4ZBMA

Crystal structure of drosophila cyclic nucleotide gated channel pore mimicking nak mutant
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
90
structure length
90
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGETPTPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title Structural implications of weak Ca2+ block in Drosophila cyclic nucleotide-gated channels.
pubmed doi rcsb
source organism Bacillus cereus (strain atcc 14579 / dsm 31)
molecule tags Membrane protein
total genus 33
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4zbmA00
4PA6A 4MS2A 4EKWA 4MW8A 1JVMA 4H33A 3T4ZA 3PJSK 4R7CA 4JTDB 3RBZA 3WG7C 1LNQA 2WLJA 3RVYA 1G4YB 1R3JC 2R9RB 3K0DA 4TWKA 4X89A 2DWDC 3AG1C 1V55C 3GB7C 3HPLC 3LDCA 3LDDA 3KG2A 5E1AC 3UM7A 3ZRSA 2HVJC 4RAIA 2H8PC 4H37A 4I9WA 1ORQC 4G28B 4J9YB 1S5HC 2EILC 1QLEC 3K06A 4MVMA 3SJQC 4WFHA 3SYQA 2A0LA 2HJFC 3TETA 3FB7C 4WFGA 2OCCC 1M56C 2ZD9A 3SYCA 5CBHA 3K0GA 4MVRA 2IH1C 2BOCC 3ASNC 4HYOA 4UUJC 2WLIA 3K03A 1P7BA 2WLLB 3E83A 3SYOA 3E8GA 2ZXWC 3T4DA 4BW5A 3F5WC 2X6AA 3OR7C 4GX1A 3RW0A 3F7VC 5EBMC 5EBLC 2NLJC 3FB5C 2QTOA 2P7TC 3SPIA 4MSWC 3OGCC 2X6BA 4LP8A 4MTFA 3SPHA 4JTAB 2WLHA 5IY5C 2A9HA 3ABMC 3TCUA 3FB6C 4HZ3A 5EK0A 4PA9A 2Y69C 4PA4A 3SPJA 2EIJC 3ABLC 1BL8A 3E8FA 3IFXA 3ABKC 3JYCA 3K04A 3LNMB 4QE9A 3AG3C 1OCRC 5J9PC 2WLLA 5EBWC 4XDKA 3OR6C 1KKDA 4LBEC 1R3KC 4MVZA 1J95A 4PDMA 2ITDC 3T1CA 5CBFA 3VOUA 4P30A 3STZC 4R8CA 3UKMA 4PA3A 1V54C 1XL4A 3T2MA 4DXWA 1XL6A 2BOBC 4MTOA 4P9OA 3AG4C 3OUSA 2WLKA 2HG5C 2EIKC 5BZBA 5KUMA 3E86A 2EINC 4G27B 4GX5A 3F7YC 3SPCA 1OCCC 2X6CA 4GX0A 2DYRC 4PA7A 4MVOA 4F4LA 3K08A 4MW3A 2DYSC 3LDEA 3SPGA 4RUFA 3STLC 2EIMC 3R65A 2HVKC 4P2ZA 2ITCC 4ZBMA 2KB1A 2Q68A 4MVUA 2W0FC 4R50A 4RUEA 5B1BC 3BEHA 3RVZA 4P9PA 2AHZA 4RO2A 4LCUC 1R3LC 3EFFK 1OCOC 4JTCB 2AHYA 3E8BA 4MVSA 2WLNA 2Q69A 4X8AA 2DWEC 4WFEA 5B3SC 5CBGA 2WLMA 5EC2C 3E8HA 4WFFA 3X2QC 2YEVA 1R3IC 3SYPA 1K4CC 2WLIB 4XDJA 1OCZC 3OUFA 4GX2A 4KFMA 4MVQA 3ZJZA 2Q6AA 3IGAC 5KUKA 4PDLA 3E89A 4PDRA 1M57C 2HFEC 3LUTB 4QNHB 1K4DC 2IH3C 2JK5C 5B1AC 5EC1C 2QKSA 4OXSA 4X88A 2A79B 2K1EA 4QE7A 1ZWIC 3AG2C 4R6ZA 4XDLA 4CBCA 3FB8C 4PDVA 4MTGA 3ASOC 4J9ZB 2Q67A 3SYAA 2ATKC
chains in the Genus database with same CATH superfamily
3WB1A 4WFBV 5KA5A 5LHIA 3K5NA 1L0LH 3L75H 3JCZA 1LNQA 3ETGA 4JI3B 3AG1C 4IT5A 5IJ9B 4W4LA 4OPHA 1YVWA 1IBKO 4B3SO 1ZAUA 1JCHA 2D2CB 3OEHG 2VQEO 1K73W 4NR1A 3SGIA 5LGTA 2HJFC 2OCCC 3CJHB 2ZD9A 4CH6A 4JAUA 4TQDA 3T4DA 1FKAO 4JPRA 4DUZB 2GHYA 4TV9B 1MSWD 4CZZA 4NKGB 5EK0A 3KZIZ 3L9DA 4PA4A 5AG2A 1BL8A 3OMIB 4LWSA 2M7WA 3E22B 1R3KC 1TUEB 3UKMA 4JV5B 1AI7A 4DXWA 2IM9A 1MMMA 1H8EG 3EVKA 4OGQB 5BZBA 1WAZA 2X6CA 2F66C 3W7TA 4F4LA 2HKOA 2GUZB 1GM9A 4EB6B 1JFFA 4UB6Z 4JI5B 3U0ZA 1G1XB 5KMGA 3BEHA 2UU9B 1R3LC 2L6LA 2UXDO 5J2UA 1SQXH 4UFZA 2DWEC 3CEIA 1O9HA 1K92A 2YXLA 5CBGA 1H38A 2GBOA 1GN4A 1ZTEA 4LF9B 3I56V 1NH2D 2UUBB 3G67A 3AG7A 4OXSA 5D5PA 3AG1B 4JI5O 3QG5A 4YIPA 3BVOA 3BRCA 2UU9O 1DLBA 1BQZA 1AI4A 4X64O 4FLYA 1N0NA 1WPBA 4X89A 1Y76B 4BW9A 3CD6V 2H8PC 4B3RB 1XNRO 2A0LA 4WFGA 1R6NA 3P3PA 2UUBO 2YXYA 3DGEA 1TAEA 3OT7A 1QQCA 1WNSA 4LF7B 4HYOA 2YSUB 2P4VA 2ZIOA 1H2MA 4QIWF 5BY1A 4DR7O 3CX5F 3NR7A 4I7ZB 2VWKA 3FB6C 4YHHB 2ILMA 3E8FA 2Y0PA 1SA0B 2HLDG 1ENVA 3UO2A 4LC1A 2P67A 4B3RO 4I55B 3LSUA 3ZX6A 1RFYA 1XL4A 3ABLB 3K3WA 4LF7O 2WLKA 2ZDIA 1I08A 3SPCA 4JAVA 4O4JA 2HP8A 5B1NA 3SR2C 3J81N 2ZM6B 4PJ0Z 3R65A 4YHHO 4UCUA 3RVZA 1TUBA 1NJIW 4UV8A 3SJAC 3RYCB 5LHGA 1QLNA 1JQ0A 1AP5A 3HKDB 2DOSA 5H6RA 4U3JA 4OX9B 4B3TB 5EC2C 3CB2A 2F95B 2CTQA 2ARHA 3FAVB 2IJKA 1K34A 5C8YB 5HFLA 2E3CA 5FNVB 2CAZC 1AJPA 1P49A 2VQFO 2ZM6O 2VWJA 1ZWIC 3AG2C 4LH7A 3CRAA 4N23A 2Q67A 5DEDA 1SRYA 1FD9A 2NNUA 4MS2A 3N2KA 5H2FZ 3DSQA 5CB4B 1QNMA 1SQGA 4OX9O 2GTAA 4B3TO 1SQBH 3APOA 4NTWA 5K1PA 1NBMG 2HVJC 3U10A 5H9CA 5KA6A 4NYKA 3KKYA 1Y74A 4FMTA 3FB7C 4FLVA 4K0KB 1Q6UA 3JD3A 4I0XA 3SJCC 1T5EA 5B66Z 4DUYO 1H2SB 4TV8B 5IJ9A 3FB5C 1GKFA 1GH6A 2QWRB 4UVCA 3ZMTA 4Q6GA 2FTKA 2WLHA 2A9HA 3CJHA 1Y67A 1KD1W 4JI0O 3K58A 4K35A 3JALB 2O57A 3T1CA 2LW7A 3B8NA 3H9VA 2OTJV 1Q5OA 2HJDA 2W6JG 4TV9A 1F23A 4K0KO 1XL6A 4DR2B 1KKCA 4UCOA 2HG5C 3CCRV 1PKXA 4X65B 1XI1A 3CPWU 2LO1A 4Z2WA 4P2ZA 5F2VO 1RM1C 1AILA 4GKJO 1XQ8A 4X1KA 1XOUA 2IJIA 4JTCB 4X8AA 3IJ4A 1QVGU 2PUSA 4FK5C 1OJHA 2LGWA 3L74H 1JR9A 3APQA 1IX9A 2VS0A 2GUZA 2DW4A 3AG2B 4EB6A 2PYJA 3ZJZA 4Z1VA 3CE2A 2K9PA 2QGNA 1NT2B 4YJ3B 4ZOLA 4X88A 1FYJA 4QJFB 4U7OA 4FZ0A 4Q20A 3ABUA 3A8TA 5IWAO 4ABMA 3OTOB 1FAFA 2OIGA 1LR1A 3D36A 1FJGB 4JASA 4DW0A 3ZHTA 2NR5A 1H2NA 3UM7A 4ZKIA 4H37A 1L8DA 4G28B 4WFHA 5LMNB 2GSMB 2FL4A 4O2BB 3OM3B 2OCHA 1M56C 3PN1A 5A2QN 4UVAA 2G38A 4UUJC 2E74B 2NLJC 4JF3A 2BTQB 2YICA 4D7SA 1PV0A 3TCUA 1FJGO 1AVMA 1MOFA 1VQ8V 1I0HA 3T1HO 3L72H 2XAQA 5KX5B 1S0VA 3MHSC 1HP8A 2YS8A 5CBFA 5LMNO 1NQTA 2QSAA 1WJZA 3HKEB 3QTCA 2A7WA 4TT3G 1HR0B 4D6TH 4JYYA 1SA0A 4L8JA 3HKBB 4RQFA 4GX0A 5DM6V 1KECA 2UXBB 2PY5A 5IT9N 1M4UA 2ETNA 2YEVB 2JEXA 2ZR3A 3TK1A 3P3NA 3WB2A 1VP7A 1WA8B 1IXBA 1OCOC 3ETQA 2AHYA 2RJZA 4U7NA 3ZCCA 3S3WA 1SQVH 3Q4HB 4H0LB 4PELA 5B3SC 1W2BU 4X62B 3JARB 1HR0O 3HKCB 5CA0B 1NS1A 2UXBO 1D2DA 3HKDA 4QE7A 5TISZ 1XMQO 1A32A 5GTIZ 1AJNA 5C8YA 3ETEA 5FNVA 4UCSA 2JEUA 1AR4A 1M56B 2YIDA 3RVYA 5LP6C 3DTUB 1VMGA 4WFAV 3C90A 2UUAO 4X62O 3BCCH 1S72V 3BFRA 4G2KA 4HAMA 3I5DA 4FZ1A 1HWYA 3ZRWA 4DK0A 2JIZG 2XTAA 5CB4A 3JAKB 1KQSU 5CBHA 4JI4O 3K5OA 2F1MA 3T1YO 1Y4MA 2WLLB 1E1RG 2A3QA 5KLVH 1FFXB 4FVMA 2X6AA 4GX1A 3RW0A 2QTOA 4B7EA 3VQWA 4MTFA 1XEQA 4O2AB 4DR1B 3OW2U 1K8AW 1ZLZA 4TV8A 3ZN1A 4BR6A 5LYJA 5C93A 4N21A 4X20A 4LFBB 1S3JA 1V54C 3JD4A 4UCRA 2P06A 1OCOB 1VF6C 2XAFA 4B3MB 4MW3A 2FMLA 3JALA 1PL0A 3H1KH 4DR1O 