4J41A

The crystal structure of a secreted protein esxb (mutant p67a) from bacillus anthracis str. sterne
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
89
structure length
89
Chain Sequence
SNAMAEIKITPEELERIAGNFKNAAGEAQSQINRLEGDINSLEGQWAGATQAKFRGEFIQSKQAMQQYIAILEGISTDLKRIADKFRNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords secreted protein EsxB
publication title The crystal structure of a secreted protein EsxB (Mutant P67A) from Bacillus anthracis str. Sterne
rcsb
source organism Bacillus anthracis
total genus 42
structure length 89
sequence length 89
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 4j41A00
4KXRA 4W4LA 4J41A 4J11A 2G38A 2GTSA 4J7KA 4IYIA 4W4KA 4J42A 4J10A 4J7JA 3FX7A 4IYHA
chains in the Genus database with same CATH superfamily
1S5HC 5IY5B 3RYCA 4YHHB 4UV8A 1BZKA 5J2UA 4HYOA 3JD0A 4JYBA 2Q0AA 4O2AA 1E1QG 4J41A 4HZ3A 4LF4B 2CUGA 1S77D 2FL4A 2ZM6O 3HKEA 2YEVA 1K5QA 4JI4B 3HKBA 3ZRVA 1XUQA 2A9HA 1H2LA 1VQ7V 2RQ6A 3CEIA 4RUFA 3W7WA 1Q8IA 5LGNA 3JCZA 4WFGA 1QQCA 3F7VC 2Z5UA 4JAUA 2NR5A 4DV5B 3AG3C 4RAIA 2UXNA 4MVRA 4X65B 3J7AU 3DC6A 5LA6B 1NH2D 4I9QA 1YCIA 1XEQA 4MVMA 5H5NA 5IJ9A 2AW9A 5B3SC 3J80N 3NXSA 3M7MX 1AI5A 4MVZA 4G2KA 5JJEB 1FFTB 1QR8A 1AR4A 3CB2A 2ZINA 4GYCB 5LA6A 3ZMSA 4YHHO 5L3BA 2H3OA 3SYAA 3E8GA 1VF5B 3E89A 3ZRSA 2OWOA 2L35A 3H1JH 4QPJA 1HNZB 4LF4O 3T4DA 1KUQA 1XBLA 3TCUA 2EX3A 3UO2A 2R72A 4K8XA 1BGYH 1NS1A 4CH4A 4JI4O 1JJ2U 2Q73A 2BSKA 2GBOA 1TA8A 4UCSA 5B1NA 4NTYA 4B08A 4LFBB 3BCCH 1I0HA 2X0LA 2NLJC 4MW8A 5E79Z 2QM8A 4DV5O 1SS3A 2UXXA 1Q6IA 5CMUA 1PL0A 1ZLZA 4X65O 4NTWA 4X88A 2HHHB 1P4RA 4W4KA 3ETQA 4PI0A 3CCMV 2DWEC 2IBZH 3MAQA 3AG3B 4GX5A 1AVMA 2JDIG 4YJ3B 3QTCA 1J95A 1K34A 3RYIB 4WFAV 5LOVB 1K97A 4K3AA 4CS3A 3EXAA 4DV1B 5B3SB 4FLTA 5EBMC 4UUJC 2RMKB 5LGTA 4Z1MG 1FFXB 2ITCC 4I9WA 3STLC 4DV4B 1ZTEA 2IU0A 1XHXA 1VIBA 1WNSA 2JS3A 4YJ3A 2YUAA 3RYIA 3LSUA 1HNZO 5CBHA 3GVMA 4FVMA 2JVDA 1DGSA 4RUEA 3R66A 1A32A 2VRZA 2QDOA 4LF7O 2N04A 3ZJZA 3LDEA 3L71H 4WCEV 1ZL8A 2V7QG 4JI0B 4I5SA 1JVMA 4LFBO 3S3WA 2Q4PA 4KL1A 3IC7A 2B9ZA 3VQVA 2CGOA 4GX0A 4YIPA 3ASOC 3CRMA 3WB2A 2HHHO 2QGNA 1SZXA 2CE4A 4IHJA 4BR6A 2ARHA 4FLVA 1OCZC 4JI1B 4DR2B 5IYZB 2YIDA 3HPLC 2UUAB 4DV1O 3QO7A 3G71V 3ICXA 4O4HB 2GSMB 1UJWB 4DV4O 4IT5A 3AK3A 1F7YA 3CCLV 2OTJV 3ZHVA 5KUMA 2G38A 2QKCA 1SETA 2H8PC 1K5SA 3JCUZ 1NT2B 4O4HA 3OTOB 1BHAA 2KG7A 1FS0G 2HVKC 3K3WA 4TQDA 3CRRA 3T4ZA 1SRYA 4RQFA 4TT3G 3TXSA 4JI0O 1K4DC 2A3QA 5BR8B 2WWWA 4LCUC 1VQKV 3SYQA 3B09A 1JPXA 3FX7A 4JAVA 1WP7A 4O4LA 1XOUA 3N2GB 3JASB 3FYIB 1O9GA 1GH6A 5AG2A 4P2ZA 3G4SV 2W0FC 5KX5A 1GN2A 5LYJA 1G4YB 4TV8A 4LFAB 1PNLA 5J2TA 3FD9A 1G1XB 4JI1O 3ASOB 4KUMA 1YZBA 4DR2O 1XL6A 4P30A 2UUAO 3JAKB 4J9YB 3BHPA 1OCZB 2YICA 2P06A 3N2GA 3T1HB 3VBBA 3OEEG 4NB5A 3JD1A 4IL6Z 4AHCA 2Y69C 1KP2A 4CH6A 5JH7A 1XILA 2VWJA 4U3JB 1Q6HA 1K3EA 3R65A 1OHHG 4KP4A 4WFEA 3JAKA 4GLXA 3CRAA 5FNVB 3OTOO 5GTIZ 1SESA 2VQFB 2CTWA 2AZ0A 1L8DA 2Q9LA 2ZCEA 1J5EB 1VF6C 3QVNA 3ZRWB 4U3JA 1KYOF 1BT8A 1SQFA 5BR8O 2OTLV 2WA4A 4O2BA 4MSWC 3B8NA 3RW0A 1BE3H 1NKDA 4LFCB 1QHTA 1WB8A 2E76B 1HWYA 3K58A 4B3TB 4LFAO 5KA5A 1COWG 2WSSG 3ZRWA 2PYLA 4MS2A 3W7UA 3CCSV 2ZQMA 4DRXA 3RBZA 1ORQC 3HKCA 5KA6A 1WJZA 3ZRXA 4FLXA 5JWPA 4DV7B 1K73W 4K35A 3T1HO 4MVSA 4BW9A 4LF6B 4JPRA 1VEWA 4WF9V 1M9NA 4JASA 2AGAA 2CK3G 4A5UB 1Y6XA 4EFEA 1HR0B 4FPPA 2Y69B 4JI7B 2Y0IA 5D5QA 2IH3C 2Z3YA 2DYSC 3AEIA 1ZX3A 3CCQV 1THZA 1W0KG 2QWOB 3ZHRA 1J5EO 1LUWA 1FXVA 2ODMA 1XQ8A 2PI4A 2RNBA 1CXZB 4G27B 3P32A 4FLYA 3JD2A 4J7KA 3CRCA 2O57A 1Q86W 4GT1A 1NTMH 4OPHA 5GTHZ 1S76D 3SYCA 2F43G 4LFCO 5KAFZ 3LSQA 2Q7GA 2DWDC 4BWAA 4MVOA 4YY3B 3ZMUA 4B3TO 3T1YB 2ZE6A 3DSQA 3WFVA 1OCRC 4R6ZA 1T5EA 1N4CA 1M56C 5A2QN 2BOBC 3MD0A 2DJVA 2X6CA 4DV7O 3TXQA 3K5NA 3O9OA 1VQOV 4RWUA 