3H1KH

Chicken cytochrome bc1 complex with zn++ and an iodinated derivative of kresoxim-methyl bound
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
69
Chain Sequence
EEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic location of two Zn(2+)-binding sites in the avian cytochrome bc(1) complex
pubmed rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 20
structure length 69
sequence length 69
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3h1kH00
1L0NH 1PP9H 4U3FH 3TGUH 3L71H 3CXHF 3CWBH 1SQBH 4D6TH 2IBZH 3H1LH 3L75H 1PPJH 2FYUH 1NU1H 1L0LH 3H1IH 5KLVH 1SQVH 3L73H 3CX5F 1NTKH 1KB9F 3H1HH 3BCCH 3H1KH 4PD4F 1BCCH 3H1JH 1SQPH 3L74H 1NTZH 1KYOF 1EZVH 1BE3H 1P84F 3L70H 2BCCH 1SQXH 3L72H 1BGYH 1SQQH 2A06H 1NTMH
chains in the Genus database with same CATH superfamily
4FM1A 2AZ2A 5B5EZ 3K0DA 2QJ1A 1QNMA 2W6JG 1L0LH 1R6TA 4IIJA 5IYBO 4PDVA 1YSCA 2B1GA 3VOUA 2CE4A 2YI8A 3AG2B 3IAYA 1VMGA 3RGBA 4KL1A 1K97A 2DYRC 4JI3O 1AP5A 4LP8A 2JIZG 2AZ0A 2CTPA 2OWOA 1RP3B 3ZEDA 3U11A 3K58A 4LFAO 2QDOA 5LXTA 1PPJH 3U0ZA 1NU1H 4LNUB 2Q0AA 4J41A 4TSFG 3SYPA 4WFBV 4I4TA 3CCUV 4GX2A 1XDCA 3PJSK 1V55B 1PD3A 5LP6B 4FM0A 3R66A 1TVKB 3OT7A 2HR3A 3JAKB 4DR3B 1OJHA 4UVAA 3FFQA 1N34B 2JEUA 1NT2B 3L9DA 5CN0A 2QGNA 1UFIA 2F4VB 1R3JC 2QWPB 1V55C 4AILC 1YIJV 2QKAA 2QWNB 1US6A 2OT5A 1K33A 4JI5O 4DRXA 3P3PA 1JR9A 1YTFB 2ZXWB 4DR7O 2Q73A 5BR8O 2DYSB 2GDSA 4DV2B 4NR1A 2ZDIA 1AI6A 1S77D 5BR8B 2EIKB 3BA8A 1F4MA 2EJRA 4MTOA 2LJ2A 4EEQA 3K57A 2KB1A 1VQNV 2YS8A 1XHZA 3JD0A 2UUBB 1XI1A 4RUEA 3OR6C 4I0XB 1NJIW 3ABLB 5FL7G 1N34O 5KX5B 1VF6A 5EBWC 2OCCB 1K5QA 1QHTA 1THZA 2A79B 3B77A 2N04A 3T2MA 1H38A 3HKBA 3L75H 1I5YA 3CPWU 3K59A 1XQ8A 2M7WA 4PHZA 2EZPA 2EILB 1IXBA 2WLHA 5H6RA 4LR3A 3B8NA 1ZUQA 1JQ0A 5JQGB 3AG4B 2GSMB 3X2QC 4LF4B 1PV0A 4MW3A 1WN7A 1GO3F 2Q8VA 3RT3C 4LWSA 2RNBA 4FLXA 3FYEB 1GMGA 3AG3C 4I9WA 1Q3EA 4GX0A 3DGEA 1TVKA 4NXMB 2GBOA 2F93B 1XNRO 5LMUO 5IYZB 5EZYA 1YZBA 1YCIA 3W7XA 3CC7V 5B3SC 4DR4B 3MDSA 2WLLA 3SPCA 3SGIA 1URFA 1KP3A 1N33B 3P3NA 1XUQA 2LGQA 4L8JA 1NTZH 4CS3A 3E8BA 5IY5B 3Q4HB 2MK3A 4RQEA 1WA8A 3ZBHA 5KHJA 1XHXA 2WA3A 5JCOA 4TOIA 3JARB 5B1OA 1ORQC 3BFRA 4LCUC 3BCCH 4JYAB 1RPRA 3H1JH 3ZX6A 1XMOO 1OCZC 3ZHVA 2AW9A 2IW5A 3RYHA 3JCUZ 5LHIA 1JFFA 4X66O 1JJOA 4I4TB 1H2LA 1OZ0A 2EINB 3CSXA 3ZRXA 2OIGA 1Q6UA 2OTJV 2GUZA 2ZIOA 2LW7A 1ZAUA 4ZOLA 2QWRB 2Q5ZA 3L73H 3RYCB 2YXLA 2RDCA 5D5QA 4JI1B 5JQGA 1K4DC 1P49A 3LDEA 2BTQB 1FFXA 4HNAB 4R8CA 3CCRV 3M7MX 4Z2WA 4I55B 4J9ZB 5CA1A 4I50B 1K4CC 4UUJC 1PP9H 5A2QN 5JJJB 1Y6XA 3K06A 1MSDA 3CEIA 1H8HG 5CA0A 2KG7B 3SPHA 2IJKA 3T1CA 3OMAB 4NXMO 1VQLV 4YIOA 2Y4UA 1SRYA 1V9PA 3J81N 2UXCB 1DTOA 4I0XA 3GWKC 2JS5A 3BABA 4JI8B 2Y69C 2YEVB 4LF4O 5C8YA 1U97A 5GTIZ 3BAAA 5L3CA 4UV9A 3ZRVA 4IYIA 1HDJA 4CS2A 2YIAA 5JWPA 2VRZA 5L3GA 4R6ZA 2EX3A 2X6CA 2LGWA 1N0NA 1RPOA 1P7GA 3L71H 1S3JA 5J9PC 4O4LB 3ABMC 2GHYA 4IL6Z 5H9CA 2HP8A 4NVPA 1XBLA 4U7OA 2XAFA 3H1HH 5JJEB 2Y4TA 2BCCH 2W0XA 3MHHC 3CXCU 2ZDIC 3KKYA 1H2GA 2FYUH 3G6EV 2VQEO 2DWEC 4JF3A 2P5OA 3TCUA 4FIPC 2P4VA 5L3BA 1PNLA 1Y74A 1QQCA 5FNVB 4TT3G 1Q90D 4FM2A 2CTRA 1SQGA 3FB5C 1A32A 1KYOF 1AJPA 3ZN0A 1GRJA 5EK0A 4JI5B 1SS3A 3H9VA 4WF9V 3CMAV 1T5EA 3CCLV 1G1XB 3JASB 1XEQA 4GUNA 3J7AU 2JVDA 3ETEA 3JAMN 4WBNB 1VQ7V 3LSQA 2A7WA 3A2FA 4NXNB 4DR3O 1K34A 4I9QA 1VF6C 3ASOC 3W7TA 2UUCB 1CP9A 2XT9A 5J2UA 2Q68A 5EIBC 3SDLA 2R72A 1R73A 1HNXB 2EIKC 3QTCA 4JASA 1KKDA 3CCEV 2VWJA 2AHZA 3OD4A 3QG5A 1GN2A 4DV6O 4WBNA 2Q4PA 4KUMA 3QO5A 2HHHO 1MOFA 3K0GA 4PI2A 1YDXA 5BY1A 5C93A 2Z3YA 4XDJA 2HHHB 1XILA 3TXSA 1WP8A 4JZ2A 3N2KA 3OMIB 5JJNB 3VBBA 1RFYA 1HNXO 4QPJA 3JALA 2EIMC 1AJNA 1G4YB 2P67A 1KUQA 3K79A 3WU2Z 4IGGA 1ZL8B 5IJ9A 2UUCO 3D8CA 3QNEA 4FMTA 5JCOC 4B3MB 4X1KA 2ODMA 2WPDG 2DOSA 2EIJB 3B2EE 1KC8W 2RMKB 2EIMB 2DYRB 1WB7A 2QM7A 1SQPH 3CCQV 4ZBMA 3JASA 1EZVH 2DMXA 1HNWB 4NB5A 1ZWIC 4X20B 4GZRB 2YI9A 1VQKV 