1HR0O

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 30
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1hr0O00
2UXDO 1KUQA 5IT9N 1XMOO 5BXZA 2FKXA 4NXMO 1NS1A 4DV2O 3J7AU 4B3RO 4DR5O 5LMNO 1N36O 4B3TO 4JYAO 3RT3C 4DV1O 1I94O 3SDLA 2UU9O 2DJVA 4AQYO 2ZM6O 1XNRO 1R1BA 1R6TA 2ZKOA 2F4VO 2UUCO 5LL6Y 1HNWO 1XMQO 4GKKO 3J80N 1XEQA 4OX9O 4DR1O 4DV7O 4LFBO 4LF4O 5A2QN 1J5EO 1D2DA 1G1XB 4JI5O 1IBKO 2UXBO 4JV5O 1FJGO 4LF9O 4X62O 5LMUO 2AGAA 2UUAO 4YHHO 4KHPO 3JAMN 4LF5O 4JI2O 1HNZO 3OTOO 2UUBO 2N74A 1YZBA 4DR2O 4DV3O 3T1HO 2E5LO 2JRIA 1F7YA 4DV0O 4JI0O 1XNQO 4K0KO 4DR7O 4B3SO 1HR0O 4JI3O 5FLXN 1N32O 1AB3A 4DR6O 2VQEO 1FKAO 1N34O 1A32A 5BY1A 1IBLO 2HHHO 4OPHA 4X64O 1IBMO 4JI4O 4DV5O 2VQFO 4JI6O 4YY3O 3T1YO 3O65A 4LFCO 3F5TA 4X66O 3J81N 4B3MO 5BR8O 4LF7O 3R66A 4DV6O 4JI7O 5IWAO 1N33O 5H5NA 4DUYO 3M8AA 2Z0AA 2UXCO 1X59A 4GKJO 4A5UB 1DK1A 1HNXO 1FYJA 4JI8O 4DR3O 4OPAA 4LF8O 1AILA 4DUZO 2LW7A 4JI1O 4LFAO 4X65O 4DR4O 4NXNO 2DOSA 4DV4O 4LF6O
chains in the Genus database with same CATH superfamily
2UXDO 1KUQA 4GX1A 2EIMC 4HZ3A 4LF9B 1SZXA 4DRXA 4JI6B 3UT5B 2IJKA 3AG3B 5B66Z 4WFBV 1QNMA 1RP3B 4DV1O 5EIBD 3W7SA 4WF9V 3AEIA 3E86A 1AJPA 3SJCC 1PNKA 4JYBA 2DE0X 5E79Z 4JI0B 1K97A 2P06A 1KB9F 3JATB 4X8AA 2HR3A 3KCYA 2EILC 1M56B 2ZD9A 4DW0A 4MTXA 1IBLB 4X64B 5LHHA 4I4TB 1SERA 5CBGA 1DF5A 5KMGB 2Q69A 3AK1A 3ZHTA 3BPZA 2YEVB 1WP7A 4MVRA 1FXKB 2P67A 2YXHA 1AI5A 5CB4A 3RWRD 3U11A 2LFSA 1QQCA 2GDSA 3RW0A 1VF6A 2DWEC 4PELA 2B5UA 2ITDC 1M9NA 3F7YC 3T1YO 5DN6G 4OGQB 1N0NA 3X2QC 3CCQV 3UM7A 4LF7O 1K5QA 5LMNB 5KAFZ 3B4SA 1FD9A 3OEHG 1XL6A 4DUYO 1XNRB 3OUFA 5LOVB 4PI0A 2ZQMA 1EFRG 1K3EA 1WB8A 1OCOB 4LF4B 2X6AA 1FYJA 3K03A 1KD1W 4B08A 2IH1C 2OCHA 2WLIB 3SPIA 1PP9H 3JSNA 3BA9A 1S5LZ 3BCCH 1V55C 4DO2A 5GTIZ 4X62B 1QVFU 2UUAB 3P3NA 3JSLA 5LP6B 4B3RO 1KMIZ 2OCCB 2JS3A 3FAVB 1JR9A 2F23A 2QSAA 4LC1A 4AQYO 3WB0A 4UB6Z 2RJZA 1WPBA 4PA4A 1R1BA 1R6TA 1M1KW 2CDYA 5H6RA 1SETA 4CC5A 1KKCA 1NU1H 4JTDB 2JDIG 3JASB 2V4DA 4OX9O 2M7WA 2W6JG 1EM1A 3P3PA 1VIBA 1IBMB 1QLEC 2Y69C 3K0GA 2UXBO 1TVKB 4O4JB 3C90A 5B1AB 3K08A 2LO1A 1WA8B 1ENVA 1FFXB 5GTHZ 3ABKB 2ZXWB 2UXDB 3VOUA 1TA8A 1YZBA 4PV1B 5KX5B 2GHYA 3JATA 1PM9A 4LR3A 5EYPB 3CJHA 3MDSA 2PUSA 4PDRA 2BTQA 5FL7G 4E4EA 4DV1B 5CBHA 1SZTA 2QWOB 2IJHA 1XI1A 1Y76A 1NJIW 1N34O 1A32A 3D36C 1KECA 1MZFA 3SJQC 1OCZB 3AG2B 4HAMA 3KCXA 5B1BC 4RQFA 3K58A 2IJJA 1EZJA 2B1GA 1Q6IA 3F5TA 5IY5B 1AI7A 5BR8O 2PI5A 1URFA 3SYPA 2UU9B 2H8PC 4X1IB 3OT7A 5B3SC 5CA0B 3BAAA 4IIJA 4J41A 1R6NA 3K0DA 1WJZA 2F4VB 1XILA 4FZ1A 1HDJA 3D8CA 1K7DA 1YEWA 4P2ZA 2FYUH 1WNSA 3GB7C 1QBZA 1JJ2U 3T1CA 2QWPB 3CWBH 3RT3C 1M90W 4IT5A 1SESA 4N21A 2ODMA 1S5JA 3HR0A 2P4VA 5KAIZ 5B1NA 1XDCA 3AG1C 2VQEB 2YIDA 2ATKC 4GZRB 1H2SB 1J5EO 2XT9A 3TK1A 1GM7A 4JI4B 4DV5B 5LGUA 1JPXA 3OE7G 4LF5O 2YIAA 3OTOO 1XL4A 1DLBA 4H44B 2H3OA 4DR2O 4FM0A 1HWYA 3D36A 2JRIA 5CMUA 2IM9A 4WFAV 3NR7A 3L71H 4FFBA 4DR7O 4Z1MG 4AQYB 3WG7C 4DR6O 2IU0A 2DW4A 5JJNB 3ZRWA 2DWDC 1VF5B 1HNXB 2CTPA 1DTOA 1VP7A 1IX9A 4LH7A 2KSDA 1KC8W 1I5YA 3JD0A 1H2KA 2QWNB 4UCUA 4FM2A 1TUEB 3O65A 4RUEA 3FB8C 1GN2A 2XAHA 1KKDA 5J2TB 3IFXA 2YIBD 4J7KA 3OW2U 1WAZA 2D2CB 1BQ0A 4MVUA 3AG4B 4GX0A 2XOKG 1L0LH 4JAUA 3E2EA 2FB5A 3ZHQA 4YIOA 2UXNA 3QTCA 1AILA 1N8RW 4X1KB 4KXRA 4AI8A 2RN9A 2DYSB 4I55B 5LMUB 2FKXA 3N2GB 1Q86W 1R3LC 4DV2O 4DW1A 5CA0A 1N36O 4B3TO 3CS5A 3D3IA 1NTKH 2WPDG 4K35A 4L8JA 1KP3A 4MVMA 1K4DC 2RNBA 1THZA 1K73W 5LXTA 4J7ZA 2Q7EA 2A9HA 2BOBC 4LFBO 1F23A 4P30A 2HFEC 1AJQA 3G4SV 3TXQA 4W4LA 5FNVB 4FK5C 2KG7A 3W7WA 1LNQA 4FLUA 3M7MX 5KUMA 2G38A 4HNAB 3JALA 3UQ8A 5FPOA 2OT5A 4Z1VA 1H8EG 1JFFA 5IWAB 4R8CA 4ZI7A 5LHIA 3Q4HA 3ZMSA 3CRCA 1COWG 1BZKA 1B06A 3B40A 2HHHO 1S0VA 4UCVA 4RAIA 2R9IA 4DR4B 1VQKV 1CP9A 4I50A 3ZRVA 1AJNA 4ASUG 3HKCB 1GN6A 1XOUA 3CRQA 5L3FA 3FYIB 2EULA 3E22B 4NB5A 4DR2B 1RM1C 3ABTA 5A9GA 4PJ0Z 4LFAO 4HYOA 2GSMB 2A79B 2GTAA 2JEUA 4NYKA 1QCEA 3PN1A 1NKDA 2CAZC 1XMOO 4YHHB 4O2BA 4KHPB 4DRXB 1FXVA 4O2AA 1JX9A 1G8MA 1DF4A 3LUTB 4UB8Z 4XDJA 3SYOA 3ZHVA 2EJ7A 4TOIA 3ASOC 3JCUZ 4PA7A 2R72A 3OAAG 2RMKB 4R6ZA 1RPRA 1B3QA 3SPCA 1MMMA 1T5EA 3BY6A 1G1XB 1UPGA 2EINB 1AVMA 4UFZA 4JV5O 2NNUA 1FJGO 1M5IA 4U7NA 3JAMN 4X66B 4HBNA 3B8MA 1HNZO 