3H1KH

Chicken cytochrome bc1 complex with zn++ and an iodinated derivative of kresoxim-methyl bound
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
69
Chain Sequence
EEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Crystallographic location of two Zn(2+)-binding sites in the avian cytochrome bc(1) complex
pubmed rcsb
total genus 20
structure length 69
sequence length 69
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3h1kH00
2BCCH 3L72H 1SQBH 1KB9F 3H1LH 1BCCH 3L71H 3L74H 1P84F 3L70H 1NU1H 3H1HH 1NTKH 1NTMH 1SQPH 1SQQH 1SQXH 3CX5F 1SQVH 3H1JH 3CXHF 1NTZH 2FYUH 3H1IH 2A06H 1L0LH 3L73H 4U3FH 3H1KH 1L0NH 4D6TH 5KLVH 1PPJH 1KYOF 3TGUH 1EZVH 4PD4F 2IBZH 3L75H 1BE3H 1PP9H 3BCCH 3CWBH 1BGYH
chains in the Genus database with same CATH superfamily
3B2EE 1Y74B 2UUAB 5K1PA 1SQPH 5LHHA 4J42A 4KP4A 3VQYA 2UUCO 3CRQA 1VARA 1I5XA 4H37A 2GHYA 4FLWA 2DOSA 1ZLZA 3B4SA 5KHHA 1H8HG 1V54B 1N34O 3CEIA 3G80A 3T1HB 1K7DA 2FKXA 1WNSA 4HAMA 3RYFB 3W7TA 5KMGA 1JA8A 4O2BB 1WB7A 2CK3G 1CP9A 1IBMO 4X64B 3GB7C 1SETA 2JJ2G 2YEVA 2JGDB 1PM9A 5CN0A 5LGUA 1P4RA 2Y4UA 4X66B 3H9VA 2OIEA 3T1CA 4FZ1A 3K5NA 4LH6A 1HNWO 2E74B 3ZHQA 1M56B 4UVBA 3ZN0A 5KAFZ 1IURA 3ZRWB 3DTUB 4UCVA 5JVDA 1PV0A 1N36O 4DUYO 1GO3F 4J41A 1AI6A 3OTOB 4NB5A 4CZZA 1KC8W 1FFXB 3MDSA 2ZXWB 4DR7O 4UCRA 3JARA 3K9AA 5L3DA 3O9OA 1BHAA 3UKMA 1QU7A 3ZEDA 2B5UA 1AI4A 4XDLA 1Q86W 2YXYA 1ZUQA 4DUZB 1SS3A 4OX9O 4UCTA 1OCCB 1M93A 3CJHA 3K03A 2JGUA 5B1OA 4MVUA 5LGNA 3DGEA 1B04A 1KKDA 5KX5A 2NN4A 4BR6A 2ATKC 1KD1W 5LP6A 3SJCC 5DECA 3CCLV 3SPGA 5B3SC 1F4MA 4TV8B 1H2LA 2WLMA 2HFEC 2PTMA 1BQ0A 1SF9A 1H38A 1R3JC 1M9NA 4JI4O 4U3FH 4FLXA 1IBLB 3ABMC 1Q6HA 3N2GB 1URFA 1XMOB 1XOUA 4LWSA 3ZMZA 1AJPA 3IAYA 5EBMC 1OJHA 1PPJH 5E1AC 4JI3B 1M5IA 3LUTB 3DC5A 4BIOA 4WFGA 3STLC 5L3CA 5LMUO 2ADPA 1H2NA 2E3CA 5BZBA 3OAAG 4IIJA 4X1YB 2RMKB 2XT9A 4TV9A 5IE9A 3Q4HA 5IWAO 5GONB 2QWQB 1I08A 1NJIW 4PA3A 5IJ9B 1VQOV 2YDEA 4X88A 2QKAA 5EYPB 4DV1O 4FIPC 3JALB 3IGAC 2MW2B 1VQ8V 1S76D 1K33A 3L71H 4WCEV 1EN5A 3K5MA 4I9QA 5J2UB 1U97A 4TUYB 2PF4E 3H1JH 3CPWU 1FAFA 1NTZH 1SA0B 3K0GA 3RT3C 4LFBO 1AP6A 1GTOA 4I4TB 4JASA 4TOIA 1FJGB 3T4DA 5FPRA 1NT2B 4A5UB 5LMNB 4KXRA 1MNGA 1THZA 4X1IB 4DV2B 2RQ6A 1YXBA 5CA1A 2QKSA 3SGIA 4JI8O 1P7BA 3CE2A 1IBKO 4MVZA 4B3MO 4J9ZB 3RYCB 2P5OA 4YY3B 2DYRC 2GV9A 1UJWB 1V9PA 3W7UA 5KA6A 4DXWA 5JH7B 2WLHA 1Q43A 5GW7A 3T2MA 1RSOB 2IJJA 4I55B 3CXHF 1Y66A 5H2FZ 3HKEA 4LF6B 2A06H 4PDRA 4X65O 2Q7HA 1VQ6V 4LF8B 4B3TB 3HKBB 3UQ8A 5L3BA 1J5EB 4UV8A 3ASOB 4I50A 3VBBA 3SPHA 1XMQO 2YIAA 4HBNA 1RM1B 5A9GA 4J80A 1V54C 5KAIZ 1AI5A 2Q67A 1WP7A 2IJIA 4UFZA 4JI0O 2FTKA 4PHZA 1DTOA 5LGTA 3BABA 2NNUA 2LP7A 4JI2B 3UT5B 2YSUB 2P90A 3QG5A 2IH1C 2NR5A 2JJ1G 1AB3A 4X62O 4LNUB 4B08A 3MD0A 1YSCA 2UUCB 2L35A 4DW1A 3JASB 1Y76A 1WA8B 1HWYA 2AHZA 5EC2C 4Z1MG 1JPXA 2XAHA 4O2AB 3ZMTA 4MTXA 1TAEA 3EHBB 2DWDC 2QDOA 1M56C 4UCOA 3CCVV 2BE3A 1YITV 3H01A 1OCZB 3P3PA 2P22C 2DMXA 4CC5A 2X6CA 2QA4V 4JF3A 1WLEA 3HPLC 2ZXWC 4JZGA 1K5QA 2IW5A 1QNMA 4MW8A 4IHJA 4B3SO 2ZE8A 4IT5A 1Q82W 5LYJB 3AEIA 1SQFA 1HNWB 1OCCC 3G6EV 3CC7V 1Y74A 4N21A 5CA0B 1YF2A 3L75H 1N32O 2L6LA 4JYBA 2ZQMA 1N36B 4JYYA 5KUMA 2DQ0A 4DRXB 5IY5C 2LQTA 4ZI7A 2V1DA 3BRCA 3OUFA 3FX7A 1S72V 4DR7B 4DO2A 1KMIZ 1AROP 1U96A 2IU3A 1X59A 2F43G 2PI5A 4FZ0A 4TWKA 4HZ3A 3TCUA 4FMTA 4W4KA 4DR1O 2Y48A 4JI5O 3WU2Z 1HNXO 1O9GA 4PDMA 3X2QC 2JK5C 4LP8A 3JYCA 4XDKA 2PUSA 4YJ2A 3L74H 3THOA 1EBOA 4MVRA 1FPOA 2UXCO 3U11A 1Y6XA 2BOCC 1NR7A 3RN4A 1QVFU 5IT9N 1M57C 1K92A 5H6QA 1FXKB 4P30A 4U7OA 2W6IG 4DR5O 4MT8A 2WLLA 4PA9A 4BAYA 1IDSA 2KB1A 1Q7YW 4JI4B 2EIJB 1NVPB 2X6BA 3SR2C 4X1KB 3ZRXA 2WA4A 3GWOA 2KKWA 4MSWC 5B5EZ 3CCRV 4I0XA 2HKOA 2NLJC 3ABKB 4ICGA 1VEWA 2KQXA 3UM7A 4YXWG 2VQEB 1NTKH 3KKYA 3SPJA 4DR4O 3JSNA 4HNAB 4GX1A 3GWKC 1YDXA 4U7NA 5LMUB 3P30A 2YICA 1YI2V 3ICXA 3IJ4A 4O4LB 4K3AA 2BTQA 3RW0A 5LA6B 4QIWF 