1HR0O

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
total genus 30
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1hr0O00
4X65O 2ZM6O 4DR1O 4JI2O 4KHPO 4DV3O 4YY3O 3M8AA 4B3TO 4B3MO 2UXBO 3T1HO 2UXCO 2Z0AA 4DR5O 4OPAA 4GKKO 1XMOO 4OX9O 1HNWO 1IBLO 4NXNO 4DV0O 5LL6Y 4LFBO 4NXMO 4K0KO 3R66A 3T1YO 4JI8O 2F4VO 1G1XB 2UUCO 4GKJO 1YZBA 3J7AU 5BXZA 1IBKO 3F5TA 1F7YA 4LF4O 4JI3O 4DR4O 1NS1A 4LF9O 4DV5O 5H5NA 1XMQO 4DV4O 1J5EO 4DV2O 5A2QN 4DUZO 4LF6O 1FJGO 2LW7A 1N33O 5IT9N 3J81N 5BY1A 4A5UB 1KUQA 1FYJA 4DR3O 1HNZO 3J80N 4DR7O 3SDLA 1R1BA 4JV5O 4OPHA 4LFAO 2AGAA 4JI5O 5FLXN 3RT3C 2E5LO 4JI6O 4DV7O 4JI4O 1A32A 5LMNO 4DUYO 1HR0O 4LF7O 1IBMO 4JI7O 4AQYO 1N32O 1AB3A 1XNQO 2UUBO 1XEQA 4B3SO 2UUAO 5LMUO 4X62O 1R6TA 4JI1O 1AILA 2N74A 2HHHO 4DV1O 4DV6O 1X59A 4DR6O 2FKXA 1D2DA 2VQEO 3O65A 4JYAO 1N34O 4B3RO 4LF5O 1FKAO 1DK1A 2UXDO 2JRIA 5IWAO 4X64O 4YHHO 2DJVA 4LF8O 2UU9O 4LFCO 2VQFO 3JAMN 1N36O 1HNXO 4DR2O 3OTOO 5BR8O 4JI0O 2ZKOA 2DOSA 4X66O 1XNRO 1I94O
chains in the Genus database with same CATH superfamily
2W6JG 2HVJC 2A7WA 2B9ZA 4JI2O 4YY3O 5KHKA 1FXKC 4X62B 4CZZA 5H6QA 1H8EG 5IY5C 4GLXA 2BSKA 2VWJA 3MAQA 1XMOO 2HHHB 2ETNA 1PD3A 4CS2A 3HKEB 3VOUA 3SGIA 4CH6A 3CS5A 1GM9A 3UKMA 1FXVA 2ADPA 3GWOA 4MW3A 3RYIB 1R3LC 2WLLB 1EFRG 3H1HH 4I50B 4X64B 1F51A 5LHGA 3AK2A 3OM3B 3JATB 4LF4O 5GTHZ 2Q6AA 3ABMB 4PA9A 1XMQO 1VARA 1WP8A 1KKDA 3L74H 1XQ8A 2YEVA 4MVQA 4GX2A 1FFXA 3FB6C 5B1AC 4A5UB 3AG2B 1YITV 1EBOA 2EINC 3J80N 4LP8A 4OPHA 1JOYA 3UO3A 3G6BA 3CJHB 5KUMA 5LYJB 2KB1A 3RT3C 3X2QC 3CCUV 2P4VA 4TUYB 1WA8A 2LFSA 3JD2A 4LBEC 1VQ4V 5CB4B 3EXAA 5FNVA 4EEQA 1QCEA 1OCRB 1V9PA 1N4CA 3LDDA 4CS3A 5LA6A 1NR7A 2VS0A 1Q8IA 4PD4F 1WPBA 1K97A 1AR1B 4O4HA 4LNUA 4N23A 5LGUA 1F23A 2PYLA 1NU1H 2A3QA 2L35A 3UO2A 1GAXA 1X59A 2ARHA 1G6UA 1KMIZ 3SYAA 4DK0A 3RYCB 3O65A 4JYAO 4ZOLB 2AHZA 3NR7A 3K58A 2XAJA 2JRIA 2DJVA 2Q73A 2CGNA 5IYCO 1XL4A 2QWNB 4LF4B 4KUMA 4LF7B 2ZKOA 2AW9A 1AJQA 2BE3A 2IU3A 4JI7B 4ZKIA 3QVNA 3SJCC 2UUBB 4JAAA 4GYCB 5CA1B 4JAUA 4KHPO 4DV3O 5CA3A 3AG2C 1QVGU 1SQBH 4OX9O 4IHJA 1EZJA 1PL0A 3CPWU 5B1BB 2QKAA 4JASA 3VQWA 5LP6A 4BIOA 1R3JC 3SJAC 2DYSB 1NS1A 2HVKC 1YI2V 1VQ5V 5H5NA 1OCRC 2AZ2A 1FXHA 2Y69B 4LF6O 4W4KA 4MT8A 5B3SC 4DR1B 2QE7G 3E8GA 5JH7B 4HZ3A 2AZ0A 4ZI7B 3SPCA 3N2GA 3FB5C 2GHYA 4JYCA 3DC5A 3JARA 3UT5A 1OJHA 2B1IA 1NBMG 5J2UA 3EVKA 4IYHA 3JASA 2XAGA 2V4DA 4RQEA 3WG7C 2V7QG 1WN7A 2DQ3A 3BRCA 1JCHA 1I5XA 3K5NA 1L1FA 1XL6A 1I08A 1S0VA 4TSFG 2QM7A 1F4MA 4RAIA 3BA9A 5EYPA 2PYJA 5JWPA 4U3JA 3E89A 4DR3B 1QHTA 4DR6O 5ITZB 4HBNA 2O57A 1QQCA 2UXNA 2YXLA 1SQGA 4W4LA 1MNGA 3VQVA 4DRXB 4HYOA 1YTFD 5CMUA 2NN4A 1E1QG 1MSWD 5LMNB 1BHAA 5EBWC 3S3XA 3M99B 5B1OA 4DR2O 4O4JA 2QKSA 4PELA 3E86A 1IXBA 4X66O 1HP8A 3E8BA 1QR9A 5HFLA 1I94O 1KECA 2JDIG 3AEIA 3B09A 1YSCA 3K5LA 2BOCC 4YXWG 2FTKA 4BIUA 2QWRB 2P6JA 4NXNO 1SA0B 1FFTB 5LXTB 1YJWV 2ZT9B 5DN6G 4FPPA 3E22B 2PI5A 4I55A 3ZHQA 1Y66A 1NVPD 3ZBHA 3M7MX 4X1KB 1NJIW 1L0NH 1QLNA 1WNSA 4DW1A 1RPRA 2EIMB 3W7SA 4N21A 1VQ9V 3OEEG 1H2GA 4FLZA 1ENVA 1NTKH 4NTYA 4B3TB 4DR7O 5KA5A 1PNLA 4K3AA 4U3FH 1AP6A 3RVZA 2E74B 2XOKG 2P5OA 1VF5B 4FVMA 3I5DA 1CP9A 1JR9A 4G27B 4DR2B 2JVDA 1ZAUA 2BSKB 4J9YB 4FM2A 1I94B 1FS0G 2E3CA 1M56B 4JYBA 2LP7A 2JGUA 1R6TA 4EB6A 1FJGB 4WFEA 1AILA 4DV1O 2XT9A 2K9PA 4IT5A 1S5HC 1VP7A 4B3RO 2YEVB 4X1YA 2IBZH 3CMEV 1FFXB 1U97A 2ZXWB 4Z2WA 3CRMA 3VBBA 4OXSA 1HW7A 2UU9O 2VWKA 2M7WA 2OTJV 2PF4E 2IJHA 2YSUB 1XNQB 2CE4A 4X65O 1R6NA 3W7TA 2UUAB 1WA8B 1G8MA 2X6AA 3BFRA 5FNVB 3S3WA 1BMFG 4CBCA 1R3KC 2Q0OC 4MVRA 3CSXA 3DC6A 5LA6B 4NXMO 3A0BZ 2V1DA 4JI8O 1SQFA 3L70H 4LF5B 1IBKO 5EC1C 2WLMA 2OCCB 4O4HB 3E2EA 4LNUB 2VRZA 3CCQV 4F6EA 4Z1VA 5K1XA 4X9QA 4FLVA 3KKYA 4DV2O 2EIJB 1K4DC 4JZGA 4G28B 5A2QN 1XNRB 5BY1A 4CC6A 2E76B 3DGEA 5LHHA 2CDYA 3SDLA 4B3MB 2UXBB 5DEDA 3FD9A 4B3RB 3QTCA 1THZA 2CH7A 1R3IC 2QEXV 4WFBV 2IU0A 3HPLC 4DO2A 1M1KW 5KMGA 4WFGA 4FMTA 2YIBA 2UU9B 1XREA 2ZXWC 5KAIZ 3P30A 3RYCA 5IDJA 5H9CA 4AQYO 4IHJB 5KAFZ 4X88A 4LR3A 4UCSA 5LGNA 4WFFA 5LP6B 4G2KA 2EIKB 1V55C 3OFNG 4H13B 1AJPA 3ABKC 1Q82W 3K9AA 5FPRA 1M90W 2F95B 3C3SA 3T4ZA 4TV9B 3THOA 3D36A 5L3DA 4DV7B 3ML0A 3ZRVA 2OCCC 4K8XA 1HR0B 3ASOC 1HNXO 3JSLA 5BR8O 2XASA 5CN0A 