3RYHA 4PI2A 1GO3F 1CEZA 1BQZA 5J2UA 2WWWA 5H6QA 4DV3O 5CB4B 2PYJA 2LJ2A 4B3TB 4B7KA 1JJOA 3ZS8C 3CC4V 2DN9A 3RFRA 1SQPH 3LDDA 5BY1A 4JI8B 5IYZA 1JOYA 4JF3A 3AK2A 4LFCO 2R9RB 1LR1A 4DYLA 4DR5B 2W6IG 1I94B 4WCEV 1VARA 3VQWA 3O9OA 5C8YA 5CA3A 5IYCO 2P22C 2K9PA 2WAMA 3CRAA 1B6QA 3EXAA 4JI1O 1IBKB 1JA8A 3JARA 1GK9A 3CC7V 2ZNIA 5IJ9A 5ITZA 3IJ4A 3VQXA 3FFQA 4PDVA 2QJ1A 2WLKA 1NI8A 2CTQA 4U3JA 4JYAO 3BVOA 2EILB 2ZM6O 1IZ3A 2Q8VA 2OTJV 4X1YA 1R6KA 5KA6A 4G2KA 2A7WA 3DC6A 1Q82W 4K0KB 1GTOA 4B3SB 3OMAB 1CXZB 3OFNG 1WP8A 5EBMC 5LA6A 4JI5O 5L3GA 2VQFB 4YY3B 3UKMA 3CCSV 5H2FZ 3VQYA 4ZIBA 1Y6XA 2R9AA 3FB6C 4QPKA 2K1EA 2DQ3A 5IYDO 4YIPA 5IJ0A 1Y74A 3B09A 4PA6A 1N33B 3CJHB 3JD2A 2PF4E 2BTQB 4J42A 1VQMV 2XUMA 1G4YB 3SPGA 3ZN0A 4GKJB 1Y76B 2DYRB 4U3FH 5L3BA 4LH6A 4LF8B 1WB7A 4JAVA 4LF6B 5JCOC 3G6EV 3RYCA 1I7FA 5JH7A 4B3MO 1P4RA 3B8NA 1FJGB 3L73H 5IE9A 2OIGA 3IGAC 4FLTA 3K59A 1MNGA 2GUZA 3M8AA 4IIJB 1M4UA 3OTFA 3AG3C 2ZDIC 5DM6V 4DUZO 1H2LA 1SQXH 4R7CA 1WPXA 5JQGA 2HP8A 3A0RA 5BXZA 1BMFG 4NXMO 2W0XA 2QKCA 3T4DA 4DK0A 2BTOA 3A0HZ 2QM4A 4UUJC 3BEHA 1M56C 3GWKC 2UUBB 2P4KA 1PD3A 2VS0A 4J80A 3RYIA 3HKBA 3K5LA 5JVDA 2QTOA 4ABMA 2UUCO 1QLEB 3RVYA 1N32B 3ASNB 1YCIA 4IHJA 3ABUA 1FXKC 2YXYA 3ETGA 4JZ2A 5KHJA 1ZL8A 2Z3YA 5E1AC 3CEIA 4LWSA 5KHIA 1QLNA 4FLYA 2LP7A 4MVOA 2XNDG 5DEDA 4FZ0A 3T2MA 4JI7B 3OM3B 4GUNA 1XNQO 1NR7A 5BMVA 3ETEA 4F4LA 1VQ5V 1OCCC 4FFBB 4XDKA 2YUAA 1N0JA 2Q67A 1IURA 1L0NH 4UCRA 3ZRWB 2OIEA 4NKGB 4OXSA 3CMEV 5HFMA 2XHBA 4FLZA 4X65B 4I9WA 4ZOLA 2Y4UA 3OR7C 3ZHRA 1I5XA 3OEEG 1W59A 2NR5A 4O4LA 3BRCA 2JGUA 1OCOC 4DV6O 4LP8A 2X6BA 1Y4MA 3BFRA 3GWOA 1NTMH 4MVSA 2QM7A 2F95B 2BE3A 3UO3A 5LP6C 3CCJV 4Q6GA 2OCCC 1SQBH 1E1RG 2ADPA 2QWQB 1HP8A 1TGOA 1H38A 1SS3A 1K33A 3G71V 1XREA 4O4IA 4UXNA 2ZNJA 4NVPA 2MW2B 4K3AA 4PDMA 2DJVA 3DXRA 4GYCB 4K8XA 3DC5A 3W7XA 3K04A 3PJSK 3OGIB 5B1AC 2HVKC 2ZCEA 1R3KC 1XMQO 2YSUB 5LXTB 4ZKIA 2VWJA 2PY5A 5H9CA 4DR1O 4DV7O 2IW5A 5A2QN 2R70A 4CH3A 2ZXWC 5K1XA 2GV9A 1NR1A 2ZR2A 3T1YB 3E35A 4CS4A 3CE2A 2VWKA 2KG7B 3ZMTA 2Q0OC 2PGGA 3CC2V 4JI2O 3N2KA 1ZLZA 1GRJA 4XBFA 4LF7B 3JALB 2FTKA 1BCCH 1Q7YW 1F4MA 3E8FA 1OCZC 3AG2C 4J9YB 1JFFB 4UVAA 2E76B 3OMNB 4W4KA 2PZSA 4DUYB 4DV0O 1ZX3A 4ZI7B 1VQ9V 3LDCA 3Q4HB 4I7ZB 5IY5C 3R65A 3T4ZA 2JJ2G 4AILC 3ETDA 2JEXA 3CXHF 1I0HA 2N05A 4G28B 4GCZA 1S76D 5LGTA 3DTUB 3WFVA 1OCRC 3EHBB 4I50B 3J81N 4D7TA 4B3RB 2ILMA 4IL6Z 3FB5C 5IDJA 4FPPA 1BL8A 1SQFA 1YITV 1FS0G 1SF9A 3W7TA 3ZRXA 1MG1A 4GX2A 2WA4A 4X9QA 1YJWV 2BCCH 4OX9B 4NTWA 3VBBA 1XNQB 2F66C 2V7QG 1AI6A 3MHSC 2X7RB 3QNEA 3SGIA 2XTAA 3DSQA 4CS2A 1FXHA 2UXBB 2WLMA 4FM1A 1QVGU 1V54C 2QM8A 1XBLA 3FKSG 3ABMC 2Y0IA 4O2BB 3OUSA 1TAEA 4O2AB 3S3XA 2BSKA 1SQVH 1KBHA 3TETA 2Q6AA 3GVMA 1NQTA 1P7GA 2ZKOA 5BZBA 1HNWO 4GKKO 5D5PA 4TT3G 4N23A 1P84F 3H1HH 4FVMA 3ZIAG 1N34B 4X20A 1FPOA 2Q7HA 3MAQA 1EN6A 1NBMG 1Q5OA 3WB1A 3H1LH 5B1OA 4EEQA 2AHYA 4JPRA 5BR8B 4EFBA 2Y4TA 3RYHB 4ZBMA 3HKEA 5J2UB 1H2GA 3CCMV 2V1DA 1OV9A 1HR0O 3SJAC 1FKAO 2Q68A 4UV9A 4I0XA 1ORQC 1SA0A 3WU2Z 5EC1C 3BABA 1WLEA 1Y66A 5IYZB 4GX5A 3ZMVA 1OHHG 1BS3A 1M57B 3QO5A 3R66A 1PV0A 4MTGA 1RM1B 1VEWA 2E75B 2D3OW 2EIKB 4CH6A 4JTCB 1GM9A 2DQ0A 3ZRSA 3L70H 4EB6A 2DYSC 1NH2D 5C8YB 2KKWA 1D5NA 2A06H 4FFKA 1E1QG 1IVSA 4J10A 1J5EB 4BW9A 4DR3O 1FAFA 4JYCA 4NXNO 4DV4O 2EIJB 5IT9N 2LW1A 3JARB 4UCTA 5IJ9B 5ITZB 2YXLA 4LF5B 2QKSA 1YVWA 3OTOB 4KP4A 2EJRA 4U3JB 1SC5B 2RQ6A 3THOA 1TUBA 1MSDA 5LL6Y 4X1YB 4TSFG 4DR7B 2YS8A 2OWOA 4DR6B 3FYEB 2JGDA 5TISZ 4MTFA 5LA6B 3L9DA 4LF9O 4U7OA 1Y67A 4GLXA 1SRYA 2OYQA 4AHCA 5IJ0B 1Y74B 1YXBA 4JI0O 5EZYA 1YDXA 3CD6V 4JI3O 4IYIA 2CH7A 5GONA 4QJFB 5L3DA 1RPOA 1IBLO 4X64O 3BHPA 4LNUA 4QE9A 4F6EA 4UV8A 5B5EZ 2CE4A 2AXTZ 2IH3C 2ETNA 1NT2B 2Y48A 4EKWA 1YIJV 3MD0A 4DV2B 3RYCB 5JH7B 2KQXA 2AZ0A 1N36B 3JYCA 4FLXA 2QA4V 2ZIOA 4TUYA 2Z5UA 3CPWU 2CGNA 2HJFC 3UO2A 2Z0AA 2GUZB 4WFFA 2M6YA 1X59A 4ICGA 2YICA 1GN4A 1KU9A 4JGSA 4LFBB 1LUWA 1NTZH 1Q3EA 3ZBHA 1H8HG 3K06A 2DOSA 2EBOA 2ARHA 1NH2B 2PYLA 3CMAV 5LYJA 3CHXA 4P9PA 5JQGB 2PI4A 4TQFA 1NS1A 1UJWB 1GN3A 1N4CA 5LMNO 2Y0PA 2UXXA 4C7UA 5LBQA 3ZX6A 4NTXA 4PA3A 2QDOA 5JWPA 2EINC 2F43G 4I5SA 3E89A 3E83A 1XNRO 3RYIB 1VQ4V 3HKBB 2EIMB 4TV9A 3K5NA 3E8BA 4RWUA 5JVDB 3UCSC 