1VQOV

The structure of ccpmn bound to the large ribosomal subunit haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vqoV00
4WFBV 3CCSV 1VQPV 1KQSU 4WFAV 1VQ9V 1K8AW 3CCQV 5DM6V 3CMAV 3CCUV 3I55V 3I56V 2QA4V 1YJWV 1S72V 3G4SV 3CXCU 3CC7V 3CCEV 1Q7YW 1W2BU 1KC8W 3G71V 1YI2V 4WCEV 1JJ2U 1K73W 3G6EV 3CMEV 1K9MW 1KD1W 3CCRV 1YHQV 1VQ4V 1M90W 1YIJV 1VQ7V 1NJIW 2QEXV 1Q81W 2D3OW 1VQ8V 1R73A 1Q82W 1Q86W 2OTLV 3CC2V 3OW2U 1VQNV 1QVFU 2OTJV 3CCJV 1VQMV 3CCLV 3CPWU 1VQ6V 3CCVV 1YJNV 1VQKV 1VQ5V 4WF9V 1QVGU 1VQLV 1N8RW 1YJ9V 1VQOV 1M1KW 3CC4V 1YITV 3CD6V 3CCMV
chains in the Genus database with same CATH superfamily
2E3CA 1NT2B 4UXNA 5LYJA 3BVOA 2K9PA 4PELA 2M6YA 3QNEA 1RM1C 1KD1W 4PDMA 4FFBB 2QE7G 4DXWA 3AK1A 3ETEA 2QKCA 2RCVA 3B4SA 3JALB 5B1AB 5B3SB 4MVQA 4LFBB 3HB3B 5LMNO 3SYPA 1SC5B 4PD4F 2H8PC 4N23A 3AK2A 1Q7YW 1K7DA 1SQFA 4OGQB 2H94A 3RW0A 1VEWA 3RYIB 2OYQA 1YF2A 1IZ3A 4XDLA 1R3JC 1SKVA 5FNVA 4LF6B 2OIGA 3JD2A 2ZNIA 3CCVV 5L3FA 1VQKV 3ZRWA 4OX9B 2Y69C 5CA3A 1TGOA 2KG7B 4Q6GA 1SQBH 3OMNB 2K1EA 1F7YA 4J7ZA 4YJ2A 3ZJZA 2GSMB 1QQCA 4JPRA 5IWAB 3GWOA 4JTAB 1AROP 3T1CA 3A8TA 5KHJA 2WLIB 4FLUA 3AG1C 5KX5B 2EZOA 1JVMA 3DXRA 3E8HA 1N32O 2HJFC 4DV4O 3K3WA 2YXYA 1JFFA 3ABLB 2AXTZ 5GTHZ 3WB0A 3CCLV 1MZFA 1CP9A 3HKCA 4XBFA 4DV0B 1YTFD 2XNDG 2F4VO 4TOIA 5TISZ 3SYQA 1AR1B 2IM9A 2DWEC 4FIPC 4ZOLA 3HKDA 4MVUA 2CTQA 4MW8A 2ITCC 1GM9A 4JI4B 4P2ZA 1COWG 2WLHA 2UXDB 2Q9LA 4CZZA 4MS2A 1HR0B 2RDCA 4FZ1A 1PD3A 2JJ2G 3K0GA 3UCSC 2QM8A 3JD1A 1QLNA 2Q5ZA 4YJ2B 1MZEA 1VQ9V 1P7GA 1TUEB 1BHAA 3CC7V 3H1HH 3K5MA 4KL1A 1O9HA 3HKBB 4IIJB 1KECA 4XDJA 3E2EA 1VQ7V 1G8MA 1PNMA 4LF7B 5KX5A 3JSLA 4MVMA 1N36O 2JK5C 1KB9F 2QM4A 4IL6Z 3OTOB 2CTRA 3B8MA 4DR6B 2ODMA 4LF8O 3K5NA 1Y6XA 4JYAO 4MT8A 1EZJA 3ICXA 3ETGA 2O57A 4EFEA 4DK1A 3HPLC 4MW3A 1U97A 5KMGB 2QEXV 3HKDB 5K1XA 2GHYA 4QPKA 4R6ZA 4TSFG 2HHHO 2P4VA 1S5JA 3CPWU 4X88A 1IXMA 1H2GA 2Y48A 3OMIB 4I0XB 4U7NA 1XL6A 5LHGA 2YXLA 4J41A 4JYCA 3QTCA 1SF9A 2FYUH 4O4HB 1GRJA 3U11A 2MW2B 3ETQA 1XNQB 3EVKA 2WLKA 3IFXA 3ZN0A 5HFLA 3RWRD 4BIUA 3EXAA 2WLMA 2EULA 4D6TH 2QM7A 4CS3A 2IJJA 5EBMC 4J10A 5L3EA 1F23A 5IT9N 1YJWV 2ZE6A 3G4SV 1VF7A 1TVKB 2ZDIA 3AG4B 2EILB 1SZTA 4LWSA 2VQFO 4RAIA 3B77A 4QE7A 1MMMA 4W4KA 3QG5A 2P5OA 3CJHA 3OM3B 4CC6A 4FJCC 4DUZO 4X65O 2QDOA 2PYLA 2AHYA 4JTCB 1FXKC 1NKDA 3M8AA 1PL0A 3BHPA 3GWKC 3N2KB 2YI9A 1XDCA 3JD0A 4BW9A 3ETDA 2P06A 2RN9A 3E35A 1FYJA 4O4JA 1WPBA 2UXXA 1JOYA 4I7ZB 1NTKH 3K57A 3OMAB 4OPHA 3ZS8C 3JD3A 1WPXA 4JAVA 1NTMH 2EINB 2CGOA 3VBBA 3T4DA 4JV5B 3BA9A 4FM0A 5BZBA 2F1MA 2H3OA 1B6QA 1ZX3A 4I55B 4X66O 1VP7A 1AR5A 2QA4V 4X1YB 4XDKA 2YXHA 1LUWA 1ZTEA 4X1IA 2IU3A 4JI5O 1FPOA 1NH2D 3RT3C 4LP8A 2E74B 3CRMA 1BZKA 3EHBB 3L70H 4J9YB 4I4TA 1N34B 1K8AW 3CRQA 3APQA 2AGAA 3CJHB 2LW1A 3ZRXA 3OTFA 5B3SC 1IBKB 2UUAO 2ZDIC 3L9DA 4K35A 3B09A 1M56C 5H6RA 1HP8A 5IYCO 2Q6AA 1K4DC 4J7JA 4K3AA 3OAAG 5CA0A 1NQTA 1R3LC 3JAMN 3S3WA 4LC1A 4WFAV 1VQPV 3C90A 4JI2O 4LR3A 3A0BZ 2B5UA 3JAWB 3CCRV 4B3MO 4RO2A 1S3JA 3CEIA 4JYAB 5L3DA 4DV5B 2ZCEA 2Q4PA 4QE9A 1GTOA 1KKCA 3ZIAG 4X1YA 2JS5A 2LP7A 3DTUB 2VWKA 3JATB 2UUBO 4GUNA 2F66C 3AG7A 3W7SA 1ZUQA 3FB6C 4FZ0A 2NR5A 1YIJV 3AG1B 3OUSA 4LBEC 3CSXA 2QWNB 2DYSB 1IBMO 5DECA 2FTKA 1WLEA 1NVPB 2PI4A 1M57B 1E1QG 3SPGA 1K5SA 1M57C 3CWBH 3KCXA 4PV1B 4JV5O 1Y74B 4FVMA 1WNSA 1XHXA 2LO1A 2UUCO 2LFRA 4JI2B 1OCZB 1THZA 5CA0B 2JGDB 3RYHB 2F93B 2QSAA 5BR8O 2WLIA 3LSSA 5JCOA 2EJRA 3CHXA 3F7VC 2DQ3A 4PA4A 4DV7B 2ZD9A 2OIEA 4GKJO 2ZR3A 4DUZB 1VF6C 1ORQC 3FFQA 5LA6B 1KBHA 4GYCB 3F7YC 4LF5B 2OTJV 1B06A 3HKCB 1PNKA 2JGUA 4TQDA 4CS2A 1JQ0A 1HNZB 4J9ZB 4NR1A 1SESA 1XILA 3CCSV 4IGGA 1SA0A 3BRCA 1XOUA 3ZRSA 2BTQB 2LQTA 2DW4A 2BSKB 1NZ6A 1YHQV 2XAFA 1WB8A 5EYPA 3K5LA 4LF9O 3WU2Z 1VQ6V 4J80A 3LNMB 2Z0AA 1DF5A 2W0XA 4R50A 3OFNG 2IH3C 4D7SA 4DR4B 4JI6O 2VQEO 3E8BA 5LYJB 3CXCU 1YI2V 4WCEV 2DWDC 3WG7C 1W0JG 3AG3C 3STZC 4YJ3A 4DR4O 4FFBA 4ZIBA 3R65A 2ZR2A 2Z3YA 3JALA 1RPRA 1QVGU 3SJQC 1XMOB 2Y0PA 3FYEB 1ZSPA 5LA6A 1J5EO 1AJPA 5IE9A 5GW7A 1NI8A 1XUQA 1JMKC 2DYSC 5BMVB 2CTPA 3TETA 5FPRA 1QR8A 3GB7C 2PY5A 1X59A 1FFXB 4JI8B 1AP6A 3O65A 1N0JA 1SQQH 2EIKC 4TV8A 3UO2A 3CB2A 3LSQA 5L3BA 2NLJC 1PM9A 3LDDA 1F4NA 2PUSA 4WFHA 1XI1A 1VF6A 2KB1A 2XT9A 2ZM6B 1DGSA 3CRRA 1OCRC 3FAVB 5IYDO 1M90W 1N34O 4GKKO 1DF4A 3ASOC 2D3OW 3JAKB 1N32B 3ML0A 4BAYA 4JZGA 4H13B 4AI8A 4NB5A 2JVDA 4YJ3B 3P3PA 4PA9A 3QF7A 4H44B 4LCUC 4BW5A 4LH6A 4H37A 5GTIZ 4X66B 1GH6A 4PDRA 1RSOB 3DC5A 1H2KA 5H5NA 2IJHA 4KP4A 3ZX6A 1R3IC 2PI5A 3ZMTA 5BMVA 2GUZB 2QTOA 3QO5A 5JWPA 1TUBA 1KU9A 1ZAUA 4Z2WA 1KQSU 3WG7B 4HAMA 1FD9A 1K33A 3LDEA 3CCUV 4B3TB 5LHHA 2EJ7A 5KAFZ 2Y69B 2LFSA 1FS0G 4JI5B 2CGNA 4DW1A 2ARHA 1O9GA 3H9VA 3L75H 1G6UA 4JI6B 2YEVB 2XAGA 3N2KA 4JAUA 4UCRA 1D5AA 3H1JH 3PJSK 1WA8B 2N05A 2RJZA 3G67A 1XMOO 3E8GA 4OX9O 1Q6IA 3CRAA 4B3RB 4QPJA 4O4JB 4DV3B 2HVKC 4TT3G 2Y4TA 1XMQO 3ZHUA 3K79A 4DR6O 1P49A 5CN0A 5E1AC 3BEHA 4A5UB 1XEQA 3JSNA 1KYOF 1QCEA 2BCCH 3ASNC 3CX5F 4GX1A 3ABUA 4UCTA 4DUYB 4RQEA 5CBGA 4X65B 3JASB 4UB6Z 1G1XB 4DK0A 4NTYA 3OUFA 1SQGA 2UU9O 4ZBMA 2ZIMA 3K9AA 2GV9A 4ABMA 3TXQA 2X7RB 4PHZA 4B08A 3OT7A 4FLZA 3BFRA 5B1BC 3UO3A 5GONA 3CD6V 1I5YA 2N74A 5H6QA 5F2VO 4YHHB 3H1IH 3WB2A 4I5SA 3SPCA 1CEZA 1M56B 1VIBA 3ZN1A 4DR5O 1VQNV 4EEQA 1ENVA 2C2AA 1EBOA 4O4HA 