4DR6B 3HKDA 1RP3B 2ADQB 4YHHB 1F51A 2QM4A 4X89A 3SPIA 3JCZA 1S5HC 4J7ZA 2CGOA 4DK0A 1QVGU 2R9RB 4L87A 1NH2B 3RVYA 2RCVA 4DV5O 3ZN1A 5EBLC 4FM1A 3OW2U 1ZTEA 4OXSA 2LFSA 2W0XA 1DGSA 4JZ2A 1F4NA 4MS2A 4O4IB 2P67A 3AK1A 3A0HZ 4MVMA 5H5NA 2GBOA 1H2KA 3K59A 4FVMA 1E1QG 2N05A 1N33B 2P06A 4F6RB 2EBOA 4RUEA 4UB8Z 1EN4A 4JI8B 4X1YA 3ZJZA 4ZIBA 1QCEA 1ZAUA 3ASOC 1IBKB 4B3MB 2QSAA 1I94O 1RM1C 2HHHB 3FYEB 1KP2A 1SESA 1HP8A 2YC0A 2DW4A 3SJQC 3JALA 1H2GA 3LSSA 2P4VA 1IXBA 1WJZA 4PI0A 4F6EA 4JAAA 4H44B 4GYCB 4EEQA 3ABLB 3NXSA 4DK1A 1TGOA 1AR5A 1XILA 1YTFB 1BCCH 1K73W 3T4ZA 5EZYB 5GTIZ 1HW7A 1Q3EA 4QNHB 2M6YA 4U3JA 4UVAA 2CGNA 3JD2A 4JAUA 3RWRD 4DV3O 2IH3C 4FK5C 2FL4A 1OCZC 2WLIA 2EX3A 3JATA 4ZKIA 3BVOA 1N0NA 5LHIA 1GN4A 4NVPA 1EM1A 3HKCA 3RYCA 1K8AW 3ZHTA 1JQ0A 4LF4B 4KHPO 4AQYO 4CH3A 4UV9A 1WAZA 2HP8A 3K0DA 4QE9A 4J11A 2Y0PA 4O4HA 3ZMUA 2HVJC 3LDDA 2N74A 3OMAB 4P9PA 4CH4A 3HKBA 3ZIAG 1NQTA 2VWJA 1B6QA 2CTPA 3CCEV 2KG7B 4FLUA 3L73H 1GH6A 1CEZA 5FPOA 5FNVB 3OGCC 2UXBO 2DYSC 4LR3A 5L3FA 2R9IA 1S5JA 3OR7C 3D8CA 5J2TB 4ZOLB 5C93A 5JQGB 3ZX6A 4LNUA 2C2AA 3WB2A 1Q81W 1N32B 4JTAB 2QM7A 1YJWV 5IYZB 3CRMA 3E22B 2JRIA 4DV0B 3F7YC 3G6BA 1Q90D 4GKKB 1KKCA 3JSLA 1FXKC 3BPZA 3ETGA 3ASNB 2PZSA 4PI2A 4FM2A 1TUEB 4WBNB 4JI5B 1DLBA 4NXNO 4FJCC 1HNXB 2OIGA 2EIJC 4O4JB 4C7UA 4X20B 5IYDO 4LFAO 2A79B 1GM9A 4FLVA 2X0LA 1R3LC 2VQFB 4D7TA 2UXCB 2B9ZA 3ABKC 3SPCA 2N04A 1WPXA 3TXQA 2E5LO 4DR5B 4LBEC 1K97A 1KP3A 2OCCB 2QWRB 3S3XA 4FPPA 3DXRA 1SZTA 3RVZA 1Q6IA 1XL4A 1WB8A 5E79Z 1AI7A 1TVKB 1GN3A 2IJKA 4LF9B 1D5AA 1XNRO 1OV9A 3STZC 2ZR2A 1GN6A 2UXNA 4CH6A 5IJ0A 2QEXV 2A0LA 4DR2B 1R1BA 1IX9A 4PV1B 4TT3G 2UU9O 2QWPB 4DYLA 1COWG 4NKGB 3AG3C 4G27B 4JI1O 5C8YA 3AG2B 3VOUA 2GSMB 2LGWA 2ZINA 3BY6A 3K5OA 1Q5OA 3E83A 1P84F 1AJQA 1SQQH 1FXKA 2Q9LA 2JVDA 3FAVA 2EZPA 3QTCA 1SC5B 4WFFA 2Z3YA 2B1GA 4QPJA 3RGBA 4N23A 3T1YO 1J95A 4YJ3B 2ZE6A 3LNMB 4X1KA 1R6TA 3F5WC 4G28B 2Z5UA 2DN9A 3ZCCA 3K06A 2GUZA 5ITZA 1BS3A 1LR1A 1NTMH 5F2VO 1ZL8B 5AG2A 3VQWA 3PJSK 4DV4B 3LDEA 4GKJB 4NTXA 2QTSA 2UXXA 1EZVH 3JAWA 3AG4C 3U10A 1JJ2U 3C3TA 4AILC 5DEDA 4ZBMA 4BIZA 4G2KA 3FB5C 4WFHA 2W6JG 3ABLC 5KHGA 1K34A 4LC1A 1SQVH 4PA4A 5B1BB 5BMVA 3K3WA 1XDCA 3D3QA 1I94B 2K1EA 2LFRA 1G6UA 3AG7A 1H8EG 4LF7O 2Y4TA 1VMGA 1EZJA 1YEWA 2BTOA 5CB4B 4CC6A 2Q4PA 1SQBH 1XHZA 3JAKA 2JS5A 3GVMA 3CD6V 4JYCA 2PGGA 2H94A 4DV6O 1ZWIC 1UFIA 3TETA 5LXTA 2GTSA 2HJFC 1I7FA 3E2EA 2CTWA 1I5YA 2ILMA 2EIKB 2B1IA 3CMAV 1JFFB 3ZHUA 2WAMA 4HYOA 1GRJA 1R6NA 1SQXH 3IC9A 2CH7A 5B1AB 3B8MA 4JGSA 1BHBA 3OFNG 4MTOA 3SYCA 3RYHB 3WB1A 1CPYA 4B7EA 3RYIB 1FKAO 4RWUA 4KHPB 3FB7C 3H1HH 2ZE7A 1QQCA 2IU0A 1N34B 1GKFA 2UUAO 1S77D 4P9OA 1IVSA 3A0RA 4UB6Z 5JVDB 1IBMB 3D36C 2VRZA 4FFBB 3ZMVA 2EULA 3JARB 4E2LA 4X9QA 3I5DA 2F95B 4JTDB 3J7AU 3OUSA 3ASNC 1MZFA 4MVSA 2Z0AA 3T1HO 2GTAA 3M7MX 4FFKA 5KA5A 2OTLV 5JCOC 1VQNV 4B7KA 1N8RW 1ZSPA 4D7SA 1NVPD 4X66O 4DUYB 5LP6B 4ABMA 2H8PC 4OPAA 3SJAC 3APOA 4W4LA 3CC2V 3CC4V 1XL6A 1BMFG 2XAFA 1NBMG 1K4DC 1FYJA 3SYPA 2OCCC 3RYFA 3WB0A 4NXNB 3KG2A 1W59A 4O2BA 4OX9B 4IGGA 1IXMA 1JVMA 2JEUA 2ZDIC 4Z2WA 1RPOA 2JGDA 4LFAB 2QM8A 5B1NA 1DF5A 3C90A 2XOKG 3ZMSA 4QE7A 2PY5A 1GM7A 1CXZB 3WFVA 4LCUC 2BSKB 3J81N 4J9YB 4J7JA 5KHJA 2E5LB 3JD1A 4DUZO 2FMLA 4ZOLA 1KECA 1A32A 1W0KG 3P3NA 2MK3A 2XNDG 1HNZO 1NR1A 5JQGA 3ZRWA 2R9AA 2X7RB 4WFAV 4UCSA 3AG2C 3E22A 3FKSG 5EK0A 3D36A 4NTWA 2YIBD 1FFXA 1NH2D 3EFFK 2FB5A 1FXVA 4IIJB 2RN9A 4GUNA 1DK1A 3Q4HB 2WLJA 2CUGA 3LSUA 4QPKA 5TISZ 2Q0AA 2YS8A 4FLYA 2UU9B 5KUKA 3AK3A 4H33A 1IBLO 5JCOA 4AI8A 1FD9A 3ETDA 2D3OW 3LDCA 4OGQB 2QKCA 1B06A 1US6A 2Q6AA 2JDIG 4JI1B 3NR7A 1MSDA 3DC6A 3K08A 1R3IC 5IYCO 2PYJA 3E86A 4CS3A 4TV8A 5EIBC 4Z1VA 5IWAB 1BGYH 1VIBA 5B66Z 2AZ0A 2V7QG 4DR3O 1VQ4V 4CS2A 1Z2GA 4DV1B 4B3RO 2JIZG 1QHTA 4K0KO 2VWKA 5JWPA 2HLDG 3CCJV 3N2GA 5CA1B 1H2SB 2ZNJA 4D6TH 1GAXA 5B1BC 2G38A 2F93B 3AK2A 1YTFD 3OEHG 4EB6B 