1HR0O

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 30
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1hr0O00
4OPAA 2DJVA 1IBLO 5LL6Y 5BXZA 4DR4O 1N36O 3J7AU 4JI7O 5LMNO 4JI3O 2UXDO 1IBMO 3T1HO 4LF4O 4JI2O 4LF7O 1YZBA 2UUCO 4LFAO 1XNRO 2E5LO 1N34O 2F4VO 5BY1A 4KHPO 4DV0O 4DV2O 4DR6O 4JV5O 1NS1A 4DR2O 4NXMO 3SDLA 2FKXA 4GKJO 4LF9O 1R6TA 5A2QN 4DUZO 3F5TA 4DR3O 4DV3O 4DV1O 3J80N 1FYJA 4K0KO 3J81N 4DR1O 1F7YA 1XMOO 1HNXO 1J5EO 2UU9O 5IWAO 2VQFO 2AGAA 1HR0O 4DV7O 1XMQO 3R66A 4X66O 4YY3O 1DK1A 2VQEO 4A5UB 4GKKO 4LF8O 4JI4O 4OPHA 4DR5O 4DV4O 4NXNO 3RT3C 3M8AA 2DOSA 4DR7O 2LW7A 1XNQO 2N74A 4JI1O 2HHHO 1X59A 4LF6O 4YHHO 4X64O 4X62O 5LMUO 1AILA 1HNZO 4B3TO 2UXCO 1A32A 4B3RO 5BR8O 4LFBO 1N32O 4JI0O 1G1XB 1D2DA 4JYAO 4JI5O 1XEQA 1R1BA 2JRIA 2ZM6O 1KUQA 4X65O 1HNWO 4LF5O 2UXBO 4LFCO 4DV5O 1I94O 1AB3A 2UUAO 3O65A 4DV6O 5IT9N 5H5NA 2UUBO 4AQYO 1IBKO 4B3MO 2Z0AA 1FKAO 4OX9O 1FJGO 1N33O 3T1YO 3JAMN 5FLXN 4JI8O 4JI6O 3OTOO 4B3SO 2ZKOA 4DUYO
chains in the Genus database with same CATH superfamily
1JQ0A 2DYSB 1PL0A 1MSWD 4YIOA 3OGCC 4TT3G 1QR9A 1XHZA 2UUBB 4RAIA 4JI7O 3M7MX 3OTOB 3T1HO 5LP6A 1SS3A 2GUZB 2A79B 3W7TA 3HKDB 4DR6O 3P32A 1CXZB 1BL8A 4PA6A 2ADQB 3X2QC 3HKCB 2Y0IA 4GX5A 1VQ9V 2B1GA 3C3SA 2Q69A 2B1IA 3CC2V 1FYJA 1EFRG 5GONA 1SZTA 3SPGA 5H6RA 4J10A 2EZOA 2AGAA 1HR0O 4UCOA 1TUEB 4X66O 4YY3O 5KMGA 4BWAA 1JFFA 3S3WA 1HNZB 1VQMV 1RSOA 5EC2C 3IGAC 4XDJA 2M6YA 4MTOA 4Z1MG 4X88A 4U7NA 1ZL8A 2EZPA 3T4DA 1WPBA 5J2TA 5BR8O 4ZI7B 1N32O 2Q0AA 4JI0O 2MK3A 2UXBB 3E83A 4LFCB 4UV8A 1F51A 3W7XA 2RDCA 1WA8A 2EIJC 3ZMZA 1YHQV 3SYOA 4FFBB 1VF7A 2LP7A 1TGOA 5EYPB 2F1MA 2X7RB 4E4EA 1WLEA 2GV9A 3N27A 3WFVA 3SYAA 1GO3F 2JGUA 4P9OA 5J2UB 5B1BC 1R3KC 4ZOLA 1H2NA 4QIWF 3SR2C 3ABKB 4E2LA 4UVCA 1PV0A 1EN5A 3DC6A 4X1KA 1AI6A 1OCRC 3ABLC 3K58A 4RO2A 4MTGA 3DC5A 4DUYB 2LGQA 1EM1A 5KX5B 2WLMA 4NXMB 4TV9A 2HVKC 4JI7B 4CZZA 4GT1A 4GX0A 1H2SB 2DYSC 5KA6A 3EHBB 1R6TA 5A2QN 3T1HB 3F5WC 1VQOV 2ITCC 5LA6A 4NKGB 4I7ZB 1K33A 5CB4A 3MD0A 1SRYA 2HP8A 3GWKC 3ZRSA 4YHHB 2K1EA 4DXWA 3H1IH 2ZIOA 1JCHA 2HHHO 1AI5A 5KLVH 2RN9A 4PDRA 2JGDA 2ZE6A 4LCUC 1HR0B 3JATA 3VQWA 2QR4A 3FYEB 3AG2B 4YY3B 3ABUA 4KXRA 1FXHA 5IJ9B 4JYAO 4IIJA 3CRAA 3K79A 2HR3A 2NR5A 1KYOF 3CE2A 2ARHA 5H5NA 4LH7A 2DWEC 2Y0PA 5L3BA 3LSQA 1W59A 3K06A 3W7SA 5BR8B 4LP8A 1XBLA 1YJWV 1N32B 2KG7A 3T1YO 4X8AA 1JPXA 3HKEB 1M56B 3CRRA 4JI3B 4CS2A 1S72V 1BSMA 5LBQA 1IBMB 1GN2A 1BQ0A 1FXKA 4PJ0Z 1AR1B 4XBFA 2AHYA 3JALA 3KZIZ 1K9MW 4FM2A 2KQXA 1WP8A 1L0NH 1ORQC 4J7KA 2UUCO 5JCOC 2ZE5A 3ZRXA 1YDXA 2XAJA 3KCYA 3E22B 2ZD9A 3A0HZ 3UT5A 4DO2A 2WA3A 3OR6C 1FFXA 3APQA 4DV1O 3ZRWA 1DLBA 4FJCC 4ZKIA 2OTLV 3NR7A 2DQ0A 3P3PA 4WFAV 1TA8A 1R73A 2QKCA 2Q73A 3K03A 3B77A 1NZ6A 2H94A 2DYRC 1VQ7V 2R9AA 4I50B 3SYPA 3JARA 4X62O 1SESA 1JVMA 3K0DA 4TQDA 2QKSA 1K4CC 1TUBB 1UFIA 4O4HB 4JTCB 3QF7A 4K8ZA 2JRIA 5KHKA 4JTDB 3JSLA 2X6AA 4ZIBA 5JJNB 1VP7A 3LNNA 4I9QA 4MVZA 2YXHA 4N23A 2WSSG 4JYAB 4LNUA 5EZYB 3UO2A 3ASNB 2DJVA 4H44B 5EIBC 5B1OA 3AG2C 3MAQA 2QWPB 3IC7A 3L74H 3UQ8A 4PD4F 2OWOA 4L87A 2G38A 1FS0G 3SGIA 4U7OA 3T1YB 2PTMA 1S0VA 1I5YA 1US6A 2HEPA 3DXRB 3M99B 2GHYA 1L1FA 3E8BA 2Z3YA 5CMUA 4JV5B 1YSCA 1YEWA 1XILA 3WG7B 1M56C 3S3XA 3F7YC 5D5PA 2VS0A 1Q6UA 4IGGA 4GYCB 4CS4A 4QJFB 2YI8A 5LYJB 2ILMA 2ZNJA 1SQQH 4O4LA 3ZCCA 2OYQA 1O9GA 4TV9B 1EZJA 3CRMA 2WLLA 4FLWA 4GCZA 2XAFA 5GW7A 1Q5OA 2ZDIA 4TSFG 1Y66A 2A7WA 2CH7B 2P4VA 4A5UB 4O4IA 1GN4A 4NTYA 3GB7C 3ABMB 3M8AA 4H0LB 2LQTA 2DQ3A 5J9PC 1Z5VA 2V1DA 3RYFB 4L8JA 3UM7A 2QE7G 1AILA 1KECA 1SETA 3F7VC 1NTMH 3K5MA 1MNGA 2EILB 3C3TA 4OGQB 4B7KA 2D3OW 2VWJA 5TISZ 4ZHQB 2V7QG 2FB5A 4R50A 2X6BA 1SA0B 5IE9A 3CJHA 4LF5O 3EVKA 5KHJA 2IJJA 5IT9N 1GM7A 5E1AC 4I5SA 1SQBH 1SQGA 2EJRA 2VWKA 1FJGO 4LR3A 1GK9A 3G6EV 3JAMN 4JI8O 4UB8Z 2Q7GA 5IYCO 2W0FC 2QWRB 3JASA 4J7JA 1KKDA 1YF2A 1XL6A 1ROPA 3OMAB 1Q86W 5FL7G 3VQVA 4J41A 5IYZB 4FLZA 4BW5A 4O2AB 5CA1A 4DV0B 2YUAA 1NH2D 2JK5C 2AHZA 2IH1C 3FAVB 4FM1A 1FXKB 1GN3A 4QE7A 3ASNC 4PI0A 2XTAA 3BRCA 4MS2A 3B2EE 1CPYA 4FPPA 4IYIA 3JD3A 3F5TA 4O2BB 5H6QA 1K8AW 4O4JB 3J80N 2XHBA 5JWPA 5L3FA 2CAZC 1ZUQA 3JCUZ 1Z5WA 3ZIAG 3LSUA 3CCQV 3EXAA 1BMFG 4DW1A 3CCUV 1Y76A 1UPGA 4MVOA 4DR5O 2W0XA 3WG7C 2ZR2A 