3EVKA 1H2MA 4IT5A 3VQVA 3ABKB 4WFAV 1KMIZ 1SQBH 3B09A 5ITZA 4LBEC 1OCCC 3F7VC 4GT1A 5K1XA 1J5EO 4JTAB 3ML0A 3L74H 1R6NA 1FXKC 1FXKA 3L70H 1RM1C 2WWWA 1XL6A 4U3JB 3K3WA 4ASUG 4H13B 3C90A 4DV3O 3ZMSA 5K1PA 2CGOA 4UCUA 4MVRA 1JVMA 1GM8A 2R70A 1BCCH 3CC4V 2WA4A 1JCHA 1B6QA 3JD1A 3LNMB 4UCTA 4JTDB 4CH5A 3AK3A 3K5NA 1D2DA 3D3QA 4E4EA 4B3RO 5FNVA 2H8PC 2OIEA 1EM1A 1RSOA 2R9IA 4RWUA 3WG7B 2JK5C 2EJ7A 4U7NA 2KKWA 4QGPA 4YY3B 2QWOB 2XHBA 2OCCC 2RJZA 4RQFA 1OCOB 4ZOLB 1SC5B 4JI8O 5IE9A 3SPIA 5JVDB 2UXCO 1GTOA 5B1NA 2FKXA 1NTMH 4LF5B 1GN6A 5H6QA 1M57B 5CA1B 3G71V 3CXHF 2XNDG 4MTGA 1K3EA 5LP6A 3AG1B 4CS4A 3LSSA 3ZN1A 4CZZA 2PZSA 3ASNB 4AI8A 4B3TB 4LF8B 3H1IH 5IYCO 1IXMA 4O2AA 5LHHA 2WSSG 1W2BU 5B1BC 2ADQB 5CBGA 4TUYA 4MT8A 1QLEC 4BIZA 4DR5B 4LH6A 3E89A 5LYJA 4YJ2A 1YVWA 3ZS8C 4BR6A 4DR6B 1AR4A 3LUTB 1BHAA 4HYOA 2UXDB 3N2KB 3UO2A 2BOCC 4O2AB 1I5XA 1MZEA 4JI7B 1M57C 2VQFB 2DN9A 1R3LC 5KAFZ 2NLJC 2X7RB 4WFGA 3I56V 4DV7O 3RYIA 1JJ2U 5KAIZ 4YXWG 4F4LA 3FB8C 3ZRWB 3ZMVA 1OCOC 1Y4MA 4UCRA 1KBHA 3UM7A 3AK2A 4R50A 3R65A 4J10A 4B7KA 3HKEB 3CS5A 3APQA 3SPGA 2N74A 3E83A 2WLIA 4DW1A 1AB3A 4O4JB 4XDLA 3AG7A 3E8GA 4LF7O 2LO1A 1OV9A 2YXHA 4TV8A 4B3SB 2CTQA 5CA3A 3J80N 3O9OA 3WB0A 1M9NA 2H94A 1Q6HA 1Q82W 3F5WC 4EB6B 3CCJV 4Z1VA 4FVMA 1BE3H 4TQDA 3CRAA 3FAVB 4X1YB 4EKWA 2QR4A 4NYKA 2QKCA 1XNRB 4X65O 4LF6O 4ZHQA 2WLNA 2MW2B 5KA5A 1ENVA 4LFBB 3JATA 3S3XA 5LMNB 1O9HA 4E2LA 2ZM6O 5EBMC 3ZMZA 3CMEV 1OCZB 1LNQA 4WFFA 3QO8A 2E3CA 1P84F 3IC9A 1BGYH 2BSKB 2Y0IA 3RYCA 2PY5A 5EYPA 4DV5O 3ABKC 1SA0B 2HVJC 1I94B 1JA8A 1IBMO 2IJIA 3G4SV 4FK5C 4DV0O 4I7ZB 2YIBA 3TJTA 4LF9O 1KB9F 1HWYA 4H33A 2WLMA 1BSMA 1IBLB 2RN9A 2PGGA 1TGOA 3RVYA 2A06H 1VQPV 4DV4O 1LR1A 1Z5VA 4QJFB 2PTMA 4X64B 4FZ0A 1S0VA 4O4IA 3F7YC 2UUBO 1DF4A 4X1IB 1O9GA 4GYCB 1FJGB 4PV1B 2JGUA 4LWSB 4OGQB 1EN6A 4N21A 3W7SA 1G8MA 2DW4A 4UXNA 1D5AA 3SR2C 5DM6V 1AI7A 2E75B 3STZC 4DR7B 2UUAB 1BMFG 2HJDA 2ZE7A 3BA9A 1I08A 2IM9A 2IJHA 1MNGA 5LGNA 2Q7EA 2OTLV 1NR7A 5A9GA 1G6UA 1VF7A 3K5OA 4ZHQB 4YIPA 2ETNA 1EN5A 3CE2A 3LDDA 4MTFA 4J7KA 2W0FC 3CRQA 4CH4A 2UUAO 3AG1C 3I55V 2ZCEA 2FL4A 1PKXA 5IDJA 2LQTA 1SA0A 1ROPA 4PA7A 4FLWA 1YI2V 4D7TA 4LFAB 1BQZA 2YICA 4MS2A 4O4JA 4Q6GA 5L3DA 4HBNA 1Q7YW 2X6AA 4K0KO 1FJGO 2IH1C 4NTXA 1WPBA 2BOBC 2Y0PA 3IC7A 1TUBB 2X0LA 3RYHB 4X64O 1P7BA 1SZXA 1Q5OA 3A0RA 1NH2D 2PYLA 4FFBA 5LGUA 1WJZA 1WLEA 4X89A 3OR7C 1EBOA 2P22C 3AK1A 1VEWA 4JAVA 5KUKA 3Q4HA 3PN1A 1Q81W 3JCZA 1IBMB 1I94O 1Z5WA 2CGNA 1M56C 5H2FZ 2PI4A 2EZOA 4J11A 4BWAA 5JVDA 1N8RW 3K9AA 2E5LO 4D7SA 1MSWD 2BTOA 2ZXWC 4J42A 2CK3G 2H3OA 1HW7A 2P6JA 1QU7A 2ZM6B 4DR2O 1QR9A 2IU0A 3HKEA 2DE0X 5EBLC 3ZJZA 1QBZA 4H44B 3WB1A 4JTCB 2HJFC 1IDSA 4K35A 5CBHA 3SYCA 3CCVV 2W6IG 4JAUA 3NR7A 4EB6A 1YJ9V 4I5SA 4JI4B 3C3SA 4BIUA 3X2QB 4DR1O 3EHBB 4CH6A 4B3SO 2P06A 1FXVA 4O2BB 2RCVA 3VQXA 5AG2A 4Z1MG 1QVFU 1QLEB 2IBZH 4LF7B 1M90W 1AILA 2JGDA 1HR0B 2QSAA 2LFSA 3SYOA 4KHPO 1JPXA 3D3IA 4WFHA 1W0KG 4GKJO 2O57A 2Y69B 4MVUA 4BW9A 1E1RG 5EC2C 3TGUH 2A3QA 4DV7B 3B8MA 1NQTA 1WB8A 4AHCA 3P32A 2VQFO 2AHYA 3CHXA 1XNQO 2ZE8A 4JI7O 2ZIMA 2UU9B 3OUSA 2CH7A 3ETQA 1VQ6V 5LL6Y 1NH2B 3WG7C 1QR8A 2UXBB 3ICXA 3JD2A 3CYOA 4UVBA 5BMVA 4PA6A 5IWAB 3CCMV 1FXKB 4GKKB 1P4RA 4KP4A 4MVMA 1FD9A 4CBCA 3E2EA 1FXHA 4I50A 4JI6O 3W7WA 2IJJA 5LBQA 3P30A 1B3QA 1R3IC 3BHPA 1Q86W 1Y67A 1K5SA 5J2TA 2C2AA 4P30A 4MVQA 2EBOA 2ZR3A 1BZKA 4OX9O 3UQ8A 4GKKO 3UKMA 5IWAO 3SJCC 4PA4A 1UPGA 1L0NH 2GTAA 4YY3O 2ARHA 1NVPD 3K04A 1VQ4V 4R7CA 1XREA 4QE7A 2L35A 1XMQO 1EFRG 1K92A 4W4KA 1FPOA 3G80A 2Q69A 1AI5A 4B3RB 4ICGA 1U96A 3K9SA 2PUSA 5EIBD 5IT9N 1ZLZA 5B1AC 4FPPA 4DV1O 3T4DA 4JI0B 1N32B 1WNSA 4RO2A 3CRMA 2PI5A 4CC6A 4TUYB 5EC1C 3H01A 2XAGA 3JD4A 4PELA 1AR5A 2PF4E 4KHPB 1VQ9V 4G28B 4MVZA 3JAKA 4F6RA 3UO3A 3G6BA 3D36A 1HP8A 2EILC 3HKBB 4X1KB 5KUMA 1XOUA 3JAWB 3ETGA 3DC5A 2Q9LA 4O4HA 3OTOO 4BIOA 2YSUB 4FJCC 4UCSA 4FLUA 3ZHUA 