1N36B 2P4KA 5IYCO 3ZHSA 1F4NA 4CC5A 4LF6O 5KMGB 1N0NA 3WB1A 1RFYA 2Z0AA 3TJTA 1HR0O 1FXHA 4LF5B 1JFFB 1JR9A 3RVZA 3BFRA 4JI7O 4DV6B 4H44B 2EJRA 5ITZB 5IT9N 5JQGB 2YIBA 4FFBB 4YJ2A 3WB0A 2CH7B 2BTQB 5KMGA 1IZ3A 3JD3A 3UO3A 1GKFA 2DYSB 1FJGB 4MTXA 2FKXA 1GN3A 1NI8A 3WG7C 2GUZB 3J81N 2LFRA 2PZSA 2A0LA 3CCEV 4YY3O 3SGIA 3T1YO 2WLLA 3O65A 1X59A 3JATA 2A06H 2JEXA 4K0KB 3TETA 4E4EA 1SQGA 3ZIAG 1OCRB 4LR3A 4UV9A 5LP6A 1N36O 4TQFA 1M56B 3F5TA 1EZVH 1SQPH 4UVBA 3H01A 5IWAB 4B3MB 2Q7HA 2VWKA 1IX9A 4I50A 2LGQA 4LF5O 3U0ZA 4H33A 2CTPA 2W6JG 5GONB 5EZYB 4DV6O 4W4LA 1IVSA 3S3XA 2ZE8A 1I5YA 2WLIA 3CHXA 3IGAC 2QKAA 1BMFG 3MDSA 1EN6A 2HLDG 1FJGO 1LNQA 3FB6C 4UCTA 5FPRA 1ENVA 3CRQA 3I56V 1KC8W 3ASNC 1AJNA 5EZYA 1AR5A 2HFEC 3RVYA 3C3TA 1AB3A 4K8ZA 1CP9A 1NTZH 3WG7B 3G6EV 4K0KO 3L75H 1N33B 1KU9A 1AI7A 3ZBHA 2Q0OC 2ILMA 3ZHQA 4J7ZA 2P5OA 4B3RB 3BEHA 2OYQA 1XDCA 4DV3B 1PNMA 5IWAO 4B3MO 3PJSK 2JGDB 4ABMA 3RT3C 2QR4A 2P6JA 1P7BA 5LHIA 2ZD9A 1YEWA 3FAVB 3HB3B 4AQYB 1H2GA 1KD1W 2K9PA 1R3JC 3ABKC 4DXWA 2YIBD 3K5LA 4B7EA 1P84F 4CS4A 3D8CA 5H6RA 1KECA 3H1KH 4PELA 2A79B 3ABTA 4WFHA 2OCCC 1Y4MA 2WA3A 2F93B 3N27A 4X89A 4I4TB 3OUSA 2BTOA 2XHBA 2IH1C 3OR6C 1K33A 4LWSB 4OGQB 5KLVH 3ASNB 4JI6B 3K0DA 5FLXN 1NJIW 1TUEB 4N23A 2ZKOA 1N33O 3SYOA 1YF2A 4GX1A 3NR7A 1GTOA 4L87A 4EFBA 3OMNB 1Q6UA 4B3RO 3RYHB 1WAZA 4U7NA 2CDYA 4LWSA 5H2FZ 4DV3O 2Q7EA 2F4VB 3CMAV 2QE7G 3HKDB 4JI3B 4AQYO 3LDDA 3CP1A 3VOUA 3RYHA 4DV2B 2N05A 4ICGA 2QM4A 4PA6A 1VMGA 4X8AA 3Q4HB 2UU9B 2B1GA 1K7DA 4FFKA 2XAJA 3ABKB 1F4MA 2YSUB 3L9DA 2ETNA 3HKDA 2Q67A 4FM1A 1PL4A 3SJCC 4EEQA 2F23A 1QR9A 5LOVA 4IIJB 1U97A 5JCOC 3QO5A 4UCRA 2BCCH 4ZOLB 1WA8B 1FFXA 3E8FA 3Q4HA 1MMMA 2OCCB 4D6TH 4JI6O 4J11A 2DMXA 2X6BA 1TUBB 4JYYA 3EFFK 1M4UA 3K03A 4IIJA 1ZAUA 3ZX6A 4BIZA 1YJNV 2Q68A 5LMNB 1GM9A 4UCUA 3OD4A 1Y74B 5JVDB 2PUSA 4JTCB 4P9OA 1QCEA 1WA8A 2XOKG 3TK1A 1XHZA 1HW7A 2F4VO 3GB7C 5EBWC 4Z2WA 1TUBA 5CA1B 4X1YB 4JI3O 5KHIA 2NN4A 4RQEA 3CCJV 1XL4A 4QIWF 3SJAC 4DV2O 1F51A 3SPCA 2IJHA 1K9MW 1CPYA 4CBCA 1MG1A 4DO2A 1VQ8V 2UU9O 2BE3A 2EZPA 3D3QA 1XNQB 2X6AA 3DC5A 3BPZA 1Q81W 2EBOA 4I0XB 3K9AA 5CA1A 1RSOB 1WP8A 3LUTB 3PN1A 2JJ1G 1VP7A 1S72V 4QJFB 5C93A 5IYZA 2V4DA 3ABUA 3VQXA 3FB5C 1MSWD 3F7YC 4I55B 3EHBB 3ML0A 2YI8A 1Q7YW 2QWPB 4I0XA 1RSOA 4TV9B 3K08A 2RDCA 4NKGB 5LMNO 1FKAO 2K1EA 2P22C 1EFRG 2A7WA 3JAMN 5KHJA 1MABG 5JCOA 3GWOA 3RWRD 1V55C 3LNNA 5EYPB 3AG4C 1SC5B 3A0RA 3KKYA 3TGUH 4Q20A 5IDJA 4DR1B 1Q5OA 1BS3A 3JASA 1CEZA 1XNQO 1B04A 3OFNG 4UCOA 1US6A 2GV9A 3SYPA 1V9PA 3E35A 2AHZA 2FB5A 5EYPA 4GZRB 1QVFU 1FXKC 4JI5B 1VQ6V 4LF8B 4GUNA 3OMAB 5BXZA 1PNKA 3ZN1A 3I5DA 4F4LA 3ABLC 4LNUB 1JCHA 1D2DA 3LDCA 1DTOA 3BVOA 2QWQB 1M5IA 3K59A 4IGGA 3OT7A 1YHQV 2JK5C 3CC2V 1IXMA 2GTAA 4FJCC 1H2SB 4X1IB 2ZDIC 5FNVA 2RN9A 5B1BC 4HNAB 3CE2A 2WPDG 3K0GA 4D7SA 3APQA 1GN6A 4PA9A 2KSDA 4WFBV 3ZN0A 4OPAA 3BAAA 1GAXA 4FMTA 4DR1O 1E1RG 2KKWA 3E2EA 1V55B 2PTMA 3AG4B 1M57C 1Q43A 2KQXA 2Y48A 3ETGA 1XREA 3AK2A 2XAFA 1ZUQA 4QE9A 5F2VO 2AHYA 4JI5O 4HBNA 4LF8O 2YDEA 4NXMB 3QF7A 3CMEV 2Q69A 5CBGA 2EILC 2HP8A 4JGSA 4X1KB 1FXKB 3M99B 5JJNB 2R9RB 5D5PA 2IJKA 4Z1VA 5B1OA 2LJ2A 2VQFO 4F6EA 3BRCA 2EINC 2XAGA 3OGIB 2QJ1A 3ABLB 4FZ1A 4CZZA 2YI9A 2DQ0A 2PI5A 1BHBA 1D5NA 4NXNB 1HNWB 2HJDA 1EM1A 3ETDA 4QNHB 4MTGA 1EN4A 1R6NA 4X1KA 4LC1A 2M7WA 1FXKA 3IJ4A 3OW2U 1RPRA 2Q5ZA 5CA3A 4X66B 3AG1C 1VQLV 3SPGA 4DK0A 3UT5B 1WPXA 3UKMA 5B1BB 3ETEA 1IURA 3VQWA 4IYIA 1YI2V 2GTSA 1FYJA 1VF6A 2YXYA 1EN5A 3WU2Z 5L3FA 3AK1A 3A8TA 4DW1A 2XNDG 1AP6A 4KFMA 1M57B 3UT5A 1VQNV 4RO2A 1IBLB 2JIZG 2JJ2G 4NXMO 1MOFA 1R6KA 2P4VA 1GM8A 4BIUA 4TUYB 5CA0B 1SF9A 1I94B 3FYEB 3EVKA 3JARB 3JYCA 1GM7A 4JAAA 3SR2C 4O4JB 1R3LC 2EILB 5HFLA 4GKJB 3K9SA 4DR3B 3FKSG 1SA0B 1FAFA 4NXNO 1NQTA 3KZIZ 5JJJB 1MA1A 4UCVA 1HNWO 3OUFA 4ZBMA 