3J7AU

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
149
structure length
149
Chain Sequence
b'RMYGKGKGISSSTLPYKRKQPSWLKQKPSEIEDAIIKLAKKGQTPSQIGATLRDNYGIPQVKSVTGNKILRILRAQGIATTIPEDLYFLIKKAVSMRKHLEKNKKDKDCKFRLILTESKIHRISRYYKRKKLLPSNWKYQSSTASALIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S ribosomal RNA
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
molecule tags Ribosome/inhibitor
total genus 41
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00312 Ribosomal_S15 Ribosomal protein S15
U PF08069 Ribosomal_S13_N Ribosomal S13/S15 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3j7aU02
5FLXN 4NXNO 4LFBO 1IBKO 3J80N 4JV5O 5A2QN 1XEQA 1KUQA 1HNXO 5BXZA 2ZKOA 4JI3O 2AGAA 4DV0O 4DR5O 2UU9O 2UUCO 4B3SO 5BY1A 1X59A 1XNRO 1A32A 1N36O 2VQFO 4JI2O 2F4VO 3JAMN 1N32O 2VQEO 2ZM6O 1R6TA 4JYAO 1AILA 4LF9O 4GKKO 4OX9O 4DR7O 4DV6O 1FJGO 4DV2O 1N33O 4DR2O 4A5UB 5LMUO 4YY3O 4DV3O 4LFAO 4KHPO 1XMOO 1G1XB 1YZBA 3RT3C 2UUBO 2UUAO 4JI7O 2UXDO 4LF4O 3M8AA 2HHHO 1AB3A 1N34O 1XMQO 5BR8O 2E5LO 4DUYO 1DK1A 2JRIA 1J5EO 2FKXA 4OPAA 4JI6O 1HNZO 1IBMO 4NXMO 4X65O 3T1HO 1IBLO 4DUZO 2UXBO 3J7AU 2N74A 5IWAO 4GKJO 4LFCO 4K0KO 4JI1O 4LF6O 3SDLA 4YHHO 4DR1O 1XNQO 3J81N 4B3MO 3O65A 2LW7A 4LF8O 1HR0O 5H5NA 2UXCO 2Z0AA 3OTOO 5LL6Y 1NS1A 4DR6O 4JI8O 2DOSA 4AQYO 1F7YA 1D2DA 4X62O 3R66A 1I94O 4DR4O 3F5TA 4JI4O 4OPHA 4DV5O 4B3TO 4JI5O 4X66O 1FKAO 4DV4O 1FYJA 1R1BA 4LF5O 3T1YO 4B3RO 4LF7O 2DJVA 4DV7O 4JI0O 5IT9N 4X64O 4DV1O 1HNWO 5LMNO 4DR3O
chains in the Genus database with same CATH superfamily
3CRQA 2HR3A 1P7BA 4I4TA 3B2EE 1N36B 4CZZA 2CK3G 5KHGA 1K33A 2WLIA 2Q9LA 3GVMA 4WFGA 1Q86W 3DSQA 2UUCO 4CH4A 1LUWA 3DC6A 3JALA 1X59A 3E2EA 1EBOA 2YC0A 3LNMB 1IXBA 2XAFA 4JAAA 3STZC 3CP1A 1V55B 5GONA 1YJWV 3K5LA 5H9CA 1PNMA 5CA1A 2GDSA 2HLDG 4OX9O 1QNMA 3G6EV 1QU7A 1PKXA 1K8AW 1Y6XA 4B7EA 4XDJA 1SA0B 3OMAB 3FB5C 4LF8B 2X0LA 1FAFA 2UXDO 3FYEB 4GLXA 1N34O 1M9NA 4EEQA 1FFXB 1TVKA 3AK1A 3BRCA 3OMNB 1PP9H 4NB5A 4TUYA 3P3PA 3A0HZ 1JFFA 1QCEA 4DW1A 3LSSA 3MHSC 4X65O 4X1YA 3ZMSA 1VF5B 4MW3A 2WSSG 4KXRA 3JSNA 5LHGA 3W7WA 2QA4V 4FLVA 1ZL8A 2Y69B 1S5JA 3ASOC 4ZOLB 2OCCB 3L70H 1ZUQA 4JYYA 1HR0O 3RYHB 1SRYA 2EJRA 3HKDB 1XHXA 5JQGA 3ABLC 1BL8A 5LOVB 5E1AC 1ZTEA 1XI1A 3THOA 1N4CA 4E2LA 1NTZH 2GBOA 1NJIW 1HNWO 4HAMA 4GX5A 3JAKB 4HNAB 1H38A 2BTQA 4LP8A 1WA8A 4UXNA 4IL6Z 2IW5A 5KUMA 2ZM6B 1FFTB 1PNLA 3CRRA 4CH3A 2IJKA 5JJEB 4DR7B 3L71H 3WB2A 4H44B 2H94A 4O4HB 4DXWA 1JJOA 4NVPA 3FKSG 4DR2O 2JJ1G 4JPRA 4JASA 2OCHA 5JVDA 1EZVH 1XNQB 1KECA 2VRZA 1BE3H 3ETQA 1YJ9V 3SJBC 3B77A 5FNVB 1YTFD 3I55V 1OCOB 3WFVA 2Q68A 3CWBH 4PDLA 5B1AB 3U11A 2LQTA 1ROPA 1SS3A 4L87A 2JRIA 3RYCB 3D3IA 2Y0IA 4WFHA 3FFQA 2WLLA 1AJQA 2ZQMA 2CGNA 2JGDA 1EM1A 3RYIA 2ZNIA 3AG1C 3JASB 4TQFA 5KA5A 4DV1B 1NVPB 2CDYA 2RJZA 4ZIBA 4FZ1A 2CH7B 1QLEC 1SQQH 1MG1A 5B1BC 2LP7A 3W7SA 1SF9A 3C3SA 1ZSPA 1K73W 1N8RW 1Q5OA 3FD9A 4DR6O 4MTOA 4JI5B 5KUKA 1GN3A 4ABMA 4UCRA 2IJHA 2KKWA 4YIOA 2WLKA 4DYLA 4O2BB 3DGEA 4JAVA 2DYSB 2EIMB 4B3RO 2PYLA 4O4JB 5IT9N 2ZE6A 4DV3B 3D8CA 1XNRB 1S3JA 3N27A 4TOIA 4QE7A 1AR5A 2DQ0A 4GCZA 1N36O 2OTJV 1O9GA 4WFFA 5K1XA 2N05A 4JYAO 5IYCO 3SPIA 3ZN0A 4KHPB 4OXSA 1AR1B 2W0XA 2BSKA 4YY3O 4W4LA 3AG4B 3CMEV 1VQ5V 1PNKA 1YZBA 5LA6B 3CJHB 4TV9B 3OAAG 4GZRB 3RYHA 3L73H 4JI7O 3M8AA 2VWKA 4JI6B 1TUEB 3HPLC 3ZHSA 2PTMA 5D5PA 1JVMA 5FPRA 2HVKC 1P4RA 4X20B 1TA8A 3CEIA 4K3AA 2ITDC 1DLBA 3APQA 1H2LA 4BWAA 2V1DA 3LDEA 4I5SA 1VEWA 1M56B 3UCSC 1JR9A 4LBEC 3NR7A 5LMNB 4RUEA 4F6RB 2ZE8A 3OEHG 1NTMH 3K3WA 1XL6A 1NR7A 3C90A 1IDSA 1K9MW 2B1GA 3OMIB 2CUGA 4FFBA 4B3SB 3H1KH 1ZLZA 4HYOA 1NS1A 2DYRC 4NTYA 2XAQA 1D5AA 3SYQA 2R9RB 3OUSA 5E79Z 1W2BU 4U3JB 1BS3A 5KA6A 1FKAO 4O4HA 2F1MA 3RN4A 2QKAA 2GSMB 3DXRB 4ZI7A 3G71V 3QNEA 5CB4B 5KX5B 4XDKA 2Y69C 5FLXN 1UPGA 4NXNO 2YEVA 5IJ0A 2F23A 1VMGA 2YXLA 3RYCA 4P2ZA 2LJ2A 4IHJA 3RWRD 3JARA 4UB8Z 1S77D 4QIWF 1J5EB 1AP5A 3ICXA 4PA6A 3K5NA 