4E4EA 2C2AA 2Y4UA 1Y6XA 1IVSA 4O4LA 4LFBO 4LH6A 1NVPD 4CH3A 1OHHG 2QWNB 3X2QC 3UT5A 3TXQA 3JATB 4MVQA 1N34B 5IJ0B 1IDSA 1AR5A 4LF6O 3LSSA 5B1AC 5LP6B 1Q43A 5L3FA 4AQYO 1N32B 4R6ZA 4XDLA 2HEPA 3P30A 1FXKB 2WSSG 4B08A 3MD0A 3CCEV 4CH5A 5LXTB 5LA6B 3ZHVA 2ZQMA 4J7JA 2GV9A 4YJ3A 4K8ZA 2DWDC 3CXHF 3SDLA 2XNDG 2Q8VA 4RAIA 1N34O 2NN4A 1CPYA 1VQ7V 5JH7A 5FPOA 1JJ2U 4LF8B 2RDCA 3ASNC 1RP3B 1N32O 2WLIA 1TA8A 1WP7A 1VQMV 1VF7A 2QWQB 2P7TC 4MSWC 1EN6A 3AK3A 2AW9A 2P4KA 4B7KA 1FXHA 3ZBHA 2ZE6A 5B1OA 2ZE7A 1PNLA 3SPJA 4TOIA 5EYPB 4U3FH 1XMOB 2V7QG 1OCRC 2ZT9B 2PZSA 3B4SA 2YDEA 4EFEA 4P30A 5IYZA 1SQQH 2Y69B 3OEEG 5GONB 4LF8O 3OUSA 2XAHA 1AI5A 3TXSA 2QR4A 1Z5VA 1US6A 2JJ2G 1HNZB 1W0KG 5KX5A 3K08A 2R9IA 4YXWG 5IYCO 3K5MA 4JI3O 2HVKC 2BCCH 2FYUH 4PI0A 1XMOO 1XNQB 4RO2A 1OV9A 5BMVA 3E8BA 1IBLB 1XHXA 4UB8Z 1JOYA 1R6KA 1E1QG 3HKBA 3B09A 5B1AB 4LFCB 2Q0OC 4WFEA 4TUYB 1W59A 2YEVA 3CYOA 2GTSA 1K4CC 4D7TA 3ZRVA 1HNZO 3ZIAG 1WA8A 3G80A 4DUZO 1M57C 4J11A 3EHBB 3BY6A 1Q81W 3OTFA 1YTFD 3Q4HA 3VQYA 5JJEB 1D5NA 4CBCA 4DV3B 1SESA 4CC5A 3MDSA 4JI1B 1XNQO 1IBLO 5JJNB 3HKCA 5CA0A 4TSFG 4JV5O 4LFCO 3OAAG 1DTOA 3RYHB 3ASNB 5KAFZ 4NXNB 4J9YB 1QLEC 1AROP 3OMNB 4FM0A 2UXXA 2UXCB 1KP3A 3BPZA 1SKVA 3M7MX 3TJTA 3DXRB 1EFRG 3F5WC 1OCRB 1K7DA 4AHCA 2OCCB 2WA3A 1QU7A 2OTLV 2E5LB 1XILA 4HZ3A 3ZMUA 1U97A 3JAKA 3TGUH 1GM7A 4KHPB 4F6EA 4LF9O 2WLLA 1FFXA 3H1JH 4IIJB 3STZC 1PNMA 4PA3A 3A0BZ 3MAQA 4O2AA 4DW1A 3CMEV 5IYDO 1Y66A 1TGOA 3ZRXA 4UCVA 4UV9A 4G27B 2V1DA 1GN2A 4WBNA 2UXNA 5LHHA 2QKAA 4RUFA 1F4NA 2E5LO 1RPRA 5ITZB 3P32A 3ZMSA 4LF4B 2KB1A 1YF2A 1Z5WA 2JS3A 4FLZA 4A5UB 4KHPO 3EFFK 4MVSA 1QR9A 2DQ3A 3CXCU 2PYLA 2XHBA 2Q7HA 2YXHA 2WLMA 4BAYA 4DR4B 4WFFA 1NZ6A 3ZHUA 2YI8A 1V9PA 1SQPH 4I50B 5KUKA 2IBZH 3E89A 3GWOA 4PDRA 1B06A 5KHJA 3B40A 4JGSA 3THOA 1YJWV 5E79Z 2CTPA 5FLXN 4PDVA 4ZHQB 1XBLA 3N2GB 3CCSV 1MABG 1B04A 3O65A 4DRXB 4EKWA 5IJ0A 5EIBD 3FFQA 4KUMA 2GDSA 1BQ0A 3RT3C 3LDCA 3LDDA 3L71H 2CDYA 4JAAA 5E1AC 3CRCA 4CS2A 1VQ5V 1RPOA 1M93A 5JVDA 1FXKA 2EX3A 1ORQC 3KCYA 5FL7G 3VQVA 1S5HC 1NVPB 1M90W 1I94B 5LXTA 1SETA 3B2EE 1SZXA 1NR1A 4DV6B 4NTYA 5IE9A 4KL1A 3WU2Z 5CA1A 4PA9A 3UO3A 3ABKC 3OR6C 4MVZA 4PDMA 3RGBA 4JI2B 3IC9A 2FB5A 3OFNG 2B9ZA 3AK2A 2BOBC 4MTOA 2IU0A 2P90A 5EYPA 4DV6O 4CH4A 3RYFB 2ITCC 2N04A 4R50A 3ZHRA 3JSNA 5JCOA 4DV4B 3GWKC 5GONA 1VIBA 2QWOB 2Y0IA 1SC5B 3AEIA 2IW5A 4DV1B 4JZ2A 3K9AA 4J7KA 3RFRA 2JGDB 1OCZC 2X7RB 3E22A 3WB0A 5K1XA 2YIBA 2KQXA 1VARA 2JRIA 3C3TA 4GZRB 5H5NA 4TUYA 5A9GA 1BE3H 1ROPA 4IYHA 3K79A 2PGGA 2AGAA 4FLWA 4FM2A 2QDOA 3FX7A 1ZSPA 4DR2O 2Z5UA 2B5UA 4UVBA 2EILC 4X65O 2Q9LA 1YZBA 3FYIB 4GCZA 2XASA 3ABTA 4GYCB 2W6IG 4CS3A 1L0NH 1G8MA 5L3BA 3ABKB 3F7VC 1KP2A 2CUGA 3OGCC 2EJRA 4JTAB 3RN4A 4JYAB 5LOVB 2Q7GA 2WWWA 3JASB 5IYBO 1SQFA 3LNMB 3AG3C 3DXRA 4X9QA 2QE7G 3VQXA 1KKDA 5DN6G 3ZMZA 3R66A 1J95A 1H2LA 5L3DA 1N36B 4WF9V 3ETDA 5JQGB 1P7GA 1NH2B 2R9AA 1Y76A 1KMIZ 5KUMA 1UJWB 4FLUA 3CWBH 2H3OA 3OTOO 4PA7A 2BSKB 4GLXA 1KU9A 1N8RW 1BS3A 4ICGA 4F6RB 2EIMC 2PI4A 1S5LZ 1OCZB 1XUQA 3SJBC 3K5LA 2KG7B 3W7SA 4GKKB 4X1YB 1I5XA 2VRZA 3CCQV 1RM1B 2M6YA 1O9GA 1Z2GA 2KSDA 1AP6A 5ITZA 5L3GA 2LP7A 3D3QA 1H8HG 2XT9A 3HR0A 4I55A 2JK5C 5JJJB 3H1LH 3I55V 2JDIG 2N74A 3CS5A 1KC8W 1BT8A 4J9ZB 3IC7A 1BGYH 2EILB 4PA6A 3CRRA 3D3IA 1BSMA 3G6EV 2Q5ZA 3LNNA 1VQOV 2YIAA 3BABA 3RYCA 1COWG 1M5IA 4EFBA 1AB3A 4DRXA 1SZTA 1JFFB 4GUNA 3ZS8C 3K03A 3E8GA 2ZXWC 3FAVA 2ZDIC 3AG3B 5EBLC 3W7XA 1UFIA 1YHQV 2QKCA 4C7UA 2X0LA 5FPRA 2JVDA 4L87A 4DV5B 1Q82W 3OD4A 4XDKA 2ITDC 4I9QA 4J80A 1GMGA 4O4IB 2W0XA 2JS5A 4P9OA 1S5JA 1PPJH 3CCMV 2LW1A 1GTOA 2HR3A 2ZINA 1ZL8B 2QA4V 1PP9H 5EZYB 4YIOA 2Y4TA 5IDJA 1IBMB 1AR1B 1YEWA 2W0FC 4DV5O 1YJ9V 4LCUC 1F4MA 2Q69A 4MTXA 1JJOA 1GO3F 1NKDA 3M8AA 3AK1A 3RYFA 2Q73A 2OYQA 4XDJA 4GX2A 3CRMA 2BTOA 1WPXA 2EBOA 5B3SB 3LUTB 1GRJA 1HW7A 4LNUB 3RWRD 2ZNIA 1VQ9V 1N33B 2JGDA 4JYBA 3S3XA 4R7CA 3L73H 2AXTZ 3K0DA 4TWKA 2QWPB 1V55C 2A06H 1VQ6V 3B8MA 2ZXWB 5DECA 4O4JB 2Q4PA 4MVMA 2DN9A 4B3MO 1SERA 3UCSC 1SF9A 2JGUA 1TUBB 1N33O 3A0HZ 3QNEA 2UUCB 1J5EB 4U3JB 2DQ0A 1QCEA 3ABMC 3M99B 4J41A 1FPOA 4UXNA 3FYEB 4DO2A 4BIUA 1DF5A 3DC5A 4EEQA 3CP1A 4FJCC 3VOUA 2JJ1G 1NTKH 4FPPA 2CH7B 3G71V 2EULA 5LOVA 4ZIBA 3JASA 1IBKB 1JX9A 1K5QA 3A2FA 3OMAB 3RYIB 4O2BA 1V54B 5H6QA 5J2TB 2UUCO 1J5EO 2RMKB 2IU3A 1GN6A 1CXZB 4ZBMA 2RN9A 2YI9A 2AHZA 1Y74B 2BTQA 2BSKA 3D36C 3O9OA 4I0XB 1PM9A 2QEXV 4F6RA 4J42A 1QHTA 4KP4A 2QTSA 3OUFA 2OIEA 1Q6HA 2KG7A 2WPDG 4BWAA 5KHGA 4QNHB 2IH3C 4I4TB 1ZUQA 4X1YA 3X2QB 2QKSA 3HKEA 1V55B 4MTGA 1NTMH 1WB7A 4O4HB 1GM8A 1GAXA 1IZ3A 3T4ZA 4H33A 1RSOB 1VQPV 3CC4V 1KB9F 4DK1A 1R3JC 1F51A 4CC6A 4DR3B 3HPLC 1GK9A 1YIJV 3NXSA 2LGQA 3KG2A 3ZRSA 2LQTA 5L3CA 2UXDB 5JWPA 1X59A 1LUVA 1Q8IA 3ABMB 1FFTB 3K0GA 4MVRA 2BOCC 3JARA 4X1KB 3BAAA 3GVMA 1AJQA 4ASUG 2F43G 4NXMB 1Q6IA 1JPXA 2LFSA 4DR3O 2EIJC 3ABLC 1IURA 3KCXA 3J7AU 2CGOA 4QE9A 5J9PC 1Q90D 1X4TA 4R8CA 4ZOLB 4X64B 1XHZA 4GT1A 1MSDA 4XBFA 4I5SA 4DV3O 2Q0AA 4JI1O 2EIKC 5LMUB 4H13B 2DYRC 1XNRB 2ADQB 4X66B 4NXMO 1NR7A 4FLXA 4DV2B 3JAMN 5KAIZ 1WN7A 1DGSA 1P4RA 2XOKG 2Q68A 4NXNO 4O4IA 3QF7A 5HFMA 3QO5A 2HHHB 3MHHC 4DR7B 2UXCO 1ZL8A 5LL6Y 1YCIA 2RNBA 1R3IC 2ZE5A 4X1IB 4LF5B 5EZYA 3FD9A 4LFAB 1NTZH 1BMFG 2ZE8A 4AI8A 4DV0B 1MNGA 4HNAB 5LMUO 5L3EA 3W7UA 4X66O 2K1EA 4DV2O 5LGUA 4WCEV 1D5AA 1M57B 3BA8A 2HHHO 1AI6A 3PJSK 2AZ2A 1L1FA 2WLJA 1MA1A 1KYOF 1FXVA 2R9RB 3LSQA 2E76B 1H2KA 4LNUA 4LF5O 1BZKA 2LJ2A 4DV7B 4LFAO 4RWUA 3K06A 3SJQC 4DV0O 2EZOA 2XAGA 3SYQA 4QGPA 3TETA 1S77D 1NI8A 4BIZA 4NVPA 4LF4O 2L35A 2EIJB 3IAYA 2IH1C 3JATA 4FFBB 3CHXA 3OR7C 1QLEB 5EBMC 1PD3A 2X6BA 3WFVA 3DC6A 4DR4O 2VQFB 4IHJB 5LP6A 4DR5B 4PHZA 1EM1A 3IFXA 2EIKB 4DV7O 5EBWC 2DYRB 1K9MW 