1JFFA 1TVKB 1P7GA 2ZIMA 3ZMZA 5LXTB 5LHHA 1R6TA 5CA0A 2IJJA 2ZIOA 3JARA 3D3IA 5ITZA 5JQGA 4FFBA 1EZJA 4NR1A 4X66O 2Y4UA 4JYCA 4X64B 1M90W 2CH7A 2D2CB 4NTXA 1VQPV 2BTQA 2YXHA 1Z5WA 3GWKC 1BQ0A 1KKCA 3AG1B 4BW5A 1TVKA 5LMUB 1ZSPA 4ASUG 4XBFA 2HVJC 3CXCU 3B2EE 1QVGU 1PKXA 2GUZA 4CH3A 1SZTA 4DR6B 4PI2A 1AJQA 4FIPC 4PDVA 4FLZA 1GMGA 2DE0X 2MK3A 1RP3B 3RGBA 1IBLO 1OZ0A 1L1FA 5DECA 4FK5C 2GDSA 4UB6Z 3OGCC 5GW7A 3SPIA 4OX9B 5HFMA 3DXRB 2DW4A 3C3SA 1I94O 3P3PA 2C2AA 2QTSA 1H38A 4PA7A 2QWNB 3RYFB 3W7TA 2QSAA 4X62B 3RYCB 3H9VA 2JGUA 4GKJO 3APOA 1SQVH 4DR3O 3W7SA 2B5UA 2IU3A 4TWKA 2RCVA 5GONA 2QKSA 3OR7C 2HEPA 4MTOA 5KHKA 3HKEB 3OAAG 3QG5A 1RM1C 3HKBB 1R3IC 4X64O 1DF4A 4P9PA 3AG7A 4XDJA 2UUCB 1R73A 2UUBB 4JYAB 1V54C 1H2NA 1XNRB 5L3GA 2LO1A 5LMUO 4J80A 1YDXA 2XAQA 3CCUV 1IBMB 3T2MA 4LH7A 2ZR3A 5B1AC 4DR6O 2DYRC 1PPJH 4ZKIA 1GK9A 4DR5B 5IJ9B 1H8HG 1AROP 2ZE5A 1H2KA 3K5MA 2XT9A 3VQYA 2F66C 4CC6A 2JS5A 1NVPB 4OX9O 1VQ4V 3BA9A 3FB7C 4BIOA 1OJHA 2LP7A 1Q3EA 2W0XA 3ZHTA 2EZOA 4R50A 5CBFA 4CS2A 4X62O 2EIKC 3CC4V 1YXBA 4DUYB 2DOSA 2JGDA 4DK1A 2DN9A 5EBLC 2VS0A 1G6UA 3FAVA 1KQSU 1PV0A 1VQ5V 4AI8A 1HDJA 5LHGA 1JQ0A 2BSKB 4PDLA 3E8BA 2UUCO 2UUBO 4JYAO 4WBNB 4D7TA 1Y67A 1XNRO 1RM1B 2MW2B 1QBZA 4DR7B 3C90A 1N34B 1V54B 1VQMV 1KP3A 1KB9F 1IBMO 3U11A 5K1PA 4B3SB 2E75B 4I4TA 1DLBA 2R70A 4JZGA 4WFFA 5LGUA 4LF7B 3CD6V 1SKVA 3RFRA 2X7RB 2OIEA 4WBNA 4DR5O 1PP9H 5DEDA 3E86A 2NNUA 3G67A 5B1AB 1VF7A 2DYRB 1PM9A 3OMIB 4ZHQB 3IFXA 4J7JA 1PD3A 5EIBC 1B3QA 1YIJV 3KG2A 2E74B 3ZCCA 3BABA 3CC7V 1B06A 4J10A 2PGGA 1WLEA 5EC1C 4DUYO 3K57A 2QTOA 1N32B 4XDKA 4UVAA 4ZI7B 2EIKB 2B1IA 4ZHQA 5H9CA 4MVQA 2HJFC 2UXBB 4X20B 2Q6AA 5BMVB 1MNGA 4U7OA 5KAIZ 4MT8A 3K06A 2LW7A 1Z2GA 4PDMA 2UXDB 1AI4A 1ZL8B 5KUKA 4DR7O 2E3CA 4X9QA 4H37A 2LW1A 4ZI7A 1SERA 1JJOA 1YJWV 1N34O 4TOIA 5E1AC 1HNXB 3A2FA 4PD4F 4B3SO 3SPHA 4X20A 4PV1B 5A9GA 5BMVA 4ZOLA 1W2BU 2XAHA 1YTFB 4IHJB 2YC0A 4LH6A 1M93A 3JAWB 5CB4B 4LBEC 3CCVV 2ZR2A 3SPJA 2HG5C 4F6RB 1XMOB 1NR1A 1Y74A 5JVDA 1UFIA 3MHSC 3ABMC 5J9PC 2M6YA 1WPBA 2Q8VA 1NZ6A 2H94A 4DV0B 3ZMVA 1M1KW 3G6BA 1N32O 3P3NA 4PA3A 4X1YA 2V1DA 3JAWA 5CB4A 1AILA 1NR7A 2QEXV 1NVPD 1SQXH 3QNEA 2DQ3A 4F6RA 3RN4A 4R8CA 4MTFA 2UXBO 1S3JA 1W0JG 2KG7B 2L6LA 2EJ7A 2CTQA 4GCZA 1I5XA 2EIMC 4MW3A 3N2KB 1NU1H 2UXDO 1E79G 5LBQA 3OTFA 5CN0A 5IYDO 3W7XA 3QO8A 2ZNIA 3H1IH 4UFZA 2AZ2A 2VQEB 2YXLA 2HKOA 2ATKC 4NVPA 4O4LB 1HNXO 2ADQB 1GRJA 1MSDA 3CSXA 3K79A 4I55A 3ZS8C 4CH5A 3CJHB 3OM3B 1IBKB 4UB8Z 4O4IB 2YIAA 5KX5B 2WLMA 5LYJB 2QA4V 2UXCB 5B66Z 4JF3A 4TV8B 5J2TB 1HP8A 3N2KA 2P67A 1XMQB 3D36C 4TV9A 4JTDB 1Z5VA 3L70H 1XMOO 1B6QA 1NTKH 1G8MA 1N0JA 1I7FA 3CJHA 3OE7G 1S5LZ 4O4IA 2WLKA 2IW5A 2ZNJA 3U10A 3P30A 4DV0O 1DK1A 4GX2A 5JH7B 3CCRV 4J9ZB 4TSFG 4Q6GA 3ABMB 4L8JA 1Y66A 2WAMA 2GHYA 2OCHA 2CAZC 1IXBA 4G28B 1H2MA 2EIJC 3JALB 1OCCC 5LL6Y 3B8MA 2W6IG 3CWBH 3T1CA 3CS5A 3DTUB 1OV9A 1URFA 4UVCA 4JI8B 1VQ9V 4O2BB 3SDLA 3B77A 2VQEO 1JMKC 2EIMB 1EBOA 2P90A 2QWRB 4UXNA 3L73H 1IBKO 4AILC 4LNUA 2F1MA 3JALA 2UXCO 1TAEA 1K8AW 4I7ZB 2XTAA 4DRXB 1XMQO 2ITDC 3CXHF 2WLJA 5FPOA 3HKCB 1H8EG 4PA4A 3AG2C 5DM6V 1GN4A 1S0VA 4JV5B 4X1IA 3F5WC 3A0HZ 5L3DA 2PY5A 3JSNA 1YTFD 4HNAA 3B40A 1L0LH 4PJ0Z 4H13B 4JZ2A 1JOYA 4DW0A 4FM2A 3FFQA 3BA8A 2HR3A 4HAMA 2OT5A 3UQ8A 3CPWU 1BSMA 1O9HA 2XUMA 1KBHA 4YXWG 4OXSA 5C8YB 2BOCC 3D36A 3L72H 2R9IA 1L0NH 2F95B 2XASA 4EKWA 1R1BA 5EIBD 1SQQH 1IDSA 3ZMTA 4JI8O 2EIJB 1BCCH 5FL7G 3M8AA 1OCCB 2IM9A 2EULA 3E22B 1D5AA 1OCOC 1AJPA 5C8YA 2PF4E 4PHZA 4FZ0A 1P49A 4IYHA 2WLNA 4JTAB 5K1XA 1YSCA 5IE9A 2FMLA 5L3CA 1QU7A 3A0BZ 1AR1B 1MZFA 1MZEA 5KHGA 2LQTA 3DGEA 2Y4TA 3KCXA 5LP6C 4GKKB 4PDRA 3JSLA 4DUZB 4YIOA 1Y76B 1LR1A 3E22A 3JD4A 1QNMA 3L74H 5H6QA 4JV5O 2R9AA 1RPOA 2P7TC 2JEUA 1YVWA 5DN6G 4LP8A 4ZIBA 1NH2B 3AG2B 3ZEDA 1YJ9V 2D3OW 3OEHG 3SJQC 2FTKA 1N8RW 2E5LB 2ZDIA 1K92A 3X2QC 2CGNA 2WLHA 2CTRA 5IJ0B 2ADPA 4J42A 2AXTZ 2N74A 1Y76A 4R7CA 3HR0A 1FPOA 4FM0A 4KHPB 1QLEC 4E2LA 1R3KC 4YJ2B 3FB8C 1XI1A 3IAYA 4QGPA 3I55V 5IYBO 1U96A 3UCSC 5EC2C 4LF9B 1YITV 2ZXWC 5IJ0A 2IJIA 1KMIZ 2RJZA 4U3FH 1I08A 2EINB 4QPKA 4JI2B 4N21A 1K4CC 4TUYA 5IY5C 3H1HH 4FLWA 1AI6A 3E83A 1TGOA 5EK0A 4DR4B 3B4SA 4MVUA 1OCOB 4O4JA 1VARA 2WLLB 3JATB 3K5OA 5TISZ 3E8HA 1WN7A 4C7UA 1BQZA 1SA0A 4GKKO 4DUZO 3CX5F 5LXTA 3UM7A 4QE7A 1W59A 2OIGA 1KKDA 2ZM6B 1BL8A 5LP6B 2LFSA 1ROPA 3CYOA 1QLNA 3LSSA 1FD9A 1S5JA 3G80A 5L3EA 3KCYA 1NBMG 2E5LO 2FYUH 4DYLA 5BY1A 4I50B 3LNMB 4NYKA 2LGWA 1AP5A 4KXRA 3SJBC 1JA8A 4KHPO 3X2QB 1X4TA 4EB6B 2QM7A 2YS8A 2ZT9B 2WLIB 1DF5A 2Y0PA 4XDLA 3H1LH 1ZWIC 3ZHUA 2ZE7A 1QLEB 1F23A 4LF9O 3IC9A 5J2UB 3BY6A 4B7KA 4FLUA 4O2AB 1UPGA 5BZBA 3K04A 5B5EZ 1Q90D 1JX9A 1WB7A 2PYJA 2JRIA 4JI2O 1SQBH 3DXRA 1GO3F 2ZXWB 1LUVA 4EB6A 4H0LB 5KHHA 3MHHC 2YEVB 1Q82W 3RYFA 3THOA 4DR4O 3STZC 4BAYA 2KB1A
chains in the Genus database with same CATH topology
4KXRA 4W4LA 4J41A 4J11A 2G38A 2GTSA 4J7KA 4IYIA 4W4KA 4J42A 4J10A 4J7JA 3FX7A 4IYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KXR A;  4W4L A;  4J41 A;  4J11 A;  2G38 A;  2GTS A;  4J7K A;  4IYI A;  4W4K A;  4J42 A;  4J10 A;  4J7J A;  3FX7 A;  4IYH A; 
#chains in the Genus database with same CATH topology
 1S5H C;  5IY5 B;  3RYC A;  4YHH B;  4UV8 A;  1BZK A;  5J2U A;  4HYO A;  3JD0 A;  4JYB A;  2Q0A A;  4O2A A;  1E1Q G;  4J41 A;  4HZ3 A;  4LF4 B;  2CUG A;  1S77 D;  2FL4 A;  2ZM6 O;  3HKE A;  2YEV A;  1K5Q A;  4JI4 B;  3HKB A;  3ZRV A;  1XUQ A;  2A9H A;  1H2L A;  1VQ7 V;  2RQ6 A;  3CEI A;  4RUF A;  3W7W A;  1Q8I A;  5LGN A;  3JCZ A;  4WFG A;  1QQC A;  3F7V C;  2Z5U A;  4JAU A;  2NR5 A;  4DV5 B;  3AG3 C;  4RAI A;  2UXN A;  4MVR A;  4X65 B;  3J7A U;  3DC6 A;  5LA6 B;  1NH2 D;  4I9Q A;  1YCI A;  1XEQ A;  4MVM A;  5H5N A;  5IJ9 A;  2AW9 A;  5B3S C;  3J80 N;  3NXS A;  3M7M X;  1AI5 A;  4MVZ A;  4G2K A;  5JJE B;  1FFT B;  1QR8 A;  1AR4 A;  3CB2 A;  2ZIN A;  4GYC B;  5LA6 A;  3ZMS A;  4YHH O;  5L3B A;  2H3O A;  3SYA A;  3E8G A;  1VF5 B;  3E89 A;  3ZRS A;  2OWO A;  2L35 A;  3H1J H;  4QPJ A;  1HNZ B;  4LF4 O;  3T4D A;  1KUQ A;  1XBL A;  3TCU A;  2EX3 A;  3UO2 A;  2R72 A;  4K8X A;  1BGY H;  1NS1 A;  4CH4 A;  4JI4 O;  1JJ2 U;  2Q73 A;  2BSK A;  2GBO A;  1TA8 A;  4UCS A;  5B1N A;  4NTY A;  4B08 A;  4LFB B;  3BCC H;  1I0H A;  2X0L A;  2NLJ C;  4MW8 A;  5E79 Z;  2QM8 A;  4DV5 O;  1SS3 A;  2UXX A;  1Q6I A;  5CMU A;  1PL0 A;  1ZLZ A;  4X65 O;  4NTW A;  4X88 A;  2HHH B;  1P4R A;  4W4K A;  3ETQ A;  4PI0 A;  3CCM V;  2DWE C;  2IBZ H;  3MAQ A;  3AG3 B;  4GX5 A;  1AVM A;  2JDI G;  4YJ3 B;  3QTC A;  1J95 A;  1K34 A;  3RYI B;  4WFA V;  5LOV B;  1K97 A;  4K3A A;  4CS3 A;  3EXA A;  4DV1 B;  5B3S B;  4FLT A;  5EBM C;  4UUJ C;  2RMK B;  5LGT A;  4Z1M G;  1FFX B;  2ITC C;  4I9W A;  3STL C;  4DV4 B;  1ZTE A;  2IU0 A;  1XHX A;  1VIB A;  1WNS A;  2JS3 A;  4YJ3 A;  2YUA A;  3RYI A;  3LSU A;  1HNZ O;  5CBH A;  3GVM A;  4FVM A;  2JVD A;  1DGS A;  4RUE A;  3R66 A;  1A32 A;  2VRZ A;  2QDO A;  4LF7 O;  2N04 A;  3ZJZ A;  3LDE A;  3L71 H;  4WCE V;  1ZL8 A;  2V7Q G;  4JI0 B;  4I5S A;  1JVM A;  4LFB O;  3S3W A;  2Q4P A;  4KL1 A;  3IC7 A;  2B9Z A;  3VQV A;  2CGO A;  4GX0 A;  4YIP A;  3ASO C;  3CRM A;  3WB2 A;  2HHH O;  2QGN A;  1SZX A;  2CE4 A;  4IHJ A;  4BR6 A;  2ARH A;  4FLV A;  1OCZ C;  4JI1 B;  4DR2 B;  5IYZ B;  2YID A;  3HPL C;  2UUA B;  4DV1 O;  3QO7 A;  3G71 V;  3ICX A;  4O4H B;  2GSM B;  1UJW B;  4DV4 O;  4IT5 A;  3AK3 A;  1F7Y A;  3CCL V;  2OTJ V;  3ZHV A;  5KUM A;  2G38 A;  2QKC A;  1SET A;  2H8P C;  1K5S A;  3JCU Z;  1NT2 B;  4O4H A;  3OTO B;  1BHA A;  2KG7 A;  1FS0 G;  2HVK C;  3K3W A;  4TQD