1S5HC

Potassium channel kcsa-fab complex t75c mutant in k+
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATCVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords ANTIBODY FAB FRAGMENT LIGHT CHAIN
publication title A mutant KcsA K(+) channel with altered conduction properties and selectivity filter ion distribution.
pubmed doi rcsb
source organism Streptomyces coelicolor, streptomyces lividans
total genus 40
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2004-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1s5hC00
2R9RB 5E1AC 4MVSA 4MVUA 2Q69A 4CBCA 3PJSK 2QTOA 3K0DA 4MS2A 2BOCC 1R3KC 2AHYA 2EIJC 2HVJC 3F7YC 4TWKA 3WG7C 4P9OA 3SYAA 4UUJC 3SYQA 5CBHA 3SYOA 1BL8A 1V55C 4PA9A 4BW5A 2ATKC 3OUSA 2ITDC 4J9YB 1OCOC 3SPJA 4I9WA 3AG2C 4G27B 1XL6A 2Q67A 3OR7C 3ABLC 1K4DC 4P2ZA 4MW8A 1K4CC 3T4ZA 3VOUA 3IGAC 4X8AA 4X88A 4MVRA 2EIMC 3RW0A 4MVOA 3BEHA 5KUMA 4MVZA 3AG3C 4PDVA 3KG2A 1ZWIC 4XDKA 3LDEA 4H37A 3IFXA 2DWEC 2A0LA 4GX0A 3STLC 4RAIA 3SYPA 1V54C 2WLHA 2H8PC 4MTGA 3OGCC 4PDMA 4PA7A 4WFEA 3T1CA 4GX2A 5EC1C 1P7BA 4R7CA 1J95A 3E8BA 3LDCA 3E86A 3FB7C 4P9PA 4QNHB 4R6ZA 1R3IC 3HPLC 3FB8C 1G4YB 4X89A 1M56C 3E8HA 4OXSA 2HVKC 3K06A 3SYCA 4RUEA 1R3JC 2A9HA 2IH1C 1QLEC 2HFEC 4JTDB 4ZBMA 2WLMA 3SJQC 3X2QC 5CBFA 4XDJA 3F5WC 3TETA 2X6BA 4P30A 3ASOC 2ZXWC 5CBGA 3ABKC 2WLLA 1R3LC 1XL4A 4PA6A 3OUFA 2WLIA 3K03A 3LDDA 4G28B 4MVMA 5B1AC 4QE9A 3K04A 4PA3A 3ABMC 2WLLB 2Y69C 4MW3A 4J9ZB 3TCUA 4HZ3A 2WLIB 3LNMB 4JTAB 5EBMC 3E8GA 1M57C 3RBZA 3AG4C 3SPHA 3SPGA 2WLKA 5EC2C 4XDLA 2AHZA 3JYCA 1OCCC 3T2MA 2W0FC 1S5HC 2JK5C 4HYOA 2P7TC 2X6AA 3ASNC 5KUKA 3E8FA 2WLJA 1KKDA 1ORQC 2EINC 4LBEC 2X6CA 4LP8A 1OCZC 2KB1A 4PDLA 5EBWC 1LNQA 3EFFK 4PA4A 5B3SC 4MTOA 2BOBC 2A79B 4RO2A 3SPCA 3K08A 2DWDC 3R65A 4MVQA 3ZJZA 5EBLC 4GX1A 3LUTB 2K1EA 4KFMA 4QE7A 3RVYA 1OCRC 3FB6C 4R8CA 3E89A 3ZRSA 2DYRC 4GX5A 2YEVA 3FB5C 2NLJC 5IY5C 4PDRA 3E83A 5EK0A 4WFHA 3RVZA 5BZBA 2DYSC 3GB7C 3UM7A 4WFFA 2IH3C 3K0GA 4MTFA 4R50A 4WFGA 2Q6AA 2HG5C 2EIKC 2OCCC 2ITCC 4RUFA 4JTCB 3SPIA 4F4LA 2HJFC 2Q68A 4H33A 3STZC 2ZD9A 4DXWA 4EKWA 2WLNA 3F7VC 5J9PC 1JVMA 3OR6C 3AG1C 4MSWC 4LCUC 2QKSA 5B1BC 3T4DA 3UKMA 2EILC
chains in the Genus database with same CATH superfamily
5LA6A 5IYZA 3CCVV 1R3KC 2AHYA 4X62B 1AILA 4HNAB 3ML0A 1SQFA 3ZCCA 1TVKB 2CE4A 4X88A 5DN6G 4UCOA 2RNBA 3QG5A 3CCJV 1AP6A 5AG2A 2CUGA 1QCEA 1K92A 2BTQA 1VF6C 3SYPA 4Z2WA 2JS3A 4MTGA 5DM6V 1YZBA 4F6RA 4JI4B 5K1PA 3E86A 2E76B 4DV6B 3RYCB 1XREA 1XNRO 2W6JG 1SESA 2A9HA 1MSWD 4X20A 3ZMSA 1VMGA 1F4NA 2QWNB 3F5WC 3RYHB 4TOIA 3G4SV 3T1YO 2FTKA 3ASNB 3P32A 3WB1A 4DR1O 1L8DA 1K5SA 2LFRA 4LC1A 3LSSA 1URFA 3SPHA 1MZFA 5C93A 2WLKA 4Z1MG 3OMIB 3CXCU 1K9MW 2HEPA 1SETA 3ZEDA 2UU9O 4QPKA 1IZ3A 1MA1A 1XILA 3JSLA 1UPGA 1EM1A 1KB9F 5LHGA 1UJWB 3SPCA 1R6KA 1K34A 1Q43A 2O57A 1L0LH 3AG1B 3ZMTA 1XMOO 1Z5WA 3FB5C 4ZIBA 1YSCA 4TQFA 4K35A 4GUNA 1AVMA 1SQVH 2ZKOA 3SDLA 1NU1H 4EKWA 3F7VC 5TISZ 2QKSA 3FKSG 2EILC 3MAQA 3A0RA 2CDYA 5IDJA 4O4JA 1BE3H 2IW5A 5LA6B 4P9OA 3C3TA 2HHHO 1UFIA 1NVPB 1U96A 4I9WA 1OZ0A 1K4DC 4H44B 2Y4TA 4GYCB 3IGAC 3MHSC 2C2AA 1QR9A 3DXRB 3B09A 4UVCA 2YDEA 5FLXN 2XAJA 2XUMA 2R9AA 1L1FA 4D6TH 4LFAO 5LXTA 3E22A 4LF8O 1PD3A 3QVNA 1MZEA 4BIZA 4F6RB 2DJVA 1BGYH 5LP6C 4FMTA 3SYCA 2DOSA 2IBZH 4KUMA 3OMAB 3X2QC 1OCCB 4K8XA 3ZN0A 4AHCA 1L0NH 1QVGU 4X20B 3K03A 1JFFA 2JEXA 2JGDA 2EINB 3K04A 2Y69C 2YSUB 3CRAA 4QJFB 1BQZA 4BWAA 3SPGA 1E1QG 4X66B 4YJ2B 2CH7A 2DYRB 1P49A 5IY5B 1YJWV 2YI8A 4DV2O 2MW2B 1ORQC 3UQ8A 4DV3O 2EZOA 4FLXA 1ZTEA 2DQ3A 1HNXB 5FPRA 4B3MO 3CS5A 3CJHA 2UUCB 1PNMA 2EIJB 4NTYA 3OM3B 3OMNB 3OGIB 4KXRA 5D5PA 2YIBA 2UXCB 3AG2B 4I4TA 5CA3A 1HNZB 5D5QA 2FYUH 2WPDG 3K58A 2ZD9A 3RGBA 1VQ5V 1FFXA 2D3OW 1SQXH 4JI1B 2IJIA 1VQNV 2XTAA 4MS2A 1PNLA 2RN9A 2Q0AA 2XAHA 3WU2Z 5CBHA 3SYQA 1ENVA 2ZIMA 1BL8A 3LNNA 4O4JB 4ZHQA 4B3RO 1SA0B 1KMIZ 5ITZA 5C8YA 4CZZA 3BHPA 3FAVA 1Z2GA 4FLWA 2LQTA 5B1OA 1GN2A 1I5YA 2ZXWB 3ABKB 4RAIA 2VWJA 1XQ8A 4R6ZA 3HPLC 3K57A 4FPPA 4I7ZB 4K3AA 1MG1A 1GM7A 5LXTB 3E22B 1R3JC 2IH1C 4GZRB 2OT5A 3D3QA 3JSNA 3HKCA 1G8MA 4JI0B 1I0HA 3CB2A 4JZ2A 3OUFA 4LFCB 2QR4A 4DK0A 1NKDA 4J9ZB 3VQYA 3LNMB 5B3SB 1HNWB 4ABMA 2L6LA 4Z1VA 4F6EA 3RFRA 4AILC 2W0FC 3RYIA 3CCEV 4X62O 4FZ0A 4JI3O 1IXBA 3H01A 2CH7B 4LF7B 3U11A 4PDLA 2JJ2G 3QTCA 1GO3F 5B1NA 2YXYA 3BCCH 4JV5O 2Z0AA 3AEIA 3FB6C 1OJHA 5LBQA 4UV9A 1KBHA 2G38A 4JI4O 4PJ0Z 1KQSU 3BY6A 3W7XA 4DV6O 3CJHB 4W4KA 3HB3B 2EIKC 3JASA 1NBMG 4CS4A 1QNMA 2UXXA 3SJAC 3E2EA 4KP4A 3A8TA 4TV9A 4DXWA 2KKWA 3JD1A 4B3SB 4FLZA 1VQKV 1N36B 5IJ9B 1FFXB 2DW4A 1XEQA 3T1YB 3F5TA 1Q86W 2QM7A 3BPZA 3C3SA 3ZHSA 2P90A 4G2KA 2V1DA 1AJPA 5ITZB 4PDVA 1I94B 2N74A 2ZDIA 2QDOA 1FXHA 2QE7G 2DN9A 1P7BA 4DR3B 2CK3G 1F23A 2F4VB 4N21A 4U3JA 4OXSA 1I5XA 4J80A 3ZX6A 3TXSA 5LYJB 3CCUV 4D7TA 3RYFB 5CBGA 5K1XA 4UCSA 3HKCB 1VP7A 4AQYO 2E3CA 3EXAA 1KU9A 2A3QA 1XMOB 4D7SA 3E35A 5KHHA 4TV8A 4LF5B 3G67A 1GK9A 2KG7A 2QTSA 1XMQB 1QLNA 4I50A 4DUZO 1FKAO 1S5HC 4LNUA 3ASNC 1JA8A 3RYIB 2OCCB 4YY3B 4PELA 2OYQA 1Q6HA 2ZIOA 3VQXA 2QKCA 2CAZC 4LFBO 1EBOA 1YDXA 3QO5A 2AW9A 3ZRSA 4IIJA 3QO7A 1AP5A 1JX9A 1Y76A 4ZKIA 4R50A 5H5NA 1YTFB 3BFRA 2GHYA 1KP2A 5DEDA 3ABLB 1XI1A 1V9PA 4LFAB 1BS3A 3AK1A 4I9QA 1ROPA 4BIOA 3JASB 4GKKB 3AG1C 1AR5A 3FFQA 3ZHRA 4X1YB 1DGSA 1N33B 4TWKA 4GLXA 2WAMA 1RSOA 2B9ZA 4PA9A 1NQTA 5KHJA 2KQXA 3K5MA 4O4HB 3RT3C 2UUBO 4GT1A 3W7TA 4XDKA 1YVWA 3ASOB 5BXZA 3STLC 1US6A 3OGCC 1WAZA 2VWKA 4DV1B 1I08A 3FB7C 4DRXB 1KC8W 2V7QG 3ZMVA 2OTLV 3AG4B 4ZBMA 4DV3B 3A2FA 3K9SA 3OT7A 2N05A 1IDSA 1HW7A 4FLUA 4B3MB 3ZHQA 2UUCO 2WLLA 3NR7A 3HKDB 1PM9A 1IXMA 4JF3A 1HNZO 5GTHZ 1RP3B 3UT5A 1O9GA 4TV8B 1WB8A 4X1KA 3JYCA 1OCCC 1WN7A 3K9AA 5JH7B 5J2UA 