4J41A

The crystal structure of a secreted protein esxb (mutant p67a) from bacillus anthracis str. sterne
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
89
structure length
89
Chain Sequence
b'SNAMAEIKITPEELERIAGNFKNAAGEAQSQINRLEGDINSLEGQWAGATQAKFRGEFIQSKQAMQQYIAILEGISTDLKRIADKFRNT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords secreted protein EsxB
publication title The crystal structure of a secreted protein EsxB (Mutant P67A) from Bacillus anthracis str. Sterne
rcsb
source organism Bacillus anthracis
molecule tags Unknown function
total genus 42
structure length 89
sequence length 89
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 4j41A00
4W4KA 4J10A 3FX7A 4J41A 4IYIA 4J42A 4J7JA 4J7KA 4J11A 4KXRA 4IYHA 4W4LA 2GTSA 2G38A
chains in the Genus database with same CATH superfamily
3RYFA 4PA6A 3K06A 3ZRWA 5FNVA 2IJKA 1WNSA 1XMOB 4JV5B 2UXNA 3CCUV 1PL4A 2XAHA 4OX9B 5EC1C 2L6LA 2BTOA 1URFA 2LGQA 4O4LB 1NS1A 2ADPA 3ABLB 4UVCA 3IJ4A 3UT5A 4I50B 1KQSU 1TUBA 1NU1H 1OZ0A 3JALB 1HDJA 1K4DC 2Q67A 2X7RB 1WPBA 1V55C 5BXZA 1K33A 2ZE8A 2H8PC 4B3MB 1PNLA 1GM9A 3T1HO 3JSLA 4DK1A 2R9AA 1N32O 4NB5A 1E79G 4NR1A 3CMEV 1WB7A 1FJGO 4TQDA 1IXBA 2RNBA 3ZHUA 1CXZB 2KG7A 2HP8A 3OEEG 4DV0B 3QO5A 3K5NA 4LF6O 1VQOV 5JJEB 4N21A 2AHZA 3DXRB 2CH7B 3ZRSA 1AROP 1O9GA 2R9IA 3U0ZA 1QVGU 3A2FA 3F5TA 2ZINA 1GM7A 4JASA 2IJIA 2UXDO 4DUZO 1Q7YW 1J95A 3JD0A 3K9SA 3E8BA 4DW1A 4DR3B 1TGOA 5LGTA 1VQ5V 1VQ4V 3G67A 1QLNA 3G6BA 2GBOA 4JI6B 3CC7V 1DGSA 1ROPA 1XHZA 4ICGA 2PYLA 2XAJA 5LYJA 3CE2A 5H6QA 1SQVH 1ZAUA 3RT3C 1GTOA 4HBNA 5LMNO 1CP9A 2IH1C 3W7SA 5FPOA 4CH3A 1FPOA 1I94O 4JI3O 2Q7GA 3EHBB 3CCJV 3TXSA 5CBFA 3HKEA 4FFBA 1NH2D 1BZKA 1DTOA 4PDVA 4XDKA 3K58A 4DYLA 1YEWA 4P9PA 3ETQA 4QPKA 3L9DA 3AK3A 5J2UA 4YHHO 4LF7O 2EX3A 2AXTZ 3A8TA 4X64O 4MVQA 3T1HB 1R6TA 1KKDA 3DC6A 2LFRA 4JI0B 1N32B 2Y0PA 2LW7A 5EC2C 1BHBA 1COWG 3SPJA 1IBKO 5KX5B 1HP8A 4KXRA 1VF6A 4WFGA 4IHJA 3K0GA 2HJDA 4DW0A 3CPWU 3L70H 2OCCC 5L3CA 3SR2C 5KA5A 1HR0O 4LF6B 4UV8A 1P84F 3HKBB 5E1AC 2B1IA 5LOVB 1JFFA 1O9HA 1BSMA 1KECA 4I0XA 3RW0A 1Q81W 3CD6V 1IX9A 1FD9A 1AVMA 3T1CA 4DV1O 1OCZC 2UXDB 4DUZB 4QE7A 2F43G 2PTMA 1N4CA 1NI8A 2IW5A 1I08A 2WLLB 2YEVA 4TOIA 2IJHA 3M8AA 1JJOA 4GX1A 3K59A 4PDLA 2Y69C 3AG3C 4HNAB 4YY3O 3K0DA 2YDEA 3E22A 3KCXA 1VARA 5LMNB 3H1KH 3HKDB 1R3LC 2LO1A 3E83A 4AQYO 1I94B 4JI3B 3G6EV 3BABA 2PI4A 4ZIBA 3E8GA 4FLTA 1M5IA 1XEQA 2HVKC 1JJ2U 1M93A 4PHZA 2ZM6O 2JEUA 3SYOA 1VQMV 4YHHB 4X64B 2P06A 2LW1A 1W0JG 2EILC 2JK5C 4AHCA 1PNKA 4ZI7B 1IBKB 3ABTA 5IYBO 2JDIG 3W7UA 4FLWA 1MMMA 3J81N 1IBMO 3FFQA 2WAMA 1VF5B 3AG1B 4LWSA 1S5HC 1S0VA 1HR0B 3CCMV 2EIKB 2Y4UA 1PL0A 3BA8A 1MNGA 4FZ0A 1IURA 1Q43A 2OCCB 4X1YA 1G6UA 1AR1B 2N04A 2JS3A 4X1KB 3E35A 4DV1B 1V9PA 3ZHSA 4MVUA 3OGIB 5H2FZ 1K92A 2CGNA 4U7NA 1RSOB 1OCZB 3S3XA 5B66Z 1F23A 5CA3A 3OTFA 3HR0A 4FZ1A 4I4TA 1P7BA 3FB8C 2P4KA 3IAYA 4YY3B 1A32A 1WLEA 4P2ZA 1VQ8V 1D2DA 2Y69B 1FXHA 4UCSA 4AQYB 3AG3B 4RUFA 1YCIA 4ZOLB 4I7ZB 4IGGA 1AJQA 1H2NA 3ZMSA 2NLJC 5KUMA 1N33O 5B5EZ 4JI4O 1BGYH 3LSQA 2CGOA 2W0XA 5BZBA 4P30A 1IXMA 2BE3A 4TV9A 1ZUQA 4UV9A 4IIJA 4F6RB 2IH3C 5CBGA 2ZM6B 3JD4A 5J2TA 2R72A 1KC8W 4JYYA 5D5QA 3ZCCA 1VQKV 2PF4E 2ETNA 2KB1A 4PELA 3X2QC 4KHPB 4LFBO 4PD4F 5JCOC 4B7EA 4UCOA 4JTAB 1TVKB 3G4SV 5LP6C 3O9OA 2R9RB 5EYPA 2GV9A 4XBFA 2EILB 1BS3A 3WFVA 2WLJA 4X20A 1IBMB 4EB6A 3M7MX 4LNUB 3H1HH 3JATB 5KHJA 3D36A 2YIDA 2ZDIA 1W2BU 1J5EO 3OE7G 3CXHF 4L87A 3IGAC 1SETA 2PUSA 3IFXA 3CSXA 3JYCA 2JGDB 1VQ6V 4DRXB 3RGBA 3OR7C 1BT8A 1RPRA 5F2VO 4FM1A 2ODMA 1SQGA 1P4RA 3CJHA 4WBNA 4WFBV 4K35A 3CS5A 3P3PA 4CBCA 2RQ6A 1KP2A 3FB5C 4GX2A 2RDCA 1K4CC 2BOCC 4TSFG 2QKSA 4DXWA 5B1AC 1TUEB 4YIPA 1WPXA 3ASNC 1N33B 4JI4B 2ZIMA 3UM7A 4MW3A 5E79Z 4UVBA 2WLKA 1U97A 4OGQB 5A9GA 4IL6Z 2QKCA 4J7KA 