3E86A

High resolution crystal structure of the open nak channel pore
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
91
structure length
91
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structure of the open NaK channel
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
molecule keywords Potassium channel protein
total genus 31
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3e86A00
1P7BA 3OGCC 3E83A 4MVUA 4ZBMA 2KB1A 3AG1C 3T4ZA 3F7YC 3KG2A 3OUFA 4LP8A 4G28B 4XDKA 3RVZA 3SYCA 1K4CC 4H33A 4H37A 2ZXWC 3E8HA 1G4YB 4X88A 2DWDC 3WG7C 2WLIB 5EBWC 5B3SC 3SJQC 3SPHA 1OCZC 3OUSA 5EC1C 1M56C 2X6AA 3RBZA 4R6ZA 2WLKA 4WFHA 4P2ZA 1S5HC 2EIKC 2WLLA 3E86A 4MTGA 4PDMA 3T1CA 2W0FC 3F5WC 2NLJC 3T4DA 4RAIA 3TCUA 4PA3A 2R9RB 1QLEC 3LNMB 3OR6C 1XL4A 4XDLA 5IY5C 2HG5C 4CBCA 3FB8C 3AG2C 3STLC 3EFFK 4HYOA 4MTOA 3E8GA 4HZ3A 4R50A 2A9HA 2H8PC 2Y69C 1OCCC 4MW3A 5BZBA 3ASNC 4R8CA 4PA4A 1R3JC 3RW0A 2WLJA 2DYSC 1XL6A 4OXSA 4JTAB 3K0GA 5EBLC 5CBHA 5KUMA 4P30A 3SPGA 3K06A 3FB5C 2HJFC 4MVOA 3AG3C 3R65A 4LCUC 4P9OA 1JVMA 2IH1C 4MVQA 3LUTB 4J9ZB 2HVKC 3JYCA 3LDDA 5CBGA 4X89A 3F7VC 3RVYA 4X8AA 3ASOC 4JTCB 1J95A 4PA6A 3SYOA 1ZWIC 1R3LC 3GB7C 3UM7A 4PA9A 4QE7A 4MSWC 4PA7A 4G27B 2AHZA 4J9YB 4MVMA 3SPJA 3ABLC 4PDRA 4BW5A 4DXWA 3FB6C 4R7CA 3VOUA 4GX2A 4JTDB 3K03A 2X6CA 3LDEA 4QE9A 4UUJC 2ITDC 2WLNA 4PDLA 4GX1A 1R3KC 3SYPA 3T2MA 2Q67A 4KFMA 2EINC 2WLMA 1LNQA 4LBEC 2X6BA 3LDCA 4MVRA 3ZJZA 2IH3C 3E8BA 5B1AC 2DWEC 2WLHA 3UKMA 2EIMC 2Q6AA 1KKDA 3IGAC 4MW8A 1V55C 4GX0A 3E89A 2A79B 4QNHB 2YEVA 1OCOC 1BL8A 4P9PA 3OR7C 1OCRC 4RO2A 3HPLC 5EK0A 3ZRSA 2OCCC 2DYRC 4TWKA 2JK5C 3BEHA 5B1BC 4XDJA 3IFXA 2QTOA 1ORQC 2A0LA 3SYQA 5J9PC 3K0DA 5KUKA 1M57C 3E8FA 3K04A 2Q68A 3SPIA 4WFEA 2ITCC 4F4LA 2WLIA 3FB7C 2HVJC 1R3IC 4PDVA 2BOBC 2HFEC 5EBMC 5E1AC 2Q69A 2AHYA 4RUFA 2QKSA 2BOCC 2EIJC 4GX5A 2K1EA 3ABKC 4RUEA 4MTFA 2EILC 3SYAA 3K08A 3ABMC 4MVZA 3X2QC 5CBFA 2ATKC 3PJSK 3STZC 5EC2C 4I9WA 2WLLB 3SPCA 4MVSA 3TETA 4WFGA 2ZD9A 1V54C 3AG4C 4WFFA 2P7TC 4EKWA 4MS2A 1K4DC
chains in the Genus database with same CATH superfamily
3E83A 3MHSC 4TUYB 5KX5A 1XNRB 1FAFA 5JQGA 5EYPA 1MOFA 4OPHA 1GN2A 2Y69B 3E8HA 3Q4HA 5IWAB 2Q5ZA 3G4SV 2RCVA 3JAMN 1M56C 3K58A 4JI7B 2QM8A 3T1CA 2W0FC 4YJ3B 4PA3A 4JAUA 3CCSV 4FZ1A 4GYCB 2A9HA 2PZSA 2E5LO 4K0KO 4H44B 3ASNC 4NKGB 2DYSC 4I0XA 1D5NA 1AJQA 3ZIAG 2LFSA 3H1JH 2VQFB 5JJNB 5JWPA 1COWG 2XUMA 4JV5O 1IBLB 1QLNA 1CXZB 2QKAA 4LF9B 1N34O 4JZGA 3OMNB 2RQ6A 1V54B 2DWEC 3JALB 3UKMA 2EZOA 2HEPA 4GX0A 3D36A 4JAAA 3TJTA 3I56V 1HWYA 2P90A 4YJ3A 4DV2B 3SJAC 5L3EA 5J9PC 1VMGA 2EINB 2Q68A 2ITCC 4PJ0Z 5LXTB 3DC5A 2EIKB 4A5UB 4JI6O 1ROPA 3CHXA 2NR5A 1JJOA 4B3SB 1PV0A 2BSKB 3OMAB 2F4VO 1MMMA 1KMIZ 4JI0B 4TV9A 1N32O 1V54C 3OAAG 1K4DC 1P7BA 3OGCC 3A8TA 3ABUA 1P49A 4H37A 1SC5B 4UVCA 1QVFU 3K5MA 3D8CA 3QNEA 1VQMV 1H2KA 2UU9O 4TSFG 1SQQH 3H1HH 3QO8A 3E86A 1VF6A 3RGBA 1PNLA 1US6A 2NLJC 1VQOV 4XDLA 1QBZA 2ZR3A 1AB3A 3AG2C 4LR3A 3CRCA 3APQA 5B1BB 1Q8IA 1NS1A 2DYSB 1E1RG 2IU0A 5BZBA 3CCMV 1KECA 2ZE7A 3WU2Z 1GN4A 2YC0A 1URFA 3N27A 5EBLC 3RWRD 4RQEA 1GM7A 3E22B 3CXHF 1SA0B 2PTMA 4KUMA 1N33O 2QM4A 3RYIB 1I5YA 5L3FA 5JH7B 4JZ2A 5CBGA 1XNRO 3BABA 1M56B 1VIBA 1VEWA 1WB7A 4DXWA 1XHXA 3IAYA 2ILMA 3K03A 4JI2O 3CB2A 1AR1B 3OE7G 2GUZB 1J5EO 4I50A 5GTHZ 2QSAA 4D6TH 2HHHO 1QR9A 4O4IA 4C7UA 3IGAC 1B6QA 1OZ0A 1PD3A 4QNHB 1OCOC 1GMGA 3CSXA 5LP6A 3B09A 2GTAA 1F4NA 4TQDA 4JF3A 1WJZA 3JCUZ 2Q7HA 3CJHA 4UB6Z 1BSMA 1TUBA 4LF4B 3JARB 1QCEA 4DR5O 4MTFA 3K08A 3ZRXA 2WA4A 2MK3A 1NH2D 3BRCA 2RNBA 4EKWA 2ZDIA 1O9GA 2QWOB 3AG1C 1BQ0A 1K33A 2ZIOA 1OCOB 1HNWB 4G28B 4CS3A 1SQXH 3OEEG 5H5NA 1GM9A 3U0ZA 4UV8A 3N2KB 1X4TA 2PYJA 1DTOA 4MTGA 1NTZH 4LF9O 3H9VA 1FYJA 3K9AA 4TV9B 1Y74A 4OPAA 5IYBO 4FPPA 4DV4B 2XASA 5KA6A 5L3GA 5FPOA 1XNQB 4J7KA 5KHGA 2KQXA 3O65A 4O2BA 3OT7A 5LXTA 5JJEB 2N04A 2HJFC 4DR4B 2VWJA 4FVMA 3J80N 4PI0A 4IHJA 1KD1W 3I55V 4DV6B 3ASOC 4ZHQA 4JI3O 1R3LC 3UM7A 5IWAO 4PDRA 4U3JB 3BA8A 5LL6Y 4CZZA 2Q0AA 4CS2A 4X1IB 3JD0A 5JVDB 2Q67A 2UXCB 4PELA 2EIMC 3VQWA 2VRZA 2CK3G 2YEVA 4P9PA 1K34A 3HPLC 1IXBA 4TWKA 1VQ5V 3GWKC 1GRJA 2Z3YA 3KKYA 5LHGA 1F7YA 2CGNA 1XI1A 2JGDB 3UT5A 4QJFB 3U10A 3CWBH 1PNKA 2HVJC 3HKDA 5FNVB 2YIBA 1B3QA 1TVKA 4RUFA 3BCCH 1FFXB 2JJ2G 4DK1A 2YXLA 5HFLA 3RYFB 4CC6A 5D5PA 2JS5A 2QWNB 2JGDA 3G71V 4XDKA 1EZVH 2JDIG 3JASA 1NZ6A 3RFRA 1FFXA 2QDOA 1KQSU 2WLKA 2XT9A 4O4HA 1ZSPA 3HKBB 2Y48A 1EN6A 2XAGA 4B3MB 4YXWG 2M6YA 5DECA 2PF4E 1XL4A 2DE0X 4O4LB 2DYRB 3OMIB 4BAYA 1F4MA 2N74A 5F2VO 4JASA 4JI2B 3SJCC 1TAEA 1OCCB 3FYEB 3G67A 3QO5A 1JPXA 3K06A 4LF8O 4I4TB 3R65A 2AW9A 4NVPA 2QEXV 4WFAV 5C8YB 1AR5A 1BCCH 1HNZO 3K5OA 3ZJZA 4B3RO 4PA9A 1XMQO 2UUAO 5LYJB 2LW1A 2YI9A 2BTQA 4BR6A 5LGNA 5FPRA 3LDEA 3L71H 1K5QA 1XMOO 4GX1A 3SYPA 2OT5A 3N2KA 4LF7O 5KHJA 4Z1VA 2BSKA 3CCVV 2FTKA 2EX3A 5H6RA 4FLXA 1OCRC 1XMQB 3ZMZA 4X64O 1YEWA 3DXRA 3CRAA 1VF7A 2K1EA 3TXSA 3JSNA 5K1PA 5CN0A 3SDLA 4JI1O 2P22C 3TETA 4WFGA 2CTQA 3FFQA 3AG4C 3RVZA 4IT5A 1GM8A 4MVUA 4UVBA 3J7AU 2ZR2A 1ZL8A 1RPRA 3KG2A 3SYCA 5KA5A 4TV8B 1GKFA 3ZRVA 2UXDO 2ZXWC 5IDJA 4I0XB 1N4CA 4XBFA 3JAKB 4UCSA 4DV5O 4I50B 1BHBA 3CMEV 2ZT9B 4TQFA 5BY1A 3E22A 1YJWV 1BZKA 2QKCA 2EJ7A 3T4DA 4BIUA 3TCUA 4LFAO 2QWPB 3ZMVA 1MZFA 3EFFK 4QPKA 1VF5B 5K1XA 4JPRA 1Q6IA 3CP1A 4X66B 2H94A 1XDCA 2EULA 5HFMA 1BE3H 1CEZA 2B1GA 5CBHA 1GN3A 3CYOA 3N2GB 5CA3A 3JD3A 5IY5B 4JGSA 2OWOA 3M7MX 1X59A 3TK1A 1R6TA 3K5LA 3F7VC 1HR0O 3VBBA 1QVGU 4UVAA 2YDEA 2D3OW 2B5UA 1KBHA 4BWAA 3L73H 2AHZA 2B9ZA 2UXXA 4BW5A 3VOUA 1AI5A 4FFBA 4U3JA 3J81N 1Q3EA 4KFMA 1LR1A 5DM6V 1H2MA 2WAMA 1R6KA 2R72A 3ZHRA 3D3QA 1V55C 1MNGA 5A2QN 3OR7C 4FJCC 4LFBB 3IFXA 2R70A 1I7FA 5B66Z 5B1OA 