1VQOV

The structure of ccpmn bound to the large ribosomal subunit haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vqoV00
3CCLV 1VQPV 1YIJV 3CCRV 1M90W 1QVFU 2OTJV 1Q82W 2QA4V 1VQ6V 3G4SV 1NJIW 3CC2V 3CC4V 1R73A 1VQ8V 1K9MW 3CD6V 1QVGU 1VQ4V 4WFAV 3CXCU 3CCJV 1YITV 1YJ9V 3CCUV 1M1KW 1S72V 1KQSU 1W2BU 1Q7YW 1VQLV 1YI2V 3CMAV 3I56V 1YHQV 1YJNV 1YJWV 2QEXV 3CCQV 4WF9V 1VQ7V 1JJ2U 1K73W 3I55V 1KC8W 3G71V 3CPWU 1VQMV 1KD1W 3CCMV 1K8AW 3OW2U 3CCVV 1VQ5V 3CCSV 5DM6V 1VQNV 3CC7V 4WCEV 2D3OW 1Q81W 1VQOV 1VQ9V 1VQKV 3CCEV 2OTLV 3G6EV 3CMEV 1Q86W 4WFBV 1N8RW
chains in the Genus database with same CATH superfamily
3CCLV 2YI9A 2ZIOA 4FM1A 1KUQA 2UUBO 1LUVA 1TUBA 1IURA 3DTUB 1SQGA 2NNUA 3JALA 1N33B 5CA0B 2RN9A 4UCOA 1NS1A 2QKCA 4F6RB 4ZIBA 4DR5O 4X64B 4GLXA 1Q8IA 1SZXA 5EC1C 4F6EA 3RGBA 1BGYH 1VMGA 1IBKB 5LMNB 2NR5A 2ZE6A 4W4KA 2RMKB 4KP4A 5LA6B 1GRJA 3W7XA 1XEQA 2HLDG 3OGIB 2AW9A 2VRZA 1FAFA 3A0RA 3CWBH 4NTYA 4RO2A 5L3DA 5B1AB 3CMAV 4BIUA 3ABKC 4CC6A 3M99B 3ABMB 3JYCA 5H2FZ 1VARA 3Q4HB 2QM7A 5FPOA 3ASNB 4QPJA 1JMKC 5K1XA 4JI0O 4MTFA 4G28B 3AG2B 2JJ1G 3B77A 4X62O 5BMVB 3PJSK 1GO3F 2EINB 3N2KB 2OTLV 3JD4A 2DW4A 4KUMA 2WWWA 2DQ3A 4Q6GA 3BA8A 4E4EA 1ORQC 1AJPA 1XNRO 2IJIA 2YEVB 5IDJA 4K3AA 2HJFC 3KG2A 4O4IA 1Q43A 2Z0AA 5IJ0A 2OWOA 2E74B 4K0KB 3ABLB 4B7EA 5IJ9A 2ADQB 2GHYA 1XL4A 2GTSA 3LNMB 1Q6IA 3N27A 4LWSB 4H44B 3ZEDA 1IBLO 3CCUV 2QM4A 3SPHA 1TAEA 4LF9B 2GTAA 1K73W 4HAMA 2IJJA 3RYHA 4MW3A 3A0BZ 1NQTA 3JD0A 4LF5O 2PYJA 2KB1A 2Q0AA 1GH6A 1OCOC 2JK5C 3ABTA 3HKCB 3QF7A 1Y74A 3RYIB 3CD6V 5B66Z 4EB6B 1H8HG 3SJQC 1GN4A 2P4KA 5C93A 4B3SB 2UUCO 4I9WA 3IGAC 1QLEC 3G67A 1SRYA 2CUGA 1I5XA 2Q68A 4UV8A 4LF6O 1DLBA 1Q5OA 2CTPA 5IYBO 1AI5A 3RN4A 1NJIW 1K33A 4GYCB 5JWPA 1GK9A 1G1XB 2PI4A 1EN6A 3M8AA 4RQEA 4OPAA 4JI8O 4DRXB 2E5LO 1ZUQA 4QPKA 2R9RB 1ZWIC 1BQZA 3G80A 2K9PA 1QU7A 4FLZA 2BOBC 1QVGU 5CMUA 2X0LA 4TOIA 5IYZA 4YIOA 5EBLC 4NTWA 1YITV 4FM2A 4EFEA 4LCUC 1ENVA 3ZRVA 3BY6A 2Q7EA 4NXNB 2BTQB 3OTOB 3AG4C 4JI7O 3RBZA 1W59A 4QNHB 2PYLA 3CC2V 1YSCA 5KMGA 2EIMB 3EHBB 3IC9A 3X2QC 2QWRB 1FFXB 4DUZO 4UUJC 4FFBB 4JI2O 2L35A 2QM8A 3T1YB 4U7OA 1I94O 1TVKB 3FAVB 1BS3A 3OW2U 2R9IA 5H6QA 1S77D 3WG7B 5EK0A 2Y48A 2BSKA 4P9OA 4H13B 4DV0O 2H8PC 4ZHQB 1R6NA 5CB4B 1IVSA 3EFFK 4FLUA 4B3MB 4FLTA 1U97A 4ZBMA 1YJNV 1JJ2U 4WF9V 1E1QG 3ZMTA 2OT5A 1RPRA 4BWAA 4X64O 3BA9A 2FMLA 1BSMA 3FB5C 2QDOA 1IBKO 5LMNO 4LP8A 4NKGB 1HW7A 2EIJB 4AHCA 1XL6A 3IAYA 4HYOA 3M7MX 1WPXA 3T2MA 3VQXA 2XOKG 2ITCC 2OIEA 4WFAV 2O57A 1AI4A 2DN9A 2P4VA 3QO5A 3THOA 3EVKA 4DK0A 2VQEB 2F4VB 2ZR3A 4PDMA 4I9QA 2UXBB 2B9ZA 4X1KA 1AVMA 3SYPA 1V55B 3B4SA 5EYPB 1KMIZ 2WLIB 1J95A 3ZIAG 5CBHA 1YI2V 4BW9A 1HNZO 3ZHRA 1FJGB 5HFMA 5EIBD 3K57A 4I0XB 3KCYA 4O2AB 4TV9B 1WA8B 4UVBA 4UCVA 4X65O 4NVPA 4PDVA 1JR9A 2Q6AA 2UUAB 4FVMA 4GX1A 1EN5A 4O2BB 3OTFA 4ZHQA 4I55A 5TISZ 1M5IA 1Z2GA 4JTCB 1NR1A 3RVZA 2IH3C 4K0KO 3T4ZA 4MSWC 5B1OA 4I4TB 5LHGA 2F43G 1FFTB 4Q20A 1EM1A 1VQ4V 2IU0A 4J7KA 5JH7A 2YUAA 1AP6A 5LGTA 1S5LZ 4LH7A 4FIPC 3N2GA 4OPHA 2AHZA 1N32O 3ZHTA 2R72A 4JYBA 2EILC 2UXCB 1URFA 3UO3A 1X59A 5GW7A 1LUWA 2AHYA 5KA6A 4LF7O 4ZOLA 4B3TB 1COWG 1OCRC 2XTAA 1ZL8B 5EBMC 2CTRA 3H01A 3L9DA 1YJ9V 4X62B 4J42A 3B40A 3CP1A 3K58A 1M56B 2Q4PA 4JPRA 1G6UA 4B7KA 1XREA 2YICA 2YXHA 2QGNA 1EFRG 3OUSA 2UU9B 1VF6A 2DYRC 1XNRB 1R1BA 4PA9A 1QR9A 4MS2A 1NI8A 4IHJB 4O4JA 1SQVH 4N23A 1BZKA 4EEQA 5IY5C 4O2BA 1W0JG 3CCEV 3B8MA 1IX9A 4CH5A 2ILMA 1M90W 1EZVH 1IBLB 3H1IH 2R9AA 1R6TA 3CCJV 2E75B 2OCCC 1Q6HA 2YXLA 3FKSG 5B1BB 5LOVA 5H6RA 2WLMA 2WLNA 3CS5A 4LF5B 3HKBA 5IE9A 1VQOV 1JOYA 1LR1A 1H2MA 3G6EV 1PD3A 5LL6Y 5LMUB 1V54B 3JARA 3OTOO 4DK1A 5J2TB 2G38A 3E83A 3OR6C 1RM1B 4UCTA 3L75H 4ZKIA 1NKDA 5GONB 4DO2A 2UUCB 3JCZA 1NH2B 1H2NA 2KSDA 4J7JA 5CN0A 2EJRA 4DV2O 3G71V 1UFIA 1XQ8A 3T1YO 4XDJA 2LFRA 4PA6A 3K0GA 1M93A 1ZLZA 4TUYA 3W7WA 1S5HC 4IL6Z 4JI8B 4DV4O 1G4YB 2WLLA 1IDSA 2QWQB 5FLXN 1R3IC 5BR8B 2RQ6A 2DMXA 1JVMA 5B1AC 4QJFB 1FPOA 3P3PA 4UVAA 3ABMC 3OMNB 1HNXB 3E89A 4PA3A 3D36A 1HNWO 1WP8A 4YY3O 4DR4O 1V9PA 3FB8C 3ASNC 2H3OA 4DV5B 1UJWB 1RSOA 3CSXA 3L71H 3KKYA 1K8AW 1NTZH 5C8YA 4LFAO 4RWUA 3R65A 4HNAA 4PJ0Z 4EKWA 3JASA 5FNVB 4LF4O 2BOCC 3AEIA 2OTJV 1FXKA 3CC4V 5LP6A 1NU1H 4X89A 4O4HA 1I94B 5JJJB 1ZSPA 1L1FA 4JF3A 2YIBA 4GX5A 2RDCA 5LYJB 1FYJA 3OR7C 4DV0B 1K4DC 1FJGO 1SKVA 4BIZA 1DTOA 3ABLC 4AILC 1YDXA 2AZ2A 1B6QA 2LQTA 4LH6A 3ZRWA 4JAUA 5BY1A 2UUAO 4CZZA 5B3SC 3JD2A 4NYKA 2EZPA 4LF8B 4R8CA 2IH1C 4J7ZA 1JFFB 2ZNJA 4OX9O 3GWKC 2KG7A 1Q6UA 1R6KA 5J2UA 1AILA 4GT1A 1VF7A 4WBNB 2P67A 3DXRB 4H37A 1QBZA 2F66C 3UCSC 3SJAC 3CXCU 2XAHA 4X88A 2BTOA 4PHZA 4YJ2A 4JGSA 2WLKA 4WFEA 4MVOA 3CRCA 1A32A 2B5UA 2ZQMA 3MDSA 1N36B 1K3EA 2UXCO 2N05A 3RT3C 1EBOA 5LHIA 1BL8A 3BVOA 1ZTEA 4B3TO 3UQ8A 1P7GA 5IYCO 4IYIA 1HNZB 1KQSU 1MNGA 2EULA 2GSMB 2MW2B 2W0XA 4RUFA 2PF4E 1U96A 2BE3A 2XUMA 4GCZA 3F5TA 2P7TC 3K79A 1CXZB 1N34O 4X65B 2KQXA 3OE7G 1PM9A 2UU9O 2Z5UA 4RQFA 3ZS8C 4B08A 2EIKB 2PGGA 2FKXA 5LXTB 3FB6C 3LNNA 2UXDB 1BT8A 4U3JB 4I7ZB 4K35A 4P9PA 5CA0A 3TJTA 3CJHB 2HHHO 3WU2Z 3BFRA 4F6RA 3ZN1A 3AK2A 4DR6O 3GWOA 2K1EA 2AXTZ 4Z2WA 4NXMB 2QTSA 1K5SA 3E22B 4H0LB 1S72V 1N32B 2EIMC 5LA6A 2GUZB 3VBBA 3CE2A 4IIJB 4LF7B 2ZD9A 5EC2C 1AI6A 4UXNA 5F2VO 3HKDB 3HKEB 4LNUB 3P3NA 3D3QA 1Z5WA 2YS8A 5JQGB 