3H1KH

Chicken cytochrome bc1 complex with zn++ and an iodinated derivative of kresoxim-methyl bound
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
69
Chain Sequence
EEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Crystallographic location of two Zn(2+)-binding sites in the avian cytochrome bc(1) complex
pubmed rcsb
molecule tags Oxidoreductase
total genus 20
structure length 69
sequence length 69
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3h1kH00
1KB9F 1L0LH 3BCCH 1P84F 3H1LH 4PD4F 1SQVH 3L72H 1BCCH 3H1JH 2FYUH 5KLVH 1EZVH 3L73H 2BCCH 1NTZH 1L0NH 1NTKH 1PPJH 1KYOF 1PP9H 1BE3H 3H1HH 2A06H 1NTMH 3TGUH 3L70H 3CXHF 1NU1H 3CX5F 3L74H 4D6TH 1SQQH 1SQXH 3H1KH 1BGYH 1SQPH 4U3FH 3CWBH 2IBZH 1SQBH 3L75H 3L71H 3H1IH
chains in the Genus database with same CATH superfamily
3D8CA 3SDLA 1TGOA 3BA9A 4JI0B 1VMGA 3TXSA 4WFAV 2JGUA 4I0XB 3DTUB 4I7ZB 2QJ1A 4JGSA 3SJAC 2CH7A 4MW3A 2HFEC 4GKKB 3CRQA 4JI7O 1RSOA 2BOBC 4J7KA 1YJ9V 1MZFA 4P9OA 1BQ0A 5IYZA 2XAFA 1PL4A 4HBNA 3H1LH 1GMGA 2RN9A 1AR4A 3AG7A 3JD0A 2GUZA 2ETNA 3LSQA 2FB5A 1IX9A 4FPPA 1YEWA 2XTAA 4UV8A 3CC2V 4DR3B 3CX5F 1WP7A 2OT5A 2Q9LA 5CMUA 3T1HO 2Y0PA 3SPCA 2P6JA 2R9AA 1IDSA 3P30A 5GTIZ 2HKOA 2JGDA 1RP3B 4WBNB 1QLNA 1FFTB 3CCJV 2EJ7A 4LBEC 4DV7O 1IURA 2QWRB 3ZHSA 4FLYA 1B04A 4X1IA 4GX5A 2XASA 2A0LA 1QVGU 1Q43A 2QWQB 4KL1A 1IBKO 4X64B 3JAWB 4LFCB 4WFBV 2W0FC 4DV2B 5JH7B 2DYRC 4ZBMA 1VQNV 3T1CA 2BCCH 1SA0A 2ZR3A 4JZ2A 1MOFA 1PP9H 4LWSA 3SPJA 4JI5O 4JAAA 2DE0X 4JAUA 1NBMG 1M1KW 2CK3G 1AP6A 3JAKA 2DWDC 4JI4B 3ZMZA 1THZA 1W2BU 2JJ1G 4NXNB 1ORQC 1BL8A 4KUMA 1PPJH 2ZM6B 1TA8A 1M5IA 2VQFO 3TJTA 2EIMB 3ZRVA 3WG7B 1MSWD 3RT3C 1ZL8B 4DV4B 4H33A 2F43G 1S3JA 2LP7A 2R9RB 1Q90D 4QNHB 2UXXA 1OCOC 1LR1A 5IYCO 3OMAB 4QE9A 4X1YA 3E8GA 1VQ8V 2EIKC 4YY3B 5BMVB 1UFIA 3GWOA 1PD3A 2KSDA 2ZNJA 3HKCA 3IGAC 1S0VA 4I5SA 1D5AA 5JCOC 1E79G 4K8ZA 2HP8A 4UCOA 4DR3O 3OM3B 1PV0A 4K8XA 4J41A 1VQOV 1E1QG 1EZVH 3CC4V 4CS4A 3JSNA 4O4LA 5AG2A 1LUWA 1L0NH 1QCEA 1WP8A 1GN4A 1G6UA 1YSCA 2WLIB 3EXAA 4FLUA 3QO5A 1Q81W 3EHBB 3O9OA 2LJ2A 4O4JB 1F51A 1BCCH 4X64O 2QTSA 4LFCO 4DV2O 5B3SB 1F4NA 3M7MX 3HKDB 4MVOA 2XHBA 1AI6A 4CBCA 4JTAB 1DTOA 3DC5A 1IBMB 3JARB 2UXBB 2QKSA 4KP4A 2WLLB 4JI8B 1HR0B 2F93B 1K9MW 1N4CA 2YXYA 4ZIBA 4JI4O 2Y4TA 4PA7A 1P7BA 4NXNO 1GM8A 1V9PA 1EFRG 2DMXA 1K97A 5KAIZ 2ZE5A 2CDYA 2ZM6O 4NKGB 2BOCC 3OUSA 4TQFA 1G8MA 1B3QA 2BTQB 4BW9A 1S76D 2W0XA 4DV4O 3K59A 3CJHB 3AK3A 4JV5B 1S72V 1U97A 3SYOA 1VF5B 2IW5A 1U96A 2PF4E 1KQSU 1Q6HA 4YY3O 5FNVB 1NU1H 2IJKA 2IU3A 2F23A 3QF7A 2R9IA 1YCIA 1KBHA 1R6NA 2EINB 3F5TA 3ZRSA 3OMIB 1SESA 2Q7EA 3FYEB 1AI7A 5EZYA 2WA3A 1JFFA 5L3BA 1V55B 1XNQB 2EBOA 4PJ0Z 4DR7B 3J81N 3WG7C 1KMIZ 5KMGA 1K73W 3N2GA 4LNUA 1D2DA 4JYAB 3F7YC 4ZOLB 5BR8B 3CRAA 3QG5A 3ETEA 1BE3H 2LGWA 4F6EA 1KD1W 2XAGA 5JJEB 4GX2A 3U10A 3BEHA 5LGUA 2IBZH 5CA0A 5FPRA 1XI1A 4IT5A 1IBMO 2UXBO 3CCSV 2AHZA 2CTQA 1K5QA 2LFSA 2Z0AA 4JI8O 1HR0O 5FL7G 1G4YB 4ZI7A 2PYJA 3W7TA 1DF5A 1EN5A 1L8DA 5CBFA 2YIBD 2P4VA 1K4DC 4D6TH 5D5QA 4B7EA 1FAFA 4OPHA 4LFAB 4KFMA 1GH6A 3VOUA 4X66B 3CB2A 1XILA 2IH3C 3R65A 4QPKA 3HPLC 3ZBHA 3ZMVA 3HKEA 1VQ9V 2YXHA 1VARA 5B3SC 1SZTA 4U7NA 4JV5O 4DRXB 1FXKC 3VBBA 3CCRV 4X89A 3DXRB 4LC1A 3I5DA 2EIJB 1FYJA 2UXNA 1JQ0A 2ZIMA 2NLJC 5LXTA 1V54B 4UCUA 4YJ3A 4DR5B 3ZMUA 1EBOA 4TUYA 4X9QA 3SJCC 4HNAA 1US6A 1NTMH 3TGUH 2O57A 1XNQO 2ITCC 3ZS8C 4DR7O 5EC2C 1AR1B 3W7SA 4MW8A 1Z2GA 2ITDC 2BSKB 2PY5A 4FK5C 2YIBA 3ZX6A 1TUBA 4FLZA 3I56V 2QSAA 4X1KB 2ZE8A 4IYIA 4JYAO 3OAAG 4KHPB 5BR8O 3F5WC 2WSSG 4LF5B 3ABUA 3K08A 1R6KA 2PUSA 1H2LA 3AK1A 2LO1A 4MVUA 3SR2C 1Q6IA 4JZGA 4HZ3A 5JJJB 1QLEC 2W6IG 5LA6B 1JPXA 2ZDIC 3WB1A 2L35A 4GKJB 2W6JG 1WPBA 4MVQA 4O2AA 5JQGA 4PELA 1J95A 2JEXA 1GN3A 1V55C 1XHXA 2F1MA 5H6RA 1JVMA 2BTOA 5L3EA 2LW7A 3BVOA 3RYFB 4EFBA 2D2CB 3GB7C 3IC7A 4LFAO 2M6YA 1F7YA 4X66O 4RUFA 4EEQA 5CB4B 3T4DA 2Q6AA 4UCSA 