3H1KH

Chicken cytochrome bc1 complex with zn++ and an iodinated derivative of kresoxim-methyl bound
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
69
Chain Sequence
b'EEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
molecule tags Oxidoreductase
publication title Crystallographic location of two Zn(2+)-binding sites in the avian cytochrome bc(1) complex
pubmed rcsb
total genus 20
structure length 69
sequence length 69
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3h1kH00
1PPJH 1SQQH 1BGYH 3L70H 1P84F 1SQBH 3BCCH 1BCCH 1EZVH 2BCCH 1KB9F 1NTMH 1SQVH 1L0NH 1NU1H 1BE3H 2IBZH 3H1JH 4D6TH 1KYOF 1SQPH 1SQXH 2FYUH 1NTKH 3L73H 3CXHF 4U3FH 3L74H 1PP9H 3L75H 3L71H 3H1LH 1L0LH 3TGUH 3H1HH 3H1KH 3CWBH 1NTZH 3H1IH 3L72H 2A06H 3CX5F 5KLVH 4PD4F
chains in the Genus database with same CATH superfamily
4DK1A 3T1YO 2Q68A 1HW7A 1M57C 1KU9A 1YJ9V 2CK3G 3PJSK 4BR6A 1FXVA 4DUZO 4IYHA 4W4LA 4NXMO 1S5JA 3K58A 4WF9V 3UCSC 3K59A 4O4JA 3K5NA 1K97A 1GM9A 4DK0A 5GONB 2IH3C 1JJOA 3FAVB 5KUMA 2Q5ZA 2UXDB 3RVZA 4O4HA 4KFMA 4B7EA 4JYCA 3O9OA 1JCHA 2BSKB 4P9OA 1PV0A 4JI7O 4U3JA 4DV1O 4J9ZB 3IGAC 1LR1A 1ZUQA 2R72A 5IY5C 3S3XA 1Q43A 3O65A 1VQ5V 2PI4A 4DR7B 4UVCA 3F5WC 5IYZA 5B3SC 2UXXA 3OE7G 3T1YB 3B2EE 4ZI7A 1KKCA 4BW9A 2QA4V 3TETA 1Y67A 1VARA 4YXWG 2PYLA 2NR5A 2ZR3A 4DV4O 1K34A 2CDYA 3G80A 1R3KC 2R9AA 1KKDA 4JI0B 1SRYA 4DV4B 5CA1A 3W7SA 1Q7YW 1ZL8B 4DR6O 4UCVA 3DSQA 1MG1A 1BE3H 2IBZH 1TGOA 4K3AA 3KZIZ 1QLEC 5B1AC 4H44B 5JJJB 3AK1A 3OFNG 3D3QA 4JAUA 1SETA 3CEIA 2EIJB 2UUAO 1RPRA 5EBLC 1N32O 4UVAA 2YI9A 3UO3A 4Z2WA 5LP6B 2YEVB 1GTOA 2DWDC 4Q20A 4LF8B 2DQ3A 2QWOB 3VQYA 1FS0G 4IL6Z 1DK1A 1FFTB 3CE2A 2UXBB 4AQYB 2C2AA 1TUBA 1BS3A 2YS8A 2BTQB 4OX9O 1F4NA 3BY6A 2E3CA 2WA3A 1R3LC 4JYAO 3CCEV 1D5AA 1A32A 4H13B 4K0KB 2DYRC 3NXSA 5KHKA 1GN6A 1LUVA 1KMIZ 2F43G 3JALB 5L3BA 2WA4A 3JAWB 2HVJC 2A3QA 3B4SA 4XBFA 4HYOA 1YDXA 1K33A 5IWAO 4X66B 3NR7A 3CCMV 4ASUG 2E5LO 3R65A 3W7TA 5K1XA 1GK9A 1KP2A 2IM9A 2IW5A 1M90W 1YEWA 1Q82W 1R3JC 3AEIA 3H1LH 5H5NA 4OGQB 4DV3B 1NTZH 2Q67A 3AG1C 4YHHB 3P32A 1M93A 4CC5A 3LSSA 2OT5A 2VS0A 2QSAA 1DF5A 2AZ2A 1QVGU 3P3PA 5CMUA 1AB3A 1BSMA 3OR7C 3CRRA 1RSOB 4YIOA 3ZMSA 3H1JH 1KYOF 5JH7B 4DO2A 1HWYA 3OEEG 1FXKC 3JATB 3H9VA 3HKEB 4HNAA 3ZRVA 1QNMA 4W4KA 1YVWA 3L9DA 1YF2A 2FL4A 1I7FA 1VQOV 4B3TB 3AG2B 1G4YB 3ZRWA 5KA6A 3DC5A 4GZRB 4DR1B 5IJ0A 3QVNA 3VOUA 1UJWB 3G4SV 2RCVA 1Y4MA 4FM2A 3ETDA 1XOUA 1VEWA 2JGDB 5E1AC 2Q8VA 2B1GA 1R6KA 1HNZO 1OCZC 4JI5O 1Q3EA 2WLHA 4I0XB 3H1IH 3B8NA 3JD3A 3K5LA 1R6TA 1OCCC 2HG5C 1KP3A 4ZOLA 2IJJA 2QM4A 2QWRB 5EYPA 3BABA 4HZ3A 1KB9F 4JI4O 3B8MA 4DW1A 5HFMA 5CBHA 5GW7A 1JA8A 1JQ0A 1ZLZA 2ZXWB 2B5UA 3JD4A 2EINB 1VF5B 2JGUA 1VIBA 3P30A 5LYJB 4QNHB 3RYIA 4WFBV 3SJCC 3SYPA 2UXDO 5L3CA 3TXQA 1H2GA 4P9PA 5LMUO 3J80N 3KKYA 3IAYA 2Q7EA 2JRIA 1GN2A 4MVMA 2WLIA 3ABKC 4O2AB 4TV8A 3CD6V 3CYOA 1N33O 2UXCB 2CE4A 2ZM6B 3WB0A 3D8CA 1PKXA 4NKGB 2F93B 1HNZB 4GLXA 2UUBO 2QWNB 5D5PA 5JQGB 2VQEB 5A9GA 2Q7HA 5LGUA 4MTXA 2CH7B 4MTFA 1WP7A 5KHIA 3FKSG 5D5QA 5J2UB 2DE0X 2Q73A 1N0NA 4DV0B 2JJ2G 2WAMA 1QLEB 5BMVB 3SPIA 3CSXA 3JD2A 4B3RB 5C8YA 4JTAB 5B1BC 2QWQB 3K5OA 2JIZG 2L35A 4JPRA 1EZJA 4X1KA 1N34O 2YIAA 2DJVA 1SQBH 4TSFG 3OTOO 2BCCH 1F7YA 1ZSPA 1EM1A 2DWEC 3K0DA 4WFGA 1N34B 1N36O 4JI2O 2EJ7A 1CPYA 5KMGA 4BAYA 2YUAA 4JI8O 1QU7A 1JJ2U 1AR1B 3FD9A 3IFXA 4TQFA 1AJQA 4I4TA 2ARHA 2UUBB 3CC4V 4JZ2A 5L3DA 5EZYB 4F6RB 1S0VA 3M8AA 1AR5A 3RFRA 1BL8A 1FAFA 2DYRB 3K04A 3U10A 3C3SA 5LXTA 1IURA 4DR3B 1L8DA 1QHTA 4KHPO 1AVMA 4UB6Z 1AP6A 3ETQA 5KHGA 1BMFG 4MW3A 1WB7A 1WPBA 3HKBA 4X65B 3SJQC 1WP8A 3U11A 1GRJA 2MK3A 4LNUA 2AGAA 5JVDB 4BWAA 2OWOA 3E8FA 4C7UA 4JTCB 4DRXB 4YJ2A 2EULA 1JFFA 4D6TH 1SKVA 5B1NA 3AG2C 4QE7A 1OCOB 4MS2A 2VWKA 2IJKA 1FPOA 3ZHRA 3CMAV 2ZE7A 1K4DC 2P7TC 1IBKB 4EB6B 1KQSU 5A2QN 4X89A 3FB8C 4CH3A 2EILC 1YXBA 4R6ZA 2JS3A 4U7NA 3ICXA 2P4KA 4TV9A 5L3EA 