2XAGA 4LFBB 2YI8A 1PNKA 1SRYA 2OWOA 3CX5F 2CTRA 3B09A 1OHHG 2EILB 2K9PA 3TXSA 1JOYA 1GN2A 3HKEB 1PNLA 4AHCA 4MW3A 3OM3B 1RPRA 3OEEG 1XNQO 2V4DA 5GONA 4I50B 3IC7A 3G67A 3TK1A 4NR1A 5IJ9A 2XAQA 3CCMV 1QR9A 5EYPA 2CE4A 3BA8A 1MMMA 4JI6O 4RQEA 2WA3A 2P4KA 3A0BZ 4DV2O 4MTFA 4RQFA 3SDLA 3FYIB 2XUMA 3W7XA 4DV6B 1ORQC 5J2UA 1K3EA 4TUYA 2BCCH 2YI9A 1TUBB 4JYAO 4X65B 1R6KA 1SA0A 4GX0A 1HR0O 1N4CA 1Y76B 1O9HA 3SYQA 1LUWA 1XMQB 5BXZA 4I4TA 4Q20A 5JJNB 3QO7A 3UO2A 4JI0B 1NI8A 3M99B 2OTJV 3UO3A 4X1IA 5LOVB 4LF8O 2WLKA 3EVKA 1J5EO 4X62B 3DSQA 1QR8A 1SZXA 3HB3B 2ZCEA 2E76B 2ZIOA 4IHJB 4CBCA 1XHXA 5CBGA 3E8HA 3R65A 5JJJB 4IL6Z 5JH7A 5L3EA 5JJEB 1RSOA 3CWBH 2YXLA 4I55A 2ITCC 1GK9A 2XTAA 2HVKC 2X6AA 2AXTZ 5LP6C 4ZI7B 4PA7A 1L0LH 2ZD9A 1JFFA 2Q0OC 2OCHA 3M8AA 3L9DA 4B3SB 2LO1A 4KFMA 4I9WA 3WG7B 4BIUA 4MVOA 2JS3A 4ASUG 1QLNA 2WPDG 3UT5A 1K5SA 3RFRA 3K57A 1AP5A 3KCXA 5CA3A 3RYHA 1VQ5V 4YJ2B 3JCUZ 3ETEA 1W0JG 3RYIA 1HDJA 2UXDO 1NS1A 3JASA 1WA8A 2KSDA 1KYOF 1YZBA 1Q6UA 4PD4F 3VQXA 1OCRB 2OYQA 4O2AA 1NKDA 4OPHA 4UXNA 4ZHQB 4JI7O 1XI1A 1GMGA 4DR1B 2WLLB 1VQLV 1AVMA 3LSQA 4XDJA 2VS0A 4FFBA 4I0XB 2IM9A 2UUBO 2AHYA 1PP9H 2DE0X 5LYJA 1YHQV 2Y69B 1L1FA 1HNZB 5EC1C 3HR0A 3MHSC 2FYUH 2ZT9B 5CA0A 3ZHRA 4JV5O 3CYOA 1GM8A 4BWAA 4NXMO 4DRXA 1EFRG 5IY5B 5LBQA 2EINB 2AW9A 2Q69A 1KU9A 4FLTA 1BZKA 4TQDA 1R73A 1Y67A 3I55V 2XASA 2BTQB 1MABG 4RO2A 1M90W 2P6JA 2AGAA 1V55B 5EIBD 3HKDB 4E4EA 2WSSG 3BEHA 1D5NA 3ZS8C 3X2QB 5LL6Y 1XBLA 1BT8A 4DV7O 4DR4B 1LUVA 2BSKA 3FFQA 1XQ8A 3SJBC 4R50A 1AILA 1M57B 1G8MA 5BR8O 3E8BA 3ZRVA 1W2BU 4DR3B 2VQEO 2ZNIA 1VQ7V 3AG1B 4PDVA 4B3RB 2EILC 5KHIA 4K0KB 2D2CB 1OCOB 4YIOA 5H6RA 1K4CC 3K5LA 4LFCO 4DV5B 3IFXA 3CCUV 3QF7A 3I56V 2YXHA 3JD4A 3O65A 1MSWD 4EKWA 4XBFA 2ZM6O 4DR6O 3FB6C 1XEQA 3N2KB 1NZ6A 4YHHO 3CS5A 2RJZA 4I5SA 4RAIA 1F23A 3N27A 1PNMA 2CDYA 3OMIB 1TA8A 4HNAA 1YJ9V 1YCIA 1P49A 2IJHA 2O57A 1KQSU 3OMNB 1K9MW 3QO5A 4FLZA 4JAVA 1M4UA 4LF5O 1ZX3A 4KUMA 4WF9V 4O4LA 1XNQB 1VP7A 1F7YA 5LA6A 3MAQA 1VF7A 1QLEB 4U3JB 2DQ3A 1WN7A 4IYIA 3R66A 4JI6B 4BW5A 4GT1A 1N33O 2WLIB 2YIBA 2Q68A 3JATB 3CCQV 1KUQA 3CP1A 2QGNA 2PYLA 2QJ1A 1SQGA 3HKCB 4JYAB 1SERA 1S5LZ 4EB6A 2HHHO 1HR0B 1VQPV 1WPBA 2ITDC 4O4IA 3UCSC 3E89A 1JJOA 2W0FC 3SYOA 4NTYA 1RFYA 2DJVA 2ZR3A 2R70A 4K35A 5H9CA 1YIJV 3ZBHA 2A3QA 3EXAA 4DV3B 1FS0G 1DF4A 4F6RA 1MA1A 3K04A 4O4HB 5KMGB 3ML0A 4WFEA 2F4VO 1L0NH 1SKVA 4H13B 3CRAA 1VF6C 2PI4A 2YEVB 2LW7A 4UUJC 1IZ3A 1MOFA 2EIMB 2R72A 1S0VA 3OT7A 3WG7C 4AQYB 3W7SA 4PJ0Z 4TQFA 2Q5ZA 1Z5VA 3BA9A 2OT5A 4EFEA 4R6ZA 3CCSV 4RUFA 1AR1B 4BW9A 3ZHSA 4TSFG 2XAJA 3K58A 5KLVH 1TUBA 4UCUA 1FFTB 5EBWC 4F4LA 1E1RG 5EZYA 4LF4O 3FB8C 3B40A 4H0LB 1XREA 2M7WA 1OCRC 2AZ2A 5KHKA 2UXBB 1JCHA 3K79A 2QR4A 2E75B 3E8GA 3QNEA 3A8TA 1VQMV 5LOVA 3APQA 1ENVA 1G4YB 3CJHB 4UVCA 3OD4A 4X64O 2IBZH 5K1XA 3BCCH 5KX5B 1BQZA 3ZRSA 2UXDB 1T5EA 5IYBO 4JPRA 2JEXA 2EZOA 3F7VC 3OTFA 5BY1A 2Y69C 2CTQA 4JI7B 1PD3A 3SYAA 5A2QN 2Q8VA 1R3KC 3DXRB 3CRCA 4QJFB 4DV0O 2EINC 2EJRA 2RDCA 4YIPA 4GCZA 3OTOO 1VF6A 2KG7A 4PELA 5FLXN 1ROPA 4GKKO 1X4TA 5FNVA 2DYSB 1PL4A 2UUBB 1PL0A 3JD3A 5IJ0B 1S3JA 3D3IA 4QGPA 1V55C 2WLNA 3BAAA 3CSXA 4FM0A 3ABUA 4LWSB 2CAZC 5D5PA 5J2TA 3CRRA 4MVQA 1KBHA 4J10A 1I0HA 4GX5A 2LW1A 4JV5B 4K8ZA 4NXMB 5IYZA 1AR4A 1NU1H 5C8YB 2VQFO 1L8DA 3KCYA 3QVNA 3H1IH 2XHBA 1XNRB 3FAVB 4ZHQA 4TV9B 1B3QA 2RNBA 1VF5B 3JAMN 4WBNA 1YJNV 4CH5A 3AG1C 2ARHA 4O4JA 3B77A 3P32A 1YVWA 2ODMA 2Y0IA 3BFRA 1BSMA 4X20A 5CMUA 3G71V 1OCOC 1FXHA 2F66C 4LF9O 1P7GA 2LGQA 1Q8IA 2HR3A 4DV7B 2GUZB 5DM6V 5HFMA 5ITZB 3H1KH 1VQKV 3G4SV 1XMOO 3OGIB 4P2ZA 1D2DA 4I7ZB 5B3SB 4DR2O 2YUAA 1G1XB 4GZRB 5BR8B 2A7WA 3QO8A 4PDLA 2EJ7A 1BE3H 2DWEC 2ZE5A 3ETQA 2GDSA 5FL7G 2WWWA 4IYHA 4X8AA 3JAWB 2F23A 4JI3O 3T1YB 2QTOA 3ABMB 2ZDIA 1TVKA 4LFCB 5CBFA 3CMEV 5BMVB 4EFBA 1MZEA 1M1KW 1PKXA 2Q7GA 3KZIZ 2LJ2A 4JTCB 1JX9A 4J7KA 1QLEC 1BL8A 2ZM6B 3RBZA 4DW0A 