3QVNA 3TXSA 2CGOA 5EK0A 4LF4O 4JYYA 3HKDA 1YJNV 2JJ1G 3QG5A 4IHJB 2X0LA 2HHHB 4BIUA 1YF2A 3MHHC 1ZL8B 1U96A 3VQVA 3CXCU 2EZOA 4X62O 4LWSB 1UFIA 2UUAO 1MSWD 3SYAA 3F5WC 3E8HA 5DECA 4YXWG 3CCUV 4NXNB 2AW9A 4BR6A 4D7SA 4JAAA 1EN4A 1VF6C 1EZVH 4PHZA 1P49A 2WLLA 4QPJA 3ZHUA 4TV8A 2ZE5A 2JIZG 3CRMA 2IBZH 2RCVA 5KUKA 4Z2WA 5BMVB 1Q81W 2ZIMA 1NZ6A 3ABLC 1IBMO 1VQPV 4WBNB 4LFAB 3I5DA 1GM8A 4ZOLB 5KA5A 1XMOB 5FPRA 1L1FA 4O4LB 2X6CA 1QHTA 1RSOA 3APOA 4KL1A 4YJ2A 3ZMZA 1VQ6V 1BE3H 1KP2A 3S3WA 4E2LA 3BA8A 4K8ZA 3X2QB 2YI9A 2LGQA 3DGEA 4I9QA 1JQ0A 4MVQA 4RUFA 1IXMA 2FL4A 2LQTA 4JI3B 2FMLA 2ZE7A 4JV5B 4D6TH 1YTFD 1PL4A 1W0KG 4MW3A 5CA1A 1F51A 5GW7A 1HNZB 2ZE8A 1PKXA 4O4IB 2YDEA 3L75H 1QR9A 2UU9O 3JAKA 5K1PA 4DV3B 3DXRB 2WSSG 1V55B 1VMGA 5EC2C 4YJ3A 3CP1A 2C2AA 2F4VO 2L35A 3LNNA 4CC6A 5LHGA 1MA1A 3E8GA 1W0JG 4QE7A 3JAWA 2Q5ZA 2XAQA 3AK3A 3C3TA 4BW5A 4J7JA 1W2BU 4LFCB 3OGCC 4Q20A 3RYFA 2Q9LA 1J95A 2Q7GA 3SPJA 3N2KB 4BIZA 5IYBO 1SQGA 3APQA 2XAGA 3FD9A 2DYRC 1OCCB 2Y69B 4NTYA 2E5LO 1PNLA 1XHZA 1F7YA 3CCLV 1Q6HA 3LNMB 4MSWC 4IYHA 1VQOV 2VQEO 3IAYA 1R3IC 2OTLV 4J11A 4O4HA 5J9PC 4OPHA 1MABG 2ITCC 4JI4O 4JI1B 4H37A 4DV5O 3C3SA 1VF7A 3K5MA 3KG2A 3HPLC 1VQLV 2Q4PA 4JYAB 1LUVA 1WN7A 1S72V 5B1BB 4MT8A 2ZM6B 5JCOA 2H94A 1JVMA 4X89A 3K79A 4R50A 3ZN1A 5L3CA 4WBNA 4MTOA 4FLVA 4ZHQA 1L8DA 1DK1A 1HNXO 2CTWA 3B77A 2WLJA 4L87A 4JI5B 5B3SB 5C93A 1D5AA 3UT5A 3ASNC 3L72H 2ZDIA 1R73A 4MW8A 4MVZA 1YTFB 1H2NA 2BSKB 1AR1B 3RN4A 3NXSA 1K34A 3IC9A 4H13B 2JK5C 2Q73A 3A0BZ 2P90A 2ZE6A 1K9MW 4X20B 4I4TA 4UCSA 5F2VO 2QWRB 3SJBC 3QO8A 5KMGA 5EIBC 5LMUO 1GKFA 2YEVA 3AG1B 4B3MB 1FXKA 2CTRA 3H01A 1Z5WA 4LCUC 2EX3A 3G80A 3HKEB 3P32A 3A8TA 1YSCA 3ABKC 4JZGA 1OZ0A 1GMGA 4KUMA 4QGPA 1OCRB 2ZINA 3CRRA 2LFRA 5FLXN 4CBCA 1HW7A 2EZPA 4X88A 2HG5C 4I0XB 1SA0B 3STLC 3H1JH 2NN4A 4DUZB 2GTSA 2AZ2A 3RBZA 1AR5A 2DMXA 4MS2A 4CS3A 4NXMB 3WG7B 2NLJC 2QTSA 1GAXA 4UVBA 2CUGA 5IWAO 5H5NA 5LOVA 1KQSU 3TGUH 2UUCB 4EB6B 1YJ9V 2E5LB 1Q43A 3QF7A 2ZR3A 4QIWF 1V54B 4H0LB 2WLIA 3ABMB 4PD4F 4DR4O 3D3QA 5KLVH 1S5HC 1IXBA 1BSMA 1SQQH 2ADQB 1S3JA 5JJJB 5LP6A 4UCOA 4F6RB 3A2FA 3FAVA 2P6JA 5JJEB 2WLHA 3W7UA 3IC7A 1TUBB 3JASA 1AR4A 3H1KH 5CBFA 3J80N 4G27B 1XEQA 3H1IH 3ZJZA 2JGDB 2GBOA 1TVKA 4PDLA 1AI4A 4O4JA 3SYCA 2CK3G 1ZTEA 3SYQA 3F7VC 1QR8A 1WA8A 1EN5A 1FFXA 4WFGA 3JCZA 4YHHO 4KHPO 4TWKA 1ROPA 4DV6B 5KX5A 5EBLC 5EYPA 3K9AA 2O57A 2QE7G 2E74B 3M99B 1SKVA 2P7TC 3FX7A 3G6BA 1G6UA 2AHZA 5EZYB 3KZIZ 2F1MA 2HJDA 1F4NA 2CH7B 5GONB 2YI8A 5KHKA 4TQDA 2HLDG 2KB1A 4EFEA 1XHXA 4LNUB 3RVZA 4CH5A 1QU7A 4X66O 2W0FC 4H33A 3B2EE 5EBWC 1I08A 1M93A 2A3QA 2N04A 4X1IA 3K9SA 3OR6C 3KKYA 4QNHB 1JCHA 4TUYB 2YC0A 4KFMA 2UXCO 2RDCA 1XMQB 4A5UB 1S77D 3JD3A 4DR1B 4DV7B 2L6LA 3SR2C 4JI8O 1XUQA 4OPAA 3AG4C 1V9PA 4NR1A 3U10A 1PL0A 1BHAA 2JVDA 5LYJB 1EBOA 4DR5O 2VRZA 4JI2B 3ICXA 2B1IA 2F93B 4FIPC 1I94O 3SDLA 3CSXA 2QGNA 1X4TA 4JASA 3HB3B 4DV0B 4TV9B 3SPHA 2QKAA 3OMIB 5L3EA 1MZEA 3ML0A 3EVKA 3HKDB 1IDSA 3STZC 1R3JC 3K5OA 1IBKO 2QEXV 2A0LA 4RQEA 4F6RA 2WLNA 3ASOB 3I56V 1XQ8A 5KHGA 1CPYA 1U97A 2N74A 2PTMA 4UVCA 5HFLA 3T1HO 2WLLB 3L74H 2XAJA 4TV8B 4K0KO 2HKOA 1M57C 4B3SO 1K92A 3ZEDA 1RFYA 3U0ZA 4B7EA 2WA3A 1AP5A 2EIKC 3P30A 2VQFO 4JI6O 4YY3O 3H9VA 1Q8IA 1VQ7V 1K4CC 2B9ZA 4FJCC 5J2TA 4WFEA 1RSOB 3CX5F 4YJ2B 3CCVV 1N33O 3K3WA 3CB2A 3I55V 4BAYA 3FB7C 1NVPD 4RO2A 2EIJC 5CN0A 1Q90D 3LSUA 1HNWB 2HVJC 4GKKB 4DK1A 4JTAB 4GKJO 3LDEA 4IGGA 2LGWA 4PA9A 1OJHA 1AROP 2IU3A 2Q0AA 4X1KA 3K57A 4FLWA 4DXWA 4LF8O 2LW7A 1VQ8V 2BOCC 2HEPA 4LF6O 4I55A 1FFTB 3N2GA 3J7AU 1ZAUA 1ZUQA 2JS5A 4P9OA 5CA1B 1US6A 4FMTA 4J9ZB 1Z5VA 3LSSA 3JD1A 3JAKB 3WB2A 3ZMUA 1DGSA 3AG7A 4YJ3B 1PNMA 1HR0B 1P7BA 1D2DA 2XASA 1Q6UA 3JAWB 2UXCB 5FNVA 1AP6A 1YI2V 2QR4A 2AGAA 1H2MA 2P5OA 1K5SA 4HNAA 1O9HA 3RYFB 3EFFK 2UUBO 4BWAA 1MOFA 1KYOF 3ETQA 3LSQA 3ZCCA 4XDLA 1E79G 2IJIA 3ABLB 1VQNV 3TJTA 1YHQV 2MK3A 4LBEC 1N32O 1AB3A 2ZT9B 4CH4A 1Z2GA 5AG2A 5LGNA 2XAFA 4O4HB 4DR3B 3OD4A 4DV4B 1JMKC 1ZWIC 1B04A 3ZHSA 3HKCA 4GT1A 3TCUA 1GH6A 3G67A 5D5QA 3CYOA 4JI7O 4BIOA 1BT8A 3QO7A 1O9GA 3E22A 1K8AW 4WFHA 2YIBA 1PPJH 3JD4A 5KHHA 3T1HB 4CZZA 3CCEV 1BHBA 4ZHQB 1NVPB 3N27A 1BGYH 1ZSPA 4X65O 3RGBA 2E3CA 3CCRV