2XAJA 2WLIA 3FB7C 4FLWA 5LMUB 1BQZA 4BW9A 1M57B 2UUCB 2XAQA 4RUEA 3ASOB 3JALA 4W4LA 3X2QC 4DW0A 3FD9A 4LH6A 5KLVH 4H0LB 2LGWA 3BAAA 3T2MA 1N36B 4YJ2A 2QGNA 4LF6B 4FM1A 2YI8A 4GKJO 1PPJH 1GO3F 2JJ1G 4AQYO 3ZHQA 1K92A 2HKOA 3L70H 4DUYO 1RM1B 1KYOF 2ETNA 3BVOA 3JAWB 1HNXB 4TV8A 1L1FA 5KAFZ 1ZL8B 4DV0O 5GONB 2CTPA 2WA3A 4LF8B 4P30A 1Q7YW 1I0HA 1Q43A 2QE7G 1NI8A 1JVMA 3MD0A 4UV9A 3EVKA 4NTWA 5CA1A 3RYCB 4NXNO 3LDDA 4NR1A 2A3QA 4EB6A 1AP5A 4GKKO 2Y0IA 4J7ZA 4LNUB 4JI8O 2JS3A 5GONA 1SZXA 2LW7A 4J10A 1J5EB 1M1KW 4LF4O 2A7WA 3FAVB 4LF5B 1MA1A 1VP7A 4J11A 1IXMA 5H2FZ 2OTLV 1UPGA 4FLZA 4OGQB 1MSWD 2Y4UA 3DXRB 1L8DA 4WFBV 4DR5B 2Q7EA 3ABKC 1H2SB 2YIAA 4DV5B 4DYLA 1S5LZ 3F5TA 4QGPA 3IC7A 1Q6UA 3NXSA 3WFVA 1IBMB 5C93A 5JQGB 2CGOA 2LGQA 5J2UB 1H2LA 3QO7A 1GN6A 3QVNA 2FB5A 1VQNV 3N2GA 5IT9N 1RFYA 2G38A 2WLIB 3OD4A 2V1DA 3SJQC 4I55B 1IBKB 1AROP 1PM9A 4DR3B 2GHYA 5B5EZ 5BMVB 2IBZH 1FXHA 2UXNA 4O4HB 1S3JA 3QG5A 1SRYA 1K9MW 1AI6A 1YF2A 1SF9A 1PL4A 3BPZA 1R1BA 2ZKOA 4CS4A 1DK1A 1YIJV 4PA4A 3HKEB 4I7ZB 1EN4A 3B77A 4OXSA 3GWOA 2Q8VA 4J80A 2CE4A 2N05A 1AP6A 4KHPB 3ZHSA 4X89A 1ZWIC 4FLVA 4QE7A 3UQ8A 4G27B 3CRQA 1N0JA 1E1QG 2Q7GA 3K9SA 5IYZB 2QJ1A 3UT5B 1NU1H 4DR6O 2PUSA 5JCOC 2ZM6B 4UUJC 1H8EG 3CCQV 5JVDA 1K7DA 1WP8A 3CEIA 1N34B 1FD9A 3ABTA 3ML0A 4FLYA 2OCCC 2P5OA 3ZMUA 4JI3B 4JI0O 2E3CA 5KUKA 5L3CA 2GSMB 5CA0A 1YJNV 1QQCA 4RWUA 4DR2O 4TUYA 5KX5B 4DUZB 3HKDB 4O2BB 3UCSC 4HNAB 1Q81W 2EILC 1HR0B 2F66C 3MAQA 4IHJB 2JEUA 3RT3C 2CAZC 4I9WA 3CCEV 2CTWA 1W0JG 2ZD9A 4YY3O 1KU9A 1S76D 5ITZB 5IJ0A 2OIEA 3CCJV 3JATA 4W4KA 1YJ9V 2HJDA 3E35A 5EZYB 1U97A 4QPJA 4O4JB 3SGIA 3CMAV 3H01A 2QR4A 1SQBH 2IJHA 2DW4A 2CUGA 1WP7A 5EIBC 1SQGA 2X0LA 3T1YO 3RN4A 3E8GA 2R9AA 4PV1B 3L75H 4IL6Z 4DR1B 2P4KA 1D2DA 4MW3A 3OTOB 1Y6XA 4R8CA 1I5XA 3QTCA 1OHHG 5KUMA 3SPGA 4X20A 2LO1A 5AG2A 1TGOA 4O4JA 4P9OA 4FM2A 1Y74B 4B08A 3FKSG 5LBQA 2ZNIA 2AGAA 3P32A 3GB7C 4MSWC 3BY6A 3FB6C 2KG7B 2GBOA 4Z1MG 4G2KA 2F1MA 1GTOA 4DR4O 2IH3C 1TUEB 2Q6AA 4LFCB 1KKDA 4LWSA 4CC5A 3OEHG 2EILB 3K3WA 2QTOA 3SYQA 5LGUA 1XMOB 3CS5A 4IYHA 5LMUO 3JASB 4GX5A 2D2CB 1B04A 2CH7B 3A0RA 4B3TB 2DOSA 5LHIA 2YEVB 4UXNA 4LF5O 4FM0A 3SPCA 5LOVA 4X9QA 3HB3B 2LP7A 5LA6B 4YIPA 3T1HB 1WPBA 1BHAA 2FYUH 3ZHTA 2GUZA 4X1IA 5E79Z 3JAKA 3ZHUA 2IM9A 3ABKB 2M7WA 3OUSA 1T5EA 1FFTB 4F6EA 3H1LH 4JYYA 4WF9V 1FKAO 2R9RB 3B8MA 5JH7A 2HG5C 3K5NA 3AK2A 4HYOA 1GAXA 4O2AB 2UXDB 2GDSA 2WWWA 5ITZA 4X1YA 4X1YB 1WA8B 1F23A 1VQ9V 1VF6C 4JYAB 3P3NA 2ADPA 4JI7O 2Q0OC 4IIJB 4U7OA 4JI5B 3C3TA 3BA9A 3A0BZ 2RN9A 1J95A 4QIWF 1AJNA 1FJGB 1QLEB 1JFFA 1TA8A 2X6CA 3K59A 3ZHVA 5GW7A 1N0NA 4I4TA 2RMKB 3LSQA 5J2TB 4WBNA 1HW7A 1VQKV 4DR7O 5EK0A 3ZRSA 5LP6B 2AZ2A 4XDJA 1MSDA 1ORQC 5IJ0B 2XAFA 3ETDA 1R6NA 2P4VA 3AK3A 1RPOA 4J42A 3IC9A 1R73A 1I08A 3CX5F 1K73W 1BS3A 3W7UA 1YDXA 1H38A 3OW2U 2DQ0A 1HNZB 4H13B 3SYAA 2BE3A 5LP6C 2E74B 5CBFA 4JYAO 1Q86W 1YI2V 4LWSB 5LOVB 5IYZA 1IBMO 1S77D 3UO3A 3RYFA 1IX9A 1JOYA 2CDYA 2KG7A 1UJWB 2XNDG 3AG7A 4ICGA 3SPHA 5D5QA 1OCZC 2X6AA 4JAVA 2NNUA 4FLUA 4WFHA 1A32A 4PI2A 3ETQA 3CRRA 2QTSA 3ICXA 4B3MO 4B7KA 4RAIA 4LC1A 2O57A 3LNMB 3RYIA 4PHZA 4BIOA 4BIZA 2YIBD 4FFKA 4KP4A 2RJZA 3TXQA 4OX9O 4MT8A 5H9CA 1G6UA 3JAWA 2ARHA 4K8XA 1YITV 3EHBB 3ETEA 1TVKB 3FB5C 2LQTA 4K3AA 1VQLV 2IH1C 4MVQA 3M8AA 2P67A 4JI4O 3RVYA 4X8AA 4JTCB 1KC8W 4OX9B 5LMNO 4ZHQB 4R7CA 1M90W 3Q4HB 1WN7A 1LUVA 1K3EA 2ITDC 1SQFA 1R3KC 3QF7A 2EINC 2X6BA 3LDCA 4X1KA 2JRIA 3P3PA 5CB4A 3NR7A 1QNMA 4B7EA 4JI1B 2Y0PA 3IJ4A 3ZCCA 1HNXO 1H2GA 2E5LB 1FXKA 3WB2A 3T1HO 3AG2B 3K0DA 2BTOA 3SPIA 1KKCA 4GUNA 2V4DA 4PDVA 5TISZ 4I9QA 2AHYA 1NQTA 3JARA 1IURA 1WA8A 2BOCC 3DC6A 4DV6O 4DR7B 2R9IA 4EFEA 3B2EE 3STZC 1M5IA 5KHIA 1IVSA 1WPXA 2HLDG 3ETGA 3T1YB 1NVPB 1YSCA 4FZ0A 2VQEB 3ASNB 2VQEO 1DGSA 1JR9A 1HNWO 5LMNB 1G4YB 1HP8A 4J7JA 1SETA 1GH6A 4DR3O 5EC1C 3KZIZ 4YIOA 4R6ZA 1IBKO 4Q6GA 1MABG 2EIKC 2WLLA 2QM7A 2L35A 2LJ2A 2L6LA 4DV3B 4NXMB 5KAIZ 3WG7B 1BGYH 1ZUQA 3VQVA 1OCRB 2Y69C 4DW1A 4KXRA 3HKEA 3E2EA 1AILA 4DV1O 3AG3B 1TUBB 4AILC 1W0KG 1W2BU 2IW5A 4DO2A 1RSOB 4JI4B 1JX9A 3ABMB 2F43G 1DLBA 4NTXA 2Q4PA 4J41A 3P30A 2DQ3A 1Q82W 1P84F 1CP9A 3CC2V 2WLMA 2DMXA 2OTJV 4DV4O 5BMVA 2OIGA 2YXYA 1AI4A 2A79B 1F51A 3O9OA 1FXKB 2YICA 4D7TA 2DYRC 3BEHA 4GKKB 2GV9A 3GVMA 3B8NA 4ZIBA 3S3XA 3K04A 5BR8B 4JV5B 1XOUA 1R3IC 2ZQMA 4FMTA 1Y67A 5EBMC 4GKJB 2H3OA 1L0NH 2FL4A 2OCCB 1QHTA 2ATKC 2ZNJA 1Q90D 1M9NA 3WB1A 4ZOLB 2YS8A 3A0HZ 4PD4F 1Y76A 1ZX3A 3CCLV 3AEIA 3F7YC 5IYDO 4X88A 5B3SC 1IZ3A 4EEQA 4P2ZA 2Z5UA 2PY5A 5CA1B 3LNNA 1YXBA 1PL0A 2E75B 1QLEC 4AI8A 3D36C 2W6IG 4YHHO 4E4EA 4MTOA 2ODMA 4X62O 1SQVH 4O4LA 2V7QG 1OCCC 3G80A 3OTOO 2JGUA 2WLJA 2EIMB 5GTIZ 4JTAB 2ZE8A 4DRXA 2PI4A 4FK5C 3BFRA 5DEDA 3FX7A 2UUCO 4N21A 4CH6A 4JYBA 2W6JG 1ZLZA 2YXHA 2ZIMA 1H2NA 1NR1A 4DR1O 1PNMA 2WSSG 3SYOA 2ADQB 2XTAA 3ABLC 4JTDB 2YSUB 3HR0A 5BR8O 4YY3B 4GZRB 1K5SA 4KL1A 4UCVA 2UXBB 5B1AC 2EBOA 3EXAA 5B3SB 1XBLA 1ZAUA 4MW8A 3RYCA 3E89A 1I94O 4GCZA 3OFNG 2QWRB 1FS0G 2ZE6A 3CRMA 3ZN1A 1EBOA 5B1AB 2VS0A 4ABMA 1IBLO 5FL7G 3BHPA 4YJ2B 2BTQB 2ZINA 4LH7A 1Y4MA 3RYHB 3B4SA 4GT1A 4ZI7B 4DK0A 1NTMH 5BXZA 4D7SA 2IJJA 4UCRA 2P06A 3AG1B 2PYLA 3S3WA 1JFFB 1JMKC 3T4ZA 4DUYB 3SR2C 1FPOA 4K0KB 1BT8A 3A2FA 3CCRV 1VQ8V 3ZBHA 1O9HA 1MZEA 5CMUA 2EJRA 1YCIA 1G1XB 3OGIB 4IIJA 5CB4B 1XHZA 1SERA 3D3IA 4KHPO 3C90A 5C8YA 4L87A 4CBCA 3U11A 5EIBD 1PP9H 1FXVA 1SESA 1Z5VA 4O2AA 4DV7B 1XILA 4UCTA 4IYIA 2QWQB 4WCEV 1RP3B 1RM1C 4X1KB 3AG3C 4AHCA 4J9ZB 2PI5A 1Y66A 1N33B 5LA6A 4X62B 3L74H 3VQXA 1NT2B 3OTFA 4GX2A 1Q5OA 4UB8Z 1Z2GA 5IYCO 4QE9A 1KP2A 4MVRA 4LBEC 1VQ6V 4LNUA 4NTYA 4O4IB 4F6RA 3E8BA 2CH7A 2WLHA 3HKBA 3ZRWA 1AR4A 4EFBA 3ZRWB 4ASUG 3H1KH 2IJKA 1YVWA 