4CH3A 1MSDA 2P67A 4P30A 1WJZA 2EIKB 4GLXA 2CTWA 1US6A 3J80N 1Z2GA 4PI0A 4DV5O 1YJ9V 1VQOV 1M9NA 4NTXA 2W6JG 3IGAC 3NXSA 3I55V 3QO8A 2OWOA 4JTDB 4Z1VA 1Q90D 4HZ3A 2UXCB 1W0KG 1A32A 2V1DA 4GX2A 4E4EA 3K04A 5LMUB 4I9QA 2UUAB 4CBCA 5KLVH 1BQZA 4U7OA 4CH6A 1MABG 4F6RA 4IYIA 1F4MA 4UCUA 1YCIA 2YS8A 4QNHB 1HNWO 1GN4A 1W2BU 3SPJA 5KA6A 4HBNA 5EBLC 2ILMA 4LNUA 1GKFA 4P9OA 1R1BA 4K8ZA 1BT8A 1NS1A 4O4IA 1CXZB 5JJJB 3ZHTA 3SGIA 1EN4A 5KHIA 2CE4A 3L74H 3SYAA 1YZBA 2ZQMA 5KHKA 3G6EV 2A9HA 2GBOA 1MA1A 1FXVA 4LFBO 1SERA 3M99B 5CB4A 4NKGB 1QHTA 5HFMA 4WFGA 1LR1A 2QKSA 2FMLA 2Q67A 3SYCA 1TA8A 2X6AA 4DYLA 1NU1H 4I50B 1SRYA 5B1NA 2HVJC 1YEWA 1FJGB 1XBLA 5A9GA 3E86A 4DV1O 1K73W 3M7MX 4PI2A 2OT5A 2GUZA 1P84F 2VS0A 1CPYA 4E2LA 5LOVA 2ATKC 3RYFB 2LJ2A 1N8RW 2VQFB 4HNAA 1NR7A 2ADPA 4NTWA 5ITZB 2QR4A 2YIDA 5IYZB 2JS3A 4B7KA 1Q43A 4MTFA 4TWKA 4NYKA 2V4DA 1Q81W 4UFZA 1PP9H 1B04A 2GTSA 4YXWG 3AG4C 1PPJH 2ZINA 4W4LA 5KUMA 4DV2O 5K1PA 1AB3A 2ZKOA 1I94O 2RMKB 3Q4HB 1AR4A 2FB5A 5J9PC 4FPPA 3CCEV 3ABKB 4WFEA 5J2UB 2Q69A 5EZYB 2DQ0A 4DV2B 4UVBA 4PA7A 1EN5A 2HG5C 4O4LA 3CRCA 3SR2C 1JFFB 1JX9A 1RP3B 3JD4A 4NVPA 5B66Z 1WB7A 1PKXA 5IY5B 1JJ2U 1R6KA 1VQ4V 1SS3A 4RQFA 3ZRVA 3TGUH 3JAKA 2VWJA 1QNMA 2DMXA 2E76B 2ZM6O 3UT5B 4MVZA 1SZXA 1MNGA 5CBFA 1OCOC 3HKEB 4JYBA 2YDEA 4GZRB 2YIBD 2A3QA 5KHGA 5JH7B 2P22C 3L71H 3K06A 5C93A 1VMGA 4B3RO 1QVFU 4R7CA 1T5EA 2BTOA 1ROPA 4TUYA 1XQ8A 4UVCA 4TQFA 1E1RG 3JYCA 3E83A 4WBNB 2Q0AA 2KSDA 3SJBC 2BTQA 2RQ6A 1Y76B 4IYHA 1VQ8V 4D7TA 2IJIA 1B3QA 1HW7A 3RGBA 3W7TA 1GM7A 2UUBB 4PDLA 4O2BB 1LUVA 1VF5B 1S77D 2Z5UA 3E22A 2EIMB 4FMTA 3CCQV 3UM7A 2Q7GA 1ZLZA 3ZRWB 4X64O 2A0LA 1K9MW 4H0LB 4DRXA 5LGUA 4JI4O 4JASA 1HWYA 3K5OA 4YIPA 3TXSA 1KMIZ 5JQGB 5E79Z 1GN2A 2QWRB 5KA5A 4O2AA 1M1KW 3W7WA 2EIJC 2UXBO 1ZL8B 4MVRA 5LP6C 4U3FH 4MTXA 2W6IG 3JATA 4P9PA 1XNRO 4DR7O 4DV0O 2PTMA 3EFFK 3CC2V 5H2FZ 5LHIA 1WAZA 3K59A 2OTLV 3E89A 3QO7A 2YC0A 4GKJB 5EK0A 1NBMG 3ZHRA 3OEEG 3T1HO 4X1KB 4ZOLB 3KZIZ 5LOVB 3FKSG 1FKAO 2YUAA 3K0DA 3LUTB 1PNLA 3RYFA 2GDSA 4LF4O 5ITZA 2FKXA 2Q68A 2OCCC 3AG2B 3FB5C 4PA6A 4DR2B 4F6EA 4IIJA 5LP6A 4NXMB 2HLDG 4KHPO 4FFKA 1BGYH 1S5HC 4JAAA 3I56V 3ZMUA 4FLYA 3PN1A 2L35A 2XAQA 1S5LZ 4EFBA 4PA3A 5IJ0B 2UXNA 2P6JA 2HR3A 2PGGA 5D5PA 2AHZA 3CCMV 5L3CA 2PF4E 4WFBV 3HR0A 3UKMA 3FD9A 4JI1O 4FM1A 1RM1B 4LFAO 3K58A 3K08A 4FLWA 3ABTA 5FNVB 3ZEDA 4NXNO 4GCZA 3A0HZ 4K0KB 3SPIA 5IJ9A 2ZIOA 3A2FA 2NNUA 5JVDB 4EB6A 4X1KA 1XMQB 1HNWB 5KAIZ 4DV3O 1I5XA 4QGPA 3ZHVA 4AQYB 2HJDA 1DLBA 3U10A 1WA8A 2CDYA 3ZMZA 4I0XA 2ETNA 5L3GA 4O4IB 1Q8IA 3DGEA 2P7TC 2XOKG 3ABLC 1R3KC 2Q8VA 1AI6A 1E79G 1XREA 4C7UA 2XAJA 5J2TA 3DXRB 1TVKA 1LNQA 1H2MA 4LWSB 3X2QB 4ZHQA 3O9OA 4DR3O 5FPOA 4ZI7B 3P32A 3ZHQA 1J95A 2NN4A 1K4CC 2G38A 3KKYA 1NR1A 2QJ1A 4YIOA 3OR7C 1V55C 2PZSA 2CH7A 2QGNA 1IURA 2GTAA 3ABKC 1IBKO 5GONB 2KQXA 2XAHA 1M5IA 1BQ0A 1IXBA 1FXKB 2KKWA 3ASNB 3BABA 4ICGA 2N04A 1JR9A 2QWPB 1H2LA 1H2SB 2F43G 3N2GA 5FL7G 4L8JA 2BOBC 1NVPD 3S3XA 1R6NA 2JEUA 1L0NH 4OPAA 3SPHA 4R8CA 3OGIB 2VQEB 4OXSA 5IYZA 1HR0O 3HKBA 4PDVA 4DR1B 4JI3O 2EX3A 5J2TB 4F4LA 3OW2U 1RPOA 4O4LB 2JIZG 4IHJB 2LGWA 4JGSA 3OGCC 3VOUA 5KMGA 3VQYA 1ZWIC 2A7WA 4JI7B 1AP5A 1IBLB 3QVNA 2WA4A 5C8YB 3MAQA 3DC6A 4I4TB 1BMFG 4X8AA 4RUFA 1M93A 2BSKA 2DN9A 4GT1A 4G2KA 3G6BA 3UT5A 2R9AA 4BIOA 5EYPB 1YDXA 5LL6Y 4MSWC 4X62O 1JPXA 2YI8A 4ASUG 1MG1A 2WPDG 2YICA 3FYIB 1Q3EA 3F5WC 3JCUZ 1SQPH 1KC8W 3R66A 1JJOA 2JDIG 2JRIA 1KP3A 3RBZA 5H9CA 1J5EB 1OCZC 2HP8A 3E8FA 4DV4B 2IU0A 3JAWA 3IJ4A 2ZE5A 3HKEA 1FJGO 2YSUB 1WN7A 3SYOA 4IT5A 4I50A 3DSQA 5JH7A 3LDCA 3D3IA 1L8DA 2CAZC 5B1AC 4MTGA 3CYOA 2XUMA 4HYOA 1V54B 4O2BA 1IVSA 4FM2A 4CH5A 3IC9A 5EC2C 3JCZA 1AI5A 4UCSA 2UU9B 4WBNA 1FFXA 3T4ZA 1K3EA 4JI0O 2UXDO 4CS4A 1H38A 5BY1A 4RWUA 4N21A 2E5LB 4J11A 5LMUO 3OEHG 2EZPA 2DE0X 4DV6O 3L73H 1KP2A 4X62B 1MOFA 3A0RA 3FB8C 3OE7G 1PL4A 5LGTA 4JI3B 5JQGA 1VQMV 1Y74A 2L6LA 4B7EA 2WLLA 4O2AB 1N36B 3VQXA 2R72A 1ZL8A 2UUCB 3FX7A 1OZ0A 4H33A 4X1IB 3STLC 2R9IA 1AJNA 1EZVH 3B2EE 5EZYA 2JJ1G 3H01A 4MTOA 1IBMB 1XL4A 3JARB 1IBLO 1H8EG 1GM8A 1H2NA 4JF3A 1XHZA 1VQLV 4ZI7A 2AZ2A 3ASOB 2Q0OC 2XTAA 2WLJA 3BCCH 1OHHG 2D2CB 4BWAA 1TUBB 4F6RB 3IC7A 3K03A 2WLNA 2X6CA 2AW9A 1AILA 5IYBO 3RYCB 1IX9A 3H1LH 1Q6HA 1EN6A 2Q7HA 2QWOB 1OJHA 5LXTA 5IDJA 1Z5VA 2IBZH 4DV7O 1UFIA 3H1KH 3C3TA 5LBQA 1YSCA 3G71V 4YY3O 4CH4A 2FL4A 4LF5O 3K9SA 4B3TO 4AHCA 1YTFB 1IDSA 1W59A 2ITDC 5IWAO 4QIWF 1K5QA 5KHHA 3TJTA 1BS3A 5DM6V 4JZ2A 2ZE7A 1S72V 1OV9A 5CA1A 3MHSC 4U3JA 5IJ0A 4UB8Z 2WSSG 5BXZA 4X89A 4DV6B 3N27A 5IY5C 3TCUA 1MSWD 3FAVA 2DOSA 2HEPA 3OD4A 3MHHC 2R9RB 1EFRG 1XNQO 3RYCA 1VARA 3UQ8A 1JCHA 4FLTA 2F4VB 5C8YA 2WWWA 3ABMB 4LFCO 4BIZA 3ABMC 4ZKIA 4B3SO 1GMGA 1TAEA 4AQYO 1XNRB 3VQWA 3ZBHA 4JI7O 2B1IA 4B3MB 4LFCB 3LSUA 3U0ZA 3I5DA 1HNXB 1FFTB 1RFYA 2X0LA 1Y67A 4ZHQB 1N33B 4UCOA 2BOCC 1N0NA 3OR6C 1NTZH 4UVAA 2Y0IA 2ADQB 3RVYA 5LMNB 3WB1A 1QLEB 5LGNA 1F51A 5J2UA 2BE3A 4KXRA 1RSOA 4LF6O 4UV8A 2ZNJA 1FAFA 3CMAV 1N4CA 2DJVA 1YXBA 3VQVA 3W7UA 1Z5WA 3P3NA 4TV9B 1DK1A 4KHPB 1GN6A 4Q20A 1Y4MA 4KUMA 4DR2O 1L0LH 2RNBA 3ZCCA 3J81N 1P7BA 4LNUB 3BAAA 2HHHB 1AI4A 1UPGA 2W0FC 3APOA 1QBZA 1FXKA 2B1GA 2IH1C 1V55B 4KFMA 2V7QG 2KG7A 1OCOB 4L87A 1YVWA 3N2GB 1WP7A 1UJWB 1I94B 1URFA 2EINC 4Z1MG 1K34A 3D3QA 4AILC 2X6BA 