5H9CA 1NVPD 4DRXB 3U11A 1Q8IA 2IJIA 1AP5A 1HNZO 1WB8A 3L72H 5EBMC 1RPRA 4IHJA 4EEQA 1MZEA 3MHHC 1GRJA 1MG1A 3G80A 2JIZG 4DK1A 4TQFA 3L73H 2EIJB 2ATKC 4HZ3A 3ZX6A 2XAGA 2UXBO 5DN6G 5BMVA 4LFCO 3BPZA 4CH3A 4X20A 3ABMC 3CP1A 1FAFA 2QSAA 1N33O 1WPXA 1L8DA 2LW1A 3ZS8C 4YJ2A 1BZKA 1H8EG 2EILC 4NTXA 4LF5B 4FK5C 1B04A 4PDMA 3JAWA 2Q7EA 2BOCC 2RMKB 1N36O 1MMMA 3HKBA 4K8XA 3OMNB 3H01A 1YTFD 4JI2O 4YJ3B 2AXTZ 2ITDC 5LGNA 3LNMB 4JPRA 1X4TA 3QNEA 1G8MA 3H1KH 5C8YB 4NXMO 4LWSB 5B5EZ 2JEUA 2HFEC 4GKJO 1MABG 1Q81W 3PN1A 1XMOB 4BR6A 4I55A 4PHZA 1KU9A 2B5UA 3CXHF 3LDEA 2BSKA 3SPHA 3PJSK 5IWAO 1WN7A 2HLDG 1WB7A 5KHIA 2L6LA 3EFFK 1WAZA 2EULA 3OFNG 3AG3B 3G4SV 2ETNA 1CP9A 4EB6A 1FXKC 4P9PA 4BAYA 1N8RW 4NTWA 1GN6A 1E1QG 4MVSA 4YHHO 1V9PA 4J11A 3ZMVA 4DK0A 3LSSA 1NBMG 1VMGA 4X1IA 5IJ0B 3E86A 2IJHA 3RYHA 3DSQA 4C7UA 1N0JA 1NTKH 4DYLA 4DR5B 5LOVB 4I4TB 1IX9A 2GSMB 3ZHTA 4G28B 2DMXA 2QEXV 3JD1A 5EC1C 4FIPC 3ZJZA 2YEVA 1AJQA 4UVBA 5GTIZ 4CH4A 1BT8A 1F23A 4DUYO 3QG5A 1FKAO 3RYIB 4GUNA 2F95B 1URFA 3H9VA 2LFSA 1PNMA 2PZSA 1K3EA 3ZMTA 5L3CA 4MVUA 3CWBH 2BTQA 3T1CA 5LMNO 4JI3O 1N33B 3FB7C 1IBMO 3AG7A 2GDSA 3ZEDA 1TVKA 3CCVV 3AG1B 1JR9A 2R72A 5K1PA 4X1YB 4KHPO 1N36B 2QTSA 3G71V 1IXMA 2NN4A 2HKOA 4F6EA 1Q6IA 4U3JB 1KMIZ 1SKVA 2LFRA 1WNSA 5DECA 1K5SA 3OM3B 4JI2B 1W2BU 5CA0A 2VQFB 1Q43A 4Z2WA 1ZWIC 3JD2A 1HNXO 1QVFU 2JJ1G 1M5IA 1Y74A 3OMIB 3SPCA 1XMQO 3SJAC 4GKJB 3FB8C 3CXCU 4WFGA 2DYRB 4UVAA 4HYOA 4JI4O 2HJFC 5HFMA 1YIJV 3RYCA 2N74A 1YVWA 3SJCC 3Q4HA 1K73W 4B3RB 5D5QA 5IWAB 2QM7A 2WLJA 5JVDA 1EN4A 1R3IC 1NH2B 2CTRA 2E74B 1M93A 4BW9A 2PYLA 4HAMA 2WLIA 3N2GB 1GMGA 1K97A 5JH7A 1KP2A 4J9YB 5JJJB 4N21A 2AZ0A 3JAKB 3D8CA 3BHPA 2YXLA 4B08A 1XQ8A 1Q82W 4HNAB 2XASA 1DF5A 2Q6AA 2AW9A 3AG3C 3OUSA 4YIPA 5EBLC 3FB5C 1Q90D 3ZHUA 2A3QA 2BE3A 3AK3A 1JA8A 1B06A 2EX3A 2XOKG 2ZKOA 3CC4V 1Y4MA 3CCJV 2E3CA 2OTJV 1HW7A 1NKDA 1RP3B 3ETGA 2VRZA 3TGUH 4WBNA 2X0LA 4I0XB 1OHHG 3BA9A 3N2KA 2GTAA 3JCZA 1NVPB 1I7FA 1VARA 1ZSPA 3CC7V 2Q8VA 2YS8A 5CBHA 3A8TA 5L3DA 3JAWB 3QO5A 1VQPV 5JQGA 3OW2U 1R3JC 3SYCA 2F4VO 5BY1A 5DEDA 5KHHA 3AK2A 5LGUA 3HKBB 5LMNB 4JV5O 4KL1A 2ZINA 2YDEA 1NT2B 2H8PC 2CTQA 3ZMSA 1D5AA 3WB1A 4TUYB 4EKWA 5IY5B 2YI9A 2ZCEA 4QPJA 4DR1O 4KHPB 1NI8A 4Q20A 3ICXA 4JF3A 3WB2A 2UU9O 5E79Z 3AG1C 4LF8B 3GVMA 1IXBA 2W6JG 3P3NA 3E89A 1DK1A 5BZBA 4OPHA 3RT3C 1T5EA 2YC0A 2F23A 4F6RA 2LW7A 1KC8W 5LP6B 1EN6A 2P67A 3CYOA 1HNXB 3HR0A 3LDCA 1YTFB 3ZHSA 1XMQB 2QDOA 3RBZA 2CTWA 5ITZA 2P22C 3VQXA 4JI4B 1I94B 2PGGA 3CB2A 1XEQA 1R1BA 3APOA 1DTOA 2FL4A 1OJHA 4U3FH 2ZM6O 3OEHG 3ZHVA 3K04A 1AB3A 4DV6O 1VQ8V 4GZRB 5GONB 3OAAG 5GTHZ 2PI5A 2DWDC 5KAFZ 1N4CA 3K5LA 2RCVA 5KMGB 2BTOA 4KUMA 1JFFB 2YIBA 2MW2B 1RSOB 3OR7C 2ADPA 5LHIA 3OTFA 3ML0A 4TV8A 1W0JG 3J7AU 1QBZA 2FTKA 1ZL8B 2UXDO 3RVZA 4W4KA 1VF6C 1Y6XA 5J2TB 1VIBA 4AILC 3CCRV 5LXTA 4WFEA 3MDSA 1IURA 3CCEV 4H37A 1WA8B 4DV0O 1AP6A 2QTOA 4PDLA 4W4LA 1V55B 2IW5A 3L71H 1WP7A 2CUGA 3W7UA 2A0LA 2R70A 2OIGA 2F4VB 5FNVA 1J95A 1COWG 2WLHA 4JAVA 2Q4PA 4X9QA 4ZOLB 2KB1A 4DV7O 1RPOA 3WU2Z 3CX5F 4X1KB 4PA4A 3ABTA 1P84F 4Q6GA 4DV4O 3ZMUA 3CPWU 4DR1B 1QLNA 1Y74B 1K5QA 4LFBB 2UU9B 2RNBA 3FD9A 4MT8A 3C90A 1L0LH 4ABMA 5IY5C 4RUEA 2BOBC 1KQSU 2WA4A 1VQ5V 2UUAB 4JI5O 4NR1A 2WAMA 1YI2V 1PNLA 1PD3A 4BIUA 2GUZA 2Z5UA 2Y4TA 4MSWC 3HKDA 2CK3G 2UXNA 5LA6B 1G4YB 2WLIB 5L3EA 3HKCA 5CB4B 5LP6C 2DN9A 1U96A 1M1KW 1PL4A 4G27B 3B09A 4OPAA 2IJKA 2ZM6B 4K35A 2K9PA 4CBCA 4NYKA 5LL6Y 4DV6B 1QR8A 5H2FZ 3B8MA 2IBZH 2AZ2A 2JGDB 2EJ7A 2ZE8A 3ZN0A 2RQ6A 3IJ4A 3JATB 5B66Z 1N34B 1Z2GA 1E1RG 2ZQMA 2N05A 4LF7O 4IIJB 1XNRO 1N0NA 3A0BZ 1HDJA 5F2VO 3VBBA 4DR3B 4ZI7A 2UXDB 2F43G 2ZIMA 3ZHQA 4DUZO 2KG7B 2QA4V 5EBWC 2IU0A 4FFBA 2PY5A 1H38A 3RN4A 5EYPA 1XMOO 3A0RA 4UB6Z 4JGSA 2ZR3A 5JCOA 3R66A 4J9ZB 1LUVA 1XOUA 3SJBC 3STLC 1JOYA 3JALB 1AI4A 5J2UA 3ZN1A 4NXNO 2DOSA 4KP4A 1XNQO 1V55C 1BQZA 3ETEA 3OT7A 4B3TO 1I5XA 2UXCO 4DV7B 4JZGA 1BE3H 1G1XB 3UT5B 4NB5A 5KX5A 1OZ0A 4DV4B 3CEIA 4EFBA 1FFXB 4AQYB 3JD0A 3ZRWB 1YXBA 4OX9B 3O65A 2LO1A 3CRQA 2UXXA 2XAQA 3KKYA 1IBLB 3I5DA 4JI5B 4MVMA 4AHCA 1QCEA 3R65A 3B40A 4GX1A 5CBFA 5BXZA 4DR4O 2WLNA 2E75B 3JARB 2B9ZA 2EINB 2JJ2G 4BIOA 3BABA 5JJEB 1THZA 2E5LB 4FMTA 4LF4O 4IYHA 1JX9A 2CDYA 4LFAO 