4J41A

The crystal structure of a secreted protein esxb (mutant p67a) from bacillus anthracis str. sterne
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
89
structure length
89
Chain Sequence
SNAMAEIKITPEELERIAGNFKNAAGEAQSQINRLEGDINSLEGQWAGATQAKFRGEFIQSKQAMQQYIAILEGISTDLKRIADKFRNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords secreted protein EsxB
publication title The crystal structure of a secreted protein EsxB (Mutant P67A) from Bacillus anthracis str. Sterne
rcsb
source organism Bacillus anthracis
molecule tags Unknown function
total genus 42
structure length 89
sequence length 89
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 4j41A00
4J42A 3FX7A 4J41A 4J7JA 4W4KA 4W4LA 2G38A 4J10A 4KXRA 4IYIA 2GTSA 4IYHA 4J7KA 4J11A
chains in the Genus database with same CATH superfamily
1SZXA 2YEVB 3DC5A 2JS5A 1FJGO 1RPOA 2YI8A 4UB8Z 4TT3G 2JVDA 5LGNA 5FPRA 4X89A 4TOIA 1YXBA 2IM9A 1TVKB 2BSKB 5JQGA 1PPJH 4MVOA 1K4DC 4ZBMA 3HKEA 3RVZA 3BVOA 2YXYA 4PD4F 3CCUV 3T1YB 3MHSC 4HNAA 4IHJA 1N4CA 4PV1B 1KP2A 4DR7O 5D5QA 1UFIA 1DK1A 4ZHQB 4O4JB 3ZRVA 3AG2B 4GKKB 4X62B 1JCHA 4DV4O 3IFXA 3JSLA 2A79B 4TV8B 5B1BC 4X66B 3LSUA 2P4VA 2XAGA 2ZE7A 3H01A 3RYCB 3BFRA 3JAKB 4DXWA 4JI0O 5L3EA 1SETA 3H1IH 1MOFA 3CCRV 2ZNIA 1SERA 4JI8O 1OCRC 1GN3A 2XAJA 4ICGA 3TK1A 4DR4O 5IJ9B 1F7YA 3JALA 5EK0A 1HNXO 1WP7A 2GTAA 1YIJV 2OYQA 3P32A 2EULA 4DR5B 3CCEV 3L9DA 2WLIA 4L87A 1FPOA 5LXTB 4LF8O 1BHBA 3WB2A 5IWAB 2OWOA 2AZ0A 3OD4A 4WFFA 2O57A 1GKFA 4JI2B 4NR1A 5J2UB 1L1FA 2P5OA 2LP7A 2JGDA 5BMVB 4FLZA 1QU7A 1K33A 1M56C 1M5IA 3RYHB 1NT2B 2ZR3A 2DN9A 4UVBA 4RUFA 2CTQA 3UKMA 5BY1A 2F43G 3AK2A 4LH6A 2W6IG 1I94B 3ICXA 1BE3H 3N2GB 4RWUA 4HYOA 1WNSA 1FXKB 1BT8A 2DWEC 1XNQO 4KL1A 2YI9A 4FVMA 3FD9A 5IYDO 5C8YB 2NNUA 4JI6O 1KECA 5L3CA 1ORQC 5LP6C 5J2TA 3CWBH 3VBBA 4GUNA 4JI7B 3Q4HB 2PI4A 4O2BA 3T1HO 4MVUA 3M8AA 2WLJA 1JR9A 3BRCA 4G2KA 2BTOA 1AP6A 1EN4A 2PZSA 2QM8A 1YJ9V 1SA0B 1R3IC 1MMMA 1ENVA 1VQKV 1JJOA 4JV5B 1HWYA 1VQ8V 1ZX3A 2AZ2A 3EXAA 1VQ6V 1IX9A 3WFVA 1RPRA 1ZSPA 3T4ZA 3G80A 4F6RA 1EM1A 3FYEB 1AVMA 1I08A 2LJ2A 2JRIA 3L70H 4TV9B 2OTJV 3KZIZ 1Q7YW 3I5DA 4WCEV 3O9OA 3CS5A 1AI4A 5LP6A 1RM1C 2GUZB 2V7QG 4FLWA 1TAEA 1IXBA 1AROP 5LOVB 3H1HH 4UVCA 4X20A 3KCXA 2EJRA 4IT5A 1O9GA 1AP5A 1HNWO 2KKWA 1QVFU 3AG1B 2YIBD 2UXCO 4BIZA 2JS3A 3CXHF 4PELA 1MSWD 3PN1A 3ZHVA 3G4SV 1VQNV 3P3NA 3L72H 4YIPA 1RP3B 5CBFA 4I9QA 5AG2A 2HP8A 4P9OA 1H8EG 1I0HA 1N32B 1T5EA 1U96A 1V54C 4PDRA 4JYCA 4TQFA 2XNDG 3TETA 1AI5A 4JTAB 3AK3A 2Y0PA 2EZOA 2ZM6B 4X1IB 3HKBB 3TCUA 2RCVA 1THZA 4JF3A 2DYSB 2G38A 5LMNO 4GX0A 1AR5A 2UXXA 3CCVV 4WFHA 1XEQA 5CMUA 2HVKC 1SQGA 3LSQA 2BTQA 2EBOA 4YJ2A 2XAQA 4ASUG 4J41A 5H6QA 4H0LB 1S72V 1Z2GA 1WA8A 5JQGB 3RBZA 2QM4A 4B3RB 3JASA 1Q6HA 5HFMA 2JIZG 3HKEB 4FZ0A 4DV6B 5L3FA 4XDKA 3R65A 4R8CA 1B3QA 3ETQA 3CC2V 4HNAB 4IHJB 4O2AB 4PA7A 2JGUA 1NVPD 4CH4A 1N36O 4LFBB 5EIBC 3R66A 1N0NA 1ZAUA 4GT1A 1COWG 1KD1W 3X2QC 4U3JA 2CTPA 2KQXA 2ODMA 4IIJB 3CCLV 3K5MA 3SJAC 4CC5A 3FB5C 1B06A 1VF6C 4IYIA 2FMLA 3SJCC 1R73A 4MSWC 4FFKA 2DYRB 1ZL8A 3JALB 1MZEA 5KX5A 4PI2A 5GTHZ 4FLXA 1AI7A 4MTXA 1QNMA 2AXTZ 3L75H 4O4LA 1XREA 5A2QN 2QGNA 2WLIB 1TUBA 3SJQC 1BQZA 2Z5UA 5B1AB 1QCEA 3JD4A 2C2AA 2Q7EA 1L8DA 4LH7A 2R70A 2H3OA 4FK5C 5FPOA 1OCZC 1JA8A 2WLKA 5LA6A 5JH7B 1XL4A 5KLVH 2DWDC 2GTSA 2WLMA 2JGDB 5EIBD 1N34O 1NH2D 3ZX6A 2WSSG 3RYFA 3K5LA 2V1DA 4OX9O 1SQQH 4RQFA 1BHAA 3E2EA 3ETEA 1NBMG 1ZTEA 1US6A 4MW8A 2HR3A 3E22A 1TUEB 4JI5O 4DK0A 4I50A 1BCCH 2CGNA 4A5UB 1WPBA 3LNNA 2H94A 2Q7HA 3ZMUA 2ARHA 5BZBA 4CZZA 1K97A 4WFEA 3BAAA 1HNZO 2ZD9A 4QGPA 4DR6O 4LF4B 4H44B 1G4YB 2QKCA 3CCSV 1S76D 3FB6C 2CH7A 3ETGA 2XT9A 4O2BB 4HZ3A 3RWRD 1Q6IA 3HB3B 3SJBC 3VQWA 1XI1A 3IJ4A 2UXBB 2F4VB 2Y48A 1CPYA 1QLEC 4MVSA 3IC7A 4K0KO 4X1YB 1QVGU 1QBZA 