1BL8A 2UU9B 5B1BC 5IJ9B 5LGTA 1M57C 3E8FA 4WFEA 1IDSA 3HKCB 3KCXA 2F93B 4ZKIA 1SKVA 3DGEA 1JQ0A 1SA0A 4LF7B 4U3FH 4WBNB 2UXBO 1NH2B 2B1IA 4DV1B 2F4VB 2YIDA 2WLLB 4MVSA 5LHHA 3THOA 4HAMA 4JI8B 3UO2A 2PGGA 1HDJA 3OUFA 3LSSA 4X65B 1K4CC 3R66A 4H33A 3I5DA 2UUBB 2DWDC 3WB0A 3WG7C 5EBWC 5L3BA 5FLXN 2E76B 3C3SA 3JSLA 5IY5C 4LFCO 3FB8C 2LFRA 1MG1A 1P4RA 2FKXA 4R50A 4L8JA 5LYJA 2CTRA 1R3JC 1VARA 3K0GA 5KMGA 3JATB 1VQ7V 5J2TA 3SJBC 3MHHC 4MVOA 3H1IH 1YHQV 3LSUA 3MDSA 4IGGA 1S0VA 3JYCA 3OM3B 1P7GA 3ZS8C 1M4UA 3FAVA 4B3TO 4YHHB 4PA6A 1VQ4V 4PA7A 4J9YB 2X7RB 4X64B 3KCYA 3TGUH 1NKDA 2ZXWB 2EZPA 1XREA 4DR6B 2WLNA 3APOA 3ZX6A 1YTFD 2Y4TA 1AI7A 4K35A 3DSQA 5EZYA 1OCZB 3JD4A 1XQ8A 3AG4B 1H8HG 2F23A 4Z2WA 2AZ0A 4CH4A 4FLTA 3FYIB 2UUAB 4B3RB 1N36O 5CA0B 1NR7A 3CXCU 1SQPH 4F4LA 3CC4V 3HKCA 2F95B 5JJJB 1M93A 5E1AC 4HNAA 1QR8A 3DTUB 2W0XA 3M99B 4N23A 3PJSK 1NJIW 2OYQA 4UFZA 4Q20A 2P7TC 3K79A 1Q6HA 5KHHA 1V9PA 4LP8A 1JJ2U 1D5AA 3RBZA 1S5JA 2XOKG 1S5HC 2K9PA 2P6JA 2AXTZ 2RDCA 2ZCEA 3L72H 3STLC 1S72V 4HZ3A 1OJHA 3W7SA 2H8PC 1CPYA 5FNVA 1AVMA 4X66O 3RW0A 3JD2A 2HR3A 3G6BA 4X20B 2HHHB 1JCHA 1EFRG 2KSDA 4ZOLA 4LFAB 3LUTB 4NB5A 2MW2B 2Z0AA 4NYKA 3CE2A 4TT3G 2JIZG 1WNSA 3SPJA 5H6QA 1THZA 5JCOA 2WPDG 4DV0B 1EM1A 1UFIA 4PDLA 4LF6O 4DR2B 1G8MA 4FFBB 2GTSA 1XEQA 3W7TA 5KHKA 4NXNB 1OV9A 1KB9F 5L3DA 1DF4A 4RQFA 1RSOA 4FIPC 1YTFB 1NTKH 2EIJB 1PKXA 1ENVA 1JA8A 1VQPV 1XUQA 2NN4A 2ZM6O 3CJHB 1W59A 2C2AA 4JI5O 3X2QB 2BOBC 2HFEC 2A06H 5KMGB 2Q69A 1NBMG 3ZEDA 2UXCO 2QKSA 2JVDA 4ZI7A 2JEXA 4MVZA 1WAZA 5EC2C 4AQYB 4EB6B 4CH5A 2QA4V 4WFFA 4MS2A 1N32B 2XHBA 1XNQO 4ZBMA 4NXMO 1SS3A 4HBNA 1L0LH 1LUWA 2KB1A 2IU3A 1EN5A 4E2LA 2HP8A 5DN6G 2UUBO 1B06A 1NVPD 3CD6V 1V55B 4X65O 2ZDIC 2Q9LA 4B3SO 3RYHA 4F6RB 3B40A 2ZE5A 4UCUA 1EZJA 1SZTA 1ZTEA 4LFBO 1K97A 4PDMA 3F5WC 4CH3A 4TOIA 5A9GA 3OR6C 2DJVA 2OCHA 1KP3A 5B1NA 1Z5WA 2YUAA 3G6EV 4MTXA 4GLXA 1XL6A 2XAHA 1E79G 1K8AW 4DRXB 1GK9A 2DN9A 4LCUC 1WB8A 1WLEA 4JI6B 2FMLA 2HVKC 1U96A 4UCOA 1N8RW 5IJ9A 1Y76B 3ABLB 1AJPA 2VQFO 3VQYA 5EYPB 3K57A 4MVMA 4JYCA 1BMFG 3L9DA 4DUZO 3CC7V 1LNQA 4I55A 1KUQA 1QU7A 1FXKC 1I94B 3AK1A 4RO2A 5J2UA 2JK5C 4DV2O 2A0LA 3W7WA 3ZMTA 4DV3O 1YZBA 2BCCH 3W7XA 1DF5A 3CPWU 4DV7O 3CCUV 5IE9A 2EIJC 2VWKA 3JD1A 4U7NA 3ZMSA 3ABMC 2Q73A 3ZN0A 4I5SA 3JCZA 1FJGO 2IJIA 3PN1A 4K8ZA 2KKWA
chains in the Genus database with same CATH topology
1GM8A 4MVUA 3E83A 3MHSC 4UVBA 2ZR2A 3T4ZA 1RPRA 1BHAA 1MOFA 3KG2A 3SYCA 5KA5A 1GKFA 3ZRVA 2ZXWC 2Y69B 5IDJA 3E8HA 3CCRV 1VQ8V 4XBFA 3G4SV 3ABKB 2M7WA 3OUSA 1BHBA 3CMEV 1M56C 5CMUA 2EJRA 2QM8A 1FFTB 1YJWV 3T1CA 3D3IA 2W0FC 1SERA 3T4DA 4WF9V 4BIUA 3TCUA 4PA3A 2R9RB 3B8MA 4JAUA 2HG5C 4L87A 3CCSV 4CBCA 3ZMVA 3EFFK 4HYOA 4QPKA 1FXVA 2A9HA 1SESA 4JPRA 2WWWA 3CP1A 2H94A 5HFMA 3ASNC 4WCEV 2DYSC 1CEZA 1F23A 2B1GA 1VQ9V 5CBHA 3CYOA 5CA3A 1RM1C 4U7OA 3JD3A 3AG3C 5IY5B 1AJQA 4JGSA 4J9ZB 2PI5A 1Y66A 3ZIAG 3TK1A 2LFSA 3F7VC 3VBBA 1J95A 4UVAA 4QIWF 2D3OW 2B5UA 1QVGU 1AJNA 2AHZA 2UXXA 4BW5A 3VOUA 1QLEB 4GX2A 1AI5A 1COWG 5IYCO 2X6CA 4QE9A 1QLNA 1KP2A 5GW7A 4KFMA 4LBEC 4MVRA 1VQ6V 5DM6V 3OMNB 3E8BA 1V54B 2DWEC 3LSQA 2WLHA 3UKMA 2WAMA 1R6KA 2EZOA 3ZRWA 1V55C 4GX0A 3ZRWB 3D36A 4ASUG 1VQKV 2IJKA 1BL8A 3OR7C 3I56V 5EK0A 3ZRSA 1HWYA 2P90A 4FJCC 5B1BC 4XDJA 3IFXA 5LGTA 5L3EA 1ORQC 5J9PC 2EINB 1M57C 3E8FA 2XAFA 2Q68A 3ETDA 2ITCC 1R6NA 4WFEA 5B1OA 1RPOA 3FB7C 2WLIA 2XAJA 1R73A 2EIKB 1K73W 4ZKIA 3W7UA 1M57B 3DGEA 1JQ0A 1ROPA 1H38A 2XAQA 4RUEA 3OW2U 2DQ0A 1NH2B 2B1IA 3ASOB 3SYAA 3X2QC 5CBFA 1Q86W 3OMAB 1YI2V 2WLLB 4MVSA 5LHHA 1V54C 3OAAG 3T2MA 4HAMA 1K4DC 1S77D 1P7BA 3OGCC 1JOYA 3ABUA 3OUFA 3LSSA 1K4CC 4H33A 4H37A 2DWDC 4UVCA 1QVFU 3WG7C 2XNDG 5EBWC 1UJWB 3QNEA 3SPHA 1OCZC 1VQMV 1GO3F 2JJ1G 5L3BA 2X6AA 4JAVA 2NNUA 4TSFG 4WFHA 3QO8A 3E86A 1K92A 2HKOA 1PNLA 2NLJC 1VQOV 4RAIA 4LC1A 3LNMB 4XDLA 5IY5C 1QBZA 4BIZA 2ZR3A 3FB8C 2LFRA 3AG2C 1RM1B 4KP4A 1MG1A 1P4RA 4R50A 5B1BB 4MT8A 5H9CA 1L1FA 2DYSB 1E1RG 3EHBB 2IU0A 3ETEA 5BZBA 3CCMV 1YITV 1R3JC 1KECA 3K0GA 5EBLC 4P30A 4RQEA 3FB5C 1Q7YW 1VQ7V 1GM7A 2QE7G 1VQLV 3MHHC 4MVOA 1JVMA 2IH1C 4KUMA 3MD0A 4MVQA 4UV9A 1YHQV 1I5YA 5L3FA 2P67A 1S0VA 3JYCA 3LDDA 3OM3B 5CBGA 3RVYA 4X8AA 4JTCB 1KC8W 1M56B 4PA6A 1VQ4V 4PA7A 4J9YB 4DXWA 2X7RB 4R7CA 1NKDA 2ZXWB 2EZPA 3K03A 1M90W 1AR1B 2ITDC 1K3EA 2WLNA 3OE7G 1YTFD 1R3KC 2EINC 1AI7A 2X6BA 3LDCA 1QR9A 1OCZB 3JD4A 3AG4B 1M1KW 1H8HG 3IGAC 1B6QA 1OZ0A 1PD3A 4QNHB 1OCOC 3ZCCA 1GMGA 3FYIB 1H2GA 1FXKA 1F4NA 1IXMA 3AG2B 3K0DA 2OTLV 4JF3A 1NR7A 3SPIA 3CXCU 4F4LA 3CC4V 1MSWD 4PDVA 5E1AC 2AHYA 1NQTA 4WFBV 2BOCC 1QCEA 3ABKC 4MTFA 1QR8A 3DTUB 3K08A 3ZRXA 3M99B 2R9IA 4N23A 3PJSK 3STZC 2MK3A 1NJIW 1NH2D 1WPXA 3IC7A 3NXSA 3WFVA 2HLDG 4EKWA 4Q20A 2P7TC 3K79A 5C93A 3ETGA 2ZDIA 1YSCA 1NVPB 3AG1C 3QO7A 1K33A 1OCOB 4LP8A 4G28B 3ASNB 1JJ2U 1VQNV 3OEEG 1G4YB 1GM9A 1SETA 2WLIB 4UV8A 2V1DA 3SJQC 5EC1C 1AROP 3RBZA 4R6ZA 2GHYA 2XOKG 1MABG 1DTOA 1S5HC 2EIKC 1FXHA 2QM7A 2WLLA 2UXNA 4MTGA 2P6JA 3K9AA 1S3JA 1SRYA 5IYBO 4FPPA 2XASA 1K9MW 5KA6A 3STLC 5L3GA 1S72V 1AI6A 4HZ3A 3WG7B 1YIJV 3W7SA 2H8PC 1CPYA 1OCRB 2Y69C 3E2EA 4PA4A 3RW0A 3B77A 3JD2A 4OXSA 3AG3B 2HR3A 3GWOA 2HJFC 1JCHA 1W0KG 1EFRG 1W2BU 2IW5A 4DO2A 3LUTB 1KD1W 3I55V 4X89A 1JX9A 3ABMB 2F43G 3ASOC 1DLBA 4TT3G 1R3LC 1ZWIC 2JIZG 3UM7A 4QE7A 4G27B 3SPJA 5H6QA 1E1QG 4PDRA 1THZA 2WPDG 4CZZA 3P30A 2DQ3A 1Q82W 3JD0A 4UUJC 1H8EG 4PDLA 3CCQV 1CP9A 3CC2V 1K7DA 1G8MA 2Q67A 2WLMA 4PELA 3W7TA 3ABTA 2OTJV 3ML0A 2EIMC 1AI4A 2A79B 2CK3G 1F51A 5L3DA 2YEVA 4P9PA 1K34A 1DF4A 1FXKB 3HPLC 4FIPC 4RQFA 2OCCC 1YTFB 2DYRC 4TWKA 1VQ5V 3ZMUA 3BEHA 2Z3YA 2EIJB 5LHGA 1PKXA 3B8NA 1ENVA 5KUKA 1VQPV 5L3CA 2GSMB 3K04A 1YJNV 4QJFB 1PNKA 