3Q4HA 4JI1O 2LFSA 2IM9A 4DK1A 4FM0A 2Q0OC 4DYLA 2EINC 4I55A 1JJOA 2YXHA 1NJIW 3QF7A 1NZ6A 1LUWA 2ZR3A 4U3FH 4B3RB 3CMAV 2RDCA 4UV8A 1FAFA 2ZR2A 4ZI7A 2DYRC 3BAAA 4GX5A 5IY5C 3E83A 4WFHA 3RVZA 3UM7A 5EZYB 1NVPD 4IIJB 3NXSA 5IYDO 4A5UB 4YJ3B 4DR2O 3APOA 5EIBD 3H1IH 4LCUC 2XAFA 4JI0O 2JGUA 4MVUA 1AJNA 3PJSK 4LFCO 2EIJC 3CCLV 3FD9A 2IU3A 3SYOA 5DECA 3CRQA 1M56B 3CD6V 1AI7A 1HNWO 3ZBHA 3AG2C 1RSOB 1NH2B 1VF7A 2PTMA 3HKBA 5KUMA 3IC9A 1K7DA 3KG2A 4J7ZA 4LF4B 4H37A 2W0XA 4JI5O 1EFRG 2WLHA 1CEZA 2YXLA 4LF7O 2YICA 3E8BA 5KHIA 1O9HA 3JATA 4DW1A 4W4LA 4J42A 4I5SA 2YI9A 2QM4A 4JI3B 3RN4A 1E1RG 1VQ8V 4DUYO 5BMVA 1EZJA 2XAGA 4H13B 4NVPA 3MD0A 5CBFA 1KYOF 2ZXWC 3ABKC 4DR4O 4MVMA 1W2BU 4ICGA 1R6NA 2ZE6A 4JV5B 2WLLB 4HZ3A 5L3CA 2M7WA 2ZNIA 1JOYA 3CE2A 1ZL8A 4CH3A 4K8ZA 1HDJA 1GH6A 1N32B 3UT5B 4L8JA 1RPOA 4B3SO 2F66C 4JAUA 1N36O 4XBFA 2WLJA 1H38A 3N2GB 2X6CA 2KB1A 1VF5B 5CB4A 5B3SC 3ZMUA 2P4KA 1H8HG 4UFZA 1BT8A 2Q5ZA 2ZE7A 3VBBA 1I94O 5KHKA 1JQ0A 2H3OA 4B3TO 5LHHA 2A7WA 2BSKA 5GW7A 4DR3O 1BZKA 3B40A 2F4VO 2GBOA 4WCEV 4O4LA 4FFBB 2OCHA 5IYCO 5J9PC 4MSWC 3VQWA 2R9RB 4FK5C 1Y4MA 2CTRA 1LUVA 4BW5A 2QSAA 2AZ0A 2ITDC 4LF5O 1SZXA 2AXTZ 1J5EB 3K5LA 4HBNA 4MW8A 3G80A 5E79Z 4KHPB 4AQYB 2YEVB 3ZRWB 1XMQO 2VQFB 1U97A 3HKBB 2GUZA 5J2TA 4PDMA 1BCCH 1BMFG 3LSUA 4DUZB 5IWAO 3M99B 1D5NA 3SJCC 4YY3O 1MNGA 2Q7HA 4NYKA 5IYZB 3JATB 1JMKC 4XDJA 2X6BA 5JCOA 2WLIA 4LFBB 2RMKB 1WLEA 2Q4PA 1WJZA 1F7YA 5KX5A 1WP7A 1D2DA 1WPXA 2BTQB 3RBZA 1Y66A 1VQPV 4GKKO 1IVSA 1X4TA 3R66A 2OWOA 2Q73A 1OCRB 4IYHA 2UXNA 5KMGA 1N33O 5LMNO 3B8NA 4UVBA 5KUKA 2EJ7A 4JI6B 2ZM6B 1VF6A 5CA0A 4MTOA 1PV0A 2YIBD 3CRCA 5FNVA 1GM8A 3CPWU 1AR4A 3R65A 4NXMB 2JRIA 3CXHF 4JGSA 1DK1A 4NB5A 3KCYA 2PI4A 5L3FA 1FFTB 2E74B 4DR5B 2UUBB 4OX9B 4DV1O 5BZBA 4WFGA 1MOFA 2BSKB 4ASUG 2Y0IA 2OCCC 2ADQB 4F4LA 1KKCA 1XDCA 1AROP 4O4LB 5KA5A 3FYEB 3T4DA 1S0VA 1BHBA 2QTOA 1W0KG 1Y6XA 1DLBA 3N2KA 4TT3G 5GONA 1PKXA 1XL6A 4FLTA 3ABLC 3T4ZA 5FPOA 4FM1A 5IJ0A 1W0JG 3IC7A 2E5LB 2JIZG 2DWEC 1KUQA 4WFEA 2PF4E 2P06A 4R7CA 2QM8A 5J2TB 3CRRA 1H2MA 1E79G 4X89A 2ILMA 5JJJB 3K06A 2Q7GA 4CS3A 2MK3A 1M90W 2ZNJA 3JAKA 4O2BA 3ASOC 4PA6A 4UCTA 4DV0O 2Y0PA 2ZDIC 1K33A 1YCIA 4WBNA 2FMLA 2WLIB 3I56V 2NN4A 3D8CA 4PV1B 2LGWA 3GVMA 3JAWA 3LSQA 3P3PA 3QNEA 3AG4C 5KX5B 3BA9A 1THZA 3JALA 2JK5C 3ZHTA 4DR2B 2OIGA 2CTWA 4DR7O 1YTFD 4LBEC 2EX3A 2QA4V 4JAVA 4JAAA 1YJNV 4UB8Z 4X65O 5CA0B 3QO8A 1JFFB 4OPHA 2JGDB 4LF4O 4X9QA 5LP6A 2K1EA 5GTIZ 3W7SA 1FXVA 1XUQA 4MT8A 1M1KW 2A06H 1PP9H 4JI5B 3CEIA 2Q8VA 1GKFA 3TGUH 4ZOLA 4RQFA 3C90A 3L72H 1VIBA 1V54B 4DUYB 5EYPA 1HR0B 1S3JA 1GMGA 2EZPA 1VQ7V 4DR4B 2Q67A 4C7UA 3EVKA 1MSDA 1GN4A 1NR7A 5LGTA 5GONB 1N32O 1Y74A 3ZN1A 2QEXV 1ZWIC 2HR3A 4LF6B 3JD2A 4I4TB 4EFEA 3K5NA 2ZINA 3EHBB 3OFNG 2XT9A 3LDCA 1BSMA 5LOVA 1ZAUA 1M56C 1VQ9V 4DR6O 4JYBA 5B66Z 2L35A 1EZVH 3TETA 2NNUA 4ZHQB 4JI7O 1R73A 1R3LC 2X7RB 4O2BB 5C8YB 2D2CB 3W7WA 1Q7YW 3FAVB 1OCZB 3DSQA 4WFBV 4B3TB 4CH5A 1VQMV 5EBMC 3E8GA 1PPJH 1HP8A 3A0HZ 2QWRB 2Y48A 1S77D 2PGGA 1G6UA 3B8MA 2IJHA 4CC6A 3E8FA 3U0ZA 4LP8A 4BAYA 4PA4A 1FXKA 3B77A 1J5EO 1T5EA 2A79B 1GM9A 4KHPO 2VQFO 1QU7A 5A9GA 5LL6Y 2LW7A 4RQEA 1NTKH 4DO2A 4E4EA 3SJBC 2NLJC 1Q5OA 4N23A 1AI4A 3W7UA 1SQPH 3APQA 2IU0A 2UXBB 3SPIA 1NH2D 5IWAB 5E1AC 2AZ2A 4IYIA 1ZX3A 3JARA 2ARHA 3K0DA 4J10A 2JS5A 4IHJA 3U10A 2E75B 2QJ1A 5LGUA 4GCZA 3OUSA 4LWSA 1QLEB 4X8AA 3UO3A 3BEHA 2P22C 2Q9LA 3P30A 3N27A 3IFXA 1M4UA 1Y74B 2PY5A 5H6RA 4GX2A 1DF4A 2ZM6O 4JI6O 4BIUA 4TV9B 1G4YB 1MABG 3CX5F 5LMNB 2HP8A 4NXMO 4FVMA 1XHXA 1Z5VA 4DR5O 4OX9O 3L71H 5CA1A 4QE9A 1B06A 2UUAB 3BABA 3BVOA 2QKAA 2RQ6A 1CXZB 5EC2C 1H2SB 1AJQA 1XOUA 2Q7EA 4L87A 2M6YA 4UB6Z 4U3JB 2XNDG 1SKVA 2X6AA 2DYSB 5EIBC 2HKOA 2BCCH 3MDSA 3IAYA 2BOBC 3H1JH 3K79A 3CYOA 2CGOA 2YS8A 1FXKB 2XAQA 3ABUA 2E5LO 4MTXA 1OCRC 4U7NA 2F95B 4PDRA 2JEUA 2KG7B 1OCOB 1QBZA 2Q6AA 4I50B 4JTCB 1IBKO 2HJFC 2Q68A 4LNUB 3UO2A 4TQDA 3OR6C 3RYCA 1N8RW 2BOCC 1YF2A 1ZUQA 4YHHO 2ZE5A 3JARB 1YIJV 3RYHA 1R1BA 2F43G 4IHJB 4DV0B 3VOUA 1COWG 4MVRA 1CP9A 3S3XA 2ODMA 4FM2A 4MVZA 1WA8A 1Y76B 1GAXA 4LWSB 3MHHC 2X0LA 1SQGA 2H8PC 3AK3A 1FD9A 2GSMB 2PZSA 5EC1C 1XNQB 1RFYA 2AGAA 4LH7A 1EN5A 1P4RA 4DR7B 4RUEA 4JTDB 3D36A 5B5EZ 2RCVA 5KAIZ 4X65B 1K8AW 1QVFU 1NTMH 4UCVA 4H0LB 4UXNA 4IL6Z 1Q90D 1H2LA 3H1KH 3TCUA 3ETQA 4JTAB 1YEWA 2WA3A 1PL4A 1NI8A 4B08A 2XOKG 3T2MA 1S72V 2JJ1G 3PN1A 4BW9A 1HR0O 1TAEA 4O4IA 5JCOC 3SGIA 4MVQA 1NTZH 3ZJZA 3DGEA 3CP1A 1WPBA 2PYLA 4QE7A 4LF6O 4FZ1A 1IURA 2DE0X 5CMUA 1M5IA 1N0NA 3WG7B 3DXRA 4X1KB 4PHZA 5J2UB 3Q4HB 4NTXA 1SERA 2EIMB 3STZC 1JJ2U 3CC4V 3AG3B 3K3WA 4EB6A 5IE9A 3OD4A 4I55B 4DR6B 2Q69A 1B04A 5CN0A 4JPRA 4NR1A 4UUJC 4JI7B 2VQEO 4P2ZA 4ZI7B 4JI8O 3GWOA 1KD1W 1FYJA 1EN6A 1S76D 1V54C 4UVAA 1WA8B 1TUEB 1KECA 5JQGA 4YJ2A 1PNKA 4TSFG 1RM1B 1TGOA 4EEQA 5HFLA 4B7KA 5JWPA 3L70H 1TUBA 4P30A 1D5AA 1IBMO 5JJEB 2Z3YA 1HWYA 5KLVH 2OTJV 3J81N 2WA4A 4PA3A 3WFVA 2UXBO 3L9DA 1WB7A 1GN3A 4J11A 4PI0A 1FPOA 1GRJA 1NT2B 3TXQA 5BMVB 2PI5A 3ZS8C 1OCZC 1H2KA 1LNQA 4J7KA 2P67A 3FYIB 1PL0A 4O4IB 4RO2A 2B1GA 2DWDC 2YIAA 1DTOA 2GV9A 1P7GA 3ZIAG 2FKXA 5B1BB 2FB5A 1SA0A 4HAMA 3CCRV 2Y4UA 4YIPA 1AB3A 1ZL8B 3GB7C 1V55B 4WFFA 1QHTA 3BRCA 2ZE8A 1Q82W 3UKMA 2GDSA 1Q81W 3S3WA 5CB4B 1G1XB 4RWUA 3WB0A 4EB6B 1AI6A 4UCRA 2H94A 3F7YC 2UUAO 3FX7A 5HFMA 3T1HO 3ETGA 2NR5A 1K4CC 2ETNA 3BA8A 4OGQB 3RW0A 4JYYA 3OEEG 5F2VO 1ZLZA 2GTSA 4FIPC 3THOA 3CCMV 2DMXA 4JYAB 2P4VA 1F51A 3L75H 4B7EA 2V4DA 5B1AB 1VQ4V 1J95A 3ABMB 5BR8O 1K97A 3I5DA 3B2EE 1WNSA 4TUYA 5JQGB 1M57B 1S5JA 4BR6A 1QLEC 3ICXA 4Q6GA 1XBLA 1QQCA 2N04A 4LF9B 1Y67A 4GKJO 2QGNA 1ZSPA 4CS2A 4J41A 3ZRXA 1IBLO 1TUBB 2WSSG 3OTOO 2VS0A 1TA8A 3O65A 2ZQMA 5LMUB 2JDIG 1OHHG 2GUZB 1A32A 