1YHQV

Crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1yhqV00
3CCQV 1KQSU 1JJ2U 3G71V 1VQ6V 3CCLV 2D3OW 1YIJV 3CC4V 1NJIW 1VQKV 3CMEV 3CCRV 1N8RW 4WFAV 5DM6V 1QVGU 3CCEV 1VQMV 3CCUV 1K73W 1KD1W 1YITV 3CD6V 2OTLV 1VQ5V 4WFBV 3CMAV 1YJ9V 3CC7V 4WCEV 1VQ4V 1YJNV 1W2BU 1YI2V 1KC8W 1Q7YW 1VQPV 1YJWV 3G4SV 2QA4V 3I55V 3CPWU 1R73A 3CXCU 1VQLV 1YHQV 1S72V 1Q81W 1M90W 2OTJV 4WF9V 3CC2V 1Q86W 3CCMV 3OW2U 1Q82W 1K9MW 2QEXV 1VQOV 1QVFU 3G6EV 1VQ8V 1VQ7V 3I56V 3CCSV 1K8AW 1VQNV 3CCVV 1M1KW 3CCJV 1VQ9V
chains in the Genus database with same CATH superfamily
2ITCC 1S5JA 3O9OA 1EN5A 3B40A 4CH6A 1VQ5V 2XAFA 2CGNA 2QM7A 4LP8A 2W0XA 4FMTA 3RYHA 1S5HC 2OCCB 2GTSA 4K35A 1UPGA 4JZ2A 5B3SC 4UCUA 4O2BB 1G1XB 5LMNB 3QVNA 2GUZB 2G38A 3VQVA 4DV5O 3U10A 3N27A 2P67A 1Q8IA 4DV2B 1GM9A 1AI7A 2Q6AA 3ZMZA 1CPYA 1SZTA 2CTWA 4ZOLB 3K0GA 5IT9N 1V55B 1S72V 4JAAA 5CA3A 3T1YO 4O4IB 1NH2D 5ITZB 4U3JB 4DK1A 2YI9A 4JI7O 1AP6A 1M9NA 4LF7B 5L3BA 1Y74A 1I7FA 1I0HA 1US6A 1GN6A 2X6CA 3CD6V 5LOVB 3STZC 5H6RA 1Q6UA 3JAWB 1Y67A 4UXNA 4FFBB 4TUYA 3BVOA 4IIJA 4PELA 3SYCA 1I5YA 3OAAG 1VARA 4O4LA 5FNVB 3E86A 5EZYB 2CDYA 4PA7A 1Q6HA 2GBOA 5EIBC 4BIUA 3K0DA 3UQ8A 4LF8B 1XI1A 1LUVA 2QKAA 4FM1A 3K5MA 1M5IA 5BMVB 3CJHA 4WFGA 1L0LH 2JIZG 2P6JA 3RYCA 1WA8B 3IAYA 1WP8A 5CBFA 3STLC 4O4JA 1XHZA 2JEXA 4DV7B 1JCHA 3D8CA 4J80A 1H8HG 1RPOA 3PN1A 3M8AA 2KG7B 4L8JA 2LFSA 4AQYB 4KHPB 3HR0A 2JVDA 2A0LA 1YJWV 2PZSA 2CAZC 1HW7A 2JEUA 3A0RA 4DW0A 3OW2U 1KECA 3JD2A 3TGUH 2NR5A 1K9MW 4H33A 1S3JA 2ZDIA 4WFEA 4DK0A 3N2KA 1V9PA 3CCVV 2B1IA 4CS2A 1IDSA 3Q4HB 3UT5B 1Y4MA 1ZTEA 5LXTA 3LSSA 2N05A 1TVKB 4A5UB 2ZKOA 4MVRA 1K3EA 4X88A 4NTYA 3FYEB 1K5SA 3BEHA 1GM7A 3E8BA 1Q90D 2WLLA 3UM7A 5JJEB 2YIBA 1UFIA 1YXBA 3CP1A 1DGSA 4AHCA 2Y69C 1RM1C 2EIJC 1RFYA 2ZM6O 5B1AC 1IURA 1FFXA 4NXMB 3ABMC 1Q81W 3THOA 3CCMV 4JI5O 1VQ8V 4I9WA 1M56C 1QLEB 1EZVH 1BS3A 1NH2B 1NR7A 3H1IH 1BHAA 4XDJA 1FXVA 2P7TC 1S77D 4B3MO 2UUCO 3OD4A 5EYPB 1WPXA 1IBMB 1DLBA 4KUMA 4QGPA 5C8YB 5BR8B 1HNZB 3OTFA 3F5TA 2D2CB 5EK0A 4NXNB 1IBLO 3S3WA 4DR3O 5B1OA 2XT9A 4PA4A 3FB8C 3ABKC 4TQDA 2ADPA 2JJ2G 3CXHF 1B6QA 1OCRC 1BGYH 2PYJA 2N74A 1FJGO 1RSOA 4F6RB 3G4SV 4KP4A 1ZWIC 2OIGA 5CA1A 4LCUC 1OV9A 3ZMUA 3AG1C 3F7YC 2CGOA 1ENVA 1EFRG 4GLXA 2ADQB 1Q5OA 2WWWA 1N34B 1BQ0A 4F6EA 3J7AU 2Q8VA 5AG2A 5J2UA 1J5EB 3ZRSA 3CRCA 3T4DA 5KX5A 2CTQA 3BA9A 3FFQA 2C2AA 4TWKA 3LNMB 2UUAO 3R66A 1P7GA 2IM9A 3P30A 2RCVA 4GX0A 4TUYB 3T1CA 4IIJB 4JTCB 4O4LB 5EIBD 5LP6C 3ETDA 4PDMA 5JWPA 1AI6A 1BL8A 1MZFA 3L73H 2BOBC 4X65O 4IHJA 4QE9A 3VOUA 3EHBB 2LFRA 2ZXWB 4JI3B 1AJQA 2P4VA 1PM9A 2DYSB 4L87A 4OXSA 4FK5C 4B3SO 4BAYA 5IY5B 3CJHB 1PL0A 1Z5VA 1VQMV 3RYCB 1CXZB 1PV0A 3W7TA 3CMAV 1EZJA 3SPHA 5CA0B 1KC8W 3K08A 1NTMH 4O4JB 1K97A 1IXBA 4FZ1A 5GTHZ 2QA4V 1PNMA 4LWSA 4DR7O 5B5EZ 1E1QG 1K7DA 2ZIOA 1SRYA 1R3JC 2KB1A 1KP3A 2Y4TA 1VQ9V 2UXXA 5D5QA 2V4DA 2WLHA 3E8GA 4U7OA 1JMKC 2ZCEA 2DN9A 3N2KB 3RW0A 4P2ZA 5KHIA 1NQTA 4RUEA 2XAGA 1N36O 2HR3A 4WF9V 1PNLA 4BWAA 1MMMA 5EC2C 2XASA 1H2GA 2PGGA 2WLNA 5JJJB 4TV9B 3TETA 1XMOB 3HKCB 1N33O 1N0JA 3WU2Z 1Y66A 3K9SA 1J95A 3SR2C 3ZMVA 1OHHG 1P7BA 1ZSPA 2DJVA 5CB4A 2W6IG 2E5LO 2DWEC 4HYOA 4CC5A 3H1JH 3T4ZA 2V7QG 4JI8O 4Q6GA 2M6YA 1BMFG 4IYIA 1ZUQA 1AP5A 4DR5O 1XNQO 1FFXB 1VQ6V 3A0HZ 3OUFA 3P3PA 1MG1A 3RT3C 3AG4B 4JI2B 4MTGA 1OCCC 2Z3YA 2HKOA 2HEPA 4EFEA 2DQ0A 4OX9O 1OCZC 2PY5A 1M1KW 1FXHA 3KKYA 3ZHUA 2F1MA 3ABLB 5CBGA 4NVPA 4PI0A 4PA3A 4X9QA 3LDCA 4O4IA 1BE3H 3MHSC 5ITZA 4H44B 1F7YA 4X66O 5E1AC 3BA8A 4H37A 1QBZA 4U3FH 2NLJC 3IC9A 4FM2A 2VS0A 4JI0O 1RSOB 1SS3A 1DF4A 3B09A 3K06A 5CA1B 1YIJV 1YDXA 1KKDA 3CHXA 5FNVA 2Q69A 3TCUA 1K34A 5KLVH 2BSKA 3ZBHA 1YTFD 1XL4A 1K4CC 4JAVA 5J2UB 1L0NH 1QQCA 1WB8A 5KX5B 1LUWA 2Z5UA 2ZINA 2P06A 3B2EE 1SKVA 5EBWC 3MDSA 4JI4B 4DR6O 1NTKH 1WNSA 2CUGA 2Q73A 4DYLA 2XAJA 1U96A 4GT1A 3I55V 2ZE5A 2KKWA 2YXLA 3AK2A 1U97A 5H9CA 2PF4E 2V1DA 3JSLA 3OR6C 5EC1C 2Q0OC 3ASNB 2FB5A 5A9GA 3RVYA 2KG7A 2HHHB 4X1KB 1VF6C 2UU9O 2Y48A 2UXBB 3AG3B 3OUSA 3MAQA 2ZE7A 1S76D 3ASOB 5H6QA 4WFFA 1OJHA 3FKSG 5A2QN 5KHGA 4ZBMA 3WG7B 3Q4HA 3AG2B 1PL4A 1K33A 4TQFA 1N4CA 2IJHA 2QR4A 1AILA 1H2NA 1WPBA 5KUKA 3JASA 1F51A 4O2AA 4JI1O 4OPHA 4LWSB 3W7UA 2F93B 1COWG 1IVSA 4MS2A 1QU7A 2ZE8A 1H2LA 1S5LZ 4EKWA 2XAQA 4K0KO 1K92A 3D36A 4JPRA 3OEEG 4DV1O 5IJ9B 1OCOB 2F95B 1M93A 2DYRC 4JASA 1D5AA 1Q43A 2FL4A 3RFRA 4DV3O 4B3RO 3QO5A 3APOA 4X64O 1B06A 3ZS8C 3I5DA 3SDLA 4QPKA 3CXCU 2HP8A 2ITDC 1JR9A 5CMUA 3CRMA 3F5WC 4E4EA 5EYPA 4B7EA 2OIEA 5IYBO 5CB4B 4DUYB 1AR4A 1NJIW 1B3QA 1K4DC 2LJ2A 1JQ0A 1SQFA 2EIMB 2EILB 2DMXA 3EXAA 3L75H 1R3LC 1XDCA 4JTDB 3G67A 4B08A 2IU3A 5IWAO 3JALB 4F6RA 5KA5A 4BW9A 3M99B 1ZL8A 4MTXA 4WFBV 4DR1B 3J80N 1YI2V 2QWPB 2ARHA 4NTWA 4XDKA 2WLIB 1GRJA 3L74H 2IU0A 2YC0A 1PD3A 1NKDA 5B1NA 3KCYA 2EBOA 1N32B 1GAXA 1GN3A 1KYOF 1HR0O 4J7KA 1KD1W 1SQGA 5JVDB 2XTAA 3SPIA 4MTFA 1FS0G 3LSUA 2X6AA 4LF4O 1Y76B 3M7MX 4DXWA 2Z0AA 3OTOO 2XHBA 2BSKB 1AB3A 1IBKO 4YJ3A 3S3XA 1M57B 1KBHA 1K73W 3C3SA 2OWOA 3K5OA 3E89A 1GK9A 2Y0IA 2X6BA 1VQPV 2LP7A 1VMGA 4GKKB 4ZI7B 4TOIA 2QEXV 4YXWG 2R9RB 1HNWO 2CTRA 3QTCA 5CA0A 2DW4A 1NVPD 3IGAC 4WBNA 3BY6A 2BOCC 1FXKC 3TJTA 3E35A 5B1BB 4QNHB 5JCOA 4DR2O 4K8ZA 1DF5A 3RYFA 1H38A 3JD0A 1GN4A 3N2GB 1VQLV 4AI8A 4LF5B 3TK1A 1WAZA 1K8AW 3RBZA 