1Z2GA 1HNZB 5C8YB 2QTSA 3D36C 5KHHA 3U10A 3CRMA 5L3BA 1HWYA 4RO2A 2YIDA 2ZM6O 5A9GA 1IX9A 5JJJB 4DK1A 4DR7O 4G28B 3I56V 4DRXB 5J2TA 2ZIMA 4LF4B 2JEXA 1BGYH 2WPDG 1Q6HA 1NI8A 3ABUA 2CTPA 1U96A 2DE0X 3N2KB 1O9HA 3ZN1A 5LP6A 4ZKIA 5LBQA 4LWSB 1YVWA 5DEDA 3ZRXA 3G4SV 1ZX3A 1KKDA 3CCUV 1CXZB 5KLVH 4DR3B 3CRCA 5JCOC 4I4TB 1K5QA 1THZA 5H6RA 3OFNG 4JV5B 1B6QA 4WFAV 1OCOC 5FPOA 3AG7A 1HNXB 2JGUA 2CTWA 5B1AC 3JALB 4DR5B 5H5NA 4FFKA 2AZ0A 4PHZA 4R8CA 4NYKA 4JI8O 4U3FH 5GONB 3CCVV 2M7WA 1R3LC 4JI5O 5CA1B 5KHKA 4GKKB 1FYJA 1YITV 3H1IH 3QVNA 4DV2B 1R3IC 1IBKB 5H6QA 1BMFG 1KC8W 3CX5F 4GX1A 3OR7C 2JIZG 3K5OA 1KD1W 1V54B 1K3EA 2HHHB 1KMIZ 2EULA 4R6ZA 1ZWIC 1JX9A 1TVKB 4R7CA 3E86A 1XNRO 1K4DC 4P9OA 5BZBA 1Q82W 1N32B 4TUYB 1NR1A 2P4VA 1JFFB 2F4VO 2Y0PA 3X2QC 2Q8VA 1FS0G 3QO7A 4X1YB 2QE7G 3JD3A 2UXNA 1S5HC 1M1KW 1KQSU 3B09A 1BQ0A 4UCOA 1ZL8B 4KHPO 1XMOO 3E8HA 2IU3A 4EB6A 2GUZA 5DECA 1QVFU 3JCZA 3CCEV 5KAFZ 4X1IA 3PJSK 5L3GA 3FB8C 5KMGA 2CE4A 5J2UA 2YIBD 5JQGB 3FYIB 3A8TA 4JI6O 1WN7A 3AG1B 2QJ1A 4UB6Z 1M4UA 4ZBMA 1OZ0A 2IM9A 2GV9A 1F4MA 2UXBO 2BCCH 3AEIA 3PN1A 3AG4C 5B1BB 4I7ZB 5KAIZ 2Q7HA 1MABG 1Q6UA 1SC5B 2BTQB 2F43G 2R9IA 1YHQV 3QTCA 1WA8B 1IXMA 2F95B 1K4CC 1N0JA 4DV5B 3JAWA 4B3TB 2DOSA 5LXTA 1Y74A 1ENVA 5IY5C 3U0ZA 4LF5B 5LYJA 4B08A 4H0LB 4NKGB 1I7FA 1F23A 4CH5A 1VQ8V 3I5DA 1M56C 1GM7A 4CH6A 1PL0A 1TUBA 2Q69A 1E1QG 5JVDB 1S0VA 1VF7A 3TETA 4MVZA 3WG7B 4LFBO 3SPJA 4DV0B 1ZAUA 4WFEA 5A2QN 4PA4A 4DW0A 2KSDA 5HFMA 3O9OA 5EBLC 1XQ8A 4WF9V 2X6AA 1YCIA 4K8XA 3CCJV 1VF6A 4AILC 2NR5A 4ZHQA 2WLLB 1H2NA 1R6NA 2JGDB 3RYIB 4KL1A 2ADPA 4MVOA 1SQPH 4FLXA 4X88A 4MS2A 1L0NH 1W59A 3E89A 4EFBA 3ZEDA 1RP3B 4B3MB 1WPBA 4LNUA 1FXKA 4LF4O 4QNHB 1AI5A 4YXWG 4DUYO 2AXTZ 1DF5A 1VQPV 3OT7A 3JCUZ 1YI2V 2QEXV 3W7XA 4N21A 3T1YB 1YXBA 2EBOA 4NR1A 1KP3A 4LFCO 4MSWC 4GYCB 3BCCH 3OTOB 1GMGA 2ADQB 2QTOA 2WWWA 1NT2B 2DYRB 3K08A 2UXCO 4LH7A 3A0RA 5LGTA 4JI4B 2X6BA 5LL6Y 1KBHA 4GX2A 1VF6C 4X66B 4DV4B 2RNBA 2AHZA 1OJHA 1SQGA 1FPOA 4FZ0A 1RSOA 2VQEB 4D7SA 3T4ZA 3UM7A 1JQ0A 2DJVA 4PDMA 3TGUH 5CMUA 2BSKB 3G80A 3H1LH 4RQFA 5CA0A 1J95A 5EZYA 2V7QG 4JYBA 3CCRV 4O4LA 1IBKO 1RPOA 2VQFB 3OEEG 5BXZA 5EBWC 4FLUA 2E3CA 2E5LB 2HP8A 3OGCC 1BQZA 2ATKC 5L3CA 2YI9A 1K97A 3CCSV 1QR8A 1WNSA 1N32O 3VQWA 1R6TA 2FB5A 3ZHRA 3W7UA 4C7UA 1Y67A 1AJPA 4PELA 3RT3C 1V54C 3K0DA 4FFBB 1Z5WA 3CYOA 4Z1VA 2G38A 2PYJA 2ILMA 2PGGA 3QF7A 1SQXH 3ZHTA 2YXYA 4LF6B 5L3EA 4ZI7B 3CD6V 3BHPA 4GKJO 1SZTA 4FVMA 4K0KO 3VBBA 3K57A 2YEVB 3E83A 1YEWA 4JI1O 5IJ0B 2QM7A 2C2AA 3H01A 2RCVA 4FJCC 3RGBA 4JGSA 2Y48A 3S3WA 1Y4MA 3L74H 4IHJB 3JARB 1FXHA 5IE9A 2YIAA 4AQYO 3SPCA 1VQNV 3BVOA 3D3QA 3SPGA 1I94O 2Q73A 3IFXA 4DV5O 2N04A 4B3TO 1IZ3A 4DO2A 1Y66A 4LF5O 1FJGB 2EX3A 4JI0O 4YJ2A 5J2TB 3MD0A 2B1IA 3F7YC 2W6IG 3H9VA 2FMLA 2GTSA 4TV8A 2DMXA 2UU9O 4I0XA 4DV0O 3BEHA 4HBNA 3VQVA 5LP6B 1S76D 1XILA 1AR4A 3K06A 3X2QB 5EYPA 2LFSA 5LHIA 2YSUB 3T1HB 4I50A 1IBLB 4I9WA 2HJDA 3ETEA 1W0KG 4OGQB 3WG7C 2UUAB 5LMUO 2QWQB 2UXXA 4YHHB 4PJ0Z 1KB9F 5LGUA 1G4YB 1QQCA 1SKVA 2Q0AA 3ZCCA 1VQ4V 4UVCA 1JJ2U 5DN6G 1XOUA 2F66C 3SYOA 4G27B 3FAVA 3ZJZA 2FKXA 5HFLA 1MSDA 3QO8A 1AI7A 1GN2A 4ICGA 3SJAC 2ZR2A 3CE2A 4E4EA 2VWJA 3RVZA 4FLTA 4DV7B 1VQLV 1YIJV 3ZRVA 4X64B 3ETGA 4AI8A 5EC1C 1B3QA 3K5MA 3UKMA 4LF8O 4O4IA 2JS5A 5H2FZ 3OTOO 5IY5B 2RMKB 2E74B 1IVSA 1Q81W 1EN6A 3KZIZ 1I5XA 3DTUB 4JI4O 2ARHA 5JH7A 2Y4TA 5GTIZ 2KG7A 3KKYA 4X66O 4DV4O 4LF9B 1LUVA 1CEZA 1HDJA 1YDXA 4LCUC 4NTXA 4PI0A 3SJQC 3CHXA 4QPKA 2PF4E 2EIKC 2ZT9B 4EB6B 2GUZB 4GUNA 4MVUA 3CPWU 1P49A 1XEQA 4X1IB 2CGOA 4BIOA 1XHZA 1M90W 5KMGB 5J2UB 1US6A 1JA8A 1NU1H 4UCTA 4CS4A 1K5SA 2VQFO 1XBLA 1N33B 1B04A 2QWOB 2VS0A 2P4KA 3HR0A 1AILA 5ITZA 4JTAB 2E76B 2CTQA 1NTKH 4CC5A 2WA3A 3CC7V 1Y76A 5C93A 1VQMV 2IJJA 1HP8A 1VQ6V 1SESA 2NN4A 5TISZ 3B8MA 4BAYA 2ZNJA 2P90A 4J9YB 4QE9A 2CAZC 3RFRA 3JAWB 3K0GA 5LXTB 1Y74B 3JSLA 4X1KA 4CS3A 4X62B 5LYJB 1WJZA 2F93B 1VQ9V 2OIGA 4KFMA 