1HNWB 5LA6A 3JD1A 1EZVH 2E75B 2MW2B 2CE4A 2EINC 2KKWA 2ZCEA 2CK3G 1I7FA 2ZKOA 3CCUV 2CH7A 4DUYB 5D5QA 4DR5O 1YITV 4P9PA 3D8CA 1I94O 1B6QA 2DJVA 2Y48A 2PTMA 3HB3B 3ZRWB 2YC0A 4JI7B 1HNWO 1P84F 1VF5B 3RYIA 3OGIB 5BXZA 5J2TA 4YJ2B 4QPKA 3FKSG 4JI0B 3CCLV 3C3SA 3IGAC 3QO8A 1VF6A 2Z3YA 1S76D 3BA9A 1HNXB 1CP9A 5EC1C 1JA8A 4ZI7B 5KHKA 4LR3A 3ZMVA 1YJNV 2ADPA 5LYJB 1B3QA 1DF4A 1BHBA 3H1IH 4X20B 4MW8A 4JI2O 5CMUA 1PL4A 2YUAA 1NU1H 4JI7O 3E35A 4MT8A 4I4TA 1TVKB 1U96A 1Q7YW 4GKJB 1Q86W 4O4HA 3ICXA 1RSOA 2WAMA 2ZIMA 1HNXO 1KBHA 4DV4O 3E83A 4FIPC 3ML0A 4J7ZA 4O4LB 1THZA 3H01A 3ZN0A 4DV1O 1WLEA 1G6UA 2H94A 3W7WA 3UT5B 3H1HH 3J80N 3JYCA 2QM4A 2EINB 3EXAA 2P6JA 5IWAB 5BR8B 3K57A 1VQNV 2F4VB 4HBNA 4KXRA 2R72A 3B77A 3RYHA 1QR8A 4E2LA 2IJJA 3JCUZ 1YTFB 3E86A 4GX5A 3U11A 1OCCC 4PI2A 4FLTA 2DYSC 2IJHA 3STLC 4YY3B 2QM7A 3N27A 2BE3A 4MVUA 4RUEA 4NB5A 3UQ8A 4PV1B 3BHPA 5JH7B 5BR8O 4BIOA 2F4VO 4K8XA 3JAWB 4PD4F 5KHIA 2RCVA 2WLIB 1M9NA 4KFMA 5EIBC 2LFRA 3T1HB 2Q6AA 2PI5A 5KHHA 4IIJA 1K4DC 4JI6B 4JYAO 1R6TA 5B5EZ 1H2GA 2CTRA 3ZHQA 1GN3A 2A79B 3CSXA 4YY3O 3E2EA 2EJ7A 4X1IA 3SYAA 3JSLA 3CCJV 1MZEA 4HNAA 5IYZB 4JTDB 3RBZA 3WG7C 1N36O 4H44B 1G4YB 2YIBD 4UCTA 1N0JA 4JZGA 3GB7C 1K97A 1HDJA 2F23A 2XUMA 1I5YA 2D3OW 5LGNA 4TQFA 2R70A 4JI6O 2WA4A 4Z1MG 4LWSB 1P7BA 3SYOA 3K59A 1EZJA 5BMVB 4GKKO 4I50A 1VEWA 1WP8A 4IGGA 4LP8A 2QJ1A 3SPHA 5IY5C 1VQKV 1EBOA 4ZHQA 3K04A 3N2GA 1XMQB 4FFBA 2EZPA 1OCCB 4FM1A 3G6BA 1F7YA 2DYSB 4DR6B 1LUWA 5CA3A 2XAJA 4K3AA 3T2MA 3CC7V 1W0JG 1YDXA 5KMGB 4JYCA 2UUAB 4IHJA 3AG4C 3A0RA 5J2UB 5LBQA 3F7YC 4MVOA 4W4KA 1YI2V 3SPGA 4FFKA 4IL6Z 3CMAV 1FS0G 1MG1A 4JI4B 5B1BC 1UPGA 4OPAA 3T1YB 4J10A 2WLNA 2DE0X 3G4SV 2EIMB 1R1BA 4DR6O 2Q7EA 3E8HA 5CN0A 2DMXA 1SS3A 1JMKC 1FXKC 1Q3EA 2CTWA 3WG7B 4JI8B 2F93B 3FB8C 3ASOC 1DK1A 4YJ2A 1PNKA 2ATKC 1N4CA 2PF4E 1JVMA 2ZR2A 1M1KW 1XDCA 1E79G 4ZI7A 2ZNJA 3ZHSA 4I9WA 4WBNB 3CC2V 1BHAA 3OE7G 4DYLA 5IY5B 4JI8O 3F5TA 2Z0AA 4IYIA 3SYCA 1IBMO 1TVKA 4BW5A 1QVFU 2OWOA 1OZ0A 2P22C 1YSCA 3SPIA 4QPJA 1VQLV 4LF6B 1BCCH 4CS4A 2Y69C 5GTHZ 4AQYB 3AG4B 3JD0A 1R73A 1MZFA 5JCOC 1WB8A 3JD2A 4LBEC 3CCVV 1IXMA 3VBBA 3L70H 1YXBA 1EN5A 5B1BB 2ODMA 1CEZA 2OT5A 2MK3A 1QBZA 2V4DA 2AZ0A 3LDEA 1XREA 2B1IA 5GW7A 1K33A 1KUQA 2CGNA 5JVDB 2N05A 1EN4A 4AILC 1K3EA 1VQ4V 2RQ6A 3SYPA 3ASOB 4B3SB 3QVNA 3N2KB 2VQEB 4PDLA 2FKXA 2HFEC 3ZEDA 1K5SA 3CRQA 5CA1B 3JAWA 1ZX3A 5JQGA 2P5OA 1URFA 3QO7A 2QM8A 3K9SA 2B1GA 4RQEA 4NTXA
chains in the Genus database with same CATH topology
1M57B 4WFBV 1AJNA 5KA5A 5LHIA 3ETEA 1AI6A 3PJSK 2JEUA 3JCZA 1M56B 1L1FA 1LNQA 2WLJA 3RVYA 4WFAV 1FXVA 2R9RB 3DTUB 3ETGA 3LSQA 3AG1C 1S72V 2Z5UA 4G2KA 2B5UA 4HAMA 4UVBA 1JCHA 2EILC 3OEHG 3K06A 1K73W 3SJQC 1HWYA 2EZOA 2XAGA 3SYQA 3ZRWA 2JIZG 5LGTA 2HJFC 3TETA 3FYIB 2OCCC 2XASA 3ABTA 4GCZA 2W6IG 1KQSU 2ZD9A 1S77D 4JAUA 4BIZA 5CBHA 2EIJB 2IH1C 1G8MA 5L3BA 3ABKB 1Y4MA 2WLLB 1E1RG 3T4DA 4GX1A 2X6AA 3OR7C 1QLEB 3RW0A 3F7VC 5EBMC 1KP2A 1PD3A 2QTOA 4JPRA 3OGCC 2EJRA 2GHYA 2X6BA 3WFVA 1MSWD 4MTFA 4JTAB 3OW2U 4CZZA 1K8AW 5EK0A 2WWWA 4PA4A 1BL8A 3IFXA 5IYBO 3ZN1A 3OMIB 2M7WA 3LNMB 2EIKB 3AG3C 2QE7G 5EBWC 1KKDA 5DN6G 3ZMZA 5C93A 1R3KC 2DYRB 1J95A 1TUEB 4N21A 1K9MW 5L3DA 4RQEA 3UKMA 1S3JA 1AI7A 1V54C 3JD4A 4WF9V 4DXWA 3ETDA 3JD1A 1NH2B 1H8EG 1OCOB 5BZBA 5KUMA 1UJWB 2EINC 2X6CA 4PA7A 3W7TA 2XAFA 4F4LA 2HKOA 4MW3A 2CK3G 1PL0A 1N8RW 3CCUV 2EIMC 1GM9A 2PI4A 1OCZB 1YITV 3BEHA 4P9PA 1R3LC 2C2AA 3W7SA 1B6QA 2Y48A 3HB3B 3ZRWB 2DWEC 1I5XA 3CCQV 1K92A 5CBGA 1RM1B 1NVPD 1OHHG 1H38A 3X2QC 4QPKA 3FKSG 4MVQA 5L3GA 3CCLV 3IGAC 3I56V 3QO8A 2LP7A 2Z3YA 1H8HG 3LSSA 1NH2D 1S76D 2JK5C 5B1AC 1CP9A 5EC1C 3I55V 2JDIG 1KC8W 4OXSA 5L3FA 3ZMVA 3AG1B 4R6ZA 4XDLA 1YJNV 3P30A 1FXKB 4J9ZB 1DF4A 1BHBA 2WSSG 3IC7A 3MD0A 3CCEV 1DLBA 2EILB 4PA6A 4MW8A 5CMUA 1AI4A 2ZQMA 3E35A 3D3IA 4MT8A 3G6EV 4X89A 2DWDC 1Q7YW 2XNDG 1VQOV 4RAIA 1Q86W 3CD6V 2H8PC 1CPYA 1COWG 1VQ7V 2A0LA 4WFGA 1R6NA 1SZTA 2WAMA 3DGEA 1JJ2U 4HYOA 3ASNC 2WLIA 3K03A 2YSUB 3E83A 3E8GA 2ZXWC 2ZDIC 3AG3B 4FIPC 5EBLC 4QIWF 3W7XA 1VQMV 2P7TC 3ML0A 1YHQV 4MSWC 1THZA 3H01A 3ZN0A 1WLEA 1FXHA 2H94A 2X0LA 3W7WA 3FB6C 5B1OA 1PNLA 3SPJA 4L87A 3E8FA 3JYCA 2V7QG 1Q82W 1OCRC 2HLDG 1ENVA 2EINB 4XDKA 2P6JA 4LC1A 2ITDC 2P67A 4P30A 1VQNV 2Y69B 1XL4A 3ABLB 3OEEG 1GMGA 3B77A 3K3WA 1QR8A 4P9OA 3OUSA 2IJJA 2XAHA 2WLKA 1AI5A 4E2LA 3CCMV 1YTFB 2ZDIA 2JJ2G 3SPCA 3E86A 4GX5A 1W0KG 1GTOA 4JAVA 2HR3A 1OCCC 5B1NA 2QA4V 3K08A 2DYSC 2IJHA 3STLC 2R9IA 4YXWG 5IYCO 3R65A 2HVKC 2QM7A 5IDJA 4MVUA 1AR1B 2W0FC 4RUEA 1YJ9V 3RVZA 1NJIW 4RO2A 4LCUC 1F4MA 3E8BA 4UV8A 2Q69A 1JOYA 5LHGA 1R6KA 1QLNA 1JQ0A 1E1QG 4MTXA 5H6RA 5B1AB 4WFEA 1GO3F 5EC2C 1NKDA 2YEVA 3CYOA 1K4CC 2WLIB 4XDJA 1M9NA 3ZRVA 4GX2A 4KFMA 2IJKA 1K34A 2LFRA 5HFLA 2Q6AA 2PI5A 3ZIAG 1WPXA 2EBOA 1AJPA 5B3SB 1M57C 3LUTB 1K4DC 3EHBB 3BY6A 1Q81W 1YTFD 1H2GA 2A79B 1ZWIC 3AG2C 4CBCA 3E2EA 1VQ9V 1SESA 4N23A 2Q67A 3SYAA 1SRYA 2NNUA 4JYBA 4MS2A 3CCJV 4TSFG 4R7CA 4JTDB 3RBZA 3WG7C 1G4YB 3K0DA 3OAAG 4TWKA 1DTOA 3GB7C 1V55C 3ASNB 1VQ6V 1K97A 3B8MA 2ZXWB 1NBMG 2HVJC 5H9CA 5KA6A 4J9YB 4MVMA 1QLEC 1AROP 1SERA 1I5YA 3OMNB 4FMTA 2D3OW 2UXXA 5LGNA 3FB7C 1KP3A 3JD3A 4Z1MG 1EFRG 1P7BA 3SYOA 3F5WC 1EZJA 1OCRB 3QNEA 3FB5C 1GKFA 1K7DA 4UVCA 2OCCB 4LP8A 3SPHA 2OTLV 3ZMTA 2FTKA 2DQ0A 2WLHA 1QCEA 2A9HA 3ABMC 5IY5C 1VQKV 4HZ3A 3M99B 3ZMUA 1GM7A 1EBOA 1KD1W 4UXNA 3FYEB 4DO2A 3K04A 4BIUA 2WLLA 2EZPA 1DF5A 1OCCB 3CP1A 4FJCC 3T1CA 3B8NA 3STZC 3VOUA 2DYSB 2JJ1G 4FPPA 2OTJV 1PNMA 2W6JG 4PA3A 2XAJA 1F23A 5CA3A 3G71V 3T2MA 3CC7V 1W0JG 1XL6A 3CMEV 4JYCA 1Y66A 5IYDO 3AG4C 3ZRXA 3A0RA 3CCRV 2HG5C 1JX9A 1K5QA 5LBQA 3OMAB 4UV9A 4G27B 1PKXA 3F7YC 2V1DA 2UXNA 4MVOA 3CPWU 1YI2V 1V54B 5H6QA 