2BOBC 3TJTA 3C3SA 5LHGA 1KB9F 4R7CA 3S3WA 3B8NA 3L70H 3LNNA 3MHHC 3AG3B 1JR9A 3JAKB 3CB2A 1VQ9V 5DN6G 1UPGA 5D5QA 2HEPA 5LXTB 1EN6A 4LF5B 4WFBV 3L72H 4GX2A 3FD9A 4DV4O 4GKJO 3BHPA 2EIKC 3W7WA 3JD0A 4PA6A 2P7TC 2ZIMA 3U0ZA 4LF7B 1FJGO 2H3OA 3CHXA 2F1MA 4LH7A 4YJ3A 5CBHA 2YIDA 3A2FA 3K9SA 1XUQA 5LMNO 3TGUH 3PN1A 5B1AC 2CH7B 2Q7EA 4K8XA 5GTHZ 2A9HA 3E8FA 1OZ0A 3CXCU 1ZL8A 1JMKC 3H1LH 5J9PC 3ZHVA 4YY3O 2EIMC 3N2KA 1Z5WA 1WP8A 1AJNA 4L8JA 3AG4B 1MG1A 3F5TA 2QWOB 1Y4MA 4KL1A 1N0JA 5HFLA 4CS4A 2HJDA 4Q6GA 4LF6O 3VQVA 3OE7G 4GLXA 2F4VB 4R8CA 3ABTA 5IDJA 4B3TO 1E79G 3OR6C 3E35A 1QBZA 2HG5C 2QE7G 2QWNB 2ZKOA 2DYRB 5L3GA 1LNQA 4MTGA 5CB4A 3J80N 4NYKA 2ETNA 2Q73A 4JI2O 1H2MA
chains in the Genus database with same CATH topology
2BCCH 3L72H 1SQBH 1KB9F 3H1LH 1BCCH 3L71H 3L74H 1P84F 3L70H 1NU1H 3H1HH 1NTKH 1NTMH 1SQPH 1SQQH 1SQXH 3CX5F 1SQVH 3H1JH 3CXHF 1NTZH 2FYUH 3H1IH 2A06H 1L0LH 3L73H 4U3FH 3H1KH 1L0NH 4D6TH 5KLVH 1PPJH 1KYOF 3TGUH 1EZVH 4PD4F 2IBZH 3L75H 1BE3H 1PP9H 3BCCH 3CWBH 1BGYH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BCC H;  3L72 H;  1SQB H;  1KB9 F;  3H1L H;  1BCC H;  3L71 H;  3L74 H;  1P84 F;  3L70 H;  1NU1 H;  3H1H H;  1NTK H;  1NTM H;  1SQP H;  1SQQ H;  1SQX H;  3CX5 F;  1SQV H;  3H1J H;  3CXH F;  1NTZ H;  2FYU H;  3H1I H;  2A06 H;  1L0L H;  3L73 H;  4U3F H;  3H1K H;  1L0N H;  4D6T H;  5KLV H;  1PPJ H;  1KYO F;  3TGU H;  1EZV H;  4PD4 F;  2IBZ H;  3L75 H;  1BE3 H;  1PP9 H;  3BCC H;  3CWB H;  1BGY H; 
#chains in the Genus database with same CATH topology
 3B2E E;  1Y74 B;  2UUA B;  5K1P A;  1SQP H;  5LHH A;  4J42 A;  4KP4 A;  3VQY A;  2UUC O;  3CRQ A;  1VAR A;  1I5X A;  4H37 A;  2GHY A;  4FLW A;  2DOS A;  1ZLZ A;  3B4S A;  5KHH A;  1H8H G;  1V54 B;  1N34 O;  3CEI A;  3G80 A;  3T1H B;  1K7D A;  2FKX A;  1WNS A;  4HAM A;  3RYF B;  3W7T A;  5KMG A;  1JA8 A;  4O2B B;  1WB7 A;  2CK3 G;  1CP9 A;  1IBM O;  4X64 B;  3GB7 C;  1SET A;  2JJ2 G;  2YEV A;  2JGD B;  1PM9 A;  5CN0 A;  5LGU A;  1P4R A;  2Y4U A;  4X66 B;  3H9V A;  2OIE A;  3T1C A;  4FZ1 A;  3K5N A;  4LH6 A;  1HNW O;  2E74 B;  3ZHQ A;  1M56 B;  4UVB A;  3ZN0 A;  5KAF Z;  1IUR A;  3ZRW B;  3DTU B;  4UCV A;  5JVD A;  1PV0 A;  1N36 O;  4DUY O;  1GO3 F;  4J41 A;  1AI6 A;  3OTO B;  4NB5 A;  4CZZ A;  1KC8 W;  1FFX B;  3MDS A;  2ZXW B;  4DR7 O;  4UCR A;  3JAR A;  3K9A A;  5L3D A;  3O9O A;  1BHA A;  3UKM A;  1QU7 A;  3ZED A;  2B5U A;  1AI4 A;  4XDL A;  1Q86 W;  2YXY A;  1ZUQ A;  4DUZ B;  1SS3 A;  4OX9 O;  4UCT A;  1OCC B;  1M93 A;  3CJH A;  3K03 A;  2JGU A;  5B1O A;  4MVU A;  5LGN A;  3DGE A;  1B04 A;  1KKD A;  5KX5 A;  2NN4 A;  4BR6 A;  2ATK C;  1KD1 W;  5LP6 A;  3SJC C;  5DEC A;  3CCL V;  3SPG A;  5B3S C;  1F4M A;  4TV8 B;  1H2L A;  2WLM A;  2HFE C;  2PTM A;  1BQ0 A;  1SF9 A;  1H38 A;  1R3J C;  1M9N A;  4JI4 O;  4U3F H;  4FLX A;  1IBL B;  3ABM C;  1Q6H A;  3N2G B;  1URF A;  1XMO B;  1XOU A;  4LWS A;  3ZMZ A;  1AJP A;  3IAY A;  5EBM C;  1OJH A;  1PPJ H;  5E1A C;  4JI3 B;  1M5I A;  3LUT B;  3DC5 A;  4BIO A;  4WFG A;  3STL C;  5L3C A;  5LMU O;  2ADP A;  1H2N A;  2E3C A;  5BZB A;  3OAA G;  4IIJ A;  4X1Y B;  2RMK B;  2XT9 A;  4TV9 A;  5IE9 A;  3Q4H A;  5IWA O;  5GON B;  2QWQ B;  1I08 A;  1NJI W;  4PA3 A;  5IJ9 B;  1VQO V;  2YDE A;  4X88 A;  2QKA A;  5EYP B;  4DV1 O;  4FIP C;  3JAL B;  3IGA C;  2MW2 B;  1VQ8 V;  1S76 D;  1K33 A;  3L71 H;  4WCE V;  1EN5 A;  3K5M A;  4I9Q A;  5J2U B;  1U97 A;  4TUY B;  2PF4 E;  3H1J H;  3CPW U;  1FAF A;  1NTZ H;  1SA0 B;  3K0G A;  3RT3 C;  4LFB O;  1AP6 A;  1GTO A;  4I4T B;  4JAS A;  4TOI A;  1FJG B;  3T4D A;  5FPR A;  1NT2 B;  4A5U B;  5LMN B;  4KXR A;  1MNG A;  1THZ A;  4X1I B;  4DV2 B;  2RQ6 A;  1YXB A;  5CA1 A;  2QKS A;  3SGI A;  4JI8 O;  1P7B A;  3CE2 A;  1IBK O;  4MVZ A;  4B3M O;  4J9Z B;  3RYC B;  2P5O A;  4YY3 B;  2DYR C;  2GV9 A;  1UJW B;  1V9P A;  