3O9OA 2N04A 2QR4A 3G4SV 5LMUO 4X1IB 3CRAA 4W4LA 3OM3B 4DR7O 3Q4HA 3T1CA 1AJQA 4DR3O 3ZMUA 2L6LA 1XI1A 3CPWU 4ZI7B 2YIDA 2Y69C 1SESA 3H1KH 1AR4A 3JATB 4UB8Z 4I50B 2X6CA 4JYAB 1N4CA 1Y66A 3MHHC 3J80N 5BMVA 2M6YA 5DECA 2JEXA 3N2KA 3T1HO 1XNQB 3RYCB 3BCCH 2YEVA 1RFYA 5BR8O 1WP7A 3C90A 3KCXA 5EBWC 1F7YA 1BMFG 3LDDA 4JTAB 4GUNA 1KU9A 1HNXO 1WB8A 4J9ZB 2VS0A 1O9HA 2QE7G 2XAQA 2JEUA 1Y67A 4LWSA 2HFEC 5IT9N 4DV5O 2ZCEA 3D3IA 3APOA 1VQKV 1VF6C 3LUTB 2F1MA 2H94A 4PI0A 3ZHSA 4XDLA 4JI6O 1OJHA 4PDLA 5D5QA 3C3TA 4G2KA 3RWRD 2A3QA 2OYQA 4DV2B 1W2BU 1ROPA 2HVKC 1CP9A 3HKCA 4P2ZA 4DV7O 4X9QA 3RYIA 1K97A 3TGUH 5KAFZ 5KHJA 2OCHA 4EB6A 3SJCC 3UT5B 2PY5A 1YIJV 3U10A 4DV4B 3UO2A 2CH7B 3E35A 3STZC 4X1YB 4CS3A 2PZSA 5CBFA 5AG2A 4E2LA 3SPCA 4LF8O 4MTXA 3ZCCA 1Q81W 4J11A 4FJCC 1MG1A 1G8MA 4DRXA 3AK3A 2ITDC 5EIBC 1HNWB 4YY3B 1NTMH 1KECA 4DR4B 3LDEA 3FYIB 4HBNA 1PV0A 3SJBC 4LFAB 4KL1A 1THZA 1JJOA 2VQFO 2C2AA 4LF4B 3J7AU 1M56C 1N36O 1M9NA 3QO8A 2E3CA 4MT8A 1WJZA 1D5AA 5CA1B 1JCHA 2BTQA 1GM8A 1H8EG 3RYFB 2LGWA 2X7RB 1S5JA 1K34A 1K4CC 2IJKA 5EZYB 1I0HA 1L0LH 1FFXA 3F5WC 4FFBA 4G27B 4CH3A 2HVJC 1I5YA 1Q3EA 1XHXA 1NTKH 3D36C 4D6TH 1TVKA 5L3EA 3FAVA 5LBQA 3B8NA 2Z3YA 1HP8A 3K0DA 5B5EZ 4DW1A 4J10A 3AG4B 3OUFA 4OX9B 5CB4A 5B1BC 2KKWA 3CRQA 4P30A 3SPIA 5JVDB 3E8HA 2UXDO 2YC0A 4DV6B 1FXKC 1F4MA 4JZ2A 5LP6C 2D2CB 2FB5A 2WLHA 1ZAUA 3WB0A 4I5SA 2A9HA 1E1RG 1SETA 2X6AA 5KX5B 4DV3O 2OIGA 3H1LH 4NXMO 1RM1C 5D5PA 4JAVA 4GKJB 3VQWA 2JGUA 1OCCB 4O4LB 1TUEB 3CCSV 1SA0B 1JQ0A 2ATKC 3MHSC 5A2QN 2WSSG 5H5NA 1IXBA 4J9YB 3HPLC 5FPRA 4FLYA 4MVZA 2QWNB 2LJ2A 2NLJC 3ZN0A 3CX5F 1WLEA 1F23A 2DWDC 5J9PC 1Y76B 2ZNIA 2R70A 2EBOA 5CA1A 2P22C 5EYPA 2JGDB 3ASOB 2CAZC 1N34B 4LBEC 2WLIA 4DV1B 4H33A 4QE7A 3ZMZA 2GV9A 1R73A 3L70H 2Q5ZA 4JYAO 1GN3A 4ABMA 4I0XA 2Q8VA 1OCZC 2ZDIC 4YIPA 4ICGA 1YHQV 5JJNB 1NH2D 5ITZB 4O2AA 2DJVA 1WA8A 4TV9A 4JI1O 3ABUA 3JAKB 3SYAA 1LNQA 2Q0OC 4YJ3B 3OEHG 3E8GA 3ZMSA 1XNQO 2DYSB 2HHHB 2WPDG 4DR6B 1M57B 1QLNA 1IXMA 1R3LC 1SQFA 2ZE5A 3E2EA 1WNSA 3VQVA 3RFRA 4K8XA 1S0VA 4X66B 4I4TA 1N0JA 3TK1A 5L3CA 1AR5A 2NN4A 4JI3B 5JCOC 1Z5VA 1H2SB 4CH4A 4PV1B 1B04A 1NT2B 2UXNA 4JYYA 1PPJH 4JYCA 3CXHF 4UCUA 4DR7B 1Y4MA 4N21A 3ZRXA 4DR3B 1MSWD 1KB9F 3I56V 1F51A 2HJDA 2A79B 4OXSA 2JRIA 1EZJA 3QVNA 3O65A 3JSNA 1ZL8A 4GKKO 2QSAA 3CRRA 1OV9A 4MTOA 1VIBA 1S3JA 4FZ0A 1W0KG 1QVFU 4TV8B 2Q7GA 3FD9A 2FYUH 2JGDA 3B2EE 2LP7A 4FM0A 1AP5A 3QG5A 3T1HB 2IW5A 2PI5A 4KFMA 4LR3A 1H2KA 2ODMA 1TUBB 1XMOO 3K03A 3TETA 2D3OW 1XMQB 3MD0A 3JALB 2P90A 3AG3B 1VP7A 3K9SA 3LDCA 4IHJA 4MVQA 3ETEA 2QWPB 2WAMA 1J5EB 3ZX6A 3SGIA 1R3JC 3ZBHA 4DR1O 4AQYO 2CK3G 3QO7A 2B1IA 4IGGA 2WA3A 4NTXA 1SF9A 3AG2C 2DYRB 3DGEA 4JI6B 4KXRA 2P5OA 1T5EA 4Z1VA 4U7NA 2EINC 4CS4A 1P4RA 1PL4A 2V4DA 5IY5B 2PTMA 4DV7B 1ZX3A 1S76D 5J2TA 3CCMV 2VWJA 3LSSA 4DUYO 3ZHVA 1FXHA 5GONA 1YXBA 2IJHA 2CTWA 1B3QA 4MVRA 3W7SA 2YSUB 3K59A 2FL4A 4PELA 2EZOA 3I55V 1PNLA 3AG1B 4B3RO 4TQFA 1XHZA 2B1GA 4MVMA 5L3FA 2PUSA 2DOSA 4O4IB 5KUMA 1QR8A 4TSFG 5H9CA 2DE0X 5IJ0B 1PNKA 4DV6O 1WN7A 2WA4A 2XAGA 3ZRSA 5IJ9B 2W6IG 4YHHB 4FPPA 5L3GA 5KHHA 1QHTA 1BCCH 2ZDIA 4GX0A 2VQFB 4GKJO 2IM9A 4MVSA 3B09A 1DGSA 3RW0A 3SYOA 4WFGA 2Q67A 1SQQH 4WFBV 2QKSA 3TXQA 3BHPA 4LC1A 2P06A 3RYHB 2ZINA 1KBHA 3ML0A 3H9VA 1GTOA 1Y6XA 5FNVA 2Q73A 3K5NA 1Y74B 1YCIA 1AR1B 1KD1W 1BQ0A 4NR1A 1F4NA 1VF5B 2Y0PA 3T4DA 3ETQA 5GTIZ 3W7UA 4DW0A 5JCOA 3CMEV 4PI2A 2DQ0A 3CCRV 4DV1O 3KZIZ 1O9GA 5LYJA 1K9MW 4MTGA 1HDJA 4LFCB 1Q90D 1HWYA 3DC5A 1YEWA 2UXXA 2V7QG 2Y0IA 2HP8A 3SDLA 5A9GA 2ZXWB 5E79Z 2JIZG 3RVYA 1PNMA 2F23A 4EFBA 2XT9A 2Q69A 3OMIB 3U0ZA 1OZ0A 3GB7C 1JFFA 5IWAB 4DV3B 3WB1A 4PA7A 4C7UA 4UB6Z 1YVWA 2F95B 2JS3A 4WBNA 3DXRA 4JTDB 1L8DA 3K04A 1PL0A 4X66O 5DM6V 2MK3A 5IYZB 4JI3O 5LHHA 4IT5A 4NB5A 4CH6A 3OMAB 3OAAG 5B3SB 1Q82W 3K5LA 3WG7C 1BHBA 1SQPH 4RUEA 4JAAA 2P6JA 4TWKA 5KUKA 4XBFA 3CEIA 3ETGA 2QEXV 5KMGB 3CHXA 2ZM6B 2LW7A 2QJ1A 1EN4A 1IZ3A 1JA8A 3E8BA 4LFBO 4DR2O 2CGNA 4QIWF 4FFKA 3ABKB 2ZR2A 1JX9A 1GM9A 3NXSA 3MAQA 2BSKB 4QGPA 4JI1B 2EIJC 1Q7YW 5KAIZ 4L8JA 2IU3A 1R3KC 1VQMV 5FL7G 2ZIMA 3JD1A 1VQNV 3D8CA 4JI5O 4JI4O 5LXTA 1N8RW 1XMQO 3FFQA 3L74H 1MMMA 3SYCA 3JAWB 4U3JA 3OEEG 3E8FA 3VOUA 1J5EO 3CJHA 5CA3A 5CBGA 1V55C 3SYQA 3FB7C 2YI8A 3IC7A 1QQCA 1GN2A 2GDSA 2A7WA 3CRMA 3E22A 3K08A 3OFNG 1PP9H 1MZFA 5HFLA 4UV9A 2XASA 5LGUA 4GZRB 2GUZA 3F7VC 4IIJA 4BAYA 3TCUA 1QNMA 3FYEB 1FXVA 3NR7A 3UKMA 3HKDA 3HKEA 4LNUA 5DEDA 5E1AC 5JQGA 4X1KB 4GKKB 1CEZA 3L72H 4X1IA 2LGQA 3WB2A 4WCEV 1NVPD 1RP3B 2XAJA 1RPOA 2QA4V 4ZI7A 5DN6G 2ZT9B 3JATA 5KHGA 3OD4A 1K92A 4J41A 4I50A 1P49A 5KA5A 1AROP 1XMOB 4IYHA 1OCOB 3J81N 3C3SA 2EX3A 2JJ2G 2BCCH 1MOFA 1OCCC 3BABA 4KHPB 4F4LA 4I55B 2ARHA 4JV5B 1BE3H 1YTFD 4DR1B 3RYCA 4AQYB 1TA8A 3P30A 2Y69B 4BR6A 1CPYA 1QLEB 3P32A 4R7CA 4AI8A 3W7TA 1N33O 4YHHO 3JAWA 2WLJA 1KP3A 5JH7B 1IBMB 1AB3A 4X20B 1NVPB 3K06A 1E79G 1WAZA 2LFSA 3N2GB 3ASOC 3GVMA 4YXWG 1SZTA 1AI7A 4OGQB 3H1JH 3CB2A 2YXYA 3LSUA 4DXWA 1KKCA 4ZOLB 1AJNA 4GX2A 5L3BA 3UM7A 4DUYB 3CCVV 5BXZA 2AZ0A 1MZEA 4R6ZA 4CBCA 1H2LA 3ZHUA 4WFHA 4FZ1A 4ASUG 2DYSC 4PA4A 1YTFB 3SPJA 2F93B 1XOUA 1M57C 3BAAA 4UVCA 1D5NA 3H1HH 4J80A 3K5MA 4LFCO 3UT5A 4B3RB 1DF4A 3S3XA 2EJ7A 1HR0B 3TXSA 3ZHQA 4PD4F 1XBLA 2CH7A 1GKFA 4X1YA 1BHAA 2UUBB 2HKOA 4PDRA 3CYOA 