2R70A 4YJ2A 3E8FA 1JPXA 1MZEA 5LMUO 3CCEV 3ZN0A 1HWYA 4GCZA 2EJ7A 2M7WA 1SETA 1XMQO 3JASB 4O2AB 5B66Z 1W0KG 2UXDB 1R73A 5IYCO 2A9HA 2Q7EA 1H2KA 4TV9A 4KFMA 2RNBA 2F4VO 3OGCC 1HNXB 3HKCA 4W4LA 4UB6Z 1AR5A 3T2MA 1KU9A 1H8EG 3D3QA 1I94O 2Q0AA 3JCZA 4UCVA 2YXHA 3K79A 4X1IB 5L3EA 3X2QB 1E1RG 4G2KA 4DR4O 2VQFB 2HG5C 5FPRA 2R9IA 2OYQA 5GW7A 4UVBA 2HLDG 1PP9H 3BCCH 3ABTA 4NYKA 3CPWU 1FKAO 3E22A 3SPJA 5LGNA 3T1HB 4CH4A 3JD4A 2PYLA 5EBLC 5L3DA 4MT8A 3ZJZA 1JJ2U 1V54B 4DV0B 4FLVA 4X62O 1OZ0A 1TUBA 3AG2C 3ZRVA 4DUZB 5DECA 3LNNA 3JAKA 3DGEA 2NN4A 2UXCO 4HBNA 3ZHQA 2W6JG 4LF9B 1EN4A 3A8TA 1JA8A 4DRXA 4YY3B 5IYDO 3WFVA 1L8DA 1G8MA 1XNRB 1KP2A 5FPOA 4JYYA 4FJCC 3ZRWB 1ZL8B 3OGIB 1ZLZA 4CS4A 4LH7A 4H0LB 1NT2B 3D3IA 4HZ3A 2IBZH 3JCUZ 2FYUH 4WFAV 1RPRA 5BY1A 1NVPB 3ZHRA 4G27B 4JYAB 4DV6B 1GKFA 4LH6A 2UUBB 4J7JA 5LMNO 1SERA 1MSDA 3AEIA 3JAMN 4JI6B 2VQEB 4K8XA 1R3KC 4DV2O 3VQYA 4IYHA 2OCCC 1Z2GA 1URFA 3FX7A 1THZA 1LR1A 2EINB 2GSMB 1WJZA 4I0XA 3AK3A 1DK1A 4LFAB 2QM4A 5LHHA 4YJ3B 2JS5A 3BFRA 4FLYA 2AW9A 4YHHB 2QTOA 4X1KA 4LF7O 2EJRA 1KQSU 4JV5B 2EX3A 4PDVA 1GMGA 1SA0A 1V55C 5F2VO 2EIKB 3CX5F 4GKJB 3A0BZ 4UVAA 4WBNB 2XOKG 4DV4B 5KAIZ 4EB6A 2WLMA 3RYFB 3GB7C 3CCQV 3IJ4A 2CK3G 4LF6B 3R65A 4LF8O 3OR7C 4B3TB 2EZOA 2PTMA 3MHHC 3OFNG 5L3FA 4X20A 1R1BA 4YJ2B 2QGNA 3SYAA 1XEQA 5IJ9A 1Y6XA 4MVZA 4C7UA 3ZHSA 1YHQV 3SPCA 3JD1A 1QVFU 3RN4A 3F7VC 3DTUB 1NI8A 2A7WA 2CH7A 4DV7O 4MVOA 2YS8A 3GWKC 3CCRV 5B3SB 2BTOA 4AQYO 4KHPO 3W7SA 3SYPA 1W2BU 3G6BA 3H1HH 1A32A 3OE7G 4UVCA 4JYCA 3BABA 2AZ2A 1BSMA 1AJPA 1XREA 3J81N 5IJ0B 2LW7A 4P9OA 4DV5B 4K3AA 3E22B 4CH5A 3LUTB 2WLKA 4LNUA 5HFLA 4OPAA 1MABG 1BHBA 5H2FZ 4PV1B 4I50A 1JFFA 2GDSA 3JALA 4I4TB 2DWDC 2ILMA 1TUBB 2ZNIA 2NNUA 5KHJA 5JH7A 1Q86W 3SJCC 1S0VA 1QHTA 3T1YB 2EZPA 1MNGA 2ZR2A 3JAKB 1H2MA 4RQFA 5LP6A 1AJNA 2WLIA 4JI7B 1SQBH 3RYIB 3ZMSA 5LA6A 3LDDA 2OTLV 4MVMA 4WCEV 4NXMO 2FMLA 2ODMA 2B9ZA 3JSNA 4F4LA 2JS3A 2VRZA 4DRXB 5KAFZ 4FLZA 4PI2A 1VIBA 1X59A 1HDJA 5JVDA 4H13B 3B8NA 3LDEA 4J9YB 3SGIA 1IBMO 4GUNA 5BR8O 1HNZO 1Y76A 5KHKA 2KSDA 1QLEC 1H2SB 5L3CA 4NXNO 3NR7A 3TXQA 2YEVA 1IXMA 1BQZA 1VQNV 3VBBA 3OT7A 1XUQA 4ZI7A 3VQWA 4RAIA 4RWUA 3UKMA 4I7ZB 4ZHQA 4CS3A 1T5EA 3FB5C 2LW1A 5BZBA 4I0XB 2B5UA 1N34O 2PUSA 4TV8A 1Z5WA 3SPGA 3EFFK 4Z1VA 3N2GA 1J5EO 2ZIMA 1MOFA 5IE9A 2N04A 3K03A 1SA0B 2AGAA 4N21A 1P84F 4FLWA 2Y69B 5KMGA 1RM1B 2EIJB 2ETNA 3L9DA 5B1AB 1WN7A 3ABMB 3JYCA 3P3NA 5K1PA 4EB6B 1M56B 4GZRB 1WLEA 4JI3O 4Z1MG 1KMIZ 3GVMA 2ZM6B 1YVWA 5J2TA 1SQXH 4QE7A 4X20B 3APQA 4TSFG 1QNMA 1YF2A 2WA4A 4X1IA 5IDJA 3ZHTA 4JI5B 4E2LA 2HVKC 4JZGA 2ZXWC 5CBHA 1DTOA 4I55A 4QIWF 3UO3A 2YSUB 4D7SA 2DYSC 4YIOA 2JGDA 4B3MB 2UUCB 1XL6A 2QTSA 2CH7B 5IYZA 5L3GA 2GHYA 3E2EA 5IY5C 3ABKB 3AK1A 2EIKC 1OCRB 4P9PA 2K9PA 1YSCA 3BAAA 3H1LH 1IBLB 4DR3B 1WP7A 4FFKA 2L6LA 3AG1B 3WB0A 2IH1C 1TGOA 1GN2A 3ETEA 1GM8A 2P22C 3ZCCA 1P4RA 3ZMTA 5E79Z 4IL6Z 3ZIAG 2QE7G 4EEQA 2LO1A 3DC6A 4ZKIA 1FJGB 2MW2B 4P30A 1NTZH 4UV9A 4UCSA 1D2DA 4LNUB 2ZDIC 1YTFB 4MTOA 2YIDA 2P5OA 4GX2A 4I50B 1JFFB 5DN6G 3QF7A 1XMOO 4UCTA 5JH7B 4JGSA 5LBQA 3ZRWA 3SYQA 2F23A 2QWRB 2W0FC 2JGUA 5LP6B 4RUFA 1PPJH 5LA6B 2QWNB 1ORQC 1NZ6A 3HKEA 2UUAB 5D5PA 1P49A 2JK5C 3U0ZA 4JI2O 1VF6A 1QVGU 5HFMA 5DEDA 2Q67A 3OMIB 2ZE6A 4EFBA 2E75B 2OT5A 3ZRXA 4X65B 3QO7A 3AG4C 4I9QA 4FVMA 4LFBB 2BCCH 2QJ1A 3RGBA 1ZAUA 1JJOA 4B3SB 1YCIA 4CZZA 2YEVB 2A06H 2F66C 4UV8A 5LYJA 2RMKB 3ZX6A 3ABLC 3ETGA 3UCSC 3KZIZ 4NTXA 2VWKA 4X1YA 4LFCB 4DR7B 3ZHVA 4J11A 4ABMA 1W0JG 1XHXA 2IJJA 2ZT9B 3SYOA 3QG5A 4ZHQB 1R6NA 4GX5A 3PJSK 4MVQA 2ZQMA 3W7WA 4ZIBA 2YI8A 1B04A 3P32A 4TV8B 1RP3B 2X7RB 4IT5A 2Q68A 2JDIG 4Z2WA 1AI4A 2WA3A 1N36B 1K5QA 2BE3A 5GONB 4UB8Z 4UCRA 4JI4O 3BRCA 4PA6A 5KMGB 3SJQC 1SQQH 3HKDA 4OGQB 1N33B 1KB9F 3JARA 1MA1A 2GV9A 4FPPA 4XBFA 4W4KA 2E5LB 5JQGA 1NBMG 2Q4PA 1VQOV 1VF7A 2HHHO 1OCCB 4JI8B 1UJWB 4MW8A 5GTIZ 1ROPA 3G71V 2YXYA 4MSWC 5TISZ 4DR5B 5J2TB 3G80A 1XNQB 2UXBO 3CCUV 3ASNC 1OCZB 2ZNJA 1NS1A 3K5NA 2AHZA 2QSAA 1JX9A 5LGTA 5IJ0A 4I55B 1MSWD 3HB3B 1NU1H 2H8PC 2RN9A 1FD9A 2JGDB 1TA8A 2O57A 4OX9B 3AG3C 5IYZB 2LQTA 3ASOC 1QLNA 4FLXA 2QDOA 3CRQA 2HVJC 5K1XA 2Q5ZA 2KQXA 4I4TA 3WG7C 2Y0PA 2Q9LA 4D6TH 2RDCA 2AHYA 3GWOA 2WAMA 2ZR3A 1ZX3A 3KG2A 1HP8A 2XUMA 3FYIB 4X66B 1Q82W 3WB1A 4J10A 3RYIA 3CB2A 2XAHA 2IW5A 4JI0B 4I5SA 2D3OW 1G6UA 1AVMA 1O9HA 4PD4F 3HKBA 4JTAB 4DW1A 2OCHA 1OCOC 3A2FA 4JYBA 1F4NA 2A79B 3H01A 4BIZA 4PHZA 4CH3A 1AROP 4DUYO 3DC5A 1VF5B 3RYHB 2MK3A 3K9AA 2ZD9A 1BCCH 1FXKA 2YIBD 3E83A 3HKEB 4PDRA 4LR3A 4MVSA 4DR6B 4HNAA 4R6ZA 4AILC 4GYCB 4NKGB 3U11A 4G28B 3FAVA 3BHPA 3CCJV 1M4UA 2JRIA 4TT3G 2EIMC 3L72H 4D7TA 2WPDG 2EILC 2E76B 1SZXA 1R6TA 4J41A 3CYOA 4DR1O 1N0NA 1XBLA 2UU9B 1WB7A 1Y74B 1QR9A 3OMNB 4QPJA 4B7KA 2E3CA 3JATA 1VQ7V 1XQ8A 5LYJB 2DE0X 1N32O 2HJDA 1LNQA 3VQXA 1VQKV 3CMEV 4JI1B 5C93A 1AI5A 1Q6IA 4X1YB 1KUQA 1YITV 4WFHA 3B8MA 4R8CA 2Q7HA 5KUMA 1I5XA 4FIPC 4PJ0Z 2DYRB 4LFBO 2BTQA 2FKXA 2R72A 3K04A 3K3WA 4CBCA 4K0KB 2H3OA 2QM8A 3CEIA 2YDEA 3JD3A 2WSSG 4MVUA 2IJIA 4X8AA 5JJNB 4DV1B 3QNEA 1F4MA 1X4TA 1EBOA 1F23A 1N8RW 1VQ4V 2E74B 4GKKO 4PA9A 3K5LA 4B3RB 4DV3B 5H5NA 4FLTA 3FB7C 5FLXN 4LFCO 4X64B 3HPLC 3HKDB 1M57C 4O4HA 3G6EV 4X89A 2L35A 4N23A 1YZBA 3JARB 3IC7A 5JQGB 2YIAA 1FFTB 3O65A 2X0LA 3CC7V 4NR1A 3K58A 