1KYOF 4Z2WA 5LP6A 5IWAB 3FB6C 4CH6A 2HR3A 2VWKA 5IY5C 4EB6A 1KU9A 2X6AA 4DR2B 2WLJA 5H2FZ 1OV9A 5LHIA 1WJZA 2WLMA 4N23A 3FAVB 1MA1A 4ZHQB 4AQYB 4DV6B 2FKXA 1NVPD 1K3EA 3ZN1A 5LL6Y 4DR5O 2B9ZA 4LF6B 4B7KA 3OUFA 3AEIA 2KG7B 2QWPB 2ZE7A 1RM1B 4J42A 2JJ2G 1R3JC 5H6QA 4IIJA 4LF7B 1OHHG 4DO2A 4KHPO 1EM1A 1JCHA 2LFRA 3RWRD 2UUCB 2B5UA 1SQBH 4LR3A 1FFXB 1JJOA 1ZTEA 1K8AW 5EIBC 1LUVA 3UT5B 3ZMSA 3C90A 4PA9A 3ZRXA 4GKJO 5LYJA 4MS2A 2Y4UA 3T1YB 1RFYA 3OT7A 1XOUA 3BPZA 2CGOA 1NR7A 4RQFA 4MT8A 2VQEB 2PYLA 5L3DA 3IAYA 1XL4A 2Q5ZA 1SETA 3HR0A 4DK0A 4I50A 3AG1C 4JASA 2AZ0A 1LNQA 1QNMA 2IJHA 2OYQA 2CTWA 4LFBB 4BIZA 5KAFZ 4UV9A 4BW5A 4K3AA 3MHSC 3OTOB 5CN0A 5IWAO 1VQ4V 4YHHB 1P7GA 3VQWA 4H0LB 4F4LA 1L0LH 3BY6A 2DQ0A 1D5NA 2ZNIA 4DR1B 3GWKC 4F6RA 3BHPA 1HNZB 4J7ZA 1Y74B 1VF7A 4DR2O 5GW7A 3ZRWB 3N2KB 1XBLA 2YC0A 1M9NA 4UXNA 1WB7A 3S3WA 4FJCC 1QHTA 2WWWA 4X65B 2RMKB 4AQYO 1YDXA 4H13B 4DV6O 3RYCA 2ZXWB 3CC7V 3ASOB 4WF9V 5HFLA 4LF6O 4JI1B 1YJWV 2Y48A 3THOA 1UPGA 4DV0B 3E22A 3KCXA 2ZIOA 3L73H 2Q4PA 2YUAA 4GUNA 4CZZA 2HHHB 3G80A 4JTDB 4YJ2B 3CCLV 1FXKA 1N36B 1R1BA 4LF7O 4TV8B 2CAZC 5J9PC 1NZ6A 1A32A 2CTPA 4BWAA 3LDDA 3RFRA 3LSUA 1KECA 4UVCA 2YXLA 2UUCO 5CBHA 2YIAA 1M57B 3NXSA 5EC1C 3VQXA 4YIPA 4GX0A 2ARHA 2P67A 4NB5A 1OCZB 3PJSK 5IJ9B 4FM0A 3T1YO 1O9GA 2ADQB 3C3SA 3CS5A 2VQEO 5EYPB 4ASUG 3JD3A 2Y0IA 5E1AC 3BABA 1BT8A 1P4RA 4U3JB 1GKFA 1H2GA 2ZD9A 3OMNB 1M90W 1DF4A 1YTFD 4JI0O 3MHHC 4MTFA 4XDLA 5DEDA 4R8CA 1WLEA 3U11A 2GSMB 3K03A 2WLHA 3RYIB 3JASB 5K1PA 4YXWG 1OCCC 4LF4B 4LFBO 3OEHG 4GKKO 3B40A 4X88A 3AG3B 3OTOO 2ZR2A 5B1BB 3HB3B 3UQ8A 2EULA 4PD4F 2ZDIA 4PHZA 3EVKA 3K9AA 3SGIA 5LHGA 3ETDA 5EBMC 5J2UA 1BZKA 4DR1O 4JYBA 3G6EV 4TSFG 4AI8A 5C93A 1HNZO 3O65A 1TVKB 5BY1A 5K1XA 5JJNB 3SPIA 2OTJV 4X65O 3ASNC 3LSSA 1MMMA 4J10A 1M93A 2ILMA 4G28B 1XREA 1HW7A 4JI1O 3HKBA 5KLVH 2P06A 2XT9A 3CD6V 1HWYA 4DV0O 2Y69B 4B3RB 3C3TA 1ZSPA 2CH7B 1CXZB 1OCRB 3AG2B 3JALA 4JAVA 1WB8A 4O4IA 1RSOB 1N36O 1YF2A 2Q0OC 4I4TA 4FZ1A 2Q73A 4FM1A 3UO2A 1N8RW 5KUMA 5IYZB 5KX5A 1FXHA 3VQVA 3OE7G 3SJBC 5CBGA 1VEWA 2E3CA 4EFEA 5LOVA 3ZHTA 1PNKA 2JRIA 3Q4HB 1WA8A 2GUZB 1H2KA 2RNBA 3UO3A 4JPRA 3AG4B 1KC8W 1B6QA 1EN6A 2GHYA 4NTYA 1JX9A 1VQLV 3CP1A 5GONA 2KB1A 3LDCA 5IDJA 3S3XA 1Y66A 2Q68A 2X6CA 1JA8A 4J11A 2R72A 2RDCA 1VQPV 3CRMA 2QWNB 2JGDB 4DR4B 1IVSA 3JATA 5C8YA 3CCMV 1VF6C 4UFZA 4BR6A 2IM9A 2N74A 5J2TA 3DSQA 4FFBA 4TV9A 4X1IB 1VQ7V 3ZHVA 3A0RA 4RQEA 4WFGA 4FLWA 3ABLB 3E8FA 4GCZA 5B1OA 4B08A 3RYHA 4O2BA 2H94A 1SQPH 2WLKA 1K34A 4G27B 4LF4O 1K7DA 2A9HA 3QO8A 1GN6A 1M57C 4QPJA 1WPXA 2UUAB 1SA0B 4X20A 4I55A 2M7WA 2Z3YA 1ROPA 2EZPA 4LWSB 2A79B 3BA8A 1RPRA 3SYCA 3H9VA 2QM7A 3AK2A 3OFNG 4IHJA 4PV1B 4PDRA 3JAKB 1NR1A 2F66C 3OR7C 3K57A 1N32B 1NS1A 1N0JA 3QO7A 3JCZA 3W7WA 3B8MA 2YEVA 2CGNA 2YI8A 2JK5C 4B3RO 2EIMC 4J80A 1H2SB 1I7FA 2K9PA 1Q8IA 4XBFA 3I55V 1M56B 1KB9F 3B8NA 4O4HA 3L9DA 3H1JH 2ODMA 2UXDB 1AB3A 4X1YB 4UCRA 1Y76A 1NTKH 4U7OA 4TT3G 3K06A 2PI5A 2EILB 4JTCB 3FD9A 1JJ2U 1N33B 1UJWB 3HKCB 3CCVV 3CMEV 2MW2B 1VP7A 4U3FH 4BAYA 4NXMB 1S5LZ 2VRZA 2IU0A 1XHZA 2P4KA 1AILA 4DR4O 4O4LB 1NTZH 1JOYA 3CYOA 3ZN0A 3JAMN 2Y69C 5ITZA 4LH6A 3W7UA 4QGPA 2X7RB 3RN4A 3W7XA 1XDCA 4NTWA 4QE7A 3ABTA 4W4KA 3ZEDA 4HAMA 1YTFB 3E86A 2Q0AA 1S5HC 5DECA 2QTOA 4PDLA 2F4VB 2QKCA 4FMTA 3BRCA 2AZ2A 4CH4A 4OGQB 2F95B 2CUGA 2UUAO 5KA5A 4IL6Z 3MAQA 3EFFK 3APQA 2GTAA 1SQQH 3LNNA 1KP3A 3QVNA 2QA4V 3APOA 2VWJA 1X4TA 5A2QN 1AI4A 4L87A 1NH2D 2Q69A 3RGBA 1XL6A 3GVMA 4PDVA 3STZC 2E76B 3X2QB 1XQ8A 1N32O 3A2FA 1DLBA 3TXQA 4CH5A 2A06H 4P2ZA 4E2LA 1H8HG 4E4EA 4OPAA 4ABMA 1BQZA 3SYQA 2IJJA 2P22C 2DYSB 2JS5A 1XEQA 2EJRA 4RUEA 4X62B 1YHQV 2H3OA 2YICA 3ICXA 2QKAA 5IJ0A 3JCUZ 3TCUA 2LW1A 2OTLV 1WNSA 1QU7A 2HVKC 5JVDA 4C7UA 2ZQMA 1T5EA 3ABKB 2UXDO 4UVBA 2HEPA 3L70H 3BAAA 4A5UB 5JCOA 4L8JA 1N33O 3CRRA 2YIDA 2EINC 2BE3A 1N34B 1PM9A 4DR6B 4NXMO 1Y67A 2OIGA 5EZYB 