1HR0O

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 30
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1hr0O00
1R1BA 4A5UB 4LFBO 3R66A 4JI6O 3J80N 4DR3O 4AQYO 1XEQA 1N36O 2UUCO 4LF9O 4DUYO 5BXZA 3J7AU 4X65O 4GKJO 3T1HO 4LF6O 4KHPO 4JYAO 4DV2O 3JAMN 1AB3A 4JI2O 4X64O 1F7YA 4DUZO 4DV5O 4DV6O 1HR0O 4DV3O 1X59A 4JI0O 1XMOO 3RT3C 4JI8O 1FJGO 1FKAO 4DV0O 4DR6O 3M8AA 4OPHA 2Z0AA 2UUBO 4B3RO 1HNZO 1I94O 1DK1A 1XNRO 1HNWO 2N74A 4DV7O 3O65A 2UU9O 1D2DA 1IBMO 2UXDO 2ZKOA 3J81N 4DV4O 4DR2O 3F5TA 4X66O 5A2QN 5H5NA 4JI7O 1XNQO 4JI5O 1N33O 4JI1O 2UUAO 2ZM6O 4X62O 5LMNO 4OPAA 2E5LO 1HNXO 4B3TO 1FYJA 4JI3O 4LFCO 1KUQA 1G1XB 5BY1A 3SDLA 2VQFO 3T1YO 3OTOO 1R6TA 4YY3O 2HHHO 4JV5O 1N34O 5LL6Y 1A32A 2FKXA 5IWAO 2VQEO 4DV1O 1YZBA 4DR1O 1AILA 4NXNO 5LMUO 2JRIA 5FLXN 1XMQO 4LF7O 4DR4O 4LF5O 1NS1A 2F4VO 1N32O 4DR7O 2UXBO 1IBLO 4OX9O 4LF4O 2DJVA 4DR5O 5IT9N 2DOSA 4LFAO 4NXMO 1J5EO 2LW7A 1IBKO 2UXCO 4K0KO 4B3SO 4JI4O 5BR8O 2AGAA 4YHHO 4B3MO 4GKKO 4LF8O
chains in the Genus database with same CATH superfamily
3OD4A 2JJ1G 4AILC 4HZ3A 2YC0A 4DV3B 4DR3O 1I7FA 2BOBC 4OXSA 1KKCA 3WB2A 1K73W 1BGYH 1XQ8A 1BMFG 1VQNV 3T1YB 1FFXB 3CCSV 3ZRWA 2UXDB 2R70A 1AB3A 1HP8A 2IM9A 1HR0O 1KC8W 4FLXA 1FJGO 1GMGA 4IYIA 1QLNA 4MVUA 2ZT9B 3AG3B 3F7YC 1WA8A 2W0XA 4OPHA 3TCUA 2OYQA 2B9ZA 4X1IB 4XBFA 4R8CA 1GKFA 2IH1C 1ZUQA 2JJ2G 4X66O 2X6CA 5IYZB 1NU1H 3BFRA 1CPYA 1EZJA 2E74B 2ZE6A 2QM8A 5FNVA 1SQVH 1LUVA 4CC5A 1JOYA 3CCUV 3KCYA 3UO3A 1Q3EA 2Y4UA 3A2FA 2ATKC 3B8MA 3T1YO 2Y69C 3MDSA 4JI6B 1F4MA 3ASNC 3OUSA 1YVWA 3IJ4A 1OCZC 3CMAV 1Q43A 4YJ2B 3K08A 2F66C 2HVKC 3F5WC 3E8GA 2MK3A 1SESA 2EIKC 2KG7B 4MVZA 4JF3A 3SYQA 1AROP 4I9WA 4ICGA 2YDEA 1Y74B 1HWYA 3DGEA 3ZBHA 5EIBD 2DJVA 4DR5O 1H2LA 1YXBA 1W0JG 1IBKO 3L73H 1GO3F 3JSLA 3KCXA 1JFFB 2WLMA 2CGNA 3TJTA 3H1JH 5F2VO 2Q7HA 2GV9A 1UJWB 4JI6O 3HKBB 1ZL8B 3JD0A 1FS0G 2QWQB 2F43G 2Q73A 2YXHA 1H8EG 3ICXA 4ZI7A 1VQPV 2UUBB 4MW8A 3JYCA 5KA6A 3GVMA 5LP6C 1WPXA 1E79G 4DR2B 2Q68A 4X88A 3HR0A 1FFXA 1KBHA 4DR1B 2QSAA 1SZXA 4RWUA 4J9YB 3RT3C 1FKAO 1IVSA 2XOKG 2W6JG 2D3OW 4MS2A 1KECA 1OHHG 2E5LB 4GT1A 2CGOA 3BAAA 3OT7A 1U96A 2BCCH 4RUFA 3ZMSA 4DO2A 1TA8A 2AHZA 3ZMZA 4FJCC 1R6KA 1BHBA 5IYZA 3B40A 4GX1A 3SJAC 2QKSA 2LO1A 1FYJA 4TT3G 5B1AB 1AI4A 3CB2A 5GW7A 3CXCU 1XOUA 4LFCO 1BE3H 3E8FA 3G6EV 1WB7A 4X20B 4N23A 5EBWC 3D36A 4JZ2A 5B1BC 3K59A 4DR1O 1K5QA 1YCIA 2QWRB 3DSQA 4YJ2A 1GTOA 4JI4B 2KG7A 5BR8B 5KUKA 2QM4A 5B3SB 4RUEA 1VF6A 1IXMA 1Y74A 4FLUA 4MTFA 3I55V 4K8XA 2EIJC 3HKCB 1KMIZ 3CWBH 1GAXA 4ZKIA 3ABMC 1AR4A 2VRZA 2Q6AA 3STZC 2WSSG 2WLNA 3HKBA 1ZL8A 4QPKA 4ZBMA 1URFA 3CRQA 4UB6Z 4JYAO 4C7UA 1VQMV 4ZHQA 5DM6V 5AG2A 2A79B 3RN4A 2ZM6B 3EXAA 3ABTA 2Z0AA 1IZ3A 4NTXA 1VQ9V 4DR4B 4PELA 2CTQA 3I5DA 4O4LB 5FPRA 4LF4B 2CAZC 2JIZG 3M7MX 4YY3B 1QBZA 2P67A 4PDMA 3H1KH 2IW5A 2GTAA 2Y69B 5CBHA 4K0KB 3B2EE 3ASNB 1OCZB 2XTAA 1HNXO 2IJKA 3AEIA 2OIGA 5EBLC 2QEXV 3QVNA 2EIKB 3F7VC 4QJFB 2P7TC 2CUGA 4LH6A 4LWSB 4X20A 3IGAC 3CS5A 1EZVH 3AG7A 1FFTB 4NVPA 4NXNO 4DV2B 2ZIMA 1YIJV 3K9SA 4DR4O 5LXTB 2LP7A 1MSWD 4J11A 5K1PA 3ZMTA 3W7UA 3N2GB 3UQ8A 5J2UA 3WG7C 4LF4O 3MD0A 1SA0B 2OIEA 1NVPD 2CDYA 4I4TB 2F95B 1M90W 4DK0A 1XBLA 1M56C 4K0KO 4UVBA 4PA9A 4JI7B 1FPOA 1VQKV 4FZ0A 3VOUA 4X62B 2MW2B 2ZQMA 3RYFB 1Q6HA 4QE9A 5LP6B 4DV0B 3A8TA 3J7AU 4X65O 3SPGA 2C2AA 2ADQB 2CK3G 3BPZA 4EFBA 4DV2O 2PGGA 4JI2O 2LJ2A 3QF7A 5JWPA 4JI1B 5IJ9B 1BSMA 2Q69A 2LGQA 5JJJB 4OX9B 2WPDG 5A2QN 4JI7O 2DWEC 3ZIAG 4O4LA 1IDSA 1N34B 2X7RB 2HVJC 4NTWA 4X62O 1BS3A 3A0RA 2XASA 2QDOA 1GH6A 4X1KB 1DTOA 3THOA 4B3MB 2X6BA 1H2GA 4G27B 1KUQA 4E2LA 1KU9A 4LH7A 2QE7G 2OTJV 1R3LC 3JD3A 5EBMC 5KHKA 5EIBC 5L3GA 4HNAB 4GX0A 1H2SB 5JCOC 2BSKB 4PI2A 1J5EB 4L8JA 1XMQO 2Q0OC 3L71H 4LWSA 1IXBA 2UXCB 2XAHA 4X8AA 2QKCA 1R3KC 2WLLA 1XMOB 1NH2D 2CTWA 2Y0IA 3MAQA 4OX9O 1E1QG 1X4TA 2EIJB 3N2GA 1H2NA 4O4HB 2HFEC 3RW0A 2EBOA 3ABMB 4DUYB 1RM1C 1YSCA 1SA0A 1EFRG 3WB1A 2LFRA 3CXHF 4I4TA 3JD4A 1S72V 4B3MO 2FB5A 5KUMA 1R1BA 2R9AA 4DUZB 4OGQB 3CCRV 2DQ0A 3RYFA 1M9NA 2UU9B 5LP6A 2AHYA 5GTIZ 4UVCA 3AG1C 3ABLC 4Z1VA 4MVQA 3SPCA 4TOIA 1OCOB 1K92A 1XMOO 1PL0A 3MHSC 2XAFA 1YJ9V 3FYEB 3KKYA 4CH3A 1HNWO 2N74A 5FL7G 4B7KA 1QR9A 3NR7A 2QWNB 3ZN1A 4E4EA 1QLEC 4BIUA 