1YHQV

Crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1yhqV00
1M90W 3CCUV 1W2BU 3G71V 3CD6V 1YJWV 1VQ7V 1VQ9V 2D3OW 1N8RW 2QEXV 3CC4V 2OTJV 3CMAV 1YJ9V 1Q82W 1VQ6V 3I55V 4WF9V 1YJNV 2QA4V 5DM6V 1KQSU 1YITV 1VQMV 1VQPV 1QVFU 3CCQV 1KC8W 1JJ2U 1R73A 1Q7YW 1QVGU 2OTLV 3CCSV 3CCRV 3CC7V 3OW2U 1VQLV 1Q81W 1K8AW 3CC2V 4WFBV 3CMEV 1VQOV 1S72V 1YHQV 1YIJV 3G4SV 1Q86W 1VQ5V 1VQ8V 3I56V 3CCJV 4WCEV 4WFAV 3CXCU 1KD1W 1K9MW 3G6EV 1YI2V 1M1KW 3CCVV 3CPWU 3CCLV 1VQNV 1K73W 1VQKV 1VQ4V 3CCMV 1NJIW 3CCEV
chains in the Genus database with same CATH superfamily
3E35A 4DR1O 1S76D 2Q6AA 2IH3C 1SZXA 3BFRA 2MW2B 2NLJC 1K97A 1N36O 4PA7A 3OUFA 3Q4HB 2IBZH 3SPCA 1KUQA 5EYPA 1FFXA 5CA0A 3CPWU 1FXKA 2Q7HA 3CRAA 4DR7O 5IYCO 4JI2B 3JCUZ 1GAXA 3ZX6A 3THOA 4PD4F 1KP3A 3S3XA 3ABKC 1EN6A 4K8ZA 4B3RO 3D36C 1Q7YW 3OTOO 2E76B 2JS5A 4OPHA 5LMUB 4TV9B 1V9PA 1NR7A 3ETGA 3K04A 2HLDG 4FLWA 4I55A 1RSOB 5FL7G 1BL8A 1HNZB 2ITDC 3P3NA 4I50B 3L74H 4DR6O 1B06A 3CCQV 1VEWA 2W6IG 3F7VC 4JYAB 1S3JA 1COWG 2XAJA 1TGOA 3SYQA 3I56V 3ABUA 2ATKC 4PELA 3RT3C 3VQYA 5J2UA 4RWUA 1G1XB 4MVZA 2VRZA 4DK1A 2EIJB 4JGSA 2UU9B 5BMVB 2UXCB 1QU7A 5IYZA 2FYUH 1JX9A 3RYFA 4OX9O 3FB5C 3FB7C 2A9HA 2JIZG 1UPGA 3OE7G 3BY6A 3DC6A 3ML0A 1PKXA 1BQ0A 1QHTA 1FYJA 2XUMA 2NR5A 3BPZA 1QR8A 4O4IB 4UB8Z 3H1JH 2ZD9A 1NTZH 4PI0A 2IJJA 3UCSC 1YEWA 3E2EA 4WFBV 1PNMA 2ZDIC 4H13B 1I0HA 5KAFZ 2Y48A 1GKFA 1SQFA 3TJTA 3AG2C 4KHPO 3A0RA 3ABTA 2PI5A 3L71H 2E5LO 3ZHSA 2AZ0A 5DEDA 4UUJC 3W7XA 2WLHA 1IURA 4J9ZB 1F4NA 4I5SA 3F7YC 1N34O 1M4UA 2WLMA 2Z5UA 2DJVA 1M5IA 1YI2V 4FK5C 1S5HC 4YJ2B 3FX7A 4BW5A 2UXDO 4NYKA 3MDSA 2FTKA 4XDKA 2YIBD 1K5SA 4I0XA 3ZHTA 4F6EA 2M7WA 2D3OW 3JATA 3K0GA 4MW8A 4GX1A 1CXZB 1HP8A 4DYLA 4AILC 1P84F 1R3JC 1XMOO 4DV2O 1US6A 5DN6G 5KA5A 2CTPA 2ZNJA 4PDMA 4LFAB 1V54C 2Q5ZA 1IBKO 3QG5A 5L3EA 5KHJA 1YJWV 1WB7A 1GN2A 4X64O 3OD4A 2ZINA 4PDVA 2CE4A 4AQYB 4GCZA 4LF7O 5HFLA 3ZBHA 4TQFA 2FKXA 4WCEV 2XAFA 4F6RA 2QM8A 4J80A 3E8GA 3A8TA 2UUAB 4DR1B 3RVZA 3WB0A 2YSUB 4MTXA 2JEUA 4X88A 1B6QA 4N21A 3BHPA 3UM7A 3CXCU 2K1EA 1VQ4V 1K4DC 1I94O 4ZHQB 3QF7A 2QJ1A 5GONA 3T4ZA 1YJ9V 4MTOA 3ZHRA 3ZHUA 3ASOC 1AR5A 4LWSB 2BTOA 4B3RB 1SQQH 4MVQA 4D7TA 5JVDB 4JV5B 3K06A 3ABLC 4FLXA 2B9ZA 5JJEB 4AHCA 5IWAO 4LFCB 2B5UA 3S3WA 4NTYA 4NXNO 3ASNB 1OHHG 2WLKA 5AG2A 4TSFG 5C8YB 3U11A 3ZHVA 2DWEC 3P3PA 4DR6B 3JALB 3VOUA 2X6AA 1D2DA 4QPJA 4FVMA 5KX5A 4B08A 3L72H 1Z5WA 1ZL8A 4LNUB 5ITZB 3LSSA 2V1DA 3QNEA 1KBHA 4XDLA 3VBBA 4G27B 4H44B 1LUWA 5IJ9A 2IJIA 1MZEA 1RPOA 5E79Z 3JYCA 5B1OA 1X59A 1YSCA 3SYCA 2F23A 3HKEB 5KMGA 5EZYB 1SQXH 1NS1A 1AB3A 3RVYA 3G4SV 4X1IA 2EILB 4B3MO 3ZN1A 3OMNB 1VIBA 2LFRA 1AP6A 3W7SA 3CB2A 1N0NA 4DR4O 1FAFA 1EN4A 1WA8A 4O2BA 5H5NA 3RGBA 4F4LA 3ABMC 5KHKA 3JASB 1ZLZA 2ZXWB 1FJGO 5EC2C 2XOKG 5JCOA 2DQ3A 4OGQB 1GMGA 4NVPA 4EFBA 4HYOA 4PHZA 2AGAA 3HKBB 2WAMA 1WB8A 4CH4A 2YXLA 2HHHO 4B3SB 1FXVA 2ZM6O 4CZZA 1N34B 1QR9A 4YJ3A 1V55C 2AXTZ 2DN9A 3FAVB 4DXWA 4O4HA 4DR2O 1NT2B 3KZIZ 3FKSG 3KG2A 3TXQA 3CRQA 4YHHO 1OZ0A 2OYQA 3RYCB 4DV2B 3K5MA 5KUKA 3ZEDA 4CBCA 3J81N 1IBKB 2YXYA 2WLLA 4J7JA 3N27A 1DTOA 3D8CA 2P67A 4X64B 1E79G 3BA8A 3VQWA 1F4MA 3OEEG 4U3JB 4G2KA 1HNWO 1Q6UA 2EBOA 4WBNB 2X7RB 4LF7B 1YHQV 4KUMA 2GDSA 3E8BA 4IIJA 1UFIA 5J9PC 1CPYA 5L3BA 3B77A 3GVMA 1OCCB 3AG1B 1Q90D 1M56C 5CB4B 4IHJA 4DUZO 1M57B 4K0KB 5IYBO 4JI3O 3AK2A 5JWPA 1I5XA 4JYBA 2W6JG 2Q7GA 1IBLB 2KQXA 4QPKA 1SF9A 2CH7A 4LC1A 2KB1A 3R65A 2PZSA 2LW1A 4PJ0Z 3FB8C 3CCEV 2LP7A 5EIBD 2H8PC 3CCUV 1I94B 2BSKA 3IJ4A 3J7AU 4WF9V 1KQSU 4JI1O 4JAVA 1QQCA 2HFEC 2RN9A 1ZX3A 4LH6A 3Q4HA 5A9GA 3CCJV 2VQFO 1I7FA 3SPGA 4LF6O 4MVRA 3LDDA 5L3DA 2V7QG 4TQDA 5IWAB 1VQ7V 1N0JA 2AHZA 2ZE7A 4NXNB 1XBLA 1IBMO 3CS5A 3D3QA 1MMMA 1VQOV 2QM7A 3K58A 1XL6A 3AG1C 4TV9A 2LGQA 2Q8VA 4BR6A 4PDRA 1NQTA 2Q67A 1M57C 4JI6O 3ABKB 1RSOA 1H2SB 1RFYA 4I50A 1AP5A 1O9GA 2MK3A 4BAYA 2IW5A 1SESA 4JI4B 3HKDB 1IZ3A 3NR7A 1WJZA 3G67A 5H6QA 3WFVA 1AR4A 3C90A 1VARA 1PPJH 4PA4A 4B3MB 3SPHA 4LFBO 3B4SA 1S77D 3BABA 3JAMN 4DV1B 4UB6Z 3AEIA 1N8RW 5KHHA 4A5UB 1TA8A 3BA9A 5KHIA 5JH7B 1XHXA 4CC6A 3AG7A 5BMVA 1YDXA 2KKWA 4X20B 1QLEB 2EULA 1XHZA 3OAAG 3WG7C 5EIBC 1MG1A 1BCCH 4RQFA 2PYLA 1SQBH 3E83A 3CCMV 1GM9A 1SQPH 3ZMTA 1FJGB 4L8JA 1D5AA 3CP1A 1SERA 4QGPA 1XNRO 4GLXA 4CC5A 1X4TA 3I5DA 4RAIA 3D3IA 2RJZA 4YXWG 2L6LA 2N74A 4O4IA 4MS2A 3ZMUA 1Z5VA 2VWJA 1K92A 4RQEA 1XNQO 5B3SC 1THZA 4NTXA 4FFBB 2HHHB 3UO3A 2ZM6B 4N23A 1VQKV 4TT3G 5IDJA 5LP6B 3UQ8A 1J95A 2QSAA 1KECA 2F1MA 3ETEA 1MSDA 1R6TA 4H37A 1JFFB 4YY3O 4AI8A 4DR2B 5JQGB 4YHHB 4LBEC 1YTFD 1GH6A 4UCUA 3X2QC 2WSSG 1WNSA 3B2EE 2IJKA 1K3EA 1Q8IA 1PV0A 2W0FC 4D6TH 2R9RB 1E1RG 2XAQA 4GZRB 1J5EB 3HR0A 2O57A 4Z1MG 4YJ2A 3AG2B 4Z2WA 1YTFB 4X65O 1ZTEA 3MD0A 4BWAA 2UUCO 2EJRA 4DO2A 2PUSA 1QLEC 4UFZA 3STLC 5BXZA 2CTQA 1HNXO 1P49A 3K0DA 5BR8O 4MTFA 4ASUG 2EJ7A 4JAAA 1BQZA 3CCLV 1QLNA 2DYSB 2F95B 5KA6A 4GKJB 1H8HG 4DUZB 1Y66A 4JI8O 5FPOA 1Q6IA 1RP3B 1AJNA 4JI3B 2KG7B 2WPDG 5LOVB 3ZS8C 4P30A 1WN7A 2Q7EA 3DXRB 4LF5O 1F23A 2F66C 3H9VA 4I4TB 4O2AB 2XNDG 5LP6C 1V54B 3SYAA 2P4KA 4NR1A 2GTSA 4FLVA 2LFSA 3JARB 4JI1B 1YZBA 2GHYA 1NI8A 2G38A 4DRXB 3T1YO 2IU0A 2DE0X 3K03A 2CGOA 2GUZB 4U7NA 4L87A 5LHGA 2VQFB 1MSWD 2HJFC 5LGTA 2FL4A 1O9HA 1XILA 1PNKA 4DR3O 3K3WA 4ZHQA 5CBFA 1QNMA 2X6CA 