4J41A

The crystal structure of a secreted protein esxb (mutant p67a) from bacillus anthracis str. sterne
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
89
structure length
89
Chain Sequence
SNAMAEIKITPEELERIAGNFKNAAGEAQSQINRLEGDINSLEGQWAGATQAKFRGEFIQSKQAMQQYIAILEGISTDLKRIADKFRNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords secreted protein EsxB
publication title The crystal structure of a secreted protein EsxB (Mutant P67A) from Bacillus anthracis str. Sterne
rcsb
source organism Bacillus anthracis
molecule tags Unknown function
total genus 42
structure length 89
sequence length 89
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 4j41A00
4J7JA 3FX7A 4IYHA 2GTSA 4IYIA 4W4KA 4J10A 4KXRA 4W4LA 4J7KA 2G38A 4J41A 4J11A 4J42A
chains in the Genus database with same CATH superfamily
3T2MA 5IWAB 4PDMA 3WG7B 3GWOA 4NR1A 1SA0B 4CH5A 2P5OA 5LP6C 1B06A 1WP8A 1WN7A 4O4HA 2AXTZ 3A0RA 4LWSB 1UFIA 1NKDA 1F4MA 3H01A 4K3AA 1AI7A 1S0VA 1R73A 3A0HZ 1AILA 3E83A 4MTXA 4U7OA 4MW8A 3RYFA 2F43G 2WA3A 3K58A 3AG1B 4NYKA 2GUZB 3TGUH 2E76B 5CA0B 3OMIB 1FS0G 5IYBO 1VF6C 2E75B 3CRAA 4C7UA 5B1BC 1SF9A 3P3PA 3FYEB 4HAMA 3RW0A 1ZX3A 2EINB 5LOVA 5L3BA 4FLXA 1Y4MA 4RUFA 4DV7B 3RVZA 3DGEA 2DOSA 1S5HC 3KG2A 1NR1A 4B3MO 2Q69A 3GWKC 4GX0A 3SPHA 3MHHC 1W59A 1VEWA 4JI3B 2QR4A 3L74H 4DV7O 2Q4PA 3AG7A 2BSKA 2R72A 3K79A 1AR1B 3VQYA 1N8RW 1R6KA 1WAZA 2RNBA 4OX9B 2OTJV 1VQ8V 3ABLC 4IYHA 4MVMA 1IBMO 3ZBHA 1NH2D 4U3FH 1G6UA 4J7ZA 3K0DA 2QM4A 1NI8A 3JASB 5JQGB 3D36A 4CC5A 2UU9B 3K06A 3G4SV 2DW4A 4X1KA 1RP3B 4OX9O 5LYJB 2F1MA 1ZSPA 4O4JA 3UM7A 1VQKV 4DR7B 2X6CA 2P90A 4HNAB 3MDSA 2HJFC 1VQPV 3CCSV 2QDOA 1O9GA 2UU9O 4JF3A 3FB6C 2IJJA 4LF7B 1Q81W 5IJ9A 2IH1C 5IYZA 2GBOA 1QR8A 4I50A 3RYIB 1E1RG 5EIBD 3LNNA 4FIPC 2YICA 2GV9A 2YIBD 1K33A 4DK0A 4KUMA 1NJIW 4LF7O 3U0ZA 4P2ZA 3TCUA 1H2NA 3CSXA 2XAQA 5KMGB 1XNQB 5B5EZ 3ML0A 1XHXA 4UV8A 2EIMB 4DUYB 2Q73A 1IBLO 1AROP 5EC1C 4G28B 5LA6A 3CC4V 4FK5C 3ZJZA 4D7TA 2N04A 3AK3A 4E4EA 5J2TA 4TWKA 3JD0A 1RSOB 3GB7C 1K34A 2N74A 3P30A 4G27B 4DUYO 5CN0A 3E2EA 4WBNA 3ETEA 4X1YB 2DYSB 2EZOA 3UQ8A 1W2BU 4EB6B 2A0LA 2CH7A 4ICGA 2VQEB 2JIZG 3QO8A 2KB1A 3WB1A 1FKAO 1R3IC 4TV8B 4LF5B 3THOA 4P9OA 3ZEDA 2XTAA 3SGIA 4QGPA 1FPOA 5JCOA 3K3WA 4LH7A 1K92A 2VQEO 1US6A 1PPJH 4Z1VA 4G2KA 2LW1A 3LNMB 4LF5O 3BY6A 3T4DA 1G4YB 2WLHA 2JDIG 3PJSK 3CCJV 1GN4A 3RBZA 4L87A 2F95B 4B3TB 4TT3G 5B1OA 1KD1W 1FXKC 4FM2A 4LR3A 4EEQA 3ASNB 3WFVA 1GAXA 4NTYA 1XDCA 1H2KA 1WPXA 1R3LC 1OZ0A 4FZ1A 3RYCB 3SYPA 3B8MA 4Z2WA 2IM9A 4JI1O 2P4VA 3DC5A 3F7VC 3L70H 4PA4A 2EIMC 4UVAA 5LHIA 2RCVA 3OUFA 2PZSA 1BSMA 4DV1B 3CCEV 3TETA 4ZIBA 1GKFA 1M4UA 4YXWG 3Q4HA 2XNDG 3M7MX 1XEQA 1F51A 4CS3A 2ZDIA 1QLEC 1QR9A 2QWRB 4HBNA 3ZMVA 1CXZB 4UCUA 2HVJC 2DYSC 4DV1O 1N33O 1R3JC 5EZYA 4TV9A 1Y74A 3O65A 4RQFA 3E8HA 4IYIA 1Z5WA 2PY5A 5DEDA 5C8YB 2UXXA 1GK9A 1P7BA 4LF4B 3K08A 3ZRWA 5L3FA 3OMAB 4J11A 2VS0A 4QE9A 4O4IA 1M56B 4FPPA 4JI7B 3OR6C 5CBFA 4K35A 3ZMSA 2Y0IA 1URFA 3I56V 5IY5C 5B3SB 5LBQA 4YJ2A 5JJNB 4K8XA 1FD9A 2JJ2G 2XAFA 4TQDA 4FLYA 4KXRA 2ATKC 3M99B 3OTFA 1S5LZ 4JI7O 3CMAV 5IJ0B 3ZHUA 3JALA 2FTKA 1ENVA 3FB5C 1OV9A 2JVDA 2KSDA 3L73H 4I5SA 3OD4A 3OEHG 5LP6A 3P3NA 1BL8A 2L35A 3C3TA 1D2DA 3FAVB 4X20A 4DV2B 4DR3B 3BABA 5BXZA 3VQVA 3AG2B 3OE7G 2JGDA 4MVUA 3N2GB 3JAKB 5A2QN 1TUBB 3OM3B 3P32A 3JARA 3D3QA 5KUKA 5L3DA 1L0LH 2Q5ZA 1VF6A 4DR3O 4IIJB 2QM7A 2M7WA 5KAIZ 3QF7A 1HWYA 1XBLA 4JZ2A 2YC0A 2OIEA 5FL7G 2OCCC 1FYJA 1ZTEA 3AG4B 2DQ3A 2V1DA 4F6EA 4YJ3A 4CZZA 4Q20A 3SYQA 4I4TB 1S72V 5HFLA 4QE7A 2VWKA 4I55A 1THZA 3FYIB 3B4SA 1OCCC 4X1IA 2Y48A 3APOA 2W0FC 1EN5A 2PF4E 3LDCA 4WCEV 4DV4B 1H8EG 1K4DC 1SRYA 4BWAA 4LF9B 5L3CA 5D5PA 1L1FA 1KECA 2M6YA 2RMKB 5LMUB 3HKCB 4NKGB 4DV6B 3IGAC 1OCRC 3K5NA 2KKWA 1V9PA 4I0XB 1Q6IA 4BR6A 2EIJC 