2C2AA 2HVJC 1R3IC 2ZQMA 2BOBC 2HFEC 4FMTA 3X2QB 5EBMC 2Q69A 4RUFA 1NBMG 2QKSA 1Q81W 2JEXA 2EILC 2OCCB 4MVZA 2JJ2G 2ATKC 2JEUA 5EC2C 1M9NA 4I9WA 3CCEV 5HFLA 1W0JG 2ZD9A 2QA4V 4WFFA 3CCLV 4MS2A 4ZBMA 2KB1A 2IU3A 3AEIA 4E2LA 1S76D 5DN6G 3G71V 3F7YC 4XDKA 1NVPD 3CD6V 1V55B 3CCJV 2ZDIC 5IYDO 2JDIG 4X88A 1YJ9V 3E35A 5B3SC 4QPJA 1EZJA 1KQSU 2WLKA 3CMAV 3H01A 4P2ZA 1SZTA 2Z5UA 2Y48A 1K97A 4PDMA 3F5WC 2XAGA 4YXWG 2IJHA 2DW4A 1PL0A 3OR6C 1QLEC 1XL4A 1KP3A 2W6IG 5B1NA 2X0LA 4MTOA 3E8GA 2DYRB 3OMIB 3G6EV 2V7QG 1F4MA 4MTXA 4BAYA 4MW3A 1OCCC 4JASA 4R8CA 3FYEB 1OCCB 2WLJA 1XL6A 1I5XA 2XAHA 2EIMB 1E79G 3QO5A 4JTAB 1OHHG 1K8AW 1JPXA 5KUMA 3SPGA 1GK9A 3K06A 2PI4A 4FK5C 3R65A 4LCUC 4P9OA 2QEXV 4WFAV 1WLEA 4N21A 2HVKC 2W6JG 4JYBA 1N8RW 3FKSG 3ABLB 1AJPA 1NR1A 5LBQA 1PNMA 2WSSG 3SYOA 3P32A 3ZJZA 3GB7C 4PA9A 4MSWC 4MVMA 4JYCA 3ABLC 3BY6A 3FB6C 5LGNA 4JTDB 1BMFG 3LDEA 1K5QA 2YSUB 3CC7V 4Z1MG 4G2KA 4GX1A 3SYPA 2OT5A 1K5SA 1LNQA 1GTOA 2IH3C 5B1AC 3CCVV 2EBOA 5B3SB 1TUEB 2FTKA 2Q6AA 1KKDA 1FXKC 4MW8A 3E89A 5H6RA 4GCZA 3OFNG 4RO2A 1OCRC 3OEHG 1FS0G 3ZMZA 2EILB 3ZN1A 2JK5C 1EBOA 5B1AB 3K3WA 2QTOA 2A0LA 3SYQA 3W7WA 5LGUA 5FL7G 3ZMTA 3W7XA 1DF5A 1Y4MA 3CPWU 4GT1A 3CCUV 4GX5A 2EIJC 2K1EA 3JD1A 4U7NA 3ZMSA 3ABMC 5CN0A 3A0RA 5LHIA 2YEVB 4UXNA 3ZN0A 4I5SA 3SPCA 3JCZA 2IJJA 3TETA 3AG1B 4WFGA 3HB3B 2IJIA 2LP7A 3AG4C 3RVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P7B A;  3OGC C;  3E83 A;  4MVU A;  4ZBM A;  2KB1 A;  3AG1 C;  3T4Z A;  3F7Y C;  3KG2 A;  3OUF A;  4LP8 A;  4G28 B;  4XDK A;  3RVZ A;  3SYC A;  1K4C C;  4H33 A;  4H37 A;  2ZXW C;  3E8H A;  1G4Y B;  4X88 A;  2DWD C;  3WG7 C;  2WLI B;  5EBW C;  5B3S C;  3SJQ C;  3SPH A;  1OCZ C;  3OUS A;  5EC1 C;  1M56 C;  2X6A A;  3RBZ A;  4R6Z A;  2WLK A;  4WFH A;  4P2Z A;  1S5H C;  2EIK C;  2WLL A;  3E86 A;  4MTG A;  4PDM A;  3T1C A;  2W0F C;  3F5W C;  2NLJ C;  3T4D A;  4RAI A;  3TCU A;  4PA3 A;  2R9R B;  1QLE C;  3LNM B;  3OR6 C;  1XL4 A;  4XDL A;  5IY5 C;  2HG5 C;  4CBC A;  3FB8 C;  3AG2 C;  3STL C;  3EFF K;  4HYO A;  4MTO A;  3E8G A;  4HZ3 A;  4R50 A;  2A9H A;  2H8P C;  2Y69 C;  1OCC C;  4MW3 A;  5BZB A;  3ASN C;  4R8C A;  4PA4 A;  1R3J C;  3RW0 A;  2WLJ A;  2DYS C;  1XL6 A;  4OXS A;  4JTA B;  3K0G A;  5EBL C;  5CBH A;  5KUM A;  4P30 A;  3SPG A;  3K06 A;  3FB5 C;  2HJF C;  4MVO A;  3AG3 C;  3R65 A;  4LCU C;  4P9O A;  1JVM A;  2IH1 C;  4MVQ A;  3LUT B;  4J9Z B;  2HVK C;  3JYC A;  3LDD A;  5CBG A;  4X89 A;  3F7V C;  3RVY A;  4X8A A;  3ASO C;  4JTC B;  1J95 A;  4PA6 A;  3SYO A;  1ZWI C;  1R3L C;  3GB7 C;  3UM7 A;  4PA9 A;  4QE7 A;  4MSW C;  4PA7 A;  4G27 B;  2AHZ A;  4J9Y B;  4MVM A;  3SPJ A;  3ABL C;  4PDR A;  4BW5 A;  4DXW A;  3FB6 C;  4R7C A;  3VOU A;  4GX2 A;  4JTD B;  3K03 A;  2X6C A;  3LDE A;  4QE9 A;  4UUJ C;  2ITD C;  2WLN A;  4PDL A;  4GX1 A;  1R3K C;  3SYP A;  3T2M A;  2Q67 A;  4KFM A;  2EIN C;  2WLM A;  1LNQ A;  4LBE C;  2X6B A;  3LDC A;  4MVR A;  3ZJZ A;  2IH3 C;  3E8B A;  5B1A C;  2DWE C;  2WLH A;  3UKM A;  2EIM C;  2Q6A A;  1KKD A;  3IGA C;  4MW8 A;  1V55 C;  4GX0 A;  3E89 A;  2A79 B;  4QNH B;  2YEV A;  1OCO C;  1BL8 A;  4P9P A;  3OR7 C;  1OCR C;  4RO2 A;  3HPL C;  5EK0 A;  3ZRS A;  2OCC C;  2DYR C;  4TWK A;  2JK5 C;  3BEH A;  5B1B C;  4XDJ A;  3IFX A;  2QTO A;  1ORQ C;  2A0L A;  3SYQ A;  5J9P C;  3K0D A;  5KUK A;  1M57 C;  3E8F A;  3K04 A;  2Q68 A;  3SPI A;  4WFE A;  2ITC C;  4F4L A;  2WLI A;  3FB7 C;  2HVJ C;  1R3I C;  4PDV A;  2BOB C;  2HFE C;  5EBM C;  5E1A C;  2Q69 A;  2AHY A;  4RUF A;  2QKS A;  2BOC C;  2EIJ C;  4GX5 A;  2K1E A;  3ABK C;  4RUE A;  4MTF A;  2EIL C;  3SYA A;  3K08 A;  3ABM C;  4MVZ A;  3X2Q C;  5CBF A;  2ATK C;  3PJS K;  3STZ C;  5EC2 C;  4I9W A;  2WLL B;  3SPC A;  4MVS A;  3TET A;  4WFG A;  2ZD9 A;  1V54 C;  3AG4 C;  4WFF A;  2P7T C;  4EKW A;  4MS2 A;  1K4D C; 
#chains in the Genus database with same CATH topology
 3E83 A;  3MHS C;  4TUY B;  5KX5 A;  1XNR B;  1FAF A;  5JQG A;  5EYP A;  1MOF A;  4OPH A;  1GN2 A;  2Y69 B;  3E8H A;  3Q4H A;  5IWA B;  2Q5Z A;  3G4S V;  2RCV A;  3JAM N;  1M56 C;  3K58 A;  4JI7 B;  2QM8 A;  3T1C A;  2W0F C;  4YJ3 B;  4PA3 A;  4JAU A;  3CCS V;  4FZ1 A;  4GYC B;  2A9H A;  2PZS A;  2E5L O;  4K0K O;  4H44 B;  3ASN C;  4NKG B;  2DYS C;  4I0X A;  1D5N A;  1AJQ A;  3ZIA G;  2LFS A;  3H1J H;  2VQF B;  5JJN B;  5JWP A;  1COW G;  2XUM A;  4JV5 O;  1IBL B;  1QLN A;  1CXZ B;  2QKA A;  4LF9 B;  1N34 O;  4JZG A;  3OMN B;  2RQ6 A;  1V54 B;  2DWE C;  3JAL B;  3UKM A;  2EZO A;  2HEP A;  4GX0 A;  3D36 A;  4JAA A;  3TJT A;  3I56 V;  1HWY A;  2P90 A;  4YJ3 A;  4DV2 B;  3SJA C;  5L3E A;  5J9P C;  1VMG A;  2EIN B;  2Q68 A;  2ITC C;  4PJ0 Z;  5LXT B;  3DC5 A;  2EIK B;  4A5U B;  4JI6 O;  1ROP A;  3CHX A;  2NR5 A;  1JJO A;  4B3S B;  1PV0 A;  2BSK B;  3OMA B;  2F4V O;  1MMM A;  1KMI Z;  4JI0 B;  4TV9 A;  1N32 O;  1V54 C;  3OAA G;  1K4D C;  1P7B A;  3OGC C;  3A8T A;  3ABU A;  1P49 A;  4H37 A;  1SC5 B;  4UVC A;  1QVF U;  3K5M A;  3D8C A;  3QNE A;  1VQM V;  1H2K A;  2UU9 O;  4TSF G;  1SQQ H;  3H1H H;  3QO8 A;  3E86 A;  1VF6 A;  3RGB A;  1PNL A;  1US6 A;  2NLJ C;  1VQO V;  4XDL A;  1QBZ A;  2ZR3 A;  1AB3 A;  3AG2 C;  4LR3 A;  3CRC A;  3APQ A;  5B1B B;  1Q8I A;  1NS1 A;  2DYS B;  1E1R G;  2IU0 A;  5BZB A;  3CCM V;  1KEC A;  2ZE7 A;  3WU2 Z;  1GN4 A;  2YC0 A;  1URF A;  3N27 A;  5EBL C;  3RWR D;  4RQE A;  1GM7 A;  3E22 B;  3CXH F;  1SA0 B;  2PTM A;  4KUM A;  1N33 O;  2QM4 A;  3RYI B;  1I5Y A;  5L3F A;  5JH7 B;  4JZ2 A;  5CBG A;  1XNR O;  3BAB A;  1M56 B;  1VIB A;  1VEW A;  1WB7 A;  4DXW A;  1XHX A;  3IAY A;  2ILM A;  3K03 A;  4JI2 O;  3CB2 A;  1AR1 B;  3OE7 G;  