2LGWA 4UVBA 3JARB 3UT5B 5J2UB 1NR1A 3M8AA 3JASB 4LH6A 1M5IA 1AP5A 4X8AA 1S5JA 1AVMA 4JTAB 1Q6IA 2XAQA 2EX3A 2Q4PA 4HAMA 1XI1A 5JH7A 2H94A 2QKCA 3IJ4A 1XUQA 4ZI7A 1JJOA 4AQYB 1WB8A 5EYPB 4UFZA 4LF8B 2GUZA 2A79B 4LFCB 2EJ7A 4JI3O 1OCOC 4LF9O 3D8CA 1CPYA 1SQXH 3APOA 4WBNA 3ZS8C 2DYRB 1H8HG 2ZM6B 1K4CC 4O4JB 2ILMA 1EZVH 2ZINA 5FLXN 2JS5A 1SZTA 4QJFB 4JI4O 1VQ8V 4D7SA 1HNXB 4EKWA 2LJ2A 3OMIB 3BPZA 2CTWA 1LNQA 2P67A 3L73H 5IY5B 4AHCA 1J5EB 1YEWA 4GX0A 4X62O 2P06A 3LSUA 5CA0A 4I55B 5KUKA 5TISZ 3PN1A 2HHHO 5EC2C 1FD9A 1M57B 4QPJA 2EJRA 4MVMA 4JV5B 2RNBA 1I5YA 2OYQA 1GO3F 1IDSA 1GM7A 4RUFA 3ZHSA 3TETA 1TA8A 3CCJV 4H37A 2E5LB 4X64O 1H2MA 4UCOA 4ICGA 1DF5A 1M9NA 4LF9B 4JF3A 5B1AB 2WA4A 2R9RB 2IW5A 2EINB 3K3WA 4B3SB 4X1KA 3JALA 3OT7A 3RWRD 5LMUB 4HNAB 1URFA 3AG4C 1XHZA 4OPAA 4DV6B 4J7JA 1BHBA 1Z2GA 3QF7A 4AILC 4O4IB 1RSOB 4E4EA 4KP4A 4MS2A 3T1YO 1G1XB 4EB6B 3J7AU 4PJ0Z 3BVOA 2A0LA 1PNKA 1BCCH 4PI0A 1TUBA 3K06A 4MTFA 1AR4A 2Q0AA 4X1YB 4DUZO 3L75H 3ETGA 2DQ0A 3G80A 5KHGA 2M6YA 1QU7A 4J7ZA 3W7WA 1Q86W 3ASNC 4ASUG 1M57C 2AGAA 5C8YB 4EFBA 1Q90D 4K0KB 3K5MA 2PI4A 2HJDA 4FLUA 4UCUA 4LF7O 1WJZA 4JI7O 1AB3A 2UUBO 3P32A 4O2BA 1VIBA 1S5LZ 1OCZC 3B2EE 1E79G 1PL4A 2HG5C 1XBLA 3CCVV 4I5SA 3T1YB 2RQ6A 2N05A 4QIWF 1N34O 1VQKV 2N04A 2QM8A 2YUAA 2BTQB 3CWBH 1DK1A 3HR0A 3MDSA 4E2LA 4NYKA 2W6IG 3SYCA 1S72V 4MVSA 2KQXA 3JAMN 1Z5WA 5B3SB 2DOSA 2CH7B 3KZIZ 4DUZB 1N32B 3I55V 4DR1O 5KMGB 4H33A 1VQOV 1K92A 2HJFC 3KCYA 1XDCA 5KHIA 1SZXA 4TOIA 3B77A 2FB5A 3B4SA 3WG7B 2CAZC 5JQGA 4GZRB 3K03A 2XHBA 1VQ6V 5L3EA 1DTOA 3D3IA 3FB7C 3K57A 3N2KA 4RUEA 3ZHUA 2Q5ZA 3ZCCA 4AI8A 1Y74A 3OAAG 5J2TB 1S77D 2F66C 2ZE7A 1PP9H 1FYJA 4DR3O 1LUVA 2Q7EA 1KP2A 2UXCB 1KQSU 3T1CA 1N34B 5BMVB 3WB1A 1KU9A 1YIJV 3BA8A 4PDLA 4R50A 2FL4A 4JTDB 5LMNO 2F4VB 3CX5F 5DM6V 2QA4V 3CC4V 4TV9A 1R6KA 3GWKC 2G38A 3EHBB 1EN5A 1DLBA 5IYBO 2Y4UA 5E1AC 2GUZB 1UFIA 1HNZB 1L0LH 2ODMA 3WB0A 3OW2U 2PUSA 5JJJB 3G4SV 3JD1A 4WBNB 4UB6Z 5EIBC 5IWAO 4LWSA 5JVDB 2XAFA 4JI6B 3PJSK 3K0DA 5B1NA 2Y48A 2WAMA 3D3QA 4PA4A 3STLC 2DWEC 4FLXA 4JYYA 2HFEC 1BE3H 4B3TO 3D36C 4BAYA 2YI8A 3LNMB 4GUNA 2QSAA 3OMNB 4ZIBA 3LDCA 4I9QA 1MMMA 4UVCA 5LL6Y 4P9OA 3RBZA 2VQEB 5GONA 5CA0B 2QWPB 1W0KG 2HLDG 3G6EV 1PM9A 3F5TA 4J9ZB 2NLJC 5IYDO 3RW0A 3EFFK 1BZKA 2RMKB 2P90A 1OV9A 1FJGO 3J81N 5HFMA 5D5PA 4FFKA 3ZHRA 1GKFA 3K79A 3T1HB 4IL6Z 2JJ1G 3CRRA 4R6ZA 1MZFA 1ZLZA 1WPXA 5LHIA 5IWAB 2EULA 3A2FA 4ZHQA 3H9VA 3JALB 2ZNIA 2D2CB 3IC7A 2YICA 4RQFA 3F7VC 4JTCB 1K7DA 1XNQO 2GBOA 3BY6A 3IFXA 3G71V 2Z3YA 2UUAO 3OGIB 1GRJA 2ZCEA 1N33B 1TUBB 3FYIB 3IC9A 4F6RA 2H3OA 2QTOA 3JSNA 4FK5C 1MSDA 4LF5O 4LFAB 1AR5A 4HNAA 4JI5B 2ZQMA 5IJ9A 4JZ2A 1H2KA 5JJEB 1EM1A 3OTFA 1M93A 2WSSG 1YDXA 4O4IA 1RSOA 1MABG 1H2SB 3U10A 1XNRO 3AK1A 1G4YB 5KHHA 1RM1B 2GSMB 4I4TA 3FYEB 1SQPH 1VF7A 1VEWA 2KKWA 4B3MO 2UXBO 1K9MW 4TT3G 1BS3A 1SC5B 5EK0A 4O2BB 4MTGA 3CC7V 2P22C 4Z1MG 5LOVA 2CTPA 2PGGA 2IH3C 4YHHB 4FFBA 4IYIA 4DXWA 1VQPV 5C8YA 4DYLA 2YIDA 1KP3A 3JYCA 2DN9A 3JD0A 4YIPA 1V55B 2F1MA 2ZDIC 2X6CA 3R65A 4PDRA 3ABKB 3TGUH 1K33A 1S3JA 2LQTA 3O9OA 2BTOA 3ASOB 4OGQB 3DXRA 4DV0B 1IXMA 4DV7O 1BT8A 4MTOA 4J80A 4F4LA 1HR0O 4GKJB 2Q9LA 3K04A 2FMLA 3ETDA 4LCUC 1XOUA 2BTQA 4FLYA 1XEQA 3OGCC 4J11A 2GTAA 4DR4B 2OWOA 3AK3A 5JQGB 3SPIA 2GV9A 1R73A 4U7OA 1RM1C 4XDJA 5H6RA 1D5AA 2KG7A 3N2KB 2ATKC 1Y74B 3VQYA 1RFYA 2HR3A 3CC2V 4JAVA 2Q7HA 4K8ZA 1BQZA 3G67A 1OCOB 1O9GA 1W59A 4NR1A 4LF8O 4D7TA 2F23A 4I0XB 4LFCO 3CYOA 1YJNV 4ABMA 3CCMV 1AJNA 3CEIA 1GN3A 4TV8A 2ZM6O 4FZ0A 5J2TA 3W7XA 1SQQH 3K9SA 2RCVA 5EZYA 4MW8A 4FM1A 5CBFA 4RO2A 3SR2C 5BMVA 1QLEC 3B40A 2WLHA 3E35A 3CCSV 3GB7C 1J5EO 3OTOB 1D5NA 4JI0B 3ZRWA 2WWWA 1IZ3A 1SETA 4LWSB 4WF9V 4P30A 1L8DA 3ZIAG 3BABA 1NZ6A 1YXBA 2ZR3A 4JV5O 4GKKB 1IBLB 3OUSA 1AI4A 2E5LO 1XILA 3CD6V 2X0LA 5LBQA 1VQ7V 3K08A 4UXNA 1NH2B 2WLKA 3H1IH 1E1RG 5JVDA 1AI7A 4YJ3A 1YJ9V 4B3SO 2YIBD 3AG4B 5GONB 5LMUO 1WLEA 4PV1B 4PDMA 1BSMA 3SPHA 4NVPA 4DV6O 1GMGA 1B6QA 4FZ1A 3AG7A 3ZEDA 2WLNA 4XDKA 3LDEA 4GX1A 2L6LA 4CH5A 3AG3B 3MD0A 3BEHA 3K0GA 5JCOC 1VF6C 2P7TC 2R70A 1QR8A 3TJTA 4DUYB 3E83A 2QR4A 2IH1C 1MOFA 1Y6XA 4ZHQB 4GCZA 3AG1C 3ASNB 2WPDG 3SYOA 1T5EA 5F2VO 1WB7A 1I7FA 1KKCA 1US6A 5IE9A 1HNWO 1VMGA 4IGGA 