3E86A

High resolution crystal structure of the open nak channel pore
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
91
structure length
91
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Potassium channel protein
publication title High-resolution structure of the open NaK channel
pubmed doi rcsb
source organism Bacillus cereus
total genus 31
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3e86A00
2WLLB 2WLHA 2KB1A 3X2QC 4G28B 4J9YB 2DYSC 2A9HA 4P9PA 1XL6A 2X6AA 2H8PC 3LDDA 4MVRA 5EC1C 2Q69A 3UM7A 2Q6AA 3K0DA 3LDEA 4PA9A 4DXWA 3BEHA 3R65A 3AG4C 3STZC 4PA3A 4MVOA 4PDRA 4ZBMA 3OUFA 5CBFA 2WLKA 5J9PC 4KFMA 3T2MA 3AG1C 4J9ZB 3OUSA 3FB5C 1ZWIC 4GX2A 4PA4A 4R50A 1R3IC 4MVZA 5KUKA 4P30A 3E8BA 1QLEC 3IGAC 3SYAA 1R3LC 2WLIB 4LBEC 4R7CA 1BL8A 4PDMA 2DWEC 2AHZA 1K4CC 3FB8C 2HG5C 4MVSA 4PDVA 1OCCC 2K1EA 5E1AC 2HVKC 1V55C 3SPJA 2EIKC 2Q68A 4EKWA 3E8HA 5B3SC 1G4YB 3T1CA 3SPIA 2ITCC 3E8GA 3WG7C 2P7TC 3SYCA 3SYOA 2X6CA 3F7YC 3E86A 3SPHA 5EBWC 1V54C 4WFEA 2AHYA 3K04A 4HZ3A 5CBGA 5IY5C 2WLLA 3LDCA 2WLMA 3ABLC 3ABKC 4LCUC 4HYOA 4TWKA 3F5WC 4BW5A 3SYQA 3TCUA 4PDLA 2YEVA 3EFFK 2DWDC 3OR7C 3PJSK 4QE7A 1KKDA 4CBCA 4OXSA 4XDKA 3T4DA 1ORQC 2OCCC 4R8CA 3TETA 3K08A 4PA6A 4RUEA 4GX1A 2QKSA 2HVJC 5KUMA 3LUTB 3T4ZA 2EIMC 1M57C 4MTGA 3KG2A 4MW3A 3K0GA 4QNHB 2NLJC 3ABMC 3ASOC 4H37A 4JTAB 4MVMA 4I9WA 4LP8A 4G27B 3STLC 3RBZA 3ZJZA 3FB6C 1M56C 4JTCB 1P7BA 3OGCC 3ASNC 2HFEC 4WFFA 4X8AA 2WLIA 5B1BC 3RW0A 3E83A 3RVZA 2R9RB 3K06A 3UKMA 4JTDB 5EK0A 1J95A 1R3KC 4X89A 1OCZC 1XL4A 3SPGA 4XDLA 3VOUA 1JVMA 2W0FC 4H33A 4MTFA 3FB7C 3JYCA 4WFHA 4P2ZA 4RUFA 1S5HC 4PA7A 1K4DC 5EBLC 4GX5A 4X88A 5EC2C 2BOBC 4MS2A 4QE9A 3SYPA 4MVQA 2A79B 3ZRSA 4RO2A 3LNMB 5BZBA 2DYRC 2WLJA 2EINC 2QTOA 3SJQC 2EIJC 2ZXWC 2WLNA 2X6BA 3E8FA 3F7VC 2BOCC 2EILC 2ATKC 5B1AC 2IH1C 3SPCA 4F4LA 3HPLC 2ITDC 2A0LA 3AG3C 3GB7C 4P9OA 4UUJC 3RVYA 4R6ZA 2Q67A 2HJFC 4MSWC 4MTOA 2IH3C 3E89A 1OCOC 5EBMC 4GX0A 4MVUA 4RAIA 2JK5C 2ZD9A 3OR6C 3K03A 2Y69C 3IFXA 4XDJA 4MW8A 1R3JC 1LNQA 3AG2C 5CBHA 1OCRC 4WFGA
chains in the Genus database with same CATH superfamily
2WLHA 2ODMA 1YCIA 1WA8A 1MNGA 2XT9A 2UUAB 2YICA 3UM7A 2RDCA 1AI6A 4GT1A 5LL6Y 1PM9A 1W2BU 1Y76A 1HNXB 3PN1A 5J9PC 2ZIMA 3CRQA 4PA4A 4ZHQA 4JZGA 4MVZA 5KUKA 4W4KA 3IGAC 2M6YA 1EN6A 1SESA 2LGQA 2Y0IA 3AK3A 2WWWA 2Q68A 5L3BA 4DV3B 1KBHA 2P7TC 3ZBHA 4JAUA 4BAYA 1Q6HA 3CCLV 1KC8W 4LF5B 4FM1A 4JI5B 1JR9A 1YITV 2AGAA 1RM1B 1BS3A 1V55B 2A06H 3BA8A 2EULA 3CJHA 4JTAB 3Q4HA 1SQPH 3FB6C 3LSSA 1YTFD 3OGCC 4DV6B 1AILA 3N2KA 5B1BC 3E83A 2M7WA 1SQFA 2YXHA 1QBZA 2YIAA 4B3SB 3VQYA 3MHSC 2ETNA 1EFRG 1CPYA 2QWRB 2CE4A 2IU3A 5GONA 4BR6A 4X88A 1AI5A 2YS8A 2ZXWB 1GO3F 1SZXA 1ZL8A 2IJIA 3MHHC 3FAVB 2EINC 2QTOA 2UXNA 3ZX6A 3F7VC 3CXHF 1KD1W 5L3GA 2IH1C 1VQMV 4DRXB 3HPLC 4RWUA 1HNZB 4LF4O 2LP7A 2ZIOA 2LQTA 1OCOC 4GX0A 4J41A 3WFVA 1NJIW 2W0XA 3CCSV 2XAJA 4X1KA 5CBHA 2ADQB 4O4IA 3JASB 4X64B 2WLLB 1XL6A 5L3EA 1FFXA 3AG4B 1K3EA 1QU7A 4DV0B 1E79G 2QWQB 4DW1A 1UPGA 2BSKA 5BR8O 4PDRA 1PNKA 4ZBMA 1Q6UA 3T2MA 1S77D 4GX2A 2F23A 4ZI7A 1VQLV 4IYIA 2QE7G 3QO8A 2DYSB 3SPJA 1QQCA 4TOIA 4RQEA 4LH7A 4B3MB 1BGYH 2X6CA 3RGBA 4L87A 1XMQB 2PY5A 2CTRA 5B66Z 4JI3O 2QM7A 1WAZA 3UO2A 1P7GA 1XILA 5CA0B 5K1XA 4LFBB 2ZDIC 1VQ6V 1WPXA 2EIKB 3CCEV 4PHZA 1M57C 2ZT9B 3JAWA 1F23A 2NLJC 3STLC 5BMVA 1KP2A 4G27B 4JASA 3RBZA 2BTOA 4Q20A 2B5UA 3B8NA 3TXSA 3L72H 1CXZB 2Q0AA 1OCZB 3TK1A 5IY5B 1OZ0A 2WLIA 5LXTB 1P49A 1XREA 2DMXA 4JI4O 5KMGA 1M9NA 1S5HC 1K4DC 4CS3A 5LGUA 3G80A 2EILB 1GH6A 3ZRSA 4UVAA 3E8FA 2BOCC 1SS3A 4JI2O 1YI2V 1S0VA 1PP9H 4UB8Z 2CGOA 3W7TA 3IC7A 4J7KA 3K57A 5DECA 2XUMA 4X62B 1KQSU 1VIBA 2YIDA 3K3WA 3T1YO 2YI9A 3HKBA 5IJ0B 5IWAO 1QCEA 2JK5C 5L3DA 2QEXV 2UXDO 4FFBB 2PYLA 3IFXA 4XDJA 3AG2C 2W6JG 3IC9A 4JF3A 2N74A 1I0HA 2ZR2A 1G8MA 1AR1B 4B3RO 4NXNO 4CH3A 2ZM6O 3HKCB 3W7SA 5IJ0A 3OMAB 2IU0A 1FXHA 3OTFA 3LDEA 4NVPA 1XI1A 3AG7A 1QLNA 1YSCA 1GN4A 3HKCA 1YVWA 4DR2O 2JS5A 5LMUO 1DGSA 3DC6A 2Q8VA 1DF4A 1S72V 1GK9A 1WJZA 1XDCA 3RYHB 1G4YB 2GDSA 1WN7A 3DXRB 3CCQV 4I4TB 1BHBA 4HZ3A 3B40A 3O65A 2FKXA 5L3CA 2Y4UA 1MZFA 2OCHA 3OR7C 1YF2A 3D36A 3DGEA 1BSMA 5KHKA 1YIJV 4JPRA 5KUMA 3LUTB 5H6QA 2D2CB 2F4VO 3GWOA 2PZSA 4XBFA 3C3SA 3CMEV 3KCXA 4FMTA 4X89A 1I08A 3FYIB 4H33A 3A0HZ 4PI0A 4UCSA 5FNVB 2OT5A 5BR8B 3L74H 4NTXA 3CXCU 2MW2B 4YY3O 5B1AB 3JAKB 3DSQA 3SJQC 1JX9A 3OT7A 5FNVA 1DF5A 1IXMA 4LFAB 2UUCO 3ZEDA 4CH5A 4P9OA 1XNRO 2JGUA 4K8XA 2DJVA 2Y4TA 4AI8A 4MSWC 2F1MA 3JAKA 5EBMC 1TUBA 2RQ6A 2Y69C 4JI3B 3CCVV 1NTKH 2HLDG 3BABA 4HAMA 2BTQA 4UFZA 3SR2C 1J5EO 4GLXA 4IT5A 4KP4A 2QJ1A 1G6UA 1OCOB 4X65O 4ZKIA 4KFMA 1B06A 1S5JA 5LHHA 5KAFZ 4IIJB 1KU9A 3JD2A 4YJ3B 4B08A 4KHPO 4L8JA 1SQQH 4LBEC 1BL8A 2DWEC 3CB2A 4UV9A 1V54B 4JI4B 4O4LA 2GBOA 1RSOA 5CB4A 1SC5B 4BW5A 3ZS8C 3ZMVA 4JI2B 1FFTB 2WA3A 2QKSA 1RM1C 1DLBA 4I55A 1JA8A 4JAAA 5EZYA 3ASNB 3T1YB 3I56V 1JPXA 4JV5O 2JIZG 3OGIB 4MVMA 2UXDB 1LUVA 4OPHA 4O4JB 3BAAA 2B1IA 1WB8A 4NXNB 4LC1A 5LA6A 2A3QA 3HKEB 3CMAV 1GM8A 4HNAB 2X0LA 3QNEA 2WA4A 1IZ3A 2QKAA 2ZDIA 4O2AA 4DR2B 5LMUB 1HNWO 3FD9A 2ZXWC 3EXAA 2X6BA 1K34A 4WBNB 1COWG 1Y74B 4FZ0A 4LF8O 1NR7A 2JDIG 1JFFA 1N33O 1H38A 3B2EE 4DR6O 2IH3C 2FB5A 1VF6C 1B6QA 4GKJO 5LHGA 3KZIZ 1BZKA 3JAMN 1DTOA 2JRIA 5KHGA 4FPPA 4P9PA 1GM9A 3RYIB 3G67A 1H2MA 2QKCA 4DV5O 2XAQA 4I0XB 5CA1B 1MZEA 3AG4C 5JJJB 1JQ0A 2CDYA 4LNUA 3CRCA 2JGDA 1NKDA 4NTWA 3ABUA 4I0XA 3VQXA 5K1PA 2K9PA 3S3WA 2Y0PA 1W0KG 4FK5C 3BCCH 4UCUA 3SPIA 4UVBA 4PELA 5LGNA 5KHHA 5EIBC 4X1YA 4LF9B 4YY3B 3JD4A 3FFQA 4I9QA 4PDLA 1NTMH 4AILC 1LUWA 1K5QA 3OW2U 1FXKA 1XNRB 3ASOB 3OMNB 4U3JB 2HVJC 3H1JH 2VQFB 4B3TO 5CBGA 4H37A 3JARB 3K5OA 3MDSA 2Q0OC 4ABMA 4ASUG 3RVZA 2CTQA 