1WN7A 4I0XA 3F7VC 3G4SV 1JFFB 4FLXA 4JI3B 3KZIZ 1K5SA 4LF8B 1W0JG 5KMGB 2YI9A 1CPYA 2ATKC 3N2GB 5IYDO 4GLXA 1Z5WA 1M56C 4LNUB 3RVZA 5IT9N 1FJGB 2FYUH 4J7JA 1IXMA 2F4VO 3ZRWA 2EILC 3WB0A 2EX3A 2EZOA 4MTGA 5B5EZ 1Z5VA 5CA0B 4IGGA 4FLTA 1R3LC 3TK1A 2XAJA 3BCCH 4FLVA 5EBWC 1VF6A 2RQ6A 3CCUV 4WBNA 2N04A 4ZI7B 5HFMA 4YJ2A 5KHKA 1AJNA 3K04A 3E83A 1Y6XA 4TV8A 3B2EE 1TAEA 1I5YA 5A9GA 1QR8A 5D5PA 1MG1A 3JAWA 2DYRB 4LH7A 5JH7A 5LMNB 3T4ZA 1BMFG 3HKEB 4X62O 1FXVA 5KHHA 2Q7GA 1NKDA 3KKYA 2DOSA 4WCEV 4B3MB 4MTXA 2K1EA 1OZ0A 1BS3A 1SRYA 2IH1C 4LF5O 1FS0G 3CCQV 2EIJC 2ZINA 4PI0A 2LQTA 3SYAA 4ICGA 5LXTB 1N34O 2PZSA 2AGAA 4YJ3B 1V54C 5LBQA 4DR6O 4TUYB 2WAMA 1QR9A 1PL0A 4HNAB 1ZAUA 2B1GA 3M99B 4Q6GA 1IBKB 2C2AA 4JI3O 2CTRA 1ZL8A 4LF8O 1HNXB 4XDKA 2QM8A 2YSUB 2DYSC 1OCOB 1URFA 1TUBB 3ZIAG 4DXWA 2GTSA 3WB2A 4PA6A 2EIKB 3H01A 4JI5B 1FJGO 1P49A 4GT1A 5GTHZ 3G67A 1HP8A 2KQXA 5BMVA 1AJQA 2P90A 5B1AB 3ABKC 1I94B 4CC5A 4OX9B 1H2MA 2E5LB 2RCVA 4I9WA 3FFQA 2Q7HA 4FM2A 3U0ZA 1SKVA 3JYCA 2PGGA 4DUZB 3B77A 5LHHA 2VQFB 1VIBA 4O2AB 5JQGB 1NH2B 1Q82W 3E89A 2UUBB 4AILC 3CSXA 1VQMV 1XNRB 1R3KC 4JF3A 3MDSA 2A7WA 2WLIA 4WFFA 3FB5C 4O4JA 1H2NA 3E8HA 4YIOA 3M8AA 3FB7C 4JI2B 2QM4A 5CA3A 3P3PA 3Q4HA 3CHXA 2KKWA 5LMNO 5LP6B 1PNLA 3HKDA 1AP5A 2DWEC 1COWG 1ENVA 4B3MO 2IJIA 3L75H 3IFXA 3JARA 2Q67A 1F23A 1EZJA 2WLLA 4EB6B 4RAIA 4UCTA 4B3SB 1R3IC 2FL4A 2YS8A 1DGSA 1QVFU 4LF9B 3OGCC 4P30A 4H44B 4FZ0A 3DGEA 2BTQA 2DW4A 2OCCB 3T2MA 4TQDA 1HNXO 2XUMA 2GDSA 3CJHA 1RM1C 4IIJB 1SERA 2AHYA 1BHAA 3K3WA 3RVYA 4GYCB 5KHIA 2PTMA 1RPOA 1Y4MA 5FNVA 1I94O 3ABMB 4J9YB 4OX9O 5F2VO 3JD1A 2E5LO 4YHHO 2XOKG 1SQFA 4DUZO 4LCUC 3SPHA 5LYJB 4RWUA 4MSWC 2DQ3A 5CA1B 2ZT9B 3OGIB 3A0BZ 2X0LA 2UUBO 1QQCA 4QIWF 3NR7A 1GN2A 3MD0A 1XNRO 4JYCA 1NVPB 1NJIW 5KA6A 1BSMA 2V7QG 4I50B 2UXCB 2Z5UA 4ZOLA 3QNEA 4BIOA 3P3NA 5B1NA 2MK3A 3ETGA 4JI2O 3CCEV 2L6LA 4K35A 5B1AC 3QTCA 2XAHA 3ZMTA 2HHHO 5EIBD 3WU2Z 1Q7YW 2NR5A 5KUKA 1OJHA 4IYHA 2Q8VA 3H1IH 4DUYB 1SQVH 4PA4A 3OEEG 4F6RB 3OR6C 4G2KA 1L1FA 4B3SO 3K0GA 1Q5OA 3CRCA 1KKCA 2D3OW 1GAXA 1I08A 2P7TC 3RYCB 5FPOA 2G38A 4CC6A 4QJFB 4J9ZB 1IXBA 2ZXWC 1R73A 4LF9O 3ASOC 2AW9A 3K5OA 3CE2A 4NTXA 1ZUQA 3E22B 1YXBA 1CEZA 1MSDA 4DW0A 4DW1A 3CMAV 2NN4A 5LP6C 1FXKB 5FLXN 2YDEA 4DRXA 1SQGA 4FVMA 1K92A 3D36C 3DXRA 1I0HA 3D3QA 1AJPA 2DN9A 3WFVA 3IJ4A 2DJVA 2UU9B 1SF9A 3K0DA 1XMQB 5B66Z 3R66A 4MTOA 4DV1B 1OCZC 2WLNA 3ML0A 5H9CA 4HYOA 5IYBO 1ZWIC 2FTKA 2OCCC 1AR5A 3TETA 2BSKA 4NR1A 1BHBA 2HVJC 3STLC 2HJDA 1AROP 1S77D 2JS3A 4X1KA 2PI4A 1GM7A 1G1XB 4UUJC 3BFRA 2UXCO 4GX1A 1VQKV 4NYKA 5KHJA 3FYIB 3FKSG 5IE9A 1YVWA 3OD4A 5LMUB 1MNGA 2ZE6A 1BGYH 3ABMC 1QLEB 4Q20A 3ZHQA 1F4MA 1X59A 3AG3C 3LDEA 3PN1A 4MVMA 5B1BC 3FX7A 3VQYA 5LA6A 4Z1MG 1JMKC 1AVMA 4X8AA 1GTOA 4UB8Z 4WFHA 5J2UB 4DK1A 4DUYO 4DV5B 4CS2A 4MVSA 2QR4A 1NQTA 1NT2B 3RYFA 1IBLB 2LGQA 4FFKA 3D3IA 1AI5A 2QEXV 3OTFA 3HKBB 5BXZA 1GRJA 5CB4A 1K4CC 1YITV 1KP2A 1FD9A 1W59A 2JVDA 4AHCA 4B3TB 3B4SA 3JALB 4D7SA 3E2EA 5DM6V 1DK1A 1OCRC 3AG2C 4O4IB 1Q3EA 4MVRA 1O9HA 4UCVA 4I4TB 3H1KH 3K9SA 2WA4A 3DC6A 4I9QA 3LUTB 2B1IA 4UB6Z 5KX5B 5IY5B 1R6TA 1KKDA 1Q6UA 4TWKA 5LOVB 1XUQA 1JR9A 2H8PC 2XAQA 1VQ6V 2R70A 2UU9O 1WA8B 2ZCEA 4DV3B 3FAVA 4ZHQA 1M4UA 3UKMA 3AG4C 3FB8C 1XMQO 1VQ5V 4PA3A 3KCYA 5GONB 4DV1O 3ETQA 3IC9A 2KG7A 1NI8A 4GZRB 3UM7A 1J5EB 4Z1VA 1Q86W 3JATB 5C8YB 3LNMB 4R7CA 4K0KB 4W4LA 3RW0A 4CS3A 1YZBA 1HNWB 5DN6G 4FFBB 5J2TB 4TV9B 3RYHB 4O2BB 3ABLC 3CWBH 5LMUO 4P9PA 1E1RG 1FFXA 2E74B 1P84F 3K5MA 4ZKIA 5H5NA 2JDIG 1ZLZA 4X20B 1EN4A 2N05A 4I55B 3UT5A 1YJNV 3KG2A 4RO2A 4DV5O 3K79A 2ZKOA 1MABG 1FPOA 1K33A 2QWOB 2V1DA 4IHJB 1IBLO 2HLDG 3SPGA 3AG1B 3G6BA 2QGNA 1TUEB 4KXRA 3P32A 2ADPA 3J7AU 1PKXA 2QE7G 2OIEA 5EBLC 5L3FA 2YEVB 4JI6B 1GO3F 1YIJV 4B3TO 3UCSC 3JD2A 4FIPC 4CH3A 1MZEA 2OCHA 1ZX3A 4O4HB 2JIZG 3K5NA 2AXTZ 3A0HZ 4JYYA 2X6BA 4OXSA 3CXCU 1Y76B 3CEIA 1Y74A 1GM9A 2FMLA 