4JTDB 4LF9B 3JATA 1FFXA 5CN0A 3E86A 1PNKA 4CS3A 2QWOB 3JYCA 4DUZO 3ASNC 1AB3A 2BCCH 1YSCA 3OMNB 3B2EE 1JFFB 4LF6B 4GKJO 4F6RB 2XOKG 3H9VA 3DTUB 1G1XB 2EINC 4W4LA 4DUZB 2UU9B 4W4KA 2HJFC 4X64O 4J10A 2W0FC 3JCZA 1Q81W 4P2ZA 3CHXA 1M93A 2RQ6A 1OCCB 1YITV 3QNEA 4R50A 4X20B 3QF7A 2YDEA 1G6UA 3JAWA 4I0XA 2ZDIC 3IAYA 1ZLZA 3WB1A 1X59A 1IBLO 1LR1A 3F7VC 4AHCA 4JZGA 3E8BA 3ZRXA 1AI6A 3ZJZA 5CBHA 3E83A 4PDMA 3KKYA 1H38A 3OMIB 4DRXA 1D5NA 2RDCA 2UUCB 1MZFA 4NXMB 2YXHA 5IY5C 2CTRA 4LWSB 4TSFG 3CE2A 4IL6Z 1WB7A 2JEUA 3H1JH 1SC5B 2MW2B 3OTFA 4JYYA 1IBMO 4NTYA 4R7CA 3A8TA 1HW7A 1CP9A 2QTSA 2BTQB 4YJ2B 2VWJA 2ZDIA 4LF7B 1AR4A 1AILA 4JAUA 4UV8A 4LFCB 3WG7C 1WA8B 3DGEA 4B7KA 3ABTA 5IYBO 3JASB 3B77A 1AJNA 1S5HC 3CP1A 4EFBA 1YVWA 4ZI7A 3ABMC 4UV9A 1XQ8A 3K06A 5KHIA 5B3SB 3OFNG 4FLYA 3TGUH 4I9WA 4NKGB 3OTOO 1FFTB 1DLBA 2NN4A 4U3JB 1F4MA 3EVKA 2OT5A 3FB8C 3CMEV 4JAVA 2JK5C 4J11A 1O9HA 2JDIG 2QWQB 4YY3O 2EIJB 1PNMA 3ZHQA 2L35A 5CBGA 3G6BA 3VOUA 4I55A 3NR7A 1YJNV 5BR8O 4LF5O 2WLNA 1V9PA 1WN7A 2UUBB 1K4CC 1ZL8B 1S77D 5KX5B 3RGBA 2CGOA 4LCUC 2UXDB 4O4LB 3AG3C 4HBNA 1EZVH 2YUAA 2V4DA 1TUBB 2OCCC 1FJGB 3M99B 5DN6G 4JYAO 1M1KW 2ZXWC 2IU0A 2IJKA 2P4KA 1NH2B 1M57C 3SYPA 4DV3O 3ABKC 2YIAA 3K04A 5CA1A 1GRJA 1R3KC 1B6QA 3RYFB 3OT7A 2EIMB 4MVMA 3FYIB 4Z1MG 4DR3O 3VQYA 4DR7B 3ASOB 3E22B 3JD2A 2KSDA 3RYIA 2X0LA 3K79A 4XDLA 2EILB 5C93A 5DM6V 1FKAO 4DV4B 1PV0A 2Q6AA 2ZNJA 1V55C 1KC8W 1GAXA 2QJ1A 1SQBH 2F93B 4JI0B 3FX7A 3S3XA 4O4HA 3ABLB 1NU1H 1Y76A 2Y69B 3K5OA 4PA3A 2CH7B 4JI8B 4GX2A 4AQYO 2ZIMA 4DR4B 1Z5WA 1EBOA 2WPDG 3ZHUA 2XAFA 1R6TA 5EC1C 3ETDA 1HNXB 4G27B 4GCZA 3W7XA 4B3MO 3A0BZ 1P84F 1LUWA 4J7JA 3JATB 4F6EA 1FFXB 4PA9A 2YSUB 4LF8B 2PUSA 4JGSA 2RJZA 3P30A 4J7KA 4ZKIA 1ZWIC 1S5JA 3UCSC 2E3CA 4P9PA 3SPIA 1J5EO 5IJ0A 3JD0A 3QO8A 2XTAA 1QHTA 1WP8A 2DW4A 2IJJA 1P7GA 2E74B 4B3SO 3L74H 5JCOC 3LNMB 1SQFA 2D3OW 1KKDA 1HR0O 2OIGA 4JPRA 1JQ0A 1BQ0A 1JJ2U 4TUYA 1P49A 4FZ1A 2A3QA 2YIDA 4RUEA 1HDJA 5EBLC 5KMGA 3JAWB 3HKDA 5KHKA 4I0XB 2B1GA 3M7MX 2Q5ZA 2XUMA 3CSXA 2Z0AA 2EIKC 1H2MA 1OHHG 2LFSA 3BA9A 3BY6A 1XNQB 2RN9A 3W7TA 1UPGA 2R9AA 3ZIAG 5L3DA 4JI6B 1JX9A 1M9NA 3T4DA 4BW9A 3RVYA 1ROPA 4DRXB 1W0KG 2KG7B 4MVRA 1D5AA 1L0NH 4DV0O 3T1HB 3CB2A 2Q8VA 4EFEA 3ZS8C 1SQXH 1RFYA 3F5WC 1MG1A 4KHPO 1K7DA 4U3FH 2W0XA 2N74A 1K5SA 2R9IA 3D36C 2QR4A 2LGWA 1PKXA 5LGTA 1SZTA 5FNVA 3MDSA 3DXRA 2LW1A 5EBWC 2YIBA 2LO1A 4X1KB 1K5QA 4H33A 3THOA 4PJ0Z 3E35A 3JD3A 3QVNA 2ILMA 4ZI7B 4QIWF 4FJCC 2M6YA 1OCOC 3ZRSA 4EB6B 4F4LA 1FYJA 4QJFB 1HNWB 1WPXA 2UXCB 5JJEB 4MS2A 1VEWA 1XMOO 3C3SA 2KB1A 3JSNA 4UVAA 3UO3A 3CYOA 2QA4V 4JI3O 3VQXA 4NB5A 4WBNB 4YHHO 1S0VA 1Z5VA 2PTMA 4I55B 5B5EZ 1XMQO 2LFRA 2QSAA 1K9MW 2X6AA 4BWAA 4QPJA 4FM2A 1VQ4V 4X88A 3T2MA 4Z1VA 4CBCA 4J80A 2VQEO 5LMNB 2A0LA 1EFRG 5KHHA 2XHBA 2XASA 4P30A 4HAMA 1R6NA 1K3EA 1TA8A 5GTIZ 3BA8A 3OEHG 4D7TA 1GN2A 1EN6A 1LNQA 4I4TA 3AG4B 2WA3A 5KAFZ 1KB9F 3GWOA 5CA1B 4D7SA 3APOA 2ZQMA 2CAZC 4NVPA 4RQEA 2VS0A 2ADQB 3D8CA 1GM8A 3AK1A 4O4IA 5GONA 1ZUQA 2DQ3A 3CRCA 1GH6A 3W7SA 1K8AW 4JAAA 4B3TO 5KHGA 2JJ2G 2GV9A 3RYIB 1N36B 1MSDA 2H8PC 2QKAA 2EX3A 2JJ1G 5LMUO 1JOYA 1YDXA 4FPPA 2ATKC 4DV7O 4N23A 2LGQA 4MT8A 2QEXV 5KA6A 3U11A 2PI5A 3L73H 2CUGA 3ZHRA 3AG2C 1AJQA 1H2NA 3DSQA 3S3WA 1X4TA 4O4HB 4LNUA 4UCSA 4H13B 1Q43A 5B1OA 1GMGA 2NR5A 1H2GA 4PDVA 4JTCB 1M90W 4CS4A 3P3PA 1YZBA 2DE0X 2ZE6A 3N2KA 4IYHA 4AILC 4J42A 1XOUA 4XDJA 1PL4A 4TWKA 5B1BB 4DV1O 1VQOV 2GBOA 2UXNA 3HR0A 1OJHA 2HEPA 3TJTA 2FL4A 4PA4A 3E8FA 1VF6A 1OCRB 2HVJC 3W7WA 2Q4PA 5K1XA 2QWRB 5IJ0B 2VWKA 1N34B 4DV1B 2FKXA 2RNBA 4DV2O 4JI1O 2HFEC 2P90A 1S5LZ 3SYOA 4JI4O 3OM3B 4DR2O 4OX9B 5DECA 4IGGA 2GDSA 4TV8A 4TUYB 2QTOA 1YJWV 3RYCA 3OEEG 2VQFO 4JI5B 3ZMZA 4MTFA 5J2TB 1J95A 2HG5C 3HKDB 4JI4B 5TISZ 2Q69A 2FYUH 1HNZB 3OMAB 4DR6B 4LC1A 