2GUZ B;  1J5E O;  4I50 A;  5GTH Z;  2QSA A;  4D6T H;  2HHH O;  1QR9 A;  4O4I A;  4C7U A;  3IGA C;  1B6Q A;  1OZ0 A;  1PD3 A;  4QNH B;  1OCO C;  1GMG A;  3CSX A;  5LP6 A;  3B09 A;  2GTA A;  1F4N A;  4TQD A;  4JF3 A;  1WJZ A;  3JCU Z;  2Q7H A;  3CJH A;  4UB6 Z;  1BSM A;  1TUB A;  4LF4 B;  3JAR B;  1QCE A;  4DR5 O;  4MTF A;  3K08 A;  3ZRX A;  2WA4 A;  2MK3 A;  1NH2 D;  3BRC A;  2RNB A;  4EKW A;  2ZDI A;  1O9G A;  2QWO B;  3AG1 C;  1BQ0 A;  1K33 A;  2ZIO A;  1OCO B;  1HNW B;  4G28 B;  4CS3 A;  1SQX H;  3OEE G;  5H5N A;  1GM9 A;  3U0Z A;  4UV8 A;  3N2K B;  1X4T A;  2PYJ A;  1DTO A;  4MTG A;  1NTZ H;  4LF9 O;  3H9V A;  1FYJ A;  3K9A A;  4TV9 B;  1Y74 A;  4OPA A;  5IYB O;  4FPP A;  4DV4 B;  2XAS A;  5KA6 A;  5L3G A;  5FPO A;  1XNQ B;  4J7K A;  5KHG A;  2KQX A;  3O65 A;  4O2B A;  3OT7 A;  5LXT A;  5JJE B;  2N04 A;  2HJF C;  4DR4 B;  2VWJ A;  4FVM A;  3J80 N;  4PI0 A;  4IHJ A;  1KD1 W;  3I55 V;  4DV6 B;  3ASO C;  4ZHQ A;  4JI3 O;  1R3L C;  3UM7 A;  5IWA O;  4PDR A;  4U3J B;  3BA8 A;  5LL6 Y;  4CZZ A;  2Q0A A;  4CS2 A;  4X1I B;  3JD0 A;  5JVD B;  2Q67 A;  2UXC B;  4PEL A;  2EIM C;  3VQW A;  2VRZ A;  2CK3 G;  2YEV A;  4P9P A;  1K34 A;  3HPL C;  1IXB A;  4TWK A;  1VQ5 V;  3GWK C;  1GRJ A;  2Z3Y A;  3KKY A;  5LHG A;  1F7Y A;  2CGN A;  1XI1 A;  2JGD B;  3UT5 A;  4QJF B;  3U10 A;  3CWB H;  1PNK A;  2HVJ C;  3HKD A;  5FNV B;  2YIB A;  1B3Q A;  1TVK A;  4RUF A;  3BCC H;  1FFX B;  2JJ2 G;  4DK1 A;  2YXL A;  5HFL A;  3RYF B;  4CC6 A;  5D5P A;  2JS5 A;  2QWN B;  2JGD A;  3G71 V;  4XDK A;  1EZV H;  2JDI G;  3JAS A;  1NZ6 A;  3RFR A;  1FFX A;  2QDO A;  1KQS U;  2WLK A;  2XT9 A;  4O4H A;  1ZSP A;  3HKB B;  2Y48 A;  1EN6 A;  2XAG A;  4B3M B;  4YXW G;  2M6Y A;  5DEC A;  2PF4 E;  1XL4 A;  2DE0 X;  4O4L B;  2DYR B;  3OMI B;  4BAY A;  1F4M A;  2N74 A;  5F2V O;  4JAS A;  4JI2 B;  3SJC C;  1TAE A;  1OCC B;  3FYE B;  3G67 A;  3QO5 A;  1JPX A;  3K06 A;  4LF8 O;  4I4T B;  3R65 A;  2AW9 A;  4NVP A;  2QEX V;  4WFA V;  5C8Y B;  1AR5 A;  1BCC H;  1HNZ O;  3K5O A;  3ZJZ A;  4B3R O;  4PA9 A;  1XMQ O;  2UUA O;  5LYJ B;  2LW1 A;  2YI9 A;  2BTQ A;  4BR6 A;  5LGN A;  5FPR A;  3LDE A;  3L71 H;  1K5Q A;  1XMO O;  4GX1 A;  3SYP A;  2OT5 A;  3N2K A;  4LF7 O;  5KHJ A;  4Z1V A;  2BSK A;  3CCV V;  2FTK A;  2EX3 A;  5H6R A;  4FLX A;  1OCR C;  1XMQ B;  3ZMZ A;  4X64 O;  1YEW A;  3DXR A;  3CRA A;  1VF7 A;  2K1E A;  3TXS A;  3JSN A;  5K1P A;  5CN0 A;  3SDL A;  4JI1 O;  2P22 C;  3TET A;  4WFG A;  2CTQ A;  3FFQ A;  3AG4 C;  3RVZ A;  4IT5 A;  1GM8 A;  4MVU A;  4UVB A;  3J7A U;  2ZR2 A;  1ZL8 A;  1RPR A;  3KG2 A;  3SYC A;  5KA5 A;  4TV8 B;  1GKF A;  3ZRV A;  2UXD O;  2ZXW C;  5IDJ A;  4I0X B;  1N4C A;  4XBF A;  3JAK B;  4UCS A;  4DV5 O;  4I50 B;  1BHB A;  3CME V;  2ZT9 B;  4TQF A;  5BY1 A;  3E22 A;  1YJW V;  1BZK A;  2QKC A;  2EJ7 A;  3T4D A;  4BIU A;  3TCU A;  4LFA O;  2QWP B;  3ZMV A;  1MZF A;  3EFF K;  4QPK A;  1VF5 B;  5K1X A;  4JPR A;  1Q6I A;  3CP1 A;  4X66 B;  2H94 A;  1XDC A;  2EUL A;  5HFM A;  1BE3 H;  1CEZ A;  2B1G A;  5CBH A;  1GN3 A;  3CYO A;  3N2G B;  5CA3 A;  3JD3 A;  5IY5 B;  4JGS A;  2OWO A;  3M7M X;  1X59 A;  3TK1 A;  1R6T A;  3K5L A;  3F7V C;  1HR0 O;  3VBB A;  1QVG U;  4UVA A;  2YDE A;  2D3O W;  2B5U A;  1KBH A;  4BWA A;  3L73 H;  2AHZ A;  2B9Z A;  2UXX A;  4BW5 A;  3VOU A;  1AI5 A;  4FFB A;  4U3J A;  3J81 N;  1Q3E A;  4KFM A;  1LR1 A;  5DM6 V;  1H2M A;  2WAM A;  1R6K A;  2R72 A;  3ZHR A;  3D3Q A;  1V55 C;  1MNG A;  5A2Q N;  3OR7 C;  4FJC C;  4LFB B;  3IFX A;  2R70 A;  1I7F A;  5B66 Z;  5B1O A;  2XAJ A;  2WLI A;  3FB7 C;  4FLW A;  5LMU B;  1BQZ A;  4BW9 A;  1M57 B;  2UUC B;  2XAQ A;  4RUE A;  3ASO B;  3JAL A;  4W4L A;  3X2Q C;  4DW0 A;  3FD9 A;  4LH6 A;  5KLV H;  4H0L B;  2LGW A;  3BAA A;  3T2M A;  1N36 B;  4YJ2 A;  2QGN A;  4LF6 B;  4FM1 A;  2YI8 A;  4GKJ O;  1PPJ H;  1GO3 F;  2JJ1 G;  4AQY O;  3ZHQ A;  1K92 A;  2HKO A;  3L70 H;  4DUY O;  1RM1 B;  1KYO F;  2ETN A;  3BVO A;  3JAW B;  1HNX B;  4TV8 A;  1L1F A;  5KAF Z;  1ZL8 B;  4DV0 O;  5GON B;  2CTP A;  2WA3 A;  4LF8 B;  4P30 A;  1Q7Y W;  1I0H A;  1Q43 A;  2QE7 G;  1NI8 A;  1JVM A;  3MD0 A;  4UV9 A;  3EVK A;  4NTW A;  5CA1 A;  3RYC B;  4NXN O;  3LDD A;  4NR1 A;  2A3Q A;  4EB6 A;  1AP5 A;  4GKK O;  2Y0I A;  4J7Z A;  4LNU B;  4JI8 O;  2JS3 A;  5GON A;  1SZX A;  2LW7 A;  4J10 A;  1J5E B;  1M1K W;  4LF4 O;  2A7W A;  3FAV B;  4LF5 B;  1MA1 A;  1VP7 A;  4J11 A;  1IXM A;  5H2F Z;  2OTL V;  1UPG A;  4FLZ A;  4OGQ B;  1MSW D;  2Y4U A;  3DXR B;  1L8D A;  4WFB V;  4DR5 B;  2Q7E A;  3ABK C;  1H2S B;  2YIA A;  4DV5 B;  4DYL A;  1S5L Z;  3F5T A;  4QGP A;  3IC7 A;  1Q6U A;  3NXS A;  3WFV A;  1IBM B;  5C93 A;  5JQG B;  2CGO A;  2LGQ A;  5J2U B;  1H2L A;  3QO7 A;  1GN6 A;  3QVN A;  2FB5 A;  1VQN V;  3N2G A;  5IT9 N;  1RFY A;  2G38 A;  2WLI B;  3OD4 A;  2V1D A;  3SJQ C;  4I55 B;  1IBK B;  1ARO P;  1PM9 A;  4DR3 B;  2GHY A;  5B5E Z;  5BMV B;  2IBZ H;  1FXH A;  2UXN A;  4O4H B;  1S3J A;  3QG5 A;  1SRY A;  1K9M W;  1AI6 A;  1YF2 A;  1SF9 A;  1PL4 A;  3BPZ A;  1R1B A;  2ZKO A;  4CS4 A;  1DK1 A;  1YIJ V;  4PA4 A;  3HKE B;  4I7Z B;  1EN4 A;  3B77 A;  4OXS A;  3GWO A;  2Q8V A;  4J80 A;  2CE4 A;  2N05 A;  1AP6 A;  4KHP B;  3ZHS A;  4X89 A;  1ZWI C;  4FLV A;  4QE7 A;  3UQ8 A;  4G27 B;  3CRQ A;  1N0J A;  1E1Q G;  2Q7G A;  3K9S A;  5IYZ B;  2QJ1 A;  3UT5 B;  1NU1 H;  4DR6 O;  2PUS A;  5JCO C;  2ZM6 B;  4UUJ C;  1H8E G;  3CCQ V;  5JVD A;  1K7D A;  1WP8 A;  3CEI A;  1N34 B;  1FD9 A;  3ABT A;  3ML0 A;  4FLY A;  2OCC C;  2P5O A;  3ZMU A;  4JI3 B;  4JI0 O;  2E3C A;  5KUK A;  5L3C A;  2GSM B;  5CA0 A;  1YJN V;  1QQC A;  4RWU A;  