3DXRA 3FD9A 4FM0A 2LGQA 4LF5O 3QO8A 3ZN1A 4JF3A 4UFZA 3FB6C 5LXTB 1BZKA 2F43G 2LGWA 5B1BC 3C90A 4XDLA 4ASUG 5J9PC 1VP7A 5IWAB 2WLLB 2QKSA 2JJ1G 4JAUA 5CN0A 2UXDO 1Q7YW 2A3QA 4MW3A 1HNXO 3ABUA 1JVMA 3K59A 3E8HA 3SJBC 3NXSA 3IFXA 2YICA 4CC6A 2CTPA 2WLJA 1G4YB 3W7XA 5LL6Y 2GTAA 2VQFO 2PI4A 1HR0B 2YUAA 4J9ZB 2RJZA 4O2BA 2VWJA 1TAEA 2AZ0A 2GUZA 2DOSA 3T1HO 1GTOA 1VEWA 4J42A 3H1KH 3OM3B 5LGUA 3D36C 3HKBB 1D5NA 1EN6A 1SF9A 2DQ3A 3X2QC 4LF4B 1I08A 4DV0O 1FPOA 4ZOLA 3CRRA 1EM1A 5KHHA 3OTOB 2P90A 4DUZO 3ZEDA 1IBKB 4LBEC 1IZ3A 3K57A 3CSXA 4U3JA 5EBMC 1V54C 1FAFA 1FXKB 2OTJV 3H9VA 4BW5A 1PNKA 1SESA 1FYJA 4HNAB 4LF9O 1IX9A 5LOVA 3JAWA 1HNWB 3CCLV 3CC4V 1YEWA 4FFBA 2XNDG 3RVZA 3BPZA 4KXRA 1BT8A 4UCOA 3MD0A 4YY3O 3FAVB 2ATKC 2UXNA 1XNRO 3EVKA 3ICXA 4R7CA 5EZYA 3CS5A 2H94A 3OMAB 4DR2B 1KKCA 3TXSA 3CC2V 1GO3F 1JOYA 4KL1A 4BR6A 3B77A 4J7ZA 4NB5A 3ML0A 4U7NA 2R9AA 2B1GA 5BMVA 4Q20A 3OEHG 4IGGA 3JATB 3CWBH 1SQPH 4RO2A 4JYAO 4DV6O 1Q3EA 5LMUB 2HFEC 3B4SA 3RWRD 1PKXA 5GONA 1WA8A 5BXZA 1SQVH 2UUBO 1XMQB 5LHGA 1QCEA 4FZ0A 4JI6O 2IH3C 4IHJB 3I56V 3CCSV 2VQEO 3WB2A 2F4VB 3LSQA 2BTQB 4YIPA 1R3IC 3KCXA 3UO2A 3SJAC 4LFAO 4R50A 1I94B 3DSQA 5KA6A 5FL7G 2FTKA 4DR4B 4QJFB 4GX1A 4YHHO 4RQEA 4BIOA 3CRAA 4ICGA 3UT5A 1NR1A 2AXTZ 1AR1B 1E79G 1TUEB 2K1EA 2EINC 4JV5O 1GH6A 1QR8A 4FLUA 2Y4UA 1TVKA 2IJKA 2QWOB 5DM6V 4GKJO 2P4KA 2HJFC 4X62B 4O4HB 2QWQB 2EULA 4HAMA 4UUJC 1YJNV 4DV4O 1W59A 1M90W 3C3TA 1O9GA 5LHIA 1CEZA 4LC1A 1XILA 3DXRB 4LF6O 4PDLA 2UXCB 3ETQA 4B3TO 3L71H 3L70H 1CP9A 2Q7GA 3CE2A 1YJ9V 5JCOC 1L1FA 1R6KA 2QKCA 4DO2A 1SC5B 2CE4A 2RQ6A 1XOUA 3AG7A 2PI5A 5C8YA
chains in the Genus database with same CATH topology
1ROPA 1KQSU 2ITCC 3K06A 3G71V 4PDVA 4MSWC 1YIJV 1GMGA 1KKDA 1V55C 2EIKB 3CCUV 3ASNC 1OCZB 1VQ5V 2XAFA 2Q69A 2QM7A 2AHZA 4UVAA 3TCUA 4LP8A 4FMTA 1JX9A 1K34A 1S5HC 2OCCB 2XOKG 5LGTA 1YTFD 1MSWD 1XL4A 1K4CC 5B3SC 3HB3B 4JAVA 2H8PC 3AG3C 2WLMA 2Z5UA 3GB7C 3CCQV 3ASOC 2CK3G 1QLNA 3R65A 2P67A 5EBWC 2HVJC 3OR7C 2EZOA 3MHHC 1UJWB 3OFNG 5L3FA 1GM9A 1AI7A 3WG7C 2Q6AA 3ZMZA 1CPYA 1SZTA 2AHYA 3SYAA 3GWOA 2WAMA 2ZR3A 2XAJA 3K0GA 4GT1A 3I55V 3KG2A 4MVZA 1YHQV 1V55B 3SPCA 1S72V 5CA3A 5H9CA 3FYIB 3JD1A 2V1DA 3OR6C 5EC1C 3ASNB 1Q82W 1QVFU 1NH2D 3F7VC 3DTUB 3RVYA 2XAHA 2IW5A 4I5SA 4MVOA 2D3OW 1M9NA 5L3BA 3CCRV 5B3SB 2X6CA 3W7SA 2Y48A 3CD6V 4JTAB 3SYPA 3STZC 3AG3B 3OUSA 5H6RA 1W2BU 1S76D 3ASOB 5H6QA 1OCOC 4WFFA 3FKSG 4UXNA 4JYBA 4ZBMA 3OE7G 4UVCA 4JYCA 4PELA 3SYCA 1I5YA 1F4NA 3OAAG 3WG7B 2A79B 3H01A 4BIZA 3AG2B 3E86A 1AROP 1K33A 2IJHA 1AJPA 5KUKA 1F51A 4PA7A 2MK3A 3K9AA 4P9OA 2ZD9A 4BIUA 1FXKA 3K0DA 3W7UA 3LUTB 3E83A 2WLKA 1COWG 4MS2A 4PDRA 5HFLA 4MVSA 1MABG 4R6ZA 1BHBA 4EKWA 2XAQA 4WFGA 2DWDC 2JIZG 2NNUA 1Q86W 1S0VA 1K92A 3D36A 4G28B 2P6JA 4JPRA 3OEEG 1OCOB 2EZPA 3CCJV 4TT3G 2EIMC 2ZR2A 3STLC 5CBFA 2WPDG 2EILC 4RQFA 2JEXA 1AJNA 2DYRC 1JCHA 2WLIA 1H8HG 1RPOA 4JASA 3CYOA 3ZMSA 3LDDA 2OTLV 4MVMA 4WCEV 2LFSA 3QO5A 2A0LA 1YJWV 1QR9A 4QPKA 4F4LA 3CXCU 3OMNB 4QPJA 2ITDC 2JEUA 3A0RA 5CMUA 3OW2U 1KECA 3JD2A 1K9MW 4H33A 3F5WC 1VQ7V 1S3JA 2ZDIA 4WFEA 3CCVV 1LNQA 5IYBO 2B1IA 1NJIW 1VQKV 3B8NA 3LDEA 3CMEV 1K4DC 4J9YB 5C93A 1AI5A 1YITV 1Y4MA 4WFHA 1JQ0A 3B8MA 4R8CA 3LSSA 2EIMB 5KUMA 1QLEC 1I5XA 2EILB 4FIPC 2DYRB 5L3CA 4MVRA 1K3EA 4X88A 1R3LC 3FYEB 2YEVA 3K04A 3K3WA 4CBCA 1IXMA 2QM8A 4JTDB 1K5SA 3BEHA 3JD3A 1GM7A 3E8BA 2IU3A 2WSSG 4MVUA 2WLLA 3UM7A 2IJIA 3VBBA 4X8AA 1VQNV 3QNEA 5KA5A 1F4MA 1EBOA 1F23A 1N8RW 3M99B 3CP1A 2Y69C 1RM1C 4MTXA 2EIJC 4WFBV 1VQ4V 4RAIA 3UKMA 1YI2V 4PA9A 5B1AC 4XDKA 2WLIB 3ABMC 3FB7C 1Q81W 2IU0A 3HPLC 3FB5C 3CCMV 1PD3A 1M57C 5BZBA 1NKDA 5B1NA 3G6EV 4X89A 1VQ8V 2B5UA 4N23A 4I9WA 1M56C 2EBOA 1QLEB 3IC7A 1NH2B 1NR7A 3SPGA 1BHAA 3EFFK 4XDJA 1FXVA 2P7TC 1S77D 1KD1W 1FFTB 1MOFA 2X0LA 1WPXA 3CC7V 1DLBA 4KUMA 3K03A 3SPIA 3QO8A 3ZN1A 4JF3A 4MTFA 1FS0G 4N21A 2Y69B 2X6AA 5EK0A 1RM1B 2PI5A 2EIJB 3FB6C 4DXWA 2F43G 5B1OA 5B1BC 5B1AB 4XDLA 4PA4A 4ASUG 3FB8C 3ABMB 5J9PC 3JYCA 3ABKC 1M57B 2JJ2G 1K73W 1B6QA 1OCRC 2QKSA 2WLLB 2JJ1G 4JAUA 5CN0A 3E89A 1GK9A 1M56B 1WLEA 2X6BA 1VQPV 1Q7YW 4Z1MG 2LP7A 3G4SV 4KP4A 1ZWIC 4LCUC 4MW3A 4QE7A 3ABUA 3ZMUA 3AG1C 3F7YC 1JVMA 4TSFG 2QEXV 3E8HA 3NXSA 4YXWG 3IFXA 1ENVA 2R9RB 1EFRG 5IDJA 2WLJA 2WWWA 4E2LA 2DW4A 1NVPD 1G4YB 3IGAC 2HVKC 3BY6A 2ZXWC 5CBHA 3W7XA 1DTOA 2BOCC 1FXKC 4QIWF 2YSUB 2PI4A 3E35A 2DYSC 5B1BB 4QNHB 4J9ZB 1XL6A 3ZRSA 1DF5A 3T4DA 1H38A 3JD0A 2GHYA 5L3GA 3E2EA 2C2AA 5IY5C 1VQLV 3ABKB 1GTOA 3TK1A 3OM3B 2EIKC 3LNMB 1OCRB 4TWKA 5LGUA 4P9PA 1YSCA 2DQ3A 3X2QC 1K8AW 3P30A 3RBZA 3E8FA 4GX0A 3T1CA 1JPXA 4JTCB 2P90A 3ETDA 4PDMA 3AG1B 3CCEV 2IH1C 3ZN0A 1HWYA 4GCZA 1AI6A 1BL8A 4LBEC 3ETEA 1GM8A 2M7WA 1SETA 3ZCCA 1P4RA 2BOBC 3ZMTA 5EBMC 3ZIAG 2QE7G 1W0KG 4QE9A 4ZKIA 1V54C 3VOUA 4P30A 3EHBB 2LFRA 2ZXWB 1R73A 4UV9A 2A9HA 5IYCO 1FXKB 2OTJV 1AJQA 4BW5A 1PNKA 1SESA 2DYSB 4KFMA 3OGCC 4L87A 4OXSA 4FK5C 2ZDIC 1YTFB 4MTOA 4BAYA 4GX2A 3CCLV 3T2MA 5IY5B 5DN6G 1PL0A 3CC4V 1H8EG 2XNDG 3RVZA 3JCZA 3MD0A 4JGSA 5LBQA 3ZRWA 1VQMV 3K79A 3SYQA 5L3EA 2ATKC 3X2QB 1E1RG 4G2KA 2UXNA 3W7TA 3CMAV 1EZJA 4R7CA 3SPHA 2HG5C 2W0FC 1KC8W 3K08A 1K97A 2R9IA 2H94A 3OMAB 4UVBA 5GW7A 2QA4V 2HLDG 1PNMA 3ABTA 3CPWU 4RUFA 3CC2V 1GO3F 3SPJA 5LGNA 1ORQC 1E1QG 1JOYA 1K7DA 3JD4A 1SRYA 