3W7TA 1SQFA 3ML0A 1UFIA 1AP6A 3GB7C 5GTHZ 1TUBB 4DR1B 3T1CA 2QWRB 3B8NA 1BT8A 4LF6O 2BE3A 4JF3A 1XNQO 4TT3G 1K7DA 1HW7A 4IYHA 3ZHUA 1EN5A 5CBGA 2OTLV 3VOUA 2BOCC 5IJ9A 4FM0A 1WLEA 2LO1A 1VARA 2EZPA 4ZHQB 1F7YA 2YICA 3L72H 4FIPC 2EINB 4J80A 3RW0A 4J42A 2W6JG 3AG3C 4WBNA 1VQKV 2NLJC 1BHAA 4K8ZA 2HJFC 4KP4A 3FB6C 4DV1O 2OYQA 1JPXA 3SYPA 1H2GA 1FXKB 4LNUB 2ZINA 2UXDB 2IJIA 1N34B 1KYOF 2AGAA 5BY1A 3CCQV 3QO5A 1XREA 3E8FA 2L6LA 1Q43A 2RQ6A 2IBZH 3JAMN 1Q8IA 1D5NA 2XTAA 1OCRB 2A3QA 4X65B 1CPYA 3APOA 1WB8A 2UUBB 1R3JC 4RWUA 2XAJA 4DV3O 1S72V 1G1XB 1XMQB 5BR8B 3TJTA 1PM9A 2UUAO 4EFEA 2CTRA 5CBHA 1HR0B 4H13B 2LFRA 5GW7A 2QWNB 5LP6C 2DWDC 1EN4A 1RPRA 1GM8A 1I5YA 5IYDO 5K1PA 3WU2Z 3STLC 1RSOB 1GH6A 4BR6A 3JYCA 1L8DA 2FYUH 5J9PC 2GHYA 5CA0B 5EZYB 2OT5A 2D2CB 1HNWB 1VQOV 3A0BZ 4O4LB 4MT8A 3J81N 2ZD9A 1FD9A 3JD0A 2Q6AA 4FM2A 3F7VC 4RAIA 3RYFA 4BW5A 3ZHVA 3JD4A 4XDLA 1D2DA 4JTCB 2H8PC 1MA1A 3ZIAG 2QWPB 2AHYA 3QG5A 2ZDIA 3HKBB 4BW9A 5EC2C 2P06A 3TXSA 5L3FA 5IDJA 2Q67A 1GN6A 1WB7A 4ASUG 3Q4HA 3K04A 5LMNO 1Z5VA 1U97A 2QSAA 3J80N 3UT5A 2A79B 2ZKOA 5JJNB 1K92A 4B3SO 3T2MA 2W0FC 1ORQC 4PDRA 2AW9A 2EIJB 1P7GA 4LR3A 3JATA 4LFAB 2XAHA 4Z2WA 1N33O 2HKOA 2LW1A 3RBZA 2XAGA 4FPPA 2MK3A 4YJ3A 1F51A 2FL4A 1IURA 3LNNA 4D6TH 2YI8A 4IYIA 1DK1A 4FLZA 2FTKA 1J5EO 3E8GA 1HNZO 5LHHA 1GKFA 4YJ2B 3MDSA 5LGNA 3CS5A 2ZXWC 3VQXA 2Q7EA 3BPZA 3SDLA 2PI4A 4O2AA 4L8JA 4YIPA 4DR1O 1YSCA 3ABKB 4TV8B 4B7KA 4I0XB 3ZRWA 5AG2A 1OV9A 2JDIG 2HEPA 5EYPB 4PA7A 1LR1A 2AZ2A 2HVJC 4JZGA 1EZJA 3CSXA 4I50B 4U7NA 2WLJA 2WLNA 2DWEC 4JYAB 1JCHA 2XOKG 2D3OW 2A9HA 3AG2C 4LC1A 2JVDA 3UO3A 2EIKB 4AHCA 4YY3B 1Q6IA 5EIBD 4DR3O 2OIEA 4N23A 1QVGU 2EJ7A 4JV5O 2R9AA 3SYAA 4JI7B 3G67A 4IIJA 1HNXO 4F6EA 4DR5O 3FAVB 4UFZA 2EINC 4PD4F 2A06H 4PA3A 2PY5A 3CRAA 5B66Z 4DV6B 1KP2A 4WCEV 5KHIA 4GKKO 5EBMC 2ETNA 1MOFA 4DV2O 1M57B 1NZ6A 4MW8A 1FXKC 1QBZA 2UUBO 5DM6V 5CA3A 5CBFA 4O4IB 1AVMA 1PPJH 2HHHO 3BY6A 1XMQO 5BR8O 1IBMB 3RVYA 3SPHA 2QDOA 4NXMB 1Q3EA 2DN9A 3ZHQA 3HKBA 2B5UA 5JH7B 2KG7B 1OCRC 3K03A 5IWAB 3HKEA 4XBFA 5B1NA 1VP7A 1GRJA 3ASNC 3TCUA 1SERA 3CMAV 1JOYA 5EIBC 4NXNB 2ZR3A 3HB3B 4UVAA 2QKCA 1SQBH 4I9QA 4JZ2A 4J7KA 3GWKC 4UVBA 3JD2A 3L9DA 4QJFB 1NQTA 2R72A 3OUFA 2IH3C 2P67A 3OTFA 4PI2A 4LF7B 4J7ZA 3N2GA 3AG3B 1E1RG 1S5LZ 2X6CA 4HZ3A 5ITZB 1Q7YW 4FMTA 4RQEA 3E22A 3MHHC 3T4DA 1Y76B 3P3NA 1B06A 2BTOA 3CCLV 1OCZC 2H3OA 2KQXA 1YJNV 4TSFG 3H1HH 2Q7GA 2EZOA 2QKSA 1GO3F 4JI2B 4H33A 4J7JA 3E35A 4UCVA 3IAYA 1PD3A 4X1KB 3DC5A 4TWKA 1JMKC 4FLWA 1KKCA 2WLMA 3M99B 3P32A 3BA8A 2JS3A 2RDCA 5BMVA 1BCCH 1XDCA 1QHTA 1NH2D 4LFAO 4MTXA 4Q20A 1BZKA 3R65A 2ITCC 1AB3A 5B3SB 5IJ9B 1G6UA 2ZE5A 4JI8B 2L35A 5KHJA 2R70A 1V9PA 1M93A 2EIJC 2P6JA 4WBNB 3ZBHA 4QPJA 4UV9A 3ZS8C 2V4DA 3ABMB 1DTOA 1NBMG 1RM1B 3SR2C 1FXVA 1OCCB 3L75H 3LSQA 4CS2A 1XUQA 4RUFA 3EVKA 4J9ZB 1SA0A 4B3MO 2YS8A 1I08A 1NKDA 3FB7C 2XASA 4UCSA 1L0LH 4DR4B 2Z0AA 1FFXA 4LH6A 3M7MX 4PDVA 2XT9A 2F4VB 3F5TA 3WB1A 4CC6A 1GN4A 3KCYA 3BFRA 3C3TA 2JEUA 2XHBA 2K1EA 5B1OA 3T1YO 3FX7A 4MVSA 1VIBA 2EILC 5IYZB 2ZE7A 1E79G 3CB2A 1MSWD 1SQVH 1XMOB 2HFEC 3EHBB 2YDEA 3ABKC 4JI3B 3CCMV 3ZMZA 1R6KA 1TAEA 1KUQA 2P5OA 4ZOLA 3ZX6A 3B4SA 1A32A 3OD4A 5EK0A 1BHBA 1T5EA 3HKDA 4PV1B 2X7RB 1V55C 2NNUA 4BIZA 2VQEO 1OHHG 4UUJC 5LOVA 3D36A 2UXBB 4DV6O 3OM3B 4A5UB 4FK5C 3CXHF 3EFFK 1H2SB 5CN0A 2E75B 3JAKA 4H37A 4I55B 4HNAA 3CC4V 3RYFB 1CP9A 1K34A 1H8EG 1PV0A 4U7OA 2E5LO 3BA9A 1H2KA 3WB0A 4DUZB 3VQYA 1H2MA 4DK0A 1IBMO 2GTAA 3K9AA 4NXMO 3B40A 5IYBO 3HKCB 2ZXWB 2PUSA 3ZMTA 1AJNA 3Q4HB 1RFYA 4UV8A 3J7AU 1M57C 5IWAO 4LFBB 3UT5B 2XUMA 2OWOA 2DW4A 5JCOA 1AI4A 5FL7G 3OW2U 1X4TA 5FNVA 3F5WC 3ZMUA 2OCCC 1DGSA 3P30A 2QM8A 1MMMA 3NXSA 4R50A 5L3DA 1VQ7V 3LUTB 4IT5A 4J11A 3JATB 1N0NA 4CBCA 2Z3YA 3AG2B 2K9PA 4LF7O 3ZMVA 2YXHA 3JASA 1MZFA 3IJ4A 1NVPD 4MTGA 2CH7A 4X8AA 2UUCB 1WP7A 4YJ3B 5B5EZ 3CC2V 3IGAC 4DUYB 1EFRG 3ETDA 1SETA 2A7WA 4JI2O 2LGWA 4GT1A 1GTOA 4OX9B 4P9PA 