3H1KH

Chicken cytochrome bc1 complex with zn++ and an iodinated derivative of kresoxim-methyl bound
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
69
Chain Sequence
EEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic location of two Zn(2+)-binding sites in the avian cytochrome bc(1) complex
pubmed rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 20
structure length 69
sequence length 69
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3h1kH00
5KLVH 1SQPH 3CXHF 3CX5F 3L74H 1L0NH 3H1JH 3L73H 1SQQH 1SQBH 1NTKH 2BCCH 1NU1H 4D6TH 1BGYH 1EZVH 1NTMH 2A06H 1PPJH 3H1LH 4U3FH 1KB9F 3L71H 2FYUH 1BE3H 3L70H 1P84F 3H1KH 2IBZH 1BCCH 3L72H 1NTZH 3L75H 4PD4F 3TGUH 1PP9H 3CWBH 3H1HH 3H1IH 3BCCH 1KYOF 1L0LH 1SQVH 1SQXH
chains in the Genus database with same CATH superfamily
1TUBA 2PI5A 1IBLO 1NQTA 4CC5A 2ITDC 2A06H 4J7KA 1WPXA 1GAXA 1XI1A 2VQEB 5KX5A 2ZE8A 3OE7G 1V55C 2PYLA 5K1XA 1N32B 4DO2A 3ZHSA 3ASNC 3OTFA 2CTPA 3CCRV 2B9ZA 2CTRA 2YC0A 1WPBA 3JATA 3ZHUA 3T1CA 1FFXB 5KHJA 4LWSB 1V55B 2JRIA 3HKBA 2Y48A 2P22C 4O2BB 2XASA 3RWRD 2GV9A 1JJ2U 4PA3A 5J2TB 1QLEC 1RSOB 2A0LA 3TCUA 1NS1A 2N04A 3RYCA 1VQKV 3PN1A 4Q20A 3QG5A 4R7CA 1VQ5V 3IFXA 2ZM6O 4X65B 3T4ZA 5LA6A 1NVPD 4X1YA 5KUMA 3SYQA 2VQFB 5J2UB 3A8TA 3W7WA 5IYCO 3SJCC 3JD4A 4DR1B 1VQOV 2XHBA 4XDLA 3HB3B 4U7OA 3JD2A 1URFA 1B06A 4LF8B 1EZVH 2WAMA 4FPPA 4JI4B 4DUZB 4PI0A 2Q7GA 4IHJB 3CCEV 2BOBC 2F4VB 1R73A 2W6IG 1L0NH 3FX7A 1VF6C 3LDCA 4DR2O 1AR4A 3ABMC 5ITZB 4PA4A 3AEIA 4LNUA 1SETA 4X64B 2DQ0A 5JCOC 4H13B 2CGNA 3VQXA 1VIBA 2PGGA 3L75H 3RYIB 1XMQB 4RUEA 2MK3A 1WB8A 4DV7B 1EM1A 2ADPA 4FLVA 2GUZB 4FIPC 2VWKA 5H2FZ 1S5HC 4BW5A 3ZRXA 3AG4C 4R8CA 4H44B 5L3GA 3ABUA 1CXZB 3CCMV 5FNVA 1JFFA 4O4LB 5JWPA 4PA7A 5JJNB 4MW8A 4UCUA 4ABMA 2HG5C 1S5LZ 4ZI7A 4JF3A 2LW7A 5J2UA 1YITV 2HVJC 1QCEA 4FJCC 3ZEDA 2UUAB 1QBZA 2IM9A 2HLDG 2ARHA 5J9PC 3E8FA 4H33A 2NNUA 5C8YB 4EFBA 4ICGA 2P90A 2QWRB 3BHPA 4YY3O 1SQPH 4BIOA 2Q73A 2UXXA 1LR1A 3A0HZ 1S76D 4Z1MG 3L73H 3X2QB 2CE4A 2PF4E 2UXDB 2LFRA 4L87A 2YSUB 4YXWG 2Q7HA 4IIJB 1H8HG 1XUQA 2M6YA 1H2MA 4MVQA 3OMIB 4DW0A 2WLMA 3IGAC 3NXSA 2WLNA 4TV9B 1AI5A 1OCOC 1V54C 4OPHA 4QPKA 1AJNA 4CC6A 3Q4HB 4U3JA 2EZPA 4P9OA 2WLIB 1XHXA 3C3SA 2Q68A 1M57C 3OTOB 4U7NA 4TSFG 4JV5O 1EN4A 1N0JA 4B3TO 1N33O 1SQGA 3E8GA 2LQTA 4K3AA 5EYPA 1VP7A 3CXHF 2PY5A 2GTSA 3AG4B 3FB8C 3ABLB 4EKWA 4DV3O 3CEIA 3K0GA 4L8JA 3OR7C 5KHHA 3BABA 2ZXWB 1KB9F 3ETGA 5JJJB 3JAKB 1HWYA 2WLHA 3F7YC 1AVMA 4LC1A 2LP7A 4MW3A 1Y6XA 2EILC 1KQSU 4DR7O 1HDJA 3N2KB 1GKFA 4AQYB 2VWJA 3G6BA 4X20B 2OTLV 2V4DA 2WWWA 3S3WA 2KQXA 4PELA 3RVZA 1R1BA 1KC8W 1FKAO 4QNHB 5LYJA 4ZIBA 4HNAB 4OX9O 4GX0A 3I55V 1LUVA 1RPRA 1RPOA 2JGDA 2R70A 1QLNA 5CB4B 4JAUA 1NZ6A 3OT7A 4JI1B 4LF9B 1WA8B 2BTOA 5IJ9A 2V1DA 3QF7A 4GZRB 4MTGA 4LFAO 2ZDIC 1VQ8V 4W4LA 1G8MA 3SJQC 2AHZA 4GLXA 2A7WA 1YVWA 3UQ8A 1OCZB 2A9HA 4GCZA 2F93B 4PDRA 4JI2O 3VOUA 1XOUA 4UV8A 2LJ2A 2R72A 2OT5A 3JYCA 4LH6A 4WBNA 1BQZA 2OYQA 2PUSA 3SJBC 4WFAV 3D36A 3M99B 1IBMO 4NTXA 3W7SA 2JEUA 4JI5O 4MTOA 1SZTA 3ZHQA 3UM7A 2RCVA 3CMAV 4PDMA 2DYSB 3VBBA 3RYHB 2Q8VA 1XBLA 4JTCB 1WN7A 3L74H 5L3FA 5LMUO 1BMFG 3U11A 5CA1A 2P7TC 5LMNO 4F4LA 2NN4A 3DC6A 2JGDB 1GMGA 2P67A 1OCZC 2ETNA 2YIDA 2W0FC 4NXNB 2CTWA 4D7TA 2ZNIA 1UFIA 3TXSA 1HR0O 4UB6Z 5LYJB 4DR5O 1K97A 4IL6Z 5LP6B 4ZHQA 3UT5A 4K0KB 4R50A 1NR7A 3TK1A 4XDJA 1YHQV 2AXTZ 5B3SB 1DTOA 1R6TA 1RP3B 2WLJA 4O2AA 2Y4UA 4J7JA 3GVMA 1N32O 3JSNA 2L6LA 3CC7V 4I50A 2WPDG 1VQ7V 1Z5WA 3R66A 1BS3A 1D5AA 3X2QC 5AG2A 4CS4A 3CRMA 3FB5C 3SR2C 3SPCA 1J5EB 2K1EA 2JJ1G 3E35A 1VMGA 3DXRA 3KZIZ 1SS3A 2N74A 4GKKB 1PL0A 2ZR2A 1P49A 5KHIA 1SQFA 3K79A 1IZ3A 3ABLC 4JZGA 1XEQA 4QE7A 2F1MA 1BCCH 1AB3A 3RYFA 4X62O 4DR3B 3OEEG 2H8PC 4B7EA 2QJ1A 5KAIZ 2F66C 1U97A 1M56B 1PNLA 1M57B 5H5NA 1Y74A 2YIBD 5CN0A 4UCOA 2DWDC 4DR4O 1KKDA 2OCHA 5FLXN 5LA6B 5LHHA 4IIJA 3P32A 5LGTA 4LF5B 3UCSC 2DQ3A 