chains in the Genus database with same CATH topology
2UXDO 1KUQA 5IT9N 1XMOO 5BXZA 2FKXA 4NXMO 1NS1A 4DV2O 3J7AU 4B3RO 4DR5O 5LMNO 1N36O 4B3TO 4JYAO 3RT3C 4DV1O 1I94O 3SDLA 2UU9O 2DJVA 4AQYO 2ZM6O 1XNRO 1R1BA 1R6TA 2ZKOA 2F4VO 2UUCO 5LL6Y 1HNWO 1XMQO 4GKKO 3J80N 1XEQA 4OX9O 4DR1O 4DV7O 4LFBO 4LF4O 5A2QN 1J5EO 1D2DA 1G1XB 4JI5O 1IBKO 2UXBO 4JV5O 1FJGO 4LF9O 4X62O 5LMUO 2AGAA 2UUAO 4YHHO 4KHPO 3JAMN 4LF5O 4JI2O 1HNZO 3OTOO 2UUBO 2N74A 1YZBA 4DR2O 4DV3O 3T1HO 2E5LO 2JRIA 1F7YA 4DV0O 4JI0O 1XNQO 4K0KO 4DR7O 4B3SO 1HR0O 4JI3O 5FLXN 1N32O 1AB3A 4DR6O 2VQEO 1FKAO 1N34O 1A32A 5BY1A 1IBLO 2HHHO 4OPHA 4X64O 1IBMO 4JI4O 4DV5O 2VQFO 4JI6O 4YY3O 3T1YO 3O65A 4LFCO 3F5TA 4X66O 3J81N 4B3MO 5BR8O 4LF7O 3R66A 4DV6O 4JI7O 5IWAO 1N33O 5H5NA 4DUYO 3M8AA 2Z0AA 2UXCO 1X59A 4GKJO 4A5UB 1DK1A 1HNXO 1FYJA 4JI8O 4DR3O 4OPAA 4LF8O 1AILA 4DUZO 2LW7A 4JI1O 4LFAO 4X65O 4DR4O 4NXNO 2DOSA 4DV4O 4LF6O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXD O;  1KUQ A;  5IT9 N;  1XMO O;  5BXZ A;  2FKX A;  4NXM O;  1NS1 A;  4DV2 O;  3J7A U;  4B3R O;  4DR5 O;  5LMN O;  1N36 O;  4B3T O;  4JYA O;  3RT3 C;  4DV1 O;  1I94 O;  3SDL A;  2UU9 O;  2DJV A;  4AQY O;  2ZM6 O;  1XNR O;  1R1B A;  1R6T A;  2ZKO A;  2F4V O;  2UUC O;  5LL6 Y;  1HNW O;  1XMQ O;  4GKK O;  3J80 N;  1XEQ A;  4OX9 O;  4DR1 O;  4DV7 O;  4LFB O;  4LF4 O;  5A2Q N;  1J5E O;  1D2D A;  1G1X B;  4JI5 O;  1IBK O;  2UXB O;  4JV5 O;  1FJG O;  4LF9 O;  4X62 O;  5LMU O;  2AGA A;  2UUA O;  4YHH O;  4KHP O;  3JAM N;  4LF5 O;  4JI2 O;  1HNZ O;  3OTO O;  2UUB O;  2N74 A;  1YZB A;  4DR2 O;  4DV3 O;  3T1H O;  2E5L O;  2JRI A;  1F7Y A;  4DV0 O;  4JI0 O;  1XNQ O;  4K0K O;  4DR7 O;  4B3S O;  1HR0 O;  4JI3 O;  5FLX N;  1N32 O;  1AB3 A;  4DR6 O;  2VQE O;  1FKA O;  1N34 O;  1A32 A;  5BY1 A;  1IBL O;  2HHH O;  4OPH A;  4X64 O;  1IBM O;  4JI4 O;  4DV5 O;  2VQF O;  4JI6 O;  4YY3 O;  3T1Y O;  3O65 A;  4LFC O;  3F5T A;  4X66 O;  3J81 N;  4B3M O;  5BR8 O;  4LF7 O;  3R66 A;  4DV6 O;  4JI7 O;  5IWA O;  1N33 O;  5H5N A;  4DUY O;  3M8A A;  2Z0A A;  2UXC O;  1X59 A;  4GKJ O;  4A5U B;  1DK1 A;  1HNX O;  1FYJ A;  4JI8 O;  4DR3 O;  4OPA A;  4LF8 O;  1AIL A;  4DUZ O;  2LW7 A;  4JI1 O;  4LFA O;  4X65 O;  4DR4 O;  4NXN O;  2DOS A;  4DV4 O;  4LF6 O; 
#chains in the Genus database with same CATH topology
 2UXD O;  1KUQ A;  4GX1 A;  2EIM C;  4HZ3 A;  4LF9 B;  1SZX A;  4DRX A;  4JI6 B;  3UT5 B;  2IJK A;  3AG3 B;  5B66 Z;  4WFB V;  1QNM A;  1RP3 B;  4DV1 O;  5EIB D;  3W7S A;  4WF9 V;  3AEI A;  3E86 A;  1AJP A;  3SJC C;  1PNK A;  4JYB A;  2DE0 X;  5E79 Z;  4JI0 B;  1K97 A;  2P06 A;  1KB9 F;  3JAT B;  4X8A A;  2HR3 A;  3KCY A;  2EIL C;  1M56 B;  2ZD9 A;  4DW0 A;  4MTX A;  1IBL B;  4X64 B;  5LHH A;  4I4T B;  1SER A;  5CBG A;  1DF5 A;  5KMG B;  2Q69 A;  3AK1 A;  3ZHT A;  3BPZ A;  2YEV B;  1WP7 A;  4MVR A;  1FXK B;  2P67 A;  2YXH A;  1AI5 A;  5CB4 A;  3RWR D;  3U11 A;  2LFS A;  1QQC A;  2GDS A;  3RW0 A;  1VF6 A;  2DWE C;  4PEL A;  2B5U A;  2ITD C;  1M9N A;  3F7Y C;  3T1Y O;  5DN6 G;  4OGQ B;  1N0N A;  3X2Q C;  3CCQ V;  3UM7 A;  4LF7 O;  1K5Q A;  5LMN B;  5KAF Z;  3B4S A;  1FD9 A;  3OEH G;  1XL6 A;  4DUY O;  1XNR B;  3OUF A;  5LOV B;  4PI0 A;  2ZQM A;  1EFR G;  1K3E A;  1WB8 A;  1OCO B;  4LF4 B;  2X6A A;  1FYJ A;  3K03 A;  1KD1 W;  4B08 A;  2IH1 C;  2OCH A;  2WLI B;  3SPI A;  1PP9 H;  3JSN A;  3BA9 A;  1S5L Z;  3BCC H;  1V55 C;  4DO2 A;  5GTI Z;  4X62 B;  1QVF U;  2UUA B;  3P3N A;  3JSL A;  5LP6 B;  4B3R O;  1KMI Z;  2OCC B;  2JS3 A;  3FAV B;  1JR9 A;  2F23 A;  2QSA A;  4LC1 A;  4AQY O;  3WB0 A;  4UB6 Z;  2RJZ A;  1WPB A;  4PA4 A;  1R1B A;  1R6T A;  1M1K W;  2CDY A;  5H6R A;  1SET A;  4CC5 A;  1KKC A;  1NU1 H;  4JTD B;  2JDI G;  3JAS B;  2V4D A;  4OX9 O;  2M7W A;  2W6J G;  1EM1 A;  3P3P A;  1VIB A;  1IBM B;  1QLE C;  2Y69 C;  3K0G A;  2UXB O;  1TVK B;  4O4J B;  3C90 A;  5B1A B;  3K08 A;  2LO1 A;  1WA8 B;  1ENV A;  1FFX B;  5GTH Z;  3ABK B;  2ZXW B;  2UXD B;  3VOU A;  1TA8 A;  1YZB A;  4PV1 B;  5KX5 B;  2GHY A;  3JAT A;  1PM9 A;  4LR3 A;  5EYP B;  3CJH A;  3MDS A;  2PUS A;  4PDR A;  2BTQ A;  5FL7 G;  4E4E A;  4DV1 B;  5CBH A;  1SZT A;  2QWO B;  2IJH A;  1XI1 A;  1Y76 A;  1NJI W;  1N34 O;  1A32 