1MG1A 3E35A 2YXHA 4LF9O 3ABTA 4DRXB 4DR4B 2DWEC 5JH7B 2DQ0A 1BE3H 3RYHB 3CC7V 1K3EA 5LMUO 4J7JA 4DV6O 3MAQA 2ARHA 3K04A 3K5OA 2OTLV 3JCUZ 2GUZA 4DR4O 2WLLA 4JV5B 4PV1B 3FKSG 3BFRA 4FFKA 3ZN1A 3ABMB 3BAAA 1VQOV 3I55V 4UB6Z 1FFXB 4QIWF 1B3QA 4J9ZB 5FNVA 1Y66A 1BMFG 3CRMA 5CA3A 5KHKA 4FLTA 2WLIA 2BOCC 3STLC 3VBBA 2CTQA 2X0LA 5KX5A 1R6NA 3SJBC 5JJJB 3ZMZA 2PYJA 3CRCA 3ZIAG 3BEHA 5D5QA 3JATB 3CJHA 5LGNA 1TGOA 5LHGA 1FJGB 2UUCO 5LXTA 1NQTA 1SZTA 4X88A 4L8JA 3LSSA 3K57A 1G1XB 4LFAB 3UCSC 4RO2A 4NTWA 2PI4A 1P7GA 1RM1B 4J7KA 4DO2A 1FJGO 1S3JA 4J42A 3T1HB 4JAAA 4KHPO 1ZL8B 3TJTA 1YVWA 4NVPA 3HKBB 4Q6GA 3OGCC 5LHHA 3HKEA 1Q82W 2UXCO 4LFAO 2CAZC 5IYCO 5CB4B 1XILA 1XHZA 1L8DA 4D6TH 1QLNA 2HVKC 4QNHB 1TAEA 5KA5A 3T1HO 4FFBA 1VQ4V 1QVFU 4X66B 3C90A 5A9GA 3ZHTA 2DMXA 4B3RB 5DECA 5EYPA 2YEVA 3JAWA 4JYBA 1FXKA 1Z5VA 1XUQA 5HFMA 5C93A 4X66O 4O2AA 4JYYA 4PDVA 2RDCA 1V54C 1YZBA 4B3RO 4TUYA 2ETNA 4XDJA 1N36B 4UCSA 3ZN0A 4MVSA 1JFFB 1Y67A 3CPWU 4FLUA 4JI6B 1WA8B 3OEEG 1R6TA 4JAUA 4NB5A 2EULA 2Y4TA 1AI4A 1PL0A 1N36O 1DK1A 5L3EA 5BR8B 4ASUG 4HYOA 5KHGA 5GTHZ 3SPJA 4W4KA 2OIGA 4K0KB 4JI6O 1KP3A 1GTOA 4B3MB 1SC5B 4IGGA 3IC7A 5BR8O 2AHYA 3RFRA 5IYDO 2GTSA 1SQQH 4MT8A 1WNSA 2DYRB 4D7SA 2JJ1G 4K0KO 3TK1A 2AW9A 2DWDC 4OXSA 2B1IA 3MHSC 4RAIA 4AQYB 3H1IH 2IU0A 3HPLC 1IBMB 2Q9LA 3CCRV 2BCCH 5GONA 3SJCC 1BCCH 4LNUA 4N23A 5GW7A 3ZHRA 3N2KB 4QJFB 4AQYO 2VRZA 4X62O 5AG2A 1K8AW 1JA8A 1PM9A 1W0KG 2EJ7A 5B1NA 2UXDO 3WG7C 4YY3O 2EBOA 2R9RB 3H1LH 2N05A 1Q90D 4O4LB 5DM6V 4XDKA 2V7QG 3G67A 5KHIA 3ABKB 4ZHQA 4MW3A 2EX3A 4JTDB 2R9AA 2F66C 3T4ZA 2CTWA 1Y6XA 4R50A 2BTQB 4MTGA 3L75H 1RPOA 1XMOO 5ITZB 1SERA 2UXNA 3E22A 1N32O 3AG1C 3HKDB 3OUSA 4FMTA 3BCCH 1IBLB 4TQFA 4UVBA 1I5YA 1AI6A 2EINC 1YI2V 2ZQMA 2KG7B 2LJ2A 1RPRA 4BIZA 2JEUA 1G8MA 2XT9A 1M57B 3BVOA 4BIOA 4CBCA 1T5EA 3S3WA 3ETGA 4J10A 4CS2A 1B6QA 1R1BA 2F93B 1TVKA 2P22C 4DR6O 4LF8B 3X2QB 5CA1A 2IJHA 4R6ZA 1QNMA 4CH6A 1KU9A 1GM7A 1JQ0A 4FLWA 4U3JA 3RYFB 4DR1B 3LSUA 1JMKC 3UT5A 3ZX6A 2W6JG 4LF8O 4GX2A 3QO7A 4FLZA 3CS5A 2HEPA 2NN4A 3UO2A 1DLBA 4CH4A 1D5AA 2A79B 2HKOA 3DXRA 1LNQA 5K1XA 2HFEC 3E86A 4DR1O 4IT5A 5LOVB 1E79G 5J2UA 1AP5A 2XAGA 3ABKC 1AP6A 5FPRA 2ADQB 2G38A 1AR4A 4UCVA 1AVMA 2HR3A 1Y76A 4MVQA 3G6BA 4MTOA 1RFYA 1XL6A 3H9VA 4GX5A 4B7KA 2PGGA 3JYCA 1YF2A 4GYCB 2LQTA 4PJ0Z 4JI1B 4B08A 2ZE5A 3W7XA 3F7YC 3OGIB 2BSKB 3KCXA 2E74B 1P84F 4JAVA 1SQVH 4EFBA 5H5NA 1VQ7V 1OHHG 5JVDB 5BMVA 4F6RA 4FM1A 2WLJA 2YIBA 4BW5A 1M57C 1JVMA 3JSLA 3OT7A 4NXMO 2QWOB 2IU3A 4UFZA 2QE7G 2FL4A 1N33B 1MSWD 2X6BA 3WB2A 1SS3A 3E8GA 2XAJA 1IZ3A 1GN2A 2MW2B 2K1EA 3DTUB 4O4JB 1AJQA 1NR7A 3J7AU 1M93A 1M5IA 1VQMV 1F7YA 2A9HA 3EVKA 5IJ9B 1MA1A 5IYZB 4I50B 2W0XA 1MOFA 1JPXA 3CXCU 4X65B 2YIDA 2JGUA 1KMIZ 1KUQA 1ORQC 1Q43A 2EJRA 5KAFZ 2VWJA 2FYUH 2CE4A 1CP9A 1XOUA 4JI2B 1H2SB 3HR0A 3G80A 4X65O 1NZ6A 4H37A 1ZAUA 1QHTA 2FMLA 4B3SB 1F23A 3G6EV 3L71H 5LA6B 2QEXV 1H38A 2GTAA 1XMQO 3QTCA 3FD9A 2QWQB 4JI2O 4WFFA 1Q3EA 5J2TB 5IT9N 4OPAA 4EFEA 2UUAB 1IXBA 4O2BA 4PI2A 4PD4F 1WLEA 3JD2A 5JJEB 5LL6Y 2WA4A 1NTKH 4WBNB 3ASNC 4JYCA 1OCOB 2F23A 4B3SO 5KLVH 3BRCA 1EN6A 3K59A 1H2GA 3OMNB 1GN6A 3T1YB 2BE3A 1SQFA 1H2MA 3UO3A 1V55B 2WAMA 1QVGU 2CH7B 4FLVA 5EBWC 3KKYA 2UUAO 1H8HG 1GO3F 1JX9A 2PYLA 4P30A 4QPJA 1K5SA 4ZOLA 3ICXA 2EIKB 3FFQA 1U97A 3T1YO 3FX7A 1NH2B 4X9QA 3SJQC 3FB7C 1H2LA 3TXSA 3U11A 1WPBA 1J5EB 1GRJA 3CCUV 4IHJA 1HDJA 1SQPH 1VQ9V 2Y4UA 5E1AC 2EZPA 2NLJC 1DF4A 1IVSA 1FXHA 4FZ0A 4PA3A 4EKWA 3VQWA 4KFMA 3MD0A 2XHBA 3B8NA 1J5EO 1BHAA 2Y69B 4ZI7A 3OAAG 5EC2C 1YJWV 1YDXA 1M56C 2JS5A 4BAYA 1BGYH 1XL4A 1YTFB 1YEWA 2WLKA 3JD1A 3KZIZ 3ZMUA 3JD4A 5B3SC 1KQSU 4WFHA 3LDEA 1WP7A 2DN9A 2LFSA 2PTMA 3RWRD 3Q4HB 1B04A 1NU1H 1SA0A 2WLMA 2F4VB 1LUVA 3NR7A 5KA6A 1X59A 4LWSA 1OCOC 3ZRVA 1YJ9V 1SQBH 2A06H 4TV9B 