A;  3CRR A;  3T4Z A;  1SRY A;  4RQF A;  4TT3 G;  3TXS A;  4JI0 O;  1K4D C;  2A3Q A;  5BR8 B;  2WWW A;  4LCU C;  1VQK V;  3SYQ A;  3B09 A;  1JPX A;  3FX7 A;  4JAV A;  1WP7 A;  4O4L A;  1XOU A;  3N2G B;  3JAS B;  3FYI B;  1O9G A;  1GH6 A;  5AG2 A;  4P2Z A;  3G4S V;  2W0F C;  5KX5 A;  1GN2 A;  5LYJ A;  1G4Y B;  4TV8 A;  4LFA B;  1PNL A;  5J2T A;  3FD9 A;  1G1X B;  4JI1 O;  3ASO B;  4KUM A;  1YZB A;  4DR2 O;  1XL6 A;  4P30 A;  2UUA O;  3JAK B;  4J9Y B;  3BHP A;  1OCZ B;  2YIC A;  2P06 A;  3N2G A;  3T1H B;  3VBB A;  3OEE G;  4NB5 A;  3JD1 A;  4IL6 Z;  4AHC A;  2Y69 C;  1KP2 A;  4CH6 A;  5JH7 A;  1XIL A;  2VWJ A;  4U3J B;  1Q6H A;  1K3E A;  3R65 A;  1OHH G;  4KP4 A;  4WFE A;  3JAK A;  4GLX A;  3CRA A;  5FNV B;  3OTO O;  5GTI Z;  1SES A;  2VQF B;  2CTW A;  2AZ0 A;  1L8D A;  2Q9L A;  2ZCE A;  1J5E B;  1VF6 C;  3QVN A;  3ZRW B;  4U3J A;  1KYO F;  1BT8 A;  1SQF A;  5BR8 O;  2OTL V;  2WA4 A;  4O2B A;  4MSW C;  3B8N A;  3RW0 A;  1BE3 H;  1NKD A;  4LFC B;  1QHT A;  1WB8 A;  2E76 B;  1HWY A;  3K58 A;  4B3T B;  4LFA O;  5KA5 A;  1COW G;  2WSS G;  3ZRW A;  2PYL A;  4MS2 A;  3W7U A;  3CCS V;  2ZQM A;  4DRX A;  3RBZ A;  1ORQ C;  3HKC A;  5KA6 A;  1WJZ A;  3ZRX A;  4FLX A;  5JWP A;  4DV7 B;  1K73 W;  4K35 A;  3T1H O;  4MVS A;  4BW9 A;  4LF6 B;  4JPR A;  1VEW A;  4WF9 V;  1M9N A;  4JAS A;  2AGA A;  2CK3 G;  4A5U B;  1Y6X A;  4EFE A;  1HR0 B;  4FPP A;  2Y69 B;  4JI7 B;  2Y0I A;  5D5Q A;  2IH3 C;  2Z3Y A;  2DYS C;  3AEI A;  1ZX3 A;  3CCQ V;  1THZ A;  1W0K G;  2QWO B;  3ZHR A;  1J5E O;  1LUW A;  1FXV A;  2ODM A;  1XQ8 A;  2PI4 A;  2RNB A;  1CXZ B;  4G27 B;  3P32 A;  4FLY A;  3JD2 A;  4J7K A;  3CRC A;  2O57 A;  1Q86 W;  4GT1 A;  1NTM H;  4OPH A;  5GTH Z;  1S76 D;  3SYC A;  2F43 G;  4LFC O;  5KAF Z;  3LSQ A;  2Q7G A;  2DWD C;  4BWA A;  4MVO A;  4YY3 B;  3ZMU A;  4B3T O;  3T1Y B;  2ZE6 A;  3DSQ A;  3WFV A;  1OCR C;  4R6Z A;  1T5E A;  1N4C A;  1M56 C;  5A2Q N;  2BOB C;  3MD0 A;  2DJV A;  2X6C A;  4DV7 O;  3TXQ A;  3K5N A;  3O9O A;  1VQO V;  4RWU A;  1N36 B;  2P4K A;  5IYC O;  3ZHS A;  1F4N A;  4CC5 A;  4LF6 O;  5KMG B;  1N0N A;  3WB1 A;  1RFY A;  2Z0A A;  3TJT A;  1HR0 O;  1FXH A;  4LF5 B;  1JFF B;  1JR9 A;  3RVZ A;  3BFR A;  4JI7 O;  4DV6 B;  4H44 B;  2EJR A;  5ITZ B;  5IT9 N;  5JQG B;  2YIB A;  4FFB B;  4YJ2 A;  3WB0 A;  2CH7 B;  2BTQ B;  5KMG A;  1IZ3 A;  3JD3 A;  3UO3 A;  1GKF A;  2DYS B;  1FJG B;  4MTX A;  2FKX A;  1GN3 A;  1NI8 A;  3WG7 C;  2GUZ B;  3J81 N;  2LFR A;  2PZS A;  2A0L A;  3CCE V;  4YY3 O;  3SGI A;  3T1Y O;  2WLL A;  3O65 A;  1X59 A;  3JAT A;  2A06 H;  2JEX A;  4K0K B;  3TET A;  4E4E A;  1SQG A;  3ZIA G;  1OCR B;  4LR3 A;  4UV9 A;  5LP6 A;  1N36 O;  4TQF A;  1M56 B;  3F5T A;  1EZV H;  1SQP H;  4UVB A;  3H01 A;  5IWA B;  4B3M B;  2Q7H A;  2VWK A;  1IX9 A;  4I50 A;  2LGQ A;  4LF5 O;  3U0Z A;  4H33 A;  2CTP A;  2W6J G;  5GON B;  5EZY B;  4DV6 O;  4W4L A;  1IVS A;  3S3X A;  2ZE8 A;  1I5Y A;  2WLI A;  3CHX A;  3IGA C;  2QKA A;  1BMF G;  3MDS A;  1EN6 A;  2HLD G;  1FJG O;  1LNQ A;  3FB6 C;  4UCT A;  5FPR A;  1ENV A;  3CRQ A;  3I56 V;  1KC8 W;  3ASN C;  1AJN A;  5EZY A;  1AR5 A;  2HFE C;  3RVY A;  3C3T A;  1AB3 A;  4K8Z A;  1CP9 A;  1NTZ H;  3WG7 B;  3G6E V;  4K0K O;  3L75 H;  1N33 B;  1KU9 A;  1AI7 A;  3ZBH A;  2Q0O C;  2ILM A;  3ZHQ A;  4J7Z A;  2P5O A;  4B3R B;  3BEH A;  2OYQ A;  1XDC A;  4DV3 B;  1PNM A;  5IWA O;  4B3M O;  3PJS K;  2JGD B;  4ABM A;  3RT3 C;  2QR4 A;  2P6J A;  1P7B A;  5LHI A;  2ZD9 A;  1YEW A;  3FAV B;  3HB3 B;  4AQY B;  1H2G A;  1KD1 W;  2K9P A;  1R3J C;  3ABK C;  4DXW A;  2YIB D;  3K5L A;  4B7E A;  1P84 F;  4CS4 A;  3D8C A;  5H6R A;  1KEC A;  3H1K H;  4PEL A;  2A79 B;  3ABT A;  4WFH A;  2OCC C;  1Y4M A;  2WA3 A;  2F93 B;  3N27 A;  4X89 A;  4I4T