1R3JC 3B77A 5EBLC 5L3DA 2KB1A 4MT8A 3ML0A 1KP3A 3ZJZA 1VQ9V 2UXXA 4U7NA 1V54B 1JJ2U 2WLHA 3E8GA 2JK5C 2B1GA 1OZ0A 4Q20A 3OEHG 4U7OA 1QVGU 5HFMA 2Q67A 4RO2A 3AG2C 3OMIB 3ZRVA 3RW0A 2HFEC 1PKXA 4P2ZA 2OT5A 3ZRXA 5LHGA 1NQTA 4RUEA 1QCEA 2XAGA 2HR3A 3DGEA 4WF9V 3QO7A 3AG4C 1PNLA 2IH3C 3I56V 3CCSV 5EC2C 2XASA 1H2GA 2W6JG 3LSQA 1R3IC 2WLNA 4CZZA 2YEVB 3TETA 4R50A 4UV8A 5KA6A 5FL7G 5IYDO 3WFVA 2FTKA 1Y66A 1J95A 1G8MA 3ZMVA 1KP2A 1OHHG 1P7BA 4QJFB 3ABLC 3ETGA 4FJCC 4GX1A 2W6IG 3ZRWB 4RQEA 2DWEC 4HYOA 1NR1A 3T4ZA 2V7QG 3D3IA 1AR1B 1E79G 1TUEB 1BMFG 2EINC 2K1EA 1QR8A 4HZ3A 1W0JG 2IJJA 3SYOA 1VQ6V 2IJKA 1R6NA 3OUFA 1MG1A 4GX5A 3PJSK 4MVQA 4WFAV 1RPRA 5DM6V 2ZQMA 3AG4B 2HJFC 3W7WA 3P32A 1NVPB 4G27B 4HAMA 4MTGA 4UUJC 1YJNV 1OCCC 1GKFA 2Z3YA 2HKOA 2X7RB 2Q68A 2JDIG 1AI4A 1M90W 2DQ0A 5LHIA 1K5QA 1CEZA 1SERA 3AEIA 4LC1A 1OCZC 4PDLA 1M1KW 1FXHA 3ABLB 5CBGA 1R3KC 4PA6A 2OCCC 3SJQC 4PA3A 1THZA 1CP9A 2EINB 3LDCA 1YJ9V 2GSMB 1L1FA 3MHSC 5LHHA 5E1AC 1R6KA 4H37A 4FPPA 4DO2A 4XBFA 2QTOA 1QBZA 2NLJC 1NBMG 1VQOV 1OCCB 1DF4A 4MW8A 2EJRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCQ V;  1KQS U;  1JJ2 U;  3G71 V;  1VQ6 V;  3CCL V;  2D3O W;  1YIJ V;  3CC4 V;  1NJI W;  1VQK V;  3CME V;  3CCR V;  1N8R W;  4WFA V;  5DM6 V;  1QVG U;  3CCE V;  1VQM V;  3CCU V;  1K73 W;  1KD1 W;  1YIT V;  3CD6 V;  2OTL V;  1VQ5 V;  4WFB V;  3CMA V;  1YJ9 V;  3CC7 V;  4WCE V;  1VQ4 V;  1YJN V;  1W2B U;  1YI2 V;  1KC8 W;  1Q7Y W;  1VQP V;  1YJW V;  3G4S V;  2QA4 V;  3I55 V;  3CPW U;  1R73 A;  3CXC U;  1VQL V;  1YHQ V;  1S72 V;  1Q81 W;  1M90 W;  2OTJ V;  4WF9 V;  3CC2 V;  1Q86 W;  3CCM V;  3OW2 U;  1Q82 W;  1K9M W;  2QEX V;  1VQO V;  1QVF U;  3G6E V;  1VQ8 V;  1VQ7 V;  3I56 V;  3CCS V;  1K8A W;  1VQN V;  3CCV V;  1M1K W;  3CCJ V;  1VQ9 V; 
#chains in the Genus database with same CATH topology
 2ITC C;  1S5J A;  3O9O A;  1EN5 A;  3B40 A;  4CH6 A;  1VQ5 V;  2XAF A;  2CGN A;  2QM7 A;  4LP8 A;  2W0X A;  4FMT A;  3RYH A;  1S5H C;  2OCC B;  2GTS A;  4K35 A;  1UPG A;  4JZ2 A;  5B3S C;  4UCU A;  4O2B B;  1G1X B;  5LMN B;  3QVN A;  2GUZ B;  2G38 A;  3VQV A;  4DV5 O;  3U10 A;  3N27 A;  2P67 A;  1Q8I A;  4DV2 B;  1GM9 A;  1AI7 A;  2Q6A A;  3ZMZ A;  1CPY A;  1SZT A;  2CTW A;  4ZOL B;  3K0G A;  5IT9 N;  1V55 B;  1S72 V;  4JAA A;  5CA3 A;  3T1Y O;  4O4I B;  1NH2 D;  5ITZ B;  4U3J B;  4DK1 A;  2YI9 A;  4JI7 O;  1AP6 A;  1M9N A;  4LF7 B;  5L3B A;  1Y74 A;  1I7F A;  1I0H A;  1US6 A;  1GN6 A;  2X6C A;  3CD6 V;  5LOV B;  3STZ C;  5H6R A;  1Q6U A;  3JAW B;  1Y67 A;  4UXN A;  4FFB B;  4TUY A;  3BVO A;  4IIJ A;  4PEL A;  3SYC A;  1I5Y A;  3OAA G;  1VAR A;  4O4L A;  5FNV B;  3E86 A;  5EZY B;  2CDY A;  4PA7 A;  1Q6H A;  2GBO A;  5EIB C;  4BIU A;  3K0D A;  3UQ8 A;  4LF8 B;  1XI1 A;  1LUV A;  2QKA A;  4FM1 A;  3K5M A;  1M5I A;  5BMV B;  3CJH A;  4WFG A;  1L0L H;  2JIZ G;  2P6J A;  3RYC A;  1WA8 B;  3IAY A;  1WP8 A;  5CBF A;  3STL C;  4O4J A;  1XHZ A;  2JEX A;  4DV7 B;  1JCH A;  3D8C A;  4J80 A;  1H8H G;  1RPO A;  3PN1 A;  3M8A A;  2KG7 B;  4L8J A;  2LFS A;  4AQY B;  4KHP B;  3HR0 A;  2JVD A;  2A0L A;  1YJW V;  2PZS A;  2CAZ C;  1HW7 A;  2JEU A;  3A0R A;  4DW0 A;  3OW2 U;  1KEC A;  3JD2 A;  3TGU H;  2NR5 A;  1K9M W;  4H33 A;  1S3J A;  2ZDI A;  4WFE A;  4DK0 A;  3N2K A;  1V9P A;  3CCV V;  2B1I A;  4CS2 A;  1IDS A;  3Q4H B;  3UT5 B;  1Y4M A;  1ZTE A;  5LXT A;  3LSS A;  2N05 A;  1TVK B;  4A5U B;  2ZKO A;  4MVR A;  1K3E A;  4X88 A;  4NTY A;  3FYE B;  1K5S A;  3BEH A;  1GM7 A;  3E8B A;  1Q90 D;  2WLL A;  3UM7 A;  5JJE B;  2YIB A;  1UFI A;  1YXB A;  3CP1 A;  1DGS A;  4AHC A;  2Y69 C;  1RM1 C;  2EIJ C;  1RFY A;  2ZM6 O;  5B1A C;  1IUR A;  1FFX A;  4NXM B;  3ABM C;  1Q81 W;  3THO A;  3CCM V;  4JI5 O;  1VQ8 V;  4I9W A;  1M56 C;  1QLE B;  1EZV H;  1BS3 A;  1NH2 B;  1NR7 A;  3H1I H;  1BHA A;  4XDJ A;  1FXV A;  2P7T C;  1S77 D;  4B3M O;  2UUC O;  3OD4 A;  5EYP B;  1WPX A;  1IBM B;  1DLB A;  4KUM A;  4QGP A;  5C8Y B;  5BR8 B;  1HNZ B;  3OTF A;  3F5T A;  2D2C B;  5EK0 A;  4NXN B;  1IBL O;  3S3W A;  4DR3 O;  5B1O A;  2XT9 A;  4PA4 A;  3FB8 C;  3ABK C;  4TQD A;  2ADP A;  2JJ2 G;  3CXH F;  1B6Q A;  1OCR C;  1BGY H;  2PYJ A;  2N74 A;  1FJG O;  1RSO A;  4F6R B;  3G4S V;  4KP4 A;  1ZWI C;  2OIG A;  5CA1 A;  4LCU C;  1OV9 A;  3ZMU A;  3AG1 C;  3F7Y C;  2CGO A;  1ENV A;  1EFR G;  4GLX A;  2ADQ B;  1Q5O A;  2WWW A;  1N34 B;  1BQ0 A;  4F6E A;  3J7A U;  2Q8V A;  5AG2 A;  5J2U A;  1J5E B;  3ZRS A;  3CRC A;  3T4D A;  5KX5 A;  2CTQ A;  3BA9 A;  3FFQ A;  2C2A A;  4TWK A;  3LNM B;  2UUA O;  3R66 A;  1P7G A;  2IM9 A;  3P30 A;  2RCV A;  4GX0 A;  4TUY B;  3T1C A;  4IIJ B;  4JTC B;  4O4L B;  5EIB D;  5LP6 C;  3ETD A;  4PDM A;  5JWP A;  1AI6 A;  1BL8 A;  1MZF A;  3L73 H;  2BOB C;  4X65 O;  4IHJ A;  4QE9 A;  3VOU A;  3EHB B;  2LFR A;  2ZXW B;  4JI3 B;  1AJQ A;  2P4V A;  1PM9 A;  2DYS B;  4L87 A;  4OXS A;  4FK5 C;  4B3S O;  4BAY A;  5IY5 B;  3CJH B;  1PL0 A;  1Z5V A;  1VQM V;  3RYC B;  1CXZ B;  1PV0 A;  3W7T A;  3CMA V;  1EZJ A;  3SPH A;  5CA0 B;  1KC8 W;  3K08 A;  1NTM H;  4O4J B;  1K97 A;  1IXB A;  4FZ1 A;  5GTH Z;  2QA4 V;  1PNM A;  4LWS A;  4DR7 O;  5B5E Z;  1E1Q G;  1K7D A;  2ZIO A;  1SRY A;  1R3J C;  2KB1 A;  1KP3 A;  2Y4T A;  