5CMUA 5EZYB 4NXNB 3C3SA 1ZWIC 1Y74B 3QNEA 1AI5A 4ABMA 3AG2C 4JASA 1K7DA 3A0BZ 4P9PA 1FFTB 5LGTA 2B5UA 2F4VO 2JS3A 3ZRWB 5TISZ 5F2VO 2LGWA 5CA0A 2QJ1A 3CRRA 5CBHA 4O4IB 1JOYA 2EIKC 2IJKA 4TSFG 4NXNO 2ZNIA 2K9PA 2ZXWB 2YXYA 3DC6A 3ZRXA 3K03A 1K9MW 2CTPA 4YJ2B 1Z2GA 2OT5A 4LF6O 3AG4C 4FJCC 2WWWA 2UUCB 1QU7A 4JI0B 3CEIA 1XREA 4LFCO 3GVMA 2ZT9B 1AR5A 3JALB 1EZJA 4R7CA 5LP6B 1BQZA 3K9AA 4DV0B 3IC9A 4X20B 4KHPB 1NTZH 4JI0O 3JD3A 3BPZA 2JGDB 2YI9A 2UXCB 4UB8Z 1A32A 1I94B 3N2KA 4DV0O 3JARB 2GSMB 4DV5B 5K1PA 1NT2B 2UUBB 1O9HA 1VQ6V 2YI8A 3JASA 5JQGA 3AG3B 1COWG 1IXMA 1JCHA 1I94O 5LYJA 1AJPA 4CH3A 4MTFA 3QO5A 3F5TA 4DV5O 4DR2B 1SZXA 2W6IG 2YUAA 4YJ3B 1Q7YW 3W7TA 2MK3A 4RWUA 5LMNB 2UUBO 1KKDA 4HNAA 1L0NH 4ZKIA 4UV9A 4UXNA 4I55B 4UCOA 1LUWA 2ILMA 1KBHA 1MZEA 4BW9A 1S5JA 1IURA 3SYAA 2JK5C 3ZHVA 4OGQB 3OW2U 3RYIA 4DR2O 4DXWA 2ZKOA 3BA8A 4U7NA 5LMNO 1W0JG 2DJVA 4MS2A 3ABMC 1HR0B 2CK3G 4HZ3A 4KL1A 4MVRA 2D3OW 1LR1A 5KMGA 3CYOA 1HR0O 1UPGA 2PUSA 5H6RA 1EBOA 1XNRB 4F4LA 1HNXB 1GM9A 1JJOA 1RSOA 3QVNA 5IWAO 5H6QA 2ZCEA 4X1YA 3K5MA 2YS8A 3KCYA 3R65A 3G71V 1J95A 2XAHA 1XNRO 1Q5OA 4WFAV 4GUNA 4EB6A 1RM1C 4LFBB 1HNXO 2WLLB 2AGAA 4TV8A 1JR9A 2Q0OC 3AG3C 2QSAA 5L3GA 4JYAB 3ETDA 2E3CA 2HG5C 4A5UB 5FNVB 2Q8VA 2V4DA 2Z5UA 4LFBO 4X62B 4R8CA 4WFGA 2JEXA 2XUMA 2WLIB 4CC6A 2QA4V 1MSDA 2UXDB 1FAFA 5KX5B 2E5LB 3WU2Z 4YY3B 3S3XA 4Z1MG 5FLXN 4I9WA 3HB3B 1M1KW 3CCQV 4JYAO 4H33A 3CHXA 3BA9A 3CJHB 2EILB 2QWPB 1X4TA 4WFEA 2GHYA 2BTOA 5KHJA 2Q68A 1E1QG 5LXTB 2E5LO 1M90W 3SPCA 3ZRSA 2OYQA 2JRIA 1XMOB 4K8ZA 3NXSA 3RYCA 1N32B 5JVDA 1I08A 4I7ZB 5EK0A 2Q7GA 4JI3O 2P06A 1IDSA 1DF5A 5H2FZ 2QKAA 3CCLV 3ABUA 4CS4A 1Q86W 3HKEB 1I5XA 4LH6A 5EBMC 1ZLZA 4DK1A 4TOIA 3SR2C 2ZR3A 4FFBB 3T1CA 2Z3YA 2Q7EA 3SPIA 1DGSA 3D3IA 1K73W 2WLNA 5EYPB 3PN1A 3OFNG 2YEVB 4LBEC 4DR6B 1BQ0A 3JAWB 2DE0X 2IW5A 5CBGA 2DYRC 5C8YA 1FXKB 3K0GA 4DR7O 1N4CA 4PDRA 4O2AB 3ZS8C 1YTFD 3B40A 2Q6AA 1MABG 1Q6UA 4TUYB 1NTMH 2P4KA 4AILC 3W7UA 3BHPA 4NTXA 4O4HB 2LP7A 4AHCA 4GLXA 3CX5F 2OWOA 3AK2A 4JTAB 2ZIMA 2IH3C 2FKXA 4PELA 2NR5A 4DW0A 1VF7A 1VQ5V 3ZCCA 4OPHA 3A8TA 5IJ0A 2EILC 2HJDA 3APQA 1XNQO 1K4CC 3IFXA 5LGUA 1QLEB 3F5WC 5IDJA 1WJZA 3OR7C 5KHHA 3CXHF 4MVZA 2ZNJA 3FAVA 2H94A 4X8AA 1R3KC 5B66Z 2ZR2A 1I0HA 2WPDG 1I7FA 1N0NA 1AJNA 3N2GA 3JAKA 1TUBA 4UVCA 4LC1A 4JGSA 1BHBA 1GMGA 2KQXA 2R70A 3JSNA 4IIJA 1GM8A 2ZM6B 1NVPB 1HW7A 1VIBA 4DYLA 1IX9A 3AEIA 1N0JA 3J80N 1PKXA 5GONB 5IY5B 3OTOB 1ROPA 4NXMB 4GKJB 3EFFK 3LDDA 4GKKB 1SETA 4LNUB 4UCRA 4H13B 1VQNV 2QWNB 2LGQA 4N21A 3VOUA 2H3OA 2ZM6O 3SDLA 4I4TA 1TUEB 3CCMV 1P49A 3OTOO 1YXBA 4GKJO 4JI8B 3O9OA 1YSCA 4GKKO 3I5DA 2O57A 4X1KB 1BT8A 2CGOA 2YIAA 4ZHQB 4B3TO 3X2QC 5JWPA 3JCZA 4JI8O 5J9PC 1BZKA 1ZUQA 2QTSA 5KUMA 2AZ2A 2HLDG 1VARA 2ZE7A 2A3QA 3HKCA 3E22B 1GN3A 3B09A 1EM1A 2LW7A 4GZRB 4YIPA 1PP9H 4I0XA 4FM0A 1Q6HA 2A7WA 3B77A 3ZMTA 1MMMA 2OCCB 3K9SA 2VQFB 4DRXA 5JH7A 2Q67A 1K5QA 3RYHA 1HNZB 1F4NA 1TA8A 2XASA 2X7RB 1XMQB 5GTIZ 3EHBB 1VP7A 2ITDC 2CDYA 1EFRG 4JPRA 2LFRA 2P7TC 2ZD9A 1OCZB 1OCCB 3H1HH 2VQFO 1M9NA 1HNZO 2CGNA 3CE2A 1TVKB 4JI4B 1MNGA 2H8PC 1QBZA 5CA1B 1FFXA 2P67A 5IE9A 2AHZA 5FPOA 2QGNA 1IBKB 4LF4O 4LP8A 2XOKG 1KP2A 4W4LA 1PNKA 4U3JB 1UJWB 2C2AA 4JTCB 2IJIA 4JI4O 2GDSA 3UT5B 1OCRB 2ZE8A 3ASOB 2WSSG 1EN4A 3D8CA 4JZGA 3E8FA 2EIJB 1IBKO 3CD6V 3JATA 2HP8A 4ZBMA 2RN9A 3E89A 3DXRB 3D36C 1NBMG 5J2UB 3WB0A 1PD3A 2FB5A 1KKCA 2X6AA 3CC2V 1XQ8A 4AI8A 1Y76B 2YXLA 1S76D 3RGBA 1WB8A 4DV2O 5BY1A 4YHHB 2HHHB 1ZL8A 3CCVV 3CMEV 4XBFA 4XDLA 3HKBA 1KC8W 4E2LA 2Q7HA 5CB4A 2BOBC 3LSQA 4UUJC 2ODMA 1PNMA 2QTOA 3N27A 3J81N 3H1KH 2ITCC 4YHHO 2HHHO 4RQEA 5BMVB 5E79Z 4F6RB 3SYOA 3H1JH 1SKVA 4J80A 4MVOA 2P6JA 3U10A 1BS3A 1CPYA 1OCZC 4DUZB 3IJ4A 4QPKA 4JI5B 3SPGA 1PNLA 4PDLA 1S77D 4IL6Z 3JAMN 3W7SA 4WF9V 1PV0A 3W7WA 1P4RA 1VQLV 