4O2BA 3LDCA 1FJGO 1MNGA 3K59A 1WP8A 4LFCB 4O4JA 2P22C 4O2AB 3KG2A 3IC7A 4TQDA 3ZRWB 1R3KC 1H8HG 2IH1C 3ASOB 2DQ3A 2UXCB 3AK2A 4J41A 1COWG 4JAUA 2WLIB 1AROP 1PL4A 4OPAA 3K58A 4MTFA 2PI5A 3OGIB 2PZSA 2M6YA 3TK1A 2XNDG 3ABLB 3ASNB 2WLHA 5IYZA 3T1HO 1IBLO 3JD1A 2Z5UA 2KB1A 4JYCA 2WAMA 4X9QA 3SGIA 4D7TA 3K9SA 1G8MA 3H1JH 2A0LA 1SZXA 3KCXA 1BSMA 4QGPA 4UCUA 4YHHO 1W0JG 4IIJB 5LA6A 3O65A 2QR4A 3CJHA 2LW7A 4TV9A 5B3SC 1WAZA 3SJCC 4JTDB 2MW2B 3K79A 3CXCU 1DF4A 3R66A 3BABA 4DR4O 1YF2A 1P84F 4OPHA 3ABMC 2QGNA 4X20A 1OCZB 1RM1C 2ZIOA 1R1BA 4FLYA 2JK5C 1OCCC 4MVRA 4MVMA 4DV7O 3AK3A 2DYSC 3OR6C 4X64O 2EIMC 3A2FA 5D5QA 3E8BA 1QR9A 4F4LA 2IU0A 4I55A 4F6RA 1GM9A 3ABTA 2B9ZA 1L1FA 1QLNA 1WPXA 1XL4A 4MVQA 4JI3O 2Q0OC 3EXAA 4GX0A 4WFBV 4Z1MG 3HKCA 2YIBA 3HKEB 4EKWA 4K35A 4DR2B 1M5IA 4U3JA 4LF9O 2BOBC 3UQ8A 2JJ2G 1AI6A 5F2VO 4GKJB 2YUAA 2LGQA 4K0KB 4W4KA 3SYCA 4NTWA 4JI1B 4X89A 3DXRA 2ODMA 2WA4A 5CB4A 5KX5A 1QLEB 1GK9A 2Q5ZA 1KU9A 3IC9A 3BAAA 3ZRSA 4KUMA 4AQYB 3N2GB 1I94B 1GAXA 2ZCEA 4BIUA 3E22B 2HG5C 3GWOA 5C8YA 5JWPA 3LDDA 4DUZO 4JI0B 1TGOA 4FM1A 2N74A 2RN9A 1LNQA 4DRXA 2P7TC 4DR6B 2QM4A 2O57A 1I0HA 2Q4PA 4IGGA 2UU9B 3TXQA 3G6BA 1YTFB 1R73A 3N2KA 2ZDIC 3OE7G 3LSUA 1URFA 4P30A 4X62O 1UJWB 4G2KA 4B3RB 4PA9A 4J10A 1MZEA 2Y4UA 2EILB 5BMVB 4LWSA 3MAQA 1NH2B 1Q90D 1F4NA 3S3XA 4Q6GA 5LMUB 3UO2A
chains in the Genus database with same CATH topology
5FLXN 4NXNO 4LFBO 1IBKO 3J80N 4JV5O 5A2QN 1XEQA 1KUQA 1HNXO 5BXZA 2ZKOA 4JI3O 2AGAA 4DV0O 4DR5O 2UU9O 2UUCO 4B3SO 5BY1A 1X59A 1XNRO 1A32A 1N36O 2VQFO 4JI2O 2F4VO 3JAMN 1N32O 2VQEO 2ZM6O 1R6TA 4JYAO 1AILA 4LF9O 4GKKO 4OX9O 4DR7O 4DV6O 1FJGO 4DV2O 1N33O 4DR2O 4A5UB 5LMUO 4YY3O 4DV3O 4LFAO 4KHPO 1XMOO 1G1XB 1YZBA 3RT3C 2UUBO 2UUAO 4JI7O 2UXDO 4LF4O 3M8AA 2HHHO 1AB3A 1N34O 1XMQO 5BR8O 2E5LO 4DUYO 1DK1A 2JRIA 1J5EO 2FKXA 4OPAA 4JI6O 1HNZO 1IBMO 4NXMO 4X65O 3T1HO 1IBLO 4DUZO 2UXBO 3J7AU 2N74A 5IWAO 4GKJO 4LFCO 4K0KO 4JI1O 4LF6O 3SDLA 4YHHO 4DR1O 1XNQO 3J81N 4B3MO 3O65A 2LW7A 4LF8O 1HR0O 5H5NA 2UXCO 2Z0AA 3OTOO 5LL6Y 1NS1A 4DR6O 4JI8O 2DOSA 4AQYO 1F7YA 1D2DA 4X62O 3R66A 1I94O 4DR4O 3F5TA 4JI4O 4OPHA 4DV5O 4B3TO 4JI5O 4X66O 1FKAO 4DV4O 1FYJA 1R1BA 4LF5O 3T1YO 4B3RO 4LF7O 2DJVA 4DV7O 4JI0O 5IT9N 4X64O 4DV1O 1HNWO 5LMNO 4DR3O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX N;  4NXN O;  4LFB O;  1IBK O;  3J80 N;  4JV5 O;  5A2Q N;  1XEQ A;  1KUQ A;  1HNX O;  5BXZ A;  2ZKO A;  4JI3 O;  2AGA A;  4DV0 O;  4DR5 O;  2UU9 O;  2UUC O;  4B3S O;  5BY1 A;  1X59 A;  1XNR O;  1A32 A;  1N36 O;  2VQF O;  4JI2 O;  2F4V O;  3JAM N;  1N32 O;  2VQE O;  2ZM6 O;  1R6T A;  4JYA O;  1AIL A;  4LF9 O;  4GKK O;  4OX9 O;  4DR7 O;  4DV6 O;  1FJG O;  4DV2 O;  1N33 O;  4DR2 O;  4A5U B;  5LMU O;  4YY3 O;  4DV3 O;  4LFA O;  4KHP O;  1XMO O;  1G1X B;  1YZB A;  3RT3 C;  2UUB O;  2UUA O;  4JI7 O;  2UXD O;  4LF4 O;  3M8A A;  2HHH O;  1AB3 A;  1N34 O;  1XMQ O;  5BR8 O;  2E5L O;  4DUY O;  1DK1 A;  2JRI A;  1J5E O;  2FKX A;  4OPA A;  4JI6 O;  1HNZ O;  1IBM O;  4NXM O;  4X65 O;  3T1H O;  1IBL O;  4DUZ O;  2UXB O;  3J7A U;  2N74 A;  5IWA O;  4GKJ O;  4LFC O;  4K0K O;  4JI1 O;  4LF6 O;  3SDL A;  4YHH O;  4DR1 O;  1XNQ O;  3J81 N;  4B3M O;  3O65 A;  2LW7 A;  4LF8 O;  1HR0 O;  5H5N A;  2UXC O;  2Z0A A;  3OTO O;  5LL6 Y;  1NS1 A;  4DR6 O;  4JI8 O;  2DOS A;  4AQY O;  1F7Y A;  1D2D A;  4X62 O;  3R66 A;  1I94 O;  4DR4 O;  3F5T A;  4JI4 O;  4OPH A;  4DV5 O;  4B3T O;  4JI5 O;  4X66 O;  1FKA O;  4DV4 O;  1FYJ A;  1R1B A;  4LF5 O;  3T1Y O;  4B3R O;  4LF7 O;  2DJV A;  4DV7 O;  4JI0 O;  5IT9 N;  4X64 O;  4DV1 O;  1HNW O;  5LMN O;  4DR3 O; 
#chains in the Genus database with same CATH topology