1GN6A 3HKCA 4K0KO 2GDSA 2LW1A 1SKVA 3WU2Z 1ZL8A 4J42A 4F6RB 3FAVA 2YXYA 4L87A 2D3OW 1F7YA 2YIAA 2XAHA 1OCZB 1N36B 3DTUB 5KX5A 2P4KA 3LUTB 5IJ9B 3CCEV 4DK1A 1V54C 2EBOA 1NTZH 4BW5A 2HP8A 3W7UA 1K3EA 1WP7A 3JD3A 1IVSA 2UXXA 2ZDIA 3T4DA 4DR5B 3B8NA 4QPKA 5DECA 5CBGA 1X4TA 1JVMA 4I4TB 1A32A 4GT1A 1YVWA 3AG3C 2UUCB 5L3BA 4YJ2A 4XBFA 1N32O 3ZHTA 3ZJZA 3QO5A 4DV5B 5KHJA 1KBHA 4K35A 5LOVB 2IJIA 4NB5A 3CRCA 4JI1O 1JFFA 2N74A 4I7ZB 2QWQB 2WLIA 4FFBB 1HNWB 1U96A 2OT5A 3H1KH 1Q7YW 1ZX3A 2ZD9A 5EBMC 5GW7A 4PA6A 3UM7A 4NTXA 4JPRA 4DW0A 1H38A 3HKDA 2CGOA 3TXQA 3RYFA 3KCXA 3F7YC 4UCVA 2PY5A 3RN4A 3JAKB 1Q43A 3DXRB 1B3QA 4WFAV 2R72A 2AXTZ 2UXCO 2B1GA 3ZX6A 2IJKA 3MHSC 2JEUA 1SF9A 5K1PA 2F4VO 3L71H 3ETEA 1YZBA 1VQMV 4P9PA 3L9DA 5BXZA 1GH6A 2KG7B 2KSDA 1IX9A 1RPOA 2QDOA 1KC8W 4MVZA 1NT2B 1ZWIC 2NNUA 4NKGB 3FX7A 4MVOA 1JJ2U 3OMAB 3NXSA 3K59A 4CS4A 2Y0PA 4FLWA 3ZMUA 5IT9N 4X20A 4JI1B 4JI2B 4QE9A 4EFEA 4YY3B 1AI6A 1BQ0A 1HNZO 4Q6GA 4O2AA 1XMOB 4TV8B 3ZRSA 4JI6O 2RN9A 5IJ0A 1ZTEA 1COWG 1IBMO 1QBZA 5EZYB 1B06A 1GN4A 2Y4TA 1XMQB 4I0XA 3ZMZA 4O4LA 2JJ2G 3BAAA 3OUFA 4IIJA 3ABTA 1TVKA 3ABMC 3ZN0A 1MA1A 4KL1A 4BIZA 2VQEO 1ROPA 1EN4A 3ZRWB 4UV8A 1OHHG 5BZBA 1Y67A 2LGQA 1GK9A 3VQXA 3WFVA 5JJNB 2PZSA 2RDCA 2X6BA 2BOBC 5JCOA 1VF6A 3CCLV 2F93B 3CRAA 3ICXA 3JAWA 3TK1A 4CH3A 1S76D 1O9HA 2ZIOA 2MK3A 1GM8A 4FM0A 3T1HO 3UCSC 3SJQC 1Y76A 2Q69A 3IGAC 3H1LH 4YJ3B 5EBLC 4UUJC 3R66A 4JYAB 1IBMB 1SESA 2ZE6A 1K5SA 2ZNJA 3HKBA 4PA3A 1Z5VA 3UQ8A 4DV4O 3ETQA 5AG2A 3ZHVA 3CHXA 2HEPA 4P2ZA 1N33O 5C93A 2YI9A 4KHPB 4DV3B 2W0FC 5IYZA 1P49A 3RGBA 3BCCH 5FPOA 1Q3EA 5FL7G 4LFAO 4JI5O 1GN2A 4H44B 2C2AA 4OX9B 3QO8A 2W0XA 3Q4HA 2JS3A 4UCRA 3STZC 3C3TA 5B1BC 1QNMA 4D6TH 3CXHF 3HKCB 1N0NA 1P4RA 3KG2A 2JK5C 1ZL8B 4PDVA 1TAEA 1Q81W 2DYSC 4LF6B 2K1EA 4B7EA 3FAVB 4TQDA 1KD1W 2Y69C 1MG1A 5L3CA 3QO7A 1SRYA 5KX5B 2B5UA 3L72H 1VQLV 4BW9A 2IM9A 1FXKA 1AI5A 2Q68A 4YHHO 3FB8C 5D5QA 1JMKC 1P7GA 5LGTA 3E8HA 2WA3A 4PI2A 3RYHB 4DV4B 1VQNV 2ZE8A 2H8PC 1BL8A 2DWDC 1IURA 3GVMA 4QE7A 1F4NA 4QNHB 3CP1A 4FJCC 5E79Z 1PPJH 2Z0AA 4YJ2B 3SYQA 4NTWA 1N0JA 4DV0O 4DR6B 3LSQA 4FLTA 1QVFU 4FIPC 4GKJO 1NH2D 3ZN1A 1B04A 1JFFB 2WLIB 1K73W 4UVAA 4B7KA 1HDJA 1CXZB 2OIEA 4DR4O 2WLJA 3RFRA 5GTIZ 2JGDA 2QTSA 1FPOA 1P7BA 3OR7C 4X66B 1K34A 3U0ZA 3CXCU 2XUMA 3MHHC 3HKDB 2OIGA 4X1IA 3RYFB 1R1BA 2GTSA 1WAZA 2QGNA 1H2NA 4NXNB 1M4UA 4Q20A 5CBHA 4MVUA 2XTAA 2X7RB 4TWKA 1EN6A 2RJZA 2R9IA 3F5WC 3HKEA 4U7NA 1RP3B 1BGYH 3OD4A 2DE0X 3B8MA 3ZMSA 3RYIA 2EIMC 2WLLA 3JAKA 3ZMVA 4I50A 3ABLB 3TCUA 3JATA 1D2DA 4DR7B 1NI8A 1QLEB 3TXSA 2QM4A 1LUWA 2LO1A 4X20B 4QGPA 3CB2A 4L8JA 2EZPA 3OTOO 4JI0O 4CH4A 4O2AB 4J41A 2PTMA 3CJHA 1CEZA 3I56V 5LYJA 4TUYA 5IJ0B 2XNDG 1TUEB 1M56C 3BHPA 5CB4A 4YIOA 4GKKO 1LR1A 3H1JH 4UV9A 4DV1B 1K5QA 3N27A 1IBLO 2CK3G 4LFBO 4PA7A 2YDEA 1K8AW 4O4LB 4IIJB 4LC1A 1TVKB 4KXRA 4I9WA 3IAYA 4XDLA 3RVYA 3OEHG 1YTFB 3JCZA 2R9AA 3ZMTA 1NTMH 1NKDA 1AROP 1YCIA 4ZOLA 3OR6C 5KLVH 1XHXA 2LW7A 1ZUQA 1YHQV 4X65B 2ITCC 1KUQA 2F43G 3LNNA 3CRQA 4R8CA 3T2MA 3ABLC 2FYUH 1SQVH 2YS8A 1H2LA 1ZSPA 2Q67A 1OCCB 3JAWB 5CA1A 4NXMB 1JX9A 4WFHA 4JI8B 4DUYO 3E8FA 4X89A 5A9GA 1IBKB 1Q6UA 3AG1B 1NVPB 2DW4A 2ITDC 4J10A 5J9PC 1Y76B 2QWOB 4UB8Z 1N8RW 4H0LB 1Q5OA 4DV2B 3N2GB 2JIZG 4GX5A 5B5EZ 2YXHA 3FFQA 1HWYA 2EIJC 2EILB 3HKBB 2Q7GA 2A06H 3HB3B 4LFBB 1Y4MA 2BCCH 1I0HA 2E75B 1SS3A 3P3PA 2CUGA 3SPGA 2ZR2A 5KA6A 2UXDO 4MTXA 1NQTA 5IYZB 2A9HA 2VQFO 3CCRV 4C7UA 1N36O 2QJ1A 3WB2A 1JQ0A 3SJBC 1V54B 3JD4A 2JEXA 3QG5A 4U3JB 1P84F 3Q4HB 1FAFA 2OCHA 4JGSA 2ADQB 4J7KA 5EIBD 4DR5O 3A0RA 2LFRA 4BWAA 1W2BU 1SERA 5LP6C 3DSQA 2EIKC 1OCCC 2EZOA 2UUCO 4CC5A 1UJWB 3CMAV 2IJJA 4ZBMA 3APQA 1UPGA 1YF2A 4DV5O 5ITZA 5BR8B 2OTLV 4DRXA 4PHZA 4RWUA 1FXKB 1PKXA 3JCUZ 3C90A 1DF4A 3QNEA 3SPJA 2EILC 3ABUA 1Q6HA 1KYOF 2Z5UA 3CE2A 1MZEA 1OZ0A 2UXDB 2CTQA 4R7CA 3A0HZ 1JA8A 3H01A 2VQFB 1W0JG 2ZE5A 2ZIMA 4UCTA 1DGSA 4MSWC 2DMXA 1JPXA 3ZRXA 2CTRA 4JI3B 1SA0A 2HKOA 3SYPA 5LXTA 3A8TA 1GTOA 1PV0A 3U11A 4LH7A 3RYHA 3P3NA 3LSSA 3E22A 4KFMA 5B66Z 3FKSG 3OE7G 2AHYA 2FKXA 2JGDB 5H2FZ 2MW2B 2DYRC 5L3FA 2NR5A 4WCEV 3X2QB 1FKAO 1PNMA 3K5OA 1KB9F 1ORQC 2Y0IA 1TGOA 4JI4B 2YC0A 5L3GA 2Q8VA 4X1IB 4TQFA 4BR6A 4B08A 1J95A