A;  3D36 C;  1KEC A;  1MZF A;  3SJQ C;  1OCZ B;  3AG2 B;  4HAM A;  3KCX A;  5B1B C;  4RQF A;  3K58 A;  2IJJ A;  1EZJ A;  2B1G A;  1Q6I A;  3F5T A;  5IY5 B;  1AI7 A;  5BR8 O;  2PI5 A;  1URF A;  3SYP A;  2UU9 B;  2H8P C;  4X1I B;  3OT7 A;  5B3S C;  5CA0 B;  3BAA A;  4IIJ A;  4J41 A;  1R6N A;  3K0D A;  1WJZ A;  2F4V B;  1XIL A;  4FZ1 A;  1HDJ A;  3D8C A;  1K7D A;  1YEW A;  4P2Z A;  2FYU H;  1WNS A;  3GB7 C;  1QBZ A;  1JJ2 U;  3T1C A;  2QWP B;  3CWB H;  3RT3 C;  1M90 W;  4IT5 A;  1SES A;  4N21 A;  2ODM A;  1S5J A;  3HR0 A;  2P4V A;  5KAI Z;  5B1N A;  1XDC A;  3AG1 C;  2VQE B;  2YID A;  2ATK C;  4GZR B;  1H2S B;  1J5E O;  2XT9 A;  3TK1 A;  1GM7 A;  4JI4 B;  4DV5 B;  5LGU A;  1JPX A;  3OE7 G;  4LF5 O;  2YIA A;  3OTO O;  1XL4 A;  1DLB A;  4H44 B;  2H3O A;  4DR2 O;  4FM0 A;  1HWY A;  3D36 A;  2JRI A;  5CMU A;  2IM9 A;  4WFA V;  3NR7 A;  3L71 H;  4FFB A;  4DR7 O;  4Z1M G;  4AQY B;  3WG7 C;  4DR6 O;  2IU0 A;  2DW4 A;  5JJN B;  3ZRW A;  2DWD C;  1VF5 B;  1HNX B;  2CTP A;  1DTO A;  1VP7 A;  1IX9 A;  4LH7 A;  2KSD A;  1KC8 W;  1I5Y A;  3JD0 A;  1H2K A;  2QWN B;  4UCU A;  4FM2 A;  1TUE B;  3O65 A;  4RUE A;  3FB8 C;  1GN2 A;  2XAH A;  1KKD A;  5J2T B;  3IFX A;  2YIB D;  4J7K A;  3OW2 U;  1WAZ A;  2D2C B;  1BQ0 A;  4MVU A;  3AG4 B;  4GX0 A;  2XOK G;  1L0L H;  4JAU A;  3E2E A;  2FB5 A;  3ZHQ A;  4YIO A;  2UXN A;  3QTC A;  1AIL A;  1N8R W;  4X1K B;  4KXR A;  4AI8 A;  2RN9 A;  2DYS B;  4I55 B;  5LMU B;  2FKX A;  3N2G B;  1Q86 W;  1R3L C;  4DV2 O;  4DW1 A;  5CA0 A;  1N36 O;  4B3T O;  3CS5 A;  3D3I A;  1NTK H;  2WPD G;  4K35 A;  4L8J A;  1KP3 A;  4MVM A;  1K4D C;  2RNB A;  1THZ A;  1K73 W;  5LXT A;  4J7Z A;  2Q7E A;  2A9H A;  2BOB C;  4LFB O;  1F23 A;  4P30 A;  2HFE C;  1AJQ A;  3G4S V;  3TXQ A;  4W4L A;  5FNV B;  4FK5 C;  2KG7 A;  3W7W A;  1LNQ A;  4FLU A;  3M7M X;  5KUM A;  2G38 A;  4HNA B;  3JAL A;  3UQ8 A;  5FPO A;  2OT5 A;  4Z1V A;  1H8E G;  1JFF A;  5IWA B;  4R8C A;  4ZI7 A;  5LHI A;  3Q4H A;  3ZMS A;  3CRC A;  1COW G;  1BZK A;  1B06 A;  3B40 A;  2HHH O;  1S0V A;  4UCV A;  4RAI A;  2R9I A;  4DR4 B;  1VQK V;  1CP9 A;  4I50 A;  3ZRV A;  1AJN A;  4ASU G;  3HKC B;  1GN6 A;  1XOU A;  3CRQ A;  5L3F A;  3FYI B;  2EUL A;  3E22 B;  4NB5 A;  4DR2 B;  1RM1 C;  3ABT A;  5A9G A;  4PJ0 Z;  4LFA O;  4HYO A;  2GSM B;  2A79 B;  2GTA A;  2JEU A;  4NYK A;  1QCE A;  3PN1 A;  1NKD A;  2CAZ C;  1XMO O;  4YHH B;  4O2B A;  4KHP B;  4DRX B;  1FXV A;  4O2A A;  1JX9 A;  1G8M A;  1DF4 A;  3LUT B;  4UB8 Z;  4XDJ A;  3SYO A;  3ZHV A;  2EJ7 A;  4TOI A;  3ASO C;  3JCU Z;  4PA7 A;  2R72 A;  3OAA G;  2RMK B;  4R6Z A;  1RPR A;  1B3Q A;  3SPC A;  1MMM A;  1T5E A;  3BY6 A;  1G1X B;  1UPG A;  2EIN B;  1AVM A;  4UFZ A;  4JV5 O;  2NNU A;  1FJG O;  1M5I A;  4U7N A;  3JAM N;  4X66 B;  4HBN A;  3B8M A;  1HNZ O;  3RYH A;  4PI2 A;  1GO3 F;  1CEZ A;  1BQZ A;  5J2U A;  2WWW A;  5H6Q A;  4DV3 O;  5CB4 B;  2PYJ A;  2LJ2 A;  4B3T B;  4B7K A;  1JJO A;  3ZS8 C;  3CC4 V;  2DN9 A;  3RFR A;  1SQP H;  3LDD A;  5BY1 A;  4JI8 B;  5IYZ A;  1JOY A;  4JF3 A;  3AK2 A;  4LFC O;  2R9R B;  1LR1 A;  4DYL A;  4DR5 B;  2W6I G;  1I94 B;  4WCE V;  1VAR A;  3VQW A;  3O9O A;  5C8Y A;  5CA3 A;  5IYC O;  2P22 C;  2K9P A;  2WAM A;  3CRA A;  1B6Q A;  3EXA A;  4JI1 O;  1IBK B;  1JA8 A;  3JAR A;  1GK9 A;  3CC7 V;  2ZNI A;  5IJ9 A;  5ITZ A;  3IJ4 A;  3VQX A;  3FFQ A;  4PDV A;  2QJ1 A;  2WLK A;  1NI8 A;  2CTQ A;  4U3J A;  4JYA O;  3BVO A;  2EIL B;  2ZM6 O;  1IZ3 A;  2Q8V A;  2OTJ V;  4X1Y A;  1R6K A;  5KA6 A;  4G2K A;  2A7W A;  3DC6 A;  1Q82 W;  4K0K B;  1GTO A;  4B3S B;  3OMA B;  1CXZ B;  3OFN G;  1WP8 A;  5EBM C;  5LA6 A;  4JI5 O;  5L3G A;  2VQF B;  4YY3 B;  3UKM A;  3CCS V;  5H2F Z;  3VQY A;  4ZIB A;  1Y6X A;  2R9A A;  3FB6 C;  4QPK A;  2K1E A;  2DQ3 A;  5IYD O;  4YIP A;  5IJ0 A;  1Y74 A;  3B09 A;  4PA6 A;  1N33 B;  3CJH B;  3JD2 A;  2PF4 E;  2BTQ B;  4J42 A;  1VQM V;  2XUM A;  1G4Y B;  3SPG A;  3ZN0 A;  4GKJ B;  1Y76 B;  2DYR B;  4U3F H;  5L3B A;  4LH6 A;  4LF8 B;  1WB7 A;  4JAV A;  4LF6 B;  5JCO C;  3G6E V;  3RYC A;  1I7F A;  5JH7 A;  4B3M O;  1P4R A;  3B8N A;  1FJG B;  3L73 H;  5IE9 A;  2OIG A;  3IGA C;  4FLT A;  3K59 A;  1MNG A;  