1FXKC 1M56B 4OPAA 1XHXA 4I7ZB 2AGAA 3IGAC 1RSOA 1TGOA 1OV9A 2Q68A 4MTGA 4RO2A 1GTOA 3CC4V 4Q20A 4X65O 4DW0A 3K08A 2CTWA 2AW9A 4D6TH 4K0KB 2M7WA 4FLTA 3QO7A 1WAZA 1SF9A 2CK3G 3AG7A 4DR1O 2VRZA 4NXNO 1GN6A 5LP6B 3SYAA 3OR7C 5K1PA 4FM0A 5FNVB 3DXRB 1VQMV 4GKJB 2WA4A 1H2KA 3DC6A 2OIEA 1VARA 1SKVA 4FFBA 1UJWB 4I5SA 3SPCA 3OAAG 4L8JA 4X64B 1Q82W 4U7OA 3BCCH 1MA1A 4E4EA 3TXSA 4DK1A 5EZYA 5ITZA 1W59A 2E5LO 1E1RG 4CS2A 1R3JC 1G8MA 3RN4A 2HKOA 1IBLB 2Q67A 1SS3A 3AG1C 2HHHO 3EFFK 1Y66A 2X7RB 1U97A 1RM1B 1H2LA 4UUJC 2UUAO 3J80N 2B5UA 2GHYA 3RW0A 4UCTA 4GX1A 3ZRWA 3FAVA 4DV5O 2F23A 1LUVA 5IDJA 2R72A 4U7NA 3U0ZA 2ADPA 2HJDA 2EZPA 5EYPA 3J7AU 1WB8A 3K59A 4PI0A 3JARA 1IBMB 3I56V 2ITDC 2A7WA 1QQCA 2DYSC 3H1LH 4I4TB 3CX5F 1D2DA 1NVPB 3ZHTA 1BMFG 1GM9A 3KG2A 5LOVA 1V54B 4DO2A 4LFAO 1BS3A 1FS0G 3UO2A 4PHZA 1IVSA 3G67A 2X6BA 2XAHA 2WLLA 1IBKO 2F66C 4O4IB 1Y74A 5GONB 3GWKC 2ZE5A 3QG5A 4YJ3A 2PF4E 1F23A 3RT3C 1N0JA 4ZOLA 3RFRA 5HFLA 3T1CA 5LHIA 3OTOB 5KA5A 5IYZA 3OE7G 1DF4A 2B1IA 3LDCA 3MAQA 4KFMA 4YY3B 1Q6UA 1KKCA 1KMIZ 2NLJC 4X1IA 3K57A 4LNUB 3CD6V 1NTZH 3B40A 5BR8B 4LF5B 3A0RA 2YXLA 1BGYH 2IJHA 3GB7C 1NTKH 3BPZA 5LA6B 3N2KB 3T1YO 1HP8A 1FD9A 3X2QB 2DYRC 5FL7G 3CRQA 1KBHA 4GKKO 5JVDA 4X62O 5IT9N 4UCOA 4JYAB 4X66O 5B1AC 4X9QA 4DV3B 4QPKA 4KP4A 4O2AA 4I50B 1SQVH 4UXNA 2QWPB 1Q5OA 4BW5A 3CEIA 3F7YC 1PL0A 3SPGA 3IC9A 4BIUA 4IIJA 4DR3B 4Q6GA 5JJJB 5LBQA 4DR5O 2GSMB 4X8AA 1R3LC 1KQSU 1OCZB 1VF5B 3CRAA 1PD3A 1XDCA 3MHHC 3CC7V 2PYLA 5IWAO 2B9ZA 4WFBV 4UCRA 4JI2O 1DF5A 1Y6XA 5GW7A 1RSOB 5LGUA 3CCJV 2D2CB 3FB7C 5KUKA 1WLEA 2LQTA 4AQYB 1NJIW 4J9YB 4DYLA 3OR6C 1KP3A 4FIPC 4JYBA 3STLC 5H5NA 2L6LA 5J9PC 4QE7A 5JH7A 5EC2C 1I94O 1P4RA 2Q0OC 4B3MB 3MD0A 5B1NA 4NTXA 1Q90D 3N27A 4MVQA 3JD1A 2OTLV 1VQ9V 2JEXA 4BIOA 1I5XA 1J5EB 1XL6A 5CA0A 1OZ0A 3D3QA 4FFBB 4B3SB 4JI7O 1K34A 3SGIA 3ABUA 4FLVA 1HR0B 3OW2U 2F95B 5IE9A 1QLEB 3ZBHA 5L3BA 5CB4A 5EZYB 5BXZA 5ITZB 3HPLC 3ASNB 1QR9A 1E1QG 4MW3A 1OCCC 4PDLA 4JV5O 5F2VO 4KXRA 5LHGA 3K0GA 3UT5A 2ZIOA 4DW1A 5JCOA 2EINB 2EJ7A 5E79Z 4X1YA 2QDOA 4GLXA 1WJZA 5LYJA 4K8XA 4DV0B 2CDYA 2Y0IA 3ZRWB 2PYJA 3SYCA 3K9SA 3FAVB 4PA6A 3K0DA 1Q86W 4UCVA 4KHPB 3B8MA 1JFFA 4UCUA 3SYQA 4ABMA 2P22C 4MTOA 2F1MA 5EYPB 2LW7A 3JARB 1H8HG 1JVMA 4JZ2A 2Y4TA 1XHZA 3B8NA 2DJVA 2K9PA 5DEDA 3ZHSA 1N33O 4EEQA 2N04A 4J7ZA 1H2SB 5H6RA 1W2BU 3C90A 5IY5B 3HKCA 1IZ3A 2WLLB 1N32O 5KHJA 1Y74B 4CC6A 4XBFA 1N33B 4E2LA 4YJ3B 3D36A 4JASA 2ZM6O 2YC0A 3APQA 4ZOLB 5IYCO 4OXSA 3L71H 1PNLA 5IYZB 3QTCA 2ETNA 1XMOB 4YIOA 1IDSA 5B3SC 1YF2A 3WG7B 1BZKA 3E89A 4JI3B 3CRMA 4LWSA 4QNHB 4YHHB 1VIBA 5A9GA 2ZT9B 3F5TA 4LR3A 1XMQB 1IURA 1MABG 3ABMB 2AHYA 4B3RO 1VP7A 2EIJC 4LP8A 3UM7A 2IBZH 4DUYO 2FTKA 2E75B 4J9ZB 1VF7A 4DV6O 4GZRB 2QM7A 3ZMVA 2VQEB 3LDDA 4OGQB 1SESA 1S3JA 4LFBO 5JVDB 5FLXN 2BOCC 4DUYB 1KU9A 3OGCC 4K3AA 4MVZA 1Y4MA 4WFGA 1PM9A 1YTFD 3CJHA 1NQTA 4K35A 4FM1A 4H37A 5LL6Y 3D3IA 1Y67A 3K03A 3SR2C 4C7UA 4GYCB 2P06A 5H2FZ 1KYOF 3AG3B 1PP9H 5KAIZ 2OCCB 3CPWU 1N8RW 3KCYA 2QE7G 4B3TB 3ZN0A 2Q0AA 4YXWG 1NZ6A 2RMKB 2EIMC 1Y76B 2BE3A 2YEVA 3BHPA 3CCQV 2ZXWB 5LHHA 5LMUB 1M57B 3ASOC 4NTWA 3ABKB 3CCMV 4DV7B 5JJNB 2AHZA 1VQ7V 2EILC 3NXSA 4TQDA 1R6KA 1TVKA 2BSKA 3OUFA 2PGGA 3ZMTA 4NYKA 1URFA 3ZMSA 3ABLC 1EZJA 3WB0A 2Y69C 3TXQA 4EKWA 2Q73A 1V55B 4ZHQA 4O4JA 4UB6Z 2K1EA 3O65A 1K73W 3J81N 1YEWA 5B66Z 4GX5A 3FKSG 4LF4O 2ZINA 3JAKA 3SDLA 1BL8A 4CH5A 2DQ0A 1QR8A 5CA0B 4DV2B 4ZIBA 4JI1B 5KMGB 2Q7GA 4DR2B 1CXZB 5IJ9A 4LBEC 5CA3A 2P7TC 1AJPA 3C3TA 2WAMA 1R1BA 2VQFB 5CB4B 2UXBO 2F4VO 2P6JA 4RAIA 2IW5A 1JPXA 5H9CA 2A9HA 1I7FA 2BOBC 5LXTA 4LF9O 3LDEA 2DOSA 2ZKOA 2YS8A 3UT5B 3LUTB 5J2UA 1NR1A 2MK3A 2X6CA 2N05A 3A2FA 4AI8A 4QE9A 4FLUA 4LF6O 5BMVA 2CE4A 3AEIA 1A32A 3JCUZ 2HLDG 1DGSA 4B08A 5LYJB 4B7EA 1IXMA 3RYHA 1NKDA 3B09A 3G6EV 1L0LH 