2EJ7A 4LBEC 1COWG 5JCOA 3G6EV 1HR0B 3S3XA 2QM8A 3AK3A 1R6NA 1K4CC 1MSDA 3M8AA 5J2TA 1YJ9V 2QKSA 3AK1A 3LUTB 1H2LA 1GN2A 1UJWB 3T1HO 4ZBMA 4FLXA 5LP6A 2FB5A 1XQ8A 1VQ9V 1TVKA 4X64O 4UCTA 4CH5A 4EFEA 1VQ6V 4BW9A 4AILC 4JASA 4DV4O 2Y4TA 4H0LB 2ATKC 1N8RW 1VQ4V 5IWAO 2LGWA 1XREA 4MTFA 4LF8O 3MHHC 5L3BA 5L3EA 4LFBB 1IURA 1H2GA 4WFHA 2EJRA 2E5LO 1Q43A 3IJ4A 2DOSA 3OMAB 1N36B 3JSLA 5B3SC 2UXNA 3RN4A 1HP8A 3OMNB 3T1HB 2IBZH 2IH3C 3L72H 3JARA 4GYCB 2AW9A 1PV0A 1HNWB 2OWOA 1AI7A 1E1QG 1WA8A 4JI5B 2Q4PA 1MA1A 5IYZA 2EZOA 5D5QA 1O9HA 4IHJA 5EBLC 1I5XA 5EC2C 1KP2A 4IYHA 1QU7A 5CB4A 1TGOA 3HKDB 4JI7B 2YI9A 4RAIA 4LF7O 2JK5C 3M7MX 1V9PA 1ZSPA 4I7ZB 1SQVH 2CK3G 4FFKA 2X6AA 2X7RB 4K8XA 4BWAA 1BGYH 3SJAC 4MT8A 3E22B 3E22A 3OW2U 3U0ZA 2Q69A 3KCYA 4X20A 4O4LA 3ZMVA 3I5DA 4LF4O 2BTQA 1SQXH 1K7DA 4UVCA 4E4EA 1F7YA 4WFFA 1QVGU 4HAMA 1WLEA 1OCRC 3H1JH 1WP7A 2KG7A 4NB5A 3QVNA 2GSMB 2B1GA 3ABTA 3CMEV 4TUYA 1FFXA 1JA8A 2WA4A 3EVKA 3STZC 1XDCA 2HP8A 4WF9V 3CWBH 5A2QN 5CA3A 1KMIZ 1NJIW 3SYPA 1RM1C 1JX9A 2OIEA 4JI4O 1NH2B 2QWQB 4LFAB 3DC5A 4HBNA 4AI8A 4JYBA 4JZ2A 1GN6A 3J81N 2HHHB 5JVDB 5KHGA 5GTHZ 2XAGA 2ZQMA 4DV6O 1P84F 5CA0A 3E86A 3LSQA 1X4TA 1P7GA 5BR8B 2ZCEA 1OCRB 3ASOC 1Q3EA 1KKCA 3MD0A 3QO7A 5IJ0B 3CCJV 4UCSA 5KA5A 1AILA 3K06A 1B3QA 2O57A 2JVDA 3K5NA 3WU2Z 3JALA 3N2GB 4NXMO 3H01A 1XMQO 3AK2A 3WFVA 4GKJO 1PNKA 1ZL8B 4YIPA 4JI7O 3N27A 4EB6B 4UV9A 2P6JA 1NH2D 3K3WA 3IAYA 5DN6G 1M5IA 5F2VO 3LDEA 1N34O 4QPJA 1GRJA 2GTAA 4G27B 1MSWD 4TV8B 1E1RG 1VARA 1L1FA 4F6RB 3D8CA 2QDOA 1PD3A 2YXHA 3UO2A 1YI2V 5B1BB 5IY5B 4EB6A 1NTZH 1FXHA 2DYRB 1QR9A 4LFCB 2Q0OC 1OJHA 3E8BA 1Y76B 2ZIOA 4DRXB 5IY5C 3CD6V 4P2ZA 3SYCA 3CYOA 1EN6A 1SQQH 4X9QA 1M4UA 2RJZA 4B3MO 4Z2WA 4NKGB 2YXYA 2FTKA 5IWAB 2EILB 4LF5O 3F5WC 3B77A 3OUFA 2CGOA 2E3CA 4CH6A 3ZS8C 2ZXWC 4JYCA 4DV6B 1O9GA 4RWUA 4GX2A 1PKXA 1PL4A 3RYIA 1FFTB 3ZBHA 2GBOA 5EK0A 1YF2A 4J80A 3MDSA 3F5TA 5CA0B 5GONA 4O4JA 4DUYO 5BZBA 4GT1A 2Q9LA 5ITZA 4PA9A 4JTDB 2AGAA 3ZRSA 3BCCH 2QE7G 1AI6A 2BE3A 3G4SV 2PTMA 2WLLB 3A0BZ 2KG7B 2ILMA 2Q5ZA 2D3OW 1H38A 4DV0O 3ZMZA 2FL4A 4YJ2B 2WLKA 4TUYB 3CCQV 2EULA 1OCOB 1K33A 1MNGA 2Y0IA 5LOVB 1BZKA 1GM7A 1SESA 2Q0AA 3ZMUA 1G1XB 1F4NA 4YHHO 1S3JA 5FL7G 1WB7A 5EZYA 4ZI7B 2W0XA 2YEVA 3K5LA 1A32A 1R6KA 1HNZB 3B09A 3QTCA 3KG2A 5CBFA 1SC5B 2F4VO 2DYSC 1K9MW 1SA0B 1UPGA 3EHBB 5B1NA 1KP3A 2ZR3A 2EX3A 4JYAB 3FB7C 4UCVA 2ITCC 2UUCO 1R3IC 4B7KA 2RNBA 4DV7O 2KSDA 3AG1C 3ZHVA 3W7TA 4DV5B 1H2NA 1ZX3A 1XNQB 2VS0A 4JI1O 3QO5A 1VQPV 1L0LH 1IXMA 4HZ3A 4QGPA 4EEQA 1IBKO 5KUKA 1XMOO 3CRCA 1Q8IA 3OFNG 3ZJZA 3O9OA 1BSMA 2JEXA 1B6QA 1DF5A 1YEWA 2DMXA 4X8AA 4PD4F 3ABKC 2KKWA 2QR4A 4FLTA 2XAQA 5KLVH 1Z5VA 5LHGA 1BHBA 1KBHA 3AG3C 1YXBA 3HR0A 5BXZA 4ZKIA 4X66O 5H6RA 4LCUC 2YI8A 1GM9A 2IJKA 4RQFA 1GK9A 2DN9A 4B3TB 1YTFD 5BMVB 3WB2A 2P4KA 2DWEC 4FLWA 4DR6O 5B66Z 5JJEB 3WG7C 3ETEA 4PA6A 2E76B 4JI3B 3E8HA 2G38A 1NT2B 5EZYB 2JS5A 3ML0A 1CPYA 3ZHTA 2UXCB 4C7UA 4DW1A 3N2KA 3K58A 1WNSA 1NR1A 1SKVA 2GUZA 5EYPB 5C93A 5EIBD 4JI6B 1P7BA 4NVPA 1GM8A 2EIMB 4WFGA 2FYUH 1K5SA 5TISZ 2Y0PA 4R6ZA 5B5EZ 5LOVA 4JAAA 2DYRC 4OGQB 4YJ3A 1YJNV 1TUEB 5FNVB 2HKOA 1FJGO 3FYEB 5CA1B 2AZ0A 4GKJB 1EN5A 4DR1O 1KYOF 3MAQA 3CJHB 4LH7A 1S0VA 2XNDG 3VQYA 3FKSG 3CCLV 4MVUA 4X1KB 1QHTA 4CS3A 1H2SB 1IBKB 1IX9A 1MG1A 1Q90D 2QWNB 3FAVA 3OM3B 5JH7A 3FAVB 5JH7B 1AJQA 2HFEC 2FMLA 4KP4A 1GTOA 4DUZO 3APOA 5HFMA 3J7AU 2ZE6A 2BSKB 4B3SO 1JVMA 2E74B 4PDVA 3JAWB 1JPXA 1F23A 2C2AA 4FM2A 2GDSA 2XTAA 3RFRA 2ZE7A 3CRQA 4X62B 4DR2B 1YZBA 2V7QG 5LXTB 2ZKOA 3ZCCA 5FPOA 3LNMB 2Y69C 4I4TB 4DV1O 2W6JG 4G28B 3ETDA 5LGNA 1FXKB 1T5EA 3UT5B 5IDJA 4UB8Z 3K08A 4CH3A 3L70H 4I5SA 3A2FA 4UVAA 4NXNO 2QTSA 3DTUB 4MVZA 3H1HH 1AJPA 1Q7YW 4J7ZA 5BY1A 4BIUA 4FLUA 1AP5A 2AHYA 2UUBB 1SERA 4IT5A 1FPOA 3O65A 1S72V 3ZRVA 3GWOA 3APQA 1JCHA 3FD9A 4E2LA 1HNWO 1I5YA 2YIBA 2VQEO 1K5QA 3JALB 1IDSA 2EBOA 1FJGB 4J41A 1FYJA 3JAWA 1WP8A 5CBGA 2RQ6A 4U3JB 5L3DA 1N33B 4YHHB 2EIKC 4OXSA 3W7UA 4TQDA 5H9CA 3B4SA 4I9WA 4PV1B 1S5JA 4I0XA 1SF9A 1GO3F 2CAZC 2ZE5A 1J5EO 2P06A 1I0HA 4X1KA 1M9NA 3BVOA 1L8DA 3JCUZ 2B1IA 4TV9A 3RW0A 4BR6A 5HFLA 5B1AB 2BTQB 2QM4A 2UU9O 2YICA 3T4DA 3EFFK 3BRCA 3T2MA 1H2KA 3CE2A 1R3LC 1ORQC 5L3CA 4HNAA 2X6BA 1G4YB 4B3MB 2CH7A 3ZX6A 3RVYA 2ZM6B 4Z1VA 3ZMTA 4JPRA 4P30A 4FFBB 4FFBA 3F7VC 4N23A 1R3JC 4GX5A 1RM1B 1N34B 4QJFB 5B1OA 4DV3B 1ZWIC 4LF6B 4J11A 2HR3A 4UXNA 4DK0A 1OV9A 3HKDA 1R3KC 5CBHA 2EIKB 3CRAA 4WCEV 2QA4V 3JATB 4MVRA 4PHZA 4YJ2A 1K8AW 3SGIA 1QNMA 4I55A 2ZIMA 1OCCC 1Q6IA 3RYHA 1Y74B 4FZ0A 4DUYB 1NTMH 1IBLB 2Q67A 2QEXV 1FAFA 3ABMB 3T1YO 4JGSA 1JFFB 1KU9A 4LF4B 3ZRWA 5KMGB 2H94A 3GWKC 4KUMA 2QTOA 1OCCB 4DV0B 1JQ0A 5KHKA 3IC9A 3AG2B 3RT3C 2YXLA 1BT8A 2OIGA 5IJ0A 1K92A 2ZINA 2IJHA 1EZJA 3DXRB 1B04A 1TUBB 3P30A 5E1AC 3JARB 4FVMA 4TWKA 5LBQA 1BL8A 4IYIA 3W7XA 3CSXA 3OR6C 3G71V 1NKDA 4J9YB 3TGUH 5JQGB 3ETQA 1YIJV 1VF7A 1HNZO 3LSUA 1THZA 3AG3B 4B3RB 1D2DA 1YTFB 4O4IB 1Y76A 3SPHA 2XT9A 4KXRA 4J42A 3AG2C 2Z3YA 4CH4A 4JTAB 4UUJC 2UU9B 3D3IA 4FM1A 1Q6UA 2UUCB 1DK1A 1U96A 2CUGA 2A79B 3FB6C 4MTXA 1BHAA 4I9QA 1MZEA 3CX5F 3B40A 3BY6A 2Z5UA 4DK1A 4ZHQB 3ASOB 3K9SA 1XNQO 2CH7B 1M90W 2HHHO 1W0JG 1RSOA 2R9AA 1H8EG 1GN3A 3MHSC 3CCUV 1XL6A 1Q81W 4XDKA 2UXBB 4D7SA 1PM9A 3HKCA 4NXMB 4CS2A 4DR5B 2YS8A 2RMKB 2QGNA 4K8ZA 4MVSA 1XILA 4TQFA 4NTYA 4DR3O 1XNRO 3TJTA 4N21A 1OZ0A 2PYJA 1NBMG 3ZMSA 3JD3A 1VQNV 2DJVA 3G80A 1Y67A 3JD1A 3RYFB 3SPJA 4DR4B 2IH1C 3C3TA 1ZTEA 2ZDIA 4GX1A 4MSWC 3BPZA 1EFRG 3E83A 1W59A 3B8NA 4GKKO 2XAFA 3K59A 4WBNB 3WG7B 5IJ9B 5FPRA 4KHPO 3ASNB 4JI0O 2ZT9B 2BCCH 1M56C 3ZRWB 5KMGA 5DM6V 1VF6A 3CCSV 3UO3A 5CMUA 1HNXB 4I50B 3HKEB 1DGSA 5KA6A 2WA3A 4J9ZB 3JD0A 3UKMA 3K57A 5IYDO 2PI4A 1JMKC 3DSQA 3RYCB 3K5MA 4FMTA 1FXKA 1I08A 4YIOA 4DRXA 4JI6O 1I94B 3RBZA 3K9AA 2Q7EA 4TOIA 1M1KW 5DEDA 3U10A 2L35A 4MVMA 3DGEA 5EBWC 1QQCA 2XAHA 4LF6O 2HJDA 1AR5A 1YJWV 2XOKG 4LWSA 4O4HA 1K4DC 1CP9A 2VRZA 4LFBO 3ZN0A 3QNEA 1HW7A 1QLEB 4LP8A 1SRYA 3IC7A 2LO1A 1W2BU 2E5LB 2UXBO 3HKBB 5BMVA 4MVOA 2DW4A 2YUAA 1TA8A 2D2CB 5E79Z 3RGBA 3N2GA 4O4JB 1G6UA 2RN9A 3PJSK 4DV4B 4PDLA 1I7FA 1XL4A 4JV5B 2F95B 4AQYO 3OUSA 2ADQB 4X89A 2WLLA 1K34A 2QM7A 2BSKA 2QKAA 2QKCA 4D6TH 4I0XB 3BA9A 1DLBA 3H1KH 3L9DA 3AG7A 2HJFC 4X1IB 5D5PA 1KECA 4CBCA 1X59A 4A5UB 1F51A 2M7WA 2DE0X 4B08A 4KL1A 1N36O 1GH6A 4LF9O 2R9RB 3D3QA 4JAVA 1Q5OA 3A0RA 4NR1A 1Q6HA 1TAEA 2WSSG 2IU3A 1BQ0A 3CC2V 3E2EA 2BOCC 1HNXO 1ENVA 1LNQA 5K1PA 3C90A 4FLYA 1Q82W 1US6A 2UXCO 2A3QA 4DV5O 4I55B 4RUFA 4X65O 4O2AB 5DECA 1JJOA 3ZHRA 1KUQA 4WFEA 4O4HB 4W4KA 2VQFO 1PNMA 5EC1C 1SQBH 3ABKB 1FXVA 1JR9A 3LNNA 1XMOB 2OCCB 1TVKB 3BAAA 2IJIA 4U3FH 3L71H 2LW1A 1IXBA 2F23A 4UFZA 5EBMC 3R65A 4DR6B 4MS2A 1MABG 2GHYA 3WB1A 1M93A 2R9IA 1VQMV 4DYLA 1QVFU 1Y66A 4OPAA 2F43G 4DXWA 4BIZA 1F4MA 4JI3O 3GB7C 5IYZB 3P3NA 3SYAA 1S77D 5IYBO 1FS0G 3LDDA 2LFSA 5BR8O 3OEHG 3HKEA 2HVKC 5JQGA 3AG1B 4UVBA 4FM0A 3JAMN 1WAZA 4B3SB 1WJZA 2ZNJA 2FKXA 2JGUA 3EXAA 2EINB 5GTIZ 4OX9B 1VF5B 2UUAO 2EIJC 1JOYA 4JYYA 4BAYA 3K0DA 5EIBC 4JI8O 3FYIB 4FZ1A 1OHHG 4YY3B 1XNRB 1NTKH 1K3EA 2X0LA 3ICXA 5LHIA 4KFMA 1SZXA 3OTOO 1AP6A 3QO8A 1BE3H 4UCRA 2UXDO 4LR3A 2ZD9A 5JVDA 1RFYA 1AR1B 4ZOLA 1PP9H 3Q4HA 4PI2A 4WFBV 3CJHA 4FK5C 3CS5A 2NLJC 4NTWA 4HYOA 3TETA 5C8YA 2ODMA 3THOA 1YCIA 4DV2B 2H3OA 2YIAA 1N0NA 4J10A 1QR8A 4JYAO 5B1AC 3CHXA 4K0KO 4F6EA 4TV8A 3CRRA 2KB1A 4AHCA 1V54B 2EIJB 3P3PA 2EINC 3H9VA 2JS3A 3BFRA 2Z0AA 3CCVV 2YEVB 4DV1B 3VQWA 1Q86W 1YSCA 2PZSA 4IGGA 4LF7B 3OD4A 1ZAUA 4I4TA 1N4CA 1ZUQA 4O2BA 3OGIB 2P4VA 2XAJA 4XBFA 5KAFZ 2YDEA 1AROP 1DF4A 1YDXA 4ZOLB 4DR7B 1LUWA 3T1YB 4G2KA 2IU0A 3TXQA 4Q6GA 4TT3G 1NI8A 2K9PA 1IVSA 2XUMA 4LNUB 5H6QA 3WB0A 1E79G 4QE9A 2OCCC 3NR7A 2RDCA 4LFCO 4X66B 2HEPA 2JIZG 3JASA 3JASB 2E75B 4JI8B 3FFQA 1NU1H 2EIMC 3SPIA 1K73W 1PPJH 3H1LH 4X1IA 5GONB 2LGQA 