4GKKB 3RN4A 4DR1O 3RYCA 1B3QA 4PDRA 2OIEA 4LF6B 1GN3A 2FTKA 1JPXA 1Z5VA 1X4TA 4LF5O 5LHIA 4OX9B 5CN0A 5CA0B 1V9PA 3K06A 4NVPA 1XHZA 4FLTA 1AR4A 2JS5A 4FLVA 4WBNA 1Q86W 3E22B 3J7AU 3H1KH 3CWBH 2DN9A 4TUYA 3CX5F 3K9AA 3RVYA 2P4VA 4JF3A 1JOYA 1PD3A 3SPHA 2E5LB 4X1YA 3BA8A 1IVSA 2P90A 2PYJA 1V54B 2BE3A 2GSMB 1S5LZ 4LNUB 1VP7A 1OCZB 3IC7A 4DV3O 1QLNA 1ZTEA 2Q7GA 2ZIMA 1BQ0A 1EN6A 1SS3A 2Y0IA 4NXNO 3LUTB 5LA6A 4NXNB 3T2MA 2EX3A 1U96A 2Y4UA 1I5XA 2P6JA 1JMKC 2VRZA 4GKJO 1GMGA 4UCOA 3ZN0A 4FM1A 2ZD9A 4RO2A 1I08A 3H1HH 4X88A 3SDLA 1GKFA 2DOSA 4I4TB 1MMMA 4R7CA 5B1AB 5DEDA 3UKMA 4WCEV 2YSUB 2EIKC 4K8XA 4GX5A 1FYJA 1ZX3A 1XNRB 1CP9A 3JARB 2PY5A 5B1BB 1QR9A 4D7SA 4O4IB 3E8BA 5FNVB 5LOVB 2N05A 3AK3A 2LFSA 2DQ0A 1F23A 1XUQA 2FKXA 4DV5O 4NB5A 2F4VB 2W6JG 1YZBA 4YHHO 3T1HO 2HHHB 1G8MA 1HNWB 1DF4A 4TWKA 1AI7A 1DLBA 3AG7A 3ZMVA 1K8AW 5JCOA 1NR7A 1EBOA 5JJNB 4UCTA 1SZXA 4B3MB 1D2DA 1Q81W 4J7KA 5J2UA 4LF4O 2Q6AA 4RWUA 1HNXB 4J7ZA 2GBOA 3E22A 3GWOA 4YY3B 2LJ2A 5H9CA 5ITZA 1U97A 4WBNB 3W7UA 1XNQO 2ZQMA 1H2NA 1SERA 2LP7A 1ORQC 5JWPA 4FZ1A 2ADPA 4X62O 3HKDB 4YIPA 1EN4A 2F1MA 4KHPB 2XAGA 2AW9A 3RYCB 3GWKC 2O57A 1AILA 1JX9A 1NI8A 1K7DA 1RFYA 2ZIOA 3ZCCA 4JI1O 1GAXA 1SQXH 1KD1W 3GVMA 2QDOA 2FMLA 5FL7G 1QVFU 3RBZA 2JK5C 2E75B 2F23A 1Q6UA 2X6BA 1TAEA 5E79Z 3TCUA 3UO2A 4PDLA 2P67A 1KBHA 4JI2B 4D7TA 3ZIAG 4MVSA 4QGPA 4MW8A 3DXRA 3X2QC 3DTUB 2CTPA 1R73A 5GTHZ 2WPDG 1EN5A 2YIBA 1K4CC 3VBBA 1AJPA 3HKBB 1K5QA 3I55V 2XAQA 3QTCA 4PD4F 1RM1B 2L6LA 4FIPC 4HNAB 2X0LA 3JATA 2X6AA 3CCVV 5JH7A 4I5SA 5EK0A 3DXRB 2B1IA 1NJIW 3QO8A 1GH6A 4DR4O 3ETGA 3STLC 1NVPD 2XAFA 3JASB 2FB5A 4CC6A 5KMGB 4RQFA 1OCRB 2XTAA 4F6EA 3DGEA 4YY3O 5IYBO 4KUMA 1CXZB 2UUAB 1MSDA 1YIJV 3OGIB 2Z5UA 3JAWA 2PZSA 1AI5A 1F51A 3OAAG 3JALA 1ENVA 1WJZA 3AG4C 2OTLV 2DYSB 4DUYO 4XDLA 2WLJA 1SESA 5ITZB 4B7KA 1FXKA 2V7QG 4JAAA 4IHJB 4IHJA 3ZEDA 1YSCA 1RM1C 3VQXA 1FXKB 4EKWA 5JQGA 2ZR2A 3BVOA 2HR3A 1BCCH 3JCZA 1XMQO 4R50A 2Q9LA 5LL6Y 2Y48A 4FLYA 1HR0O 5AG2A 2YC0A 1M5IA 5F2VO 4TV8B 4O2AA 2WLIB 3RT3C 3BA9A 2QWPB 2D2CB 2ZINA 3OTFA 2ODMA 5LMNO 1UFIA 5LOVA 3E83A 4LFCO 4JI4B 4O4IA 4DR6B 1K3EA 5LYJA 2LW7A 1WNSA 2ITDC 3ABTA 1NTMH 2IU3A 4E4EA 1NT2B 3KCYA 3OUFA 3JSLA 3ZJZA 3AG3B 1FXHA 3JASA 4IYIA 1J5EB 4WFFA 2K1EA 1L0LH 4QJFB 5CA1B 2QR4A 1IBKO 2HVKC 5H2FZ 5EBWC 3BRCA 3OMNB 4I0XA 1SQQH 2JVDA 5B3SB 3ZHTA 3I5DA 1D5NA 2H94A 2ZE5A 4ZKIA 3CCQV 1NTKH 1P7BA 2QGNA 2XHBA 3CCLV 3K3WA 4PELA 4DR3O 3WFVA 1OJHA 3ZRWB 1H2KA 4LC1A 1PNMA 3HKEA 3ETEA 2YDEA 3EFFK 4K0KO 4RAIA 5LGTA 2P06A 5LP6C 3HR0A 2LFRA 3SPCA 4X1YB 3E86A 4FJCC 5LMNB 4TT3G 2CUGA 5KAFZ 2JJ1G 1K92A 2PF4E 3JD0A 1MZFA 4TUYB 4PDVA 4K35A 4RQEA 1LNQA 1R3IC 4OPAA 2YIDA 4ZIBA 2ZDIA 1XBLA 3AG1B 4RUFA 2IH1C 3SR2C 5CA0A 3G71V 3CXHF 3OR6C 1K5SA 4FM0A 3JYCA 3CRQA 3FX7A 2ZM6O 4JV5B 3OMAB 3HKDA 2A06H 1BQZA 3LDDA 2Y0PA 2CTQA 4ABMA 4G2KA 4LF7O 3ABMB 2AZ0A 2WLLA 3A0HZ 2IU0A 2CAZC 2RQ6A 2OYQA 4EFEA 2QTSA 2RMKB 1E1RG 5TISZ 1OCOC 4J11A 3BFRA 4JYYA 1NH2B 1GN4A 2AHZA 3OTOB 3FYIB 1IBLO 3CC2V 2ZE6A 2OCHA 2BTQA 3SPGA 1NQTA 4LFBB 4LFCB 3BAAA 2YXYA 2ZNIA 1JVMA 3OT7A 3LNMB 3JAKB 2AHYA 4QE9A 3B09A 4DV7B 3ZX6A 5JVDA 3J81N 3RYFB 2QKAA 5LHGA 4O2BB 2YEVA 3A0BZ 1COWG 1Q6HA 2PI5A 2EZOA 1I94O 3L72H 1M56B 1ROPA 5FNVA 5H6QA 3UQ8A 2XT9A 2LGQA 3JARA 2QEXV 1OCCB 4TQDA 3EHBB 2RJZA 1WB8A 4CS4A 3CCJV 2Z3YA 2Y4TA 4F6RA 1W59A 3FYEB 5LMUB 4X8AA 3E2EA 2KKWA 2HKOA 1EFRG 3Q4HA 1NZ6A 3WU2Z 3ZRSA 4B3RO 5CBFA 3SYQA 3SYOA 4MVOA 2XASA 4QIWF 4PA9A 5IWAB 3JSNA 4CS3A 2QKSA 4I50B 5LA6B 1TVKB 3OD4A 1QBZA 1XNRO 3ABUA 2KB1A 4GYCB 4H33A 1IX9A 5KLVH 1XL6A 4NTXA 4X65O 5BXZA 1CEZA 2EZPA 4FLWA 5H6RA 2CTWA 1WN7A 2WWWA 1S72V 4XDKA 4B3MO 4NTWA 4B3SO 1JR9A 3OEHG 1QCEA 1LUWA 1DTOA 4WFEA 4U3JB 5IY5B 1VQNV 2G38A 2BSKA 2QM7A 1IXBA 3L75H 3E8GA 3B77A 1NBMG 3K79A 2YICA 2CH7A 2Q4PA 4G28B 4GUNA 3CS5A 2H8PC 3D36C 4KXRA 3ML0A 4Z1VA 1S5HC 2RNBA 4O4JB 2IJHA 2KSDA 1US6A 4KL1A 