1W0JG 3E8GA 2UU9O 4WFAV 4X65B 3K5NA 3ZN1A 3WU2Z 2EIKB 1K92A 3N2GA 2ZE8A 3CRRA 1QLNA 3SPJA 4DR1B 1GK9A 1MNGA 5D5PA 1FXKA 4NXNB 2R9RB 2QKSA 3ZEDA 1KUQA 3BEHA 1Q8IA 4FMTA 3VQVA 5E1AC 5C8YA 1GM7A 1F51A 3A0HZ 1FXHA 1XNRO 2WLHA 4Z2WA 4UFZA 2FB5A 3B4SA 3Q4HA 3HKCB 4R6ZA 3FFQA 1FAFA 3BABA 4CH3A 2UUCO 4CH6A 1XILA 1M4UA 4NXMO 1F4NA 1NTMH 2WWWA 1GN4A 1YI2V 1XNRB 2OCHA 1B04A 2E5LB 3LSSA 2Z3YA 1SA0A 1EN5A 3GVMA 4G28B 3G71V 4N21A 1SQPH 2YICA 2A06H 2KG7A 5JWPA 3CMAV 1NS1A 2HHHB 1GO3F 4LF7O 1AR1B 3E8HA 1XBLA 1SRYA 5EBMC 1XUQA 3OUSA 2ZR2A 2UUAB 4LFCO 1NI8A 2Y4UA 2Q9LA 1OCOB 4TV9A 2DMXA 5KUMA 3UQ8A 4DV5B 2GUZA 3H1KH 1DTOA 3W7UA 4KUMA 2IJIA 2P67A 2W6JG 1P7BA 3ML0A 3I55V 1VQPV 3CXCU 4X1KA 2ITCC 2ZCEA 3SPHA 1VMGA 2IH1C 1JMKC 1YCIA 1YHQV 1FXVA 3OGIB 1CEZA 1YTFB 3K58A 1Q3EA 4K8ZA 2E76B 3ZCCA 1VQ5V 2IU3A 4BR6A 3EHBB 4WF9V 4OPHA 3CJHB 4LFAB 1I5YA 3STZC 4EB6A 1NR7A 2PY5A 3AG4C 1IBKB 2IH3C 1VQLV 2UUBO 2QWNB 3K9AA 3PJSK 3JAMN 1BSMA 3U10A 3HKBA 4BAYA 5L3GA 4WBNA 1E79G 2UXDO 3QO5A 3K3WA
chains in the Genus database with same CATH topology
4J42A 3FX7A 4J41A 4J7JA 4W4KA 4W4LA 2G38A 4J10A 4KXRA 4IYIA 2GTSA 4IYHA 4J7KA 4J11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J42 A;  3FX7 A;  4J41 A;  4J7J A;  4W4K A;  4W4L A;  2G38 A;  4J10 A;  4KXR A;  4IYI A;  2GTS A;  4IYH A;  4J7K A;  4J11 A; 
#chains in the Genus database with same CATH topology
 1SZX A;  2YEV B;  3DC5 A;  2JS5 A;  1FJG O;  1RPO A;  2YI8 A;  4UB8 Z;  4TT3 G;  2JVD A;  5LGN A;  5FPR A;  4X89 A;  4TOI A;  1YXB A;  2IM9 A;  1TVK B;  2BSK B;  5JQG A;  1PPJ H;  4MVO A;  1K4D C;  4ZBM A;  3HKE A;  3RVZ A;  3BVO A;  2YXY A;  4PD4 F;  3CCU V;  3T1Y B;  3MHS C;  4HNA A;  4IHJ A;  1N4C A;  4PV1 B;  1KP2 A;  4DR7 O;  5D5Q A;  1UFI A;  1DK1 A;  4ZHQ B;  4O4J B;  3ZRV A;  3AG2 B;  4GKK B;  4X62 B;  1JCH A;  4DV4 O;  3IFX A;  3JSL A;  2A79 B;  4TV8 B;  5B1B C;  4X66 B;  3LSU A;  2P4V A;  2XAG A;  2ZE7 A;  3H01 A;  3RYC B;  3BFR A;  3JAK B;  4DXW A;  4JI0 O;  5L3E A;  1SET A;  3H1I H;  1MOF A;  3CCR V;  2ZNI A;  1SER A;  4JI8 O;  1OCR C;  1GN3 A;  2XAJ A;  4ICG A;  3TK1 A;  4DR4 O;  5IJ9 B;  1F7Y A;  3JAL A;  5EK0 A;  1HNX O;  1WP7 A;  2GTA A;  1YIJ V;  2OYQ A;  3P32 A;  2EUL A;  4DR5 B;  3CCE V;  3L9D A;  2WLI A;  4L87 A;  1FPO A;  5LXT B;  4LF8 O;  1BHB A;  3WB2 A;  5IWA B;  2OWO A;  2AZ0 A;  3OD4 A;  4WFF A;  2O57 A;  1GKF A;  4JI2 B;  4NR1 A;  5J2U B;  1L1F A;  2P5O A;  2LP7 A;  2JGD A;  5BMV B;  4FLZ A;  1QU7 A;  1K33 A;  1M56 C;  1M5I A;  3RYH B;  1NT2 B;  2ZR3 A;  2DN9 A;  4UVB A;  4RUF A;  2CTQ A;  3UKM A;  5BY1 A;  2F43 G;  3AK2 A;  4LH6 A;  2W6I G;  1I94 B;  3ICX A;  1BE3 H;  3N2G B;  4RWU A;  4HYO A;  1WNS A;  1FXK B;  1BT8 A;  2DWE C;  1XNQ O;  4KL1 A;  2YI9 A;  4FVM A;  3FD9 A;  5IYD O;  5C8Y B;  2NNU A;  4JI6 O;  1KEC A;  5L3C A;  1ORQ C;  5LP6 C;  5J2T A;  3CWB H;  3VBB A;  4GUN A;  4JI7 B;  3Q4H B;  2PI4 A;  4O2B A;  3T1H O;  4MVU A;  3M8A A;  2WLJ A;  1JR9 A;  3BRC A;  4G2K A;  2BTO A;  1AP6 A;  1EN4 A;  2PZS A;  2QM8 A;  1YJ9 V;  1SA0 B;  1R3I C;  1MMM A;  1ENV A;  1VQK V;  1JJO A;  4JV5 B;  1HWY A;  1VQ8 V;  1ZX3 A;  2AZ2 A;  3EXA A;  1VQ6 V;  1IX9 A;  3WFV A;  1RPR A;  1ZSP A;  3T4Z A;  3G80 A;  4F6R A;  1EM1 A;  3FYE B;  1AVM A;  1I08 A;  2LJ2 A;  2JRI A;  3L70 H;  4TV9 B;  2OTJ V;  3KZI Z;  1Q7Y W;  3I5D A;  4WCE V;  3O9O A;  3CS5 A;  1AI4 A;  5LP6 A;  1RM1 C;  2GUZ B;  2V7Q G;  4FLW A;  1TAE A;  1IXB A;  1ARO P;  5LOV B;  3H1H H;  4UVC A;  4X20 A;  3KCX A;  2EJR A;  4IT5 A;  1O9G A;  1AP5 A;  1HNW O;  2KKW A;  1QVF U;  3AG1 B;  2YIB D;  2UXC O;  4BIZ A;  2JS3 A;  3CXH F;  4PEL A;  1MSW D;  3PN1 A;  3ZHV A;  3G4S V;  1VQN V;  3P3N A;  3L72 H;  4YIP A;  1RP3 B;  5CBF A;  4I9Q A;  5AG2 A;  2HP8 A;  4P9O A;  1H8E