1I08A 4WFBV 1NU1H 5KAIZ 2QGNA 3K5OA 1JJ2U 1R3LC 1SQVH 4KFMA 1VQLV 2QM8A 1EBOA 2NLJC 3SDLA 1E79G 5IJ9A 1BHBA 1M57B 3SJQC 2OCCC 4LF7B 4LNUB 4UCVA 4FLXA 1XNRB 1K34A 1D5NA 4CS3A 3L70H 1F7YA 1NQTA 2ZT9B 2VQFO 1P7GA 2C2AA 4DUZB 3HKEA 2X6CA 1RFYA 4PA3A 3AG4C 3TK1A 1K4DC 1AROP 2E76B 4JAUA 4WCEV 4PI2A 4HBNA 1A32A 4B3RO 2YICA 5KUMA 3ZBHA 4NXNB 3H1HH 1JJOA 2YSUB 4PV1B 1XNQB 4O4LB 4X65O 1HNWO 1W0KG 4DV5O 4IT5A 2DE0X 4B3TB 2ZNIA 2WLLB 3E22A 2UXCB 3CCSV 3RGBA 3K57A 2PI4A 2QWOB 2WLKA 4O4IB 4FM0A 4YXWG 3E8FA 4EFEA 3THOA 5B3SB 2JVDA 3D36A 3UCSC 1NR1A 3FYIB 3T2MA 4TWKA 1GTOA 5HFLA 2P06A 1MSDA 3H1LH 1TAEA 2GTSA 4I50A 1M4UA 1FFTB 3CJHB 4DR4B 1P7BA 1ZX3A 5IDJA 2PYJA 1V54B 1GKFA 5C93A 1QVGU 2XT9A 2FKXA 5FPRA 1SF9A 5LHGA 1TUBA 4O4HA 4LF9O 4K0KB 5CBGA 4LF4B 2CGOA 5KHGA 1OCCB 2EINC 4LFAB 3JASB 4JYYA 4JYBA 3UO3A 1DF4A 1P49A 3KG2A 3K9AA 4DR7B 4FVMA 5EZYA 3TJTA 3I56V 1VEWA 3BFRA 4LF8O 3E35A 5CA1B 3D3QA 4PA9A 1FD9A 4I9WA 1GAXA 1M57C 4QGPA 1H2MA 4MW3A 3DXRA 2EIMC 3K08A 1GM9A 1QQCA 2O57A 2XNDG 3K5NA 1I94O 3LDDA 3LUTB 2XUMA 2HVJC 2JEXA 4BIZA 3ETQA 5LYJA 4B3MO 1KB9F 4RUFA 2WPDG 3IC9A 4FZ0A 4K3AA 1VQ4V 4RQFA 5FLXN 1Y76B 4GX2A 4X65B 1HNWB 2M7WA 4DV5B 3BVOA 4LH6A 1OCOB 3BA8A 1OCZB 3K3WA 4UCSA 2CE4A 2CH7A 4QNHB 4UCTA 3IAYA 3E2EA 4IHJB 2D2CB 3SPJA 3RW0A 3IFXA 2ZDIC 1AI7A 1YZBA 4UV9A 4DR6B 3RYFA 1YCIA 1GM8A 4CC6A 2KKWA 3D3IA 5BMVB 4PA7A 2QWNB 3WB0A 5AG2A 3L75H 1HWYA 3BEHA 4DV2O 1NTZH 4R8CA 1ZLZA 4X20B 4WFHA 3W7WA 1OV9A 4ZHQA 3T4ZA 1QHTA 1XUQA 5B3SC 3OUFA 2P90A 1B3QA 1SA0A 4R6ZA 1R6NA 2Y69B 3O9OA 4R7CA 4YJ2B 4H33A 3K0GA 4UXNA 3OGIB 4X66B 1J5EO 4LF9B 5B1AB 1V54C 2QM4A 1Y67A 3FKSG 2EBOA 3OD4A 3E8GA 4LF6O 1QLEB 1M9NA 3STZC 2V4DA 4JI0B 1AVMA 1P4RA 5IYZA 1OCCC 1BHAA 3G67A 4O2AA 4LFBO 1LR1A 4JTAB 1BS3A 5CN0A 2F93B 1RM1B 2YIAA 1Q7YW 4I55B 3FAVA 2UUAO 4FLTA 3SYQA 2PF4E 1IBKO 2BSKB 4JZ2A 2Z0AA 1VF5B 2YIBD 3B8NA 2R9IA 5L3GA 1FPOA 2H3OA 4O2BA 4B3SO 4XDLA 5KA5A 3QO8A 5LGTA 4O4JA 1VQKV 1EZVH 3QTCA 4EB6B 2XAHA 2HJDA 3JSNA 1IVSA 3VOUA 3TXQA 1QU7A 3MHSC 1CEZA 4B3MB 2A06H 3DGEA 3ABKC 2Q68A 3VQYA 4X1IB 1SQFA 1KP3A 3QO7A 3RYHB 4JAAA 2ODMA 3AEIA 2EIKB 4DRXA 2P6JA 4D7SA 1XI1A 1N34O 4ICGA 2Y48A 3TCUA 2YEVB 3P30A 1ZTEA 2Q0OC 3K9SA 1OCOC 3RFRA 1OCZC 4DR3O 2RJZA 3ASOB 2Q5ZA 3CHXA 4QPKA 1S5JA 4WF9V 4F4LA 1ENVA 3J81N 2YXYA 4DV2B 3FFQA 4RWUA 2BTQB 3A2FA 4MVQA 2VQEO 3BAAA 2HHHB 1U97A 1VQ6V 1K92A 1PM9A 1KD1W 1TVKB 2LGWA 4MTXA 4PELA 4UFZA 4JI1O 1J5EB 5LMUO 4X64O 1G6UA 2GBOA 2Y69C 3CSXA 1S5HC 1D2DA 4YJ3A 1XDCA 1JMKC 5CA0B 4LF6B 3U10A 5B1AC 5C8YA 4AQYO 4LWSA 3CRCA 3B4SA 5K1XA 4OX9O 1KBHA 2W6IG 1B6QA 2ZXWB 1QLEC 3ZRVA 1H2GA 4JI6O 2JS5A 1F4NA 4P2ZA 1O9HA 3OE7G 1SQXH 4CH6A 1IBLO 4NVPA 1XL4A 3RYCB 1H2LA 3CMEV 3Q4HB 1IBKB 3CS5A 5EK0A 5JVDB 1IDSA 1MZFA 1GH6A 1RM1C 3ETDA 2UUCB 4CH5A 1MA1A 4B3SB 2IU3A 5A9GA 2NNUA 2Q67A 1AJNA 5JH7B 1WJZA 2IH3C 2E5LO 3UKMA 4D7TA 3E8HA 2KSDA 3KCXA 5IJ0A 4TOIA 1NS1A 4DR2O 4FLYA 4H13B 4Z1VA 1PP9H 3CCLV 4DV1B 2OCCB 3CD6V 5LOVA 4I4TA 4JYCA 1MOFA 4LBEC 2P4KA 4DV3O 2JDIG 4J7ZA 4MVRA 3BCCH 4RQEA 4MTFA 4WBNB 4G2KA 1VQNV 2EIKC 3N2KB 3RYIA 2QJ1A 1XREA 4FLUA 1R6KA 3AG4B 4FFKA 1XHXA 4GKKO 1SZXA 2P7TC 1UJWB 4X62B 3D36C 1H8HG 3NXSA 4D6TH 5JQGB 3QVNA 2LJ2A 3ZHRA 3ASOC 4GLXA 5FPOA 2HG5C 1LNQA 2WWWA 3I55V 2FMLA 2VQEB 4X89A 5IYBO 1YITV 2Q7HA 4X1YA 2F66C 2N04A 1PKXA 4UUJC 4JI1B 1BCCH 1BGYH 5LMUB 4X64B 4AI8A 1KKCA 3RWRD 1SC5B 4P30A 3K59A 2UUBO 3H1JH 2OCHA 4U3JA 2IM9A 1S5LZ 3SPIA 1Q3EA 1NR7A 3OTOO 2YIDA 3HPLC 3RVYA 3X2QB 1NJIW 3AK1A 4F6RB 1YJNV 1Q6HA 2PUSA 4JASA 3G6BA 2ZE7A 1F4MA 1S3JA 3DTUB 5ITZB 5DM6V 4JI6B 3L9DA 3HB3B 3TETA 5EIBD 2CGNA 1FXVA 1YJ9V 1SERA 2Y4UA 2ZXWC 3OEEG 2Q9LA 4FLVA 1AR4A 1ZAUA 3U0ZA 3N2GA 3FX7A 2R9RB 3GWOA 1DGSA 3JAKA 2QKAA 2DW4A 5IYDO 1M90W 3JYCA 4ZBMA 2BCCH 4HNAA 1VF6A 4K0KO 5CA3A 1AR5A 4DR2B 1IZ3A 4TV8B 2JS3A 2QWQB 1SQPH 1PNKA 1S76D 3TXSA 5LHHA 1AJPA 4DV3B 4LC1A 2A9HA 4FZ1A 2CTPA 4ASUG 3FB6C 3CMAV 5LXTB 4DR7O 4UCRA 3CCMV 4CC5A 4I0XA 1X59A 4UCUA 4DW0A 2P5OA 4B7EA 2EIMB 5B1BB 4QE9A 1H2KA 3BY6A 4PDVA 4GKKB 1K7DA 4MW8A 1QNMA 4OXSA 4XDKA 5KUKA 1OCRB 3ABLB 1KUQA 1LUWA 2L35A 1FJGB 1I0HA 5FNVB 4JI8B 4J42A 2OT5A 2FYUH 1PPJH 1S77D 3JD4A 4J80A 2OIEA 4TUYA 4WFFA 1HP8A 4IL6Z 5B1NA