4JTDB 4X66O 2PGGA 1ZUQA 2YDEA 1OCZC 1YJ9V 1J5EB 4JGSA 3VOUA 3LSQA 3ICXA 3R66A 1NU1H 3MAQA 1L8DA 3E22B 4X65B 5EC2C 1Z5WA 4JYAO 3LNNA 3H1IH 1SRYA 4KHPB 3QVNA 5DEDA 2B9ZA 3IJ4A 2EILC 4WFAV 4HBNA 3I55V 2Q67A 4UCTA 1Q3EA 2ZKOA 1H2SB 3OR6C 5B1NA 3CWBH 2LJ2A 3M99B 1I94O 4X20B 1B04A 4NXMO 4LWSA 1NBMG 4YXWG 4TV8B 3R65A 4TQDA 3D3QA 2UXBO 3W7UA 4JV5B 2P4KA 3WB2A 1W0JG 2ZE8A 3FB5C 4R50A 1RPRA 4ZOLB 1F4NA 4EB6A 3L70H 3SJAC 2FMLA 5EYPA 3CPWU 5LGTA 5LMNO 3E8HA 2YUAA 5JH7B 4K0KO 5A9GA 1QR9A 3SPHA 1G1XB 4ZIBA 1GN2A 1HNWB 5DN6G 3B09A 1GN3A 2DWDC 4PJ0Z 4AQYB 1JJ2U 2N04A 4IL6Z 4YHHO 2EIMC 2XHBA 3CRAA 4DR6B 2FYUH 2E75B 5GW7A 1FAFA 3P3NA 3K06A 1EM1A 5E79Z 1T5EA 3K9AA 3SPGA 5KLVH 3ZHSA 2QM4A 1XBLA 4BWAA 1NH2D 3CC7V 2R72A 4MVQA 4FJCC 2ZNIA 4FLXA 3APQA 1XUQA 2L35A 1CP9A 4PD4F 5B1AC 1EN4A 4I50B 4AHCA 3HKDB 4UV8A 5C8YB 3GB7C 1HDJA 4DR1O 4R6ZA 2XAFA 1BQZA 5CA3A 5IYDO 1TVKB 3P30A 5C8YA 1MABG 4JI7O 1VQOV 4MVRA 4KUMA 1TVKA 5ITZB 3UT5B 2KSDA 4DV2O 3QO7A 1R73A 4B3TB 1ZWIC 1FXVA 2OTLV 3FAVA 2DE0X 1L0NH 1K33A 4X66B 5FLXN 4PDVA 1VF6A 4DRXA 5IJ9B 1Y66A 1IBLO 4EKWA 1ZTEA 2KQXA 5LOVB 1VQ7V 2UXCO 3ZHQA 1V54C 3BPZA 4I7ZB 1GM7A 4C7UA 5IJ9A 3JASA 2P5OA 2WLLA 3LDCA 4FZ1A 1I5YA 1H8EG 2R70A 3JALB 4DR7O 1FJGO 1U96A 2A7WA 5H6RA 1FD9A 1K97A 3ZRWB 1NVPB 1D5AA 3A8TA 1CEZA 5BXZA 3ASNC 1Q5OA 3RYCB 1WP8A 4NXMB 1JVMA 1WNSA 1O9GA 2VRZA 4WFHA 2ZE7A 4RUFA 2UXBB 1KP3A 2QWOB 2DW4A 2BOBC 4WFBV 3ZHRA 1Y67A 2Z0AA 3K79A 2VS0A 2QSAA 5CA0A 3LNMB 2YSUB 5BZBA 3CE2A 4FLVA 2WLNA 2IM9A 2P90A 3RWRD 1YXBA 4DR5O 2ZE5A 1QNMA 3H9VA 4YIOA 5LMNB 2PI5A 2Q7EA 1VQPV 3FKSG 1WLEA 2LGWA 4JI8O 4K0KB 4MVUA 3MD0A 3QO5A 4J80A 5DM6V 5LXTA 1P4RA 4TV9B 3C3TA 1AJPA 2AXTZ 2Q4PA 2WPDG 4PA9A 4PA3A 4MVOA 1TA8A 1KECA 4H44B 2OIGA 2XAGA 1OCCB 3SYAA 3KCYA 3LSUA 2AHZA 1VQ4V 1THZA 2HVKC 2IJKA 1PKXA 3CX5F 3CC2V 4H13B 2QM8A 1Z5VA 1SQVH 2UXXA 2VWKA 4FFBA 4WFEA 2VWJA 4BIOA 2E76B 4GKKO 3ABKC 1TAEA 4PI2A 1OV9A 3JSLA 1H8HG 3K08A 1NR1A 2UU9O 4DR1B 1NQTA 3I5DA 5JCOC 2NN4A 2JJ2G 2RN9A 1YEWA 2OIEA 3ASOC 3GVMA 2Y48A 3E2EA 2V1DA 4F6RB 2HFEC 4DO2A 5JJEB 3UKMA 4JI7B 1JCHA 3RYHA 4JYCA 2EZOA 2EJRA 1Y4MA 3DXRA 2EIMB 4I4TA 2EIJB 3SYPA 1AR4A 4LF4B 3CSXA 1A32A 4LF6O 1PNLA 2E3CA 5F2VO 1IBLB 3JD3A 3SPCA 4DR4O 5FPRA 5KA6A 3VQWA 2UXCB 3RVYA 2HJFC 4LF7O 4CH6A 5LYJB 3AK1A 3OMIB 3K03A 1MA1A 4FLWA 3OTOO 4FIPC 4DR7B 1FJGB 1NT2B 1IVSA 2GUZB 3K9SA 3A0RA 5KHJA 1Q86W 2Z5UA 4Z1VA 3BEHA 3UQ8A 4BIZA 3ZCCA 1BCCH 4J9ZB 3OUSA 1VQNV 2X7RB 3OD4A 2F43G 5LP6C 3ETDA 3E8BA 2E5LO 4O4HB 1R6NA 2Q73A 1QHTA 2OYQA 3QF7A 2ITCC 4JI0O 2QR4A 3D8CA 3WG7C 2F95B 4CH4A 5EIBD 3ABLB 3F7YC 1S5LZ 5HFMA 4O4HA 5EBWC 2V7QG 1M4UA 4DV4O 2CTWA 2WLMA 4TWKA 3K5LA 4CBCA 1TGOA 4OXSA 4XDKA 1H2KA 4TUYB 1XMOO 2YXLA 5J2TB 3SJCC 2ZCEA 3T4ZA 3P3PA 4JI8B 2JEXA 3ZJZA 4IIJA 3OEEG 2FL4A 3G4SV 1VMGA 4NKGB 2FTKA 4YJ3A 4X8AA 4UXNA 2XOKG 3ZRXA 2XASA 1R3KC 5KAIZ 2PI4A 2W0FC 4QPJA 1RPOA 3M7MX 1ENVA 2H94A 5JVDB 1HR0O 3ML0A 2KG7B 2R9IA 5KA5A 4DR3O 5IWAB 3H1KH 3SGIA 2ATKC 4JI6O 4JYYA 4B3RB 2ZM6B 3W7WA 4F6EA 4WF9V 4NTYA 4X9QA 1JMKC 5IE9A 4DV7O 1Y6XA 2O57A 4O4JA 1R3JC 3B4SA 3M8AA 1KUQA 3EVKA 2KB1A 3HKEA 2A9HA 3ETEA 4HNAA 1N36O 1B3QA 3VQVA 2CH7B 2WSSG 1KMIZ 2Q6AA 2UU9B 5D5QA 2QDOA 2HHHO 5IDJA 3BY6A 2WLKA 1KYOF 1XQ8A 1PD3A 2HKOA 2UUAO 3CRRA 1VQKV 4P30A 4WBNA 1Y74A 1VQ5V 4R7CA 4FLYA 4K3AA 2YC0A 1HNXO 3SJBC 4CZZA 3CYOA 5KX5B 4NB5A 3SYCA 1Q6IA 3B77A 1SQGA 4DV1O 1US6A 4X1IB 2F4VB 2AZ2A 4TSFG 4LF6B 1F7YA 3RYIA 1AR5A 3E35A 4DR4B 4RUEA 5CA1A 4X1IA 2R9AA 5H2FZ 1M56B 4DK0A 3C90A 4DYLA 1YTFB 3N2GB 2ZQMA 4IYHA 4I9WA 1BE3H 3UO3A 3OTOB 3ABKB 2E74B 2Q7GA 1IX9A 3JATB 1XL4A 3CCRV 5D5PA 2UUCB 4DV6O 3G6BA 1AVMA 2P06A 4B3SO 3OEHG 4PV1B 4U3JA 1IBMO 2A0LA 1GAXA 2RJZA 3K58A 4JI0B 4D7SA 5BY1A 4MTOA 3BA9A 3JARA 3RYFB 4RAIA 2RNBA 4DV4B 1BHAA 3NR7A 1HNZO 2YEVB 4YIPA 1XMOB 1K73W 2Q69A 1QR8A 1AROP 4IGGA 3STZC 3RT3C 4J42A 3E22A 3EHBB 3W7XA 2ADPA 1Q8IA 2IJJA 4X64O 3AG1C 2EJ7A 4NYKA 2P22C 3RN4A 3TGUH 4DV0O 4WFGA 3K59A 5E1AC 1OCCC 1XOUA 1FKAO 3L75H 5AG2A 2QWPB 3SYOA 1QVFU 1HR0B 1BT8A 2Q7HA 1SZTA 3THOA 3GWKC 4MT8A 5LP6B 2CGNA 4DR3B 3TJTA 4X20A 3TETA 4W4LA 4TV8A 2CUGA 4WCEV 3ABMB 3WG7B 4MTGA 3KKYA 1HWYA 4DV7B 2HEPA 4ZOLA 1WP7A 2DN9A 4WFFA 5J2UB 1N36B 1WA8B 4QPKA 5JH7A 2HHHB 4LF8B 4MTXA 1UJWB 4PA7A 3OFNG 5J2UA 2OTJV 4UCVA 1N33B 1XNQO 4NR1A 1Y76B 3QG5A 4MS2A 1N4CA 1HP8A 2GHYA 1Q43A 4OGQB 4ZHQB 2EIJC 4GKJB 1R6TA 1Q81W 3D36C 1PPJH 1S3JA 4CS2A 4LR3A 3APOA 4GCZA 1NS1A 4DV5B 4DV1B 4U7NA 3U10A 3H01A 2D3OW 1L1FA 2G38A 3X2QC 2YI8A 5GTHZ 4BW9A 4X62O 2YXYA 3ZMSA 1RFYA 4DXWA 4QGPA 4JI1O 5CMUA 1BMFG 1QLEB 2LFSA 3CJHB 3Q4HB 3P32A 2N05A 3N2KB 1VQ9V 1MG1A 4I50A 3HKDA 1M1KW 1VEWA 2HG5C 2QWNB 4FVMA 5B3SC 1ZLZA 3E8GA 1RP3B 4QJFB 5GONB 4J7JA 4O2BB 4A5UB 1AJQA 2AHYA 1LR1A 2ZNJA 3K04A 1Q90D 3ABLC 1ZL8B 3SYQA 2KKWA 3EFFK 3T1HO 1IBKO 1E1QG 3CCMV 4FLTA 4O2BA 2JVDA 5ITZA 3WB1A 3UT5A 1IBMB 2RCVA 4K8ZA 2HJDA 1ZX3A 1P84F 4MW3A 1OHHG 2CK3G 3K0GA 2GTSA 4EEQA 3CCJV 1KKCA 1R1BA 2IBZH 4DW0A 4X1KB 4U3FH 4JYAB 4O4IB 5EK0A 1J95A 3IAYA 3A2FA 4XDLA 2LO1A 1FFXB 5LOVA 3J80N 1ROPA 3AK2A 2RMKB 4K35A 2BSKB 1TUEB 4Z1MG 4QE9A 2Q9LA 3RFRA 2DYRC 2NR5A 4ZI7B 1VQ8V 2VQEO 3JALA 1Z2GA 1SA0B 4J10A 1MMMA 3ZRWA 1M93A 1I94B 1X4TA 3AG3B 2AW9A 2IJHA 1VP7A 1AB3A 3ZMUA 1SA0A 2HR3A 4LFAO 1OCRC 1N0NA 3UCSC 3DC5A 3RYCA 5FL7G 2X6AA 5EC1C 3K0DA 5IYBO 3L9DA 2F66C 4DUZO 1K8AW 1MOFA 3JAWB 5BMVB 1SF9A 4KXRA 1R3LC 3BFRA 2WLIB 3JCZA 1K4CC 1FPOA 5LBQA 2MK3A 2LFRA 5IT9N 4G2KA 5KMGB 2JJ1G 3E86A 1SERA 1XNQB 3CHXA 3AG1B 1FS0G 2ZE6A 4YHHB 5H5NA 5IYCO 3FYEB 1QVGU 1XHZA 4LCUC 1D2DA 2WAMA 4FLUA 3AEIA 4TV9A 1WB7A 1KKDA 3T4DA 2EZPA 1DK1A 5A2QN 2PYJA 4CC6A 1PL4A 4OX9O 2ZR3A 3HKBB 1M56C 1AJNA 3B8MA 1U97A 4JAVA 3L73H 