2GUZ A;  3M8A A;  4IIJ B;  1M4U A;  3OTF A;  3AG3 C;  2ZDI C;  5DM6 V;  4DUZ O;  1H2L A;  1SQX H;  4R7C A;  1WPX A;  5JQG A;  2HP8 A;  3A0R A;  5BXZ A;  1BMF G;  4NXM O;  2W0X A;  2QKC A;  3T4D A;  4DK0 A;  2BTO A;  3A0H Z;  2QM4 A;  4UUJ C;  3BEH A;  1M56 C;  3GWK C;  2UUB B;  2P4K A;  1PD3 A;  2VS0 A;  4J80 A;  3RYI A;  3HKB A;  3K5L A;  5JVD A;  2QTO A;  4ABM A;  2UUC O;  1QLE B;  3RVY A;  1N32 B;  3ASN B;  1YCI A;  4IHJ A;  3ABU A;  1FXK C;  2YXY A;  3ETG A;  4JZ2 A;  5KHJ A;  1ZL8 A;  2Z3Y A;  5E1A C;  3CEI A;  4LWS A;  5KHI A;  1QLN A;  4FLY A;  2LP7 A;  4MVO A;  2XND G;  5DED A;  4FZ0 A;  3T2M A;  4JI7 B;  3OM3 B;  4GUN A;  1XNQ O;  1NR7 A;  5BMV A;  3ETE A;  4F4L A;  1VQ5 V;  1OCC C;  4FFB B;  4XDK A;  2YUA A;  1N0J A;  2Q67 A;  1IUR A;  1L0N H;  4UCR A;  3ZRW B;  2OIE A;  4NKG B;  4OXS A;  3CME V;  5HFM A;  2XHB A;  4FLZ A;  4X65 B;  4I9W A;  4ZOL A;  2Y4U A;  3OR7 C;  3ZHR A;  1I5X A;  3OEE G;  1W59 A;  2NR5 A;  4O4L A;  3BRC A;  2JGU A;  1OCO C;  4DV6 O;  4LP8 A;  2X6B A;  1Y4M A;  3BFR A;  3GWO A;  1NTM H;  4MVS A;  2QM7 A;  2F95 B;  2BE3 A;  3UO3 A;  5LP6 C;  3CCJ V;  4Q6G A;  2OCC C;  1SQB H;  1E1R G;  2ADP A;  2QWQ B;  1HP8 A;  1TGO A;  1H38 A;  1SS3 A;  1K33 A;  3G71 V;  1XRE A;  4O4I A;  4UXN A;  2ZNJ A;  4NVP A;  2MW2 B;  4K3A A;  4PDM A;  2DJV A;  3DXR A;  4GYC B;  4K8X A;  3DC5 A;  3W7X A;  3K04 A;  3PJS K;  3OGI B;  5B1A C;  2HVK C;  2ZCE A;  1R3K C;  1XMQ O;  2YSU B;  5LXT B;  4ZKI A;  2VWJ A;  2PY5 A;  5H9C A;  4DR1 O;  4DV7 O;  2IW5 A;  5A2Q N;  2R70 A;  4CH3 A;  2ZXW C;  5K1X A;  2GV9 A;  1NR1 A;  2ZR2 A;  3T1Y B;  3E35 A;  4CS4 A;  3CE2 A;  2VWK A;  2KG7 B;  3ZMT A;  2Q0O C;  2PGG A;  3CC2 V;  4JI2 O;  3N2K A;  1ZLZ A;  1GRJ A;  4XBF A;  4LF7 B;  3JAL B;  2FTK A;  1BCC H;  1Q7Y W;  1F4M A;  3E8F A;  1OCZ C;  3AG2 C;  4J9Y B;  1JFF B;  4UVA A;  2E76 B;  3OMN B;  4W4K A;  2PZS A;  4DUY B;  4DV0 O;  1ZX3 A;  4ZI7 B;  1VQ9 V;  3LDC A;  3Q4H B;  4I7Z B;  5IY5 C;  3R65 A;  3T4Z A;  2JJ2 G;  4AIL C;  3ETD A;  2JEX A;  3CXH F;  1I0H A;  2N05 A;  4G28 B;  4GCZ A;  1S76 D;  5LGT A;  3DTU B;  3WFV A;  1OCR C;  3EHB B;  4I50 B;  3J81 N;  4D7T A;  4B3R B;  2ILM A;  4IL6 Z;  3FB5 C;  5IDJ A;  4FPP A;  1BL8 A;  1SQF A;  1YIT V;  1FS0 G;  1SF9 A;  3W7T A;  3ZRX A;  1MG1 A;  4GX2 A;  2WA4 A;  4X9Q A;  1YJW V;  2BCC H;  4OX9 B;  4NTW A;  3VBB A;  1XNQ B;  2F66 C;  2V7Q G;  1AI6 A;  3MHS C;  2X7R B;  3QNE A;  3SGI A;  2XTA A;  3DSQ A;  4CS2 A;  1FXH A;  2UXB B;  2WLM A;  4FM1 A;  1QVG U;  1V54 C;  2QM8 A;  1XBL A;  3FKS G;  3ABM C;  2Y0I A;  4O2B B;  3OUS A;  1TAE A;  4O2A B;  3S3X A;  2BSK A;  1SQV H;  1KBH A;  3TET A;  2Q6A A;  3GVM A;  1NQT A;  1P7G A;  2ZKO A;  5BZB A;  1HNW O;  4GKK O;  5D5P A;  4TT3 G;  4N23 A;  1P84 F;  3H1H H;  4FVM A;  3ZIA G;  1N34 B;  4X20 A;  1FPO A;  2Q7H A;  3MAQ A;  1EN6 A;  1NBM G;  1Q5O A;  3WB1 A;  3H1L H;  5B1O A;  4EEQ A;  2AHY A;  4JPR A;  5BR8 B;  4EFB A;  2Y4T A;  3RYH B;  4ZBM A;  3HKE A;  5J2U B;  1H2G A;  3CCM V;  2V1D A;  1OV9 A;  1HR0 O;  3SJA C;  1FKA O;  2Q68 A;  4UV9 A;  4I0X A;  1ORQ C;  1SA0 A;  3WU2 Z;  5EC1 C;  3BAB A;  1WLE A;  1Y66 A;  5IYZ B;  4GX5 A;  3ZMV A;  1OHH G;  1BS3 A;  1M57 B;  3QO5 A;  3R66 A;  1PV0 A;  4MTG A;  1RM1 B;  1VEW A;  2E75 B;  2D3O W;  2EIK B;  4CH6 A;  4JTC B;  1GM9 A;  2DQ0 A;  3ZRS A;  3L70 H;  4EB6 A;  2DYS C;  1NH2 D;  5C8Y B;  2KKW A;  1D5N A;  2A06 H;  4FFK A;  1E1Q G;  1IVS A;  4J10 A;  1J5E B;  4BW9 A;  4DR3 O;  1FAF A;  4JYC A;  4NXN O;  4DV4 O;  2EIJ B;  5IT9 N;  2LW1 A;  3JAR B;  4UCT A;  5IJ9 B;  5ITZ B;  2YXL A;  4LF5 B;  2QKS A;  1YVW A;  3OTO B;  4KP4 A;  2EJR A;  4U3J B;  1SC5 B;  2RQ6 A;  3THO A;  1TUB A;  1MSD A;  5LL6 Y;  4X1Y B;  4TSF G;  4DR7 B;  2YS8 A;  2OWO A;  4DR6 B;  3FYE B;  2JGD A;  5TIS Z;  4MTF A;  5LA6 B;  3L9D A;  4LF9 O;  4U7O A;  1Y67 A;  4GLX A;  1SRY A;  2OYQ A;  4AHC A;  5IJ0 B;  1Y74 B;  1YXB A;  4JI0 O;  5EZY A;  1YDX A;  3CD6 V;  4JI3 O;  4IYI A;  2CH7 A;  5GON A;  4QJF B;  5L3D A;  1RPO A;  1IBL O;  4X64 O;  3BHP A;  4LNU A;  4QE9 A;  4F6E A;  4UV8 A;  5B5E Z;  2CE4 A;  2AXT Z;  2IH3 C;  2ETN A;  1NT2 B;  2Y48 A;  4EKW