chains in the Genus database with same CATH topology
4X65O 2ZM6O 4DR1O 4JI2O 4KHPO 4DV3O 4YY3O 3M8AA 4B3TO 4B3MO 2UXBO 3T1HO 2UXCO 2Z0AA 4DR5O 4OPAA 4GKKO 1XMOO 4OX9O 1HNWO 1IBLO 4NXNO 4DV0O 5LL6Y 4LFBO 4NXMO 4K0KO 3R66A 3T1YO 4JI8O 2F4VO 1G1XB 2UUCO 4GKJO 1YZBA 3J7AU 5BXZA 1IBKO 3F5TA 1F7YA 4LF4O 4JI3O 4DR4O 1NS1A 4LF9O 4DV5O 5H5NA 1XMQO 4DV4O 1J5EO 4DV2O 5A2QN 4DUZO 4LF6O 1FJGO 2LW7A 1N33O 5IT9N 3J81N 5BY1A 4A5UB 1KUQA 1FYJA 4DR3O 1HNZO 3J80N 4DR7O 3SDLA 1R1BA 4JV5O 4OPHA 4LFAO 2AGAA 4JI5O 5FLXN 3RT3C 2E5LO 4JI6O 4DV7O 4JI4O 1A32A 5LMNO 4DUYO 1HR0O 4LF7O 1IBMO 4JI7O 4AQYO 1N32O 1AB3A 1XNQO 2UUBO 1XEQA 4B3SO 2UUAO 5LMUO 4X62O 1R6TA 4JI1O 1AILA 2N74A 2HHHO 4DV1O 4DV6O 1X59A 4DR6O 2FKXA 1D2DA 2VQEO 3O65A 4JYAO 1N34O 4B3RO 4LF5O 1FKAO 1DK1A 2UXDO 2JRIA 5IWAO 4X64O 4YHHO 2DJVA 4LF8O 2UU9O 4LFCO 2VQFO 3JAMN 1N36O 1HNXO 4DR2O 3OTOO 5BR8O 4JI0O 2ZKOA 2DOSA 4X66O 1XNRO 1I94O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X65 O;  2ZM6 O;  4DR1 O;  4JI2 O;  4KHP O;  4DV3 O;  4YY3 O;  3M8A A;  4B3T O;  4B3M O;  2UXB O;  3T1H O;  2UXC O;  2Z0A A;  4DR5 O;  4OPA A;  4GKK O;  1XMO O;  4OX9 O;  1HNW O;  1IBL O;  4NXN O;  4DV0 O;  5LL6 Y;  4LFB O;  4NXM O;  4K0K O;  3R66 A;  3T1Y O;  4JI8 O;  2F4V O;  1G1X B;  2UUC O;  4GKJ O;  1YZB A;  3J7A U;  5BXZ A;  1IBK O;  3F5T A;  1F7Y A;  4LF4 O;  4JI3 O;  4DR4 O;  1NS1 A;  4LF9 O;  4DV5 O;  5H5N A;  1XMQ O;  4DV4 O;  1J5E O;  4DV2 O;  5A2Q N;  4DUZ O;  4LF6 O;  1FJG O;  2LW7 A;  1N33 O;  5IT9 N;  3J81 N;  5BY1 A;  4A5U B;  1KUQ A;  1FYJ A;  4DR3 O;  1HNZ O;  3J80 N;  4DR7 O;  3SDL A;  1R1B A;  4JV5 O;  4OPH A;  4LFA O;  2AGA A;  4JI5 O;  5FLX N;  3RT3 C;  2E5L O;  4JI6 O;  4DV7 O;  4JI4 O;  1A32 A;  5LMN O;  4DUY O;  1HR0 O;  4LF7 O;  1IBM O;  4JI7 O;  4AQY O;  1N32 O;  1AB3 A;  1XNQ O;  2UUB O;  1XEQ A;  4B3S O;  2UUA O;  5LMU O;  4X62 O;  1R6T A;  4JI1 O;  1AIL A;  2N74 A;  2HHH O;  4DV1 O;  4DV6 O;  1X59 A;  4DR6 O;  2FKX A;  1D2D A;  2VQE O;  3O65 A;  4JYA O;  1N34 O;  4B3R O;  4LF5 O;  1FKA O;  1DK1 A;  2UXD O;  2JRI A;  5IWA O;  4X64 O;  4YHH O;  2DJV A;  4LF8 O;  2UU9 O;  4LFC O;  2VQF O;  3JAM N;  1N36 O;  1HNX O;  4DR2 O;  3OTO O;  5BR8 O;  4JI0 O;  2ZKO A;  2DOS A;  4X66 O;  1XNR O;  1I94 O; 
#chains in the Genus database with same CATH topology
 2W6J G;  2HVJ C;  2A7W A;  2B9Z A;  4JI2 O;  4YY3 O;  5KHK A;  1FXK C;  4X62 B;  4CZZ A;  5H6Q A;  1H8E G;  5IY5 C;  4GLX A;  2BSK A;  2VWJ A;  3MAQ A;  1XMO O;  2HHH B;  2ETN A;  1PD3 A;  4CS2 A;  3HKE B;  3VOU A;  3SGI A;  4CH6 A;  3CS5 A;  1GM9 A;  3UKM A;  1FXV A;  2ADP A;  3GWO A;  4MW3 A;  3RYI B;  1R3L C;  2WLL B;  1EFR G;  3H1H H;  4I50 B;  4X64 B;  1F51 A;  5LHG A;  3AK2 A;  3OM3 B;  3JAT B;  4LF4 O;  5GTH Z;  2Q6A A;  3ABM B;  4PA9 A;  1XMQ O;  1VAR A;  1WP8 A;  1KKD A;  3L74 H;  1XQ8 A;  2YEV A;  4MVQ A;  4GX2 A;  1FFX A;  3FB6 C;  5B1A C;  4A5U B;  3AG2 B;  1YIT V;  1EBO A;  2EIN C;  3J80 N;  4LP8 A;  4OPH A;  1JOY A;  3UO3 A;  3G6B A;  3CJH B;  5KUM A;  5LYJ B;  2KB1 A;  3RT3 C;  3X2Q C;  3CCU V;  2P4V A;  4TUY B;  1WA8 A;  2LFS A;  3JD2 A;  4LBE C;  1VQ4 V;  5CB4 B;  3EXA A;  5FNV A;  4EEQ A;  1QCE A;  1OCR B;  1V9P A;  1N4C A;  3LDD A;  4CS3 A;  5LA6 A;  1NR7 A;  2VS0 A;  1Q8I A;  4PD4 F;  1WPB A;  1K97 A;  1AR1 B;  4O4H A;  4LNU A;  4N23 A;  5LGU A;  1F23 A;  2PYL A;  1NU1 H;  2A3Q A;  2L35 A;  3UO2 A;  1GAX A;  1X59 A;  2ARH A;  1G6U A;  1KMI Z;  3SYA A;  4DK0 A;  3RYC B;  3O65 A;  4JYA O;  4ZOL B;  2AHZ A;  3NR7 A;  3K58 A;  2XAJ A;  2JRI A;  2DJV A;  2Q73 A;  2CGN A;  5IYC O;  1XL4 A;  2QWN B;  4LF4 B;  4KUM A;  4LF7 B;  2ZKO A;  2AW9 A;  1AJQ A;  2BE3 A;  2IU3 A;  4JI7 B;  4ZKI A;  3QVN A;  3SJC C;  2UUB B;  4JAA A;  4GYC B;  5CA1 B;  4JAU A;  4KHP O;  4DV3 O;  5CA3 A;  3AG2 C;  1QVG U;  1SQB H;  4OX9 O;  4IHJ A;  1EZJ A;  1PL0 A;  3CPW U;  5B1B B;  2QKA A;  4JAS A;  3VQW A;  5LP6 A;  4BIO A;  1R3J C;  3SJA C;  2DYS B;  1NS1 A;  2HVK C;  1YI2 V;  1VQ5 V;  5H5N A;  1OCR C;  2AZ2 A;  1FXH A;  2Y69 B;  4LF6 O;  4W4K A;  4MT8 A;  5B3S C;  4DR1 B;  2QE7 G;  3E8G A;  5JH7 B;  4HZ3 A;  2AZ0 A;  4ZI7 B;  3SPC A;  3N2G A;  3FB5 C;  2GHY A;  4JYC A;  3DC5 A;  3JAR