5LHHA 3SPGA 4RUFA 1F4NA 2IU3A 1RPRA 4P2ZA 1RM1C 3P32A 4ZBMA 1FS0G 3ZMSA 1MG1A 2KB1A 3CMAV 5B1BC 2AHZA 2IJIA 3EFFK 4JTCB 4MVSA 2WLNA 1QR9A 4X8AA 3G4SV 1QVGU 2DQ3A 2EIMB 3CXCU 4FK5C 2WLMA 4BAYA 3E8HA 2QEXV 4WFFA 3AG2B 2DW4A 5CN0A 4KP4A 3OUFA 3ZJZA 1FXKC 5KUKA 2WPDG 3E89A 3GWOA 4PDRA 4QNHB 2IH3C 3WG7B 4JGSA 3X2QB 1YJWV 2QKSA 4X88A 4QJFB 1V55B 3FB8C 4PDVA 4U7OA 4MTGA 3ASOC 3CCSV 4Q20A 1PNKA 1MABG 2ATKC 3ABUA 1GM8A 4EKWA 1JVMA 4H33A 3T4ZA 1VQPV 3CC4V 3D36A 2ZR2A 1M1KW 1R3JC 1F51A 4JASA 4KUMA 1E79G 3HPLC 3LDCA 1GK9A 1YIJV 3NXSA 3LDDA 3KG2A 5E1AC 3UM7A 3ZRSA 1VQ5V 1RPOA 4ZKIA 4I9WA 1FXKA 4H37A 1ORQC 4G28B 5FL7G 5L3CA 1S5HC 1NVPB 1M90W 4WFHA 2GSMB 3CC2V 1BHAA 3OE7G 3OM3B 1M56C 5IY5B 3ABMB 1FFTB 3SYCA 4UVAA 1SETA 3K0GA 4MVRA 4UUJC 2BOCC 1NR1A 4BW5A 1QVFU 1AJQA 1OZ0A 2NLJC 4JF3A 1YSCA 3SPIA 4QPJA 4ASUG 2F43G 1VQLV 1JPXA 2LFSA 3TCUA 4PA9A 2Y69C 1MOFA 1VQ8V 2EIJC 3ABLC 3AG4B 3JD0A 3ABKC 1R73A 4QE9A 5J9PC 2XAQA 3OR6C 3JD2A 4LBEC 3CCVV 4MVZA 4PDMA 1S0VA 3MHSC 5CBFA 1NQTA 4R8CA 1IXMA 3VBBA 4GT1A 3OFNG 4XBFA 4I5SA 2BOBC 4MTOA 4TT3G 2IU0A 5B1BB 1CEZA 2P90A 2EIKC 2OT5A 4RQFA 2MK3A 4GX0A 1QBZA 1KECA 2DYRC 5DM6V 3LDEA 1NR7A 2YEVB 2JEXA 2ZR3A 2B1IA 2ITCC 5GW7A 1K33A 1P4RA 2XOKG 3TK1A 2Q68A 4R50A 5HFMA 1OCOC 2AHYA 4U7NA 3QO5A 3ZCCA 3MHHC 1K3EA 3AEIA 2IW5A 4PELA 1VQ4V 5B3SC 1W2BU 3K9AA 1R3IC 3SYPA 3ASOB 1OCZC 2X7RB 1BMFG 4PDLA 5L3EA 2HFEC 1K5SA 3W7UA 2K1EA 4QE7A 5LGUA 3QO7A 2QM8A 1ROPA 4WCEV 2B1GA 3K79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PA6 A;  4MS2 A;  4EKW A;  4MW8 A;  1JVM A;  4H33 A;  3T4Z A;  3PJS K;  4R7C A;  4JTD B;  3RBZ A;  3WG7 C;  1LNQ A;  2WLJ A;  3RVY A;  1G4Y B;  1R3J C;  2R9R B;  3K0D A;  4TWK A;  4X89 A;  2DWD C;  3AG1 C;  1V55 C;  3GB7 C;  3HPL C;  3LDC A;  3LDD A;  3KG2 A;  5E1A C;  3UM7 A;  3ZRS A;  2HVJ C;  4RAI A;  2H8P C;  4H37 A;  4I9W A;  1ORQ C;  4G28 B;  4J9Y B;  1S5H C;  2EIL C;  1QLE C;  3K06 A;  4MVM A;  3SJQ C;  4WFH A;  3SYQ A;  2A0L A;  2HJF C;  3TET A;  3FB7 C;  4WFG A;  2OCC C;  1M56 C;  2ZD9 A;  3SYC A;  5CBH A;  3K0G A;  4MVR A;  2IH1 C;  2BOC C;  3ASN C;  4HYO A;  4UUJ C;  2WLI A;  3K03 A;  1P7B A;  2WLL B;  3E83 A;  3SYO A;  3E8G A;  2ZXW C;  3T4D A;  4BW5 A;  3F5W C;  2X6A A;  3OR7 C;  4GX1 A;  3RW0 A;  3F7V C;  5EBM C;  5EBL C;  2NLJ C;  3FB5 C;  2QTO A;  2P7T C;  3SPI A;  4MSW C;  3OGC C;  2X6B A;  4LP8 A;  4MTF A;  3SPH A;  4JTA B;  2WLH A;  5IY5 C;  2A9H A;  3ABM C;  3TCU A;  3FB6 C;  4HZ3 A;  5EK0 A;  4PA9 A;  2Y69 C;  4PA4 A;  3SPJ A;  2EIJ C;  3ABL C;  1BL8 A;  3E8F A;  3IFX A;  3ABK C;  3JYC A;  3K04 A;  3LNM B;  4QE9 A;  3AG3 C;  1OCR C;  5J9P C;  2WLL A;  5EBW C;  4XDK A;  3OR6 C;  1KKD A;  4LBE C;  1R3K C;  4MVZ A;  1J95 A;  4PDM A;  2ITD C;  3T1C A;  5CBF A;  3VOU A;  4P30 A;  3STZ C;  4R8C A;  3UKM A;  4PA3 A;  1V54 C;  1XL4 A;  3T2M A;  4DXW A;  1XL6 A;  2BOB C;  4MTO A;  4P9O A;  3AG4 C;  3OUS A;  2WLK A;  2HG5 C;  2EIK C;  5BZB A;  5KUM A;  3E86 A;  2EIN C;  4G27 B;  4GX5 A;  3F7Y C;  3SPC A;  1OCC C;  2X6C A;  4GX0 A;  2DYR C;  4PA7 A;  4MVO A;  4F4L A;  3K08 A;  4MW3 A;  2DYS C;  3LDE A;  3SPG A;  4RUF A;  3STL C;  2EIM C;  3R65 A;  2HVK C;  4P2Z A;  2ITC C;  4ZBM A;  2KB1 A;  2Q68 A;  4MVU A;  2W0F C;  4R50 A;  4RUE A;  5B1B C;  3BEH A;  3RVZ A;  4P9P A;  2AHZ A;  4RO2 A;  4LCU C;  1R3L C;  3EFF K;  1OCO C;  4JTC B;  2AHY A;  3E8B A;  4MVS A;  2WLN A;  2Q69 A;  4X8A A;  2DWE C;  4WFE A;  5B3S C;  5CBG A;  2WLM A;  5EC2 C;  3E8H A;  4WFF A;  3X2Q C;  2YEV A;  1R3I C;  3SYP A;  1K4C C;  2WLI B;  4XDJ A;  1OCZ C;  3OUF A;  4GX2 A;  4KFM A;  4MVQ A;  3ZJZ A;  2Q6A A;  3IGA C;  5KUK A;  4PDL A;  3E89 A;  4PDR A;  1M57 C;  2HFE C;  3LUT B;  4QNH B;  1K4D C;  2IH3 C;  2JK5 C;  5B1A C;  5EC1 C;  2QKS A;  4OXS A;  4X88 A;  2A79 B;  2K1E A;  4QE7 A;  1ZWI C;  3AG2 C;  4R6Z A;  4XDL A;  4CBC A;  3FB8 C;  4PDV A;  4MTG A;  3ASO C;  4J9Z B;  2Q67 A;  3SYA A;  2ATK C; 
#chains in the Genus database with same CATH topology
 3WB1 A;  4WFB V;  5KA5 A;  5LHI A;  3K5N A;  1L0L H;  3L75 H;  3JCZ A;  1LNQ A;  3ETG A;  4JI3 B;  3AG1 C;  4IT5 A;  5IJ9 B;  4W4L A;  4OPH A;  1YVW A;  1IBK O;  4B3S O;  1ZAU A;  1JCH A;  2D2C B;  3OEH G;  2VQE O;  1K73 W;  4NR1 A;  3SGI A;  5LGT A;  2HJF C;  2OCC C;  3CJH B;  2ZD9 A;  4CH6 A;  4JAU A;  4TQD A;  3T4D A;  1FKA O;  4JPR A;  4DUZ B;  2GHY A;  4TV9 B;  1MSW D;  4CZZ A;  4NKG B;  5EK0 A;  3KZI Z;  3L9D A;  4PA4 A;  5AG2 A;  1BL8 A;  3OMI B;  4LWS A;  2M7W A;  3E22 B;  1R3K C;  1TUE B;  3UKM A;  4JV5 B;  1AI7 A;  4DXW A;  2IM9 A;  1MMM A;  1H8E G;  3EVK A;  4OGQ B;  5BZB A;  1WAZ A;  2X6C A;  2F66 C;  3W7T A;  4F4L A;  2HKO A;  2GUZ B;  1GM9 A;  4EB6 B;  1JFF A;  4UB6 Z;  4JI5 B;  3U0Z A;  1G1X B;  5KMG A;  3BEH A;  2UU9 B;  1R3L C;  2L6L A;  2UXD O;  5J2U A;  1SQX H;  4UFZ A;  2DWE C;  3CEI A;  1O9H A;  1K92 A;  2YXL A;  5CBG A;  1H38 A;  2GBO A;  1GN4 A;  1ZTE A;  4LF9 B;  3I56 V;  1NH2 D;  2UUB B;  3G67 A;  3AG7 A;  4OXS A;  5D5P A;  3AG1 B;  4JI5 O;  3QG5 A;  4YIP A;  3BVO A;  3BRC A;  2UU9 O;  1DLB A;  1BQZ A;  1AI4 A;  4X64 O;  4FLY A;  1N0N A;  1WPB A;  4X89 A;  1Y76 B;  4BW9 A;  3CD6 V;  2H8P C;  4B3R B;  1XNR O;  2A0L A;  4WFG A;  1R6N A;  3P3P A;  2UUB O;  2YXY A;  3DGE A;  1TAE A;  3OT7 A;  1QQC A;  1WNS A;  4LF7 B;  4HYO A;  2YSU B;  2P4V A;  2ZIO A;  1H2M A;  4QIW F;  5BY1 A;  4DR7 O;  3CX5 F;  3NR7 A;  4I7Z B;  2VWK A;  3FB6 C;  4YHH B;  2ILM A;  3E8F A;  2Y0P A;  1SA0 B;  2HLD G;  1ENV A;  3UO2 A;  4LC1 A;  2P67 A;  4B3R O;  4I55 B;  3LSU A;  3ZX6 A;  1RFY A;  1XL4 A;  3ABL B;  3K3W A;  4LF7 O;  2WLK A;  2ZDI A;  1I08 A;  3SPC A;  4JAV A;  