1HNWB 1AB3A 4DUZO 1JFFA 4DR5B 4JI5O 1PL4A 1WA8A 1JJ2U 4I9QA 1SQGA 1SQXH 3RT3C 1V55C 3UKMA 4LCUC 5B1AB 3ASOC 5BZBA 4PI0A 1K97A 3M8AA 4DV4O 2QKCA 4DV3B 4PA9A 1HNWO 1KB9F 4DR5O 4LF6B 5H9CA 4PHZA 1NS1A 2OCHA 4BIUA 1QCEA 4LFCB 2Y0PA 3LUTB 3DSQA 5JCOC 4PA7A 1VF5B 2Z0AA 3QG5A 1WB7A 4DV3O 4GX1A 3IAYA 4GT1A 3CB2A 4KP4A 1YHQV 3A2FA 1FXVA 4UCTA 1V54B 3ZHSA 4H44B 3E8BA 1SESA 2Y69C 2QKSA 4O2BB 3R66A 4MSWC 4YIOA 3ETQA 1GH6A 3K5LA 4JV5O 4WFBV 1KYOF 5EIBC 2QM8A 3B2EE 1U96A 4X64B 3CP1A 3RN4A 5DN6G 2IBZH 4FVMA 3SYCA 4J9YB 1OJHA 4ZOLB 4B7EA 2YDEA 2L6LA 2YSUB 2R9IA 2ZINA 1VMGA 2B9ZA 4PA6A 5B1BB 3SJAC 4RUEA 4X64O 2LO1A 4O4LA 4IHJB 2UXBB 2ZDIC 1CEZA 1HP8A 2B1GA 2CUGA 1D5NA 2ZIOA 1YJNV 5EBLC 1XI1A 3STZC 2PI5A 4H0LB 3TXQA 1NVPD 3FB8C 2BTQA 2ZE6A 1QQCA 1YCIA 3L9DA 5B1AC 5ITZA 4ZI7B 2UXBO 2NNUA 3RVYA 1N34B 2AZ0A 2Q0AA 3HKDA 1DTOA 4X1IB 1MZFA 3ZHQA 2CTRA 4GCZA 4DW1A 3CWBH 1YIJV 2RJZA 3L72H 2ADPA 1EZVH 3AK1A 3EXAA 4X89A 3VQXA 2ZXWC 2D2CB 2RQ6A 1Q8IA 2KG7A 1YITV 1N34O 4J41A 3CRQA 3ABLB
chains in the Genus database with same CATH topology
4J7JA 3FX7A 4IYHA 2GTSA 4IYIA 4W4KA 4J10A 4KXRA 4W4LA 4J7KA 2G38A 4J41A 4J11A 4J42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J7J A;  3FX7 A;  4IYH A;  2GTS A;  4IYI A;  4W4K A;  4J10 A;  4KXR A;  4W4L A;  4J7K A;  2G38 A;  4J41 A;  4J11 A;  4J42 A; 
#chains in the Genus database with same CATH topology
 3T2M A;  5IWA B;  4PDM A;  3WG7 B;  3GWO A;  4NR1 A;  1SA0 B;  4CH5 A;  2P5O A;  5LP6 C;  1B06 A;  1WP8 A;  1WN7 A;  4O4H A;  2AXT Z;  3A0R A;  4LWS B;  1UFI A;  1NKD A;  1F4M A;  3H01 A;  4K3A A;  1AI7 A;  1S0V A;  1R73 A;  3A0H Z;  1AIL A;  3E83 A;  4MTX A;  4U7O A;  4MW8 A;  3RYF A;  2F43 G;  2WA3 A;  3K58 A;  3AG1 B;  4NYK A;  2GUZ B;  3TGU H;  2E76 B;  5CA0 B;  3OMI B;  1FS0 G;  5IYB O;  1VF6 C;  2E75 B;  3CRA A;  4C7U A;  5B1B C;  1SF9 A;  3P3P A;  3FYE B;  4HAM A;  3RW0 A;  1ZX3 A;  2EIN B;  5LOV A;  5L3B A;  4FLX A;  1Y4M A;  4RUF A;  4DV7 B;  3RVZ A;  3DGE A;  2DOS A;  1S5H C;  3KG2 A;  1NR1 A;  4B3M O;  2Q69 A;  3GWK C;  4GX0 A;  3SPH A;  3MHH C;  1W59 A;  1VEW A;  4JI3 B;  2QR4 A;  3L74 H;  4DV7 O;  2Q4P A;  3AG7 A;  2BSK A;  2R72 A;  3K79 A;  1AR1 B;  3VQY A;  1N8R W;  1R6K A;  1WAZ A;  2RNB A;  4OX9 B;  2OTJ V;  1VQ8 V;  3ABL C;  4IYH A;  4MVM A;  1IBM O;  3ZBH A;  1NH2 D;  4U3F H;  1G6U A;  4J7Z A;  3K0D A;  2QM4 A;  1NI8 A;  3JAS B;  5JQG B;  3D36 A;  4CC5 A;  2UU9 B;  3K06 A;  3G4S V;  2DW4 A;  4X1K A;  1RP3 B;  4OX9 O;  5LYJ B;  2F1M A;  1ZSP A;  4O4J A;  3UM7 A;  1VQK V;  4DR7 B;  2X6C A;  2P90 A;  4HNA B;  3MDS A;  2HJF C;  1VQP V;  3CCS V;  2QDO A;  1O9G A;  2UU9 O;  4JF3 A;  3FB6 C;  2IJJ A;  4LF7 B;  1Q81 W;  5IJ9 A;  2IH1 C;  5IYZ A;  2GBO A;  1QR8 A;  4I50 A;  3RYI B;  1E1R G;  5EIB D;  3LNN A;  4FIP C;  2YIC A;  2GV9 A;  2YIB D;  1K33 A;  4DK0 A;  4KUM A;  1NJI W;  4LF7 O;  3U0Z A;  4P2Z A;  3TCU A;  1H2N A;  3CSX A;  2XAQ A;  5KMG B;  1XNQ B;  5B5E Z;  3ML0 A;  1XHX A;  4UV8 A;  2EIM B;  4DUY B;  2Q73 A;  1IBL O;  1ARO P;  5EC1 C;  4G28 B;  5LA6 A;  3CC4 V;  4FK5 C;  3ZJZ A;  4D7T A;  2N04 A;  3AK3 A;  4E4E A;  5J2T A;  4TWK A;  3JD0 A;  1RSO B;  3GB7 C;  1K34 A;  2N74 A;  3P30 A;  4G27 B;  4DUY O;  5CN0 A;  3E2E A;  4WBN A;  3ETE A;  4X1Y B;  2DYS B;  2EZO A;  3UQ8 A;  1W2B U;  4EB6 B;  2A0L A;  2CH7 A;  4ICG A;  2VQE B;  2JIZ G;  3QO8 A;  2KB1 A;  3WB1 A;  1FKA O;  1R3I C;  4TV8 B;  4LF5 B;  3THO A;  4P9O A;  3ZED A;  2XTA A;  3SGI A;  4QGP A;  1FPO A;  5JCO A;  3K3W A;  4LH7 A;  1K92 A;  2VQE O;  1US6 A;  1PPJ H;  4Z1V A;  4G2K A;  2LW1 A;  3LNM B;  4LF5 O;  3BY6 A;  3T4D A;  1G4Y B;  2WLH A;  2JDI G;  3PJS K;  3CCJ V;  1GN4 A;  3RBZ A;  4L87 A;  2F95 B;  4B3T B;  4TT3 G;  5B1O A;  1KD1 W;  1FXK C;  4FM2 A;  4LR3 