 3CRQ A;  2HR3 A;  1P7B A;  4I4T A;  3B2E E;  1N36 B;  4CZZ A;  2CK3 G;  5KHG A;  1K33 A;  2WLI A;  2Q9L A;  3GVM A;  4WFG A;  1Q86 W;  3DSQ A;  2UUC O;  4CH4 A;  1LUW A;  3DC6 A;  3JAL A;  1X59 A;  3E2E A;  1EBO A;  2YC0 A;  3LNM B;  1IXB A;  2XAF A;  4JAA A;  3STZ C;  3CP1 A;  1V55 B;  5GON A;  1YJW V;  3K5L A;  5H9C A;  1PNM A;  5CA1 A;  2GDS A;  2HLD G;  4OX9 O;  1QNM A;  3G6E V;  1QU7 A;  1PKX A;  1K8A W;  1Y6X A;  4B7E A;  4XDJ A;  1SA0 B;  3OMA B;  3FB5 C;  4LF8 B;  2X0L A;  1FAF A;  2UXD O;  3FYE B;  4GLX A;  1N34 O;  1M9N A;  4EEQ A;  1FFX B;  1TVK A;  3AK1 A;  3BRC A;  3OMN B;  1PP9 H;  4NB5 A;  4TUY A;  3P3P A;  3A0H Z;  1JFF A;  1QCE A;  4DW1 A;  3LSS A;  3MHS C;  4X65 O;  4X1Y A;  3ZMS A;  1VF5 B;  4MW3 A;  2WSS G;  4KXR A;  3JSN A;  5LHG A;  3W7W A;  2QA4 V;  4FLV A;  1ZL8 A;  2Y69 B;  1S5J A;  3ASO C;  4ZOL B;  2OCC B;  3L70 H;  1ZUQ A;  4JYY A;  1HR0 O;  3RYH B;  1SRY A;  2EJR A;  3HKD B;  1XHX A;  5JQG A;  3ABL C;  1BL8 A;  5LOV B;  5E1A C;  1ZTE A;  1XI1 A;  3THO A;  1N4C A;  4E2L A;  1NTZ H;  2GBO A;  1NJI W;  1HNW O;  4HAM A;  4GX5 A;  3JAK B;  4HNA B;  1H38 A;  2BTQ A;  4LP8 A;  1WA8 A;  4UXN A;  4IL6 Z;  2IW5 A;  5KUM A;  2ZM6 B;  1FFT B;  1PNL A;  3CRR A;  4CH3 A;  2IJK A;  5JJE B;  4DR7 B;  3L71 H;  3WB2 A;  4H44 B;  2H94 A;  4O4H B;  4DXW A;  1JJO A;  4NVP A;  3FKS G;  4DR2 O;  2JJ1 G;  4JPR A;  4JAS A;  2OCH A;  5JVD A;  1EZV H;  1XNQ B;  1KEC A;  2VRZ A;  1BE3 H;  3ETQ A;  1YJ9 V;  3SJB C;  3B77 A;  5FNV B;  1YTF D;  3I55 V;  1OCO B;  3WFV A;  2Q68 A;  3CWB H;  4PDL A;  5B1A B;  3U11 A;  2LQT A;  1ROP A;  1SS3 A;  4L87 A;  2JRI A;  3RYC B;  3D3I A;  2Y0I A;  4WFH A;  3FFQ A;  2WLL A;  1AJQ A;  2ZQM A;  2CGN A;  2JGD A;  1EM1 A;  3RYI A;  2ZNI A;  3AG1 C;  3JAS B;  4TQF A;  5KA5 A;  4DV1 B;  1NVP B;  2CDY A;  2RJZ A;  4ZIB A;  4FZ1 A;  2CH7 B;  1QLE C;  1SQQ H;  1MG1 A;  5B1B C;  2LP7 A;  3W7S A;  1SF9 A;  3C3S A;  1ZSP A;  1K73 W;  1N8R W;  1Q5O A;  3FD9 A;  4DR6 O;  4MTO A;  4JI5 B;  5KUK A;  1GN3 A;  4ABM A;  4UCR A;  2IJH A;  2KKW A;  4YIO A;  2WLK A;  4DYL A;  4O2B B;  3DGE A;  4JAV A;  2DYS B;  2EIM B;  4B3R O;  2PYL A;  4O4J B;  5IT9 N;  2ZE6 A;  4DV3 B;  3D8C A;  1XNR B;  1S3J A;  3N27 A;  4TOI A;  4QE7 A;  1AR5 A;  2DQ0 A;  4GCZ A;  1N36 O;  2OTJ V;  1O9G A;  4WFF A;  5K1X A;  2N05 A;  4JYA O;  5IYC O;  3SPI A;  3ZN0 A;  4KHP B;  4OXS A;  1AR1 B;  2W0X A;  2BSK A;  4YY3 O;  4W4L A;  3AG4 B;  3CME V;  1VQ5 V;  1PNK A;  1YZB A;  5LA6 B;  3CJH B;  4TV9 B;  3OAA G;  4GZR B;  3RYH A;  3L73 H;  4JI7 O;  3M8A A;  2VWK A;  4JI6 B;  1TUE B;  3HPL C;  3ZHS A;  2PTM A;  5D5P A;  1JVM A;  5FPR A;  2HVK C;  1P4R A;  4X20 B;  1TA8 A;  3CEI A;  4K3A A;  2ITD C;  1DLB A;  3APQ A;  1H2L A;  4BWA A;  2V1D A;  3LDE A;  4I5S A;  1VEW A;  1M56 B;  3UCS C;  1JR9 A;  4LBE C;  3NR7 A;  5LMN B;  4RUE A;  4F6R B;  2ZE8 A;  3OEH G;  1NTM H;  3K3W A;  1XL6 A;  1NR7 A;  3C90 A;  1IDS A;  1K9M W;  2B1G A;  3OMI B;  2CUG A;  4FFB A;  4B3S B;  3H1K H;  1ZLZ A;  4HYO A;  1NS1 A;  2DYR C;  4NTY A;  2XAQ A;  1D5A A;  3SYQ A;  2R9R B;  3OUS A;  5E79 Z;  1W2B U;  4U3J B;  1BS3 A;  5KA6 A;  1FKA O;  4O4H A;  2F1M A;  3RN4 A;  2QKA A;  2GSM B;  3DXR B;  4ZI7 A;  3G71 V;  3QNE A;  5CB4 B;  5KX5 B;  4XDK A;  2Y69 C;  5FLX N;  1UPG A;  4NXN O;  2YEV A;  5IJ0 A;  2F23 A;  1VMG A;  2YXL A;  3RYC A;  4P2Z A;  2LJ2 A;  4IHJ A;  3RWR D;  3JAR A;  4UB8 Z;  1S77 D;  4QIW F;  1J5E B;  1AP5 A;  3ICX A;  4PA6 A;  3K5N A;  1Z2G A;  1HNZ B;  5C8Y B;  2QTS A;  3D36 C;  5KHH A;  3U10 A;  3CRM A;  5L3B A;  1HWY A;  4RO2 A;  2YID A;  2ZM6 O;  5A9G A;  1IX9 A;  5JJJ B;  4DK1 A;  4DR7 O;  4G28 B;  3I56 V;  4DRX B;  5J2T A;  2ZIM A;  4LF4 B;  2JEX A;  1BGY H;  2WPD G;  1Q6H A;  1NI8 A;  3ABU A;  2CTP A;  1U96 A;  2DE0 X;  3N2K B;  1O9H A;  3ZN1 A;  5LP6 A;  4ZKI A;  5LBQ A;  4LWS B;  1YVW A;  5DED A;  3ZRX A;  3G4S V;  1ZX3 A;  1KKD A;  3CCU V;  1CXZ B;  5KLV H;  4DR3 B;  3CRC A;  5JCO C;  4I4T B;  1K5Q A;  1THZ A;  5H6R A;  3OFN G;  4JV5 B;  1B6Q A;  4WFA V;  1OCO C;  5FPO A;  3AG7 A;  1HNX B;  2JGU A;  2CTW A;  5B1A C;  3JAL B;  