4ZBMA

Crystal structure of drosophila cyclic nucleotide gated channel pore mimicking nak mutant
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
90
structure length
90
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGETPTPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural implications of weak Ca2+ block in Drosophila cyclic nucleotide-gated channels.
pubmed doi rcsb
molecule keywords Potassium channel protein
molecule tags Membrane protein
source organism Bacillus cereus (strain atcc 14579 / dsm 31)
total genus 33
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4zbmA00
2X6CA 4J9YB 3EFFK 5B1AC 5KUKA 1LNQA 5EBLC 2ATKC 4RO2A 2AHZA 1K4DC 2JK5C 1BL8A 4H33A 3OGCC 4GX0A 4R8CA 5KUMA 3VOUA 1M57C 2A79B 3AG3C 1KKDA 3LUTB 1R3IC 2HG5C 3SYPA 3WG7C 4JTDB 3T2MA 4RUFA 4CBCA 2HVKC 3K08A 1OCOC 5J9PC 2BOCC 4G27B 2WLKA 4PDMA 3F7YC 1OCCC 4UUJC 3UKMA 3IGAC 3TETA 1OCZC 1R3KC 3BEHA 2WLLB 4HZ3A 4RUEA 2X6BA 3E86A 2W0FC 4JTCB 4WFFA 4XDJA 5EC2C 1R3JC 2OCCC 4BW5A 3ABKC 2AHYA 4G28B 4WFGA 1XL6A 2QKSA 2KB1A 1K4CC 5B1BC 3HPLC 2DWEC 3RBZA 4MW3A 4JTAB 4MS2A 4MVSA 5CBHA 2H8PC 2ZD9A 2ITDC 1OCRC 3AG1C 2BOBC 1R3LC 2WLIA 3K03A 3STZC 3RVZA 5EC1C 5EBWC 4P2ZA 4P30A 2HJFC 3ASOC 3AG2C 4PDVA 4X88A 3E8BA 3JYCA 3LNMB 4PA4A 4WFEA 4X89A 2EINC 3ZRSA 2DWDC 2Q69A 4J9ZB 1S5HC 3X2QC 3K06A 4PDRA 3SPIA 4XDKA 1G4YB 1M56C 3LDCA 4OXSA 2EIJC 4LBEC 3RW0A 3SYAA 3ABLC 5E1AC 3OR6C 4XDLA 2A0LA 2NLJC 2DYRC 2EIMC 4HYOA 3SYOA 4LCUC 3F7VC 5CBGA 4GX1A 2R9RB 4MVOA 4MTGA 3E8HA 2Q67A 3IFXA 3FB7C 4P9OA 3TCUA 4DXWA 4MVQA 3SYCA 3ABMC 5EBMC 3F5WC 2EILC 1V54C 2IH1C 3OUSA 3R65A 4MVMA 2Q6AA 3UM7A 2IH3C 1QLEC 3T1CA 2WLHA 2WLIB 4F4LA 3K0GA 2K1EA 3ASNC 1JVMA 2Y69C 3FB8C 4EKWA 3K0DA 4MVUA 4ZBMA 3OUFA 5CBFA 4H37A 4PA7A 4GX5A 4MSWC 4PA3A 3SPJA 2A9HA 2WLJA 2ZXWC 2HFEC 4MTFA 4PA6A 4P9PA 2ITCC 4X8AA 5BZBA 2P7TC 4QNHB 2YEVA 5EK0A 3RVYA 4MVZA 1J95A 3T4ZA 3AG4C 4I9WA 4TWKA 1ORQC 2WLLA 4QE9A 4PA9A 1XL4A 5IY5C 1V55C 2EIKC 3K04A 1P7BA 3FB5C 4RAIA 2WLNA 3ZJZA 2Q68A 4QE7A 2DYSC 2X6AA 3OR7C 3E89A 4MTOA 3SJQC 3SPHA 4PDLA 3STLC 2HVJC 4MW8A 4R50A 3E8GA 4WFHA 3PJSK 5B3SC 3E83A 2WLMA 3GB7C 3SYQA 3LDEA 4LP8A 4KFMA 4GX2A 4MVRA 3LDDA 3E8FA 4R7CA 3SPCA 3SPGA 3KG2A 3T4DA 2QTOA 3FB6C 4R6ZA 1ZWIC
chains in the Genus database with same CATH superfamily
1FFTB 5KUKA 3QNEA 4FVMA 1KUQA 3L9DA 4ZHQB 5LMUB 4N21A 2JK5C 2YS8A 1K3EA 1YJWV 2KSDA 1BQ0A 3M99B 4X9QA 2H94A 4LF5O 2Q5ZA 2RQ6A 1RSOA 1AP6A 3CXHF 4WFFA 1OCRB 2P90A 3ABKC 3DC6A 3K3WA 2E5LO 1R73A 1YSCA 1S0VA 5LL6Y 4MVSA 2VS0A 3I5DA 4LFAO 5GONB 3SJBC 1HR0O 4X20B 4MTXA 4DUYO 3ZHQA 3L70H 3LNMB 3FD9A 2Q7EA 1SF9A 5CN0A 5IE9A 2DYRC 2XASA 4UVAA 5KHHA 2RNBA 4F6EA 5LMNO 1CP9A 1RSOB 3OMNB 4DR5B 3CS5A 3O9OA 2EILC 2V1DA 4MVMA 5FPRA 1ZL8A 4KUMA 4EFEA 3ZCCA 4DR2B 1N36O 1KP2A 3L72H 3L75H 2WLHA 1D5NA 3CJHA 2OWOA 1Y74A 2K1EA 1TUEB 3G71V 4D7SA 2Q0OC 1PM9A 3QTCA 2ADPA 4JZ2A 4UCRA 1XEQA 2CTWA 2HEPA 4QIWF 4JASA 1KQSU 3AG4C 1V9PA 1M1KW 5B1NA 3DTUB 3CD6V 3JARB 3KKYA 1FD9A 1N0NA 5KA6A 3E89A 1XOUA 2XAGA 4WFHA 5IYZB 1ZL8B 4JI5B 2GHYA 4L87A 4LF6B 1VMGA 3H1LH 3CJHB 5LP6C 2VRZA 3FB6C 5LGNA 3CCVV 2E74B 2ZE8A 4DR6O 1IBMO 1K4DC 3EVKA 1UFIA 1XILA 2HG5C 3N2KA 3UT5A 4JTDB 3ABKB 2ILMA 2BOCC 3ZHRA 1RPRA 1Y66A 3E22A 2DMXA 1OCZC 3BEHA 1YTFB 1LR1A 4JTCB 4BW5A 4NXMB 1R6KA 4JV5B 1CEZA 4KP4A 2HR3A 2OCHA 5LHIA 4TUYA 4FLZA 5CBHA 2PF4E 3JD4A 3K03A 1H2GA 4P2ZA 3ZRSA 4WFEA 2DYRB 2Q69A 4J9ZB 3FX7A 4HBNA 1SKVA 3QG5A 1G4YB 4OX9O 3N2KB 3UT5B 3LDCA 4LBEC 4DR3B 2CTPA 3CEIA 3LSUA 4B3SB 2EILB 2WA3A 2XT9A 1JX9A 1VQ5V 2UXDO 3IFXA 3FB7C 3JD0A 1HR0B 1THZA 1S76D 1CPYA 1V54C 3ZHVA 3R65A 4KXRA 4YY3B 1F51A 4TUYB 5JJJB 5JCOC 5BY1A 4GCZA 2P4KA 1QNMA 1YCIA 3IC7A 1BQZA 5LBQA 3CHXA 4HNAA 4NTXA 3OUFA 3I56V 3G80A 3AG4B 4PA3A 1LUWA 1FS0G 4NTYA 1XNQO 3DXRA 1H2KA 3RYHA 1XHZA 4K0KB 1Y76A 3UO3A 2YC0A 4TQDA 1VQ7V 5LP6B 3L71H 5CA1B 1KD1W 2F66C 4JAUA 3LDEA 2Y0IA 3JSLA 1YHQV 4HNAB 3J80N 4LF4O 1AI7A 1XQ8A 1VQNV 4NYKA 1OCZB 1XDCA 4CH5A 1BL8A 2RCVA 4DW1A 4LH7A 4H44B 4U3FH 4LNUA 3NXSA 1OCOC 2HHHO 5CA0B 1BHAA 5B66Z 4DV5O 5JCOA 1XL6A 1WJZA 2PYLA 2KB1A 3HPLC 3RBZA 4LF8B 1I5YA 4X1YA 4IYIA 2ZD9A 5JH7A 3Q4HB 4X65O 2XOKG 2HJFC 5A9GA 4YJ2A 3E8BA 3RYFA 1EN4A 3ZHSA 3SPIA 4LNUB 1GN2A 5KHGA 2OYQA 2ETNA 5E1AC 1V54B 3G67A 3F7VC 2PTMA 4DV1O 2R9RB 3A2FA 1YF2A 3TCUA 3H9VA 1ZUQA 4CH6A 4X1YB 3T1HO 4NXNB 4OX9B 5JH7B 4PD4F 2QSAA 2YXYA 3RYIB 2Z3YA 3C90A 1DF5A 1Z5VA 1M90W 1TVKA 1PNMA 1FJGB 3B4SA 4J7ZA 1H38A 3ZBHA 1JFFA 4G2KA 1E1QG 4DUZB 2RDCA 4CS3A 3HKEA 4DYLA 1NZ6A 3W7UA 2QWNB 4DR4O 1MZFA 3HKCA 3GB7C 4DK1A 2WSSG 2Y4TA 3HKDA 1XNQB 3SPGA 1OCOB 1WA8B 4J9YB 2IJKA 2QA4V 4H33A 2BSKB 3OGCC 1OJHA 1TVKB 1L8DA 3OAAG 1P49A 2LFRA 4AILC 2QM4A 1JFFB 2GUZA 5TISZ 1EZJA 3W7SA 3JAKA 2JJ1G 3HKEB 2B9ZA 1Q82W 3E35A 4FLWA 1WN7A 1QHTA 2IU3A 3RN4A 3HKBB 3HKCB 4X64O 3K9AA 3HKDB 3STZC 1ENVA 1XHXA 4GKKO 2VQFO 4PA4A 5F2VO 1I08A 3JCUZ 1S77D 2WAMA 5IWAO 1BE3H 2DE0X 1M56C 1TGOA 5GTIZ 2VWJA 1RPOA 4J10A 1IDSA 2GUZB 3VQXA 3RYCA 3T1YB 3JAKB 1W2BU 2CDYA 1IXBA 1VQ4V 1EZVH 1Q6UA 1Y67A 1VQ6V 2LGWA 3F5TA 1QLEC 3CC7V 1NVPB 1JVMA 2Y69C 2N04A 1IBLO 2CGOA 3K0DA 4O4IA 1SQPH 4DV1B 5EIBC 1CXZB 4O2AB 2WLJA 2A06H 3B8MA 4P9PA 2ITCC 4QNHB 3QO5A 4K8XA 1SQQH 1N33O 2ZNIA 3B2EE 4UB6Z 3WB1A 3RYCB 1SQGA 3ZRWA 3B40A 3ZMVA 4YIOA 3FAVA 2X6AA 4PDLA 2QM7A 3OE7G 1I5XA 4FK5C 4O4JA 1ZLZA 1D5AA 2QTOA 1YEWA 4OGQB 4RO2A 4GX0A 2M7WA 4IGGA 1KKDA 4B3RO 1URFA 5J9PC 3ETDA 2WWWA 1W0KG 4IHJB 3TETA 2UUCO 1XMQO 2UXBB 1QCEA 3ZRWB 1DK1A 4KL1A 4G28B 4WFGA 3MHSC 1EN5A 3JATB 2JEXA 4JAAA 4D6TH 2CH7B 2QDOA 5LYJA 1M56B 4Z1MG 4F6RA 1VF5B 5EBWC 3UQ8A 5EK0A 4GKJB 1HP8A 1SQXH 1EFRG 3CE2A 2LQTA 4OXSA 1N32B 3LSSA 2EULA 3OM3B 4FMTA 1IZ3A 2QEXV 1Q86W 5H6QA 1MSDA 4LF7B 