A;  4EEQ A;  3ASN B;  3WFV A;  1GAX A;  4NTY A;  1XDC A;  1H2K A;  1WPX A;  1R3L C;  1OZ0 A;  4FZ1 A;  3RYC B;  3SYP A;  3B8M A;  4Z2W A;  2IM9 A;  4JI1 O;  2P4V A;  3DC5 A;  3F7V C;  3L70 H;  4PA4 A;  2EIM C;  4UVA A;  5LHI A;  2RCV A;  3OUF A;  2PZS A;  1BSM A;  4DV1 B;  3CCE V;  3TET A;  4ZIB A;  1GKF A;  1M4U A;  4YXW G;  3Q4H A;  2XND G;  3M7M X;  1XEQ A;  1F51 A;  4CS3 A;  2ZDI A;  1QLE C;  1QR9 A;  2QWR B;  4HBN A;  3ZMV A;  1CXZ B;  4UCU A;  2HVJ C;  2DYS C;  4DV1 O;  1N33 O;  1R3J C;  5EZY A;  4TV9 A;  1Y74 A;  3O65 A;  4RQF A;  3E8H A;  4IYI A;  1Z5W A;  2PY5 A;  5DED A;  5C8Y B;  2UXX A;  1GK9 A;  1P7B A;  4LF4 B;  3K08 A;  3ZRW A;  5L3F A;  3OMA B;  4J11 A;  2VS0 A;  4QE9 A;  4O4I A;  1M56 B;  4FPP A;  4JI7 B;  3OR6 C;  5CBF A;  4K35 A;  3ZMS A;  2Y0I A;  1URF A;  3I56 V;  5IY5 C;  5B3S B;  5LBQ A;  4YJ2 A;  5JJN B;  4K8X A;  1FD9 A;  2JJ2 G;  2XAF A;  4TQD A;  4FLY A;  4KXR A;  2ATK C;  3M99 B;  3OTF A;  1S5L Z;  4JI7 O;  3CMA V;  5IJ0 B;  3ZHU A;  3JAL A;  2FTK A;  1ENV A;  3FB5 C;  1OV9 A;  2JVD A;  2KSD A;  3L73 H;  4I5S A;  3OD4 A;  3OEH G;  5LP6 A;  3P3N A;  1BL8 A;  2L35 A;  3C3T A;  1D2D A;  3FAV B;  4X20 A;  4DV2 B;  4DR3 B;  3BAB A;  5BXZ A;  3VQV A;  3AG2 B;  3OE7 G;  2JGD A;  4MVU A;  3N2G B;  3JAK B;  5A2Q N;  1TUB B;  3OM3 B;  3P32 A;  3JAR A;  3D3Q A;  5KUK A;  5L3D A;  1L0L H;  2Q5Z A;  1VF6 A;  4DR3 O;  4IIJ B;  2QM7 A;  2M7W A;  5KAI Z;  3QF7 A;  1HWY A;  1XBL A;  4JZ2 A;  2YC0 A;  2OIE A;  5FL7 G;  2OCC C;  1FYJ A;  1ZTE A;  3AG4 B;  2DQ3 A;  2V1D A;  4F6E A;  4YJ3 A;  4CZZ A;  4Q20 A;  3SYQ A;  4I4T B;  1S72 V;  5HFL A;  4QE7 A;  2VWK A;  4I55 A;  1THZ A;  3FYI B;  3B4S A;  1OCC C;  4X1I A;  2Y48 A;  3APO A;  2W0F C;  1EN5 A;  2PF4 E;  3LDC A;  4WCE V;  4DV4 B;  1H8E G;  1K4D C;  1SRY A;  4BWA A;  4LF9 B;  5L3C A;  5D5P A;  1L1F A;  1KEC A;  2M6Y A;  2RMK B;  5LMU B;  3HKC B;  4NKG B;  4DV6 B;  3IGA C;  1OCR C;  3K5N A;  2KKW A;  1V9P A;  4I0X B;  1Q6I A;  4BR6 A;  2EIJ C;  1MG1 A;  3E35 A;  2YXH A;  4LF9 O;  3ABT A;  4DRX B;  4DR4 B;  2DWE C;  5JH7 B;  2DQ0 A;  1BE3 H;  3RYH B;  3CC7 V;  1K3E A;  5LMU O;  4J7J A;  4DV6 O;  3MAQ A;  2ARH A;  3K04 A;  3K5O A;  2OTL V;  3JCU Z;  2GUZ A;  4DR4 O;  2WLL A;  4JV5 B;  4PV1 B;  3FKS G;  3BFR A;  4FFK A;  3ZN1 A;  3ABM B;  3BAA A;  1VQO V;  3I55 V;  4UB6 Z;  1FFX B;  4QIW F;  1B3Q A;  4J9Z B;  5FNV A;  1Y66 A;  1BMF G;  3CRM A;  5CA3 A;  5KHK A;  4FLT A;  2WLI A;  2BOC C;  3STL C;  3VBB A;  2CTQ A;  2X0L A;  5KX5 A;  1R6N A;  3SJB C;  5JJJ B;  3ZMZ A;  2PYJ A;  3CRC A;  3ZIA G;  3BEH A;  5D5Q A;  3JAT B;  3CJH A;  5LGN A;  1TGO A;  5LHG A;  1FJG B;  2UUC O;  5LXT A;  1NQT A;  1SZT A;  4X88 A;  4L8J A;  3LSS A;  3K57 A;  1G1X B;  4LFA B;  3UCS C;  4RO2 A;  4NTW A;  2PI4 A;  1P7G A;  1RM1 B;  4J7K A;  4DO2 A;  1FJG O;  1S3J A;  4J42 A;  3T1H B;  4JAA A;  4KHP O;  1ZL8 B;  3TJT A;  1YVW A;  4NVP A;  3HKB B;  4Q6G A;  3OGC C;  5LHH A;  3HKE A;  1Q82 W;  2UXC O;  4LFA O;  2CAZ C;  5IYC O;  5CB4 B;  1XIL A;  1XHZ A;  1L8D A;  4D6T H;  1QLN A;  2HVK C;  4QNH B;  1TAE A;  5KA5 A;  3T1H O;  4FFB A;  1VQ4 V;  1QVF U;  4X66 B;  3C90 A;  5A9G A;  3ZHT A;  2DMX A;  4B3R B;  5DEC A;  5EYP A;  2YEV A;  3JAW A;  4JYB A;  1FXK A;  1Z5V A;  1XUQ A;  5HFM A;  5C93 A;  4X66 O;  4O2A A;  4JYY A;  4PDV A;  2RDC A;  1V54 C;  1YZB A;  4B3R O;  4TUY A;  2ETN A;  4XDJ A;  1N36 B;  4UCS A;  3ZN0 A;  4MVS A;  1JFF B;  1Y67 A;  3CPW U;  4FLU A;  4JI6 B;  1WA8 B;  3OEE G;  1R6T A;  4JAU A;  4NB5 A;  2EUL A;  2Y4T A;  1AI4 A;  1PL0 A;  1N36 O;  1DK1 A;  5L3E A;  5BR8 B;  4ASU G;  4HYO A;  5KHG A;  5GTH Z;  3SPJ A;  4W4K A;  2OIG A;  4K0K B;  4JI6 O;  1KP3 A;  1GTO A;  4B3M B;  1SC5 B;  4IGG A;  3IC7 A;  5BR8 O;  