3ZHVA 3F7YC 1MA1A 2A9HA 5FLXN 2RN9A 2B9ZA 4X20A 4AI8A 1P49A 3KG2A 3LSUA 1VQ4V 4LFAO 3U0ZA 1S76D 4FZ0A 1AP5A 1N4CA 3RYIB 1M57B 4G27B 3UM7A 1Y76A 3TJTA 4TV9B 1SC5B 2KG7A 4JI6O 4MVZA 1VQKV 3JD1A 4ZHQB 4LCUC 2JEXA 1NR1A 1FFXA 3UT5B 5EYPB 3QO7A 4EB6A 4ZOLB 2XUMA 2UUCB 1GO3F 5GTIZ 4GT1A 2CGNA 2HLDG 5EC2C 1JFFB 4L87A 4YJ2B 4DRXA 1SQGA 2F95B 1YITV 2JGDA 2AXTZ 1XQ8A 5CB4B 4J9YB 5IJ0B 3RYHB 3GB7C 3I56V 2XAHA 1XNQB 2W0XA 3K08A 4N21A 5CA3A 2GHYA 4B08A 2VQEO 4DV6O 4LF6O 3W7WA 3K57A 3OMIB 2N04A 3A2FA 3MHSC 5B66Z 5LXTB 1RSOA 2DYSC 5HFLA 3KCXA 3AG4B 2HJDA 2Q0AA 3ZMZA 5EZYA 2HFEC 1HNWO 5DECA 1R6NA 4BW5A 2GUZA 1OV9A 4LH7A 4DV5B 1VQLV 5B5EZ 2F66C 1FKAO 4UUJC 1BZKA 1L0NH 4DR2O 3SGIA 1MOFA 3CJHB 2P22C 2UU9B 2ZXWC 2OCCC 3SYCA 2GDSA 3LNNA 1M1KW 4FLZA 2UU9O 4X1KB 2M7WA 4JYBA 3WB2A 1Q90D 3HKCA 3ZBHA 4H0LB 1K73W 2F4VO 2P5OA 4IT5A 4IGGA 5C8YB 1DGSA 2QKCA 3WG7C 5BMVA 4FK5C 4DUYB 3P3NA 2K9PA 4I55A 4FFBA 1NKDA 4J41A 2QE7G 4UV8A 1FJGB 3ZN1A 4X1IA 4N23A 3N2GB 5K1PA 1IXMA 3MD0A 1N8RW 4H37A 2EIMC 3C3TA 3RW0A 2BTOA 1TUBB 4DV0O 3QNEA 3MHHC 1HR0B 5KX5B 5DM6V 3T4ZA 1IBMB 4PDMA 4DXWA 4GKJB 1SQPH 1KECA 2ATKC 2EIJC 4NR1A 5EIBC 3L73H 3X2QB 4QPJA 4U3FH 4ZBMA 4JASA 5FPOA 2QTOA 2EIKB 1M9NA 3OM3B 2XNDG 4JGSA 1TUEB 2OTJV 1Z2GA 3CXCU 1W0KG 3T1CA 2YIBD 5IJ9A 1YTFD 1KC8W 1J5EO 2BOCC 2H3OA 1ZL8A 1Y6XA 2QM8A 4OXSA 2HJFC 1FD9A 2XAJA 4MT8A 1WLEA 2NLJC 4X64O 2OIGA 1T5EA 3SJAC 3ZRXA 5L3GA 4YJ3B 5CBGA 4LFAB 4ZI7B 4PA6A 1P7GA 4O4LB 4UCUA 4AHCA 4E2LA 3FB5C 4JI3B 1WPXA 4PHZA 3G6EV 1VQ6V 1VF7A 3BEHA 2NN4A 1Y66A 4HBNA 4NYKA 5LBQA 3ZHQA 4JI0O 3W7XA 2VQFB 3RGBA 1G1XB 3SYAA 5J2TB 2DMXA 3AK2A 1H2MA 4KP4A 3CRCA 4O4HB 3STZC 1GM7A 3ABMC 4LWSA 1N32B 2V4DA 1SQFA 2CTRA 1XHXA 3SJBC 3F7VC 1P4RA 2DW4A 3WB1A 1VQ9V 2E76B 4FLUA 2X7RB 2UUCO 3E8HA 1YJNV 4GKKO 4I9WA 4P30A 3OGCC 1MSWD 5DN6G 1XMOO 3K0GA 2BOBC 1SA0A 4LF9O 1S3JA 3WG7B 3N27A 5KAIZ 1W0JG 3G6BA 1I5YA 1PPJH 4R8CA 4LF4B 4Q6GA 2R9RB 3OW2U 4UCRA 2WLKA 3ASNB 4JI6B 5IT9N 2A0LA 3D36A 3QF7A 1ZAUA 1PNLA 2IJIA 4JI3O 1UPGA 2YXHA 3JCUZ 3B40A 1YCIA 5BR8O 4IIJA 3RWRD 2W0FC 1B04A 4LWSB 1M4UA 4MVRA 2EJRA 2V1DA 1NH2D 4HAMA 5J2TA 3APQA 4CBCA 4J7JA 1I94B 2YXLA 1X59A 1V54C 4B3SB 1AI4A 4J10A 5LP6A 2Z0AA 4DR2B 3TGUH 4DR4B 2HP8A 4CH5A 3THOA 3M99B 4P2ZA 1BGYH 1BT8A 1MZEA 4O4LA 3TXSA 1NVPB 2KQXA 3CCSV 1BHAA 2GTAA 2E74B 1SZTA 3E89A 4GCZA 4AQYO 4UVBA 1AROP 1BHBA 4FFKA 4I9QA 3N2KB 1H8HG 5J9PC 3L74H 1MABG 2JEUA 4JTDB 3L71H 2ZE8A 5BZBA 4LF5B 4DV6B 1FJGO 2Q69A 5IJ9B 2W6IG 3A0RA 2ITCC 4NTYA 5IYZB 4DV7O 4DW0A 2NNUA 3FB7C 3CB2A 3R66A 4MVUA 1G6UA 2ZKOA 4CH4A 2MW2B 4UV9A 2ZNJA 3K5MA 1THZA 2R70A 1PM9A 2X6CA 1V55C 1MNGA 4DR7O 4JI1B 1Q8IA 1K9MW 2ZCEA 4JAVA 1GM8A 2WLNA 4EEQA 4WFAV 1N33B 2EBOA 5KX5A 3IC9A 4OPHA 3MAQA 5L3FA 1XMOB 4AILC 3ABKB 3SPJA 2PGGA 3FAVA 4IIJB 1Q5OA 3N2GA 3EVKA 4X1IB 5GONA 5JJEB 4FPPA 2UXCO 4DR5B 1TA8A 5JCOC 5EIBD 1L1FA 1OZ0A 2ILMA 4X64B 2M6YA 3LDCA 1WA8A 2A7WA 2N74A 1H8EG 3ASNC 3HKCB 4DV2O 3AG3C 1YI2V 5KUKA 1SA0B 3HB3B 2UXNA 1S77D 1KUQA 1Z5WA 2ADQB 3CJHA 4LP8A 1NU1H 5KA5A 1XREA 1B06A 4MTGA 2ZT9B 3TK1A 2YI8A 3FB6C 4LF9B 3CP1A 4XDJA 3QO5A 1V55B 1HP8A 1IZ3A 1R1BA 1OHHG 2Q0OC 1H38A 1VF6A 4UCSA 1XDCA 4NXMB 1Y74B 1PP9H 1ZWIC 3ZHUA 2PTMA 2LW1A 1Q6IA 1VF6C 3HPLC 4UB8Z 3LDEA 5BR8B 2A79B 2PUSA 2Y69B 5CB4A 4BIZA 4RUEA 3CRMA 2R9IA 3PN1A 1Y74A 1VMGA 2ETNA 4YJ3A 1URFA 1IBLB 1O9GA 3OUSA 3IJ4A 4JV5O 5BY1A 4K8ZA 5IDJA 4PV1B 4FLXA 4DYLA 4PA3A 4LF8O 1H2LA 4UFZA 1H2SB 1PL0A 3L70H 4LF7B 1O9HA 1HDJA 4L8JA 3UT5A 4UXNA 4CZZA 2UXBO 2LQTA 3CMEV 3ZHSA 3FFQA 3EXAA 2KG7B 3E35A 1Y76B 4PI2A 1N0JA 5IE9A 4JI8B 4LFBO 3CCRV 3ASOB 1XILA 4X20B 4BIOA 2LO1A 2D3OW 3S3WA 4I7ZB 1AI6A 5EBMC 5B1OA 2FYUH 1VQ8V 4DV2B 5KHJA 3C90A 4MVQA 4MSWC 1B6QA 1XEQA 3ZS8C 4PA4A 1WAZA 4Z1MG 3ZMTA 2Y69C 4X62B 4F4LA 4BIUA 4FVMA 1P84F 3BCCH 4DR5O 1YJWV 1EZVH 1QQCA 1E79G 4FFBB 2RDCA 3CC7V 4JI5B 4I55B 3ABLB 1YHQV 3F5TA 2LGWA 4TOIA 1IBMO 1VQ7V 4QPKA 