A;  3UT5 A;  1OJH A;  2B1I A;  1NBM G;  5J2U A;  3EVK A;  4IYH A;  3JAS A;  2XAG A;  2V4D A;  4RQE A;  3WG7 C;  2V7Q G;  1WN7 A;  2DQ3 A;  3BRC A;  1JCH A;  1I5X A;  3K5N A;  1L1F A;  1XL6 A;  1I08 A;  1S0V A;  4TSF G;  2QM7 A;  1F4M A;  4RAI A;  3BA9 A;  5EYP A;  2PYJ A;  5JWP A;  4U3J A;  3E89 A;  4DR3 B;  1QHT A;  4DR6 O;  5ITZ B;  4HBN A;  2O57 A;  1QQC A;  2UXN A;  2YXL A;  1SQG A;  4W4L A;  1MNG A;  3VQV A;  4DRX B;  4HYO A;  1YTF D;  5CMU A;  2NN4 A;  1E1Q G;  1MSW D;  5LMN B;  1BHA A;  5EBW C;  3S3X A;  3M99 B;  5B1O A;  4DR2 O;  4O4J A;  2QKS A;  4PEL A;  3E86 A;  1IXB A;  4X66 O;  1HP8 A;  3E8B A;  1QR9 A;  5HFL A;  1I94 O;  1KEC A;  2JDI G;  3AEI A;  3B09 A;  1YSC A;  3K5L A;  2BOC C;  4YXW G;  2FTK A;  4BIU A;  2QWR B;  2P6J A;  4NXN O;  1SA0 B;  1FFT B;  5LXT B;  1YJW V;  2ZT9 B;  5DN6 G;  4FPP A;  3E22 B;  2PI5 A;  4I55 A;  3ZHQ A;  1Y66 A;  1NVP D;  3ZBH A;  3M7M X;  4X1K B;  1NJI W;  1L0N H;  1QLN A;  1WNS A;  4DW1 A;  1RPR A;  2EIM B;  3W7S A;  4N21 A;  1VQ9 V;  3OEE G;  1H2G A;  4FLZ A;  1ENV A;  1NTK H;  4NTY A;  4B3T B;  4DR7 O;  5KA5 A;  1PNL A;  4K3A A;  4U3F H;  1AP6 A;  3RVZ A;  2E74 B;  2XOK G;  2P5O A;  1VF5 B;  4FVM A;  3I5D A;  1CP9 A;  1JR9 A;  4G27 B;  4DR2 B;  2JVD A;  1ZAU A;  2BSK B;  4J9Y B;  4FM2 A;  1I94 B;  1FS0 G;  2E3C A;  1M56 B;  4JYB A;  2LP7 A;  2JGU A;  1R6T A;  4EB6 A;  1FJG B;  4WFE A;  1AIL A;  4DV1 O;  2XT9 A;  2K9P A;  4IT5 A;  1S5H C;  1VP7 A;  4B3R O;  2YEV B;  4X1Y A;  2IBZ H;  3CME V;  1FFX B;  1U97 A;  2ZXW B;  4Z2W A;  3CRM A;  3VBB A;  4OXS A;  1HW7 A;  2UU9 O;  2VWK A;  2M7W A;  2OTJ V;  2PF4 E;  2IJH A;  2YSU B;  1XNQ B;  2CE4 A;  4X65 O;  1R6N A;  3W7T A;  2UUA B;  1WA8 B;  1G8M A;  2X6A A;  3BFR A;  5FNV B;  3S3W A;  1BMF G;  4CBC A;  1R3K C;  2Q0O C;  4MVR A;  3CSX A;  3DC6 A;  5LA6 B;  4NXM O;  3A0B Z;  2V1D A;  4JI8 O;  1SQF A;  3L70 H;  4LF5 B;  1IBK O;  5EC1 C;  2WLM A;  2OCC B;  4O4H B;  3E2E A;  4LNU B;  2VRZ A;  3CCQ V;  4F6E A;  4Z1V A;  5K1X A;  4X9Q A;  4FLV A;  3KKY A;  4DV2 O;  2EIJ B;  1K4D C;  4JZG A;  4G28 B;  5A2Q N;  1XNR B;  5BY1 A;  4CC6 A;  2E76 B;  3DGE A;  5LHH A;  2CDY A;  3SDL A;  4B3M B;  2UXB B;  5DED A;  3FD9 A;  4B3R B;  3QTC A;  1THZ A;  2CH7 A;  1R3I C;  2QEX V;  4WFB V;  2IU0 A;  3HPL C;  4DO2 A;  1M1K W;  5KMG A;  4WFG A;  4FMT A;  2YIB A;  2UU9 B;  1XRE A;  2ZXW C;  5KAI Z;  3P30 A;  3RYC A;  5IDJ A;  5H9C A;  4AQY O;  4IHJ B;  5KAF Z;  4X88 A;  4LR3 A;  4UCS A;  5LGN A;  4WFF A;  5LP6 B;  4G2K A;  2EIK B;  1V55 C;  3OFN G;  4H13 B;  1AJP A;  3ABK C;  1Q82 W;  3K9A A;  5FPR A;  1M90 W;  2F95 B;  3C3S A;  3T4Z A;  4TV9 B;  3THO A;  3D36 A;  5L3D A;  4DV7 B;  3ML0 A;  3ZRV A;  2OCC C;  4K8X A;  1HR0 B;  3ASO C;  1HNX O;  3JSL A;  5BR8 O;  2XAS A;  5CN0 A;  2LGW A;  4UVB A;  3JAR B;  3UT5 B;  5J2U B;  1NR1 A;  3M8A A;  3JAS B;  4LH6 A;  1M5I A;  1AP5 A;  4X8A A;  1S5J A;  1AVM A;  4JTA B;  1Q6I A;  2XAQ A;  2EX3 A;  2Q4P A;  4HAM A;  1XI1 A;  5JH7 A;  2H94 A;  2QKC A;  3IJ4 A;  1XUQ A;  4ZI7 A;  1JJO A;  4AQY B;  1WB8 A;  5EYP B;  4UFZ A;  4LF8 B;  2GUZ A;  2A79 B;  4LFC B;  2EJ7 A;  4JI3 O;  1OCO C;  4LF9 O;  3D8C A;  1CPY A;  1SQX H;  3APO A;  4WBN A;  3ZS8 C;  2DYR B;  1H8H G;  2ZM6 B;  1K4C C;  4O4J B;  2ILM A;  1EZV H;  2ZIN A;  5FLX N;  2JS5 A;  1SZT A;  4QJF B;  4JI4 O;  1VQ8 V;  4D7S A;  1HNX B;  4EKW A;  2LJ2 A;  3OMI B;  3BPZ A;  2CTW A;  1LNQ A;  2P67 A;  3L73 H;  5IY5 B;  4AHC A;  1J5E B;  1YEW A;  4GX0 A;  4X62 O;  2P06 A;  3LSU A;  5CA0 A;  4I55 B;  5KUK A;  5TIS Z;  3PN1 A;  2HHH O;  5EC2 C;  1FD9 A;  1M57 B;  4QPJ A;  2EJR A;  4MVM A;  4JV5 B;  2RNB A;  1I5Y A;  2OYQ A;  1GO3 F;  1IDS A;  1GM7 A;  4RUF A;  3ZHS A;  3TET A;  1TA8 A;  3CCJ V;  4H37 A;  2E5L B;  4X64 O;  1H2M A;  4UCO A;  4ICG A;  1DF5 A;  1M9N A;  4LF9 B;  4JF3 A;  5B1A B;  2WA4 A;  2R9R B;  2IW5 A;  2EIN B;  3K3W A;  4B3S B;  4X1K A;  3JAL A;  3OT7 A;  3RWR D;  5LMU B;  4HNA B;  1URF A;  3AG4 C;  1XHZ A;  4OPA A;  4DV6 B;  4J7J A;  1BHB A;  1Z2G A;  3QF7 A;  4AIL C;  4O4I B;  1RSO B;  4E4E A;  4KP4 A;  4MS2 A;  3T1Y O;  1G1X B;  4EB6 B;  3J7A U;  4PJ0 Z;  3BVO A;  2A0L A;  1PNK