1VQ9 V;  2UXX A;  5D5Q A;  2V4D A;  2WLH A;  3E8G A;  4U7O A;  1JMK C;  2ZCE A;  2DN9 A;  3N2K B;  3RW0 A;  4P2Z A;  5KHI A;  1NQT A;  4RUE A;  2XAG A;  1N36 O;  2HR3 A;  4WF9 V;  1PNL A;  4BWA A;  1MMM A;  5EC2 C;  2XAS A;  1H2G A;  2PGG A;  2WLN A;  5JJJ B;  4TV9 B;  3TET A;  1XMO B;  3HKC B;  1N33 O;  1N0J A;  3WU2 Z;  1Y66 A;  3K9S A;  1J95 A;  3SR2 C;  3ZMV A;  1OHH G;  1P7B A;  1ZSP A;  2DJV A;  5CB4 A;  2W6I G;  2E5L O;  2DWE C;  4HYO A;  4CC5 A;  3H1J H;  3T4Z A;  2V7Q G;  4JI8 O;  4Q6G A;  2M6Y A;  1BMF G;  4IYI A;  1ZUQ A;  1AP5 A;  4DR5 O;  1XNQ O;  1FFX B;  1VQ6 V;  3A0H Z;  3OUF A;  3P3P A;  1MG1 A;  3RT3 C;  3AG4 B;  4JI2 B;  4MTG A;  1OCC C;  2Z3Y A;  2HKO A;  2HEP A;  4EFE A;  2DQ0 A;  4OX9 O;  1OCZ C;  2PY5 A;  1M1K W;  1FXH A;  3KKY A;  3ZHU A;  2F1M A;  3ABL B;  5CBG A;  4NVP A;  4PI0 A;  4PA3 A;  4X9Q A;  3LDC A;  4O4I A;  1BE3 H;  3MHS C;  5ITZ A;  4H44 B;  1F7Y A;  4X66 O;  5E1A C;  3BA8 A;  4H37 A;  1QBZ A;  4U3F H;  2NLJ C;  3IC9 A;  4FM2 A;  2VS0 A;  4JI0 O;  1RSO B;  1SS3 A;  1DF4 A;  3B09 A;  3K06 A;  5CA1 B;  1YIJ V;  1YDX A;  1KKD A;  3CHX A;  5FNV A;  2Q69 A;  3TCU A;  1K34 A;  5KLV H;  2BSK A;  3ZBH A;  1YTF D;  1XL4 A;  1K4C C;  4JAV A;  5J2U B;  1L0N H;  1QQC A;  1WB8 A;  5KX5 B;  1LUW A;  2Z5U A;  2ZIN A;  2P06 A;  3B2E E;  1SKV A;  5EBW C;  3MDS A;  4JI4 B;  4DR6 O;  1NTK H;  1WNS A;  2CUG A;  2Q73 A;  4DYL A;  2XAJ A;  1U96 A;  4GT1 A;  3I55 V;  2ZE5 A;  2KKW A;  2YXL A;  3AK2 A;  1U97 A;  5H9C A;  2PF4 E;  2V1D A;  3JSL A;  3OR6 C;  5EC1 C;  2Q0O C;  3ASN B;  2FB5 A;  5A9G A;  3RVY A;  2KG7 A;  2HHH B;  4X1K B;  1VF6 C;  2UU9 O;  2Y48 A;  2UXB B;  3AG3 B;  3OUS A;  3MAQ A;  2ZE7 A;  1S76 D;  3ASO B;  5H6Q A;  4WFF A;  1OJH A;  3FKS G;  5A2Q N;  5KHG A;  4ZBM A;  3WG7 B;  3Q4H A;  3AG2 B;  1PL4 A;  1K33 A;  4TQF A;  1N4C A;  2IJH A;  2QR4 A;  1AIL A;  1H2N A;  1WPB A;  5KUK A;  3JAS A;  1F51 A;  4O2A A;  4JI1 O;  4OPH A;  4LWS B;  3W7U A;  2F93 B;  1COW G;  1IVS A;  4MS2 A;  1QU7 A;  2ZE8 A;  1H2L A;  1S5L Z;  4EKW A;  2XAQ A;  4K0K O;  1K92 A;  3D36 A;  4JPR A;  3OEE G;  4DV1 O;  5IJ9 B;  1OCO B;  2F95 B;  1M93 A;  2DYR C;  4JAS A;  1D5A A;  1Q43 A;  2FL4 A;  3RFR A;  4DV3 O;  4B3R O;  3QO5 A;  3APO A;  4X64 O;  1B06 A;  3ZS8 C;  3I5D A;  3SDL A;  4QPK A;  3CXC U;  2HP8 A;  2ITD C;  1JR9 A;  5CMU A;  3CRM A;  3F5W C;  4E4E A;  5EYP A;  4B7E A;  2OIE A;  5IYB O;  5CB4 B;  4DUY B;  1AR4 A;  1NJI W;  1B3Q A;  1K4D C;  2LJ2 A;  1JQ0 A;  1SQF A;  2EIM B;  2EIL B;  2DMX A;  3EXA A;  3L75 H;  1R3L C;  1XDC A;  4JTD B;  3G67 A;  4B08 A;  2IU3 A;  5IWA O;  3JAL B;  4F6R A;  5KA5 A;  4BW9 A;  3M99 B;  1ZL8 A;  4MTX A;  4WFB V;  4DR1 B;  3J80 N;  1YI2 V;  2QWP B;  2ARH A;  4NTW A;  4XDK A;  2WLI B;  1GRJ A;  3L74 H;  2IU0 A;  2YC0 A;  1PD3 A;  1NKD A;  5B1N A;  3KCY A;  2EBO A;  1N32 B;  1GAX A;  1GN3 A;  1KYO F;  1HR0 O;  4J7K A;  1KD1 W;  1SQG A;  5JVD B;  2XTA A;  3SPI A;  4MTF A;  1FS0 G;  3LSU A;  2X6A A;  4LF4 O;  1Y76 B;  3M7M X;  4DXW A;  2Z0A A;  3OTO O;  2XHB A;  2BSK B;  1AB3 A;  1IBK O;  4YJ3 A;  3S3X A;  1M57 B;  1KBH A;  1K73 W;  3C3S A;  2OWO A;  3K5O A;  3E89 A;  1GK9 A;  2Y0I A;  2X6B A;  1VQP V;  2LP7 A;  1VMG A;  4GKK B;  4ZI7 B;  4TOI A;  2QEX V;  4YXW G;  2R9R B;  1HNW O;  2CTR A;  3QTC A;  5CA0 A;  2DW4 A;  1NVP D;  3IGA C;  4WBN A;  3BY6 A;  2BOC C;  1FXK C;  3TJT A;  3E35 A;  5B1B B;  4QNH B;  5JCO A;  4DR2 O;  4K8Z A;  1DF5 A;  3RYF A;  1H38 A;  3JD0 A;  1GN4 A;  3N2G B;  1VQL V;  4AI8 A;  4LF5 B;  3TK1 A;  1WAZ A;  1K8A W;  3RBZ A;  2R70 A;  4YJ2 A;  3E8F A;  1JPX A;  1MZE A;  5LMU O;  3CCE V;  3ZN0 A;  1HWY A;  4GCZ A;  2EJ7 A;  2M7W A;  1SET A;  1XMQ O;  3JAS B;  4O2A B;  5B66 Z;  1W0K G;  2UXD B;  1R73 A;  5IYC O;  2A9H A;  2Q7E A;  1H2K A;  4TV9 A;  4KFM A;  2RNB A;  2F4V O;  3OGC C;  1HNX B;  3HKC A;  4W4L A;  4UB6 Z;  1AR5 A;  3T2M A;  1KU9 A;  1H8E G;  3D3Q A;  1I94 O;  2Q0A A;  3JCZ A;  4UCV A;  2YXH A;  3K79 A;  4X1I B;  5L3E A;  3X2Q B;  1E1R G;  4G2K A;  4DR4 O;  2VQF B;  2HG5 C;  5FPR A;  2R9I A;  2OYQ A;  5GW7 A;  4UVB A;  2HLD G;  1PP9 H;  3BCC H;  3ABT A;  4NYK A;  3CPW U;  1FKA O;  3E22 A;  3SPJ A;  5LGN A;  3T1H B;  4CH4 A;  3JD4 A;  2PYL A;  5EBL C;  5L3D A;  4MT8 A;  3ZJZ A;  1JJ2 U;  1V54 B;  4DV0 B;  4FLV A;  4X62 O;  1OZ0 A;  1TUB A;  3AG2 C;  3ZRV A;  4DUZ B;  5DEC A;  3LNN A;  3JAK A;  3DGE A;  2NN4 A;  2UXC O;  4HBN A;  3ZHQ A;  2W6J G;  4LF9 B;  1EN4 A;  3A8T A;  1JA8 A;  4DRX A;  4YY3 B;  5IYD O;  3WFV A;  1L8D A;  1G8M A;  1XNR B;  1KP2 A;  5FPO A;  4JYY A;  4FJC C;  3ZRW B;  1ZL8 B;  3OGI B;  1ZLZ A;  4CS4 A;  4LH7 A;  4H0L B;  1NT2 B;  3D3I A;  4HZ3 A;  2IBZ H;  3JCU Z;  2FYU H;  4WFA V;  1RPR A;  5BY1 A;  1NVP B;  3ZHR A;  4G27 B;  4JYA B;  4DV6 B;  1GKF A;  4LH6 A;  2UUB B;  4J7J A;  5LMN O;  1SER A;  1MSD A;  3AEI A;  3JAM N;  4JI6 B;  2VQE B;  4K8X A;  1R3K C;  4DV2 O;  3VQY A;  4IYH A;  2OCC C;  1Z2G A;  1URF A;  3FX7 A;  1THZ A;  1LR1 A;  2EIN B;  2GSM B;  1WJZ A;  4I0X A;  3AK3 A;  1DK1 A;  4LFA B;  2QM4 A;  5LHH A;  4YJ3 B;  2JS5 A;  3BFR A;  4FLY A;  2AW9 A;  4YHH B;  2QTO A;  4X1K A;  4LF7 O;  2EJR A;  1KQS U;  4JV5 B;  2EX3 A;  4PDV