5KAIZ 4CZZA 3EHBB 2AXTZ 3QNEA 2YXLA 4K35A 5LGTA 2BTQB 5KHGA 3E86A 2L35A 2WLHA 3OGCC 1JCHA 4X1KA 1TAEA 1A32A 3JD2A 1S0VA 4LF9B 4UCOA 1AVMA 2PI4A 3FB6C 3E2EA 4LF6B 3FX7A 5IYDO 1Q82W 3CCQV 4HNAA 3WG7B 2XHBA 3RYHB 1GN6A 4LF5O 4GX5A 2NN4A 2BSKA 2ZD9A 1AJQA 1N32O 3LNMB 4Q6GA 3K0DA 2DWDC 1M56B 2ZR3A 3JARB 3LSSA 1JR9A 2LW7A 3K5NA 1DGSA 5CBGA 3DXRB 3RGBA 4O4HA 2E76B 5C8YB 2FL4A 5LOVB 4YJ3A 3TETA 4FLVA 4FFKA 5CA1A 1P7BA 2H8PC 3UM7A 1KD1W 3W7WA 1FJGB 3K04A 4LF9O 4I0XB 1PV0A 3E35A 4LF6O 4HAMA 5IE9A 2ZXWC 1NR7A 3RVYA 1R3JC 4X66B 2Z3YA 3C90A 1AP6A 1GRJA 4JI0O 3RWRD 3UO2A 1WN7A 4ZI7B 4NKGB 1XNRO 4F4LA 1GM8A 1BL8A 2DN9A 1XHXA 2R9RB 3E89A 5EC2C 4TUYB 4FMTA 3RYIB 1V55C 4UV8A 1WP8A 2DE0X 5D5PA 4PHZA 4P30A 4CH5A 3A0BZ 3FB5C 1CEZA 4KUMA 1O9HA 5H9CA 2ZE7A 2W6IG 2EILB 3APQA 1VP7A 1R6TA 1B3QA 2BTQA 2WAMA 3CCJV 2VQEO 4DR5B 2PY5A 3K5OA 1N0NA 4U7OA 3ZS8C 1TUBA 3AG4C 1IBKB 2XAQA 3RFRA 1OJHA 4GLXA 2Q5ZA 3OAAG 1RM1B 3RYHA 3VQYA 2YSUB 4CS3A 3OEHG 1VMGA 1SQBH 3BRCA 3BEHA 1PL4A 2YIBA 3JARA 2OTLV 5CBFA 1MABG 4ZOLB 5JH7B 3SJBC 4YHHO 3ZX6A 3DXRA 4FLZA 3L70H 1Q6IA 5C8YA 5K1XA 3X2QC 1E1RG 1WNSA 4O2AB 5B5EZ 5LOVA 2EJ7A 4J7KA 3AG1B 3ABLB 4WFHA 4YIOA 1T5EA 4I0XA 1F7YA 1W59A 1L1FA 2WLJA 4MTOA 1X59A 2E75B 2JEUA 1MNGA 3SPJA 5L3FA 2EINC 5EZYB 1QLEB 1R3IC 1IURA 2WA3A 4I7ZB 4LFCB 1GM9A 5LHIA 2CTPA 4ZHQB 1N33O 1BQ0A 2GSMB 4TUYA 1JMKC 4UCUA 2IH3C 3RYIA 3JALB 1QU7A 3E83A 1XL4A 5KHHA 1TGOA 1HW7A 2A06H 1YTFB 4ZIBA 1J95A 1D5AA 2YS8A 3SYCA 1N36B 1VEWA 5JCOA 1YZBA 3E8HA 3OMNB 1DF5A 2PUSA 4R50A 4MVMA 3APOA 1OCRB 1QHTA 1NS1A 4P2ZA 2B1IA 2P6JA 3BY6A 4BIZA 2QWOB 4JI8B 3MHHC 1NTZH 1FXVA 3CRRA 4H33A 3P3NA 1OV9A 2GDSA 4BAYA 4IIJB 1QR8A 5LYJA 4JI5B 3AK3A 4JYAB 2DYRC 5J2UB 4JYYA 4ZOLA 4YXWG 5JH7A 3LDDA 1N36O 2JDIG 1QCEA 4TV9B 1M57C 2LFSA 2ZXWB 1YDXA 4JPRA 1NBMG 4O2AA 2YXYA 1CXZB 4FPPA 1VQLV 1YF2A 2XAGA 4NYKA 4TQDA 4Z1MG 4D7TA 5IWAB 3ZHTA 5GTHZ 1V54C 1LR1A 3FYIB 4JI8O 5LMUB 1ROPA 3OEEG 2KB1A 2OWOA 2DQ3A 1V55B 3SYPA 2M6YA 1HNXB 3FD9A 1SQFA 3ZJZA 1BCCH 5EZYA 1N8RW 1WP7A 3W7XA 4JI5O 3ZRSA 3GWOA 2UUAO 3D8CA 4EB6B 5LMNO 1Z5VA 2N05A 4K3AA 1Y6XA 3IC9A 4N21A 4NXNB 3G80A 3JALA 1G6UA 4I9QA 4LF8B 2X0LA 3JATB 4LNUB 3OTOO 1EN5A 2ZCEA 3AG4B 3VQXA 5IWAO 3CYOA 5DECA 1AILA 5DN6G 5LMUO 1G4YB 1K8AW 1XUQA 3CD6V 5LGNA 2D2CB 3TXSA 3H1LH 4R6ZA 2RQ6A 4UCTA 1YJWV 5IT9N 4JASA 3RVZA 2DOSA 3CCEV 1S77D 2QTSA 1YI2V 3S3WA 1M1KW 3OFNG 4X65B 1GM7A 4W4LA 3CX5F 5BMVB 4LF8O 2WLLB 3TGUH 2GUZA 1XILA 4JI2B 4IIJA 4LFBO 4UCSA 3R66A 1XREA 2CTRA 3OM3B 3C3SA 1BQZA 1XEQA 1PKXA 2Q9LA 3N27A 2ZDIC 2YIDA 3K03A 2A7WA 4I55B 3B09A 3A0HZ 1B04A 4TV9A 1VF7A 2EINB 2NNUA 3ZHUA 1F23A 3LDEA 3CHXA 1S5LZ 3H1HH 1SQGA 4UB8Z 4DR6O 3M8AA 4LF7B 3JAWB 3IFXA 4G28B 3HB3B 2BOCC 3T2MA 4BR6A 1SS3A 2V4DA 3QO5A 2P4VA 2QTOA 1XNQO 1N0JA 4U3FH 2ZE5A 4MTGA 4EB6A 4EEQA 1VQ6V 1XMQB 1SQXH 2VQFO 3VQVA 2NR5A 4F6RA 3EFFK 5KHIA 3JATA 1K97A 4LNUA 2WA4A 2JK5C 2GTSA 4LF7O 4TV8B 3ZHSA 3SPIA 4JTDB 2QA4V 4FIPC 1MOFA 2DW4A 2QJ1A 1ORQC 5B1BB 1P84F 1SF9A 1K3EA 2QKAA 2EIMC 2DYRB 3M99B 2XT9A 3EVKA 4FK5C 2PTMA 1VQ7V 1NR1A 4O4JB 5H2FZ 1L0LH 2F23A 4PDLA 2VWKA 2K9PA 1PM9A 2GHYA 3OR6C 4RO2A 5BMVA 3S3XA 4B3TB 1V9PA 2KQXA 3WB0A 2FMLA 3ASOC 1JX9A 3AG3C 4FLYA 2RMKB 1HNWB 3BVOA 3FB7C 2JGDA 4QIWF 4DYLA 4YJ3B 4X64O 4FFBB 4I55A 3QG5A 1MMMA 2A3QA 4O2BB 1N4CA 5CA1B 1FXHA 3G71V 1PNLA 3STLC 2M7WA 3CRCA 1D2DA 4CS4A 4DR7B 3J81N 4DV4O 5HFMA 3D36C 3JAWA 1KQSU 5LGUA 4NTYA 3KG2A 3LNNA 4PA6A 2EZPA 1ZSPA 4QPJA 5KA5A 2IJHA 3L9DA 1YJNV 4B3TO 1P49A 3UCSC 3ETGA 1H8HG 3ETQA 4LF5B 1Y4MA 4B08A 2K1EA 3T4ZA 1N32B 2YEVB 2CH7B 1NI8A 4BW5A 4CH6A 1RPOA 3CJHB 1LNQA 2PZSA 3T1HB 2PYJA 4KHPB 1MSDA 3ABKC 4MSWC 1I5YA 4XDJA 3RBZA 1VQOV 2Q0AA 4DRXB 4AHCA 1WPBA 4UCRA 2F4VO 4DR7O 2IU3A 3CRAA 4TV8A 1IBLO 4JYCA 2P06A 4GZRB 4RAIA 5HFLA 3IC7A 2ZNJA 4IYHA 4PDRA 4LFAO 4NXMO 2BE3A 1TUBB 4X9QA 5B66Z 1JJ2U 4JGSA 1AJPA 4MVOA 3K5LA 1H38A 5CMUA 1ZX3A 1S3JA 3DC6A 3LSQA 4O4JA 3K0GA 4JI0B 4FM2A 5KLVH 2B5UA 4QGPA 3U11A 4GCZA 1XNRB 2R9IA 2R72A 3T4DA 4IL6Z 3T1HO 4FM1A 4KHPO 3CP1A 2V7QG 4WBNB 1DLBA 4HBNA 4DW1A 2Y0PA 4DV5O 1K9MW 3FB8C 5L3EA 5LA6B 2PYLA 4X1YA 4FFBA 1AR5A 4J41A 3E22B 3SPHA 1WB8A 3SYOA 4B3RO 4O2BA 3ETEA 3B8NA 1AI7A 4WF9V 3QTCA 4CH4A 4UXNA 1TVKB 1WJZA 1GK9A 