3E22B 1GN6A 2JS3A 1H2GA 1ROPA 1IBMB 2GSMB 5KLVH 3L9DA 4LWSA 1JR9A 5LA6B 1S72V 4J11A 5GW7A 5K1PA 5B1AB 2Z0AA 3H1LH 4DV6O 2DYSC 3ZMZA 2FB5A 1TVKB 3G6BA 3IAYA 4DUYO 1AI6A 3UT5B 3N2GB 3E8FA 5LXTB 2LJ2A 1XREA 4JI6B 2PY5A 4FLYA 3ASOB 2R9IA 5LGUA 3BVOA 2HJDA 5IYDO 1I08A 5C8YA 3EFFK 4LF8O 4J9YB 1BMFG 3JALA 1VQ8V 3STZC 4WFAV 1HDJA 1L0LH 4IT5A 3ABLB 1NR1A 1ZSPA 3B8NA 5ITZA 3OTFA 4LFBB 2BOCC 1KKDA 3MHSC 1NBMG 4NXMO 1EZJA 3MHHC 4PI2A 3AG3C 4GUNA 4DV5B 2QKSA 5KUMA 4EB6B 2OCHA 3GB7C 1P7BA 2P90A 1MNGA 3HKEA 4FZ0A 1PL4A 5EZYA 1N32B 3ZHQA 1AI5A 1A32A 2A3QA 4MSWC 1XL4A 2CDYA 4KP4A 3TXSA 3CRCA 4JI0B 2OTJV 4K3AA 4X8AA 1K4CC 4HBNA 3P32A 1BT8A 5LMNO 2QWRB 2E75B 4RUEA 1N36B 1FXKC 4OXSA 1Y74B 2AW9A 2YI9A 5B1AC 3CCVV 4J7ZA 1TUEB 2E3CA 2QDOA 5KHGA 1MA1A 4RO2A 5E1AC 1NH2D 3JASA 2Q0OC 5L3FA 4DR7B 2ZKOA 3ZRXA 3ICXA 3ZMSA 2ETNA 1QBZA 3J80N 1BGYH 2YXHA 3CC2V 4R8CA 3CCSV 3HKBA 1NH2B 4JI5O 3ABMB 3WB1A 3OTOB 2Q4PA 3ZRVA 1PL0A 5JJJB 4MTGA 4CS2A 3EVKA 1SA0B 1Y76B 2QTOA 1XEQA 2JJ2G 1G4YB 3FAVA 2IM9A 4UV9A 3OGCC 2WWWA 4X65B 1JPXA 4MVOA 1KP2A 4BIUA 1RM1B 3TK1A 3C3SA 1HNXB 3T1CA 5EBMC 5CBHA 4GKKO 3OT7A 1V55B 3RYCA 2ZE6A 3CD6V 2ADQB 2DYRC 3DGEA 3T4DA 4O4JB 3OR7C 1H2MA 4JI8B 4QE7A 4U3JA 4LF9O 4U7OA 4WBNA 3K9AA 4P9PA 4I9WA 4OX9B 3CSXA 1NKDA 4LF5B 1EM1A 4Z1VA 4DV3O 3LDEA 4IYIA 3ETQA 2QGNA 5J2TB 5CB4A 4P2ZA 3QO7A 3QTCA 4H0LB 4O4LB 2ADPA 1K8AW 1WPXA 2VS0A 5H6RA 1S5LZ 4DV7O 3RW0A 4X66O 2F4VO 1PD3A 2DQ0A 2KSDA 1VF5B 1AROP 4GX2A 1M56B 4GT1A 2RNBA 3K5NA 2OIEA 4LCUC 2AHYA 2PTMA 4KHPB 4DR3B 1JVMA 2CTRA 2E5LB 1RM1C 5LL6Y 3IC9A 1IXMA 3OR6C 4J7KA 1OCRB 2EINB 1ZWIC 4TV8B 1NTKH 2VQEO 4ZI7B 1VF6C 4BW9A 4ZIBA 4DV6B 1GO3F 2V4DA 2A06H 2WLNA 2R72A 3ZRWB 4BIZA 2UXDB 3CC4V 3PN1A 3CMAV 2PYJA 4DUYB 1H8EG 2JGUA 3ZRSA 4IYHA 4UCTA 2QM4A 3CCRV 5FPRA 3SPJA 2LGWA 2P7TC 4I7ZB 4LF8B 1LR1A 1G8MA 1Y67A 1XMOB 4JI2O 4KXRA 2D2CB 4CS3A 1K73W 4J10A 1EN5A 2ZQMA 1VP7A 3I55V 5L3CA 2RDCA 3GWKC 1VQPV 5IJ0B 4NXMB 3JAWB 1OCZB 5LMUO 3CHXA 3D36A 3CRRA 2NNUA 4ZBMA 3HKDA 4GYCB 2UXXA 3DC5A 5H2FZ 3SPIA 3CYOA 3JAKB 2ZIMA 1HR0O 4JPRA 1DLBA 4X1KB 1YJNV 2BCCH 4JTAB 2BTQB 2CAZC 1SS3A 4JAUA 5JH7A 1GK9A 2LW7A 3BAAA 3FD9A 4DV4O 5LMNB 1JA8A 1OCRC 2EINC 4X20A 3W7WA 3RWRD 1KMIZ 1U97A 4LF4O 5KAIZ 4LR3A 5IY5B 2UU9O 4W4KA 4JYCA 3VQVA 2UXCO 3SYOA 1E1QG 5LYJB 5D5PA 4HNAB 1N4CA 1WP7A 2QWQB 4R50A 4X1YB 1TUBB 1Z2GA 3WG7B 3E86A 2R70A 2B1IA 2HG5C 4FFBA 4PDLA 1S5JA 5LP6A 3TETA 3LSUA 2P5OA 3WU2Z 2HVJC 1L1FA 1FD9A 3W7TA 4FZ1A 4UCOA 1Q5OA 1JFFA 1QVGU 4R7CA 3JD0A 1OCZC 1K34A 2JVDA 5JQGA 5B3SB 3MAQA 3RYIB 3LNMB 4XDJA 5CBGA 1URFA 1AVMA 3OEHG 1S0VA 2ZDIA 2R9AA 5CN0A 1W2BU 4GKKB 4YIOA 3DSQA 1L0NH 4CH6A 1I5YA 3L73H 1W0JG 1AI4A 3HKCB 2ZNIA 1YF2A 2JGDB 2QE7G 4FLZA 1KB9F 5EC1C 3SDLA 3X2QB 3EHBB 3CEIA 4LF9B 4OPAA 2YC0A 1CP9A 5IY5C 2Q0AA 5GTIZ 4DV3B 3SR2C 1MABG 2A7WA 3K5LA 1CEZA 1ZAUA 4DR4B 2HEPA 5B1NA 5CMUA 5JCOC 4JYYA 1W0KG 2KG7A 3ZJZA 3TCUA 2QKCA 5LOVA 4LFAO 3BRCA 2P6JA 1M1KW 4WFEA 1XOUA 1ENVA 3DXRA 4W4LA 5D5QA 4DV7B 4X66B 1NJIW 2F4VB 5C93A 2OWOA 3CRMA 4I4TA 4O2AA 2ZR3A 1B04A 4AQYO 5FNVB 3NXSA 4JZ2A 3M99B 2Y0PA 3JARA 3APOA 3P30A 5IT9N 4DRXA 1Y6XA 4NKGB 2UUAO 2F43G 3A2FA 1BS3A 2GUZA 3RYHB 3B40A 1XUQA 3K59A 3C3TA 4B7EA 2ZCEA 1VQMV 3UKMA 3M7MX 1K33A 2WLIB 3CJHB 3E22A 3HB3B 2BOBC 2Q69A 3K08A 4TOIA 1KD1W 1YCIA 5LA6A 1R3KC 3H1IH 4FM1A 1M9NA 5EK0A 2EIMC 4JTDB 4PA6A 3U10A 5JJNB 1TVKA 1JMKC 2YS8A 4NTWA 5B66Z 5A2QN 4UVAA 3UT5A 1KC8W 2HR3A 3N2GA 5CA1B 4DW1A 5LXTA 1AJQA 2XAGA 1FKAO 4JV5O 3H1HH 4UCRA 1HNWB 3SJBC 1JQ0A 2OIGA 1BE3H 2GV9A 4ZOLB 1AJPA 4LFCO 1G6UA 3A0HZ 1MOFA 2DWDC 4FIPC 2YIBA 2Y69B 1R6NA 1HR0B 3E89A 1H2LA 2OCCC 3JSNA 2YEVB 1GTOA 1LUVA 2RMKB 4TUYB 1JCHA 1Q86W 4EB6A 4DV4B 1DGSA 2QWOB 4UXNA 4FFKA 4LF4B 2UUBO 1AILA 3GWOA 1GM8A 3OUSA 4FM0A 4FMTA 3N2KB 1GN4A 3AG3B 3L70H 4J42A 2IH1C 1K7DA 1DF5A 3KCYA 3QO5A 1QCEA 1VQ5V 3OGIB 1YXBA 1Y74A 1WPBA 3T2MA 3K5OA 2LQTA 3OFNG 4LF6B 3FYEB 4PV1B 2PGGA 1JOYA 4FLUA 2JJ1G 3JD4A 5EYPB 4KL1A 1FFXB 2QWNB 1FS0G 1VQLV 5CA0B 3CXHF 2RCVA 1M93A 3CMEV 4HAMA 1FXKB 1XMQO 4Q6GA 2XASA 2EIKB 3JD3A 2ZE8A 2UXBO 2IJHA 5EBWC 5JVDA 3JSLA 1F7YA 2Y69C 4X89A 3F5TA 1XI1A 5BZBA 1SA0A 1Y76A 1QVFU 3RN4A 1JJ2U 1FPOA 4B3SO 3CX5F 3ZCCA 4RUFA 2NN4A 4ZKIA 1K9MW 4I55B 2CK3G 3L75H 5B5EZ 3FYIB 1N33O 2QTSA 1VF6A 2UXNA 3TGUH 4LNUA 2EIJC 3G80A 2QA4V 2XHBA 2VWKA 1YITV 5CA3A 2ILMA 2DW4A 2ZR2A 1ORQC 1UJWB 4O4JA 5J2UB 1SETA 2H3OA 3AG4B 3IGAC 4UVCA 4DV0O 2Q68A 2YICA 1NU1H 1ZUQA 2A79B 5IYZB 4WFFA 4PA9A 4DR5O 2PI4A 2DYRB 1XNRB 3HPLC 3APQA 5J2TA 3RYFB 2YUAA 2RQ6A 1PNLA 3DTUB 3K79A 1Q43A 4D7SA 2EX3A 5K1XA 2BE3A 4FLTA 4O4LA 4X9QA 1EZVH 3QO8A 2C2AA 1YIJV 1DK1A 2EIKC 1XNQB 3F5WC 1SKVA 4K0KO 2Z3YA 1M90W 1VF7A 1FFTB 1PP9H 2HVKC 2PF4E 3RBZA 5TISZ 1IBLO 5HFMA 4NB5A 4E2LA 4YY3B 4QE9A 3H1KH 2JDIG 4WFHA 1AR1B 4Q20A 2WA4A 1LNQA 1H38A 1Q3EA 1R1BA 2P06A 3PJSK 4TV8A 4WFGA 2Y4UA 4ZI7A 3G71V 1IVSA 4B3TO 2YDEA 1OV9A 4P9OA 3ZRWA 3R66A 5DM6V 1SQVH 2CTWA 3O65A 2UUCB 2AZ2A 4EFEA 4GX0A 3VQXA 1D5NA 5IE9A 4DW0A 2E74B 2K9PA 5BR8B 2DOSA 4I0XB 4FM2A 3AG4C 3JATB 3AK1A 3WB2A 2DMXA 2YIAA 5LBQA 1GM7A 1K5QA 1MZFA 1KU9A 2M6YA 5IJ0A 3JAWA 4MT8A 3W7UA 1IDSA 4ABMA 3KCXA 3ETDA 3SGIA 1AI7A 5B1BB 5F2VO 4U3FH 4JF3A 1Q82W 3JAKA 1VQ6V 5FLXN 1SZTA 2UUBB 4X1KA 4JI4O 2QKAA 2QR4A 4I9QA 2BTQA 1GN3A 4F6RB 2EZPA 