2AHY A;  3RFR A;  5IYD O;  2GTS A;  1SQQ H;  4MT8 A;  1WNS A;  2DYR B;  4D7S A;  2JJ1 G;  4K0K O;  3TK1 A;  2AW9 A;  2DWD C;  4OXS A;  2B1I A;  3MHS C;  4RAI A;  4AQY B;  3H1I H;  2IU0 A;  3HPL C;  1IBM B;  2Q9L A;  3CCR V;  2BCC H;  5GON A;  3SJC C;  1BCC H;  4LNU A;  4N23 A;  5GW7 A;  3ZHR A;  3N2K B;  4QJF B;  4AQY O;  2VRZ A;  4X62 O;  5AG2 A;  1K8A W;  1JA8 A;  1PM9 A;  1W0K G;  2EJ7 A;  5B1N A;  2UXD O;  3WG7 C;  4YY3 O;  2EBO A;  2R9R B;  3H1L H;  2N05 A;  1Q90 D;  4O4L B;  5DM6 V;  4XDK A;  2V7Q G;  3G67 A;  5KHI A;  3ABK B;  4ZHQ A;  4MW3 A;  2EX3 A;  4JTD B;  2R9A A;  2F66 C;  3T4Z A;  2CTW A;  1Y6X A;  4R50 A;  2BTQ B;  4MTG A;  3L75 H;  1RPO A;  1XMO O;  5ITZ B;  1SER A;  2UXN A;  3E22 A;  1N32 O;  3AG1 C;  3HKD B;  3OUS A;  4FMT A;  3BCC H;  1IBL B;  4TQF A;  4UVB A;  1I5Y A;  1AI6 A;  2EIN C;  1YI2 V;  2ZQM A;  2KG7 B;  2LJ2 A;  1RPR A;  4BIZ A;  2JEU A;  1G8M A;  2XT9 A;  1M57 B;  3BVO A;  4BIO A;  4CBC A;  1T5E A;  3S3W A;  3ETG A;  4J10 A;  4CS2 A;  1B6Q A;  1R1B A;  2F93 B;  1TVK A;  2P22 C;  4DR6 O;  4LF8 B;  3X2Q B;  5CA1 A;  2IJH A;  4R6Z A;  1QNM A;  4CH6 A;  1KU9 A;  1GM7 A;  1JQ0 A;  4FLW A;  4U3J A;  3RYF B;  4DR1 B;  3LSU A;  1JMK C;  3UT5 A;  3ZX6 A;  2W6J G;  4LF8 O;  4GX2 A;  3QO7 A;  4FLZ A;  3CS5 A;  2HEP A;  2NN4 A;  3UO2 A;  1DLB A;  4CH4 A;  1D5A A;  2A79 B;  2HKO A;  3DXR A;  1LNQ A;  5K1X A;  2HFE C;  3E86 A;  4DR1 O;  4IT5 A;  5LOV B;  1E79 G;  5J2U A;  1AP5 A;  2XAG A;  3ABK C;  1AP6 A;  5FPR A;  2ADQ B;  2G38 A;  1AR4 A;  4UCV A;  1AVM A;  2HR3 A;  1Y76 A;  4MVQ A;  3G6B A;  4MTO A;  1RFY A;  1XL6 A;  3H9V A;  4GX5 A;  4B7K A;  2PGG A;  3JYC A;  1YF2 A;  4GYC B;  2LQT A;  4PJ0 Z;  4JI1 B;  4B08 A;  2ZE5 A;  3W7X A;  3F7Y C;  3OGI B;  2BSK B;  3KCX A;  2E74 B;  1P84 F;  4JAV A;  1SQV H;  4EFB A;  5H5N A;  1VQ7 V;  1OHH G;  5JVD B;  5BMV A;  4F6R A;  4FM1 A;  2WLJ A;  2YIB A;  4BW5 A;  1M57 C;  1JVM A;  3JSL A;  3OT7 A;  4NXM O;  2QWO B;  2IU3 A;  4UFZ A;  2QE7 G;  2FL4 A;  1N33 B;  1MSW D;  2X6B A;  3WB2 A;  1SS3 A;  3E8G A;  2XAJ A;  1IZ3 A;  1GN2 A;  2MW2 B;  2K1E A;  3DTU B;  4O4J B;  1AJQ A;  1NR7 A;  3J7A U;  1M93 A;  1M5I A;  1VQM V;  1F7Y A;  2A9H A;  3EVK A;  5IJ9 B;  1MA1 A;  5IYZ B;  4I50 B;  2W0X A;  1MOF A;  1JPX A;  3CXC U;  4X65 B;  2YID A;  2JGU A;  1KMI Z;  1KUQ A;  1ORQ C;  1Q43 A;  2EJR A;  5KAF Z;  2VWJ A;  2FYU H;  2CE4 A;  1CP9 A;  1XOU A;  4JI2 B;  1H2S B;  3HR0 A;  3G80 A;  4X65 O;  1NZ6 A;  4H37 A;  1ZAU A;  1QHT A;  2FML A;  4B3S B;  1F23 A;  3G6E V;  3L71 H;  5LA6 B;  2QEX V;  1H38 A;  2GTA A;  1XMQ O;  3QTC A;  3FD9 A;  2QWQ B;  4JI2 O;  4WFF A;  1Q3E A;  5J2T B;  5IT9 N;  4OPA A;  4EFE A;  2UUA B;  1IXB A;  4O2B A;  4PI2 A;  4PD4 F;  1WLE A;  3JD2 A;  5JJE B;  5LL6 Y;  2WA4 A;  1NTK H;  4WBN B;  3ASN C;  4JYC A;  1OCO B;  2F23 A;  4B3S O;  5KLV H;  3BRC A;  1EN6 A;  3K59 A;  1H2G A;  3OMN B;  1GN6 A;  3T1Y B;  2BE3 A;  1SQF A;  1H2M A;  3UO3 A;  1V55 B;  2WAM A;  1QVG U;  2CH7 B;  4FLV A;  5EBW C;  3KKY A;  2UUA O;  1H8H G;  1GO3 F;  1JX9 A;  2PYL A;  4P30 A;  4QPJ A;  1K5S A;  4ZOL A;  3ICX A;  2EIK B;  3FFQ A;  1U97 A;  3T1Y O;  3FX7 A;  1NH2 B;  4X9Q A;  3SJQ C;  3FB7 C;  1H2L A;  3TXS A;  3U11 A;  1WPB A;  1J5E B;  1GRJ A;  3CCU V;  4IHJ A;  1HDJ A;  1SQP H;  1VQ9 V;  2Y4U A;  5E1A C;  2EZP A;  2NLJ C;  1DF4 A;  1IVS A;  1FXH A;  4FZ0 A;  4PA3 A;  4EKW A;  3VQW A;  4KFM A;  3MD0 A;  2XHB A;  3B8N A;  1J5E O;  1BHA A;  2Y69 B;  4ZI7 A;  3OAA G;  5EC2 C;  1YJW V;  1YDX A;  1M56 C;  2JS5 A;  4BAY A;  1BGY H;  1XL4 A;  1YTF B;  1YEW A;  2WLK A;  3JD1 A;  3KZI Z;  3ZMU A;  3JD4 A;  5B3S C;  1KQS U;  4WFH A;  3LDE A;  1WP7 A;  2DN9 A;  2LFS A;  2PTM A;  3RWR D;  3Q4H B;  1B04 A;  1NU1 H;  1SA0 