1ZAUA 2PF4E 3FB7C 3JSNA 4JI1B 1L0LH 1EZJA 4OPAA 1URFA 3ZHTA 5H9CA 2Z3YA 2CTPA 1FXKC 1MSWD 1I7FA 1PV0A 5JWPA 3E89A 4EFEA 4QIWF 2GSMB 4F6RA 4DV2B 3JD0A 2W6IG 4G28B 1V9PA 3JD1A 3DTUB 3T1HB 1IBKB 2H8PC 4U7OA 1WPBA 1IXBA 3HR0A 1H2GA 3U11A 1YZBA 5CBFA 2YIBA 1GKFA 3X2QB 2DOSA 3OE7G 4DK1A 4MVSA 3CD6V 3CS5A 1BQ0A 1O9HA 5LYJA 4ICGA 1AP5A 1FYJA 2P67A 2JS3A 1MSDA 2EX3A 2ARHA 3K5MA 4HYOA 2VQEB 5FPOA 1F51A 4LFCO 2OCCC 2GUZA 2P4VA 1OJHA 3ZHVA 4PA6A 5B3SB 4J7ZA 3HB3B 4GX1A 1F4MA 4LF9O 1K7DA 2B1GA 3KG2A 4H0LB 5B1BB 3ABMC 1TUBB 1NVPD 3G6EV 1IDSA 1H2NA 1AI7A 1P7BA 2LW7A 1N34O 2R9RB 2BTQB 2DQ0A 3J81N 2VQFO 1SKVA 1HW7A 1JOYA 4DR5B 2F93B 2ILMA 4DUZB 3CCUV 2EINB 2UUBO 1YDXA 2QA4V 2WLJA 2XAHA 4DUYO 2JEUA 1N32O 1KB9F 4TUYA 1R6KA 5J2TA 4E2LA 4F4LA 1M90W 3BVOA 1IURA 4O4LB 3ZMTA 2HP8A 4FFKA 5L3FA 2NNUA 4B7KA 4MW8A 1RSOB 1K9MW 2DYRB 1AP6A 3F5TA 5CB4B 1K92A 4J9YB 3ZN1A 3H1LH 1SQXH 4UCOA 3ABTA 5B5EZ 3ZHUA 1Q7YW 1AI4A 1GN6A 4GZRB 1VARA 1XEQA 5JVDA 4OX9B 3CP1A 4I55B 5EZYB 2KG7A 4Q6GA 1W59A 3H1HH 1GRJA 2PTMA 2GV9A 2V4DA 1OCRB 2XTAA 1NTZH 4GUNA 2Q5ZA 1QLEC 1ZSPA 4PDMA 3FB8C 4GKKB 5LA6B 2K1EA 1PNMA 1V55C 2QTSA 4UB6Z 4N23A 1YHQV 1JJOA 4LH6A 3SDLA 1D5NA 4O2AB 3F5WC 3TCUA 3CEIA 2CH7A 4QE7A 4R8CA 1M57B 4E4EA 3D3IA 1E1RG 2QGNA 2OWOA 5B1OA 3OM3B 1JFFB 1N8RW 3L71H 3J7AU 4TQFA 1UFIA 4QNHB 1K5SA 3G71V 4I5SA 4D6TH 4AQYO 2EBOA 3U0ZA 5GTIZ 4IHJB 3VBBA 2BE3A 1NH2B 5TISZ 4MTFA 5KX5A 3JYCA 2L6LA 4P2ZA 4DV3O 3N27A 1YJNV 3ZRVA 4LNUB 4LF5O 4IHJA 4YJ2B 1EBOA 2A79B 4JI5O 4LF7B 4JYBA 3NXSA 2JGDB 5JJNB 1X59A 2YIBD 1Q82W 4YJ2A 2ITDC 1NI8A 4J11A 3BRCA 1PL0A 3AG2B 3N2GA 4EFBA 1GMGA 2ZD9A 4X1YB 3BHPA 5KHIA 1EN5A 1LNQA 3AG3C 3JATA 1NZ6A 2DYSC 2ZINA 4D7TA 4LFCB 3LDDA 1VF5B 5IYZB 3ETQA 4JZ2A 2DQ3A 2E5LB 5JCOA 1FXKB 2GTAA 2PUSA 1YJWV 5JQGB 1H2LA 3ZN0A 3OUFA 1I5XA 4N21A 4UCRA 5IYZA 3O9OA 1R3IC 1N34B 4FM0A 1S76D 5JQGA 2EIKC 4UVCA 3WU2Z 3T1CA 3WB0A 3JCUZ 3RYFA 4FLZA 4Z2WA 2UUBB 3S3XA 4KL1A 5IY5C 4DUYB 1N32B 5HFLA 2YEVA 1SETA 3PJSK 4FM2A 1ORQC 1N0JA 4TT3G 4CS4A 1EZVH 4GYCB 3OAAG 5C93A 4LP8A 2AZ0A 1GTOA 4JTCB 3ETGA 3ZIAG 3CC4V 3RW0A 3ZMZA 5CN0A 1VF7A 2OCCB 3FX7A 4CC5A 2BCCH 4LWSB 4BIUA 3QTCA 4B3MO 4JI6B 2XNDG 5EBLC 2CAZC 4GX5A 1XMQO 5LP6A 4RO2A 4RQFA 4LFBO 3TXQA 1SQBH 2H3OA 4EB6B 5LHIA 1M5IA 5EYPB 4UUJC 2C2AA 4B7EA 2LW1A 2Y69B 2P6JA 3A0BZ 3K5NA 2IW5A 1XHXA 3CRMA
chains in the Genus database with same CATH topology
2WLHA 1DTOA 4FPPA 4P9PA 5FL7G 2X6AA 4FIPC 1GM9A 5EC1C 3UM7A 3K0DA 3A0RA 1Q86W 2Z5UA 5IYBO 3BEHA 1AI6A 2XAQA 4GT1A 3AG4C 1JQ0A 1W2BU 1K8AW 1MOFA 4BIZA 5J9PC 3ZCCA 4J9ZB 3OUSA 1VQNV 2X7RB 4PA4A 1NKDA 2F43G 3ETDA 3ABUA 4MVZA 5KUKA 3E8BA 3IGAC 1R3LC 3JCZA 2WLIB 1SESA 1R6NA 1K4CC 5LBQA 2WWWA 1W0KG 2Q68A 5L3BA 4FK5C 2MK3A 3SPIA 2ITCC 2LFRA 4G2KA 4UVBA 3WG7C 2P7TC 2JJ1G 4JAUA 3ABLB 3F7YC 4PELA 3E86A 4BAYA 5HFMA 5LGNA 3CCLV 1KC8W 1SERA 5EBWC 3AG1B 2V7QG 1FS0G 3JD4A 5IYCO 3FYEB 1QVGU 2WLMA 4LCUC 4TWKA 1YITV 2WAMA 4PDLA 3AEIA 1RM1B 1KKDA 4CBCA 4OXSA 2EZPA 4XDKA 3T4DA 1K5QA 3OW2U 1FXKA 1V55B 3ASOB 3OMNB 2HVJC 3T4ZA 2ZR3A 5CBGA 4H37A 4JTAB 2JEXA 3ZJZA 3OEEG 3FB6C 3G4SV 3LSSA 1M56C 1YTFD 2FTKA 3OGCC 4X8AA 1AJNA 4UXNA 4ASUG 3B8MA 5B1BC 2XOKG 2M7WA 2XASA 3E83A 3RVZA 3ZRXA 1QBZA 4JTDB 1R3KC 1OCZC 1YJ9V 4JGSA 4JAVA 3LSQA 3VOUA 2PI4A 3MHSC 2W0FC 4QPJA 1RPOA 1EFRG 1CPYA 3FB7C 2IU3A 1ENVA 1EZJA 2H94A 4X88A 5EC2C 1AI5A 2ZXWB 3ML0A 1GO3F 2R9IA 2IJIA 1SRYA 3MHHC 5KA5A 2EINC 2QTOA 2UXNA 3F7VC 1KD1W 2EILC 2ATKC 5L3GA 2IH1C 2Z3YA 5H9CA 4WFAV 1VQMV 3I55V 1FXKC 3HPLC 1MSWD 3W7WA 2Q67A 4WF9V 2LP7A 3E89A 1OCOC 4GX0A 3WFVA 4QIWF 2GSMB 1NJIW 3OR6C 3JD0A 5B1NA 3CCSV 2XAJA 1R3JC 2W6IG 5CBHA 2WLLB 2KB1A 4G28B 3M99B 2A9HA 3ETEA 3JD1A 1XL6A 3DTUB 3AG4B 5L3EA 2H8PC 2WSSG 1K3EA 2Q6AA 1NBMG 4YXWG 1E79G 3R65A 4U7OA 5IDJA 3BY6A 4PDRA 1PNKA 1H2GA 4ZBMA 5CBFA 2WLKA 3W7UA 3T2MA 1S77D 1W0JG 3FB5C 4GX2A 4R50A 1RPRA 1GKFA 1PD3A 2HKOA 1F4NA 1VQKV 4P30A 1VQLV 2QE7G 3X2QB 3QO8A 2DYSB 4R7CA 3OE7G 1VQ5V 4MVSA 3CPWU 5LGTA 3SPJA 3CD6V 3E8HA 4RQEA 4CZZA 3CYOA 3SYCA 2X6CA 1QR9A 3B77A 3SPHA 4L87A 2P67A 2QM7A 5DN6G 4HYOA 4TSFG 2DWDC 1F51A 2OCCC 2ZDIC 1VQ6V 3E35A 1WPXA 4PA6A 4RUEA 5B3SB 2EIKB 1JJ2U 3HB3B 4GX1A 3CCEV 1F4MA 1K7DA 1M56B 2EIMC 1M57C 2B1GA 3KG2A 1YTFB 1F23A 2NLJC 3ABMC 5B1BB 3STLC 2ZQMA 4I9WA 1KP2A 4G27B 4JASA 3RBZA 4Q20A 2B5UA 3B8NA 3G6EV 1NVPD 5IY5B 3TK1A 1OCZB 1AI7A 1P7BA 5GW7A 3ABKB 1OZ0A 2WLIA 2R9RB 3K06A 3K9AA 3SPGA 1XL4A 2DQ0A 3CCRV 1JOYA 1M9NA 1S5HC 1K4DC 1NH2D 3CC7V 3CCUV 2EINB 4MVQA 4FJCC 5LGUA 2EILB 3ZRSA 2QA4V 4UVAA 2WLJA 2XAHA 2JEUA 3OEHG 1R6KA 3E8FA 2BOCC 1CP9A 1YI2V 5B1AC 1S0VA 3W7TA 3IC7A 4E2LA 4F4LA 4UV8A 1M90W 2A0LA 3GB7C 4R6ZA 1KQSU 4MTOA 2XAFA 3K3WA 5CA3A 1QCEA 2JK5C 4RAIA 5L3DA 3ZMTA 5L3FA 5IYDO 2QEXV 2NNUA 3P30A 3IFXA 4XDJA 4MW8A 3AG2C 2W6JG 1K9MW 2DYRB 1BHAA 4JF3A 1K92A 2ZR2A 4J9YB 1G8MA 3ZN1A 1MABG 1AR1B 2YEVB 3ABTA 1VQOV 4MVRA 3W7SA 3OMAB 1K73W 2Q69A 4KUMA 2IU0A 1FXHA 1QR8A 1AROP 3LDEA 1Q7YW 1AI4A 3STZC 3QO7A 3EHBB 3CP1A 3W7XA 1R73A 1QLNA 2IJJA 1YSCA 3AG1C 1ZWIC 1FXVA 2OTLV 1OCRB 1QLEC 1K33A 4PDMA 4WFGA 1DF4A 3FB8C 5E1AC 4PDVA 1OCCC 2K1EA 1Y66A 1PNMA 1S72V 1GK9A 1V55C 4EKWA 1G4YB 1VQ7V 4N23A 3SYOA 1QVFU 1V54C 3CCQV 1YHQV 1SZTA 1GM7A 1BHBA 4HZ3A 4MT8A 2WLLA 3LDCA 5L3CA 3F5WC 3TCUA 3OR7C 4QE7A 1I5YA 1H8EG 4R8CA 3TETA 1M57B 3D36A 3DGEA 1YIJV 4WCEV 3D3IA 1E1RG 5B1OA 3OM3B 4JPRA 3ABMB 5H6RA 5KUMA 1K97A 1N8RW 3LUTB 5H6QA 3ZRWB 3WG7B 3GWOA 4MTGA 1NVPB 1HWYA 4QNHB 1K5SA 3G71V 1CEZA 4I5SA 4XBFA 4WFFA 3ASNC 3CMEV 2EBOA 4FMTA 3VBBA 4X89A 3FYIB 1JVMA 1NH2B 4H33A 4MTFA 4QPKA 3JYCA 4WFHA 4P2ZA 4MTXA 4RUFA 1UJWB 4PA7A 1KP3A 2OT5A 1YJNV 3OFNG 2DW4A 3ZRVA 2OTJV 2BOBC 4WFBV 4MS2A 3K79A 1EBOA 2GHYA 3CXCU 2A79B 