2Q7HA 3OFNG 5C8YB 3JARB 1WP8A 4ABMA 1JOYA 3OMNB 3THOA 1R3KC 2EIJC 5GONA 4RQFA 3OGCC 4B3SB 4TV8A 4R7CA 1AILA 2WLHA 1P49A 3F7VC 3JAKA 2RCVA 4IYHA 3QO7A 4JTCB 4O2AA 4PA3A 3SPCA 1KBHA 5GTIZ 3FD9A 1Q86W 3MDSA 3X2QB 3K9AA 4PDMA 3QTCA 3SGIA 1G1XB 5LP6B 4FK5C 2Y0IA 4JI2B 3KCYA 2WA4A 4TWKA 1J5EB 2ZKOA 4FM0A 3AK2A 5EK0A 5BMVA 2HLDG 1EM1A 1SS3A 3RVZA 3BAAA 4GLXA 3ABLC 3JCUZ 4OX9O 3ZBHA 2W6IG 4XDJA 2QWRB 3CXCU 3OW2U 4EKWA 3ZMVA 4I9QA 2QWPB 3ZMZA 3R66A 3Q4HB 1IBLO 3ZN1A 3OEHG 1NR1A 2YI8A 2FMLA 2Z3YA 4KL1A 1QLEC 4X8AA 1XQ8A 3JAWB 3RYHA 2WPDG 4GX5A 1NZ6A 4DV7B 1THZA 2FB5A 1I5XA 3AK1A 4O2BB 4PDRA 1XHXA 1QCEA 3P3NA 2X6AA 1VQLV 2X0LA 4FLYA 2YSUB 1FFTB 2V1DA 4MT8A 2UUBO 5CA1A 2M6YA 2IU3A 1EFRG 1K73W 3ASNB 2IJJA 1SC5B 4W4LA 1UPGA 2QKAA 1FFXA 2CAZC 4O4IB 3VBBA 1GK9A 3A0BZ 1MOFA 4EFBA 1Y76B 2ZE6A 4QGPA 1FXKA 2NNUA 3JASA 4ZHQB 2AHYA 4Z1MG 4DR3O 4YJ2A 5LXTB 3JSNA 3QVNA 4MTXA 2BTQA 4D7TA 2FTKA 4GYCB 1GN4A 3DC5A 3B09A 3F7YC 2F1MA 3SYPA 3A0HZ 3CCRV 3D3IA 3W7WA 1FYJA 1BQ0A 4KFMA 3UKMA 3SJAC 2FYUH 4XDLA 1YF2A 4U3JA 4X1IA 4DR5O 2Q9LA 3OR6C 1OCOC 1KKCA 4JI5O 2QEXV 1PV0A 1KU9A 3RYIA 4R50A 2GUZA 1IBLB 1KMIZ 3I56V 5CBHA 3W7XA 3VOUA 2Q8VA 5CA0A 2Q7EA 1I0HA 2XAGA 4DUYO 1NJIW 3SPIA 5IJ0B 2ADQB 4FFKA 1AJPA 4JI0O 3LDDA 3ZMTA 1YJNV 4BIOA 4QNHB 1QLEB 4X89A 3K03A 2HFEC 3BHPA 2UUBB 2A7WA 1ZLZA 3MHSC 4O4LA 1ZL8B 1XILA 3ASOC 2WLMA 1K5SA 4YJ3B 1QVFU 4I50A 2JEXA 2UXBO 5LA6B 4J10A 4GUNA 3JALA 3RFRA 1K8AW 2ZXWC 3E89A 1SQBH 3CCSV 3CP1A 2QE7G 5JVDB 1VEWA 2IU0A 1Z5WA 1M4UA 1Y74B 3L75H 2M7WA 2RN9A 3GB7C 3I5DA 4RWUA 3DTUB 5LGUA 3TXQA 4QPJA 3B8MA 2YXHA 5CMUA 3GVMA 3O65A 2PGGA 3ABKB 4RQEA 3ZEDA 1DLBA 3STZC 1QBZA 1JCHA 3ZS8C 3KZIZ 2IM9A 3DXRA 5LHIA 2F23A 4FLZA 2CH7A 3NR7A 4UUJC 2CTPA 4O4HB 4FLVA 3SDLA 3OTOO 4DR5B 4PV1B 4Q6GA 3M99B 3ZMUA 3ZHQA 3D8CA 1WB8A 2DW4A 4JI5B 5BY1A 1L0NH 2QR4A 1N0NA 4IYIA 2CK3G 1OCOB 2LP7A 4JYAO 1M56C 1H8HG 1R1BA 2QSAA 3DGEA 3R65A 3WB1A 3CCLV 4DUYB 3QF7A 1G4YB 1VF7A 2QDOA 3APQA 3OM3B 1K5QA 2YI9A 2E75B 2FL4A 3AG1C 1B6QA 1R3JC 2NN4A 3MAQA 1W0KG 1QQCA 2EIKC 2UUAO 1JMKC 4U3FH 3JD1A 5IYZB 2UXBB 4OPHA 3OUFA 4E2LA 2F93B 1XL4A 3ASOB 2QTOA 4FPPA 4DO2A 4G2KA 2R70A 4GT1A 4O4JB 2ZXWB 5EZYB 3ZJZA 2HR3A 5FLXN 2OIGA 4FIPC 1HNWO 3WB0A 2V7QG 1GN3A 2B1GA 5KX5A 4GKKO 3OUSA 3RYCB 5KA6A 3JCZA 3E2EA 2GTSA 3CEIA 1KYOF 1YJ9V 3HKBA 5LOVA 2YC0A 5DEDA 1BE3H 3T4DA 4B7KA 2HHHB 3OTOB 1Q3EA 1M9NA 5A2QN 2B9ZA 2H94A 4X88A 1YIJV 5B1OA 5JQGB 5K1XA 4FLXA 4PI0A 4JYAB 2JGUA 2WLLA 1GM8A 3B8NA 2C2AA 1Z5VA 4Z1VA 5JH7B 2EJ7A 2VS0A 1Q90D 2MW2B 4UB6Z 5IYCO 1M56B 3ETDA 3BEHA 4HNAA 4D6TH 4KHPO 3VQVA 1R6NA 3K3WA 2XTAA 3CX5F 4MVZA 1XDCA 2Y4TA 1NTKH 2ZR3A 1I7FA 3WB2A 1NT2B 2UUAB 5CB4B 4I55B 4B3TO 1WJZA 1NR7A 3LSUA 1S76D 2A79B 4DV4O 4G27B 5FPRA 5KAIZ 2E3CA 1BHAA 3U10A 3OD4A 4DR2O 3RWRD 3ABUA 5ITZB 4EFEA 4J80A 4JAUA 4QJFB 3BRCA 4UFZA 1DK1A 2OYQA 4PA4A 1QHTA 4HAMA 1HNWB 4X66O 2ITCC 4UB8Z 3RN4A 2VRZA 5IYDO 4ZI7A 3HKCB 3AEIA 4DR6O 3P30A 4GKKB 4BIUA 2P7TC 4JI7O 1WA8B 5B1NA 4K8XA 1H2GA 1PM9A 1NVPB 3CCVV 1N0JA 4IIJB 1ENVA 2ZE7A 4K0KB 2MK3A 1K97A 4W4KA 5KHHA 4X1KA 1YSCA 4JI1B 2A9HA 4JAVA 2ITDC 2XOKG 2BCCH 1F7YA 3T1YO 2YXYA 2HVJC 1RSOA 3LUTB 2B5UA 5KMGB 2YICA 1MZFA 4B3SO 1AP5A 3MHHC 2GDSA 2HJFC 4X20B 4EEQA 4LF8O 1H2KA 1N34O 2ZIOA 5IE9A 4DR4O 2A0LA 5H9CA 1YXBA 4JPRA 4K3AA 2BSKA 4LF9B 3C3TA 3RVYA 3LNMB 2IBZH 2F4VO 1D5AA 4LP8A 4LBEC 2Q6AA 3K57A 2QA4V 4P9OA 2GHYA 5H5NA 4ZOLA 2WLNA 1K9MW 1KD1W 4JI8O 4B3TB 1VQ7V 4TUYB 4JI2O 4DV4B 2JJ1G 4I5SA 3N2KB 4X62O 1YI2V 4CH6A 2ZNIA 2WWWA 3AG2C 4CZZA 1FAFA 4F6RA 3CMAV 3L72H 4DR2B 3OMAB 2P4VA 3AG7A 1SF9A 2X6CA 4J7JA 4J9YB 3TCUA 1L8DA 2DWDC 1CEZA 1VMGA 4X66B 4UCTA 1TVKA 2DYRB 4CC5A 2YS8A 4DR6B 4G28B 4JTDB 4OXSA 4JI7B 5IJ9B 1Y6XA 4LNUA 1EBOA 3JATA 4DR7O 1T5EA 2XAQA 4MS2A 4DV7O 2GTAA 4ZBMA 5B3SC 2O57A 3CC2V 1ZWIC 4LFAB 