4DR5 B;  5H5N A;  4FFK A;  2AZ0 A;  4PHZ A;  4R8C A;  4NYK A;  4JI8 O;  4U3F H;  5GON B;  3CCV V;  2M7W A;  1R3L C;  4JI5 O;  5CA1 B;  5KHK A;  4GKK B;  1FYJ A;  1YIT V;  3H1I H;  3QVN A;  4DV2 B;  1R3I C;  1IBK B;  5H6Q A;  1BMF G;  1KC8 W;  3CX5 F;  4GX1 A;  3OR7 C;  2JIZ G;  3K5O A;  1KD1 W;  1V54 B;  1K3E A;  2HHH B;  1KMI Z;  2EUL A;  4R6Z A;  1ZWI C;  1JX9 A;  1TVK B;  4R7C A;  3E86 A;  1XNR O;  1K4D C;  4P9O A;  5BZB A;  1Q82 W;  1N32 B;  4TUY B;  1NR1 A;  2P4V A;  1JFF B;  2F4V O;  2Y0P A;  3X2Q C;  2Q8V A;  1FS0 G;  3QO7 A;  4X1Y B;  2QE7 G;  3JD3 A;  2UXN A;  1S5H C;  1M1K W;  1KQS U;  3B09 A;  1BQ0 A;  4UCO A;  1ZL8 B;  4KHP O;  1XMO O;  3E8H A;  2IU3 A;  4EB6 A;  2GUZ A;  5DEC A;  1QVF U;  3JCZ A;  3CCE V;  5KAF Z;  4X1I A;  3PJS K;  5L3G A;  3FB8 C;  5KMG A;  2CE4 A;  5J2U A;  2YIB D;  5JQG B;  3FYI B;  3A8T A;  4JI6 O;  1WN7 A;  3AG1 B;  2QJ1 A;  4UB6 Z;  1M4U A;  4ZBM A;  1OZ0 A;  2IM9 A;  2GV9 A;  1F4M A;  2UXB O;  2BCC H;  3AEI A;  3PN1 A;  3AG4 C;  5B1B B;  4I7Z B;  5KAI Z;  2Q7H A;  1MAB G;  1Q6U A;  1SC5 B;  2BTQ B;  2F43 G;  2R9I A;  1YHQ V;  3QTC A;  1WA8 B;  1IXM A;  2F95 B;  1K4C C;  1N0J A;  4DV5 B;  3JAW A;  4B3T B;  2DOS A;  5LXT A;  1Y74 A;  1ENV A;  5IY5 C;  3U0Z A;  4LF5 B;  5LYJ A;  4B08 A;  4H0L B;  4NKG B;  1I7F A;  1F23 A;  4CH5 A;  1VQ8 V;  3I5D A;  1M56 C;  1GM7 A;  4CH6 A;  1PL0 A;  1TUB A;  2Q69 A;  1E1Q G;  5JVD B;  1S0V A;  1VF7 A;  3TET A;  4MVZ A;  3WG7 B;  4LFB O;  3SPJ A;  4DV0 B;  1ZAU A;  4WFE A;  5A2Q N;  4PA4 A;  4DW0 A;  2KSD A;  5HFM A;  3O9O A;  5EBL C;  1XQ8 A;  4WF9 V;  2X6A A;  1YCI A;  4K8X A;  3CCJ V;  1VF6 A;  4AIL C;  2NR5 A;  4ZHQ A;  2WLL B;  1H2N A;  1R6N A;  2JGD B;  3RYI B;  4KL1 A;  2ADP A;  4MVO A;  1SQP H;  4FLX A;  4X88 A;  4MS2 A;  1L0N H;  1W59 A;  3E89 A;  4EFB A;  3ZED A;  1RP3 B;  4B3M B;  1WPB A;  4LNU A;  1FXK A;  4LF4 O;  4QNH B;  1AI5 A;  4YXW G;  4DUY O;  2AXT Z;  1DF5 A;  1VQP V;  3OT7 A;  3JCU Z;  1YI2 V;  2QEX V;  3W7X A;  4N21 A;  3T1Y B;  1YXB A;  2EBO A;  4NR1 A;  1KP3 A;  4LFC O;  4MSW C;  4GYC B;  3BCC H;  3OTO B;  1GMG A;  2ADQ B;  2QTO A;  2WWW A;  1NT2 B;  2DYR B;  3K08 A;  2UXC O;  4LH7 A;  3A0R A;  5LGT A;  4JI4 B;  2X6B A;  5LL6 Y;  1KBH A;  4GX2 A;  1VF6 C;  4X66 B;  4DV4 B;  2RNB A;  2AHZ A;  1OJH A;  1SQG A;  1FPO A;  4FZ0 A;  1RSO A;  2VQE B;  4D7S A;  3T4Z A;  3UM7 A;  1JQ0 A;  2DJV A;  4PDM A;  3TGU H;  5CMU A;  2BSK B;  3G80 A;  3H1L H;  4RQF A;  5CA0 A;  1J95 A;  5EZY A;  2V7Q G;  4JYB A;  3CCR V;  4O4L A;  1IBK O;  1RPO A;  2VQF B;  3OEE G;  5BXZ A;  5EBW C;  4FLU A;  2E3C A;  2E5L B;  2HP8 A;  3OGC C;  1BQZ A;  2ATK C;  5L3C A;  2YI9 A;  1K97 A;  3CCS V;  1QR8 A;  1WNS A;  1N32 O;  3VQW A;  1R6T A;  2FB5 A;  3ZHR A;  3W7U A;  4C7U A;  1Y67 A;  1AJP A;  4PEL A;  3RT3 C;  1V54 C;  3K0D A;  4FFB B;  1Z5W A;  3CYO A;  4Z1V A;  2G38 A;  2PYJ A;  2ILM A;  2PGG A;  3QF7 A;  1SQX H;  3ZHT A;  2YXY A;  4LF6 B;  5L3E A;  4ZI7 B;  3CD6 V;  3BHP A;  4GKJ O;  1SZT A;  4FVM A;  4K0K O;  3VBB A;  3K57 A;  2YEV B;  3E83 A;  1YEW A;  4JI1 O;  5IJ0 B;  2QM7 A;  2C2A A;  3H01 A;  2RCV A;  4FJC C;  3RGB A;  4JGS A;  2Y48 A;  3S3W A;  1Y4M A;  3L74 H;  4IHJ B;  3JAR B;  1FXH A;  5IE9 A;  2YIA A;  4AQY O;  3SPC A;  1VQN V;  3BVO A;  3D3Q A;  3SPG A;  1I94 O;  2Q73 A;  3IFX A;  4DV5 O;  2N04 A;  4B3T O;  1IZ3 A;  4DO2 A;  1Y66 A;  4LF5 O;  1FJG B;  2EX3 A;  4JI0 O;  4YJ2 A;  5J2T B;  3MD0 A;  2B1I A;  3F7Y C;  2W6I G;  3H9V A;  2FML A;  2GTS A;  4TV8 A;  2DMX A;  2UU9 O;  4I0X A;  4DV0 O;  3BEH A;  4HBN A;  3VQV A;  5LP6 B;  1S76 D;  1XIL A;  1AR4 A;  3K06 A;  3X2Q B;  5EYP A;  2LFS A;  5LHI A;  2YSU B;  3T1H B;  4I50 A;  1IBL B;  4I9W A;  2HJD A;  3ETE A;  1W0K G;  4OGQ B;  3WG7 C;  2UUA B;  5LMU O;  2QWQ B;  2UXX A;  4YHH B;  4PJ0 Z;  1KB9 F;  5LGU A;  1G4Y B;  1QQC A;  1SKV A;  2Q0A A;  3ZCC A;  1VQ4 