G;  1I0H A;  1N32 B;  1T5E A;  1U96 A;  1V54 C;  4PDR A;  4JYC A;  4TQF A;  2XND G;  3TET A;  1AI5 A;  4JTA B;  3AK3 A;  2Y0P A;  2EZO A;  2ZM6 B;  4X1I B;  3HKB B;  3TCU A;  2RCV A;  1THZ A;  4JF3 A;  2DYS B;  2G38 A;  5LMN O;  4GX0 A;  1AR5 A;  2UXX A;  3CCV V;  4WFH A;  1XEQ A;  5CMU A;  2HVK C;  1SQG A;  3LSQ A;  2BTQ A;  2EBO A;  4YJ2 A;  2XAQ A;  4ASU G;  4J41 A;  5H6Q A;  4H0L B;  1S72 V;  1Z2G A;  1WA8 A;  5JQG B;  3RBZ A;  2QM4 A;  4B3R B;  3JAS A;  1Q6H A;  5HFM A;  2JIZ G;  3HKE B;  4FZ0 A;  4DV6 B;  5L3F A;  4XDK A;  3R65 A;  4R8C A;  1B3Q A;  3ETQ A;  3CC2 V;  4HNA B;  4IHJ B;  4O2A B;  4PA7 A;  2JGU A;  1NVP D;  4CH4 A;  1N36 O;  4LFB B;  5EIB C;  3R66 A;  1N0N A;  1ZAU A;  4GT1 A;  1COW G;  1KD1 W;  3X2Q C;  4U3J A;  2CTP A;  2KQX A;  2ODM A;  4IIJ B;  3CCL V;  3K5M A;  3SJA C;  4CC5 A;  3FB5 C;  1B06 A;  1VF6 C;  4IYI A;  2FML A;  3SJC C;  1R73 A;  4MSW C;  4FFK A;  2DYR B;  1ZL8 A;  3JAL B;  1MZE A;  5KX5 A;  4PI2 A;  5GTH Z;  4FLX A;  1AI7 A;  4MTX A;  1QNM A;  2AXT Z;  3L75 H;  4O4L A;  1XRE A;  5A2Q N;  2QGN A;  2WLI B;  1TUB A;  3SJQ C;  1BQZ A;  2Z5U A;  5B1A B;  1QCE A;  3JD4 A;  2C2A A;  2Q7E A;  1L8D A;  4LH7 A;  2R70 A;  2H3O A;  4FK5 C;  5FPO A;  1OCZ C;  1JA8 A;  2WLK A;  5LA6 A;  5JH7 B;  1XL4 A;  5KLV H;  2DWD C;  2GTS A;  2WLM A;  2JGD B;  5EIB D;  1N34 O;  1NH2 D;  3ZX6 A;  2WSS G;  3RYF A;  3K5L A;  2V1D A;  4OX9 O;  1SQQ H;  4RQF A;  1BHA A;  3E2E A;  3ETE A;  1NBM G;  1ZTE A;  1US6 A;  4MW8 A;  2HR3 A;  3E22 A;  1TUE B;  4JI5 O;  4DK0 A;  4I50 A;  1BCC H;  2CGN A;  4A5U B;  1WPB A;  3LNN A;  2H94 A;  2Q7H A;  3ZMU A;  2ARH A;  5BZB A;  4CZZ A;  1K97 A;  4WFE A;  3BAA A;  1HNZ O;  2ZD9 A;  4QGP A;  4DR6 O;  4LF4 B;  4H44 B;  1G4Y B;  2QKC A;  3CCS V;  1S76 D;  3FB6 C;  2CH7 A;  3ETG A;  2XT9 A;  4O2B B;  4HZ3 A;  3RWR D;  1Q6I A;  3HB3 B;  3SJB C;  3VQW A;  1XI1 A;  3IJ4 A;  2UXB B;  2F4V B;  2Y48 A;  1CPY A;  1QLE C;  4MVS A;  3IC7 A;  4K0K O;  4X1Y B;  1QVG U;  1QBZ A;  4JTD B;  4LF9 B;  3JAT A;  1FFX A;  5CN0 A;  3E86 A;  1PNK A;  4CS3 A;  2QWO B;  3JYC A;  4DUZ O;  3ASN C;  1AB3 A;  2BCC H;  1YSC A;  3OMN B;  3B2E E;  1JFF B;  4LF6 B;  4GKJ O;  4F6R B;  2XOK G;  3H9V A;  3DTU B;  1G1X B;  2EIN C;  4W4L A;  4DUZ B;  2UU9 B;  4W4K A;  2HJF C;  4X64 O;  4J10 A;  2W0F C;  3JCZ A;  1Q81 W;  4P2Z A;  3CHX A;  1M93 A;  2RQ6 A;  1OCC B;  1YIT V;  3QNE A;  4R50 A;  4X20 B;  3QF7 A;  2YDE A;  1G6U A;  3JAW A;  4I0X A;  2ZDI C;  3IAY A;  1ZLZ A;  3WB1 A;  1X59 A;  1IBL O;  1LR1 A;  3F7V C;  4AHC A;  4JZG A;  3E8B A;  3ZRX A;  1AI6 A;  3ZJZ A;  5CBH A;  3E83 A;  4PDM A;  3KKY A;  1H38 A;  3OMI B;  4DRX A;  1D5N A;  2RDC A;  2UUC B;  1MZF A;  4NXM B;  2YXH A;  5IY5 C;  2CTR A;  4LWS B;  4TSF G;  3CE2 A;  4IL6 Z;  1WB7 A;  2JEU A;  3H1J H;  1SC5 B;  2MW2 B;  3OTF A;  4JYY A;  1IBM O;  4NTY A;  4R7C A;  3A8T A;  1HW7 A;  1CP9 A;  2QTS A;  2BTQ B;  4YJ2 B;  2VWJ A;  2ZDI A;  4LF7 B;  1AR4 A;  1AIL A;  4JAU A;  4UV8 A;  4LFC B;  3WG7 C;  1WA8 B;  3DGE A;  4B7K A;  3ABT A;  5IYB O;  3JAS B;  3B77 A;  1AJN A;  1S5H C;  3CP1 A;  4EFB A;  1YVW A;  4ZI7 A;  3ABM C;  4UV9 A;  1XQ8 A;  3K06 A;  5KHI A;  5B3S B;  3OFN G;  4FLY A;  3TGU H;  4I9W A;  4NKG B;  3OTO O;  1FFT B;  1DLB A;  2NN4 A;  4U3J B;  1F4M A;  3EVK A;  2OT5 A;  3FB8 C;  3CME V;  4JAV A;  2JK5 C;  4J11 A;  1O9H A;  2JDI G;  2QWQ B;  4YY3 O;  2EIJ B;  1PNM A;  3ZHQ A;  2L35 A;  5CBG A;  3G6B A;  3VOU A;  4I55 A;  3NR7 A;  1YJN V;  5BR8 O;  4LF5 O;  2WLN A;  1V9P A;  1WN7 A;  2UUB B;  1K4C C;  1ZL8 B;  1S77 D;  5KX5 B;  3RGB A;  2CGO A;  4LCU C;  2UXD B;  4O4L B;  3AG3 C;  4HBN A;  1EZV H;  2YUA A;  2V4D A;  1TUB B;  2OCC C;  1FJG B;  3M99 B;  5DN6 G;  4JYA O;  1M1K W;  2ZXW C;  