4DR2 O;  4TUY A;  5KX5 B;  4DUZ B;  3HKD B;  4O2B B;  3UCS C;  4HNA B;  1Q81 W;  2EIL C;  1HR0 B;  2F66 C;  3MAQ A;  4IHJ B;  2JEU A;  3RT3 C;  2CAZ C;  4I9W A;  3CCE V;  2CTW A;  1W0J G;  2ZD9 A;  4YY3 O;  1KU9 A;  1S76 D;  5ITZ B;  5IJ0 A;  2OIE A;  3CCJ V;  3JAT A;  4W4K A;  1YJ9 V;  2HJD A;  3E35 A;  5EZY B;  1U97 A;  4QPJ A;  4O4J B;  3SGI A;  3CMA V;  3H01 A;  2QR4 A;  1SQB H;  2IJH A;  2DW4 A;  2CUG A;  1WP7 A;  5EIB C;  1SQG A;  2X0L A;  3T1Y O;  3RN4 A;  3E8G A;  2R9A A;  4PV1 B;  3L75 H;  4IL6 Z;  4DR1 B;  2P4K A;  1D2D A;  4MW3 A;  3OTO B;  1Y6X A;  4R8C A;  1I5X A;  3QTC A;  1OHH G;  5KUM A;  3SPG A;  4X20 A;  2LO1 A;  5AG2 A;  1TGO A;  4O4J A;  4P9O A;  4FM2 A;  1Y74 B;  4B08 A;  3FKS G;  5LBQ A;  2ZNI A;  2AGA A;  3P32 A;  3GB7 C;  4MSW C;  3BY6 A;  3FB6 C;  2KG7 B;  2GBO A;  4Z1M G;  4G2K A;  2F1M A;  1GTO A;  4DR4 O;  2IH3 C;  1TUE B;  2Q6A A;  4LFC B;  1KKD A;  4LWS A;  4CC5 A;  3OEH G;  2EIL B;  3K3W A;  2QTO A;  3SYQ A;  5LGU A;  1XMO B;  3CS5 A;  4IYH A;  5LMU O;  3JAS B;  4GX5 A;  2D2C B;  1B04 A;  2CH7 B;  3A0R A;  4B3T B;  2DOS A;  5LHI A;  2YEV B;  4UXN A;  4LF5 O;  4FM0 A;  3SPC A;  5LOV A;  4X9Q A;  3HB3 B;  2LP7 A;  5LA6 B;  4YIP A;  3T1H B;  1WPB A;  1BHA A;  2FYU H;  3ZHT A;  2GUZ A;  4X1I A;  5E79 Z;  3JAK A;  3ZHU A;  2IM9 A;  3ABK B;  2M7W A;  3OUS A;  1T5E A;  1FFT B;  4F6E A;  3H1L H;  4JYY A;  4WF9 V;  1FKA O;  2R9R B;  3B8M A;  5JH7 A;  2HG5 C;  3K5N A;  3AK2 A;  4HYO A;  1GAX A;  4O2A B;  2UXD B;  2GDS A;  2WWW A;  5ITZ A;  4X1Y A;  4X1Y B;  1WA8 B;  1F23 A;  1VQ9 V;  1VF6 C;  4JYA B;  3P3N A;  2ADP A;  4JI7 O;  2Q0O C;  4IIJ B;  4U7O A;  4JI5 B;  3C3T A;  3BA9 A;  3A0B Z;  2RN9 A;  1J95 A;  4QIW F;  1AJN A;  1FJG B;  1QLE B;  1JFF A;  1TA8 A;  2X6C A;  3K59 A;  3ZHV A;  5GW7 A;  1N0N A;  4I4T A;  2RMK B;  3LSQ A;  5J2T B;  4WBN A;  1HW7 A;  1VQK V;  4DR7 O;  5EK0 A;  3ZRS A;  5LP6 B;  2AZ2 A;  4XDJ A;  1MSD A;  1ORQ C;  5IJ0 B;  2XAF A;  3ETD A;  1R6N A;  2P4V A;  3AK3 A;  1RPO A;  4J42 A;  3IC9 A;  1R73 A;  1I08 A;  3CX5 F;  1K73 W;  1BS3 A;  3W7U A;  1YDX A;  1H38 A;  3OW2 U;  2DQ0 A;  1HNZ B;  4H13 B;  3SYA A;  2BE3 A;  5LP6 C;  2E74 B;  5CBF A;  4JYA O;  1Q86 W;  1YI2 V;  4LWS B;  5LOV B;  5IYZ A;  1IBM O;  1S77 D;  3UO3 A;  3RYF A;  1IX9 A;  1JOY A;  2CDY A;  2KG7 A;  1UJW B;  2XND G;  3AG7 A;  4ICG A;  3SPH A;  5D5Q A;  1OCZ C;  2X6A A;  4JAV A;  2NNU A;  4FLU A;  4WFH A;  1A32 A;  4PI2 A;  3ETQ A;  3CRR A;  2QTS A;  3ICX A;  4B3M O;  4B7K A;  4RAI A;  4LC1 A;  2O57 A;  3LNM B;  3RYI A;  4PHZ A;  4BIO A;  4BIZ A;  2YIB D;  4FFK A;  4KP4 A;  2RJZ A;  3TXQ A;  4OX9 O;  4MT8 A;  5H9C A;  1G6U A;  3JAW A;  2ARH A;  4K8X A;  1YIT V;  3EHB B;  3ETE A;  1TVK B;  3FB5 C;  2LQT A;  4K3A A;  1VQL V;  2IH1 C;  4MVQ A;  3M8A A;  2P67 A;  4JI4 O;  3RVY A;  4X8A A;  4JTC B;  1KC8 W;  4OX9 B;  5LMN O;  4ZHQ B;  4R7C A;  1M90 W;  3Q4H B;  1WN7 A;  1LUV A;  1K3E A;  2ITD C;  1SQF A;  1R3K C;  3QF7 A;  2EIN C;  2X6B A;  3LDC A;  4X1K A;  2JRI A;  3P3P A;  5CB4 A;  3NR7 A;  1QNM A;  4B7E A;  4JI1 B;  2Y0P A;  3IJ4 A;  3ZCC A;  1HNX O;  1H2G A;  2E5L B;  1FXK A;  3WB2 A;  3T1H O;  3AG2 B;  3K0D A;  2BTO A;  3SPI A;  1KKC A;  4GUN A;  2V4D A;  4PDV A;  5TIS Z;  4I9Q A;  2AHY A;  1NQT A;  3JAR A;  1IUR A;  1WA8 A;  2BOC C;  3DC6 A;  4DV6 O;  4DR7 B;  2R9I A;  4EFE A;  3B2E E;  3STZ C;  1M5I A;  5KHI A;  1IVS A;  1WPX A;  2HLD G;  3ETG A;  3T1Y B;  1NVP B;  1YSC A;  4FZ0 A;  2VQE B;  3ASN B;  2VQE O;  1DGS A;  1JR9 A;  1HNW O;  5LMN B;  1G4Y B;  1HP8 A;  4J7J A;  1SET A;  1GH6 A;  4DR3 O;  5EC1 C;  3KZI Z;  4YIO A;  4R6Z A;  1IBK O;  4Q6G A;  1MAB G;  2EIK C;  2WLL A;  2QM7 A;  2L35 A;  2LJ2 A;  2L6L A;  4DV3 B;  4NXM B;  5KAI Z;  3WG7 B;  1BGY H;  1ZUQ A;  3VQV A;  1OCR B;  2Y69 C;  4DW1 A;  4KXR A;  3HKE A;  3E2E A;  1AIL A;  4DV1 O;  3AG3 B;  1TUB B;  4AIL C;  1W0K G;  1W2B U;  2IW5 A;  4DO2 A;  1RSO B;  4JI4 B;  1JX9 A;  3ABM B;  2F43 G;  1DLB A;  4NTX A;  2Q4P A;  4J41 A;  3P30 A;  2DQ3 A;  1Q82 W;  1P84 F;  1CP9 A;  3CC2 V;  2WLM A;  2DMX A;  2OTJ V;  4DV4 O;  5BMV A;  2OIG A;  2YXY A;  1AI4 A;  2A79 B;  1F51 A;  3O9O A;  1FXK B;  2YIC A;  4D7T A;  2DYR C;  3BEH A;  4GKK B;  2GV9 A;  3GVM A;  3B8N A;  4ZIB A;  3S3X A;  3K04 A;  5BR8 B;  4JV5 B;  1XOU A;  1R3I C;  2ZQM A;  4FMT A;  1Y67 A;  5EBM C;  4GKJ B;  2H3O A;  1L0N H;  2FL4 A;  2OCC B;  1QHT A;  2ATK C;  2ZNJ A;  1Q90 D;  1M9N A;  3WB1 A;  4ZOL B;  2YS8 A;  3A0H Z;  4PD4 F;  1Y76 A;  1ZX3 A;  3CCL V;  3AEI A;  3F7Y C;  5IYD O;  4X88 A;  5B3S C;  1IZ3 A;  4EEQ A;  4P2Z A;  2Z5U A;  2PY5 A;  5CA1 B;  3LNN A;  1YXB A;  1PL0 A;  2E75 B;  1QLE C;  4AI8 A;  3D36 C;  2W6I G;  4YHH O;  4E4E A;  4MTO A;  2ODM A;  4X62 O;  1SQV H;  4O4L A;  2V7Q G;  1OCC C;  3G80 A;  3OTO O;  2JGU A;  2WLJ A;  2EIM B;  5GTI Z;  4JTA B;  2ZE8 A;  4DRX A;  2PI4 A;  4FK5 C;  3BFR A;  5DED A;  3FX7 A;  2UUC O;  4N21 A;  4CH6 A;  4JYB A;  2W6J G;  1ZLZ A;  2YXH A;  2ZIM A;  1H2N A;  1NR1 A;  4DR1 O;  1PNM A;  2WSS G;  3SYO A;  2ADQ B;  2XTA A;  3ABL C;  4JTD B;  2YSU B;  3HR0 A;  5BR8 O;  4YY3 B;  4GZR B;  1K5S A;  4KL1 A;  4UCV A;  2UXB B;  5B1A C;  2EBO A;  3EXA A;  5B3S B;  1XBL A;  1ZAU A;  4MW8 A;  3RYC A;  3E89 A;  1I94 O;  4GCZ A;  3OFN G;  2QWR B;  1FS0 G;  2ZE6 A;  3CRM A;  3ZN1 A;  1EBO A;  5B1A B;  2VS0 A;  4ABM A;  1IBL O;  5FL7 G;  3BHP A;  4YJ2 B;  2BTQ B;  2ZIN A;  4LH7 A;  1Y4M A;  3RYH B;  3B4S A;  4GT1 A;  4ZI7 B;  4DK0 A;  1NTM H;  5BXZ A;  4D7S A;  2IJJ A;  4UCR A;  2P06 A;  3AG1 B;  2PYL A;  3S3W A;  1JFF B;  1JMK C;  3T4Z A;  4DUY B;  3SR2 C;  1FPO A;  4K0K B;  1BT8 A;  3A2F A;  3CCR V;  1VQ8 V;  3ZBH A;  1O9H A;  1MZE A;  5CMU A;  2EJR A;  1YCI A;  1G1X B;  3OGI B;  4IIJ A;  5CB4 B;  1XHZ A;  1SER A;  3D3I A;  4KHP O;  3C90 A;  5C8Y A;  4L87 A;  4CBC A;  3U11 A;  5EIB D;  1PP9 H;  1FXV A;  1SES A;  1Z5V A;  4O2A A;  4DV7 B;  1XIL A;  4UCT A;  4IYI A;  2QWQ B;  4WCE V;  1RP3 B;  1RM1 C;  4X1K B;  3AG3 C;  4AHC A;  4J9Z B;  2PI5 A;  1Y66 A;  1N33 B;  5LA6 A;  4X62 B;  3L74 H;  3VQX A;  1NT2 B;  3OTF A;  4GX2 A;  1Q5O A;  4UB8 Z;  1Z2G A;  5IYC O;  4QE9 A;  1KP2 A;  4MVR A;  4LBE C;  1VQ6 V;  4LNU A;  4NTY A;  4O4I B;  4F6R A;  3E8B A;  2CH7 A;  2WLH A;  3HKB A;  3ZRW A;  1AR4 A;  4EFB A;  3ZRW B;  4ASU G;  3H1K H;  2IJK A;  1YVW A;  1BL8 A;  2UU9 B;  5B1B C;  5IJ9 B;  5LGT A;  1M57 C;  3E8F A;  4WFE A;  1IDS A;  3HKC B;  3KCX A;  2F93 B;  4ZKI A;  1SKV A;  3DGE A;  1JQ0 A;  1SA0 A;  4LF7 B;  4U3F H;  4WBN B;  2UXB O;  1NH2 B;  2B1I A;  4DV1 B;  2F4V B;  2YID A;  2WLL B;  4MVS A;  5LHH A;  3THO A;  4HAM A;  4JI8 B;  3UO2 A;  2PGG A;  1HDJ A;  3OUF A;  3LSS A;  4X65 B;  1K4C C;  3R66 A;  4H33 A;  3I5D A;  2UUB B;  2DWD C;  3WB0 A;  3WG7 C;  5EBW C;  5L3B A;  5FLX N;  2E76 B;  3C3S A;  3JSL A;  5IY5 C;  4LFC O;  3FB8 C;  2LFR A;  1MG1 A;  1P4R A;  2FKX A;  4R50 A;  4L8J A;  5LYJ A;  2CTR A;  1R3J C;  1VAR A;  3K0G A;  5KMG A;  3JAT B;  1VQ7 V;  5J2T A;  3SJB C;  3MHH C;  4MVO A;  3H1I H;  1YHQ V;  3LSU A;  3MDS A;  4IGG A;  1S0V A;  3JYC A;  3OM3 B;  1P7G A;  3ZS8 C;  1M4U A;  3FAV A;  4B3T O;  4YHH B;  4PA6 A;  1VQ4 V;  4PA7 A;  4J9Y B;  2X7R B;  4X64 B;  3KCY A;  3TGU H;  1NKD A;  2ZXW B;  2EZP A;  1XRE A;  4DR6 B;  2WLN A;  3APO A;  3ZX6 A;  1YTF D;  2Y4T A;  1AI7 A;  4K35 A;  3DSQ A;  5EZY A;  1OCZ B;  3JD4 A;  1XQ8 A;  3AG4 B;  1H8H G;  2F23 A;  4Z2W A;  2AZ0 A;  4CH4 A;  4FLT A;  3FYI B;  2UUA B;  4B3R B;  1N36 O;  5CA0 B;  1NR7 A;  3CXC U;  1SQP H;  4F4L A;  3CC4 V;  3HKC A;  2F95 B;  5JJJ B;  1M93 A;  5E1A C;  4HNA A;  1QR8 A;  3DTU B;  2W0X A;  3M99 B;  4N23 A;  3PJS K;  1NJI W;  2OYQ A;  4UFZ A;  4Q20 A;  2P7T C;  3K79 A;  1Q6H A;  5KHH A;  1V9P A;  4LP8 A;  1JJ2 U;  1D5A A;  3RBZ A;  1S5J A;  2XOK G;  1S5H C;  2K9P A;  2P6J A;  2AXT Z;  2RDC A;  2ZCE A;  3L72 H;  3STL C;  1S72 V;  4HZ3 A;  1OJH A;  3W7S A;  2H8P C;  1CPY A;  5FNV A;  1AVM A;  4X66 O;  3RW0 A;  3JD2 A;  2HR3 A;  3G6B A;  4X20 B;  2HHH B;  1JCH A;  1EFR G;  2KSD A;  4ZOL A;  4LFA B;  3LUT B;  4NB5 A;  2MW2 B;  2Z0A A;  4NYK A;  3CE2 A;  4TT3 G;  2JIZ G;  1WNS A;  3SPJ A;  5H6Q A;  1THZ A;  5JCO A;  2WPD G;  4DV0 B;  1EM1 A;  1UFI A;  4PDL A;  4LF6 O;  4DR2 B;  1G8M A;  4FFB B;  2GTS A;  1XEQ A;  3W7T A;  5KHK A;  4NXN B;  1OV9 A;  1KB9 F;  5L3D A;  1DF4 A;  4RQF A;  1RSO A;  4FIP C;  1YTF B;  1NTK H;  2EIJ B;  1PKX A;  1ENV A;  1JA8 A;  1VQP V;  1XUQ A;  2NN4 A;  2ZM6 O;  3CJH B;  1W59 A;  2C2A A;  4JI5 O;  3X2Q B;  2BOB C;  2HFE C;  2A06 H;  5KMG B;  2Q69 A;  1NBM G;  3ZED A;  2UXC O;  2QKS A;  2JVD A;  4ZI7 A;  2JEX A;  4MVZ A;  1WAZ A;  5EC2 C;  4AQY B;  4EB6 B;  4CH5 A;  2QA4 V;  4WFF A;  4MS2 A;  1N32 B;  2XHB A;  1XNQ O;  4ZBM A;  4NXM O;  1SS3 A;  4HBN A;  1L0L H;  1LUW A;  2KB1 A;  2IU3 A;  1EN5 A;  4E2L A;  2HP8 A;  5DN6 G;  2UUB O;  1B06 A;  1NVP D;  3CD6 V;  1V55 B;  4X65 O;  2ZDI C;  2Q9L A;  4B3S O;  3RYH A;  4F6R B;  3B40 A;  2ZE5 A;  4UCU A;  1EZJ A;  1SZT A;  1ZTE A;  4LFB O;  1K97 A;  4PDM A;  3F5W C;  4CH3 A;  4TOI A;  5A9G A;  3OR6 C;  2DJV A;  2OCH A;  1KP3 A;  5B1N A;  1Z5W A;  2YUA A;  3G6E V;  4MTX A;  4GLX A;  1XL6 A;  2XAH A;  1E79 G;  1K8A W;  4DRX B;  1GK9 A;  2DN9 A;  4LCU C;  1WB8 A;  1WLE A;  4JI6 B;  2FML A;  2HVK C;  1U96 A;  4UCO A;  1N8R W;  5IJ9 A;  1Y76 B;  3ABL B;  1AJP A;  2VQF O;  3VQY A;  5EYP B;  3K57 A;  4MVM A;  4JYC A;  1BMF G;  3L9D A;  4DUZ O;  3CC7 V;  1LNQ A;  4I55 A;  1KUQ A;  1QU7 A;  1FXK C;  1I94 B;  3AK1 A;  4RO2 A;  5J2U A;  2JK5 C;  4DV2 O;  2A0L A;  3W7W A;  3ZMT A;  4DV3 O;  1YZB A;  2BCC H;  3W7X A;  1DF5 A;  3CPW U;  4DV7 O;  3CCU V;  5IE9 A;  2EIJ C;  2VWK A;  3JD1 A;  4U7N A;  3ZMS A;  3ABM C;  2Q73 A;  3ZN0 A;  4I5S A;  3JCZ A;  1FJG O;  2IJI A;  3PN1 A;  4K8Z A;  2KKW A; 
#chains in the Genus database with same CATH homology
 1GM8 A;  4MVU A;  3E83 A;  3MHS C;  4UVB A;  2ZR2 A;  3T4Z A;  1RPR A;  1BHA A;  1MOF A;  3KG2 A;  3SYC A;  5KA5 A;  1GKF A;  3ZRV A;  2ZXW C;  2Y69 B;  5IDJ A;  3E8H A;  3CCR V;  1VQ8 V;  4XBF A;  3G4S V;  3ABK B;  2M7W A;  3OUS A;  1BHB A;  3CME V;  1M56 C;  5CMU A;  2EJR A;  2QM8 A;  1FFT B;  1YJW V;  3T1C A;  3D3I A;  2W0F C;  1SER A;  3T4D A;  4WF9 V;  4BIU A;  3TCU A;  4PA3 A;  2R9R B;  3B8M A;  4JAU A;  2HG5 C;  4L87 A;  3CCS V;  4CBC A;  3ZMV A;  3EFF K;  4HYO A;  4QPK A;  1FXV A;  2A9H A;  1SES A;  4JPR A;  2WWW A;  3CP1 A;  2H94 A;  5HFM A;  3ASN C;  4WCE V;  2DYS C;  1CEZ A;  1F23 A;  2B1G A;  1VQ9 V;  5CBH A;  3CYO A;  5CA3 A;  1RM1 C;  4U7O A;  3JD3 A;  3AG3 C;  5IY5 B;  1AJQ A;  4JGS A;  4J9Z B;  2PI5 A;  1Y66 A;  3ZIA G;  3TK1 A;  2LFS A;  3F7V C;  3VBB A;  1J95 A;  4UVA A;  4QIW F;  2D3O W;  2B5U A;  1QVG U;  1AJN A;  2AHZ A;  2UXX A;  4BW5 A;  3VOU A;  1QLE B;  4GX2 A;  1AI5 A;  1COW G;  5IYC O;  2X6C A;  4QE9 A;  1QLN A;  1KP2 A;  5GW7 A;  4KFM A;  4LBE C;  4MVR A;  1VQ6 V;  5DM6 V;  3OMN B;  3E8B A;  1V54 B;  2DWE C;  3LSQ A;  2WLH A;  3UKM A;  2WAM A;  1R6K A;  2EZO A;  3ZRW A;  1V55 C;  4GX0 A;  3ZRW B;  3D36 A;  4ASU G;  1VQK V;  2IJK A;  1BL8 A;  3OR7 C;  3I56 V;  5EK0 A;  3ZRS A;  1HWY A;  2P90 A;  4FJC C;  5B1B C;  4XDJ A;  3IFX A;  5LGT A;  5L3E A;  1ORQ C;  5J9P C;  2EIN B;  1M57 C;  3E8F A;  2XAF A;  2Q68 A;  3ETD A;  2ITC C;  1R6N A;  4WFE A;  5B1O A;  1RPO A;  3FB7 C;  2WLI A;  2XAJ A;  1R73 A;  2EIK B;  1K73 W;  4ZKI A;  3W7U A;  1M57 B;  3DGE A;  1JQ0 A;  1ROP A;  1H38 A;  2XAQ A;  4RUE A;  3OW2 U;  2DQ0 A;  1NH2 B;  2B1I A;  3ASO B;  3SYA A;  3X2Q C;  5CBF A;  1Q86 W;  3OMA B;  1YI2 V;  2WLL B;  4MVS A;  5LHH A;  1V54 C;  3OAA G;  3T2M A;  4HAM A;  1K4D C;  1S77 D;  1P7B A;  3OGC C;  1JOY A;  3ABU A;  3OUF A;  3LSS A;  1K4C C;  4H33 A;  4H37 A;  2DWD C;  4UVC A;  1QVF U;  3WG7 C;  2XND G;  5EBW C;  1UJW B;  3QNE A;  3SPH A;  1OCZ C;  1VQM V;  1GO3 F;  2JJ1 G;  5L3B A;  2X6A A;  4JAV A;  2NNU A;  4TSF G;  4WFH A;  3QO8 A;  3E86 A;  1K92 A;  2HKO A;  1PNL A;  2NLJ C;  1VQO V;  4RAI A;  4LC1 A;  3LNM B;  4XDL A;  5IY5 C;  1QBZ A;  4BIZ A;  2ZR3 A;  3FB8 C;  2LFR A;  3AG2 C;  1RM1 B;  4KP4 A;  1MG1 A;  1P4R A;  4R50 A;  5B1B B;  4MT8 A;  5H9C A;  1L1F A;  2DYS B;  1E1R G;  3EHB B;  2IU0 A;  3ETE A;  5BZB A;  3CCM V;  1YIT V;  1R3J C;  1KEC A;  3K0G A;  5EBL C;  4P30 A;  4RQE A;  3FB5 C;  1Q7Y W;  1VQ7 V;  1GM7 A;  2QE7 G;  1VQL V;  3MHH C;  4MVO A;  1JVM A;  2IH1 C;  4KUM A;  3MD0 A;  4MVQ A;  4UV9 A;  1YHQ V;  1I5Y A;  5L3F A;  2P67 A;  1S0V A;  3JYC A;  3LDD A;  3OM3 B;  5CBG A;  3RVY A;  4X8A A;  4JTC B;  1KC8 W;  1M56 B;  4PA6 A;  1VQ4 V;  4PA7 A;  4J9Y B;  4DXW A;  2X7R B;  4R7C A;  1NKD A;  2ZXW B;  2EZP A;  3K03 A;  1M90 W;  1AR1 B;  2ITD C;  1K3E A;  2WLN A;  3OE7 G;  1YTF D;  1R3K C;  2EIN C;  1AI7 A;  2X6B A;  3LDC A;  1QR9 A;  1OCZ B;  3JD4 A;  3AG4 B;  1M1K W;  1H8H G;  3IGA C;  1B6Q A;  1OZ0 A;  1PD3 A;  4QNH B;  1OCO C;  3ZCC A;  1GMG A;  3FYI B;  1H2G A;  1FXK A;  1F4N A;  1IXM A;  3AG2 B;  3K0D A;  2OTL V;  4JF3 A;  1NR7 A;  3SPI A;  3CXC U;  4F4L A;  3CC4 V;  1MSW D;  4PDV A;  5E1A C;  2AHY A;  1NQT A;  4WFB V;  2BOC C;  1QCE A;  3ABK C;  4MTF A;  1QR8 A;  3DTU B;  3K08 A;  3ZRX A;  3M99 B;  2R9I A;  4N23 A;  3PJS K;  3STZ C;  2MK3 A;  1NJI W;  1NH2 D;  1WPX A;  3IC7 A;  3NXS A;  3WFV A;  2HLD G;  4EKW A;  4Q20 A;  2P7T C;  3K79 A;  5C93 A;  3ETG A;  2ZDI A;  1YSC A;  1NVP B;  3AG1 C;  3QO7 A;  1K33 A;  1OCO B;  4LP8 A;  4G28 B;  3ASN B;  1JJ2 U;  1VQN V;  3OEE G;  1G4Y B;  1GM9 A;  1SET A;  2WLI B;  4UV8 A;  2V1D A;  3SJQ C;  5EC1 C;  1ARO P;  3RBZ A;  4R6Z A;  2GHY A;  2XOK G;  1MAB G;  1DTO A;  1S5H C;  2EIK C;  1FXH A;  2QM7 A;  2WLL A;  2UXN A;  4MTG A;  2P6J A;  3K9A A;  1S3J A;  1SRY A;  5IYB O;  4FPP A;  2XAS A;  1K9M W;  5KA6 A;  3STL C;  5L3G A;  1S72 V;  1AI6 A;  4HZ3 A;  3WG7 B;  1YIJ V;  3W7S A;  2H8P C;  1CPY A;  1OCR B;  2Y69 C;  3E2E A;  4PA4 A;  3RW0 A;  3B77 A;  3JD2 A;  4OXS A;  3AG3 B;  2HR3 A;  3GWO A;  2HJF C;  1JCH A;  1W0K G;  1EFR G;  1W2B U;  2IW5 A;  4DO2 A;  3LUT B;  1KD1 W;  3I55 V;  4X89 A;  1JX9 A;  3ABM B;  2F43 G;  3ASO C;  1DLB A;  4TT3 G;  1R3L C;  1ZWI C;  2JIZ G;  3UM7 A;  4QE7 A;  4G27 B;  3SPJ A;  5H6Q A;  1E1Q G;  4PDR A;  1THZ A;  2WPD G;  4CZZ A;  3P30 A;  2DQ3 A;  1Q82 W;  3JD0 A;  4UUJ C;  1H8E G;  4PDL A;  3CCQ V;  1CP9 A;  3CC2 V;  1K7D A;  1G8M A;  2Q67 A;  2WLM A;  4PEL A;  3W7T A;  3ABT A;  2OTJ V;  3ML0 A;  2EIM C;  1AI4 A;  2A79 B;  2CK3 G;  1F51 A;  5L3D A;  2YEV A;  4P9P A;  1K34 A;  1DF4 A;  1FXK B;  3HPL C;  4FIP C;  4RQF A;  2OCC C;  1YTF B;  2DYR C;  4TWK A;  1VQ5 V;  3ZMU A;  3BEH A;  2Z3Y A;  2EIJ B;  5LHG A;  1PKX A;  3B8N A;  1ENV A;  5KUK A;  1VQP V;  5L3C A;  2GSM B;  3K04 A;  1YJN V;  4QJF B;  1PNK A;  2C2A A;  2HVJ C;  1R3I C;  2ZQM A;  2BOB C;  2HFE C;  4FMT A;  3X2Q B;  5EBM C;  2Q69 A;  4RUF A;  1NBM G;  2QKS A;  1Q81 W;  2JEX A;  2EIL C;  2OCC B;  4MVZ A;  2JJ2 G;  2ATK C;  2JEU A;  5EC2 C;  1M9N A;  4I9W A;  3CCE V;  5HFL A;  1W0J G;  2ZD9 A;  2QA4 V;  4WFF A;  3CCL V;  4MS2 A;  4ZBM A;  2KB1 A;  2IU3 A;  3AEI A;  4E2L A;  1S76 D;  5DN6 G;  3G71 V;  3F7Y C;  4XDK A;  1NVP D;  3CD6 V;  1V55 B;  3CCJ V;  2ZDI C;  5IYD O;  2JDI G;  4X88 A;  1YJ9 V;  3E35 A;  5B3S C;  4QPJ A;  1EZJ A;  1KQS U;  2WLK A;  3CMA V;  3H01 A;  4P2Z A;  1SZT A;  2Z5U A;  2Y48 A;  1K97 A;  4PDM A;  3F5W C;  2XAG A;  4YXW G;  2IJH A;  2DW4 A;  1PL0 A;  3OR6 C;  1QLE C;  1XL4 A;  1KP3 A;  2W6I G;  5B1N A;  2X0L A;  4MTO A;  3E8G A;  2DYR B;  3OMI B;  3G6E V;  2V7Q G;  1F4M A;  4MTX A;  4BAY A;  4MW3 A;  1OCC C;  4JAS A;  4R8C A;  3FYE B;  1OCC B;  2WLJ A;  1XL6 A;  1I5X A;  2XAH A;  2EIM B;  1E79 G;  3QO5 A;  4JTA B;  1OHH G;  1K8A W;  1JPX A;  5KUM A;  3SPG A;  1GK9 A;  3K06 A;  2PI4 A;  4FK5 C;  3R65 A;  4LCU C;  4P9O A;  2QEX V;  4WFA V;  1WLE A;  4N21 A;  2HVK C;  2W6J G;  4JYB A;  1N8R W;  3FKS G;  3ABL B;  1AJP A;  1NR1 A;  5LBQ A;  1PNM A;  2WSS G;  3SYO A;  3P32 A;  3ZJZ A;  3GB7 C;  4PA9 A;  4MSW C;  4MVM A;  4JYC A;  3ABL C;  3BY6 A;  3FB6 C;  5LGN A;  4JTD B;  1BMF G;  3LDE A;  1K5Q A;  2YSU B;  3CC7 V;  4Z1M G;  4G2K A;  4GX1 A;  3SYP A;  2OT5 A;  1K5S A;  1LNQ A;  1GTO A;  2IH3 C;  5B1A C;  3CCV V;  2EBO A;  5B3S B;  1TUE B;  2FTK A;  2Q6A A;  1KKD A;  1FXK C;  4MW8 A;  3E89 A;  5H6R A;  4GCZ A;  3OFN G;  4RO2 A;  1OCR C;  3OEH G;  1FS0 G;  3ZMZ A;  2EIL B;  3ZN1 A;  2JK5 C;  1EBO A;  5B1A B;  3K3W A;  2QTO A;  2A0L A;  3SYQ A;  3W7W A;  5LGU A;  5FL7 G;  3ZMT A;  3W7X A;  1DF5 A;  1Y4M A;  3CPW U;  4GT1 A;  3CCU V;  4GX5 A;  2EIJ C;  2K1E A;  3JD1 A;  4U7N A;  3ZMS A;  3ABM C;  5CN0 A;  3A0R A;  5LHI A;  2YEV B;  4UXN A;  3ZN0 A;  4I5S A;  3SPC A;  3JCZ A;  2IJJ A;  3TET A;  3AG1 B;  4WFG A;  3HB3 B;  2IJI A;  2LP7 A;  3AG4 C;  3RVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...