3APOA 3A8TA 1YTFB 1E1QG 4ICGA 1HNXO 4A5UB 1W2BU 4MTOA 4JI7B 2VWJA 2JDIG 2VQFO 3ASOC 1TVKA 4I50A 2XOKG 3M7MX 1XI1A 1J95A 4FMTA 3G67A 1SQVH 4LR3A 3H01A 3CPWU 3T4DA 3CCUV 4CS2A 2WSSG 2OCCB 2GUZB 2GTSA 3Q4HB 4X9QA 4LH6A 2EINC 1RPOA 3N2KA 4JZGA 2QJ1A 1OCRC 1XMQB 2GV9A 5KHHA 1M56C 5EC1C 5LHHA 4WFHA 5IYDO 1NS1A 4J42A 4DUZB 5C93A 5LGNA 1SF9A 4B3TO 4X66O 1RP3B 3K03A 3RYHA 3MDSA 4GX1A 3DC6A 4PI0A 4JYAB 1PL4A 3BPZA 4O2BA 3CHXA 3RYFA 3D3IA 3JAMN 1QR8A 5IYCO 5FPRA 2WLMA 4EFBA 3JAKA 1N36B 1AJNA 4PJ0Z 3VQVA 3VQWA 4GX2A 1PNKA 1VQMV 1F4MA 1XL4A 3T1HB 2HHHO 3K9SA 4DV1B 4LBEC 1FFXB 1IDSA 2EIMB 4ZHQA 3LSQA 3CRAA 4PA7A 2HEPA 2WLLB 3ZMUA 4CH6A 4U7OA 3QG5A 1VQPV 2EILB 4GX0A 2CGOA 1I0HA 4J80A 3BHPA 3ABLC 1WA8B 2ZDIC
chains in the Genus database with same CATH topology
1PPJH 1SQQH 1BGYH 3L70H 1P84F 1SQBH 3BCCH 1BCCH 1EZVH 2BCCH 1KB9F 1NTMH 1SQVH 1L0NH 1NU1H 1BE3H 2IBZH 3H1JH 4D6TH 1KYOF 1SQPH 1SQXH 2FYUH 1NTKH 3L73H 3CXHF 4U3FH 3L74H 1PP9H 3L75H 3L71H 3H1LH 1L0LH 3TGUH 3H1HH 3H1KH 3CWBH 1NTZH 3H1IH 3L72H 2A06H 3CX5F 5KLVH 4PD4F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PPJ H;  1SQQ H;  1BGY H;  3L70 H;  1P84 F;  1SQB H;  3BCC H;  1BCC H;  1EZV H;  2BCC H;  1KB9 F;  1NTM H;  1SQV H;  1L0N H;  1NU1 H;  1BE3 H;  2IBZ H;  3H1J H;  4D6T H;  1KYO F;  1SQP H;  1SQX H;  2FYU H;  1NTK H;  3L73 H;  3CXH F;  4U3F H;  3L74 H;  1PP9 H;  3L75 H;  3L71 H;  3H1L H;  1L0L H;  3TGU H;  3H1H H;  3H1K H;  3CWB H;  1NTZ H;  3H1I H;  3L72 H;  2A06 H;  3CX5 F;  5KLV H;  4PD4 F; 
#chains in the Genus database with same CATH topology
 4DK1 A;  3T1Y O;  2Q68 A;  1HW7 A;  1M57 C;  1KU9 A;  1YJ9 V;  2CK3 G;  3PJS K;  4BR6 A;  1FXV A;  4DUZ O;  4IYH A;  4W4L A;  4NXM O;  1S5J A;  3K58 A;  4WF9 V;  3UCS C;  3K59 A;  4O4J A;  3K5N A;  1K97 A;  1GM9 A;  4DK0 A;  5GON B;  2IH3 C;  1JJO A;  3FAV B;  5KUM A;  2Q5Z A;  2UXD B;  3RVZ A;  4O4H A;  4KFM A;  4B7E A;  4JYC A;  3O9O A;  1JCH A;  2BSK B;  4P9O A;  1PV0 A;  4JI7 O;  4U3J A;  4DV1 O;  4J9Z B;  3IGA C;  1LR1 A;  1ZUQ A;  2R72 A;  5IY5 C;  3S3X A;  1Q43 A;  3O65 A;  1VQ5 V;  2PI4 A;  4DR7 B;  4UVC A;  3F5W C;  5IYZ A;  5B3S C;  2UXX A;  3OE7 G;  3T1Y B;  3B2E E;  4ZI7 A;  1KKC A;  4BW9 A;  2QA4 V;  3TET A;  1Y67 A;  1VAR A;  4YXW G;  2PYL A;  2NR5 A;  2ZR3 A;  4DV4 O;  1K34 A;  2CDY A;  3G80 A;  1R3K C;  2R9A A;  1KKD A;  4JI0 B;  1SRY A;  4DV4 B;  5CA1 A;  3W7S A;  1Q7Y W;  1ZL8 B;  4DR6 O;  4UCV A;  3DSQ A;  1MG1 A;  1BE3 H;  2IBZ H;  1TGO A;  4K3A A;  3KZI Z;  1QLE C;  5B1A C;  4H44 B;  5JJJ B;  3AK1 A;  3OFN G;  3D3Q A;  4JAU A;  1SET A;  3CEI A;  2EIJ B;  2UUA O;  1RPR A;  5EBL C;  1N32 O;  4UVA A;  2YI9 A;  3UO3 A;  4Z2W A;  5LP6 B;  2YEV B;  1GTO A;  2DWD C;  4Q20 A;  4LF8 B;  2DQ3 A;  2QWO B;  3VQY A;  1FS0 G;  4IL6 Z;  1DK1 A;  1FFT B;  3CE2 A;  2UXB B;  4AQY B;  2C2A A;  1TUB A;  1BS3 A;  2YS8 A;  2BTQ B;  4OX9 O;  1F4N A;  3BY6 A;  2E3C A;  2WA3 A;  1R3L C;  4JYA O;  3CCE V;  1D5A A;  1A32 A;  4H13 B;  4K0K B;  2DYR C;  3NXS A;  5KHK A;  1GN6 A;  1LUV A;  1KMI Z;  2F43 G;  3JAL B;  5L3B A;  2WA4 A;  3JAW B;  2HVJ C;  2A3Q A;  3B4S A;  4XBF A;  4HYO A;  1YDX A;  1K33 A;  5IWA O;  4X66 B;  3NR7 A;  3CCM V;  4ASU G;  2E5L O;  3R65 A;  3W7T A;  5K1X A;  1GK9 A;  1KP2 A;  2IM9 A;  2IW5 A;  1M90 W;  1YEW A;  1Q82 W;  1R3J C;  3AEI A;  3H1L H;  5H5N A;  4OGQ B;  4DV3 B;  1NTZ H;  2Q67 A;  3AG1 C;  4YHH B;  3P32 A;  1M93 A;  4CC5 A;  3LSS A;  2OT5 A;  2VS0 A;  2QSA A;  1DF5 A;  2AZ2 A;  1QVG U;  3P3P A;  5CMU A;  1AB3 A;  1BSM A;  3OR7 C;  3CRR A;  1RSO B;  4YIO A;  3ZMS A;  3H1J H;  1KYO F;  5JH7 B;  4DO2 A;  1HWY A;  3OEE G;  1FXK C;  3JAT B;  3H9V A;  3HKE B;  4HNA A;  3ZRV A;  1QNM A;  4W4K A;  1YVW A;  3L9D A;  1YF2 A;  2FL4 A;  1I7F A;  1VQO V;  4B3T B;  3AG2 B;  1G4Y B;  3ZRW A;  5KA6 A;  3DC5 A;  4GZR B;  4DR1 B;  5IJ0 A;  3QVN