4O4J A;  2HP8 A;  5B1N A;  3SR2 C;  3J81 N;  2ZM6 B;  4PJ0 Z;  3R65 A;  4YHH O;  4UCU A;  3RVZ A;  1TUB A;  1NJI W;  4UV8 A;  3SJA C;  3RYC B;  5LHG A;  1QLN A;  1JQ0 A;  1AP5 A;  3HKD B;  2DOS A;  5H6R A;  4U3J A;  4OX9 B;  4B3T B;  5EC2 C;  3CB2 A;  2F95 B;  2CTQ A;  2ARH A;  3FAV B;  2IJK A;  1K34 A;  5C8Y B;  5HFL A;  2E3C A;  5FNV B;  2CAZ C;  1AJP A;  1P49 A;  2VQF O;  2ZM6 O;  2VWJ A;  1ZWI C;  3AG2 C;  4LH7 A;  3CRA A;  4N23 A;  2Q67 A;  5DED A;  1SRY A;  1FD9 A;  2NNU A;  4MS2 A;  3N2K A;  5H2F Z;  3DSQ A;  5CB4 B;  1QNM A;  1SQG A;  4OX9 O;  2GTA A;  4B3T O;  1SQB H;  3APO A;  4NTW A;  5K1P A;  1NBM G;  2HVJ C;  3U10 A;  5H9C A;  5KA6 A;  4NYK A;  3KKY A;  1Y74 A;  4FMT A;  3FB7 C;  4FLV A;  4K0K B;  1Q6U A;  3JD3 A;  4I0X A;  3SJC C;  1T5E A;  5B66 Z;  4DUY O;  1H2S B;  4TV8 B;  5IJ9 A;  3FB5 C;  1GKF A;  1GH6 A;  2QWR B;  4UVC A;  3ZMT A;  4Q6G A;  2FTK A;  2WLH A;  2A9H A;  3CJH A;  1Y67 A;  1KD1 W;  4JI0 O;  3K58 A;  4K35 A;  3JAL B;  2O57 A;  3T1C A;  2LW7 A;  3B8N A;  3H9V A;  2OTJ V;  1Q5O A;  2HJD A;  2W6J G;  4TV9 A;  1F23 A;  4K0K O;  1XL6 A;  4DR2 B;  1KKC A;  4UCO A;  2HG5 C;  3CCR V;  1PKX A;  4X65 B;  1XI1 A;  3CPW U;  2LO1 A;  4Z2W A;  4P2Z A;  5F2V O;  1RM1 C;  1AIL A;  4GKJ O;  1XQ8 A;  4X1K A;  1XOU A;  2IJI A;  4JTC B;  4X8A A;  3IJ4 A;  1QVG U;  2PUS A;  4FK5 C;  1OJH A;  2LGW A;  3L74 H;  1JR9 A;  3APQ A;  1IX9 A;  2VS0 A;  2GUZ A;  2DW4 A;  3AG2 B;  4EB6 A;  2PYJ A;  3ZJZ A;  4Z1V A;  3CE2 A;  2K9P A;  2QGN A;  1NT2 B;  4YJ3 B;  4ZOL A;  4X88 A;  1FYJ A;  4QJF B;  4U7O A;  4FZ0 A;  4Q20 A;  3ABU A;  3A8T A;  5IWA O;  4ABM A;  3OTO B;  1FAF A;  2OIG A;  1LR1 A;  3D36 A;  1FJG B;  4JAS A;  4DW0 A;  3ZHT A;  2NR5 A;  1H2N A;  3UM7 A;  4ZKI A;  4H37 A;  1L8D A;  4G28 B;  4WFH A;  5LMN B;  2GSM B;  2FL4 A;  4O2B B;  3OM3 B;  2OCH A;  1M56 C;  3PN1 A;  5A2Q N;  4UVA A;  2G38 A;  4UUJ C;  2E74 B;  2NLJ C;  4JF3 A;  2BTQ B;  2YIC A;  4D7S A;  1PV0 A;  3TCU A;  1FJG O;  1AVM A;  1MOF A;  1VQ8 V;  1I0H A;  3T1H O;  3L72 H;  2XAQ A;  5KX5 B;  1S0V A;  3MHS C;  1HP8 A;  2YS8 A;  5CBF A;  5LMN O;  1NQT A;  2QSA A;  1WJZ A;  3HKE B;  3QTC A;  2A7W A;  4TT3 G;  1HR0 B;  4D6T H;  4JYY A;  1SA0 A;  4L8J A;  3HKB B;  4RQF A;  4GX0 A;  5DM6 V;  1KEC A;  2UXB B;  2PY5 A;  5IT9 N;  1M4U A;  2ETN A;  2YEV B;  2JEX A;  2ZR3 A;  3TK1 A;  3P3N A;  3WB2 A;  1VP7 A;  1WA8 B;  1IXB A;  1OCO C;  3ETQ A;  2AHY A;  2RJZ A;  4U7N A;  3ZCC A;  3S3W A;  1SQV H;  3Q4H B;  4H0L B;  4PEL A;  5B3S C;  1W2B U;  4X62 B;  3JAR B;  1HR0 O;  3HKC B;  5CA0 B;  1NS1 A;  2UXB O;  1D2D A;  3HKD A;  4QE7 A;  5TIS Z;  1XMQ O;  1A32 A;  5GTI Z;  1AJN A;  5C8Y A;  3ETE A;  5FNV A;  4UCS A;  2JEU A;  1AR4 A;  1M56 B;  2YID A;  3RVY A;  5LP6 C;  3DTU B;  1VMG A;  4WFA V;  3C90 A;  2UUA O;  4X62 O;  3BCC H;  1S72 V;  3BFR A;  4G2K A;  4HAM A;  3I5D A;  4FZ1 A;  1HWY A;  3ZRW A;  4DK0 A;  2JIZ G;  2XTA A;  5CB4 A;  3JAK B;  1KQS U;  5CBH A;  4JI4 O;  3K5O A;  2F1M A;  3T1Y O;  1Y4M A;  2WLL B;  1E1R G;  2A3Q A;  5KLV H;  1FFX B;  4FVM A;  2X6A A;  4GX1 A;  3RW0 A;  2QTO A;  4B7E A;  3VQW A;  4MTF A;  1XEQ A;  4O2A B;  4DR1 B;  3OW2 U;  1K8A W;  1ZLZ A;  4TV8 A;  3ZN1 A;  4BR6 A;  5LYJ A;  5C93 A;  4N21 A;  4X20 A;  4LFB B;  1S3J A;  1V54 C;  3JD4 A;  4UCR A;  2P06 A;  1OCO B;  1VF6 C;  2XAF A;  4B3M B;  4MW3 A;  2FML A;  3JAL A;  1PL0 A;  3H1K H;  4DR1 O;  4E4E A;  2C2A A;  2Y4U A;  1Y6X A;  1IVS A;  4O4L A;  4LFB O;  4LH6 A;  1NVP D;  4CH3 A;  1OHH G;  2QWN B;  3X2Q C;  3UT5 A;  3TXQ A;  3JAT B;  4MVQ A;  1N34 B;  5IJ0 B;  1IDS A;  1AR5 A;  4LF6 O;  3LSS A;  5B1A C;  5LP6 B;  1Q43 A;  5L3F A;  4AQY O;  1N32 B;  4R6Z A;  4XDL A;  2HEP A;  3P30 A;  1FXK B;  2WSS G;  4B08 A;  3MD0 A;  3CCE V;  4CH5 A;  5LXT B;  5LA6 B;  3ZHV A;  2ZQM A;  4J7J A;  2GV9 A;  4YJ3 A;  4K8Z A;  2DWD C;  3CXH F;  3SDL A;  2XND G;  2Q8V A;  4RAI A;  1N34 O;  2NN4 A;  1CPY A;  1VQ7 V;  5JH7 A;  5FPO A;  1JJ2 U;  4LF8 B;  2RDC A;  3ASN C;  1RP3 B;  1N32 O;  2WLI A;  1TA8 A;  1WP7 A;  1VQM V;  1VF7 A;  2QWQ B;  2P7T C;  4MSW C;  1EN6 A;  3AK3 A;  2AW9 A;  2P4K A;  4B7K A;  1FXH A;  3ZBH A;  2ZE6 A;  5B1O A;  2ZE7 A;  1PNL A;  3SPJ A;  4TOI A;  5EYP B;  4U3F H;  1XMO B;  2V7Q G;  1OCR C;  2ZT9 B;  2PZS A;  3B4S A;  2YDE A;  4EFE A;  4P30 A;  5IYZ A;  1SQQ H;  2Y69 B;  3OEE G;  5GON B;  4LF8 O;  3OUS A;  2XAH A;  1AI5 A;  3TXS A;  2QR4 A;  1Z5V A;  1US6 A;  2JJ2 G;  1HNZ B;  1W0K G;  5KX5 A;  3K08 A;  2R9I A;  4YXW G;  5IYC O;  3K5M A;  4JI3 O;  2HVK C;  2BCC H;  2FYU H;  4PI0 A;  1XMO O;  1XNQ B;  4RO2 A;  1OV9 A;  5BMV A;  3E8B A;  1IBL B;  1XHX A;  4UB8 Z;  1JOY A;  1R6K A;  1E1Q G;  3HKB A;  3B09 A;  5B1A B;  4LFC B;  2Q0O C;  4WFE A;  4TUY B;  1W59 A;  2YEV A;  3CYO A;  2GTS A;  1K4C C;  4D7T A;  3ZRV A;  1HNZ O;  3ZIA G;  1WA8 A;  3G80 A;  4DUZ O;  1M57 C;  4J11 A;  3EHB B;  3BY6 A;  1Q81 W;  3OTF A;  1YTF D;  3Q4H A;  3VQY A;  5JJE B;  1D5N A;  4CBC A;  4DV3 B;  1SES A;  4CC5 A;  3MDS A;  4JI1 B;  1XNQ O;  1IBL O;  5JJN B;  3HKC A;  5CA0 A;  4TSF G;  4JV5 O;  4LFC O;  3OAA G;  1DTO A;  3RYH B;  3ASN B;  5KAF Z;  4NXN B;  4J9Y B;  1QLE C;  1ARO P;  3OMN B;  4FM0 A;  2UXX A;  2UXC B;  1KP3 A;  3BPZ A;  1SKV A;  3M7M X;  3TJT A;  3DXR B;  1EFR G;  3F5W C;  1OCR B;  1K7D A;  4AHC A;  2OCC B;  2WA3 A;  1QU7 A;  2OTL V;  2E5L B;  1XIL A;  4HZ3 A;  3ZMU A;  1U97 A;  3JAK A;  3TGU H;  1GM7 A;  4KHP B;  4F6E A;  4LF9 O;  2WLL A;  1FFX A;  3H1J H;  4IIJ B;  3STZ C;  1PNM A;  4PA3 A;  3A0B Z;  3MAQ A;  4O2A A;  4DW1 A;  3CME V;  5IYD O;  1Y66 A;  1TGO A;  3ZRX A;  4UCV A;  4UV9 A;  4G27 