4NXNB 2F23A 1KP3A 5KHGA 1VEWA 2AHZA 1YITV 2IJJA 4DV7O 1IBKB 2K9PA 4X64O 1VQOV 2B1IA 5KAFZ 4JASA 1SS3A 2P5OA 1K3EA 3EFFK 3OAAG 1SRYA 4YHHB 3ZHVA 5IJ9A 3K08A 1H8EG 4DV4B 2QWQB 4J7JA 3L73H 3OW2U 3RVYA 2P6JA 3E89A 1JR9A 4U7OA 1GN6A 4DV5O 1XNQO 1YJ9V 2DYSC 1Q6UA 3K0GA 4MTFA 5JVDA 4FJCC 3HR0A 5KMGB 3TJTA 3UCSC 4YIOA 1FXKC 3A0BZ 1N0JA 2UXDO 4CBCA 5KA6A 4JI2O 3HKEA 5FNVB 1N34O 1B3QA 2HVJC 5LYJA 3H1HH 3K5OA 4DW0A 3RYFA 1OCOC 1EN4A 4G27B 3OR7C 1R6TA 1SC5B 4WFAV 3DTUB 2CGNA 5L3GA 1YXBA 4K0KB 3J80N 3LDEA 2LO1A 4JYCA 5L3BA 1OV9A 3ETDA 3CCSV 2QWOB 4PA7A 3KKYA 1FJGB 4P9PA 4QNHB 4FFKA 1K73W 3AK2A 4CC5A 1JCHA 3E8HA 2WWWA 3JCUZ 2OIEA 3H1LH 4TUYB 3SJQC 2YUAA 2R72A 3N2KB 4QPJA 1AI5A 4JZGA 4CH4A 1XL4A 1SZTA 3L74H 3AG7A 3JD0A 5IJ0B 3K59A 4NKGB 1I7FA 2LP7A 1H2NA 4EFBA 3CWBH 1M9NA 5H2FZ 1SQBH 3H9VA 3CMEV 5H9CA 2P7TC 1KKDA 4WF9V 1YHQV 1LR1A 5EBWC 4X1YA 3JAKB 1XNRB 1SQQH 3CCQV 4LH6A 3JAMN 5EBLC 2VQEB 3LUTB 2EILB 4KFMA 5L3DA 4WBNB 4R8CA 4O4HA 3JAWB 4JI8B 3IJ4A 4DR1B 4FLVA 3JALB 3ZHUA 5LGNA 4RUFA 5JVDB 4DRXA 3OEHG 1SF9A 2IJKA 2B5UA 1YI2V 2GTAA 2PYJA 4PD4F 4X1IA 1M93A 1BHAA 1X59A 3WG7C 2UU9B 1N4CA 2EULA 3OTFA 1IBMB 3HKEB 2ATKC 3I55V 5LP6B 5A2QN 3RWRD 2HLDG 3HKDA 2EIMC 3X2QB 3AG3C 4GX0A 1JPXA 3T1CA 2BE3A 2F93B 4ZOLB 2Y69B 2CTQA 5JH7A 5JJNB 1R3IC 1VARA 2DQ0A 3G6BA 4E2LA 2HFEC 4NTWA 5EYPB 3JD3A 1H2GA 4Q20A 4PI2A 4MW3A 1RM1C 2HHHB 2CTPA 4QIWF 2W6IG 2PUSA 5EZYA 2EBOA 4O2AA 4LR3A 4I0XA 5LOVB 1FS0G 3D36C 4HYOA 4IGGA 3CC7V 4YJ3A 3J7AU 2EJRA 3SR2C 5LHIA 3GWKC 4LF8B 2ZCEA 2R70A 2XASA 4UCUA 2QWPB 3T1HB 2KSDA 4JYAO 3JD4A 2HJDA 5IYBO 1P84F 3ZRVA 3B4SA 3TK1A 5H6QA 5EK0A 2RJZA 1Q6IA 1B6QA 2IH3C 2YC0A 1NS1A 4X66O 3OE7G 2HG5C 2ITCC 4CH6A 5BR8B 4LF9O 2WLNA 2LGQA 5B1BC 4MVSA 4HNAA 1IX9A 3VQVA 5L3EA 1WP8A 1TVKA 4DV2B 1HNXO 3SYAA 4GKJB 1V55C 3M7MX 4X1IB 4J9YB 3SPJA 1IBLB 5LMUO 1GTOA 3ETEA 3OTOB 4NXNO 4MVOA 3CC2V 2VRZA 2A0LA 2UXCO 1RPRA 3M8AA 1AR1B 2BTOA 5FL7G 3KCXA 4DV7B 2ADPA 4X64B 4IT5A 3FB8C 3WB2A 2HVKC 4YXWG 3JCZA 3N2GA 2WLMA 4DV4O 3G71V 1VQ6V 1MMMA 4AI8A 1S5LZ 4QGPA 3G6EV 5BY1A 4G28B 1CPYA 3LDDA 5B1AC 3ABMC 2XHBA 4DV5B 2LJ2A 1Q3EA 1BQ0A 1K5QA 1M57C 1F4MA 3D3IA 4KL1A 2F1MA 3CHXA 3CSXA 4XDLA 3DC5A 5IT9N 4FFBA 4O2AB 1Q8IA 3ZMZA 4I0XB 4FLYA 2UXDB 2YIDA 2EIKB 3KZIZ 4JI2B 1DF5A 2FL4A 1N34B 1NR1A 3DC6A 2ZT9B 1VQLV 4K0KO 5CA1B 4GX1A 3CRMA 3P3NA 2R9IA 1QR8A 2YEVA 1XHZA 2LW1A 3ZRWA 1FJGO 2Z5UA 3O9OA 4OPAA 3ABTA 4H33A 2JVDA 1JVMA 1W59A
chains in the Genus database with same CATH topology
1Q81W 1V54B 3CCVV 1AI6A 1R3KC 2AHYA 2H94A 3F7YC 4TWKA 2WAMA 1S3JA 3ML0A 1GMGA 4PA9A 2EZPA 5HFMA 1NQTA 1VQ7V 3ETGA 3ZCCA 2Q67A 1K4CC 4X88A 5DN6G 1NR7A 5LGTA 3CCJV 3RW0A 3OEEG 4GT1A 3ZN1A 4FIPC 3W7TA 3CCMV 4XDKA 2QEXV 1ZWIC 2HR3A 1QCEA 3ASOB 1F51A 1K92A 3STLC 3SYPA 3JD2A 4MTGA 3OGCC 5B1AB 5DM6V 3EHBB 1VQ4V 1J95A 3OFNG 3ABMB 3LDCA 3E86A 3FB7C 1K97A 1KC8W 2V7QG 3ZMVA 1M56C 2OTLV 1M57B 2W6JG 1VQ9V 3AG4B 1SESA 2A9HA 1QLEC 4ZBMA 4JYBA 1MSWD 3ZMSA 1F4NA 3F5WC 3TETA 2NNUA 1R73A 3G4SV 3ZRXA 2WLLA 1R3LC 2FTKA 3ASNB 2WSSG 2X7RB 3P32A 3W7WA 1IXMA 1Q7YW 1OCZB 4JF3A 1K5SA 2LFRA 2ZQMA 4WFBV 1VQMV 5EBMC 3E8GA 2JDIG 4LC1A 3LSSA 1OHHG 3SPHA 5C93A 2WLKA 1KP3A 2Y48A 2AHZA 3JYCA 1OCCC 4Z1MG 2IJJA 3K9AA 1YITV 1S77D 1VQOV 3OMIB 2B1IA 3CXCU 3B8MA 1K9MW 2IJHA 4JASA 2LFSA 1SETA 3E8FA 4QPKA 2EINC 4LP8A 4BAYA 1NJIW 1K3EA 3EFFK 3OAAG 4PA4A 1FXKA 3B77A 2A79B 1SRYA 1GM9A 2ZR3A 5LHGA 1UJWB 3SPCA 1R6KA 1H8EG 1K34A 3K08A 3CMAV 3AG1B 4UV8A 3ZMTA 4RQEA 3RVYA 2ZR2A 3OW2U 2P6JA 3E89A 4U7OA 4DO2A 2DYRC 4GX5A 3FB5C 2NLJC 5IY5C 1YSCA 3E83A 4WFHA 3RVZA 4N23A 1YJ9V 1AI4A 2DYSC 3W7UA 3UM7A 3K0GA 4MTFA 1NVPD 3NXSA 4FJCC 2IU0A 5IYDO 3SPIA 1NH2D 4EKWA 3F7VC 1FXKC 4LCUC 2QKSA 2XAFA 3FKSG 2EILC 3A0RA 5E1AC 4MVUA 1AJNA 4CBCA 5KA6A 3PJSK 3K0DA 5IDJA 2IW5A 2EIJC 2HVJC 3CCLV 2IU3A 4P9OA 3SYOA 5LGUA 4GCZA 1M56B 3OUSA 1AI7A 1OCOC 1NVPB 3CD6V 4I9WA 3AG2C 4G27B 1OZ0A 3OR7C 1K4DC 1QLEB 4WFAV 3DTUB 3IGAC 3MHSC 4X8AA 1NH2B 2C2AA 5KUMA 3BEHA 5L3GA 1QR9A 1K7DA 3KG2A 3P30A 3LDEA 4H37A 4UVCA 3IFXA 4JYCA 5L3BA 3ETDA 2XAJA 1EFRG 2WLHA 3CCSV 1CEZA 4PA7A 5H6RA 4GX2A 1DF4A 1L1FA 3E8BA 4BIUA 4P9PA 4QNHB 1PD3A 1K73W 1G4YB 1MABG 4I5SA 1JCHA 3E8HA 2WWWA 4FMTA 4BIZA 3SYCA 4KUMA 1E1RG 1VQ8V 3OMAB 1EZJA 2XAGA 3SJQC 3X2QC 3MD0A 1OCCB 5CBFA 3ZN0A 4QPJA 1AI5A 2ZXWC 3ABKC 1QVGU 1XL4A 1SZTA 3K03A 2JEXA 4MVMA 3JD0A 2EINB 4QE9A 3K04A 1W2BU 1R6NA 2WLLB 2Y69C 2YSUB 4HZ3A 5L3CA 4QJFB 2M7WA 1JOYA 2LP7A 3SPGA 5EC2C 1M9NA 1E1QG 1AJQA 1RPOA 4L87A 3CMEV 4JAUA 2DYRB 5H9CA 5IY5B 2XNDG 1YJWV 2P7TC 2X6AA 4XBFA 2DYSB 2WLJA 1H38A 1KKDA 1ORQC 2HKOA 4WF9V 2X6CA 2EZOA 2KB1A 5EBWC 1YHQV 5B3SC 3ZMUA 2BOBC 3K79A 2DQ3A 3CCQV 1H8HG 3CYOA 1FXKB 5EBLC 2XAQA 3VBBA 3ABUA 3LUTB 2EILB 4KFMA 4MTXA 5L3DA 1JQ0A 1OCRC 4R8CA 4U7NA 1PNMA 2EIJB 5LHHA 3OM3B 2JEUA 3OMNB 4PDRA 5GW7A 1OCOB 1QBZA 2Q6AA 3AG2B 5CA3A 4WCEV 5LGNA 4RUFA 4JTCB 2WPDG 2HJFC 2Q68A 2ZD9A 3OEHG 5IYCO 5J9PC 3OR6C 4MSWC 2IJKA 1VQ5V 2B5UA 1YI2V 1N8RW 2R9RB 4FK5C 2D3OW 2IJIA 1VQNV 4MS2A 2BOCC 1Y4MA 1PNLA 1BHAA 2XAHA 3WG7C 5CBHA 1YIJV 3SYQA 1ENVA 1BL8A 4BW5A 2ATKC 2F43G 2ITDC 3I55V 2HLDG 3VOUA 4MW8A 1COWG 4MVRA 2EIMC 1CP9A 2YEVB 3X2QB 4CZZA 3ZRWB 4MVZA 3AG3C 5B1OA 1I5YA 3MHHC 2ZXWB 2X0LA 3ABKB 4GX0A 1JPXA 4RAIA 2H8PC 4PDMA 3T1CA 2GSMB 1BMFG 5EC1C 2Y69B 3M99B 4R6ZA 1R3IC 3HPLC 2DQ0A 4FPPA 1MG1A 4E2LA 1GM7A 1P4RA 4RUEA 1R3JC 2IH1C 2HFEC 4JTDB 3D36A 2OT5A 4XDJA 1G8MA 2X6BA 3JD3A 1K8AW 1H2GA 1QVFU 3OUFA 2WLIA 4UXNA 1WLEA 4Q20A 1NKDA 4MW3A 3TCUA 4J9ZB 3LNMB 5B3SB 1RM1C 4JTAB 1WPXA 3RBZA 4QIWF 1Y66A 2W6IG 1VQPV 2EBOA 2XOKG 3T2MA 1S72V 1OCRB 2W0FC 2JJ1G 1FS0G 2UXNA 4HYOA 3CC7V 3B8NA 3CCEV 2EJRA 5LHIA 4UVBA 5KUKA 3H01A 4PDLA 4MTOA 1GM8A 2JJ2G 2XASA 3CPWU 