A;  1GMG A;  1SA0 A;  1V55 C;  5F2V O;  2EIK B;  3CX5 F;  4GKJ B;  3A0B Z;  4UVA A;  4WBN B;  2XOK G;  4DV4 B;  5KAI Z;  4EB6 A;  2WLM A;  3RYF B;  3GB7 C;  3CCQ V;  3IJ4 A;  2CK3 G;  4LF6 B;  3R65 A;  4LF8 O;  3OR7 C;  4B3T B;  2EZO A;  2PTM A;  3MHH C;  3OFN G;  5L3F A;  4X20 A;  1R1B A;  4YJ2 B;  2QGN A;  3SYA A;  1XEQ A;  5IJ9 A;  1Y6X A;  4MVZ A;  4C7U A;  3ZHS A;  1YHQ V;  3SPC A;  3JD1 A;  1QVF U;  3RN4 A;  3F7V C;  3DTU B;  1NI8 A;  2A7W A;  2CH7 A;  4DV7 O;  4MVO A;  2YS8 A;  3GWK C;  3CCR V;  5B3S B;  2BTO A;  4AQY O;  4KHP O;  3W7S A;  3SYP A;  1W2B U;  3G6B A;  3H1H H;  1A32 A;  3OE7 G;  4UVC A;  4JYC A;  3BAB A;  2AZ2 A;  1BSM A;  1AJP A;  1XRE A;  3J81 N;  5IJ0 B;  2LW7 A;  4P9O A;  4DV5 B;  4K3A A;  3E22 B;  4CH5 A;  3LUT B;  2WLK A;  4LNU A;  5HFL A;  4OPA A;  1MAB G;  1BHB A;  5H2F Z;  4PV1 B;  4I50 A;  1JFF A;  2GDS A;  3JAL A;  4I4T B;  2DWD C;  2ILM A;  1TUB B;  2ZNI A;  2NNU A;  5KHJ A;  5JH7 A;  1Q86 W;  3SJC C;  1S0V A;  1QHT A;  3T1Y B;  2EZP A;  1MNG A;  2ZR2 A;  3JAK B;  1H2M A;  4RQF A;  5LP6 A;  1AJN A;  2WLI A;  4JI7 B;  1SQB H;  3RYI B;  3ZMS A;  5LA6 A;  3LDD A;  2OTL V;  4MVM A;  4WCE V;  4NXM O;  2FML A;  2ODM A;  2B9Z A;  3JSN A;  4F4L A;  2JS3 A;  2VRZ A;  4DRX B;  5KAF Z;  4FLZ A;  4PI2 A;  1VIB A;  1X59 A;  1HDJ A;  5JVD A;  4H13 B;  3B8N A;  3LDE A;  4J9Y B;  3SGI A;  1IBM O;  4GUN A;  5BR8 O;  1HNZ O;  1Y76 A;  5KHK A;  2KSD A;  1QLE C;  1H2S B;  5L3C A;  4NXN O;  3NR7 A;  3TXQ A;  2YEV A;  1IXM A;  1BQZ A;  1VQN V;  3VBB A;  3OT7 A;  1XUQ A;  4ZI7 A;  3VQW A;  4RAI A;  4RWU A;  3UKM A;  4I7Z B;  4ZHQ A;  4CS3 A;  1T5E A;  3FB5 C;  2LW1 A;  5BZB A;  4I0X B;  2B5U A;  1N34 O;  2PUS A;  4TV8 A;  1Z5W A;  3SPG A;  3EFF K;  4Z1V A;  3N2G A;  1J5E O;  2ZIM A;  1MOF A;  5IE9 A;  2N04 A;  3K03 A;  1SA0 B;  2AGA A;  4N21 A;  1P84 F;  4FLW A;  2Y69 B;  5KMG A;  1RM1 B;  2EIJ B;  2ETN A;  3L9D A;  5B1A B;  1WN7 A;  3ABM B;  3JYC A;  3P3N A;  5K1P A;  4EB6 B;  1M56 B;  4GZR B;  1WLE A;  4JI3 O;  4Z1M G;  1KMI Z;  3GVM A;  2ZM6 B;  1YVW A;  5J2T A;  1SQX H;  4QE7 A;  4X20 B;  3APQ A;  4TSF G;  1QNM A;  1YF2 A;  2WA4 A;  4X1I A;  5IDJ A;  3ZHT A;  4JI5 B;  4E2L A;  2HVK C;  4JZG A;  2ZXW C;  5CBH A;  1DTO A;  4I55 A;  4QIW F;  3UO3 A;  2YSU B;  4D7S A;  2DYS C;  4YIO A;  2JGD A;  4B3M B;  2UUC B;  1XL6 A;  2QTS A;  2CH7 B;  5IYZ A;  5L3G A;  2GHY A;  3E2E A;  5IY5 C;  3ABK B;  3AK1 A;  2EIK C;  1OCR B;  4P9P A;  2K9P A;  1YSC A;  3BAA A;  3H1L H;  1IBL B;  4DR3 B;  1WP7 A;  4FFK A;  2L6L A;  3AG1 B;  3WB0 A;  2IH1 C;  1TGO A;  1GN2 A;  3ETE A;  1GM8 A;  2P22 C;  3ZCC A;  1P4R A;  3ZMT A;  5E79 Z;  4IL6 Z;  3ZIA G;  2QE7 G;  4EEQ A;  2LO1 A;  3DC6 A;  4ZKI A;  1FJG B;  2MW2 B;  4P30 A;  1NTZ H;  4UV9 A;  4UCS A;  1D2D A;  4LNU B;  2ZDI C;  1YTF B;  4MTO A;  2YID A;  2P5O A;  4GX2 A;  4I50 B;  1JFF B;  5DN6 G;  3QF7 A;  1XMO O;  4UCT A;  5JH7 B;  4JGS A;  5LBQ A;  3ZRW A;  3SYQ A;  2F23 A;  2QWR B;  2W0F C;  2JGU A;  5LP6 B;  4RUF A;  1PPJ H;  5LA6 B;  2QWN B;  1ORQ C;  1NZ6 A;  3HKE A;  2UUA B;  5D5P A;  1P49 A;  2JK5 C;  3U0Z A;  4JI2 O;  1VF6 A;  1QVG U;  5HFM A;  5DED A;  2Q67 A;  3OMI B;  2ZE6 A;  4EFB A;  2E75 B;  2OT5 A;  3ZRX A;  4X65 B;  3QO7 A;  3AG4 C;  4I9Q A;  4FVM A;  4LFB B;  2BCC H;  2QJ1 A;  3RGB A;  1ZAU A;  1JJO A;  4B3S B;  1YCI A;  4CZZ A;  2YEV B;  2A06 H;  2F66 C;  4UV8 A;  5LYJ A;  2RMK B;  3ZX6 A;  3ABL C;  3ETG A;  3UCS C;  3KZI Z;  4NTX A;  2VWK A;  4X1Y A;  4LFC B;  4DR7 B;  3ZHV A;  4J11 A;  4ABM A;  1W0J G;  1XHX A;  2IJJ A;  2ZT9 B;  3SYO A;  3QG5 A;  4ZHQ B;  1R6N A;  4GX5 A;  3PJS K;  4MVQ A;  2ZQM A;  3W7W A;  4ZIB A;  2YI8 A;  1B04 A;  3P32 A;  4TV8 B;  1RP3 B;  2X7R B;  4IT5 A;  2Q68 A;  2JDI G;  4Z2W A;  1AI4 A;  2WA3 A;  1N36 B;  1K5Q A;  2BE3 A;  5GON B;  4UB8 Z;  4UCR A;  4JI4 O;  3BRC A;  4PA6 A;  5KMG B;  3SJQ C;  1SQQ H;  3HKD A;  4OGQ B;  1N33 B;  1KB9 F;  3JAR A;  1MA1 A;  2GV9 A;  4FPP A;  4XBF A;  4W4K A;  2E5L B;  5JQG A;  1NBM G;  2Q4P A;  1VQO V;  1VF7 A;  2HHH O;  1OCC B;  4JI8 B;  1UJW B;  4MW8 A;  5GTI Z;  1ROP A;  3G71 V;  2YXY A;  4MSW C;  5TIS Z;  4DR5 B;  5J2T B;  3G80 A;  1XNQ B;  2UXB O;  3CCU V;  3ASN C;  1OCZ B;  2ZNJ A;  1NS1 A;  3K5N A;  2AHZ A;  2QSA A;  1JX9 A;  5LGT A;  5IJ0 A;  4I55 B;  1MSW D;  3HB3 B;  1NU1 H;  2H8P C;  2RN9 A;  1FD9 A;  2JGD B;  1TA8 A;  2O57 A;  4OX9 B;  3AG3 C;  5IYZ B;  2LQT A;  3ASO C;  1QLN A;  4FLX A;  2QDO A;  3CRQ A;  2HVJ C;  5K1X A;  2Q5Z A;  2KQX A;  4I4T A;  3WG7 C;  2Y0P A;  2Q9L A;  4D6T H;  2RDC A;  2AHY A;  3GWO A;  2WAM A;  2ZR3 A;  1ZX3 A;  3KG2 A;  1HP8 A;  2XUM A;  3FYI B;  4X66 B;  1Q82 W;  3WB1 A;  4J10 A;  3RYI A;  3CB2 A;  2XAH A;  2IW5 A;  4JI0 B;  4I5S A;  2D3O W;  1G6U A;  1AVM A;  1O9H A;  4PD4 F;  3HKB A;  4JTA B;  4DW1 A;  2OCH A;  1OCO C;  3A2F A;  4JYB A;  1F4N A;  2A79 B;  3H01 A;  4BIZ A;  4PHZ A;  4CH3 A;  1ARO P;  4DUY O;  3DC5 A;  1VF5 B;  3RYH B;  2MK3 A;  3K9A A;  2ZD9 A;  1BCC H;  1FXK A;  2YIB D;  3E83 A;  3HKE B;  4PDR A;  4LR3 A;  4MVS A;  4DR6 B;  4HNA A;  4R6Z A;  4AIL C;  4GYC B;  4NKG B;  3U11 A;  4G28 B;  3FAV A;  3BHP A;  3CCJ V;  1M4U A;  2JRI A;  4TT3 G;  2EIM C;  