A;  3VOU A;  1UJW B;  3G4S V;  2RCV A;  1Y4M A;  4FM2 A;  3ETD A;  1XOU A;  1VEW A;  2JGD B;  5E1A C;  2Q8V A;  2B1G A;  1R6K A;  1HNZ O;  1OCZ C;  4JI5 O;  1Q3E A;  2WLH A;  4I0X B;  3H1I H;  3B8N A;  3JD3 A;  3K5L A;  1R6T A;  1OCC C;  2HG5 C;  1KP3 A;  4ZOL A;  2IJJ A;  2QM4 A;  2QWR B;  5EYP A;  3BAB A;  4HZ3 A;  1KB9 F;  4JI4 O;  3B8M A;  4DW1 A;  5HFM A;  5CBH A;  5GW7 A;  1JA8 A;  1JQ0 A;  1ZLZ A;  2ZXW B;  2B5U A;  3JD4 A;  2EIN B;  1VF5 B;  2JGU A;  1VIB A;  3P30 A;  5LYJ B;  4QNH B;  3RYI A;  4WFB V;  3SJC C;  3SYP A;  2UXD O;  5L3C A;  3TXQ A;  1H2G A;  4P9P A;  5LMU O;  3J80 N;  3KKY A;  3IAY A;  2Q7E A;  2JRI A;  1GN2 A;  4MVM A;  2WLI A;  3ABK C;  4O2A B;  4TV8 A;  3CD6 V;  3CYO A;  1N33 O;  2UXC B;  2CE4 A;  2ZM6 B;  3WB0 A;  3D8C A;  1PKX A;  4NKG B;  2F93 B;  1HNZ B;  4GLX A;  2UUB O;  2QWN B;  5D5P A;  5JQG B;  2VQE B;  5A9G A;  2Q7H A;  5LGU A;  4MTX A;  2CH7 B;  4MTF A;  1WP7 A;  5KHI A;  3FKS G;  5D5Q A;  5J2U B;  2DE0 X;  2Q73 A;  1N0N A;  4DV0 B;  2JJ2 G;  2WAM A;  1QLE B;  5BMV B;  3SPI A;  3CSX A;  3JD2 A;  4B3R B;  5C8Y A;  4JTA B;  5B1B C;  2QWQ B;  3K5O A;  2JIZ G;  2L35 A;  4JPR A;  1EZJ A;  4X1K A;  1N34 O;  2YIA A;  2DJV A;  1SQB H;  4TSF G;  3OTO O;  2BCC H;  1F7Y A;  1ZSP A;  1EM1 A;  2DWE C;  3K0D A;  4WFG A;  1N34 B;  1N36 O;  4JI2 O;  2EJ7 A;  1CPY A;  5KMG A;  4BAY A;  2YUA A;  4JI8 O;  1QU7 A;  1JJ2 U;  1AR1 B;  3FD9 A;  3IFX A;  4TQF A;  1AJQ A;  4I4T A;  2ARH A;  2UUB B;  3CC4 V;  4JZ2 A;  5L3D A;  5EZY B;  4F6R B;  1S0V A;  3M8A A;  1AR5 A;  3RFR A;  1BL8 A;  1FAF A;  2DYR B;  3K04 A;  3U10 A;  3C3S A;  5LXT A;  1IUR A;  4DR3 B;  1L8D A;  1QHT A;  4KHP O;  1AVM A;  4UB6 Z;  1AP6 A;  3ETQ A;  5KHG A;  1BMF G;  4MW3 A;  1WB7 A;  1WPB A;  3HKB A;  4X65 B;  3SJQ C;  1WP8 A;  3U11 A;  1GRJ A;  2MK3 A;  4LNU A;  2AGA A;  5JVD B;  4BWA A;  2OWO A;  3E8F A;  4C7U A;  4JTC B;  4DRX B;  4YJ2 A;  2EUL A;  1JFF A;  4D6T H;  1SKV A;  5B1N A;  3AG2 C;  4QE7 A;  1OCO B;  4MS2 A;  2VWK A;  2IJK A;  1FPO A;  3ZHR A;  3CMA V;  2ZE7 A;  1K4D C;  2P7T C;  1IBK B;  4EB6 B;  1KQS U;  5A2Q N;  4X89 A;  3FB8 C;  4CH3 A;  2EIL C;  1YXB A;  4R6Z A;  2JS3 A;  4U7N A;  3ICX A;  2P4K A;  4TV9 A;  5L3E A;  4GKK B;  3RN4 A;  4DR1 O;  3RYC A;  1B3Q A;  4PDR A;  2OIE A;  4LF6 B;  1GN3 A;  2FTK A;  1JPX A;  1Z5V A;  1X4T A;  4LF5 O;  5LHI A;  4OX9 B;  5CN0 A;  5CA0 B;  1V9P A;  3K06 A;  4NVP A;  1XHZ A;  4FLT A;  1AR4 A;  2JS5 A;  4FLV A;  4WBN A;  1Q86 W;  3E22 B;  3J7A U;  3H1K H;  3CWB H;  2DN9 A;  4TUY A;  3CX5 F;  3K9A A;  3RVY A;  2P4V A;  4JF3 A;  1JOY A;  1PD3 A;  3SPH A;  2E5L B;  4X1Y A;  3BA8 A;  1IVS A;  2P90 A;  2PYJ A;  1V54 B;  2BE3 A;  2GSM B;  1S5L Z;  4LNU B;  1VP7 A;  1OCZ B;  3IC7 A;  4DV3 O;  1QLN A;  1ZTE A;  2Q7G A;  2ZIM A;  1BQ0 A;  1EN6 A;  1SS3 A;  2Y0I A;  4NXN O;  3LUT B;  5LA6 A;  4NXN B;  3T2M A;  2EX3 A;  1U96 A;  2Y4U A;  1I5X A;  2P6J A;  1JMK C;  2VRZ A;  4GKJ O;  1GMG A;  4UCO A;  3ZN0 A;  4FM1 A;  2ZD9 A;  4RO2 A;  1I08 A;  3H1H H;  4X88 A;  3SDL A;  1GKF A;  2DOS A;  4I4T B;  1MMM A;  4R7C A;  5B1A B;  5DED A;  3UKM A;  4WCE V;  2YSU B;  2EIK C;  4K8X A;  4GX5 A;  1FYJ A;  1ZX3 A;  1XNR B;  1CP9 A;  3JAR B;  2PY5 A;  5B1B B;  1QR9 A;  4D7S A;  4O4I B;  3E8B A;  5FNV B;  5LOV B;  2N05 A;  3AK3 A;  2LFS A;  2DQ0 A;  1F23 A;  1XUQ A;  2FKX A;  4DV5 O;  4NB5 A;  2F4V B;  2W6J G;  1YZB A;  4YHH O;  3T1H O;  2HHH B;  1G8M A;  1HNW B;  1DF4 A;  4TWK A;  1AI7 A;  1DLB A;  3AG7 A;  3ZMV A;  1K8A W;  5JCO A;  1NR7 A;  1EBO A;  5JJN B;  4UCT A;  1SZX A;  4B3M B;  1D2D A;  1Q81 W;  4J7K A;  5J2U A;  4LF4 O;  2Q6A A;  4RWU A;  1HNX B;  4J7Z A;  2GBO A;  3E22 A;  3GWO A;  4YY3 B;  2LJ2 A;  5H9C A;  5ITZ A;  1U97 A;  4WBN B;  3W7U A;  1XNQ O;  2ZQM A;  1H2N A;  1SER A;  2LP7 A;  1ORQ C;  5JWP A;  4FZ1 A;  2ADP A;  