1GO3F 3R65A 4MVQA 3ZJZA 3DGEA 3CP1A 5B1NA 3JD4A 4JGSA 5IYBO 3ZRVA 4QE7A 3AEIA 3FB6C 2PI4A 3TK1A 5CMUA 5L3FA 1FFTB 5LBQA 4UV9A 5H6QA 5EK0A 3WG7B 5BZBA 1KQSU 3BY6A 3W7XA 1B6QA 2IH3C 4WFGA 1MOFA 3HB3B 3OE7G 2HG5C 2EIKC 4ASUG 2OCCC 2ITCC 1NBMG 2UXXA 4F4LA 1SERA 2EIMB 3STZC 3E2EA 1AROP 4KP4A 1JJ2U 3CC4V 4DXWA 2WLNA 3AG3B 3K3WA 5KA5A 3FYEB 5B1BC 3JD1A 3T4DA 4MVSA 1S0VA 2Q69A 1BHBA 2QTOA 1W0KG 1VQKV 5L3EA 5CN0A 4JPRA 3SYAA 2DW4A 1DLBA 4UUJC 1V55C 4J9YB 4TT3G 2QM7A 3SPJA 1PKXA 1Q86W 1GTOA 3ETEA 1XL6A 2P90A 3ABLC 4G2KA 4P2ZA 3T4ZA 3GWOA 1KD1W 2V1DA 4MVOA 1AJPA 3CC2V 1W0JG 4PDVA 3IC7A 2ZDIA 2JIZG 2DWEC 1S76D 2A0LA 1FXHA 1V54C 1RPRA 4UVAA 2QE7G 4WFEA 1TUEB 1AR1B 1P7BA 4R7CA 5FL7G 1KECA 2QM8A 1PNKA 2CK3G 4TSFG 1F23A 1RM1B 3FB8C 4N21A 1E79G 4X89A 4OXSA 1I5XA 2HVKC 5HFLA 3K06A 4YXWG 3JCZA 2WLMA 3G71V 1VQ6V 2MK3A 1M90W 3CCUV 4P30A 3ASOC 3G6EV 5CBGA 2Z3YA 4PA6A 1HWYA 2OTJV 4G28B 1CPYA 3LDDA 5B1AC 2ZDIC 4PA3A 1K33A 3ABMC 3WFVA 2WLIB 3E35A 3I56V 3LSQA 1K5QA 3QNEA 1M57C 3AG4C 1F4MA 1GK9A 3D3IA 1THZA 1QLNA 4XDLA 1S5HC 2JK5C 3ASNC 3ZMZA 1YTFD 4LBEC 2PI5A 1OCZC 2EIKB 2QA4V 1LNQA 2OCCB 2P67A 3FYIB 4JAVA 1YJNV 1DF5A 1PL0A 4PELA 4RO2A 1NR1A 2B1GA 2DWDC 3QO8A 1DTOA 3ZIAG 1VQLV 5B1BB 4GX1A 4HAMA 1EBOA 2K1EA 3QO5A 3CCRV 2R9IA 3ZRSA 3W7SA 1QR8A 2YEVA 1FXVA 3ZRWA 3QO7A 4MT8A 1JX9A 2Z5UA 3GB7C 1V55B 4ZKIA 4WFFA 1M1KW 4R50A 1YTFB 2GHYA 1KP2A 1GKFA 3ABLB 3ABTA 4H33A 4RQFA 1ROPA 1JVMA 3AG1C 1Q82W 3UKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R9R B;  5E1A C;  4MVS A;  4MVU A;  2Q69 A;  4CBC A;  3PJS K;  2QTO A;  3K0D A;  4MS2 A;  2BOC C;  1R3K C;  2AHY A;  2EIJ C;  2HVJ C;  3F7Y C;  4TWK A;  3WG7 C;  4P9O A;  3SYA A;  4UUJ C;  3SYQ A;  5CBH A;  3SYO A;  1BL8 A;  1V55 C;  4PA9 A;  4BW5 A;  2ATK C;  3OUS A;  2ITD C;  4J9Y B;  1OCO C;  3SPJ A;  4I9W A;  3AG2 C;  4G27 B;  1XL6 A;  2Q67 A;  3OR7 C;  3ABL C;  1K4D C;  4P2Z A;  4MW8 A;  1K4C C;  3T4Z A;  3VOU A;  3IGA C;  4X8A A;  4X88 A;  4MVR A;  2EIM C;  3RW0 A;  4MVO A;  3BEH A;  5KUM A;  4MVZ A;  3AG3 C;  4PDV A;  3KG2 A;  1ZWI C;  4XDK A;  3LDE A;  4H37 A;  3IFX A;  2DWE C;  2A0L A;  4GX0 A;  3STL C;  4RAI A;  3SYP A;  1V54 C;  2WLH A;  2H8P C;  4MTG A;  3OGC C;  4PDM A;  4PA7 A;  4WFE A;  3T1C A;  4GX2 A;  5EC1 C;  1P7B A;  4R7C A;  1J95 A;  3E8B A;  3LDC A;  3E86 A;  3FB7 C;  4P9P A;  4QNH B;  4R6Z A;  1R3I C;  3HPL C;  3FB8 C;  1G4Y B;  4X89 A;  1M56 C;  3E8H A;  4OXS A;  2HVK C;  3K06 A;  3SYC A;  4RUE A;  1R3J C;  2A9H A;  2IH1 C;  1QLE C;  2HFE C;  4JTD B;  4ZBM A;  2WLM A;  3SJQ C;  3X2Q C;  5CBF A;  4XDJ A;  3F5W C;  3TET A;  2X6B A;  4P30 A;  3ASO C;  2ZXW C;  5CBG A;  3ABK C;  2WLL A;  1R3L C;  1XL4 A;  4PA6 A;  3OUF A;  2WLI A;  3K03 A;  3LDD A;  4G28 B;  4MVM A;  5B1A C;  4QE9 A;  3K04 A;  4PA3 A;  3ABM C;  2WLL B;  2Y69 C;  4MW3 A;  4J9Z B;  3TCU A;  4HZ3 A;  2WLI B;  3LNM B;  4JTA B;  5EBM C;  3E8G A;  1M57 C;  3RBZ A;  3AG4 C;  3SPH A;  3SPG A;  2WLK A;  5EC2 C;  4XDL A;  2AHZ A;  3JYC A;  1OCC C;  3T2M A;  2W0F C;  1S5H C;  2JK5 C;  4HYO A;  2P7T C;  2X6A A;  3ASN C;  5KUK A;  3E8F A;  2WLJ A;  1KKD A;  1ORQ C;  2EIN C;  4LBE C;  2X6C A;  4LP8 A;  1OCZ C;  2KB1 A;  4PDL A;  5EBW C;  1LNQ A;  3EFF K;  4PA4 A;  5B3S C;  4MTO A;  2BOB C;  2A79 B;  4RO2 A;  3SPC A;  3K08 A;  2DWD C;  3R65 A;  4MVQ A;  3ZJZ A;  5EBL C;  4GX1 A;  3LUT B;  2K1E A;  4KFM A;  4QE7 A;  3RVY A;  1OCR C;  3FB6 C;  4R8C A;  3E89 A;  3ZRS A;  2DYR C;  4GX5 A;  2YEV A;  3FB5 C;  2NLJ C;  5IY5 C;  4PDR A;  3E83 A;  5EK0 A;  4WFH A;  3RVZ A;  5BZB A;  2DYS C;  3GB7 C;  3UM7 A;  4WFF A;  2IH3 C;  3K0G A;  4MTF A;  4R50 A;  4WFG A;  2Q6A A;  2HG5 C;  2EIK C;  2OCC C;  2ITC C;  4RUF A;  4JTC B;  3SPI A;  4F4L A;  2HJF C;  2Q68 A;  4H33 A;  3STZ C;  2ZD9 A;  4DXW A;  4EKW A;  2WLN A;  3F7V C;  5J9P C;  1JVM A;  3OR6 C;  3AG1 C;  4MSW C;  4LCU C;  2QKS A;  5B1B C;  3T4D A;  3UKM A;  2EIL C; 
#chains in the Genus database with same CATH topology
 5LA6 A;  5IYZ A;  3CCV V;  1R3K C;  2AHY A;  4X62 B;  1AIL A;  4HNA B;  3ML0 A;  1SQF A;  3ZCC A;  1TVK B;  2CE4 A;  4X88 A;  5DN6 G;  4UCO A;  2RNB A;  3QG5 A;  3CCJ V;  1AP6 A;  5AG2 A;  2CUG A;  1QCE A;  1K92 A;  2BTQ A;  1VF6 C;  3SYP A;  4Z2W A;  2JS3 A;  4MTG A;  5DM6 V;  1YZB A;  4F6R A;  4JI4 B;  5K1P A;  3E86 A;  2E76 B;  4DV6 B;  3RYC B;  1XRE A;  1XNR O;  2W6J G;  1SES A;  2A9H A;  1MSW D;  4X20 A;  3ZMS A;  1VMG A;  1F4N A;  2QWN B;  3F5W C;  3RYH B;  4TOI A;  3G4S V;  3T1Y O;  2FTK A;  3ASN B;  3P32 A;  3WB1 A;  4DR1 O;  1L8D A;  1K5S A;  2LFR A;  4LC1 A;  3LSS A;  1URF A;  3SPH A;  1MZF A;  5C93 A;  2WLK A;  4Z1M G;  3OMI B;  3CXC U;  1K9M W;  2HEP A;  1SET A;  3ZED A;  2UU9 O;  4QPK A;  1IZ3 A;  1MA1 A;  1XIL A;  3JSL A;  1UPG A;  1EM1 A;  1KB9 F;  5LHG A;  1UJW B;  3SPC A;  1R6K A;  1K34 A;  1Q43 A;  2O57 A;  1L0L H;  3AG1 B;  3ZMT A;  1XMO O;  1Z5W A;  3FB5 C;  4ZIB A;  1YSC A;  4TQF A;  4K35 A;  4GUN A;  1AVM A;  1SQV H;  2ZKO A;  3SDL A;  1NU1 H;  4EKW A;  3F7V C;  5TIS Z;  2QKS A;  3FKS G;  2EIL C;  3MAQ A;  3A0R A;  2CDY A;  5IDJ A;  4O4J A;  1BE3 H;  2IW5 A;  5LA6 B;  4P9O A;  3C3T A;  2HHH O;  1UFI A;  1NVP B;  1U96 A;  4I9W A;  1OZ0 A;  1K4D C;  4H44 B;  2Y4T A;  4GYC B;  3IGA C;  3MHS C;  2C2A A;  1QR9 A;  3DXR B;  3B09 A;  4UVC A;  2YDE A;  5FLX N;  2XAJ A;  2XUM A;  2R9A A;  1L1F A;  4D6T H;  4LFA O;  5LXT A;  3E22 A;  4LF8 O;  1PD3 A;  3QVN A;  1MZE A;  4BIZ A;  4F6R B;  2DJV A;  1BGY H;  5LP6 C;  4FMT A;  3SYC A;  2DOS A;  2IBZ H;  4KUM A;  3OMA B;  3X2Q C;  1OCC B;  4K8X A;  3ZN0 A;  4AHC A;  1L0N H;  1QVG U;  4X20 B;  3K03 A;  1JFF A;  2JEX A;  2JGD