3L72 H;  4D7T A;  2WPD G;  2EIL C;  2E76 B;  1SZX A;  1R6T A;  4J41 A;  3CYO A;  4DR1 O;  1N0N A;  1XBL A;  2UU9 B;  1WB7 A;  1Y74 B;  1QR9 A;  3OMN B;  4QPJ A;  4B7K A;  2E3C A;  3JAT A;  1VQ7 V;  1XQ8 A;  5LYJ B;  2DE0 X;  1N32 O;  2HJD A;  1LNQ A;  3VQX A;  1VQK V;  3CME V;  4JI1 B;  5C93 A;  1AI5 A;  1Q6I A;  4X1Y B;  1KUQ A;  1YIT V;  4WFH A;  3B8M A;  4R8C A;  2Q7H A;  5KUM A;  1I5X A;  4FIP C;  4PJ0 Z;  2DYR B;  4LFB O;  2BTQ A;  2FKX A;  2R72 A;  3K04 A;  3K3W A;  4CBC A;  4K0K B;  2H3O A;  2QM8 A;  3CEI A;  2YDE A;  3JD3 A;  2WSS G;  4MVU A;  2IJI A;  4X8A A;  5JJN B;  4DV1 B;  3QNE A;  1F4M A;  1X4T A;  1EBO A;  1F23 A;  1N8R W;  1VQ4 V;  2E74 B;  4GKK O;  4PA9 A;  3K5L A;  4B3R B;  4DV3 B;  5H5N A;  4FLT A;  3FB7 C;  5FLX N;  4LFC O;  4X64 B;  3HPL C;  3HKD B;  1M57 C;  4O4H A;  3G6E V;  4X89 A;  2L35 A;  4N23 A;  1YZB A;  3JAR B;  3IC7 A;  5JQG B;  2YIA A;  1FFT B;  3O65 A;  2X0L A;  3CC7 V;  4NR1 A;  3K58 A;  3DXR A;  3FD9 A;  4FM0 A;  2LGQ A;  4LF5 O;  3QO8 A;  3ZN1 A;  4JF3 A;  4UFZ A;  3FB6 C;  5LXT B;  1BZK A;  2F43 G;  2LGW A;  5B1B C;  3C90 A;  4XDL A;  4ASU G;  5J9P C;  1VP7 A;  5IWA B;  2WLL B;  2QKS A;  2JJ1 G;  4JAU A;  5CN0 A;  2UXD O;  1Q7Y W;  2A3Q A;  4MW3 A;  1HNX O;  3ABU A;  1JVM A;  3K59 A;  3E8H A;  3SJB C;  3NXS A;  3IFX A;  2YIC A;  4CC6 A;  2CTP A;  2WLJ A;  1G4Y B;  3W7X A;  5LL6 Y;  2GTA A;  2VQF O;  2PI4 A;  1HR0 B;  2YUA A;  4J9Z B;  2RJZ A;  4O2B A;  2VWJ A;  1TAE A;  2AZ0 A;  2GUZ A;  2DOS A;  3T1H O;  1GTO A;  1VEW A;  4J42 A;  3H1K H;  3OM3 B;  5LGU A;  3D36 C;  3HKB B;  1D5N A;  1EN6 A;  1SF9 A;  2DQ3 A;  3X2Q C;  4LF4 B;  1I08 A;  4DV0 O;  1FPO A;  4ZOL A;  3CRR A;  1EM1 A;  5KHH A;  3OTO B;  2P90 A;  4DUZ O;  3ZED A;  1IBK B;  4LBE C;  1IZ3 A;  3K57 A;  3CSX A;  4U3J A;  5EBM C;  1V54 C;  1FAF A;  1FXK B;  2OTJ V;  3H9V A;  4BW5 A;  1PNK A;  1SES A;  1FYJ A;  4HNA B;  4LF9 O;  1IX9 A;  5LOV A;  3JAW A;  1HNW B;  3CCL V;  3CC4 V;  1YEW A;  4FFB A;  2XND G;  3RVZ A;  3BPZ A;  4KXR A;  1BT8 A;  4UCO A;  3MD0 A;  4YY3 O;  3FAV B;  2ATK C;  2UXN A;  1XNR O;  3EVK A;  3ICX A;  4R7C A;  5EZY A;  3CS5 A;  2H94 A;  3OMA B;  4DR2 B;  1KKC A;  3TXS A;  3CC2 V;  1GO3 F;  1JOY A;  4KL1 A;  4BR6 A;  3B77 A;  4J7Z A;  4NB5 A;  3ML0 A;  4U7N A;  2R9A A;  2B1G A;  5BMV A;  4Q20 A;  3OEH G;  4IGG A;  3JAT B;  3CWB H;  1SQP H;  4RO2 A;  4JYA O;  4DV6 O;  1Q3E A;  5LMU B;  2HFE C;  3B4S A;  3RWR D;  1PKX A;  5GON A;  1WA8 A;  5BXZ A;  1SQV H;  2UUB O;  1XMQ B;  5LHG A;  1QCE A;  4FZ0 A;  4JI6 O;  2IH3 C;  4IHJ B;  3I56 V;  3CCS V;  2VQE O;  3WB2 A;  2F4V B;  3LSQ A;  2BTQ B;  4YIP A;  1R3I C;  3KCX A;  3UO2 A;  3SJA C;  4LFA O;  4R50 A;  1I94 B;  3DSQ A;  5KA6 A;  5FL7 G;  2FTK A;  4DR4 B;  4QJF B;  4GX1 A;  4YHH O;  4RQE A;  4BIO A;  3CRA A;  4ICG A;  3UT5 A;  1NR1 A;  2AXT Z;  1AR1 B;  1E79 G;  1TUE B;  2K1E A;  2EIN C;  4JV5 O;  1GH6 A;  1QR8 A;  4FLU A;  2Y4U A;  1TVK A;  2IJK A;  2QWO B;  5DM6 V;  4GKJ O;  2P4K A;  2HJF C;  4X62 B;  4O4H B;  2QWQ B;  2EUL A;  4HAM A;  4UUJ C;  1YJN V;  4DV4 O;  1W59 A;  1M90 W;  3C3T A;  1O9G A;  5LHI A;  1CEZ A;  4LC1 A;  1XIL A;  3DXR B;  4LF6 O;  4PDL A;  2UXC B;  3ETQ A;  4B3T O;  3L71 H;  3L70 H;  1CP9 A;  2Q7G A;  3CE2 A;  1YJ9 V;  5JCO C;  1L1F A;  1R6K A;  2QKC A;  4DO2 A;  1SC5 B;  2CE4 A;  2RQ6 A;  1XOU A;  3AG7 A;  2PI5 A;  5C8Y A; 
#chains in the Genus database with same CATH homology
 1ROP A;  1KQS U;  2ITC C;  3K06 A;  3G71 V;  4PDV A;  4MSW C;  1YIJ V;  1GMG A;  1KKD A;  1V55 C;  2EIK B;  3CCU V;  3ASN C;  1OCZ B;  1VQ5 V;  2XAF A;  2Q69 A;  2QM7 A;  2AHZ A;  4UVA A;  3TCU A;  4LP8 A;  4FMT A;  1JX9 A;  1K34 A;  1S5H C;  2OCC B;  2XOK G;  5LGT A;  1YTF D;  1MSW D;  1XL4 A;  1K4C C;  5B3S C;  3HB3 B;  4JAV A;  2H8P C;  3AG3 C;  2WLM A;  2Z5U A;  3GB7 C;  3CCQ V;  3ASO C;  2CK3 G;  1QLN A;  3R65 A;  2P67 A;  5EBW C;  2HVJ C;  3OR7 C;  2EZO A;  3MHH C;  1UJW B;  3OFN G;  5L3F A;  1GM9 A;  1AI7 A;  3WG7 C;  2Q6A A;  3ZMZ A;  1CPY A;  1SZT A;  2AHY A;  3SYA A;  3GWO A;  2WAM A;  2ZR3 A;  2XAJ A;  3K0G A;  4GT1 A;  3I55 V;  3KG2 A;  4MVZ A;  1YHQ V;  1V55 B;  3SPC A;  1S72 V;  5CA3 A;  5H9C A;  3FYI B;  3JD1 A;  2V1D A;  3OR6 C;  5EC1 C;  3ASN B;  1Q82 W;  1QVF U;  1NH2 D;  3F7V C;  3DTU B;  3RVY A;  2XAH A;  2IW5 A;  4I5S A;  4MVO A;  2D3O W;  1M9N A;  5L3B A;  3CCR V;  5B3S B;  2X6C A;  3W7S A;  2Y48 A;  3CD6 V;  4JTA B;  3SYP A;  3STZ C;  3AG3 B;  3OUS A;  5H6R A;  1W2B U;  1S76 D;  3ASO B;  5H6Q A;  1OCO C;  4WFF A;  3FKS G;  4UXN A;  4JYB A;  4ZBM A;  3OE7 G;  4UVC A;  4JYC A;  4PEL A;  3SYC A;  1I5Y A;  1F4N A;  3OAA G;  3WG7 B;  2A79 B;  3H01 A;  4BIZ A;  3AG2 B;  3E86 A;  1ARO P;  1K33 A;  2IJH A;  1AJP A;  5KUK A;  1F51 A;  4PA7 A;  2MK3 A;  3K9A A;  4P9O A;  2ZD9 A;  4BIU A;  1FXK A;  3K0D A;  3W7U A;  3LUT B;  3E83 A;  2WLK A;  1COW G;  4MS2 A;  4PDR A;  5HFL A;  4MVS A;  1MAB G;  4R6Z A;  1BHB A;  4EKW A;  2XAQ A;  4WFG A;  2DWD C;  2JIZ G;  2NNU A;  1Q86 W;  1S0V A;  1K92 A;  3D36 A;  4G28 B;  2P6J A;  4JPR A;  3OEE G;  1OCO B;  2EZP A;  3CCJ V;  4TT3 G;  2EIM C;  2ZR2 A;  3STL C;  5CBF A;  2WPD G;  2EIL C;  4RQF A;  2JEX A;  1AJN A;  