4ASUG 1EBOA 1W0KG 5IT9N 2N05A 2WLIA 1D5NA 2P5OA 1Y4MA 5A9GA 3B8MA 4PJ0Z 2QWPB 3E89A 1ROPA 3CP1A 5LGUA 1MMMA 2IJJA 2IW5A 2QWOB 5GW7A 3CC4V 3KKYA 2Y69B 3ZN1A 2JJ2G 3K04A 3JCZA 3LSSA 1KD1W 4DV2O 1MOFA 5LL6Y 2UUBO 3HKCB 4YJ3B 1GN4A 4X88A 2QSAA 1ZLZA 4P9PA 3BA8A 3CB2A 3OAAG 4GUNA 3VQVA 2B5UA 3OGCC 3CPWU 3BEHA 4NYKA 1J95A 2MW2B 1CEZA 3B2EE 2NR5A 3STLC 4F6RA 2CTQA 1SA0A 1AI4A 4X1YB 1VEWA 3G67A 2Q6AA 1Z2GA 5IE9A 3K03A 1XHZA 5LMUB 1VQLV 4RQEA 2JDIG 1P4RA 1NVPB 1ZL8A 3HPLC 3SYOA 3SPGA 3KCXA 3JAKA 4RO2A 4FLZA 1I94O 2AZ2A 3ZIAG 4O4IA 3CXCU 4JI2B 5B1BC 5LMNB 4H37A 3D36C 4K35A 1FXKC 4QIWF 5LXTA 4JI0B 1MZFA 1FD9A 2CDYA 5LP6C 3J80N 2X6CA 5KX5B 1IBMB 3K5OA 2OTJV 4CZZA 3H1IH 4KHPB 3I56V 4B3RO 3SDLA
chains in the Genus database with same CATH topology
5KLVH 1SQPH 3CXHF 3CX5F 3L74H 1L0NH 3H1JH 3L73H 1SQQH 1SQBH 1NTKH 2BCCH 1NU1H 4D6TH 1BGYH 1EZVH 1NTMH 2A06H 1PPJH 3H1LH 4U3FH 1KB9F 3L71H 2FYUH 1BE3H 3L70H 1P84F 3H1KH 2IBZH 1BCCH 3L72H 1NTZH 3L75H 4PD4F 3TGUH 1PP9H 3CWBH 3H1HH 3H1IH 3BCCH 1KYOF 1L0LH 1SQVH 1SQXH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KLV H;  1SQP H;  3CXH F;  3CX5 F;  3L74 H;  1L0N H;  3H1J H;  3L73 H;  1SQQ H;  1SQB H;  1NTK H;  2BCC H;  1NU1 H;  4D6T H;  1BGY H;  1EZV H;  1NTM H;  2A06 H;  1PPJ H;  3H1L H;  4U3F H;  1KB9 F;  3L71 H;  2FYU H;  1BE3 H;  3L70 H;  1P84 F;  3H1K H;  2IBZ H;  1BCC H;  3L72 H;  1NTZ H;  3L75 H;  4PD4 F;  3TGU H;  1PP9 H;  3CWB H;  3H1H H;  3H1I H;  3BCC H;  1KYO F;  1L0L H;  1SQV H;  1SQX H; 
#chains in the Genus database with same CATH topology
 1TUB A;  2PI5 A;  1IBL O;  1NQT A;  4CC5 A;  2ITD C;  2A06 H;  4J7K A;  1WPX A;  1GAX A;  1XI1 A;  2VQE B;  5KX5 A;  2ZE8 A;  3OE7 G;  1V55 C;  2PYL A;  5K1X A;  1N32 B;  4DO2 A;  3ZHS A;  3ASN C;  3OTF A;  2CTP A;  3CCR V;  2B9Z A;  2CTR A;  2YC0 A;  1WPB A;  3JAT A;  3ZHU A;  3T1C A;  1FFX B;  5KHJ A;  4LWS B;  1V55 B;  2JRI A;  3HKB A;  2Y48 A;  2P22 C;  4O2B B;  2XAS A;  3RWR D;  2GV9 A;  1JJ2 U;  4PA3 A;  5J2T B;  1QLE C;  1RSO B;  2A0L A;  3TCU A;  1NS1 A;  2N04 A;  3RYC A;  1VQK V;  3PN1 A;  4Q20 A;  3QG5 A;  4R7C A;  1VQ5 V;  3IFX A;  2ZM6 O;  4X65 B;  3T4Z A;  5LA6 A;  1NVP D;  4X1Y A;  5KUM A;  3SYQ A;  2VQF B;  5J2U B;  3A8T A;  3W7W A;  5IYC O;  3SJC C;  3JD4 A;  4DR1 B;  1VQO V;  2XHB A;  4XDL A;  3HB3 B;  4U7O A;  3JD2 A;  1URF A;  1B06 A;  4LF8 B;  1EZV H;  2WAM A;  4FPP A;  4JI4 B;  4DUZ B;  4PI0 A;  2Q7G A;  4IHJ B;  3CCE V;  2BOB C;  2F4V B;  1R73 A;  2W6I G;  1L0N H;  3FX7 A;  1VF6 C;  3LDC A;  4DR2 O;  1AR4 A;  3ABM C;  5ITZ B;  4PA4 A;  3AEI A;  4LNU A;  1SET A;  4X64 B;  2DQ0 A;  5JCO C;  4H13 B;  2CGN A;  3VQX A;  1VIB A;  2PGG A;  3L75 H;  3RYI B;  1XMQ B;  4RUE A;  2MK3 A;  1WB8 A;  4DV7 B;  1EM1 A;  2ADP A;  4FLV A;  2GUZ B;  4FIP C;  2VWK A;  5H2F Z;  1S5H C;  4BW5 A;  3ZRX A;  3AG4 C;  4R8C A;  4H44 B;  5L3G A;  3ABU A;  1CXZ B;  3CCM V;  5FNV A;  1JFF A;  4O4L B;  5JWP A;  4PA7 A;  5JJN B;  4MW8 A;  4UCU A;  4ABM A;  2HG5 C;  1S5L Z;  4ZI7 A;  4JF3 A;  2LW7 A;  5J2U A;  1YIT V;  2HVJ C;  1QCE A;  4FJC C;  3ZED A;  2UUA B;  1QBZ A;  2IM9 A;  2HLD G;  2ARH A;  5J9P C;  3E8F A;  4H33 A;  2NNU A;  5C8Y B;  4EFB A;  4ICG A;  2P90 A;  2QWR B;  3BHP A;  4YY3 O;  1SQP H;  4BIO A;  2Q73 A;  2UXX A;  1LR1 A;  3A0H Z;  1S76 D;  4Z1M G;  3L73 H;  3X2Q B;  2CE4 A;  2PF4 E;  2UXD B;  2LFR A;  4L87 A;  2YSU B;  4YXW G;  2Q7H A;  4IIJ B;  1H8H G;  1XUQ A;  2M6Y A;  1H2M A;  4MVQ A;  3OMI B;  4DW0 A;  2WLM A;  3IGA C;  3NXS A;  2WLN A;  4TV9 B;  1AI5 A;  1OCO C;  1V54 C;  4OPH A;  4QPK A;  1AJN A;  4CC6 A;  3Q4H B;  4U3J A;  2EZP A;  4P9O A;  2WLI B;  1XHX A;  3C3S A;  2Q68 A;  1M57 C;  3OTO B;  4U7N A;  4TSF G;  4JV5 O;  1EN4 A;  1N0J A;  4B3T O;  1N33 O;  1SQG A;  3E8G A;  2LQT A;  4K3A A;  5EYP A;  1VP7 A;  3CXH F;  2PY5 A;  2GTS A;  3AG4 B;  3FB8 C;  