3BPZA 1NS1A 3AEIA 2BSKA 1NTKH 2L6LA 1Y66A 1SESA 2Z5UA 2NR5A 2V4DA 1HNWO 3LDCA 5BXZA 4JI2B 1AROP 4FFKA 2ZINA 4DR2B 2K9PA 3CJHB 5HFMA 4DUZO 2Q7HA 3N2GA 2BTQA 3SPJA 1M4UA 1N36B 4PA3A 3GB7C 1VQMV 3ABLC 1B06A 2YDEA 4ZKIA 1YJNV 4I55A 2JRIA 5J2UB 3ASOB 4O4HB 3JSLA 2LW1A 3E35A 3E8HA 3ZRSA 1KKCA 1FAFA 2CH7B 4X1IA 2ZE6A 3MAQA 1N36O 2ZKOA 4DK1A 4CH3A 1RM1B 3BY6A 3NXSA 3HPLC 3OFNG 3SJBC 2E76B 3C3TA 1GAXA 4N23A 2XOKG 4UCOA 3ABMB 1K8AW 4DV6B 1W59A 2YC0A 1OCCB 1K73W 1HNZB 3ZRWA 4NKGB 2P7TC 3HKCB 2OYQA 1F4NA 3DC6A 1M56B 4XBFA 1FYJA 5DN6G 2ILMA 2WAMA 3ASNC 1AP6A 4H37A 1IBKO 4HNAA 2ATKC 1NVPB 2LP7A 3HB3B 4LNUA 4J7JA 2WLKA 3IJ4A 2F95B 1H2SB 4O4LA 3RWRD 2EIJC 3JD3A 4NXNO 2NN4A 3I5DA 1L8DA 2QE7G 4AQYB 1CPYA 2Q0OC 2VWKA 2JJ1G 3EXAA 4TV9A 1VF5B 1VQOV 4X88A 4DV1B 1E1QG 5KMGB 1I7FA 5KHKA 2R9RB 1MG1A 2QM4A 3DXRA 1ZX3A 5FPRA 4KFMA 1XMQB 1XL4A 4OPHA 4GLXA 1QVGU 2VQEB 3CB2A 4FLVA 3AG4C 3HR0A 1F51A 4QE9A 1JX9A 4DUYB 3ZHTA 2HLDG 2KQXA 3RFRA 1UJWB 3TETA 4OX9B 3OGCC 4F6RB 5L3EA 1Q8IA 1IVSA 2Q7GA 1D5NA 4D6TH 1KU9A 2B1IA 3MHSC 3BRCA 1E79G 1VIBA 4LF9B 3DSQA 4MVSA 2ZD9A 4JAAA 1SF9A 3E86A 1SQFA 1VQ8V 2OCHA 2EINC 4X20A 2G38A 2ZT9B 2JEXA 1KD1W 5BMVB 3OGIB 4CC5A 4MVOA 3BEHA 5LMNO 2LFRA 2JS3A 2UXBO 1AJQA 1CEZA 3JARA 3OM3B 2GV9A 1PL0A 2ZQMA 4ZI7A 4KXRA 1R1BA 4O2BA 5B3SB 4YJ3B 4NTWA 4QPKA 2N05A 5C8YB 1R3KC 1XNQB 2P90A 4X9QA 5D5PA 3A0BZ 4G2KA 2HKOA 5TISZ 1TUEB 5EYPB 1Q6IA 4JPRA 1MMMA 2WLLB 4LH7A 2FMLA 1WP7A 4Q20A 3T1YB 3HKCA 3MD0A 5CBFA 2ZR2A 4XDKA 5GONA 1DF5A 1GN3A 1GKFA 4QNHB 3RW0A 3RBZA 1HR0O 3ZCCA 1L1FA 4YJ3A 3T1YO 3ZHQA 4ZI7B 4P2ZA 3UT5B 4BAYA 3CX5F 3U10A 4X66B 3G67A 2GTSA 2NNUA 1YITV 3EFFK 4K8XA 1DGSA 4JYBA 3K08A 3SYAA 3HKDB 1OCRB 2QM8A 1KECA 2UXDO 1AI4A 3F5TA 1QCEA 3IGAC 1TAEA 3FYIB 4UB8Z 1JFFB 4DR6O 3QO7A 3BVOA 1NBMG 3CC2V 3FB6C 4HAMA 4DO2A 1F23A 1H2KA 3UT5A 1AVMA 4TQFA 4TV8B 3FB7C 5IJ0A 3ZHSA 4DR4O 4MTXA 3ZMUA 4H0LB 4UV8A 2A0LA 1X4TA 4MSWC 5KX5A 1PL4A 2XAQA 3H1KH 4B7EA 4X1YA 1V54C 2Z0AA 5LMUB 3OAAG 5KA6A 3WFVA 4GX1A 3TK1A 4DW0A 4PDLA 1YTFD 5E79Z 1LUVA 1LUWA 4HZ3A 3FKSG 2QA4V 3LSUA 2DQ3A 2X6BA 1IZ3A 5LOVB 4EFBA 4FLYA 4DUYO 3M8AA 4K8ZA 3A0HZ 4K0KB 1BT8A 1Q43A 2DQ0A 3OEHG 2CDYA 2K1EA 2Q6AA 4C7UA 1FFTB 5J2TB 1YF2A 3STLC 3KCXA 5B1AB 4JYCA 2V1DA 3CRRA 1JOYA 5IYDO 5B1BB 3DXRB 3S3WA 1SKVA 2YIBD 5LP6C 4X8AA 1ZL8A 5EZYB 1V54B 1QLNA 4AQYO 4O4IB 4DV3B 4OPAA 2JDIG 5LXTB 3HKDA 2HVKC 5IJ9B 1N4CA 2M6YA 1BQ0A 3OEEG 3THOA 4U3FH 2UXXA 2AXTZ 1DK1A 4QIWF 3T4ZA 4NTYA 1PNMA 5L3FA 5JH7A 2XAJA 1J5EB 5KLVH 1GN4A 1IBKB 2D2CB 1YJWV 4DV2O 4W4LA 3JATB 2YIDA 5ITZB 4L87A 3AG3B 1S5LZ 2XASA 4G27B 2XUMA 2ADPA 2IH3C 4EFEA 4UCVA 1ZSPA 1Y76A 1HNZO 3JYCA 2F23A 2F4VO 4IYHA 4A5UB 1GM9A 4DV4B 3W7UA 4U3JA 1DLBA 3RYIB 2EULA 3KG2A 2WLJA 1KP2A 3E8FA 3TXQA 4JZGA 4B3MO 1IBLO 2GUZB 1S72V 1YEWA 5KHIA 1M93A 1F7YA 5BZBA 2YXYA 3ABUA 5JH7B 4WCEV 4DV0B 4J7ZA 4DV5B 2QTOA 1K9MW 4JI3B 3OUFA 3ZIAG 4B08A 4YJ2B 5LYJB 2RQ6A 2QEXV 2CAZC 4PI0A 3L72H 4DK0A 3OMNB 4DUZB 1YXBA 3N27A 2ZE5A 1IX9A 4LFBO 4JI2O 4PA9A 1H8EG 2FB5A 3H1LH 4X65B 4LF6B 2JJ2G 3APOA 4DRXB 2DYSC 3E22A 3RYFA 3UCSC 2VS0A 3RVZA 1FKAO 3CD6V 3VQWA 3VQYA 1GM7A 1NR1A 4JV5O 1S76D 3OTOB 1SQVH 3OE7G 5LOVA 4GCZA 3JALB 2Q67A 1JMKC 4IHJA 4JGSA 5GTHZ 3T1HB 5DEDA 2F1MA 3K03A 3B4SA 2BE3A 1BS3A 3KCYA 5LHGA 1BL8A 1RSOB 1Y76B 1VP7A 3E22B 4LFCB 1N32O 4JI0O 5B66Z 3IFXA 1M1KW 2UXNA 1B04A 2R9AA 2PYJA 5IJ0B 3AG2C 3FD9A 1COWG 2ITDC 1NZ6A 2ZNIA 2DWDC 4TWKA 5CMUA 3M99B 1IURA 4UFZA 1SQXH 1NKDA 1ZTEA 4X62B 2CUGA 5FPOA 4F6EA 1MZFA 2JGDB 3JSNA 1NI8A 3WB2A 1VARA 3CWBH 3ETDA 2F43G 5KHHA 5LGTA 4P9PA 4BW5A 1GK9A 2WLIB 1S5JA 4DR5O 3ABTA 4DXWA 4RAIA 1OHHG 1KQSU 1SERA 1MABG 1N0JA 4YHHO 2HFEC 2FTKA 1WPXA 3QVNA 2QTSA 2B5UA 3RYFB 1X59A 4B3TO 4LF8O 1OCRC 2ZNJA 4GX5A 4PDMA 3FAVA 5KHGA 5KMGA 2HG5C 1FFXB 1CXZB 4JI6B 5CB4A 4PJ0Z 1TA8A 5LA6A 3CRCA 4LF5O 2Y48A 2A9HA 1WAZA 3ZMTA 4ABMA 4IHJB 2ITCC 1K7DA 3K5LA 3N2GB 1Y74B 