3W7U A;  5KA6 A;  4DXW A;  5JH7 B;  2WLH A;  1Q43 A;  5GW7 A;  3T2M A;  1RSO B;  2IJJ A;  4I55 B;  3CXH F;  1Y66 A;  5H2F Z;  3HKE A;  4LF6 B;  2A06 H;  4PDR A;  4X65 O;  2Q7H A;  1VQ6 V;  4LF8 B;  4B3T B;  3HKB B;  3UQ8 A;  5L3B A;  1J5E B;  4UV8 A;  3ASO B;  4I50 A;  3VBB A;  3SPH A;  1XMQ O;  2YIA A;  4HBN A;  1RM1 B;  5A9G A;  4J80 A;  1V54 C;  5KAI Z;  1AI5 A;  2Q67 A;  1WP7 A;  2IJI A;  4UFZ A;  4JI0 O;  2FTK A;  4PHZ A;  1DTO A;  5LGT A;  3BAB A;  2NNU A;  2LP7 A;  4JI2 B;  3UT5 B;  2YSU B;  2P90 A;  3QG5 A;  2IH1 C;  2NR5 A;  2JJ1 G;  1AB3 A;  4X62 O;  4LNU B;  4B08 A;  3MD0 A;  1YSC A;  2UUC B;  2L35 A;  4DW1 A;  3JAS B;  1Y76 A;  1WA8 B;  1HWY A;  2AHZ A;  5EC2 C;  4Z1M G;  1JPX A;  2XAH A;  4O2A B;  3ZMT A;  4MTX A;  1TAE A;  3EHB B;  2DWD C;  2QDO A;  1M56 C;  4UCO A;  3CCV V;  2BE3 A;  1YIT V;  3H01 A;  1OCZ B;  3P3P A;  2P22 C;  2DMX A;  4CC5 A;  2X6C A;  2QA4 V;  4JF3 A;  1WLE A;  3HPL C;  2ZXW C;  4JZG A;  1K5Q A;  2IW5 A;  1QNM A;  4MW8 A;  4IHJ A;  4B3S O;  2ZE8 A;  4IT5 A;  1Q82 W;  5LYJ B;  3AEI A;  1SQF A;  1HNW B;  1OCC C;  3G6E V;  3CC7 V;  1Y74 A;  4N21 A;  5CA0 B;  1YF2 A;  3L75 H;  1N32 O;  2L6L A;  4JYB A;  2ZQM A;  1N36 B;  4JYY A;  5KUM A;  2DQ0 A;  4DRX B;  5IY5 C;  2LQT A;  4ZI7 A;  2V1D A;  3BRC A;  3OUF A;  3FX7 A;  1S72 V;  4DR7 B;  4DO2 A;  1KMI Z;  1ARO P;  1U96 A;  2IU3 A;  1X59 A;  2F43 G;  2PI5 A;  4FZ0 A;  4TWK A;  4HZ3 A;  3TCU A;  4FMT A;  4W4K A;  4DR1 O;  2Y48 A;  4JI5 O;  3WU2 Z;  1HNX O;  1O9G A;  4PDM A;  3X2Q C;  2JK5 C;  4LP8 A;  3JYC A;  4XDK A;  2PUS A;  4YJ2 A;  3L74 H;  3THO A;  1EBO A;  4MVR A;  1FPO A;  2UXC O;  3U11 A;  1Y6X A;  2BOC C;  1NR7 A;  3RN4 A;  1QVF U;  5IT9 N;  1M57 C;  1K92 A;  5H6Q A;  1FXK B;  4P30 A;  4U7O A;  2W6I G;  4DR5 O;  4MT8 A;  2WLL A;  4PA9 A;  4BAY A;  1IDS A;  2KB1 A;  1Q7Y W;  4JI4 B;  2EIJ B;  1NVP B;  2X6B A;  3SR2 C;  4X1K B;  3ZRX A;  2WA4 A;  3GWO A;  2KKW A;  4MSW C;  5B5E Z;  3CCR V;  4I0X A;  2HKO A;  2NLJ C;  3ABK B;  4ICG A;  1VEW A;  2KQX A;  3UM7 A;  4YXW G;  2VQE B;  1NTK H;  3KKY A;  3SPJ A;  4DR4 O;  3JSN A;  4HNA B;  4GX1 A;  3GWK C;  1YDX A;  4U7N A;  5LMU B;  3P30 A;  2YIC A;  1YI2 V;  3ICX A;  3IJ4 A;  4O4L B;  4K3A A;  2BTQ A;  3RW0 A;  5LA6 B;  4QIW F;  4DR6 B;  3HKD A;  1RP3 B;  2ADQ B;  4YHH B;  1F51 A;  2QM4 A;  4X89 A;  3SPI A;  3JCZ A;  1S5H C;  4J7Z A;  2CGO A;  4DK0 A;  1QVG U;  2R9R B;  4L87 A;  1NH2 B;  3RVY A;  2RCV A;  4DV5 O;  3ZN1 A;  5EBL C;  4FM1 A;  3OW2 U;  1ZTE A;  4OXS A;  2LFS A;  2W0X A;  1DGS A;  4JZ2 A;  1F4N A;  4MS2 A;  4O4I B;  2P67 A;  3AK1 A;  3A0H Z;  4MVM A;  5H5N A;  2GBO A;  1H2K A;  3K59 A;  4FVM A;  1E1Q G;  2N05 A;  1N33 B;  2P06 A;  4F6R B;  2EBO A;  4RUE A;  4UB8 Z;  1EN4 A;  4JI8 B;  4X1Y A;  3ZJZ A;  4ZIB A;  1QCE A;  1ZAU A;  3ASO C;  1IBK B;  4B3M B;  2QSA A;  1I94 O;  1RM1 C;  2HHH B;  3FYE B;  1KP2 A;  1SES A;  1HP8 A;  2YC0 A;  2DW4 A;  3SJQ C;  3JAL A;  1H2G A;  3LSS A;  2P4V A;  1IXB A;  1WJZ A;  4PI0 A;  4F6E A;  4JAA A;  4H44 B;  4GYC B;  4EEQ A;  3ABL B;  3NXS A;  4DK1 A;  1TGO A;  1AR5 A;  1XIL A;  1YTF B;  1BCC H;  1K73 W;  3T4Z A;  5EZY B;  5GTI Z;  1HW7 A;  1Q3E A;  4QNH B;  2M6Y A;  4U3J A;  4UVA A;  2CGN A;  3JD2 A;  4JAU A;  3RWR D;  4DV3 O;  2IH3 C;  4FK5 C;  2FL4 A;  1OCZ C;  2WLI A;  2EX3 A;  3JAT A;  4ZKI A;  3BVO A;  1N0N A;  5LHI A;  1GN4 A;  4NVP A;  1EM1 A;  3HKC A;  3RYC A;  1K8A W;  3ZHT A;  1JQ0 A;  4LF4 B;  4KHP O;  4AQY O;  4CH3 A;  4UV9 A;  1WAZ A;  2HP8 A;  3K0D A;  4QE9 A;  4J11 A;  2Y0P A;  4O4H A;  3ZMU A;  2HVJ C;  3LDD A;  2N74 A;  3OMA B;  4P9P A;  4CH4 A;  3HKB A;  3ZIA G;  1NQT A;  2VWJ A;  1B6Q A;  2CTP A;  3CCE V;  2KG7 B;  4FLU A;  3L73 H;  1GH6 A;  1CEZ A;  5FPO A;  5FNV B;  3OGC C;  2UXB O;  2DYS C;  4LR3 A;  5L3F A;  2R9I A;  1S5J A;  3OR7 C;  3D8C A;  