A;  1BCC H;  4PI0 A;  1TUB A;  3K06 A;  4MTF A;  1AR4 A;  2Q0A A;  4X1Y B;  4DUZ O;  3L75 H;  3ETG A;  2DQ0 A;  3G80 A;  5KHG A;  2M6Y A;  1QU7 A;  4J7Z A;  3W7W A;  1Q86 W;  3ASN C;  4ASU G;  1M57 C;  2AGA A;  5C8Y B;  4EFB A;  1Q90 D;  4K0K B;  3K5M A;  2PI4 A;  2HJD A;  4FLU A;  4UCU A;  4LF7 O;  1WJZ A;  4JI7 O;  1AB3 A;  2UUB O;  3P32 A;  4O2B A;  1VIB A;  1S5L Z;  1OCZ C;  3B2E E;  1E79 G;  1PL4 A;  2HG5 C;  1XBL A;  3CCV V;  4I5S A;  3T1Y B;  2RQ6 A;  2N05 A;  4QIW F;  1N34 O;  1VQK V;  2N04 A;  2QM8 A;  2YUA A;  2BTQ B;  3CWB H;  1DK1 A;  3HR0 A;  3MDS A;  4E2L A;  4NYK A;  2W6I G;  3SYC A;  1S72 V;  4MVS A;  2KQX A;  3JAM N;  1Z5W A;  5B3S B;  2DOS A;  2CH7 B;  3KZI Z;  4DUZ B;  1N32 B;  3I55 V;  4DR1 O;  5KMG B;  4H33 A;  1VQO V;  1K92 A;  2HJF C;  3KCY A;  1XDC A;  5KHI A;  1SZX A;  4TOI A;  3B77 A;  2FB5 A;  3B4S A;  3WG7 B;  2CAZ C;  5JQG A;  4GZR B;  3K03 A;  2XHB A;  1VQ6 V;  5L3E A;  1DTO A;  3D3I A;  3FB7 C;  3K57 A;  3N2K A;  4RUE A;  3ZHU A;  2Q5Z A;  3ZCC A;  4AI8 A;  1Y74 A;  3OAA G;  5J2T B;  1S77 D;  2F66 C;  2ZE7 A;  1PP9 H;  1FYJ A;  4DR3 O;  1LUV A;  2Q7E A;  1KP2 A;  2UXC B;  1KQS U;  3T1C A;  1N34 B;  5BMV B;  3WB1 A;  1KU9 A;  1YIJ V;  3BA8 A;  4PDL A;  4R50 A;  2FL4 A;  4JTD B;  5LMN O;  2F4V B;  3CX5 F;  5DM6 V;  2QA4 V;  3CC4 V;  4TV9 A;  1R6K A;  3GWK C;  2G38 A;  3EHB B;  1EN5 A;  1DLB A;  5IYB O;  2Y4U A;  5E1A C;  2GUZ B;  1UFI A;  1HNZ B;  1L0L H;  2ODM A;  3WB0 A;  3OW2 U;  2PUS A;  5JJJ B;  3G4S V;  3JD1 A;  4WBN B;  4UB6 Z;  5EIB C;  5IWA O;  4LWS A;  5JVD B;  2XAF A;  4JI6 B;  3PJS K;  3K0D A;  5B1N A;  2Y48 A;  2WAM A;  3D3Q A;  4PA4 A;  3STL C;  2DWE C;  4FLX A;  4JYY A;  2HFE C;  1BE3 H;  4B3T O;  3D36 C;  4BAY A;  2YI8 A;  3LNM B;  4GUN A;  2QSA A;  3OMN B;  4ZIB A;  3LDC A;  4I9Q A;  1MMM A;  4UVC A;  5LL6 Y;  4P9O A;  3RBZ A;  2VQE B;  5GON A;  5CA0 B;  2QWP B;  1W0K G;  2HLD G;  3G6E V;  1PM9 A;  3F5T A;  4J9Z B;  2NLJ C;  5IYD O;  3RW0 A;  3EFF K;  1BZK A;  2RMK B;  2P90 A;  1OV9 A;  1FJG O;  3J81 N;  5HFM A;  5D5P A;  4FFK A;  3ZHR A;  1GKF A;  3K79 A;  3T1H B;  4IL6 Z;  2JJ1 G;  3CRR A;  4R6Z A;  1MZF A;  1ZLZ A;  1WPX A;  5LHI A;  5IWA B;  2EUL A;  3A2F A;  4ZHQ A;  3H9V A;  3JAL B;  2ZNI A;  2D2C B;  3IC7 A;  2YIC A;  4RQF A;  3F7V C;  4JTC B;  1K7D A;  1XNQ O;  2GBO A;  3BY6 A;  3IFX A;  3G71 V;  2Z3Y A;  2UUA O;  3OGI B;  1GRJ A;  2ZCE A;  1N33 B;  1TUB B;  3FYI B;  3IC9 A;  4F6R A;  2H3O A;  2QTO A;  3JSN A;  4FK5 C;  1MSD A;  4LF5 O;  4LFA B;  1AR5 A;  4HNA A;  4JI5 B;  2ZQM A;  5IJ9 A;  4JZ2 A;  1H2K A;  5JJE B;  1EM1 A;  3OTF A;  1M93 A;  2WSS G;  1YDX A;  4O4I A;  1RSO A;  1MAB G;  1H2S B;  3U10 A;  1XNR O;  3AK1 A;  1G4Y B;  5KHH A;  1RM1 B;  2GSM B;  4I4T A;  3FYE B;  1SQP H;  1VF7 A;  1VEW A;  2KKW A;  4B3M O;  2UXB O;  1K9M W;  4TT3 G;  1BS3 A;  1SC5 B;  5EK0 A;  4O2B B;  4MTG A;  3CC7 V;  2P22 C;  4Z1M G;  5LOV A;  2CTP A;  2PGG A;  2IH3 C;  4YHH B;  4FFB A;  4IYI A;  4DXW A;  1VQP V;  5C8Y A;  4DYL A;  2YID A;  1KP3 A;  3JYC A;  2DN9 A;  3JD0 A;  4YIP A;  1V55 B;  2F1M A;  2ZDI C;  2X6C A;  3R65 A;  4PDR A;  3ABK B;  3TGU H;  1K33 A;  1S3J A;  2LQT A;  3O9O A;  2BTO A;  3ASO B;  4OGQ B;  3DXR A;  4DV0 B;  1IXM A;  4DV7 O;  1BT8 A;  4MTO A;  4J80 A;  4F4L A;  1HR0 O;  4GKJ B;  2Q9L A;  3K04 A;  2FML A;  3ETD A;  4LCU C;  1XOU A;  2BTQ A;  4FLY A;  1XEQ A;  3OGC C;  4J11 A;  2GTA A;  4DR4 B;  2OWO A;  3AK3 A;  5JQG B;  3SPI A;  2GV9 A;  1R73 A;  4U7O A;  1RM1 C;  4XDJ A;  5H6R A;  1D5A A;  2KG7 A;  3N2K B;  2ATK C;  1Y74 B;  3VQY A;  1RFY A;  2HR3 A;  3CC2 V;  4JAV A;  2Q7H A;  4K8Z A;  1BQZ A;  3G67 A;  1OCO B;  1O9G A;  1W59 A;  4NR1 A;  4LF8 O;  4D7T A;  2F23 A;  4I0X B;  4LFC O;  3CYO A;  1YJN V;  4ABM A;  3CCM V;  1AJN A;  3CEI A;  1GN3 A;  4TV8 A;  2ZM6 O;  4FZ0 A;  5J2T A;  3W7X A;  1SQQ H;  3K9S A;  2RCV A;  5EZY A;  4MW8 A;  4FM1 A;  5CBF A;  4RO2 A;  3SR2 C;  5BMV A;  1QLE C;  3B40 A;  2WLH A;  3E35 A;  3CCS V;  3GB7 C;  1J5E O;  3OTO B;  1D5N A;  4JI0 B;  3ZRW A;  2WWW A;  1IZ3 A;  1SET A;  4LWS B;  4WF9 V;  4P30 A;  1L8D A;  3ZIA G;  3BAB A;  1NZ6 A;  1YXB A;  2ZR3 A;  4JV5 