4X62 O;  3HKD B;  4YIP A;  1EN4 A;  2F1M A;  4KHP B;  2XAG A;  2AW9 A;  3RYC B;  3GWK C;  2O57 A;  1AIL A;  1JX9 A;  1NI8 A;  1K7D A;  1RFY A;  2ZIO A;  3ZCC A;  4JI1 O;  1GAX A;  1SQX H;  1KD1 W;  3GVM A;  2QDO A;  2FML A;  5FL7 G;  1QVF U;  3RBZ A;  2JK5 C;  2E75 B;  2F23 A;  1Q6U A;  2X6B A;  1TAE A;  5E79 Z;  3TCU A;  3UO2 A;  4PDL A;  2P67 A;  1KBH A;  4JI2 B;  4D7T A;  3ZIA G;  4MVS A;  4QGP A;  4MW8 A;  3DXR A;  3X2Q C;  3DTU B;  2CTP A;  1R73 A;  5GTH Z;  2WPD G;  1EN5 A;  2YIB A;  1K4C C;  3VBB A;  1AJP A;  3HKB B;  1K5Q A;  3I55 V;  2XAQ A;  3QTC A;  4PD4 F;  1RM1 B;  2L6L A;  4FIP C;  4HNA B;  2X0L A;  3JAT A;  2X6A A;  3CCV V;  5JH7 A;  4I5S A;  5EK0 A;  3DXR B;  2B1I A;  1NJI W;  3QO8 A;  1GH6 A;  4DR4 O;  3ETG A;  3STL C;  1NVP D;  2XAF A;  3JAS B;  2FB5 A;  4CC6 A;  5KMG B;  4RQF A;  1OCR B;  2XTA A;  4F6E A;  3DGE A;  4YY3 O;  5IYB O;  4KUM A;  1CXZ B;  2UUA B;  1MSD A;  1YIJ V;  3OGI B;  2Z5U A;  3JAW A;  2PZS A;  1AI5 A;  1F51 A;  3OAA G;  3JAL A;  1ENV A;  1WJZ A;  3AG4 C;  2OTL V;  2DYS B;  4DUY O;  4XDL A;  2WLJ A;  1SES A;  5ITZ B;  4B7K A;  1FXK A;  2V7Q G;  4JAA A;  4IHJ B;  4IHJ A;  3ZED A;  1YSC A;  1RM1 C;  3VQX A;  1FXK B;  4EKW A;  5JQG A;  2ZR2 A;  3BVO A;  2HR3 A;  1BCC H;  3JCZ A;  1XMQ O;  4R50 A;  2Q9L A;  5LL6 Y;  2Y48 A;  4FLY A;  1HR0 O;  5AG2 A;  2YC0 A;  1M5I A;  5F2V O;  4TV8 B;  4O2A A;  2WLI B;  3RT3 C;  3BA9 A;  2QWP B;  2D2C B;  2ZIN A;  3OTF A;  2ODM A;  5LMN O;  1UFI A;  5LOV A;  3E83 A;  4LFC O;  4JI4 B;  4O4I A;  4DR6 B;  1K3E A;  5LYJ A;  2LW7 A;  1WNS A;  2ITD C;  3ABT A;  1NTM H;  2IU3 A;  4E4E A;  1NT2 B;  3KCY A;  3OUF A;  3JSL A;  3ZJZ A;  3AG3 B;  1FXH A;  3JAS A;  4IYI A;  1J5E B;  4WFF A;  2K1E A;  1L0L H;  4QJF B;  5CA1 B;  2QR4 A;  1IBK O;  2HVK C;  5H2F Z;  5EBW C;  3BRC A;  3OMN B;  4I0X A;  1SQQ H;  2JVD A;  5B3S B;  3ZHT A;  3I5D A;  1D5N A;  2H94 A;  2ZE5 A;  4ZKI A;  3CCQ V;  1NTK H;  1P7B A;  2QGN A;  2XHB A;  3CCL V;  3K3W A;  4PEL A;  4DR3 O;  3WFV A;  1OJH A;  3ZRW B;  1H2K A;  4LC1 A;  1PNM A;  3HKE A;  3ETE A;  2YDE A;  3EFF K;  4K0K O;  4RAI A;  5LGT A;  2P06 A;  5LP6 C;  3HR0 A;  2LFR A;  3SPC A;  4X1Y B;  3E86 A;  4FJC C;  5LMN B;  4TT3 G;  2CUG A;  5KAF Z;  2JJ1 G;  1K92 A;  2PF4 E;  3JD0 A;  1MZF A;  4TUY B;  4PDV A;  4K35 A;  4RQE A;  1LNQ A;  1R3I C;  4OPA A;  2YID A;  4ZIB A;  2ZDI A;  1XBL A;  3AG1 B;  4RUF A;  2IH1 C;  3SR2 C;  5CA0 A;  3G71 V;  3CXH F;  3OR6 C;  1K5S A;  4FM0 A;  3JYC A;  3CRQ A;  3FX7 A;  2ZM6 O;  4JV5 B;  3OMA B;  3HKD A;  2A06 H;  1BQZ A;  3LDD A;  2Y0P A;  2CTQ A;  4ABM A;  4G2K A;  4LF7 O;  3ABM B;  2AZ0 A;  2WLL A;  3A0H Z;  2IU0 A;  2CAZ C;  2RQ6 A;  2OYQ A;  4EFE A;  2QTS A;  2RMK B;  1E1R G;  5TIS Z;  1OCO C;  4J11 A;  3BFR A;  4JYY A;  1NH2 B;  1GN4 A;  2AHZ A;  3OTO B;  3FYI B;  1IBL O;  3CC2 V;  2ZE6 A;  2OCH A;  2BTQ A;  3SPG A;  1NQT A;  4LFB B;  4LFC B;  3BAA A;  2YXY A;  2ZNI A;  1JVM A;  3OT7 A;  3LNM B;  3JAK B;  2AHY A;  4QE9 A;  3B09 A;  4DV7 B;  3ZX6 A;  5JVD A;  3J81 N;  3RYF B;  2QKA A;  5LHG A;  4O2B B;  2YEV A;  3A0B Z;  1COW G;  1Q6H A;  2PI5 A;  2EZO A;  1I94 O;  3L72 H;  1M56 B;  1ROP A;  5FNV A;  5H6Q A;  3UQ8 A;  2XT9 A;  2LGQ A;  3JAR A;  2QEX V;  1OCC B;  4TQD A;  3EHB B;  2RJZ A;  1WB8 A;  4CS4 A;  3CCJ V;  2Z3Y A;  2Y4T A;  4F6R A;  1W59 A;  3FYE B;  5LMU B;  4X8A A;  3E2E A;  2KKW A;  2HKO A;  1EFR G;  3Q4H A;  1NZ6 A;  3WU2 Z;  3ZRS A;  4B3R O;  5CBF A;  3SYQ A;  3SYO A;  4MVO A;  2XAS A;  4QIW F;  4PA9 A;  5IWA B;  3JSN A;  4CS3 A;  2QKS A;  4I50 B;  5LA6 B;  1TVK B;  3OD4 A;  1QBZ A;  1XNR O;  3ABU A;  2KB1 A;  4GYC B;  4H33 A;  1IX9 A;  5KLV H;  1XL6 A;  4NTX A;  4X65 O;  5BXZ A;  1CEZ A;  2EZP A;  4FLW A;  5H6R A;  2CTW A;  1WN7 A;  2WWW A;  1S72 V;  4XDK A;  4B3M O;  4NTW A;  4B3S O;  1JR9 A;  3OEH G;  1QCE