5GTHZ 3I5DA 4U3FH 3X2QB 3A8TA 2QWOB 4O4JB 2Q7HA 4D7TA 2QKAA 1DF5A 4FLXA 4DR5B 1H2GA 5IWAO 1GAXA 2RCVA 1V54C 2V1DA 1VQLV 1VQ7V 2Y4TA 1SERA 4FLVA 1VEWA 3OT7A 3APQA 3ZMVA 2CE4A 2XAFA 1VQ9V 3HR0A 4R50A 5LOVB 2FTKA 1X4TA 3K5OA 4BIOA 2A06H 4TT3G 2N74A 3HKBB 1MABG 4X20A 3VQYA 1GM7A 2ZKOA 2LO1A 2GBOA 3JARB 3JAMN 1WPBA 4HZ3A 4LF9O 3F7YC 1FS0G 3RYFA 3ICXA 2ZM6O 2W6JG 1I08A 2ETNA 4BW5A 4JI0B 5EZYA 3AG3C 3BEHA 4X8AA 2Y4UA 1QCEA 1YJWV 4WFFA 1SS3A 4TUYB 1YF2A 4B3SO 5JJEB 2XNDG 3SR2C 5K1PA 1VQ5V 1N0NA 3BRCA 5KHIA 1K5QA 2ADPA 1VQPV 1YZBA 2WLLB 2YIBD 4JZGA 1US6A 3QTCA 1TGOA 4FMTA 5KHKA 3S3WA 5JVDA 3PN1A 3R66A 4UCRA 2RNBA 5IYDO 4UCSA 4D7SA 2Q9LA 3JCUZ 3IFXA 3CC7V 5KX5A 3K9AA 1NR7A 1Q86W 1FKAO 3DC6A 4CC5A 1RSOB 1JPXA 4Z1MG 3OGCC 4O4LA 1B06A 3HB3B 5C8YB 1SA0A 4TQDA 2JVDA 1I7FA 4HNAB 1PKXA 4XDKA 1UPGA 3JASB 3WFVA 2XHBA 4UFZA 5BZBA 5LGNA 1KKDA 1NBMG 1KYOF 1FXKB 5LP6B 3ETDA 2YIAA 2QTOA 3QNEA 1SQBH 2ZE8A 4O4HB 4LFBB 4DR2B 3AG1C 1KC8W 4NXNO 1Y76A 3AG7A 1GMGA 1M4UA 3ZJZA 2CDYA 4JASA 3L73H 2EILB 2JS5A 2W0FC 4K8ZA 3CCQV 1K7DA 4FLWA 5B1NA 1XDCA 2ZE7A 2CTQA 4JI5B 3SPGA 3ZRWB 4JI4B 1OCRB 4LF6B 3U11A 4L87A 4MVUA 5ITZA 3JAKA 4KHPO 4YJ3A 1VQ8V 2YDEA 2KG7B 1DK1A 4JV5O 5J2UB 1MSDA 2E5LB 2M7WA 3JSLA 1M1KW 3JD3A 1L0NH 4B3MO 2HG5C 3BPZA 1NZ6A 2AGAA 3E86A 3A2FA 4YJ2B 2CGOA 1SC5B 1IBMO 1OCZB 4FK5C 1VQ6V 5KLVH 1XUQA 2HR3A 3DSQA 3AK1A 4QE9A 2HEPA 3STLC 2IBZH 4JI7B 2A0LA 2EIKC 3IJ4A 4CS2A 3G6BA 2RJZA 2VWKA 2ZXWC 2VQEO 1H38A 2F4VO 1WB7A 2JDIG 1P7BA 2OCCB 2UXBO 4DUZB 4DYLA 4JI2B 1MA1A 1OHHG 3K3WA 1SQXH 2X6BA 1D2DA 3EXAA 1GN6A 4MW8A 4RAIA 4TV8A 1FD9A 2E76B 1P84F 2LW1A 1HR0O 2DWEC 3LSQA 1KP2A 3FX7A 1XILA 4A5UB 3A0HZ
chains in the Genus database with same CATH topology
3B8MA 3CCLV 1M9NA 3QO8A 1M90W 4MT8A 4QIWF 1JCHA 3ABKB 2ZR2A 3CCJV 1JX9A 1GM9A 1GM8A 3DTUB 2OCCC 3NXSA 1H8EG 2NNUA 3FKSG 5B1BB 2EIJC 5H6RA 1Q7YW 2X7RB 2WLMA 2WLNA 1K34A 5EC1C 2IU3A 1R3KC 1VQMV 5FL7G 1K4CC 2IJKA 3JD1A 1VQNV 1VQOV 1JOYA 3F5WC 4G27B 3G6EV 1PD3A 2HVJC 1I5YA 4KP4A 1N8RW 1V54B 3E83A 3OR6C 5L3EA 5LBQA 1RM1B 4ZKIA 3SYCA 1NKDA 3B8NA 3W7XA 2Z3YA 2HLDG 3OEEG 4DO2A 3E8FA 3K0DA 3VOUA 3A0RA 4RO2A 5L3DA 3JCZA 1NH2B 5CA3A 5B1AB 5CBGA 1V55C 4BIUA 3CMAV 3AG4B 3OUFA 3ABKC 5CN0A 2EJRA 3M99B 3FB7C 3SYQA 3G71V 3IC7A 5B1BC 4P30A 3ABMB 4XDJA 3JYCA 2LFRA 3SPIA 4PA6A 3K0GA 3E8HA 3K08A 2QM7A 3OFNG 5HFLA 1FXKC 1F4MA 4UV9A 2XASA 5LGUA 3ASNB 4QPJA 2WLHA 3F7VC 4BAYA 3W7WA 4I5SA 3TCUA 2A9HA 4MTFA 1E1RG 1SETA 1S5HC 2X6AA 3FYEB 4G28B 1FXVA 3AG2B 2JJ1G 3B77A 3UKMA 1RM1C 1G4YB 5E1AC 4JAVA 2WLLA 1OCCB 1TUEB 1CEZA 1R3IC 3PJSK 3CCSV 1JVMA 1GO3F 5B1AC 4WCEV 2EINB 4QJFB 1JQ0A 1NVPD 2ATKC 4UVAA 2OTLV 3JD4A 3MHSC 2XAJA 1RPOA 2DW4A 2WSSG 2WWWA 4KUMA 2DQ3A 3ABMC 3OMNB 4J9YB 3E89A 2QA4V 4PA3A 3HPLC 5DN6G 1ORQC 3D36A 4MVZA 1AJPA 2IJIA 2NLJC 2YEVB 5IDJA 1K92A 3ZN0A 3FB8C 3ASNC 1WLEA 1F23A 2DWDC 2HJFC 3KG2A 5J9PC 5KA5A 1AROP 1UJWB 1OCOB 2EBOA 1K8AW 3ASOB 3ABLB 2GHYA 2JJ2G 4LBEC 2WLIA 1MOFA 1XL4A 3R65A 3LNMB 4H33A 4QE7A 1OCCC 3ZMZA 4EKWA 4F4LA 2BOCC 3AEIA 2OTJV 1YTFD 1FXKA 3CC4V 1R73A 3P30A 4X89A 2Y69B 2ZDIC 1OCZC 3CCUV 1CPYA 1QLEB 3P32A 4R7CA 3W7TA 1YHQV 3SPHA 1NH2D 1L1FA 4JF3A 1K73W 3ABUA 2IJJA 4HAMA 3SYAA 4GX5A 1LNQA 4MW3A 3OEHG 2WLJA 1NQTA 1KP3A 3E8GA 3JD0A 3ZMSA 2DYSB 3OR7C 2WPDG 2KB1A 1NVPB 1OCOC 2JK5C 3K06A 1K4DC 1E79G 1M57B 2LFSA 3ABTA 4BIZA 1DTOA 3ASOC 1QLNA 3ABLC 4YXWG 1IXMA 1SZTA 1R3LC 1AI7A 3CD6V 1B6QA 3E2EA 3ZRWA 1H8HG 4DXWA 3SJQC 4JAUA 5C93A 4CZZA 5B3SC 3JD2A 1AJNA 2EZPA 4GX2A 4R8CA 5L3BA 1S0VA 2IH1C 3TK1A 5L3CA 4I9WA 3UM7A 3IGAC 3CCVV 1QLEC 1R6KA 4R6ZA 1SRYA 4CBCA 2UXNA 1I5XA 2Q68A 4GT1A 4WFHA 4UV8A 4JYCA 1DLBA 2P67A 4ASUG 2DYSC 4PA4A 1AI5A 4H37A 1QBZA 3SPJA 5IYBO 1K33A 1NJIW 1YTFB 1Y4MA 1GK9A 4N21A 1M57C 4UVCA 3ZRXA 3CXCU 2PI4A 2XAHA 4X88A 4RQEA 1MSWD 4JGSA 3I56V 1F51A 2WLKA 2A79B 4OXSA 1DF4A 4WFEA 1EZJA 4MVOA 4QPKA 2B5UA 2ZQMA 1K3EA 2R9RB 1ZWIC 1GKFA 1BHAA 2HKOA 4MTOA 3CYOA 4PDRA 1S3JA 3X2QB 1EBOA 1W0KG 5LHIA 1QVFU 1BL8A 1DF5A 1QVGU 2BOBC 2LP7A 5CMUA 2X0LA 5IYCO 1H2GA 1YITV 5EBLC 1V54C 2IW5A 1KQSU 2PI5A 2V1DA 1VQLV 2GSMB 4LCUC 1VQ7V 1ENVA 4KFMA 1SERA 3ZRVA 4RUFA 4GCZA 3BY6A 3ZMVA 2P7TC 3K79A 3K03A 3TETA 2D3OW 2XAFA 1VQ9V 3MD0A 3AG4C 2P90A 4R50A 3RBZA 2FTKA 3AG3B 4QNHB 3LDCA 4MVQA 3ETEA 3OE7G 4TT3G 3CC2V 1YSCA 2WAMA 2EIMB 3EHBB 1MABG 2Z5UA 4RQFA 1R3JC 3X2QC 2EIKB 4UUJC 2CK3G 3QO7A 2B1IA 1GM7A 2QM8A 4U7OA 3FB6C 4HZ3A 3OW2U 2R9IA 3AG2C 2DYRB 1FS0G 3F7YC 5H6QA 1S77D 3WG7B 3DGEA 5EK0A 2Y48A 4P9PA 4P9OA 2W6JG 4BW5A 3ZN1A 2H8PC 1R6NA 3GWOA 4U7NA 2K1EA 2EINC 3EFFK 1P4RA 3AG3C 3BEHA 4X8AA 1K5SA 1QCEA 1S72V 5IY5B 1YJWV 4ZBMA 1YJNV 2EIMC 4WFFA 1JJ2U 4WF9V 1E1QG 3ZMTA 1S76D 2OT5A 3VBBA 3CCMV 1RPRA 2XNDG 3LSSA 1VQ5V 2ZD9A 1FXHA 5EC2C 1AI6A 1K5QA 2IJHA 4UXNA 3FB5C 4LP8A 2WLLB 4MVRA 1VQPV 2EIJB 3W7SA 1XL6A 3G4SV 4HYOA 2YSUB 1WPXA 3T2MA 2XOKG 2ITCC 3OM3B 4FMTA 4PELA 4WFAV 2EZOA 1AI4A 3T1CA 1AJQA 5IYDO 3ZMUA 3I55V 1PNLA 3QO5A 3CPWU 3AG1B 2Y69C 1SESA 2B1GA 4MVMA 3IFXA 5L3FA 3CC7V 2ZR3A 4PDMA 3K9AA 1NR7A 1Q86W 2X6CA 5KUMA 1QR8A 4TSFG 4Z1MG 1JPXA 3OGCC 5H9CA 3SYPA 1V55B 1Y66A 3MHHC 1PNKA 3HB3B 2JEXA 2XAGA 3ZRSA 2WLIB 1J95A 2W6IG 1PKXA 4FPPA 4XDKA 5L3GA 3ZIAG 5CBHA 1YI2V 3WFVA 5BZBA 5LGNA 1KKDA 1NBMG 2ZDIA 4GX0A 1FXKB 3ETDA 4MVSA 2QTOA 3QNEA 5HFMA 2YEVA 