1R6KA 3T1YB 3OMIB 4X62O 3JD1A 2P22C 4DV1O 4JI7O 4H33A 3EXAA 5LYJA 4HNAA 4KFMA 2OT5A 1R3LC 3OW2U 2FMLA 3T1HO 1XDCA 4MVSA 4X1YA 3K57A 1Y4MA 2WA3A 1TUBA 1VMGA 1XMQB 2P4VA 3IFXA 5GONB 2UXBB 4PA3A 4CH3A 3ZIAG 4JTCB 4B7KA 3ASNC 4UCVA 4UCSA 2H94A 4JZGA 1HW7A 3E8HA 1Q81W 2Y4TA 2N04A 5LGNA 2Y0IA 3B09A 3SJAC 5H9CA 1BSMA 1L8DA 2F93B 4IL6Z 1T5EA 2X0LA 3CE2A 4MVUA 3RYIA 1BZKA 5LHIA 5B1BC 1N33B 2WLJA 4JASA 1IXBA 2XTAA 4G28B 2L35A 5KX5B 3CC7V 3HKCA 1BHBA 1ZL8B 5L3GA 1IX9A 2EILC 3OMAB 2JGDA 2CGNA 5BY1A 1J5EO 5EBLC 1WAZA 5IJ9B 3LDCA 4GX5A 4DK0A 3JCZA 1HNZO 2EZOA 1EFRG 4DV0B 3JD2A 2QWPB 2HP8A 4DR5B 2HKOA 1XQ8A 2Q73A 5KMGB 3RFRA 1EBOA 4JYAO 4X1IB 4FPPA 4MW3A 2IU3A 3KKYA 4IGGA 2ZXWC 4QIWF 3G6EV 2W0XA 1SQGA 1VQNV 4GKJO 1SC5B 2YI8A 3BCCH 4K35A 1WA8B 4BIOA 4EEQA 3BEHA 4FJCC 4O2BB 1NVPD 4EKWA 3ZN0A 3O9OA 4LH7A 2ZT9B 3U0ZA 1H2NA 5FNVA 2XT9A 2OTLV 1H2KA 3SJCC 1Q6HA 3LNNA 3FFQA 4CS4A 3FB6C 4MVMA 2JRIA 3B8MA 3UO2A 4JI5B 1NVPB 1OCOB 2QEXV 1PM9A 4CH5A 4B3TB 1GRJA 1P7GA 3RYHA 4E4EA 1TAEA 3M8AA 1KYOF 4QNHB 1NTMH 3SYPA 5LHHA 4YJ3B 2CUGA 3QVNA 2ITCC 2WLIA 2B1GA 1YVWA 3CJHA 4YIPA 2ARHA 3K9SA 4O4HB 1DF4A 1R3IC 2X6BA 4J41A 1KKCA 2GTAA 1SRYA 2ZIOA 3A0BZ 2LO1A 4TWKA 4QJFB 3LUTB 3IC7A 3AK3A 5CA1A 3OM3B 1U96A 4ICGA 2XAHA 2YIDA 2ZE5A 1HWYA 4UV8A 1OCCC 2WLLB 1NZ6A 2EIMB 1RPRA 4ZOLA 1BHAA 3H01A 1F51A 1WLEA 1W59A 4LP8A 5DECA 3SJQC 2Q9LA 4IIJB 2YEVA 1B3QA 1P4RA 4TUYA 1JJOA 2GBOA 4IHJB 4X62B 2JEXA 3CWBH 4UVBA 1VQ9V 1OCOC 4JI7B 3LSQA 4DV5O 3ZMVA 2OCCB 1R73A 1FXHA 1OJHA 2CH7B 5GTHZ 1N32O 3N2KA 3T1HB 2JK5C 2ODMA 2A0LA 1WP8A 4XBFA 4C7UA 4K8XA 4HZ3A 2BSKB 2N05A 4R6ZA 2VQEB 4JI0O
chains in the Genus database with same CATH topology
1M56C 3E35A 1S76D 3CD6V 2Y69C 4X89A 1M57B 2DYRC 2Q6AA 3DGEA 2IH3C 3T4DA 5IYBO 5BZBA 2NLJC 1QVFU 3OR7C 1K97A 1I5XA 4PA7A 1JJ2U 3OUFA 2W6JG 4JYBA 3SPCA 4QPKA 3ZCCA 4QE7A 4RUFA 4U7OA 4LC1A 3K9AA 4P9PA 4I9WA 2KB1A 3R65A 4ZKIA 1K9MW 1NKDA 3CPWU 1FXKA 2CK3G 3FB8C 3FYIB 2LP7A 5IYCO 3CCEV 3LDEA 2H8PC 3CCUV 2UXNA 2EIJC 1KP3A 3ABKC 4P2ZA 4WF9V 2QA4V 1KQSU 3QO7A 1YITV 4JAVA 5CA3A 2HFEC 1Q7YW 2DW4A 2ZR2A 1ORQC 1UJWB 1K8AW 1WPXA 1SETA 3CCJV 5H6RA 3SPGA 3RW0A 1NR7A 1PD3A 2DQ0A 3AG4B 3IGAC 4UVCA 4MVRA 1AROP 3LDDA 3ETGA 2Q68A 3K04A 2HLDG 2V7QG 1M56B 4GT1A 4GX2A 5FL7G 5L3DA 1VQ7V 2A79B 1BL8A 2AHZA 3B77A 4PA9A 4WFFA 2PI4A 2ITDC 2DYRB 4LCUC 2AHYA 3HPLC 1JVMA 3CCQV 1PNLA 3DTUB 2W6IG 3K79A 1RM1C 3F7VC 1VQOV 1IXMA 1S3JA 3OR6C 3QO8A 1COWG 1OCRB 1ZWIC 2C2AA 2EINB 2XAJA 1YIJV 3SYQA 3I56V 2EIKC 3ABUA 2QM7A 2ATKC 4PELA 4MVZA 3F5WC 1XL6A 1GO3F 3AG1C 2Z3YA 1M90W 2WLNA 3ZRWB 4BIZA 4PDRA 1NQTA 2Q67A 3CC4V 1M57C 2EIJB 3CMAV 4JGSA 1FFTB 3ABKB 2HVKC 1H8EG 3RBZA 3ZRSA 5HFMA 4E2LA 2MK3A 4BAYA 2IW5A 1SESA 4QE9A 1JX9A 3CCRV 2JDIG 4WFHA 3SPJA 3FB5C 3FB7C 1AR1B 2P7TC 4Q20A 2A9HA 2JIZG 5H6QA 3WFVA 3OE7G 1G8MA 1LNQA 3BY6A 3ML0A 1PKXA 4PA4A 1H38A 3PJSK 3SPHA 1K73W 4WFGA 1S77D 3G71V 2ZQMA 3AEIA 1N8RW 1QR8A 2ZD9A 3I55V 4P9OA 3ZRWA 5DM6V 5L3CA 2IJJA 1VQPV 1QLEB 3E2EA 1OCZB 4WFBV 4GX0A 1PNMA 3OAAG 2ZDIC 3WG7C 1MG1A 3D36A 4RQFA 2NNUA 4ZBMA 2UXXA 3SPIA 2Y48A 3E83A 3AG4C 3CCMV 1GKFA 1GM9A 3ZMTA 3CYOA 3CP1A 1SERA 3AG2C 4JPRA 1DLBA 3A0RA 4RAIA 3ABTA 3D3IA 1YJNV 4JTAB 2PI5A 4YXWG 5LBQA 4MS2A 3ZMUA 1GM7A 1K5QA 4JAUA 4UUJC 3W7XA 1GK9A 1K92A 2WLHA 4J9ZB 4RQEA 1F4NA 4I5SA 5B3SC 3F7YC 1THZA 1OCRC 2EINC 3W7WA 2WLMA 2Z5UA 1YI2V 4FK5C 4MT8A 4N23A 3W7UA 1S5HC 1VQKV 3ETDA 4TT3G 4BW5A 5IDJA 5IY5B 2FTKA 4XDKA 1J95A 1AI7A 1K5SA 4JYCA 5B1BB 2M7WA 1KECA 2D3OW 3ETEA 4JF3A 3SYOA 3K0GA 1Q82W 1VQ6V 1E1QG 1SZTA 4H37A 4MW8A 4GX1A 4R50A 1R3JC 4LBEC 1YTFD 3X2QC 2WSSG 2EZPA 2IJKA 1R6KA 3WG7B 3OMIB 5DN6G 1K3EA 5KA5A 2W0FC 3E86A 2R9RB 1E1RG 2B1IA 3JD1A 4PDMA 2HG5C 1V54C 4PDLA 2XAQA 5L3EA 1YJWV 4Z1MG 4H33A 3AG2B 3TETA 1YTFB 3MD0A 2HVJC 1L1FA 3W7TA 2EJRA 4DO2A 4PDVA 4GCZA 4KFMA 1QLEC 2OT5A 1R3LC 5HFLA 4R7CA 3STLC 3OW2U 3JD0A 1OCZC 1QVGU 3K0DA 1K34A 4MVSA 5B3SB 4MTFA 1Y4MA 4ASUG 4WCEV 3LNMB 4XDJA 2XAFA 5CBGA 3OEHG 3CCLV 1QLNA 1S0VA 2DYSB 2QM8A 2ZDIA 3IFXA 3E8GA 5CN0A 1W2BU 4PA3A 3ZIAG 5KA6A 4JTCB 1H8HG 3ASNC 1I5YA 3RVZA 1W0JG 2YSUB 1AI4A 1Y66A 2H94A 4MTXA 2JEUA 3E8HA 1AJNA 4X88A 2WPDG 1B6QA 2QE7G 1Q81W 5EC1C 4P30A 5LGNA 3X2QB 4N21A 3EHBB 3UM7A 3CXCU 5H9CA 1F23A 1CP9A 2K1EA 1VQ4V 1K4DC 2X0LA 2XNDG 4MVUA 5LHIA 1V54B 5IY5C 3SYAA 5B1BC 3T4ZA 1MABG 2WLJA 4JASA 1YJ9V 4MTOA 4G28B 3ASOC 1CEZA 2LFSA 5B1NA 2GHYA 3CC7V 4MVQA 2IU0A 1BHBA 5CMUA 3K03A 5L3GA 1W0KG 2EILC 3OMAB 3TCUA 3ZJZA 3K06A 3ABLC 2P6JA 1M1KW 4WFEA 5EBLC 4U7NA 4L87A 1ENVA 5LHGA 1MSWD 1NJIW 2HJFC 3LDCA 4GX5A 5C93A 5LGTA 3JCZA 2B5UA 2EZOA 1EFRG 3JD2A 1PNKA 2ZR3A 3K3WA 3ASNB 1OHHG 2WLKA 2HKOA 5CBFA 4TSFG 2X6CA 3NXSA 2DWEC 1EBOA 3M99B 1H2GA 3VOUA 2X6AA 1ROPA 2GSMB 4FPPA 4MW3A 3P30A 1S72V 4QPJA 2IU3A 5GW7A 2ZXWC 4QIWF 5B1AB 3G6EV 3LSSA 2DYSC 2F43G 1VQNV 3ZMZA 2V1DA 3QNEA 4XDLA 3VBBA 4G27B 1AI6A 3BEHA 4FJCC 2IJIA 1NVPD 1RPOA 3E8FA 4EKWA 3JYCA 3ZN0A 1VQMV 5B1OA 3UKMA 3ASOB 2R9IA 5LGUA 1YSCA 3SYCA 1K33A 5IYDO 2OTLV 2WLIB 3EFFK 3HB3B 4J9YB 2BOBC 2Q69A 3K08A 1BMFG 3RVYA 3G4SV 3FB6C 4MVMA 1VQ8V 3STZC 2EILB 4WFAV 1KD1W 3ZN1A 3B8MA 3ABLB 1R3KC 1NR1A 1M9NA 3OMNB 1NVPB 5EK0A 2EIMC 2LFRA 3B8NA 4JTDB 4PA6A 3W7SA 1OCOB 2QEXV 2BOCC 1KKDA 3MHSC 1NBMG 1EZJA 3MHHC 4UVAA 1KC8W 2HR3A 4F4LA 4QNHB 1AJQA 