2G38A 2Z0AA 4I5SA 3JD1A 5EIBD 5CBGA 3CPWU 1Q81W 4FPPA 3RGBA 1QLEB 2PYJA 5EBMC 1VF6A 2Y69B 4Q20A 2IH1C 4LFBB 5LYJB 1X4TA 4IYHA 4F6RB 3SPJA 4UVBA 2ZXWC 1MOFA 1GN3A 4X8AA 3ZMSA 2EZPA 2IJJA 1FAFA 4I9WA 2NNUA 3CCSV 3FYEB 4JI3O 1V55C 4RWUA 4RAIA 2CAZC 3OR7C 4DV6O 1I0HA 4E2LA 5IYBO 1JPXA 4W4KA 3ICXA 2VQEB 4GX2A 1A32A 2JGDB 1IXMA 3VQVA 3CCRV 1J5EB 2GTSA 1NS1A 4TQFA 5B1AC 4BIUA 4FM1A 1TA8A 3WG7C 2QR4A 3K08A 2E76B 5D5PA 3TGUH 2F1MA 1R3KC 1I94O 2UXCO 2R72A 1HW7A 2AHYA 3N2GB 5HFLA 5JJNB 5BR8O 1KP3A 4B3MB 1H2LA 1TUBB 1IBKB 3M8AA 4GYCB 5FPOA 1PL4A 5L3GA 2YI9A 4JI7O 4JI8B 2R70A 1JMKC 3AEIA 3U11A 2EINC 1XMQB 3X2QC 2ZIMA 1AILA 5ITZB 2CTQA 5JVDA 4X66B 2EIJC 4XBFA 2QM8A 1BCCH 1WP8A 2EIMC 3SYOA 1SS3A 4DV7O 1R6TA 2A3QA 1NTMH 2IW5A 4ZKIA 3TK1A 4X1KA 2LW7A 2HJDA 4OPHA 5LHHA 2Q6AA 3OTOO 2QGNA 5EYPA 3WB0A 1FPOA 4BW9A 2ODMA 2ZDIA 2A7WA 2P4VA 1PD3A 1V55B 1EN6A 5JVDB 2MW2B 4I0XA 1UPGA 2P7TC 4GT1A 3JARA 2UUAO 1YDXA 1F23A 5LOVA 2HP8A 5IYZA 2DYSC 4X1KB 2HVJC 5B1AB 2LW1A 1ROPA 4RQEA 4LP8A 1P84F 4R7CA 3TXQA 4JI4O 3WG7B 4DR7O 2Y48A 5EYPB 1F4MA 1N34O 1WAZA 3CXCU 4DV3O 4PI0A 5FNVA 4I0XB 2KKWA 4PDMA 4DV6B 5L3DA 2CUGA 2XTAA 4DV2O 3I55V 5LOVB 2X6BA 3KCYA 4J80A 4FIPC 3BA8A 4BAYA 3AK3A 4JPRA 3JASA 2DWEC 1SESA 2EINB 3P3PA 2YDEA 3VQYA 3CCQV 3X2QB 4MS2A 2H8PC 2QKCA 1AI6A 4TV8A 2ZNJA 4I4TA 2ZIOA 4FZ0A 2EIJB 4JYCA 5L3EA 3CCJV 2E75B 2EIMB 3ZMUA 1I94B 3EHBB 3J81N 4XDKA 1VQ9V 1KMIZ 4YIPA 4FM2A 5FNVB 3KZIZ 2NLJC 2XAFA 4PV1B 1DLBA 5KMGB 2QWQB 5L3FA 3JASB 1XUQA 4FLUA 1T5EA 2P6JA 4JI0O 2JRIA 2OTJV 1F4NA 3HB3B 2IH3C 3SJAC 4FFBB 4LF5B 2WPDG 4TV8B 1YI2V 4I4TB 2ZM6O 2W6JG 3QO8A 4MSWC 2E5LB 1L0NH 2FTKA 1W0JG 2FB5A 2GSMB 1Q43A 2M6YA 2DYSB 4LFAB 4Z1VA 3JAWA 4I7ZB 4YJ3B 5LP6A 4DUYB 5CA1A 3K04A 2Q7HA 4DV4O 4R50A 3OTFA 2XUMA 1VQKV 5CMUA 1OV9A 3BY6A 2OIEA 5LMNB 5IYCO 1NH2D 1GKFA 2UUAB 5CA0A 4TOIA 5LGTA 3BRCA 3SYPA 4G27B 1N36B 3D3IA 3SGIA 3JAWB 4HZ3A 2ZE6A 3LSQA 2FMLA 2W0FC 3H1JH 1R3JC 1SERA 4JI6O 5EZYA 3Q4HA 1QLNA 4LF9O 2F4VO 1M9NA 1R3LC 3AK1A 1YVWA 5C93A 2F95B 4FLTA 4A5UB 3K5MA 1RFYA 3K59A 1GMGA 4DV2B 2LO1A 2V7QG 4GUNA 4LWSA 3WB2A 3CP1A 5KHJA 2PUSA 5KX5A 4FM0A 4B3TO 1O9HA 1PNKA 4DR6B 1IBMB 3U0ZA 1S72V 1VEWA 2FYUH 3RWRD 5EZYB 1JR9A 1NT2B 3OUSA 4WBNA 4ZOLB 3A0RA 4LFCO 3UM7A 4AQYO 2FL4A 3RYIA 2BCCH 1AR1B 1AJPA 3FB8C 1TAEA 4MVUA 5CBFA 5B1OA 2N74A 3GVMA 1B06A 5KLVH 4JYAO 5FL7G 4LWSB 5BZBA 1M93A 2V4DA 4NB5A 5KX5B 3JD3A 1FKAO 2Q8VA 1VP7A 4X62O 4FLVA 1XREA 4QE7A 3STLC 3A8TA 4FZ1A 4WBNB 4B08A 2OIGA 1KC8W 1WA8A 4U3JA 3SPCA 2BSKA 1SQFA 2EZOA 3B77A 1HDJA 3KG2A 1GO3F 1DGSA 4JYBA 2DJVA 2X6CA 2UXDB 4C7UA 1WB8A 1L1FA 2LGQA 3D36C 2P67A 1MNGA 3T2MA 4RUFA 4CBCA 2CTRA 1GRJA 1RM1C 1K92A 4ABMA 1YIJV 3IJ4A 3ZRXA 1YJNV 3HKBA 5BXZA 3APOA 3G6EV 1R1BA 2QWPB 2RMKB 4PELA 1VQLV 2Y4UA 1SQVH 2GBOA 1JQ0A 3A0HZ 4WFBV 4TT3G 4U3JB 3ZS8C 5LA6A 2F23A 3DSQA 3UCSC 4BIZA 1H8HG 5IJ9B 1X59A 3DC5A 1E79G 4TV9B 1VF7A 2P22C 5HFMA 3CCEV 3M7MX 3BA9A 1SC5B 2Y0PA 1N0JA 1QR9A 4LF9B 2F4VB 4KHPO 4U7OA 4ZIBA 4LF4B 4MVOA 1B6QA 3ZEDA 4U7NA 3ABMC 1Y6XA 3APQA 4IT5A 2Q9LA 1NU1H 2HHHB 4UCOA 1FYJA 3D36A 3ABTA 4DV5B 5LA6B 3K0GA 4O2AA 4ZBMA 1H8EG 2D2CB 1K97A 3BCCH 5LXTA 2A9HA 2BTQA 3CX5F 5FLXN 1H2MA 4X65B 3AG7A 2QKAA 4MVZA 3RVYA 1YITV 1P7BA 4BIOA 1K73W 2Q68A 1AVMA 1WPBA 5DM6V 1UJWB 2L6LA 4CH4A 1BHBA 1BT8A 4CZZA 1US6A 5LHGA 1MMMA 2P5OA 1RM1B 3FFQA 3LNNA 5LXTB 2IJIA 3VOUA 4X62B 2BTQB 4IHJA 3OMAB 4DW0A 2GDSA 1XI1A 3T1HB 3ZIAG 2X7RB 1N8RW 2XAJA 3JATA 3E86A 2IM9A 4K3AA 1XNRO 5AG2A 2VWKA 3B09A 2CH7A 1K4CC 3GWKC 4DV0O 3L73H 1KYOF 1Q90D 4WCEV 2UU9O 3JD2A 4Z2WA 1BGYH 4H0LB 4DRXA 5EC1C 4CS4A 4X88A 3JYCA 2DWDC 4J7KA 3ETQA 4DR4B 3BFRA 3RW0A 4JI2O 3J7AU 3QF7A 5LMUO 2DOSA 3CRRA 3MHHC 2B5UA 4F4LA 4NR1A 1JOYA 4DRXB 4WFAV 2XHBA 1L0LH 4E4EA 2QE7G 4GX5A 5J2UA 3H1IH 2R9IA 2UXNA 2YIDA 1SRYA 3JSNA 5BMVA 4X64B 2F43G 2ZR3A 1U97A 3E2EA 1ORQC 4PA9A 4GKKB 2VQFB 4GLXA 1H2NA 3CMAV 3ZJZA 3JCZA 5IWAB 2JGDA 1AR4A 3JAMN 1BS3A 3E8GA 3SYQA 1Q6IA 4IL6Z 1ZWIC 1LNQA 5EBLC 2ATKC 3OFNG 4EFBA 1FXVA 1WPXA 5J2UB 1DTOA 2A79B 3AG3C 5BMVB 3F7YC 3UKMA 4X1IA 4BWAA 3N2GA 5D5QA 4DR2O 1KB9F 2HKOA 4RUEA 1IBLB 1TUBA 1VQPV 1VQ8V 2BTOA 1AP5A 4HAMA 1Z2GA 5KA5A 1N33B 3CRAA 2FKXA 2YIBA 1SZXA 5ITZA 1HWYA 3R66A 2IBZH 1S5HC 3K06A 1XMOO 1AB3A 3HR0A 4UCVA 4DK0A 3K5LA 3S3WA 1XNRB 3SYAA 4JI5O 5DECA 4X1IB 4LCUC 5H9CA 1WP7A 1PKXA 2IU0A 1QR8A 4DXWA 4MVQA 4B3RB 3SDLA 4WF9V 5CA3A 5KAFZ 3W7XA 4UV8A 2RN9A 2UUCB 3ASNC 4NXMO 4PJ0Z 4JV5O 4PA6A 2F93B 3H1HH 2RJZA 1K8AW 2WLLA 1SETA 3ZN0A 1GM7A 1FXKC 2ZKOA 4IIJA 1Q3EA 2ZXWB 3CRQA 1JA8A 1MSWD 3EXAA 3ABUA 4DR3O 3AG3B 3E8FA 4D7TA 1EM1A 4B3SO 2ZQMA 5K1XA 2JVDA 3MD0A 2AHZA 2KG7A 1R3IC 2EBOA 3K79A 1VQMV 4YY3O 3ZMTA 1OCCC 2PGGA 1IX9A 5CB4A 2WLLB 2OCCC 1PNLA 3C3SA 3SJCC 1HNXO 3A0BZ 4IIJB 3H1KH 4L8JA 2Z5UA 2W0XA 3AK2A 1Q6HA 2PZSA 4JI3B 1KKCA 4QPJA 4BR6A 4K0KO 1SQBH 2QWRB 4X89A 4PDRA 2KG7B 2YXHA 4QJFB 1FXKA 2YIAA 5KMGA 2N05A 1ZX3A 3OR6C 1IURA 1FFXA 5CB4B 1R6NA 3OEHG 4P9OA 1ZAUA 3ASNB 1NJIW 1GM8A 1K5QA 4FFBA 3W7WA 1GH6A 3TJTA 1XMOB 2ZR2A 4B7EA 4O4LA 3T1CA 1PL0A 2UXCB 2LJ2A 5BR8B 2XAHA 4CC6A 3P32A 2CGNA 3OD4A 1Y74B 4YJ3A 2HFEC 1FXKB 4LF8O 2YEVA 1YTFD 1N4CA 3T4ZA 1J95A 4JI7B 1FFXB 1E1RG 1XL4A 3ZN1A 3K5OA 4NKGB 4W4LA 1MZEA 2AW9A 2EX3A 3FB5C 3QVNA 1Q7YW 2LFSA 5JQGA 4MTOA 4FLYA 4MW8A 3PJSK 2C2AA 1SZTA 1NI8A 3E83A 3THOA 4O4LB 3VQWA 2L35A 4DV7B 1SA0A 3L74H 3RT3C 3W7TA 1OCCB 3RFRA 1YZBA 3WU2Z 4JZGA 3LUTB 1F7YA 2OCCB 2HVKC 1VQOV 3OTOB 4RQFA 1W59A 2YEVB 3CMEV 4NXNO 1S3JA 1K9MW 1AR5A 2ZE5A 4FLXA 3E22B 5JQGB 2QKSA 4ICGA 1Q5OA 1FJGO 1QVFU 3JALA 4TSFG 3D8CA 2ITDC 1QBZA 3AG1C 4FFKA 2AZ0A 1ZTEA 2ARHA 2JEUA 5KAIZ 4DUZO 1SA0B 3BAAA 4P30A 3ASOC 4J7JA 4PDVA 4H13B 2XAQA 4UV9A 2ZINA 1NH2B 1HNXB 2JJ2G 4JI4B 4DR7B 2HLDG 