2DYR C;  1JCH A;  2WLI A;  1H8H G;  1RPO A;  4JAS A;  3CYO A;  3ZMS A;  3LDD A;  2OTL V;  4MVM A;  4WCE V;  2LFS A;  3QO5 A;  2A0L A;  1YJW V;  1QR9 A;  4QPK A;  4F4L A;  3CXC U;  3OMN B;  4QPJ A;  2ITD C;  2JEU A;  3A0R A;  5CMU A;  3OW2 U;  1KEC A;  3JD2 A;  1K9M W;  4H33 A;  3F5W C;  1VQ7 V;  1S3J A;  2ZDI A;  4WFE A;  3CCV V;  1LNQ A;  5IYB O;  2B1I A;  1NJI W;  1VQK V;  3B8N A;  3LDE A;  3CME V;  1K4D C;  4J9Y B;  5C93 A;  1AI5 A;  1YIT V;  1Y4M A;  4WFH A;  1JQ0 A;  3B8M A;  4R8C A;  3LSS A;  2EIM B;  5KUM A;  1QLE C;  1I5X A;  2EIL B;  4FIP C;  2DYR B;  5L3C A;  4MVR A;  1K3E A;  4X88 A;  1R3L C;  3FYE B;  2YEV A;  3K04 A;  3K3W A;  4CBC A;  1IXM A;  2QM8 A;  4JTD B;  1K5S A;  3BEH A;  3JD3 A;  1GM7 A;  3E8B A;  2IU3 A;  2WSS G;  4MVU A;  2WLL A;  3UM7 A;  2IJI A;  3VBB A;  4X8A A;  1VQN V;  3QNE A;  5KA5 A;  1F4M A;  1EBO A;  1F23 A;  1N8R W;  3M99 B;  3CP1 A;  2Y69 C;  1RM1 C;  4MTX A;  2EIJ C;  4WFB V;  1VQ4 V;  4RAI A;  3UKM A;  1YI2 V;  4PA9 A;  5B1A C;  4XDK A;  2WLI B;  3ABM C;  3FB7 C;  1Q81 W;  2IU0 A;  3HPL C;  3FB5 C;  3CCM V;  1PD3 A;  1M57 C;  5BZB A;  1NKD A;  5B1N A;  3G6E V;  4X89 A;  1VQ8 V;  2B5U A;  4N23 A;  4I9W A;  1M56 C;  2EBO A;  1QLE B;  3IC7 A;  1NH2 B;  1NR7 A;  3SPG A;  1BHA A;  3EFF K;  4XDJ A;  1FXV A;  2P7T C;  1S77 D;  1KD1 W;  1FFT B;  1MOF A;  2X0L A;  1WPX A;  3CC7 V;  1DLB A;  4KUM A;  3K03 A;  3SPI A;  3QO8 A;  3ZN1 A;  4JF3 A;  4MTF A;  1FS0 G;  4N21 A;  2Y69 B;  2X6A A;  5EK0 A;  1RM1 B;  2PI5 A;  2EIJ B;  3FB6 C;  4DXW A;  2F43 G;  5B1O A;  5B1B C;  5B1A B;  4XDL A;  4PA4 A;  4ASU G;  3FB8 C;  3ABM B;  5J9P C;  3JYC A;  3ABK C;  1M57 B;  2JJ2 G;  1K73 W;  1B6Q A;  1OCR C;  2QKS A;  2WLL B;  2JJ1 G;  4JAU A;  5CN0 A;  3E89 A;  1GK9 A;  1M56 B;  1WLE A;  2X6B A;  1VQP V;  1Q7Y W;  4Z1M G;  2LP7 A;  3G4S V;  4KP4 A;  1ZWI C;  4LCU C;  4MW3 A;  4QE7 A;  3ABU A;  3ZMU A;  3AG1 C;  3F7Y C;  1JVM A;  4TSF G;  2QEX V;  3E8H A;  3NXS A;  4YXW G;  3IFX A;  1ENV A;  2R9R B;  1EFR G;  5IDJ A;  2WLJ A;  2WWW A;  4E2L A;  2DW4 A;  1NVP D;  1G4Y B;  3IGA C;  2HVK C;  3BY6 A;  2ZXW C;  5CBH A;  3W7X A;  1DTO A;  2BOC C;  1FXK C;  4QIW F;  2YSU B;  2PI4 A;  3E35 A;  2DYS C;  5B1B B;  4QNH B;  4J9Z B;  1XL6 A;  3ZRS A;  1DF5 A;  3T4D A;  1H38 A;  3JD0 A;  2GHY A;  5L3G A;  3E2E A;  2C2A A;  5IY5 C;  1VQL V;  3ABK B;  1GTO A;  3TK1 A;  3OM3 B;  2EIK C;  3LNM B;  1OCR B;  4TWK A;  5LGU A;  4P9P A;  1YSC A;  2DQ3 A;  3X2Q C;  1K8A W;  3P30 A;  3RBZ A;  3E8F A;  4GX0 A;  3T1C A;  1JPX A;  4JTC B;  2P90 A;  3ETD A;  4PDM A;  3AG1 B;  3CCE V;  2IH1 C;  3ZN0 A;  1HWY A;  4GCZ A;  1AI6 A;  1BL8 A;  4LBE C;  3ETE A;  1GM8 A;  2M7W A;  1SET A;  3ZCC A;  1P4R A;  2BOB C;  3ZMT A;  5EBM C;  3ZIA G;  2QE7 G;  1W0K G;  4QE9 A;  4ZKI A;  1V54 C;  3VOU A;  4P30 A;  3EHB B;  2LFR A;  2ZXW B;  1R73 A;  4UV9 A;  2A9H A;  5IYC O;  1FXK B;  2OTJ V;  1AJQ A;  4BW5 A;  1PNK A;  1SES A;  2DYS B;  4KFM A;  3OGC C;  4L87 A;  4OXS A;  4FK5 C;  2ZDI C;  1YTF B;  4MTO A;  4BAY A;  4GX2 A;  3CCL V;  3T2M A;  5IY5 B;  5DN6 G;  1PL0 A;  3CC4 V;  1H8E G;  2XND G;  3RVZ A;  3JCZ A;  3MD0 A;  4JGS A;  5LBQ A;  3ZRW A;  1VQM V;  3K79 A;  3SYQ A;  5L3E A;  2ATK C;  3X2Q B;  1E1R G;  4G2K A;  2UXN A;  3W7T A;  3CMA V;  1EZJ A;  4R7C A;  3SPH A;  2HG5 C;  2W0F C;  1KC8 W;  3K08 A;  1K97 A;  2R9I A;  2H94 A;  3OMA B;  4UVB A;  5GW7 A;  2QA4 V;  2HLD G;  1PNM A;  3ABT A;  3CPW U;  4RUF A;  3CC2 V;  1GO3 F;  3SPJ A;  5LGN A;  1ORQ C;  1E1Q G;  1JOY A;  1K7D A;  3JD4 A;  1SRY A;  1R3J C;  3B77 A;  5EBL C;  5L3D A;  2KB1 A;  4MT8 A;  3ML0 A;  1KP3 A;  3ZJZ A;  1VQ9 V;  2UXX A;  4U7N A;  1V54 B;  1JJ2 U;  2WLH A;  3E8G A;  2JK5 C;  2B1G A;  1OZ0 A;  4Q20 A;  3OEH G;  4U7O A;  1QVG U;  5HFM A;  2Q67 A;  4RO2 A;  3AG2 C;  3OMI B;  3ZRV A;  3RW0 A;  2HFE C;  1PKX A;  4P2Z A;  2OT5 A;  3ZRX A;  5LHG A;  1NQT A;  4RUE A;  1QCE A;  2XAG A;  2HR3 A;  3DGE A;  4WF9 V;  3QO7 A;  3AG4 C;  1PNL A;  2IH3 C;  3I56 V;  3CCS V;  5EC2 C;  2XAS A;  1H2G A;  2W6J G;  3LSQ A;  1R3I C;  2WLN A;  4CZZ A;  2YEV B;  3TET A;  4R50 A;  4UV8 A;  5KA6 A;  5FL7 G;  5IYD O;  3WFV A;  2FTK A;  1Y66 A;  1J95 A;  1G8M A;  3ZMV A;  1KP2 A;  1OHH G;  1P7B A;  4QJF B;  3ABL C;  3ETG A;  4FJC C;  4GX1 A;  2W6I G;  3ZRW B;  4RQE A;  2DWE C;  4HYO A;  1NR1 A;  3T4Z A;  2V7Q G;  3D3I A;  1AR1 B;  1E79 G;  1TUE B;  1BMF G;  2EIN C;  2K1E A;  1QR8 A;  4HZ3 A;  1W0J G;  2IJJ A;  3SYO A;  1VQ6 V;  2IJK A;  1R6N A;  3OUF A;  1MG1 A;  4GX5 A;  3PJS K;  4MVQ A;  4WFA V;  1RPR A;  5DM6 V;  2ZQM A;  3AG4 B;  2HJF C;  3W7W A;  3P32 A;  1NVP B;  4G27 B;  4HAM A;  4MTG A;  4UUJ C;  1YJN V;  1OCC C;  1GKF A;  2Z3Y A;  2HKO A;  2X7R B;  2Q68 A;  2JDI G;  1AI4 A;  1M90 W;  2DQ0 A;  5LHI A;  1K5Q A;  1CEZ A;  1SER A;  3AEI A;  4LC1 A;  1OCZ C;  4PDL A;  1M1K W;  1FXH A;  3ABL B;  5CBG A;  1R3K C;  4PA6 A;  2OCC C;  3SJQ C;  4PA3 A;  1THZ A;  1CP9 A;  2EIN B;  3LDC A;  1YJ9 V;  2GSM B;  1L1F A;  3MHS C;  5LHH A;  5E1A C;  1R6K A;  4H37 A;  4FPP A;  4DO2 A;  4XBF A;  2QTO A;  1QBZ A;  2NLJ C;  1NBM G;  1VQO V;  1OCC B;  1DF4 A;  4MW8 A;  2EJR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...