3N2KA 1SZXA 3H1HH 5L3CA 4DV3O 1XMOB 1QBZA 4TOIA 4DYLA 1HDJA 3ZHUA 4R6ZA 5KHGA 1J5EO 3G71V 4PI2A 2WPDG 4K0KO 5ITZB 4JI7B 2A3QA 2XNDG 4WFEA 3ZCCA 3D36A 2NNUA 1HNWO 2OWOA 1B06A 3L74H 5TISZ 1SQXH 1SC5B 2E75B 3A8TA 3N27A 5L3GA 1S5JA 2V4DA 2JEUA 1N0NA 3E35A 4D7TA 5LGTA 3ZHRA 2P5OA 2QDOA 4R50A 4H37A 2VS0A 3K5LA 4BIUA 1WAZA 3ZJZA 3T1HB 1W0KG 3J80N 4EKWA 2CE4A 5IJ9A 3K58A 5BZBA 5EK0A 4NVPA 3OW2U 1CP9A 5EYPA 3JD4A 3L71H 1SS3A 1YI2V 3L72H 4U3JA 4DV7B 4N21A 4UVAA 3E8BA 1IZ3A 3X2QC 1GK9A 2HG5C 1OCCB 3SYPA 1PNMA 5LGNA 3RYIA 3JASA 4PDMA 4JI6O 2GBOA 1I5XA 1KUQA 1H38A 1H8EG 2RJZA 5IJ0B 3RBZA 4XDJA 5E79Z 5JVDB 5CA1A 3JSLA 1TVKA 2HJFC 3B09A 3CPWU 3CXHF 3ASNB 5JWPA 1FKAO 2GV9A 3SJQC 1XMOO 4MVZA 4LP8A
chains in the Genus database with same CATH topology
1KB9F 1L0LH 3BCCH 1P84F 3H1LH 4PD4F 1SQVH 3L72H 1BCCH 3H1JH 2FYUH 5KLVH 1EZVH 3L73H 2BCCH 1NTZH 1L0NH 1NTKH 1PPJH 1KYOF 1PP9H 1BE3H 3H1HH 2A06H 1NTMH 3TGUH 3L70H 3CXHF 1NU1H 3CX5F 3L74H 4D6TH 1SQQH 1SQXH 3H1KH 1BGYH 1SQPH 4U3FH 3CWBH 2IBZH 1SQBH 3L75H 3L71H 3H1IH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KB9 F;  1L0L H;  3BCC H;  1P84 F;  3H1L H;  4PD4 F;  1SQV H;  3L72 H;  1BCC H;  3H1J H;  2FYU H;  5KLV H;  1EZV H;  3L73 H;  2BCC H;  1NTZ H;  1L0N H;  1NTK H;  1PPJ H;  1KYO F;  1PP9 H;  1BE3 H;  3H1H H;  2A06 H;  1NTM H;  3TGU H;  3L70 H;  3CXH F;  1NU1 H;  3CX5 F;  3L74 H;  4D6T H;  1SQQ H;  1SQX H;  3H1K H;  1BGY H;  1SQP H;  4U3F H;  3CWB H;  2IBZ H;  1SQB H;  3L75 H;  3L71 H;  3H1I H; 
#chains in the Genus database with same CATH topology
 3D8C A;  3SDL A;  1TGO A;  3BA9 A;  4JI0 B;  1VMG A;  3TXS A;  4WFA V;  2JGU A;  4I0X B;  3DTU B;  4I7Z B;  2QJ1 A;  4JGS A;  3SJA C;  2CH7 A;  4MW3 A;  2HFE C;  4GKK B;  3CRQ A;  4JI7 O;  1RSO A;  2BOB C;  4J7K A;  1YJ9 V;  1MZF A;  4P9O A;  1BQ0 A;  5IYZ A;  2XAF A;  1PL4 A;  4HBN A;  3H1L H;  1GMG A;  2RN9 A;  1AR4 A;  3AG7 A;  3JD0 A;  2GUZ A;  2ETN A;  3LSQ A;  2FB5 A;  1IX9 A;  4FPP A;  1YEW A;  2XTA A;  4UV8 A;  3CC2 V;  4DR3 B;  3CX5 F;  1WP7 A;  2OT5 A;  2Q9L A;  5CMU A;  3T1H O;  2Y0P A;  3SPC A;  2P6J A;  2R9A A;  1IDS A;  3P30 A;  5GTI Z;  2HKO A;  2JGD A;  1RP3 B;  4WBN B;  1QLN A;  1FFT B;  3CCJ V;  2EJ7 A;  4LBE C;  4DV7 O;  1IUR A;  2QWR B;  3ZHS A;  4FLY A;  1B04 A;  4X1I A;  4GX5 A;  2XAS A;  2A0L A;  1QVG U;  1Q43 A;  2QWQ B;  4KL1 A;  1IBK O;  4X64 B;  3JAW B;  4LFC B;  4WFB V;  2W0F C;  4DV2 B;  5JH7 B;  2DYR C;  4ZBM A;  1VQN V;  3T1C A;  2BCC H;  1SA0 A;  2ZR3 A;  4JZ2 A;  1MOF A;  1PP9 H;  4LWS A;  3SPJ A;  4JI5 O;  4JAA A;  2DE0 X;  4JAU A;  1NBM G;  1M1K W;  2CK3 G;  1AP6 A;  3JAK A;  2DWD C;  4JI4 B;  3ZMZ A;  1THZ A;  1W2B U;  2JJ1 G;  4NXN B;  1ORQ C;  1BL8 A;  4KUM A;  1PPJ H;  2ZM6 B;  1TA8 A;  1M5I A;  2VQF O;  3TJT A;  2EIM B;  3ZRV A;  3WG7 B;  1MSW D;  3RT3 C;  1ZL8 B;  4DV4 B;  4H33 A;  2F43 G;  1S3J A;  2LP7 A;  2R9R B;  1Q90 D;  4QNH B;  2UXX A;  1OCO C;  1LR1 A;  5IYC O;  3OMA B;  4QE9 A;  4X1Y A;  3E8G A;  1VQ8 V;  2EIK C;  4YY3 B;  5BMV B;  1UFI A;  3GWO A;  1PD3 A;  2KSD A;  2ZNJ A;  3HKC A;  3IGA C;  1S0V A;  4I5S A;  1D5A A;  5JCO C;  1E79 G;  4K8Z A;  2HP8 A;  4UCO A;  4DR3 O;  3OM3 B;  1PV0 A;  4K8X A;  4J41 A;  1VQO V;  1E1Q G;  1EZV H;  3CC4 V;  4CS4 A;  3JSN A;  4O4L A;  5AG2 A;  1LUW A;  1L0N H;  1QCE A;  1WP8 A;  1GN4 A;  1G6U A;  1YSC A;  2WLI B;  3EXA A;  4FLU A;  3QO5 A;  1Q81 W;  3EHB B;  3O9O A;  2LJ2 A;  4O4J B;  1F51 A;  1BCC H;  4X64 O;  2QTS A;  4LFC O;  4DV2 O;  5B3S B;  1F4N A;  3M7M X;  3HKD B;  4MVO A;  2XHB A;  1AI6 A;  4CBC A;  4JTA B;  1DTO A;  3DC5 A;  1IBM B;  3JAR B;  2UXB B;  2QKS A;  4KP4 A;  2WLL B;  4JI8 B;  1HR0 B;  2F93 B;  1K9M W;  1N4C A;  2YXY A;  4ZIB A;  4JI4 O;  2Y4T A;  4PA7 A;  1P7B A;  4NXN O;  1GM8 A;  1V9P A;  1EFR G;  2DMX A;  1K97 A;  5KAI Z;  2ZE5 A;  2CDY A;  2ZM6 O;  4NKG