3AG3C 2QKSA 2XAGA 5KUMA 5LHHA 3SYPA 3GB7C 1P7BA 2P90A 1JQ0A 3ABMC 2ITCC 2WLIA 2B1GA 2ZXWB 1AJPA 5EC2C 2XOKG 1AI5A 2DQ3A 1MOFA 4MSWC 1XL4A 2DWDC 4FIPC 1DF4A 1R3IC 2X6BA 4KP4A 2Y69B 1R6NA 1GMGA 2OTJV 3E89A 1SRYA 4HYOA 4X8AA 2OCCC 2YEVB 1K4CC 4TWKA 2WAMA 1GTOA 4QJFB 3P32A 3LUTB 3IC7A 4RUEA 1FXKC 3OM3B 1JCHA 4OXSA 1FXVA 1Q86W 4CZZA 2XAHA 1QR9A 5B1AC 3CCVV 4UXNA 1TUEB 1HWYA 4UV8A 1V55C 4RO2A 5E1AC 1OCCC 1NH2D 2WLLB 2EIMB 1RPRA 5L3FA 4DXWA 3GWOA 3ZRXA 1GM8A 3OUSA 1BHAA 3FKSG 3H01A 1F51A 3KG2A 3ZMSA 1QBZA 1WLEA 4FMTA 1OZ0A 4LP8A 3AG3B 4R8CA 3SJQC 3CCSV 3CC2V 2IH1C 1K7DA 1DF5A 2YEVA 3QO5A 1NH2B 1QCEA 3ABMB 1VQ5V 1P4RA 3ZRVA 5KUKA 1PL0A 3T2MA 4MTGA 2JEXA 4CBCA 3OFNG 4UVBA 3FYEB 1VQ9V 1OCOC 2WLLA 2QTOA 1DTOA 1G4YB 2JJ2G 3LSQA 4UV9A 1JOYA 3OGCC 2WWWA 2P67A 1E79G 1JPXA 2OCCB 2JJ1G 3JD4A 1F4MA 3OEEG 4MVOA 4G2KA 3ZMVA 1FXHA 1KP2A 1R73A 1FS0G 4BIUA 2EBOA 1VQLV 1RM1B 2X7RB 3TK1A 3CMEV 4HAMA 1FXKB 1YHQV 4KUMA 2JK5C 3E8BA 2A0LA 2XASA 2EIKB 3T1CA 5J9PC 5EBMC 1CPYA 3JD3A 5L3BA 4XBFA 2IJHA 5CBHA 4HZ3A 5EBWC 1V55B 4R6ZA 1OCCB 3AG1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M90 W;  3CCU V;  1W2B U;  3G71 V;  3CD6 V;  1YJW V;  1VQ7 V;  1VQ9 V;  2D3O W;  1N8R W;  2QEX V;  3CC4 V;  2OTJ V;  3CMA V;  1YJ9 V;  1Q82 W;  1VQ6 V;  3I55 V;  4WF9 V;  1YJN V;  2QA4 V;  5DM6 V;  1KQS U;  1YIT V;  1VQM V;  1VQP V;  1QVF U;  3CCQ V;  1KC8 W;  1JJ2 U;  1R73 A;  1Q7Y W;  1QVG U;  2OTL V;  3CCS V;  3CCR V;  3CC7 V;  3OW2 U;  1VQL V;  1Q81 W;  1K8A W;  3CC2 V;  4WFB V;  3CME V;  1VQO V;  1S72 V;  1YHQ V;  1YIJ V;  3G4S V;  1Q86 W;  1VQ5 V;  1VQ8 V;  3I56 V;  3CCJ V;  4WCE V;  4WFA V;  3CXC U;  1KD1 W;  1K9M W;  3G6E V;  1YI2 V;  1M1K W;  3CCV V;  3CPW U;  3CCL V;  1VQN V;  1K73 W;  1VQK V;  1VQ4 V;  3CCM V;  1NJI W;  3CCE V; 
#chains in the Genus database with same CATH topology
 3E35 A;  4DR1 O;  1S76 D;  2Q6A A;  2IH3 C;  1SZX A;  3BFR A;  2MW2 B;  2NLJ C;  1K97 A;  1N36 O;  4PA7 A;  3OUF A;  3Q4H B;  2IBZ H;  3SPC A;  1KUQ A;  5EYP A;  1FFX A;  5CA0 A;  3CPW U;  1FXK A;  2Q7H A;  3CRA A;  4DR7 O;  5IYC O;  4JI2 B;  3JCU Z;  1GAX A;  3ZX6 A;  3THO A;  4PD4 F;  1KP3 A;  3S3X A;  3ABK C;  1EN6 A;  4K8Z A;  4B3R O;  3D36 C;  1Q7Y W;  3OTO O;  2E76 B;  2JS5 A;  4OPH A;  5LMU B;  4TV9 B;  1V9P A;  1NR7 A;  3ETG A;  3K04 A;  2HLD G;  4FLW A;  4I55 A;  1RSO B;  5FL7 G;  1BL8 A;  1HNZ B;  2ITD C;  3P3N A;  4I50 B;  3L74 H;  4DR6 O;  1B06 A;  3CCQ V;  1VEW A;  2W6I G;  3F7V C;  4JYA B;  1S3J A;  1COW G;  2XAJ A;  1TGO A;  3SYQ A;  3I56 V;  3ABU A;  2ATK C;  4PEL A;  3RT3 C;  3VQY A;  5J2U A;  4RWU A;  1G1X B;  4MVZ A;  2VRZ A;  4DK1 A;  2EIJ B;  4JGS A;  2UU9 B;  5BMV B;  2UXC B;  1QU7 A;  5IYZ A;  2FYU H;  1JX9 A;  3RYF A;  4OX9 O;  3FB5 C;  3FB7 C;  2A9H A;  2JIZ G;  1UPG A;  3OE7 G;  3BY6 A;  3DC6 A;  3ML0 A;  1PKX A;  1BQ0 A;  1QHT A;  1FYJ A;  2XUM A;  2NR5 A;  3BPZ A;  1QR8 A;  4O4I B;  4UB8 Z;  3H1J H;  2ZD9 A;  1NTZ H;  4PI0 A;  2IJJ A;  3UCS C;  1YEW A;  3E2E A;  4WFB V;  1PNM A;  2ZDI C;  4H13 B;  1I0H A;  5KAF Z;  2Y48 A;  1GKF A;  1SQF A;  3TJT A;  3AG2 C;  4KHP O;  3A0R A;  3ABT A;  2PI5 A;  3L71 H;  2E5L O;  3ZHS A;  2AZ0 A;  5DED A;  4UUJ C;  3W7X A;  2WLH A;  1IUR A;  4J9Z B;  1F4N A;  4I5S A;  3F7Y C;  1N34 O;  1M4U A;  2WLM A;  2Z5U A;  2DJV A;  1M5I A;  1YI2 V;  4FK5 C;  1S5H C;  4YJ2 B;  3FX7 A;  4BW5 A;  2UXD O;  4NYK A;  3MDS A;  2FTK A;  4XDK A;  2YIB D;  1K5S A;  4I0X A;  3ZHT A;  4F6E A;  2M7W A;  2D3O W;  3JAT A;  3K0G A;  4MW8 A;  4GX1 A;  1CXZ B;  1HP8 A;  4DYL A;  4AIL C;  1P84 F;  1R3J C;  1XMO O;  4DV2 O;  1US6 A;  5DN6 G;  5KA5 A;  2CTP A;  2ZNJ A;  4PDM A;  4LFA B;  1V54 C;  2Q5Z A;  1IBK O;  3QG5 A;  5L3E A;  5KHJ A;  1YJW V;  1WB7 A;  1GN2 A;  4X64 O;  3OD4 A;  2ZIN A;  4PDV A;  2CE4 A;  4AQY B;  4GCZ A;  4LF7 O;  5HFL A;  3ZBH A;  4TQF A;  2FKX A;  4WCE V;  2XAF A;  4F6R A;  2QM8 A;  4J80 A;  3E8G A;  3A8T A;  2UUA B;  4DR1 B;  3RVZ A;  3WB0 A;  2YSU B;  4MTX A;  2JEU A;  4X88 A;  1B6Q A;  4N21 A;  3BHP A;  3UM7 A;  3CXC U;  2K1E A;  1VQ4 V;  1K4D C;  1I94 O;  4ZHQ B;  3QF7 A;  2QJ1 A;  5GON A;  3T4Z A;  1YJ9 V;  4MTO A;  3ZHR A;  3ZHU A;  3ASO C;  1AR5 A;  4LWS B;  2BTO A;  4B3R B;  1SQQ H;  4MVQ A;  4D7T A;  5JVD B;  4JV5 B;  3K06 A;  3ABL C;  4FLX A;  2B9Z A;  5JJE B;  4AHC A;  5IWA O;  4LFC B;  2B5U A;  3S3W A;  4NTY A;  4NXN O;  3ASN B;  1OHH G;  2WLK A;  5AG2 A;  4TSF G;  5C8Y B;  3U11 A;  3ZHV A;  2DWE C;  3P3P A;  4DR6 B;  3JAL B;  3VOU A;  2X6A A;  1D2D A;  4QPJ A;  4FVM A;  5KX5 A;  4B08 A;  3L72 H;  1Z5W A;  1ZL8 A;  4LNU B;  5ITZ B;  3LSS A;  2V1D A;  3QNE A;  1KBH A;  4XDL A;  3VBB A;  4G27 B;  4H44 B;  1LUW A;  5IJ9 A;  2IJI A;  1MZE A;  1RPO A;  5E79 Z;  3JYC A;  5B1O A;  1X59 A;  1YSC A;  3SYC A;  2F23 A;  3HKE B;  5KMG A;  5EZY B;  1SQX H;  1NS1 A;  1AB3 A;  3RVY A;  3G4S V;  4X1I A;  2EIL B;  4B3M O;  3ZN1 A;  3OMN B;  1VIB A;  2LFR A;  1AP6 A;  3W7S A;  3CB2 A;  1N0N A;  4DR4 O;  1FAF A;  1EN4 A;  1WA8 A;  4O2B A;  5H5N A;  3RGB A;  4F4L A;  3ABM C;  5KHK A;  3JAS B;  1ZLZ A;  2ZXW B;  1FJG O;  5EC2 C;  2XOK G;  5JCO A;  2DQ3 A;  4OGQ B;  1GMG A;  4NVP A;  4EFB A;  4HYO A;  4PHZ A;  2AGA A;  3HKB B;  2WAM