3P30A 2OCHA 2B9ZA 2Y4UA 2EILC 1G4YB 4K0KO 1QU7A 4PJ0Z 3D36C 4NXNB 4G28B 1SQVH 1PV0A 3B8NA 1OCRB 2MK3A 1Q5OA 1NJIW 1K92A 4LF8B 4TV8B 3KCYA 1S0VA 1Y66A 3TK1A 4FLVA 3SDLA 3JASA 5A2QN 4DUYO 4J7KA 1NH2B 4DW0A 2LGQA 1R6TA 4QJFB 5BR8B 3ZMVA 1BHBA 3E22B 1S76D 3D36A 1GN3A 5JJNB 4MVOA 3CMEV 2JGDA 3RYHA 3FB7C 1Q82W 1GAXA 1Q86W 1HNXO 2YIAA 1I7FA 3L72H 1Q6UA 4JI1B 3RVZA 4DR3B 3AK3A 4GKKB 2A06H 4FLXA 2ZXWB 1HNZO 4MVSA 5JCOC 2ZXWC 3T2MA 2OCCB 3AG2C 2M7WA 1WP8A 5FLXN 4DO2A 5JJEB 3CS5A 3W7XA 4NXMO 2QWQB 5DEDA 3RYIA 2CK3G 5EIBD 4LF9B 3BPZA 3NR7A 1YITV 1K97A 1V54C 2ZT9B 4K8XA 2HKOA 5CBHA 2IJKA 4RUEA 1X4TA 2XASA 1BCCH 3G80A 4X9QA 2P90A 1I08A 4JYYA 5KUKA 1L1FA 1N33O 4DV1B 2LW7A 4UUJC 4FK5C 1FXHA 3CP1A 1D5NA 3C3SA 2WLLB 3CE2A 4DR5B 4LFAB 1GK9A 2E5LO 3BY6A 3CC4V 2ZE8A 5B1OA 2EIJB 3WFVA 4I9WA 5AG2A 4EKWA 4DR1O 5LP6B 5EBWC 1EM1A 1SQXH 3T1YB 4LF4B 3AEIA 3BA8A 1V9PA 2PYJA 4J42A 2UXBB 2QKAA 1JA8A 1M4UA 1VQ5V 4DR7B 2HFEC 5B1BB 1QR9A 4IHJA 5CB4B 2F23A 4YY3B 2XHBA 2IW5A 2A79B 1AI7A 4TUYB 5D5QA 4JI8O 1DTOA 2WAMA 3CXHF 3MDSA 5B5EZ 2R70A 1GO3F 3JARA 3GVMA 2EBOA 2P4KA 2QTSA 4HNAB 1Y76A 2F95B 1P4RA 5LXTB 5IJ9B 4WF9V 1BE3H 3T1HB 4X20A 4GX0A 4EB6B 5JVDA 2YIBA 4TV9A 3AG3B 2UXCO 3OTOO 4I55A 3MD0A 5EIBC 2E75B 3RN4A 2DYRB 4G27B 4CC5A 1R73A 2DYRC 4DRXB 3Q4HA 3T1YO 1U96A 4UCVA 3THOA 3ZHSA 2EIMC 1BSMA 1KKDA 1KUQA 3LNNA 3IAYA 2Q73A 3F5TA 5CA1B 3RFRA 1SETA 4GX5A 3X2QC 4JI0B 1H8HG 1I0HA 3B40A 3SJCC 2Q7EA 4X64B 3SJAC 2CH7B 2CUGA 3KG2A 4LF7O 1QLEC 1SA0B 1AVMA 1BL8A 4U3JB 1D2DA 4LH7A 3J7AU 5DN6G 1OCCC 4UV9A 4X20B 1AJQA 4BR6A 3D8CA 1OCCB 2WA3A 4B3SB 5CMUA 3CCJV 4WFFA 2YEVA 2JEXA 1YJNV 3ZMSA 5EC1C 4YHHO 2AZ0A 1HDJA 2VRZA
chains in the Genus database with same CATH topology
5CBFA 3CCSV 1OCOC 4JYBA 1OHHG 3ZRSA 4UXNA 4PELA 3QNEA 2DW4A 3IC7A 3K03A 1RM1C 2WLNA 2X6CA 1KD1W 1YHQV 5IYBO 4PDMA 2XAFA 2QE7G 3K06A 4DXWA 3ETEA 4WFAV 5C93A 1QVFU 4R7CA 1ROPA 1VQ6V 5IDJA 3LNMB 5B1AB 1DF5A 5B3SB 4MVQA 4UVCA 3HB3B 3SYPA 4R50A 3OFNG 1E1RG 2IH3C 3JYCA 3E83A 2H8PC 4N23A 3E8BA 5LBQA 1YSCA 3CXCU 1Q7YW 1K7DA 3G71V 1YI2V 4WCEV 1VQ8V 2DWDC 2H94A 2IJIA 3RW0A 3WG7C 1W0JG 3AG3C 3STZC 3W7TA 1GM7A 4XDLA 1R3JC 4PDLA 3JD2A 3R65A 1S77D 3CCVV 2ZR2A 5L3FA 2Z3YA 1YTFB 1VQKV 3ZRWA 1RPRA 2Z5UA 3SJQC 1QVGU 2Y69C 5CA3A 2EIMB 3FYEB 4FMTA 2ITDC 4QIWF 1AJPA 1K5QA 3OMNB 5GW7A 3CCQV 3UM7A 2K1EA 5DM6V 2DYSC 1S72V 3ZRWB 3MHSC 3TETA 3ZJZA 2GSMB 2A0LA 1K9MW 5LGUA 1QR8A 4JASA 4JPRA 3GB7C 3GWOA 4JTAB 2WSSG 1HWYA 1AROP 3T1CA 4X89A 5IY5C 2EIKC 2WLIB 3TCUA 5KA5A 1MSWD 3AG1C 3LSQA 5L3BA 3MHHC 2NLJC 3W7WA 2EIJC 1M1KW 3LDDA 2R9RB 1F4NA 1EFRG 4MVRA 4WFHA 4MTXA 2W6IG 4P9PA 1JCHA 2KB1A 2EZOA 2WWWA 1JVMA 3ABMB 4BIZA 1OCRC 3E8HA 3EFFK 3ABMC 3CC2V 4ZKIA 2HJFC 5IYDO 1M90W 1GMGA 3K3WA 5LHIA 1DF4A 3ASOC 2D3OW 2OTLV 3ABLB 3E89A 3QO7A 2B1IA 3CCLV 3ML0A 4BAYA 1CP9A 1YTFD 4XBFA 2XNDG 5EK0A 1FFTB 1NBMG 2X0LA 3SYQA 1AR1B 2DWEC 4FIPC 4MVUA 4MW8A 2ITCC 1GM9A 2BOCC 4PA9A 3OEEG 4P2ZA 3OR6C 4LCUC 4BW5A 4H37A 1COWG 4UVAA 2WLHA 3RVYA 3FKSG 1QLEB 3K0DA 3LUTB 4PDRA 5LGNA 1F51A 1PNLA 4CZZA 4MS2A 1PD3A 2IJHA 4KP4A 2JJ2G 3K0GA 1R3IC 2QM8A 3JD1A 1QLNA 2PI5A 3ZMTA 2Q68A 2OCCC 2QTOA 3AG2B 3FB5C 3QO5A 4PA6A 4UV8A 2HLDG 1KQSU 1VQ9V 3WG7B 4HAMA 1K33A 1S5HC 3LDEA 3CMAV 3CCUV 1TUEB 3I56V 1BHAA 3ZMUA 5LHHA 3CC7V 2Y69B 4XDJA 1KECA 1FS0G 2LFSA 3W7UA 3E2EA 1VQ7V 1G8MA 1PNMA 2XAQA 4PA3A 4Q20A 4MVMA 1Y4MA 2JK5C 4KUMA 2UXNA 2P6JA 2HR3A 3B8MA 3ZCCA 1P7BA 1AI4A 2YEVB 2W0FC 1QBZA 2AHZA 1FXKA 2B1GA 2IH1C 2XAGA 1V55B 4JAUA 4KFMA 4MT8A 2V7QG 3UKMA 5L3CA 4WFBV 1EZJA 3PJSK 1OCOB 4L87A 3ETGA 1RM1B 3E8GA 3K08A 3ABTA 1UJWB 3HPLC 4QPJA 4MW3A 2EINC 4Z1MG 1K34A 2HVKC 4GCZA 4TT3G 2QEXV 2GHYA 4QPKA 3K79A 4R6ZA 4TSFG 3SPIA 5CN0A 2X6BA 3P30A 5E1AC 3CPWU 4X88A 3BEHA 1IXMA 2NNUA 1H2GA 2Y48A 2EILC 1G4YB 3OMIB 1I5XA 1QCEA 4G28B 4U7NA 3CCMV 1XL6A 5LHGA 3ASNC 4GX1A 3ABUA 4JYCA 4RQEA 1DLBA 3B8NA 5CBGA 1OCRB 2MK3A 3ZMZA 5L3GA 1NJIW 1K92A 3OUFA 1S0VA 4ZBMA 1Y66A 3K9AA 2WLKA 3TK1A 3IFXA 3DGEA 2P7TC 2XOKG 3ZN0A 5HFLA 3ABLC 4BIUA 1R3KC 2WLMA 1AI6A 1E79G 2X7RB 1NH2B 2QM7A 2IJJA 2XAJA 5EBMC 5B1BC 4QJFB 5L3EA 3ZMVA 1BHBA 1LNQA 3CD6V 1I5YA 5H6QA 3X2QB 1S76D 3D36A 1F23A 4I5SA 3P32A 3SPCA 1M56B 3ZN1A 1YJWV 3G4SV 1VQNV 1CEZA 4MVOA 1J95A 3CMEV 1ENVA 2ZDIA 3AG4B 2EILB 1K4CC 1SZTA 1EBOA 2C2AA 3FB7C 2P67A 4RAIA 1NR1A 3B77A 4P30A 4QE7A 3OR7C 1V55C 1Q82W 1Q86W 2EIKB 3OM3B 4FJCC 3RVZA 3ABKC 1YJ9V 1VQOV 1M9NA 2AHYA 2W6JG 4JTCB 1FXKC 2ZXWB 2XAHA 1NKDA 3IGAC 4MVSA 3NXSA 1PL0A 1FXKB 2ZXWC 3ASNB 3T2MA 3I55V 3JD0A 2OCCB 3AG2C 3QO8A 3ETDA 2M7WA 2F43G 3E35A 4JTDB 5FL7G 4DO2A 2BOBC 4HZ3A 3W7XA 1NVPD 2UXXA 1R6NA 2JEUA 1JOYA 1W0KG 2V1DA 4GX2A 3SPHA 3OMAB 3JD3A 1WPXA 2CK3G 3K04A 4R8CA 4JAVA 3VBBA 2EINB 3T4DA 4CBCA 1YITV 4OXSA 5BZBA 1K97A 4U7OA 1V54C 1MABG 1B6QA 1F4MA 2HKOA 4QNHB 2QA4V 5CBHA 1W2BU 3SPJA 2IJKA 4PDVA 4RUEA 2XASA 5KA6A 4XDKA 2P90A 5EBLC 4P9OA 1GKFA 5KUKA 1L1FA 4F4LA 4UUJC 4FK5C 2IU3A 3OW2U 1FXHA 3CP1A 2WLLB 1RPOA 1NH2D 4LP8A 2JIZG 1GK9A 3BY6A 3EHBB 3CC4V 5B1OA 4JGSA 4J9YB 2EIJB 3OGCC 3WFVA 4I9WA 4EKWA 1K8AW 3VOUA 1ZWIC 5EBWC 3SYAA 2ZQMA 3G6EV 2A9HA 3ZRXA 5B3SC 3AEIA 1FXVA 1SERA 1BMFG 3M99B 2ZDIC 4X8AA 1M56C 5H6RA 4RUFA 5HFMA 4GT1A 4G2KA 5IYCO 1VQ5V 2Q6AA 4WFGA 1K4DC 2QKSA 2HFEC 2Q67A 3OAAG 5B1BB 1NQTA 1R3LC 3SYCA 1QR9A 2X6AA 