B;  2BOC C;  3OUS A;  4TQF A;  1G8M A;  1B3Q A;  2BTQ B;  4BW9 A;  1S76 D;  2W0X A;  4DV4 O;  3K59 A;  3CJH B;  3AK3 A;  4JV5 B;  1S72 V;  1U97 A;  3SYO A;  1VF5 B;  2IW5 A;  1U96 A;  2PF4 E;  1KQS U;  1Q6H A;  4YY3 O;  5FNV B;  1NU1 H;  2IJK A;  2IU3 A;  2F23 A;  3QF7 A;  2R9I A;  1YCI A;  1KBH A;  1R6N A;  2EIN B;  3F5T A;  3ZRS A;  3OMI B;  1SES A;  2Q7E A;  3FYE B;  1AI7 A;  5EZY A;  2WA3 A;  1JFF A;  5L3B A;  1V55 B;  1XNQ B;  2EBO A;  4PJ0 Z;  4DR7 B;  3J81 N;  3WG7 C;  1KMI Z;  5KMG A;  1K73 W;  3N2G A;  4LNU A;  1D2D A;  4JYA B;  3F7Y C;  4ZOL B;  5BR8 B;  3CRA A;  3QG5 A;  3ETE A;  1BE3 H;  2LGW A;  4F6E A;  1KD1 W;  2XAG A;  5JJE B;  4GX2 A;  3U10 A;  3BEH A;  5LGU A;  2IBZ H;  5CA0 A;  5FPR A;  1XI1 A;  4IT5 A;  1IBM O;  2UXB O;  3CCS V;  2AHZ A;  2CTQ A;  1K5Q A;  2LFS A;  2Z0A A;  4JI8 O;  1HR0 O;  5FL7 G;  1G4Y B;  4ZI7 A;  2PYJ A;  3W7T A;  1DF5 A;  1EN5 A;  1L8D A;  5CBF A;  2YIB D;  2P4V A;  1K4D C;  4D6T H;  5D5Q A;  4B7E A;  1FAF A;  4OPH A;  4LFA B;  4KFM A;  1GH6 A;  3VOU A;  4X66 B;  3CB2 A;  1XIL A;  2IH3 C;  3R65 A;  4QPK A;  3HPL C;  3ZBH A;  3ZMV A;  3HKE A;  1VQ9 V;  2YXH A;  1VAR A;  5B3S C;  1SZT A;  4U7N A;  4JV5 O;  4DRX B;  1FXK C;  3VBB A;  3CCR V;  4X89 A;  3DXR B;  4LC1 A;  3I5D A;  2EIJ B;  1FYJ A;  2UXN A;  1JQ0 A;  2ZIM A;  2NLJ C;  5LXT A;  1V54 B;  4UCU A;  4YJ3 A;  4DR5 B;  3ZMU A;  1EBO A;  4TUY A;  4X9Q A;  3SJC C;  4HNA A;  1US6 A;  1NTM H;  3TGU H;  2O57 A;  1XNQ O;  2ITC C;  3ZS8 C;  4DR7 O;  5EC2 C;  1AR1 B;  3W7S A;  4MW8 A;  1Z2G A;  2ITD C;  2BSK B;  2PY5 A;  4FK5 C;  2YIB A;  3ZX6 A;  1TUB A;  4FLZ A;  3I56 V;  2QSA A;  4X1K B;  2ZE8 A;  4IYI A;  4JYA O;  3OAA G;  4KHP B;  5BR8 O;  3F5W C;  2WSS G;  4LF5 B;  3ABU A;  3K08 A;  1R6K A;  2PUS A;  1H2L A;  3AK1 A;  2LO1 A;  4MVU A;  3SR2 C;  1Q6I A;  4JZG A;  4HZ3 A;  5JJJ B;  1QLE C;  2W6I G;  5LA6 B;  1JPX A;  2ZDI C;  3WB1 A;  2L35 A;  4GKJ B;  2W6J G;  1WPB A;  4MVQ A;  4O2A A;  5JQG A;  4PEL A;  1J95 A;  2JEX A;  1GN3 A;  1V55 C;  1XHX A;  2F1M A;  5H6R A;  1JVM A;  2BTO A;  5L3E A;  2LW7 A;  3BVO A;  3RYF B;  4EFB A;  2D2C B;  3GB7 C;  3IC7 A;  4LFA O;  2M6Y A;  1F7Y A;  4X66 O;  4RUF A;  4EEQ A;  5CB4 B;  3T4D A;  2Q6A A;  4UCS A;  1KYO F;  4Z2W A;  5LP6 A;  5IWA B;  3FB6 C;  4CH6 A;  2HR3 A;  2VWK A;  5IY5 C;  4EB6 A;  1KU9 A;  2X6A A;  4DR2 B;  2WLJ A;  5H2F Z;  1OV9 A;  5LHI A;  1WJZ A;  2WLM A;  4N23 A;  3FAV B;  1MA1 A;  4ZHQ B;  4AQY B;  4DV6 B;  2FKX A;  1NVP D;  1K3E A;  3ZN1 A;  5LL6 Y;  4DR5 O;  2B9Z A;  4LF6 B;  4B7K A;  3OUF A;  3AEI A;  2KG7 B;  2QWP B;  2ZE7 A;  1RM1 B;  4J42 A;  2JJ2 G;  1R3J C;  5H6Q A;  4IIJ A;  4LF7 B;  1OHH G;  4DO2 A;  4KHP O;  1EM1 A;  1JCH A;  2LFR A;  3RWR D;  2UUC B;  2B5U A;  1SQB H;  4LR3 A;  1FFX B;  1JJO A;  1ZTE A;  1K8A W;  5EIB C;  1LUV A;  3UT5 B;  3ZMS A;  3C90 A;  4PA9 A;  3ZRX A;  4GKJ O;  5LYJ A;  4MS2 A;  2Y4U A;  3T1Y B;  1RFY A;  3OT7 A;  1XOU A;  3BPZ A;  2CGO A;  1NR7 A;  4RQF A;  4MT8 A;  2VQE B;  2PYL A;  5L3D A;  3IAY A;  1XL4 A;  2Q5Z A;  1SET A;  3HR0 A;  4DK0 A;  4I50 A;  3AG1 C;  4JAS A;  2AZ0 A;  1LNQ A;  1QNM A;  2IJH A;  2OYQ A;  2CTW A;  4LFB B;  4BIZ A;  5KAF Z;  4UV9 A;  4BW5 A;  4K3A A;  3MHS C;  3OTO B;  5CN0 A;  5IWA O;  1VQ4 V;  4YHH B;  1P7G A;  3VQW A;  4H0L B;  4F4L A;  1L0L H;  3BY6 A;  2DQ0 A;  1D5N A;  2ZNI A;  4DR1 B;  3GWK C;  4F6R A;  3BHP A;  1HNZ B;  4J7Z A;  1Y74 B;  1VF7 A;  4DR2 O;  5GW7 A;  3ZRW B;  3N2K B;  1XBL A;  2YC0 A;  1M9N A;  4UXN A;  1WB7 A;  3S3W A;  4FJC C;  1QHT A;  2WWW A;  4X65 B;  2RMK B;  4AQY O;  1YDX A;  4H13 B;  4DV6 O;  3RYC A;  2ZXW B;  3CC7 V;  3ASO B;  4WF9 V;  5HFL A;  4LF6 O;  4JI1 B;  1YJW V;  2Y48 A;  3THO A;  1UPG A;  4DV0 B;  3E22 A;  3KCX A;  2ZIO A;  3L73 H;  2Q4P A;  2YUA A;  4GUN A;  4CZZ A;  2HHH B;  3G80 A;  4JTD B;  