3ABL B;  4EKW A;  4DV3 O;  3CEI A;  3K0G A;  4L8J A;  3OR7 C;  5KHH A;  3BAB A;  2ZXW B;  1KB9 F;  3ETG A;  5JJJ B;  3JAK B;  1HWY A;  2WLH A;  3F7Y C;  1AVM A;  4LC1 A;  2LP7 A;  4MW3 A;  1Y6X A;  2EIL C;  1KQS U;  4DR7 O;  1HDJ A;  3N2K B;  1GKF A;  4AQY B;  2VWJ A;  3G6B A;  4X20 B;  2OTL V;  2V4D A;  2WWW A;  3S3W A;  2KQX A;  4PEL A;  3RVZ A;  1R1B A;  1KC8 W;  1FKA O;  4QNH B;  5LYJ A;  4ZIB A;  4HNA B;  4OX9 O;  4GX0 A;  3I55 V;  1LUV A;  1RPR A;  1RPO A;  2JGD A;  2R70 A;  1QLN A;  5CB4 B;  4JAU A;  1NZ6 A;  3OT7 A;  4JI1 B;  4LF9 B;  1WA8 B;  2BTO A;  5IJ9 A;  2V1D A;  3QF7 A;  4GZR B;  4MTG A;  4LFA O;  2ZDI C;  1VQ8 V;  4W4L A;  1G8M A;  3SJQ C;  2AHZ A;  4GLX A;  2A7W A;  1YVW A;  3UQ8 A;  1OCZ B;  2A9H A;  4GCZ A;  2F93 B;  4PDR A;  4JI2 O;  3VOU A;  1XOU A;  4UV8 A;  2LJ2 A;  2R72 A;  2OT5 A;  3JYC A;  4LH6 A;  4WBN A;  1BQZ A;  2OYQ A;  2PUS A;  3SJB C;  4WFA V;  3D36 A;  3M99 B;  1IBM O;  4NTX A;  3W7S A;  2JEU A;  4JI5 O;  4MTO A;  1SZT A;  3ZHQ A;  3UM7 A;  2RCV A;  3CMA V;  4PDM A;  2DYS B;  3VBB A;  3RYH B;  2Q8V A;  1XBL A;  4JTC B;  1WN7 A;  3L74 H;  5L3F A;  5LMU O;  1BMF G;  3U11 A;  5CA1 A;  2P7T C;  5LMN O;  4F4L A;  2NN4 A;  3DC6 A;  2JGD B;  1GMG A;  2P67 A;  1OCZ C;  2ETN A;  2YID A;  2W0F C;  4NXN B;  2CTW A;  4D7T A;  2ZNI A;  1UFI A;  3TXS A;  1HR0 O;  4UB6 Z;  5LYJ B;  4DR5 O;  1K97 A;  4IL6 Z;  5LP6 B;  4ZHQ A;  3UT5 A;  4K0K B;  4R50 A;  1NR7 A;  3TK1 A;  4XDJ A;  1YHQ V;  2AXT Z;  5B3S B;  1DTO A;  1R6T A;  1RP3 B;  2WLJ A;  4O2A A;  2Y4U A;  4J7J A;  3GVM A;  1N32 O;  3JSN A;  2L6L A;  3CC7 V;  4I50 A;  2WPD G;  1VQ7 V;  1Z5W A;  3R66 A;  1BS3 A;  1D5A A;  3X2Q C;  5AG2 A;  4CS4 A;  3CRM A;  3FB5 C;  3SR2 C;  3SPC A;  1J5E B;  2K1E A;  2JJ1 G;  3E35 A;  1VMG A;  3DXR A;  3KZI Z;  1SS3 A;  2N74 A;  4GKK B;  1PL0 A;  2ZR2 A;  1P49 A;  5KHI A;  1SQF A;  3K79 A;  1IZ3 A;  3ABL C;  4JZG A;  1XEQ A;  4QE7 A;  2F1M A;  1BCC H;  1AB3 A;  3RYF A;  4X62 O;  4DR3 B;  3OEE G;  2H8P C;  4B7E A;  2QJ1 A;  5KAI Z;  2F66 C;  1U97 A;  1M56 B;  1PNL A;  1M57 B;  5H5N A;  1Y74 A;  2YIB D;  5CN0 A;  4UCO A;  2DWD C;  4DR4 O;  1KKD A;  2OCH A;  5FLX N;  5LA6 B;  5LHH A;  4IIJ A;  3P32 A;  5LGT A;  4LF5 B;  3UCS C;  2DQ3 A;  2EJ7 A;  4LBE C;  1COW G;  5JCO A;  3G6E V;  1HR0 B;  3S3X A;  2QM8 A;  3AK3 A;  1R6N A;  1K4C C;  1MSD A;  3M8A A;  5J2T A;  1YJ9 V;  2QKS A;  3AK1 A;  3LUT B;  1H2L A;  1GN2 A;  1UJW B;  3T1H O;  4ZBM A;  4FLX A;  5LP6 A;  2FB5 A;  1XQ8 A;  1VQ9 V;  1TVK A;  4X64 O;  4UCT A;  4CH5 A;  4EFE A;  1VQ6 V;  4BW9 A;  4AIL C;  4JAS A;  4DV4 O;  2Y4T A;  4H0L B;  2ATK C;  1N8R W;  1VQ4 V;  5IWA O;  2LGW A;  1XRE A;  4MTF A;  4LF8 O;  3MHH C;  5L3B A;  5L3E A;  4LFB B;  1IUR A;  1H2G A;  4WFH A;  2EJR A;  2E5L O;  1Q43 A;  3IJ4 A;  2DOS A;  3OMA B;  1N36 B;  3JSL A;  5B3S C;  2UXN A;  3RN4 A;  1HP8 A;  3OMN B;  3T1H B;  2IBZ H;  2IH3 C;  3L72 H;  3JAR A;  4GYC B;  2AW9 A;  1PV0 A;  1HNW B;  2OWO A;  1AI7 A;  1E1Q G;  1WA8 A;  4JI5 B;  2Q4P A;  1MA1 A;  5IYZ A;  2EZO A;  5D5Q A;  1O9H A;  4IHJ A;  5EBL C;  1I5X A;  5EC2 C;  1KP2 A;  4IYH A;  1QU7 A;  5CB4 A;  1TGO A;  3HKD B;  4JI7 B;  2YI9 A;  4RAI A;  4LF7 O;  2JK5 C;  3M7M X;  1V9P A;  1ZSP A;  4I7Z B;  1SQV H;  2CK3 G;  4FFK A;  2X6A A;  2X7R B;  4K8X A;  4BWA A;  1BGY H;  3SJA C;  4MT8 A;  3E22 B;  3E22 A;  3OW2 U;  3U0Z A;  2Q69 A;  3KCY A;  4X20 A;  4O4L A;  3ZMV A;  3I5D A;  4LF4 O;  2BTQ A;  1SQX H;  1K7D A;  4UVC A;  4E4E A;  1F7Y A;  4WFF A;  1QVG U;  4HAM A;  1WLE A;  1OCR C;  3H1J H;  1WP7 A;  2KG7 A;  4NB5 A;  3QVN A;  2GSM B;  2B1G A;  3ABT A;  3CME V;  4TUY A;  1FFX A;  1JA8 A;  2WA4 A;  3EVK A;  3STZ C;  1XDC A;  2HP8 A;  4WF9 V;  3CWB H;  5A2Q N;  5CA3 A;  1KMI Z;  1NJI W;  3SYP A;  1RM1 C;  1JX9 A;  2OIE A;  4JI4 O;  1NH2 B;  2QWQ B;  4LFA B;  