A;  2EIN B;  3K04 A;  2Y69 C;  2YSU B;  3CRA A;  4QJF B;  1BQZ A;  4BWA A;  3SPG A;  1E1Q G;  4X66 B;  4YJ2 B;  2CH7 A;  2DYR B;  1P49 A;  5IY5 B;  1YJW V;  2YI8 A;  4DV2 O;  2MW2 B;  1ORQ C;  3UQ8 A;  4DV3 O;  2EZO A;  4FLX A;  1ZTE A;  2DQ3 A;  1HNX B;  5FPR A;  4B3M O;  3CS5 A;  3CJH A;  2UUC B;  1PNM A;  2EIJ B;  4NTY A;  3OM3 B;  3OMN B;  3OGI B;  4KXR A;  5D5P A;  2YIB A;  2UXC B;  3AG2 B;  4I4T A;  5CA3 A;  1HNZ B;  5D5Q A;  2FYU H;  2WPD G;  3K58 A;  2ZD9 A;  3RGB A;  1VQ5 V;  1FFX A;  2D3O W;  1SQX H;  4JI1 B;  2IJI A;  1VQN V;  2XTA A;  4MS2 A;  1PNL A;  2RN9 A;  2Q0A A;  2XAH A;  3WU2 Z;  5CBH A;  3SYQ A;  1ENV A;  2ZIM A;  1BL8 A;  3LNN A;  4O4J B;  4ZHQ A;  4B3R O;  1SA0 B;  1KMI Z;  5ITZ A;  5C8Y A;  4CZZ A;  3BHP A;  3FAV A;  1Z2G A;  4FLW A;  2LQT A;  5B1O A;  1GN2 A;  1I5Y A;  2ZXW B;  3ABK B;  4RAI A;  2VWJ A;  1XQ8 A;  4R6Z A;  3HPL C;  3K57 A;  4FPP A;  4I7Z B;  4K3A A;  1MG1 A;  1GM7 A;  5LXT B;  3E22 B;  1R3J C;  2IH1 C;  4GZR B;  2OT5 A;  3D3Q A;  3JSN A;  3HKC A;  1G8M A;  4JI0 B;  1I0H A;  3CB2 A;  4JZ2 A;  3OUF A;  4LFC B;  2QR4 A;  4DK0 A;  1NKD A;  4J9Z B;  3VQY A;  3LNM B;  5B3S B;  1HNW B;  4ABM A;  2L6L A;  4Z1V A;  4F6E A;  3RFR A;  4AIL C;  2W0F C;  3RYI A;  3CCE V;  4X62 O;  4FZ0 A;  4JI3 O;  1IXB A;  3H01 A;  2CH7 B;  4LF7 B;  3U11 A;  4PDL A;  2JJ2 G;  3QTC A;  1GO3 F;  5B1N A;  2YXY A;  3BCC H;  4JV5 O;  2Z0A A;  3AEI A;  3FB6 C;  1OJH A;  5LBQ A;  4UV9 A;  1KBH A;  2G38 A;  4JI4 O;  4PJ0 Z;  1KQS U;  3BY6 A;  3W7X A;  4DV6 O;  3CJH B;  4W4K A;  3HB3 B;  2EIK C;  3JAS A;  1NBM G;  4CS4 A;  1QNM A;  2UXX A;  3SJA C;  3E2E A;  4KP4 A;  3A8T A;  4TV9 A;  4DXW A;  2KKW A;  3JD1 A;  4B3S B;  4FLZ A;  1VQK V;  1N36 B;  5IJ9 B;  1FFX B;  2DW4 A;  1XEQ A;  3T1Y B;  3F5T A;  1Q86 W;  2QM7 A;  3BPZ A;  3C3S A;  3ZHS A;  2P90 A;  4G2K A;  2V1D A;  1AJP A;  5ITZ B;  4PDV A;  1I94 B;  2N74 A;  2ZDI A;  2QDO A;  1FXH A;  2QE7 G;  2DN9 A;  1P7B A;  4DR3 B;  2CK3 G;  1F23 A;  2F4V B;  4N21 A;  4U3J A;  4OXS A;  1I5X A;  4J80 A;  3ZX6 A;  3TXS A;  5LYJ B;  3CCU V;  4D7T A;  3RYF B;  5CBG A;  5K1X A;  4UCS A;  3HKC B;  1VP7 A;  4AQY O;  2E3C A;  3EXA A;  1KU9 A;  2A3Q A;  1XMO B;  4D7S A;  3E35 A;  5KHH A;  4TV8 A;  4LF5 B;  3G67 A;  1GK9 A;  2KG7 A;  2QTS A;  1XMQ B;  1QLN A;  4I50 A;  4DUZ O;  1FKA O;  1S5H C;  4LNU A;  3ASN C;  1JA8 A;  3RYI B;  2OCC B;  4YY3 B;  4PEL A;  2OYQ A;  1Q6H A;  2ZIO A;  3VQX A;  2QKC A;  2CAZ C;  4LFB O;  1EBO A;  1YDX A;  3QO5 A;  2AW9 A;  3ZRS A;  4IIJ A;  3QO7 A;  1AP5 A;  1JX9 A;  1Y76 A;  4ZKI A;  4R50 A;  5H5N A;  1YTF B;  3BFR A;  2GHY A;  1KP2 A;  5DED A;  3ABL B;  1XI1 A;  1V9P A;  4LFA B;  1BS3 A;  3AK1 A;  4I9Q A;  1ROP A;  4BIO A;  3JAS B;  4GKK B;  3AG1 C;  1AR5 A;  3FFQ A;  3ZHR A;  4X1Y B;  1DGS A;  1N33 B;  4TWK A;  4GLX A;  2WAM A;  1RSO A;  2B9Z A;  4PA9 A;  1NQT A;  5KHJ A;  2KQX A;  3K5M A;  4O4H B;  3RT3 C;  2UUB O;  4GT1 A;  3W7T A;  4XDK A;  1YVW A;  3ASO B;  5BXZ A;  3STL C;  1US6 A;  3OGC C;  1WAZ A;  2VWK A;  4DV1 B;  1I08 A;  3FB7 C;  4DRX B;  1KC8 W;  2V7Q G;  3ZMV A;  2OTL V;  3AG4 B;  4ZBM A;  4DV3 B;  3A2F A;  3K9S A;  3OT7 A;  2N05 A;  1IDS A;  1HW7 A;  4FLU A;  4B3M B;  3ZHQ A;  2UUC O;  2WLL A;  3NR7 A;  3HKD B;  1PM9 A;  1IXM A;  4JF3 A;  1HNZ O;  5GTH Z;  1RP3 B;  3UT5 A;  1O9G A;  4TV8 B;  1WB8 A;  4X1K A;  3JYC A;  1OCC C;  1WN7 A;  3K9A A;  5JH7 B;  5J2U A;  3Q4H A;  4JI1 O;  2LFS A;  2IM9 A;  4DK1 A;  4FM0 A;  2Q0O C;  4DYL A;  2EIN C;  4I55 A;  1JJO A;  2YXH A;  1NJI W;  3QF7 A;  1NZ6 A;  1LUW A;  2ZR3 A;  4U3F H;  4B3R B;  3CMA V;  2RDC A;  4UV8 A;  1FAF A;  2ZR2 A;  4ZI7 A;  2DYR C;  3BAA A;  4GX5 A;  5IY5 C;  3E83 A;  4WFH A;  3RVZ A;  3UM7 A;  5EZY B;  1NVP D;  4IIJ B;  3NXS A;  5IYD O;  4A5U B;  4YJ3 B;  4DR2 O;  3APO A;  5EIB D;  3H1I H;  4LCU C;  2XAF A;  4JI0 O;  2JGU A;  4MVU A;  1AJN A;  3PJS K;  4LFC O;  2EIJ C;  3CCL V;  3FD9 A;  2IU3 A;  3SYO A;  5DEC A;  3CRQ A;  1M56 B;  3CD6 V;  1AI7 A;  1HNW O;  3ZBH A;  3AG2 C;  1RSO B;  1NH2 B;  1VF7 A;  2PTM A;  3HKB A;  5KUM A;  3IC9 A;  1K7D A;  3KG2 A;  4J7Z A;  4LF4 B;  4H37 A;  2W0X A;  4JI5 O;  1EFR G;  2WLH A;  1CEZ A;  2YXL A;  4LF7 O;  2YIC A;  3E8B A;  5KHI A;  1O9H A;  3JAT A;  4DW1 A;  4W4L A;  4J42 A;  4I5S A;  2YI9 A;  2QM4 A;  4JI3 B;  3RN4 A;  1E1R G;  1VQ8 V;  4DUY O;  5BMV A;  1EZJ A;  2XAG A;  4H13 B;  4NVP A;  3MD0 A;  5CBF A;  1KYO F;  2ZXW C;  3ABK C;  4DR4 O;  4MVM A;  1W2B U;  4ICG A;  1R6N A;  2ZE6 A;  4JV5 B;  2WLL B;  4HZ3 A;  5L3C A;  2M7W A;  2ZNI A;  1JOY A;  3CE2 A;  1ZL8 A;  4CH3 A;  4K8Z A;  1HDJ A;  1GH6 A;  1N32 B;  3UT5 B;  4L8J A;  1RPO A;  4B3S O;  2F66 C;  4JAU A;  1N36 O;  4XBF A;  2WLJ A;  1H38 A;  3N2G B;  2X6C A;  2KB1 A;  1VF5 B;  5CB4 A;  5B3S C;  3ZMU A;  2P4K A;  1H8H G;  4UFZ A;  1BT8 A;  2Q5Z A;  2ZE7 A;  3VBB A;  1I94 O;  5KHK A;  1JQ0 A;  2H3O A;  4B3T O;  5LHH A;  2A7W A;  2BSK A;  5GW7 A;  4DR3 O;  1BZK A;  3B40 A;  2F4V O;  2GBO A;  4WCE V;  4O4L A;  4FFB B;  2OCH A;  5IYC O;  5J9P C;  4MSW C;  3VQW A;  2R9R B;  4FK5 C;  1Y4M A;  2CTR A;  1LUV A;  4BW5 A;  2QSA A;  2AZ0 A;  2ITD C;  4LF5 O;  1SZX A;  2AXT Z;  1J5E B;  3K5L A;  4HBN A;  4MW8 A;  3G80 A;  5E79 Z;  4KHP B;  4AQY B;  2YEV B;  3ZRW B;  1XMQ O;  2VQF B;  1U97 A;  3HKB B;  2GUZ A;  5J2T A;  4PDM A;  1BCC H;  1BMF G;  3LSU A;  4DUZ B;  5IWA O;  3M99 B;  1D5N A;  3SJC C;  4YY3 O;  1MNG A;  2Q7H A;  4NYK A;  5IYZ B;  3JAT B;  1JMK C;  4XDJ A;  2X6B A;  5JCO A;  2WLI A;  4LFB B;  2RMK B;  1WLE A;  2Q4P A;  1WJZ A;  1F7Y A;  5KX5 A;  1WP7 A;  1D2D A;  1WPX A;  2BTQ B;  3RBZ A;  1Y66 A;  1VQP V;  4GKK O;  1IVS A;  1X4T A;  3R66 A;  2OWO A;  2Q73 A;  1OCR B;  4IYH A;  2UXN A;  5KMG A;  1N33 O;  5LMN O;  3B8N A;  4UVB A;  5KUK A;  2EJ7 A;  4JI6 B;  2ZM6 B;  1VF6 A;  5CA0 A;  4MTO A;  1PV0 A;  2YIB D;  3CRC A;  5FNV A;  1GM8 A;  3CPW U;  1AR4 A;  3R65 A;  4NXM B;  2JRI A;  3CXH F;  4JGS A;  1DK1 A;  4NB5 A;  3KCY A;  2PI4 A;  5L3F A;  1FFT B;  2E74 B;  4DR5 B;  2UUB B;  4OX9 B;  4DV1 O;  5BZB A;  4WFG A;  1MOF A;  2BSK B;  4ASU G;  2Y0I A;  2OCC C;  2ADQ B;  4F4L A;  1KKC A;  1XDC A;  1ARO P;  4O4L B;  5KA5 A;  3FYE B;  3T4D A;  1S0V A;  1BHB A;  2QTO A;  1W0K G;  1Y6X A;  1DLB A;  3N2K A;  4TT3 G;  5GON A;  1PKX A;  1XL6 A;  4FLT A;  3ABL C;  3T4Z A;  5FPO A;  4FM1 A;  5IJ0 A;  1W0J G;  3IC7 A;  2E5L B;  2JIZ G;  2DWE C;  1KUQ A;  4WFE A;  2PF4 E;  2P06 A;  4R7C A;  2QM8 A;  5J2T B;  3CRR A;  1H2M A;  1E79 G;  4X89 A;  2ILM A;  5JJJ B;  3K06 A;  2Q7G A;  4CS3 A;  2MK3 A;  1M90 W;  2ZNJ A;  3JAK A;  4O2B A;  3ASO C;  4PA6 A;  4UCT A;  4DV0 O;  2Y0P A;  2ZDI C;  1K33 A;  1YCI A;  4WBN A;  2FML A;  2WLI B;  3I56 V;  2NN4 A;  3D8C A;  4PV1 B;  2LGW A;  3GVM A;  3JAW A;  3LSQ A;  3P3P A;  3QNE A;  3AG4 C;  5KX5 B;  3BA9 A;  1THZ A;  3JAL A;  2JK5 C;  3ZHT A;  4DR2 B;  2OIG A;  2CTW A;  4DR7 O;  1YTF D;  4LBE C;  2EX3 A;  2QA4 V;  4JAV A;  4JAA A;  1YJN V;  4UB8 Z;  4X65 O;  5CA0 B;  3QO8 A;  1JFF B;  4OPH A;  2JGD B;  4LF4 O;  4X9Q A;  5LP6 A;  2K1E A;  5GTI Z;  3W7S A;  1FXV A;  1XUQ A;  4MT8 A;  1M1K W;  2A06 H;  1PP9 H;  4JI5 B;  3CEI A;  2Q8V A;  1GKF A;  3TGU H;  4ZOL A;  4RQF A;  3C90 A;  3L72 H;  1VIB A;  1V54 B;  4DUY B;  5EYP A;  1HR0 B;  1S3J A;  1GMG A;  2EZP A;  1VQ7 V;  4DR4 B;  2Q67 A;  4C7U A;  3EVK A;  1MSD A;  1GN4 A;  1NR7 A;  5LGT A;  5GON B;  1N32 O;  1Y74 A;  3ZN1 A;  2QEX V;  1ZWI C;  2HR3 A;  4LF6 B;  3JD2 A;  4I4T B;  4EFE A;  3K5N A;  2ZIN A;  3EHB B;  3OFN G;  2XT9 A;  3LDC A;  1BSM A;  5LOV A;  1ZAU A;  1M56 C;  1VQ9 V;  4DR6 O;  4JYB A;  5B66 Z;  2L35 A;  1EZV H;  3TET A;  2NNU A;  4ZHQ B;  4JI7 O;  1R73 A;  1R3L C;  2X7R B;  4O2B B;  5C8Y B;  2D2C B;  3W7W A;  1Q7Y W;  3FAV B;  1OCZ B;  3DSQ A;  4WFB V;  4B3T B;  4CH5 A;  1VQM V;  5EBM C;  3E8G A;  1PPJ H;  1HP8 A;  3A0H Z;  2QWR B;  2Y48 A;  1S77 D;  2PGG A;  1G6U A;  3B8M A;  2IJH A;  4CC6 A;  3E8F A;  3U0Z A;  4LP8 A;  4BAY A;  4PA4 A;  1FXK A;  3B77 A;  1J5E O;  1T5E A;  2A79 B;  1GM9 A;  4KHP O;  2VQF O;  1QU7 A;  5A9G A;  5LL6 Y;  2LW7 A;  4RQE A;  1NTK H;  4DO2 A;  4E4E A;  3SJB C;  2NLJ C;  1Q5O A;  4N23 A;  1AI4 A;  3W7U A;  1SQP H;  3APQ A;  2IU0 A;  2UXB B;  3SPI A;  1NH2 D;  5IWA B;  5E1A C;  2AZ2 A;  4IYI A;  1ZX3 A;  3JAR A;  2ARH A;  3K0D A;  4J10 A;  2JS5 A;  4IHJ A;  3U10 A;  2E75 B;  2QJ1 A;  5LGU A;  4GCZ A;  3OUS A;  4LWS A;  1QLE B;  4X8A A;  3UO3 A;  3BEH A;  2P22 C;  2Q9L A;  3P30 A;  3N27 A;  3IFX A;  1M4U A;  1Y74 B;  2PY5 A;  5H6R A;  4GX2 A;  1DF4 A;  2ZM6 O;  4JI6 O;  4BIU A;  4TV9 B;  1G4Y B;  1MAB G;  3CX5 F;  5LMN B;  2HP8 A;  4NXM O;  4FVM A;  1XHX A;  1Z5V A;  4DR5 O;  4OX9 O;  3L71 H;  5CA1 A;  4QE9 A;  1B06 A;  2UUA B;  3BAB A;  3BVO A;  2QKA A;  2RQ6 A;  1CXZ B;  5EC2 C;  1H2S B;  1AJQ A;  1XOU A;  2Q7E A;  4L87 A;  2M6Y A;  4UB6 Z;  4U3J B;  2XND G;  1SKV A;  2X6A A;  2DYS B;  5EIB C;  2HKO A;  2BCC H;  3MDS A;  3IAY A;  2BOB C;  3H1J H;  3K79 A;  3CYO A;  2CGO A;  2YS8 A;  1FXK B;  2XAQ A;  3ABU A;  2E5L O;  4MTX A;  1OCR C;  4U7N A;  2F95 B;  4PDR A;  2JEU A;  2KG7 B;  1OCO B;  1QBZ A;  2Q6A A;  4I50 B;  4JTC B;  1IBK O;  2HJF C;  2Q68 A;  4LNU B;  3UO2 A;  4TQD A;  3OR6 C;  3RYC A;  1N8R W;  2BOC C;  1YF2 A;  1ZUQ A;  4YHH O;  2ZE5 A;  3JAR B;  1YIJ V;  3RYH A;  1R1B A;  2F43 G;  4IHJ B;  4DV0 B;  3VOU A;  1COW G;  4MVR A;  1CP9 A;  3S3X A;  2ODM A;  4FM2 A;  4MVZ A;  1WA8 A;  1Y76 B;  1GAX A;  4LWS B;  3MHH C;  2X0L A;  1SQG A;  2H8P C;  3AK3 A;  1FD9 A;  2GSM B;  2PZS A;  5EC1 C;  1XNQ B;  1RFY A;  2AGA A;  4LH7 A;  1EN5 A;  1P4R A;  4DR7 B;  4RUE A;  4JTD B;  3D36 A;  5B5E Z;  2RCV A;  5KAI Z;  4X65 B;  1K8A W;  1QVF U;  1NTM H;  4UCV A;  4H0L B;  4UXN A;  4IL6 Z;  1Q90 D;  1H2L A;  3H1K H;  3TCU A;  3ETQ A;  4JTA B;  1YEW A;  2WA3 A;  1PL4 A;  1NI8 A;  4B08 A;  2XOK G;  3T2M A;  1S72 V;  2JJ1 G;  3PN1 A;  4BW9 A;  1HR0 O;  1TAE A;  4O4I A;  5JCO C;  3SGI A;  4MVQ A;  1NTZ H;  3ZJZ A;  3DGE A;  3CP1 A;  1WPB A;  2PYL A;  4QE7 A;  4LF6 O;  4FZ1 A;  1IUR A;  2DE0 X;  5CMU A;  1M5I A;  1N0N A;  3WG7 B;  3DXR A;  4X1K B;  4PHZ A;  5J2U B;  3Q4H B;  4NTX A;  1SER A;  2EIM B;  3STZ C;  1JJ2 U;  3CC4 V;  3AG3 B;  3K3W A;  4EB6 A;  5IE9 A;  3OD4 A;  4I55 B;  4DR6 B;  2Q69 A;  1B04 A;  5CN0 A;  4JPR A;  4NR1 A;  4UUJ C;  4JI7 B;  2VQE O;  4P2Z A;  4ZI7 B;  4JI8 O;  3GWO A;  1KD1 W;  1FYJ A;  1EN6 A;  1S76 D;  1V54 C;  4UVA A;  1WA8 B;  1TUE B;  1KEC A;  5JQG A;  4YJ2 A;  1PNK A;  4TSF G;  1RM1 B;  1TGO A;  4EEQ A;  5HFL A;  4B7K A;  5JWP A;  3L70 H;  1TUB A;  4P30 A;  1D5A A;  1IBM O;  5JJE B;  2Z3Y A;  1HWY A;  5KLV H;  2OTJ V;  3J81 N;  2WA4 A;  4PA3 A;  3WFV A;  2UXB O;  3L9D A;  1WB7 A;  1GN3 A;  4J11 A;  4PI0 A;  1FPO A;  1GRJ A;  1NT2 B;  3TXQ A;  5BMV B;  2PI5 A;  3ZS8 C;  1OCZ C;  1H2K A;  1LNQ A;  4J7K A;  2P67 A;  3FYI B;  1PL0 A;  4O4I B;  4RO2 A;  2B1G A;  2DWD C;  2YIA A;  1DTO A;  2GV9 A;  1P7G A;  3ZIA G;  2FKX A;  5B1B B;  2FB5 A;  1SA0 A;  4HAM A;  3CCR V;  2Y4U A;  4YIP A;  1AB3 A;  1ZL8 B;  3GB7 C;  1V55 B;  4WFF A;  1QHT A;  3BRC A;  2ZE8 A;  1Q82 W;  3UKM A;  2GDS A;  1Q81 W;  3S3W A;  5CB4 B;  1G1X B;  4RWU A;  3WB0 A;  4EB6 B;  1AI6 A;  4UCR A;  2H94 A;  3F7Y C;  