3RW0A 3SYOA 4WFGA 3AG1C 2Q67A 1KC8W 4WFBV 5EBWC 2QKSA 4UVBA 4LC1A 1BMFG 1GMGA 3LDDA 4PDVA 2Q6AA 4JTAB 3ZJZA 3ML0A 4GX1A 4JASA 4J9ZB 2QE7G 2EILB 1GTOA 2W0FC 2XAQA 2JEUA 3CCQV 1K7DA 1AR1B 1KD1W 5B1NA 1F4NA 2HFEC 4JTCB 3SPGA 3T4DA 3ZRWB 3D3IA 1NR1A 1OCRB 1VQKV 3W7UA 3RVZA 3LUTB 2H94A 3CMEV 2IH3C 3T4ZA 2DQ0A 4MSWC 4XDLA 4L87A 5B1OA 4MVUA 5LHGA 3CCRV 2F43G 4PDLA 1FFTB 4Q20A 4G2KA 1VQ8V 1K9MW 4MTGA 1VQ4V 2IU0A 1HWYA 2M7WA 5LGTA 1M1KW 2UXXA 3JD3A 1W2BU 4FIPC 1ROPA 2HVKC 1CP9A 2V7QG 2HG5C 2AHZA 4P2ZA 2ZXWB 3RVYA 2JIZG 4JYBA 1PNMA 1K97A 2EILC 5GW7A 2AHYA 3E86A 5KA6A 2Q69A 3OMIB 1OZ0A 3GB7C 1COWG 1OCZB 1YIJV 4FK5C 1OCRC 1VQ6V 5EBMC 4PA7A 3H01A 3E35A 2HR3A 3STZC 4QE9A 1YJ9V 3CP1A 5CBFA 4E2LA 3STLC 1M56B 4JPRA 4JTDB 3SPCA 3K04A 2A0LA 2EIKC 4MTXA 1PL0A 3ZCCA 5DM6V 2MK3A 1Q81W 5LHHA 2ZXWC 4FJCC 1EFRG 1H38A 2JDIG 3OUSA 1MG1A 1P7BA 1G8MA 2OCCB 2ITDC 3OMAB 3OAAG 5B3SB 1Q82W 2DYRC 3WG7C 1KECA 1BHBA 3LDEA 1OHHG 3FYIB 3K3WA 2X6BA 4PA9A 4RUEA 2P6JA 4TWKA 1QR9A 5KUKA 4XBFA 4MS2A 3ETGA 2QEXV 4MW8A 4RAIA 1THZA 4N23A 2C2AA 2DWEC 3LSQA 5IY5C 1KP2A 1W0JG 1M56C 3CCEV 3E8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL V;  1VQP V;  1YIJ V;  3CCR V;  1M90 W;  1QVF U;  2OTJ V;  1Q82 W;  2QA4 V;  1VQ6 V;  3G4S V;  1NJI W;  3CC2 V;  3CC4 V;  1R73 A;  1VQ8 V;  1K9M W;  3CD6 V;  1QVG U;  1VQ4 V;  4WFA V;  3CXC U;  3CCJ V;  1YIT V;  1YJ9 V;  3CCU V;  1M1K W;  1S72 V;  1KQS U;  1W2B U;  1Q7Y W;  1VQL V;  1YI2 V;  3CMA V;  3I56 V;  1YHQ V;  1YJN V;  1YJW V;  2QEX V;  3CCQ V;  4WF9 V;  1VQ7 V;  1JJ2 U;  1K73 W;  3I55 V;  1KC8 W;  3G71 V;  3CPW U;  1VQM V;  1KD1 W;  3CCM V;  1K8A W;  3OW2 U;  3CCV V;  1VQ5 V;  3CCS V;  5DM6 V;  1VQN V;  3CC7 V;  4WCE V;  2D3O W;  1Q81 W;  1VQO V;  1VQ9 V;  1VQK V;  3CCE V;  2OTL V;  3G6E V;  3CME V;  1Q86 W;  4WFB V;  1N8R W; 
#chains in the Genus database with same CATH topology
 3CCL V;  2YI9 A;  2ZIO A;  4FM1 A;  1KUQ A;  2UUB O;  1LUV A;  1TUB A;  1IUR A;  3DTU B;  1SQG A;  2NNU A;  3JAL A;  1N33 B;  5CA0 B;  2RN9 A;  4UCO A;  1NS1 A;  2QKC A;  4F6R B;  4ZIB A;  4DR5 O;  4X64 B;  4GLX A;  1Q8I A;  1SZX A;  5EC1 C;  4F6E A;  3RGB A;  1BGY H;  1VMG A;  1IBK B;  5LMN B;  2NR5 A;  2ZE6 A;  4W4K A;  2RMK B;  4KP4 A;  5LA6 B;  1GRJ A;  3W7X A;  1XEQ A;  2HLD G;  3OGI B;  2AW9 A;  2VRZ A;  1FAF A;  3A0R A;  3CWB H;  4NTY A;  4RO2 A;  5L3D A;  5B1A B;  3CMA V;  4BIU A;  3ABK C;  4CC6 A;  3M99 B;  3ABM B;  3JYC A;  5H2F Z;  1VAR A;  3Q4H B;  2QM7 A;  5FPO A;  3ASN B;  4QPJ A;  1JMK C;  5K1X A;  4JI0 O;  4MTF A;  4G28 B;  3AG2 B;  2JJ1 G;  3B77 A;  4X62 O;  5BMV B;  3PJS K;  1GO3 F;  2EIN B;  3N2K B;  2OTL V;  3JD4 A;  2DW4 A;  4KUM A;  2WWW A;  2DQ3 A;  4Q6G A;  3BA8 A;  4E4E A;  1ORQ C;  1AJP A;  1XNR O;  2IJI A;  2YEV B;  5IDJ A;  4K3A A;  2HJF C;  3KG2 A;  4O4I A;  1Q43 A;  2Z0A A;  5IJ0 A;  2OWO A;  2E74 B;  4K0K B;  3ABL B;  4B7E A;  5IJ9 A;  2ADQ B;  2GHY A;  1XL4 A;  2GTS A;  3LNM B;  1Q6I A;  3N27 A;  4LWS B;  4H44 B;  3ZED A;  1IBL O;  3CCU V;  2QM4 A;  3SPH A;  1TAE A;  4LF9 B;  2GTA A;  1K73 W;  4HAM A;  2IJJ A;  3RYH A;  4MW3 A;  3A0B Z;  1NQT A;  3JD0 A;  4LF5 O;  2PYJ A;  2KB1 A;  2Q0A A;  1GH6 A;  1OCO C;  2JK5 C;  3ABT A;  3HKC B;  3QF7 A;  1Y74 A;  3RYI B;  3CD6 V;  5B66 Z;  4EB6 B;  1H8H G;  3SJQ C;  1GN4 A;  2P4K A;  5C93 A;  4B3S B;  2UUC O;  4I9W A;  3IGA C;  1QLE C;  3G67 A;  1SRY A;  2CUG A;  1I5X A;  2Q68 A;  4UV8 A;  4LF6 O;  1DLB A;  1Q5O A;  2CTP A;  5IYB O;  1AI5 A;  3RN4 A;  1NJI W;  1K33 A;  4GYC B;  5JWP A;  1GK9 A;  1G1X B;  2PI4 A;  1EN6 A;  3M8A A;  4RQE A;  4OPA A;  4JI8 O;  4DRX B;  2E5L O;  1ZUQ A;  4QPK A;  2R9R B;  1ZWI C;  1BQZ A;  3G80 A;  2K9P A;  1QU7 A;  4FLZ A;  2BOB C;  1QVG U;  5CMU A;  2X0L A;  4TOI A;  5IYZ A;  4YIO A;  5EBL C;  4NTW A;  1YIT V;  4FM2 A;  4EFE A;  4LCU C;  1ENV A;  3ZRV A;  3BY6 A;  2Q7E A;  4NXN B;  2BTQ B;  3OTO B;  3AG4 C;  4JI7 O;  3RBZ A;  1W59 A;  4QNH B;  2PYL A;  3CC2 V;  1YSC A;  5KMG A;  2EIM B;  3EHB B;  3IC9 A;  3X2Q C;  2QWR B;  1FFX B;  4DUZ O;  4UUJ C;  4FFB B;  4JI2 O;  2L35 A;  2QM8 A;  3T1Y B;  4U7O A;  1I94 O;  1TVK B;  3FAV B;  1BS3 A;  3OW2 U;  2R9I A;  5H6Q A;  1S77 D;  3WG7 B;  5EK0 A;  2Y48 A;  2BSK A;  4P9O A;  4H13 B;  4DV0 O;  2H8P C;  4ZHQ B;  1R6N A;  5CB4 B;  1IVS A;  3EFF K;  4FLU A;  4B3M B;  4FLT A;  1U97 A;  4ZBM A;  1YJN V;  1JJ2 U;  4WF9 V;  1E1Q G;  3ZMT A;  2OT5 A;  1RPR A;  4BWA A;  4X64 O;  3BA9 A;  2FML A;  1BSM A;  3FB5 C;  2QDO A;  1IBK O;  5LMN O;  4LP8 A;  4NKG B;  1HW7 A;  2EIJ B;  4AHC A;  1XL6 A;  3IAY A;  4HYO A;  3M7M X;  1WPX A;  3T2M A;  3VQX A;  2XOK G;  2ITC C;  2OIE A;  4WFA V;  2O57 A;  1AI4 A;  2DN9 A;  2P4V A;  3QO5 A;  3THO A;  3EVK A;  4DK0 A;  2VQE B;  2F4V B;  2ZR3 A;  4PDM A;  4I9Q A;  2UXB B;  2B9Z A;  4X1K A;  1AVM A;  3SYP A;  1V55 B;  3B4S A;  5EYP B;  1KMI Z;  2WLI B;  1J95 A;  3ZIA G;  5CBH A;  1YI2 V;  4BW9 A;  1HNZ O;  3ZHR A;  1FJG B;  5HFM A;  5EIB D;  3K57 A;  4I0X B;  3KCY A;  4O2A B;  4TV9 B;  1WA8 B;  4UVB A;  4UCV A;  4X65 O;  4NVP A;  4PDV A;  1JR9 A;  2Q6A A;  2UUA B;  4FVM A;  4GX1 A;  1EN5 A;  4O2B B;  3OTF A;  4ZHQ A;  4I55 A;  5TIS Z;  1M5I A;  1Z2G A;  4JTC B;  1NR1 A;  3RVZ A;  2IH3 C;  4K0K O;  3T4Z A;  4MSW C;  5B1O A;  4I4T B;  5LHG A;  2F43 G;  1FFT B;  4Q20 A;  1EM1 A;  1VQ4 V;  2IU0 A;  4J7K A;  5JH7 A;  2YUA A;  1AP6 A;  5LGT A;  1S5L Z;  4LH7 A;  4FIP C;  3N2G A;  4OPH A;  2AHZ A;  1N32 O;  3ZHT A;  2R72 A;  4JYB A;  2EIL C;  2UXC B;  1URF A;  3UO3 A;  1X59 A;  5GW7 A;  1LUW A;  2AHY A;  5KA6 A;  4LF7 O;  4ZOL A;  4B3T B;  1COW G;  1OCR C;  2XTA A;  1ZL8 B;  5EBM C;  2CTR A;  3H01 A;  3L9D A;  1YJ9 V;  4X62 B;  4J42 A;  3B40 A;  3CP1 A;  3K58 A;  1M56 B;  2Q4P A;  4JPR A;  1G6U A;  4B7K A;  1XRE A;  2YIC A;  2YXH A;  2QGN A;  1EFR G;  3OUS A;  2UU9 B;  1VF6 A;  2DYR C;  1XNR B;  1R1B A;  4PA9 A;  1QR9 A;  4MS2 A;  1NI8 A;  4IHJ B;  4O4J A;  1SQV H;  4N23 A;  1BZK A;  4EEQ A;  5IY5 C;  4O2B A;  1W0J G;  3CCE V;  3B8M A;  1IX9 A;  4CH5 A;  2ILM A;  1M90 W;  1EZV H;  1IBL B;  3H1I H;  2R9A A;  1R6T A;  3CCJ V;  2E75 B;  2OCC C;  1Q6H A;  2YXL A;  3FKS G;  5B1B B;  5LOV A;  5H6R A;  2WLM A;  2WLN A;  3CS5 A;  4LF5 B;  3HKB A;  5IE9 A;  1VQO V;  1JOY A;  1LR1 A;  1H2M A;  3G6E V;  1PD3 A;  5LL6 Y;  5LMU B;  1V54 B;  3JAR A;  3OTO O;  4DK1 A;  5J2T B;  2G38 A;  3E83 A;  3OR6 C;  1RM1 B;  4UCT A;  3L75 H;  4ZKI A;  1NKD A;  5GON B;  4DO2 A;  2UUC B;  3JCZ A;  1NH2 B;  1H2N A;  2KSD A;  4J7J A;  5CN0 A;  2EJR A;  4DV2 O;  3G71 V;  1UFI A;  1XQ8 A;  3T1Y O;  4XDJ A;  2LFR A;  4PA6 A;  3K0G A;  1M93 A;  1ZLZ A;  4TUY A;  3W7W A;  1S5H C;  4IL6 Z;  4JI8 B;  4DV4 O;  1G4Y B;  2WLL A;  1IDS A;  2QWQ B;  5FLX N;  1R3I C;  5BR8 B;  2RQ6 A;  2DMX A;  1JVM A;  5B1A C;  4QJF B;  1FPO A;  3P3P A;  4UVA A;  3ABM C;  3OMN B;  1HNX B;  3E89 A;  4PA3 A;  3D36 A;  1HNW O;  1WP8 A;  4YY3 O;  4DR4 O;  1V9P A;  3FB8 C;  3ASN C;  2H3O A;  4DV5 B;  1UJW B;  1RSO A;  3CSX A;  3L71 H;  3KKY A;  1K8A W;  1NTZ H;  5C8Y A;  4LFA O;  4RWU A;  3R65 A;  4HNA A;  4PJ0 Z;  4EKW A;  3JAS A;  5FNV B;  4LF4 O;  2BOC C;  3AEI A;  2OTJ V;  1FXK A;  3CC4 V;  5LP6 A;  1NU1 H;  4X89 A;  4O4H A;  1I94 B;  5JJJ B;  1ZSP A;  1L1F A;  4JF3 A;  2YIB A;  4GX5 A;  2RDC A;  5LYJ B;  1FYJ A;  3OR7 C;  4DV0 B;  1K4D C;  1FJG O;  1SKV A;  4BIZ A;  1DTO A;  3ABL C;  4AIL C;  1YDX A;  2AZ2 A;  1B6Q A;  2LQT A;  4LH6 A;  3ZRW A;  4JAU A;  5BY1 A;  2UUA O;  4CZZ A;  5B3S C;  3JD2 A;  4NYK A;  2EZP A;  4LF8 B;  4R8C A;  2IH1 C;  4J7Z A;  1JFF B;  2ZNJ A;  4OX9 O;  3GWK C;  2KG7 A;  1Q6U A;  1R6K A;  5J2U A;  1AIL A;  4GT1 A;  1VF7 A;  4WBN B;  2P67 A;  3DXR B;  4H37 A;  1QBZ A;  2F66 C;  3UCS C;  3SJA C;  3CXC U;  2XAH A;  4X88 A;  2BTO A;  4PHZ A;  4YJ2 A;  4JGS A;  2WLK A;  4WFE A;  4MVO A;  3CRC A;  1A32 A;  2B5U A;  2ZQM A;  3MDS A;  1N36 B;  1K3E A;  2UXC O;  2N05 A;  3RT3 C;  1EBO A;  5LHI A;  1BL8 A;  3BVO A;  1ZTE A;  4B3T O;  3UQ8 A;  1P7G A;  5IYC O;  4IYI A;  1HNZ B;  1KQS U;  1MNG A;  2EUL A;  2GSM B;  2MW2 B;  2W0X A;  4RUF A;  2PF4 E;  1U96 A;  2BE3 A;  2XUM A;  4GCZ A;  3F5T A;  2P7T C;  3K79 A;  1CXZ B;  1N34 O;  4X65 B;  2KQX A;  3OE7 G;  1PM9 A;  2UU9 O;  2Z5U A;  4RQF A;  3ZS8 C;  4B08 A;  2EIK B;  2PGG A;  2FKX A;  5LXT B;  3FB6 C;  3LNN A;  2UXD B;  1BT8 A;  4U3J B;  4I7Z B;  4K35 A;  4P9P A;  5CA0 A;  3TJT A;  3CJH B;  2HHH O;  3WU2 Z;  3BFR A;  4F6R A;  3ZN1 A;  3AK2 A;  4DR6 O;  3GWO A;  2K1E A;  2AXT Z;  4Z2W A;  4NXM B;  2QTS A;  1K5S A;  3E22 B;  4H0L B;  1S72 V;  1N32 B;  2EIM C;  5LA6 A;  2GUZ B;  3VBB A;  3CE2 A;  4IIJ B;  4LF7 B;  2ZD9 A;  5EC2 C;  1AI6 A;  4UXN A;  5F2V O;  3HKD B;  3HKE B;  4LNU B;  3P3N A;  3D3Q A;  1Z5W A;  2YS8 A;  5JQG B;  3O9O A;  2N04 A;  2QR4 A;  3G4S V;  5LMU O;  4X1I B;  3CRA A;  4W4L A;  3OM3 B;  4DR7 O;  3Q4H A;  3T1C A;  1AJQ A;  4DR3 O;  3ZMU A;  2L6L A;  1XI1 A;  3CPW U;  4ZI7 B;  2YID A;  2Y69 C;  1SES A;  3H1K H;  1AR4 A;  3JAT B;  4UB8 Z;  4I50 B;  2X6C A;  4JYA B;  1N4C A;  1Y66 A;  3MHH C;  3J80 N;  5BMV A;  2M6Y A;  5DEC A;  2JEX A;  3N2K A;  3T1H O;  1XNQ B;  3RYC B;  3BCC H;  2YEV A;  1RFY A;  5BR8 O;  1WP7 A;  3C90 A;  3KCX A;  5EBW C;  1F7Y A;  1BMF G;  3LDD A;  4JTA B;  4GUN A;  1KU9 A;  1HNX O;  1WB8 A;  4J9Z B;  2VS0 A;  1O9H A;  2QE7 G;  2XAQ A;  2JEU A;  1Y67 A;  4LWS A;  2HFE C;  5IT9 N;  4DV5 O;  2ZCE A;  3D3I A;  3APO A;  1VQK V;  1VF6 C;  3LUT B;  2F1M A;  2H94 A;  4PI0 A;  3ZHS A;  4XDL A;  4JI6 O;  1OJH A;  4PDL A;  5D5Q A;  3C3T A;  4G2K A;  3RWR D;  2A3Q A;  2OYQ A;  4DV2 B;  1W2B U;  1ROP A;  2HVK C;  1CP9 A;  3HKC A;  4P2Z A;  4DV7 O;  4X9Q A;  3RYI A;  1K97 A;  3TGU H;  5KAF Z;  5KHJ A;  2OCH A;  4EB6 A;  3SJC C;  3UT5 B;  2PY5 A;  1YIJ V;  3U10 A;  4DV4 B;  3UO2 A;  2CH7 B;  3E35 A;  3STZ C;  4X1Y B;  4CS3 A;  2PZS A;  5CBF A;  5AG2 A;  4E2L A;  3SPC A;  4LF8 O;  4MTX A;  3ZCC A;  1Q81 W;  4J11 A;  4FJC C;  1MG1 A;  1G8M A;  4DRX A;  3AK3 A;  2ITD C;  5EIB C;  1HNW B;  4YY3 B;  1NTM H;  1KEC A;  4DR4 B;  3LDE A;  3FYI B;  4HBN A;  1PV0 A;  3SJB C;  4LFA B;  4KL1 A;  1THZ A;  1JJO A;  2VQF O;  2C2A A;  4LF4 B;  3J7A U;  1M56 C;  1N36 O;  1M9N A;  3QO8 A;  2E3C A;  4MT8 A;  1WJZ A;  1D5A A;  5CA1 B;  1JCH A;  2BTQ A;  1GM8 A;  1H8E G;  3RYF B;  2LGW A;  2X7R B;  1S5J A;  1K34 A;  1K4C C;  2IJK A;  5EZY B;  1I0H A;  1L0L H;  1FFX A;  3F5W C;  4FFB A;  4G27 B;  4CH3 A;  2HVJ C;  