A;  1YIJ V;  3MD0 A;  4DV2 B;  3RYC B;  5JH7 B;  2KQX A;  2AZ0 A;  1N36 B;  3JYC A;  4FLX A;  2QA4 V;  2ZIO A;  4TUY A;  2Z5U A;  3CPW U;  2CGN A;  2HJF C;  3UO2 A;  2Z0A A;  2GUZ B;  4WFF A;  2M6Y A;  1X59 A;  4ICG A;  2YIC A;  1GN4 A;  1KU9 A;  4JGS A;  4LFB B;  1LUW A;  1NTZ H;  1Q3E A;  3ZBH A;  1H8H G;  3K06 A;  2DOS A;  2EBO A;  2ARH A;  1NH2 B;  2PYL A;  3CMA V;  5LYJ A;  3CHX A;  4P9P A;  5JQG B;  2PI4 A;  4TQF A;  1NS1 A;  1UJW B;  1GN3 A;  1N4C A;  5LMN O;  2Y0P A;  2UXX A;  4C7U A;  5LBQ A;  3ZX6 A;  4NTX A;  4PA3 A;  2QDO A;  5JWP A;  2EIN C;  2F43 G;  4I5S A;  3E89 A;  3E83 A;  1XNR O;  3RYI B;  1VQ4 V;  3HKB B;  2EIM B;  4TV9 A;  3K5N A;  3E8B A;  4RWU A;  5JVD B;  3UCS C;  3QVN A;  3TXS A;  2CGO A;  5EK0 A;  4LF4 O;  4JYY A;  3HKD A;  1YJN V;  2JJ1 G;  3QG5 A;  4IHJ B;  2X0L A;  2HHH B;  4BIU A;  1YF2 A;  3MHH C;  1ZL8 B;  1U96 A;  3VQV A;  3CXC U;  2EZO A;  4X62 O;  4LWS B;  1UFI A;  2UUA O;  1MSW D;  3SYA A;  3F5W C;  3E8H A;  5DEC A;  4YXW G;  3CCU V;  4NXN B;  2AW9 A;  4BR6 A;  4D7S A;  4JAA A;  1EN4 A;  1VF6 C;  1EZV H;  4PHZ A;  1P49 A;  2WLL A;  4QPJ A;  3ZHU A;  4TV8 A;  2ZE5 A;  2JIZ G;  3CRM A;  2IBZ H;  2RCV A;  5KUK A;  4Z2W A;  5BMV B;  1Q81 W;  2ZIM A;  1NZ6 A;  3ABL C;  1IBM O;  1VQP V;  4WBN B;  4LFA B;  3I5D A;  1GM8 A;  4ZOL B;  5KA5 A;  1XMO B;  5FPR A;  1L1F A;  4O4L B;  2X6C A;  1QHT A;  1RSO A;  3APO A;  4KL1 A;  4YJ2 A;  3ZMZ A;  1VQ6 V;  1BE3 H;  1KP2 A;  3S3W A;  4E2L A;  3BA8 A;  4K8Z A;  3X2Q B;  2YI9 A;  2LGQ A;  3DGE A;  4I9Q A;  1JQ0 A;  4MVQ A;  4RUF A;  1IXM A;  2FL4 A;  2LQT A;  4JI3 B;  2FML A;  2ZE7 A;  4JV5 B;  4D6T H;  1YTF D;  1PL4 A;  1W0K G;  4MW3 A;  5CA1 A;  1F51 A;  5GW7 A;  1HNZ B;  2ZE8 A;  1PKX A;  4O4I B;  2YDE A;  3L75 H;  1QR9 A;  2UU9 O;  3JAK A;  5K1P A;  4DV3 B;  3DXR B;  2WSS G;  1V55 B;  1VMG A;  5EC2 C;  4YJ3 A;  3CP1 A;  2C2A A;  2F4V O;  2L35 A;  3LNN A;  4CC6 A;  5LHG A;  1MA1 A;  3E8G A;  1W0J G;  4QE7 A;  3JAW A;  2Q5Z A;  2XAQ A;  3AK3 A;  3C3T A;  4BW5 A;  4J7J A;  1W2B U;  4LFC B;  3OGC C;  4Q20 A;  3RYF A;  2Q9L A;  1J95 A;  2Q7G A;  3SPJ A;  3N2K B;  4BIZ A;  5IYB O;  1SQG A;  3APQ A;  2XAG A;  3FD9 A;  2DYR C;  1OCC B;  2Y69 B;  4NTY A;  2E5L O;  1PNL A;  1XHZ A;  1F7Y A;  3CCL V;  1Q6H A;  3LNM B;  4MSW C;  4IYH A;  1VQO V;  2VQE O;  3IAY A;  1R3I C;  2OTL V;  4J11 A;  4O4H A;  5J9P C;  4OPH A;  1MAB G;  2ITC C;  4JI4 O;  4JI1 B;  4H37 A;  4DV5 O;  3C3S A;  1VF7 A;  3K5M A;  3KG2 A;  3HPL C;  1VQL V;  2Q4P A;  4JYA B;  1LUV A;  1WN7 A;  1S72 V;  5B1B B;  4MT8 A;  2ZM6 B;  5JCO A;  2H94 A;  1JVM A;  4X89 A;  3K79 A;  4R50 A;  3ZN1 A;  5L3C A;  4WBN A;  4MTO A;  4FLV A;  4ZHQ A;  1L8D A;  1DK1 A;  1HNX O;  2CTW A;  3B77 A;  2WLJ A;  4L87 A;  4JI5 B;  5B3S B;  5C93 A;  1D5A A;  3UT5 A;  3ASN C;  3L72 H;  2ZDI A;  1R73 A;  4MW8 A;  4MVZ A;  1YTF B;  1H2N A;  2BSK B;  1AR1 B;  3RN4 A;  3NXS A;  1K34 A;  3IC9 A;  4H13 B;  2JK5 C;  2Q73 A;  3A0B Z;  2P90 A;  2ZE6 A;  1K9M W;  4X20 B;  4I4T A;  4UCS A;  5F2V O;  2QWR B;  3SJB C;  3QO8 A;  5KMG A;  5EIB C;  5LMU O;  1GKF A;  2YEV A;  3AG1 B;  4B3M B;  1FXK A;  2CTR A;  3H01 A;  1Z5W A;  4LCU C;  2EX3 A;  3G80 A;  3HKE B;  3P32 A;  3A8T A;  1YSC A;  3ABK C;  4JZG A;  1OZ0 A;  1GMG A;  4KUM A;  4QGP A;  1OCR B;  2ZIN A;  3CRR A;  2LFR A;  5FLX N;  4CBC A;  1HW7 A;  2EZP A;  4X88 A;  2HG5 C;  4I0X B;  1SA0 B;  3STL C;  3H1J H;  2NN4 A;  4DUZ B;  2GTS A;  2AZ2 A;  3RBZ A;  1AR5 A;  2DMX A;  4MS2 A;  4CS3 A;  4NXM B;  3WG7 B;  2NLJ C;  2QTS A;  1GAX A;  4UVB A;  2CUG A;  5IWA O;  5H5N A;  5LOV A;  1KQS U;  3TGU H;  2UUC B;  4EB6 B;  1YJ9 V;  2E5L B;  1Q43 A;  3QF7 A;  2ZR3 A;  4QIW F;  1V54 B;  4H0L B;  2WLI A;  3ABM B;  4PD4 F;  4DR4 O;  3D3Q A;  5KLV H;  1S5H C;  1IXB A;  1BSM A;  1SQQ H;  2ADQ B;  1S3J A;  5JJJ B;  5LP6 A;  4UCO A;  4F6R B;  3A2F A;  3FAV A;  2P6J A;  5JJE B;  2WLH A;  3W7U A;  3IC7 A;  1TUB B;  3JAS A;  1AR4 A;  3H1K H;  5CBF A;  3J80 N;  4G27 B;  1XEQ A;  3H1I H;  3ZJZ A;  2JGD B;  2GBO A;  1TVK A;  4PDL A;  1AI4 A;  4O4J A;  3SYC A;  2CK3 G;  1ZTE A;  3SYQ A;  3F7V C;  1QR8 A;  1WA8 A;  1EN5 A;  1FFX A;  