3DC5 A;  4HBN A;  4AI8 A;  4JYB A;  4JZ2 A;  1GN6 A;  3J81 N;  2HHH B;  5JVD B;  5KHG A;  5GTH Z;  2XAG A;  2ZQM A;  4DV6 O;  1P84 F;  5CA0 A;  3E86 A;  3LSQ A;  1X4T A;  1P7G A;  5BR8 B;  2ZCE A;  1OCR B;  3ASO C;  1Q3E A;  1KKC A;  3MD0 A;  3QO7 A;  5IJ0 B;  3CCJ V;  4UCS A;  5KA5 A;  1AIL A;  3K06 A;  1B3Q A;  2O57 A;  2JVD A;  3K5N A;  3WU2 Z;  3JAL A;  3N2G B;  4NXM O;  3H01 A;  1XMQ O;  3AK2 A;  3WFV A;  4GKJ O;  1PNK A;  1ZL8 B;  4YIP A;  4JI7 O;  3N27 A;  4EB6 B;  4UV9 A;  2P6J A;  1NH2 D;  3K3W A;  3IAY A;  5DN6 G;  1M5I A;  5F2V O;  3LDE A;  1N34 O;  4QPJ A;  1GRJ A;  2GTA A;  4G27 B;  1MSW D;  4TV8 B;  1E1R G;  1VAR A;  1L1F A;  4F6R B;  3D8C A;  2QDO A;  1PD3 A;  2YXH A;  3UO2 A;  1YI2 V;  5B1B B;  5IY5 B;  4EB6 A;  1NTZ H;  1FXH A;  2DYR B;  1QR9 A;  4LFC B;  2Q0O C;  1OJH A;  3E8B A;  1Y76 B;  2ZIO A;  4DRX B;  5IY5 C;  3CD6 V;  4P2Z A;  3SYC A;  3CYO A;  1EN6 A;  1SQQ H;  4X9Q A;  1M4U A;  2RJZ A;  4B3M O;  4Z2W A;  4NKG B;  2YXY A;  2FTK A;  5IWA B;  2EIL B;  4LF5 O;  3F5W C;  3B77 A;  3OUF A;  2CGO A;  2E3C A;  4CH6 A;  3ZS8 C;  2ZXW C;  4JYC A;  4DV6 B;  1O9G A;  4RWU A;  4GX2 A;  1PKX A;  1PL4 A;  3RYI A;  1FFT B;  3ZBH A;  2GBO A;  5EK0 A;  1YF2 A;  4J80 A;  3MDS A;  3F5T A;  5CA0 B;  5GON A;  4O4J A;  4DUY O;  5BZB A;  4GT1 A;  2Q9L A;  5ITZ A;  4PA9 A;  4JTD B;  2AGA A;  3ZRS A;  3BCC H;  2QE7 G;  1AI6 A;  2BE3 A;  3G4S V;  2PTM A;  2WLL B;  3A0B Z;  2KG7 B;  2ILM A;  2Q5Z A;  2D3O W;  1H38 A;  4DV0 O;  3ZMZ A;  2FL4 A;  4YJ2 B;  2WLK A;  4TUY B;  3CCQ V;  2EUL A;  1OCO B;  1K33 A;  1MNG A;  2Y0I A;  5LOV B;  1BZK A;  1GM7 A;  1SES A;  2Q0A A;  3ZMU A;  1G1X B;  1F4N A;  4YHH O;  1S3J A;  5FL7 G;  1WB7 A;  5EZY A;  4ZI7 B;  2W0X A;  2YEV A;  3K5L A;  1A32 A;  1R6K A;  1HNZ B;  3B09 A;  3QTC A;  3KG2 A;  5CBF A;  1SC5 B;  2F4V O;  2DYS C;  1K9M W;  1SA0 B;  1UPG A;  3EHB B;  5B1N A;  1KP3 A;  2ZR3 A;  2EX3 A;  4JYA B;  3FB7 C;  4UCV A;  2ITC C;  2UUC O;  1R3I C;  4B7K A;  2RNB A;  4DV7 O;  2KSD A;  3AG1 C;  3ZHV A;  3W7T A;  4DV5 B;  1H2N A;  1ZX3 A;  1XNQ B;  2VS0 A;  4JI1 O;  3QO5 A;  1VQP V;  1L0L H;  1IXM A;  4HZ3 A;  4QGP A;  4EEQ A;  1IBK O;  5KUK A;  1XMO O;  3CRC A;  1Q8I A;  3OFN G;  3ZJZ A;  3O9O A;  1BSM A;  2JEX A;  1B6Q A;  1DF5 A;  1YEW A;  2DMX A;  4X8A A;  4PD4 F;  3ABK C;  2KKW A;  2QR4 A;  4FLT A;  2XAQ A;  5KLV H;  1Z5V A;  5LHG A;  1BHB A;  1KBH A;  3AG3 C;  1YXB A;  3HR0 A;  5BXZ A;  4ZKI A;  4X66 O;  5H6R A;  4LCU C;  2YI8 A;  1GM9 A;  2IJK A;  4RQF A;  1GK9 A;  2DN9 A;  4B3T B;  1YTF D;  5BMV B;  3WB2 A;  2P4K A;  2DWE C;  4FLW A;  4DR6 O;  5B66 Z;  5JJE B;  3WG7 C;  3ETE A;  4PA6 A;  2E76 B;  4JI3 B;  3E8H A;  2G38 A;  1NT2 B;  5EZY B;  2JS5 A;  3ML0 A;  1CPY A;  3ZHT A;  2UXC B;  4C7U A;  4DW1 A;  3N2K A;  3K58 A;  1WNS A;  1NR1 A;  1SKV A;  2GUZ A;  5EYP B;  5C93 A;  5EIB D;  4JI6 B;  1P7B A;  4NVP A;  1GM8 A;  2EIM B;  4WFG A;  2FYU H;  1K5S A;  5TIS Z;  2Y0P A;  4R6Z A;  5B5E Z;  5LOV A;  4JAA A;  2DYR C;  4OGQ B;  4YJ3 A;  1YJN V;  1TUE B;  5FNV B;  2HKO A;  1FJG O;  3FYE B;  5CA1 B;  2AZ0 A;  4GKJ B;  1EN5 A;  4DR1 O;  1KYO F;  3MAQ A;  3CJH B;  4LH7 A;  1S0V A;  2XND G;  3VQY A;  3FKS G;  3CCL V;  4MVU A;  4X1K B;  1QHT A;  4CS3 A;  1H2S B;  1IBK B;  1IX9 A;  1MG1 A;  1Q90 D;  2QWN B;  3FAV A;  3OM3 B;  5JH7 A;  3FAV B;  5JH7 B;  1AJQ A;  2HFE C;  2FML A;  4KP4 A;  1GTO A;  4DUZ O;  3APO A;  5HFM A;  3J7A U;  2ZE6 A;  2BSK B;  4B3S O;  1JVM A;  2E74 B;  4PDV A;  3JAW B;  1JPX A;  1F23 A;  2C2A A;  4FM2 A;  2GDS A;  2XTA A;  3RFR A;  2ZE7 A;  3CRQ A;  4X62 B;  4DR2 B;  1YZB A;  2V7Q G;  5LXT B;  2ZKO A;  3ZCC A;  5FPO A;  3LNM B;  2Y69 C;  4I4T B;  4DV1 O;  2W6J G;  4G28 B;  3ETD A;  5LGN A;  1FXK B;  1T5E A;  3UT5 B;  5IDJ A;  4UB8 Z;  3K08 A;  4CH3 A;  3L70 H;  4I5S A;  3A2F A;  4UVA A;  4NXN