A0L A;  5HFL A;  4E2L A;  3MHH C;  2JEX A;  3ZN1 A;  2ZR2 A;  3T4D A;  5H9C A;  1RPO A;  2EIN B;  3LSS A;  1K5Q A;  4LC1 A;  3K06 A;  3CME V;  1PL0 A;  1GK9 A;  5B1N A;  2DWD C;  1OCO C;  2XAS A;  5IYD O;  5DN6 G;  2XND G;  3CXC U;  3OR6 C;  1DF4 A;  4GX1 A;  1Y66 A;  1COW G;  1BMF G;  2X6A A;  3SYA A;  3CPW U;  1SRY A;  4G28 B;  5L3E A;  1QVF U;  3ZRW A;  5EBW C;  1F4M A;  1Q86 W;  3OUS A;  1M57 B;  4J9Z B;  4MSW C;  1NH2 D;  1KEC A;  1YTF B;  1J95 A;  3SPC A;  3ZRS A;  1QCE A;  3ZRX A;  2WLL A;  4MVR A;  5L3B A;  2Z3Y A;  5FL7 G;  4R8C A;  2X7R B;  2V7Q G;  3P32 A;  5B3S C;  4F4L A;  4DO2 A;  4Z1M G;  1F4N A;  3E89 A;  3K08 A;  4WFE A;  5CBG A;  1R3I C;  3NXS A;  2JDI G;  3ZMU A;  2LP7 A;  1S3J A;  1H8E G;  1I5X A;  1KP2 A;  4FPP A;  2OTL V;  1MOF A;  1AJP A;  3MHS C;  3ML0 A;  2XAQ A;  3CYO A;  4XDJ A;  3OFN G;  4ASU G;  2QKS A;  4MVO A;  2DYS B;  3B8M A;  4EKW A;  3H01 A;  5CBF A;  1AI7 A;  3RVZ A;  4PDL A;  4QPJ A;  1QLN A;  1CPY A;  5GW7 A;  2V1D A;  2NLJ C;  3CMA V;  1NH2 B;  4G2K A;  1JJ2 U;  2EIM C;  2QM8 A;  1F23 A;  3B8N A;  5LGN A;  2DYR C;  2A79 B;  4GX2 A;  1OCC C;  5LHH A;  5IY5 C;  3CC2 V;  2WLI A;  1OCZ C;  3K3W A;  5HFM A;  3E2E A;  1XL6 A;  4WFB V;  1GMG A;  4PDV A;  2AHZ A;  2HKO A;  2KB1 A;  4MVU A;  1H38 A;  2WLJ A;  5B1B C;  3OEE G;  4X8A A;  1PNL A;  2B1G A;  1JPX A;  4G27 B;  1ARO P;  4TWK A;  4FMT A;  3OUF A;  4N21 A;  3JYC A;  1E1R G;  1HWY A;  1JCH A;  4H37 A;  3OMI B;  5L3D A;  5CBH A;  2DW4 A;  3WFV A;  1DLB A;  3VBB A;  3AG2 C;  3OE7 G;  1R73 A;  3ZRV A;  1AR1 B;  2NNU A;  1K4D C;  5IYB O;  3IGA C;  5KUM A;  4GX0 A;  1YSC A;  3R65 A;  2ZR3 A;  4TSF G;  1CP9 A;  3G4S V;  3F5W C;  1BHA A;  1NR7 A;  4ZBM A;  4WF9 V;  2HVK C;  2XAG A;  3LNM B;  3G6E V;  3CCE V;  1IXM A;  4UXN A;  3W7S A;  4JTA B;  2Q68 A;  1K97 A;  1QLE B;  4R6Z A;  3UM7 A;  3CCL V;  1M1K W;  2Z5U A;  3F7V C;  1OHH G;  5EC1 C;  3RW0 A;  2IU0 A;  1FS0 G;  1GKF A;  5H6R A;  1QVG U;  2WSS G;  1FXV A;  3CCR V;  1SER A;  4JTC B;  4RQF A;  4WCE V;  2EIK C;  2X0L A;  4RUE A;  4XDK A;  4FIP C;  3ABM C;  4MVQ A;  4MVZ A;  1S0V A;  3LSQ A;  4OXS A;  3WG7 B;  3QO7 A;  3E8B A;  3QNE A;  3BEH A;  2HFE C;  1OCO B;  1JVM A;  3IFX A;  4QE9 A;  4ZKI A;  3JD4 A;  1PD3 A;  1N8R W;  3HPL C;  4KP4 A;  3T2M A;  1QBZ A;  1L1F A;  3ABT A;  4PEL A;  3CCU V;  3W7U A;  1QR9 A;  1R3J C;  3CD6 V;  3SPH A;  2GSM B;  2XAH A;  2Q67 A;  2ZD9 A;  1FXK A;  1K3E A;  3AG1 C;  3W7X A;  1AI5 A;  1JX9 A;  3IC7 A;  4MVM A;  4PA9 A;  3GWO A;  4Q20 A;  4GT1 A;  4XBF A;  1M9N A;  5IYC O;  1Q82 W;  1NR1 A;  3CC4 V;  1OZ0 A;  2H94 A;  4JTD B;  1R6K A;  4QE7 A;  4CBC A;  3ABK C;  3DGE A;  1EZJ A;  1G4Y B;  3SPI A;  4MTO A;  2CK3 G;  1M56 C;  1PNK A;  2Y69 B;  4JF3 A;  2EIN C;  5H6Q A;  5B1A C;  4H33 A;  4BW5 A;  2A9H A;  4KFM A;  3ZMZ A;  4CZZ A;  1MG1 A;  1S5H C;  1V55 B;  3TCU A;  5KA6 A;  1NVP B;  1GM7 A;  1F51 A;  1K92 A;  2QTO A;  1V54 B;  5L3G A;  5E1A C;  3ZRW B;  3E35 A;  3MD0 A;  5LGU A;  3FYE B;  2P6J A;  3GB7 C;  1Y4M A;  4R7C A;  1OCC B;  2EIJ C;  3OMN B;  3X2Q B;  3K03 A;  5IY5 B;  3W7W A;  1OCZ B;  4JYC A;  4N23 A;  5KA5 A;  2Y48 A;  2P90 A;  1FXK C;  1ORQ C;  1XL4 A;  3ZN0 A;  4PA4 A;  3I55 V;  2WLL B;  2WLN A;  3AG3 B;  1EBO A;  2YEV B;  3ASN B;  4JAV A;  4LCU C;  4MW8 A;  3SYO A;  1KKD A;  4P9O A;  3OW2 U;  2M7W A;  2ZQM A;  3OAA G;  1VQ5 V;  3ETG A;  3EFF K;  2EZP A;  1AJQ A;  3JD0 A;  5LBQ A;  3AG2 B;  5LHI A;  1PNM A;  3LDC A;  4X88 A;  1EFR G;  1G8M A;  4QIW F;  1CEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...