5J2T B;  4ZOL B;  5C93 A;  5JQG B;  3ZX6 A;  4LNU A;  2C2A A;  3WB2 A;  1Q81 W;  1N32 B;  4JTA B;  2QM7 A;  1YJW V;  5IYZ B;  3CRM A;  3E22 B;  2JRI A;  4DV0 B;  3F7Y C;  3G6B A;  1Q90 D;  4GKK B;  1KKC A;  3JSL A;  1FXK C;  3BPZ A;  3ETG A;  3ASN B;  2PZS A;  4PI2 A;  4FM2 A;  1TUE B;  4WBN B;  4JI5 B;  1DLB A;  4NXN O;  4FJC C;  1HNX B;  2OIG A;  2EIJ C;  4O4J B;  4C7U A;  4X20 B;  5IYD O;  4LFA O;  2A79 B;  1GM9 A;  4FLV A;  2X0L A;  1R3L C;  2VQF B;  4D7T A;  2UXC B;  2B9Z A;  3ABK C;  3SPC A;  2N04 A;  1WPX A;  3TXQ A;  2E5L O;  4DR5 B;  4LBE C;  1K97 A;  1KP3 A;  2OCC B;  2QWR B;  3S3X A;  4FPP A;  3DXR A;  1SZT A;  3RVZ A;  1Q6I A;  1XL4 A;  1WB8 A;  5E79 Z;  1AI7 A;  1TVK B;  1GN3 A;  2IJK A;  4LF9 B;  1D5A A;  1XNR O;  1OV9 A;  3STZ C;  2ZR2 A;  1GN6 A;  2UXN A;  4CH6 A;  5IJ0 A;  2QEX V;  2A0L A;  4DR2 B;  1R1B A;  1IX9 A;  4PV1 B;  4TT3 G;  2UU9 O;  2QWP B;  4DYL A;  1COW G;  4NKG B;  3AG3 C;  4G27 B;  4JI1 O;  5C8Y A;  3AG2 B;  3VOU A;  2GSM B;  2LGW A;  2ZIN A;  3BY6 A;  3K5O A;  1Q5O A;  3E83 A;  1P84 F;  1AJQ A;  1SQQ H;  1FXK A;  2Q9L A;  2JVD A;  3FAV A;  2EZP A;  3QTC A;  1SC5 B;  4WFF A;  2Z3Y A;  2B1G A;  4QPJ A;  3RGB A;  4N23 A;  3T1Y O;  1J95 A;  4YJ3 B;  2ZE6 A;  3LNM B;  4X1K A;  1R6T A;  3F5W C;  4G28 B;  2Z5U A;  2DN9 A;  3ZCC A;  3K06 A;  2GUZ A;  5ITZ A;  1BS3 A;  1LR1 A;  1NTM H;  5F2V O;  1ZL8 B;  5AG2 A;  3VQW A;  3PJS K;  4DV4 B;  3LDE A;  4GKJ B;  4NTX A;  2QTS A;  2UXX A;  1EZV H;  3JAW A;  3AG4 C;  3U10 A;  1JJ2 U;  3C3T A;  4AIL C;  5DED A;  4ZBM A;  4BIZ A;  4G2K A;  3FB5 C;  4WFH A;  2W6J G;  3ABL C;  5KHG A;  1K34 A;  4LC1 A;  1SQV H;  4PA4 A;  5B1B B;  5BMV A;  3K3W A;  1XDC A;  3D3Q A;  1I94 B;  2K1E A;  2LFR A;  1G6U A;  3AG7 A;  1H8E G;  4LF7 O;  2Y4T A;  1VMG A;  1EZJ A;  1YEW A;  2BTO A;  5CB4 B;  4CC6 A;  2Q4P A;  1SQB H;  1XHZ A;  3JAK A;  2JS5 A;  3GVM A;  3CD6 V;  4JYC A;  2PGG A;  2H94 A;  4DV6 O;  1ZWI C;  1UFI A;  3TET A;  5LXT A;  2GTS A;  2HJF C;  1I7F A;  3E2E A;  2CTW A;  1I5Y A;  2ILM A;  2EIK B;  2B1I A;  3CMA V;  1JFF B;  3ZHU A;  2WAM A;  4HYO A;  1GRJ A;  1R6N A;  1SQX H;  3IC9 A;  2CH7 A;  5B1A B;  3B8M A;  4JGS A;  1BHB A;  3OFN G;  4MTO A;  3SYC A;  3RYH B;  3WB1 A;  1CPY A;  4B7E A;  3RYI B;  1FKA O;  4RWU A;  4KHP B;  3FB7 C;  3H1H H;  2ZE7 A;  1QQC A;  2IU0 A;  1N34 B;  1GKF A;  2UUA O;  1S77 D;  4P9O A;  1IVS A;  3A0R A;  4UB6 Z;  5JVD B;  1IBM B;  3D36 C;  2VRZ A;  4FFB B;  3ZMV A;  2EUL A;  3JAR B;  4E2L A;  4X9Q A;  3I5D A;  2F95 B;  4JTD B;  3J7A U;  3OUS A;  3ASN C;  1MZF A;  4MVS A;  2Z0A A;  3T1H O;  2GTA A;  3M7M X;  4FFK A;  5KA5 A;  2OTL V;  5JCO C;  1VQN V;  4B7K A;  1N8R W;  1ZSP A;  4D7S A;  1NVP D;  4X66 O;  4DUY B;  5LP6 B;  4ABM A;  2H8P C;  4OPA A;  3SJA C;  3APO A;  4W4L A;  3CC2 V;  3CC4 V;  1XL6 A;  1BMF G;  2XAF A;  1NBM G;  1K4D C;  1FYJ A;  3SYP A;  2OCC C;  3RYF A;  3WB0 A;  4NXN B;  3KG2 A;  1W59 A;  4O2B A;  4OX9 B;  4IGG A;  1IXM A;  1JVM A;  2JEU A;  2ZDI C;  4Z2W A;  1RPO A;  2JGD A;  4LFA B;  2QM8 A;  5B1N A;  1DF5 A;  3C90 A;  2XOK G;  3ZMS A;  4QE7 A;  2PY5 A;  1GM7 A;  1CXZ B;  3WFV A;  4LCU C;  2BSK B;  3J81 N;  4J9Y B;  4J7J A;  5KHJ A;  2E5L B;  3JD1 A;  4DUZ O;  2FML A;  4ZOL A;  1KEC A;  1A32 A;  1W0K G;  3P3N A;  2MK3 A;  2XND G;  1HNZ O;  1NR1 A;  5JQG A;  3ZRW A;  2R9A A;  2X7R B;  4WFA V;  4UCS A;  3AG2 C;  3E22 A;  3FKS G;  5EK0 A;  3D36 A;  4NTW A;  2YIB D;  1FFX A;  1NH2 D;  3EFF K;  2FB5 A;  1FXV A;  4IIJ B;  2RN9 A;  4GUN A;  1DK1 A;  3Q4H B;  2WLJ A;  2CUG A;  3LSU A;  4QPK A;  5TIS Z;  2Q0A A;  2YS8 A;  4FLY A;  2UU9 B;  5KUK A;  3AK3 A;  4H33 A;  1IBL O;  5JCO A;  4AI8 A;  1FD9 A;  3ETD A;  2D3O W;  3LDC A;  4OGQ B;  2QKC A;  1B06 A;  1US6 A;  2Q6A A;  2JDI G;  4JI1 B;  3NR7 A;  1MSD A;  3DC6 A;  3K08 A;  1R3I C;  5IYC O;  