2V7QG 4JYYA 3ZHRA 1SZTA 4RUFA 1R6KA 2QKSA 1EZJA 3SJAC 5CB4B 4DYLA 1YHQV 1PM9A 3A8TA 3O65A 3OW2U 1WA8B 3FX7A 1MA1A 2UU9O 4LC1A 5GONB 3GVMA 2B9ZA 4YHHB 4ZIBA 4FLZA 2F66C 3SYQA 4P9OA 4TV9B 5LA6B 2QWQB 5F2VO 5IY5C 4GKJB 2AGAA 1PNKA 4FZ1A 1FS0G 4JI1O 1AR1B 1W0JG 5GW7A 4X62O 1SETA 4J9YB 1M5IA 5IYZA 3RN4A 1I0HA 3SJQC 1H2NA 2HEPA 4DR1B 4JI4O 2KSDA 4UB6Z 3QF7A 1VQ5V 2IU3A 5DECA 2XAHA 1J95A 3D36C 4PDRA 1XMOB 2KG7A 4WFEA 3KZIZ 4FLTA 3DTUB 4FFBB 4JYAO 1BHBA 4LFCO 5H5NA 4PD4F 2E74B 4UVCA 1TUBA 4MW8A 3CJHA 2P4KA 2XTAA 5CA0B 4IIJB 1Z2GA 3K5MA 2DJVA 5E1AC 3B40A 5FLXN 3T1HO 2YEVA 3JAWA 5HFLA 4OXSA 1GH6A 2D3OW 2E5LB 1N33O 4K3AA 3OTFA 4JV5B 2CTWA 3GWOA 1S5HC 2YUAA 3CCSV 4J80A 1SQQH 3CP1A 3LNNA 1EN4A
chains in the Genus database with same CATH topology
1L0NH 1PP9H 4U3FH 3TGUH 3L71H 3CXHF 3CWBH 1SQBH 4D6TH 2IBZH 3H1LH 3L75H 1PPJH 2FYUH 1NU1H 1L0LH 3H1IH 5KLVH 1SQVH 3L73H 3CX5F 1NTKH 1KB9F 3H1HH 3BCCH 3H1KH 4PD4F 1BCCH 3H1JH 1SQPH 3L74H 1NTZH 1KYOF 1EZVH 1BE3H 1P84F 3L70H 2BCCH 1SQXH 3L72H 1BGYH 1SQQH 2A06H 1NTMH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0N H;  1PP9 H;  4U3F H;  3TGU H;  3L71 H;  3CXH F;  3CWB H;  1SQB H;  4D6T H;  2IBZ H;  3H1L H;  3L75 H;  1PPJ H;  2FYU H;  1NU1 H;  1L0L H;  3H1I H;  5KLV H;  1SQV H;  3L73 H;  3CX5 F;  1NTK H;  1KB9 F;  3H1H H;  3BCC H;  3H1K H;  4PD4 F;  1BCC H;  3H1J H;  1SQP H;  3L74 H;  1NTZ H;  1KYO F;  1EZV H;  1BE3 H;  1P84 F;  3L70 H;  2BCC H;  1SQX H;  3L72 H;  1BGY H;  1SQQ H;  2A06 H;  1NTM H; 
#chains in the Genus database with same CATH topology
 4FM1 A;  2AZ2 A;  5B5E Z;  3K0D A;  2QJ1 A;  1QNM A;  2W6J G;  1L0L H;  1R6T A;  4IIJ A;  5IYB O;  4PDV A;  1YSC A;  2B1G A;  3VOU A;  2CE4 A;  2YI8 A;  3AG2 B;  3IAY A;  1VMG A;  3RGB A;  4KL1 A;  1K97 A;  2DYR C;  4JI3 O;  1AP5 A;  4LP8 A;  2JIZ G;  2AZ0 A;  2CTP A;  2OWO A;  1RP3 B;  3ZED A;  3U11 A;  3K58 A;  4LFA O;  2QDO A;  5LXT A;  1PPJ H;  3U0Z A;  1NU1 H;  4LNU B;  2Q0A A;  4J41 A;  4TSF G;  3SYP A;  4WFB V;  4I4T A;  3CCU V;  4GX2 A;  1XDC A;  3PJS K;  1V55 B;  1PD3 A;  5LP6 B;  4FM0 A;  3R66 A;  1TVK B;  3OT7 A;  2HR3 A;  3JAK B;  4DR3 B;  1OJH A;  4UVA A;  3FFQ A;  1N34 B;  2JEU A;  1NT2 B;  3L9D A;  5CN0 A;  2QGN A;  1UFI A;  2F4V B;  1R3J C;  2QWP B;  1V55 C;  4AIL C;  1YIJ V;  2QKA A;  2QWN B;  1US6 A;  2OT5 A;  1K33 A;  4JI5 O;  4DRX A;  3P3P A;  1JR9 A;  1YTF B;  2ZXW B;  4DR7 O;  2Q73 A;  5BR8 O;  2DYS B;  2GDS A;  4DV2 B;  4NR1 A;  2ZDI A;  1AI6 A;  1S77 D;  5BR8 B;  2EIK B;  3BA8 A;  1F4M A;  2EJR A;  4MTO A;  2LJ2 A;  4EEQ A;  3K57 A;  2KB1 A;  1VQN V;  2YS8 A;  1XHZ A;  3JD0 A;  2UUB B;  1XI1 A;  4RUE A;  3OR6 C;  4I0X B;  1NJI W;  3ABL B;  5FL7 G;  1N34 O;  5KX5 B;  1VF6 A;  5EBW C;  2OCC B;  1K5Q A;  1QHT A;  1THZ A;  2A79 B;  3B77 A;  2N04 A;  3T2M A;  1H38 A;  3HKB A;  3L75 H;  1I5Y A;  3CPW U;  3K59 A;  1XQ8 A;  2M7W A;  4PHZ A;  2EZP A;  2EIL B;  1IXB A;  2WLH A;  5H6R A;  4LR3 A;  3B8N A;  1ZUQ A;  1JQ0 A;  5JQG B;  3AG4 B;  2GSM B;  3X2Q C;  4LF4 B;  1PV0 A;  4MW3 A;  1WN7 A;  1GO3 F;  2Q8V A;  3RT3 C;  4LWS A;  2RNB A;  4FLX A;  3FYE B;  1GMG A;  3AG3 C;  4I9W A;  1Q3E A;  4GX0 A;  3DGE A;  1TVK A;  4NXM B;  2GBO A;  2F93 B;  1XNR O;  5LMU O;  5IYZ B;  5EZY A;  1YZB A;  1YCI A;  3W7X A;  3CC7 V;  5B3S C;  4DR4 B;  3MDS A;  2WLL A;  3SPC A;  3SGI A;  1URF A;  1KP3 A;  1N33 B;  3P3N A;  1XUQ A;  2LGQ A;  4L8J A;  1NTZ H;  4CS3 A;  3E8B A;  5IY5 B;  3Q4H B;  2MK3 A;  4RQE A;  1WA8 A;  3ZBH A;  5KHJ A;  1XHX A;  2WA3 A;  5JCO A;  4TOI A;  3JAR B;  5B1O A;  1ORQ C;  3BFR A;  4LCU C;  3BCC H;  4JYA B;  1RPR A;  3H1J H;  3ZX6 A;  1XMO O;  1OCZ C;  3ZHV A;  2AW9 A;  2IW5 A;  3RYH A;  3JCU Z;  5LHI A;  1JFF A;  4X66 O;  1JJO A;  4I4T B;  1H2L A;  1OZ0 A;  2EIN B;  3CSX A;  3ZRX A;  2OIG A;  1Q6U A;  2OTJ V;  2GUZ A;  2ZIO A;  2LW7 A;  1ZAU A;  