1FXHA 1WLEA 4XDLA 1KECA 2P06A 3BVOA 2JS3A 4ZOLA 5KHKA 1NR1A 1N34B 2NN4A 1JJ2U 2Q67A 2K9PA 4DV3B 2MK3A 3F5WC 4EEQA 5IDJA 1WNSA 5E79Z 5JJEB 3JALB 5GTHZ 4O2BA 4PI2A 3IC9A 3OEEG 1NTKH 4LH6A 4LR3A 2W6IG 5GW7A 3TXSA 2H3OA 4ZI7A 2GV9A 3ZRVA 4CC5A 3ZMZA 2JIZG 1IVSA 5H2FZ 4UFZA 5IY5C 2EIKC 3DXRB 4B7KA 4K8ZA 2PI4A 3GWOA 2WLNA 5H6RA 1Q8IA 1QU7A 3RYHB 4O4HA 1Y76B 4J42A 3QO7A 3K5NA 4O2BB 3H01A 1QVGU 1JCHA 2CK3G 4UCSA 3T1YO 4GZRB 2PI5A 1D2DA 5KUMA 4JI0B 4ZI7B 1M57C 2EJRA 3CWBH 1B3QA 3B8NA 3ZHUA 4I55A 3SR2C 5C8YA 3OW2U 1Z5WA 1AI5A 3IGAC 2ZM6B 3AG1B 2UUBO 5IJ0A 2LP7A 1HNZO 4O4HB 2Q7GA 5B1BC 1NQTA 3ASOB 1K7DA 1HNWO 2BE3A 5IJ9A 5K1PA 1EBOA 2XNDG 1DF4A 2AZ2A 2WLIA 2DQ3A 3DGEA 3P3NA 3ZHTA 2ZT9B 4TV9A 3N27A 1PV0A 1B04A 4DV4B 3CSXA 4YJ2B 3RYFB 4I55B 5C8YB 4HYOA 5JWPA 2QTSA 1GN4A 5IJ0B 3E8HA 3OMIB 2WA4A 3SYCA 1WB7A 1GK9A 4JI1O 1S5LZ 3K9SA 2WLIB 4UB8Z 5L3BA 2UXBO 4ASUG 4JI6B 3G6BA 1BSMA 5IY5B 2EIKB 1VIBA 4I50A 2D3OW 2IJHA 3K58A 2JDIG 5LGUA 4Q6GA 5IYDO 4TWKA 4QE9A 4LC1A 1YJ9V 1KBHA 4GKJO 4YHHO 4AHCA 3ML0A 2AXTZ 5A2QN 2WLMA 2DQ0A 4KFMA 4B3TB 1N32O 1M57B 1G1XB 2DN9A 4NVPA 4JYYA 4LF7O 1G8MA 3ETEA 3EFFK 4J41A 2Q0AA 4LFCB 3IAYA 3P30A 4I50B 4AQYB 2WLKA 1GN6A 2JS5A 4LFBO 5B1BB 4I9QA 1PP9H 2ZCEA 4XDJA 1GAXA 5EC2C 2YUAA 1MA1A 1M4UA 1YXBA 1MABG 4K35A 5DN6G 4JYAB 1NR7A 4N23A 1AROP 4JTAB 1NVPD 1K33A 2BOBC 2OTLV 1P4RA 2E3CA 1NTZH 3AG2C 1AJNA 2UUBB 2YSUB 1HNZB 3MAQA 3CRMA 3ABLC 3PN1A 2VQEO 2A0LA 1HNWB 1OZ0A 1G6UA 5KHIA 1J5EO 4GX1A 4MTGA 4QGPA 1VARA 3CCLV 1RP3B 1H2SB 5DEDA 4UVCA 5B5EZ 4DR1O 2GTAA 2KQXA 1COWG 2UXXA 4J11A 1NKDA 1K5SA 4H37A 1GTOA 3ABMB 4UXNA 4B3MO 1VF6C 4MTFA 4EB6A 1IBKO 4O4IB 4QPKA 1KU9A 1ZSPA 3ZX6A 4JI1B 2O57A 2Q4PA 4JI8O 4MT8A 3CC4V 3SPHA 1BZKA 5B3SC 4X66O 1P7GA 4MVRA 2ZE7A 3FAVB 2EJ7A 2YI8A 4KHPB 2OT5A 2DW4A 3T4DA 4R6ZA 5H5NA 4O4JB 4R8CA 4AI8A 1OHHG 2X0LA 4FJCC 1AJQA 4JF3A 1BMFG 3FYIB 4EB6B 4YHHB 4DO2A 2ADQB 4UUJC 3CRCA 2YICA 2PY5A 1LUVA 3KCXA 5IT9N 1M5IA 2NR5A 3CCMV 3WFVA 3AG2B 2CE4A 1AI4A 4MW3A 1OCRC 4DR5O 4YXWG 1QQCA 3RVZA 3ABLB 4EKWA 3OT7A 2QWOB 3CYOA 2YXLA 1NBMG 4JGSA 4OPAA 3O65A 3BPZA 3UO2A 5J2TA 3CB2A 3U10A 3D3QA 2QJ1A 1XBLA 2R9AA 3MDSA 4UCUA 3G4SV 3CC2V 3OGIB 4CS2A 3VBBA 1Y4MA 4ZHQA 2B1GA 1O9GA 3FKSG 4PA7A 1K34A 4DV0B 2AGAA 4JAVA 4LF6O 3CCUV 3NR7A 3BHPA 1I7FA 1MG1A 3C3TA 3S3XA 2UU9B 5B3SB 3K57A 4CH3A 2Q73A 4DR1B 1S5JA 2ZDIC 2B1IA 4NTWA 3BABA 3SJQC 5J2TB 1JJOA 1GM9A 3ETGA 4JI2B 2JGUA 1U96A 5L3CA 1PPJH 5GONA 4PHZA 4X20A 3LDDA 4UCTA 2YIBD
chains in the Genus database with same CATH topology
1OCCB 2X6CA 1FFTB 5KUKA 3QNEA 1L1FA 4N21A 4RO2A 2JK5C 4GX0A 2M7WA 1KKDA 2P67A 3LUTB 1K3EA 2OCCB 3T2MA 4RUFA 3ETDA 2HVKC 4CBCA 5J9PC 1VQOV 4RQFA 1YJWV 2WWWA 1RM1C 1W0KG 2YEVB 1K92A 3CMEV 3TETA 3M99B 1S3JA 2H94A 1YIJV 1K9MW 3ZRXA 1QCEA 1YJNV 4WFFA 3ZRWB 1OCRB 2P90A 3ABKC 4G28B 4WFGA 3G6EV 3MHSC 2QKSA 4PELA 3K3WA 1VQLV 1R73A 1YSCA 2JEXA 1S0VA 1QVFU 1JQ0A 4WFBV 4TT3G 4MVSA 4TSFG 2ITDC 1QBZA 3AG1C 1M56B 2JEUA 4Z1MG 4BIZA 5EBWC 1H8HG 4MTXA 4P30A 3ASOC 5EK0A 4PDVA 3LNMB 2XAQA 1EFRG 4UV9A 1NH2B 1E79G 4OXSA 5CN0A 2JJ2G 5HFMA 3CCEV 3LSSA 4FMTA 2HLDG 1FXHA 1WLEA 3OM3B 4XDLA 2QEXV 1Q86W 2DYRC 2XASA 5H6QA 1KECA 4UVAA 1QR9A 4U7OA 4I5SA 1CP9A 1NR1A 3JD1A 3OMNB 5CBGA 4MVOA 3CPWU 1Q81W 1B6QA 4FPPA 1JJ2U 1QLEB 2Q67A 2MK3A 4U7NA 3ABMC 2Y69B 5EBMC 3F5WC 4Q20A 2EILC 2IH1C 2V1DA 4MVMA 4KUMA 5IDJA 3ZCCA 1KP2A 3D36A 3ABTA 2WLHA 3K0GA 2K1EA 1TUEB 3OEEG 3G71V 4ZBMA 1H8EG 2W6IG 1K97A 5GW7A 3SPJA 4UVBA 2A9HA 3ZRVA 2ZXWC 1MOFA 3ZMZA 4X8AA 4QIWF 2JIZG 3ZMSA 2EZPA 4JASA 3RVYA 2IJJA 4MVZA 1KQSU 3AG4C 2NNUA 4I9WA 3FYEB 3CCSV 1YITV 1M1KW 5IY5C 1V55C 2EIKC 5B1NA 3DTUB 3CD6V 1P7BA 3GWOA 2PI4A 4RAIA 2WLNA 5H6RA 1K73W 5KA6A 2Q68A 3OR7C 3E89A 5DM6V 3QO7A 4E2LA 1UJWB 2XAGA 4WFHA 5IYBO 1JPXA 1BHBA 2GHYA 4GX2A 4L87A 3H01A 4CZZA 1QVGU 1JCHA 2CK3G 5LHGA 1IXMA 3CCRV 3FB6C 1RM1B 4BIUA 5B1AC 5LGNA 3CCVV 2PI5A 1K4DC 5KUMA 2IJIA 3VOUA 1M57C 2EJRA 3WG7C 2HG5C 2QTOA 3OMAB 3B8NA 3ABKB 4JTDB 3K08A 2BOCC 1RPRA 1Y66A 3OW2U 3ZIAG 1AI5A 3IGAC 2X7RB 1N8RW 1OCZC 1R3KC 3BEHA 2XAJA 1YTFB 3E86A 4JTCB 4BW5A 3AG1B 2AHYA 1R6KA 2LP7A 5HFLA 1CEZA 1KP3A 4KP4A 1K4CC 1NQTA 5B1BC 2HR3A 3ASOB 1K7DA 5LHIA 1EBOA 2XNDG 5CBHA 1DF4A 4WCEV 3JD4A 2WLIA 2DQ3A 3JD2A 3K03A 3DGEA 5L3GA 5EC1C 1H2GA 4P2ZA 3ZRSA 4X88A 3JYCA 3AEIA 4WFEA 2DYRB 2EINC 2DWDC 2Q69A 4J9ZB 3X2QC 1G4YB 3LDCA 2EIJC 4LBEC 3RW0A 4XBFA 2EILB 2QM8A 4HYOA 2EIMC 3SYOA 1JX9A 1VQ5V 2IW5A 3E8HA 3IFXA 3OMIB 3FB7C 3JD0A 4ZKIA 3TK1A 3SYCA 1THZA 1S76D 1CPYA 1V54C 3R65A 1F51A 5LHHA 2Q6AA 3MHHC 1GK9A 4GCZA 2B5UA 2WLIB 4F4LA 3IC7A 5LBQA 1JOYA 4WFAV 5L3BA 3OUFA 4ASUG 3I56V 2ZDIA 3AG4B 2QE7G 4GX5A 4PA3A 1PD3A 5IY5B 1V55B 2EIKB 1FS0G 2R9IA 2UXNA 1SRYA 2D3OW 2IJHA 2P7TC 4GT1A 2F43G 2ZR3A 2JDIG 5LGUA 5IYDO 3E2EA 1F23A 4TWKA 1ORQC 4QE9A 4PA9A 4LC1A 1YJ9V 1VQ7V 3CMAV 3ZJZA 3JCZA 3W7TA 2DYSC 3ML0A 2HVJC 1KD1W 3E8GA 5B1AB 4JAUA 1ROPA 2WLMA 3SYQA 4RQEA 3LDEA 2DQ0A 4LP8A 4KFMA 1M57B 4R7CA 3WG7B 1YHQV 2Y48A 1F4MA 1ZWIC 1G8MA 3ETEA 3EFFK 1LNQA 1AI7A 5EBLC 1VQNV 2ATKC 3OFNG 1OCZB 1FXVA 1WPXA 1BL8A 3CXCU 1DTOA 2A79B 3AG3C 3NXSA 3P30A 1OCOC 2WLKA 4PDMA 5L3DA 3F7YC 3UKMA 5B1BB 2HKOA 3I55V 1BHAA 4RUEA 2X6BA 4FIPC 4XDJA 5EC2C 4BAYA 4JPRA 1XL6A 1VQPV 1MABG 1VQ8V 5DN6G 2KB1A 1NR7A 3HPLC 2DWEC 1SESA 4HAMA 3RBZA 2EINB 4N23A 3CCQV 1AROP 1I5YA 3X2QB 4JTAB 4MS2A 5KA5A 1NVPD 2H8PC 2ZD9A 1K33A 2BOBC 2OTLV 1AI6A 1P4RA 2XOKG 2EIJB 4JYCA 2HJFC 3AG2C 3E8BA 5L3EA 3CCJV 1HWYA 2EIMB 1S5HC 3ZMUA 3K06A 3SPIA 3EHBB 4XDKA 1VQ9V 1AJNA 2YSUB 3SYAA 3ABLC 5E1AC 2A0LA 2NLJC 2XAFA 1V54B 1OZ0A 1DLBA 4LCUC 5H9CA 3F7VC 1PKXA 5L3FA 4GX1A 2IU0A 2R9RB 4MTGA 1QR8A 3TCUA 4DXWA 4MVQA 4WF9V 3CCLV 2P6JA 5CA3A 2OTJV 4UVCA 3W7XA 1F4NA 3HB3B 