3UO3A 5DM6V 1SQQH 5JJNB 2JGDA 1JPXA 2DMXA 3H1JH 5JJJB 4DRXA 5HFLA 2ATKC 4U7OA 5GTHZ 5KHKA 4KP4A 3T1YB 2VWJA 1Q6HA 1NKDA 2A06H 1RPOA 2QM7A 3ICXA 1AI5A 1MABG 4LH6A 3CRQA 3U11A 4LF4O 4GZRB 4LF8B 1N34B 2LQTA 4DR4B 1PPJH 1E1RG 2W6JG 2F4VB 3E8FA 1SQPH 2EJRA 3A0RA 4JZ2A 2ZE5A 2BOBC 4UCRA 4JI8B 3IC7A 1XNRO 1KB9F 2K1EA 4TQFA 1V54C 1N36O 2AW9A 2K9PA 4X62B 1BQZA 2HKOA 2VQFO 2KSDA 5C8YA 3JARA 3J80N 4GX0A 3AG2B 4Z2WA 4JYCA 2QGNA 5LL6Y 1Q5OA 1UJWB 2WLIB 1BMFG 1DF5A 4PI2A 4OPAA 5IWAO 4F6EA 1EN5A 4BW5A 2Q0OC 1W59A 1XL6A 5JCOA 3VQYA 5EIBC 3TETA 5LP6A 3ZHTA 2EINC 3L71H 4DR7B 4YXWG 1M57C 1SA0B 1QNMA 5IY5C 1GH6A 1JVMA 2HG5C 4DV6O 4GKJO 1TAEA 1R3IC 5HFMA 3SPHA 1YTFB 5B3SB 1JA8A 1UFIA 4A5UB 1HWYA 3OAAG 4TT3G 3N2GB 4MVOA 3BVOA 3Q4HA 3OT7A 4LF4B 3LDEA 1PD3A 2RMKB 3RYFB 3ZRWB 5FNVB 3JAWA 1F4MA 1WAZA 3PJSK 3B77A 1MSWD 1QR9A 4O2BA 3CWBH 3ABKC 1XNRB 2H3OA 1AI4A 1N36B 2Q73A 1AI6A 4DV2O 5GW7A 3UT5B 3SYAA 1LUWA 2VQFB 1TUBB 2ZR2A 1ZSPA 1V54B 4NXNO 2DYSC 4ZKIA 4O4IA 2HEPA 1D5NA 1Y76A 2Q5ZA 3JD3A 2OTLV 2QWOB 3L73H 5BR8O 4QE9A 1AJNA 1P7GA 3FAVA 4I9WA 4HYOA 4H13B 1VF6C 5IWAB 1ZX3A 4ZHQA 1U96A 1L0LH 3ZX6A 2UXXA 4LR3A 1TA8A 3SYCA 5LXTA 3W7TA 3CHXA 1IDSA 2VWKA 1YITV 2KG7B 4JGSA 2CTQA 3FYEB 3H1LH 2V4DA 1XBLA 1S77D 2AGAA 1YJWV 3EVKA 5KUKA 2ARHA 4RAIA 2EINB 3SJQC 2EZOA 4DV6B 2EULA 4GKJB 1M57B 5IY5B 2UXCB 1IVSA 3AG4B 2JRIA 5LHGA 2DE0X 2Q68A 4MTOA 1VQPV 3BA9A 1GO3F 4CH5A 5KAFZ 4FVMA 1OCCC 2AZ2A 1OCRC 2P5OA 5LYJB 3QO8A 1S5JA 3G80A 4NVPA 4AILC 5J9PC 2EIMC 5IJ0A 2KKWA 3QG5A 1N8RW 4L8JA 5K1PA 5L3GA 2QM4A 4IT5A 3NXSA 4WCEV 1XNQO 1OJHA 3LNNA 4DV2B 3VQXA 3HKEB 5EBWC 4FFBB 4NTWA 1ZL8A 1KP3A 4YJ3A 4NXNB 2ZNJA 5LA6A 5CN0A 5EBLC 2P6JA 3K5LA 3JD2A 1VIBA 3N27A 4LC1A 1B3QA 3VQWA 5JVDA 2HHHO 5BR8B 4MTGA 5J2UB 2DYSB 3RBZA 4JZGA 3BFRA 1PKXA 1Y74A 4WF9V 1FXVA 1RM1C 1K7DA 4IHJB 4NTYA 1XREA 3QNEA 1H2MA 3EXAA 3CRRA 1JFFB 4LFCO 3SPGA 2L35A 4I0XB 4WFHA 1LNQA 1SKVA 4O4HA 2OWOA 2E76B 2EBOA 3MD0A 2Q4PA 2Q69A 4C7UA 2FKXA 1V55B 4RO2A 2YEVB 5DECA 2XAFA 4MVMA 3TK1A 2YXLA 2XT9A 2E5LO 2KQXA 1FJGB 1RP3B 2PZSA 3H9VA 2Z5UA 3FB6C 2ILMA 1OCCB 4CC6A 4WFFA 4MW8A 2LJ2A 1OHHG 3E22B 4CS3A 3J7AU 1OCRB 1Q6UA 3IC9A 3BY6A 3K5OA 2EIMB 4LH7A 3ZHVA 2WA3A 1XNQB 2N05A 5IDJA 1WN7A 4D7SA 3ETEA 5IYZA 1ORQC 2PYJA 1GAXA 3FKSG 4K0KO 4WFEA 2ZD9A 1NVPD 1G8MA 4JI1O 3JAMN 1AR4A 1EN6A 4O4JA 5EZYA 3K79A 3STLC 3ABMC 4RUEA 4F4LA 2YIBD 1WP7A 4BAYA 3D36C 2ZDIC 4GCZA 1NH2B 1GN6A 4J41A 4LWSB 1RM1B 1R6KA 3RYCA 1GKFA 5LGNA 3BCCH 5KHIA 3FB7C 4NTXA 4LFCB 4LF9O 3KG2A 3L74H 4X1YB 3SJCC 3HKDA 1K3EA 4J9ZB 2XNDG 5TISZ 3UO2A 1H2LA 5L3DA 1KUQA 3APOA 4LF7B 3C3SA 1SERA 2UUCO 4NYKA 3TGUH 5JQGA 1LR1A 5L3BA 2E5LB 2LFSA 5B1BC 5AG2A 2D2CB 2F95B 4JYBA 2Q0AA 5JH7A 3CB2A 4I4TB 2CDYA 1YHQV 2XUMA 1QR8A 2DYRC 5IT9N 1K34A 1SESA 2A3QA 1B04A 1YVWA 1NBMG 3UCSC 3UQ8A 2CUGA 4K8ZA 5DN6G 2YIAA 1US6A 4MVSA 2X6BA 4NXMO 1H8EG 3HB3B 5CB4A 4I55A 1FS0G 3H1IH 4TV9B 2JVDA 3T4ZA 4BW9A 3CYOA 4R6ZA 3DSQA 4LFAO 4B3RO 1E1QG 1PNMA 5J2TB 3ZRXA 2E74B 2ZCEA 2G38A 5ITZA 2LGWA 3ZRVA 2PI5A 1XMQO 3GWKC 1AP6A 2BSKB 3K08A 5EYPB 2P90A 2UU9O 4N23A 3HKCA 1BCCH 3ABMB 4UVAA 1H2SB 4EB6B 3EFFK 2DWEC 1WA8A 1S5LZ 2N74A 4HZ3A 1L1FA 4BIZA 3CRMA 3E86A 4PA9A 1DF4A 1EZJA 4R8CA 1VP7A 5KHGA 2VQEO 2QWNB 1LUVA 2YUAA 3KKYA 2D3OW 1JX9A 2RJZA 4DR1O 1SQXH 4J11A 2YIBA 2UUCB 4PJ0Z 2EZPA 1Y66A 2QWQB 4Q20A 4FLUA 3CJHB 4H44B 4WBNB 5KMGA 4BWAA 2JS5A 2AZ0A 2QTSA 3S3WA 3TJTA 4FM2A 1NTMH 1XUQA 2W0FC 5B1BB 2PY5A 4UCUA 2OT5A 1AI7A 4CS4A 4WFAV 2NR5A 4J7ZA 4LCUC 4H33A 3CC4V 2DQ0A 4DV5O 1AB3A 3F5WC 2ZT9B 1F4NA 4NXMB 3HPLC 1NTZH 5LMUO 4DV3O 4LF5O 3H01A 4TUYA 1XI1A 3E8HA 3N2KA 2OCHA 3C90A 4X65O 5GONB 1FXKC 4UCVA 2DOSA 1OV9A 4B3RB 1Q82W 2ZQMA 4TV8B 4J42A 3JAKB 1HNXO 5LHHA 1XMQB 1R73A 4O2AB 1X4TA 1SZTA 2XASA 1YTFD 5LBQA 1JQ0A 1MA1A 4B08A 3WG7C 2UU9B 3CRCA 2F66C 