3LNMB 4JYBA 2YSUB 3NXSA 5B1AB 5BZBA 3SJQC 2EIJC 1JX9A 2WLNA 2P90A 1DF5A 1IXMA 1Q81W 1Q82W 2PI5A 2ITDC 4P9OA 1VQPV 1S3JA 3FKSG 1WLEA 4MSWC 4GCZA 1PL0A 3AG2B 5EBMC 1GMGA 4MVUA 4U7NA 3H01A 2ZD9A 3MD0A 3QO5A 2D3OW 2Y69C 5DM6V 3CCVV 3AG3C 1LNQA 2HLDG 4HAMA 1P4RA 1L1FA 3X2QC 2DYSC 3LDDA 3ZMSA 1AJPA 2DQ3A 1FXKB 4PA9A 2WPDG 4DXWA 4KP4A 1YJWV 4PA3A 5CMUA 4MVOA 3ZN0A 3OUFA 1OCOB 1I5XA 1KECA 1BMFG 1QLEB 2LFSA 4KFMA 4N21A 4ZKIA 5LHHA 1R3IC 2XAGA 1OCCB 3JD2A 3P32A 3SYAA 4LBEC 1VQ9V 1MG1A 1BL8A 1S76D 2DWEC 2AHZA 1M1KW 1THZA 2HG5C 1VQ4V 4UV9A 2HVKC 5B3SC 2EIKC 4UVCA 1V54B 3T1CA 2IJKA 3E8GA 1PKXA 3CC2V 4QJFB 2QM8A 2UXXA 4WFEA 1AJQA 2AHYA 3K04A 5IY5C 3ABLC 3ABKC 4BW5A 5HFLA 3SYQA 2YEVA 3EFFK 1SETA 3PJSK 3ZMVA 1ORQC 1H8HG 1E1QG 3CCMV 1FFTB 3K08A 1NR1A 4TT3G 1NQTA 2QKSA 1RM1C 1DLBA 2JJ2G 3ASNB 4MW3A 1OHHG 2CK3G 3K0GA 3I56V 1JPXA 3ASOC 2JIZG 3OAAG 4LP8A 4MVMA 5C93A 3CCJV 1GTOA 2Y48A 3E2EA 4JTCB 2V1DA 2HFEC 3ETGA 3ZIAG 3CC4V 2B1IA 3RW0A 3ZMZA 4DO2A 3UKMA 4LC1A 5CN0A 5EK0A 1J95A 3CMAV 1GM8A 1JCHA 2OCCB 4XDLA 4JYCA 2EZOA 2X0LA 2EJRA 4BIUA 1ROPA 1Y4MA 3QNEA 2EIMB 2XNDG 5EBLC 4GX5A 1TUEB 4Z1MG 2EIJB 4QE9A 3SYPA 2ZDIA 4RO2A 4RQFA 2DYRC 2ZXWC 1VQ8V 2X6BA 1K34A 1PNLA 1COWG 5LHIA 1NR7A 2JDIG 3JD3A 3SPCA 3ZRWA 5KA6A 4UUJC 1H38A 2C2AA 3RVYA 2HJFC 2Y69B 2P6JA 3AG3B 2IH3C 1B6QA 2IJHA 3OMIB 2IW5A 3K03A 5LHGA 3ZMUA 2HR3A 1OCRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WLL B;  2WLH A;  2KB1 A;  3X2Q C;  4G28 B;  4J9Y B;  2DYS C;  2A9H A;  4P9P A;  1XL6 A;  2X6A A;  2H8P C;  3LDD A;  4MVR A;  5EC1 C;  2Q69 A;  3UM7 A;  2Q6A A;  3K0D A;  3LDE A;  4PA9 A;  4DXW A;  3BEH A;  3R65 A;  3AG4 C;  3STZ C;  4PA3 A;  4MVO A;  4PDR A;  4ZBM A;  3OUF A;  5CBF A;  2WLK A;  5J9P C;  4KFM A;  3T2M A;  3AG1 C;  4J9Z B;  3OUS A;  3FB5 C;  1ZWI C;  4GX2 A;  4PA4 A;  4R50 A;  1R3I C;  4MVZ A;  5KUK A;  4P30 A;  3E8B A;  1QLE C;  3IGA C;  3SYA A;  1R3L C;  2WLI B;  4LBE C;  4R7C A;  1BL8 A;  4PDM A;  2DWE C;  2AHZ A;  1K4C C;  3FB8 C;  2HG5 C;  4MVS A;  4PDV A;  1OCC C;  2K1E A;  5E1A C;  2HVK C;  1V55 C;  3SPJ A;  2EIK C;  2Q68 A;  4EKW A;  3E8H A;  5B3S C;  1G4Y B;  3T1C A;  3SPI A;  2ITC C;  3E8G A;  3WG7 C;  2P7T C;  3SYC A;  3SYO A;  2X6C A;  3F7Y C;  3E86 A;  3SPH A;  5EBW C;  1V54 C;  4WFE A;  2AHY A;  3K04 A;  4HZ3 A;  5CBG A;  5IY5 C;  2WLL A;  3LDC A;  2WLM A;  3ABL C;  3ABK C;  4LCU C;  4HYO A;  4TWK A;  3F5W C;  4BW5 A;  3SYQ A;  3TCU A;  4PDL A;  2YEV A;  3EFF K;  2DWD C;  3OR7 C;  3PJS K;  4QE7 A;  1KKD A;  4CBC A;  4OXS A;  4XDK A;  3T4D A;  1ORQ C;  2OCC C;  4R8C A;  3TET A;  3K08 A;  4PA6 A;  4RUE A;  4GX1 A;  2QKS A;  2HVJ C;  5KUM A;  3LUT B;  3T4Z A;  2EIM C;  1M57 C;  4MTG A;  3KG2 A;  4MW3 A;  3K0G A;  4QNH B;  2NLJ C;  3ABM C;  3ASO C;  4H37 A;  4JTA B;  4MVM A;  4I9W A;  4LP8 A;  4G27 B;  3STL C;  3RBZ A;  3ZJZ A;  3FB6 C;  1M56 C;  4JTC B;  1P7B A;  3OGC C;  3ASN C;  2HFE C;  4WFF A;  4X8A A;  2WLI A;  5B1B C;  3RW0 A;  3E83 A;  3RVZ A;  2R9R B;  3K06 A;  3UKM A;  4JTD B;  5EK0 A;  1J95 A;  1R3K C;  4X89 A;  1OCZ C;  1XL4 A;  3SPG A;  4XDL A;  3VOU A;  1JVM A;  2W0F C;  4H33 A;  4MTF A;  3FB7 C;  3JYC A;  4WFH A;  4P2Z A;  4RUF A;  1S5H C;  4PA7 A;  1K4D C;  5EBL C;  4GX5 A;  4X88 A;  5EC2 C;  2BOB C;  4MS2 A;  4QE9 A;  3SYP A;  4MVQ A;  2A79 B;  3ZRS A;  4RO2 A;  3LNM B;  5BZB A;  2DYR C;  2WLJ A;  2EIN C;  2QTO A;  3SJQ C;  2EIJ C;  2ZXW C;  2WLN A;  2X6B A;  3E8F A;  3F7V C;  2BOC C;  2EIL C;  2ATK C;  5B1A C;  2IH1 C;  3SPC A;  4F4L A;  3HPL C;  2ITD C;  2A0L A;  3AG3 C;  3GB7 C;  4P9O A;  4UUJ C;  3RVY A;  4R6Z A;  2Q67 A;  2HJF C;  4MSW C;  4MTO A;  2IH3 C;  3E89 A;  1OCO C;  5EBM C;  4GX0 A;  4MVU A;  4RAI A;  2JK5 C;  2ZD9 A;  3OR6 C;  3K03 A;  2Y69 C;  3IFX A;  4XDJ A;  4MW8 A;  1R3J C;  1LNQ A;  3AG2 C;  5CBH A;  1OCR C;  4WFG A; 
#chains in the Genus database with same CATH topology
 2WLH A;  2ODM A;  1YCI A;  1WA8 A;  1MNG A;  2XT9 A;  2UUA B;  2YIC A;  3UM7 A;  2RDC A;  1AI6 A;  4GT1 A;  5LL6 Y;  1PM9 A;  1W2B U;  1Y76 A;  1HNX B;  3PN1 A;  5J9P C;  2ZIM A;  3CRQ A;  4PA4 A;  4ZHQ A;  4JZG A;  4MVZ A;  5KUK A;  4W4K A;  3IGA C;  2M6Y A;  1EN6 A;  1SES A;  2LGQ A;  2Y0I A;  3AK3 A;  2WWW A;  2Q68 A;  5L3B A;  4DV3 B;  1KBH A;  2P7T C;  3ZBH A;  4JAU A;  4BAY A;  1Q6H A;  3CCL V;  1KC8 W;  4LF5 B;  4FM1 A;  4JI5 B;  1JR9 A;  1YIT V;  2AGA A;  1RM1 B;  1BS3 A;  1V55 B;  2A06 H;  3BA8 A;  2EUL A;  3CJH A;  4JTA B;  3Q4H A;  1SQP H;  3FB6 C;  3LSS A;  1YTF D;  3OGC C;  4DV6 B;  1AIL A;  3N2K A;  5B1B C;  3E83 A;  2M7W A;  1SQF A;  2YXH A;  1QBZ A;  2YIA A;  4B3S B;  3VQY A;  3MHS C;  2ETN A;  1EFR G;  1CPY A;  2QWR B;  2CE4 A;  2IU3 A;  5GON A;  4BR6 A;  4X88 A;  1AI5 A;  2YS8 A;  2ZXW B;  1GO3 F;  1SZX A;  1ZL8 A;  2IJI A;  3MHH C;  3FAV B;  2EIN C;  2QTO A;  2UXN A;  3ZX6 A;  3F7V C;  3CXH F;  1KD1 W;  5L3G A;  2IH1 C;  1VQM V;  4DRX B;  3HPL C;  4RWU A;  1HNZ B;  4LF4 O;  2LP7 A;  2ZIO A;  2LQT A;  1OCO C;  4GX0 A;  4J41 A;  3WFV A;  1NJI W;  2W0X A;  3CCS V;  2XAJ A;  4X1K A;  5CBH A;  2ADQ B;  4O4I A;  3JAS B;  4X64 B;  2WLL B;  1XL6 A;  5L3E A;  1FFX A;  3AG4 B;  1K3E A;  1QU7 A;  4DV0 B;  1E79 G;  2QWQ B;  4DW1 A;  1UPG A;  2BSK A;  5BR8 O;  4PDR A;  1PNK A;  4ZBM A;  1Q6U A;  3T2M A;  1S77 D;  4GX2 A;  2F23 A;  4ZI7 A;  1VQL V;  4IYI A;  2QE7 G;  3QO8 A;  2DYS B;  3SPJ A;  1QQC A;  4TOI A;  4RQE A;  4LH7 A;  4B3M B;  1BGY H;  2X6C A;  3RGB A;  4L87 A;  1XMQ B;  2PY5 A;  2CTR A;  5B66 Z;  4JI3 O;  2QM7 A;  1WAZ A;  3UO2 A;  1P7G A;  1XIL A;  5CA0 B;  5K1X A;  4LFB B;  2ZDI C;  1VQ6 V;  1WPX A;  2EIK B;  3CCE V;  4PHZ A;  1M57 C;  2ZT9 B;  3JAW A;  1F23 A;  2NLJ C;  3STL C;  5BMV A;  1KP2 A;  4G27 B;  4JAS A;  3RBZ A;  2BTO A;  4Q20 A;  2B5U A;  3B8N A;  3TXS A;  3L72 H;  1CXZ B;  2Q0A A;  1OCZ B;  3TK1 A;  5IY5 B;  1OZ0 A;  2WLI A;  5LXT B;  1P49 A;  1XRE A;  2DMX A;  4JI4 O;  5KMG A;  1M9N A;  1S5H C;  1K4D C;  4CS3 A;  5LGU A;  3G80 A;  2EIL B;  1GH6 A;  3ZRS A;  4UVA A;  3E8F A;  2BOC C;  1SS3 A;  4JI2 O;  1YI2 V;  1S0V A;  1PP9 H;  4UB8 Z;  2CGO A;  3W7T A;  3IC7 A;  4J7K A;  3K57 A;  5DEC A;  2XUM A;  4X62 B;  1KQS U;  1VIB A;  2YID A;  3K3W A;  3T1Y O;  2YI9 A;  3HKB A;  5IJ0 B;  5IWA O;  1QCE A;  2JK5 C;  5L3D A;  2QEX V;  2UXD O;  4FFB B;  2PYL A;  3IFX A;  4XDJ A;  3AG2 C;  2W6J G;  3IC9 A;  4JF3 A;  2N74 A;  1I0H A;  2ZR2 A;  1G8M A;  1AR1 B;  4B3R O;  4NXN O;  4CH3 A;  2ZM6 O;  3HKC B;  3W7S A;  5IJ0 A;  3OMA B;  2IU0 A;  1FXH A;  3OTF A;  3LDE A;  4NVP A;  1XI1 A;  3AG7 A;  1QLN A;  1YSC A;  1GN4 A;  3HKC A;  1YVW A;  4DR2 O;  2JS5 A;  5LMU O;  1DGS A;  3DC6 A;  2Q8V A;  1DF4 A;  1S72 V;  1GK9 A;  1WJZ A;  1XDC A;  3RYH B;  1G4Y B;  2GDS A;  1WN7 A;  3DXR B;  3CCQ V;  4I4T B;  1BHB A;  4HZ3 A;  3B40 A;  3O65 A;  2FKX A;  5L3C A;  2Y4U A;  1MZF A;  2OCH A;  3OR7 C;  1YF2 A;  3D36 A;  3DGE A;  1BSM A;  5KHK A;  1YIJ V;  4JPR A;  5KUM A;  3LUT B;  5H6Q A;  2D2C B;  2F4V O;  3GWO A;  2PZS A;  4XBF A;  3C3S A;  3CME V;  3KCX A;  4FMT A;  4X89 A;  1I08 A;  3FYI B;  4H33 A;  3A0H Z;  4PI0 A;  4UCS A;  5FNV B;  2OT5 A;  5BR8 B;  3L74 H;  4NTX A;  3CXC U;  2MW2 B;  4YY3 O;  5B1A B;  3JAK B;  3DSQ A;  3SJQ C;  1JX9 A;  3OT7 A;  5FNV A;  1DF5 A;  1IXM A;  4LFA B;  2UUC O;  3ZED A;  4CH5 A;  4P9O A;  1XNR O;  2JGU A;  4K8X A;  2DJV A;  2Y4T A;  4AI8 A;  4MSW C;  2F1M A;  3JAK A;  5EBM C;  1TUB A;  2RQ6 A;  2Y69 C;  4JI3 B;  3CCV V;  1NTK H;  2HLD G;  3BAB A;  4HAM A;  2BTQ A;  4UFZ A;  3SR2 C;  1J5E O;  4GLX A;  4IT5 A;  4KP4 A;  2QJ1 A;  1G6U A;  1OCO B;  4X65 O;  4ZKI A;  4KFM A;  1B06 A;  1S5J A;  5LHH A;  5KAF Z;  4IIJ B;  1KU9 A;  3JD2 A;  4YJ3 B;  4B08 A;  4KHP O;  4L8J A;  1SQQ H;  4LBE C;  1BL8 A;  2DWE C;  3CB2 A;  4UV9 A;  1V54 B;  4JI4 B;  4O4L A;  2GBO A;  1RSO A;  5CB4 A;  1SC5 B;  4BW5 A;  3ZS8 C;  3ZMV A;  4JI2 B;  1FFT B;  2WA3 A;  2QKS A;  1RM1 C;  1DLB A;  4I55 A;  1JA8 A;  4JAA A;  5EZY A;  3ASN B;  3T1Y B;  3I56 V;  1JPX A;  4JV5 O;  2JIZ G;  3OGI B;  4MVM A;  2UXD B;  1LUV A;  4OPH A;  4O4J B;  3BAA A;  2B1I A;  1WB8 A;  4NXN B;  4LC1 A;  5LA6 A;  2A3Q A;  3HKE B;  3CMA V;  1GM8 A;  4HNA B;  2X0L A;  3QNE A;  2WA4 A;  1IZ3 A;  2QKA A;  2ZDI A;  4O2A A;  4DR2 B;  5LMU B;  1HNW O;  3FD9 A;  2ZXW C;  3EXA A;  2X6B A;  1K34 A;  4WBN B;  1COW G;  1Y74 B;  4FZ0 A;  4LF8 O;  1NR7 A;  2JDI G;  1JFF A;  1N33 O;  1H38 A;  3B2E E;  4DR6 O;  2IH3 C;  2FB5 A;  1VF6 C;  1B6Q A;  4GKJ O;  5LHG A;  3KZI Z;  1BZK A;  3JAM N;  1DTO A;  2JRI A;  5KHG A;  4FPP A;  4P9P A;  1GM9 A;  3RYI B;  3G67 A;  1H2M A;  2QKC A;  4DV5 O;  2XAQ A;  4I0X B;  5CA1 B;  1MZE A;  3AG4 C;  5JJJ B;  1JQ0 A;  2CDY A;  4LNU A;  3CRC A;  2JGD A;  1NKD A;  4NTW A;  3ABU A;  4I0X A;  3VQX A;  5K1P A;  2K9P A;  3S3W A;  2Y0P A;  1W0K G;  4FK5 C;  3BCC H;  4UCU A;  3SPI A;  4UVB A;  4PEL A;  5LGN A;  5KHH A;  5EIB C;  4X1Y A;  4LF9 B;  4YY3 B;  3JD4 A;  3FFQ A;  4I9Q A;  4PDL A;  1NTM H;  4AIL C;  1LUW A;  1K5Q A;  3OW2 U;  1FXK A;  1XNR B;  3ASO B;  3OMN B;  4U3J B;  2HVJ C;  3H1J H;  2VQF B;  4B3T O;  5CBG A;  4H37 A;  3JAR B;  3K5O A;  3MDS A;  2Q0O C;  4ABM A;  4ASU G;  3RVZ A;  2CTQ A;  4JTD B;  4X66 O;  2PGG A;  1ZUQ A;  2YDE A;  1OCZ C;  1YJ9 V;  1J5E B;  4JGS A;  3VOU A;  3LSQ A;  3ICX A;  3R66 A;  1NU1 H;  3MAQ A;  1L8D A;  3E22 B;  4X65 B;  5EC2 C;  1Z5W A;  4JYA O;  3LNN A;  3H1I H;  1SRY A;  4KHP B;  3QVN A;  5DED A;  2B9Z A;  3IJ4 A;  2EIL C;  4WFA V;  4HBN A;  3I55 V;  2Q67 A;  4UCT A;  1Q3E A;  2ZKO A;  1H2S B;  3OR6 C;  5B1N A;  3CWB H;  2LJ2 A;  3M99 B;  1I94 O;  4X20 B;  1B04 A;  4NXM O;  4LWS A;  1NBM G;  4YXW G;  4TV8 B;  3R65 A;  4TQD A;  3D3Q A;  2UXB O;  3W7U A;  4JV5 B;  2P4K A;  3WB2 A;  1W0J G;  2ZE8 A;  3FB5 C;  4R50 A;  1RPR A;  4ZOL B;  1F4N A;  4EB6 A;  3L70 H;  3SJA C;  2FML A;  5EYP A;  3CPW U;  5LGT A;  5LMN O;  3E8H A;  2YUA A;  5JH7 B;  4K0K O;  5A9G A;  1QR9 A;  3SPH A;  1G1X B;  4ZIB A;  1GN2 A;  1HNW B;  5DN6 G;  3B09 A;  1GN3 A;  2DWD C;  4PJ0 Z;  4AQY B;  1JJ2 U;  2N04 A;  4IL6 Z;  4YHH O;  2EIM C;  2XHB A;  3CRA A;  4DR6 B;  2FYU H;  2E75 B;  5GW7 A;  1FAF A;  3P3N A;  3K06 A;  1EM1 A;  5E79 Z;  1T5E A;  3K9A A;  3SPG A;  5KLV H;  3ZHS A;  2QM4 A;  1XBL A;  4BWA A;  1NH2 D;  3CC7 V;  2R72 A;  4MVQ A;  4FJC C;  2ZNI A;  4FLX A;  3APQ A;  1XUQ A;  2L35 A;  1CP9 A;  4PD4 F;  5B1A C;  1EN4 A;  4I50 B;  4AHC A;  3HKD B;  4UV8 A;  5C8Y B;  3GB7 C;  1HDJ A;  4DR1 O;  4R6Z A;  2XAF A;  1BQZ A;  5CA3 A;  5IYD O;  1TVK B;  3P30 A;  5C8Y A;  1MAB G;  4JI7 O;  1VQO V;  4MVR A;  4KUM A;  1TVK A;  5ITZ B;  3UT5 B;  2KSD A;  4DV2 O;  3QO7 A;  1R73 A;  4B3T B;  1ZWI C;  1FXV A;  2OTL V;  3FAV A;  2DE0 X;  1L0N H;  1K33 A;  4X66 B;  5FLX N;  4PDV A;  1VF6 A;  4DRX A;  5IJ9 B;  1Y66 A;  1IBL O;  4EKW A;  1ZTE A;  2KQX A;  5LOV B;  1VQ7 V;  2UXC O;  3ZHQ A;  1V54 C;  3BPZ A;  4I7Z B;  1GM7 A;  4C7U A;  5IJ9 A;  3JAS A;  2P5O A;  2WLL A;  3LDC A;  4FZ1 A;  1I5Y A;  1H8E G;  2R70 A;  3JAL B;  4DR7 O;  1FJG O;  1U96 A;  2A7W A;  5H6R A;  1FD9 A;  1K97 A;  3ZRW B;  1NVP B;  1D5A A;  3A8T A;  1CEZ A;  5BXZ A;  3ASN C;  1Q5O A;  3RYC B;  1WP8 A;  4NXM B;  1JVM A;  1WNS A;  1O9G A;  2VRZ A;  4WFH A;  2ZE7 A;  4RUF A;  2UXB B;  1KP3 