1I5Y A;  1Q3E A;  1XHX A;  1NTK H;  3D36 C;  4D6T H;  1TVK A;  5L3E A;  3FAV A;  5LBQ A;  3B8N A;  2Z3Y A;  1HP8 A;  3K0D A;  5B5E Z;  4DW1 A;  4J10 A;  3AG4 B;  3OUF A;  4OX9 B;  5CB4 A;  5B1B C;  2KKW A;  3CRQ A;  4P30 A;  3SPI A;  5JVD B;  3E8H A;  2UXD O;  2YC0 A;  4DV6 B;  1FXK C;  1F4M A;  4JZ2 A;  5LP6 C;  2D2C B;  2FB5 A;  2WLH A;  1ZAU A;  3WB0 A;  4I5S A;  2A9H A;  1E1R G;  1SET A;  2X6A A;  5KX5 B;  4DV3 O;  2OIG A;  3H1L H;  4NXM O;  1RM1 C;  5D5P A;  4JAV A;  4GKJ B;  3VQW A;  2JGU A;  1OCC B;  4O4L B;  1TUE B;  3CCS V;  1SA0 B;  1JQ0 A;  2ATK C;  3MHS C;  5A2Q N;  2WSS G;  5H5N A;  1IXB A;  4J9Y B;  3HPL C;  5FPR A;  4FLY A;  4MVZ A;  2QWN B;  2LJ2 A;  2NLJ C;  3ZN0 A;  3CX5 F;  1WLE A;  1F23 A;  2DWD C;  5J9P C;  1Y76 B;  2ZNI A;  2R70 A;  2EBO A;  5CA1 A;  2P22 C;  5EYP A;  2JGD B;  3ASO B;  2CAZ C;  1N34 B;  4LBE C;  2WLI A;  4DV1 B;  4H33 A;  4QE7 A;  3ZMZ A;  2GV9 A;  1R73 A;  3L70 H;  2Q5Z A;  4JYA O;  1GN3 A;  4ABM A;  4I0X A;  2Q8V A;  1OCZ C;  2ZDI C;  4YIP A;  4ICG A;  1YHQ V;  5JJN B;  1NH2 D;  5ITZ B;  4O2A A;  2DJV A;  1WA8 A;  4TV9 A;  4JI1 O;  3ABU A;  3JAK B;  3SYA A;  1LNQ A;  2Q0O C;  4YJ3 B;  3OEH G;  3E8G A;  3ZMS A;  1XNQ O;  2DYS B;  2HHH B;  2WPD G;  4DR6 B;  1M57 B;  1QLN A;  1IXM A;  1R3L C;  1SQF A;  2ZE5 A;  3E2E A;  1WNS A;  3VQV A;  3RFR A;  4K8X A;  1S0V A;  4X66 B;  4I4T A;  1N0J A;  3TK1 A;  5L3C A;  1AR5 A;  2NN4 A;  4JI3 B;  5JCO C;  1Z5V A;  1H2S B;  4CH4 A;  4PV1 B;  1B04 A;  1NT2 B;  2UXN A;  4JYY A;  1PPJ H;  4JYC A;  3CXH F;  4UCU A;  4DR7 B;  1Y4M A;  4N21 A;  3ZRX A;  4DR3 B;  1MSW D;  1KB9 F;  3I56 V;  1F51 A;  2HJD A;  2A79 B;  4OXS A;  2JRI A;  1EZJ A;  3QVN A;  3O65 A;  3JSN A;  1ZL8 A;  4GKK O;  2QSA A;  3CRR A;  1OV9 A;  4MTO A;  1VIB A;  1S3J A;  4FZ0 A;  1W0K G;  1QVF U;  4TV8 B;  2Q7G A;  3FD9 A;  2FYU H;  2JGD A;  3B2E E;  2LP7 A;  4FM0 A;  1AP5 A;  3QG5 A;  3T1H B;  2IW5 A;  2PI5 A;  4KFM A;  4LR3 A;  1H2K A;  2ODM A;  1TUB B;  1XMO O;  3K03 A;  3TET A;  2D3O W;  1XMQ B;  3MD0 A;  3JAL B;  2P90 A;  3AG3 B;  1VP7 A;  3K9S A;  3LDC A;  4IHJ A;  4MVQ A;  3ETE A;  2QWP B;  2WAM A;  1J5E B;  3ZX6 A;  3SGI A;  1R3J C;  3ZBH A;  4DR1 O;  4AQY O;  2CK3 G;  3QO7 A;  2B1I A;  4IGG A;  2WA3 A;  4NTX A;  1SF9 A;  3AG2 C;  2DYR B;  3DGE A;  4JI6 B;  4KXR A;  2P5O A;  1T5E A;  4Z1V A;  4U7N A;  2EIN C;  4CS4 A;  1P4R A;  1PL4 A;  2V4D A;  5IY5 B;  2PTM A;  4DV7 B;  1ZX3 A;  1S76 D;  5J2T A;  3CCM V;  2VWJ A;  3LSS A;  4DUY O;  3ZHV A;  1FXH A;  5GON A;  1YXB A;  2IJH A;  2CTW A;  1B3Q A;  4MVR A;  3W7S A;  2YSU B;  3K59 A;  2FL4 A;  4PEL A;  2EZO A;  3I55 V;  1PNL A;  3AG1 B;  4B3R O;  4TQF A;  1XHZ A;  2B1G A;  4MVM A;  5L3F A;  2PUS A;  2DOS A;  4O4I B;  5KUM A;  1QR8 A;  4TSF G;  5H9C A;  2DE0 X;  5IJ0 B;  1PNK A;  4DV6 O;  1WN7 A;  2WA4 A;  2XAG A;  3ZRS A;  5IJ9 B;  2W6I G;  4YHH B;  4FPP A;  5L3G A;  5KHH A;  1QHT A;  1BCC H;  2ZDI A;  4GX0 A;  2VQF B;  4GKJ O;  2IM9 A;  4MVS A;  3B09 A;  1DGS A;  3RW0 A;  3SYO A;  4WFG A;  2Q67 A;  1SQQ H;  4WFB V;  2QKS A;  3TXQ A;  3BHP A;  4LC1 A;  2P06 A;  3RYH B;  2ZIN A;  1KBH A;  3ML0 A;  3H9V A;  1GTO A;  1Y6X A;  5FNV A;  2Q73 A;  3K5N A;  1Y74 B;  1YCI A;  1AR1 B;  1KD1 W;  1BQ0 A;  4NR1 A;  1F4N A;  1VF5 B;  2Y0P A;  3T4D A;  3ETQ A;  5GTI Z;  3W7U A;  4DW0 A;  5JCO A;  3CME V;  4PI2 A;  2DQ0 A;  3CCR V;  4DV1 O;  3KZI Z;  1O9G A;  5LYJ A;  1K9M W;  4MTG A;  1HDJ A;  4LFC B;  1Q90 D;  1HWY A;  3DC5 A;  1YEW A;  2UXX A;  2V7Q G;  2Y0I A;  2HP8 A;  3SDL A;  5A9G A;  2ZXW B;  5E79 Z;  2JIZ G;  3RVY A;  1PNM A;  2F23 A;  4EFB A;  2XT9 A;  2Q69 A;  3OMI B;  3U0Z A;  1OZ0 A;  3GB7 C;  1JFF A;  5IWA B;  4DV3 B;  3WB1 A;  4PA7 A;  4C7U A;  4UB6 Z;  1YVW A;  2F95 B;  2JS3 A;  4WBN A;  3DXR A;  4JTD B;  1L8D A;  3K04 A;  1PL0 A;  4X66 O;  5DM6 V;  2MK3 A;  5IYZ B;  4JI3 O;  5LHH A;  4IT5 A;  4NB5 A;  4CH6 A;  3OMA B;  3OAA G;  5B3S B;  1Q82 W;  3K5L A;  3WG7 C;  1BHB A;  1SQP H;  4RUE A;  4JAA A;  2P6J A;  4TWK A;  5KUK A;  4XBF A;  3CEI A;  3ETG A;  2QEX V;  5KMG B;  3CHX A;  2ZM6 B;  2LW7 A;  2QJ1 A;  1EN4 A;  1IZ3 A;  1JA8 A;  3E8B A;  4LFB O;  4DR2 O;  2CGN A;  4QIW F;  4FFK A;  3ABK B;  2ZR2 A;  1JX9 A;  1GM9 A;  3NXS A;  3MAQ A;  2BSK B;  4QGP A;  4JI1 B;  2EIJ C;  1Q7Y W;  5KAI Z;  4L8J A;  2IU3 A;  1R3K C;  1VQM V;  5FL7 G;  2ZIM A;  3JD1 A;  1VQN V;  3D8C A;  4JI5 O;  4JI4 O;  5LXT A;  1N8R W;  1XMQ O;  3FFQ A;  3L74 H;  1MMM A;  3SYC A;  3JAW B;  4U3J A;  3OEE G;  3E8F A;  3VOU A;  1J5E O;  3CJH A;  5CA3 A;  5CBG A;  1V55 C;  3SYQ A;  3FB7 C;  2YI8 A;  3IC7 A;  1QQC A;  1GN2 A;  2GDS A;  2A7W A;  3CRM A;  3E22 A;  3K08 A;  3OFN G;  1PP9 H;  1MZF A;  5HFL A;  4UV9 A;  2XAS A;  5LGU A;  4GZR B;  2GUZ A;  3F7V C;  4IIJ A;  4BAY A;  3TCU A;  1QNM A;  3FYE B;  1FXV A;  3NR7 A;  3UKM A;  3HKD A;  3HKE A;  4LNU A;  5DED A;  5E1A C;  5JQG A;  4X1K B;  4GKK B;  1CEZ A;  3L72 H;  4X1I A;  2LGQ A;  3WB2 A;  4WCE V;  1NVP D;  1RP3 B;  2XAJ A;  1RPO A;  2QA4 V;  4ZI7 A;  5DN6 G;  2ZT9 B;  3JAT A;  5KHG A;  3OD4 A;  1K92 A;  4J41 A;  4I50 A;  1P49 A;  5KA5 A;  1ARO P;  1XMO B;  4IYH A;  1OCO B;  3J81 N;  3C3S A;  2EX3 A;  2JJ2 G;  2BCC H;  