4WFG A;  3JCZ A;  4YHH O;  4KHP O;  4TWK A;  1ROP A;  4DV6 B;  5KX5 A;  5EBL C;  5EYP A;  3K9A A;  2O57 A;  2QE7 G;  2E74 B;  3M99 B;  1SKV A;  2P7T C;  3FX7 A;  3G6B A;  1G6U A;  2AHZ A;  5EZY B;  3KZI Z;  2F1M A;  2HJD A;  1F4N A;  2CH7 B;  5GON B;  2YI8 A;  5KHK A;  4TQD A;  2HLD G;  2KB1 A;  4EFE A;  1XHX A;  4LNU B;  3RVZ A;  4CH5 A;  1QU7 A;  4X66 O;  2W0F C;  4H33 A;  3B2E E;  5EBW C;  1I08 A;  1M93 A;  2A3Q A;  2N04 A;  4X1I A;  3K9S A;  3OR6 C;  3KKY A;  4QNH B;  1JCH A;  4TUY B;  2YC0 A;  4KFM A;  2UXC O;  2RDC A;  1XMQ B;  4A5U B;  1S77 D;  3JD3 A;  4DR1 B;  4DV7 B;  2L6L A;  3SR2 C;  4JI8 O;  1XUQ A;  4OPA A;  3AG4 C;  1V9P A;  4NR1 A;  3U10 A;  1PL0 A;  1BHA A;  2JVD A;  5LYJ B;  1EBO A;  4DR5 O;  2VRZ A;  4JI2 B;  3ICX A;  2B1I A;  2F93 B;  4FIP C;  1I94 O;  3SDL A;  3CSX A;  2QGN A;  1X4T A;  4JAS A;  3HB3 B;  4DV0 B;  4TV9 B;  3SPH A;  2QKA A;  3OMI B;  5L3E A;  1MZE A;  3ML0 A;  3EVK A;  3HKD B;  1IDS A;  3STZ C;  1R3J C;  3K5O A;  1IBK O;  2QEX V;  2A0L A;  4RQE A;  4F6R A;  2WLN A;  3ASO B;  3I56 V;  1XQ8 A;  5KHG A;  1CPY A;  1U97 A;  2N74 A;  2PTM A;  4UVC A;  5HFL A;  3T1H O;  2WLL B;  3L74 H;  2XAJ A;  4TV8 B;  4K0K O;  2HKO A;  1M57 C;  4B3S O;  1K92 A;  3ZED A;  1RFY A;  3U0Z A;  4B7E A;  2WA3 A;  1AP5 A;  2EIK C;  3P30 A;  2VQF O;  4JI6 O;  4YY3 O;  3H9V A;  1Q8I A;  1VQ7 V;  1K4C C;  2B9Z A;  4FJC C;  5J2T A;  4WFE A;  1RSO B;  3CX5 F;  4YJ2 B;  3CCV V;  1N33 O;  3K3W A;  3CB2 A;  3I55 V;  4BAY A;  3FB7 C;  1NVP D;  4RO2 A;  2EIJ C;  5CN0 A;  1Q90 D;  3LSU A;  1HNW B;  2HVJ C;  4GKK B;  4DK1 A;  4JTA B;  4GKJ O;  3LDE A;  4IGG A;  2LGW A;  4PA9 A;  1OJH A;  1ARO P;  2IU3 A;  2Q0A A;  4X1K A;  3K57 A;  4FLW A;  4DXW A;  4LF8 O;  2LW7 A;  1VQ8 V;  2BOC C;  2HEP A;  4LF6 O;  4I55 A;  1FFT B;  3N2G A;  3J7A U;  1ZAU A;  1ZUQ A;  2JS5 A;  4P9O A;  5CA1 B;  1US6 A;  4FMT A;  4J9Z B;  1Z5V A;  3LSS A;  3JD1 A;  3JAK B;  3WB2 A;  3ZMU A;  1DGS A;  3AG7 A;  4YJ3 B;  1PNM A;  1HR0 B;  1P7B A;  1D2D A;  2XAS A;  1Q6U A;  3JAW B;  2UXC B;  5FNV A;  1AP6 A;  1YI2 V;  2QR4 A;  2AGA A;  1H2M A;  2P5O A;  1K5S A;  4HNA A;  1O9H A;  3RYF B;  3EFF K;  2UUB O;  4BWA A;  1MOF A;  1KYO F;  3ETQ A;  3LSQ A;  3ZCC A;  4XDL A;  1E79 G;  2IJI A;  3ABL B;  1VQN V;  3TJT A;  1YHQ V;  2MK3 A;  4LBE C;  1N32 O;  1AB3 A;  2ZT9 B;  4CH4 A;  1Z2G A;  5AG2 A;  5LGN A;  2XAF A;  4O4H B;  4DR3 B;  3OD4 A;  4DV4 B;  1JMK C;  1ZWI C;  1B04 A;  3ZHS A;  3HKC A;  4GT1 A;  3TCU A;  1GH6 A;  3G67 A;  5D5Q A;  3CYO A;  4JI7 O;  4BIO A;  1BT8 A;  3QO7 A;  1O9G A;  3E22 A;  1K8A W;  4WFH A;  2YIB A;  1PPJ H;  3JD4 A;  5KHH A;  3T1H B;  4CZZ A;  3CCE V;  1BHB A;  4ZHQ B;  1NVP B;  3N27 A;  1BGY H;  1ZSP A;  4X65 O;  3RGB A;  2E3C A;  3CCR V; 
#chains in the Genus database with same CATH homology
 2UXD O;  1KUQ A;  5IT9 N;  1XMO O;  5BXZ A;  2FKX A;  4NXM O;  1NS1 A;  4DV2 O;  3J7A U;  4B3R O;  4DR5 O;  5LMN O;  1N36 O;  4B3T O;  4JYA O;  3RT3 C;  4DV1 O;  1I94 O;  3SDL A;  2UU9 O;  2DJV A;  4AQY O;  2ZM6 O;  1XNR O;  1R1B A;  1R6T A;  2ZKO A;  2F4V O;  2UUC O;  5LL6 Y;  1HNW O;  1XMQ O;  4GKK O;  3J80 N;  1XEQ A;  4OX9 O;  4DR1 O;  4DV7 O;  4LFB O;  4LF4 O;  5A2Q N;  1J5E O;  1D2D A;  1G1X B;  4JI5 O;  1IBK O;  2UXB O;  4JV5 O;  1FJG O;  4LF9 O;  4X62 O;  5LMU O;  2AGA A;  2UUA O;  4YHH O;  4KHP O;  3JAM N;  4LF5 O;  4JI2 O;  1HNZ O;  3OTO O;  2UUB O;  2N74 A;  1YZB A;  4DR2 O;  4DV3 O;  3T1H O;  2E5L O;  2JRI A;  1F7Y A;  4DV0 O;  4JI0 O;  1XNQ O;  4K0K O;  4DR7 O;  4B3S O;  1HR0 O;  4JI3 O;  5FLX N;  1N32 O;  1AB3 A;  4DR6 O;  2VQE O;  1FKA O;  1N34 O;  1A32 A;  5BY1 A;  1IBL O;  2HHH O;  4OPH A;  4X64 O;  1IBM O;  4JI4 O;  4DV5 O;  2VQF O;  4JI6 O;  4YY3 O;  3T1Y O;  3O65 A;  4LFC O;  3F5T A;  4X66 O;  3J81 N;  4B3M O;  5BR8 O;  4LF7 O;  3R66 A;  4DV6 O;  4JI7 O;  5IWA O;  1N33 O;  5H5N A;  4DUY O;  3M8A A;  2Z0A A;  2UXC O;  1X59 A;  4GKJ O;  4A5U B;  1DK1 A;  1HNX O;  1FYJ A;  4JI8 O;  4DR3 O;  4OPA A;  4LF8 O;  1AIL A;  4DUZ O;  2LW7 A;  4JI1 O;  4LFA O;  4X65 O;  4DR4 O;  4NXN O;  2DOS A;  4DV4 O;  4LF6 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...