2PYJ A;  3E86 A;  4CS3 A;  4TV8 A;  5EIB C;  4Z1V A;  5IWA B;  1BGY H;  1VIB A;  5B66 Z;  2AZ0 A;  2V7Q G;  4DR3 O;  1VQ4 V;  4CS2 A;  1Z2G A;  4DV1 B;  4B3R O;  2JIZ G;  1QHT A;  4K0K O;  2VWK A;  5JWP A;  2HLD G;  3CCJ V;  3N2G A;  5CA1 B;  1H2S B;  2ZNJ A;  4D6T H;  1GAX A;  5B1B C;  2G38 A;  2F93 B;  3AK2 A;  1YTF D;  3OEH G;  4EB6 B;  2XAG A;  4LFB B;  2YI8 A;  1PNK A;  1SRY A;  2OWO A;  3CX5 F;  2CTR A;  3B09 A;  1OHH G;  2EIL B;  2K9P A;  3TXS A;  1JOY A;  1GN2 A;  3HKE B;  1PNL A;  4AHC A;  4MW3 A;  3OM3 B;  1RPR A;  3OEE G;  1XNQ O;  2V4D A;  5GON A;  4I50 B;  3IC7 A;  3G67 A;  3TK1 A;  4NR1 A;  5IJ9 A;  2XAQ A;  3CCM V;  1QR9 A;  5EYP A;  2CE4 A;  3BA8 A;  1MMM A;  4JI6 O;  4RQE A;  2WA3 A;  2P4K A;  3A0B Z;  4DV2 O;  4MTF A;  4RQF A;  3SDL A;  3FYI B;  2XUM A;  3W7X A;  4DV6 B;  1ORQ C;  5J2U A;  1K3E A;  4TUY A;  2BCC H;  2YI9 A;  1TUB B;  4JYA O;  4X65 B;  1R6K A;  1SA0 A;  4GX0 A;  1HR0 O;  1N4C A;  1Y76 B;  1O9H A;  3SYQ A;  1LUW A;  1XMQ B;  5BXZ A;  4I4T A;  4Q20 A;  5JJN B;  3QO7 A;  3UO2 A;  4JI0 B;  1NI8 A;  3M99 B;  2OTJ V;  3UO3 A;  4X1I A;  5LOV B;  4LF8 O;  2WLK A;  3EVK A;  1J5E O;  4X62 B;  3DSQ A;  1QR8 A;  1SZX A;  3HB3 B;  2ZCE A;  2E76 B;  2ZIO A;  4IHJ B;  4CBC A;  1XHX A;  5CBG A;  3E8H A;  3R65 A;  5JJJ B;  4IL6 Z;  5JH7 A;  5L3E A;  5JJE B;  1RSO A;  3CWB H;  2YXL A;  4I55 A;  2ITC C;  1GK9 A;  2XTA A;  2HVK C;  2X6A A;  2AXT Z;  5LP6 C;  4ZI7 B;  4PA7 A;  1L0L H;  2ZD9 A;  1JFF A;  2Q0O C;  2OCH A;  3M8A A;  3L9D A;  4B3S B;  2LO1 A;  4KFM A;  4I9W A;  3WG7 B;  4BIU A;  4MVO A;  2JS3 A;  4ASU G;  1QLN A;  2WPD G;  3UT5 A;  1K5S A;  3RFR A;  3K57 A;  1AP5 A;  3KCX A;  5CA3 A;  3RYH A;  1VQ5 V;  4YJ2 B;  3JCU Z;  3ETE A;  1W0J G;  3RYI A;  1HDJ A;  2UXD O;  1NS1 A;  3JAS A;  1WA8 A;  2KSD A;  1KYO F;  1YZB A;  1Q6U A;  4PD4 F;  3VQX A;  1OCR B;  2OYQ A;  4O2A A;  1NKD A;  4OPH A;  4UXN A;  4ZHQ B;  4JI7 O;  1XI1 A;  1GMG A;  4DR1 B;  2WLL B;  1VQL V;  1AVM A;  3LSQ A;  4XDJ A;  2VS0 A;  4FFB A;  4I0X B;  2IM9 A;  2UUB O;  2AHY A;  1PP9 H;  2DE0 X;  5LYJ A;  1YHQ V;  2Y69 B;  1L1F A;  1HNZ B;  5EC1 C;  3HR0 A;  3MHS C;  2FYU H;  2ZT9 B;  5CA0 A;  3ZHR A;  4JV5 O;  3CYO A;  1GM8 A;  4BWA A;  4NXM O;  4DRX A;  1EFR G;  5IY5 B;  5LBQ A;  2EIN B;  2AW9 A;  2Q69 A;  1KU9 A;  4FLT A;  1BZK A;  4TQD A;  1R73 A;  1Y67 A;  3I55 V;  2XAS A;  2BTQ B;  1MAB G;  4RO2 A;  1M90 W;  2P6J A;  2AGA A;  1V55 B;  5EIB D;  3HKD B;  4E4E A;  2WSS G;  3BEH A;  1D5N A;  3ZS8 C;  3X2Q B;  5LL6 Y;  1XBL A;  1BT8 A;  4DV7 O;  4DR4 B;  1LUV A;  2BSK A;  3FFQ A;  1XQ8 A;  3SJB C;  4R50 A;  1AIL A;  1M57 B;  1G8M A;  5BR8 O;  3E8B A;  3ZRV A;  1W2B U;  4DR3 B;  2VQE O;  2ZNI A;  1VQ7 V;  3AG1 B;  4PDV A;  4B3R B;  2EIL C;  5KHI A;  4K0K B;  2D2C B;  1OCO B;  4YIO A;  5H6R A;  1K4C C;  3K5L A;  4LFC O;  4DV5 B;  3IFX A;  3CCU V;  3QF7 A;  3I56 V;  2YXH A;  3JD4 A;  3O65 A;  1MSW D;  4EKW A;  4XBF A;  2ZM6 O;  4DR6 O;  3FB6 C;  1XEQ A;  3N2K B;  1NZ6 A;  4YHH O;  3CS5 A;  2RJZ A;  4I5S A;  4RAI A;  1F23 A;  3N27 A;  1PNM A;  2CDY A;  3OMI B;  1TA8 A;  4HNA A;  1YJ9 V;  1YCI A;  1P49 A;  2IJH A;  2O57 A;  1KQS U;  3OMN B;  1K9M W;  3QO5 A;  4FLZ A;  4JAV A;  1M4U A;  4LF5 O;  1ZX3 A;  4KUM A;  4WF9 V;  4O4L A;  1XNQ B;  1VP7 A;  1F7Y A;  5LA6 A;  3MAQ A;  1VF7 A;  1QLE B;  4U3J B;  2DQ3 A;  1WN7 A;  4IYI A;  3R66 A;  4JI6 B;  4BW5 A;  4GT1 A;  1N33 O;  2WLI B;  2YIB A;  2Q68 A;  3JAT B;  3CCQ V;  1KUQ A;  3CP1 A;  2QGN A;  2PYL A;  2QJ1 A;  1SQG A;  3HKC B;  4JYA B;  1SER A;  1S5L Z;  4EB6 A;  2HHH O;  1HR0 B;  1VQP V;  1WPB A;  2ITD C;  4O4I A;  3UCS C;  3E89 A;  1JJO A;  2W0F C;  3SYO A;  4NTY A;  1RFY A;  2DJV A;  2ZR3 A;  2R70 A;  4K35 A;  5H9C A;  1YIJ V;  3ZBH A;  2A3Q A;  3EXA A;  4DV3 B;  1FS0 G;  1DF4 A;  4F6R A;  1MA1 A;  3K04 A;  