2JJ2G 1MG1A 1XOUA 4KUMA 3SJBC 5IJ9A 2Y48A 3LSSA 3ML0A 3CRAA 3PN1A 5BMVB 4MSWC 3K5MA 1SZXA 2Z0AA 2DQ3A 2VQEB 3FYIB 4DR1B 5KLVH 3B4SA 5C93A 4LFBB 1EZVH 1FKAO 2XHBA 3K04A 4MVRA 3CCEV 2P22C 1AR5A 2QM8A 2DN9A 1M1KW 1HNZO 1ZTEA 3D3QA 4FMTA 3RYHB 2CTWA 1HW7A 1JR9A 5D5PA 1XMOO 4DV5B 5EBMC 4JV5O 2OTJV 2CE4A 1GRJA 1YDXA 1M90W 1CPYA 5LMUB 1Z2GA 4DV3B 4E4EA 2OIEA 2DJVA 5CA1B 4LF5B 3B2EE 4JF3A 4YIOA 1VQNV 4CS2A 3G71V 5L3EA 1GN2A 1FFXB 3AG4C 4X65B 4AI8A 1QU7A 1BL8A 1NQTA 3FX7A 1B06A 3B40A 4FJCC 5EIBD 1HNXB 3OMIB 2UXCO 1FXKB 1IZ3A 3JASB 1Q6IA 4B3MO 5FL7G 2WLIA 4JAAA 4YJ2B 4H37A 1PP9H 1YZBA 4CH4A 2BTQB 1VQ9V 2WSSG 3I55V 5H6RA 4X9QA 4UXNA 5B1AB 3WG7B 1S3JA 4QIWF 1MZEA 1F51A 4DV0O 3T2MA 1SA0A 2GSMB 2JIZG 3ETGA 1Y67A 3BPZA 4BR6A 1MSDA 1EN4A 2CTRA 2QJ1A 3SYQA 4H0LB 3ZHRA 5L3FA 1Y4MA 3LDCA 1S72V 4U3JB 4X1IB 1I5YA 2P67A 2EIJB 5JWPA 3FAVB 1RFYA 3ZN0A 4NKGB 4DK0A 1SQFA 1SRYA 4MTFA 3P32A 3RYIB 2GUZB 1Q8IA 3ZIAG 3N2GA 4ASUG 4PA7A 3CCQV 1X59A 5CA0B 1HNZB 4JI6O 3WU2Z 1H38A 3GWOA 1GMGA
chains in the Genus database with same CATH topology
4W4KA 4J10A 3FX7A 4J41A 4IYIA 4J42A 4J7JA 4J7KA 4J11A 4KXRA 4IYHA 4W4LA 2GTSA 2G38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W4K A;  4J10 A;  3FX7 A;  4J41 A;  4IYI A;  4J42 A;  4J7J A;  4J7K A;  4J11 A;  4KXR A;  4IYH A;  4W4L A;  2GTS A;  2G38 A; 
#chains in the Genus database with same CATH topology
 3RYF A;  4PA6 A;  3K06 A;  3ZRW A;  5FNV A;  2IJK A;  1WNS A;  1XMO B;  4JV5 B;  2UXN A;  3CCU V;  1PL4 A;  2XAH A;  4OX9 B;  5EC1 C;  2L6L A;  2BTO A;  1URF A;  2LGQ A;  4O4L B;  1NS1 A;  2ADP A;  3ABL B;  4UVC A;  3IJ4 A;  3UT5 A;  4I50 B;  1KQS U;  1TUB A;  1NU1 H;  1OZ0 A;  3JAL B;  1HDJ A;  1K4D C;  2Q67 A;  2X7R B;  1WPB A;  1V55 C;  5BXZ A;  1K33 A;  2ZE8 A;  2H8P C;  4B3M B;  1PNL A;  1GM9 A;  3T1H O;  3JSL A;  4DK1 A;  2R9A A;  1N32 O;  4NB5 A;  1E79 G;  4NR1 A;  3CME V;  1WB7 A;  1FJG O;  4TQD A;  1IXB A;  2RNB A;  3ZHU A;  1CXZ B;  2KG7 A;  2HP8 A;  3OEE G;  4DV0 B;  3QO5 A;  3K5N A;  4LF6 O;  1VQO V;  5JJE B;  4N21 A;  2AHZ A;  3DXR B;  2CH7 B;  3ZRS A;  1ARO P;  1O9G A;  2R9I A;  3U0Z A;  1QVG U;  3A2F A;  3F5T A;  2ZIN A;  1GM7 A;  4JAS A;  2IJI A;  2UXD O;  4DUZ O;  1Q7Y W;  1J95 A;  3JD0 A;  3K9S A;  3E8B A;  4DW1 A;  4DR3 B;  1TGO A;  5LGT A;  1VQ5 V;  1VQ4 V;  3G67 A;  1QLN A;  3G6B A;  2GBO A;  4JI6 B;  3CC7 V;  1DGS A;  1ROP A;  1XHZ A;  4ICG A;  2PYL A;  2XAJ A;  5LYJ A;  3CE2 A;  5H6Q A;  1SQV H;  1ZAU A;  3RT3 C;  1GTO A;  4HBN A;  5LMN O;  1CP9 A;  2IH1 C;  3W7S A;  5FPO A;  4CH3 A;  1FPO A;  1I94 O;  4JI3 O;  2Q7G A;  3EHB B;  3CCJ V;  3TXS A;  5CBF A;  3HKE A;  4FFB A;  1NH2 D;  1BZK A;  1DTO A;  4PDV A;  4XDK A;  3K58 A;  4DYL A;  1YEW A;  4P9P A;  3ETQ A;  4QPK A;  3L9D A;  3AK3 A;  5J2U A;  4YHH O;  4LF7 O;  2EX3 A;  2AXT Z;  3A8T A;  4X64 O;  4MVQ A;  3T1H B;  1R6T A;  1KKD A;  3DC6 A;  2LFR A;  4JI0 B;  1N32 B;  2Y0P A;  2LW7 A;  5EC2 C;  1BHB A;  1COW G;  3SPJ A;  1IBK O;  5KX5 B;  1HP8 A;  4KXR A;  1VF6 A;  4WFG A;  4IHJ A;  3K0G A;  2HJD A;  4DW0 A;  3CPW U;  3L70 H;  2OCC C;  5L3C A;  3SR2 C;  5KA5 A;  1HR0 O;  4LF6 B;  4UV8 A;  1P84 F;  3HKB B;  5E1A C;  2B1I A;  5LOV B;  1JFF A;  1O9H A;  1BSM A;  1KEC A;  4I0X A;  3RW0 A;  1Q81 W;  3CD6 V;  1IX9 A;  1FD9 A;  1AVM A;  3T1C A;  4DV1 O;  1OCZ C;  2UXD B;  4DUZ B;  4QE7 A;  2F43 G;  2PTM A;  1N4C A;  1NI8 A;  2IW5 A;  1I08 A;  2WLL B;  2YEV A;  4TOI A;  2IJH A;  3M8A A;  1JJO A;  4GX1 A;  3K59 A;  4PDL A;  2Y69 C;  3AG3 C;  4HNA B;  4YY3 O;  3K0D A;  2YDE A;  3E22 A;  3KCX A;  1VAR A;  5LMN B;  3H1K H;  3HKD B;  1R3L C;  2LO1 A;  3E83 A;  4AQY O;  1I94 B;  4JI3 B;  3G6E V;  3BAB A;  2PI4 A;  4ZIB A;  3E8G A;  4FLT A;  1M5I A;  1XEQ A;  2HVK C;  1JJ2 U;  1M93 A;  4PHZ A;  2ZM6 O;  2JEU A;  3SYO A;  1VQM V;  4YHH B;  4X64 B;  2P06 A;  2LW1 A;  1W0J G;  2EIL C;  2JK5 C;  4AHC A;  1PNK A;  4ZI7 B;  1IBK B;  3ABT A;  5IYB O;  2JDI G;  3W7U A;  4FLW A;  1MMM A;  3J81 N;  1IBM O;  3FFQ A;  2WAM A;  1VF5 B;  3AG1 B;  4LWS A;  1S5H C;  1S0V A;  1HR0 B;  3CCM V;  2EIK B;  2Y4U A;  1PL0 A;  3BA8 A;  1MNG A;  4FZ0 A;  1IUR A;  1Q43 A;  2OCC B;  4X1Y A;  1G6U A;  1AR1 B;  2N04 A;  2JS3 A;  4X1K B;  3E35 A;  4DV1 B;  1V9P A;  3ZHS A;  4MVU A;  3OGI B;  5H2F Z;  1K92 A;  2CGN A;  4U7N A;  1RSO B;  1OCZ B;  3S3X A;  5B66 Z;  1F23 A;  5CA3 A;  3OTF A;  3HR0 A;  4FZ1 A;  4I4T A;  1P7B A;  3FB8 C;  2P4K A;  3IAY A;  4YY3 B;  1A32 A;  1WLE A;  4P2Z A;  1VQ8 V;  1D2D A;  2Y69 B;  1FXH A;  4UCS A;  4AQY B;  3AG3 B;  4RUF A;  1YCI A;  4ZOL B;  4I7Z B;  4IGG A;  1AJQ A;  1H2N A;  3ZMS A;  2NLJ C;  5KUM A;  1N33 O;  5B5E Z;  4JI4 O;  1BGY H;  3LSQ A;  2CGO A;  2W0X A;  5BZB A;  4P30 A;  1IXM A;  2BE3 A;  4TV9 A;  1ZUQ A;  4UV9 A;  4IIJ A;  4F6R B;  2IH3 C;  5CBG A;  2ZM6 B;  3JD4 A;  5J2T A;  2R72 A;  1KC8 W;  4JYY A;  5D5Q A;  3ZCC A;  1VQK V;  2PF4 E;  2ETN A;  2KB1 A;  4PEL A;  3X2Q C;  4KHP B;  4LFB O;  4PD4 F;  5JCO C;  4B7E A;  4UCO A;  4JTA B;  1TVK B;  3G4S V;  5LP6 C;  3O9O A;  2R9R B;  5EYP A;  2GV9 A;  4XBF A;  2EIL B;  1BS3 A;  3WFV A;  2WLJ A;  4X20 A;  1IBM B;  4EB6 A;  3M7M X;  4LNU B;  3H1H H;  3JAT B;  5KHJ A;  3D36 A;  2YID A;  2ZDI A;  1W2B U;  1J5E O;  3OE7 G;  3CXH F;  4L87 A;  3IGA C;  1SET A;  2PUS A;  3IFX A;  3CSX A;  3JYC A;  2JGD B;  1VQ6 V;  4DRX B;  3RGB A;  3OR7 C;  1BT8 A;  1RPR A;  5F2V O;  4FM1 A;  2ODM A;  1SQG A;  1P4R A;  3CJH A;  4WBN A;  4WFB V;  4K35 A;  3CS5 A;  3P3P A;  4CBC A;  2RQ6 A;  1KP2 A;  3FB5 C;  4GX2 A;  2RDC A;  1K4C C;  2BOC C;  4TSF G;  2QKS A;  4DXW A;  5B1A C;  1TUE B;  4YIP A;  1WPX A;  3ASN C;  1N33 B;  4JI4 B;  2ZIM A;  3UM7 A;  4MW3 A;  5E79 Z;  4UVB A;  2WLK A;  1U97 A;  4OGQ B;  5A9G A;  4IL6 Z;  2QKC A;  4J7K A;  2Q7H A;  3OFN G;  5C8Y B;  3JAR B;  1WP8 A;  4ABM A;  1JOY A;  3OMN B;  3THO A;  1R3K C;  2EIJ C;  5GON A;  4RQF A;  3OGC C;  4B3S B;  4TV8 A;  4R7C A;  1AIL A;  2WLH A;  1P49 A;  3F7V C;  3JAK A;  2RCV A;  4IYH A;  3QO7 A;  4JTC B;  4O2A A;  4PA3 A;  3SPC A;  1KBH A;  5GTI Z;  3FD9 A;  1Q86 W;  3MDS A;  3X2Q B;  3K9A A;  4PDM A;  3QTC A;  3SGI A;  1G1X B;  5LP6 B;  4FK5 C;  2Y0I A;  4JI2 B;  3KCY A;  2WA4 A;  4TWK A;  1J5E B;  2ZKO A;  4FM0 A;  3AK2 A;  5EK0 A;  5BMV A;  2HLD G;  1EM1 A;  1SS3 A;  3RVZ A;  3BAA A;  4GLX A;  3ABL C;  3JCU Z;  4OX9 O;  3ZBH A;  2W6I G;  4XDJ A;  2QWR B;  3CXC U;  3OW2 U;  4EKW A;  3ZMV A;  4I9Q A;  2QWP B;  3ZMZ A;  3R66 A;  3Q4H B;  1IBL O;  3ZN1 A;  3OEH G;  1NR1 A;  2YI8 A;  2FML A;  2Z3Y A;  4KL1 A;  1QLE C;  4X8A A;  1XQ8 A;  3JAW B;  3RYH A;  2WPD G;  4GX5 A;  1NZ6 A;  4DV7 B;  1THZ A;  2FB5 A;  1I5X A;  3AK1 A;  4O2B B;  4PDR A;  1XHX A;  1QCE A;  3P3N A;  2X6A A;  1VQL V;  2X0L A;  4FLY A;  2YSU B;  1FFT B;  2V1D A;  4MT8 A;  2UUB O;  5CA1 A;  2M6Y A;  2IU3 A;  1EFR G;  1K73 W;  3ASN B;  2IJJ A;  1SC5 B;  4W4L A;  1UPG A;  2QKA A;  1FFX A;  2CAZ C;  4O4I B;  3VBB A;  1GK9 A;  3A0B Z;  1MOF A;  4EFB A;  1Y76 B;  2ZE6 A;  4QGP A;  1FXK A;  2NNU A;  3JAS A;  4ZHQ B;  2AHY A;  4Z1M G;  4DR3 O;  4YJ2 A;  5LXT B;  3JSN A;  3QVN A;  4MTX A;  2BTQ A;  4D7T A;  2FTK A;  4GYC B;  1GN4 A;  3DC5 A;  3B09 A;  3F7Y C;  2F1M A;  3SYP A;  3A0H Z;  3CCR V;  3D3I A;  3W7W A;  1FYJ A;  1BQ0 A;  4KFM A;  3UKM A;  3SJA C;  2FYU H;  4XDL A;  1YF2 A;  4U3J A;  4X1I A;  4DR5 O;  2Q9L A;  3OR6 C;  1OCO C;  1KKC A;  4JI5 O;  2QEX V;  1PV0 A;  1KU9 A;  3RYI A;  4R50 A;  2GUZ A;  1IBL B;  1KMI Z;  3I56 V;  5CBH A;  3W7X A;  3VOU A;  2Q8V A;  5CA0 A;  