4BWAA 4X89A 1KP2A 3JCUZ 4WFGA 1Y76B 3W7SA 4I5SA 4TSFG 1Q90D 1Z2GA 2VQEB 4H0LB 4IHJB 2DMXA 2ARHA 1EN6A 1VQ4V 4PA7A 1AI5A 1H2KA 4JZGA 1QVGU 2QR4A 4GKJB 2OCHA 2YUAA 2YEVA 2CH7A 5LBQA 3ZHRA 3CJHA 4GUNA 2Z5UA 4UVAA 5KHJA 4DV6B 2EIMB 4YHHB 2RJZA 2UXBO 2PF4E 3CMEV 4DRXA 4Q20A 2YIBD 1NJIW 2LQTA 4PI0A 3VQWA 3UT5B 4B3SO 1QNMA 1O9GA 4TQFA 4F6EA 4AI8A 5B1NA 3ASOB 3SR2C 1Z5WA 2HLDG 2UUCO 2ZDIA 1JJOA 2KSDA 1EM1A 4JI3B 1K7DA 5BXZA 1VIBA 2HJFC 3UKMA 4GKJO 4ASUG 5LYJB 2YI9A 1NQTA 4P9OA 4PV1B 2OT5A 2FTKA 4DV6O 1N33B 1DF4A 4WBNA 4DV3O 1M5IA 2CE4A 2KKWA 1L8DA 5LHHA 4KP4A 2A0LA 5LA6A 2HP8A 1R6NA 3L74H 1RPRA 1L0NH 2UXDO 3E22A 1ZLZA 4O4IB 5IYCO 2VWJA 1NT2B 1NTMH 5H5NA 1Q5OA 3BA9A 3U10A 1WLEA 1FAFA 2QM7A 1TVKA 1TUEB 1Y76A 1P7GA 3HKEB 5D5QA 4L87A 4R7CA 4I50B 3ZMVA 2IJJA 2DYSC 2JVDA 4JI3O 2BTOA 4IHJA 3ZRVA 3ABKB 2HJDA 2HEPA 4MT8A 1Q8IA 4K8ZA 1THZA 4RQFA 3JCZA 1Y66A 4KL1A 4PA4A 4KXRA 3H1IH 1W2BU 1MZEA 3I56V 3SYAA 1OCCC 3LSUA 4LC1A 5L3CA 1HNZB 1I94B 4W4KA 3ZN0A 1D5NA 1RFYA 3ZCCA 1IBMB 4CS2A 3HKDB 5ITZB 2LGWA 1VF5B 1SZTA 3JASB 4QE7A 2EULA 1JA8A 3IAYA 2LW1A 1BZKA 1PD3A 3B4SA 4NB5A 4J80A 3K06A 2OCCC 3UT5A 5A9GA 2WLKA 1UFIA 2VS0A 2O57A 1I0HA 4X1IA 2ZNIA 4XDKA 3T1CA 5KX5B 3AK2A 5JVDB 3JAMN 2IBZH 2A9HA 2GUZB 3O9OA 4DV1B 2UUAB 2G38A 1COWG 5LMNB 3CCMV 2HG5C 2UUBO 1HNZO 3E8BA 1I94O 3L75H 1R73A 1GN2A 2Y48A 4LCUC 1IBMO 1G8MA 3CRMA 2ITDC 1H2MA 4DR2O 3TXQA 4J7ZA 2V1DA 2ZR2A 3OTOB 4O4IA 1CP9A 1K4DC 3LDCA 2E5LO 3K9AA 3ZMUA 2Q7GA 1YITV 1S5JA 4WFBV 3HKEA 3SDLA 1YTFD 3ML0A 1MZFA 4I50A 5IDJA 1PNMA 5LL6Y 4AQYB 1XI1A 1RSOB 4DV1O 4PA3A 1EBOA 4LP8A 4UFZA 1VARA 2JRIA 2AW9A 3ZHQA 3R65A 2ZIOA 2QGNA 1PNKA 1JFFA 2Q8VA 4F6RB 2JGUA 5H6QA 1JPXA 1QVFU 1MA1A 2XUMA 3DC5A 1NVPB 4LFBB 2L6LA 1FXKC 3GB7C 4DV7B 2ODMA 4JTCB 4EKWA 3H9VA 2JS5A 2RDCA 2PI5A 1FD9A 4PD4F 2WWWA 3G6BA 1SETA 5BR8O 4JI4O 4WCEV 5EYPB 3HKDA 4FZ1A 1SQPH 1W0KG 5ITZA 5TISZ 1QQCA 3CC2V 3JASA 2EJRA 1AP5A 3AG2C 4FVMA 1PP9H 4MW3A 1VQ5V 3HPLC 1GN4A 2IU0A 3G67A 4J7JA 5GONB 4BIOA 3J80N 4AQYO 1OCOC 1F4NA 1Q81W 4D6TH 4LR3A 4PJ0Z 4DR6B 3BA8A 3W7TA 2UXXA 1M93A 2HHHB 3SJCC 2RN9A 4JAAA 1KP3A 3PN1A 1XNQB 5J2TB 3X2QB 5KX5A 3RYCB 4MVRA 5JVDA 4JAUA 3U0ZA 2ZE8A 4NR1A 4DV7O 2JEXA 5JJNB 2JGDB 2WLIB 1OZ0A 2F93B 2HR3A 2UXNA 1YEWA 3F5TA 3JD1A 2VQFB 5CN0A 5EK0A 1SKVA 2F1MA 1P4RA 1Y67A 3K3WA 1SQQH 2ZM6O 2DYSB 5CB4B 3C3TA 1SC5B 3D3QA 4IT5A 2RNBA 3BABA 4YY3O 1JQ0A 2IJIA 2HHHO 1AR1B 3JAKB 3Q4HB 2EX3A 2FKXA 5IY5C 2N04A 4CC6A 4U3JB 1XL6A 1RSOA 1OCCB 1GN3A 5KMGB 5JJEB 3HKCA 3LUTB 3OW2U 1WAZA 3WU2Z 1NH2B 5EC1C 3ZEDA 4UUJC 2YIAA 2ETNA 3K58A 3CSXA 5IJ0B 1JVMA 4FLWA 4DW0A 1SRYA 1PPJH 2OCCB 2X6AA 2AZ2A 4DXWA 4CBCA 1UPGA 4WFEA 5L3DA 1Q7YW 1NTKH 2ITCC 3TK1A 3CCLV 2H3OA 4X64B 3GWKC 3OGIB 5EYPA 5LHGA 3CE2A 1LUWA 2P22C 1ZWIC 4XDLA 4YIPA 5GONA 4QNHB 4J42A 2E3CA 2P90A 4JV5B 3FKSG 4DV4B 2P5OA 4GX2A 2P4KA 4WFFA 4MTXA 4EFEA 3L72H 1M57B 4TWKA 3CEIA 4DV0O 1SERA 5E79Z 4ABMA 2Q67A 5J2TA 3RYCA 1DK1A 3KZIZ 1KYOF 5B1OA 3AK1A 2QWPB 2ZKOA 1Q86W 2B1GA 3PJSK 4H37A 2EILC 1V54B 4JYBA 4GYCB 4JI1O 3FAVB 2WLIA 1S5HC 1ZAUA 2ADPA 5J9PC 4X1YB 4BW9A 1Q6UA 1XDCA 3N2KB 4J9ZB 2FYUH 3SJQC 5CB4A 3SGIA 5LXTA 1XHZA 1YHQV 3BCCH 4JV5O 1M4UA 1N34O 3OR7C 2F4VB 4B7EA 1ZTEA 3FFQA 5C93A 1IBLB 4KFMA 1MG1A 4PDVA 3WFVA 1S76D 4LFAB 4NXMB 3JAKA 3Q4HA 3VBBA 4Z2WA 5E1AC 1IX9A 5FLXN 1NZ6A 3CPWU 3B77A 3P32A 5FPOA 3OTFA 4U3JA 1FXKB 5KMGA 4U7NA 1EN4A 3CC7V 1HDJA 5CA0B 3NXSA 5KAFZ 1VF6C 4G2KA 1J5EO 2YICA 3K79A 5JQGB 3AG2B 1K4CC 2UXCO 4JTAB 3K57A 5BZBA 3BHPA 5IJ0A 1VQ8V 4H13B 2Y4TA 2AGAA 1B06A 4IGGA 3K5MA 4P9PA 4A5UB 4DV5B 3ZRXA 4RQEA 5IJ9A 3H01A 3ZRWB 4DUYO 4B3RB 1BT8A 1B6QA 4H44B 2YI8A 3G4SV 1KB9F 4DUZO 2Q4PA 3CCVV 1ENVA 4JAVA 1K5SA 1WA8B 1I5XA 3P30A 3ABUA 4J10A 1RP3B 2W0FC 5IYBO 2Q7EA 3OMIB 4FM0A 2JS3A 4DK1A 3O65A 2UU9O 4FLTA 3DTUB 1US6A 1K34A 5FNVB 4LBEC 4UV9A 4HYOA 2XAJA 4OPAA 1U97A 3FAVA 2AZ0A 4GKKB 5IY5B 3N2KA 5BY1A 1G1XB 3ETDA 3JSNA 2ZINA 3CC4V 1OCRC 2EZOA 3OUFA 2UXBB 4DR3B 5B1AC 4WFAV 2XNDG 3D3IA 3ZHVA 3QO7A 4MVSA 2H94A 1I08A 4UCVA 4B3SB 1HR0B 5H6RA 2NLJC 3QO8A 2RCVA 5L3BA 1FXKA 1BHAA 1NKDA 3P3PA 2HKOA 2GBOA 2ILMA 4D7SA 2UUCB 1AJNA 1AI6A 5B3SC 1K33A 1F51A 5DEDA 5CA0A 1KKDA 3OE7G 5CA3A 4GKKO 5JQGA 3OMAB