4UV8A 2IH3C 2WPDG 1YI2V 1COWG 3ASNC 2UXXA 1NKDA 2W6JG 3QO8A 1K5SA 4H37A 1GTOA 4MSWC 2Z3YA 3ABMB 1DF5A 4UXNA 1M90W 1PNMA 4MTFA 4PA6A 2FTKA 1W0JG 2GSMB 1H38A 2DYSB 4QPKA 4G2KA 1E1QG 1K8AW 2WLLA 1SETA 3ZN0A 3K04A 1GM7A 1FXKC 4MT8A 3CC4V 3SPHA 2ZXWB 3W7UA 4R50A 1VQKV 1MSWD 5B3SC 5CMUA 3GB7C 2WSSG 4MVRA 3LDDA 3AG3B 3E8FA 3BY6A 2ZQMA 2OT5A 3SPGA 1OCOB 2DW4A 3T4DA 5IYCO 4R6ZA 1NH2D 1GKFA 4J9YB 2IJKA 3MD0A 2QA4V 2AHZA 4H33A 4R8CA 3OGCC 1OHHG 5LGTA 2X0LA 1R3IC 2EBOA 3K79A 3OAAG 4FJCC 1AJQA 4JF3A 3SYPA 1BMFG 3FYIB 1VQMV 4G27B 3D3IA 2LFRA 3ZMTA 1OCCC 4UUJC 4DO2A 4HZ3A 2WLLB 1EZJA 3LSQA 3W7SA 2W0FC 2JJ1G 1R3JC 2OCCC 1SERA 1PNLA 3CCMV 1Q82W 3E35A 1QLNA 3WFVA 2IU3A 3AG2B 1AI4A 2Z5UA 4MW3A 1M9NA 1OCRC 3K9AA 1R3LC 3STZC 1ENVA 5C93A 4YXWG 4QPJA 3RVZA 1GMGA 3ABLB 4EKWA 4PA4A 4X89A 3CYOA 4PDRA 2V7QG 1S77D 2WAMA 4QJFB 1FXKA 1M56C 3CP1A 1RPOA 3OR6C 1NBMG 1PNKA 4JGSA 1R6NA 3OEHG 1W2BU 4P9OA 1S72V 1VQ4V 3ASNB 1NJIW 1GM8A 1K5QA 3OUSA 3W7WA 3A0RA 2ZR2A 3UM7A 1VQ6V 3T1CA 1QLEC 1PL0A 3G4SV 1AR1B 3CC7V 3CC2V 1NVPB 1JVMA 2Y69C 1AJPA 3FB8C 3VBBA 1Y4MA 3K0DA 4MVUA 5CBFA 5B1OA 2B1GA 2XAHA 3FKSG 4PA7A 1K34A 3P32A 4JAVA 2WLJA 3CCUV 2HFEC 5FL7G 1FXKB 3B8MA 4P9PA 2ITCC 5BZBA 1MG1A 4QNHB 2YEVA 3QO5A 1YTFD 3JD3A 3T4ZA 1J95A 5B3SB 1E1RG 1XL4A 3ZN1A 3ZRWA 3ZMVA 3FB5C 1Q7YW 2LFSA 2ZDIC 2B1IA 4QE7A 4MTOA 2X6AA 3SJQC 3STLC 4PDLA 2QM7A 4MW8A 3PJSK 2C2AA 1SZTA 1GM9A 3E83A 1KC8W 3ETGA 3OE7G 1I5XA 4FK5C 5L3CA 3SPCA 2EZOA 3B77A 3KG2A 1GO3F 3ABUA 4JYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X6C A;  4J9Y B;  3EFF K;  5B1A C;  5KUK A;  1LNQ A;  5EBL C;  2ATK C;  4RO2 A;  2AHZ A;  1K4D C;  2JK5 C;  1BL8 A;  4H33 A;  3OGC C;  4GX0 A;  4R8C A;  5KUM A;  3VOU A;  1M57 C;  2A79 B;  3AG3 C;  1KKD A;  3LUT B;  1R3I C;  2HG5 C;  3SYP A;  3WG7 C;  4JTD B;  3T2M A;  4RUF A;  4CBC A;  2HVK C;  3K08 A;  1OCO C;  5J9P C;  2BOC C;  4G27 B;  2WLK A;  4PDM A;  3F7Y C;  1OCC C;  4UUJ C;  3UKM A;  3IGA C;  3TET A;  1OCZ C;  1R3K C;  3BEH A;  2WLL B;  4HZ3 A;  4RUE A;  2X6B A;  3E86 A;  2W0F C;  4JTC B;  4WFF A;  4XDJ A;  5EC2 C;  1R3J C;  2OCC C;  4BW5 A;  3ABK C;  2AHY A;  4G28 B;  4WFG A;  1XL6 A;  2QKS A;  2KB1 A;  1K4C C;  5B1B C;  3HPL C;  2DWE C;  3RBZ A;  4MW3 A;  4JTA B;  4MS2 A;  4MVS A;  5CBH A;  2H8P C;  2ZD9 A;  2ITD C;  1OCR C;  3AG1 C;  2BOB C;  1R3L C;  2WLI A;  3K03 A;  3STZ C;  3RVZ A;  5EC1 C;  5EBW C;  4P2Z A;  4P30 A;  2HJF C;  3ASO C;  3AG2 C;  4PDV A;  4X88 A;  3E8B A;  3JYC A;  3LNM B;  4PA4 A;  4WFE A;  4X89 A;  2EIN C;  3ZRS A;  2DWD C;  2Q69 A;  4J9Z B;  1S5H C;  3X2Q C;  3K06 A;  4PDR A;  3SPI A;  4XDK A;  1G4Y B;  1M56 C;  3LDC A;  4OXS A;  2EIJ C;  4LBE C;  3RW0 A;  3SYA A;  3ABL C;  5E1A C;  3OR6 C;  4XDL A;  2A0L A;  2NLJ C;  2DYR C;  2EIM C;  4HYO A;  3SYO A;  4LCU C;  3F7V C;  5CBG A;  4GX1 A;  2R9R B;  4MVO A;  4MTG A;  3E8H A;  2Q67 A;  3IFX A;  3FB7 C;  4P9O A;  3TCU A;  4DXW A;  4MVQ A;  3SYC A;  3ABM C;  5EBM C;  3F5W C;  2EIL C;  1V54 C;  2IH1 C;  3OUS A;  3R65 A;  4MVM A;  2Q6A A;  3UM7 A;  2IH3 C;  1QLE C;  3T1C A;  2WLH A;  2WLI B;  4F4L A;  3K0G A;  2K1E A;  3ASN C;  1JVM A;  2Y69 C;  3FB8 C;  4EKW A;  3K0D A;  4MVU A;  4ZBM A;  3OUF A;  5CBF A;  4H37 A;  4PA7 A;  4GX5 A;  4MSW C;  4PA3 A;  3SPJ A;  2A9H A;  2WLJ A;  2ZXW C;  2HFE C;  4MTF A;  4PA6 A;  4P9P A;  2ITC C;  4X8A A;  5BZB A;  2P7T C;  4QNH B;  2YEV A;  5EK0 A;  3RVY A;  4MVZ A;  1J95 A;  3T4Z A;  3AG4 C;  4I9W A;  4TWK A;  1ORQ C;  2WLL A;  4QE9 A;  4PA9 A;  1XL4 A;  5IY5 C;  1V55 C;  2EIK C;  3K04 A;  1P7B A;  3FB5 C;  4RAI A;  2WLN A;  3ZJZ A;  2Q68 A;  4QE7 A;  2DYS C;  2X6A A;  3OR7 C;  3E89 A;  4MTO A;  3SJQ C;  3SPH A;  4PDL A;  3STL C;  2HVJ C;  4MW8 A;  4R50 A;  3E8G A;  4WFH A;  3PJS K;  5B3S C;  3E83 A;  2WLM A;  3GB7 C;  3SYQ A;  3LDE A;  4LP8 A;  4KFM A;  4GX2 A;  4MVR A;  3LDD A;  3E8F A;  4R7C A;  3SPC A;  3SPG A;  3KG2 A;  3T4D A;  2QTO A;  3FB6 C;  4R6Z A;  1ZWI C; 
#chains in the Genus database with same CATH topology
 1FFT B;  5KUK A;  3QNE A;  4FVM A;  1KUQ A;  3L9D A;  4ZHQ B;  5LMU B;  4N21 A;  2JK5 C;  2YS8 A;  1K3E A;  1YJW V;  2KSD A;  1BQ0 A;  3M99 B;  4X9Q A;  2H94 A;  4LF5 O;  2Q5Z A;  2RQ6 A;  1RSO A;  1AP6 A;  3CXH F;  4WFF A;  1OCR B;  2P90 A;  3ABK C;  3DC6 A;  3K3W A;  2E5L O;  1R73 A;  1YSC A;  1S0V A;  5LL6 Y;  4MVS A;  2VS0 A;  3I5D A;  4LFA O;  5GON B;  3SJB C;  1HR0 O;  4X20 B;  4MTX A;  4DUY O;  3ZHQ A;  3L70 H;  3LNM B;  3FD9 A;  2Q7E A;  1SF9 A;  5CN0 A;  5IE9 A;  2DYR C;  2XAS A;  4UVA A;  5KHH A;  2RNB A;  4F6E A;  5LMN O;  1CP9 A;  1RSO B;  3OMN B;  4DR5 B;  3CS5 A;  3O9O A;  2EIL C;  2V1D A;  4MVM A;  5FPR A;  1ZL8 A;  4KUM A;  4EFE A;  3ZCC A;  4DR2 B;  1N36 O;  1KP2 A;  3L72 H;  3L75 H;  2WLH A;  1D5N A;  3CJH A;  2OWO A;  1Y74 A;  2K1E A;  1TUE B;  3G71 V;  4D7S A;  2Q0O C;  1PM9 A;  3QTC A;  2ADP A;  4JZ2 A;  4UCR A;  1XEQ A;  2CTW A;  2HEP A;  4QIW F;  4JAS A;  1KQS U;  3AG4 C;  1V9P A;  1M1K W;  5B1N A;  3DTU B;  3CD6 V;  3JAR B;  3KKY A;  1FD9 A;  1N0N A;  5KA6 A;  3E89 A;  1XOU A;  2XAG A;  4WFH A;  5IYZ B;  1ZL8 B;  4JI5 B;  2GHY A;  4L87 A;  4LF6 B;  1VMG A;  3H1L H;  3CJH B;  5LP6 C;  2VRZ A;  3FB6 C;  5LGN A;  3CCV V;  2E74 B;  2ZE8 A;  4DR6 O;  1IBM O;  1K4D C;  3EVK A;  1UFI A;  1XIL A;  2HG5 C;  3N2K A;  3UT5 A;  4JTD B;  3ABK B;  2ILM A;  2BOC C;  3ZHR A;  1RPR A;  1Y66 A;  3E22 A;  2DMX A;  1OCZ C;  3BEH A;  1YTF B;  1LR1 A;  4JTC B;  4BW5 A;  4NXM B;  1R6K A;  4JV5 B;  1CEZ A;  4KP4 A;  2HR3 A;  2OCH A;  5LHI A;  4TUY A;  4FLZ A;  5CBH A;  2PF4 E;  3JD4 A;  3K03 A;  1H2G A;  4P2Z A;  3ZRS A;  4WFE A;  2DYR B;  2Q69 A;  4J9Z