A;  2WLM A;  2F4V B;  1LUV A;  3NR7 A;  5KA6 A;  1X59 A;  4LWS A;  1OCO C;  3ZRV A;  1YJ9 V;  1SQB H;  2A06 H;  4TV9 B;  5CMU A;  5EZY B;  4NXN B;  3C3S A;  1ZWI C;  1Y74 B;  3QNE A;  1AI5 A;  4ABM A;  3AG2 C;  4JAS A;  1K7D A;  3A0B Z;  4P9P A;  1FFT B;  5LGT A;  2B5U A;  2F4V O;  2JS3 A;  3ZRW B;  5TIS Z;  5F2V O;  2LGW A;  5CA0 A;  2QJ1 A;  3CRR A;  5CBH A;  4O4I B;  1JOY A;  2EIK C;  2IJK A;  4TSF G;  4NXN O;  2ZNI A;  2K9P A;  2ZXW B;  2YXY A;  3DC6 A;  3ZRX A;  3K03 A;  1K9M W;  2CTP A;  4YJ2 B;  1Z2G A;  2OT5 A;  4LF6 O;  3AG4 C;  4FJC C;  2WWW A;  2UUC B;  1QU7 A;  4JI0 B;  3CEI A;  1XRE A;  4LFC O;  3GVM A;  2ZT9 B;  1AR5 A;  3JAL B;  1EZJ A;  4R7C A;  5LP6 B;  1BQZ A;  3K9A A;  4DV0 B;  3IC9 A;  4X20 B;  4KHP B;  1NTZ H;  4JI0 O;  3JD3 A;  3BPZ A;  2JGD B;  2YI9 A;  2UXC B;  4UB8 Z;  1A32 A;  1I94 B;  3N2K A;  4DV0 O;  3JAR B;  2GSM B;  4DV5 B;  5K1P A;  1NT2 B;  2UUB B;  1O9H A;  1VQ6 V;  2YI8 A;  3JAS A;  5JQG A;  3AG3 B;  1COW G;  1IXM A;  1JCH A;  1I94 O;  5LYJ A;  1AJP A;  4CH3 A;  4MTF A;  3QO5 A;  3F5T A;  4DV5 O;  4DR2 B;  1SZX A;  2W6I G;  2YUA A;  4YJ3 B;  1Q7Y W;  3W7T A;  2MK3 A;  4RWU A;  5LMN B;  2UUB O;  1KKD A;  4HNA A;  1L0N H;  4ZKI A;  4UV9 A;  4UXN A;  4I55 B;  4UCO A;  1LUW A;  2ILM A;  1KBH A;  1MZE A;  4BW9 A;  1S5J A;  1IUR A;  3SYA A;  2JK5 C;  3ZHV A;  4OGQ B;  3OW2 U;  3RYI A;  4DR2 O;  4DXW A;  2ZKO A;  3BA8 A;  4U7N A;  5LMN O;  1W0J G;  2DJV A;  4MS2 A;  3ABM C;  1HR0 B;  2CK3 G;  4HZ3 A;  4KL1 A;  4MVR A;  2D3O W;  1LR1 A;  5KMG A;  3CYO A;  1HR0 O;  1UPG A;  2PUS A;  5H6R A;  1EBO A;  1XNR B;  4F4L A;  1HNX B;  1GM9 A;  1JJO A;  1RSO A;  3QVN A;  5IWA O;  5H6Q A;  2ZCE A;  4X1Y A;  3K5M A;  2YS8 A;  3KCY A;  3R65 A;  3G71 V;  1J95 A;  2XAH A;  1XNR O;  1Q5O A;  4WFA V;  4GUN A;  4EB6 A;  1RM1 C;  4LFB B;  1HNX O;  2WLL B;  2AGA A;  4TV8 A;  1JR9 A;  2Q0O C;  3AG3 C;  2QSA A;  5L3G A;  4JYA B;  3ETD A;  2E3C A;  2HG5 C;  4A5U B;  5FNV B;  2Q8V A;  2V4D A;  2Z5U A;  4LFB O;  4X62 B;  4R8C A;  4WFG A;  2JEX A;  2XUM A;  2WLI B;  4CC6 A;  2QA4 V;  1MSD A;  2UXD B;  1FAF A;  5KX5 B;  2E5L B;  3WU2 Z;  4YY3 B;  3S3X A;  4Z1M G;  5FLX N;  4I9W A;  3HB3 B;  1M1K W;  3CCQ V;  4JYA O;  4H33 A;  3CHX A;  3BA9 A;  3CJH B;  2EIL B;  2QWP B;  1X4T A;  4WFE A;  2GHY A;  2BTO A;  5KHJ A;  2Q68 A;  1E1Q G;  5LXT B;  2E5L O;  1M90 W;  3SPC A;  3ZRS A;  2OYQ A;  2JRI A;  1XMO B;  4K8Z A;  3NXS A;  3RYC A;  1N32 B;  5JVD A;  1I08 A;  4I7Z B;  5EK0 A;  2Q7G A;  4JI3 O;  2P06 A;  1IDS A;  1DF5 A;  5H2F Z;  2QKA A;  3CCL V;  3ABU A;  4CS4 A;  1Q86 W;  3HKE B;  1I5X A;  4LH6 A;  5EBM C;  1ZLZ A;  4DK1 A;  4TOI A;  3SR2 C;  2ZR3 A;  4FFB B;  3T1C A;  2Z3Y A;  2Q7E A;  3SPI A;  1DGS A;  3D3I A;  1K73 W;  2WLN A;  5EYP B;  3PN1 A;  3OFN G;  2YEV B;  4LBE C;  4DR6 B;  1BQ0 A;  3JAW B;  2DE0 X;  2IW5 A;  5CBG A;  2DYR C;  5C8Y A;  1FXK B;  3K0G A;  4DR7 O;  1N4C A;  4PDR A;  4O2A B;  3ZS8 C;  1YTF D;  3B40 A;  2Q6A A;  1MAB G;  1Q6U A;  4TUY B;  1NTM H;  2P4K A;  4AIL C;  3W7U A;  3BHP A;  4NTX A;  4O4H B;  2LP7 A;  4AHC A;  4GLX A;  3CX5 F;  2OWO A;  3AK2 A;  4JTA B;  2ZIM A;  2IH3 C;  2FKX A;  4PEL A;  2NR5 A;  4DW0 A;  1VF7 A;  1VQ5 V;  3ZCC A;  4OPH A;  3A8T A;  5IJ0 A;  2EIL C;  2HJD A;  3APQ A;  1XNQ O;  1K4C C;  3IFX A;  5LGU A;  1QLE B;  3F5W C;  5IDJ A;  1WJZ A;  3OR7 C;  5KHH A;  3CXH F;  4MVZ A;  2ZNJ A;  3FAV A;  2H94 A;  4X8A A;  1R3K C;  5B66 Z;  2ZR2 A;  1I0H A;  2WPD G;  1I7F A;  1N0N A;  1AJN A;  3N2G A;  3JAK A;  1TUB A;  4UVC A;  4LC1 A;  4JGS A;  1BHB A;  1GMG A;  2KQX A;  2R70 A;  3JSN A;  4IIJ A;  1GM8 A;  2ZM6 B;  1NVP B;  1HW7 A;  1VIB A;  4DYL A;  1IX9 A;  3AEI A;  1N0J A;  3J80 N;  1PKX A;  5GON B;  5IY5 B;  3OTO B;  