A;  1LUW A;  1DTO A;  4WFE A;  4U3J B;  5IY5 B;  1VQN V;  2G38 A;  2BSK A;  2QM7 A;  1IXB A;  3L75 H;  3E8G A;  3B77 A;  1NBM G;  3K79 A;  2YIC A;  2CH7 A;  2Q4P A;  4G28 B;  4GUN A;  3CS5 A;  2H8P C;  3D36 C;  4KXR A;  3ML0 A;  4Z1V A;  1S5H C;  2RNB A;  4O4J B;  2IJH A;  2KSD A;  1US6 A;  4KL1 A;  3ZHV A;  3F7Y C;  1MA1 A;  2A9H A;  5FLX N;  2RN9 A;  2B9Z A;  4X20 A;  4AI8 A;  1P49 A;  3KG2 A;  3LSU A;  1VQ4 V;  4LFA O;  3U0Z A;  1S76 D;  4FZ0 A;  1AP5 A;  1N4C A;  3RYI B;  1M57 B;  4G27 B;  3UM7 A;  1Y76 A;  3TJT A;  4TV9 B;  1SC5 B;  2KG7 A;  4JI6 O;  4MVZ A;  1VQK V;  3JD1 A;  4ZHQ B;  4LCU C;  2JEX A;  1NR1 A;  1FFX A;  3UT5 B;  5EYP B;  3QO7 A;  4EB6 A;  4ZOL B;  2XUM A;  2UUC B;  1GO3 F;  5GTI Z;  4GT1 A;  2CGN A;  2HLD G;  5EC2 C;  1JFF B;  4L87 A;  4YJ2 B;  4DRX A;  1SQG A;  2F95 B;  1YIT V;  2JGD A;  2AXT Z;  1XQ8 A;  5CB4 B;  4J9Y B;  5IJ0 B;  3RYH B;  3GB7 C;  3I56 V;  2XAH A;  1XNQ B;  2W0X A;  3K08 A;  4N21 A;  5CA3 A;  2GHY A;  4B08 A;  2VQE O;  4DV6 O;  4LF6 O;  3W7W A;  3K57 A;  3OMI B;  2N04 A;  3A2F A;  3MHS C;  5B66 Z;  5LXT B;  1RSO A;  2DYS C;  5HFL A;  3KCX A;  3AG4 B;  2HJD A;  2Q0A A;  3ZMZ A;  5EZY A;  2HFE C;  1HNW O;  5DEC A;  1R6N A;  4BW5 A;  2GUZ A;  1OV9 A;  4LH7 A;  4DV5 B;  1VQL V;  5B5E Z;  2F66 C;  1FKA O;  4UUJ C;  1BZK A;  1L0N H;  4DR2 O;  3SGI A;  1MOF A;  3CJH B;  2P22 C;  2UU9 B;  2ZXW C;  2OCC C;  3SYC A;  2GDS A;  3LNN A;  1M1K W;  4FLZ A;  2UU9 O;  4X1K B;  2M7W A;  4JYB A;  3WB2 A;  1Q90 D;  3HKC A;  3ZBH A;  4H0L B;  1K73 W;  2F4V O;  2P5O A;  4IT5 A;  4IGG A;  5C8Y B;  1DGS A;  2QKC A;  3WG7 C;  5BMV A;  4FK5 C;  4DUY B;  3P3N A;  2K9P A;  4I55 A;  4FFB A;  1NKD A;  4J41 A;  2QE7 G;  4UV8 A;  1FJG B;  3ZN1 A;  4X1I A;  4N23 A;  3N2G B;  5K1P A;  1IXM A;  3MD0 A;  1N8R W;  4H37 A;  2EIM C;  3C3T A;  3RW0 A;  2BTO A;  1TUB B;  4DV0 O;  3QNE A;  3MHH C;  1HR0 B;  5KX5 B;  5DM6 V;  3T4Z A;  1IBM B;  4PDM A;  4DXW A;  4GKJ B;  1SQP H;  1KEC A;  2ATK C;  2EIJ C;  4NR1 A;  5EIB C;  3L73 H;  3X2Q B;  4QPJ A;  4U3F H;  4ZBM A;  4JAS A;  5FPO A;  2QTO A;  2EIK B;  1M9N A;  3OM3 B;  2XND G;  4JGS A;  1TUE B;  2OTJ V;  1Z2G A;  3CXC U;  1W0K G;  3T1C A;  2YIB D;  5IJ9 A;  1YTF D;  1KC8 W;  1J5E O;  2BOC C;  2H3O A;  1ZL8 A;  1Y6X A;  2QM8 A;  4OXS A;  2HJF C;  1FD9 A;  2XAJ A;  4MT8 A;  1WLE A;  2NLJ C;  4X64 O;  2OIG A;  1T5E A;  3SJA C;  3ZRX A;  5L3G A;  4YJ3 B;  5CBG A;  4LFA B;  4ZI7 B;  4PA6 A;  1P7G A;  4O4L B;  4UCU A;  4AHC A;  4E2L A;  3FB5 C;  4JI3 B;  1WPX A;  4PHZ A;  3G6E V;  1VQ6 V;  1VF7 A;  3BEH A;  2NN4 A;  1Y66 A;  4HBN A;  4NYK A;  5LBQ A;  3ZHQ A;  4JI0 O;  3W7X A;  2VQF B;  3RGB A;  1G1X B;  3SYA A;  5J2T B;  2DMX A;  3AK2 A;  1H2M A;  4KP4 A;  3CRC A;  4O4H B;  3STZ C;  1GM7 A;  3ABM C;  4LWS A;  1N32 B;  2V4D A;  1SQF A;  2CTR A;  1XHX A;  3SJB C;  3F7V C;  1P4R A;  2DW4 A;  3WB1 A;  1VQ9 V;  2E76 B;  4FLU A;  2X7R B;  2UUC O;  3E8H A;  1YJN V;  4GKK O;  4I9W A;  4P30 A;  3OGC C;  1MSW D;  5DN6 G;  1XMO O;  3K0G A;  2BOB C;  1SA0 A;  4LF9 O;  1S3J A;  3WG7 B;  3N27 A;  5KAI Z;  1W0J G;  3G6B A;  1I5Y A;  1PPJ H;  4R8C A;  4LF4 B;  4Q6G A;  2R9R B;  3OW2 U;  4UCR A;  2WLK A;  3ASN B;  4JI6 B;  5IT9 N;  2A0L A;  3D36 A;  3QF7 A;  1ZAU A;  1PNL A;  2IJI A;  4JI3 O;  1UPG A;  2YXH A;  3JCU Z;  3B40 A;  1YCI A;  5BR8 O;  4IIJ A;  3RWR D;  2W0F C;  1B04 A;  4LWS B;  1M4U A;  4MVR A;  2EJR A;  2V1D A;  1NH2 D;  4HAM A;  5J2T A;  3APQ A;  4CBC A;  4J7J A;  1I94 B;  2YXL A;  1X59 A;  1V54 C;  4B3S B;  1AI4 A;  4J10 A;  5LP6 A;  2Z0A A;  4DR2 B;  3TGU H;  4DR4 B;  2HP8 A;  4CH5 A;  3THO A;  3M99 B;  4P2Z A;  1BGY H;  1BT8 A;  1MZE A;  4O4L A;  3TXS A;  1NVP B;  2KQX A;  3CCS V;  1BHA A;  2GTA A;  2E74 B;  1SZT A;  3E89 A;  4GCZ A;  4AQY O;  4UVB A;  1ARO P;  1BHB A;  4FFK A;  4I9Q A;  3N2K B;  