A;  1WB8 A;  4CH4 A;  2YXL A;  2HHH O;  4B3S B;  1FXV A;  2ZM6 O;  4CZZ A;  1N34 B;  1QR9 A;  4YJ3 A;  1V55 C;  2AXT Z;  2DN9 A;  3FAV B;  4DXW A;  4O4H A;  4DR2 O;  1NT2 B;  3KZI Z;  3FKS G;  3KG2 A;  3TXQ A;  3CRQ A;  4YHH O;  1OZ0 A;  2OYQ A;  3RYC B;  4DV2 B;  3K5M A;  5KUK A;  3ZED A;  4CBC A;  3J81 N;  1IBK B;  2YXY A;  2WLL A;  4J7J A;  3N27 A;  1DTO A;  3D8C A;  2P67 A;  4X64 B;  1E79 G;  3BA8 A;  3VQW A;  1F4M A;  3OEE G;  4U3J B;  4G2K A;  1HNW O;  1Q6U A;  2EBO A;  4WBN B;  2X7R B;  4LF7 B;  1YHQ V;  4KUM A;  2GDS A;  3E8B A;  4IIJ A;  1UFI A;  5J9P C;  1CPY A;  5L3B A;  3B77 A;  3GVM A;  1OCC B;  3AG1 B;  1Q90 D;  1M56 C;  5CB4 B;  4IHJ A;  4DUZ O;  1M57 B;  4K0K B;  5IYB O;  4JI3 O;  3AK2 A;  5JWP A;  1I5X A;  4JYB A;  2W6J G;  2Q7G A;  1IBL B;  2KQX A;  4QPK A;  1SF9 A;  2CH7 A;  4LC1 A;  2KB1 A;  3R65 A;  2PZS A;  2LW1 A;  4PJ0 Z;  3FB8 C;  3CCE V;  2LP7 A;  5EIB D;  2H8P C;  3CCU V;  1I94 B;  2BSK A;  3IJ4 A;  3J7A U;  4WF9 V;  1KQS U;  4JI1 O;  4JAV A;  1QQC A;  2HFE C;  2RN9 A;  1ZX3 A;  4LH6 A;  3Q4H A;  5A9G A;  3CCJ V;  2VQF O;  1I7F A;  3SPG A;  4LF6 O;  4MVR A;  3LDD A;  5L3D A;  2V7Q G;  4TQD A;  5IWA B;  1VQ7 V;  1N0J A;  2AHZ A;  2ZE7 A;  4NXN B;  1XBL A;  1IBM O;  3CS5 A;  3D3Q A;  1MMM A;  1VQO V;  2QM7 A;  3K58 A;  1XL6 A;  3AG1 C;  4TV9 A;  2LGQ A;  2Q8V A;  4BR6 A;  4PDR A;  1NQT A;  2Q67 A;  1M57 C;  4JI6 O;  3ABK B;  1RSO A;  1H2S B;  1RFY A;  4I50 A;  1AP5 A;  1O9G A;  2MK3 A;  4BAY A;  2IW5 A;  1SES A;  4JI4 B;  3HKD B;  1IZ3 A;  3NR7 A;  1WJZ A;  3G67 A;  5H6Q A;  3WFV A;  1AR4 A;  3C90 A;  1VAR A;  1PPJ H;  4PA4 A;  4B3M B;  3SPH A;  4LFB O;  3B4S A;  1S77 D;  3BAB A;  3JAM N;  4DV1 B;  4UB6 Z;  3AEI A;  1N8R W;  5KHH A;  4A5U B;  1TA8 A;  3BA9 A;  5KHI A;  5JH7 B;  1XHX A;  4CC6 A;  3AG7 A;  5BMV A;  1YDX A;  2KKW A;  4X20 B;  1QLE B;  2EUL A;  1XHZ A;  3OAA G;  3WG7 C;  5EIB C;  1MG1 A;  1BCC H;  4RQF A;  2PYL A;  1SQB H;  3E83 A;  3CCM V;  1GM9 A;  1SQP H;  3ZMT A;  1FJG B;  4L8J A;  1D5A A;  3CP1 A;  1SER A;  4QGP A;  1XNR O;  4GLX A;  4CC5 A;  1X4T A;  3I5D A;  4RAI A;  3D3I A;  2RJZ A;  4YXW G;  2L6L A;  2N74 A;  4O4I A;  4MS2 A;  3ZMU A;  1Z5V A;  2VWJ A;  1K92 A;  4RQE A;  1XNQ O;  5B3S C;  1THZ A;  4NTX A;  4FFB B;  2HHH B;  3UO3 A;  2ZM6 B;  4N23 A;  1VQK V;  4TT3 G;  5IDJ A;  5LP6 B;  3UQ8 A;  1J95 A;  2QSA A;  1KEC A;  2F1M A;  3ETE A;  1MSD A;  1R6T A;  4H37 A;  1JFF B;  4YY3 O;  4AI8 A;  4DR2 B;  5JQG B;  4YHH B;  4LBE C;  1YTF D;  1GH6 A;  4UCU A;  3X2Q C;  2WSS G;  1WNS A;  3B2E E;  2IJK A;  1K3E A;  1Q8I A;  1PV0 A;  2W0F C;  4D6T H;  2R9R B;  1E1R G;  2XAQ A;  4GZR B;  1J5E B;  3HR0 A;  2O57 A;  4Z1M G;  4YJ2 A;  3AG2 B;  4Z2W A;  1YTF B;  4X65 O;  1ZTE A;  3MD0 A;  4BWA A;  2UUC O;  2EJR A;  4DO2 A;  2PUS A;  1QLE C;  4UFZ A;  3STL C;  5BXZ A;  2CTQ A;  1HNX O;  1P49 A;  3K0D A;  5BR8 O;  4MTF A;  4ASU G;  2EJ7 A;  4JAA A;  1BQZ A;  3CCL V;  1QLN A;  2DYS B;  2F95 B;  5KA6 A;  4GKJ B;  1H8H G;  4DUZ B;  1Y66 A;  4JI8 O;  5FPO A;  1Q6I A;  1RP3 B;  1AJN A;  4JI3 B;  2KG7 B;  2WPD G;  5LOV B;  3ZS8 C;  4P30 A;  1WN7 A;  2Q7E A;  3DXR B;  4LF5 O;  1F23 A;  2F66 C;  3H9V A;  4I4T B;  4O2A B;  2XND G;  5LP6 C;  1V54 B;  3SYA A;  2P4K A;  4NR1 A;  2GTS A;  4FLV A;  2LFS A;  3JAR B;  4JI1 B;  1YZB A;  2GHY A;  1NI8 A;  2G38 A;  4DRX B;  3T1Y O;  2IU0 A;  2DE0 X;  3K03 A;  2CGO A;  2GUZ B;  4U7N A;  4L87 A;  5LHG A;  2VQF B;  1MSW D;  2HJF C;  5LGT A;  2FL4 A;  1O9H A;  1XIL A;  1PNK A;  4DR3 O;  3K3W A;  4ZHQ A;  5CBF A;  1QNM A;  2X6C A;  3E22 B;  1GN6 A;  2JS3 A;  1H2G A;  1ROP A;  1IBM B;  2GSM B;  5KLV H;  3L9D A;  4LWS A;  1JR9 A;  5LA6 B;  1S72 V;  4J11 A;  5GW7 A;  5K1P A;  5B1A B;  2Z0A A;  3H1L H;  4DV6 O;  2DYS C;  3ZMZ A;  2FB5 A;  1TVK B;  3G6B A;  3IAY A;  4DUY O;  1AI6 A;  3UT5 B;  3N2G B;  3E8F A;  5LXT B;  2LJ2 A;  1XRE A;  4JI6 B;  2PY5 A;  4FLY A;  3ASO B;  2R9I A;  5LGU A;  3BVO A;  2HJD A;  5IYD O;  1I08 A;  5C8Y A;  3EFF K;  4LF8 O;  4J9Y B;  1BMF G;  3JAL A;  1VQ8 V;  3STZ C;  4WFA V;  1HDJ A;  1L0L H;  4IT5 A;  3ABL B;  1NR1 A;  1ZSP A;  3B8N A;  5ITZ A;  3OTF A;  4LFB B;  2BOC C;  1KKD A;  3MHS C;  1NBM G;  4NXM O;  1EZJ A;  3MHH C;  4PI2 A;  3AG3 C;  4GUN A;  4DV5 B;  2QKS A;  5KUM A;  4EB6 B;  2OCH A;  3GB7 C;  1P7B A;  2P90 A;  1MNG A;  3HKE A;  4FZ0 A;  1PL4 A;  5EZY A;  1N32 B;  3ZHQ A;  1AI5 A;  1A32 A;  2A3Q A;  4MSW C;  1XL4 A;  2CDY A;  4KP4 A;  3TXS A;  3CRC A;  4JI0 B;  2OTJ V;  4K3A A;  4X8A A;  1K4C C;  4HBN A;  3P32 A;  1BT8 A;  5LMN O;  2QWR B;  2E75 B;  4RUE A;  1N36 B;  1FXK C;  4OXS A;  1Y74 B;  2AW9 A;  2YI9 A;  5B1A C;  3CCV V;  4J7Z A;  1TUE B;  2E3C A;  2QDO A;  5KHG A;  1MA1 A;  4RO2 A;  5E1A C;  1NH2 D;  3JAS A;  2Q0O C;  5L3F A;  4DR7 B;  2ZKO A;  3ZRX A;  3ICX A;  3ZMS A;  2ETN A;  1QBZ A;  3J80 N;  1BGY H;  2YXH A;  3CC2 V;  4R8C A;  3CCS V;  3HKB A;  1NH2 B;  4JI5 O;  3ABM B;  3WB1 A;  3OTO B;  2Q4P A;  3ZRV A;  1PL0 A;  5JJJ B;  4MTG A;  4CS2 A;  3EVK A;  1SA0 B;  1Y76 B;  2QTO A;  1XEQ A;  2JJ2 G;  1G4Y B;  3FAV A;  2IM9 A;  4UV9 A;  3OGC C;  2WWW A;  4X65 B;  1JPX A;  4MVO A;  1KP2 A;  4BIU A;  1RM1 B;  3TK1 A;  3C3S A;  