chains in the Genus database with same CATH topology
1R1BA 4A5UB 4LFBO 3R66A 4JI6O 3J80N 4DR3O 4AQYO 1XEQA 1N36O 2UUCO 4LF9O 4DUYO 5BXZA 3J7AU 4X65O 4GKJO 3T1HO 4LF6O 4KHPO 4JYAO 4DV2O 3JAMN 1AB3A 4JI2O 4X64O 1F7YA 4DUZO 4DV5O 4DV6O 1HR0O 4DV3O 1X59A 4JI0O 1XMOO 3RT3C 4JI8O 1FJGO 1FKAO 4DV0O 4DR6O 3M8AA 4OPHA 2Z0AA 2UUBO 4B3RO 1HNZO 1I94O 1DK1A 1XNRO 1HNWO 2N74A 4DV7O 3O65A 2UU9O 1D2DA 1IBMO 2UXDO 2ZKOA 3J81N 4DV4O 4DR2O 3F5TA 4X66O 5A2QN 5H5NA 4JI7O 1XNQO 4JI5O 1N33O 4JI1O 2UUAO 2ZM6O 4X62O 5LMNO 4OPAA 2E5LO 1HNXO 4B3TO 1FYJA 4JI3O 4LFCO 1KUQA 1G1XB 5BY1A 3SDLA 2VQFO 3T1YO 3OTOO 1R6TA 4YY3O 2HHHO 4JV5O 1N34O 5LL6Y 1A32A 2FKXA 5IWAO 2VQEO 4DV1O 1YZBA 4DR1O 1AILA 4NXNO 5LMUO 2JRIA 5FLXN 1XMQO 4LF7O 4DR4O 4LF5O 1NS1A 2F4VO 1N32O 4DR7O 2UXBO 1IBLO 4OX9O 4LF4O 2DJVA 4DR5O 5IT9N 2DOSA 4LFAO 4NXMO 1J5EO 2LW7A 1IBKO 2UXCO 4K0KO 4B3SO 4JI4O 5BR8O 2AGAA 4YHHO 4B3MO 4GKKO 4LF8O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R1B A;  4A5U B;  4LFB O;  3R66 A;  4JI6 O;  3J80 N;  4DR3 O;  4AQY O;  1XEQ A;  1N36 O;  2UUC O;  4LF9 O;  4DUY O;  5BXZ A;  3J7A U;  4X65 O;  4GKJ O;  3T1H O;  4LF6 O;  4KHP O;  4JYA O;  4DV2 O;  3JAM N;  1AB3 A;  4JI2 O;  4X64 O;  1F7Y A;  4DUZ O;  4DV5 O;  4DV6 O;  1HR0 O;  4DV3 O;  1X59 A;  4JI0 O;  1XMO O;  3RT3 C;  4JI8 O;  1FJG O;  1FKA O;  4DV0 O;  4DR6 O;  3M8A A;  4OPH A;  2Z0A A;  2UUB O;  4B3R O;  1HNZ O;  1I94 O;  1DK1 A;  1XNR O;  1HNW O;  2N74 A;  4DV7 O;  3O65 A;  2UU9 O;  1D2D A;  1IBM O;  2UXD O;  2ZKO A;  3J81 N;  4DV4 O;  4DR2 O;  3F5T A;  4X66 O;  5A2Q N;  5H5N A;  4JI7 O;  1XNQ O;  4JI5 O;  1N33 O;  4JI1 O;  2UUA O;  2ZM6 O;  4X62 O;  5LMN O;  4OPA A;  2E5L O;  1HNX O;  4B3T O;  1FYJ A;  4JI3 O;  4LFC O;  1KUQ A;  1G1X B;  5BY1 A;  3SDL A;  2VQF O;  3T1Y O;  3OTO O;  1R6T A;  4YY3 O;  2HHH O;  4JV5 O;  1N34 O;  5LL6 Y;  1A32 A;  2FKX A;  5IWA O;  2VQE O;  4DV1 O;  1YZB A;  4DR1 O;  1AIL A;  4NXN O;  5LMU O;  2JRI A;  5FLX N;  1XMQ O;  4LF7 O;  4DR4 O;  4LF5 O;  1NS1 A;  2F4V O;  1N32 O;  4DR7 O;  2UXB O;  1IBL O;  4OX9 O;  4LF4 O;  2DJV A;  4DR5 O;  5IT9 N;  2DOS A;  4LFA O;  4NXM O;  1J5E O;  2LW7 A;  1IBK O;  2UXC O;  4K0K O;  4B3S O;  4JI4 O;  5BR8 O;  2AGA A;  4YHH O;  4B3M O;  4GKK O;  4LF8 O; 
#chains in the Genus database with same CATH topology
 3OD4 A;  2JJ1 G;  4AIL C;  4HZ3 A;  2YC0 A;  4DV3 B;  4DR3 O;  1I7F A;  2BOB C;  4OXS A;  1KKC A;  3WB2 A;  1K73 W;  1BGY H;  1XQ8 A;  1BMF G;  1VQN V;  3T1Y B;  1FFX B;  3CCS V;  3ZRW A;  2UXD B;  2R70 A;  1AB3 A;  1HP8 A;  2IM9 A;  1HR0 O;  1KC8 W;  4FLX A;  1FJG O;  1GMG A;  4IYI A;  1QLN A;  4MVU A;  2ZT9 B;  3AG3 B;  3F7Y C;  1WA8 A;  2W0X A;  4OPH A;  3TCU A;  2OYQ A;  2B9Z A;  4X1I B;  4XBF A;  4R8C A;  1GKF A;  2IH1 C;  1ZUQ A;  2JJ2 G;  4X66 O;  2X6C A;  5IYZ B;  1NU1 H;  3BFR A;  1CPY A;  1EZJ A;  2E74 B;  2ZE6 A;  2QM8 A;  5FNV A;  1SQV H;  1LUV A;  4CC5 A;  1JOY A;  3CCU V;  3KCY A;  3UO3 A;  1Q3E A;  2Y4U A;  3A2F A;  2ATK C;  3B8M A;  3T1Y O;  2Y69 C;  3MDS A;  4JI6 B;  1F4M A;  3ASN C;  3OUS A;  1YVW A;  3IJ4 A;  1OCZ C;  3CMA V;  1Q43 A;  4YJ2 B;  3K08 A;  2F66 C;  2HVK C;  3F5W C;  3E8G A;  2MK3 A;  1SES A;  2EIK C;  2KG7 B;  4MVZ A;  4JF3 A;  3SYQ A;  1ARO P;  4I9W A;  4ICG A;  2YDE A;  1Y74 B;  1HWY A;  3DGE A;  3ZBH A;  5EIB D;  2DJV A;  4DR5 O;  1H2L A;  1YXB A;  1W0J G;  1IBK O;  3L73 H;  1GO3 F;  3JSL A;  3KCX A;  1JFF B;  2WLM A;  2CGN A;  3TJT A;  3H1J H;  5F2V O;  2Q7H A;  2GV9 A;  1UJW B;  4JI6 O;  3HKB B;  1ZL8 B;  3JD0 A;  1FS0 G;  2QWQ B;  2F43 G;  2Q73 A;  2YXH A;  1H8E G;  3ICX A;  4ZI7 A;  1VQP V;  2UUB B;  4MW8 A;  3JYC A;  5KA6 A;  3GVM A;  5LP6 C;  1WPX A;  1E79 G;  4DR2 B;  2Q68 A;  4X88 A;  3HR0 A;  1FFX A;  1KBH A;  4DR1 B;  2QSA A;  1SZX A;  4RWU A;  4J9Y B;  3RT3 C;  1FKA O;  1IVS A;  2XOK G;  2W6J G;  2D3O W;  4MS2 A;  1KEC A;  1OHH G;  2E5L B;  4GT1 A;  2CGO A;  3BAA A;  3OT7 A;  1U96 A;  2BCC H;  4RUF A;  3ZMS A;  4DO2 A;  1TA8 A;  2AHZ A;  3ZMZ A;  4FJC C;  1R6K A;  1BHB A;  5IYZ A;  3B40 A;  4GX1 A;  3SJA C;  2QKS A;  2LO1 A;  1FYJ A;  4TT3 G;  5B1A B;  1AI4 A;  3CB2 A;  5GW7 A;  3CXC U;  1XOU A;  4LFC O;  1BE3 H;  3E8F A;  3G6E V;  1WB7 