B;  3FX7 A;  4HBN A;  1SKV A;  3QG5 A;  1G4Y B;  4OX9 O;  3N2K B;  3UT5 B;  3LDC A;  4LBE C;  4DR3 B;  2CTP A;  3CEI A;  3LSU A;  4B3S B;  2EIL B;  2WA3 A;  2XT9 A;  1JX9 A;  1VQ5 V;  2UXD O;  3IFX A;  3FB7 C;  3JD0 A;  1HR0 B;  1THZ A;  1S76 D;  1CPY A;  1V54 C;  3ZHV A;  3R65 A;  4KXR A;  4YY3 B;  1F51 A;  4TUY B;  5JJJ B;  5JCO C;  5BY1 A;  4GCZ A;  2P4K A;  1QNM A;  1YCI A;  3IC7 A;  1BQZ A;  5LBQ A;  3CHX A;  4HNA A;  4NTX A;  3OUF A;  3I56 V;  3G80 A;  3AG4 B;  4PA3 A;  1LUW A;  1FS0 G;  4NTY A;  1XNQ O;  3DXR A;  1H2K A;  3RYH A;  1XHZ A;  4K0K B;  1Y76 A;  3UO3 A;  2YC0 A;  4TQD A;  1VQ7 V;  5LP6 B;  3L71 H;  5CA1 B;  1KD1 W;  2F66 C;  4JAU A;  3LDE A;  2Y0I A;  3JSL A;  1YHQ V;  4HNA B;  3J80 N;  4LF4 O;  1AI7 A;  1XQ8 A;  1VQN V;  4NYK A;  1OCZ B;  1XDC A;  4CH5 A;  1BL8 A;  2RCV A;  4DW1 A;  4LH7 A;  4H44 B;  4U3F H;  4LNU A;  3NXS A;  1OCO C;  2HHH O;  5CA0 B;  1BHA A;  5B66 Z;  4DV5 O;  5JCO A;  1XL6 A;  1WJZ A;  2PYL A;  2KB1 A;  3HPL C;  3RBZ A;  4LF8 B;  1I5Y A;  4X1Y A;  4IYI A;  2ZD9 A;  5JH7 A;  3Q4H B;  4X65 O;  2XOK G;  2HJF C;  5A9G A;  4YJ2 A;  3E8B A;  3RYF A;  1EN4 A;  3ZHS A;  3SPI A;  4LNU B;  1GN2 A;  5KHG A;  2OYQ A;  2ETN A;  5E1A C;  1V54 B;  3G67 A;  3F7V C;  2PTM A;  4DV1 O;  2R9R B;  3A2F A;  1YF2 A;  3TCU A;  3H9V A;  1ZUQ A;  4CH6 A;  4X1Y B;  3T1H O;  4NXN B;  4OX9 B;  5JH7 B;  4PD4 F;  2QSA A;  2YXY A;  3RYI B;  2Z3Y A;  3C90 A;  1DF5 A;  1Z5V A;  1M90 W;  1TVK A;  1PNM A;  1FJG B;  3B4S A;  4J7Z A;  1H38 A;  3ZBH A;  1JFF A;  4G2K A;  1E1Q G;  4DUZ B;  2RDC A;  4CS3 A;  3HKE A;  4DYL A;  1NZ6 A;  3W7U A;  2QWN B;  4DR4 O;  1MZF A;  3HKC A;  3GB7 C;  4DK1 A;  2WSS G;  2Y4T A;  3HKD A;  1XNQ B;  3SPG A;  1OCO B;  1WA8 B;  4J9Y B;  2IJK A;  2QA4 V;  4H33 A;  2BSK B;  3OGC C;  1OJH A;  1TVK B;  1L8D A;  3OAA G;  1P49 A;  2LFR A;  4AIL C;  2QM4 A;  1JFF B;  2GUZ A;  5TIS Z;  1EZJ A;  3W7S A;  3JAK A;  2JJ1 G;  3HKE B;  2B9Z A;  1Q82 W;  3E35 A;  4FLW A;  1WN7 A;  1QHT A;  2IU3 A;  3RN4 A;  3HKB B;  3HKC B;  4X64 O;  3K9A A;  3HKD B;  3STZ C;  1ENV A;  1XHX A;  4GKK O;  2VQF O;  4PA4 A;  5F2V O;  1I08 A;  3JCU Z;  1S77 D;  2WAM A;  5IWA O;  1BE3 H;  2DE0 X;  1M56 C;  1TGO A;  5GTI Z;  2VWJ A;  1RPO A;  4J10 A;  1IDS A;  2GUZ B;  3VQX A;  3RYC A;  3T1Y B;  3JAK B;  1W2B U;  2CDY A;  1IXB A;  1VQ4 V;  1EZV H;  1Q6U A;  1Y67 A;  1VQ6 V;  2LGW A;  3F5T A;  1QLE C;  3CC7 V;  1NVP B;  1JVM A;  2Y69 C;  2N04 A;  1IBL O;  2CGO A;  3K0D A;  4O4I A;  1SQP H;  4DV1 B;  5EIB C;  1CXZ B;  4O2A B;  2WLJ A;  2A06 H;  3B8M A;  4P9P A;  2ITC C;  4QNH B;  3QO5 A;  4K8X A;  1SQQ H;  1N33 O;  2ZNI A;  3B2E E;  4UB6 Z;  3WB1 A;  3RYC B;  1SQG A;  3ZRW A;  3B40 A;  3ZMV A;  4YIO A;  3FAV A;  2X6A A;  4PDL A;  2QM7 A;  3OE7 G;  1I5X A;  4FK5 C;  4O4J A;  1ZLZ A;  1D5A A;  2QTO A;  1YEW A;  4OGQ B;  4RO2 A;  4GX0 A;  2M7W A;  4IGG A;  1KKD A;  4B3R O;  1URF A;  5J9P C;  3ETD A;  2WWW A;  1W0K G;  4IHJ B;  3TET A;  2UUC O;  1XMQ O;  2UXB B;  1QCE A;  3ZRW B;  1DK1 A;  4KL1 A;  4G28 B;  4WFG A;  3MHS C;  1EN5 A;  3JAT B;  2JEX A;  4JAA A;  4D6T H;  2CH7 B;  2QDO A;  5LYJ A;  1M56 B;  4Z1M G;  4F6R A;  1VF5 B;  5EBW C;  3UQ8 A;  5EK0 A;  4GKJ B;  1HP8 A;  1SQX H;  1EFR G;  3CE2 A;  2LQT A;  4OXS A;  1N32 B;  3LSS A;  2EUL A;  3OM3 B;  4FMT A;  1IZ3 A;  2QEX V;  1Q86 W;  5H6Q A;  1MSD A;  4LF7 B;  2G38 A;  2Z0A A;  4I5S A;  3JD1 A;  5EIB D;  5CBG A;  3CPW U;  1Q81 W;  4FPP A;  3RGB A;  1QLE B;  2PYJ A;  5EBM C;  1VF6 A;  2Y69 B;  4Q20 A;  2IH1 C;  4LFB B;  5LYJ B;  1X4T A;  4IYH A;  4F6R B;  3SPJ A;  4UVB A;  2ZXW C;  1MOF A;  1GN3 A;  4X8A A;  3ZMS A;  2EZP A;  2IJJ A;  1FAF A;  4I9W A;  2NNU A;  3CCS V;  3FYE B;  4JI3 O;  1V55 C;  4RWU A;  4RAI A;  2CAZ C;  3OR7 C;  4DV6 O;  1I0H A;  4E2L A;  5IYB O;  1JPX A;  4W4K A;  3ICX A;  2VQE B;  4GX2 A;  1A32 A;  2JGD B;  1IXM A;  3VQV A;  3CCR V;  1J5E B;  2GTS A;  1NS1 A;  4TQF A;  5B1A C;  4BIU A;  4FM1 A;  1TA8 A;  3WG7 C;  2QR4 A;  3K08 A;  2E76 B;  5D5P A;  3TGU H;  2F1M A;  1R3K C;  1I94 O;  2UXC O;  2R72 A;  1HW7 A;  2AHY A;  3N2G B;  5HFL A;  5JJN B;  5BR8 O;  1KP3 A;  4B3M B;  1H2L A;  1TUB B;  1IBK B;  3M8A A;  4GYC B;  5FPO A;  1PL4 A;  5L3G A;  2YI9 A;  4JI7 O;  4JI8 B;  2R70 A;  1JMK C;  3AEI A;  3U11 A;  2EIN C;  1XMQ B;  3X2Q C;  2ZIM A;  1AIL A;  5ITZ B;  2CTQ A;  5JVD A;  4X66 B;  2EIJ C;  4XBF A;  2QM8 A;  1BCC H;  1WP8 A;  2EIM C;  3SYO A;  1SS3 A;  4DV7 O;  1R6T A;  2A3Q A;  1NTM H;  2IW5 A;  4ZKI A;  3TK1 A;  4X1K A;  2LW7 A;  2HJD A;  4OPH A;  5LHH A;  2Q6A A;  3OTO O;  2QGN A;  5EYP A;  3WB0 A;  1FPO A;  4BW9 A;  2ODM A;  2ZDI A;  2A7W A;  2P4V A;  1PD3 A;  1V55 B;  1EN6 A;  5JVD B;  2MW2 B;  4I0X A;  1UPG A;  2P7T C;  4GT1 A;  3JAR A;  2UUA O;  1YDX A;  1F23 A;  5LOV A;  2HP8 A;  5IYZ A;  2DYS C;  4X1K B;  2HVJ C;  5B1A B;  2LW1 A;  1ROP A;  4RQE A;  4LP8 A;  1P84 F;  4R7C A;  3TXQ A;  4JI4 O;  3WG7 B;  4DR7 O;  2Y48 A;  5EYP B;  1F4M A;  1N34 O;  1WAZ A;  3CXC U;  4DV3 O;  4PI0 A;  5FNV A;  4I0X B;  2KKW A;  4PDM A;  4DV6 B;  5L3D A;  2CUG A;  2XTA A;  4DV2 O;  3I55 V;  5LOV B;  2X6B A;  3KCY A;  4J80 A;  4FIP C;  3BA8 A;  4BAY A;  3AK3 A;  4JPR A;  3JAS A;  2DWE C;  1SES A;  2EIN B;  3P3P A;  2YDE A;  3VQY A;  3CCQ V;  3X2Q B;  4MS2 A;  2H8P C;  2QKC A;  1AI6 A;  4TV8 A;  2ZNJ A;  4I4T A;  2ZIO A;  4FZ0 A;  2EIJ B;  4JYC A;  5L3E A;  3CCJ V;  2E75 B;  2EIM B;  3ZMU A;  1I94 B;  3EHB B;  3J81 N;  4XDK A;  1VQ9 V;  1KMI Z;  4YIP A;  4FM2 A;  5FNV B;  3KZI Z;  2NLJ C;  2XAF A;  4PV1 B;  1DLB A;  5KMG B;  2QWQ B;  5L3F A;  3JAS B;  1XUQ A;  4FLU A;  1T5E A;  