1HNX B;  3T1C A;  5EBM C;  5CBH A;  4GKK O;  3OT7 A;  1V55 B;  3RYC A;  2ZE6 A;  3CD6 V;  2ADQ B;  2DYR C;  3DGE A;  3T4D A;  4O4J B;  3OR7 C;  1H2M A;  4JI8 B;  4QE7 A;  4U3J A;  4LF9 O;  4U7O A;  4WBN A;  3K9A A;  4P9P A;  4I9W A;  4OX9 B;  3CSX A;  1NKD A;  4LF5 B;  1EM1 A;  4Z1V A;  4DV3 O;  3LDE A;  4IYI A;  3ETQ A;  2QGN A;  5J2T B;  5CB4 A;  4P2Z A;  3QO7 A;  3QTC A;  4H0L B;  4O4L B;  2ADP A;  1K8A W;  1WPX A;  2VS0 A;  5H6R A;  1S5L Z;  4DV7 O;  3RW0 A;  4X66 O;  2F4V O;  1PD3 A;  2DQ0 A;  2KSD A;  1VF5 B;  1ARO P;  4GX2 A;  1M56 B;  4GT1 A;  2RNB A;  3K5N A;  2OIE A;  4LCU C;  2AHY A;  2PTM A;  4KHP B;  4DR3 B;  1JVM A;  2CTR A;  2E5L B;  1RM1 C;  5LL6 Y;  3IC9 A;  1IXM A;  3OR6 C;  4J7K A;  1OCR B;  2EIN B;  1ZWI C;  4TV8 B;  1NTK H;  2VQE O;  4ZI7 B;  1VF6 C;  4BW9 A;  4ZIB A;  4DV6 B;  1GO3 F;  2V4D A;  2A06 H;  2WLN A;  2R72 A;  3ZRW B;  4BIZ A;  2UXD B;  3CC4 V;  3PN1 A;  3CMA V;  2PYJ A;  4DUY B;  1H8E G;  2JGU A;  3ZRS A;  4IYH A;  4UCT A;  2QM4 A;  3CCR V;  5FPR A;  3SPJ A;  2LGW A;  2P7T C;  4I7Z B;  4LF8 B;  1LR1 A;  1G8M A;  1Y67 A;  1XMO B;  4JI2 O;  4KXR A;  2D2C B;  4CS3 A;  1K73 W;  4J10 A;  1EN5 A;  2ZQM A;  1VP7 A;  3I55 V;  5L3C A;  2RDC A;  3GWK C;  1VQP V;  5IJ0 B;  4NXM B;  3JAW B;  1OCZ B;  5LMU O;  3CHX A;  3D36 A;  3CRR A;  2NNU A;  4ZBM A;  3HKD A;  4GYC B;  2UXX A;  3DC5 A;  5H2F Z;  3SPI A;  3CYO A;  3JAK B;  2ZIM A;  1HR0 O;  4JPR A;  1DLB A;  4X1K B;  1YJN V;  2BCC H;  4JTA B;  2BTQ B;  2CAZ C;  1SS3 A;  4JAU A;  5JH7 A;  1GK9 A;  2LW7 A;  3BAA A;  3FD9 A;  4DV4 O;  5LMN B;  1JA8 A;  1OCR C;  2EIN C;  4X20 A;  3W7W A;  3RWR D;  1KMI Z;  1U97 A;  4LF4 O;  5KAI Z;  4LR3 A;  5IY5 B;  2UU9 O;  4W4K A;  4JYC A;  3VQV A;  2UXC O;  3SYO A;  1E1Q G;  5LYJ B;  5D5P A;  4HNA B;  1N4C A;  1WP7 A;  2QWQ B;  4R50 A;  4X1Y B;  1TUB B;  1Z2G A;  3WG7 B;  3E86 A;  2R70 A;  2B1I A;  2HG5 C;  4FFB A;  4PDL A;  1S5J A;  5LP6 A;  3TET A;  3LSU A;  2P5O A;  3WU2 Z;  2HVJ C;  1L1F A;  1FD9 A;  3W7T A;  4FZ1 A;  4UCO A;  1Q5O A;  1JFF A;  1QVG U;  4R7C A;  3JD0 A;  1OCZ C;  1K34 A;  2JVD A;  5JQG A;  5B3S B;  3MAQ A;  3RYI B;  3LNM B;  4XDJ A;  5CBG A;  1URF A;  1AVM A;  3OEH G;  1S0V A;  2ZDI A;  2R9A A;  5CN0 A;  1W2B U;  4GKK B;  4YIO A;  3DSQ A;  1L0N H;  4CH6 A;  1I5Y A;  3L73 H;  1W0J G;  1AI4 A;  3HKC B;  2ZNI A;  1YF2 A;  2JGD B;  2QE7 G;  4FLZ A;  1KB9 F;  5EC1 C;  3SDL A;  3X2Q B;  3EHB B;  3CEI A;  4LF9 B;  4OPA A;  2YC0 A;  1CP9 A;  5IY5 C;  2Q0A A;  5GTI Z;  4DV3 B;  3SR2 C;  1MAB G;  2A7W A;  3K5L A;  1CEZ A;  1ZAU A;  4DR4 B;  2HEP A;  5B1N A;  5CMU A;  5JCO C;  4JYY A;  1W0K G;  2KG7 A;  3ZJZ A;  3TCU A;  2QKC A;  5LOV A;  4LFA O;  3BRC A;  2P6J A;  1M1K W;  4WFE A;  1XOU A;  1ENV A;  3DXR A;  4W4L A;  5D5Q A;  4DV7 B;  4X66 B;  1NJI W;  2F4V B;  5C93 A;  2OWO A;  3CRM A;  4I4T A;  4O2A A;  2ZR3 A;  1B04 A;  4AQY O;  5FNV B;  3NXS A;  4JZ2 A;  3M99 B;  2Y0P A;  3JAR A;  3APO A;  3P30 A;  5IT9 N;  4DRX A;  1Y6X A;  4NKG B;  2UUA O;  2F43 G;  3A2F A;  1BS3 A;  2GUZ A;  3RYH B;  3B40 A;  1XUQ A;  3K59 A;  3C3T A;  4B7E A;  2ZCE A;  1VQM V;  3UKM A;  3M7M X;  1K33 A;  2WLI B;  3CJH B;  3E22 A;  3HB3 B;  2BOB C;  2Q69 A;  3K08 A;  4TOI A;  1KD1 W;  1YCI A;  5LA6 A;  1R3K C;  3H1I H;  4FM1 A;  1M9N A;  5EK0 A;  2EIM C;  4JTD B;  4PA6 A;  3U10 A;  5JJN B;  1TVK A;  1JMK C;  2YS8 A;  4NTW A;  5B66 Z;  5A2Q N;  4UVA A;  3UT5 A;  1KC8 W;  2HR3 A;  3N2G A;  5CA1 B;  4DW1 A;  5LXT A;  1AJQ A;  2XAG A;  1FKA O;  4JV5 O;  3H1H H;  4UCR A;  1HNW B;  3SJB C;  1JQ0 A;  2OIG A;  1BE3 H;  2GV9 A;  4ZOL B;  1AJP A;  4LFC O;  1G6U A;  3A0H Z;  1MOF A;  2DWD C;  4FIP C;  2YIB A;  2Y69 B;  1R6N A;  1HR0 B;  3E89 A;  1H2L A;  2OCC C;  3JSN A;  2YEV B;  1GTO A;  1LUV A;  2RMK B;  4TUY B;  1JCH A;  1Q86 W;  4EB6 A;  4DV4 B;  1DGS A;  2QWO B;  4UXN A;  4FFK A;  4LF4 B;  2UUB O;  1AIL A;  3GWO A;  1GM8 A;  3OUS A;  4FM0 A;  4FMT A;  3N2K B;  1GN4 A;  3AG3 B;  3L70 H;  4J42 A;  2IH1 C;  1K7D A;  1DF5 A;  3KCY A;  3QO5 A;  1QCE A;  1VQ5 V;  3OGI B;  1YXB A;  1Y74 A;  1WPB A;  3T2M A;  3K5O A;  2LQT A;  3OFN G;  4LF6 B;  3FYE B;  4PV1 B;  2PGG A;  1JOY A;  4FLU A;  2JJ1 G;  3JD4 A;  5EYP B;  4KL1 A;  1FFX B;  2QWN B;  1FS0 G;  1VQL V;  5CA0 B;  3CXH F;  2RCV A;  1M93 A;  3CME V;  4HAM A;  1FXK B;  1XMQ O;  4Q6G A;  2XAS A;  2EIK B;  3JD3 A;  2ZE8 A;  2UXB O;  2IJH A;  5EBW C;  5JVD A;  3JSL A;  1F7Y A;  2Y69 C;  4X89 A;  3F5T A;  1XI1 A;  5BZB A;  1SA0 A;  1Y76 A;  1QVF U;  3RN4 A;  1JJ2 U;  1FPO A;  4B3S O;  3CX5 F;  3ZCC A;  4RUF A;  2NN4 A;  4ZKI A;  1K9M W;  4I55 B;  2CK3 G;  3L75 H;  5B5E Z;  3FYI B;  1N33 O;  2QTS A;  1VF6 A;  2UXN A;  3TGU H;  4LNU A;  2EIJ C;  3G80 A;  2QA4 V;  2XHB A;  2VWK A;  1YIT V;  5CA3 A;  2ILM A;  2DW4 A;  2ZR2 A;  1ORQ C;  1UJW B;  4O4J A;  5J2U B;  1SET A;  2H3O A;  3AG4 B;  3IGA C;  4UVC A;  4DV0 O;  2Q68 A;  2YIC A;  1NU1 H;  1ZUQ A;  2A79 B;  5IYZ B;  4WFF A;  4PA9 A;  4DR5 O;  2PI4 A;  2DYR B;  1XNR B;  3HPL C;  3APQ A;  5J2T A;  3RYF B;  2YUA A;  2RQ6 A;  1PNL A;  3DTU B;  3K79 A;  1Q43 A;  4D7S A;  2EX3 A;  5K1X A;  2BE3 A;  4FLT A;  4O4L A;  4X9Q A;  1EZV H;  3QO8 A;  2C2A A;  1YIJ V;  1DK1 A;  2EIK C;  1XNQ B;  3F5W C;  1SKV A;  4K0K O;  2Z3Y A;  1M90 W;  1VF7 A;  1FFT B;  1PP9 H;  2HVK C;  2PF4 E;  3RBZ A;  5TIS Z;  1IBL O;  5HFM A;  4NB5 A;  4E2L A;  4YY3 B;  4QE9 A;  3H1K H;  2JDI G;  4WFH A;  1AR1 B;  4Q20 A;  2WA4 A;  1LNQ A;  1H38 A;  1Q3E A;  1R1B A;  2P06 A;  3PJS K;  4TV8 A;  4WFG A;  2Y4U A;  4ZI7 A;  3G71 V;  1IVS A;  4B3T O;  2YDE A;  1OV9 A;  4P9O A;  3ZRW A;  3R66 A;  5DM6 V;  1SQV H;  2CTW A;  3O65 A;  2UUC B;  2AZ2 A;  4EFE A;  4GX0 A;  3VQX A;  1D5N A;  5IE9 A;  4DW0 A;  2E74 B;  2K9P A;  5BR8 B;  2DOS A;  4I0X B;  4FM2 A;  3AG4 C;  3JAT B;  3AK1 A;  3WB2 A;  2DMX A;  2YIA A;  5LBQ A;  1GM7 A;  1K5Q A;  1MZF A;  1KU9 A;  2M6Y A;  5IJ0 A;  3JAW A;  4MT8 A;  3W7U A;  1IDS A;  4ABM A;  3KCX A;  3ETD A;  3SGI A;  1AI7 A;  5B1B B;  5F2V O;  4U3F H;  4JF3 A;  1Q82 W;  3JAK A;  1VQ6 V;  5FLX N;  1SZT A;  2UUB B;  4X1K A;  4JI4 O;  2QKA A;  2QR4 A;  4I9Q A;  2BTQ A;  1GN3 A;  4F6R B;  2EZP A;  1R6K A;  3T1Y B;  3OMI B;  4X62 O;  3JD1 A;  2P22 C;  4DV1 O;  4JI7 O;  4H33 A;  3EXA A;  5LYJ A;  4HNA A;  4KFM A;  2OT5 A;  1R3L C;  3OW2 U;  2FML A;  3T1H O;  1XDC A;  4MVS A;  4X1Y A;  3K57 A;  1Y4M A;  2WA3 A;  1TUB A;  1VMG A;  1XMQ B;  2P4V A;  3IFX A;  5GON B;  2UXB B;  4PA3 A;  4CH3 A;  3ZIA G;  4JTC B;  4B7K A;  3ASN C;  4UCV A;  4UCS A;  2H94 A;  4JZG A;  1HW7 A;  3E8H A;  1Q81 W;  2Y4T A;  2N04 A;  5LGN A;  2Y0I A;  3B09 A;  3SJA C;  5H9C A;  1BSM A;  1L8D A;  2F93 B;  4IL6 Z;  1T5E A;  2X0L A;  3CE2 A;  4MVU A;  3RYI A;  1BZK A;  5LHI A;  5B1B C;  1N33 B;  2WLJ A;  4JAS A;  1IXB A;  2XTA A;  4G28 B;  2L35 A;  5KX5 B;  3CC7 V;  3HKC A;  1BHB A;  1ZL8 B;  5L3G A;  1IX9 A;  2EIL C;  3OMA B;  2JGD A;  2CGN A;  5BY1 A;  1J5E O;  5EBL C;  1WAZ A;  5IJ9 B;  3LDC A;  4GX5 A;  4DK0 A;  3JCZ A;  1HNZ O;  2EZO A;  1EFR G;  4DV0 B;  3JD2 A;  2QWP B;  2HP8 A;  4DR5 B;  2HKO A;  1XQ8 A;  2Q73 A;  5KMG B;  3RFR A;  1EBO A;  4JYA O;  4X1I B;  4FPP A;  4MW3 A;  2IU3 A;  3KKY A;  4IGG A;  2ZXW C;  4QIW F;  3G6E V;  2W0X A;  1SQG A;  1VQN V;  4GKJ O;  1SC5 B;  2YI8 A;  3BCC H;  4K35 A;  1WA8 B;  4BIO A;  4EEQ A;  3BEH A;  4FJC C;  4O2B B;  1NVP D;  4EKW A;  3ZN0 A;  3O9O A;  4LH7 A;  2ZT9 B;  3U0Z A;  1H2N A;  5FNV A;  2XT9 A;  2OTL V;  1H2K A;  3SJC C;  1Q6H A;  3LNN A;  3FFQ A;  4CS4 A;  3FB6 C;  4MVM A;  2JRI A;  3B8M A;  3UO2 A;  4JI5 B;  1NVP B;  1OCO B;  2QEX V;  1PM9 A;  4CH5 A;  4B3T B;  1GRJ A;  1P7G A;  3RYH A;  4E4E A;  1TAE A;  3M8A A;  1KYO F;  4QNH B;  1NTM H;  3SYP A;  5LHH A;  4YJ3 B;  2CUG A;  3QVN A;  2ITC C;  2WLI A;  2B1G A;  1YVW A;  3CJH A;  4YIP A;  2ARH A;  3K9S A;  4O4H B;  1DF4 A;  1R3I C;  2X6B A;  4J41 A;  1KKC A;  2GTA A;  1SRY A;  2ZIO A;  3A0B Z;  2LO1 A;  4TWK A;  4QJF B;  3LUT B;  3IC7 A;  3AK3 A;  5CA1 A;  3OM3 B;  1U96 A;  4ICG A;  2XAH A;  2YID A;  2ZE5 A;  1HWY A;  4UV8 A;  1OCC C;  2WLL B;  1NZ6 A;  2EIM B;  1RPR A;  4ZOL A;  1BHA A;  3H01 A;  1F51 A;  1WLE A;  1W59 A;  4LP8 A;  5DEC A;  3SJQ C;  2Q9L A;  4IIJ B;  2YEV A;  1B3Q A;  1P4R A;  4TUY A;  1JJO A;  2GBO A;  4IHJ B;  4X62 B;  2JEX A;  3CWB H;  4UVB A;  1VQ9 V;  1OCO C;  4JI7 B;  3LSQ A;  4DV5 O;  3ZMV A;  2OCC B;  1R73 A;  1FXH A;  1OJH A;  2CH7 B;  5GTH Z;  1N32 O;  3N2K A;  3T1H B;  2JK5 C;  2ODM A;  2A0L A;  1WP8 A;  4XBF A;  4C7U A;  4K8X A;  4HZ3 A;  2BSK B;  2N05 A;  4R6Z A;  2VQE B;  4JI0 O; 
#chains in the Genus database with same CATH homology
 1M56 C;  3E35 A;  1S76 D;  3CD6 V;  2Y69 C;  4X89 A;  1M57 B;  2DYR C;  2Q6A A;  3DGE A;  2IH3 C;  3T4D A;  5IYB O;  5BZB A;  2NLJ C;  1QVF U;  3OR7 C;  1K97 A;  1I5X A;  4PA7 A;  1JJ2 U;  3OUF A;  2W6J G;  4JYB A;  3SPC A;  4QPK A;  3ZCC A;  4QE7 A;  4RUF A;  4U7O A;  4LC1 A;  3K9A A;  4P9P A;  4I9W A;  2KB1 A;  3R65 A;  4ZKI A;  1K9M W;  1NKD A;  3CPW U;  1FXK A;  2CK3 G;  3FB8 C;  3FYI B;  2LP7 A;  5IYC O;  3CCE V;  3LDE A;  2H8P C;  3CCU V;  2UXN A;  2EIJ C;  1KP3 A;  3ABK C;  4P2Z A;  4WF9 V;  2QA4 V;  1KQS U;  3QO7 A;  1YIT V;  4JAV A;  5CA3 A;  2HFE C;  1Q7Y W;  2DW4 A;  2ZR2 A;  1ORQ C;  1UJW B;  1K8A W;  1WPX A;  1SET A;  3CCJ V;  5H6R A;  3SPG A;  3RW0 A;  1NR7 A;  1PD3 A;  2DQ0 A;  3AG4 B;  3IGA C;  4UVC A;  4MVR A;  1ARO P;  3LDD A;  3ETG A;  2Q68 A;  3K04 A;  2HLD G;  2V7Q G;  1M56 B;  4GT1 A;  4GX2 A;  5FL7 G;  5L3D A;  1VQ7 V;  2A79 B;  1BL8 A;  2AHZ A;  3B77 A;  4PA9 A;  4WFF A;  2PI4 A;  2ITD C;  2DYR B;  4LCU C;  2AHY A;  3HPL C;  1JVM A;  3CCQ V;  1PNL A;  3DTU B;  2W6I G;  3K79 A;  1RM1 C;  3F7V C;  1VQO V;  1IXM A;  1S3J A;  3OR6 C;  3QO8 A;  1COW G;  1OCR B;  1ZWI C;  2C2A A;  2EIN B;  2XAJ A;  1YIJ V;  3SYQ A;  3I56 V;  2EIK C;  3ABU A;  2QM7 A;  2ATK C;  4PEL A;  4MVZ A;  3F5W C;  1XL6 A;  1GO3 F;  3AG1 C;  2Z3Y A;  1M90 W;  2WLN A;  3ZRW B;  4BIZ A;  4PDR A;  1NQT A;  2Q67 A;  3CC4 V;  1M57 C;  2EIJ B;  3CMA V;  4JGS A;  1FFT B;  3ABK B;  2HVK C;  1H8E G;  3RBZ A;  3ZRS A;  5HFM A;  4E2L A;  2MK3 A;  4BAY A;  2IW5 A;  1SES A;  4QE9 A;  1JX9 A;  3CCR V;  2JDI G;  4WFH A;  3SPJ A;  3FB5 C;  3FB7 C;  1AR1 B;  2P7T C;  4Q20 A;  2A9H A;  2JIZ G;  5H6Q A;  3WFV A;  3OE7 G;  1G8M A;  1LNQ A;  3BY6 A;  3ML0 A;  1PKX A;  4PA4 A;  1H38 A;  3PJS K;  