4YJ2 B;  3CCL V;  1FXK A;  1N36 B;  1R1B A;  4LF7 O;  4TV8 B;  2CAZ C;  5J9P C;  1NZ6 A;  1A32 A;  2CTP A;  4BWA A;  3LDD A;  3RFR A;  3LSU A;  1KEC A;  4UVC A;  2YXL A;  2UUC O;  5CBH A;  2YIA A;  1M57 B;  3NXS A;  5EC1 C;  3VQX A;  4YIP A;  4GX0 A;  2ARH A;  2P67 A;  4NB5 A;  1OCZ B;  3PJS K;  5IJ9 B;  4FM0 A;  3T1Y O;  1O9G A;  2ADQ B;  3C3S A;  3CS5 A;  2VQE O;  5EYP B;  4ASU G;  3JD3 A;  2Y0I A;  5E1A C;  3BAB A;  1BT8 A;  1P4R A;  4U3J B;  1GKF A;  1H2G A;  2ZD9 A;  3OMN B;  1M90 W;  1DF4 A;  1YTF D;  4JI0 O;  3MHH C;  4MTF A;  4XDL A;  5DED A;  4R8C A;  1WLE A;  3U11 A;  2GSM B;  3K03 A;  2WLH A;  3RYI B;  3JAS B;  5K1P A;  4YXW G;  1OCC C;  4LF4 B;  4LFB O;  3OEH G;  4GKK O;  3B40 A;  4X88 A;  3AG3 B;  3OTO O;  2ZR2 A;  5B1B B;  3HB3 B;  3UQ8 A;  2EUL A;  4PD4 F;  2ZDI A;  4PHZ A;  3EVK A;  3K9A A;  3SGI A;  5LHG A;  3ETD A;  5EBM C;  5J2U A;  1BZK A;  4DR1 O;  4JYB A;  3G6E V;  4TSF G;  4AI8 A;  5C93 A;  1HNZ O;  3O65 A;  1TVK B;  5BY1 A;  5K1X A;  5JJN B;  3SPI A;  2OTJ V;  4X65 O;  3ASN C;  3LSS A;  1MMM A;  4J10 A;  1M93 A;  2ILM A;  4G28 B;  1XRE A;  1HW7 A;  4JI1 O;  3HKB A;  5KLV H;  2P06 A;  2XT9 A;  3CD6 V;  1HWY A;  4DV0 O;  2Y69 B;  4B3R B;  3C3T A;  1ZSP A;  2CH7 B;  1CXZ B;  1OCR B;  3AG2 B;  3JAL A;  4JAV A;  1WB8 A;  4O4I A;  1RSO B;  1N36 O;  1YF2 A;  2Q0O C;  4I4T A;  4FZ1 A;  2Q73 A;  4FM1 A;  3UO2 A;  1N8R W;  5KUM A;  5IYZ B;  5KX5 A;  1FXH A;  3VQV A;  3OE7 G;  3SJB C;  5CBG A;  1VEW A;  2E3C A;  4EFE A;  5LOV A;  3ZHT A;  1PNK A;  2JRI A;  3Q4H B;  1WA8 A;  2GUZ B;  1H2K A;  2RNB A;  3UO3 A;  4JPR A;  3AG4 B;  1KC8 W;  1B6Q A;  1EN6 A;  2GHY A;  4NTY A;  1JX9 A;  1VQL V;  3CP1 A;  5GON A;  2KB1 A;  3LDC A;  5IDJ A;  3S3X A;  1Y66 A;  2Q68 A;  2X6C A;  1JA8 A;  4J11 A;  2R72 A;  2RDC A;  1VQP V;  3CRM A;  2QWN B;  2JGD B;  4DR4 B;  1IVS A;  3JAT A;  5C8Y A;  3CCM V;  1VF6 C;  4UFZ A;  4BR6 A;  2IM9 A;  2N74 A;  5J2T A;  3DSQ A;  4FFB A;  4TV9 A;  4X1I B;  1VQ7 V;  3ZHV A;  3A0R A;  4RQE A;  4WFG A;  4FLW A;  3ABL B;  3E8F A;  4GCZ A;  5B1O A;  4B08 A;  3RYH A;  4O2B A;  2H94 A;  1SQP H;  2WLK A;  1K34 A;  4G27 B;  4LF4 O;  1K7D A;  2A9H A;  3QO8 A;  1GN6 A;  1M57 C;  4QPJ A;  1WPX A;  2UUA B;  1SA0 B;  4X20 A;  4I55 A;  2M7W A;  2Z3Y A;  1ROP A;  2EZP A;  4LWS B;  2A79 B;  3BA8 A;  1RPR A;  3SYC A;  3H9V A;  2QM7 A;  3AK2 A;  3OFN G;  4IHJ A;  4PV1 B;  4PDR A;  3JAK B;  1NR1 A;  2F66 C;  3OR7 C;  3K57 A;  1N32 B;  1NS1 A;  1N0J A;  3QO7 A;  3JCZ A;  3W7W A;  3B8M A;  2YEV A;  2CGN A;  2YI8 A;  2JK5 C;  4B3R O;  2EIM C;  4J80 A;  1H2S B;  1I7F A;  2K9P A;  1Q8I A;  4XBF A;  3I55 V;  1M56 B;  1KB9 F;  3B8N A;  4O4H A;  3L9D A;  3H1J H;  2ODM A;  2UXD B;  1AB3 A;  4X1Y B;  4UCR A;  1Y76 A;  1NTK H;  4U7O A;  4TT3 G;  3K06 A;  2PI5 A;  2EIL B;  4JTC B;  3FD9 A;  1JJ2 U;  1N33 B;  1UJW B;  3HKC B;  3CCV V;  3CME V;  2MW2 B;  1VP7 A;  4U3F H;  4BAY A;  4NXM B;  1S5L Z;  2VRZ A;  2IU0 A;  1XHZ A;  2P4K A;  1AIL A;  4DR4 O;  4O4L B;  1NTZ H;  1JOY A;  3CYO A;  3ZN0 A;  3JAM N;  2Y69 C;  5ITZ A;  4LH6 A;  3W7U A;  4QGP A;  2X7R B;  3RN4 A;  3W7X A;  1XDC A;  4NTW A;  4QE7 A;  3ABT A;  4W4K A;  3ZED A;  4HAM A;  1YTF B;  3E86 A;  2Q0A A;  1S5H C;  5DEC A;  2QTO A;  4PDL A;  2F4V B;  2QKC A;  4FMT A;  3BRC A;  2AZ2 A;  4CH4 A;  4OGQ B;  2F95 B;  2CUG A;  2UUA O;  5KA5 A;  4IL6 Z;  3MAQ A;  3EFF K;  3APQ A;  2GTA A;  1SQQ H;  3LNN A;  1KP3 A;  3QVN A;  2QA4 V;  3APO A;  2VWJ A;  1X4T A;  5A2Q N;  1AI4 A;  4L87 A;  1NH2 D;  2Q69 A;  3RGB A;  1XL6 A;  3GVM A;  4PDV A;  3STZ C;  2E76 B;  3X2Q B;  1XQ8 A;  1N32 O;  3A2F A;  1DLB A;  3TXQ A;  4CH5 A;  2A06 H;  4P2Z A;  4E2L A;  1H8H G;  4E4E A;  4OPA A;  4ABM A;  1BQZ A;  3SYQ A;  2IJJ A;  2P22 C;  2DYS B;  2JS5 A;  1XEQ A;  2EJR A;  4RUE A;  4X62 B;  1YHQ V;  2H3O A;  2YIC A;  3ICX