2UUA O;  3FX7 A;  5HFM A;  3T1H O;  3ETG A;  2NR5 A;  1K4C C;  2ETN A;  3BA8 A;  4OGQ B;  3RW0 A;  4JYY A;  3OEE G;  5F2V O;  1ZLZ A;  2GTS A;  4FIP C;  3THO A;  3CCM V;  2DMX A;  4JYA B;  2P4V A;  1F51 A;  3L75 H;  4B7E A;  2V4D A;  5B1A B;  1VQ4 V;  1J95 A;  3ABM B;  5BR8 O;  1K97 A;  3I5D A;  3B2E E;  1WNS A;  4TUY A;  5JQG B;  1M57 B;  1S5J A;  4BR6 A;  1QLE C;  3ICX A;  4Q6G A;  1XBL A;  1QQC A;  2N04 A;  4LF9 B;  1Y67 A;  4GKJ O;  2QGN A;  1ZSP A;  4CS2 A;  4J41 A;  3ZRX A;  1IBL O;  1TUB B;  2WSS G;  3OTO O;  2VS0 A;  1TA8 A;  3O65 A;  2ZQM A;  5LMU B;  2JDI G;  1OHH G;  2GUZ B;  1A32 A;  4NXN B;  2F23 A;  1KP3 A;  5KHG A;  1VEW A;  2AHZ A;  1YIT V;  2IJJ A;  4DV7 O;  1IBK B;  2K9P A;  4X64 O;  1VQO V;  2B1I A;  5KAF Z;  4JAS A;  1SS3 A;  2P5O A;  1K3E A;  3EFF K;  3OAA G;  1SRY A;  4YHH B;  3ZHV A;  5IJ9 A;  3K08 A;  1H8E G;  4DV4 B;  2QWQ B;  4J7J A;  3L73 H;  3OW2 U;  3RVY A;  2P6J A;  3E89 A;  1JR9 A;  4U7O A;  1GN6 A;  4DV5 O;  1XNQ O;  1YJ9 V;  2DYS C;  1Q6U A;  3K0G A;  4MTF A;  5JVD A;  4FJC C;  3HR0 A;  5KMG B;  3TJT A;  3UCS C;  4YIO A;  1FXK C;  3A0B Z;  1N0J A;  2UXD O;  4CBC A;  5KA6 A;  4JI2 O;  3HKE A;  5FNV B;  1N34 O;  1B3Q A;  2HVJ C;  5LYJ A;  3H1H H;  3K5O A;  4DW0 A;  3RYF A;  1OCO C;  1EN4 A;  4G27 B;  3OR7 C;  1R6T A;  1SC5 B;  4WFA V;  3DTU B;  2CGN A;  5L3G A;  1YXB A;  4K0K B;  3J80 N;  3LDE A;  2LO1 A;  4JYC A;  5L3B A;  1OV9 A;  3ETD A;  3CCS V;  2QWO B;  4PA7 A;  3KKY A;  1FJG B;  4P9P A;  4QNH B;  4FFK A;  1K73 W;  3AK2 A;  4CC5 A;  1JCH A;  3E8H A;  2WWW A;  3JCU Z;  2OIE A;  3H1L H;  4TUY B;  3SJQ C;  2YUA A;  2R72 A;  3N2K B;  4QPJ A;  1AI5 A;  4JZG A;  4CH4 A;  1XL4 A;  1SZT A;  3L74 H;  3AG7 A;  3JD0 A;  5IJ0 B;  3K59 A;  4NKG B;  1I7F A;  2LP7 A;  1H2N A;  4EFB A;  3CWB H;  1M9N A;  5H2F Z;  1SQB H;  3H9V A;  3CME V;  5H9C A;  2P7T C;  1KKD A;  4WF9 V;  1YHQ V;  1LR1 A;  5EBW C;  4X1Y A;  3JAK B;  1XNR B;  1SQQ H;  3CCQ V;  4LH6 A;  3JAM N;  5EBL C;  2VQE B;  3LUT B;  2EIL B;  4KFM A;  5L3D A;  4WBN B;  4R8C A;  4O4H A;  3JAW B;  4JI8 B;  3IJ4 A;  4DR1 B;  4FLV A;  3JAL B;  3ZHU A;  5LGN A;  4RUF A;  5JVD B;  4DRX A;  3OEH G;  1SF9 A;  2IJK A;  2B5U A;  1YI2 V;  2GTA A;  2PYJ A;  4PD4 F;  4X1I A;  1M93 A;  1BHA A;  1X59 A;  3WG7 C;  2UU9 B;  1N4C A;  2EUL A;  3OTF A;  1IBM B;  3HKE B;  2ATK C;  3I55 V;  5LP6 B;  5A2Q N;  3RWR D;  2HLD G;  3HKD A;  2EIM C;  3X2Q B;  3AG3 C;  4GX0 A;  1JPX A;  3T1C A;  2BE3 A;  2F93 B;  4ZOL B;  2Y69 B;  2CTQ A;  5JH7 A;  5JJN B;  1R3I C;  1VAR A;  2DQ0 A;  3G6B A;  4E2L A;  2HFE C;  4NTW A;  5EYP B;  3JD3 A;  1H2G A;  4Q20 A;  4PI2 A;  4MW3 A;  1RM1 C;  2HHH B;  2CTP A;  4QIW F;  2W6I G;  2PUS A;  5EZY A;  2EBO A;  4O2A A;  4LR3 A;  4I0X A;  5LOV B;  1FS0 G;  3D36 C;  4HYO A;  4IGG A;  3CC7 V;  4YJ3 A;  3J7A U;  2EJR A;  3SR2 C;  5LHI A;  3GWK C;  4LF8 B;  2ZCE A;  2R70 A;  2XAS A;  4UCU A;  2QWP B;  3T1H B;  2KSD A;  4JYA O;  3JD4 A;  2HJD A;  5IYB O;  1P84 F;  3ZRV A;  3B4S A;  3TK1 A;  5H6Q A;  5EK0 A;  2RJZ A;  1Q6I A;  1B6Q A;  2IH3 C;  2YC0 A;  1NS1 A;  4X66 O;  3OE7 G;  2HG5 C;  2ITC C;  4CH6 A;  5BR8 B;  4LF9 O;  2WLN A;  2LGQ A;  5B1B C;  4MVS A;  4HNA A;  1IX9 A;  3VQV A;  5L3E A;  1WP8 A;  1TVK A;  4DV2 B;  1HNX O;  3SYA A;  4GKJ B;  1V55 C;  3M7M X;  4X1I B;  4J9Y B;  3SPJ A;  1IBL B;  5LMU O;  1GTO A;  3ETE A;  3OTO B;  4NXN O;  4MVO A;  3CC2 V;  2VRZ A;  2A0L A;  2UXC O;  1RPR A;  3M8A A;  1AR1 B;  2BTO A;  5FL7 G;  3KCX A;  4DV7 B;  2ADP A;  4X64 B;  4IT5 A;  3FB8 C;  3WB2 A;  2HVK C;  4YXW G;  3JCZ A;  3N2G A;  2WLM A;  4DV4 O;  3G71 V;  1VQ6 V;  1MMM A;  4AI8 A;  1S5L Z;  4QGP A;  3G6E V;  5BY1 A;  4G28 B;  1CPY A;  3LDD A;  5B1A C;  3ABM C;  2XHB A;  4DV5 B;  2LJ2 A;  1Q3E A;  1BQ0 A;  1K5Q A;  1M57 C;  1F4M A;  3D3I A;  4KL1 A;  2F1M A;  3CHX A;  3CSX A;  4XDL A;  3DC5 A;  5IT9 N;  4FFB A;  4O2A B;  1Q8I A;  3ZMZ A;  4I0X B;  4FLY A;  2UXD B;  2YID A;  2EIK B;  3KZI Z;  4JI2 B;  1DF5 A;  2FL4 A;  1N34 B;  1NR1 A;  3DC6 A;  2ZT9 B;  1VQL V;  4K0K O;  5CA1 B;  4GX1 A;  3CRM A;  3P3N A;  2R9I A;  1QR8 A;  2YEV A;  1XHZ A;  2LW1 A;  3ZRW A;  1FJG O;  2Z5U A;  3O9O A;  4OPA A;  3ABT A;  4H33 A;  2JVD A;  1JVM A;  1W59 A; 
#chains in the Genus database with same CATH homology
 1Q81 W;  1V54 B;  3CCV V;  1AI6 A;  1R3K C;  2AHY A;  2H94 A;  3F7Y C;  4TWK A;  2WAM A;  1S3J A;  3ML0 A;  1GMG A;  4PA9 A;  2EZP A;  5HFM A;  1NQT A;  1VQ7 V;  3ETG A;  3ZCC A;  2Q67 A;  1K4C C;  4X88 A;  5DN6 G;  1NR7 A;  5LGT A;  3CCJ V;  3RW0 A;  3OEE G;  4GT1 A;  3ZN1 A;  4FIP C;  3W7T A;  3CCM V;  4XDK A;  2QEX V;  1ZWI C;  2HR3 A;  1QCE A;  3ASO B;  1F51 A;  1K92 A;  3STL C;  3SYP A;  3JD2 A;  4MTG A;  3OGC C;  5B1A B;  5DM6 V;  3EHB B;  1VQ4 V;  1J95 A;  3OFN G;  3ABM B;  3LDC A;  3E86 A;  3FB7 C;  1K97 A;  1KC8 W;  2V7Q G;  3ZMV A;  1M56 C;  2OTL V;  1M57 B;  2W6J G;  1VQ9 V;  3AG4 B;  1SES A;  2A9H A;  1QLE C;  4ZBM A;  4JYB A;  1MSW D;  3ZMS A;  1F4N A;  3F5W C;  3TET A;  2NNU A;  1R73 A;  3G4S V;  3ZRX A;  2WLL A;  1R3L C;  2FTK A;  3ASN B;  2WSS G;  2X7R B;  3P32 A;  3W7W A;  1IXM A;  1Q7Y W;  1OCZ B;  4JF3 A;  1K5S A;  2LFR A;  2ZQM A;  4WFB V;  1VQM V;  5EBM C;  3E8G A;  2JDI G;  4LC1 A;  3LSS A;  1OHH G;  3SPH A;  5C93 A;  2WLK A;  1KP3 A;  2Y48 A;  2AHZ A;  3JYC A;  1OCC C;  4Z1M G;  2IJJ A;  3K9A A;  1YIT V;  1S77 D;  1VQO V;  3OMI B;  2B1I A;  3CXC U;  3B8M A;  1K9M W;  2IJH A;  4JAS A;  2LFS A;  1SET A;  3E8F A;  4QPK A;  2EIN C;  4LP8 A;  4BAY A;  1NJI W;  1K3E A;  3EFF K;  3OAA G;  4PA4 A;  1FXK A;  3B77 A;  2A79 B;  1SRY A;  1GM9 A;  2ZR3 