2P6J A;  4JI0 O;  2JRI A;  2OTJ V;  1F4N A;  3HB3 B;  2IH3 C;  3SJA C;  4FFB B;  4LF5 B;  2WPD G;  4TV8 B;  1YI2 V;  4I4T B;  2ZM6 O;  2W6J G;  3QO8 A;  4MSW C;  2E5L B;  1L0N H;  2FTK A;  1W0J G;  2FB5 A;  2GSM B;  1Q43 A;  2M6Y A;  2DYS B;  4LFA B;  4Z1V A;  3JAW A;  4I7Z B;  4YJ3 B;  5LP6 A;  4DUY B;  5CA1 A;  3K04 A;  2Q7H A;  4DV4 O;  4R50 A;  3OTF A;  2XUM A;  1VQK V;  5CMU A;  1OV9 A;  3BY6 A;  2OIE A;  5LMN B;  5IYC O;  1NH2 D;  1GKF A;  2UUA B;  5CA0 A;  4TOI A;  5LGT A;  3BRC A;  3SYP A;  4G27 B;  1N36 B;  3D3I A;  3SGI A;  3JAW B;  4HZ3 A;  2ZE6 A;  3LSQ A;  2FML A;  2W0F C;  3H1J H;  1R3J C;  1SER A;  4JI6 O;  5EZY A;  3Q4H A;  1QLN A;  4LF9 O;  2F4V O;  1M9N A;  1R3L C;  3AK1 A;  1YVW A;  5C93 A;  2F95 B;  4FLT A;  4A5U B;  3K5M A;  1RFY A;  3K59 A;  1GMG A;  4DV2 B;  2LO1 A;  2V7Q G;  4GUN A;  4LWS A;  3WB2 A;  3CP1 A;  5KHJ A;  2PUS A;  5KX5 A;  4FM0 A;  4B3T O;  1O9H A;  1PNK A;  4DR6 B;  1IBM B;  3U0Z A;  1S72 V;  1VEW A;  2FYU H;  3RWR D;  5EZY B;  1JR9 A;  1NT2 B;  3OUS A;  4WBN A;  4ZOL B;  3A0R A;  4LFC O;  3UM7 A;  4AQY O;  2FL4 A;  3RYI A;  2BCC H;  1AR1 B;  1AJP A;  3FB8 C;  1TAE A;  4MVU A;  5CBF A;  5B1O A;  2N74 A;  3GVM A;  1B06 A;  5KLV H;  4JYA O;  5FL7 G;  4LWS B;  5BZB A;  1M93 A;  2V4D A;  4NB5 A;  5KX5 B;  3JD3 A;  1FKA O;  2Q8V A;  1VP7 A;  4X62 O;  4FLV A;  1XRE A;  4QE7 A;  3STL C;  3A8T A;  4FZ1 A;  4WBN B;  4B08 A;  2OIG A;  1KC8 W;  1WA8 A;  4U3J A;  3SPC A;  2BSK A;  1SQF A;  2EZO A;  3B77 A;  1HDJ A;  3KG2 A;  1GO3 F;  1DGS A;  4JYB A;  2DJV A;  2X6C A;  2UXD B;  4C7U A;  1WB8 A;  1L1F A;  2LGQ A;  3D36 C;  2P67 A;  1MNG A;  3T2M A;  4RUF A;  4CBC A;  2CTR A;  1GRJ A;  1RM1 C;  1K92 A;  4ABM A;  1YIJ V;  3IJ4 A;  3ZRX A;  1YJN V;  3HKB A;  5BXZ A;  3APO A;  3G6E V;  1R1B A;  2QWP B;  2RMK B;  4PEL A;  1VQL V;  2Y4U A;  1SQV H;  2GBO A;  1JQ0 A;  3A0H Z;  4WFB V;  4TT3 G;  4U3J B;  3ZS8 C;  5LA6 A;  2F23 A;  3DSQ A;  3UCS C;  4BIZ A;  1H8H G;  5IJ9 B;  1X59 A;  3DC5 A;  1E79 G;  4TV9 B;  1VF7 A;  2P22 C;  5HFM A;  3CCE V;  3M7M X;  3BA9 A;  1SC5 B;  2Y0P A;  1N0J A;  1QR9 A;  4LF9 B;  2F4V B;  4KHP O;  4U7O A;  4ZIB A;  4LF4 B;  4MVO A;  1B6Q A;  3ZED A;  4U7N A;  3ABM C;  1Y6X A;  3APQ A;  4IT5 A;  2Q9L A;  1NU1 H;  2HHH B;  4UCO A;  1FYJ A;  3D36 A;  3ABT A;  4DV5 B;  5LA6 B;  3K0G A;  4O2A A;  4ZBM A;  1H8E G;  2D2C B;  1K97 A;  3BCC H;  5LXT A;  2A9H A;  2BTQ A;  3CX5 F;  5FLX N;  1H2M A;  4X65 B;  3AG7 A;  2QKA A;  4MVZ A;  3RVY A;  1YIT V;  1P7B A;  4BIO A;  1K73 W;  2Q68 A;  1AVM A;  1WPB A;  5DM6 V;  1UJW B;  2L6L A;  4CH4 A;  1BHB A;  1BT8 A;  4CZZ A;  1US6 A;  5LHG A;  1MMM A;  2P5O A;  1RM1 B;  3FFQ A;  3LNN A;  5LXT B;  2IJI A;  3VOU A;  4X62 B;  2BTQ B;  4IHJ A;  3OMA B;  4DW0 A;  2GDS A;  1XI1 A;  3T1H B;  3ZIA G;  2X7R B;  1N8R W;  2XAJ A;  3JAT A;  3E86 A;  2IM9 A;  4K3A A;  1XNR O;  5AG2 A;  2VWK A;  3B09 A;  2CH7 A;  1K4C C;  3GWK C;  4DV0 O;  3L73 H;  1KYO F;  1Q90 D;  4WCE V;  2UU9 O;  3JD2 A;  4Z2W A;  1BGY H;  4H0L B;  4DRX A;  5EC1 C;  4CS4 A;  4X88 A;  3JYC A;  2DWD C;  4J7K A;  3ETQ A;  4DR4 B;  3BFR A;  3RW0 A;  4JI2 O;  3J7A U;  3QF7 A;  5LMU O;  2DOS A;  3CRR A;  3MHH C;  2B5U A;  4F4L A;  4NR1 A;  1JOY A;  4DRX B;  4WFA V;  2XHB A;  1L0L H;  4E4E A;  2QE7 G;  4GX5 A;  5J2U A;  3H1I H;  2R9I A;  2UXN A;  2YID A;  1SRY A;  3JSN A;  5BMV A;  4X64 B;  2F43 G;  2ZR3 A;  1U97 A;  3E2E A;  1ORQ C;  4PA9 A;  4GKK B;  2VQF B;  4GLX A;  1H2N A;  3CMA V;  3ZJZ A;  3JCZ A;  5IWA B;  2JGD A;  1AR4 A;  3JAM N;  1BS3 A;  3E8G A;  3SYQ A;  1Q6I A;  4IL6 Z;  1ZWI C;  1LNQ A;  5EBL C;  2ATK C;  3OFN G;  4EFB A;  1FXV A;  1WPX A;  5J2U B;  1DTO A;  2A79 B;  3AG3 C;  5BMV B;  3F7Y C;  3UKM A;  4X1I A;  4BWA A;  3N2G A;  5D5Q A;  4DR2 O;  1KB9 F;  2HKO A;  4RUE A;  1IBL B;  1TUB A;  1VQP V;  1VQ8 V;  2BTO A;  1AP5 A;  4HAM A;  1Z2G A;  5KA5 A;  1N33 B;  3CRA A;  2FKX A;  2YIB A;  1SZX A;  5ITZ A;  1HWY A;  3R66 A;  2IBZ H;  1S5H C;  3K06 A;  1XMO O;  1AB3 A;  3HR0 A;  4UCV A;  4DK0 A;  3K5L A;  3S3W A;  1XNR B;  3SYA A;  4JI5 O;  5DEC A;  4X1I B;  4LCU C;  5H9C A;  1WP7 A;  1PKX A;  2IU0 A;  1QR8 A;  4DXW A;  4MVQ A;  4B3R B;  3SDL A;  4WF9 V;  5CA3 A;  5KAF Z;  3W7X A;  4UV8 A;  2RN9 A;  2UUC B;  3ASN C;  4NXM O;  4PJ0 Z;  4JV5 O;  4PA6 A;  2F93 B;  3H1H H;  2RJZ A;  1K8A W;  2WLL A;  1SET A;  3ZN0 A;  1GM7 A;  1FXK C;  2ZKO A;  4IIJ A;  1Q3E A;  2ZXW B;  3CRQ A;  1JA8 A;  1MSW D;  3EXA A;  3ABU A;  4DR3 O;  3AG3 B;  3E8F A;  4D7T A;  1EM1 A;  4B3S O;  2ZQM A;  5K1X A;  2JVD A;  3MD0 A;  2AHZ A;  2KG7 A;  1R3I C;  2EBO A;  3K79 A;  1VQM V;  4YY3 O;  3ZMT A;  1OCC C;  2PGG A;  1IX9 A;  5CB4 A;  2WLL B;  2OCC C;  1PNL A;  3C3S A;  3SJC C;  1HNX O;  3A0B Z;  4IIJ B;  3H1K H;  4L8J A;  2Z5U A;  2W0X A;  3AK2 A;  1Q6H A;  2PZS A;  4JI3 B;  1KKC A;  4QPJ A;  4BR6 A;  4K0K O;  1SQB H;  2QWR B;  4X89 A;  4PDR A;  2KG7 B;  2YXH A;  4QJF B;  1FXK A;  2YIA A;  5KMG A;  2N05 A;  1ZX3 A;  3OR6 C;  1IUR A;  1FFX A;  5CB4 B;  1R6N A;  3OEH G;  4P9O A;  1ZAU A;  3ASN B;  1NJI W;  1GM8 A;  1K5Q A;  4FFB A;  3W7W A;  1GH6 A;  3TJT A;  1XMO B;  2ZR2 A;  4B7E A;  4O4L A;  3T1C A;  1PL0 A;  2UXC B;  2LJ2 A;  5BR8 B;  2XAH A;  4CC6 A;  3P32 A;  2CGN A;  3OD4 A;  1Y74 B;  4YJ3 A;  2HFE C;  1FXK B;  4LF8 O;  2YEV A;  1YTF D;  1N4C A;  3T4Z A;  1J95 A;  4JI7 B;  1FFX B;  1E1R G;  1XL4 A;  3ZN1 A;  3K5O A;  4NKG B;  4W4L A;  1MZE A;  2AW9 A;  2EX3 A;  3FB5 C;  3QVN A;  1Q7Y W;  2LFS A;  5JQG A;  4MTO A;  4FLY A;  4MW8 A;  3PJS K;  2C2A A;  1SZT A;  1NI8 A;  3E83 A;  3THO A;  4O4L B;  3VQW A;  2L35 A;  4DV7 