chains in the Genus database with same CATH topology
4OPAA 2DJVA 1IBLO 5LL6Y 5BXZA 4DR4O 1N36O 3J7AU 4JI7O 5LMNO 4JI3O 2UXDO 1IBMO 3T1HO 4LF4O 4JI2O 4LF7O 1YZBA 2UUCO 4LFAO 1XNRO 2E5LO 1N34O 2F4VO 5BY1A 4KHPO 4DV0O 4DV2O 4DR6O 4JV5O 1NS1A 4DR2O 4NXMO 3SDLA 2FKXA 4GKJO 4LF9O 1R6TA 5A2QN 4DUZO 3F5TA 4DR3O 4DV3O 4DV1O 3J80N 1FYJA 4K0KO 3J81N 4DR1O 1F7YA 1XMOO 1HNXO 1J5EO 2UU9O 5IWAO 2VQFO 2AGAA 1HR0O 4DV7O 1XMQO 3R66A 4X66O 4YY3O 1DK1A 2VQEO 4A5UB 4GKKO 4LF8O 4JI4O 4OPHA 4DR5O 4DV4O 4NXNO 3RT3C 3M8AA 2DOSA 4DR7O 2LW7A 1XNQO 2N74A 4JI1O 2HHHO 1X59A 4LF6O 4YHHO 4X64O 4X62O 5LMUO 1AILA 1HNZO 4B3TO 2UXCO 1A32A 4B3RO 5BR8O 4LFBO 1N32O 4JI0O 1G1XB 1D2DA 4JYAO 4JI5O 1XEQA 1R1BA 2JRIA 2ZM6O 1KUQA 4X65O 1HNWO 4LF5O 2UXBO 4LFCO 4DV5O 1I94O 1AB3A 2UUAO 3O65A 4DV6O 5IT9N 5H5NA 2UUBO 4AQYO 1IBKO 4B3MO 2Z0AA 1FKAO 4OX9O 1FJGO 1N33O 3T1YO 3JAMN 5FLXN 4JI8O 4JI6O 3OTOO 4B3SO 2ZKOA 4DUYO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OPA A;  2DJV A;  1IBL O;  5LL6 Y;  5BXZ A;  4DR4 O;  1N36 O;  3J7A U;  4JI7 O;  5LMN O;  4JI3 O;  2UXD O;  1IBM O;  3T1H O;  4LF4 O;  4JI2 O;  4LF7 O;  1YZB A;  2UUC O;  4LFA O;  1XNR O;  2E5L O;  1N34 O;  2F4V O;  5BY1 A;  4KHP O;  4DV0 O;  4DV2 O;  4DR6 O;  4JV5 O;  1NS1 A;  4DR2 O;  4NXM O;  3SDL A;  2FKX A;  4GKJ O;  4LF9 O;  1R6T A;  5A2Q N;  4DUZ O;  3F5T A;  4DR3 O;  4DV3 O;  4DV1 O;  3J80 N;  1FYJ A;  4K0K O;  3J81 N;  4DR1 O;  1F7Y A;  1XMO O;  1HNX O;  1J5E O;  2UU9 O;  5IWA O;  2VQF O;  2AGA A;  1HR0 O;  4DV7 O;  1XMQ O;  3R66 A;  4X66 O;  4YY3 O;  1DK1 A;  2VQE O;  4A5U B;  4GKK O;  4LF8 O;  4JI4 O;  4OPH A;  4DR5 O;  4DV4 O;  4NXN O;  3RT3 C;  3M8A A;  2DOS A;  4DR7 O;  2LW7 A;  1XNQ O;  2N74 A;  4JI1 O;  2HHH O;  1X59 A;  4LF6 O;  4YHH O;  4X64 O;  4X62 O;  5LMU O;  1AIL A;  1HNZ O;  4B3T O;  2UXC O;  1A32 A;  4B3R O;  5BR8 O;  4LFB O;  1N32 O;  4JI0 O;  1G1X B;  1D2D A;  4JYA O;  4JI5 O;  1XEQ A;  1R1B A;  2JRI A;  2ZM6 O;  1KUQ A;  4X65 O;  1HNW O;  4LF5 O;  2UXB O;  4LFC O;  4DV5 O;  1I94 O;  1AB3 A;  2UUA O;  3O65 A;  4DV6 O;  5IT9 N;  5H5N A;  2UUB O;  4AQY O;  1IBK O;  4B3M O;  2Z0A A;  1FKA O;  4OX9 O;  1FJG O;  1N33 O;  3T1Y O;  3JAM N;  5FLX N;  4JI8 O;  4JI6 O;  3OTO O;  4B3S O;  2ZKO A;  4DUY O; 
#chains in the Genus database with same CATH topology
 1JQ0 A;  2DYS B;  1PL0 A;  1MSW D;  4YIO A;  3OGC C;  4TT3 G;  1QR9 A;  1XHZ A;  2UUB B;  4RAI A;  4JI7 O;  3M7M X;  3OTO B;  3T1H O;  5LP6 A;  1SS3 A;  2GUZ B;  2A79 B;  3W7T A;  3HKD B;  4DR6 O;  3P32 A;  1CXZ B;  1BL8 A;  4PA6 A;  2ADQ B;  3X2Q C;  3HKC B;  2Y0I A;  4GX5 A;  1VQ9 V;  2B1G A;  3C3S A;  2Q69 A;  2B1I A;  3CC2 V;  1FYJ A;  1EFR G;  5GON A;  1SZT A;  3SPG A;  5H6R A;  4J10 A;  2EZO A;  2AGA A;  1HR0 O;  4UCO A;  1TUE B;  4X66 O;  4YY3 O;  5KMG A;  4BWA A;  1JFF A;  3S3W A;  1HNZ B;  1VQM V;  1RSO A;  5EC2 C;  3IGA C;  4XDJ A;  2M6Y A;  4MTO A;  4Z1M G;  4X88 A;  4U7N A;  1ZL8 A;  2EZP A;  3T4D A;  1WPB A;  5J2T A;  5BR8 O;  4ZI7 B;  1N32 O;  2Q0A A;  4JI0 O;  2MK3 A;  2UXB B;  3E83 A;  4LFC B;  4UV8 A;  1F51 A;  3W7X A;  2RDC A;  1WA8 A;  2EIJ C;  3ZMZ A;  1YHQ V;  3SYO A;  4FFB B;  1VF7 A;  2LP7 A;  1TGO A;  5EYP B;  2F1M A;  2X7R B;  4E4E A;  1WLE A;  2GV9 A;  3N27 A;  3WFV A;  3SYA A;  1GO3 F;  2JGU A;  4P9O A;  5J2U B;  5B1B C;  1R3K C;  4ZOL A;  1H2N A;  4QIW F;  3SR2 C;  3ABK B;  4E2L A;  4UVC A;  1PV0 A;  1EN5 A;  3DC6 A;  4X1K A;  1AI6 A;  1OCR C;  3ABL C;  3K58 A;  4RO2 A;  4MTG A;  3DC5 A;  4DUY B;  2LGQ A;  1EM1 A;  5KX5 B;  2WLM A;  4NXM B;  4TV9 A;  2HVK C;  4JI7 B;  4CZZ A;  4GT1 A;  4GX0 A;  1H2S B;  2DYS C;  5KA6 A;  3EHB B;  1R6T A;  5A2Q N;  3T1H B;  3F5W C;  1VQO V;  2ITC C;  5LA6 A;  4NKG B;  4I7Z B;  1K33 A;  5CB4 A;  3MD0 A;  1SRY A;  2HP8 A;  3GWK C;  3ZRS A;  4YHH B;  2K1E A;  4DXW A;  3H1I H;  2ZIO A;  1JCH A;  2HHH O;  1AI5 A;  5KLV H;  2RN9 A;  4PDR A;  2JGD A;  2ZE6 A;  4LCU C;  1HR0 B;  3JAT A;  3VQW A;  2QR4 A;  3FYE B;  3AG2 B;  4YY3 B;  3ABU A;  4KXR A;  1FXH A;  5IJ9 B;  4JYA O;  4IIJ A;  3CRA A;  3K79 A;  2HR3 A;  2NR5 A;  1KYO F;  3CE2 A;  2ARH A;  5H5N A;  4LH7 A;  2DWE C;  2Y0P A;  5L3B A;  3LSQ A;  1W59 A;  3K06 A;  3W7S A;  5BR8 