2IU0 A;  2IJK A;  2P4K A;  1NH2 B;  1M57 C;  3SYP A;  4DV3 O;  3ABK C;  2YIA A;  3K04 A;  5CA1 A;  1GRJ A;  1R3K C;  1B6Q A;  3RYF B;  3OT7 A;  2EIM B;  4MVM A;  3FYI B;  4Z1M G;  4DR3 O;  3VQY A;  4DR7 B;  3ASO B;  3E22 B;  3JD2 A;  2KSD A;  3RYI A;  2X0L A;  3K79 A;  4XDL A;  2EIL B;  5C93 A;  5DM6 V;  1FKA O;  4DV4 B;  1PV0 A;  2Q6A A;  2ZNJ A;  1V55 C;  1KC8 W;  1GAX A;  2QJ1 A;  1SQB H;  2F93 B;  4JI0 B;  3FX7 A;  3S3X A;  4O4H A;  3ABL B;  1NU1 H;  1Y76 A;  2Y69 B;  3K5O A;  4PA3 A;  2CH7 B;  4JI8 B;  4GX2 A;  4AQY O;  2ZIM A;  4DR4 B;  1Z5W A;  1EBO A;  2WPD G;  3ZHU A;  2XAF A;  1R6T A;  5EC1 C;  3ETD A;  1HNX B;  4G27 B;  4GCZ A;  3W7X A;  4B3M O;  3A0B Z;  1P84 F;  1LUW A;  4J7J A;  3JAT B;  4F6E A;  1FFX B;  4PA9 A;  2YSU B;  4LF8 B;  2PUS A;  4JGS A;  2RJZ A;  3P30 A;  4J7K A;  4ZKI A;  1ZWI C;  1S5J A;  3UCS C;  2E3C A;  4P9P A;  3SPI A;  1J5E O;  5IJ0 A;  3JD0 A;  3QO8 A;  2XTA A;  1QHT A;  1WP8 A;  2DW4 A;  2IJJ A;  1P7G A;  2E74 B;  4B3S O;  3L74 H;  5JCO C;  3LNM B;  1SQF A;  2D3O W;  1KKD A;  1HR0 O;  2OIG A;  4JPR A;  1JQ0 A;  1BQ0 A;  1JJ2 U;  4TUY A;  1P49 A;  4FZ1 A;  2A3Q A;  2YID A;  4RUE A;  1HDJ A;  5EBL C;  5KMG A;  3JAW B;  3HKD A;  5KHK A;  4I0X B;  2B1G A;  3M7M X;  2Q5Z A;  2XUM A;  3CSX A;  2Z0A A;  2EIK C;  1H2M A;  1OHH G;  2LFS A;  3BA9 A;  3BY6 A;  1XNQ B;  2RN9 A;  3W7T A;  1UPG A;  2R9A A;  3ZIA G;  5L3D A;  4JI6 B;  1JX9 A;  1M9N A;  3T4D A;  4BW9 A;  3RVY A;  1ROP A;  4DRX B;  1W0K G;  2KG7 B;  4MVR A;  1D5A A;  1L0N H;  4DV0 O;  3T1H B;  3CB2 A;  2Q8V A;  4EFE A;  3ZS8 C;  1SQX H;  1RFY A;  3F5W C;  1MG1 A;  4KHP O;  1K7D A;  4U3F H;  2W0X A;  2N74 A;  1K5S A;  2R9I A;  3D36 C;  2QR4 A;  2LGW A;  1PKX A;  5LGT A;  1SZT A;  5FNV A;  3MDS A;  3DXR A;  2LW1 A;  5EBW C;  2YIB A;  2LO1 A;  4X1K B;  1K5Q A;  4H33 A;  3THO A;  4PJ0 Z;  3E35 A;  3JD3 A;  3QVN A;  2ILM A;  4ZI7 B;  4QIW F;  4FJC C;  2M6Y A;  1OCO C;  3ZRS A;  4EB6 B;  4F4L A;  1FYJ A;  4QJF B;  1HNW B;  1WPX A;  2UXC B;  5JJE B;  4MS2 A;  1VEW A;  1XMO O;  3C3S A;  2KB1 A;  3JSN A;  4UVA A;  3UO3 A;  3CYO A;  2QA4 V;  4JI3 O;  3VQX A;  4NB5 A;  4WBN B;  4YHH O;  1S0V A;  1Z5V A;  2PTM A;  4I55 B;  5B5E Z;  1XMQ O;  2LFR A;  2QSA A;  1K9M W;  2X6A A;  4BWA A;  4QPJ A;  4FM2 A;  1VQ4 V;  4X88 A;  3T2M A;  4Z1V A;  4CBC A;  4J80 A;  2VQE O;  5LMN B;  2A0L A;  1EFR G;  5KHH A;  2XHB A;  2XAS A;  4P30 A;  4HAM A;  1R6N A;  1K3E A;  1TA8 A;  5GTI Z;  3BA8 A;  3OEH G;  4D7T A;  1GN2 A;  1EN6 A;  1LNQ A;  4I4T A;  3AG4 B;  2WA3 A;  5KAF Z;  1KB9 F;  3GWO A;  5CA1 B;  4D7S A;  3APO A;  2ZQM A;  2CAZ C;  4NVP A;  4RQE A;  2VS0 A;  2ADQ B;  3D8C A;  1GM8 A;  3AK1 A;  4O4I A;  5GON A;  1ZUQ A;  2DQ3 A;  3CRC A;  1GH6 A;  3W7S A;  1K8A W;  4JAA A;  4B3T O;  5KHG A;  2JJ2 G;  2GV9 A;  3RYI B;  1N36 B;  1MSD A;  2H8P C;  2QKA A;  2EX3 A;  2JJ1 G;  5LMU O;  1JOY A;  1YDX A;  4FPP A;  2ATK C;  4DV7 O;  4N23 A;  2LGQ A;  4MT8 A;  2QEX V;  5KA6 A;  3U11 A;  2PI5 A;  3L73 H;  2CUG A;  3ZHR A;  3AG2 C;  1AJQ A;  1H2N A;  3DSQ A;  3S3W A;  1X4T A;  4O4H B;  4LNU A;  4UCS A;  4H13 B;  1Q43 A;  5B1O A;  1GMG A;  2NR5 A;  1H2G A;  4PDV A;  4JTC B;  1M90 W;  4CS4 A;  3P3P A;  1YZB A;  2DE0 X;  2ZE6 A;  3N2K A;  4IYH A;  4AIL C;  4J42 A;  1XOU A;  4XDJ A;  1PL4 A;  4TWK A;  5B1B B;  4DV1 O;  1VQO V;  2GBO A;  2UXN A;  3HR0 A;  1OJH A;  2HEP A;  3TJT A;  2FL4 A;  4PA4 A;  3E8F A;  1VF6 A;  1OCR B;  2HVJ C;  3W7W A;  2Q4P A;  5K1X A;  2QWR B;  5IJ0 B;  2VWK A;  1N34 B;  4DV1 B;  2FKX A;  2RNB A;  4DV2 O;  4JI1 O;  2HFE C;  2P90 A;  1S5L Z;  3SYO A;  4JI4 O;  3OM3 B;  4DR2 O;  4OX9 B;  5DEC A;  4IGG A;  2GDS A;  4TV8 A;  4TUY B;  2QTO A;  1YJW V;  3RYC A;  3OEE G;  2VQF O;  4JI5 B;  3ZMZ A;  4MTF A;  5J2T B;  1J95 A;  2HG5 C;  3HKD B;  4JI4 B;  5TIS Z;  2Q69 A;  2FYU H;  1HNZ B;  3OMA B;  4DR6 B;  4LC1 A;  1FXK C;  1M56 B;  4OPA A;  1XHX A;  4I7Z B;  2AGA A;  3IGA C;  1RSO A;  1TGO A;  1OV9 A;  2Q68 A;  4MTG A;  4RO2 A;  1GTO A;  3CC4 V;  4Q20 A;  4X65 O;  4DW0 A;  3K08 A;  2CTW A;  2AW9 A;  4D6T H;  4K0K B;  2M7W A;  4FLT A;  3QO7 A;  1WAZ A;  1SF9 A;  2CK3 G;  3AG7 A;  4DR1 O;  2VRZ A;  4NXN O;  1GN6 A;  5LP6 B;  3SYA A;  3OR7 C;  5K1P A;  4FM0 A;  5FNV B;  3DXR B;  1VQM V;  4GKJ B;  2WA4 A;  1H2K A;  3DC6 A;  2OIE A;  1VAR A;  1SKV A;  4FFB A;  1UJW B;  4I5S A;  3SPC A;  3OAA G;  4L8J A;  4X64 B;  1Q82 W;  4U7O A;  3BCC H;  1MA1 A;  4E4E A;  3TXS A;  4DK1 A;  5EZY A;  5ITZ A;  1W59 A;  2E5L O;  1E1R G;  4CS2 A;  1R3J C;  1G8M A;  3RN4 A;  2HKO A;  1IBL B;  2Q67 A;  1SS3 A;  3AG1 C;  2HHH O;  3EFF K;  1Y66 A;  2X7R B;  1U97 A;  1RM1 B;  1H2L A;  4UUJ C;  2UUA O;  3J80 N;  2B5U A;  2GHY A;  3RW0 A;  4UCT A;  4GX1 A;  3ZRW A;  3FAV A;  4DV5 O;  2F23 A;  1LUV A;  5IDJ A;  2R72 A;  4U7N A;  3U0Z A;  2ADP A;  2HJD A;  2EZP A;  5EYP A;  3J7A U;  1WB8 A;  3K59 A;  4PI0 A;  3JAR A;  1IBM B;  3I56 V;  2ITD C;  2A7W A;  1QQC A;  2DYS C;  3H1L H;  4I4T B;  3CX5 F;  1D2D A;  1NVP B;  3ZHT A;  1BMF G;  1GM9 A;  3KG2 A;  5LOV A;  1V54 B;  4DO2 A;  4LFA O;  1BS3 A;  1FS0 G;  3UO2 A;  4PHZ A;  1IVS A;  3G67 A;  2X6B A;  2XAH A;  2WLL A;  1IBK O;  2F66 C;  4O4I B;  1Y74 A;  5GON B;  3GWK C;  2ZE5 A;  3QG5 A;  4YJ3 A;  2PF4 E;  1F23 A;  3RT3 C;  1N0J A;  4ZOL A;  3RFR A;  5HFL A;  3T1C A;  5LHI A;  3OTO B;  5KA5 A;  5IYZ A;  3OE7 G;  1DF4 A;  2B1I A;  3LDC A;  3MAQ A;  4KFM A;  4YY3 B;  1Q6U A;  1KKC A;  1KMI Z;  2NLJ C;  4X1I A;  3K57 A;  4LNU B;  3CD6 V;  1NTZ H;  3B40 A;  5BR8 B;  4LF5 B;  3A0R A;  2YXL A;  1BGY H;  2IJH A;  3GB7 C;  1NTK H;  3BPZ A;  5LA6 B;  3N2K B;  3T1Y O;  1HP8 A;  1FD9 A;  3X2Q B;  2DYR C;  5FL7 G;  3CRQ A;  1KBH A;  4GKK O;  5JVD A;  4X62 O;  5IT9 N;  4UCO A;  4JYA B;  4X66 O;  5B1A C;  4X9Q A;  4DV3 B;  4QPK A;  4KP4 A;  4O2A A;  4I50 B;  1SQV H;  4UXN A;  2QWP B;  1Q5O A;  4BW5 A;  3CEI A;  3F7Y C;  1PL0 A;  3SPG A;  3IC9 A;  4BIU A;  4IIJ A;  4DR3 B;  4Q6G A;  5JJJ B;  5LBQ A;  4DR5 O;  2GSM B;  4X8A A;  1R3L C;  1KQS U;  1OCZ B;  1VF5 B;  3CRA A;  1PD3 A;  1XDC A;  3MHH C;  3CC7 V;  2PYL A;  5IWA O;  2B9Z A;  4WFB V;  4UCR A;  4JI2 O;  1DF5 A;  1Y6X A;  5GW7 A;  1RSO B;  5LGU A;  3CCJ V;  2D2C B;  3FB7 C;  5KUK A;  1WLE A;  2LQT A;  4AQY B;  1NJI W;  4J9Y B;  4DYL A;  3OR6 C;  1KP3 A;  4FIP C;  4JYB A;  3STL C;  5H5N A;  2L6L A;  5J9P C;  4QE7 A;  5JH7 A;  5EC2 C;  1I94 O;  1P4R A;  2Q0O C;  4B3M B;  3MD0 A;  5B1N A;  4NTX A;  1Q90 D;  3N27 A;  4MVQ A;  3JD1 A;  2OTL V;  1VQ9 V;  2JEX A;  4BIO A;  1I5X A;  1J5E B;  1XL6 A;  5CA0 A;  1OZ0 A;  3D3Q A;  4FFB B;  4B3S B;  4JI7 O;  1K34 A;  3SGI A;  3ABU A;  4FLV A;  1HR0 B;  3OW2 U;  2F95 B;  5IE9 A;  1QLE B;  3ZBH A;  5L3B A;  5CB4 A;  5EZY B;  5BXZ A;  5ITZ B;  3HPL C;  3ASN B;  1QR9 A;  1E1Q G;  4MW3 A;  1OCC C;  4PDL A;  4JV5 O;  5F2V O;  4KXR A;  5LHG A;  3K0G A;  3UT5 A;  2ZIO A;  4DW1 A;  5JCO A;  2EIN B;  2EJ7 A;  5E79 Z;  4X1Y A;  2QDO A;  4GLX A;  1WJZ A;  5LYJ A;  4K8X A;  4DV0 B;  2CDY A;  2Y0I A;  3ZRW B;  2PYJ A;  3SYC A;  3K9S A;  3FAV B;  4PA6 A;  3K0D A;  1Q86 W;  4UCV A;  4KHP B;  3B8M A;  1JFF A;  4UCU A;  3SYQ A;  4ABM A;  2P22 C;  4MTO A;  2F1M A;  5EYP B;  2LW7 A;  3JAR B;  1H8H G;  1JVM A;  4JZ2 A;  2Y4T A;  1XHZ A;  3B8N A;  2DJV A;  2K9P A;  5DED A;  3ZHS A;  1N33 O;  4EEQ A;  2N04 A;  4J7Z A;  1H2S B;  5H6R A;  1W2B U;  3C90 A;  5IY5 B;  3HKC A;  1IZ3 A;  2WLL B;  1N32 O;  5KHJ A;  1Y74 B;  4CC6 A;  4XBF A;  1N33 B;  4E2L A;  4YJ3 B;  3D36 A;  4JAS A;  