2Q7E A;  1I0H A;  2XAG A;  4DUY O;  1NJI W;  3SPI A;  5IJ0 B;  2ADQ B;  4FFK A;  1AJP A;  4JI0 O;  3LDD A;  3ZMT A;  1YJN V;  4BIO A;  4QNH B;  1QLE B;  4X89 A;  3K03 A;  2HFE C;  3BHP A;  2UUB B;  2A7W A;  1ZLZ A;  3MHS C;  4O4L A;  1ZL8 B;  1XIL A;  3ASO C;  2WLM A;  1K5S A;  4YJ3 B;  1QVF U;  4I50 A;  2JEX A;  2UXB O;  5LA6 B;  4J10 A;  4GUN A;  3JAL A;  3RFR A;  1K8A W;  2ZXW C;  3E89 A;  1SQB H;  3CCS V;  3CP1 A;  2QE7 G;  5JVD B;  1VEW A;  2IU0 A;  1Z5W A;  1M4U A;  1Y74 B;  3L75 H;  2M7W A;  2RN9 A;  3GB7 C;  3I5D A;  4RWU A;  3DTU B;  5LGU A;  3TXQ A;  4QPJ A;  3B8M A;  2YXH A;  5CMU A;  3GVM A;  3O65 A;  2PGG A;  3ABK B;  4RQE A;  3ZED A;  1DLB A;  3STZ C;  1QBZ A;  1JCH A;  3ZS8 C;  3KZI Z;  2IM9 A;  3DXR A;  5LHI A;  2F23 A;  4FLZ A;  2CH7 A;  3NR7 A;  4UUJ C;  2CTP A;  4O4H B;  4FLV A;  3SDL A;  3OTO O;  4DR5 B;  4PV1 B;  4Q6G A;  3M99 B;  3ZMU A;  3ZHQ A;  3D8C A;  1WB8 A;  2DW4 A;  4JI5 B;  5BY1 A;  1L0N H;  2QR4 A;  1N0N A;  4IYI A;  2CK3 G;  1OCO B;  2LP7 A;  4JYA O;  1M56 C;  1H8H G;  1R1B A;  2QSA A;  3DGE A;  3R65 A;  3WB1 A;  3CCL V;  4DUY B;  3QF7 A;  1G4Y B;  1VF7 A;  2QDO A;  3APQ A;  3OM3 B;  1K5Q A;  2YI9 A;  2E75 B;  2FL4 A;  3AG1 C;  1B6Q A;  1R3J C;  2NN4 A;  3MAQ A;  1W0K G;  1QQC A;  2EIK C;  2UUA O;  1JMK C;  4U3F H;  3JD1 A;  5IYZ B;  2UXB B;  4OPH A;  3OUF A;  4E2L A;  2F93 B;  1XL4 A;  3ASO B;  2QTO A;  4FPP A;  4DO2 A;  4G2K A;  2R70 A;  4GT1 A;  4O4J B;  2ZXW B;  5EZY B;  3ZJZ A;  2HR3 A;  5FLX N;  2OIG A;  4FIP C;  1HNW O;  3WB0 A;  2V7Q G;  1GN3 A;  2B1G A;  5KX5 A;  4GKK O;  3OUS A;  3RYC B;  5KA6 A;  3JCZ A;  3E2E A;  2GTS A;  3CEI A;  1KYO F;  1YJ9 V;  3HKB A;  5LOV A;  2YC0 A;  5DED A;  1BE3 H;  3T4D A;  4B7K A;  2HHH B;  3OTO B;  1Q3E A;  1M9N A;  5A2Q N;  2B9Z A;  2H94 A;  4X88 A;  1YIJ V;  5B1O A;  5JQG B;  5K1X A;  4FLX A;  4PI0 A;  4JYA B;  2JGU A;  2WLL A;  1GM8 A;  3B8N A;  2C2A A;  1Z5V A;  4Z1V A;  5JH7 B;  2EJ7 A;  2VS0 A;  1Q90 D;  2MW2 B;  4UB6 Z;  5IYC O;  1M56 B;  3ETD A;  3BEH A;  4HNA A;  4D6T H;  4KHP O;  3VQV A;  1R6N A;  3K3W A;  2XTA A;  3CX5 F;  4MVZ A;  1XDC A;  2Y4T A;  1NTK H;  2ZR3 A;  1I7F A;  3WB2 A;  1NT2 B;  2UUA B;  5CB4 B;  4I55 B;  4B3T O;  1WJZ A;  1NR7 A;  3LSU A;  1S76 D;  2A79 B;  4DV4 O;  4G27 B;  5FPR A;  5KAI Z;  2E3C A;  1BHA A;  3U10 A;  3OD4 A;  4DR2 O;  3RWR D;  3ABU A;  5ITZ B;  4EFE A;  4J80 A;  4JAU A;  4QJF B;  3BRC A;  4UFZ A;  1DK1 A;  2OYQ A;  4PA4 A;  1QHT A;  4HAM A;  1HNW B;  4X66 O;  2ITC C;  4UB8 Z;  3RN4 A;  2VRZ A;  5IYD O;  4ZI7 A;  3HKC B;  3AEI A;  4DR6 O;  3P30 A;  4GKK B;  4BIU A;  2P7T C;  4JI7 O;  1WA8 B;  5B1N A;  4K8X A;  1H2G A;  1PM9 A;  1NVP B;  3CCV V;  1N0J A;  4IIJ B;  1ENV A;  2ZE7 A;  4K0K B;  2MK3 A;  1K97 A;  4W4K A;  5KHH A;  4X1K A;  1YSC A;  4JI1 B;  2A9H A;  4JAV A;  2ITD C;  2XOK G;  2BCC H;  1F7Y A;  3T1Y O;  2YXY A;  2HVJ C;  1RSO A;  3LUT B;  2B5U A;  5KMG B;  2YIC A;  1MZF A;  4B3S O;  1AP5 A;  3MHH C;  2GDS A;  2HJF C;  4X20 B;  4EEQ A;  4LF8 O;  1H2K A;  1N34 O;  2ZIO A;  5IE9 A;  4DR4 O;  2A0L A;  5H9C A;  1YXB A;  4JPR A;  4K3A A;  2BSK A;  4LF9 B;  3C3T A;  3RVY A;  3LNM B;  2IBZ H;  2F4V O;  1D5A A;  4LP8 A;  4LBE C;  2Q6A A;  3K57 A;  2QA4 V;  4P9O A;  2GHY A;  5H5N A;  4ZOL A;  2WLN A;  1K9M W;  1KD1 W;  4JI8 O;  4B3T B;  1VQ7 V;  4TUY B;  4JI2 O;  4DV4 B;  2JJ1 G;  4I5S A;  3N2K B;  4X62 O;  1YI2 V;  4CH6 A;  2ZNI A;  2WWW A;  3AG2 C;  4CZZ A;  1FAF A;  4F6R A;  3CMA V;  3L72 H;  4DR2 B;  3OMA B;  2P4V A;  3AG7 A;  1SF9 A;  2X6C A;  4J7J A;  4J9Y B;  3TCU A;  1L8D A;  2DWD C;  1CEZ A;  1VMG A;  4X66 B;  4UCT A;  1TVK A;  2DYR B;  4CC5 A;  2YS8 A;  4DR6 B;  4G28 B;  4JTD B;  4OXS A;  4JI7 B;  5IJ9 B;  1Y6X A;  4LNU A;  1EBO