B;  4LP8 A;  1XBL A;  1YJW V;  1N32 B;  2KG7 A;  3T1Y O;  4X8A A;  1JPX A;  3HKE B;  1M56 B;  3CRR A;  4JI3 B;  4CS2 A;  1S72 V;  1BSM A;  5LBQ A;  1IBM B;  1GN2 A;  1BQ0 A;  1FXK A;  4PJ0 Z;  1AR1 B;  4XBF A;  2AHY A;  3JAL A;  3KZI Z;  1K9M W;  4FM2 A;  2KQX A;  1WP8 A;  1L0N H;  1ORQ C;  4J7K A;  2UUC O;  5JCO C;  2ZE5 A;  3ZRX A;  1YDX A;  2XAJ A;  3KCY A;  3E22 B;  2ZD9 A;  3A0H Z;  3UT5 A;  4DO2 A;  2WA3 A;  3OR6 C;  1FFX A;  3APQ A;  4DV1 O;  3ZRW A;  1DLB A;  4FJC C;  4ZKI A;  2OTL V;  3NR7 A;  2DQ0 A;  3P3P A;  4WFA V;  1TA8 A;  1R73 A;  2QKC A;  2Q73 A;  3K03 A;  3B77 A;  1NZ6 A;  2H94 A;  2DYR C;  1VQ7 V;  2R9A A;  4I50 B;  3SYP A;  3JAR A;  4X62 O;  1SES A;  1JVM A;  3K0D A;  4TQD A;  2QKS A;  1K4C C;  1TUB B;  1UFI A;  4O4H B;  4JTC B;  3QF7 A;  4K8Z A;  2JRI A;  5KHK A;  4JTD B;  3JSL A;  2X6A A;  4ZIB A;  5JJN B;  1VP7 A;  3LNN A;  4I9Q A;  4MVZ A;  2YXH A;  4N23 A;  2WSS G;  4JYA B;  4LNU A;  5EZY B;  3UO2 A;  3ASN B;  2DJV A;  4H44 B;  5EIB C;  5B1O A;  3AG2 C;  3MAQ A;  2QWP B;  3IC7 A;  3L74 H;  3UQ8 A;  4PD4 F;  2OWO A;  4L87 A;  2G38 A;  1FS0 G;  3SGI A;  4U7O A;  3T1Y B;  2PTM A;  1S0V A;  1I5Y A;  1US6 A;  2HEP A;  3DXR B;  3M99 B;  2GHY A;  1L1F A;  3E8B A;  2Z3Y A;  5CMU A;  4JV5 B;  1YSC A;  1YEW A;  1XIL A;  3WG7 B;  1M56 C;  3S3X A;  3F7Y C;  5D5P A;  2VS0 A;  1Q6U A;  4IGG A;  4GYC B;  4CS4 A;  4QJF B;  2YI8 A;  5LYJ B;  2ILM A;  2ZNJ A;  1SQQ H;  4O4L A;  3ZCC A;  2OYQ A;  1O9G A;  4TV9 B;  1EZJ A;  3CRM A;  2WLL A;  4FLW A;  4GCZ A;  2XAF A;  5GW7 A;  1Q5O A;  2ZDI A;  4TSF G;  1Y66 A;  2A7W A;  2CH7 B;  2P4V A;  4A5U B;  4O4I A;  1GN4 A;  4NTY A;  3GB7 C;  3ABM B;  3M8A A;  4H0L B;  2LQT A;  2DQ3 A;  5J9P C;  1Z5V A;  2V1D A;  3RYF B;  4L8J A;  3UM7 A;  2QE7 G;  1AIL A;  1KEC A;  1SET A;  3F7V C;  1NTM H;  3K5M A;  1MNG A;  2EIL B;  3C3T A;  4OGQ B;  4B7K A;  2D3O W;  2VWJ A;  5TIS Z;  4ZHQ B;  2V7Q G;  2FB5 A;  4R50 A;  2X6B A;  1SA0 B;  5IE9 A;  3CJH A;  4LF5 O;  3EVK A;  5KHJ A;  2IJJ A;  5IT9 N;  1GM7 A;  5E1A C;  4I5S A;  1SQB H;  1SQG A;  2EJR A;  2VWK A;  1FJG O;  4LR3 A;  1GK9 A;  3G6E V;  3JAM N;  4JI8 O;  4UB8 Z;  2Q7G A;  5IYC O;  2W0F C;  2QWR B;  3JAS A;  4J7J A;  1KKD A;  1YF2 A;  1XL6 A;  1ROP A;  3OMA B;  1Q86 W;  5FL7 G;  3VQV A;  4J41 A;  5IYZ B;  4FLZ A;  4BW5 A;  4O2A B;  5CA1 A;  4DV0 B;  2YUA A;  1NH2 D;  2JK5 C;  2AHZ A;  2IH1 C;  3FAV B;  4FM1 A;  1FXK B;  1GN3 A;  4QE7 A;  3ASN C;  4PI0 A;  2XTA A;  3BRC A;  4MS2 A;  3B2E E;  1CPY A;  4FPP A;  4IYI A;  3JD3 A;  3F5T A;  4O2B B;  5H6Q A;  1K8A W;  4O4J B;  3J80 N;  2XHB A;  5JWP A;  5L3F A;  2CAZ C;  1ZUQ A;  3JCU Z;  1Z5W A;  3ZIA G;  3LSU A;  3CCQ V;  3EXA A;  1BMF G;  4DW1 A;  3CCU V;  1Y76 A;  1UPG A;  4MVO A;  4DR5 O;  2W0X A;  3WG7 C;  2ZR2 A;  5H9C A;  1NVP D;  4DRX B;  3U11 A;  1Q8I A;  2IJI A;  1AP5 A;  1HNZ O;  1WB8 A;  3L72 H;  5EBM C;  1RPR A;  4IHJ A;  4EEQ A;  1MZE A;  3MHH C;  1GRJ A;  1MG1 A;  3G80 A;  2JIZ G;  4DK1 A;  4TQF A;  3L73 H;  2EIJ B;  2ATK C;  4HZ3 A;  3ZX6 A;  2XAG A;  2UXB O;  5DN6 G;  5BMV A;  4LFC O;  3BPZ A;  4CH3 A;  4X20 A;  3ABM C;  3CP1 A;  1FAF A;  2QSA A;  1N33 O;  1WPX A;  1L8D A;  2LW1 A;  3ZS8 C;  4YJ2 A;  1BZK A;  1H8E G;  2EIL C;  4NTX A;  4LF5 B;  4FK5 C;  1B04 A;  4PDM A;  3JAW A;  2Q7E A;  2BOC C;  2RMK B;  1N36 O;  1MMM A;  3HKB A;  4K8X A;  3OMN B;  3H01 A;  1YTF D;  4JI2 O;  4YJ3 B;  2AXT Z;  2ITD C;  5LGN A;  3LNM B;  4JPR A;  1X4T A;  3QNE A;  1G8M A;  3H1K H;  5C8Y B;  4NXM O;  4LWS B;  5B5E Z;  2JEU A;  2HFE C;  4GKJ O;  1MAB G;  1Q81 W;  3PN1 A;  1XMO B;  4BR6 A;  4I55 A;  4PHZ A;  1KU9 A;  2B5U A;  3CXH F;  3LDE A;  2BSK A;  3SPH A;  3PJS K;  5IWA O;  1WN7 A;  2HLD G;  1WB7 A;  5KHI A;  2L6L A;  3EFF K;  1WAZ A;  2EUL A;  3OFN G;  3AG3 B;  3G4S V;  2ETN A;  1CP9 A;  4EB6 A;  1FXK C;  4P9P A;  4BAY A;  1N8R W;  4NTW A;  1GN6 A;  1E1Q G;  4MVS A;  4YHH O;  1V9P A;  4J11 A;  3ZMV A;  4DK0 A;  3LSS A;  1NBM G;  1VMG A;  4X1I A;  5IJ0 B;  3E86 A;  2IJH A;  3RYH A;  3DSQ A;  4C7U A;  1N0J A;  1NTK H;  4DYL A;  4DR5 B;  5LOV B;  4I4T B;  1IX9 A;  2GSM B;  3ZHT A;  4G28 B;  2DMX A;  2QEX V;  