4ZOL A;  2QWR B;  2Q5Z A;  3L73 H;  3RYC B;  2YXL A;  2RDC A;  5D5Q A;  4JI1 B;  5JQG A;  1K4D C;  1P49 A;  3LDE A;  2BTQ B;  1FFX A;  4HNA B;  4R8C A;  3CCR V;  3M7M X;  4Z2W A;  4I55 B;  4J9Z B;  5CA1 A;  4I50 B;  1K4C C;  4UUJ C;  1PP9 H;  5A2Q N;  5JJJ B;  1Y6X A;  3K06 A;  1MSD A;  3CEI A;  1H8H G;  5CA0 A;  2KG7 B;  3SPH A;  2IJK A;  3T1C A;  3OMA B;  4NXM O;  1VQL V;  4YIO A;  2Y4U A;  1SRY A;  1V9P A;  3J81 N;  2UXC B;  1DTO A;  4I0X A;  3GWK C;  2JS5 A;  3BAB A;  4JI8 B;  2Y69 C;  2YEV B;  4LF4 O;  5C8Y A;  1U97 A;  5GTI Z;  3BAA A;  5L3C A;  4UV9 A;  3ZRV A;  4IYI A;  1HDJ A;  4CS2 A;  2YIA A;  5JWP A;  2VRZ A;  5L3G A;  4R6Z A;  2EX3 A;  2X6C A;  2LGW A;  1N0N A;  1RPO A;  1P7G A;  3L71 H;  1S3J A;  5J9P C;  4O4L B;  3ABM C;  2GHY A;  4IL6 Z;  5H9C A;  2HP8 A;  4NVP A;  1XBL A;  4U7O A;  2XAF A;  3H1H H;  5JJE B;  2Y4T A;  2BCC H;  2W0X A;  3MHH C;  3CXC U;  2ZDI C;  3KKY A;  1H2G A;  2FYU H;  3G6E V;  2VQE O;  2DWE C;  4JF3 A;  2P5O A;  3TCU A;  4FIP C;  2P4V A;  5L3B A;  1PNL A;  1Y74 A;  1QQC A;  5FNV B;  4TT3 G;  1Q90 D;  4FM2 A;  2CTR A;  1SQG A;  3FB5 C;  1A32 A;  1KYO F;  1AJP A;  3ZN0 A;  1GRJ A;  5EK0 A;  4JI5 B;  1SS3 A;  3H9V A;  4WF9 V;  3CMA V;  1T5E A;  3CCL V;  1G1X B;  3JAS B;  1XEQ A;  4GUN A;  3J7A U;  2JVD A;  3ETE A;  3JAM N;  4WBN B;  1VQ7 V;  3LSQ A;  2A7W A;  3A2F A;  4NXN B;  4DR3 O;  1K34 A;  4I9Q A;  1VF6 C;  3ASO C;  3W7T A;  2UUC B;  1CP9 A;  2XT9 A;  5J2U A;  2Q68 A;  5EIB C;  3SDL A;  2R72 A;  1R73 A;  1HNX B;  2EIK C;  3QTC A;  4JAS A;  1KKD A;  3CCE V;  2VWJ A;  2AHZ A;  3OD4 A;  3QG5 A;  1GN2 A;  4DV6 O;  4WBN A;  2Q4P A;  4KUM A;  3QO5 A;  2HHH O;  1MOF A;  3K0G A;  4PI2 A;  1YDX A;  5BY1 A;  5C93 A;  2Z3Y A;  4XDJ A;  2HHH B;  1XIL A;  3TXS A;  1WP8 A;  4JZ2 A;  3N2K A;  3OMI B;  5JJN B;  3VBB A;  1RFY A;  1HNX O;  4QPJ A;  3JAL A;  2EIM C;  1AJN A;  1G4Y B;  2P67 A;  1KUQ A;  3K79 A;  3WU2 Z;  4IGG A;  1ZL8 B;  5IJ9 A;  2UUC O;  3D8C A;  3QNE A;  4FMT A;  5JCO C;  4B3M B;  4X1K A;  2ODM A;  2WPD G;  2DOS A;  2EIJ B;  3B2E E;  1KC8 W;  2RMK B;  2EIM B;  2DYR B;  1WB7 A;  2QM7 A;  1SQP H;  3CCQ V;  4ZBM A;  3JAS A;  1EZV H;  2DMX A;  1HNW B;  4NB5 A;  1ZWI C;  4X20 B;  4GZR B;  2YI9 A;  1VQK V;  3EVK A;  1H2M A;  4IT5 A;  3VQV A;  3ABK B;  4WFA V;  1KMI Z;  1SQB H;  3B09 A;  5ITZ A;  4LBE C;  1OCC C;  3F7V C;  4GT1 A;  5K1X A;  1J5E O;  4JTA B;  3ML0 A;  3L74 H;  1R6N A;  1FXK C;  1FXK A;  3L70 H;  1RM1 C;  2WWW A;  1XL6 A;  4U3J B;  3K3W A;  4ASU G;  4H13 B;  3C90 A;  4DV3 O;  3ZMS A;  5K1P A;  2CGO A;  4UCU A;  4MVR A;  1JVM A;  1GM8 A;  2R70 A;  1BCC H;  3CC4 V;  2WA4 A;  1JCH A;  1B6Q A;  3JD1 A;  3LNM B;  4UCT A;  4JTD B;  4CH5 A;  3AK3 A;  3K5N A;  1D2D A;  3D3Q A;  4E4E A;  4B3R O;  5FNV A;  2H8P C;  2OIE A;  1EM1 A;  1RSO A;  2R9I A;  4RWU A;  3WG7 B;  2JK5 C;  2EJ7 A;  4U7N A;  2KKW A;  4QGP A;  4YY3 B;  2QWO B;  2XHB A;  2OCC C;  2RJZ A;  4RQF A;  1OCO B;  4ZOL B;  1SC5 B;  4JI8 O;  5IE9 A;  3SPI A;  5JVD B;  2UXC O;  1GTO A;  5B1N A;  2FKX A;  1NTM H;  4LF5 B;  1GN6 A;  5H6Q A;  1M57 B;  5CA1 B;  3G71 V;  3CXH F;  2XND G;  4MTG A;  1K3E A;  5LP6 A;  3AG1 B;  4CS4 A;  3LSS A;  3ZN1 A;  4CZZ A;  2PZS A;  3ASN B;  4AI8 A;  4B3T B;  4LF8 B;  3H1I H;  5IYC O;  1IXM A;  4O2A A;  5LHH A;  2WSS G;  1W2B U;  5B1B C;  2ADQ B;  5CBG A;  4TUY A;  4MT8 A;  1QLE C;  4BIZ A;  4DR5 B;  4LH6 A;  3E89 A;  5LYJ A;  4YJ2 A;  1YVW A;  3ZS8 C;  4BR6 A;  4DR6 B;  1AR4 A;  3LUT B;  1BHA A;  4HYO A;  2UXD B;  3N2K B;  3UO2 A;  2BOC C;  4O2A B;  1I5X A;  1MZE A;  4JI7 B;  1M57 C;  2VQF B;  2DN9 A;  1R3L C;  5KAF Z;  2NLJ C;  2X7R B;  4WFG A;  3I56 V;  4DV7 O;  3RYI A;  1JJ2 U;  5KAI Z;  4YXW G;  4F4L A;  3FB8 C;  3ZRW B;  3ZMV A;  1OCO C;  1Y4M A;  4UCR A;  1KBH A;  3UM7 A;  3AK2 A;  4R50 A;  3R65 A;  4J10 A;  