A;  2QWO B;  2DW4 A;  2BOB C;  4WFB V;  3ZHR A;  1Y67 A;  2Z0A A;  3K79 A;  2VS0 A;  2QSA A;  5CA0 A;  3LNM B;  2YSU B;  5BZB A;  3CE2 A;  4FLV A;  2WLN A;  2IM9 A;  2P90 A;  3RWR D;  1YXB A;  4DR5 O;  2ZE5 A;  1QNM A;  3H9V A;  4YIO A;  5LMN B;  2PI5 A;  2Q7E A;  1VQP V;  3FKS G;  1WLE A;  2LGW A;  4JI8 O;  4K0K B;  4MVU A;  3MD0 A;  3QO5 A;  4J80 A;  5DM6 V;  5LXT A;  1P4R A;  4TV9 B;  3C3T A;  1AJP A;  2AXT Z;  2Q4P A;  2WPD G;  4PA9 A;  4PA3 A;  4MVO A;  1TA8 A;  1KEC A;  4H44 B;  2OIG A;  2XAG A;  1OCC B;  3SYA A;  3KCY A;  3LSU A;  2AHZ A;  1VQ4 V;  1THZ A;  2HVK C;  2IJK A;  1PKX A;  3CX5 F;  3CC2 V;  4H13 B;  2QM8 A;  1Z5V A;  1SQV H;  2UXX A;  2VWK A;  4FFB A;  4WFE A;  2VWJ A;  4BIO A;  2E76 B;  4GKK O;  3ABK C;  1TAE A;  4PI2 A;  1OV9 A;  3JSL A;  1H8H G;  3K08 A;  1NR1 A;  2UU9 O;  4DR1 B;  1NQT A;  3I5D A;  5JCO C;  2NN4 A;  2JJ2 G;  2RN9 A;  1YEW A;  2OIE A;  3ASO C;  3GVM A;  2Y48 A;  3E2E A;  2V1D A;  4F6R B;  2HFE C;  4DO2 A;  5JJE B;  3UKM A;  4JI7 B;  1JCH A;  3RYH A;  4JYC A;  2EZO A;  2EJR A;  1Y4M A;  3DXR A;  2EIM B;  4I4T A;  2EIJ B;  3SYP A;  1AR4 A;  4LF4 B;  3CSX A;  1A32 A;  4LF6 O;  1PNL A;  2E3C A;  5F2V O;  1IBL B;  3JD3 A;  3SPC A;  4DR4 O;  5FPR A;  5KA6 A;  3VQW A;  2UXC B;  3RVY A;  2HJF C;  4LF7 O;  4CH6 A;  5LYJ B;  3AK1 A;  3OMI B;  3K03 A;  1MA1 A;  4FLW A;  3OTO O;  4FIP C;  4DR7 B;  1FJG B;  1NT2 B;  1IVS A;  2GUZ B;  3K9S A;  3A0R A;  5KHJ A;  1Q86 W;  2Z5U A;  4Z1V A;  3BEH A;  3UQ8 A;  4BIZ A;  3ZCC A;  1BCC H;  4J9Z B;  3OUS A;  1VQN V;  2X7R B;  3OD4 A;  2F43 G;  5LP6 C;  3ETD A;  3E8B A;  2E5L O;  4O4H B;  1R6N A;  2Q73 A;  1QHT A;  2OYQ A;  3QF7 A;  2ITC C;  4JI0 O;  2QR4 A;  3D8C A;  3WG7 C;  2F95 B;  4CH4 A;  5EIB D;  3ABL B;  3F7Y C;  1S5L Z;  5HFM A;  4O4H A;  5EBW C;  2V7Q G;  1M4U A;  4DV4 O;  2CTW A;  2WLM A;  4TWK A;  3K5L A;  4CBC A;  1TGO A;  4OXS A;  4XDK A;  1H2K A;  4TUY B;  1XMO O;  2YXL A;  5J2T B;  3SJC C;  2ZCE A;  3T4Z A;  3P3P A;  4JI8 B;  2JEX A;  3ZJZ A;  4IIJ A;  3OEE G;  2FL4 A;  3G4S V;  1VMG A;  4NKG B;  2FTK A;  4YJ3 A;  4X8A A;  4UXN A;  2XOK G;  3ZRX A;  2XAS A;  1R3K C;  5KAI Z;  2PI4 A;  2W0F C;  4QPJ A;  1RPO A;  3M7M X;  1ENV A;  2H94 A;  5JVD B;  1HR0 O;  3ML0 A;  2KG7 B;  2R9I A;  5KA5 A;  4DR3 O;  5IWA B;  3H1K H;  3SGI A;  2ATK C;  4JI6 O;  4JYY A;  4B3R B;  2ZM6 B;  3W7W A;  4F6E A;  4WF9 V;  4NTY A;  4X9Q A;  1JMK C;  5IE9 A;  4DV7 O;  1Y6X A;  2O57 A;  4O4J A;  1R3J C;  3B4S A;  3M8A A;  1KUQ A;  3EVK A;  2KB1 A;  3HKE A;  2A9H A;  3ETE A;  4HNA A;  1N36 O;  1B3Q A;  3VQV A;  2CH7 B;  2WSS G;  1KMI Z;  2Q6A A;  2UU9 B;  5D5Q A;  2QDO A;  2HHH O;  5IDJ A;  3BY6 A;  2WLK A;  1KYO F;  1XQ8 A;  1PD3 A;  2HKO A;  2UUA O;  3CRR A;  1VQK V;  4P30 A;  4WBN A;  1Y74 A;  1VQ5 V;  4R7C A;  4FLY A;  4K3A A;  2YC0 A;  1HNX O;  3SJB C;  4CZZ A;  3CYO A;  5KX5 B;  4NB5 A;  3SYC A;  1Q6I A;  3B77 A;  1SQG A;  4DV1 O;  1US6 A;  4X1I B;  2F4V B;  2AZ2 A;  4TSF G;  4LF6 B;  1F7Y A;  3RYI A;  1AR5 A;  3E35 A;  4DR4 B;  4RUE A;  5CA1 A;  4X1I A;  2R9A A;  5H2F Z;  1M56 B;  4DK0 A;  3C90 A;  4DYL A;  1YTF B;  3N2G B;  2ZQM A;  4IYH A;  4I9W A;  1BE3 H;  3UO3 A;  3OTO B;  3ABK B;  2E74 B;  2Q7G A;  1IX9 A;  3JAT B;  1XL4 A;  3CCR V;  5D5P A;  2UUC B;  4DV6 O;  3G6B A;  1AVM A;  2P06 A;  4B3S O;  3OEH G;  4PV1 B;  4U3J A;  1IBM O;  2A0L A;  1GAX A;  2RJZ A;  3K58 A;  4JI0 B;  4D7S A;  5BY1 A;  4MTO A;  3BA9 A;  3JAR A;  3RYF B;  4RAI A;  2RNB A;  4DV4 B;  1BHA A;  3NR7 A;  1HNZ O;  2YEV B;  4YIP A;  1XMO B;  1K73 W;  2Q69 A;  1QR8 A;  1ARO P;  4IGG A;  3STZ C;  3RT3 C;  4J42 A;  3E22 A;  3EHB B;  3W7X A;  2ADP A;  1Q8I A;  2IJJ A;  4X64 O;  3AG1 C;  2EJ7 A;  4NYK A;  2P22 C;  3RN4 A;  3TGU H;  4DV0 O;  4WFG A;  3K59 A;  5E1A C;  1OCC C;  1XOU A;  1FKA O;  3L75 H;  5AG2 A;  2QWP B;  3SYO A;  1QVF U;  1HR0 B;  1BT8 A;  2Q7H A;  1SZT A;  3THO A;  3GWK C;  4MT8 A;  5LP6 B;  2CGN A;  4DR3 B;  3TJT A;  4X20 A;  3TET A;  4W4L A;  4TV8 A;  2CUG A;  4WCE V;  3ABM B;  3WG7 B;  4MTG A;  3KKY A;  1HWY A;  4DV7 B;  2HEP A;  4ZOL A;  1WP7 A;  2DN9 A;  4WFF A;  5J2U B;  1N36 B;  1WA8 B;  4QPK A;  5JH7 A;  2HHH B;  4LF8 B;  4MTX A;  1UJW B;  4PA7 A;  3OFN G;  5J2U A;  2OTJ V;  4UCV A;  1N33 B;  1XNQ O;  4NR1 A;  1Y76 B;  3QG5 A;  4MS2 A;  1N4C A;  1HP8 A;  2GHY A;  1Q43 A;  4OGQ B;  4ZHQ B;  2EIJ C;  4GKJ B;  1R6T A;  1Q81 W;  3D36 C;  1PPJ H;  1S3J A;  4CS2 A;  4LR3 A;  3APO A;  4GCZ A;  1NS1 A;  4DV5 B;  4DV1 B;  4U7N A;  3U10 A;  3H01 A;  2D3O W;  1L1F A;  2G38 A;  3X2Q C;  2YI8 A;  5GTH Z;  4BW9 A;  4X62 O;  2YXY A;  3ZMS A;  1RFY A;  4DXW A;  4QGP A;  4JI1 O;  5CMU A;  1BMF G;  1QLE B;  2LFS A;  3CJH B;  3Q4H B;  3P32 A;  2N05 A;  3N2K B;  1VQ9 V;  1MG1 A;  4I50 A;  3HKD A;  1M1K W;  1VEW A;  2HG5 C;  2QWN B;  4FVM A;  5B3S C;  1ZLZ A;  3E8G A;  1RP3 B;  4QJF B;  5GON B;  4J7J A;  4O2B B;  4A5U B;  1AJQ A;  2AHY A;  1LR1 A;  2ZNJ A;  3K04 A;  1Q90 D;  3ABL C;  1ZL8 B;  3SYQ A;  2KKW A;  3EFF K;  3T1H O;  1IBK O;  1E1Q G;  3CCM V;  4FLT A;  4O2B A;  2JVD A;  5ITZ A;  3WB1 A;  3UT5 A;  1IBM B;  2RCV A;  4K8Z A;  2HJD A;  1ZX3 A;  1P84 F;  4MW3 A;  1OHH G;  2CK3 G;  3K0G A;  2GTS A;  4EEQ A;  3CCJ V;  1KKC A;  1R1B A;  2IBZ H;  4DW0 A;  4X1K B;  4U3F H;  4JYA B;  4O4I B;  5EK0 A;  1J95 A;  3IAY A;  3A2F A;  4XDL A;  2LO1 A;  1FFX B;  5LOV A;  3J80 N;  1ROP A;  3AK2 A;  2RMK B;  4K35 A;  2BSK B;  1TUE B;  4Z1M G;  4QE9 A;  2Q9L A;  3RFR A;  2DYR C;  2NR5 A;  4ZI7 B;  1VQ8 V;  2VQE O;  3JAL A;  1Z2G A;  1SA0 B;  4J10 A;  1MMM A;  3ZRW A;  1M93 A;  1I94 B;  1X4T