O;  4GKK B;  1IBL B;  3OUS A;  1AI4 A;  2E5L O;  1XIL A;  3CD6 V;  2X0L A;  5LBQ A;  1VQ7 V;  3K08 A;  4UXN A;  1NH2 B;  2WLK A;  3H1I H;  1E1R G;  5JVD A;  1AI7 A;  4YJ3 A;  1YJ9 V;  4B3S O;  2YIB D;  3AG4 B;  5GON B;  5LMU O;  1WLE A;  4PV1 B;  4PDM A;  1BSM A;  3SPH A;  4NVP A;  4DV6 O;  1GMG A;  1B6Q A;  4FZ1 A;  3AG7 A;  3ZED A;  2WLN A;  4XDK A;  3LDE A;  4GX1 A;  2L6L A;  4CH5 A;  3AG3 B;  3MD0 A;  3BEH A;  3K0G A;  5JCO C;  1VF6 C;  2P7T C;  2R70 A;  1QR8 A;  3TJT A;  4DUY B;  3E83 A;  2QR4 A;  2IH1 C;  1MOF A;  1Y6X A;  4ZHQ B;  4GCZ A;  3AG1 C;  3ASN B;  2WPD G;  3SYO A;  1T5E A;  5F2V O;  1WB7 A;  1I7F A;  1KKC A;  1US6 A;  5IE9 A;  1HNW O;  1VMG A;  4IGG A;  1GN6 A;  3HKC A;  4K0K O;  2GDS A;  2LW1 A;  1SKV A;  3WU2 Z;  1ZL8 A;  4J42 A;  4F6R B;  3FAV A;  2YXY A;  4L87 A;  2D3O W;  1F7Y A;  2YIA A;  2XAH A;  1OCZ B;  1N36 B;  3DTU B;  5KX5 A;  2P4K A;  3LUT B;  5IJ9 B;  3CCE V;  4DK1 A;  1V54 C;  2EBO A;  1NTZ H;  4BW5 A;  2HP8 A;  3W7U A;  1K3E A;  1WP7 A;  3JD3 A;  1IVS A;  2UXX A;  2ZDI A;  3T4D A;  4DR5 B;  3B8N A;  4QPK A;  5DEC A;  5CBG A;  1X4T A;  1JVM A;  4I4T B;  1A32 A;  4GT1 A;  1YVW A;  3AG3 C;  2UUC B;  5L3B A;  4YJ2 A;  4XBF A;  1N32 O;  3ZHT A;  3ZJZ A;  3QO5 A;  4DV5 B;  5KHJ A;  1KBH A;  4K35 A;  5LOV B;  2IJI A;  4NB5 A;  3CRC A;  4JI1 O;  1JFF A;  2N74 A;  4I7Z B;  2QWQ B;  2WLI A;  4FFB B;  1HNW B;  1U96 A;  2OT5 A;  3H1K H;  1Q7Y W;  1ZX3 A;  2ZD9 A;  5EBM C;  5GW7 A;  4PA6 A;  3UM7 A;  4NTX A;  4JPR A;  4DW0 A;  1H38 A;  3HKD A;  2CGO A;  3TXQ A;  3RYF A;  3KCX A;  3F7Y C;  4UCV A;  2PY5 A;  3RN4 A;  3JAK B;  1Q43 A;  3DXR B;  1B3Q A;  4WFA V;  2R72 A;  2AXT Z;  2UXC O;  2B1G A;  3ZX6 A;  2IJK A;  3MHS C;  2JEU A;  1SF9 A;  5K1P A;  2F4V O;  3L71 H;  3ETE A;  1YZB A;  1VQM V;  4P9P A;  3L9D A;  5BXZ A;  1GH6 A;  2KG7 B;  2KSD A;  1IX9 A;  1RPO A;  2QDO A;  1KC8 W;  4MVZ A;  1NT2 B;  1ZWI C;  2NNU A;  4NKG B;  3FX7 A;  4MVO A;  1JJ2 U;  3OMA B;  3NXS A;  3K59 A;  4CS4 A;  2Y0P A;  4FLW A;  3ZMU A;  5IT9 N;  4X20 A;  4JI1 B;  4JI2 B;  4QE9 A;  4EFE A;  4YY3 B;  1AI6 A;  1BQ0 A;  1HNZ O;  4Q6G A;  4O2A A;  1XMO B;  4TV8 B;  3ZRS A;  4JI6 O;  2RN9 A;  5IJ0 A;  1ZTE A;  1COW G;  1IBM O;  1QBZ A;  5EZY B;  1B06 A;  1GN4 A;  2Y4T A;  1XMQ B;  4I0X A;  3ZMZ A;  4O4L A;  2JJ2 G;  3BAA A;  3OUF A;  4IIJ A;  3ABT A;  1TVK A;  3ABM C;  3ZN0 A;  1MA1 A;  4KL1 A;  4BIZ A;  2VQE O;  1ROP A;  1EN4 A;  3ZRW B;  4UV8 A;  1OHH G;  5BZB A;  1Y67 A;  2LGQ A;  1GK9 A;  3VQX A;  3WFV A;  5JJN B;  2PZS A;  2RDC A;  2X6B A;  2BOB C;  5JCO A;  1VF6 A;  3CCL V;  2F93 B;  3CRA A;  3ICX A;  3JAW A;  3TK1 A;  4CH3 A;  1S76 D;  1O9H A;  2ZIO A;  2MK3 A;  1GM8 A;  4FM0 A;  3T1H O;  3UCS C;  3SJQ C;  1Y76 A;  2Q69 A;  3IGA C;  3H1L H;  4YJ3 B;  5EBL C;  4UUJ C;  3R66 A;  4JYA B;  1IBM B;  1SES A;  2ZE6 A;  1K5S A;  2ZNJ A;  3HKB A;  4PA3 A;  1Z5V A;  3UQ8 A;  4DV4 O;  3ETQ A;  5AG2 A;  3ZHV A;  3CHX A;  2HEP A;  4P2Z A;  1N33 O;  5C93 A;  2YI9 A;  4KHP B;  4DV3 B;  2W0F C;  5IYZ A;  1P49 A;  3RGB A;  3BCC H;  5FPO A;  1Q3E A;  5FL7 G;  4LFA O;  4JI5 O;  1GN2 A;  4H44 B;  2C2A A;  4OX9 B;  3QO8 A;  2W0X A;  3Q4H A;  2JS3 A;  4UCR A;  3STZ C;  3C3T A;  5B1B C;  1QNM A;  4D6T H;  3CXH F;  3HKC B;  1N0N A;  1P4R A;  3KG2 A;  2JK5 C;  1ZL8 B;  4PDV A;  1TAE A;  1Q81 W;  2DYS C;  4LF6 B;  2K1E A;  4B7E A;  3FAV B;  4TQD A;  1KD1 W;  2Y69 C;  1MG1 A;  5L3C A;  3QO7 A;  1SRY A;  5KX5 B;  2B5U A;  3L72 H;  1VQL V;  4BW9 A;  2IM9 A;  1FXK A;  1AI5 A;  2Q68 A;  4YHH O;  3FB8 C;  5D5Q A;  1JMK C;  1P7G A;  5LGT A;  3E8H A;  2WA3 A;  4PI2 A;  3RYH B;  4DV4 B;  1VQN V;  2ZE8 A;  2H8P C;  1BL8 A;  2DWD C;  1IUR A;  3GVM A;  4QE7 A;  1F4N A;  4QNH B;  3CP1 A;  4FJC C;  5E79 Z;  1PPJ H;  2Z0A A;  4YJ2 B;  3SYQ A;  4NTW A;  1N0J A;  4DV0 O;  4DR6 B;  3LSQ A;  4FLT A;  1QVF U;  4FIP C;  4GKJ O;  1NH2 D;  3ZN1 A;  1B04 A;  1JFF B;  2WLI B;  1K73 W;  4UVA A;  4B7K A;  1HDJ A;  1CXZ B;  2OIE A;  4DR4 O;  2WLJ A;  3RFR A;  5GTI Z;  2JGD A;  2QTS A;  1FPO A;  1P7B A;  3OR7 C;  4X66 B;  1K34 A;  3U0Z A;  3CXC U;  2XUM A;  3MHH C;  3HKD B;  2OIG A;  4X1I A;  3RYF B;  