1MOF A;  1OCC C;  3BAB A;  4KHP B;  4F4L A;  4I55 B;  2ARH A;  4JV5 B;  1BE3 H;  1YTF D;  4DR1 B;  3RYC A;  4AQY B;  1TA8 A;  3P30 A;  2Y69 B;  4BR6 A;  1CPY A;  1QLE B;  3P32 A;  4R7C A;  4AI8 A;  3W7T A;  1N33 O;  4YHH O;  3JAW A;  2WLJ A;  1KP3 A;  5JH7 B;  1IBM B;  1AB3 A;  4X20 B;  1NVP B;  3K06 A;  1E79 G;  1WAZ A;  2LFS A;  3N2G B;  3ASO C;  3GVM A;  4YXW G;  1SZT A;  1AI7 A;  4OGQ B;  3H1J H;  3CB2 A;  2YXY A;  3LSU A;  4DXW A;  1KKC A;  4ZOL B;  1AJN A;  4GX2 A;  5L3B A;  3UM7 A;  4DUY B;  3CCV V;  5BXZ A;  2AZ0 A;  1MZE A;  4R6Z A;  4CBC A;  1H2L A;  3ZHU A;  4WFH A;  4FZ1 A;  4ASU G;  2DYS C;  4PA4 A;  1YTF B;  3SPJ A;  2F93 B;  1XOU A;  1M57 C;  3BAA A;  4UVC A;  1D5N A;  3H1H H;  4J80 A;  3K5M A;  4LFC O;  3UT5 A;  4B3R B;  1DF4 A;  3S3X A;  2EJ7 A;  1HR0 B;  3TXS A;  3ZHQ A;  4PD4 F;  1XBL A;  2CH7 A;  1GKF A;  4X1Y A;  1BHA A;  2UUB B;  2HKO A;  4PDR A;  3CYO A;  5GTH Z;  3I5D A;  4U3F H;  3X2Q B;  3A8T A;  2QWO B;  4O4J B;  2Q7H A;  4D7T A;  2QKA A;  1DF5 A;  4FLX A;  4DR5 B;  1H2G A;  5IWA O;  1GAX A;  2RCV A;  1V54 C;  2V1D A;  1VQL V;  1VQ7 V;  2Y4T A;  1SER A;  4FLV A;  1VEW A;  3OT7 A;  3APQ A;  3ZMV A;  2CE4 A;  2XAF A;  1VQ9 V;  3HR0 A;  4R50 A;  5LOV B;  2FTK A;  1X4T A;  3K5O A;  4BIO A;  2A06 H;  4TT3 G;  2N74 A;  3HKB B;  1MAB G;  4X20 A;  3VQY A;  1GM7 A;  2ZKO A;  2LO1 A;  2GBO A;  3JAR B;  3JAM N;  1WPB A;  4HZ3 A;  4LF9 O;  3F7Y C;  1FS0 G;  3RYF A;  3ICX A;  2ZM6 O;  2W6J G;  1I08 A;  2ETN A;  4BW5 A;  4JI0 B;  5EZY A;  3AG3 C;  3BEH A;  4X8A A;  2Y4U A;  1QCE A;  1YJW V;  4WFF A;  1SS3 A;  4TUY B;  1YF2 A;  4B3S O;  5JJE B;  2XND G;  3SR2 C;  5K1P A;  1VQ5 V;  1N0N A;  3BRC A;  5KHI A;  1K5Q A;  2ADP A;  1VQP V;  1YZB A;  2WLL B;  2YIB D;  4JZG A;  1US6 A;  3QTC A;  1TGO A;  4FMT A;  5KHK A;  3S3W A;  5JVD A;  3PN1 A;  3R66 A;  4UCR A;  2RNB A;  5IYD O;  4UCS A;  4D7S A;  2Q9L A;  3JCU Z;  3IFX A;  3CC7 V;  5KX5 A;  3K9A A;  1NR7 A;  1Q86 W;  1FKA O;  3DC6 A;  4CC5 A;  1RSO B;  1JPX A;  4Z1M G;  3OGC C;  4O4L A;  1B06 A;  3HB3 B;  5C8Y B;  1SA0 A;  4TQD A;  2JVD A;  1I7F A;  4HNA B;  1PKX A;  4XDK A;  1UPG A;  3JAS B;  3WFV A;  2XHB A;  4UFZ A;  5BZB A;  5LGN A;  1KKD A;  1NBM G;  1KYO F;  1FXK B;  5LP6 B;  3ETD A;  2YIA A;  2QTO A;  3QNE A;  1SQB H;  2ZE8 A;  4O4H B;  4LFB B;  4DR2 B;  3AG1 C;  1KC8 W;  4NXN O;  1Y76 A;  3AG7 A;  1GMG A;  1M4U A;  3ZJZ A;  2CDY A;  4JAS A;  3L73 H;  2EIL B;  2JS5 A;  2W0F C;  4K8Z A;  3CCQ V;  1K7D A;  4FLW A;  5B1N A;  1XDC A;  2ZE7 A;  2CTQ A;  4JI5 B;  3SPG A;  3ZRW B;  4JI4 B;  1OCR B;  4LF6 B;  3U11 A;  4L87 A;  4MVU A;  5ITZ A;  3JAK A;  4KHP O;  4YJ3 A;  1VQ8 V;  2YDE A;  2KG7 B;  1DK1 A;  4JV5 O;  5J2U B;  1MSD A;  2E5L B;  2M7W A;  3JSL A;  1M1K W;  3JD3 A;  1L0N H;  4B3M O;  2HG5 C;  3BPZ A;  1NZ6 A;  2AGA A;  3E86 A;  3A2F A;  4YJ2 B;  2CGO A;  1SC5 B;  1IBM O;  1OCZ B;  4FK5 C;  1VQ6 V;  5KLV H;  1XUQ A;  2HR3 A;  3DSQ A;  3AK1 A;  4QE9 A;  2HEP A;  3STL C;  2IBZ H;  4JI7 B;  2A0L A;  2EIK C;  3IJ4 A;  4CS2 A;  3G6B A;  2RJZ A;  2VWK A;  2ZXW C;  2VQE O;  1H38 A;  2F4V O;  1WB7 A;  2JDI G;  1P7B A;  2OCC B;  2UXB O;  4DUZ B;  4DYL A;  4JI2 B;  1MA1 A;  1OHH G;  3K3W A;  1SQX H;  2X6B A;  1D2D A;  3EXA A;  1GN6 A;  4MW8 A;  4RAI A;  4TV8 A;  1FD9 A;  2E76 B;  1P84 F;  2LW1 A;  1HR0 O;  2DWE C;  3LSQ A;  1KP2 A;  3FX7 A;  1XIL A;  4A5U B;  3A0H Z; 
#chains in the Genus database with same CATH homology
 3B8M A;  3CCL V;  1M9N A;  3QO8 A;  1M90 W;  4MT8 A;  4QIW F;  1JCH A;  3ABK B;  2ZR2 A;  3CCJ V;  1JX9 A;  1GM9 A;  1GM8 A;  3DTU B;  2OCC C;  3NXS A;  1H8E G;  2NNU A;  3FKS G;  5B1B B;  2EIJ C;  5H6R A;  1Q7Y W;  2X7R B;  2WLM A;  2WLN A;  1K34 A;  5EC1 C;  2IU3 A;  1R3K C;  1VQM V;  5FL7 G;  1K4C C;  2IJK A;  3JD1 A;  1VQN V;  1VQO V;  1JOY A;  3F5W C;  4G27 B;  3G6E V;  1PD3 A;  2HVJ C;  1I5Y A;  4KP4 A;  1N8R W;  1V54 B;  3E83 A;  3OR6 C;  5L3E A;  5LBQ A;  1RM1 B;  4ZKI A;  3SYC A;  1NKD A;  3B8N A;  3W7X A;  2Z3Y A;  2HLD G;  3OEE G;  4DO2 A;  3E8F A;  3K0D A;  3VOU A;  3A0R A;  4RO2 A;  5L3D A;  3JCZ A;  1NH2 B;  5CA3 A;  5B1A B;  5CBG A;  1V55 C;  4BIU A;  3CMA V;  3AG4 B;  3OUF A;  3ABK C;  5CN0 A;  2EJR A;  3M99 B;  3FB7 C;  3SYQ A;  3G71 V;  3IC7 A;  5B1B C;  4P30 A;  3ABM B;  4XDJ A;  3JYC A;  2LFR A;  3SPI A;  4PA6 A;  3K0G A;  3E8H A;  3K08 A;  2QM7 A;  3OFN G;  5HFL A;  1FXK C;  1F4M A;  4UV9 A;  2XAS A;  5LGU A;  3ASN B;  4QPJ A;  2WLH A;  3F7V C;  4BAY A;  3W7W A;  4I5S A;  3TCU A;  2A9H A;  4MTF A;  1E1R G;  1SET A;  1S5H C;  2X6A A;  3FYE B;  4G28 B;  1FXV A;  3AG2 B;  2JJ1 G;  3B77 A;  3UKM A;  1RM1 C;  1G4Y B;  5E1A C;  4JAV A;  2WLL A;  1OCC B;  1TUE B;  1CEZ A;  1R3I C;  3PJS K;  3CCS V;  1JVM A;  1GO3 F;  5B1A C;  4WCE V;  2EIN B;  4QJF B;  1JQ0 A;  1NVP D;  2ATK C;  4UVA A;  2OTL V;  3JD4 A;  3MHS C;  2XAJ A;  1RPO A;  2DW4 A;  2WSS G;  2WWW A;  4KUM A;  2DQ3 A;  3ABM C;  3OMN B;  4J9Y B;  3E89 A;  2QA4 V;  4PA3 A;  3HPL C;  5DN6 G;  1ORQ C;  3D36 A;  4MVZ A;  1AJP A;  2IJI A;  2NLJ C;  2YEV B;  5IDJ A;  1K92 A;  3ZN0 A;  3FB8 C;  3ASN C;  1WLE A;  1F23 A;  2DWD C;  2HJF C;  3KG2 A;  5J9P C;  5KA5 A;  1ARO P;  1UJW B;  1OCO B;  2EBO