4B7K A;  3HKE B;  3CS5 A;  3APQ A;  3SPG A;  2N74 A;  3E83 A;  2WLI A;  4DW1 A;  1AB3 A;  4O4J B;  4XDL A;  3AG7 A;  3E8G A;  4LF7 O;  2LO1 A;  1OV9 A;  2YXH A;  4TV8 A;  4B3S B;  2CTQ A;  5CA3 A;  3J80 N;  3O9O A;  3WB0 A;  1M9N A;  2H94 A;  1Q6H A;  1Q82 W;  3F5W C;  4EB6 B;  3CCJ V;  4Z1V A;  4FVM A;  1BE3 H;  4TQD A;  3CRA A;  3FAV B;  4X1Y B;  4EKW A;  2QR4 A;  4NYK A;  2QKC A;  1XNR B;  4X65 O;  4LF6 O;  4ZHQ A;  2WLN A;  2MW2 B;  5KA5 A;  1ENV A;  4LFB B;  3JAT A;  3S3X A;  5LMN B;  1O9H A;  4E2L A;  2ZM6 O;  5EBM C;  3ZMZ A;  3CME V;  1OCZ B;  1LNQ A;  4WFF A;  3QO8 A;  2E3C A;  1P84 F;  3IC9 A;  1BGY H;  2BSK B;  2Y0I A;  3RYC A;  2PY5 A;  5EYP A;  4DV5 O;  3ABK C;  1SA0 B;  2HVJ C;  1I94 B;  1JA8 A;  1IBM O;  2IJI A;  3G4S V;  4FK5 C;  4DV0 O;  4I7Z B;  2YIB A;  3TJT A;  4LF9 O;  1KB9 F;  1HWY A;  4H33 A;  2WLM A;  1BSM A;  1IBL B;  2RN9 A;  2PGG A;  1TGO A;  3RVY A;  2A06 H;  1VQP V;  4DV4 O;  1LR1 A;  1Z5V A;  4QJF B;  2PTM A;  4X64 B;  4FZ0 A;  1S0V A;  4O4I A;  3F7Y C;  2UUB O;  1DF4 A;  4X1I B;  1O9G A;  4GYC B;  1FJG B;  4PV1 B;  2JGU A;  4LWS B;  4OGQ B;  1EN6 A;  4N21 A;  3W7S A;  1G8M A;  2DW4 A;  4UXN A;  1D5A A;  3SR2 C;  5DM6 V;  1AI7 A;  2E75 B;  3STZ C;  4DR7 B;  2UUA B;  1BMF G;  2HJD A;  2ZE7 A;  3BA9 A;  1I08 A;  2IM9 A;  2IJH A;  1MNG A;  5LGN A;  2Q7E A;  2OTL V;  1NR7 A;  5A9G A;  1G6U A;  1VF7 A;  3K5O A;  4ZHQ B;  4YIP A;  2ETN A;  1EN5 A;  3CE2 A;  3LDD A;  4MTF A;  4J7K A;  2W0F C;  3CRQ A;  4CH4 A;  2UUA O;  3AG1 C;  3I55 V;  2ZCE A;  2FL4 A;  1PKX A;  5IDJ A;  2LQT A;  1SA0 A;  1ROP A;  4PA7 A;  4FLW A;  1YI2 V;  4D7T A;  4LFA B;  1BQZ A;  2YIC A;  4MS2 A;  4O4J A;  4Q6G A;  5L3D A;  4HBN A;  1Q7Y W;  2X6A A;  4K0K O;  1FJG O;  2IH1 C;  4NTX A;  1WPB A;  2BOB C;  2Y0P A;  3IC7 A;  1TUB B;  2X0L A;  3RYH B;  4X64 O;  1P7B A;  1SZX A;  1Q5O A;  3A0R A;  1NH2 D;  2PYL A;  4FFB A;  5LGU A;  1WJZ A;  1WLE A;  4X89 A;  3OR7 C;  1EBO A;  2P22 C;  3AK1 A;  1VEW A;  4JAV A;  5KUK A;  3Q4H A;  3PN1 A;  1Q81 W;  3JCZ A;  1IBM B;  1I94 O;  1Z5W A;  2CGN A;  1M56 C;  5H2F Z;  2PI4 A;  2EZO A;  4J11 A;  4BWA A;  5JVD A;  1N8R W;  3K9A A;  2E5L O;  4D7S A;  1MSW D;  2BTO A;  2ZXW C;  4J42 A;  2CK3 G;  2H3O A;  1HW7 A;  2P6J A;  1QU7 A;  2ZM6 B;  4DR2 O;  1QR9 A;  2IU0 A;  3HKE A;  2DE0 X;  5EBL C;  3ZJZ A;  1QBZ A;  4H44 B;  3WB1 A;  4JTC B;  2HJF C;  1IDS A;  4K35 A;  5CBH A;  3SYC A;  3CCV V;  2W6I G;  4JAU A;  3NR7 A;  4EB6 A;  1YJ9 V;  4I5S A;  4JI4 B;  3C3S A;  4BIU A;  3X2Q B;  4DR1 O;  3EHB B;  4CH6 A;  4B3S O;  2P06 A;  1FXV A;  4O2B B;  2RCV A;  3VQX A;  5AG2 A;  4Z1M G;  1QVF U;  1QLE B;  2IBZ H;  4LF7 B;  1M90 W;  1AIL A;  2JGD A;  1HR0 B;  2QSA A;  2LFS A;  3SYO A;  4KHP O;  1JPX A;  3D3I A;  4WFH A;  1W0K G;  4GKJ O;  2O57 A;  2Y69 B;  4MVU A;  4BW9 A;  1E1R G;  5EC2 C;  3TGU H;  2A3Q A;  4DV7 B;  3B8M A;  1NQT A;  1WB8 A;  4AHC A;  3P32 A;  2VQF O;  2AHY A;  3CHX A;  1XNQ O;  2ZE8 A;  4JI7 O;  2ZIM A;  2UU9 B;  3OUS A;  2CH7 A;  3ETQ A;  1VQ6 V;  5LL6 Y;  1NH2 B;  3WG7 C;  1QR8 A;  2UXB B;  3ICX A;  3JD2 A;  3CYO A;  4UVB A;  5BMV A;  4PA6 A;  5IWA B;  3CCM V;  1FXK B;  4GKK B;  1P4R A;  4KP4 A;  4MVM A;  1FD9 A;  4CBC A;  3E2E A;  1FXH A;  4I50 A;  4JI6 O;  3W7W A;  2IJJ A;  5LBQ A;  3P30 A;  1B3Q A;  1R3I C;  3BHP A;  1Q86 W;  1Y67 A;  1K5S A;  5J2T A;  2C2A A;  4P30 A;  4MVQ A;  2EBO A;  2ZR3 A;  1BZK A;  4OX9 O;  3UQ8 A;  4GKK O;  3UKM A;  5IWA O;  3SJC C;  4PA4 A;  1UPG A;  1L0N H;  2GTA A;  4YY3 O;  2ARH A;  1NVP D;  3K04 A;  1VQ4 V;  4R7C A;  1XRE A;  4QE7 A;  2L35 A;  1XMQ O;  1EFR G;  1K92 A;  4W4K A;  1FPO A;  3G80 A;  2Q69 A;  1AI5 A;  4B3R B;  4ICG A;  1U96 A;  3K9S A;  2PUS A;  5EIB D;  5IT9 N;  1ZLZ A;  5B1A C;  4FPP A;  4DV1 O;  3T4D A;  4JI0 B;  1N32 B;  1WNS A;  4RO2 A;  3CRM A;  2PI5 A;  4CC6 