O;  2QTS A;  3DTU B;  4MVZ A;  3H1H H;  1AJP A;  1Q7Y W;  4J7Z A;  5BY1 A;  4BIU A;  4FLU A;  1AP5 A;  2AHY A;  2UUB B;  1SER A;  4IT5 A;  1FPO A;  3O65 A;  1S72 V;  3ZRV A;  3GWO A;  3APQ A;  1JCH A;  3FD9 A;  4E2L A;  1HNW O;  1I5Y A;  2YIB A;  2VQE O;  1K5Q A;  3JAL B;  1IDS A;  2EBO A;  1FJG B;  4J41 A;  1FYJ A;  3JAW A;  1WP8 A;  5CBG A;  2RQ6 A;  4U3J B;  5L3D A;  1N33 B;  4YHH B;  2EIK C;  4OXS A;  3W7U A;  4TQD A;  5H9C A;  3B4S A;  4I9W A;  4PV1 B;  1S5J A;  4I0X A;  1SF9 A;  1GO3 F;  2CAZ C;  2ZE5 A;  1J5E O;  2P06 A;  1I0H A;  4X1K A;  1M9N A;  3BVO A;  1L8D A;  3JCU Z;  2B1I A;  4TV9 A;  3RW0 A;  4BR6 A;  5HFL A;  5B1A B;  2BTQ B;  2QM4 A;  2UU9 O;  2YIC A;  3T4D A;  3EFF K;  3BRC A;  3T2M A;  1H2K A;  3CE2 A;  1R3L C;  1ORQ C;  5L3C A;  4HNA A;  2X6B A;  1G4Y B;  4B3M B;  2CH7 A;  3ZX6 A;  3RVY A;  2ZM6 B;  4Z1V A;  3ZMT A;  4JPR A;  4P30 A;  4FFB B;  4FFB A;  3F7V C;  4N23 A;  1R3J C;  4GX5 A;  1RM1 B;  1N34 B;  4QJF B;  5B1O A;  4DV3 B;  1ZWI C;  4LF6 B;  4J11 A;  2HR3 A;  4UXN A;  4DK0 A;  1OV9 A;  3HKD A;  1R3K C;  5CBH A;  2EIK B;  3CRA A;  4WCE V;  2QA4 V;  3JAT B;  4MVR A;  4PHZ A;  4YJ2 A;  1K8A W;  3SGI A;  1QNM A;  4I55 A;  2ZIM A;  1OCC C;  1Q6I A;  3RYH A;  1Y74 B;  4FZ0 A;  4DUY B;  1NTM H;  1IBL B;  2Q67 A;  2QEX V;  1FAF A;  3ABM B;  3T1Y O;  4JGS A;  1JFF B;  1KU9 A;  4LF4 B;  3ZRW A;  5KMG B;  2H94 A;  3GWK C;  4KUM A;  2QTO A;  1OCC B;  4DV0 B;  1JQ0 A;  5KHK A;  3IC9 A;  3AG2 B;  3RT3 C;  2YXL A;  1BT8 A;  2OIG A;  5IJ0 A;  1K92 A;  2ZIN A;  2IJH A;  1EZJ A;  3DXR B;  1B04 A;  1TUB B;  3P30 A;  5E1A C;  3JAR B;  4FVM A;  4TWK A;  5LBQ A;  1BL8 A;  4IYI A;  3W7X A;  3CSX A;  3OR6 C;  3G71 V;  1NKD A;  4J9Y B;  3TGU H;  5JQG B;  3ETQ A;  1YIJ V;  1VF7 A;  1HNZ O;  3LSU A;  1THZ A;  3AG3 B;  4B3R B;  1D2D A;  1YTF B;  4O4I B;  1Y76 A;  3SPH A;  2XT9 A;  4KXR A;  4J42 A;  3AG2 C;  2Z3Y A;  4CH4 A;  4JTA B;  4UUJ C;  2UU9 B;  3D3I A;  4FM1 A;  1Q6U A;  2UUC B;  1DK1 A;  1U96 A;  2CUG A;  2A79 B;  3FB6 C;  4MTX A;  1BHA A;  4I9Q A;  1MZE A;  3CX5 F;  3B40 A;  3BY6 A;  2Z5U A;  4DK1 A;  4ZHQ B;  3ASO B;  3K9S A;  1XNQ O;  2CH7 B;  1M90 W;  2HHH O;  1W0J G;  1RSO A;  2R9A A;  1H8E G;  1GN3 A;  3MHS C;  3CCU V;  1XL6 A;  1Q81 W;  4XDK A;  2UXB B;  4D7S A;  1PM9 A;  3HKC A;  4NXM B;  4CS2 A;  4DR5 B;  2YS8 A;  2RMK B;  2QGN A;  4K8Z A;  4MVS A;  1XIL A;  4TQF A;  4NTY A;  4DR3 O;  1XNR O;  3TJT A;  4N21 A;  1OZ0 A;  2PYJ A;  1NBM G;  3ZMS A;  3JD3 A;  1VQN V;  2DJV A;  3G80 A;  1Y67 A;  3JD1 A;  3RYF B;  3SPJ A;  4DR4 B;  2IH1 C;  3C3T A;  1ZTE A;  2ZDI A;  4GX1 A;  4MSW C;  3BPZ A;  1EFR G;  3E83 A;  1W59 A;  3B8N A;  4GKK O;  2XAF A;  3K59 A;  4WBN B;  3WG7 B;  5IJ9 B;  5FPR A;  4KHP O;  3ASN B;  4JI0 O;  2ZT9 B;  2BCC H;  1M56 C;  3ZRW B;  5KMG A;  5DM6 V;  1VF6 A;  3CCS V;  3UO3 A;  5CMU A;  1HNX B;  4I50 B;  3HKE B;  1DGS A;  5KA6 A;  2WA3 A;  4J9Z B;  3JD0 A;  3UKM A;  3K57 A;  5IYD O;  2PI4 A;  1JMK C;  3DSQ A;  3RYC B;  3K5M A;  4FMT A;  1FXK A;  1I08 A;  4YIO A;  4DRX A;  4JI6 O;  1I94 B;  3RBZ A;  3K9A A;  2Q7E A;  4TOI A;  1M1K W;  5DED A;  3U10 A;  2L35 A;  4MVM A;  3DGE A;  5EBW C;  1QQC A;  2XAH A;  4LF6 O;  2HJD A;  1AR5 A;  1YJW V;  2XOK G;  4LWS A;  4O4H A;  1K4D C;  1CP9 A;  2VRZ A;  4LFB O;  3ZN0 A;  3QNE A;  1HW7 A;  1QLE B;  4LP8 A;  1SRY A;  3IC7 A;  2LO1 A;  1W2B U;  2E5L B;  2UXB O;  3HKB B;  5BMV A;  4MVO A;  2DW4 A;  2YUA A;  1TA8 A;  2D2C B;  5E79 Z;  3RGB A;  3N2G A;  4O4J B;  1G6U A;  2RN9 A;  3PJS K;  4DV4 B;  4PDL A;  1I7F A;  1XL4 A;  4JV5 B;  2F95 B;  4AQY O;  3OUS A;  2ADQ B;  4X89 A;  2WLL A;  1K34 A;  2QM7 A;  2BSK A;  2QKA A;  2QKC A;  4D6T H;  4I0X B;  3BA9 A;  1DLB A;  3H1K H;  3L9D A;  3AG7 A;  2HJF C;  4X1I B;  5D5P A;  1KEC A;  4CBC A;  1X59 A;  4A5U B;  1F51 A;  2M7W A;  2DE0 