1ROP A;  4NXM B;  4GKJ B;  3EFF K;  3LDD A;  4GKK B;  1SET A;  4LNU B;  4UCR A;  4H13 B;  1VQN V;  2QWN B;  2LGQ A;  4N21 A;  3VOU A;  2H3O A;  2ZM6 O;  3SDL A;  4I4T A;  1TUE B;  3CCM V;  1P49 A;  3OTO O;  1YXB A;  4GKJ O;  4JI8 B;  3O9O A;  1YSC A;  4GKK O;  3I5D A;  2O57 A;  4X1K B;  1BT8 A;  2CGO A;  2YIA A;  4ZHQ B;  4B3T O;  3X2Q C;  5JWP A;  3JCZ A;  4JI8 O;  5J9P C;  1BZK A;  1ZUQ A;  2QTS A;  5KUM A;  2AZ2 A;  2HLD G;  1VAR A;  2ZE7 A;  2A3Q A;  3HKC A;  3E22 B;  1GN3 A;  3B09 A;  1EM1 A;  2LW7 A;  4GZR B;  4YIP A;  1PP9 H;  4I0X A;  4FM0 A;  1Q6H A;  2A7W A;  3B77 A;  3ZMT A;  1MMM A;  2OCC B;  3K9S A;  2VQF B;  4DRX A;  5JH7 A;  2Q67 A;  1K5Q A;  3RYH A;  1HNZ B;  1F4N A;  1TA8 A;  2XAS A;  2X7R B;  1XMQ B;  5GTI Z;  3EHB B;  1VP7 A;  2ITD C;  2CDY A;  1EFR G;  4JPR A;  2LFR A;  2P7T C;  2ZD9 A;  1OCZ B;  1OCC B;  3H1H H;  2VQF O;  1M9N A;  1HNZ O;  2CGN A;  3CE2 A;  1TVK B;  4JI4 B;  1MNG A;  2H8P C;  1QBZ A;  5CA1 B;  1FFX A;  2P67 A;  5IE9 A;  2AHZ A;  5FPO A;  2QGN A;  1IBK B;  4LF4 O;  4LP8 A;  2XOK G;  1KP2 A;  4W4L A;  1PNK A;  4U3J B;  1UJW B;  2C2A A;  4JTC B;  2IJI A;  4JI4 O;  2GDS A;  3UT5 B;  1OCR B;  2ZE8 A;  3ASO B;  2WSS G;  1EN4 A;  3D8C A;  4JZG A;  3E8F A;  2EIJ B;  1IBK O;  3CD6 V;  3JAT A;  2HP8 A;  4ZBM A;  2RN9 A;  3E89 A;  3DXR B;  3D36 C;  1NBM G;  5J2U B;  3WB0 A;  1PD3 A;  2FB5 A;  1KKC A;  2X6A A;  3CC2 V;  1XQ8 A;  4AI8 A;  1Y76 B;  2YXL A;  1S76 D;  3RGB A;  1WB8 A;  4DV2 O;  5BY1 A;  4YHH B;  2HHH B;  1ZL8 A;  3CCV V;  3CME V;  4XBF A;  4XDL A;  3HKB A;  1KC8 W;  4E2L A;  2Q7H A;  5CB4 A;  2BOB C;  3LSQ A;  4UUJ C;  2ODM A;  1PNM A;  2QTO A;  3N27 A;  3J81 N;  3H1K H;  2ITC C;  4YHH O;  2HHH O;  4RQE A;  5BMV B;  5E79 Z;  4F6R B;  3SYO A;  3H1J H;  1SKV A;  4J80 A;  4MVO A;  2P6J A;  3U10 A;  1BS3 A;  1CPY A;  1OCZ C;  4DUZ B;  3IJ4 A;  4QPK A;  4JI5 B;  3SPG A;  1PNL A;  4PDL A;  1S77 D;  4IL6 Z;  3JAM N;  3W7S A;  4WF9 V;  1PV0 A;  3W7W A;  1P4R A;  1VQL V;  1HNW B;  1AB3 A;  4DUZ O;  1JFF A;  4DR5 B;  4JI5 O;  1PL4 A;  1WA8 A;  1JJ2 U;  4I9Q A;  1SQG A;  1SQX H;  3RT3 C;  1V55 C;  3UKM A;  4LCU C;  5B1A B;  3ASO C;  5BZB A;  4PI0 A;  1K97 A;  3M8A A;  4DV4 O;  2QKC A;  4DV3 B;  4PA9 A;  1HNW O;  1KB9 F;  4DR5 O;  4LF6 B;  5H9C A;  4PHZ A;  1NS1 A;  2OCH A;  4BIU A;  1QCE A;  4LFC B;  2Y0P A;  3LUT B;  3DSQ A;  5JCO C;  4PA7 A;  1VF5 B;  2Z0A A;  3QG5 A;  1WB7 A;  4DV3 O;  4GX1 A;  3IAY A;  4GT1 A;  3CB2 A;  4KP4 A;  1YHQ V;  3A2F A;  1FXV A;  4UCT A;  1V54 B;  3ZHS A;  4H44 B;  3E8B A;  1SES A;  2Y69 C;  2QKS A;  4O2B B;  3R66 A;  4MSW C;  4YIO A;  3ETQ A;  1GH6 A;  3K5L A;  4JV5 O;  4WFB V;  1KYO F;  5EIB C;  2QM8 A;  3B2E E;  1U96 A;  4X64 B;  3CP1 A;  3RN4 A;  5DN6 G;  2IBZ H;  4FVM A;  3SYC A;  4J9Y B;  1OJH A;  4ZOL B;  4B7E A;  2YDE A;  2L6L A;  2YSU B;  2R9I A;  2ZIN A;  1VMG A;  2B9Z A;  4PA6 A;  5B1B B;  3SJA C;  4RUE A;  4X64 O;  2LO1 A;  4O4L A;  4IHJ B;  2UXB B;  2ZDI C;  1CEZ A;  1HP8 A;  2B1G A;  2CUG A;  1D5N A;  2ZIO A;  1YJN V;  5EBL C;  1XI1 A;  3STZ C;  2PI5 A;  4H0L B;  3TXQ A;  1NVP D;  3FB8 C;  2BTQ A;  2ZE6 A;  1QQC A;  1YCI A;  3L9D A;  5B1A C;  5ITZ A;  4ZI7 B;  2UXB O;  2NNU A;  3RVY A;  1N34 B;  2AZ0 A;  2Q0A A;  3HKD A;  1DTO A;  4X1I B;  1MZF A;  3ZHQ A;  2CTR A;  4GCZ A;  4DW1 A;  3CWB H;  1YIJ V;  2RJZ A;  3L72 H;  2ADP A;  1EZV H;  3AK1 A;  3EXA A;  4X89 A;  3VQX A;  2ZXW C;  2D2C B;  2RQ6 A;  1Q8I A;  2KG7 A;  1YIT V;  1N34 O;  4J41 A;  3CRQ A;  3ABL B; 
#chains in the Genus database with same CATH homology
 4J7J A;  3FX7 A;  4IYH A;  2GTS A;  4IYI A;  4W4K A;  4J10 A;  4KXR A;  4W4L A;  4J7K A;  2G38 A;  4J41 A;  4J11 A;  4J42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...