A;  3JAT A;  4DR7 O;  1T5E A;  2XAQ A;  4MS2 A;  4DV7 O;  2GTA A;  4ZBM A;  5B3S C;  2O57 A;  3CC2 V;  1ZWI C;  4LFA B;  3UO3 A;  5DM6 V;  1SQQ H;  5JJN B;  2JGD A;  1JPX A;  2DMX A;  3H1J H;  5JJJ B;  4DRX A;  5HFL A;  2ATK C;  4U7O A;  5GTH Z;  5KHK A;  4KP4 A;  3T1Y B;  2VWJ A;  1Q6H A;  1NKD A;  2A06 H;  1RPO A;  2QM7 A;  3ICX A;  1AI5 A;  1MAB G;  4LH6 A;  3CRQ A;  3U11 A;  4LF4 O;  4GZR B;  4LF8 B;  1N34 B;  2LQT A;  4DR4 B;  1PPJ H;  1E1R G;  2W6J G;  2F4V B;  3E8F A;  1SQP H;  2EJR A;  3A0R A;  4JZ2 A;  2ZE5 A;  2BOB C;  4UCR A;  4JI8 B;  3IC7 A;  1XNR O;  1KB9 F;  2K1E A;  4TQF A;  1V54 C;  1N36 O;  2AW9 A;  2K9P A;  4X62 B;  1BQZ A;  2HKO A;  2VQF O;  2KSD A;  5C8Y A;  3JAR A;  3J80 N;  4GX0 A;  3AG2 B;  4Z2W A;  4JYC A;  2QGN A;  5LL6 Y;  1Q5O A;  1UJW B;  2WLI B;  1BMF G;  1DF5 A;  4PI2 A;  4OPA A;  5IWA O;  4F6E A;  1EN5 A;  4BW5 A;  2Q0O C;  1W59 A;  1XL6 A;  5JCO A;  3VQY A;  5EIB C;  3TET A;  5LP6 A;  3ZHT A;  2EIN C;  3L71 H;  4DR7 B;  4YXW G;  1M57 C;  1SA0 B;  1QNM A;  5IY5 C;  1GH6 A;  1JVM A;  2HG5 C;  4DV6 O;  4GKJ O;  1TAE A;  1R3I C;  5HFM A;  3SPH A;  1YTF B;  5B3S B;  1JA8 A;  1UFI A;  4A5U B;  1HWY A;  3OAA G;  4TT3 G;  3N2G B;  4MVO A;  3BVO A;  3Q4H A;  3OT7 A;  4LF4 B;  3LDE A;  1PD3 A;  2RMK B;  3RYF B;  3ZRW B;  5FNV B;  3JAW A;  1F4M A;  1WAZ A;  3PJS K;  3B77 A;  1MSW D;  1QR9 A;  4O2B A;  3CWB H;  3ABK C;  1XNR B;  2H3O A;  1AI4 A;  1N36 B;  2Q73 A;  1AI6 A;  4DV2 O;  5GW7 A;  3UT5 B;  3SYA A;  1LUW A;  2VQF B;  1TUB B;  2ZR2 A;  1ZSP A;  1V54 B;  4NXN O;  2DYS C;  4ZKI A;  4O4I A;  2HEP A;  1D5N A;  1Y76 A;  2Q5Z A;  3JD3 A;  2OTL V;  2QWO B;  3L73 H;  5BR8 O;  4QE9 A;  1AJN A;  1P7G A;  3FAV A;  4I9W A;  4HYO A;  4H13 B;  1VF6 C;  5IWA B;  1ZX3 A;  4ZHQ A;  1U96 A;  1L0L H;  3ZX6 A;  2UXX A;  4LR3 A;  1TA8 A;  3SYC A;  5LXT A;  3W7T A;  3CHX A;  1IDS A;  2VWK A;  1YIT V;  2KG7 B;  4JGS A;  2CTQ A;  3FYE B;  3H1L H;  2V4D A;  1XBL A;  1S77 D;  2AGA A;  1YJW V;  3EVK A;  5KUK A;  2ARH A;  4RAI A;  2EIN B;  3SJQ C;  2EZO A;  4DV6 B;  2EUL A;  4GKJ B;  1M57 B;  5IY5 B;  2UXC B;  1IVS A;  3AG4 B;  2JRI A;  5LHG A;  2DE0 X;  2Q68 A;  4MTO A;  1VQP V;  3BA9 A;  1GO3 F;  4CH5 A;  5KAF Z;  4FVM A;  1OCC C;  2AZ2 A;  1OCR C;  2P5O A;  5LYJ B;  3QO8 A;  1S5J A;  3G80 A;  4NVP A;  4AIL C;  5J9P C;  2EIM C;  5IJ0 A;  2KKW A;  3QG5 A;  1N8R W;  4L8J A;  5K1P A;  5L3G A;  2QM4 A;  4IT5 A;  3NXS A;  4WCE V;  1XNQ O;  1OJH A;  3LNN A;  4DV2 B;  3VQX A;  3HKE B;  5EBW C;  4FFB B;  4NTW A;  1ZL8 A;  1KP3 A;  4YJ3 A;  4NXN B;  2ZNJ A;  5LA6 A;  5CN0 A;  5EBL C;  2P6J A;  3K5L A;  3JD2 A;  1VIB A;  3N27 A;  4LC1 A;  1B3Q A;  3VQW A;  5JVD A;  2HHH O;  5BR8 B;  4MTG A;  5J2U B;  2DYS B;  3RBZ A;  4JZG A;  3BFR A;  1PKX A;  1Y74 A;  4WF9 V;  1FXV A;  1RM1 C;  1K7D A;  4IHJ B;  4NTY A;  1XRE A;  3QNE A;  1H2M A;  3EXA A;  3CRR A;  1JFF B;  4LFC O;  3SPG A;  2L35 A;  4I0X B;  4WFH A;  1LNQ A;  1SKV A;  4O4H A;  2OWO A;  2E76 B;  2EBO A;  3MD0 A;  2Q4P A;  2Q69 A;  4C7U A;  2FKX A;  1V55 B;  4RO2 A;  2YEV B;  5DEC A;  2XAF A;  4MVM A;  3TK1 A;  2YXL A;  2XT9 A;  2E5L O;  2KQX A;  1FJG B;  1RP3 B;  2PZS A;  3H9V A;  2Z5U A;  3FB6 C;  2ILM A;  1OCC B;  4CC6 A;  4WFF A;  4MW8 A;  2LJ2 A;  1OHH G;  3E22 B;  4CS3 A;  3J7A U;  1OCR B;  1Q6U A;  3IC9 A;  3BY6 A;  3K5O A;  2EIM B;  4LH7 A;  3ZHV A;  2WA3 A;  1XNQ B;  2N05 A;  5IDJ A;  1WN7 A;  4D7S A;  3ETE A;  5IYZ A;  1ORQ C;  2PYJ A;  1GAX A;  3FKS G;  4K0K O;  4WFE A;  2ZD9 A;  1NVP D;  1G8M A;  4JI1 O;  3JAM N;  1AR4 A;  1EN6 A;  4O4J A;  5EZY A;  3K79 A;  3STL C;  3ABM C;  4RUE A;  4F4L A;  2YIB D;  1WP7 A;  4BAY A;  3D36 C;  2ZDI C;  4GCZ A;  1NH2 B;  1GN6 A;  4J41 A;  4LWS B;  1RM1 B;  1R6K A;  