B;  1SA0 A;  3L74 H;  3RT3 C;  3W7T A;  1OCC B;  3RFR A;  1YZB A;  3WU2 Z;  4JZG A;  3LUT B;  1F7Y A;  2OCC B;  2HVK C;  1VQO V;  3OTO B;  4RQF A;  1W59 A;  2YEV B;  3CME V;  4NXN O;  1S3J A;  1K9M W;  1AR5 A;  2ZE5 A;  4FLX A;  3E22 B;  5JQG B;  2QKS A;  4ICG A;  1Q5O A;  1FJG O;  1QVF U;  3JAL A;  4TSF G;  3D8C A;  2ITD C;  1QBZ A;  3AG1 C;  4FFK A;  2AZ0 A;  1ZTE A;  2ARH A;  2JEU A;  5KAI Z;  4DUZ O;  1SA0 B;  3BAA A;  4P30 A;  3ASO C;  4J7J A;  4PDV A;  4H13 B;  2XAQ A;  4UV9 A;  2ZIN A;  1NH2 B;  1HNX B;  2JJ2 G;  4JI4 B;  4DR7 B;  2HLD G;  1FXH A;  1WLE A;  4XDL A;  1KEC A;  2P06 A;  3BVO A;  2JS3 A;  4ZOL A;  5KHK A;  1NR1 A;  1N34 B;  2NN4 A;  1JJ2 U;  2Q67 A;  2K9P A;  4DV3 B;  2MK3 A;  3F5W C;  4EEQ A;  5IDJ A;  1WNS A;  5E79 Z;  5JJE B;  3JAL B;  5GTH Z;  4O2B A;  4PI2 A;  3IC9 A;  3OEE G;  1NTK H;  4LH6 A;  4LR3 A;  2W6I G;  5GW7 A;  3TXS A;  2H3O A;  4ZI7 A;  2GV9 A;  3ZRV A;  4CC5 A;  3ZMZ A;  2JIZ G;  1IVS A;  5H2F Z;  4UFZ A;  5IY5 C;  2EIK C;  3DXR B;  4B7K A;  4K8Z A;  2PI4 A;  3GWO A;  2WLN A;  5H6R A;  1Q8I A;  1QU7 A;  3RYH B;  4O4H A;  1Y76 B;  4J42 A;  3QO7 A;  3K5N A;  4O2B B;  3H01 A;  1QVG U;  1JCH A;  2CK3 G;  4UCS A;  3T1Y O;  4GZR B;  2PI5 A;  1D2D A;  5KUM A;  4JI0 B;  4ZI7 B;  1M57 C;  2EJR A;  3CWB H;  1B3Q A;  3B8N A;  3ZHU A;  4I55 A;  3SR2 C;  5C8Y A;  3OW2 U;  1Z5W A;  1AI5 A;  3IGA C;  2ZM6 B;  3AG1 B;  2UUB O;  5IJ0 A;  2LP7 A;  1HNZ O;  4O4H B;  2Q7G A;  5B1B C;  1NQT A;  3ASO B;  1K7D A;  1HNW O;  2BE3 A;  5IJ9 A;  5K1P A;  1EBO A;  2XND G;  1DF4 A;  2AZ2 A;  2WLI A;  2DQ3 A;  3DGE A;  3P3N A;  3ZHT A;  2ZT9 B;  4TV9 A;  3N27 A;  1PV0 A;  1B04 A;  4DV4 B;  3CSX A;  4YJ2 B;  3RYF B;  4I55 B;  5C8Y B;  4HYO A;  5JWP A;  2QTS A;  1GN4 A;  5IJ0 B;  3E8H A;  3OMI B;  2WA4 A;  3SYC A;  1WB7 A;  1GK9 A;  4JI1 O;  1S5L Z;  3K9S A;  2WLI B;  4UB8 Z;  5L3B A;  2UXB O;  4ASU G;  4JI6 B;  3G6B A;  1BSM A;  5IY5 B;  2EIK B;  1VIB A;  4I50 A;  2D3O W;  2IJH A;  3K58 A;  2JDI G;  5LGU A;  4Q6G A;  5IYD O;  4TWK A;  4QE9 A;  4LC1 A;  1YJ9 V;  1KBH A;  4GKJ O;  4YHH O;  4AHC A;  3ML0 A;  2AXT Z;  5A2Q N;  2WLM A;  2DQ0 A;  4KFM A;  4B3T B;  1N32 O;  1M57 B;  1G1X B;  2DN9 A;  4NVP A;  4JYY A;  4LF7 O;  1G8M A;  3ETE A;  3EFF K;  4J41 A;  2Q0A A;  4LFC B;  3IAY A;  3P30 A;  4I50 B;  4AQY B;  2WLK A;  1GN6 A;  2JS5 A;  4LFB O;  5B1B B;  4I9Q A;  1PP9 H;  2ZCE A;  4XDJ A;  1GAX A;  5EC2 C;  2YUA A;  1MA1 A;  1M4U A;  1YXB A;  1MAB G;  4K35 A;  5DN6 G;  4JYA B;  1NR7 A;  4N23 A;  1ARO P;  4JTA B;  1NVP D;  1K33 A;  2BOB C;  2OTL V;  1P4R A;  2E3C A;  1NTZ H;  3AG2 C;  1AJN A;  2UUB B;  2YSU B;  1HNZ B;  3MAQ A;  3CRM A;  3ABL C;  3PN1 A;  2VQE O;  2A0L A;  1HNW B;  1OZ0 A;  1G6U A;  5KHI A;  1J5E O;  4GX1 A;  4MTG A;  4QGP A;  1VAR A;  3CCL V;  1RP3 B;  1H2S B;  5DED A;  4UVC A;  5B5E Z;  4DR1 O;  2GTA A;  2KQX A;  1COW G;  2UXX A;  4J11 A;  1NKD A;  1K5S A;  4H37 A;  1GTO A;  3ABM B;  4UXN A;  4B3M O;  1VF6 C;  4MTF A;  4EB6 A;  1IBK O;  4O4I B;  4QPK A;  1KU9 A;  1ZSP A;  3ZX6 A;  4JI1 B;  2O57 A;  2Q4P A;  4JI8 O;  4MT8 A;  3CC4 V;  3SPH A;  1BZK A;  5B3S C;  4X66 O;  1P7G A;  4MVR A;  2ZE7 A;  3FAV B;  2EJ7 A;  2YI8 A;  4KHP B;  2OT5 A;  2DW4 A;  3T4D A;  4R6Z A;  5H5N A;  4O4J B;  4R8C A;  4AI8 A;  1OHH G;  2X0L A;  4FJC C;  1AJQ A;  4JF3 A;  1BMF G;  3FYI B;  4EB6 B;  4YHH B;  4DO2 A;  2ADQ B;  4UUJ C;  3CRC A;  2YIC A;  2PY5 A;  1LUV A;  3KCX A;  5IT9 N;  1M5I A;  2NR5 A;  3CCM V;  3WFV A;  3AG2 B;  2CE4 A;  1AI4 A;  4MW3 A;  1OCR C;  4DR5 O;  4YXW G;  1QQC A;  3RVZ A;  3ABL B;  4EKW A;  3OT7 A;  2QWO B;  3CYO A;  2YXL A;  1NBM G;  4JGS A;  4OPA A;  3O65 A;  3BPZ A;  3UO2 A;  5J2T A;  3CB2 A;  3U10 A;  3D3Q A;  2QJ1 A;  1XBL A;  2R9A A;  3MDS A;  4UCU A;  3G4S V;  3CC2 V;  3OGI B;  4CS2 A;  3VBB A;  1Y4M A;  4ZHQ A;  2B1G A;  1O9G A;  3FKS G;  4PA7 A;  1K34 A;  4DV0 B;  2AGA A;  4JAV A;  4LF6 O;  3CCU V;  3NR7 A;  3BHP A;  1I7F A;  1MG1 A;  3C3T A;  3S3X A;  2UU9 B;  5B3S B;  3K57 A;  4CH3 A;  2Q73 A;  4DR1 B;  1S5J A;  2ZDI C;  2B1I A;  4NTW A;  3BAB A;  3SJQ C;  5J2T B;  1JJO A;  1GM9 A;  3ETG A;  4JI2 B;  2JGU A;  1U96 A;  5L3C A;  1PPJ H;  5GON A;  4PHZ A;  4X20 A;  3LDD A;  4UCT A;  2YIB D; 
#chains in the Genus database with same CATH homology
 1OCC B;  2X6C A;  1FFT B;  5KUK A;  3QNE A;  1L1F A;  4N21 A;  4RO2 A;  2JK5 C;  4GX0 A;  2M7W A;  1KKD A;  2P67 A;  3LUT B;  1K3E A;  2OCC B;  3T2M A;  4RUF A;  3ETD A;  2HVK C;  4CBC A;  5J9P C;  1VQO V;  4RQF A;  1YJW V;  2WWW A;  1RM1 C;  1W0K G;  2YEV B;  1K92 A;  3CME V;  3TET A;  3M99 B;  1S3J A;  2H94 A;  1YIJ V;  1K9M W;  3ZRX A;  1QCE A;  1YJN V;  4WFF A;  3ZRW B;  1OCR B;  2P90 A;  3ABK C;  4G28 B;  4WFG A;  3G6E V;  3MHS C;  2QKS A;  4PEL A;  3K3W A;  1VQL V;  1R73 A;  1YSC A;  2JEX A;  1S0V A;  1QVF U;  1JQ0 A;  4WFB V;  4TT3 G;  4MVS A;  4TSF G;  2ITD C;  1QBZ A;  3AG1 C;  1M56 B;  2JEU A;  4Z1M G;  4BIZ A;  5EBW C;  1H8H G;  4MTX A;  4P30 A;  3ASO C;  5EK0 A;  4PDV A;  3LNM B;  2XAQ A;  1EFR G;  4UV9 A;  1NH2 B;  1E79 G;  4OXS A;  5CN0 A;  2JJ2 G;  5HFM A;  3CCE V;  3LSS A;  4FMT A;  2HLD G;  1FXH A;  1WLE A;  3OM3 B;  4XDL A;  2QEX V;  1Q86 W;  2DYR C;  2XAS A;  5H6Q A;  1KEC A;  4UVA A;  1QR9 A;  4U7O A;  4I5S A;  1CP9 A;  1NR1 A;  3JD1 A;  3OMN B;  5CBG A;  4MVO A;  3CPW U;  1Q81 W;  1B6Q A;  4FPP A;  1JJ2 U;  1QLE B;  2Q67 A;  2MK3 A;  4U7N A;  3ABM C;  2Y69 B;  5EBM C;  3F5W C;  4Q20 A;  2EIL C;  2IH1 C;  2V1D A;  4MVM A;  4KUM A;  5IDJ A;  3ZCC A;  1KP2 A;  3D36 A;  3ABT A;  2WLH A;  3K0G A;  2K1E A;  1TUE B;  3OEE G;  3G71 V;  4ZBM A;  