B;  3OUS A;  2BTO A;  2XHB A;  2IH1 C;  3OR6 C;  1K33 A;  4LWS B;  4OGQ B;  5KLV H;  3ASN B;  4JI6 B;  3K0D A;  5FLX N;  1NJI W;  1TUE B;  4N23 A;  2ZKO A;  1N33 O;  3SYO A;  1YF2 A;  4GX1 A;  3NR7 A;  1GTO A;  4L87 A;  4EFB A;  3OMN B;  1Q6U A;  4B3R O;  3RYH B;  1WAZ A;  4U7N A;  2CDY A;  4LWS A;  5H2F Z;  4DV3 O;  2Q7E A;  2F4V B;  3CMA V;  2QE7 G;  3HKD B;  4JI3 B;  4AQY O;  3LDD A;  3CP1 A;  3VOU A;  3RYH A;  4DV2 B;  2N05 A;  4ICG A;  2QM4 A;  4PA6 A;  1VMG A;  4X8A A;  3Q4H B;  2UU9 B;  2B1G A;  1K7D A;  4FFK A;  2XAJ A;  3ABK B;  1F4M A;  2YSU B;  3L9D A;  2ETN A;  3HKD A;  2Q67 A;  4FM1 A;  1PL4 A;  3SJC C;  4EEQ A;  2F23 A;  1QR9 A;  5LOV A;  4IIJ B;  1U97 A;  5JCO C;  3QO5 A;  4UCR A;  2BCC H;  4ZOL B;  1WA8 B;  1FFX A;  3E8F A;  3Q4H A;  1MMM A;  2OCC B;  4D6T H;  4JI6 O;  4J11 A;  2DMX A;  2X6B A;  1TUB B;  4JYY A;  3EFF K;  1M4U A;  3K03 A;  4IIJ A;  1ZAU A;  3ZX6 A;  4BIZ A;  1YJN V;  2Q68 A;  5LMN B;  1GM9 A;  4UCU A;  3OD4 A;  1Y74 B;  5JVD B;  2PUS A;  4JTC B;  4P9O A;  1QCE A;  1WA8 A;  2XOK G;  3TK1 A;  1XHZ A;  1HW7 A;  2F4V O;  3GB7 C;  5EBW C;  4Z2W A;  1TUB A;  5CA1 B;  4X1Y B;  4JI3 O;  5KHI A;  2NN4 A;  4RQE A;  3CCJ V;  1XL4 A;  4QIW F;  3SJA C;  4DV2 O;  1F51 A;  3SPC A;  2IJH A;  1K9M W;  1CPY A;  4CBC A;  1MG1 A;  4DO2 A;  1VQ8 V;  2UU9 O;  2BE3 A;  2EZP A;  3D3Q A;  1XNQ B;  2X6A A;  3DC5 A;  3BPZ A;  1Q81 W;  2EBO A;  4I0X B;  3K9A A;  5CA1 A;  1RSO B;  1WP8 A;  3LUT B;  3PN1 A;  2JJ1 G;  1VP7 A;  1S72 V;  4QJF B;  5C93 A;  5IYZ A;  2V4D A;  3ABU A;  3VQX A;  3FB5 C;  1MSW D;  3F7Y C;  4I55 B;  3EHB B;  3ML0 A;  2YI8 A;  1Q7Y W;  2QWP B;  4I0X A;  1RSO A;  4TV9 B;  3K08 A;  2RDC A;  4NKG B;  5LMN O;  1FKA O;  2K1E A;  2P22 C;  1EFR G;  2A7W A;  3JAM N;  5KHJ A;  1MAB G;  5JCO A;  3GWO A;  3RWR D;  1V55 C;  3LNN A;  5EYP B;  3AG4 C;  1SC5 B;  3A0R A;  3KKY A;  3TGU H;  4Q20 A;  5IDJ A;  4DR1 B;  1Q5O A;  1BS3 A;  3JAS A;  1CEZ A;  1XNQ O;  1B04 A;  3OFN G;  4UCO A;  1US6 A;  2GV9 A;  3SYP A;  1V9P A;  3E35 A;  2AHZ A;  2FB5 A;  5EYP A;  4GZR B;  1QVF U;  1FXK C;  4JI5 B;  1VQ6 V;  4LF8 B;  4GUN A;  3OMA B;  5BXZ A;  1PNK A;  3ZN1 A;  3I5D A;  4F4L A;  3ABL C;  4LNU B;  1JCH A;  1D2D A;  3LDC A;  1DTO A;  3BVO A;  2QWQ B;  1M5I A;  3K59 A;  4IGG A;  3OT7 A;  1YHQ V;  2JK5 C;  3CC2 V;  1IXM A;  2GTA A;  4FJC C;  1H2S B;  4X1I B;  2ZDI C;  5FNV A;  2RN9 A;  5B1B C;  4HNA B;  3CE2 A;  2WPD G;  3K0G A;  4D7S A;  3APQ A;  1GN6 A;  4PA9 A;  2KSD A;  4WFB V;  3ZN0 A;  4OPA A;  3BAA A;  1GAX A;  4FMT A;  4DR1 O;  1E1R G;  2KKW A;  3E2E A;  1V55 B;  2PTM A;  3AG4 B;  1M57 C;  1Q43 A;  2KQX A;  2Y48 A;  3ETG A;  1XRE A;  3AK2 A;  2XAF A;  1ZUQ A;  4QE9 A;  5F2V O;  2AHY A;  4JI5 O;  4HBN A;  4LF8 O;  2YDE A;  4NXM B;  3QF7 A;  3CME V;  2Q69 A;  5CBG A;  2EIL C;  2HP8 A;  4JGS A;  4X1K B;  1FXK B;  3M99 B;  5JJN B;  2R9R B;  5D5P A;  2IJK A;  4Z1V A;  5B1O A;  2LJ2 A;  2VQF O;  4F6E A;  3BRC A;  2EIN C;  2XAG A;  3OGI B;  2QJ1 A;  3ABL B;  4FZ1 A;  4CZZ A;  2YI9 A;  2DQ0 A;  2PI5 A;  1BHB A;  1D5N A;  4NXN B;  1HNW B;  2HJD A;  1EM1 A;  3ETD A;  4QNH B;  4MTG A;  1EN4 A;  1R6N A;  4X1K A;  4LC1 A;  2M7W A;  1FXK A;  3IJ4 A;  3OW2 U;  1RPR A;  2Q5Z A;  5CA3 A;  4X66 B;  3AG1 C;  1VQL V;  3SPG A;  4DK0 A;  3UT5 B;  1WPX A;  3UKM A;  5B1B B;  3ETE A;  1IUR A;  3VQW A;  4IYI A;  1YI2 V;  2GTS A;  1FYJ A;  1VF6 A;  2YXY A;  1EN5 A;  3WU2 Z;  5L3F A;  3AK1 A;  3A8T A;  4DW1 A;  2XND G;  1AP6 A;  4KFM A;  1M57 B;  3UT5 A;  1VQN V;  4RO2 A;  1IBL B;  2JIZ G;  2JJ2 G;  4NXM O;  1MOF A;  1R6K A;  2P4V A;  1GM8 A;  4BIU A;  4TUY B;  5CA0 B;  1SF9 A;  1I94 B;  3FYE B;  3EVK A;  3JAR B;  3JYC A;  1GM7 A;  4JAA A;  3SR2 C;  4O4J B;  1R3L C;  2EIL