1VQPV 4LC1A 4MSWC 1JPXA 1SRYA 1MG1A 2WPDG 2IW5A 2HVJC 5B1NA 4ASUG 2A79B 1AI7A 3FYIB 3E86A 3F5WC 1KC8W 1DTOA 2WAMA 1K73W 2B5UA 3CCRV 2JDIG 1GO3F 1KP3A 4RO2A 3RBZA 2EBOA 1S3JA 2OT5A 5H9CA 5L3DA 1OCZC 3E8FA 4QE9A 1CPYA 1GTOA 1P4RA 2IU0A 4E2LA 3ZIAG 2LP7A 3DTUB 4WF9V 2ATKC 1N8RW 2YSUB 4GX0A 3SYOA 1NR7A 3AG3B 3W7SA 3FB6C 3LDCA 3D3IA 3MD0A 5B1AC 4MTGA 3CYOA 1YIJV 3AG1B 4HYOA 4MTFA 1V54B 4TWKA 3OUSA 4LBEC 2DYRB 1Q81W 4G27B 1R73A 2DYRC 2DYSB 4YXWG 5EC2C 3JCZA 1AI5A 3AG4C 2FTKA 5KUMA 3T4ZA 1WLEA 1K3EA 2EIMC 1NVPB 2PI4A 1KKDA 1H38A 1M57B 1E1QG 4N21A 3SPGA 1K5SA 1M57C 5J9PC 4FPPA 3CCEV 3ABKB 4WFEA 3OEHG 2EZPA 1SETA 4GX5A 2Q69A 1KP2A 2DQ0A 2LFRA 3X2QC 1MOFA 3A0RA 3FB8C 3OE7G 1OCZB 1THZA 5LGTA 1H8HG 4UVBA 4PA7A 2WLIA 1VQMV 3LSSA 2WLLA 2HG5C 2EJRA 3KG2A 1JX9A 3F7VC 2DQ3A 4PA4A 1QLEC 3JD4A 1BL8A 2ZD9A 1OZ0A 4H33A 2ZR3A 1JJ2U 1PKXA 5IY5B 3STLC 2R9IA 1R6KA 5DN6G 1AJNA 1VQ4V 4RQFA 1ORQC 1OCCC 4UV9A 3ZRVA 1AJQA 2JJ1G 3H01A 4MTOA 1OCCB 1XL4A 5CMUA 3F7YC 1H8EG 2OTJV 3CCJV 4WFFA 1GM8A 2YEVA 4JF3A 2JEXA 1PNKA 1YJNV 1VQLV 3ZMSA 1JQ0A 5EC1C 4MVZA 4J9ZB 3ASOB 2WLJA 1SESA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WFB V;  3CCS V;  1VQP V;  1KQS U;  4WFA V;  1VQ9 V;  1K8A W;  3CCQ V;  5DM6 V;  3CMA V;  3CCU V;  3I55 V;  3I56 V;  2QA4 V;  1YJW V;  1S72 V;  3G4S V;  3CXC U;  3CC7 V;  3CCE V;  1Q7Y W;  1W2B U;  1KC8 W;  3G71 V;  1YI2 V;  4WCE V;  1JJ2 U;  1K73 W;  3G6E V;  3CME V;  1K9M W;  1KD1 W;  3CCR V;  1YHQ V;  1VQ4 V;  1M90 W;  1YIJ V;  1VQ7 V;  1NJI W;  2QEX V;  1Q81 W;  2D3O W;  1VQ8 V;  1R73 A;  1Q82 W;  1Q86 W;  2OTL V;  3CC2 V;  3OW2 U;  1VQN V;  1QVF U;  2OTJ V;  3CCJ V;  1VQM V;  3CCL V;  3CPW U;  1VQ6 V;  3CCV V;  1YJN V;  1VQK V;  1VQ5 V;  4WF9 V;  1QVG U;  1VQL V;  1N8R W;  1YJ9 V;  1VQO V;  1M1K W;  3CC4 V;  1YIT V;  3CD6 V;  3CCM V; 
#chains in the Genus database with same CATH topology
 2E3C A;  1NT2 B;  4UXN A;  5LYJ A;  3BVO A;  2K9P A;  4PEL A;  2M6Y A;  3QNE A;  1RM1 C;  1KD1 W;  4PDM A;  4FFB B;  2QE7 G;  4DXW A;  3AK1 A;  3ETE A;  2QKC A;  2RCV A;  3B4S A;  3JAL B;  5B1A B;  5B3S B;  4MVQ A;  4LFB B;  3HB3 B;  5LMN O;  3SYP A;  1SC5 B;  4PD4 F;  2H8P C;  4N23 A;  3AK2 A;  1Q7Y W;  1K7D A;  1SQF A;  4OGQ B;  2H94 A;  3RW0 A;  1VEW A;  3RYI B;  2OYQ A;  1YF2 A;  1IZ3 A;  4XDL A;  1R3J C;  1SKV A;  5FNV A;  4LF6 B;  2OIG A;  3JD2 A;  2ZNI A;  3CCV V;  5L3F A;  1VQK V;  3ZRW A;  4OX9 B;  2Y69 C;  5CA3 A;  1TGO A;  2KG7 B;  4Q6G A;  1SQB H;  3OMN B;  2K1E A;  1F7Y A;  4J7Z A;  4YJ2 A;  3ZJZ A;  2GSM B;  1QQC A;  4JPR A;  5IWA B;  3GWO A;  4JTA B;  1ARO P;  3T1C A;  3A8T A;  5KHJ A;  2WLI B;  4FLU A;  3AG1 C;  5KX5 B;  2EZO A;  1JVM A;  3DXR A;  3E8H A;  1N32 O;  2HJF C;  4DV4 O;  3K3W A;  2YXY A;  1JFF A;  3ABL B;  2AXT Z;  5GTH Z;  3WB0 A;  3CCL V;  1MZF A;  1CP9 A;  3HKC A;  4XBF A;  4DV0 B;  1YTF D;  2XND G;  2F4V O;  4TOI A;  5TIS Z;  3SYQ A;  1AR1 B;  2IM9 A;  2DWE C;  4FIP C;  4ZOL A;  3HKD A;  4MVU A;  2CTQ A;  4MW8 A;  2ITC C;  1GM9 A;  4JI4 B;  4P2Z A;  1COW G;  2WLH A;  2UXD B;  2Q9L A;  4CZZ A;  4MS2 A;  1HR0 B;  2RDC A;  4FZ1 A;  1PD3 A;  2JJ2 G;  3K0G A;  3UCS C;  2QM8 A;  3JD1 A;  1QLN A;  2Q5Z A;  4YJ2 B;  1MZE A;  1VQ9 V;  1P7G A;  1TUE B;  1BHA A;  3CC7 V;  3H1H H;  3K5M A;  4KL1 A;  1O9H A;  3HKB B;  4IIJ B;  1KEC A;  4XDJ A;  3E2E A;  1VQ7 V;  1G8M A;  1PNM A;  4LF7 B;  5KX5 A;  3JSL A;  4MVM A;  1N36 O;  2JK5 C;  1KB9 F;  2QM4 A;  4IL6 Z;  3OTO B;  2CTR A;  3B8M A;  4DR6 B;  2ODM A;  4LF8 O;  3K5N A;  1Y6X A;  4JYA O;  4MT8 A;  1EZJ A;  3ICX A;  3ETG A;  2O57 A;  4EFE A;  4DK1 A;  3HPL C;  4MW3 A;  1U97 A;  5KMG B;  2QEX V;  3HKD B;  5K1X A;  2GHY A;  4QPK A;  4R6Z A;  4TSF G;  2HHH O;  2P4V A;  1S5J A;  3CPW U;  4X88 A;  1IXM A;  1H2G A;  2Y48 A;  3OMI B;  4I0X B;  4U7N A;  1XL6 A;  5LHG A;  2YXL A;  4J41 A;  4JYC A;  3QTC A;  1SF9 A;  2FYU H;  4O4H B;  1GRJ A;  3U11 A;  2MW2 B;  3ETQ A;  1XNQ B;  3EVK A;  2WLK A;  3IFX A;  3ZN0 A;  5HFL A;  3RWR D;  4BIU A;  3EXA A;  2WLM A;  2EUL A;  4D6T H;  2QM7 A;  4CS3 A;  2IJJ A;  5EBM C;  4J10 A;  5L3E A;  1F23 A;  5IT9 N;  1YJW V;  2ZE6 A;  3G4S V;  1VF7 A;  1TVK B;  2ZDI A;  3AG4 B;  2EIL B;  1SZT A;  4LWS A;  2VQF O;  4RAI A;  3B77 A;  4QE7 A;  1MMM A;  4W4K A;  3QG5 A;  2P5O A;  3CJH A;  3OM3 B;  4CC6 A;  4FJC C;  4DUZ O;  4X65 O;  2QDO A;  2PYL A;  2AHY A;  4JTC B;  1FXK C;  1NKD A;  3M8A A;  1PL0 A;  3BHP A;  3GWK C;  3N2K B;  2YI9 A;  1XDC A;  3JD0 A;  4BW9 A;  3ETD A;  2P06 A;  2RN9 A;  3E35 A;  1FYJ A;  4O4J A;  1WPB A;  2UXX A;  1JOY A;  4I7Z B;  1NTK H;  3K57 A;  3OMA B;  4OPH A;  3ZS8 C;  3JD3 A;  1WPX A;  4JAV A;  1NTM H;  2EIN B;  2CGO A;  3VBB A;  3T4D A;  4JV5 B;  3BA9 A;  4FM0 A;  5BZB A;  2F1M A;  2H3O A;  1B6Q A;  1ZX3 A;  4I55 B;  4X66 O;  1VP7 A;  1AR5 A;  2QA4 V;  4X1Y B;  4XDK A;  2YXH A;  1LUW A;  1ZTE A;  4X1I A;  2IU3 A;  4JI5 O;  1FPO A;  1NH2 D;  3RT3 C;  4LP8 A;  2E74 B;  3CRM A;  1BZK A;  3EHB B;  3L70 H;  4J9Y B;  4I4T A;  1N34 B;  1K8A W;  3CRQ A;  3APQ A;  2AGA A;  3CJH B;  2LW1 A;  3ZRX A;  3OTF A;  5B3S C;  1IBK B;  2UUA O;  2ZDI C;  3L9D A;  4K35 A;  3B09 A;  1M56 C;  5H6R A;  1HP8 A;  5IYC O;  2Q6A A;  1K4D C;  4J7J A;  4K3A A;  3OAA G;  5CA0 A;  1NQT A;  1R3L C;  3JAM N;  3S3W A;  4LC1 A;  4WFA V;  1VQP V;  3C90 A;  4JI2 O;  4LR3 A;  3A0B Z;  2B5U A;  3JAW B;  3CCR V;  4B3M O;  4RO2 A;  1S3J A;  3CEI A;  4JYA B;  5L3D A;  4DV5 B;  2ZCE A;  2Q4P A;  4QE9 A;  1GTO A;  1KKC A;  3ZIA G;  4X1Y A;  2JS5 A;  2LP7 A;  3DTU B;  2VWK A;  3JAT B;  2UUB O;  4GUN A;  2F66 C;  3AG7 A;  3W7S A;  1ZUQ A;  3FB6 C;  4FZ0 A;  2NR5 A;  1YIJ V;  3AG1 B;  3OUS A;  4LBE C;  3CSX A;  2QWN B;  2DYS B;  1IBM O;  5DEC A;  2FTK A;  1WLE A;  1NVP B;  2PI4 A;  1M57 B;  1E1Q G;  3SPG A;  1K5S A;  1M57 C;  3CWB H;  3KCX A;  4PV1 B;  4JV5 O;  1Y74 B;  4FVM A;  1WNS A;  1XHX A;  2LO1 A;  2UUC O;  2LFR A;  4JI2 B;  1OCZ B;  1THZ A;  5CA0 B;  2JGD B;  3RYH B;  2F93 B;  2QSA A;  5BR8 O;  2WLI A;  3LSS A;  5JCO A;  2EJR A;  3CHX A;  3F7V C;  2DQ3 A;  4PA4 A;  4DV7 B;  2ZD9 A;  2OIE A;  4GKJ O;  2ZR3 A;  4DUZ B;  1VF6 C;  1ORQ C;  3FFQ A;  5LA6 B;  1KBH A;  4GYC B;  3F7Y C;  4LF5 B;  2OTJ V;  1B06 A;  3HKC B;  1PNK A;  2JGU A;  4TQD A;  4CS2 A;  1JQ0 A;  1HNZ B;  4J9Z B;  4NR1 A;  1SES A;  1XIL A;  3CCS V;  4IGG A;  1SA0 A;  3BRC A;  1XOU A;  3ZRS A;  2BTQ B;  2LQT A;  2DW4 A;  2BSK B;  1NZ6 A;  1YHQ V;  2XAF A;  1WB8 A;  5EYP A;  3K5L A;  4LF9 O;  3WU2 Z;  1VQ6 V;  4J80 A;  3LNM B;  2Z0A A;  1DF5 A;  2W0X A;  4R50 A;  3OFN G;  2IH3 C;  4D7S A;  4DR4 B;  4JI6 O;  2VQE O;  3E8B A;  5LYJ B;  3CXC U;  1YI2 V;  4WCE V;  2DWD C;  3WG7 C;  1W0J G;  3AG3 C;  3STZ C;  4YJ3 A;  4DR4 O;  4FFB A;  4ZIB A;  3R65 A;  2ZR2 A;  2Z3Y A;  3JAL A;  1RPR A;  1QVG U;  3SJQ C;  1XMO B;  2Y0P A;  3FYE B;  1ZSP A;  5LA6 A;  1J5E O;  1AJP A;  5IE9 A;  5GW7 A;  1NI8 A;  1XUQ A;  1JMK C;  2DYS C;  5BMV B;  2CTP A;  3TET A;  5FPR A;  1QR8 A;  3GB7 C;  2PY5 A;  1X59 A;  1FFX B;  4JI8 B;  1AP6 A;  3O65 A;  1N0J A;  1SQQ H;  2EIK C;  4TV8 A;  3UO2 A;  3CB2 A;  3LSQ A;  5L3B A;  2NLJ C;  1PM9 A;  3LDD A;  1F4N A;  2PUS A;  4WFH A;  1XI1 A;  1VF6 A;  2KB1 A;  2XT9 A;  2ZM6 B;  1DGS A;  3CRR A;  1OCR C;  3FAV B;  5IYD O;  1M90 W;  1N34 O;  4GKK O;  1DF4 A;  3ASO C;  2D3O W;  3JAK B;  1N32 B;  3ML0 A;  4BAY A;  4JZG A;  4H13 B;  4AI8 A;  4NB5 A;  2JVD A;  4YJ3 B;  3P3P A;  4PA9 A;  3QF7 A;  4H44 B;  4LCU C;  4BW5 A;  4LH6 A;  4H37 A;  5GTI Z;  4X66 B;  1GH6 A;  4PDR A;  1RSO B;  3DC5 A;  1H2K A;  5H5N A;  2IJH A;  4KP4 A;  3ZX6 A;  1R3I C;  2PI5 A;  3ZMT A;  5BMV A;  2GUZ B;  2QTO A;  3QO5 A;  5JWP A;  1TUB A;  1KU9 A;  1ZAU A;  4Z2W A;  1KQS U;  3WG7 B;  4HAM A;  1FD9 A;  1K33 A;  3LDE A;  3CCU V;  4B3T B;  5LHH A;  2EJ7 A;  5KAF Z;  2Y69 B;  2LFS A;  1FS0 G;  4JI5 B;  2CGN A;  4DW1 A;  2ARH A;  1O9G A;  3H9V A;  3L75 H;  1G6U A;  4JI6 B;  2YEV B;  2XAG A;  3N2K A;  4JAU A;  4UCR A;  1D5A A;  3H1J H;  3PJS K;  1WA8 B;  2N05 A;  2RJZ A;  3G67 A;  1XMO O;  3E8G A;  4OX9 O;  1Q6I A;  3CRA A;  4B3R B;  4QPJ A;  4O4J B;  4DV3 B;  2HVK C;  4TT3 G;  2Y4T A;  1XMQ O;  3ZHU A;  3K79 A;  4DR6 O;  1P49 A;  5CN0 A;  5E1A C;  3BEH A;  4A5U B;  1XEQ A;  3JSN A;  1KYO F;  1QCE A;  2BCC H;  3ASN C;  3CX5 F;  4GX1 A;  3ABU A;  4UCT A;  4DUY B;  4RQE A;  5CBG A;  4X65 B;  3JAS B;  4UB6 Z;  1G1X B;  4DK0 A;  4NTY A;  3OUF A;  1SQG A;  2UU9 O;  4ZBM A;  2ZIM A;  3K9A A;  2GV9 A;  4ABM A;  3TXQ A;  2X7R B;  4PHZ A;  4B08 A;  3OT7 A;  4FLZ A;  3BFR A;  5B1B C;  3UO3 A;  5GON A;  3CD6 V;  1I5Y A;  2N74 A;  5H6Q A;  5F2V O;  4YHH B;  3H1I H;  3WB2 A;  4I5S A;  3SPC A;  1CEZ A;  1M56 B;  1VIB A;  3ZN1 A;  4DR5 O;  1VQN V;  4EEQ A;  1ENV A;  2C2A A;  1EBO A;  4O4H A;  4CH3 A;  1MSD A;  2P67 A;  4P30 A;  1WJZ A;  2EIK B;  4GLX A;  2CTW A;  1US6 A;  3J80 N;  1Z2G A;  4PI0 A;  4DV5 O;  1YJ9 V;  1VQO V;  1M9N A;  4NTX A;  2W6J G;  3IGA C;  3NXS A;  3I55 V;  3QO8 A;  2OWO A;  4JTD B;  4Z1V A;  1Q90 D;  4HZ3 A;  2UXC B;  1W0K G;  1A32 A;  2V1D A;  4GX2 A;  4E4E A;  3K04 A;  5LMU B;  4I9Q A;  2UUA B;  4CBC A;  5KLV H;  1BQZ A;  4U7O A;  4CH6 A;  1MAB G;  4F6R A;  4IYI A;  1F4M A;  4UCU A;  1YCI A;  2YS8 A;  4QNH B;  1HNW O;  1GN4 A;  1W2B U;  3SPJ A;  5KA6 A;  4HBN A;  5EBL C;  2ILM A;  4LNU A;  1GKF A;  4P9O A;  1R1B A;  4K8Z A;  1BT8 A;  1NS1 A;  4O4I A;  1CXZ B;  5JJJ B;  3ZHT A;  3SGI A;  1EN4 A;  5KHI A;  2CE4 A;  3L74 H;  3SYA A;  1YZB A;  2ZQM A;  5KHK A;  3G6E V;  2A9H A;  2GBO A;  1MA1 A;  1FXV A;  4LFB O;  1SER A;  3M99 B;  5CB4 A;  4NKG B;  1QHT A;  5HFM A;  4WFG A;  1LR1 A;  2QKS A;  2FML A;  2Q67 A;  3SYC A;  1TA8 A;  2X6A A;  4DYL A;  1NU1 H;  4I50 B;  1SRY A;  5B1N A;  2HVJ C;  1YEW A;  1FJG B;  1XBL A;  5A9G A;  3E86 A;  4DV1 O;  1K73 W;  3M7M X;  4PI2 A;  2OT5 A;  2GUZ A;  1P84 F;  2VS0 A;  1CPY A;  4E2L A;  5LOV A;  2ATK C;  3RYF B;  2LJ2 A;  1N8R W;  2VQF B;  4HNA A;  1NR7 A;  2ADP A;  4NTW A;  5ITZ B;  2QR4 A;  2YID A;  5IYZ B;  2JS3 A;  4B7K A;  1Q43 A;  4MTF A;  4TWK A;  4NYK A;  2V4D A;  1Q81 W;  4UFZ A;  1PP9 H;  1B04 A;  2GTS A;  4YXW G;  3AG4 C;  1PPJ H;  2ZIN A;  4W4L A;  5KUM A;  4DV2 O;  5K1P A;  1AB3 A;  2ZKO A;  1I94 O;  2RMK B;  3Q4H B;  1AR4 A;  2FB5 A;  5J9P C;  4FPP A;  3CCE V;  3ABK B;  4WFE A;  5J2U B;  2Q69 A;  5EZY B;  2DQ0 A;  4DV2 B;  4UVB A;  4PA7 A;  1EN5 A;  2HG5 C;  4O4L A;  3CRC A;  3SR2 C;  1JFF B;  1JX9 A;  1RP3 B;  