A;  4X20 B;  4N23 A;  5EBW C;  3D36 A;  4JZ2 A;  5B1B C;  3K59 A;  4DR1 O;  1K5Q A;  1YCI A;  2QWR B;  3DSQ A;  4YJ2 A;  1GTO A;  4JI4 B;  2KG7 A;  5BR8 B;  5KUK A;  2QM4 A;  5B3S B;  4RUE A;  1VF6 A;  1IXM A;  1Y74 A;  4FLU A;  4MTF A;  3I55 V;  4K8X A;  2EIJ C;  3HKC B;  1KMI Z;  3CWB H;  1GAX A;  4ZKI A;  3ABM C;  1AR4 A;  2VRZ A;  2Q6A A;  3STZ C;  2WSS G;  2WLN A;  3HKB A;  1ZL8 A;  4QPK A;  4ZBM A;  1URF A;  3CRQ A;  4UB6 Z;  4JYA O;  4C7U A;  1VQM V;  4ZHQ A;  5DM6 V;  5AG2 A;  2A79 B;  3RN4 A;  2ZM6 B;  3EXA A;  3ABT A;  2Z0A A;  1IZ3 A;  4NTX A;  1VQ9 V;  4DR4 B;  4PEL A;  2CTQ A;  3I5D A;  4O4L B;  5FPR A;  4LF4 B;  2CAZ C;  2JIZ G;  3M7M X;  4YY3 B;  1QBZ A;  2P67 A;  4PDM A;  3H1K H;  2IW5 A;  2GTA A;  2Y69 B;  5CBH A;  4K0K B;  3B2E E;  3ASN B;  1OCZ B;  2XTA A;  1HNX O;  2IJK A;  3AEI A;  2OIG A;  5EBL C;  2QEX V;  3QVN A;  2EIK B;  3F7V C;  4QJF B;  2P7T C;  2CUG A;  4LH6 A;  4LWS B;  4X20 A;  3IGA C;  3CS5 A;  1EZV H;  3AG7 A;  1FFT B;  4NVP A;  4NXN O;  4DV2 B;  2ZIM A;  1YIJ V;  3K9S A;  4DR4 O;  5LXT B;  2LP7 A;  1MSW D;  4J11 A;  5K1P A;  3ZMT A;  3W7U A;  3N2G B;  3UQ8 A;  5J2U A;  3WG7 C;  4LF4 O;  3MD0 A;  1SA0 B;  2OIE A;  1NVP D;  2CDY A;  4I4T B;  2F95 B;  1M90 W;  4DK0 A;  1XBL A;  1M56 C;  4K0K O;  4UVB A;  4PA9 A;  4JI7 B;  1FPO A;  1VQK V;  4FZ0 A;  3VOU A;  4X62 B;  2MW2 B;  2ZQM A;  3RYF B;  1Q6H A;  4QE9 A;  5LP6 B;  4DV0 B;  3A8T A;  3J7A U;  4X65 O;  3SPG A;  2C2A A;  2ADQ B;  2CK3 G;  3BPZ A;  4EFB A;  4DV2 O;  2PGG A;  4JI2 O;  2LJ2 A;  3QF7 A;  5JWP A;  4JI1 B;  5IJ9 B;  1BSM A;  2Q69 A;  2LGQ A;  5JJJ B;  4OX9 B;  2WPD G;  5A2Q N;  4JI7 O;  2DWE C;  3ZIA G;  4O4L A;  1IDS A;  1N34 B;  2X7R B;  2HVJ C;  4NTW A;  4X62 O;  1BS3 A;  3A0R A;  2XAS A;  2QDO A;  1GH6 A;  4X1K B;  1DTO A;  3THO A;  4B3M B;  2X6B A;  1H2G A;  4G27 B;  1KUQ A;  4E2L A;  1KU9 A;  4LH7 A;  2QE7 G;  2OTJ V;  1R3L C;  3JD3 A;  5EBM C;  5KHK A;  5EIB C;  5L3G A;  4HNA B;  4GX0 A;  1H2S B;  5JCO C;  2BSK B;  4PI2 A;  1J5E B;  4L8J A;  1XMQ O;  2Q0O C;  3L71 H;  4LWS A;  1IXB A;  2UXC B;  2XAH A;  4X8A A;  2QKC A;  1R3K C;  2WLL A;  1XMO B;  1NH2 D;  2CTW A;  2Y0I A;  3MAQ A;  4OX9 O;  1E1Q G;  1X4T A;  2EIJ B;  3N2G A;  1H2N A;  4O4H B;  2HFE C;  3RW0 A;  2EBO A;  3ABM B;  4DUY B;  1RM1 C;  1YSC A;  1SA0 A;  1EFR G;  3WB1 A;  2LFR A;  3CXH F;  4I4T A;  3JD4 A;  1S72 V;  4B3M O;  2FB5 A;  5KUM A;  1R1B A;  2R9A A;  4DUZ B;  4OGQ B;  3CCR V;  2DQ0 A;  3RYF A;  1M9N A;  2UU9 B;  5LP6 A;  2AHY A;  5GTI Z;  4UVC A;  3AG1 C;  3ABL C;  4Z1V A;  4MVQ A;  3SPC A;  4TOI A;  1OCO B;  1K92 A;  1XMO O;  1PL0 A;  3MHS C;  2XAF A;  1YJ9 V;  3FYE B;  3KKY A;  4CH3 A;  1HNW O;  2N74 A;  5FL7 G;  4B7K A;  1QR9 A;  3NR7 A;  2QWN B;  3ZN1 A;  4E4E A;  1QLE C;  4BIU A;  5KAI Z;  4CZZ A;  3EHB B;  2AXT Z;  3QNE A;  2YXL A;  4K35 A;  5LGT A;  2BTQ B;  5KHG A;  3E86 A;  2L35 A;  2WLH A;  3OGC C;  1JCH A;  4X1K A;  1TAE A;  1A32 A;  3JD2 A;  1S0V A;  4LF9 B;  4UCO A;  1AVM A;  2PI4 A;  3FB6 C;  3E2E A;  4LF6 B;  3FX7 A;  5IYD O;  1Q82 W;  3CCQ V;  4HNA A;  3WG7 B;  2XHB A;  3RYH B;  1GN6 A;  4LF5 O;  4GX5 A;  2NN4 A;  2BSK A;  2ZD9 A;  1AJQ A;  1N32 O;  3LNM B;  4Q6G A;  3K0D A;  2DWD C;  1M56 B;  2ZR3 A;  3JAR B;  3LSS A;  1JR9 A;  2LW7 A;  3K5N A;  1DGS A;  5CBG A;  3DXR B;  3RGB A;  4O4H A;  2E76 B;  5C8Y B;  2FL4 A;  5LOV B;  4YJ3 A;  3TET A;  4FLV A;  4FFK A;  5CA1 A;  1P7B A;  2H8P C;  3UM7 A;  1KD1 W;  3W7W A;  1FJG B;  3K04 A;  4LF9 O;  4I0X B;  1PV0 A;  3E35 A;  4LF6 O;  4HAM A;  5IE9 A;  2ZXW C;  1NR7 A;  3RVY A;  1R3J C;  4X66 B;  2Z3Y A;  3C90 A;  1AP6 A;  1GRJ A;  4JI0 O;  3RWR D;  3UO2 A;  1WN7 A;  4ZI7 B;  4NKG B;  1XNR O;  4F4L A;  1GM8 A;  1BL8 A;  2DN9 A;  1XHX A;  2R9R B;  3E89 A;  5EC2 C;  4TUY B;  4FMT A;  3RYI B;  1V55 C;  4UV8 A;  1WP8 A;  2DE0 X;  5D5P A;  4PHZ A;  4P30 A;  4CH5 A;  3A0B Z;  3FB5 C;  1CEZ A;  4KUM A;  1O9H A;  5H9C A;  2ZE7 A;  2W6I G;  2EIL B;  3APQ A;  1VP7 A;  1R6T A;  1B3Q A;  2BTQ A;  2WAM A;  3CCJ V;  2VQE O;  4DR5 B;  2PY5 A;  3K5O A;  1N0N A;  4U7O A;  3ZS8 C;  1TUB A;  3AG4 C;  1IBK B;  2XAQ A;  3RFR A;  1OJH A;  