1R1B A;  2GTS A;  1WAZ A;  2QGN A;  1H2N A;  4NXN B;  1M4U A;  4Q20 A;  5CBH A;  4MVU A;  2XTA A;  2X7R B;  4TWK A;  1EN6 A;  2RJZ A;  2R9I A;  3F5W C;  3HKE A;  4U7N A;  1RP3 B;  1BGY H;  3OD4 A;  2DE0 X;  3B8M A;  3ZMS A;  3RYI A;  2EIM C;  2WLL A;  3JAK A;  3ZMV A;  4I50 A;  3ABL B;  3TCU A;  3JAT A;  1D2D A;  4DR7 B;  1NI8 A;  1QLE B;  3TXS A;  2QM4 A;  1LUW A;  2LO1 A;  4X20 B;  4QGP A;  3CB2 A;  4L8J A;  2EZP A;  3OTO O;  4JI0 O;  4CH4 A;  4O2A B;  4J41 A;  2PTM A;  3CJH A;  1CEZ A;  3I56 V;  5LYJ A;  4TUY A;  5IJ0 B;  2XND G;  1TUE B;  1M56 C;  3BHP A;  5CB4 A;  4YIO A;  4GKK O;  1LR1 A;  3H1J H;  4UV9 A;  4DV1 B;  1K5Q A;  3N27 A;  1IBL O;  2CK3 G;  4LFB O;  4PA7 A;  2YDE A;  1K8A W;  4O4L B;  4IIJ B;  4LC1 A;  1TVK B;  4KXR A;  4I9W A;  3IAY A;  4XDL A;  3RVY A;  3OEH G;  1YTF B;  3JCZ A;  2R9A A;  3ZMT A;  1NTM H;  1NKD A;  1ARO P;  1YCI A;  4ZOL A;  3OR6 C;  5KLV H;  1XHX A;  2LW7 A;  1ZUQ A;  1YHQ V;  4X65 B;  2ITC C;  1KUQ A;  2F43 G;  3LNN A;  3CRQ A;  4R8C A;  3T2M A;  3ABL C;  2FYU H;  1SQV H;  2YS8 A;  1H2L A;  1ZSP A;  2Q67 A;  1OCC B;  3JAW B;  5CA1 A;  4NXM B;  1JX9 A;  4WFH A;  4JI8 B;  4DUY O;  3E8F A;  4X89 A;  5A9G A;  1IBK B;  1Q6U A;  3AG1 B;  1NVP B;  2DW4 A;  2ITD C;  4J10 A;  5J9P C;  1Y76 B;  2QWO B;  4UB8 Z;  1N8R W;  4H0L B;  1Q5O A;  4DV2 B;  3N2G B;  2JIZ G;  4GX5 A;  5B5E Z;  2YXH A;  3FFQ A;  1HWY A;  2EIJ C;  2EIL B;  3HKB B;  2Q7G A;  2A06 H;  3HB3 B;  4LFB B;  1Y4M A;  2BCC H;  1I0H A;  2E75 B;  1SS3 A;  3P3P A;  2CUG A;  3SPG A;  2ZR2 A;  5KA6 A;  2UXD O;  4MTX A;  1NQT A;  5IYZ B;  2A9H A;  2VQF O;  3CCR V;  4C7U A;  1N36 O;  2QJ1 A;  3WB2 A;  1JQ0 A;  3SJB C;  1V54 B;  3JD4 A;  2JEX A;  3QG5 A;  4U3J B;  1P84 F;  3Q4H B;  1FAF A;  2OCH A;  4JGS A;  2ADQ B;  4J7K A;  5EIB D;  4DR5 O;  3A0R A;  2LFR A;  4BWA A;  1W2B U;  1SER A;  5LP6 C;  3DSQ A;  2EIK C;  1OCC C;  2EZO A;  2UUC O;  4CC5 A;  1UJW B;  3CMA V;  2IJJ A;  4ZBM A;  3APQ A;  1UPG A;  1YF2 A;  4DV5 O;  5ITZ A;  5BR8 B;  2OTL V;  4DRX A;  4PHZ A;  4RWU A;  1FXK B;  1PKX A;  3JCU Z;  3C90 A;  1DF4 A;  3QNE A;  3SPJ A;  2EIL C;  3ABU A;  1Q6H A;  1KYO F;  2Z5U A;  3CE2 A;  1MZE A;  1OZ0 A;  2UXD B;  2CTQ A;  4R7C A;  3A0H Z;  1JA8 A;  3H01 A;  2VQF B;  1W0J G;  2ZE5 A;  2ZIM A;  4UCT A;  1DGS A;  4MSW C;  2DMX A;  1JPX A;  3ZRX A;  2CTR A;  4JI3 B;  1SA0 A;  2HKO A;  3SYP A;  5LXT A;  3A8T A;  1GTO A;  1PV0 A;  3U11 A;  4LH7 A;  3RYH A;  3P3N A;  3LSS A;  3E22 A;  4KFM A;  5B66 Z;  3FKS G;  3OE7 G;  2AHY A;  2FKX A;  2JGD B;  5H2F Z;  2MW2 B;  2DYR C;  5L3F A;  2NR5 A;  4WCE V;  3X2Q B;  1FKA O;  1PNM A;  3K5O A;  1KB9 F;  1ORQ C;  2Y0I A;  1TGO A;  4JI4 B;  2YC0 A;  5L3G A;  2Q8V A;  4X1I B;  4TQF A;  4BR6 A;  4B08 A;  1J95 A; 
#chains in the Genus database with same CATH homology
 4X65 O;  2ZM6 O;  4DR1 O;  4JI2 O;  4KHP O;  4DV3 O;  4YY3 O;  3M8A A;  4B3T O;  4B3M O;  2UXB O;  3T1H O;  2UXC O;  2Z0A A;  4DR5 O;  4OPA A;  4GKK O;  1XMO O;  4OX9 O;  1HNW O;  1IBL O;  4NXN O;  4DV0 O;  5LL6 Y;  4LFB O;  4NXM O;  4K0K O;  3R66 A;  3T1Y O;  4JI8 O;  2F4V O;  1G1X B;  2UUC O;  4GKJ O;  1YZB A;  3J7A U;  5BXZ A;  1IBK O;  3F5T A;  1F7Y A;  4LF4 O;  4JI3 O;  4DR4 O;  1NS1 A;  4LF9 O;  4DV5 O;  5H5N A;  1XMQ O;  4DV4 O;  1J5E O;  4DV2 O;  5A2Q N;  4DUZ O;  4LF6 O;  1FJG O;  2LW7 A;  1N33 O;  5IT9 N;  3J81 N;  5BY1 A;  4A5U B;  1KUQ A;  1FYJ A;  4DR3 O;  1HNZ O;  3J80 N;  4DR7 O;  3SDL A;  1R1B A;  4JV5 O;  4OPH A;  4LFA O;  2AGA A;  4JI5 O;  5FLX N;  3RT3 C;  2E5L O;  4JI6 O;  4DV7 O;  4JI4 O;  1A32 A;  5LMN O;  4DUY O;  1HR0 O;  4LF7 O;  1IBM O;  4JI7 O;  4AQY O;  1N32 O;  1AB3 A;  1XNQ O;  2UUB O;  1XEQ A;  4B3S O;  2UUA O;  5LMU O;  4X62 O;  1R6T A;  4JI1 O;  1AIL A;  2N74 A;  2HHH O;  4DV1 O;  4DV6 O;  1X59 A;  4DR6 O;  2FKX A;  1D2D A;  2VQE O;  3O65 A;  4JYA O;  1N34 O;  4B3R O;  4LF5 O;  1FKA O;  1DK1 A;  2UXD O;  2JRI A;  5IWA O;  4X64 O;  4YHH O;  2DJV A;  4LF8 O;  2UU9 O;  4LFC O;  2VQF O;  3JAM N;  1N36 O;  1HNX O;  4DR2 O;  3OTO O;  5BR8 O;  4JI0 O;  2ZKO A;  2DOS A;  4X66 O;  1XNR O;  1I94 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...