B;  5HFL A;  4GKJ B;  3K9S A;  4DR3 B;  3FKS G;  1SA0 B;  1FAF A;  4NXN O;  1NQT A;  3KZI Z;  5JJJ B;  1MA1 A;  4UCV A;  1HNW O;  3OUF A;  4ZBM A;  1JFF A;  1TVK B;  1P7G A;  2ZIM A;  3ZMZ A;  5LXT B;  5LHH A;  1R6T A;  5CA0 A;  2IJJ A;  2ZIO A;  3JAR A;  3D3I A;  5ITZ A;  5JQG A;  4FFB A;  1EZJ A;  4NR1 A;  4X66 O;  2Y4U A;  4JYC A;  4X64 B;  1M90 W;  2CH7 A;  2D2C B;  4NTX A;  1VQP V;  2BTQ A;  2YXH A;  1Z5W A;  3GWK C;  1BQ0 A;  1KKC A;  3AG1 B;  4BW5 A;  1TVK A;  5LMU B;  1ZSP A;  4ASU G;  4XBF A;  2HVJ C;  3CXC U;  3B2E E;  1QVG U;  1PKX A;  2GUZ A;  4CH3 A;  1SZT A;  4DR6 B;  4PI2 A;  1AJQ A;  4FIP C;  4PDV A;  4FLZ A;  1GMG A;  2DE0 X;  2MK3 A;  1RP3 B;  3RGB A;  1IBL O;  1OZ0 A;  1L1F A;  5DEC A;  4FK5 C;  2GDS A;  4UB6 Z;  3OGC C;  5GW7 A;  3SPI A;  4OX9 B;  5HFM A;  3DXR B;  2DW4 A;  3C3S A;  1I94 O;  3P3P A;  2C2A A;  2QTS A;  1H38 A;  4PA7 A;  2QWN B;  3RYF B;  3W7T A;  2QSA A;  4X62 B;  3RYC B;  3H9V A;  2JGU A;  4GKJ O;  3APO A;  1SQV H;  4DR3 O;  3W7S A;  2B5U A;  2IU3 A;  4TWK A;  2RCV A;  5GON A;  2QKS A;  3OR7 C;  2HEP A;  4MTO A;  5KHK A;  3HKE B;  3OAA G;  3QG5 A;  1RM1 C;  3HKB B;  1R3I C;  4X64 O;  1DF4 A;  4P9P A;  3AG7 A;  4XDJ A;  2UUC B;  1R73 A;  2UUB B;  4JYA B;  1V54 C;  1H2N A;  1XNR B;  5L3G A;  2LO1 A;  5LMU O;  4J80 A;  1YDX A;  2XAQ A;  3CCU V;  1IBM B;  3T2M A;  4LH7 A;  2ZR3 A;  5B1A C;  4DR6 O;  2DYR C;  1PPJ H;  4ZKI A;  1GK9 A;  4DR5 B;  5IJ9 B;  1H8H G;  1ARO P;  2ZE5 A;  1H2K A;  3K5M A;  2XT9 A;  3VQY A;  2F66 C;  4CC6 A;  2JS5 A;  1NVP B;  4OX9 O;  1VQ4 V;  3BA9 A;  3FB7 C;  4BIO A;  1OJH A;  2LP7 A;  1Q3E A;  2W0X A;  3ZHT A;  2EZO A;  4R50 A;  5CBF A;  4CS2 A;  4X62 O;  2EIK C;  3CC4 V;  1YXB A;  4DUY B;  2DOS A;  2JGD A;  4DK1 A;  2DN9 A;  5EBL C;  2VS0 A;  1G6U A;  3FAV A;  1KQS U;  1PV0 A;  1VQ5 V;  4AI8 A;  1HDJ A;  5LHG A;  1JQ0 A;  2BSK B;  4PDL A;  3E8B A;  2UUC O;  2UUB O;  4JYA O;  4WBN B;  4D7T A;  1Y67 A;  1XNR O;  1RM1 B;  2MW2 B;  1QBZ A;  4DR7 B;  3C90 A;  1N34 B;  1V54 B;  1VQM V;  1KP3 A;  1KB9 F;  1IBM O;  3U11 A;  5K1P A;  4B3S B;  2E75 B;  4I4T A;  1DLB A;  2R70 A;  4JZG A;  4WFF A;  5LGU A;  4LF7 B;  3CD6 V;  1SKV A;  3RFR A;  2X7R B;  2OIE A;  4WBN A;  4DR5 O;  1PP9 H;  5DED A;  3E86 A;  2NNU A;  3G67 A;  5B1A B;  1VF7 A;  2DYR B;  1PM9 A;  3OMI B;  4ZHQ B;  3IFX A;  4J7J A;  1PD3 A;  5EIB C;  1B3Q A;  1YIJ V;  3KG2 A;  2E74 B;  3ZCC A;  3BAB A;  3CC7 V;  1B06 A;  4J10 A;  2PGG A;  1WLE A;  5EC1 C;  4DUY O;  3K57 A;  2QTO A;  1N32 B;  4XDK A;  4UVA A;  4ZI7 B;  2EIK B;  2B1I A;  4ZHQ A;  5H9C A;  4MVQ A;  2HJF C;  2UXB B;  4X20 B;  2Q6A A;  5BMV B;  1MNG A;  4U7O A;  5KAI Z;  4MT8 A;  3K06 A;  2LW7 A;  1Z2G A;  4PDM A;  2UXD B;  1AI4 A;  1ZL8 B;  5KUK A;  4DR7 O;  2E3C A;  4X9Q A;  4H37 A;  2LW1 A;  4ZI7 A;  1SER A;  1JJO A;  1YJW V;  1N34 O;  4TOI A;  5E1A C;  1HNX B;  3A2F A;  4PD4 F;  4B3S O;  3SPH A;  4X20 A;  4PV1 B;  5A9G A;  5BMV A;  4ZOL A;  1W2B U;  2XAH A;  1YTF B;  4IHJ B;  2YC0 A;  4LH6 A;  1M93 A;  3JAW B;  5CB4 B;  4LBE C;  3CCV V;  2ZR2 A;  3SPJ A;  2HG5 C;  4F6R B;  1XMO B;  1NR1 A;  1Y74 A;  5JVD A;  1UFI A;  3MHS C;  3ABM C;  5J9P C;  2M6Y A;  1WPB A;  2Q8V A;  1NZ6 A;  2H94 A;  4DV0 B;  3ZMV A;  1M1K W;  3G6B A;  1N32 O;  3P3N A;  4PA3 A;  4X1Y A;  2V1D A;  3JAW A;  5CB4 A;  1AIL A;  1NR7 A;  2QEX V;  1NVP D;  1SQX H;  3QNE A;  2DQ3 A;  4F6R A;  3RN4 A;  4R8C A;  4MTF A;  2UXB O;  1S3J A;  1W0J G;  2KG7 B;  2L6L A;  2EJ7 A;  2CTQ A;  4GCZ A;  1I5X A;  2EIM C;  4MW3 A;  3N2K B;  1NU1 H;  2UXD O;  1E79 G;  5LBQ A;  3OTF A;  5CN0 A;  5IYD O;  3W7X A;  3QO8 A;  2ZNI A;  3H1I H;  4UFZ A;  2AZ2 A;  2VQE B;  2YXL A;  2HKO A;  2ATK C;  4NVP A;  4O4L B;  1HNX O;  2ADQ B;  1GRJ A;  1MSD A;  3CSX A;  3K79 A;  4I55 A;  3ZS8 C;  4CH5 A;  3CJH B;  3OM3 B;  1IBK B;  4UB8 Z;  4O4I B;  2YIA A;  5KX5 B;  2WLM A;  5LYJ B;  2QA4 V;  2UXC B;  5B66 Z;  4JF3 A;  4TV8 B;  5J2T B;  1HP8 A;  3N2K A;  2P67 A;  1XMQ B;  3D36 C;  4TV9 A;  4JTD B;  1Z5V A;  3L70 H;  1XMO O;  1B6Q A;  1NTK H;  1G8M A;  1N0J A;  1I7F A;  3CJH A;  3OE7 G;  1S5L Z;  4O4I A;  2WLK A;  2IW5 A;  2ZNJ A;  3U10 A;  3P30 A;  4DV0 O;  1DK1 A;  4GX2 A;  5JH7 B;  3CCR V;  4J9Z B;  4TSF G;  4Q6G A;  3ABM B;  4L8J A;  1Y66 A;  2WAM A;  2GHY A;  2OCH A;  2CAZ C;  1IXB A;  4G28 B;  1H2M A;  2EIJ C;  3JAL B;  1OCC C;  5LL6 Y;  3B8M A;  2W6I G;  3CWB H;  3T1C A;  3CS5 A;  3DTU B;  1OV9 A;  1URF A;  4UVC A;  4JI8 B;  1VQ9 V;  4O2B B;  3SDL A;  3B77 A;  2VQE O;  1JMK C;  2EIM B;  1EBO A;  2P90 A;  2QWR B;  4UXN A;  3L73 H;  1IBK O;  4AIL C;  4LNU A;  2F1M A;  3JAL A;  2UXC O;  1TAE A;  1K8A W;  4I7Z B;  2XTA A;  4DRX B;  1XMQ O;  2ITD C;  3CXH F;  2WLJ A;  5FPO A;  3HKC B;  1H8E G;  4PA4 A;  3AG2 C;  5DM6 V;  1GN4 A;  1S0V A;  4JV5 B;  4X1I A;  3F5W C;  3A0H Z;  5L3D A;  2PY5 A;  3JSN A;  1YTF D;  4HNA A;  3B40 A;  1L0L H;  4PJ0 Z;  4H13 B;  4JZ2 A;  1JOY A;  4DW0 A;  4FM2 A;  3FFQ A;  3BA8 A;  2HR3 A;  4HAM A;  2OT5 A;  3UQ8 A;  3CPW U;  1BSM A;  1O9H A;  2XUM A;  1KBH A;  4YXW G;  4OXS A;  5C8Y B;  2BOC C;  3D36 A;  3L72 H;  2R9I A;  1L0N H;  2F95 B;  2XAS A;  4EKW A;  1R1B A;  5EIB D;  1SQQ H;  1IDS A;  3ZMT A;  4JI8 O;  2EIJ B;  1BCC H;  5FL7 G;  3M8A A;  1OCC B;  2IM9 A;  2EUL A;  3E22 B;  1D5A A;  1OCO C;  1AJP A;  5C8Y A;  2PF4 E;  4PHZ A;  4FZ0 A;  1P49 A;  4IYH A;  2WLN A;  4JTA B;  5K1X A;  1YSC A;  5IE9 A;  2FML A;  5L3C A;  1QU7 A;  3A0B Z;  1AR1 B;  1MZF A;  1MZE A;  5KHG A;  2LQT A;  3DGE A;  2Y4T A;  3KCX A;  5LP6 C;  4GKK B;  4PDR A;  3JSL A;  4DUZ B;  4YIO A;  1Y76 B;  1LR1 A;  3E22 A;  3JD4 A;  1QNM A;  3L74 H;  5H6Q A;  4JV5 O;  2R9A A;  1RPO A;  2P7T C;  2JEU A;  1YVW A;  5DN6 G;  4LP8 A;  4ZIB A;  1NH2 B;  3AG2 B;  3ZED A;  1YJ9 V;  2D3O W;  3OEH G;  3SJQ C;  2FTK A;  1N8R W;  2E5L B;  2ZDI A;  1K92 A;  3X2Q C;  2CGN A;  2WLH A;  2CTR A;  5IJ0 B;  2ADP A;  4J42 A;  2AXT Z;  2N74 A;  1Y76 A;  4R7C A;  3HR0 A;  1FPO A;  4FM0 A;  4KHP B;  1QLE C;  4E2L A;  1R3K C;  4YJ2 B;  3FB8 C;  1XI1 A;  3IAY A;  4QGP A;  3I55 V;  5IYB O;  1U96 A;  3UCS C;  5EC2 C;  4LF9 B;  1YIT V;  2ZXW C;  5IJ0 A;  2IJI A;  1KMI Z;  2RJZ A;  4U3F H;  1I08 A;  2EIN B;  4QPK A;  4JI2 B;  4N21 A;  1K4C C;  4TUY A;  5IY5 C;  3H1H H;  4FLW A;  1AI6 A;  3E83 A;  1TGO A;  5EK0 A;  4DR4 B;  3B4S A;  4MVU A;  1OCO B;  4O4J A;  1VAR A;  2WLL B;  3JAT B;  3K5O A;  5TIS Z;  3E8H A;  1WN7 A;  4C7U A;  1BQZ A;  1SA0 A;  4GKK O;  4DUZ O;  3CX5 F;  5LXT A;  3UM7 A;  4QE7 A;  1W59 A;  2OIG A;  1KKD A;  2ZM6 B;  1BL8 A;  5LP6 B;  2LFS A;  1ROP A;  3CYO A;  1QLN A;  3LSS A;  1FD9 A;  1S5J A;  3G80 A;  5L3E A;  3KCY A;  1NBM G;  2E5L O;  2FYU H;  4DYL A;  5BY1 A;  4I50 B;  3LNM B;  4NYK A;  2LGW A;  1AP5 A;  4KXR A;  3SJB C;  1JA8 A;  4KHP O;  3X2Q B;  1X4T A;  4EB6 B;  2QM7 A;  2YS8 A;  2ZT9 B;  2WLI B;  1DF5 A;  2Y0P A;  4XDL A;  3H1L H;  1ZWI C;  3ZHU A;  2ZE7 A;  1QLE B;  1F23 A;  4LF9 O;  3IC9 A;  5J2U B;  3BY6 A;  4B7K A;  4FLU A;  4O2A B;  1UPG A;  5BZB A;  3K04 A;  5B5E Z;  1Q90 D;  1JX9 A;  1WB7 A;  2PYJ A;  2JRI A;  4JI2 O;  1SQB H;  3DXR A;  1GO3 F;  2ZXW B;  1LUV A;  4EB6 A;  4H0L B;  5KHH A;  3MHH C;  2YEV B;  1Q82 W;  3RYF A;  3THO A;  4DR4 O;  3STZ C;  4BAY A;  2KB1 A; 
#chains in the Genus database with same CATH homology
 4KXR A;  4W4L A;  4J41 A;  4J11 A;  2G38 A;  2GTS A;  4J7K A;  4IYI A;  4W4K A;  4J42 A;  4J10 A;  4J7J A;  3FX7 A;  4IYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...