4GLX A;  2Q5Z A;  3OAA G;  1RM1 B;  3RYH A;  3VQY A;  2YSU B;  4CS3 A;  3OEH G;  1VMG A;  1SQB H;  3BRC A;  3BEH A;  1PL4 A;  2YIB A;  3JAR A;  2OTL V;  5CBF A;  1MAB G;  4ZOL B;  5JH7 B;  3SJB C;  4YHH O;  3ZX6 A;  3DXR A;  4FLZ A;  3L70 H;  1Q6I A;  5C8Y A;  5K1X A;  3X2Q C;  1E1R G;  1WNS A;  4O2A B;  5B5E Z;  5LOV A;  2EJ7 A;  4J7K A;  3AG1 B;  3ABL B;  4WFH A;  4YIO A;  1T5E A;  4I0X A;  1F7Y A;  1W59 A;  1L1F A;  2WLJ A;  4MTO A;  1X59 A;  2E75 B;  2JEU A;  1MNG A;  3SPJ A;  5L3F A;  2EIN C;  5EZY B;  1QLE B;  1R3I C;  1IUR A;  2WA3 A;  4I7Z B;  4LFC B;  1GM9 A;  5LHI A;  2CTP A;  4ZHQ B;  1N33 O;  1BQ0 A;  2GSM B;  4TUY A;  1JMK C;  4UCU A;  2IH3 C;  3RYI A;  3JAL B;  1QU7 A;  3E83 A;  1XL4 A;  5KHH A;  1TGO A;  1HW7 A;  2A06 H;  1YTF B;  4ZIB A;  1J95 A;  1D5A A;  2YS8 A;  3SYC A;  1N36 B;  1VEW A;  5JCO A;  1YZB A;  3E8H A;  3OMN B;  1DF5 A;  2PUS A;  4R50 A;  4MVM A;  3APO A;  1OCR B;  1QHT A;  1NS1 A;  4P2Z A;  2B1I A;  2P6J A;  3BY6 A;  4BIZ A;  2QWO B;  4JI8 B;  3MHH C;  1NTZ H;  1FXV A;  3CRR A;  4H33 A;  3P3N A;  1OV9 A;  2GDS A;  4BAY A;  4IIJ B;  1QR8 A;  5LYJ A;  4JI5 B;  3AK3 A;  4JYA B;  2DYR C;  5J2U B;  4JYY A;  4ZOL A;  4YXW G;  5JH7 A;  3LDD A;  1N36 O;  2JDI G;  1QCE A;  4TV9 B;  1M57 C;  2LFS A;  2ZXW B;  1YDX A;  4JPR A;  1NBM G;  4O2A A;  2YXY A;  1CXZ B;  4FPP A;  1VQL V;  1YF2 A;  2XAG A;  4NYK A;  4TQD A;  4Z1M G;  4D7T A;  5IWA B;  3ZHT A;  5GTH Z;  1V54 C;  1LR1 A;  3FYI B;  4JI8 O;  5LMU B;  1ROP A;  3OEE G;  2KB1 A;  2OWO A;  2DQ3 A;  1V55 B;  3SYP A;  2M6Y A;  1HNX B;  3FD9 A;  1SQF A;  3ZJZ A;  1BCC H;  5EZY A;  1N8R W;  1WP7 A;  3W7X A;  4JI5 O;  3ZRS A;  3GWO A;  2UUA O;  3D8C A;  4EB6 B;  5LMN O;  1Z5V A;  2N05 A;  4K3A A;  1Y6X A;  3IC9 A;  4N21 A;  4NXN B;  3G80 A;  3JAL A;  1G6U A;  4I9Q A;  4LF8 B;  2X0L A;  3JAT B;  4LNU B;  3OTO O;  1EN5 A;  2ZCE A;  3AG4 B;  3VQX A;  5IWA O;  3CYO A;  5DEC A;  1AIL A;  5DN6 G;  5LMU O;  1G4Y B;  1K8A W;  1XUQ A;  3CD6 V;  5LGN A;  2D2C B;  3TXS A;  3H1L H;  4R6Z A;  2RQ6 A;  4UCT A;  1YJW V;  5IT9 N;  4JAS A;  3RVZ A;  2DOS A;  3CCE V;  1S77 D;  2QTS A;  1YI2 V;  3S3W A;  1M1K W;  3OFN G;  4X65 B;  1GM7 A;  4W4L A;  3CX5 F;  5BMV B;  4LF8 O;  2WLL B;  3TGU H;  2GUZ A;  1XIL A;  4JI2 B;  4IIJ A;  4LFB O;  4UCS A;  3R66 A;  1XRE A;  2CTR A;  3OM3 B;  3C3S A;  1BQZ A;  1XEQ A;  1PKX A;  2Q9L A;  3N27 A;  2ZDI C;  2YID A;  3K03 A;  2A7W A;  4I55 B;  3B09 A;  3A0H Z;  1B04 A;  4TV9 A;  1VF7 A;  2EIN B;  2NNU A;  3ZHU A;  1F23 A;  3LDE A;  3CHX A;  1S5L Z;  3H1H H;  1SQG A;  4UB8 Z;  4DR6 O;  3M8A A;  4LF7 B;  3JAW B;  3IFX A;  4G28 B;  3HB3 B;  2BOC C;  3T2M A;  4BR6 A;  1SS3 A;  2V4D A;  3QO5 A;  2P4V A;  2QTO A;  1XNQ O;  1N0J A;  4U3F H;  2ZE5 A;  4MTG A;  4EB6 A;  4EEQ A;  1VQ6 V;  1XMQ B;  1SQX H;  2VQF O;  3VQV A;  2NR5 A;  4F6R A;  3EFF K;  5KHI A;  3JAT A;  1K97 A;  4LNU A;  2WA4 A;  2JK5 C;  2GTS A;  4LF7 O;  4TV8 B;  3ZHS A;  3SPI A;  4JTD B;  2QA4 V;  4FIP C;  1MOF A;  2DW4 A;  2QJ1 A;  1ORQ C;  5B1B B;  1P84 F;  1SF9 A;  1K3E A;  2QKA A;  2EIM C;  2DYR B;  3M99 B;  2XT9 A;  3EVK A;  4FK5 C;  2PTM A;  1VQ7 V;  1NR1 A;  4O4J B;  5H2F Z;  1L0L H;  2F23 A;  4PDL A;  2VWK A;  2K9P A;  1PM9 A;  2GHY A;  3OR6 C;  4RO2 A;  5BMV A;  3S3X A;  4B3T B;  1V9P A;  2KQX A;  3WB0 A;  2FML A;  3ASO C;  1JX9 A;  3AG3 C;  4FLY A;  2RMK B;  1HNW B;  3BVO A;  3FB7 C;  2JGD A;  4QIW F;  4DYL A;  4YJ3 B;  4X64 O;  4FFB B;  4I55 A;  3QG5 A;  1MMM A;  2A3Q A;  4O2B B;  1N4C A;  5CA1 B;  1FXH A;  3G71 V;  1PNL A;  3STL C;  2M7W A;  3CRC A;  1D2D A;  4CS4 A;  4DR7 B;  3J81 N;  4DV4 O;  5HFM A;  3D36 C;  3JAW A;  1KQS U;  5LGU A;  4NTY A;  3KG2 A;  3LNN A;  4PA6 A;  2EZP A;  1ZSP A;  4QPJ A;  5KA5 A;  2IJH A;  3L9D A;  1YJN V;  4B3T O;  1P49 A;  3UCS C;  3ETG A;  1H8H G;  3ETQ A;  4LF5 B;  1Y4M A;  4B08 A;  2K1E A;  3T4Z A;  1N32 B;  2YEV B;  2CH7 B;  1NI8 A;  4BW5 A;  4CH6 A;  1RPO A;  3CJH B;  1LNQ A;  2PZS A;  3T1H B;  2PYJ A;  4KHP B;  1MSD A;  3ABK C;  4MSW C;  1I5Y A;  4XDJ A;  3RBZ A;  1VQO V;  2Q0A A;  4DRX B;  4AHC A;  1WPB A;  4UCR A;  2F4V O;  4DR7 O;  2IU3 A;  3CRA A;  4TV8 