3JD1 A;  5EC1 C;  4FIP C;  3ZJZ A;  2YEV A;  1AJQ A;  4UVB A;  5GTI Z;  4CH4 A;  1BT8 A;  1F23 A;  4DUY O;  3QG5 A;  1FKA O;  3RYI B;  4GUN A;  2F95 B;  1URF A;  3H9V A;  2LFS A;  1PNM A;  2PZS A;  1K3E A;  3ZMT A;  5L3C A;  4MVU A;  3CWB H;  2BTQ A;  3T1C A;  5LMN O;  4JI3 O;  1N33 B;  3FB7 C;  1IBM O;  3AG7 A;  2GDS A;  3ZED A;  1TVK A;  3CCV V;  3AG1 B;  1JR9 A;  2R72 A;  5K1P A;  4X1Y B;  4KHP O;  1N36 B;  2QTS A;  3G71 V;  1IXM A;  2NN4 A;  2HKO A;  4F6E A;  1Q6I A;  4U3J B;  1KMI Z;  1SKV A;  2LFR A;  1WNS A;  5DEC A;  1K5S A;  3OM3 B;  4JI2 B;  1W2B U;  5CA0 A;  2VQF B;  1Q43 A;  4Z2W A;  1ZWI C;  3JD2 A;  1HNX O;  1QVF U;  2JJ1 G;  1M5I A;  1Y74 A;  3OMI B;  3SPC A;  1XMQ O;  3SJA C;  4GKJ B;  3FB8 C;  3CXC U;  4WFG A;  2DYR B;  4UVA A;  4HYO A;  4JI4 O;  2HJF C;  5HFM A;  1YIJ V;  3RYC A;  2N74 A;  1YVW A;  3SJC C;  3Q4H A;  1K73 W;  4B3R B;  5D5Q A;  5IWA B;  2QM7 A;  2WLJ A;  5JVD A;  1EN4 A;  1R3I C;  1NH2 B;  2CTR A;  2E74 B;  1M93 A;  4BW9 A;  2PYL A;  4HAM A;  2WLI A;  3N2G B;  1GMG A;  1K97 A;  5JH7 A;  1KP2 A;  4J9Y B;  5JJJ B;  4N21 A;  2AZ0 A;  3JAK B;  3D8C A;  3BHP A;  2YXL A;  4B08 A;  1XQ8 A;  1Q82 W;  4HNA B;  2XAS A;  1DF5 A;  2Q6A A;  2AW9 A;  3AG3 C;  3OUS A;  4YIP A;  5EBL C;  3FB5 C;  1Q90 D;  3ZHU A;  2A3Q A;  2BE3 A;  3AK3 A;  1JA8 A;  1B06 A;  2EX3 A;  2XOK G;  2ZKO A;  3CC4 V;  1Y4M A;  3CCJ V;  2E3C A;  2OTJ V;  1HW7 A;  1NKD A;  1RP3 B;  3ETG A;  2VRZ A;  3TGU H;  4WBN A;  2X0L A;  4I0X B;  1OHH G;  3BA9 A;  3N2K A;  2GTA A;  3JCZ A;  1NVP B;  1I7F A;  1VAR A;  1ZSP A;  3CC7 V;  2Q8V A;  2YS8 A;  5CBH A;  3A8T A;  5L3D A;  3JAW B;  3QO5 A;  1VQP V;  5JQG A;  3OW2 U;  1R3J C;  3SYC A;  2F4V O;  5BY1 A;  5DED A;  5KHH A;  3AK2 A;  5LGU A;  3HKB B;  5LMN B;  4JV5 O;  4KL1 A;  2ZIN A;  2YDE A;  1NT2 B;  2H8P C;  2CTQ A;  3ZMS A;  1D5A A;  3WB1 A;  4TUY B;  4EKW A;  5IY5 B;  2YI9 A;  2ZCE A;  4QPJ A;  4DR1 O;  4KHP B;  1NI8 A;  4Q20 A;  3ICX A;  4JF3 A;  3WB2 A;  2UU9 O;  5E79 Z;  3AG1 C;  4LF8 B;  3GVM A;  1IXB A;  2W6J G;  3P3N A;  3E89 A;  1DK1 A;  5BZB A;  4OPH A;  3RT3 C;  1T5E A;  2YC0 A;  2F23 A;  4F6R A;  2LW7 A;  1KC8 W;  5LP6 B;  1EN6 A;  2P67 A;  3CYO A;  1HNX B;  3HR0 A;  3LDC A;  1YTF B;  3ZHS A;  1XMQ B;  2QDO A;  3RBZ A;  2CTW A;  5ITZ A;  2P22 C;  3VQX A;  4JI4 B;  1I94 B;  2PGG A;  3CB2 A;  1XEQ A;  1R1B A;  3APO A;  1DTO A;  2FL4 A;  1OJH A;  4U3F H;  2ZM6 O;  3OEH G;  3ZHV A;  3K04 A;  1AB3 A;  4DV6 O;  1VQ8 V;  4GZR B;  5GON B;  3OAA G;  5GTH Z;  2PI5 A;  2DWD C;  5KAF Z;  1N4C A;  3K5L A;  2RCV A;  5KMG B;  2BTO A;  4KUM A;  1JFF B;  2YIB A;  2MW2 B;  1RSO B;  3OR7 C;  2ADP A;  5LHI A;  3OTF A;  3ML0 A;  4TV8 A;  1W0J G;  3J7A U;  1QBZ A;  2FTK A;  1ZL8 B;  2UXD O;  3RVZ A;  4W4K A;  1VF6 C;  1Y6X A;  5J2T B;  1VIB A;  4AIL C;  3CCR V;  5LXT A;  4WFE A;  3MDS A;  1IUR A;  3CCE V;  4H37 A;  1WA8 B;  4DV0 O;  1AP6 A;  2QTO A;  4PDL A;  4W4L A;  1V55 B;  2IW5 A;  3L71 H;  1WP7 A;  2CUG A;  3W7U A;  2A0L A;  2R70 A;  2OIG A;  2F4V B;  5FNV A;  1J95 A;  1COW G;  2WLH A;  4JAV A;  2Q4P A;  4X9Q A;  4ZOL B;  2KB1 A;  4DV7 O;  1RPO A;  3WU2 Z;  3CX5 F;  4X1K B;  4PA4 A;  3ABT A;  1P84 F;  4Q6G A;  4DV4 O;  3ZMU A;  3CPW U;  4DR1 B;  1QLN A;  1Y74 B;  1K5Q A;  4LFB B;  2UU9 B;  2RNB A;  3FD9 A;  4MT8 A;  3C90 A;  1L0L H;  4ABM A;  5IY5 C;  4RUE A;  2BOB C;  1KQS U;  2WA4 A;  1VQ5 V;  2UUA B;  4JI5 O;  4NR1 A;  2WAM A;  1YI2 V;  1PNL A;  1PD3 A;  4BIU A;  2GUZ A;  2Z5U A;  2Y4T A;  4MSW C;  3HKD A;  2CK3 G;  2UXN A;  5LA6 B;  1G4Y B;  2WLI B;  5L3E A;  3HKC A;  5CB4 B;  5LP6 C;  2DN9 A;  1U96 A;  1M1K W;  1PL4 A;  4G27 B;  3B09 A;  4OPA A;  2IJK A;  2ZM6 B;  4K35 A;  2K9P A;  4CBC A;  4NYK A;  5LL6 Y;  4DV6 B;  1QR8 A;  5H2F Z;  3B8M A;  2IBZ H;  2AZ2 A;  2JGD B;  2EJ7 A;  2ZE8 A;  3ZN0 A;  2RQ6 A;  3IJ4 A;  3JAT B;  5B66 Z;  1N34 B;  1Z2G A;  1E1R G;  2ZQM A;  2N05 A;  4LF7 O;  4IIJ B;  1XNR O;  1N0N A;  3A0B Z;  1HDJ A;  5F2V O;  3VBB A;  4DR3 B;  4ZI7 A;  2UXD B;  2F43 G;  2ZIM A;  3ZHQ A;  4DUZ O;  2KG7 B;  2QA4 V;  5EBW C;  2IU0 A;  4FFB A;  2PY5 A;  1H38 A;  3RN4 A;  5EYP A;  1XMO O;  3A0R A;  4UB6 