B;  2V1D A;  1GN2 A;  4WBN A;  2UXN A;  5LHH A;  2QKA A;  4RUF A;  1F4N A;  2E5L O;  1RPR A;  5ITZ B;  3P32 A;  3ZMS A;  4LF4 B;  2KB1 A;  1YF2 A;  1Z5W A;  2JS3 A;  4FLZ A;  4A5U B;  4KHP O;  3EFF K;  4MVS A;  1QR9 A;  2DQ3 A;  3CXC U;  2PYL A;  2XHB A;  2Q7H A;  2YXH A;  2WLM A;  4BAY A;  4DR4 B;  4WFF A;  1NZ6 A;  3ZHU A;  2YI8 A;  1V9P A;  1SQP H;  4I50 B;  5KUK A;  2IBZ H;  3E89 A;  3GWO A;  4PDR A;  1B06 A;  5KHJ A;  3B40 A;  4JGS A;  3THO A;  1YJW V;  5E79 Z;  2CTP A;  5FLX N;  4PDV A;  4ZHQ B;  1XBL A;  3N2G B;  3CCS V;  1MAB G;  1B04 A;  3O65 A;  4DRX B;  4EKW A;  5IJ0 A;  5EIB D;  3FFQ A;  4KUM A;  2GDS A;  1BQ0 A;  3RT3 C;  3LDC A;  3LDD A;  3L71 H;  2CDY A;  4JAA A;  5E1A C;  3CRC A;  4CS2 A;  1VQ5 V;  1RPO A;  1M93 A;  5JVD A;  1FXK A;  2EX3 A;  1ORQ C;  3KCY A;  5FL7 G;  3VQV A;  1S5H C;  1NVP B;  1M90 W;  1I94 B;  5LXT A;  1SET A;  3B2E E;  1SZX A;  1NR1 A;  4DV6 B;  4NTY A;  5IE9 A;  4KL1 A;  3WU2 Z;  5CA1 A;  4PA9 A;  3UO3 A;  3ABK C;  3OR6 C;  4MVZ A;  4PDM A;  3RGB A;  4JI2 B;  3IC9 A;  2FB5 A;  3OFN G;  2B9Z A;  3AK2 A;  2BOB C;  4MTO A;  2IU0 A;  2P90 A;  5EYP A;  4DV6 O;  4CH4 A;  3RYF B;  2ITC C;  2N04 A;  4R50 A;  3ZHR A;  3JSN A;  5JCO A;  4DV4 B;  3GWK C;  5GON A;  1VIB A;  2QWO B;  2Y0I A;  1SC5 B;  3AEI A;  2IW5 A;  4DV1 B;  4JZ2 A;  3K9A A;  4J7K A;  3RFR A;  2JGD B;  1OCZ C;  2X7R B;  3E22 A;  3WB0 A;  5K1X A;  2YIB A;  2KQX A;  1VAR A;  2JRI A;  3C3T A;  4GZR B;  5H5N A;  4TUY A;  5A9G A;  1BE3 H;  1ROP A;  4IYH A;  3K79 A;  2PGG A;  2AGA A;  4FLW A;  4FM2 A;  2QDO A;  3FX7 A;  1ZSP A;  4DR2 O;  2Z5U A;  2B5U A;  4UVB A;  2EIL C;  4X65 O;  2Q9L A;  1YZB A;  3FYI B;  4GCZ A;  2XAS A;  3ABT A;  4GYC B;  2W6I G;  4CS3 A;  1L0N H;  1G8M A;  5L3B A;  3ABK B;  3F7V C;  1KP2 A;  2CUG A;  3OGC C;  2EJR A;  4JTA B;  3RN4 A;  4JYA B;  5LOV B;  2Q7G A;  2WWW A;  3JAS B;  5IYB O;  1SQF A;  3LNM B;  3AG3 C;  3DXR A;  4X9Q A;  2QE7 G;  3VQX A;  1KKD A;  5DN6 G;  3ZMZ A;  3R66 A;  1J95 A;  1H2L A;  5L3D A;  1N36 B;  4WF9 V;  3ETD A;  5JQG B;  1P7G A;  1NH2 B;  2R9A A;  1Y76 A;  1KMI Z;  5KUM A;  1UJW B;  4FLU A;  3CWB H;  2H3O A;  3OTO O;  4PA7 A;  2BSK B;  4GLX A;  1KU9 A;  1N8R W;  1BS3 A;  4ICG A;  4F6R B;  2EIM C;  2PI4 A;  1S5L Z;  1OCZ B;  1XUQ A;  3SJB C;  3K5L A;  2KG7 B;  3W7S A;  4GKK B;  4X1Y B;  1I5X A;  2VRZ A;  3CCQ V;  1RM1 B;  2M6Y A;  1O9G A;  1Z2G A;  2KSD A;  1AP6 A;  5ITZ A;  5L3G A;  2LP7 A;  3D3Q A;  1H8H G;  2XT9 A;  3HR0 A;  4I55 A;  2JK5 C;  5JJJ B;  3H1L H;  3I55 V;  2JDI G;  2N74 A;  3CS5 A;  1KC8 W;  1BT8 A;  4J9Z B;  3IC7 A;  1BGY H;  2EIL B;  4PA6 A;  3CRR A;  3D3I A;  1BSM A;  3G6E V;  2Q5Z A;  3LNN A;  1VQO V;  2YIA A;  3BAB A;  3RYC A;  1COW G;  1M5I A;  4EFB A;  1AB3 A;  4DRX A;  1SZT A;  1JFF B;  4GUN A;  3ZS8 C;  3K03 A;  3E8G A;  2ZXW C;  3FAV A;  2ZDI C;  3AG3 B;  5EBL C;  3W7X A;  1UFI A;  1YHQ V;  2QKC A;  4C7U A;  2X0L A;  5FPR A;  2JVD A;  4L87 A;  4DV5 B;  1Q82 W;  3OD4 A;  4XDK A;  2ITD C;  4I9Q A;  4J80 A;  1GMG A;  4O4I B;  2W0X A;  2JS5 A;  4P9O A;  1S5J A;  1PPJ H;  3CCM V;  2LW1 A;  1GTO A;  2HR3 A;  2ZIN A;  1ZL8 B;  2QA4 V;  1PP9 H;  5EZY B;  4YIO A;  2Y4T A;  5IDJ A;  1IBM B;  1AR1 B;  1YEW A;  2W0F C;  4DV5 O;  1YJ9 V;  4LCU C;  1F4M A;  2Q69 A;  4MTX A;  1JJO A;  1GO3 F;  1NKD A;  3M8A A;  3AK1 A;  3RYF A;  2Q73 A;  2OYQ A;  4XDJ A;  4GX2 A;  3CRM A;  2BTO A;  1WPX A;  2EBO A;  5B3S B;  3LUT B;  1GRJ A;  1HW7 A;  4LNU B;  3RWR D;  2ZNI A;  1VQ9 V;  1N33 B;  2JGD A;  4JYB A;  3S3X A;  4R7C A;  3L73 H;  2AXT Z;  3K0D A;  4TWK A;  2QWP B;  1V55 C;  2A06 H;  1VQ6 V;  3B8M A;  2ZXW B;  5DEC A;  4O4J B;  2Q4P A;  4MVM A;  2DN9 A;  4B3M O;  1SER A;  3UCS C;  1SF9 A;  2JGU A;  1TUB B;  1N33 O;  3A0H Z;  3QNE A;  2UUC B;  1J5E B;  4U3J B;  2DQ0 A;  1QCE A;  3ABM C;  3M99 B;  4J41 A;  1FPO A;  4UXN A;  3FYE B;  4DO2 A;  4BIU A;  1DF5 A;  3DC5 A;  4EEQ A;  3CP1 A;  4FJC C;  3VOU A;  2JJ1 G;  1NTK H;  4FPP A;  2CH7 B;  3G71 V;  2EUL A;  5LOV A;  4ZIB A;  3JAS A;  1IBK B;  1JX9 A;  1K5Q A;  3A2F A;  3OMA B;  3RYI B;  4O2B A;  1V54 B;  5H6Q A;  5J2T B;  2UUC O;  1J5E O;  2RMK B;  2IU3 A;  1GN6 A;  1CXZ B;  4ZBM A;  2RN9 A;  2YI9 A;  2AHZ A;  1Y74 B;  2BTQ A;  2BSK A;  3D36 C;  3O9O A;  4I0X B;  1PM9 A;  2QEX V;  4F6R A;  4J42 A;  1QHT A;  4KP4 A;  2QTS A;  3OUF A;  2OIE A;  1Q6H A;  2KG7 A;  2WPD G;  4BWA A;  5KHG A;  4QNH B;  2IH3 C;  4I4T B;  1ZUQ A;  4X1Y A;  3X2Q B;  2QKS A;  3HKE A;  1V55 B;  4MTG A;  1NTM H;  1WB7 A;  4O4H B;  1GM8 A;  1GAX A;  1IZ3 A;  3T4Z A;  4H33 A;  1RSO B;  1VQP V;  3CC4 V;  1KB9 F;  4DK1 A;  1R3J C;  1F51 A;  4CC6 A;  4DR3 B;  3HPL C;  1GK9 A;  1YIJ V;  3NXS A;  2LGQ A;  3KG2 A;  3ZRS A;  2LQT A;  5L3C A;  2UXD B;  5JWP A;  1X59 A;  1LUV A;  1Q8I A;  3ABM B;  1FFT B;  3K0G A;  4MVR A;  2BOC C;  3JAR A;  4X1K B;  3BAA A;  3GVM A;  1AJQ A;  4ASU G;  2F43 G;  4NXM B;  1Q6I A;  1JPX A;  2LFS A;  4DR3 O;  2EIJ C;  3ABL C;  1IUR A;  3KCX A;  3J7A U;  2CGO A;  4QE9 A;  5J9P C;  1Q90 D;  1X4T A;  4R8C A;  4ZOL B;  4X64 B;  1XHZ A;  4GT1 A;  1MSD A;  4XBF A;  4I5S A;  4DV3 O;  2Q0A A;  4JI1 O;  2EIK C;  5LMU B;  4H13 B;  2DYR C;  1XNR B;  2ADQ B;  4X66 B;  4NXM O;  1NR7 A;  4FLX A;  4DV2 B;  3JAM N;  5KAI Z;  1WN7 A;  1DGS A;  1P4R A;  2XOK G;  2Q68 A;  4NXN O;  4O4I A;  3QF7 A;  5HFM A;  3QO5 A;  2HHH B;  3MHH C;  4DR7 B;  2UXC O;  1ZL8 A;  5LL6 Y;  1YCI A;  2RNB A;  1R3I C;  2ZE5 A;  4X1I B;  4LF5 B;  5EZY A;  3FD9 A;  4LFA B;  1NTZ H;  1BMF G;  2ZE8 A;  4AI8 A;  4DV0 B;  1MNG A;  4HNA B;  5LMU O;  5L3E A;  3W7U A;  4X66 O;  2K1E A;  4DV2 O;  5LGU