3JD4 A;  4NVP A;  5B66 Z;  1WB7 A;  1PKX A;  5IY5 B;  1JJ2 U;  1R6K A;  1VQ4 V;  1SS3 A;  4RQF A;  3ZRV A;  3TGU H;  3JAK A;  2VWJ A;  1QNM A;  2DMX A;  2E76 B;  2ZM6 O;  3UT5 B;  4MVZ A;  1SZX A;  1MNG A;  5CBF A;  1OCO C;  3HKE B;  4JYB A;  2YDE A;  4GZR B;  2YIB D;  2A3Q A;  5KHG A;  5JH7 B;  2P22 C;  3L71 H;  3K06 A;  5C93 A;  1VMG A;  4B3R O;  1QVF U;  4R7C A;  1T5E A;  2BTO A;  1ROP A;  4TUY A;  1XQ8 A;  4UVC A;  4TQF A;  1E1R G;  3JYC A;  3E83 A;  4WBN B;  2Q0A A;  2KSD A;  3SJB C;  2BTQ A;  2RQ6 A;  1Y76 B;  4IYH A;  1VQ8 V;  4D7T A;  2IJI A;  1B3Q A;  1HW7 A;  3RGB A;  3W7T A;  1GM7 A;  2UUB B;  4PDL A;  4O2B B;  1LUV A;  1VF5 B;  1S77 D;  2Z5U A;  3E22 A;  2EIM B;  4FMT A;  3CCQ V;  3UM7 A;  2Q7G A;  1ZLZ A;  3ZRW B;  4X64 O;  2A0L A;  1K9M W;  4H0L B;  4DRX A;  5LGU A;  4JI4 O;  4JAS A;  1HWY A;  3K5O A;  4YIP A;  3TXS A;  1KMI Z;  5JQG B;  5E79 Z;  1GN2 A;  2QWR B;  5KA5 A;  4O2A A;  1M1K W;  3W7W A;  2EIJ C;  2UXB O;  1ZL8 B;  4MVR A;  5LP6 C;  4U3F H;  4MTX A;  2W6I G;  3JAT A;  4P9P A;  1XNR O;  4DR7 O;  4DV0 O;  2PTM A;  3EFF K;  3CC2 V;  5H2F Z;  5LHI A;  1WAZ A;  3K59 A;  2OTL V;  3E89 A;  3QO7 A;  2YC0 A;  4GKJ B;  5EK0 A;  1NBM G;  3ZHR A;  3OEE G;  3T1H O;  4X1K B;  4ZOL B;  3KZI Z;  5LOV B;  3FKS G;  1FKA O;  2YUA A;  3K0D A;  3LUT B;  1PNL A;  3RYF A;  2GDS A;  4LF4 O;  5ITZ A;  2FKX A;  2Q68 A;  2OCC C;  3AG2 B;  3FB5 C;  4PA6 A;  4DR2 B;  4F6E A;  4IIJ A;  5LP6 A;  4NXM B;  2HLD G;  4KHP O;  4FFK A;  1BGY H;  1S5H C;  4JAA A;  3I56 V;  3ZMU A;  4FLY A;  3PN1 A;  2L35 A;  2XAQ A;  1S5L Z;  4EFB A;  4PA3 A;  5IJ0 B;  2UXN A;  2P6J A;  2HR3 A;  2PGG A;  5D5P A;  2AHZ A;  3CCM V;  5L3C A;  2PF4 E;  4WFB V;  3HR0 A;  3UKM A;  3FD9 A;  4JI1 O;  4FM1 A;  1RM1 B;  4LFA O;  3K58 A;  3K08 A;  4FLW A;  3ABT A;  5FNV B;  3ZED A;  4NXN O;  4GCZ A;  3A0H Z;  4K0K B;  3SPI A;  5IJ9 A;  2ZIO A;  3A2F A;  2NNU A;  5JVD B;  4EB6 A;  4X1K A;  1XMQ B;  1HNW B;  5KAI Z;  4DV3 O;  1I5X A;  4QGP A;  3ZHV A;  4AQY B;  2HJD A;  1DLB A;  3U10 A;  1WA8 A;  2CDY A;  3ZMZ A;  4I0X A;  2ETN A;  5L3G A;  4O4I B;  1Q8I A;  3DGE A;  2P7T C;  2XOK G;  3ABL C;  1R3K C;  2Q8V A;  1AI6 A;  1E79 G;  1XRE A;  4C7U A;  2XAJ A;  5J2T A;  3DXR B;  1TVK A;  1LNQ A;  1H2M A;  4LWS B;  3X2Q B;  4ZHQ A;  3O9O A;  4DR3 O;  5FPO A;  4ZI7 B;  3P32 A;  3ZHQ A;  1J95 A;  2NN4 A;  1K4C C;  2G38 A;  3KKY A;  1NR1 A;  2QJ1 A;  4YIO A;  3OR7 C;  1V55 C;  2PZS A;  2CH7 A;  2QGN A;  1IUR A;  2GTA A;  3ABK C;  1IBK O;  5GON B;  2KQX A;  2XAH A;  1M5I A;  1BQ0 A;  1IXB A;  1FXK B;  2KKW A;  3ASN B;  3BAB A;  4ICG A;  2N04 A;  1JR9 A;  2QWP B;  1H2L A;  1H2S B;  2F43 G;  3N2G A;  5FL7 G;  4L8J A;  2BOB C;  1NVP D;  3S3X A;  1R6N A;  2JEU A;  1L0N H;  4OPA A;  3SPH A;  4R8C A;  3OGI B;  2VQE B;  4OXS A;  5IYZ A;  1HR0 O;  3HKB A;  4PDV A;  4DR1 B;  4JI3 O;  2EX3 A;  5J2T B;  4F4L A;  3OW2 U;  1RPO A;  4O4L B;  2JIZ G;  4IHJ B;  2LGW A;  4JGS A;  3OGC C;  3VOU A;  5KMG A;  3VQY A;  1ZWI C;  2A7W A;  4JI7 B;  1AP5 A;  1IBL B;  3QVN A;  2WA4 A;  5C8Y B;  3MAQ A;  3DC6 A;  4I4T B;  1BMF G;  4X8A A;  4RUF A;  1M93 A;  2BSK A;  2DN9 A;  4GT1 A;  4G2K A;  3G6B A;  3UT5 A;  2R9A A;  4BIO A;  5EYP B;  1YDX A;  5LL6 Y;  4MSW C;  4X62 O;  1JPX A;  2YI8 A;  4ASU G;  1MG1 A;  2WPD G;  2YIC A;  3FYI B;  1Q3E A;  3F5W C;  3JCU Z;  1SQP H;  1KC8 W;  3R66 A;  1JJO A;  2JDI G;  2JRI A;  1KP3 A;  3RBZ A;  5H9C A;  1J5E B;  1OCZ C;  2HP8 A;  3E8F A;  4DV4 B;  2IU0 A;  3JAW A;  3IJ4 A;  2ZE5 A;  3HKE A;  1FJG O;  2YSU B;  1WN7 A;  3SYO A;  4IT5 A;  4I50 A;  3DSQ A;  5JH7 A;  3LDC A;  3D3I A;  1L8D A;  2CAZ C;  5B1A C;  4MTG A;  3CYO A;  2XUM A;  4HYO A;  1V54 B;  4O2B A;  1IVS A;  4FM2 A;  4CH5 A;  3IC9 A;  5EC2 C;  3JCZ A;  1AI5 A;  4UCS A;  2UU9 B;  4WBN A;  1FFX A;  3T4Z A;  1K3E A;  4JI0 O;  2UXD O;  4CS4 A;  1H38 A;  5BY1 A;  4RWU A;  4N21 A;  2E5L B;  4J11 A;  5LMU O;  3OEH G;  2EZP A;  2DE0 X;  4DV6 O;  3L73 H;  1KP2 A;  4X62 B;  1MOF A;  3A0R A;  3FB8 C;  3OE7 G;  1PL4 A;  5LGT A;  4JI3 B;  5JQG A;  1VQM V;  1Y74 A;  2L6L A;  4B7E A;  2WLL A;  4O2A B;  1N36 B;  3VQX A;  2R72 A;  1ZL8 A;  2UUC B;  3FX7 A;  1OZ0 A;  4H33 A;  4X1I B;  3STL C;  2R9I A;  1AJN A;  1EZV H;  3B2E E;  5EZY A;  2JJ1 G;  3H01 A;  4MTO A;  1IBM B;  1XL4 A;  3JAR B;  1IBL O;  1H8E G;  1GM8 A;  1H2N A;  4JF3 A;  1XHZ A;  1VQL V;  4ZI7 A;  2AZ2 A;  3ASO B;  2Q0O C;  2XTA A;  2WLJ A;  3BCC H;  1OHH G;  2D2C B;  4BWA A;  1TUB B;  4F6R B;  3IC7 A;  3K03 A;  2WLN A;  2X6C A;  2AW9 A;  1AIL A;  5IYB O;  3RYC B;  1IX9 A;  3H1L H;  1Q6H A;  1EN6 A;  2Q7H A;  2QWO B;  1OJH A;  5LXT A;  5IDJ A;  1Z5V A;  2IBZ H;  4DV7 O;  1UFI A;  3H1K H;  3C3T A;  5LBQ A;  1YSC A;  3G71 V;  4YY3 O;  4CH4 A;  2FL4 A;  4LF5 O;  3K9S A;  4B3T O;  4AHC A;  1YTF B;  1IDS A;  1W59 A;  2ITD C;  5IWA O;  4QIW F;  1K5Q A;  5KHH A;  3TJT A;  1BS3 A;  5DM6 V;  4JZ2 A;  2ZE7 A;  1S72 V;  1OV9 A;  5CA1 A;  3MHS C;  4U3J A;  5IJ0 A;  4UB8 Z;  2WSS G;  5BXZ A;  4X89 A;  4DV6 B;  3N27 A;  5IY5 C;  3TCU A;  1MSW D;  3FAV A;  2DOS A;  2HEP A;  3OD4 A;  3MHH C;  2R9R B;  1EFR G;  1XNQ O;  3RYC A;  1VAR A;  3UQ8 A;  1JCH A;  4FLT A;  2F4V B;  5C8Y A;  