Z;  4JGS A;  2ZR3 A;  5JCO A;  3R66 A;  4J9Z B;  1LUV A;  1XOU A;  3SJB C;  3STL C;  1JOY A;  3JAL B;  1AI4 A;  5J2U A;  3ZN1 A;  4NXN O;  2DOS A;  4KP4 A;  1XNQ O;  1V55 C;  1BQZ A;  3ETE A;  3OT7 A;  4B3T O;  1I5X A;  2UXC O;  4DV7 B;  4JZG A;  1BE3 H;  1G1X B;  3UT5 B;  4NB5 A;  5KX5 A;  1OZ0 A;  4DV4 B;  3CEI A;  4EFB A;  1FFX B;  4AQY B;  3JD0 A;  3ZRW B;  1YXB A;  4OX9 B;  3O65 A;  2LO1 A;  3CRQ A;  2UXX A;  2XAQ A;  3KKY A;  1IBL B;  3I5D A;  4JI5 B;  4MVM A;  4AHC A;  1QCE A;  3R65 A;  3B40 A;  4GX1 A;  5CBF A;  5BXZ A;  4DR4 O;  2WLN A;  2E75 B;  3JAR B;  2B9Z A;  2EIN B;  2JJ2 G;  4BIO A;  3BAB A;  5JJE B;  1THZ A;  2E5L B;  4FMT A;  4LF4 O;  4IYH A;  1JX9 A;  2CDY A;  4LFA O;  1I08 A;  4WFB V;  1NU1 H;  5KAI Z;  2QGN A;  3K5O A;  1JJ2 U;  1R3L C;  1SQV H;  4KFM A;  1VQL V;  2QM8 A;  1EBO A;  2NLJ C;  3SDL A;  1E79 G;  5IJ9 A;  1BHB A;  1M57 B;  3SJQ C;  2OCC C;  4LF7 B;  4LNU B;  4UCV A;  4FLX A;  1XNR B;  1K34 A;  1D5N A;  4CS3 A;  3L70 H;  1F7Y A;  1NQT A;  2ZT9 B;  2VQF O;  1P7G A;  2C2A A;  4DUZ B;  3HKE A;  2X6C A;  1RFY A;  4PA3 A;  3AG4 C;  3TK1 A;  1K4D C;  1ARO P;  2E76 B;  4JAU A;  4WCE V;  4PI2 A;  4HBN A;  1A32 A;  4B3R O;  2YIC A;  5KUM A;  3ZBH A;  4NXN B;  3H1H H;  1JJO A;  2YSU B;  4PV1 B;  1XNQ B;  4O4L B;  4X65 O;  1HNW O;  1W0K G;  4DV5 O;  4IT5 A;  2DE0 X;  4B3T B;  2ZNI A;  2WLL B;  3E22 A;  2UXC B;  3CCS V;  3RGB A;  3K57 A;  2PI4 A;  2QWO B;  2WLK A;  4O4I B;  4FM0 A;  4YXW G;  3E8F A;  4EFE A;  3THO A;  5B3S B;  2JVD A;  3D36 A;  3UCS C;  1NR1 A;  3FYI B;  3T2M A;  4TWK A;  1GTO A;  5HFL A;  2P06 A;  1MSD A;  3H1L H;  1TAE A;  2GTS A;  4I50 A;  1M4U A;  1FFT B;  3CJH B;  4DR4 B;  1P7B A;  1ZX3 A;  5IDJ A;  2PYJ A;  1V54 B;  1GKF A;  5C93 A;  1QVG U;  2XT9 A;  2FKX A;  5FPR A;  1SF9 A;  5LHG A;  1TUB A;  4O4H A;  4LF9 O;  4K0K B;  5CBG A;  4LF4 B;  2CGO A;  5KHG A;  1OCC B;  2EIN C;  4LFA B;  3JAS B;  4JYY A;  4JYB A;  3UO3 A;  1DF4 A;  1P49 A;  3KG2 A;  3K9A A;  4DR7 B;  4FVM A;  5EZY A;  3TJT A;  3I56 V;  1VEW A;  3BFR A;  4LF8 O;  3E35 A;  5CA1 B;  3D3Q A;  4PA9 A;  1FD9 A;  4I9W A;  1GAX A;  1M57 C;  4QGP A;  1H2M A;  4MW3 A;  3DXR A;  2EIM C;  3K08 A;  1GM9 A;  1QQC A;  2O57 A;  2XND G;  3K5N A;  1I94 O;  3LDD A;  3LUT B;  2XUM A;  2HVJ C;  2JEX A;  4BIZ A;  3ETQ A;  5LYJ A;  4B3M O;  1KB9 F;  4RUF A;  2WPD G;  3IC9 A;  4FZ0 A;  4K3A A;  1VQ4 V;  4RQF A;  5FLX N;  1Y76 B;  4GX2 A;  4X65 B;  1HNW B;  2M7W A;  4DV5 B;  3BVO A;  4LH6 A;  1OCO B;  3BA8 A;  1OCZ B;  3K3W A;  4UCS A;  2CE4 A;  2CH7 A;  4QNH B;  4UCT A;  3IAY A;  3E2E A;  4IHJ B;  2D2C B;  3SPJ A;  3RW0 A;  3IFX A;  2ZDI C;  1AI7 A;  1YZB A;  4UV9 A;  4DR6 B;  3RYF A;  1YCI A;  1GM8 A;  4CC6 A;  2KKW A;  3D3I A;  5BMV B;  4PA7 A;  2QWN B;  3WB0 A;  5AG2 A;  3L75 H;  1HWY A;  3BEH A;  4DV2 O;  1NTZ H;  4R8C A;  1ZLZ A;  4X20 B;  4WFH A;  3W7W A;  1OV9 A;  4ZHQ A;  3T4Z A;  1QHT A;  1XUQ A;  5B3S C;  3OUF A;  2P90 A;  1B3Q A;  1SA0 A;  4R6Z A;  1R6N A;  2Y69 B;  3O9O A;  4R7C A;  4YJ2 B;  4H33 A;  3K0G A;  4UXN A;  3OGI B;  4X66 B;  1J5E O;  4LF9 B;  5B1A B;  1V54 C;  2QM4 A;  1Y67 A;  3FKS G;  2EBO A;  3OD4 A;  3E8G A;  4LF6 O;  1QLE B;  1M9N A;  3STZ C;  2V4D A;  4JI0 B;  1AVM A;  1P4R A;  5IYZ A;  1OCC C;  1BHA A;  3G67 A;  4O2A A;  4LFB O;  1LR1 A;  4JTA B;  1BS3 A;  5CN0 A;  2F93 B;  1RM1 B;  2YIA A;  1Q7Y W;  4I55 B;  3FAV A;  2UUA O;  4FLT A;  3SYQ A;  2PF4 E;  1IBK O;  2BSK B;  4JZ2 A;  2Z0A A;  1VF5 B;  2YIB D;  3B8N A;  2R9I A;  5L3G A;  1FPO A;  2H3O A;  4O2B A;  4B3S O;  4XDL A;  5KA5 A;  3QO8 A;  5LGT A;  4O4J A;  1VQK V;  1EZV H;  3QTC A;  4EB6 B;  2XAH A;  2HJD A;  3JSN A;  1IVS A;  3VOU A;  3TXQ A;  1QU7 A;  3MHS C;  1CEZ A;  4B3M B;  2A06 H;  3DGE A;  3ABK C;  2Q68 A;  3VQY A;  4X1I B;  1SQF A;  1KP3 A;  3QO7 A;  3RYH B;  4JAA A;  2ODM A;  3AEI A;  2EIK B;  4DRX A;  2P6J A;  4D7S A;  1XI1 A;  1N34 O;  4ICG A;  2Y48 A;  3TCU A;  2YEV B;  3P30 A;  1ZTE A;  2Q0O C;  3K9S A;  1OCO C;  3RFR A;  1OCZ C;  4DR3 O;  2RJZ A;  3ASO B;  2Q5Z A;  3CHX A;  4QPK A;  1S5J A;  4WF9 V;  4F4L A;  1ENV A;  3J81 N;  2YXY A;  4DV2 B;  3FFQ A;  4RWU A;  2BTQ B;  3A2F A;  4MVQ A;  2VQE O;  3BAA A;  2HHH B;  1U97 A;  1VQ6 V;  1K92 A;  1PM9 A;  1KD1 W;  1TVK B;  2LGW A;  4MTX A;  4PEL A;  4UFZ A;  4JI1 O;  1J5E B;  5LMU O;  4X64 O;  1G6U A;  2GBO A;  2Y69 C;  3CSX A;  1S5H C;  1D2D A;  4YJ3 A;  1XDC A;  1JMK C;  5CA0 B;  4LF6 B;  3U10 A;  5B1A C;  5C8Y A;  4AQY O;  4LWS A;  3CRC A;  3B4S A;  5K1X A;  4OX9 O;  1KBH A;  2W6I G;  1B6Q A;  2ZXW B;  1QLE C;  3ZRV A;  1H2G A;  4JI6 O;  2JS5 A;  1F4N A;  4P2Z A;  1O9H A;  3OE7 G;  1SQX H;  4CH6 A;  1IBL O;  4NVP A;  1XL4 A;  3RYC B;  1H2L A;  3CME V;  3Q4H B;  1IBK B;  3CS5 A;  5EK0 A;  5JVD B;  1IDS A;  1MZF A;  1GH6 A;  1RM1 C;  3ETD A;  2UUC B;  4CH5 A;  1MA1 A;  4B3S B;  2IU3 A;  5A9G A;  2NNU A;  2Q67 A;  1AJN A;  5JH7 B;  1WJZ A;  2IH3 C;  2E5L O;  3UKM A;  4D7T A;  3E8H A;  2KSD A;  3KCX A;  5IJ0 A;  4TOI A;  1NS1 A;  4DR2 O;  4FLY A;  4H13 B;  4Z1V A;  1PP9 H;  3CCL V;  4DV1 B;  2OCC B;  3CD6 V;  5LOV A;  4I4T A;  4JYC A;  1MOF A;  4LBE C;  2P4K A;  4DV3 O;  2JDI G;  4J7Z A;  4MVR A;  3BCC H;  4RQE A;  4MTF A;  4WBN B;  4G2K A;  1VQN V;  2EIK C;  3N2K B;  3RYI A;  2QJ1 A;  1XRE A;  4FLU A;  1R6K A;  3AG4 B;  4FFK A;  1XHX A;  4GKK O;  1SZX A;  2P7T C;  1UJW B;  4X62 B;  3D36 C;  1H8H G;  3NXS A;  4D6T H;  5JQG B;  3QVN A;  2LJ2 A;  3ZHR A;  3ASO C;  4GLX A;  5FPO A;  2HG5 C;  1LNQ A;  2WWW A;  3I55 V;  2FML A;  2VQE B;  4X89 A;  5IYB O;  1YIT V;  2Q7H A;  4X1Y A;  2F66 C;  2N04 A;  1PKX A;  4UUJ C;  4JI1 B;  1BCC H;  1BGY H;  5LMU B;  4X64 B;  4AI8 A;  1KKC A;  3RWR D;  1SC5 B;  4P30 A;  3K59 A;  2UUB O;  3H1J H;  2OCH A;  4U3J A;  2IM9 A;  1S5L Z;  3SPI A;  1Q3E A;  1NR7 A;  3OTO O;  2YID A;  3HPL C;  3RVY A;  3X2Q B;  1NJI W;  3AK1 A;  4F6R B;  1YJN V;  1Q6H A;  2PUS A;  4JAS A;  3G6B A;  2ZE7 A;  1F4M A;  1S3J A;  3DTU B;  5ITZ B;  5DM6 V;  4JI6 B;  3L9D A;  3HB3 B;  3TET A;  5EIB D;  2CGN A;  1FXV A;  1YJ9 V;  1SER A;  2Y4U A;  2ZXW C;  3OEE G;  2Q9L A;  4FLV A;  1AR4 A;  1ZAU A;  3U0Z A;  3N2G A;  3FX7 A;  2R9R B;  3GWO A;  1DGS A;  3JAK A;  2QKA A;  2DW4 A;  5IYD O;  1M90 W;  3JYC A;  4ZBM A;  2BCC H;  4HNA A;  1VF6 A;  4K0K O;  5CA3 A;  1AR5 A;  4DR2 B;  1IZ3 A;  4TV8 B;  2JS3 A;  2QWQ B;  1SQP H;  1PNK A;  1S76 D;  3TXS A;  5LHH A;  1AJP A;  4DV3 B;  4LC1 A;  2A9H A;  4FZ1 A;  2CTP A;  4ASU G;  3FB6 C;  3CMA V;  5LXT B;  4DR7 O;  4UCR A;  3CCM V;  4CC5 A;  4I0X A;  1X59 A;  4UCU A;  4DW0 A;  2P5O A;  4B7E A;  2EIM B;  5B1B B;  4QE9 A;  1H2K A;  3BY6 A;  4PDV A;  4GKK B;  1K7D A;  4MW8 A;  1QNM A;  4OXS A;  4XDK A;  5KUK A;  1OCR B;  3ABL B;  1KUQ A;  1LUW A;  2L35 A;  1FJG B;  1I0H A;  5FNV B;  4JI8 B;  4J42 A;  2OT5 A;  2FYU H;  1PPJ H;  1S77 D;  3JD4 A;  4J80 A;  2OIE A;  4TUY A;  4WFF A;  1HP8 A;  4IL6 Z;  5B1N A; 
#chains in the Genus database with same CATH homology
 4OPA A;  2DJV A;  1IBL O;  5LL6 Y;  5BXZ A;  4DR4 O;  1N36 O;  3J7A U;  4JI7 O;  5LMN O;  4JI3 O;  2UXD O;  1IBM O;  3T1H O;  4LF4 O;  4JI2 O;  4LF7 O;  1YZB A;  2UUC O;  4LFA O;  1XNR O;  2E5L O;  1N34 O;  2F4V O;  5BY1 A;  4KHP O;  4DV0 O;  4DV2 O;  4DR6 O;  4JV5 O;  1NS1 A;  4DR2 O;  4NXM O;  3SDL A;  2FKX A;  4GKJ O;  4LF9 O;  1R6T A;  5A2Q N;  4DUZ O;  3F5T A;  4DR3 O;  4DV3 O;  4DV1 O;  3J80 N;  1FYJ A;  4K0K O;  3J81 N;  4DR1 O;  1F7Y A;  1XMO O;  1HNX O;  1J5E O;  2UU9 O;  5IWA O;  2VQF O;  2AGA A;  1HR0 O;  4DV7 O;  1XMQ O;  3R66 A;  4X66 O;  4YY3 O;  1DK1 A;  2VQE O;  4A5U B;  4GKK O;  4LF8 O;  4JI4 O;  4OPH A;  4DR5 O;  4DV4 O;  4NXN O;  3RT3 C;  3M8A A;  2DOS A;  4DR7 O;  2LW7 A;  1XNQ O;  2N74 A;  4JI1 O;  2HHH O;  1X59 A;  4LF6 O;  4YHH O;  4X64 O;  4X62 O;  5LMU O;  1AIL A;  1HNZ O;  4B3T O;  2UXC O;  1A32 A;  4B3R O;  5BR8 O;  4LFB O;  1N32 O;  4JI0 O;  1G1X B;  1D2D A;  4JYA O;  4JI5 O;  1XEQ A;  1R1B A;  2JRI A;  2ZM6 O;  1KUQ A;  4X65 O;  1HNW O;  4LF5 O;  2UXB O;  4LFC O;  4DV5 O;  1I94 O;  1AB3 A;  2UUA O;  3O65 A;  4DV6 O;  5IT9 N;  5H5N A;  2UUB O;  4AQY O;  1IBK O;  4B3M O;  2Z0A A;  1FKA O;  4OX9 O;  1FJG O;  1N33 O;  3T1Y O;  3JAM N;  5FLX N;  4JI8 O;  4JI6 O;  3OTO O;  4B3S O;  2ZKO A;  4DUY O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...