A;  5LHG A;  1UJW B;  3SPC A;  1R6K A;  1H8E G;  1K34 A;  3K08 A;  3CMA V;  3AG1 B;  4UV8 A;  3ZMT A;  4RQE A;  3RVY A;  2ZR2 A;  3OW2 U;  2P6J A;  3E89 A;  4U7O A;  4DO2 A;  2DYR C;  4GX5 A;  3FB5 C;  2NLJ C;  5IY5 C;  1YSC A;  3E83 A;  4WFH A;  3RVZ A;  4N23 A;  1YJ9 V;  1AI4 A;  2DYS C;  3W7U A;  3UM7 A;  3K0G A;  4MTF A;  1NVP D;  3NXS A;  4FJC C;  2IU0 A;  5IYD O;  3SPI A;  1NH2 D;  4EKW A;  3F7V C;  1FXK C;  4LCU C;  2QKS A;  2XAF A;  3FKS G;  2EIL C;  3A0R A;  5E1A C;  4MVU A;  1AJN A;  4CBC A;  5KA6 A;  3PJS K;  3K0D A;  5IDJ A;  2IW5 A;  2EIJ C;  2HVJ C;  3CCL V;  2IU3 A;  4P9O A;  3SYO A;  5LGU A;  4GCZ A;  1M56 B;  3OUS A;  1AI7 A;  1OCO C;  1NVP B;  3CD6 V;  4I9W A;  3AG2 C;  4G27 B;  1OZ0 A;  3OR7 C;  1K4D C;  1QLE B;  4WFA V;  3DTU B;  3IGA C;  3MHS C;  4X8A A;  1NH2 B;  2C2A A;  5KUM A;  3BEH A;  5L3G A;  1QR9 A;  1K7D A;  3KG2 A;  3P30 A;  3LDE A;  4H37 A;  4UVC A;  3IFX A;  4JYC A;  5L3B A;  3ETD A;  2XAJ A;  1EFR G;  2WLH A;  3CCS V;  1CEZ A;  4PA7 A;  5H6R A;  4GX2 A;  1DF4 A;  1L1F A;  3E8B A;  4BIU A;  4P9P A;  4QNH B;  1PD3 A;  1K73 W;  1G4Y B;  1MAB G;  4I5S A;  1JCH A;  3E8H A;  2WWW A;  4FMT A;  4BIZ A;  3SYC A;  4KUM A;  1E1R G;  1VQ8 V;  3OMA B;  1EZJ A;  2XAG A;  3SJQ C;  3X2Q C;  3MD0 A;  1OCC B;  5CBF A;  3ZN0 A;  4QPJ A;  1AI5 A;  2ZXW C;  3ABK C;  1QVG U;  1XL4 A;  1SZT A;  3K03 A;  2JEX A;  4MVM A;  3JD0 A;  2EIN B;  4QE9 A;  3K04 A;  1W2B U;  1R6N A;  2WLL B;  2Y69 C;  2YSU B;  4HZ3 A;  5L3C A;  4QJF B;  2M7W A;  1JOY A;  2LP7 A;  3SPG A;  5EC2 C;  1M9N A;  1E1Q G;  1AJQ A;  1RPO A;  4L87 A;  3CME V;  4JAU A;  2DYR B;  5H9C A;  5IY5 B;  2XND G;  1YJW V;  2P7T C;  2X6A A;  4XBF A;  2DYS B;  2WLJ A;  1H38 A;  1KKD A;  1ORQ C;  2HKO A;  4WF9 V;  2X6C A;  2EZO A;  2KB1 A;  5EBW C;  1YHQ V;  5B3S C;  3ZMU A;  2BOB C;  3K79 A;  2DQ3 A;  3CCQ V;  1H8H G;  3CYO A;  1FXK B;  5EBL C;  2XAQ A;  3VBB A;  3ABU A;  3LUT B;  2EIL B;  4KFM A;  4MTX A;  5L3D A;  1JQ0 A;  1OCR C;  4R8C A;  4U7N A;  1PNM A;  2EIJ B;  5LHH A;  3OM3 B;  2JEU A;  3OMN B;  4PDR A;  5GW7 A;  1OCO B;  1QBZ A;  2Q6A A;  3AG2 B;  5CA3 A;  4WCE V;  5LGN A;  4RUF A;  4JTC B;  2WPD G;  2HJF C;  2Q68 A;  2ZD9 A;  3OEH G;  5IYC O;  5J9P C;  3OR6 C;  4MSW C;  2IJK A;  1VQ5 V;  2B5U A;  1YI2 V;  1N8R W;  2R9R B;  4FK5 C;  2D3O W;  2IJI A;  1VQN V;  4MS2 A;  2BOC C;  1Y4M A;  1PNL A;  1BHA A;  2XAH A;  3WG7 C;  5CBH A;  1YIJ V;  3SYQ A;  1ENV A;  1BL8 A;  4BW5 A;  2ATK C;  2F43 G;  2ITD C;  3I55 V;  2HLD G;  3VOU A;  4MW8 A;  1COW G;  4MVR A;  2EIM C;  1CP9 A;  2YEV B;  3X2Q B;  4CZZ A;  3ZRW B;  4MVZ A;  3AG3 C;  5B1O A;  1I5Y A;  3MHH C;  2ZXW B;  2X0L A;  3ABK B;  4GX0 A;  1JPX A;  4RAI A;  2H8P C;  4PDM A;  3T1C A;  2GSM B;  1BMF G;  5EC1 C;  2Y69 B;  3M99 B;  4R6Z A;  1R3I C;  3HPL C;  2DQ0 A;  4FPP A;  1MG1 A;  4E2L A;  1GM7 A;  1P4R A;  4RUE A;  1R3J C;  2IH1 C;  2HFE C;  4JTD B;  3D36 A;  2OT5 A;  4XDJ A;  1G8M A;  2X6B A;  3JD3 A;  1K8A W;  1H2G A;  1QVF U;  3OUF A;  2WLI A;  4UXN A;  1WLE A;  4Q20 A;  1NKD A;  4MW3 A;  3TCU A;  4J9Z B;  3LNM B;  5B3S B;  1RM1 C;  4JTA B;  1WPX A;  3RBZ A;  4QIW F;  1Y66 A;  2W6I G;  1VQP V;  2EBO A;  2XOK G;  3T2M A;  1S72 V;  1OCR B;  2W0F C;  2JJ1 G;  1FS0 G;  2UXN A;  4HYO A;  3CC7 V;  3B8N A;  3CCE V;  2EJR A;  5LHI A;  4UVB A;  5KUK A;  3H01 A;  4PDL A;  4MTO A;  1GM8 A;  2JJ2 G;  2XAS A;  3CPW U;  1GO3 F;  3R65 A;  4MVQ A;  3ZJZ A;  3DGE A;  3CP1 A;  5B1N A;  3JD4 A;  4JGS A;  5IYB O;  3ZRV A;  4QE7 A;  3AEI A;  3FB6 C;  2PI4 A;  3TK1 A;  5CMU A;  5L3F A;  1FFT B;  5LBQ A;  4UV9 A;  5H6Q A;  5EK0 A;  3WG7 B;  5BZB A;  1KQS U;  3BY6 A;  3W7X A;  1B6Q A;  2IH3 C;  4WFG A;  1MOF A;  3HB3 B;  3OE7 G;  2HG5 C;  2EIK C;  4ASU G;  2OCC C;  2ITC C;  1NBM G;  2UXX A;  4F4L A;  1SER A;  2EIM B;  3STZ C;  3E2E A;  1ARO P;  4KP4 A;  1JJ2 U;  3CC4 V;  4DXW A;  2WLN A;  3AG3 B;  3K3W A;  5KA5 A;  3FYE B;  5B1B C;  3JD1 A;  3T4D A;  4MVS A;  1S0V A;  2Q69 A;  1BHB A;  2QTO A;  1W0K G;  1VQK V;  5L3E A;  5CN0 A;  4JPR A;  3SYA A;  2DW4 A;  1DLB A;  4UUJ C;  1V55 C;  4J9Y B;  4TT3 G;  2QM7 A;  3SPJ A;  1PKX A;  1Q86 W;  1GTO A;  3ETE A;  1XL6 A;  2P90 A;  3ABL C;  4G2K A;  4P2Z A;  3T4Z A;  3GWO A;  1KD1 W;  2V1D A;  4MVO A;  1AJP A;  3CC2 V;  1W0J G;  4PDV A;  3IC7 A;  2ZDI A;  2JIZ G;  2DWE C;  1S76 D;  2A0L A;  1FXH A;  1V54 C;  1RPR A;  4UVA A;  2QE7 G;  4WFE A;  1TUE B;  1AR1 B;  1P7B A;  4R7C A;  5FL7 G;  1KEC A;  2QM8 A;  1PNK A;  2CK3 G;  4TSF G;  1F23 A;  1RM1 B;  3FB8 C;  4N21 A;  1E79 G;  4X89 A;  4OXS A;  1I5X A;  2HVK C;  5HFL A;  3K06 A;  4YXW G;  3JCZ A;  2WLM A;  3G71 V;  1VQ6 V;  2MK3 A;  1M90 W;  3CCU V;  4P30 A;  3ASO C;  3G6E V;  5CBG A;  2Z3Y A;  4PA6 A;  1HWY A;  2OTJ V;  4G28 B;  1CPY A;  3LDD A;  5B1A C;  2ZDI C;  4PA3 A;  1K33 A;  3ABM C;  3WFV A;  2WLI B;  3E35 A;  3I56 V;  3LSQ A;  1K5Q A;  3QNE A;  1M57 C;  3AG4 C;  1F4M A;  1GK9 A;  3D3I A;  1THZ A;  1QLN A;  4XDL A;  1S5H C;  2JK5 C;  3ASN C;  3ZMZ A;  1YTF D;  4LBE C;  2PI5 A;  1OCZ C;  2EIK B;  2QA4 V;  1LNQ A;  2OCC B;  2P67 A;  3FYI B;  4JAV A;  1YJN V;  1DF5 A;  1PL0 A;  4PEL A;  4RO2 A;  1NR1 A;  2B1G A;  2DWD C;  3QO8 A;  1DTO A;  3ZIA G;  1VQL V;  5B1B B;  4GX1 A;  4HAM A;  1EBO A;  2K1E A;  3QO5 A;  3CCR V;  2R9I A;  3ZRS A;  3W7S A;  1QR8 A;  2YEV A;  1FXV A;  3ZRW A;  3QO7 A;  4MT8 A;  1JX9 A;  2Z5U A;  3GB7 C;  1V55 B;  4ZKI A;  4WFF A;  1M1K W;  4R50 A;  1YTF B;  2GHY A;  1KP2 A;  1GKF A;  3ABL B;  3ABT A;  4H33 A;  4RQF A;  1ROP A;  1JVM A;  3AG1 C;  1Q82 W;  3UKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...