3SPH A;  1K73 W;  4WFG A;  1S77 D;  3G71 V;  2ZQM A;  3AEI A;  1N8R W;  1QR8 A;  2ZD9 A;  3I55 V;  4P9O A;  3ZRW A;  5DM6 V;  5L3C A;  2IJJ A;  1VQP V;  1QLE B;  3E2E A;  1OCZ B;  4WFB V;  4GX0 A;  1PNM A;  3OAA G;  2ZDI C;  3WG7 C;  1MG1 A;  3D36 A;  4RQF A;  2NNU A;  4ZBM A;  2UXX A;  3SPI A;  2Y48 A;  3E83 A;  3AG4 C;  3CCM V;  1GKF A;  1GM9 A;  3ZMT A;  3CYO A;  3CP1 A;  1SER A;  3AG2 C;  4JPR A;  1DLB A;  3A0R A;  4RAI A;  3ABT A;  3D3I A;  1YJN V;  4JTA B;  2PI5 A;  4YXW G;  5LBQ A;  4MS2 A;  3ZMU A;  1GM7 A;  1K5Q A;  4JAU A;  4UUJ C;  3W7X A;  1GK9 A;  1K92 A;  2WLH A;  4J9Z B;  4RQE A;  1F4N A;  4I5S A;  5B3S C;  3F7Y C;  1THZ A;  1OCR C;  2EIN C;  3W7W A;  2WLM A;  2Z5U A;  1YI2 V;  4FK5 C;  4MT8 A;  4N23 A;  3W7U A;  1S5H C;  1VQK V;  3ETD A;  4TT3 G;  4BW5 A;  5IDJ A;  5IY5 B;  2FTK A;  4XDK A;  1J95 A;  1AI7 A;  1K5S A;  4JYC A;  5B1B B;  2M7W A;  1KEC A;  2D3O W;  3ETE A;  4JF3 A;  3SYO A;  3K0G A;  1Q82 W;  1VQ6 V;  1E1Q G;  1SZT A;  4H37 A;  4MW8 A;  4GX1 A;  4R50 A;  1R3J C;  4LBE C;  1YTF D;  3X2Q C;  2WSS G;  2EZP A;  2IJK A;  1R6K A;  3WG7 B;  3OMI B;  5DN6 G;  1K3E A;  5KA5 A;  2W0F C;  3E86 A;  2R9R B;  1E1R G;  2B1I A;  3JD1 A;  4PDM A;  2HG5 C;  1V54 C;  4PDL A;  2XAQ A;  5L3E A;  1YJW V;  4Z1M G;  4H33 A;  3AG2 B;  3TET A;  1YTF B;  3MD0 A;  2HVJ C;  1L1F A;  3W7T A;  2EJR A;  4DO2 A;  4PDV A;  4GCZ A;  4KFM A;  1QLE C;  2OT5 A;  1R3L C;  5HFL A;  4R7C A;  3STL C;  3OW2 U;  3JD0 A;  1OCZ C;  1QVG U;  3K0D A;  1K34 A;  4MVS A;  5B3S B;  4MTF A;  1Y4M A;  4ASU G;  4WCE V;  3LNM B;  4XDJ A;  2XAF A;  5CBG A;  3OEH G;  3CCL V;  1QLN A;  1S0V A;  2DYS B;  2QM8 A;  2ZDI A;  3IFX A;  3E8G A;  5CN0 A;  1W2B U;  4PA3 A;  3ZIA G;  5KA6 A;  4JTC B;  1H8H G;  3ASN C;  1I5Y A;  3RVZ A;  1W0J G;  2YSU B;  1AI4 A;  1Y66 A;  2H94 A;  4MTX A;  2JEU A;  3E8H A;  1AJN A;  4X88 A;  2WPD G;  1B6Q A;  2QE7 G;  1Q81 W;  5EC1 C;  4P30 A;  5LGN A;  3X2Q B;  4N21 A;  3EHB B;  3UM7 A;  3CXC U;  5H9C A;  1F23 A;  1CP9 A;  2K1E A;  1VQ4 V;  1K4D C;  2X0L A;  2XND G;  4MVU A;  5LHI A;  1V54 B;  5IY5 C;  3SYA A;  5B1B C;  3T4Z A;  1MAB G;  2WLJ A;  4JAS A;  1YJ9 V;  4MTO A;  4G28 B;  3ASO C;  1CEZ A;  2LFS A;  5B1N A;  2GHY A;  3CC7 V;  4MVQ A;  2IU0 A;  1BHB A;  5CMU A;  3K03 A;  5L3G A;  1W0K G;  2EIL C;  3OMA B;  3TCU A;  3ZJZ A;  3K06 A;  3ABL C;  2P6J A;  1M1K W;  4WFE A;  5EBL C;  4U7N A;  4L87 A;  1ENV A;  5LHG A;  1MSW D;  1NJI W;  2HJF C;  3LDC A;  4GX5 A;  5C93 A;  5LGT A;  3JCZ A;  2B5U A;  2EZO A;  1EFR G;  3JD2 A;  1PNK A;  2ZR3 A;  3K3W A;  3ASN B;  1OHH G;  2WLK A;  2HKO A;  5CBF A;  4TSF G;  2X6C A;  3NXS A;  2DWE C;  1EBO A;  3M99 B;  1H2G A;  3VOU A;  2X6A A;  1ROP A;  2GSM B;  4FPP A;  4MW3 A;  3P30 A;  1S72 V;  4QPJ A;  2IU3 A;  5GW7 A;  2ZXW C;  4QIW F;  5B1A B;  3G6E V;  3LSS A;  2DYS C;  2F43 G;  1VQN V;  3ZMZ A;  2V1D A;  3QNE A;  4XDL A;  3VBB A;  4G27 B;  1AI6 A;  3BEH A;  4FJC C;  2IJI A;  1NVP D;  1RPO A;  3E8F A;  4EKW A;  3JYC A;  3ZN0 A;  1VQM V;  5B1O A;  3UKM A;  3ASO B;  2R9I A;  5LGU A;  1YSC A;  3SYC A;  1K33 A;  5IYD O;  2OTL V;  2WLI B;  3EFF K;  3HB3 B;  4J9Y B;  2BOB C;  2Q69 A;  3K08 A;  1BMF G;  3RVY A;  3G4S V;  3FB6 C;  4MVM A;  1VQ8 V;  3STZ C;  2EIL B;  4WFA V;  1KD1 W;  3ZN1 A;  3B8M A;  3ABL B;  1R3K C;  1NR1 A;  1M9N A;  3OMN B;  1NVP B;  5EK0 A;  2EIM C;  2LFR A;  3B8N A;  4JTD B;  4PA6 A;  3W7S A;  1OCO B;  2QEX V;  2BOC C;  1KKD A;  3MHS C;  1NBM G;  1EZJ A;  3MHH C;  4UVA A;  1KC8 W;  2HR3 A;  4F4L A;  4QNH B;  1AJQ A;  3AG3 C;  2QKS A;  2XAG A;  5KUM A;  5LHH A;  3SYP A;  3GB7 C;  1P7B A;  2P90 A;  1JQ0 A;  3ABM C;  2ITC C;  2WLI A;  2B1G A;  2ZXW B;  1AJP A;  5EC2 C;  2XOK G;  1AI5 A;  2DQ3 A;  1MOF A;  4MSW C;  1XL4 A;  2DWD C;  4FIP C;  1DF4 A;  1R3I C;  2X6B A;  4KP4 A;  2Y69 B;  1R6N A;  1GMG A;  2OTJ V;  3E89 A;  1SRY A;  4HYO A;  4X8A A;  2OCC C;  2YEV B;  1K4C C;  4TWK A;  2WAM A;  1GTO A;  4QJF B;  3P32 A;  3LUT B;  3IC7 A;  4RUE A;  1FXK C;  3OM3 B;  1JCH A;  4OXS A;  1FXV A;  1Q86 W;  4CZZ A;  2XAH A;  1QR9 A;  5B1A C;  3CCV V;  4UXN A;  1TUE B;  1HWY A;  4UV8 A;  1V55 C;  4RO2 A;  5E1A C;  1OCC C;  1NH2 D;  2WLL B;  2EIM B;  1RPR A;  5L3F A;  4DXW A;  3GWO A;  3ZRX A;  1GM8 A;  3OUS A;  1BHA A;  3FKS G;  3H01 A;  1F51 A;  3KG2 A;  3ZMS A;  1QBZ A;  1WLE A;  4FMT A;  1OZ0 A;  4LP8 A;  3AG3 B;  4R8C A;  3SJQ C;  3CCS V;  3CC2 V;  2IH1 C;  1K7D A;  1DF5 A;  2YEV A;  3QO5 A;  1NH2 B;  1QCE A;  3ABM B;  1VQ5 V;  1P4R A;  3ZRV A;  5KUK A;  1PL0 A;  3T2M A;  4MTG A;  2JEX A;  4CBC A;  3OFN G;  4UVB A;  3FYE B;  1VQ9 V;  1OCO C;  2WLL A;  2QTO A;  1DTO A;  1G4Y B;  2JJ2 G;  3LSQ A;  4UV9 A;  1JOY A;  3OGC C;  2WWW A;  2P67 A;  1E79 G;  1JPX A;  2OCC B;  2JJ1 G;  3JD4 A;  1F4M A;  3OEE G;  4MVO A;  4G2K A;  3ZMV A;  1FXH A;  1KP2 A;  1R73 A;  1FS0 G;  4BIU A;  2EBO A;  1VQL V;  1RM1 B;  2X7R B;  3TK1 A;  3CME V;  4HAM A;  1FXK B;  1YHQ V;  4KUM A;  2JK5 C;  3E8B A;  2A0L A;  2XAS A;  2EIK B;  3T1C A;  5J9P C;  5EBM C;  1CPY A;  3JD3 A;  5L3B A;  4XBF A;  2IJH A;  5CBH A;  4HZ3 A;  5EBW C;  1V55 B;  4R6Z A;  1OCC B;  3AG1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...