2ZM6 O;  2YC0 A;  3APQ A;  4ZOL B;  5IYC O;  4OXS A;  3L71 H;  1PNL A;  5IYZ B;  3QTC A;  2ETN A;  1XMO B;  4YIO A;  1IDS A;  5B3S C;  1YF2 A;  3WG7 B;  1BZK A;  3E89 A;  4JI3 B;  3CRM A;  4LWS A;  4QNH B;  4YHH B;  1VIB A;  5A9G A;  2ZT9 B;  3F5T A;  4LR3 A;  1XMQ B;  1IUR A;  1MAB G;  3ABM B;  2AHY A;  4B3R O;  1VP7 A;  2EIJ C;  4LP8 A;  3UM7 A;  2IBZ H;  4DUY O;  2FTK A;  2E75 B;  4J9Z B;  1VF7 A;  4DV6 O;  4GZR B;  2QM7 A;  3ZMV A;  2VQE B;  3LDD A;  4OGQ B;  1SES A;  1S3J A;  4LFB O;  5JVD B;  5FLX N;  2BOC C;  4DUY B;  1KU9 A;  3OGC C;  4K3A A;  4MVZ A;  1Y4M A;  4WFG A;  1PM9 A;  1YTF D;  3CJH A;  1NQT A;  4K35 A;  4FM1 A;  4H37 A;  5LL6 Y;  3D3I A;  1Y67 A;  3K03 A;  3SR2 C;  4C7U A;  4GYC B;  2P06 A;  5H2F Z;  1KYO F;  3AG3 B;  1PP9 H;  5KAI Z;  2OCC B;  3CPW U;  1N8R W;  3KCY A;  2QE7 G;  4B3T B;  3ZN0 A;  2Q0A A;  4YXW G;  1NZ6 A;  2RMK B;  2EIM C;  1Y76 B;  2BE3 A;  2YEV A;  3BHP A;  3CCQ V;  2ZXW B;  5LHH A;  5LMU B;  1M57 B;  3ASO C;  4NTW A;  3ABK B;  3CCM V;  4DV7 B;  5JJN B;  2AHZ A;  1VQ7 V;  2EIL C;  3NXS A;  4TQD A;  1R6K A;  1TVK A;  2BSK A;  3OUF A;  2PGG A;  3ZMT A;  4NYK A;  1URF A;  3ZMS A;  3ABL C;  1EZJ A;  3WB0 A;  2Y69 C;  3TXQ A;  4EKW A;  2Q73 A;  1V55 B;  4ZHQ A;  4O4J A;  4UB6 Z;  2K1E A;  3O65 A;  1K73 W;  3J81 N;  1YEW A;  5B66 Z;  4GX5 A;  3FKS G;  4LF4 O;  2ZIN A;  3JAK A;  3SDL A;  1BL8 A;  4CH5 A;  2DQ0 A;  1QR8 A;  5CA0 B;  4DV2 B;  4ZIB A;  4JI1 B;  5KMG B;  2Q7G A;  4DR2 B;  1CXZ B;  5IJ9 A;  4LBE C;  5CA3 A;  2P7T C;  1AJP A;  3C3T A;  2WAM A;  1R1B A;  2VQF B;  5CB4 B;  2UXB O;  2F4V O;  2P6J A;  4RAI A;  2IW5 A;  1JPX A;  5H9C A;  2A9H A;  1I7F A;  2BOB C;  5LXT A;  4LF9 O;  3LDE A;  2DOS A;  2ZKO A;  2YS8 A;  3UT5 B;  3LUT B;  5J2U A;  1NR1 A;  2MK3 A;  2X6C A;  2N05 A;  3A2F A;  4AI8 A;  4QE9 A;  4FLU A;  4LF6 O;  5BMV A;  2CE4 A;  3AEI A;  1A32 A;  3JCU Z;  2HLD G;  1DGS A;  4B08 A;  5LYJ B;  4B7E A;  1IXM A;  3RYH A;  1NKD A;  3B09 A;  3G6E V;  1L0L H;  1W0J G;  3E8G A;  2UU9 O;  4WFA V;  4X65 B;  3K5N A;  3ZN1 A;  3WU2 Z;  2EIK B;  1K92 A;  3N2G A;  2ZE8 A;  3CRR A;  1QLN A;  3SPJ A;  4DR1 B;  1GK9 A;  1MNG A;  5D5P A;  1FXK A;  4NXN B;  2R9R B;  2QKS A;  3ZED A;  1KUQ A;  3BEH A;  1Q8I A;  4FMT A;  3VQV A;  5E1A C;  5C8Y A;  1GM7 A;  1F51 A;  3A0H Z;  1FXH A;  1XNR O;  2WLH A;  4Z2W A;  4UFZ A;  2FB5 A;  3B4S A;  3Q4H A;  3HKC B;  4R6Z A;  3FFQ A;  1FAF A;  3BAB A;  4CH3 A;  2UUC O;  4CH6 A;  1XIL A;  1M4U A;  4NXM O;  1F4N A;  1NTM H;  2WWW A;  1GN4 A;  1YI2 V;  1XNR B;  2OCH A;  1B04 A;  2E5L B;  3LSS A;  2Z3Y A;  1SA0 A;  1EN5 A;  3GVM A;  4G28 B;  3G71 V;  4N21 A;  1SQP H;  2YIC A;  2A06 H;  2KG7 A;  5JWP A;  3CMA V;  1NS1 A;  2HHH B;  1GO3 F;  4LF7 O;  1AR1 B;  3E8H A;  1XBL A;  1SRY A;  5EBM C;  1XUQ A;  3OUS A;  2ZR2 A;  2UUA B;  4LFC O;  1NI8 A;  2Y4U A;  2Q9L A;  1OCO B;  4TV9 A;  2DMX A;  5KUM A;  3UQ8 A;  4DV5 B;  2GUZ A;  3H1K H;  1DTO A;  3W7U A;  4KUM A;  2IJI A;  2P67 A;  2W6J G;  1P7B A;  3ML0 A;  3I55 V;  1VQP V;  3CXC U;  4X1K A;  2ITC C;  2ZCE A;  3SPH A;  1VMG A;  2IH1 C;  1JMK C;  1YCI A;  1YHQ V;  1FXV A;  3OGI B;  1CEZ A;  1YTF B;  3K58 A;  1Q3E A;  4K8Z A;  2E76 B;  3ZCC A;  1VQ5 V;  2IU3 A;  4BR6 A;  3EHB B;  4WF9 V;  4OPH A;  3CJH B;  4LFA B;  1I5Y A;  3STZ C;  4EB6 A;  1NR7 A;  2PY5 A;  3AG4 C;  1IBK B;  2IH3 C;  1VQL V;  2UUB O;  2QWN B;  3K9A A;  3PJS K;  3JAM N;  1BSM A;  3U10 A;  3HKB A;  4BAY A;  5L3G A;  4WBN A;  1E79 G;  2UXD O;  3QO5 A;  3K3W A; 
#chains in the Genus database with same CATH homology
 4J42 A;  3FX7 A;  4J41 A;  4J7J A;  4W4K A;  4W4L A;  2G38 A;  4J10 A;  4KXR A;  4IYI A;  2GTS A;  4IYH A;  4J7K A;  4J11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...