V;  4UVC A;  1JJ2 U;  5DN6 G;  1XOU A;  2F66 C;  3SYO A;  4G27 B;  3FAV A;  3ZJZ A;  2FKX A;  5HFL A;  1MSD A;  3QO8 A;  1AI7 A;  1GN2 A;  4ICG A;  3SJA C;  2ZR2 A;  3CE2 A;  4E4E A;  2VWJ A;  3RVZ A;  4FLT A;  4DV7 B;  1VQL V;  1YIJ V;  3ZRV A;  4X64 B;  3ETG A;  4AI8 A;  5EC1 C;  1B3Q A;  3K5M A;  3UKM A;  4LF8 O;  4O4I A;  2JS5 A;  5H2F Z;  3OTO O;  5IY5 B;  2RMK B;  2E74 B;  1IVS A;  1Q81 W;  1EN6 A;  3KZI Z;  1I5X A;  3DTU B;  4JI4 O;  2ARH A;  5JH7 A;  2Y4T A;  5GTI Z;  2KG7 A;  3KKY A;  4X66 O;  4DV4 O;  4LF9 B;  1LUV A;  1CEZ A;  1HDJ A;  1YDX A;  4LCU C;  4NTX A;  4PI0 A;  3SJQ C;  3CHX A;  4QPK A;  2PF4 E;  2EIK C;  2ZT9 B;  4EB6 B;  2GUZ B;  4GUN A;  4MVU A;  3CPW U;  1P49 A;  1XEQ A;  4X1I B;  2CGO A;  4BIO A;  1XHZ A;  1M90 W;  5KMG B;  5J2U B;  1US6 A;  1JA8 A;  1NU1 H;  4UCT A;  4CS4 A;  1K5S A;  2VQF O;  1XBL A;  1N33 B;  1B04 A;  2QWO B;  2VS0 A;  2P4K A;  3HR0 A;  1AIL A;  5ITZ A;  4JTA B;  2E76 B;  2CTQ A;  1NTK H;  4CC5 A;  2WA3 A;  3CC7 V;  1Y76 A;  5C93 A;  1VQM V;  2IJJ A;  1HP8 A;  1VQ6 V;  1SES A;  2NN4 A;  5TIS Z;  3B8M A;  4BAY A;  2ZNJ A;  2P90 A;  4J9Y B;  4QE9 A;  2CAZ C;  3RFR A;  3JAW B;  3K0G A;  5LXT B;  1Y74 B;  3JSL A;  4X1K A;  4CS3 A;  4X62 B;  5LYJ B;  1WJZ A;  2F93 B;  1VQ9 V;  2OIG A;  4KFM A;  3W7T A;  1SQF A;  3ML0 A;  1UFI A;  1AP6 A;  3GB7 C;  5GTH Z;  1TUB B;  4DR1 B;  3T1C A;  2QWR B;  3B8N A;  1BT8 A;  4LF6 O;  2BE3 A;  4JF3 A;  1XNQ O;  4TT3 G;  1K7D A;  1HW7 A;  4IYH A;  3ZHU A;  1EN5 A;  5CBG A;  2OTL V;  3VOU A;  2BOC C;  5IJ9 A;  4FM0 A;  1WLE A;  2LO1 A;  1VAR A;  2EZP A;  4ZHQ B;  1F7Y A;  2YIC A;  3L72 H;  4FIP C;  2EIN B;  4J80 A;  3RW0 A;  4J42 A;  2W6J G;  3AG3 C;  4WBN A;  1VQK V;  2NLJ C;  1BHA A;  4K8Z A;  2HJF C;  4KP4 A;  3FB6 C;  4DV1 O;  2OYQ A;  1JPX A;  3SYP A;  1H2G A;  1FXK B;  4LNU B;  2ZIN A;  2UXD B;  2IJI A;  1N34 B;  1KYO F;  2AGA A;  5BY1 A;  3CCQ V;  3QO5 A;  1XRE A;  3E8F A;  2L6L A;  1Q43 A;  2RQ6 A;  2IBZ H;  3JAM N;  1Q8I A;  1D5N A;  2XTA A;  1OCR B;  2A3Q A;  4X65 B;  1CPY A;  3APO A;  1WB8 A;  2UUB B;  1R3J C;  4RWU A;  2XAJ A;  4DV3 O;  1S72 V;  1G1X B;  1XMQ B;  5BR8 B;  3TJT A;  1PM9 A;  2UUA O;  4EFE A;  2CTR A;  5CBH A;  1HR0 B;  4H13 B;  2LFR A;  5GW7 A;  2QWN B;  5LP6 C;  2DWD C;  1EN4 A;  1RPR A;  1GM8 A;  1I5Y A;  5IYD O;  5K1P A;  3WU2 Z;  3STL C;  1RSO B;  1GH6 A;  4BR6 A;  3JYC A;  1L8D A;  2FYU H;  5J9P C;  2GHY A;  5CA0 B;  5EZY B;  2OT5 A;  2D2C B;  1HNW B;  1VQO V;  3A0B Z;  4O4L B;  4MT8 A;  3J81 N;  2ZD9 A;  1FD9 A;  3JD0 A;  2Q6A A;  4FM2 A;  3F7V C;  4RAI A;  3RYF A;  4BW5 A;  3ZHV A;  3JD4 A;  4XDL A;  1D2D A;  4JTC B;  2H8P C;  1MA1 A;  3ZIA G;  2QWP B;  2AHY A;  3QG5 A;  2ZDI A;  3HKB B;  4BW9 A;  5EC2 C;  2P06 A;  3TXS A;  5L3F A;  5IDJ A;  2Q67 A;  1GN6 A;  1WB7 A;  4ASU G;  3Q4H A;  3K04 A;  5LMN O;  1Z5V A;  1U97 A;  2QSA A;  3J80 N;  3UT5 A;  2A79 B;  2ZKO A;  5JJN B;  1K92 A;  4B3S O;  3T2M A;  2W0F C;  1ORQ C;  4PDR A;  2AW9 A;  2EIJ B;  1P7G A;  4LR3 A;  3JAT A;  4LFA B;  2XAH A;  4Z2W A;  1N33 O;  2HKO A;  2LW1 A;  3RBZ A;  2XAG A;  4FPP A;  2MK3 A;  4YJ3 A;  1F51 A;  2FL4 A;  1IUR A;  3LNN A;  4D6T H;  2YI8 A;  4IYI A;  1DK1 A;  4FLZ A;  2FTK A;  1J5E O;  3E8G A;  1HNZ O;  5LHH A;  1GKF A;  4YJ2 B;  3MDS A;  5LGN A;  3CS5 A;  2ZXW C;  3VQX A;  2Q7E A;  3BPZ A;  3SDL A;  2PI4 A;  4O2A A;  4L8J A;  4YIP A;  4DR1 O;  1YSC A;  3ABK B;  4TV8 B;  4B7K A;  4I0X B;  3ZRW A;  5AG2 A;  1OV9 A;  2JDI G;  2HEP A;  5EYP B;  4PA7 A;  1LR1 A;  2AZ2 A;  2HVJ C;  4JZG A;  1EZJ A;  3CSX A;  4I50 B;  4U7N A;  2WLJ A;  2WLN A;  2DWE C;  4JYA B;  1JCH A;  2XOK G;  2D3O W;  2A9H A;  3AG2 C;  4LC1 A;  2JVD A;  3UO3 A;  2EIK B;  4AHC A;  4YY3 B;  1Q6I A;  5EIB D;  4DR3 O;  2OIE A;  4N23 A;  1QVG U;  2EJ7 A;  4JV5 O;  2R9A A;  3SYA A;  4JI7 B;  3G67 A;  4IIJ A;  1HNX O;  4F6E A;  4DR5 O;  