A;  3AG3 B;  2AW9 A;  2IJH A;  1VP7 A;  1AB3 A;  3ZMU A;  1SA0 A;  2HR3 A;  4LFA O;  1OCR C;  1N0N A;  3UCS C;  3DC5 A;  3RYC A;  5FL7 G;  2X6A A;  5EC1 C;  3K0D A;  5IYB O;  3L9D A;  2F66 C;  4DUZ O;  1K8A W;  1MOF A;  3JAW B;  5BMV B;  1SF9 A;  4KXR A;  1R3L C;  3BFR A;  2WLI B;  3JCZ A;  1K4C C;  1FPO A;  5LBQ A;  2MK3 A;  2LFR A;  5IT9 N;  4G2K A;  5KMG B;  2JJ1 G;  3E86 A;  1SER A;  1XNQ B;  3CHX A;  3AG1 B;  1FS0 G;  2ZE6 A;  4YHH B;  5H5N A;  5IYC O;  3FYE B;  1QVG U;  1XHZ A;  4LCU C;  1D2D A;  2WAM A;  4FLU A;  3AEI A;  4TV9 A;  1WB7 A;  1KKD A;  3T4D A;  2EZP A;  1DK1 A;  5A2Q N;  2PYJ A;  4CC6 A;  1PL4 A;  4OX9 O;  2ZR3 A;  3HKB B;  1M56 C;  1AJN A;  3B8M A;  1U97 A;  4JAV A;  3L73 H;  1ZAU A;  2PF4 E;  3FB7 C;  3JSN A;  4JI1 B;  1L0L H;  1EZJ A;  4OPA A;  1URF A;  3ZHT A;  5H9C A;  2Z3Y A;  2CTP A;  1FXK C;  1MSW D;  1I7F A;  1PV0 A;  5JWP A;  3E89 A;  4EFE A;  4QIW F;  2GSM B;  4F6R A;  4DV2 B;  3JD0 A;  2W6I G;  4G28 B;  1V9P A;  3JD1 A;  3DTU B;  3T1H B;  1IBK B;  2H8P C;  4U7O A;  1WPB A;  1IXB A;  3HR0 A;  1H2G A;  3U11 A;  1YZB A;  5CBF A;  2YIB A;  1GKF A;  3X2Q B;  2DOS A;  3OE7 G;  4DK1 A;  4MVS A;  3CD6 V;  3CS5 A;  1BQ0 A;  1O9H A;  5LYJ A;  4ICG A;  1AP5 A;  1FYJ A;  2P67 A;  2JS3 A;  1MSD A;  2EX3 A;  2ARH A;  3K5M A;  4HYO A;  2VQE B;  5FPO A;  1F51 A;  4LFC O;  2OCC C;  2GUZ A;  2P4V A;  1OJH A;  3ZHV A;  4PA6 A;  5B3S B;  4J7Z A;  3HB3 B;  4GX1 A;  1F4M A;  4LF9 O;  1K7D A;  2B1G A;  3KG2 A;  4H0L B;  5B1B B;  3ABM C;  1TUB B;  1NVP D;  3G6E V;  1IDS A;  1H2N A;  1AI7 A;  1P7B A;  2LW7 A;  1N34 O;  2R9R B;  2BTQ B;  2DQ0 A;  3J81 N;  2VQF O;  1SKV A;  1HW7 A;  1JOY A;  4DR5 B;  2F93 B;  2ILM A;  4DUZ B;  3CCU V;  2EIN B;  2UUB O;  1YDX A;  2QA4 V;  2WLJ A;  2XAH A;  4DUY O;  2JEU A;  1N32 O;  1KB9 F;  4TUY A;  1R6K A;  5J2T A;  4E2L A;  4F4L A;  1M90 W;  3BVO A;  1IUR A;  4O4L B;  3ZMT A;  2HP8 A;  4FFK A;  5L3F A;  2NNU A;  4B7K A;  4MW8 A;  1RSO B;  1K9M W;  2DYR B;  1AP6 A;  3F5T A;  5CB4 B;  1K92 A;  4J9Y B;  3ZN1 A;  3H1L H;  1SQX H;  4UCO A;  3ABT A;  5B5E Z;  3ZHU A;  1Q7Y W;  1AI4 A;  1GN6 A;  4GZR B;  1VAR A;  1XEQ A;  5JVD A;  4OX9 B;  3CP1 A;  4I55 B;  5EZY B;  2KG7 A;  4Q6G A;  1W59 A;  3H1H H;  1GRJ A;  2PTM A;  2GV9 A;  2V4D A;  1OCR B;  2XTA A;  1NTZ H;  4GUN A;  2Q5Z A;  1QLE C;  1ZSP A;  4PDM A;  3FB8 C;  4GKK B;  5LA6 B;  2K1E A;  1PNM A;  1V55 C;  2QTS A;  4UB6 Z;  4N23 A;  1YHQ V;  1JJO A;  4LH6 A;  3SDL A;  1D5N A;  4O2A B;  3F5W C;  3TCU A;  3CEI A;  2CH7 A;  4QE7 A;  4R8C A;  1M57 B;  4E4E A;  3D3I A;  1E1R G;  2QGN A;  2OWO A;  5B1O A;  3OM3 B;  1JFF B;  1N8R W;  3L71 H;  3J7A U;  4TQF A;  1UFI A;  4QNH B;  1K5S A;  3G71 V;  4I5S A;  4D6T H;  4AQY O;  2EBO A;  3U0Z A;  5GTI Z;  4IHJ B;  3VBB A;  2BE3 A;  1NH2 B;  5TIS Z;  4MTF A;  5KX5 A;  3JYC A;  2L6L A;  4P2Z A;  4DV3 O;  3N27 A;  1YJN V;  3ZRV A;  4LNU B;  4LF5 O;  4IHJ A;  4YJ2 B;  1EBO A;  2A79 B;  4JI5 O;  4LF7 B;  4JYB A;  3NXS A;  2JGD B;  5JJN B;  1X59 A;  2YIB D;  1Q82 W;  4YJ2 A;  2ITD C;  1NI8 A;  4J11 A;  3BRC A;  1PL0 A;  3AG2 B;  3N2G A;  4EFB A;  1GMG A;  2ZD9 A;  4X1Y B;  3BHP A;  5KHI A;  1EN5 A;  1LNQ A;  3AG3 C;  3JAT A;  1NZ6 A;  2DYS C;  2ZIN A;  4D7T A;  4LFC B;  3LDD A;  1VF5 B;  5IYZ B;  3ETQ A;  4JZ2 A;  2DQ3 A;  2E5L B;  5JCO A;  1FXK B;  2GTA A;  2PUS A;  1YJW V;  5JQG B;  1H2L A;  3ZN0 A;  3OUF A;  1I5X A;  4N21 A;  4UCR A;  5IYZ A;  3O9O A;  1R3I C;  1N34 B;  4FM0 A;  1S76 D;  5JQG A;  2EIK C;  4UVC A;  3WU2 Z;  3T1C A;  3WB0 A;  3JCU Z;  3RYF A;  4FLZ A;  4Z2W A;  2UUB B;  3S3X A;  4KL1 A;  5IY5 C;  4DUY B;  1N32 B;  5HFL A;  2YEV A;  1SET A;  3PJS K;  4FM2 A;  1ORQ C;  1N0J A;  4TT3 G;  4CS4 A;  1EZV H;  4GYC B;  3OAA G;  5C93 A;  4LP8 A;  2AZ0 A;  1GTO A;  4JTC B;  3ETG A;  3ZIA G;  3CC4 V;  3RW0 A;  3ZMZ A;  5CN0 A;  1VF7 A;  2OCC B;  3FX7 A;  4CC5 A;  2BCC H;  4LWS B;  4BIU A;  3QTC A;  4B3M O;  4JI6 B;  2XND G;  5EBL C;  2CAZ C;  4GX5 A;  1XMQ O;  5LP6 A;  4RO2 A;  4RQF A;  4LFB O;  3TXQ A;  1SQB H;  2H3O A;  4EB6 B;  5LHI A;  1M5I A;  5EYP B;  4UUJ C;  2C2A A;  4B7E A;  2LW1 A;  2Y69 B;  2P6J A;  3A0B Z;  3K5N A;  2IW5 A;  1XHX A;  3CRM A; 
#chains in the Genus database with same CATH homology
 2WLH A;  1DTO A;  4FPP A;  4P9P A;  5FL7 G;  2X6A A;  4FIP C;  1GM9 A;  5EC1 C;  3UM7 A;  3K0D A;  3A0R A;  1Q86 W;  2Z5U A;  5IYB O;  3BEH A;  1AI6 A;  2XAQ A;  4GT1 A;  3AG4 C;  1JQ0 A;  1W2B U;  1K8A W;  1MOF A;  4BIZ A;  5J9P C;  3ZCC A;  4J9Z B;  3OUS A;  1VQN V;  2X7R B;  4PA4 A;  1NKD A;  2F43 G;  3ETD A;  3ABU A;  4MVZ A;  5KUK A;  3E8B A;  3IGA C;  1R3L C;  3JCZ A;  2WLI B;  1SES A;  1R6N A;  1K4C C;  5LBQ A;  2WWW A;  1W0K G;  2Q68 A;  5L3B A;  4FK5 C;  2MK3 A;  3SPI A;  2ITC C;  2LFR A;  4G2K A;  4UVB A;  3WG7 C;  2P7T C;  2JJ1 G;  4JAU A;  3ABL B;  3F7Y C;  4PEL A;  3E86 A;  4BAY A;  5HFM A;  5LGN A;  3CCL V;  1KC8 W;  1SER A;  5EBW C;  3AG1 B;  2V7Q G;  1FS0 G;  3JD4 A;  5IYC O;  3FYE B;  1QVG U;  2WLM A;  4LCU C;  4TWK A;  1YIT V;  2WAM A;  4PDL A;  3AEI A;  1RM1 B;  1KKD A;  4CBC A;  4OXS A;  2EZP A;  4XDK A;  3T4D A;  1K5Q A;  3OW2 U;  1FXK A;  1V55 B;  3ASO B;  3OMN B;  2HVJ C;  3T4Z A;  2ZR3 A;  5CBG A;  4H37 A;  4JTA B;  2JEX A;  3ZJZ A;  3OEE G;  3FB6 C;  3G4S V;  3LSS A;  1M56 C;  1YTF D;  2FTK A;  3OGC C;  4X8A A;  1AJN A;  4UXN A;  4ASU G;  3B8M A;  5B1B C;  2XOK G;  2M7W A;  2XAS A;  3E83 A;  3RVZ A;  3ZRX A;  1QBZ A;  4JTD B;  1R3K C;  1OCZ C;  1YJ9 V;  4JGS A;  4JAV A;  3LSQ A;  3VOU A;  2PI4 A;  3MHS C;  2W0F C;  4QPJ A;  1RPO A;  1EFR G;  1CPY A;  3FB7 