A;  1IBL O;  4JYC A;  2P06 A;  4GZR B;  4RAI A;  5HFL A;  3IC7 A;  2ZNJ A;  4IYH A;  4PDR A;  4LFA O;  4NXM O;  2BE3 A;  1TUB B;  4X9Q A;  5B66 Z;  1JJ2 U;  4JGS A;  1AJP A;  4MVO A;  3K5L A;  1H38 A;  5CMU A;  1ZX3 A;  1S3J A;  3DC6 A;  3LSQ A;  4O4J A;  3K0G A;  4JI0 B;  4FM2 A;  5KLV H;  2B5U A;  4QGP A;  3U11 A;  4GCZ A;  1XNR B;  2R9I A;  2R72 A;  3T4D A;  4IL6 Z;  3T1H O;  4FM1 A;  4KHP O;  3CP1 A;  2V7Q G;  4WBN B;  1DLB A;  4HBN A;  4DW1 A;  2Y0P A;  4DV5 O;  1K9M W;  3FB8 C;  5L3E A;  5LA6 B;  2PYL A;  4X1Y A;  4FFB A;  1AR5 A;  4J41 A;  3E22 B;  3SPH A;  1WB8 A;  3SYO A;  4B3R O;  4O2B A;  3ETE A;  3B8N A;  1AI7 A;  4WF9 V;  3QTC A;  4CH4 A;  4UXN A;  1TVK B;  1WJZ A;  1GK9 A;  4BWA A;  4X89 A;  1KP2 A;  3JCU Z;  4WFG A;  1Y76 B;  3W7S A;  4I5S A;  4TSF G;  1Q90 D;  1Z2G A;  2VQE B;  4H0L B;  4IHJ B;  2DMX A;  2ARH A;  1EN6 A;  1VQ4 V;  4PA7 A;  1AI5 A;  1H2K A;  4JZG A;  1QVG U;  2QR4 A;  4GKJ B;  2OCH A;  2YUA A;  2YEV A;  2CH7 A;  5LBQ A;  3ZHR A;  3CJH A;  4GUN A;  2Z5U A;  4UVA A;  5KHJ A;  4DV6 B;  2EIM B;  4YHH B;  2RJZ A;  2UXB O;  2PF4 E;  3CME V;  4DRX A;  4Q20 A;  2YIB D;  1NJI W;  2LQT A;  4PI0 A;  3VQW A;  3UT5 B;  4B3S O;  1QNM A;  1O9G A;  4TQF A;  4F6E A;  4AI8 A;  5B1N A;  3ASO B;  3SR2 C;  1Z5W A;  2HLD G;  2UUC O;  2ZDI A;  1JJO A;  2KSD A;  1EM1 A;  4JI3 B;  1K7D A;  5BXZ A;  1VIB A;  2HJF C;  3UKM A;  4GKJ O;  4ASU G;  5LYJ B;  2YI9 A;  1NQT A;  4P9O A;  4PV1 B;  2OT5 A;  2FTK A;  4DV6 O;  1N33 B;  1DF4 A;  4WBN A;  4DV3 O;  1M5I A;  2CE4 A;  2KKW A;  1L8D A;  5LHH A;  4KP4 A;  2A0L A;  5LA6 A;  2HP8 A;  1R6N A;  3L74 H;  1RPR A;  1L0N H;  2UXD O;  3E22 A;  1ZLZ A;  4O4I B;  5IYC O;  2VWJ A;  1NT2 B;  1NTM H;  5H5N A;  1Q5O A;  3BA9 A;  3U10 A;  1WLE A;  1FAF A;  2QM7 A;  1TVK A;  1TUE B;  1Y76 A;  1P7G A;  3HKE B;  5D5Q A;  4L87 A;  4R7C A;  4I50 B;  3ZMV A;  2IJJ A;  2DYS C;  2JVD A;  4JI3 O;  2BTO A;  4IHJ A;  3ZRV A;  3ABK B;  2HJD A;  2HEP A;  4MT8 A;  1Q8I A;  4K8Z A;  1THZ A;  4RQF A;  3JCZ A;  1Y66 A;  4KL1 A;  4PA4 A;  4KXR A;  3H1I H;  1W2B U;  1MZE A;  3I56 V;  3SYA A;  1OCC C;  3LSU A;  4LC1 A;  5L3C A;  1HNZ B;  1I94 B;  4W4K A;  3ZN0 A;  1D5N A;  1RFY A;  3ZCC A;  1IBM B;  4CS2 A;  3HKD B;  5ITZ B;  2LGW A;  1VF5 B;  1SZT A;  3JAS B;  4QE7 A;  2EUL A;  1JA8 A;  3IAY A;  2LW1 A;  1BZK A;  1PD3 A;  3B4S A;  4NB5 A;  4J80 A;  3K06 A;  2OCC C;  3UT5 A;  5A9G A;  2WLK A;  1UFI A;  2VS0 A;  2O57 A;  1I0H A;  4X1I A;  2ZNI A;  4XDK A;  3T1C A;  5KX5 B;  3AK2 A;  5JVD B;  3JAM N;  2IBZ H;  2A9H A;  2GUZ B;  3O9O A;  4DV1 B;  2UUA B;  2G38 A;  1COW G;  5LMN B;  3CCM V;  2HG5 C;  2UUB O;  1HNZ O;  3E8B A;  1I94 O;  3L75 H;  1R73 A;  1GN2 A;  2Y48 A;  4LCU C;  1IBM O;  1G8M A;  3CRM A;  2ITD C;  1H2M A;  4DR2 O;  3TXQ A;  4J7Z A;  2V1D A;  2ZR2 A;  3OTO B;  4O4I A;  1CP9 A;  1K4D C;  3LDC A;  2E5L O;  3K9A A;  3ZMU A;  2Q7G A;  1YIT V;  1S5J A;  4WFB V;  3HKE A;  3SDL A;  1YTF D;  3ML0 A;  1MZF A;  4I50 A;  5IDJ A;  1PNM A;  5LL6 Y;  4AQY B;  1XI1 A;  1RSO B;  4DV1 O;  4PA3 A;  1EBO A;  4LP8 A;  4UFZ A;  1VAR A;  2JRI A;  2AW9 A;  3ZHQ A;  3R65 A;  2ZIO A;  2QGN A;  1PNK A;  1JFF A;  2Q8V A;  4F6R B;  2JGU A;  5H6Q A;  1JPX A;  1QVF U;  1MA1 A;  2XUM A;  3DC5 A;  1NVP B;  4LFB B;  2L6L A;  1FXK C;  3GB7 C;  4DV7 B;  2ODM A;  4JTC B;  4EKW A;  3H9V A;  2JS5 A;  2RDC A;  2PI5 A;  1FD9 A;  4PD4 F;  2WWW A;  3G6B A;  1SET A;  5BR8 O;  4JI4 O;  4WCE V;  5EYP B;  3HKD A;  4FZ1 A;  1SQP H;  1W0K G;  5ITZ A;  5TIS Z;  1QQC A;  3CC2 V;  3JAS A;  2EJR A;  1AP5 A;  3AG2 C;  4FVM A;  1PP9 H;  4MW3 A;  1VQ5 V;  3HPL C;  1GN4 A;  2IU0 A;  3G67 A;  4J7J A;  5GON B;  4BIO A;  3J80 N;  4AQY O;  1OCO C;  1F4N A;  1Q81 W;  4D6T H;  4LR3 A;  4PJ0 Z;  4DR6 B;  3BA8 A;  3W7T A;  2UXX A;  1M93 A;  2HHH B;  3SJC C;  2RN9 A;  4JAA A;  1KP3 A;  3PN1 A;  1XNQ B;  5J2T B;  3X2Q B;  5KX5 A;  3RYC B;  4MVR A;  5JVD A;  4JAU A;  3U0Z A;  2ZE8 A;  4NR1 A;  4DV7 O;  2JEX A;  5JJN B;  2JGD B;  2WLI B;  1OZ0 A;  2F93 B;  2HR3 A;  2UXN A;  1YEW A;  3F5T A;  3JD1 A;  2VQF B;  5CN0 A;  5EK0 A;  1SKV A;  2F1M A;  1P4R A;  1Y67 A;  3K3W A;  1SQQ H;  2ZM6 O;  2DYS B;  5CB4 B;  3C3T A;  1SC5 B;  3D3Q A;  4IT5 A;  2RNB A;  3BAB A;  4YY3 O;  1JQ0 A;  2IJI A;  2HHH O;  1AR1 B;  3JAK B;  3Q4H B;  2EX3 A;  2FKX A;  5IY5 C;  2N04 A;  4CC6 A;  4U3J B;  1XL6 A;  1RSO A;  1OCC B;  1GN3 A;  5KMG B;  5JJE B;  3HKC A;  3LUT B;  3OW2 U;  1WAZ A;  3WU2 Z;  1NH2 B;  5EC1 C;  3ZED A;  4UUJ C;  2YIA A;  2ETN A;  3K58 A;  3CSX A;  5IJ0 B;  1JVM A;  4FLW A;  4DW0 A;  1SRY A;  1PPJ H;  2OCC B;  2X6A A;  2AZ2 A;  4DXW A;  4CBC A;  1UPG A;  4WFE A;  5L3D A;  1Q7Y W;  1NTK H;  2ITC C;  3TK1 A;  3CCL V;  2H3O A;  4X64 B;  3GWK C;  3OGI B;  5EYP A;  5LHG A;  3CE2 A;  1LUW A;  2P22 C;  1ZWI C;  4XDL A;  4YIP A;  5GON A;  4QNH B;  4J42 A;  2E3C A;  2P90 A;  4JV5 B;  3FKS G;  4DV4 B;  2P5O A;  4GX2 A;  2P4K A;  4WFF A;  4MTX A;  4EFE A;  3L72 H;  1M57 B;  4TWK A;  3CEI A;  4DV0 O;  1SER A;  5E79 Z;  4ABM A;  2Q67 A;  5J2T A;  3RYC A;  1DK1 A;  3KZI Z;  1KYO F;  5B1O A;  3AK1 A;  2QWP B;  2ZKO A;  1Q86 W;  2B1G A;  3PJS K;  4H37 A;  2EIL C;  1V54 B;  4JYB A;  4GYC B;  4JI1 O;  3FAV B;  2WLI A;  1S5H C;  1ZAU A;  2ADP A;  5J9P C;  4X1Y B;  4BW9 A;  1Q6U A;  1XDC A;  3N2K B;  4J9Z B;  2FYU H;  3SJQ C;  5CB4 A;  3SGI A;  5LXT A;  1XHZ A;  1YHQ V;  3BCC H;  4JV5 O;  1M4U A;  1N34 O;  3OR7 C;  2F4V B;  4B7E A;  1ZTE A;  3FFQ A;  5C93 A;  1IBL B;  4KFM A;  1MG1 A;  4PDV A;  3WFV A;  1S76 D;  4LFA B;  4NXM B;  3JAK A;  3Q4H A;  3VBB A;  4Z2W A;  5E1A C;  1IX9 A;  5FLX N;  1NZ6 A;  3CPW U;  3B77 A;  3P32 A;  5FPO A;  3OTF A;  4U3J A;  1FXK B;  5KMG A;  4U7N A;  1EN4 A;  3CC7 V;  1HDJ A;  5CA0 B;  3NXS A;  5KAF Z;  1VF6 C;  4G2K A;  1J5E O;  2YIC A;  3K79 A;  5JQG B;  3AG2 B;  1K4C C;  2UXC O;  4JTA B;  3K57 A;  5BZB A;  3BHP A;  5IJ0 A;  1VQ8 V;  4H13 B;  2Y4T A;  2AGA A;  1B06 A;  4IGG A;  3K5M A;  4P9P A;  4A5U B;  4DV5 B;  3ZRX A;  4RQE A;  5IJ9 A;  3H01 A;  3ZRW B;  4DUY O;  4B3R B;  1BT8 A;  1B6Q A;  4H44 B;  2YI8 A;  3G4S V;  1KB9 F;  4DUZ O;  2Q4P A;  3CCV V;  1ENV A;  4JAV A;  1K5S A;  1WA8 B;  1I5X A;  3P30 A;  3ABU A;  4J10 A;  1RP3 B;  2W0F C;  5IYB O;  2Q7E A;  3OMI B;  4FM0 A;  2JS3 A;  4DK1 A;  3O65 A;  2UU9 O;  4FLT A;  3DTU B;  1US6 A;  1K34 A;  5FNV B;  4LBE C;  4UV9 A;  4HYO A;  2XAJ A;  4OPA A;  1U97 A;  3FAV A;  2AZ0 A;  4GKK B;  5IY5 B;  3N2K A;  5BY1 A;  1G1X B;  3ETD A;  3JSN A;  2ZIN A;  3CC4 V;  1OCR C;  2EZO A;  3OUF A;  2UXB B;  4DR3 B;  5B1A C;  4WFA V;  2XND G;  3D3I A;  3ZHV A;  3QO7 A;  4MVS A;  2H94 A;  1I08 A;  4UCV A;  4B3S B;  1HR0 B;  5H6R A;  2NLJ C;  3QO8 A;  2RCV A;  5L3B A;  1FXK A;  1BHA A;  1NKD A;  3P3P A;  2HKO A;  2GBO A;  2ILM A;  4D7S A;  2UUC B;  1AJN A;  1AI6 A;  5B3S C;  1K33 A;  1F51 A;  5DED A;  5CA0 A;  1KKD A;  3OE7 G;  5CA3 A;  4GKK O;  5JQG A;  3OMA B; 
#chains in the Genus database with same CATH homology
 1R1B A;  4A5U B;  4LFB O;  3R66 A;  4JI6 O;  3J80 N;  4DR3 O;  4AQY O;  1XEQ A;  1N36 O;  2UUC O;  4LF9 O;  4DUY O;  5BXZ A;  3J7A U;  4X65 O;  4GKJ O;  3T1H O;  4LF6 O;  4KHP O;  4JYA O;  4DV2 O;  3JAM N;  1AB3 A;  4JI2 O;  4X64 O;  1F7Y A;  4DUZ O;  4DV5 O;  4DV6 O;  1HR0 O;  4DV3 O;  1X59 A;  4JI0 O;  1XMO O;  3RT3 C;  4JI8 O;  1FJG O;  1FKA O;  4DV0 O;  4DR6 O;  3M8A A;  4OPH A;  2Z0A A;  2UUB O;  4B3R O;  1HNZ O;  1I94 O;  1DK1 A;  1XNR O;  1HNW O;  2N74 A;  4DV7 O;  3O65 A;  2UU9 O;  1D2D A;  1IBM O;  2UXD O;  2ZKO A;  3J81 N;  4DV4 O;  4DR2 O;  3F5T A;  4X66 O;  5A2Q N;  5H5N A;  4JI7 O;  1XNQ O;  4JI5 O;  1N33 O;  4JI1 O;  2UUA O;  2ZM6 O;  4X62 O;  5LMN O;  4OPA A;  2E5L O;  1HNX O;  4B3T O;  1FYJ A;  4JI3 O;  4LFC O;  1KUQ A;  1G1X B;  5BY1 A;  3SDL A;  2VQF O;  3T1Y O;  3OTO O;  1R6T A;  4YY3 O;  2HHH O;  4JV5 O;  1N34 O;  5LL6 Y;  1A32 A;  2FKX A;  5IWA O;  2VQE O;  4DV1 O;  1YZB A;  4DR1 O;  1AIL A;  4NXN O;  5LMU O;  2JRI A;  5FLX N;  1XMQ O;  4LF7 O;  4DR4 O;  4LF5 O;  1NS1 A;  2F4V O;  1N32 O;  4DR7 O;  2UXB O;  1IBL O;  4OX9 O;  4LF4 O;  2DJV A;  4DR5 O;  5IT9 N;  2DOS A;  4LFA O;  4NXM O;  1J5E O;  2LW7 A;  1IBK O;  2UXC O;  4K0K O;  4B3S O;  4JI4 O;  5BR8 O;  2AGA A;  4YHH O;  4B3M O;  4GKK O;  4LF8 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...