1H8H G;  5J9P C;  3L74 H;  1MAB G;  2JEU A;  4JTD B;  3L71 H;  2ZE8 A;  5BZB A;  4LF5 B;  4DV6 B;  1FJG O;  2Q69 A;  5IJ9 B;  2W6I G;  3A0R A;  2ITC C;  4NTY A;  5IYZ B;  4DV7 O;  4DW0 A;  2NNU A;  3FB7 C;  3CB2 A;  3R66 A;  4MVU A;  1G6U A;  2ZKO A;  4CH4 A;  2MW2 B;  4UV9 A;  2ZNJ A;  3K5M A;  1THZ A;  2R70 A;  1PM9 A;  2X6C A;  1V55 C;  1MNG A;  4DR7 O;  4JI1 B;  1Q8I A;  1K9M W;  2ZCE A;  4JAV A;  1GM8 A;  2WLN A;  4EEQ A;  4WFA V;  1N33 B;  2EBO A;  5KX5 A;  3IC9 A;  4OPH A;  3MAQ A;  5L3F A;  1XMO B;  4AIL C;  3ABK B;  3SPJ A;  2PGG A;  3FAV A;  4IIJ B;  1Q5O A;  3N2G A;  3EVK A;  4X1I B;  5GON A;  5JJE B;  4FPP A;  2UXC O;  4DR5 B;  1TA8 A;  5JCO C;  5EIB D;  1L1F A;  1OZ0 A;  2ILM A;  4X64 B;  2M6Y A;  3LDC A;  1WA8 A;  2A7W A;  2N74 A;  1H8E G;  3ASN C;  3HKC B;  4DV2 O;  3AG3 C;  1YI2 V;  5KUK A;  1SA0 B;  3HB3 B;  2UXN A;  1S77 D;  1KUQ A;  1Z5W A;  2ADQ B;  3CJH A;  4LP8 A;  1NU1 H;  5KA5 A;  1XRE A;  1B06 A;  4MTG A;  2ZT9 B;  3TK1 A;  2YI8 A;  3FB6 C;  4LF9 B;  3CP1 A;  4XDJ A;  3QO5 A;  1V55 B;  1HP8 A;  1IZ3 A;  1R1B A;  1OHH G;  2Q0O C;  1H38 A;  1VF6 A;  4UCS A;  1XDC A;  4NXM B;  1Y74 B;  1PP9 H;  1ZWI C;  3ZHU A;  2PTM A;  2LW1 A;  1Q6I A;  1VF6 C;  3HPL C;  4UB8 Z;  3LDE A;  5BR8 B;  2A79 B;  2PUS A;  2Y69 B;  5CB4 A;  4BIZ A;  4RUE A;  3CRM A;  2R9I A;  3PN1 A;  1Y74 A;  1VMG A;  2ETN A;  4YJ3 A;  1URF A;  1IBL B;  1O9G A;  3OUS A;  3IJ4 A;  4JV5 O;  5BY1 A;  4K8Z A;  5IDJ A;  4PV1 B;  4FLX A;  4DYL A;  4PA3 A;  4LF8 O;  1H2L A;  4UFZ A;  1H2S B;  1PL0 A;  3L70 H;  4LF7 B;  1O9H A;  1HDJ A;  4L8J A;  3UT5 A;  4UXN A;  4CZZ A;  2UXB O;  2LQT A;  3CME V;  3ZHS A;  3FFQ A;  3EXA A;  2KG7 B;  3E35 A;  1Y76 B;  4PI2 A;  1N0J A;  5IE9 A;  4JI8 B;  4LFB O;  3CCR V;  3ASO B;  1XIL A;  4X20 B;  4BIO A;  2LO1 A;  2D3O W;  3S3W A;  4I7Z B;  1AI6 A;  5EBM C;  5B1O A;  2FYU H;  1VQ8 V;  4DV2 B;  5KHJ A;  3C90 A;  4MVQ A;  4MSW C;  1B6Q A;  1XEQ A;  3ZS8 C;  4PA4 A;  1WAZ A;  4Z1M G;  3ZMT A;  2Y69 C;  4X62 B;  4F4L A;  4BIU A;  4FVM A;  1P84 F;  3BCC H;  4DR5 O;  1YJW V;  1EZV H;  1QQC A;  1E79 G;  4FFB B;  2RDC A;  3CC7 V;  4JI5 B;  4I55 B;  3ABL B;  1YHQ V;  3F5T A;  2LGW A;  4TOI A;  1IBM O;  1VQ7 V;  4QPK A;  3APO A;  3A8T A;  1YTF B;  1E1Q G;  4ICG A;  1HNX O;  4A5U B;  1W2B U;  4MTO A;  4JI7 B;  2VWJ A;  2JDI G;  2VQF O;  3ASO C;  1TVK A;  4I50 A;  2XOK G;  3M7M X;  1XI1 A;  1J95 A;  4FMT A;  3G67 A;  1SQV H;  4LR3 A;  3H01 A;  3CPW U;  3T4D A;  3CCU V;  4CS2 A;  2WSS G;  2OCC B;  2GUZ B;  2GTS A;  3Q4H B;  4X9Q A;  4LH6 A;  2EIN C;  1RPO A;  3N2K A;  4JZG A;  2QJ1 A;  1OCR C;  1XMQ B;  2GV9 A;  5KHH A;  1M56 C;  5EC1 C;  5LHH A;  4WFH A;  5IYD O;  1NS1 A;  4J42 A;  4DUZ B;  5C93 A;  5LGN A;  1SF9 A;  4B3T O;  4X66 O;  1RP3 B;  3K03 A;  3RYH A;  3MDS A;  4GX1 A;  3DC6 A;  4PI0 A;  4JYA B;  1PL4 A;  3BPZ A;  4O2B A;  3CHX A;  3RYF A;  3D3I A;  3JAM N;  1QR8 A;  5IYC O;  5FPR A;  2WLM A;  4EFB A;  3JAK A;  1N36 B;  1AJN A;  4PJ0 Z;  3VQV A;  3VQW A;  4GX2 A;  1PNK A;  1VQM V;  1F4M A;  1XL4 A;  3T1H B;  2HHH O;  3K9S A;  4DV1 B;  4LBE C;  1FFX B;  1IDS A;  2EIM B;  4ZHQ A;  3LSQ A;  3CRA A;  4PA7 A;  2HEP A;  2WLL B;  3ZMU A;  4CH6 A;  4U7O A;  3QG5 A;  1VQP V;  2EIL B;  4GX0 A;  2CGO A;  1I0H A;  4J80 A;  3BHP A;  3ABL C;  1WA8 B;  2ZDI C; 
#chains in the Genus database with same CATH homology
 1PPJ H;  1SQQ H;  1BGY H;  3L70 H;  1P84 F;  1SQB H;  3BCC H;  1BCC H;  1EZV H;  2BCC H;  1KB9 F;  1NTM H;  1SQV H;  1L0N H;  1NU1 H;  1BE3 H;  2IBZ H;  3H1J H;  4D6T H;  1KYO F;  1SQP H;  1SQX H;  2FYU H;  1NTK H;  3L73 H;  3CXH F;  4U3F H;  3L74 H;  1PP9 H;  3L75 H;  3L71 H;  3H1L H;  1L0L H;  3TGU H;  3H1H H;  3H1K H;  3CWB H;  1NTZ H;  3H1I H;  3L72 H;  2A06 H;  3CX5 F;  5KLV H;  4PD4 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...