A;  2QKA A;  5IJ0 A;  3JCU Z;  3TCU A;  2LW1 A;  2OTL V;  1WNS A;  1QU7 A;  2HVK C;  5JVD A;  4C7U A;  2ZQM A;  1T5E A;  3ABK B;  2UXD O;  4UVB A;  2HEP A;  3L70 H;  3BAA A;  4A5U B;  5JCO A;  4L8J A;  1N33 O;  3CRR A;  2YID A;  2EIN C;  2BE3 A;  1N34 B;  1PM9 A;  4DR6 B;  4NXM O;  1Y67 A;  2OIG A;  5EZY B;  1WN7 A;  4I0X A;  3F7V C;  3G4S V;  1JFF B;  4FLX A;  4JI3 B;  3KZI Z;  1K5S A;  4LF8 B;  1W0J G;  5KMG B;  2YI9 A;  1CPY A;  2ATK C;  3N2G B;  5IYD O;  4GLX A;  1Z5W A;  1M56 C;  4LNU B;  3RVZ A;  5IT9 N;  1FJG B;  2FYU H;  4J7J A;  1IXM A;  2F4V O;  3ZRW A;  2EIL C;  3WB0 A;  2EX3 A;  2EZO A;  4MTG A;  5B5E Z;  1Z5V A;  5CA0 B;  4IGG A;  4FLT A;  1R3L C;  3TK1 A;  2XAJ A;  3BCC H;  4FLV A;  5EBW C;  1VF6 A;  2RQ6 A;  3CCU V;  4WBN A;  2N04 A;  4ZI7 B;  5HFM A;  4YJ2 A;  5KHK A;  1AJN A;  3K04 A;  3E83 A;  1Y6X A;  4TV8 A;  3B2E E;  1TAE A;  1I5Y A;  5A9G A;  1QR8 A;  5D5P A;  1MG1 A;  3JAW A;  2DYR B;  4LH7 A;  5JH7 A;  5LMN B;  3T4Z A;  1BMF G;  3HKE B;  4X62 O;  1FXV A;  5KHH A;  2Q7G A;  1NKD A;  3KKY A;  2DOS A;  4WCE V;  4B3M B;  4MTX A;  2K1E A;  1OZ0 A;  1BS3 A;  1SRY A;  2IH1 C;  4LF5 O;  1FS0 G;  3CCQ V;  2EIJ C;  2ZIN A;  4PI0 A;  2LQT A;  3SYA A;  4ICG A;  5LXT B;  1N34 O;  2PZS A;  2AGA A;  4YJ3 B;  1V54 C;  5LBQ A;  4DR6 O;  4TUY B;  2WAM A;  1QR9 A;  1PL0 A;  4HNA B;  1ZAU A;  2B1G A;  3M99 B;  4Q6G A;  1IBK B;  2C2A A;  4JI3 O;  2CTR A;  1ZL8 A;  4LF8 O;  1HNX B;  4XDK A;  2QM8 A;  2YSU B;  2DYS C;  1OCO B;  1URF A;  1TUB B;  3ZIA G;  4DXW A;  2GTS A;  3WB2 A;  4PA6 A;  2EIK B;  3H01 A;  4JI5 B;  1FJG O;  1P49 A;  4GT1 A;  5GTH Z;  3G67 A;  1HP8 A;  2KQX A;  5BMV A;  1AJQ A;  2P90 A;  5B1A B;  3ABK C;  1I94 B;  4CC5 A;  4OX9 B;  1H2M A;  2E5L B;  2RCV A;  4I9W A;  3FFQ A;  2Q7H A;  4FM2 A;  3U0Z A;  1SKV A;  3JYC A;  2PGG A;  4DUZ B;  3B77 A;  5LHH A;  2VQF B;  1VIB A;  4O2A B;  5JQG B;  1NH2 B;  1Q82 W;  3E89 A;  2UUB B;  4AIL C;  3CSX A;  1VQM V;  1XNR B;  1R3K C;  4JF3 A;  3MDS A;  2A7W A;  2WLI A;  4WFF A;  3FB5 C;  4O4J A;  1H2N A;  3E8H A;  4YIO A;  3M8A A;  3FB7 C;  4JI2 B;  2QM4 A;  5CA3 A;  3P3P A;  3Q4H A;  3CHX A;  2KKW A;  5LMN O;  5LP6 B;  1PNL A;  3HKD A;  1AP5 A;  2DWE C;  1COW G;  1ENV A;  4B3M O;  2IJI A;  3L75 H;  3IFX A;  3JAR A;  2Q67 A;  1F23 A;  1EZJ A;  2WLL A;  4EB6 B;  4RAI A;  4UCT A;  4B3S B;  1R3I C;  2FL4 A;  2YS8 A;  1DGS A;  1QVF U;  4LF9 B;  3OGC C;  4P30 A;  4H44 B;  4FZ0 A;  3DGE A;  2BTQ A;  2DW4 A;  2OCC B;  3T2M A;  4TQD A;  1HNX O;  2XUM A;  2GDS A;  3CJH A;  1RM1 C;  4IIJ B;  1SER A;  2AHY A;  1BHA A;  3K3W A;  3RVY A;  4GYC B;  5KHI A;  2PTM A;  1RPO A;  1Y4M A;  5FNV A;  1I94 O;  3ABM B;  4J9Y B;  4OX9 O;  5F2V O;  3JD1 A;  2E5L O;  4YHH O;  2XOK G;  1SQF A;  4DUZ O;  4LCU C;  3SPH A;  5LYJ B;  4RWU A;  4MSW C;  2DQ3 A;  5CA1 B;  2ZT9 B;  3OGI B;  3A0B Z;  2X0L A;  2UUB O;  1QQC A;  4QIW F;  3NR7 A;  1GN2 A;  3MD0 A;  1XNR O;  4JYC A;  1NVP B;  1NJI W;  5KA6 A;  1BSM A;  2V7Q G;  4I50 B;  2UXC B;  2Z5U A;  4ZOL A;  3QNE A;  4BIO A;  3P3N A;  5B1N A;  2MK3 A;  3ETG A;  4JI2 O;  3CCE V;  2L6L A;  4K35 A;  5B1A C;  3QTC A;  2XAH A;  3ZMT A;  2HHH O;  5EIB D;  3WU2 Z;  1Q7Y W;  2NR5 A;  5KUK A;  1OJH A;  4IYH A;  2Q8V A;  3H1I H;  4DUY B;  1SQV H;  4PA4 A;  3OEE G;  4F6R B;  3OR6 C;  4G2K A;  1L1F A;  4B3S O;  3K0G A;  1Q5O A;  3CRC A;  1KKC A;  2D3O W;  1GAX A;  1I08 A;  2P7T C;  3RYC B;  5FPO A;  2G38 A;  4CC6 A;  4QJF B;  4J9Z B;  1IXB A;  2ZXW C;  1R73 A;  4LF9 O;  3ASO C;  2AW9 A;  3K5O A;  3CE2 A;  4NTX A;  1ZUQ A;  3E22 B;  1YXB A;  1CEZ A;  1MSD A;  4DW0 A;  4DW1 A;  3CMA V;  2NN4 A;  5LP6 C;  1FXK B;  5FLX N;  2YDE A;  4DRX A;  1SQG A;  4FVM A;  1K92 A;  3D36 C;  3DXR A;  1I0H A;  3D3Q A;  1AJP A;  2DN9 A;  3WFV A;  3IJ4 A;  2DJV A;  2UU9 B;  1SF9 A;  3K0D A;  1XMQ B;  5B66 