2WWW A;  3ABM B;  4LFC O;  4BIZ A;  3ABM C;  4ZKI A;  4B3S O;  1GMG A;  1TAE A;  4AQY O;  1XNR B;  3VQW A;  3ZBH A;  4JI7 O;  2B1I A;  4B3M B;  4LFC B;  3LSU A;  3U0Z A;  3I5D A;  1HNX B;  1FFT B;  1RFY A;  2X0L A;  1Y67 A;  4ZHQ B;  1N33 B;  4UCO A;  2BOC C;  1N0N A;  3OR6 C;  1NTZ H;  4UVA A;  2Y0I A;  2ADQ B;  3RVY A;  5LMN B;  3WB1 A;  1QLE B;  5LGN A;  1F51 A;  5J2U A;  2BE3 A;  4KXR A;  1RSO A;  4LF6 O;  4UV8 A;  2ZNJ A;  1FAF A;  3CMA V;  1N4C A;  2DJV A;  1YXB A;  3VQV A;  3W7U A;  1Z5W A;  3P3N A;  4TV9 B;  1DK1 A;  4KHP B;  1GN6 A;  4Q20 A;  1Y4M A;  4KUM A;  4DR2 O;  1L0L H;  2RNB A;  3ZCC A;  3J81 N;  1P7B A;  4LNU B;  3BAA A;  2HHH B;  1AI4 A;  1UPG A;  2W0F C;  3APO A;  1QBZ A;  1FXK A;  2B1G A;  2IH1 C;  1V55 B;  4KFM A;  2V7Q G;  2KG7 A;  1OCO B;  4L87 A;  1YVW A;  3N2G B;  1WP7 A;  1UJW B;  1I94 B;  1URF A;  2EIN C;  4Z1M G;  1K34 A;  3D3Q A;  4AIL C;  2X6B A;  3P30 A;  2OCH A;  2B9Z A;  2Y4U A;  2EIL C;  1G4Y B;  4K0K O;  1QU7 A;  4PJ0 Z;  3D36 C;  4NXN B;  4G28 B;  1SQV H;  1PV0 A;  3B8N A;  1OCR B;  2MK3 A;  1Q5O A;  1NJI W;  1K92 A;  4LF8 B;  4TV8 B;  3KCY A;  1S0V A;  1Y66 A;  3TK1 A;  4FLV A;  3SDL A;  3JAS A;  5A2Q N;  4DUY O;  4J7K A;  1NH2 B;  4DW0 A;  2LGQ A;  1R6T A;  4QJF B;  5BR8 B;  3ZMV A;  1BHB A;  3E22 B;  1S76 D;  3D36 A;  1GN3 A;  5JJN B;  4MVO A;  3CME V;  2JGD A;  3RYH A;  3FB7 C;  1Q82 W;  1GAX A;  1Q86 W;  1HNX O;  2YIA A;  1I7F A;  3L72 H;  1Q6U A;  4JI1 B;  3RVZ A;  4DR3 B;  3AK3 A;  4GKK B;  2A06 H;  4FLX A;  2ZXW B;  1HNZ O;  4MVS A;  5JCO C;  2ZXW C;  3T2M A;  2OCC B;  3AG2 C;  2M7W A;  1WP8 A;  5FLX N;  4DO2 A;  5JJE B;  3CS5 A;  3W7X A;  4NXM O;  2QWQ B;  5DED A;  3RYI A;  2CK3 G;  5EIB D;  4LF9 B;  3BPZ A;  3NR7 A;  1YIT V;  1K97 A;  1V54 C;  2ZT9 B;  4K8X A;  2HKO A;  5CBH A;  2IJK A;  4RUE A;  1X4T A;  2XAS A;  1BCC H;  3G80 A;  4X9Q A;  2P90 A;  1I08 A;  4JYY A;  5KUK A;  1L1F A;  1N33 O;  4DV1 B;  2LW7 A;  4UUJ C;  4FK5 C;  1FXH A;  3CP1 A;  1D5N A;  3C3S A;  2WLL B;  3CE2 A;  4DR5 B;  4LFA B;  1GK9 A;  2E5L O;  3BY6 A;  3CC4 V;  2ZE8 A;  5B1O A;  2EIJ B;  3WFV A;  4I9W A;  5AG2 A;  4EKW A;  4DR1 O;  5LP6 B;  5EBW C;  1EM1 A;  1SQX H;  3T1Y B;  4LF4 B;  3AEI A;  3BA8 A;  1V9P A;  2PYJ A;  4J42 A;  2UXB B;  2QKA A;  1JA8 A;  1M4U A;  1VQ5 V;  4DR7 B;  2HFE C;  5B1B B;  1QR9 A;  4IHJ A;  5CB4 B;  2F23 A;  4YY3 B;  2XHB A;  2IW5 A;  2A79 B;  1AI7 A;  4TUY B;  5D5Q A;  4JI8 O;  1DTO A;  2WAM A;  3CXH F;  3MDS A;  5B5E Z;  2R70 A;  1GO3 F;  3JAR A;  3GVM A;  2EBO A;  2P4K A;  2QTS A;  4HNA B;  1Y76 A;  2F95 B;  1P4R A;  5LXT B;  5IJ9 B;  4WF9 V;  1BE3 H;  3T1H B;  4X20 A;  4GX0 A;  4EB6 B;  5JVD A;  2YIB A;  4TV9 A;  3AG3 B;  2UXC O;  3OTO O;  4I55 A;  3MD0 A;  5EIB C;  2E75 B;  3RN4 A;  2DYR B;  4G27 B;  4CC5 A;  1R73 A;  2DYR C;  4DRX B;  3Q4H A;  3T1Y O;  1U96 A;  4UCV A;  3THO A;  3ZHS A;  2EIM C;  1BSM A;  1KKD A;  1KUQ A;  3LNN A;  3IAY A;  2Q73 A;  3F5T A;  5CA1 B;  3RFR A;  1SET A;  4GX5 A;  3X2Q C;  4JI0 B;  1H8H G;  1I0H A;  3B40 A;  3SJC C;  2Q7E A;  4X64 B;  3SJA C;  2CH7 B;  2CUG A;  3KG2 A;  4LF7 O;  1QLE C;  1SA0 B;  1AVM A;  1BL8 A;  4U3J B;  1D2D A;  4LH7 A;  3J7A U;  5DN6 G;  1OCC C;  4UV9 A;  4X20 B;  1AJQ A;  4BR6 A;  3D8C A;  1OCC B;  2WA3 A;  4B3S B;  5CMU A;  3CCJ V;  4WFF A;  2YEV A;  2JEX A;  1YJN V;  3ZMS A;  5EC1 C;  4YHH O;  2AZ0 A;  1HDJ A;  2VRZ A; 
#chains in the Genus database with same CATH homology
 5CBF A;  3CCS V;  1OCO C;  4JYB A;  1OHH G;  3ZRS A;  4UXN A;  4PEL A;  3QNE A;  2DW4 A;  3IC7 A;  3K03 A;  1RM1 C;  2WLN A;  2X6C A;  1KD1 W;  1YHQ V;  5IYB O;  4PDM A;  2XAF A;  2QE7 G;  3K06 A;  4DXW A;  3ETE A;  4WFA V;  5C93 A;  1QVF U;  4R7C A;  1ROP A;  1VQ6 V;  5IDJ A;  3LNM B;  5B1A B;  1DF5 A;  5B3S B;  4MVQ A;  4UVC A;  3HB3 B;  3SYP A;  4R50 A;  3OFN G;  1E1R G;  2IH3 C;  3JYC A;  3E83 A;  2H8P C;  4N23 A;  3E8B A;  5LBQ A;  1YSC A;  3CXC U;  1Q7Y W;  1K7D A;  3G71 V;  1YI2 V;  4WCE V;  1VQ8 V;  2DWD C;  2H94 A;  2IJI A;  3RW0 A;  3WG7 C;  1W0J G;  3AG3 C;  3STZ C;  3W7T A;  1GM7 A;  4XDL A;  1R3J C;  4PDL A;  3JD2 A;  3R65 A;  1S77 D;  3CCV V;  2ZR2 A;  5L3F A;  2Z3Y A;  1YTF B;  1VQK V;  3ZRW A;  1RPR A;  2Z5U A;  3SJQ C;  1QVG U;  2Y69 C;  5CA3 A;  2EIM B;  3FYE B;  4FMT A;  2ITD C;  4QIW F;  1AJP A;  1K5Q A;  3OMN B;  5GW7 A;  3CCQ V;  3UM7 A;  2K1E A;  5DM6 V;  2DYS C;  1S72 V;  3ZRW B;  3MHS C;  3TET A;  3ZJZ A;  2GSM B;  2A0L A;  1K9M W;  5LGU A;  1QR8 A;  4JAS A;  4JPR A;  3GB7 C;  3GWO A;  4JTA B;  2WSS G;  1HWY A;  1ARO P;  3T1C A;  4X89 A;  5IY5 C;  2EIK C;  2WLI B;  3TCU A;  5KA5 A;  1MSW D;  3AG1 C;  3LSQ A;  5L3B A;  3MHH C;  2NLJ C;  3W7W A;  2EIJ C;  1M1K W;  3LDD A;  2R9R B;  1F4N A;  1EFR G;  4MVR A;  4WFH A;  4MTX A;  2W6I G;  4P9P A;  1JCH A;  2KB1 A;  2EZO A;  2WWW A;  1JVM A;  3ABM B;  4BIZ A;  1OCR C;  3E8H A;  3EFF K;  3ABM C;  3CC2 V;  4ZKI A;  2HJF C;  5IYD O;  1M90 W;  1GMG A;  3K3W A;  5LHI A;  1DF4 A;  3ASO C;  2D3O W;  2OTL V;  3ABL B;  3E89 A;  3QO7 A;  2B1I A;  3CCL V;  3ML0 A;  4BAY A;  1CP9 A;  1YTF D;  4XBF A;  2XND G;  5EK0 A;  1FFT B;  1NBM G;  2X0L A;  3SYQ A;  1AR1 B;  2DWE C;  4FIP C;  4MVU A;  4MW8 A;  2ITC