1H8E G;  2W6I G;  1K97 A;  5GW7 A;  3SPJ A;  4UVB A;  2A9H A;  3ZRV A;  2ZXW C;  1MOF A;  3ZMZ A;  4X8A A;  4QIW F;  2JIZ G;  3ZMS A;  2EZP A;  4JAS A;  3RVY A;  2IJJ A;  4MVZ A;  1KQS U;  3AG4 C;  2NNU A;  4I9W A;  3FYE B;  3CCS V;  1YIT V;  1M1K W;  5IY5 C;  1V55 C;  2EIK C;  5B1N A;  3DTU B;  3CD6 V;  1P7B A;  3GWO A;  2PI4 A;  4RAI A;  2WLN A;  5H6R A;  1K73 W;  5KA6 A;  2Q68 A;  3OR7 C;  3E89 A;  5DM6 V;  3QO7 A;  4E2L A;  1UJW B;  2XAG A;  4WFH A;  5IYB O;  1JPX A;  1BHB A;  2GHY A;  4GX2 A;  4L87 A;  3H01 A;  4CZZ A;  1QVG U;  1JCH A;  2CK3 G;  5LHG A;  1IXM A;  3CCR V;  3FB6 C;  1RM1 B;  4BIU A;  5B1A C;  5LGN A;  3CCV V;  2PI5 A;  1K4D C;  5KUM A;  2IJI A;  3VOU A;  1M57 C;  2EJR A;  3WG7 C;  2HG5 C;  2QTO A;  3OMA B;  3B8N A;  3ABK B;  4JTD B;  3K08 A;  2BOC C;  1RPR A;  1Y66 A;  3OW2 U;  3ZIA G;  1AI5 A;  3IGA C;  2X7R B;  1N8R W;  1OCZ C;  1R3K C;  3BEH A;  2XAJ A;  1YTF B;  3E86 A;  4JTC B;  4BW5 A;  3AG1 B;  2AHY A;  1R6K A;  2LP7 A;  5HFL A;  1CEZ A;  1KP3 A;  4KP4 A;  1K4C C;  1NQT A;  5B1B C;  2HR3 A;  3ASO B;  1K7D A;  5LHI A;  1EBO A;  2XND G;  5CBH A;  1DF4 A;  4WCE V;  3JD4 A;  2WLI A;  2DQ3 A;  3JD2 A;  3K03 A;  3DGE A;  5L3G A;  5EC1 C;  1H2G A;  4P2Z A;  3ZRS A;  4X88 A;  3JYC A;  3AEI A;  4WFE A;  2DYR B;  2EIN C;  2DWD C;  2Q69 A;  4J9Z B;  3X2Q C;  1G4Y B;  3LDC A;  2EIJ C;  4LBE C;  3RW0 A;  4XBF A;  2EIL B;  2QM8 A;  4HYO A;  2EIM C;  3SYO A;  1JX9 A;  1VQ5 V;  2IW5 A;  3E8H A;  3IFX A;  3OMI B;  3FB7 C;  3JD0 A;  4ZKI A;  3TK1 A;  3SYC A;  1THZ A;  1S76 D;  1CPY A;  1V54 C;  3R65 A;  1F51 A;  5LHH A;  2Q6A A;  3MHH C;  1GK9 A;  4GCZ A;  2B5U A;  2WLI B;  4F4L A;  3IC7 A;  5LBQ A;  1JOY A;  4WFA V;  5L3B A;  3OUF A;  4ASU G;  3I56 V;  2ZDI A;  3AG4 B;  2QE7 G;  4GX5 A;  4PA3 A;  1PD3 A;  5IY5 B;  1V55 B;  2EIK B;  1FS0 G;  2R9I A;  2UXN A;  1SRY A;  2D3O W;  2IJH A;  2P7T C;  4GT1 A;  2F43 G;  2ZR3 A;  2JDI G;  5LGU A;  5IYD O;  3E2E A;  1F23 A;  4TWK A;  1ORQ C;  4QE9 A;  4PA9 A;  4LC1 A;  1YJ9 V;  1VQ7 V;  3CMA V;  3ZJZ A;  3JCZ A;  3W7T A;  2DYS C;  3ML0 A;  2HVJ C;  1KD1 W;  3E8G A;  5B1A B;  4JAU A;  1ROP A;  2WLM A;  3SYQ A;  4RQE A;  3LDE A;  2DQ0 A;  4LP8 A;  4KFM A;  1M57 B;  4R7C A;  3WG7 B;  1YHQ V;  2Y48 A;  1F4M A;  1ZWI C;  1G8M A;  3ETE A;  3EFF K;  1LNQ A;  1AI7 A;  5EBL C;  1VQN V;  2ATK C;  3OFN G;  1OCZ B;  1FXV A;  1WPX A;  1BL8 A;  3CXC U;  1DTO A;  2A79 B;  3AG3 C;  3NXS A;  3P30 A;  1OCO C;  2WLK A;  4PDM A;  5L3D A;  3F7Y C;  3UKM A;  5B1B B;  2HKO A;  3I55 V;  1BHA A;  4RUE A;  2X6B A;  4FIP C;  4XDJ A;  5EC2 C;  4BAY A;  4JPR A;  1XL6 A;  1VQP V;  1MAB G;  1VQ8 V;  5DN6 G;  2KB1 A;  1NR7 A;  3HPL C;  2DWE C;  1SES A;  4HAM A;  3RBZ A;  2EIN B;  4N23 A;  3CCQ V;  1ARO P;  1I5Y A;  3X2Q B;  4JTA B;  4MS2 A;  5KA5 A;  1NVP D;  2H8P C;  2ZD9 A;  1K33 A;  2BOB C;  2OTL V;  1AI6 A;  1P4R A;  2XOK G;  2EIJ B;  4JYC A;  2HJF C;  3AG2 C;  3E8B A;  5L3E A;  3CCJ V;  1HWY A;  2EIM B;  1S5H C;  3ZMU A;  3K06 A;  3SPI A;  3EHB B;  4XDK A;  1VQ9 V;  1AJN A;  2YSU B;  3SYA A;  3ABL C;  5E1A C;  2A0L A;  2NLJ C;  2XAF A;  1V54 B;  1OZ0 A;  1DLB A;  4LCU C;  5H9C A;  3F7V C;  1PKX A;  5L3F A;  4GX1 A;  2IU0 A;  2R9R B;  4MTG A;  1QR8 A;  3TCU A;  4DXW A;  4MVQ A;  4WF9 V;  3CCL V;  2P6J A;  5CA3 A;  2OTJ V;  4UVC A;  3W7X A;  1F4N A;  3HB3 B;  4UV8 A;  2IH3 C;  2WPD G;  1YI2 V;  1COW G;  3ASN C;  2UXX A;  1NKD A;  2W6J G;  3QO8 A;  1K5S A;  4H37 A;  1GTO A;  4MSW C;  2Z3Y A;  3ABM B;  1DF5 A;  4UXN A;  1M90 W;  1PNM A;  4MTF A;  4PA6 A;  2FTK A;  1W0J G;  2GSM B;  1H38 A;  2DYS B;  4QPK A;  4G2K A;  1E1Q G;  1K8A W;  2WLL A;  1SET A;  3ZN0 A;  3K04 A;  1GM7 A;  1FXK C;  4MT8 A;  3CC4 V;  3SPH A;  2ZXW B;  3W7U A;  4R50 A;  1VQK V;  1MSW D;  5B3S C;  5CMU A;  3GB7 C;  2WSS G;  4MVR A;  3LDD A;  3AG3 B;  3E8F A;  3BY6 A;  2ZQM A;  2OT5 A;  3SPG A;  1OCO B;  2DW4 A;  3T4D A;  5IYC O;  4R6Z A;  1NH2 D;  1GKF A;  4J9Y B;  2IJK A;  3MD0 A;  2QA4 V;  2AHZ A;  4H33 A;  4R8C A;  3OGC C;  1OHH G;  5LGT A;  2X0L A;  1R3I C;  2EBO A;  3K79 A;  3OAA G;  4FJC C;  1AJQ A;  4JF3 A;  3SYP A;  1BMF G;  3FYI B;  1VQM V;  4G27 B;  3D3I A;  2LFR A;  3ZMT A;  1OCC C;  4UUJ C;  4DO2 A;  4HZ3 A;  2WLL B;  1EZJ A;  3LSQ A;  3W7S A;  2W0F C;  2JJ1 G;  1R3J C;  2OCC C;  1SER A;  1PNL A;  3CCM V;  1Q82 W;  3E35 A;  1QLN A;  3WFV A;  2IU3 A;  3AG2 B;  1AI4 A;  2Z5U A;  4MW3 A;  1M9N A;  1OCR C;  3K9A A;  1R3L C;  3STZ C;  1ENV A;  5C93 A;  4YXW G;  4QPJ A;  3RVZ A;  1GMG A;  3ABL B;  4EKW A;  4PA4 A;  4X89 A;  3CYO A;  4PDR A;  2V7Q G;  1S77 D;  2WAM A;  4QJF B;  1FXK A;  1M56 C;  3CP1 A;  1RPO A;  3OR6 C;  1NBM G;  1PNK A;  4JGS A;  1R6N A;  3OEH G;  1W2B U;  4P9O A;  1S72 V;  1VQ4 V;  3ASN B;  1NJI W;  1GM8 A;  1K5Q A;  3OUS A;  3W7W A;  3A0R A;  2ZR2 A;  3UM7 A;  1VQ6 V;  3T1C A;  1QLE C;  1PL0 A;  3G4S V;  1AR1 B;  3CC7 V;  3CC2 V;  1NVP B;  1JVM A;  2Y69 C;  1AJP A;  3FB8 C;  3VBB A;  1Y4M A;  3K0D A;  4MVU A;  5CBF A;  5B1O A;  2B1G A;  2XAH A;  3FKS G;  4PA7 A;  1K34 A;  3P32 A;  4JAV A;  2WLJ A;  3CCU V;  2HFE C;  5FL7 G;  1FXK B;  3B8M A;  4P9P A;  2ITC C;  5BZB A;  1MG1 A;  4QNH B;  2YEV A;  3QO5 A;  1YTF D;  3JD3 A;  3T4Z A;  1J95 A;  5B3S B;  1E1R G;  1XL4 A;  3ZN1 A;  3ZRW A;  3ZMV A;  3FB5 C;  1Q7Y W;  2LFS A;  2ZDI C;  2B1I A;  4QE7 A;  4MTO A;  2X6A A;  3SJQ C;  3STL C;  4PDL A;  2QM7 A;  4MW8 A;  3PJS K;  2C2A A;  1SZT A;  1GM9 A;  3E83 A;  1KC8 W;  3ETG A;  3OE7 G;  1I5X A;  4FK5 C;  5L3C A;  3SPC A;  2EZO A;  3B77 A;  3KG2 A;  1GO3 F;  3ABU A;  4JYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...