A;  4TUY B;  5EC1 C;  3H01 A;  2XAG A;  3JD4 A;  4PEL A;  1AR5 A;  2PF4 E;  4KHP B;  1VQ9 V;  4G28 B;  4MVZ A;  3JAK A;  4F6R A;  3UO3 A;  3G6B A;  3D36 A;  1HP8 A;  2EIL C;  3HKB B;  4X1K B;  5KUM A;  1XOU A;  3JAW B;  3ETG A;  3DC5 A;  2Q9L A;  4O4H A;  3OTO O;  4BIO A;  2YSU B;  4FJC C;  4UCS A;  4FLU A;  3ZHU A;  3BPZ A;  1NS1 A;  3AEI A;  2BSK A;  1NTK H;  2L6L A;  1Y66 A;  1SES A;  2Z5U A;  2NR5 A;  2V4D A;  1HNW O;  3LDC A;  5BXZ A;  4JI2 B;  1ARO P;  4FFK A;  2ZIN A;  4DR2 B;  2K9P A;  3CJH B;  5HFM A;  4DUZ O;  2Q7H A;  3N2G A;  2BTQ A;  3SPJ A;  1M4U A;  1N36 B;  4PA3 A;  3GB7 C;  1VQM V;  3ABL C;  1B06 A;  2YDE A;  4ZKI A;  1YJN V;  4I55 A;  2JRI A;  5J2U B;  3ASO B;  4O4H B;  3JSL A;  2LW1 A;  3E35 A;  3E8H A;  3ZRS A;  1KKC A;  1FAF A;  2CH7 B;  4X1I A;  2ZE6 A;  3MAQ A;  1N36 O;  2ZKO A;  4DK1 A;  4CH3 A;  1RM1 B;  3BY6 A;  3NXS A;  3HPL C;  3OFN G;  3SJB C;  2E76 B;  3C3T A;  1GAX A;  4N23 A;  2XOK G;  4UCO A;  3ABM B;  1K8A W;  4DV6 B;  1W59 A;  2YC0 A;  1OCC B;  1K73 W;  1HNZ B;  3ZRW A;  4NKG B;  2P7T C;  3HKC B;  2OYQ A;  1F4N A;  3DC6 A;  1M56 B;  4XBF A;  1FYJ A;  5DN6 G;  2ILM A;  2WAM A;  3ASN C;  1AP6 A;  4H37 A;  1IBK O;  4HNA A;  2ATK C;  1NVP B;  2LP7 A;  3HB3 B;  4LNU A;  4J7J A;  2WLK A;  3IJ4 A;  2F95 B;  1H2S B;  4O4L A;  3RWR D;  2EIJ C;  3JD3 A;  4NXN O;  2NN4 A;  3I5D A;  1L8D A;  2QE7 G;  4AQY B;  1CPY A;  2Q0O C;  2VWK A;  2JJ1 G;  3EXA A;  4TV9 A;  1VF5 B;  1VQO V;  4X88 A;  4DV1 B;  1E1Q G;  5KMG B;  1I7F A;  5KHK A;  2R9R B;  1MG1 A;  2QM4 A;  3DXR A;  1ZX3 A;  5FPR A;  4KFM A;  1XMQ B;  1XL4 A;  4OPH A;  4GLX A;  1QVG U;  2VQE B;  3CB2 A;  4FLV A;  3AG4 C;  3HR0 A;  1F51 A;  4QE9 A;  1JX9 A;  4DUY B;  3ZHT A;  2HLD G;  2KQX A;  3RFR A;  1UJW B;  3TET A;  4OX9 B;  3OGC C;  4F6R B;  5L3E A;  1Q8I A;  1IVS A;  2Q7G A;  1D5N A;  4D6T H;  1KU9 A;  2B1I A;  3MHS C;  3BRC A;  1E79 G;  1VIB A;  4LF9 B;  3DSQ A;  4MVS A;  2ZD9 A;  4JAA A;  1SF9 A;  3E86 A;  1SQF A;  1VQ8 V;  2OCH A;  2EIN C;  4X20 A;  2G38 A;  2ZT9 B;  2JEX A;  1KD1 W;  5BMV B;  3OGI B;  4CC5 A;  4MVO A;  3BEH A;  5LMN O;  2LFR A;  2JS3 A;  2UXB O;  1AJQ A;  1CEZ A;  3JAR A;  3OM3 B;  2GV9 A;  1PL0 A;  2ZQM A;  4ZI7 A;  4KXR A;  1R1B A;  4O2B A;  5B3S B;  4YJ3 B;  4NTW A;  4QPK A;  2N05 A;  5C8Y B;  1R3K C;  1XNQ B;  2P90 A;  4X9Q A;  5D5P A;  3A0B Z;  4G2K A;  2HKO A;  5TIS Z;  1TUE B;  5EYP B;  1Q6I A;  4JPR A;  1MMM A;  2WLL B;  4LH7 A;  2FML A;  1WP7 A;  4Q20 A;  3T1Y B;  3HKC A;  3MD0 A;  5CBF A;  2ZR2 A;  4XDK A;  5GON A;  1DF5 A;  1GN3 A;  1GKF A;  4QNH B;  3RW0 A;  3RBZ A;  1HR0 O;  3ZCC A;  1L1F A;  4YJ3 A;  3T1Y O;  3ZHQ A;  4ZI7 B;  4P2Z A;  3UT5 B;  4BAY A;  3CX5 F;  3U10 A;  4X66 B;  3G67 A;  2GTS A;  2NNU A;  1YIT V;  3EFF K;  4K8X A;  1DGS A;  4JYB A;  3K08 A;  3SYA A;  3HKD B;  1OCR B;  2QM8 A;  1KEC A;  2UXD O;  1AI4 A;  3F5T A;  1QCE A;  3IGA C;  1TAE A;  3FYI B;  4UB8 Z;  1JFF B;  4DR6 O;  3QO7 A;  3BVO A;  1NBM G;  3CC2 V;  3FB6 C;  4HAM A;  4DO2 A;  1F23 A;  1H2K A;  3UT5 A;  1AVM A;  4TQF A;  4TV8 B;  3FB7 C;  5IJ0 A;  3ZHS A;  4DR4 O;  4MTX A;  3ZMU A;  4H0L B;  4UV8 A;  2A0L A;  1X4T A;  4MSW C;  5KX5 A;  1PL4 A;  2XAQ A;  3H1K H;  4B7E A;  4X1Y A;  1V54 C;  2Z0A A;  5LMU B;  3OAA G;  5KA6 A;  3WFV A;  4GX1 A;  3TK1 A;  4DW0 A;  4PDL A;  1YTF D;  5E79 Z;  1LUV A;  1LUW A;  4HZ3 A;  3FKS G;  2QA4 V;  3LSU A;  2DQ3 A;  2X6B A;  1IZ3 A;  5LOV B;  4EFB A;  4FLY A;  4DUY O;  3M8A A;  4K8Z A;  3A0H Z;  4K0K B;  1BT8 A;  1Q43 A;  2DQ0 A;  3OEH G;  2CDY A;  2K1E A;  2Q6A A;  4C7U A;  1FFT B;  5J2T B;  1YF2 A;  3STL C;  3KCX A;  5B1A B;  4JYC A;  2V1D A;  3CRR A;  1JOY A;  5IYD O;  5B1B B;  3DXR B;  3S3W A;  1SKV A;  2YIB D;  5LP6 C;  4X8A A;  1ZL8 A;  5EZY B;  1V54 B;  1QLN A;  4AQY O;  4O4I B;  4DV3 B;  4OPA A;  2JDI G;  5LXT