C;  1GM9 A;  2BOC C;  4PA9 A;  3OEE G;  4P2Z A;  3OR6 C;  4LCU C;  4BW5 A;  4H37 A;  1COW G;  4UVA A;  2WLH A;  3RVY A;  3FKS G;  1QLE B;  3K0D A;  3LUT B;  4PDR A;  5LGN A;  1F51 A;  1PNL A;  4CZZ A;  4MS2 A;  1PD3 A;  2IJH A;  4KP4 A;  2JJ2 G;  3K0G A;  1R3I C;  2QM8 A;  3JD1 A;  1QLN A;  2PI5 A;  3ZMT A;  2Q68 A;  2OCC C;  2QTO A;  3AG2 B;  3FB5 C;  3QO5 A;  4PA6 A;  4UV8 A;  2HLD G;  1KQS U;  1VQ9 V;  3WG7 B;  4HAM A;  1K33 A;  1S5H C;  3LDE A;  3CMA V;  3CCU V;  1TUE B;  3I56 V;  1BHA A;  3ZMU A;  5LHH A;  3CC7 V;  2Y69 B;  4XDJ A;  1KEC A;  1FS0 G;  2LFS A;  3W7U A;  3E2E A;  1VQ7 V;  1G8M A;  1PNM A;  2XAQ A;  4PA3 A;  4Q20 A;  4MVM A;  1Y4M A;  2JK5 C;  4KUM A;  2UXN A;  2P6J A;  2HR3 A;  3B8M A;  3ZCC A;  1P7B A;  1AI4 A;  2YEV B;  2W0F C;  1QBZ A;  2AHZ A;  1FXK A;  2B1G A;  2IH1 C;  2XAG A;  1V55 B;  4JAU A;  4KFM A;  4MT8 A;  2V7Q G;  3UKM A;  5L3C A;  4WFB V;  1EZJ A;  3PJS K;  1OCO B;  4L87 A;  3ETG A;  1RM1 B;  3E8G A;  3K08 A;  3ABT A;  1UJW B;  3HPL C;  4QPJ A;  4MW3 A;  2EIN C;  4Z1M G;  1K34 A;  2HVK C;  4GCZ A;  4TT3 G;  2QEX V;  2GHY A;  4QPK A;  3K79 A;  4R6Z A;  4TSF G;  3SPI A;  5CN0 A;  2X6B A;  3P30 A;  5E1A C;  3CPW U;  4X88 A;  3BEH A;  1IXM A;  2NNU A;  1H2G A;  2Y48 A;  2EIL C;  1G4Y B;  3OMI B;  1I5X A;  1QCE A;  4G28 B;  4U7N A;  3CCM V;  1XL6 A;  5LHG A;  3ASN C;  4GX1 A;  3ABU A;  4JYC A;  4RQE A;  1DLB A;  3B8N A;  5CBG A;  1OCR B;  2MK3 A;  3ZMZ A;  5L3G A;  1NJI W;  1K92 A;  3OUF A;  1S0V A;  4ZBM A;  1Y66 A;  3K9A A;  2WLK A;  3TK1 A;  3IFX A;  3DGE A;  2P7T C;  2XOK G;  3ZN0 A;  5HFL A;  3ABL C;  4BIU A;  1R3K C;  2WLM A;  1AI6 A;  1E79 G;  2X7R B;  1NH2 B;  2QM7 A;  2IJJ A;  2XAJ A;  5EBM C;  5B1B C;  4QJF B;  5L3E A;  3ZMV A;  1BHB A;  1LNQ A;  3CD6 V;  1I5Y A;  5H6Q A;  3X2Q B;  1S76 D;  3D36 A;  1F23 A;  4I5S A;  3P32 A;  3SPC A;  1M56 B;  3ZN1 A;  1YJW V;  3G4S V;  1VQN V;  1CEZ A;  4MVO A;  1J95 A;  3CME V;  1ENV A;  2ZDI A;  3AG4 B;  2EIL B;  1K4C C;  1SZT A;  1EBO A;  2C2A A;  3FB7 C;  2P67 A;  4RAI A;  1NR1 A;  3B77 A;  4P30 A;  4QE7 A;  3OR7 C;  1V55 C;  1Q82 W;  1Q86 W;  2EIK B;  3OM3 B;  4FJC C;  3RVZ A;  3ABK C;  1YJ9 V;  1VQO V;  1M9N A;  2AHY A;  2W6J G;  4JTC B;  1FXK C;  2ZXW B;  2XAH A;  1NKD A;  3IGA C;  4MVS A;  3NXS A;  1PL0 A;  1FXK B;  2ZXW C;  3ASN B;  3T2M A;  3I55 V;  3JD0 A;  2OCC B;  3AG2 C;  3QO8 A;  3ETD A;  2M7W A;  2F43 G;  3E35 A;  4JTD B;  5FL7 G;  4DO2 A;  2BOB C;  4HZ3 A;  3W7X A;  1NVP D;  2UXX A;  1R6N A;  2JEU A;  1JOY A;  1W0K G;  2V1D A;  4GX2 A;  3SPH A;  3OMA B;  3JD3 A;  1WPX A;  2CK3 G;  3K04 A;  4R8C A;  4JAV A;  3VBB A;  2EIN B;  3T4D A;  4CBC A;  1YIT V;  4OXS A;  5BZB A;  1K97 A;  4U7O A;  1V54 C;  1MAB G;  1B6Q A;  1F4M A;  2HKO A;  4QNH B;  2QA4 V;  5CBH A;  1W2B U;  3SPJ A;  2IJK A;  4PDV A;  4RUE A;  2XAS A;  5KA6 A;  4XDK A;  2P90 A;  5EBL C;  4P9O A;  1GKF A;  5KUK A;  1L1F A;  4F4L A;  4UUJ C;  4FK5 C;  2IU3 A;  3OW2 U;  1FXH A;  3CP1 A;  2WLL B;  1RPO A;  1NH2 D;  4LP8 A;  2JIZ G;  1GK9 A;  3BY6 A;  3EHB B;  3CC4 V;  5B1O A;  4JGS A;  4J9Y B;  2EIJ B;  3OGC C;  3WFV A;  4I9W A;  4EKW A;  1K8A W;  3VOU A;  1ZWI C;  5EBW C;  3SYA A;  2ZQM A;  3G6E V;  2A9H A;  3ZRX A;  5B3S C;  3AEI A;  1FXV A;  1SER A;  1BMF G;  3M99 B;  2ZDI C;  4X8A A;  1M56 C;  5H6R A;  4RUF A;  5HFM A;  4GT1 A;  4G2K A;  5IYC O;  1VQ5 V;  2Q6A A;  4WFG A;  1K4D C;  2QKS A;  2HFE C;  2Q67 A;  3OAA G;  5B1B B;  1NQT A;  1R3L C;  3SYC A;  1QR9 A;  2X6A A;  1VQP V;  4LC1 A;  4MSW C;  1JPX A;  1SRY A;  1MG1 A;  2WPD G;  2IW5 A;  2HVJ C;  5B1N A;  4ASU G;  2A79 B;  1AI7 A;  3FYI B;  3E86 A;  3F5W C;  1KC8 W;  1DTO A;  2WAM A;  1K73 W;  2B5U A;  3CCR V;  2JDI G;  1GO3 F;  1KP3 A;  4RO2 A;  3RBZ A;  2EBO A;  1S3J A;  2OT5 A;  5H9C A;  5L3D A;  1OCZ C;  3E8F A;  4QE9 A;  1CPY A;  1GTO A;  1P4R A;  2IU0 A;  4E2L A;  3ZIA G;  2LP7 A;  3DTU B;  4WF9 V;  2ATK C;  1N8R W;  2YSU B;  4GX0 A;  3SYO A;  1NR7 A;  3AG3 B;  3W7S A;  3FB6 C;  3LDC A;  3D3I A;  3MD0 A;  5B1A C;  4MTG A;  3CYO A;  1YIJ V;  3AG1 B;  4HYO A;  4MTF A;  1V54 B;  4TWK A;  3OUS A;  4LBE C;  2DYR B;  1Q81 W;  4G27 B;  1R73 A;  2DYR C;  2DYS B;  4YXW G;  5EC2 C;  3JCZ A;  1AI5 A;  3AG4 C;  2FTK A;  5KUM A;  3T4Z A;  1WLE A;  1K3E A;  2EIM C;  1NVP B;  2PI4 A;  1KKD A;  1H38 A;  1M57 B;  1E1Q G;  4N21 A;  3SPG A;  1K5S A;  1M57 C;  5J9P C;  4FPP A;  3CCE V;  3ABK B;  4WFE A;  3OEH G;  2EZP A;  1SET A;  4GX5 A;  2Q69 A;  1KP2 A;  2DQ0 A;  2LFR A;  3X2Q C;  1MOF A;  3A0R A;  3FB8 C;  3OE7 G;  1OCZ B;  1THZ A;  5LGT A;  1H8H G;  4UVB A;  4PA7 A;  2WLI A;  1VQM V;  3LSS A;  2WLL A;  2HG5 C;  2EJR A;  3KG2 A;  1JX9 A;  3F7V C;  2DQ3 A;  4PA4 A;  1QLE C;  3JD4 A;  1BL8 A;  2ZD9 A;  1OZ0 A;  4H33 A;  2ZR3 A;  1JJ2 U;  1PKX A;  5IY5 B;  3STL C;  2R9I A;  1R6K A;  5DN6 G;  1AJN A;  1VQ4 V;  4RQF A;  1ORQ C;  1OCC C;  4UV9 A;  3ZRV A;  1AJQ A;  2JJ1 G;  3H01 A;  4MTO A;  1OCC B;  1XL4 A;  5CMU A;  3F7Y C;  1H8E G;  2OTJ V;  3CCJ V;  4WFF A;  1GM8 A;  2YEV A;  4JF3 A;  2JEX A;  1PNK A;  1YJN V;  1VQL V;  3ZMS A;  1JQ0 A;  5EC1 C;  4MVZ A;  4J9Z B;  3ASO B;  2WLJ A;  1SES A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...