Z;  3R66 A;  4MTO A;  4DV1 B;  1OCZ C;  2WLN A;  3ML0 A;  5H9C A;  4HYO A;  5IYB O;  1ZWI C;  2FTK A;  2OCC C;  1AR5 A;  3TET A;  2BSK A;  4NR1 A;  1BHB A;  2HVJ C;  3STL C;  2HJD A;  1ARO P;  1S77 D;  2JS3 A;  4X1K A;  2PI4 A;  1GM7 A;  1G1X B;  4UUJ C;  3BFR A;  2UXC O;  4GX1 A;  1VQK V;  4NYK A;  5KHJ A;  3FYI B;  3FKS G;  5IE9 A;  1YVW A;  3OD4 A;  5LMU B;  1MNG A;  2ZE6 A;  1BGY H;  3ABM C;  1QLE B;  4Q20 A;  3ZHQ A;  1F4M A;  1X59 A;  3AG3 C;  3LDE A;  3PN1 A;  4MVM A;  5B1B C;  3FX7 A;  3VQY A;  5LA6 A;  4Z1M G;  1JMK C;  1AVM A;  4X8A A;  1GTO A;  4UB8 Z;  4WFH A;  5J2U B;  4DK1 A;  4DUY O;  4DV5 B;  4CS2 A;  4MVS A;  2QR4 A;  1NQT A;  1NT2 B;  3RYF A;  1IBL B;  2LGQ A;  4FFK A;  3D3I A;  1AI5 A;  2QEX V;  3OTF A;  3HKB B;  5BXZ A;  1GRJ A;  5CB4 A;  1K4C C;  1YIT V;  1KP2 A;  1FD9 A;  1W59 A;  2JVD A;  4AHC A;  4B3T B;  3B4S A;  3JAL B;  4D7S A;  3E2E A;  5DM6 V;  1DK1 A;  1OCR C;  3AG2 C;  4O4I B;  1Q3E A;  4MVR A;  1O9H A;  4UCV A;  4I4T B;  3H1K H;  3K9S A;  2WA4 A;  3DC6 A;  4I9Q A;  3LUT B;  2B1I A;  4UB6 Z;  5KX5 B;  5IY5 B;  1R6T A;  1KKD A;  1Q6U A;  4TWK A;  5LOV B;  1XUQ A;  1JR9 A;  2H8P C;  2XAQ A;  1VQ6 V;  2R70 A;  2UU9 O;  1WA8 B;  2ZCE A;  4DV3 B;  3FAV A;  4ZHQ A;  1M4U A;  3UKM A;  3AG4 C;  3FB8 C;  1XMQ O;  1VQ5 V;  4PA3 A;  3KCY A;  5GON B;  4DV1 O;  3ETQ A;  3IC9 A;  2KG7 A;  1NI8 A;  4GZR B;  3UM7 A;  1J5E B;  4Z1V A;  1Q86 W;  3JAT B;  5C8Y B;  3LNM B;  4R7C A;  4K0K B;  4W4L A;  3RW0 A;  4CS3 A;  1YZB A;  1HNW B;  5DN6 G;  4FFB B;  5J2T B;  4TV9 B;  3RYH B;  4O2B B;  3ABL C;  3CWB H;  5LMU O;  4P9P A;  1E1R G;  1FFX A;  2E74 B;  1P84 F;  3K5M A;  4ZKI A;  5H5N A;  2JDI G;  1ZLZ A;  4X20 B;  1EN4 A;  2N05 A;  4I55 B;  3UT5 A;  1YJN V;  3KG2 A;  4RO2 A;  4DV5 O;  3K79 A;  2ZKO A;  1MAB G;  1FPO A;  1K33 A;  2QWO B;  2V1D A;  4IHJ B;  1IBL O;  2HLD G;  3SPG A;  3AG1 B;  3G6B A;  2QGN A;  1TUE B;  4KXR A;  3P32 A;  2ADP A;  3J7A U;  1PKX A;  2QE7 G;  2OIE A;  5EBL C;  5L3F A;  2YEV B;  4JI6 B;  1GO3 F;  1YIJ V;  4B3T O;  3UCS C;  3JD2 A;  4FIP C;  4CH3 A;  1MZE A;  2OCH A;  1ZX3 A;  4O4H B;  2JIZ G;  3K5N A;  2AXT Z;  3A0H Z;  4JYY A;  2X6B A;  4OXS A;  3CXC U;  1Y76 B;  3CEI A;  1Y74 A;  1GM9 A;  2FML A;  3N2K A;  1SZX A;  3H1H H;  5L3C A;  4DV3 O;  1XMO B;  1QBZ A;  4TOI A;  4DYL A;  1HDJ A;  3ZHU A;  4R6Z A;  5KHG A;  1J5E O;  3G71 V;  4PI2 A;  2WPD G;  4K0K O;  5ITZ B;  4JI7 B;  2A3Q A;  2XND G;  4WFE A;  3ZCC A;  3D36 A;  2NNU A;  1HNW O;  2OWO A;  1B06 A;  3L74 H;  5TIS Z;  1SQX H;  1SC5 B;  2E75 B;  3A8T A;  3N27 A;  5L3G A;  1S5J A;  2V4D A;  2JEU A;  1N0N A;  3E35 A;  4D7T A;  5LGT A;  3ZHR A;  2P5O A;  2QDO A;  4R50 A;  4H37 A;  2VS0 A;  3K5L A;  4BIU A;  1WAZ A;  3ZJZ A;  3T1H B;  1W0K G;  3J80 N;  4EKW A;  2CE4 A;  5IJ9 A;  3K58 A;  5BZB A;  5EK0 A;  4NVP A;  3OW2 U;  1CP9 A;  5EYP A;  3JD4 A;  3L71 H;  1SS3 A;  1YI2 V;  3L72 H;  4U3J A;  4DV7 B;  4N21 A;  4UVA A;  3E8B A;  1IZ3 A;  3X2Q C;  1GK9 A;  2HG5 C;  1OCC B;  3SYP A;  1PNM A;  5LGN A;  3RYI A;  3JAS A;  4PDM A;  4JI6 O;  2GBO A;  1I5X A;  1KUQ A;  1H38 A;  1H8E G;  2RJZ A;  5IJ0 B;  3RBZ A;  4XDJ A;  5E79 Z;  5JVD B;  5CA1 A;  3JSL A;  1TVK A;  2HJF C;  3B09 A;  3CPW U;  3CXH F;  3ASN B;  5JWP A;  1FKA O;  2GV9 A;  3SJQ C;  1XMO O;  4MVZ A;  4LP8 A; 
#chains in the Genus database with same CATH homology
 1KB9 F;  1L0L H;  3BCC H;  1P84 F;  3H1L H;  4PD4 F;  1SQV H;  3L72 H;  1BCC H;  3H1J H;  2FYU H;  5KLV H;  1EZV H;  3L73 H;  2BCC H;  1NTZ H;  1L0N H;  1NTK H;  1PPJ H;  1KYO F;  1PP9 H;  1BE3 H;  3H1H H;  2A06 H;  1NTM H;  3TGU H;  3L70 H;  3CXH F;  1NU1 H;  3CX5 F;  3L74 H;  4D6T H;  1SQQ H;  1SQX H;  3H1K H;  1BGY H;  1SQP H;  4U3F H;  3CWB H;  2IBZ H;  1SQB H;  3L75 H;  3L71 H;  3H1I H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...