C;  2IU3 A;  1ENV A;  1EZJ A;  2H94 A;  4X88 A;  5EC2 C;  1AI5 A;  2ZXW B;  3ML0 A;  1GO3 F;  2R9I A;  2IJI A;  1SRY A;  3MHH C;  5KA5 A;  2EIN C;  2QTO A;  2UXN A;  3F7V C;  1KD1 W;  2EIL C;  2ATK C;  5L3G A;  2IH1 C;  2Z3Y A;  5H9C A;  4WFA V;  1VQM V;  3I55 V;  1FXK C;  3HPL C;  1MSW D;  3W7W A;  2Q67 A;  4WF9 V;  2LP7 A;  3E89 A;  1OCO C;  4GX0 A;  3WFV A;  4QIW F;  2GSM B;  1NJI W;  3OR6 C;  3JD0 A;  5B1N A;  3CCS V;  2XAJ A;  1R3J C;  2W6I G;  5CBH A;  2WLL B;  2KB1 A;  4G28 B;  3M99 B;  2A9H A;  3ETE A;  3JD1 A;  1XL6 A;  3DTU B;  3AG4 B;  5L3E A;  2H8P C;  2WSS G;  1K3E A;  2Q6A A;  1NBM G;  4YXW G;  1E79 G;  3R65 A;  4U7O A;  5IDJ A;  3BY6 A;  4PDR A;  1PNK A;  1H2G A;  4ZBM A;  5CBF A;  2WLK A;  3W7U A;  3T2M A;  1S77 D;  1W0J G;  3FB5 C;  4GX2 A;  4R50 A;  1RPR A;  1GKF A;  1PD3 A;  2HKO A;  1F4N A;  1VQK V;  4P30 A;  1VQL V;  2QE7 G;  3X2Q B;  3QO8 A;  2DYS B;  4R7C A;  3OE7 G;  1VQ5 V;  4MVS A;  3CPW U;  5LGT A;  3SPJ A;  3CD6 V;  3E8H A;  4RQE A;  4CZZ A;  3CYO A;  3SYC A;  2X6C A;  1QR9 A;  3B77 A;  3SPH A;  4L87 A;  2P67 A;  2QM7 A;  5DN6 G;  4HYO A;  4TSF G;  2DWD C;  1F51 A;  2OCC C;  2ZDI C;  1VQ6 V;  3E35 A;  1WPX A;  4PA6 A;  4RUE A;  5B3S B;  2EIK B;  1JJ2 U;  3HB3 B;  4GX1 A;  3CCE V;  1F4M A;  1K7D A;  1M56 B;  2EIM C;  1M57 C;  2B1G A;  3KG2 A;  1YTF B;  1F23 A;  2NLJ C;  3ABM C;  5B1B B;  3STL C;  2ZQM A;  4I9W A;  1KP2 A;  4G27 B;  4JAS A;  3RBZ A;  4Q20 A;  2B5U A;  3B8N A;  3G6E V;  1NVP D;  5IY5 B;  3TK1 A;  1OCZ B;  1AI7 A;  1P7B A;  5GW7 A;  3ABK B;  1OZ0 A;  2WLI A;  2R9R B;  3K06 A;  3K9A A;  3SPG A;  1XL4 A;  2DQ0 A;  3CCR V;  1JOY A;  1M9N A;  1S5H C;  1K4D C;  1NH2 D;  3CC7 V;  3CCU V;  2EIN B;  4MVQ A;  4FJC C;  5LGU A;  2EIL B;  3ZRS A;  2QA4 V;  4UVA A;  2WLJ A;  2XAH A;  2JEU A;  3OEH G;  1R6K A;  3E8F A;  2BOC C;  1CP9 A;  1YI2 V;  5B1A C;  1S0V A;  3W7T A;  3IC7 A;  4E2L A;  4F4L A;  4UV8 A;  1M90 W;  2A0L A;  3GB7 C;  4R6Z A;  1KQS U;  4MTO A;  2XAF A;  3K3W A;  5CA3 A;  1QCE A;  2JK5 C;  4RAI A;  5L3D A;  3ZMT A;  5L3F A;  5IYD O;  2QEX V;  2NNU A;  3P30 A;  3IFX A;  4XDJ A;  4MW8 A;  3AG2 C;  2W6J G;  1K9M W;  2DYR B;  1BHA A;  4JF3 A;  1K92 A;  2ZR2 A;  4J9Y B;  1G8M A;  3ZN1 A;  1MAB G;  1AR1 B;  2YEV B;  3ABT A;  1VQO V;  4MVR A;  3W7S A;  3OMA B;  1K73 W;  2Q69 A;  4KUM A;  2IU0 A;  1FXH A;  1QR8 A;  1ARO P;  3LDE A;  1Q7Y W;  1AI4 A;  3STZ C;  3QO7 A;  3EHB B;  3CP1 A;  3W7X A;  1R73 A;  1QLN A;  2IJJ A;  1YSC A;  3AG1 C;  1ZWI C;  1FXV A;  2OTL V;  1OCR B;  1QLE C;  1K33 A;  4PDM A;  4WFG A;  1DF4 A;  3FB8 C;  5E1A C;  4PDV A;  1OCC C;  2K1E A;  1Y66 A;  1PNM A;  1S72 V;  1GK9 A;  1V55 C;  4EKW A;  1G4Y B;  1VQ7 V;  4N23 A;  3SYO A;  1QVF U;  1V54 C;  3CCQ V;  1YHQ V;  1SZT A;  1GM7 A;  1BHB A;  4HZ3 A;  4MT8 A;  2WLL A;  3LDC A;  5L3C A;  3F5W C;  3TCU A;  3OR7 C;  4QE7 A;  1I5Y A;  1H8E G;  4R8C A;  3TET A;  1M57 B;  3D36 A;  3DGE A;  1YIJ V;  4WCE V;  3D3I A;  1E1R G;  5B1O A;  3OM3 B;  4JPR A;  3ABM B;  5H6R A;  5KUM A;  1K97 A;  1N8R W;  3LUT B;  5H6Q A;  3ZRW B;  3WG7 B;  3GWO A;  4MTG A;  1NVP B;  1HWY A;  4QNH B;  1K5S A;  3G71 V;  1CEZ A;  4I5S A;  4XBF A;  4WFF A;  3ASN C;  3CME V;  2EBO A;  4FMT A;  3VBB A;  4X89 A;  3FYI B;  1JVM A;  1NH2 B;  4H33 A;  4MTF A;  4QPK A;  3JYC A;  4WFH A;  4P2Z A;  4MTX A;  4RUF A;  1UJW B;  4PA7 A;  1KP3 A;  2OT5 A;  1YJN V;  3OFN G;  2DW4 A;  3ZRV A;  2OTJ V;  2BOB C;  4WFB V;  4MS2 A;  3K79 A;  1EBO A;  2GHY A;  3CXC U;  2A79 B;  3LNM B;  4JYB A;  2YSU B;  3NXS A;  5B1A B;  5BZB A;  3SJQ C;  2EIJ C;  1JX9 A;  2WLN A;  2P90 A;  1DF5 A;  1IXM A;  1Q81 W;  1Q82 W;  2PI5 A;  2ITD C;  4P9O A;  1VQP V;  1S3J A;  3FKS G;  1WLE A;  4MSW C;  4GCZ A;  1PL0 A;  3AG2 B;  5EBM C;  1GMG A;  4MVU A;  4U7N A;  3H01 A;  2ZD9 A;  3MD0 A;  3QO5 A;  2D3O W;  2Y69 C;  5DM6 V;  3CCV V;  3AG3 C;  1LNQ A;  2HLD G;  4HAM A;  1P4R A;  1L1F A;  3X2Q C;  2DYS C;  3LDD A;  3ZMS A;  1AJP A;  2DQ3 A;  1FXK B;  4PA9 A;  2WPD G;  4DXW A;  4KP4 A;  1YJW V;  4PA3 A;  5CMU A;  4MVO A;  3ZN0 A;  3OUF A;  1OCO B;  1I5X A;  1KEC A;  1BMF G;  1QLE B;  2LFS A;  4KFM A;  4N21 A;  4ZKI A;  5LHH A;  1R3I C;  2XAG A;  1OCC B;  3JD2 A;  3P32 A;  3SYA A;  4LBE C;  1VQ9 V;  1MG1 A;  1BL8 A;  1S76 D;  2DWE C;  2AHZ A;  1M1K W;  1THZ A;  2HG5 C;  1VQ4 V;  4UV9 A;  2HVK C;  5B3S C;  2EIK C;  4UVC A;  1V54 B;  3T1C A;  2IJK A;  3E8G A;  1PKX A;  3CC2 V;  4QJF B;  2QM8 A;  2UXX A;  4WFE A;  1AJQ A;  2AHY A;  3K04 A;  5IY5 C;  3ABL C;  3ABK C;  4BW5 A;  5HFL A;  3SYQ A;  2YEV A;  3EFF K;  1SET A;  3PJS K;  3ZMV A;  1ORQ C;  1H8H G;  1E1Q G;  3CCM V;  1FFT B;  3K08 A;  1NR1 A;  4TT3 G;  1NQT A;  2QKS A;  1RM1 C;  1DLB A;  2JJ2 G;  3ASN B;  4MW3 A;  1OHH G;  2CK3 G;  3K0G A;  3I56 V;  1JPX A;  3ASO C;  2JIZ G;  3OAA G;  4LP8 A;  4MVM A;  5C93 A;  3CCJ V;  1GTO A;  2Y48 A;  3E2E A;  4JTC B;  2V1D A;  2HFE C;  3ETG A;  3ZIA G;  3CC4 V;  2B1I A;  3RW0 A;  3ZMZ A;  4DO2 A;  3UKM A;  4LC1 A;  5CN0 A;  5EK0 A;  1J95 A;  3CMA V;  1GM8 A;  1JCH A;  2OCC B;  4XDL A;  4JYC A;  2EZO A;  2X0L A;  2EJR A;  4BIU A;  1ROP A;  1Y4M A;  3QNE A;  2EIM B;  2XND G;  5EBL C;  4GX5 A;  1TUE B;  4Z1M G;  2EIJ B;  4QE9 A;  3SYP A;  2ZDI A;  4RO2 A;  4RQF A;  2DYR C;  2ZXW C;  1VQ8 V;  2X6B A;  1K34 A;  1PNL A;  1COW G;  5LHI A;  1NR7 A;  2JDI G;  3JD3 A;  3SPC A;  3ZRW A;  5KA6 A;  4UUJ C;  1H38 A;  2C2A A;  3RVY A;  2HJF C;  2Y69 B;  2P6J A;  3AG3 B;  2IH3 C;  1B6Q A;  2IJH A;  3OMI B;  2IW5 A;  3K03 A;  5LHG A;  3ZMU A;  2HR3 A;  1OCR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...