X;  4B08 A;  4KL1 A;  1N36 O;  1GH6 A;  4LF9 O;  2R9R B;  3D3Q A;  4JAV A;  1Q5O A;  3A0R A;  4NR1 A;  1Q6H A;  1TAE A;  2WSS G;  2IU3 A;  1BQ0 A;  3CC2 V;  3E2E A;  2BOC C;  1HNX O;  1ENV A;  1LNQ A;  5K1P A;  3C90 A;  4FLY A;  1Q82 W;  1US6 A;  2UXC O;  2A3Q A;  4DV5 O;  4I55 B;  4RUF A;  4X65 O;  4O2A B;  5DEC A;  1JJO A;  3ZHR A;  1KUQ A;  4WFE A;  4O4H B;  4W4K A;  2VQF O;  1PNM A;  5EC1 C;  1SQB H;  3ABK B;  1FXV A;  1JR9 A;  3LNN A;  1XMO B;  2OCC B;  1TVK B;  3BAA A;  2IJI A;  4U3F H;  3L71 H;  2LW1 A;  1IXB A;  2F23 A;  4UFZ A;  5EBM C;  3R65 A;  4DR6 B;  4MS2 A;  1MAB G;  2GHY A;  3WB1 A;  1M93 A;  2R9I A;  1VQM V;  4DYL A;  1QVF U;  1Y66 A;  4OPA A;  2F43 G;  4DXW A;  4BIZ A;  1F4M A;  4JI3 O;  3GB7 C;  5IYZ B;  3P3N A;  3SYA A;  1S77 D;  5IYB O;  1FS0 G;  3LDD A;  2LFS A;  5BR8 O;  3OEH G;  3HKE A;  2HVK C;  5JQG A;  3AG1 B;  4UVB A;  4FM0 A;  3JAM N;  1WAZ A;  4B3S B;  1WJZ A;  2ZNJ A;  2FKX A;  2JGU A;  3EXA A;  2EIN B;  5GTI Z;  4OX9 B;  1VF5 B;  2UUA O;  2EIJ C;  1JOY A;  4JYY A;  4BAY A;  3K0D A;  5EIB C;  4JI8 O;  3FYI B;  4FZ1 A;  1OHH G;  4YY3 B;  1XNR B;  1NTK H;  1K3E A;  2X0L A;  3ICX A;  5LHI A;  4KFM A;  1SZX A;  3OTO O;  1AP6 A;  3QO8 A;  1BE3 H;  4UCR A;  2UXD O;  4LR3 A;  2ZD9 A;  5JVD A;  1RFY A;  1AR1 B;  4ZOL A;  1PP9 H;  3Q4H A;  4PI2 A;  4WFB V;  3CJH A;  4FK5 C;  3CS5 A;  2NLJ C;  4NTW A;  4HYO A;  3TET A;  5C8Y A;  2ODM A;  3THO A;  1YCI A;  4DV2 B;  2H3O A;  2YIA A;  1N0N A;  4J10 A;  1QR8 A;  4JYA O;  5B1A C;  3CHX A;  4K0K O;  4F6E A;  4TV8 A;  3CRR A;  2KB1 A;  4AHC A;  1V54 B;  2EIJ B;  3P3P A;  2EIN C;  3H9V A;  2JS3 A;  3BFR A;  2Z0A A;  3CCV V;  2YEV B;  4DV1 B;  3VQW A;  1Q86 W;  1YSC A;  2PZS A;  4IGG A;  4LF7 B;  3OD4 A;  1ZAU A;  4I4T A;  1N4C A;  1ZUQ A;  4O2B A;  3OGI B;  2P4V A;  2XAJ A;  4XBF A;  5KAF Z;  2YDE A;  1ARO P;  1DF4 A;  1YDX A;  4ZOL B;  4DR7 B;  1LUW A;  3T1Y B;  4G2K A;  2IU0 A;  3TXQ A;  4Q6G A;  4TT3 G;  1NI8 A;  2K9P A;  1IVS A;  2XUM A;  4LNU B;  5H6Q A;  3WB0 A;  1E79 G;  4QE9 A;  2OCC C;  3NR7 A;  2RDC A;  4LFC O;  4X66 B;  2HEP A;  2JIZ G;  3JAS A;  3JAS B;  2E75 B;  4JI8 B;  3FFQ A;  1NU1 H;  2EIM C;  3SPI A;  1K73 W;  1PPJ H;  3H1L H;  4X1I A;  5GON B;  2LGQ A;  4ASU G;  1EBO A;  1W0K G;  5IT9 N;  2N05 A;  2WLI A;  1D5N A;  2P5O A;  1Y4M A;  5A9G A;  3B8M A;  4PJ0 Z;  2QWP B;  3E89 A;  1ROP A;  3CP1 A;  5LGU A;  1MMM A;  2IJJ A;  2IW5 A;  2QWO B;  5GW7 A;  3CC4 V;  3KKY A;  2Y69 B;  3ZN1 A;  2JJ2 G;  3K04 A;  3JCZ A;  3LSS A;  1KD1 W;  4DV2 O;  1MOF A;  5LL6 Y;  2UUB O;  3HKC B;  4YJ3 B;  1GN4 A;  4X88 A;  2QSA A;  1ZLZ A;  4P9P A;  3BA8 A;  3CB2 A;  3OAA G;  4GUN A;  3VQV A;  2B5U A;  3OGC C;  3CPW U;  3BEH A;  4NYK A;  1J95 A;  2MW2 B;  1CEZ A;  3B2E E;  2NR5 A;  3STL C;  4F6R A;  2CTQ A;  1SA0 A;  1AI4 A;  4X1Y B;  1VEW A;  3G67 A;  2Q6A A;  1Z2G A;  5IE9 A;  3K03 A;  1XHZ A;  5LMU B;  1VQL V;  4RQE A;  2JDI G;  1P4R A;  1NVP B;  1ZL8 A;  3HPL C;  3SYO A;  3SPG A;  3KCX A;  3JAK A;  4RO2 A;  4FLZ A;  1I94 O;  2AZ2 A;  3ZIA G;  4O4I A;  3CXC U;  4JI2 B;  5B1B C;  5LMN B;  4H37 A;  3D36 C;  4K35 A;  1FXK C;  4QIW F;  5LXT A;  4JI0 B;  1MZF A;  1FD9 A;  2CDY A;  5LP6 C;  3J80 N;  2X6C A;  5KX5 B;  1IBM B;  3K5O A;  2OTJ V;  4CZZ A;  3H1I H;  4KHP B;  3I56 V;  4B3R O;  3SDL A; 
#chains in the Genus database with same CATH homology
 5KLV H;  1SQP H;  3CXH F;  3CX5 F;  3L74 H;  1L0N H;  3H1J H;  3L73 H;  1SQQ H;  1SQB H;  1NTK H;  2BCC H;  1NU1 H;  4D6T H;  1BGY H;  1EZV H;  1NTM H;  2A06 H;  1PPJ H;  3H1L H;  4U3F H;  1KB9 F;  3L71 H;  2FYU H;  1BE3 H;  3L70 H;  1P84 F;  3H1K H;  2IBZ H;  1BCC H;  3L72 H;  1NTZ H;  3L75 H;  4PD4 F;  3TGU H;  1PP9 H;  3CWB H;  3H1H H;  3H1I H;  3BCC H;  1KYO F;  1L0L H;  1SQV H;  1SQX H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...