A;  4WCE V;  1D5A A;  1M57 B;  3BA8 A;  2HHH O;  1AI6 A;  3PJS K;  2AZ2 A;  1L1F A;  2WLJ A;  1MA1 A;  1KYO F;  1FXV A;  2R9R B;  3LSQ A;  2E76 B;  1H2K A;  4LNU A;  4LF5 O;  1BZK A;  2LJ2 A;  4DV7 B;  4LFA O;  4RWU A;  3K06 A;  3SJQ C;  4DV0 O;  2EZO A;  2XAG A;  3SYQ A;  4QGP A;  3TET A;  1S77 D;  1NI8 A;  4BIZ A;  4NVP A;  4LF4 O;  2L35 A;  2EIJ B;  3IAY A;  2IH1 C;  3JAT A;  4FFB B;  3CHX A;  3OR7 C;  1QLE B;  5EBM C;  1PD3 A;  2X6B A;  3WFV A;  3DC6 A;  4DR4 O;  2VQF B;  4IHJ B;  5LP6 A;  4DR5 B;  4PHZ A;  1EM1 A;  3IFX A;  2EIK B;  4DV7 O;  5EBW C;  2DYR B;  1K9M W;  1HNW B;  5LA6 A;  3JD1 A;  1EZV H;  2E75 B;  2MW2 B;  2CE4 A;  2EIN C;  2KKW A;  2ZCE A;  2CK3 G;  1I7F A;  2ZKO A;  3CCU V;  2CH7 A;  4DUY B;  5D5Q A;  4DR5 O;  1YIT V;  4P9P A;  3D8C A;  1I94 O;  1B6Q A;  2DJV A;  2Y48 A;  2PTM A;  3HB3 B;  3ZRW B;  2YC0 A;  4JI7 B;  1HNW O;  1P84 F;  1VF5 B;  3RYI A;  3OGI B;  5BXZ A;  5J2T A;  4YJ2 B;  4QPK A;  3FKS G;  4JI0 B;  3CCL V;  3C3S A;  3IGA C;  3QO8 A;  1VF6 A;  2Z3Y A;  1S76 D;  3BA9 A;  1HNX B;  1CP9 A;  5EC1 C;  1JA8 A;  4ZI7 B;  5KHK A;  4LR3 A;  3ZMV A;  1YJN V;  2ADP A;  5LYJ B;  1B3Q A;  1DF4 A;  1BHB A;  3H1I H;  4X20 B;  4MW8 A;  4JI2 O;  5CMU A;  1PL4 A;  2YUA A;  1NU1 H;  4JI7 O;  3E35 A;  4MT8 A;  4I4T A;  1TVK B;  1U96 A;  1Q7Y W;  4GKJ B;  1Q86 W;  4O4H A;  3ICX A;  1RSO A;  2WAM A;  2ZIM A;  1HNX O;  1KBH A;  4DV4 O;  3E83 A;  4FIP C;  3ML0 A;  4J7Z A;  4O4L B;  1THZ A;  3H01 A;  3ZN0 A;  4DV1 O;  1WLE A;  1G6U A;  2H94 A;  3W7W A;  3UT5 B;  3H1H H;  3J80 N;  3JYC A;  2QM4 A;  2EIN B;  3EXA A;  2P6J A;  5IWA B;  5BR8 B;  3K57 A;  1VQN V;  2F4V B;  4HBN A;  4KXR A;  2R72 A;  3B77 A;  3RYH A;  1QR8 A;  4E2L A;  2IJJ A;  3JCU Z;  1YTF B;  3E86 A;  4GX5 A;  3U11 A;  1OCC C;  4PI2 A;  4FLT A;  2DYS C;  2IJH A;  3STL C;  4YY3 B;  2QM7 A;  3N27 A;  2BE3 A;  4MVU A;  4RUE A;  4NB5 A;  3UQ8 A;  4PV1 B;  3BHP A;  5JH7 B;  5BR8 O;  4BIO A;  2F4V O;  4K8X A;  3JAW B;  4PD4 F;  5KHI A;  2RCV A;  2WLI B;  1M9N A;  4KFM A;  5EIB C;  2LFR A;  3T1H B;  2Q6A A;  2PI5 A;  5KHH A;  4IIJ A;  1K4D C;  4JI6 B;  4JYA O;  1R6T A;  5B5E Z;  1H2G A;  2CTR A;  3ZHQ A;  1GN3 A;  2A79 B;  3CSX A;  4YY3 O;  3E2E A;  2EJ7 A;  4X1I A;  3SYA A;  3JSL A;  3CCJ V;  1MZE A;  4HNA A;  5IYZ B;  4JTD B;  3RBZ A;  3WG7 C;  1N36 O;  4H44 B;  1G4Y B;  2YIB D;  4UCT A;  1N0J A;  4JZG A;  3GB7 C;  1K97 A;  1HDJ A;  2F23 A;  2XUM A;  1I5Y A;  2D3O W;  5LGN A;  4TQF A;  2R70 A;  4JI6 O;  2WA4 A;  4Z1M G;  4LWS B;  1P7B A;  3SYO A;  3K59 A;  1EZJ A;  5BMV B;  4GKK O;  4I50 A;  1VEW A;  1WP8 A;  4IGG A;  4LP8 A;  2QJ1 A;  3SPH A;  5IY5 C;  1VQK V;  1EBO A;  4ZHQ A;  3K04 A;  3N2G A;  1XMQ B;  4FFB A;  2EZP A;  1OCC B;  4FM1 A;  3G6B A;  1F7Y A;  2DYS B;  4DR6 B;  1LUW A;  5CA3 A;  2XAJ A;  4K3A A;  3T2M A;  3CC7 V;  1W0J G;  1YDX A;  5KMG B;  4JYC A;  2UUA B;  4IHJ A;  3AG4 C;  3A0R A;  5J2U B;  5LBQ A;  3F7Y C;  4MVO A;  4W4K A;  1YI2 V;  3SPG A;  4FFK A;  4IL6 Z;  3CMA V;  1FS0 G;  1MG1 A;  4JI4 B;  5B1B C;  1UPG A;  4OPA A;  3T1Y B;  4J10 A;  2WLN A;  2DE0 X;  3G4S V;  2EIM B;  1R1B A;  4DR6 O;  2Q7E A;  3E8H A;  5CN0 A;  2DMX A;  1SS3 A;  1JMK C;  1FXK C;  1Q3E A;  2CTW A;  3WG7 B;  4JI8 B;  2F93 B;  3FB8 C;  3ASO C;  1DK1 A;  4YJ2 A;  1PNK A;  2ATK C;  1N4C A;  2PF4 E;  1JVM A;  2ZR2 A;  1M1K W;  1XDC A;  1E79 G;  4ZI7 A;  2ZNJ A;  3ZHS A;  4I9W A;  4WBN B;  3CC2 V;  1BHA A;  3OE7 G;  4DYL A;  5IY5 B;  4JI8 O;  3F5T A;  2Z0A A;  4IYI A;  3SYC A;  1IBM O;  1TVK A;  4BW5 A;  1QVF U;  2OWO A;  1OZ0 A;  2P22 C;  1YSC A;  3SPI A;  4QPJ A;  1VQL V;  4LF6 B;  1BCC H;  4CS4 A;  2Y69 C;  5GTH Z;  4AQY B;  3AG4 B;  3JD0 A;  1R73 A;  1MZF A;  5JCO C;  1WB8 A;  3JD2 A;  4LBE C;  3CCV V;  1IXM A;  3VBB A;  3L70 H;  1YXB A;  1EN5 A;  5B1B B;  2ODM A;  1CEZ A;  2OT5 A;  2MK3 A;  1QBZ A;  2V4D A;  2AZ0 A;  3LDE A;  1XRE A;  2B1I A;  5GW7 A;  1K33 A;  1KUQ A;  2CGN A;  5JVD B;  2N05 A;  1EN4 A;  4AIL C;  1K3E A;  1VQ4 V;  2RQ6 A;  3SYP A;  3ASO B;  4B3S B;  3QVN A;  3N2K B;  2VQE B;  4PDL A;  2FKX A;  2HFE C;  3ZED A;  1K5S A;  3CRQ A;  5CA1 B;  3JAW A;  1ZX3 A;  5JQG A;  2P5O A;  1URF A;  3QO7 A;  2QM8 A;  3K9S A;  2B1G A;  4RQE A;  4NTX A; 
#chains in the Genus database with same CATH homology
 1M57 B;  4WFB V;  1AJN A;  5KA5 A;  5LHI A;  3ETE A;  1AI6 A;  3PJS K;  2JEU A;  3JCZ A;  1M56 B;  1L1F A;  1LNQ A;  2WLJ A;  3RVY A;  4WFA V;  1FXV A;  2R9R B;  3DTU B;  3ETG A;  3LSQ A;  3AG1 C;  1S72 V;  2Z5U A;  4G2K A;  2B5U A;  4HAM A;  4UVB A;  1JCH A;  2EIL C;  3OEH G;  3K06 A;  1K73 W;  3SJQ C;  1HWY A;  2EZO A;  2XAG A;  3SYQ A;  3ZRW A;  2JIZ G;  5LGT A;  2HJF C;  3TET A;  3FYI B;  2OCC C;  2XAS A;  3ABT A;  4GCZ A;  2W6I G;  1KQS U;  2ZD9 A;  1S77 D;  4JAU A;  4BIZ A;  5CBH A;  2EIJ B;  2IH1 C;  1G8M A;  5L3B A;  3ABK B;  1Y4M A;  2WLL B;  1E1R G;  3T4D A;  4GX1 A;  2X6A A;  3OR7 C;  1QLE B;  3RW0 A;  3F7V C;  5EBM C;  1KP2 A;  1PD3 A;  2QTO A;  4JPR A;  3OGC C;  2EJR A;  2GHY A;  2X6B A;  3WFV A;  1MSW D;  4MTF A;  4JTA B;  3OW2 U;  4CZZ A;  1K8A W;  5EK0 A;  2WWW A;  4PA4 A;  1BL8 A;  3IFX A;  5IYB O;  3ZN1 A;  3OMI B;  2M7W A;  3LNM B;  2EIK B;  3AG3 C;  2QE7 G;  5EBW C;  1KKD A;  5DN6 G;  3ZMZ A;  5C93 A;  1R3K C;  2DYR B;  1J95 A;  1TUE B;  4N21 A;  1K9M W;  5L3D A;  4RQE A;  3UKM A;  1S3J A;  1AI7 A;  1V54 C;  3JD4 A;  4WF9 V;  4DXW A;  3ETD A;  3JD1 A;  1NH2 B;  1H8E G;  1OCO B;  5BZB A;  5KUM A;  1UJW B;  2EIN C;  2X6C A;  4PA7 A;  3W7T A;  2XAF A;  4F4L A;  2HKO A;  4MW3 A;  2CK3 G;  1PL0 A;  1N8R W;  3CCU V;  2EIM C;  1GM9 A;  2PI4 A;  1OCZ B;  1YIT V;  3BEH A;  4P9P A;  1R3L C;  2C2A A;  3W7S A;  1B6Q A;  2Y48 A;  3HB3 B;  3ZRW B;  2DWE C;  1I5X A;  3CCQ V;  1K92 A;  5CBG A;  1RM1 B;  1NVP D;  1OHH G;  1H38 A;  3X2Q C;  4QPK A;  3FKS G;  4MVQ A;  5L3G A;  3CCL V;  3IGA C;  3I56 V;  3QO8 A;  2LP7 A;  2Z3Y A;  1H8H G;  3LSS A;  1NH2 D;  1S76 D;  2JK5 C;  5B1A C;  1CP9 A;  5EC1 C;  3I55 V;  2JDI G;  1KC8 W;  4OXS A;  5L3F A;  3ZMV A;  3AG1 B;  4R6Z A;  4XDL A;  1YJN V;  3P30 A;  1FXK B;  4J9Z B;  1DF4 A;  1BHB A;  2WSS G;  3IC7 A;  3MD0 A;  3CCE V;  1DLB A;  2EIL B;  4PA6 A;  4MW8 A;  5CMU A;  1AI4 A;  2ZQM A;  3E35 A;  3D3I A;  4MT8 A;  3G6E V;  4X89 A;  2DWD C;  1Q7Y W;  2XND G;  1VQO V;  4RAI A;  1Q86 W;  3CD6 V;  2H8P C;  1CPY A;  1COW G;  1VQ7 V;  2A0L A;  4WFG A;  1R6N A;  1SZT A;  2WAM A;  3DGE A;  1JJ2 U;  4HYO A;  3ASN C;  2WLI A;  3K03 A;  2YSU B;  3E83 A;  3E8G A;  2ZXW C;  2ZDI C;  3AG3 B;  4FIP C;  5EBL C;  4QIW F;  3W7X A;  1VQM V;  2P7T C;  3ML0 A;  1YHQ V;  4MSW C;  1THZ A;  3H01 A;  3ZN0 A;  1WLE A;  1FXH A;  2H94 A;  2X0L A;  3W7W A;  3FB6 C;  5B1O A;  1PNL A;  3SPJ A;  4L87 A;  3E8F A;  3JYC A;  2V7Q G;  1Q82 W;  1OCR C;  2HLD G;  1ENV A;  2EIN B;  4XDK A;  2P6J A;  4LC1 A;  2ITD C;  2P67 A;  4P30 A;  1VQN V;  2Y69 B;  1XL4 A;  3ABL B;  3OEE G;  1GMG A;  3B77 A;  3K3W A;  1QR8 A;  4P9O A;  3OUS A;  2IJJ A;  2XAH A;  2WLK A;  1AI5 A;  4E2L A;  3CCM V;  1YTF B;  2ZDI A;  2JJ2 G;  3SPC A;  3E86 A;  4GX5 A;  1W0K G;  1GTO A;  4JAV A;  2HR3 A;  1OCC C;  5B1N A;  2QA4 V;  3K08 A;  2DYS C;  2IJH A;  3STL C;  2R9I A;  4YXW G;  5IYC O;  3R65 A;  2HVK C;  2QM7 A;  5IDJ A;  4MVU A;  1AR1 B;  2W0F C;  4RUE A;  1YJ9 V;  3RVZ A;  1NJI W;  4RO2 A;  4LCU C;  1F4M A;  3E8B A;  4UV8 A;  2Q69 A;  1JOY A;  5LHG A;  1R6K A;  1QLN A;  1JQ0 A;  1E1Q G;  4MTX A;  5H6R A;  5B1A B;  4WFE A;  1GO3 F;  5EC2 C;  1NKD A;  2YEV A;  3CYO A;  1K4C C;  2WLI B;  4XDJ A;  1M9N A;  3ZRV A;  4GX2 A;  4KFM A;  2IJK A;  1K34 A;  2LFR A;  5HFL A;  2Q6A A;  2PI5 A;  3ZIA G;  1WPX A;  2EBO A;  1AJP A;  5B3S B;  1M57 C;  3LUT B;  1K4D C;  3EHB B;  3BY6 A;  1Q81 W;  1YTF D;  1H2G A;  2A79 B;  1ZWI C;  3AG2 C;  4CBC A;  3E2E A;  1VQ9 V;  1SES A;  4N23 A;  2Q67 A;  3SYA A;  1SRY A;  2NNU A;  4JYB A;  4MS2 A;  3CCJ V;  4TSF G;  4R7C A;  4JTD B;  3RBZ A;  3WG7 C;  1G4Y B;  3K0D A;  3OAA G;  4TWK A;  1DTO A;  3GB7 C;  1V55 C;  3ASN B;  1VQ6 V;  1K97 A;  3B8M A;  2ZXW B;  1NBM G;  2HVJ C;  5H9C A;  5KA6 A;  4J9Y B;  4MVM A;  1QLE C;  1ARO P;  1SER A;  1I5Y A;  3OMN B;  4FMT A;  2D3O W;  2UXX A;  5LGN A;  3FB7 C;  1KP3 A;  3JD3 A;  4Z1M G;  1EFR G;  1P7B A;  3SYO A;  3F5W C;  1EZJ A;  1OCR B;  3QNE A;  3FB5 C;  1GKF A;  1K7D A;  4UVC A;  2OCC B;  4LP8 A;  3SPH A;  2OTL V;  3ZMT A;  2FTK A;  2DQ0 A;  2WLH A;  1QCE A;  2A9H A;  3ABM C;  5IY5 C;  1VQK V;  4HZ3 A;  3M99 B;  3ZMU A;  1GM7 A;  1EBO A;  1KD1 W;  4UXN A;  3FYE B;  4DO2 A;  3K04 A;  4BIU A;  2WLL A;  2EZP A;  1DF5 A;  1OCC B;  3CP1 A;  4FJC C;  3T1C A;  3B8N A;  3STZ C;  3VOU A;  2DYS B;  2JJ1 G;  4FPP A;  2OTJ V;  1PNM A;  2W6J G;  4PA3 A;  2XAJ A;  1F23 A;  5CA3 A;  3G71 V;  3T2M A;  3CC7 V;  1W0J G;  1XL6 A;  3CME V;  4JYC A;  1Y66 A;  5IYD O;  3AG4 C;  3ZRX A;  3A0R A;  3CCR V;  2HG5 C;  1JX9 A;  1K5Q A;  5LBQ A;  3OMA B;  4UV9 A;  4G27 B;  1PKX A;  3F7Y C;  2V1D A;  2UXN A;  4MVO A;  3CPW U;  1YI2 V;  1V54 B;  5H6Q A;  5LHH A;  3SPG A;  4RUF A;  1F4N A;  2IU3 A;  1RPR A;  4P2Z A;  1RM1 C;  3P32 A;  4ZBM A;  1FS0 G;  3ZMS A;  1MG1 A;  2KB1 A;  3CMA V;  5B1B C;  2AHZ A;  2IJI A;  3EFF K;  4JTC B;  4MVS A;  2WLN A;  1QR9 A;  4X8A A;  3G4S V;  1QVG U;  2DQ3 A;  2EIM B;  3CXC U;  4FK5 C;  2WLM A;  4BAY A;  3E8H A;  2QEX V;  4WFF A;  3AG2 B;  2DW4 A;  5CN0 A;  4KP4 A;  3OUF A;  3ZJZ A;  1FXK C;  5KUK A;  2WPD G;  3E89 A;  3GWO A;  4PDR A;  4QNH B;  2IH3 C;  3WG7 B;  4JGS A;  3X2Q B;  1YJW V;  2QKS A;  4X88 A;  4QJF B;  1V55 B;  3FB8 C;  4PDV A;  4U7O A;  4MTG A;  3ASO C;  3CCS V;  4Q20 A;  1PNK A;  1MAB G;  2ATK C;  3ABU A;  1GM8 A;  4EKW A;  1JVM A;  4H33 A;  3T4Z A;  1VQP V;  3CC4 V;  3D36 A;  2ZR2 A;  1M1K W;  1R3J C;  1F51 A;  4JAS A;  4KUM A;  1E79 G;  3HPL C;  3LDC A;  1GK9 A;  1YIJ V;  3NXS A;  3LDD A;  3KG2 A;  5E1A C;  3UM7 A;  3ZRS A;  1VQ5 V;  1RPO A;  4ZKI A;  4I9W A;  1FXK A;  4H37 A;  1ORQ C;  4G28 B;  5FL7 G;  5L3C A;  1S5H C;  1NVP B;  1M90 W;  4WFH A;  2GSM B;  3CC2 V;  1BHA A;  3OE7 G;  3OM3 B;  1M56 C;  5IY5 B;  3ABM B;  1FFT B;  3SYC A;  4UVA A;  1SET A;  3K0G A;  4MVR A;  4UUJ C;  2BOC C;  1NR1 A;  4BW5 A;  1QVF U;  1AJQ A;  1OZ0 A;  2NLJ C;  4JF3 A;  1YSC A;  3SPI A;  4QPJ A;  4ASU G;  2F43 G;  1VQL V;  1JPX A;  2LFS A;  3TCU A;  4PA9 A;  2Y69 C;  1MOF A;  1VQ8 V;  2EIJ C;  3ABL C;  3AG4 B;  3JD0 A;  3ABK C;  1R73 A;  4QE9 A;  5J9P C;  2XAQ A;  3OR6 C;  3JD2 A;  4LBE C;  3CCV V;  4MVZ A;  4PDM A;  1S0V A;  3MHS C;  5CBF A;  1NQT A;  4R8C A;  1IXM A;  3VBB A;  4GT1 A;  3OFN G;  4XBF A;  4I5S A;  2BOB C;  4MTO A;  4TT3 G;  2IU0 A;  5B1B B;  1CEZ A;  2P90 A;  2EIK C;  2OT5 A;  4RQF A;  2MK3 A;  4GX0 A;  1QBZ A;  1KEC A;  2DYR C;  5DM6 V;  3LDE A;  1NR7 A;  2YEV B;  2JEX A;  2ZR3 A;  2B1I A;  2ITC C;  5GW7 A;  1K33 A;  1P4R A;  2XOK G;  3TK1 A;  2Q68 A;  4R50 A;  5HFM A;  1OCO C;  2AHY A;  4U7N A;  3QO5 A;  3ZCC A;  3MHH C;  1K3E A;  3AEI A;  2IW5 A;  4PEL A;  1VQ4 V;  5B3S C;  1W2B U;  3K9A A;  1R3I C;  3SYP A;  3ASO B;  1OCZ C;  2X7R B;  1BMF G;  4PDL A;  5L3E A;  2HFE C;  1K5S A;  3W7U A;  2K1E A;  4QE7 A;  5LGU A;  3QO7 A;  2QM8 A;  1ROP A;  4WCE V;  2B1G A;  3K79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...