A;  1K8A W;  3ASO B;  3ABL B;  2GHY A;  2JJ2 G;  4LBE C;  2WLI A;  1MOF A;  1XL4 A;  3R65 A;  3LNM B;  4H33 A;  4QE7 A;  1OCC C;  3ZMZ A;  4EKW A;  4F4L A;  2BOC C;  3AEI A;  2OTJ V;  1YTF D;  1FXK A;  3CC4 V;  1R73 A;  3P30 A;  4X89 A;  2Y69 B;  2ZDI C;  1OCZ C;  3CCU V;  1CPY A;  1QLE B;  3P32 A;  4R7C A;  3W7T A;  1YHQ V;  3SPH A;  1NH2 D;  1L1F A;  4JF3 A;  1K73 W;  3ABU A;  2IJJ A;  4HAM A;  3SYA A;  4GX5 A;  1LNQ A;  4MW3 A;  3OEH G;  2WLJ A;  1NQT A;  1KP3 A;  3E8G A;  3JD0 A;  3ZMS A;  2DYS B;  3OR7 C;  2WPD G;  2KB1 A;  1NVP B;  1OCO C;  2JK5 C;  3K06 A;  1K4D C;  1E79 G;  1M57 B;  2LFS A;  3ABT A;  4BIZ A;  1DTO A;  3ASO C;  1QLN A;  3ABL C;  4YXW G;  1IXM A;  1SZT A;  1R3L C;  1AI7 A;  3CD6 V;  1B6Q A;  3E2E A;  3ZRW A;  1H8H G;  4DXW A;  3SJQ C;  4JAU A;  5C93 A;  4CZZ A;  5B3S C;  3JD2 A;  1AJN A;  2EZP A;  4GX2 A;  4R8C A;  5L3B A;  1S0V A;  2IH1 C;  3TK1 A;  5L3C A;  4I9W A;  3UM7 A;  3IGA C;  3CCV V;  1QLE C;  1R6K A;  4R6Z A;  1SRY A;  4CBC A;  2UXN A;  1I5X A;  2Q68 A;  4GT1 A;  4WFH A;  4UV8 A;  4JYC A;  1DLB A;  2P67 A;  4ASU G;  2DYS C;  4PA4 A;  1AI5 A;  4H37 A;  1QBZ A;  3SPJ A;  5IYB O;  1K33 A;  1NJI W;  1YTF B;  1Y4M A;  1GK9 A;  4N21 A;  1M57 C;  4UVC A;  3ZRX A;  3CXC U;  2PI4 A;  2XAH A;  4X88 A;  4RQE A;  1MSW D;  4JGS A;  3I56 V;  1F51 A;  2WLK A;  2A79 B;  4OXS A;  1DF4 A;  4WFE A;  1EZJ A;  4MVO A;  4QPK A;  2B5U A;  2ZQM A;  1K3E A;  2R9R B;  1ZWI C;  1GKF A;  1BHA A;  2HKO A;  4MTO A;  3CYO A;  4PDR A;  1S3J A;  3X2Q B;  1EBO A;  1W0K G;  5LHI A;  1QVF U;  1BL8 A;  1DF5 A;  1QVG U;  2BOB C;  2LP7 A;  5CMU A;  2X0L A;  5IYC O;  1H2G A;  1YIT V;  5EBL C;  1V54 C;  2IW5 A;  1KQS U;  2PI5 A;  2V1D A;  1VQL V;  2GSM B;  4LCU C;  1VQ7 V;  1ENV A;  4KFM A;  1SER A;  3ZRV A;  4RUF A;  4GCZ A;  3BY6 A;  3ZMV A;  2P7T C;  3K79 A;  3K03 A;  3TET A;  2D3O W;  2XAF A;  1VQ9 V;  3MD0 A;  3AG4 C;  2P90 A;  4R50 A;  3RBZ A;  2FTK A;  3AG3 B;  4QNH B;  3LDC A;  4MVQ A;  3ETE A;  3OE7 G;  4TT3 G;  3CC2 V;  1YSC A;  2WAM A;  2EIM B;  3EHB B;  1MAB G;  2Z5U A;  4RQF A;  1R3J C;  3X2Q C;  2EIK B;  4UUJ C;  2CK3 G;  3QO7 A;  2B1I A;  1GM7 A;  2QM8 A;  4U7O A;  3FB6 C;  4HZ3 A;  3OW2 U;  2R9I A;  3AG2 C;  2DYR B;  1FS0 G;  3F7Y C;  5H6Q A;  1S77 D;  3WG7 B;  3DGE A;  5EK0 A;  2Y48 A;  4P9P A;  4P9O A;  2W6J G;  4BW5 A;  3ZN1 A;  2H8P C;  1R6N A;  3GWO A;  4U7N A;  2K1E A;  2EIN C;  3EFF K;  1P4R A;  3AG3 C;  3BEH A;  4X8A A;  1K5S A;  1QCE A;  1S72 V;  5IY5 B;  1YJW V;  4ZBM A;  1YJN V;  2EIM C;  4WFF A;  1JJ2 U;  4WF9 V;  1E1Q G;  3ZMT A;  1S76 D;  2OT5 A;  3VBB A;  3CCM V;  1RPR A;  2XND G;  3LSS A;  1VQ5 V;  2ZD9 A;  1FXH A;  5EC2 C;  1AI6 A;  1K5Q A;  2IJH A;  4UXN A;  3FB5 C;  4LP8 A;  2WLL B;  4MVR A;  1VQP V;  2EIJ B;  3W7S A;  1XL6 A;  3G4S V;  4HYO A;  2YSU B;  1WPX A;  3T2M A;  2XOK G;  2ITC C;  3OM3 B;  4FMT A;  4PEL A;  4WFA V;  2EZO A;  1AI4 A;  3T1C A;  1AJQ A;  5IYD O;  3ZMU A;  3I55 V;  1PNL A;  3QO5 A;  3CPW U;  3AG1 B;  2Y69 C;  1SES A;  2B1G A;  4MVM A;  3IFX A;  5L3F A;  3CC7 V;  2ZR3 A;  4PDM A;  3K9A A;  1NR7 A;  1Q86 W;  2X6C A;  5KUM A;  1QR8 A;  4TSF G;  4Z1M G;  1JPX A;  3OGC C;  5H9C A;  3SYP A;  1V55 B;  1Y66 A;  3MHH C;  1PNK A;  3HB3 B;  2JEX A;  2XAG A;  3ZRS A;  2WLI B;  1J95 A;  2W6I G;  1PKX A;  4FPP A;  4XDK A;  5L3G A;  3ZIA G;  5CBH A;  1YI2 V;  3WFV A;  5BZB A;  5LGN A;  1KKD A;  1NBM G;  2ZDI A;  4GX0 A;  1FXK B;  3ETD A;  4MVS A;  2QTO A;  3QNE A;  5HFM A;  2YEV A;  3RW0 A;  3SYO A;  4WFG A;  3AG1 C;  2Q67 A;  1KC8 W;  4WFB V;  5EBW C;  2QKS A;  4UVB A;  4LC1 A;  1BMF G;  1GMG A;  3LDD A;  4PDV A;  2Q6A A;  4JTA B;  3ZJZ A;  3ML0 A;  4GX1 A;  4JAS A;  4J9Z B;  2QE7 G;  2EIL B;  1GTO A;  2W0F C;  2XAQ A;  2JEU A;  3CCQ V;  1K7D A;  1AR1 B;  1KD1 W;  5B1N A;  1F4N A;  2HFE C;  4JTC B;  3SPG A;  3T4D A;  3ZRW B;  3D3I A;  1NR1 A;  1OCR B;  1VQK V;  3W7U A;  3RVZ A;  3LUT B;  2H94 A;  3CME V;  2IH3 C;  3T4Z A;  2DQ0 A;  4MSW C;  4XDL A;  4L87 A;  5B1O A;  4MVU A;  5LHG A;  3CCR V;  2F43 G;  4PDL A;  1FFT B;  4Q20 A;  4G2K A;  1VQ8 V;  1K9M W;  4MTG A;  1VQ4 V;  2IU0 A;  1HWY A;  2M7W A;  5LGT A;  1M1K W;  2UXX A;  3JD3 A;  1W2B U;  4FIP C;  1ROP A;  2HVK C;  1CP9 A;  2V7Q G;  2HG5 C;  2AHZ A;  4P2Z A;  2ZXW B;  3RVY A;  2JIZ G;  4JYB A;  1PNM A;  1K97 A;  2EIL C;  5GW7 A;  2AHY A;  3E86 A;  5KA6 A;  2Q69 A;  3OMI B;  1OZ0 A;  3GB7 C;  1COW G;  1OCZ B;  1YIJ V;  4FK5 C;  1OCR C;  1VQ6 V;  5EBM C;  4PA7 A;  3H01 A;  3E35 A;  2HR3 A;  3STZ C;  4QE9 A;  1YJ9 V;  3CP1 A;  5CBF A;  4E2L A;  3STL C;  1M56 B;  4JPR A;  4JTD B;  3SPC A;  3K04 A;  2A0L A;  2EIK C;  4MTX A;  1PL0 A;  3ZCC A;  5DM6 V;  2MK3 A;  1Q81 W;  5LHH A;  2ZXW C;  4FJC C;  1EFR G;  1H38 A;  2JDI G;  3OUS A;  1MG1 A;  1P7B A;  1G8M A;  2OCC B;  2ITD C;  3OMA B;  3OAA G;  5B3S B;  1Q82 W;  2DYR C;  3WG7 C;  1KEC A;  1BHB A;  3LDE A;  1OHH G;  3FYI B;  3K3W A;  2X6B A;  4PA9 A;  4RUE A;  2P6J A;  4TWK A;  1QR9 A;  5KUK A;  4XBF A;  4MS2 A;  3ETG A;  2QEX V;  4MW8 A;  4RAI A;  1THZ A;  4N23 A;  2C2A A;  2DWE C;  3LSQ A;  5IY5 C;  1KP2 A;  1W0J G;  1M56 C;  3CCE V;  3E8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...