4O4H B;  5KMG B;  3ML0 A;  4WFE A;  2F4V O;  1L0N H;  1SKV A;  4H13 B;  3CRA A;  1VF6 C;  2PI4 A;  2YEV B;  2LW7 A;  4UUJ C;  1IZ3 A;  1MOF A;  2EIM B;  2R72 A;  1S0V A;  3OT7 A;  3WG7 C;  4AQY B;  3W7S A;  4PJ0 Z;  4TQF A;  2Q5Z A;  1Z5V A;  3BA9 A;  2OT5 A;  4EFE A;  4R6Z A;  3CCS V;  4RUF A;  1AR1 B;  4BW9 A;  3ZHS A;  4TSF G;  2XAJ A;  3K58 A;  5KLV H;  1TUB A;  4UCU A;  1FFT B;  5EBW C;  4F4L A;  1E1R G;  5EZY A;  4LF4 O;  3FB8 C;  3B40 A;  4H0L B;  1XRE A;  2M7W A;  1OCR C;  2AZ2 A;  5KHK A;  2UXB B;  1JCH A;  3K79 A;  2QR4 A;  2E75 B;  3E8G A;  3QNE A;  3A8T A;  1VQM V;  5LOV A;  3APQ A;  1ENV A;  1G4Y B;  3CJH B;  4UVC A;  3OD4 A;  4X64 O;  2IBZ H;  5K1X A;  3BCC H;  5KX5 B;  1BQZ A;  3ZRS A;  2UXD B;  1T5E A;  5IYB O;  4JPR A;  2JEX A;  2EZO A;  3F7V C;  3OTF A;  5BY1 A;  2Y69 C;  2CTQ A;  4JI7 B;  1PD3 A;  3SYA A;  5A2Q N;  2Q8V A;  1R3K C;  3DXR B;  3CRC A;  4QJF B;  4DV0 O;  2EIN C;  2EJR A;  2RDC A;  4YIP A;  4GCZ A;  3OTO O;  1VF6 A;  2KG7 A;  4PEL A;  5FLX N;  1ROP A;  4GKK O;  1X4T A;  5FNV A;  2DYS B;  1PL4 A;  2UUB B;  1PL0 A;  3JD3 A;  5IJ0 B;  1S3J A;  3D3I A;  4QGP A;  1V55 C;  2WLN A;  3BAA A;  3CSX A;  4FM0 A;  3ABU A;  4LWS B;  2CAZ C;  5D5P A;  5J2T A;  3CRR A;  4MVQ A;  1KBH A;  4J10 A;  1I0H A;  4GX5 A;  2LW1 A;  4JV5 B;  4K8Z A;  4NXM B;  5IYZ A;  1AR4 A;  1NU1 H;  5C8Y B;  2VQF O;  1L8D A;  3KCY A;  3QVN A;  3H1I H;  2XHB A;  1XNR B;  3FAV B;  4ZHQ A;  4TV9 B;  1B3Q A;  2RNB A;  1VF5 B;  3JAM N;  4WBN A;  1YJN V;  4CH5 A;  3AG1 C;  2ARH A;  4O4J A;  3B77 A;  3P32 A;  1YVW A;  2ODM A;  2Y0I A;  3BFR A;  1BSM A;  4X20 A;  5CMU A;  3G71 V;  1OCO C;  1FXH A;  2F66 C;  4LF9 O;  1P7G A;  2LGQ A;  1Q8I A;  2HR3 A;  4DV7 B;  2GUZ B;  5DM6 V;  5HFM A;  5ITZ B;  3H1K H;  1VQK V;  3G4S V;  1XMO O;  3OGI B;  4P2Z A;  1D2D A;  4I7Z B;  5B3S B;  4DR2 O;  2YUA A;  1G1X B;  4GZR B;  5BR8 B;  2A7W A;  3QO8 A;  4PDL A;  2EJ7 A;  1BE3 H;  2DWE C;  2ZE5 A;  3ETQ A;  2GDS A;  5FL7 G;  2WWW A;  4IYH A;  4X8A A;  3JAW B;  2F23 A;  4JI3 O;  3T1Y B;  2QTO A;  3ABM B;  2ZDI A;  1TVK A;  4LFC B;  5CBF A;  3CME V;  5BMV B;  4EFB A;  1MZE A;  1M1K W;  1PKX A;  2Q7G A;  3KZI Z;  2LJ2 A;  4JTC B;  1JX9 A;  4J7K A;  1QLE C;  1BL8 A;  2ZM6 B;  3RBZ A;  4DW0 A;  2BOB C;  3TJT A;  3C3S A;  5LHG A;  1KB9 F;  4R7C A;  3S3W A;  3B8N A;  3L70 H;  3LNN A;  3MHH C;  3AG3 B;  1JR9 A;  3JAK B;  3CB2 A;  1VQ9 V;  5DN6 G;  1UPG A;  5D5Q A;  2HEP A;  5LXT B;  1EN6 A;  4LF5 B;  4WFB V;  3L72 H;  4GX2 A;  3FD9 A;  4DV4 O;  4GKJ O;  3BHP A;  2EIK C;  3W7W A;  3JD0 A;  4PA6 A;  2P7T C;  2ZIM A;  3U0Z A;  4LF7 B;  1FJG O;  2H3O A;  3CHX A;  2F1M A;  4LH7 A;  4YJ3 A;  5CBH A;  2YID A;  3A2F A;  3K9S A;  1XUQ A;  5LMN O;  3TGU H;  3PN1 A;  5B1A C;  2CH7 B;  2Q7E A;  4K8X A;  5GTH Z;  2A9H A;  3E8F A;  1OZ0 A;  3CXC U;  1ZL8 A;  1JMK C;  3H1L H;  5J9P C;  3ZHV A;  4YY3 O;  2EIM C;  3N2K A;  1Z5W A;  1WP8 A;  1AJN A;  4L8J A;  3AG4 B;  1MG1 A;  3F5T A;  2QWO B;  1Y4M A;  4KL1 A;  1N0J A;  5HFL A;  4CS4 A;  2HJD A;  4Q6G A;  4LF6 O;  3VQV A;  3OE7 G;  4GLX A;  2F4V B;  4R8C A;  3ABT A;  5IDJ A;  4B3T O;  1E79 G;  3OR6 C;  3E35 A;  1QBZ A;  2HG5 C;  2QE7 G;  2QWN B;  2ZKO A;  2DYR B;  5L3G A;  1LNQ A;  4MTG A;  5CB4 A;  3J80 N;  4NYK A;  2ETN A;  2Q73 A;  4JI2 O;  1H2M A; 
#chains in the Genus database with same CATH homology
 2BCC H;  3L72 H;  1SQB H;  1KB9 F;  3H1L H;  1BCC H;  3L71 H;  3L74 H;  1P84 F;  3L70 H;  1NU1 H;  3H1H H;  1NTK H;  1NTM H;  1SQP H;  1SQQ H;  1SQX H;  3CX5 F;  1SQV H;  3H1J H;  3CXH F;  1NTZ H;  2FYU H;  3H1I H;  2A06 H;  1L0L H;  3L73 H;  4U3F H;  3H1K H;  1L0N H;  4D6T H;  5KLV H;  1PPJ H;  1KYO F;  3TGU H;  1EZV H;  4PD4 F;  2IBZ H;  3L75 H;  1BE3 H;  1PP9 H;  3BCC H;  3CWB H;  1BGY H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...