3RYC A;  1GKF A;  5LGN A;  3BCC H;  5KHI A;  3FB7 C;  4NTX A;  4LFC B;  4LF9 O;  3KG2 A;  3L74 H;  4X1Y B;  3SJC C;  3HKD A;  1K3E A;  4J9Z B;  2XND G;  5TIS Z;  3UO2 A;  1H2L A;  5L3D A;  1KUQ A;  3APO A;  4LF7 B;  3C3S A;  1SER A;  2UUC O;  4NYK A;  3TGU H;  5JQG A;  1LR1 A;  5L3B A;  2E5L B;  2LFS A;  5B1B C;  5AG2 A;  2D2C B;  2F95 B;  4JYB A;  2Q0A A;  5JH7 A;  3CB2 A;  4I4T B;  2CDY A;  1YHQ V;  2XUM A;  1QR8 A;  2DYR C;  5IT9 N;  1K34 A;  1SES A;  2A3Q A;  1B04 A;  1YVW A;  1NBM G;  3UCS C;  3UQ8 A;  2CUG A;  4K8Z A;  5DN6 G;  2YIA A;  1US6 A;  4MVS A;  2X6B A;  4NXM O;  1H8E G;  3HB3 B;  5CB4 A;  4I55 A;  1FS0 G;  3H1I H;  4TV9 B;  2JVD A;  3T4Z A;  4BW9 A;  3CYO A;  4R6Z A;  3DSQ A;  4LFA O;  4B3R O;  1E1Q G;  1PNM A;  5J2T B;  3ZRX A;  2E74 B;  2ZCE A;  2G38 A;  5ITZ A;  2LGW A;  3ZRV A;  2PI5 A;  1XMQ O;  3GWK C;  1AP6 A;  2BSK B;  3K08 A;  5EYP B;  2P90 A;  2UU9 O;  4N23 A;  3HKC A;  1BCC H;  3ABM B;  4UVA A;  1H2S B;  4EB6 B;  3EFF K;  2DWE C;  1WA8 A;  1S5L Z;  2N74 A;  4HZ3 A;  1L1F A;  4BIZ A;  3CRM A;  3E86 A;  4PA9 A;  1DF4 A;  1EZJ A;  4R8C A;  1VP7 A;  5KHG A;  2VQE O;  2QWN B;  1LUV A;  2YUA A;  3KKY A;  2D3O W;  1JX9 A;  2RJZ A;  4DR1 O;  1SQX H;  4J11 A;  2YIB A;  2UUC B;  4PJ0 Z;  2EZP A;  1Y66 A;  2QWQ B;  4Q20 A;  4FLU A;  3CJH B;  4H44 B;  4WBN B;  5KMG A;  4BWA A;  2JS5 A;  2AZ0 A;  2QTS A;  3S3W A;  3TJT A;  4FM2 A;  1NTM H;  1XUQ A;  2W0F C;  5B1B B;  2PY5 A;  4UCU A;  2OT5 A;  1AI7 A;  4CS4 A;  4WFA V;  2NR5 A;  4J7Z A;  4LCU C;  4H33 A;  3CC4 V;  2DQ0 A;  4DV5 O;  1AB3 A;  3F5W C;  2ZT9 B;  1F4N A;  4NXM B;  3HPL C;  1NTZ H;  5LMU O;  4DV3 O;  4LF5 O;  3H01 A;  4TUY A;  1XI1 A;  3E8H A;  3N2K A;  2OCH A;  3C90 A;  4X65 O;  5GON B;  1FXK C;  4UCV A;  2DOS A;  1OV9 A;  4B3R B;  1Q82 W;  2ZQM A;  4TV8 B;  4J42 A;  3JAK B;  1HNX O;  5LHH A;  1XMQ B;  1R73 A;  4O2A B;  1X4T A;  1SZT A;  2XAS A;  1YTF D;  5LBQ A;  1JQ0 A;  1MA1 A;  4B08 A;  3WG7 C;  2UU9 B;  3CRC A;  2F66 C;  2JJ2 G;  1MG1 A;  1XOU A;  4KUM A;  3SJB C;  5IJ9 A;  2Y48 A;  3LSS A;  3ML0 A;  3CRA A;  3PN1 A;  5BMV B;  4MSW C;  3K5M A;  1SZX A;  2Z0A A;  2DQ3 A;  2VQE B;  3FYI B;  4DR1 B;  5KLV H;  3B4S A;  5C93 A;  4LFB B;  1EZV H;  1FKA O;  2XHB A;  3K04 A;  4MVR A;  3CCE V;  2P22 C;  1AR5 A;  2QM8 A;  2DN9 A;  1M1K W;  1HNZ O;  1ZTE A;  3D3Q A;  4FMT A;  3RYH B;  2CTW A;  1HW7 A;  1JR9 A;  5D5P A;  1XMO O;  4DV5 B;  5EBM C;  4JV5 O;  2OTJ V;  2CE4 A;  1GRJ A;  1YDX A;  1M90 W;  1CPY A;  5LMU B;  1Z2G A;  4DV3 B;  4E4E A;  2OIE A;  2DJV A;  5CA1 B;  4LF5 B;  3B2E E;  4JF3 A;  4YIO A;  1VQN V;  4CS2 A;  3G71 V;  5L3E A;  1GN2 A;  1FFX B;  3AG4 C;  4X65 B;  4AI8 A;  1QU7 A;  1BL8 A;  1NQT A;  3FX7 A;  1B06 A;  3B40 A;  4FJC C;  5EIB D;  1HNX B;  3OMI B;  2UXC O;  1FXK B;  1IZ3 A;  3JAS B;  1Q6I A;  4B3M O;  5FL7 G;  2WLI A;  4JAA A;  4YJ2 B;  4H37 A;  1PP9 H;  1YZB A;  4CH4 A;  2BTQ B;  1VQ9 V;  2WSS G;  3I55 V;  5H6R A;  4X9Q A;  4UXN A;  5B1A B;  3WG7 B;  1S3J A;  4QIW F;  1MZE A;  1F51 A;  4DV0 O;  3T2M A;  1SA0 A;  2GSM B;  2JIZ G;  3ETG A;  1Y67 A;  3BPZ A;  4BR6 A;  1MSD A;  1EN4 A;  2CTR A;  2QJ1 A;  3SYQ A;  4H0L B;  3ZHR A;  5L3F A;  1Y4M A;  3LDC A;  1S72 V;  4U3J B;  4X1I B;  1I5Y A;  2P67 A;  2EIJ B;  5JWP A;  3FAV B;  1RFY A;  3ZN0 A;  4NKG B;  4DK0 A;  1SQF A;  1SRY A;  4MTF A;  3P32 A;  3RYI B;  2GUZ B;  1Q8I A;  3ZIA G;  3N2G A;  4ASU G;  4PA7 A;  3CCQ V;  1X59 A;  5CA0 B;  1HNZ B;  4JI6 O;  3WU2 Z;  1H38 A;  3GWO A;  1GMG A; 
#chains in the Genus database with same CATH homology
 4W4K A;  4J10 A;  3FX7 A;  4J41 A;  4IYI A;  4J42 A;  4J7J A;  4J7K A;  4J11 A;  4KXR A;  4IYH A;  4W4L A;  2GTS A;  2G38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...