B;  3HKD A;  2HVK C;  5IJ9 B;  1N4C A;  2M6Y A;  1BQ0 A;  3OEE G;  3THO A;  4U3F H;  2UXX A;  2AXT Z;  1DK1 A;  4QIW F;  3T4Z A;  4NTY A;  1PNM A;  5L3F A;  5JH7 A;  2XAJ A;  1J5E B;  5KLV H;  1GN4 A;  1IBK B;  2D2C B;  1YJW V;  4DV2 O;  4W4L A;  3JAT B;  2YID A;  5ITZ B;  4L87 A;  3AG3 B;  1S5L Z;  2XAS A;  4G27 B;  2XUM A;  2ADP A;  2IH3 C;  4EFE A;  4UCV A;  1ZSP A;  1Y76 A;  1HNZ O;  3JYC A;  2F23 A;  2F4V O;  4IYH A;  4A5U B;  1GM9 A;  4DV4 B;  3W7U A;  4U3J A;  1DLB A;  3RYI B;  2EUL A;  3KG2 A;  2WLJ A;  1KP2 A;  3E8F A;  3TXQ A;  4JZG A;  4B3M O;  1IBL O;  2GUZ B;  1S72 V;  1YEW A;  5KHI A;  1M93 A;  1F7Y A;  5BZB A;  2YXY A;  3ABU A;  5JH7 B;  4WCE V;  4DV0 B;  4J7Z A;  4DV5 B;  2QTO A;  1K9M W;  4JI3 B;  3OUF A;  3ZIA G;  4B08 A;  4YJ2 B;  5LYJ B;  2RQ6 A;  2QEX V;  2CAZ C;  4PI0 A;  3L72 H;  4DK0 A;  3OMN B;  4DUZ B;  1YXB A;  3N27 A;  2ZE5 A;  1IX9 A;  4LFB O;  4JI2 O;  4PA9 A;  1H8E G;  2FB5 A;  3H1L H;  4X65 B;  4LF6 B;  2JJ2 G;  3APO A;  4DRX B;  2DYS C;  3E22 A;  3RYF A;  3UCS C;  2VS0 A;  3RVZ A;  1FKA O;  3CD6 V;  3VQW A;  3VQY A;  1GM7 A;  1NR1 A;  4JV5 O;  1S76 D;  3OTO B;  1SQV H;  3OE7 G;  5LOV A;  4GCZ A;  3JAL B;  2Q67 A;  1JMK C;  4IHJ A;  4JGS A;  5GTH Z;  3T1H B;  5DED A;  2F1M A;  3K03 A;  3B4S A;  2BE3 A;  1BS3 A;  3KCY A;  5LHG A;  1BL8 A;  1RSO B;  1Y76 B;  1VP7 A;  3E22 B;  4LFC B;  1N32 O;  4JI0 O;  5B66 Z;  3IFX A;  1M1K W;  2UXN A;  1B04 A;  2R9A A;  2PYJ A;  5IJ0 B;  3AG2 C;  3FD9 A;  1COW G;  2ITD C;  1NZ6 A;  2ZNI A;  2DWD C;  4TWK A;  5CMU A;  3M99 B;  1IUR A;  4UFZ A;  1SQX H;  1NKD A;  1ZTE A;  4X62 B;  2CUG A;  5FPO A;  4F6E A;  1MZF A;  2JGD B;  3JSN A;  1NI8 A;  3WB2 A;  1VAR A;  3CWB H;  3ETD A;  2F43 G;  5KHH A;  5LGT A;  4P9P A;  4BW5 A;  1GK9 A;  2WLI B;  1S5J A;  4DR5 O;  3ABT A;  4DXW A;  4RAI A;  1OHH G;  1KQS U;  1SER A;  1MAB G;  1N0J A;  4YHH O;  2HFE C;  2FTK A;  1WPX A;  3QVN A;  2QTS A;  2B5U A;  3RYF B;  1X59 A;  4B3T O;  4LF8 O;  1OCR C;  2ZNJ A;  4GX5 A;  4PDM A;  3FAV A;  5KHG A;  5KMG A;  2HG5 C;  1FFX B;  1CXZ B;  4JI6 B;  5CB4 A;  4PJ0 Z;  1TA8 A;  5LA6 A;  3CRC A;  4LF5 O;  2Y48 A;  2A9H A;  1WAZ A;  3ZMT A;  4ABM A;  4IHJ B;  2ITC C;  1K7D A;  3K5L A;  3N2G B;  1Y74 B;  2V7Q G;  4JYY A;  3ZHR A;  1SZT A;  4RUF A;  1R6K A;  2QKS A;  1EZJ A;  3SJA C;  5CB4 B;  4DYL A;  1YHQ V;  1PM9 A;  3A8T A;  3O65 A;  3OW2 U;  1WA8 B;  3FX7 A;  1MA1 A;  2UU9 O;  4LC1 A;  5GON B;  3GVM A;  2B9Z A;  4YHH B;  4ZIB A;  4FLZ A;  2F66 C;  3SYQ A;  4P9O A;  4TV9 B;  5LA6 B;  2QWQ B;  5F2V O;  5IY5 C;  4GKJ B;  2AGA A;  1PNK A;  4FZ1 A;  1FS0 G;  4JI1 O;  1AR1 B;  1W0J G;  5GW7 A;  4X62 O;  1SET A;  4J9Y B;  1M5I A;  5IYZ A;  3RN4 A;  1I0H A;  3SJQ C;  1H2N A;  2HEP A;  4DR1 B;  4JI4 O;  2KSD A;  4UB6 Z;  3QF7 A;  1VQ5 V;  2IU3 A;  5DEC A;  2XAH A;  1J95 A;  3D36 C;  4PDR A;  1XMO B;  2KG7 A;  4WFE A;  3KZI Z;  4FLT A;  3DTU B;  4FFB B;  4JYA O;  1BHB A;  4LFC O;  5H5N A;  4PD4 F;  2E74 B;  4UVC A;  1TUB A;  4MW8 A;  3CJH A;  2P4K A;  2XTA A;  5CA0 B;  4IIJ B;  1Z2G A;  3K5M A;  2DJV A;  5E1A C;  3B40 A;  5FLX N;  3T1H O;  2YEV A;  3JAW A;  5HFL A;  4OXS A;  1GH6 A;  2D3O W;  2E5L B;  1N33 O;  4K3A A;  3OTF A;  4JV5 B;  2CTW A;  3GWO A;  1S5H C;  2YUA A;  3CCS V;  4J80 A;  1SQQ H;  3CP1 A;  3LNN A;  1EN4 A; 
#chains in the Genus database with same CATH homology
 1L0N H;  1PP9 H;  4U3F H;  3TGU H;  3L71 H;  3CXH F;  3CWB H;  1SQB H;  4D6T H;  2IBZ H;  3H1L H;  3L75 H;  1PPJ H;  2FYU H;  1NU1 H;  1L0L H;  3H1I H;  5KLV H;  1SQV H;  3L73 H;  3CX5 F;  1NTK H;  1KB9 F;  3H1H H;  3BCC H;  3H1K H;  4PD4 F;  1BCC H;  3H1J H;  1SQP H;  3L74 H;  1NTZ H;  1KYO F;  1EZV H;  1BE3 H;  1P84 F;  3L70 H;  2BCC H;  1SQX H;  3L72 H;  1BGY H;  1SQQ H;  2A06 H;  1NTM H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...