3FAV B;  4UFZ A;  2EIN C;  4PD4 F;  2A06 H;  4PA3 A;  2PY5 A;  3CRA A;  5B66 Z;  4DV6 B;  1KP2 A;  4WCE V;  5KHI A;  4GKK O;  5EBM C;  2ETN A;  1MOF A;  4DV2 O;  1M57 B;  1NZ6 A;  4MW8 A;  1FXK C;  1QBZ A;  2UUB O;  5DM6 V;  5CA3 A;  5CBF A;  4O4I B;  1AVM A;  1PPJ H;  2HHH O;  3BY6 A;  1XMQ O;  5BR8 O;  1IBM B;  3RVY A;  3SPH A;  2QDO A;  4NXM B;  1Q3E A;  2DN9 A;  3ZHQ A;  3HKB A;  2B5U A;  5JH7 B;  2KG7 B;  1OCR C;  3K03 A;  5IWA B;  3HKE A;  4XBF A;  5B1N A;  1VP7 A;  1GRJ A;  3ASN C;  3TCU A;  1SER A;  3CMA V;  1JOY A;  5EIB C;  4NXN B;  2ZR3 A;  3HB3 B;  4UVA A;  2QKC A;  1SQB H;  4I9Q A;  4JZ2 A;  4J7K A;  3GWK C;  4UVB A;  3JD2 A;  3L9D A;  4QJF B;  1NQT A;  2R72 A;  3OUF A;  2IH3 C;  2P67 A;  3OTF A;  4PI2 A;  4LF7 B;  4J7Z A;  3N2G A;  3AG3 B;  1E1R G;  1S5L Z;  2X6C A;  4HZ3 A;  5ITZ B;  1Q7Y W;  4FMT A;  4RQE A;  3E22 A;  3MHH C;  3T4D A;  1Y76 B;  3P3N A;  1B06 A;  2BTO A;  3CCL V;  1OCZ C;  2H3O A;  2KQX A;  1YJN V;  4TSF G;  3H1H H;  2Q7G A;  2EZO A;  2QKS A;  1GO3 F;  4JI2 B;  4H33 A;  4J7J A;  3E35 A;  4UCV A;  3IAY A;  1PD3 A;  4X1K B;  3DC5 A;  4TWK A;  1JMK C;  4FLW A;  1KKC A;  2WLM A;  3M99 B;  3P32 A;  3BA8 A;  2JS3 A;  2RDC A;  5BMV A;  1BCC H;  1XDC A;  1QHT A;  1NH2 D;  4LFA O;  4MTX A;  4Q20 A;  1BZK A;  3R65 A;  2ITC C;  1AB3 A;  5B3S B;  5IJ9 B;  1G6U A;  2ZE5 A;  4JI8 B;  2L35 A;  5KHJ A;  2R70 A;  1V9P A;  1M93 A;  2EIJ C;  2P6J A;  4WBN B;  3ZBH A;  4QPJ A;  4UV9 A;  3ZS8 C;  2V4D A;  3ABM B;  1DTO A;  1NBM G;  1RM1 B;  3SR2 C;  1FXV A;  1OCC B;  3L75 H;  3LSQ A;  4CS2 A;  1XUQ A;  4RUF A;  3EVK A;  4J9Z B;  1SA0 A;  4B3M O;  2YS8 A;  1I08 A;  1NKD A;  3FB7 C;  2XAS A;  4UCS A;  1L0L H;  4DR4 B;  2Z0A A;  1FFX A;  4LH6 A;  3M7M X;  4PDV A;  2XT9 A;  2F4V B;  3F5T A;  3WB1 A;  4CC6 A;  1GN4 A;  3KCY A;  3BFR A;  3C3T A;  2JEU A;  2XHB A;  2K1E A;  5B1O A;  3T1Y O;  3FX7 A;  4MVS A;  1VIB A;  2EIL C;  5IYZ B;  2ZE7 A;  1E79 G;  3CB2 A;  1MSW D;  1SQV H;  1XMO B;  2HFE C;  3EHB B;  2YDE A;  3ABK C;  4JI3 B;  3CCM V;  3ZMZ A;  1R6K A;  1TAE A;  1KUQ A;  2P5O A;  4ZOL A;  3ZX6 A;  3B4S A;  1A32 A;  3OD4 A;  5EK0 A;  1BHB A;  1T5E A;  3HKD A;  4PV1 B;  2X7R B;  1V55 C;  2NNU A;  4BIZ A;  2VQE O;  1OHH G;  4UUJ C;  5LOV A;  3D36 A;  2UXB B;  4DV6 O;  3OM3 B;  4A5U B;  4FK5 C;  3CXH F;  3EFF K;  1H2S B;  5CN0 A;  2E75 B;  3JAK A;  4H37 A;  4I55 B;  4HNA A;  3CC4 V;  3RYF B;  1CP9 A;  1K34 A;  1H8E G;  1PV0 A;  4U7O A;  2E5L O;  3BA9 A;  1H2K A;  3WB0 A;  4DUZ B;  3VQY A;  1H2M A;  4DK0 A;  1IBM O;  2GTA A;  3K9A A;  4NXM O;  3B40 A;  5IYB O;  3HKC B;  2ZXW B;  2PUS A;  3ZMT A;  1AJN A;  3Q4H B;  1RFY A;  4UV8 A;  3J7A U;  1M57 C;  5IWA O;  4LFB B;  3UT5 B;  2XUM A;  2OWO A;  2DW4 A;  5JCO A;  1AI4 A;  5FL7 G;  3OW2 U;  1X4T A;  5FNV A;  3F5W C;  3ZMU A;  2OCC C;  1DGS A;  3P30 A;  2QM8 A;  1MMM A;  3NXS A;  4R50 A;  5L3D A;  1VQ7 V;  3LUT B;  4IT5 A;  4J11 A;  3JAT B;  1N0N A;  4CBC A;  2Z3Y A;  3AG2 B;  2K9P A;  4LF7 O;  3ZMV A;  2YXH A;  3JAS A;  1MZF A;  3IJ4 A;  1NVP D;  4MTG A;  2CH7 A;  4X8A A;  2UUC B;  1WP7 A;  4YJ3 B;  5B5E Z;  3CC2 V;  3IGA C;  4DUY B;  1EFR G;  3ETD A;  1SET A;  2A7W A;  4JI2 O;  2LGW A;  4GT1 A;  1GTO A;  4OX9 B;  4P9P A;  4O2B A;  3LDC A;  1FJG O;  1MNG A;  3K59 A;  1WP8 A;  4LFC B;  4O4J A;  2P22 C;  4O2A B;  3KG2 A;  3IC7 A;  4TQD A;  3ZRW B;  1R3K C;  1H8H G;  2IH1 C;  3ASO B;  2DQ3 A;  2UXC B;  3AK2 A;  4J41 A;  1COW G;  4JAU A;  2WLI B;  1ARO P;  1PL4 A;  4OPA A;  3K58 A;  4MTF A;  2PI5 A;  3OGI B;  2PZS A;  2M6Y A;  3TK1 A;  2XND G;  3ABL B;  3ASN B;  2WLH A;  5IYZ A;  3T1H O;  1IBL O;  3JD1 A;  2Z5U A;  2KB1 A;  4JYC A;  2WAM A;  4X9Q A;  3SGI A;  4D7T A;  3K9S A;  1G8M A;  3H1J H;  2A0L A;  1SZX A;  3KCX A;  1BSM A;  4QGP A;  4UCU A;  4YHH O;  1W0J G;  4IIJ B;  5LA6 A;  3O65 A;  2QR4 A;  3CJH A;  2LW7 A;  4TV9 A;  5B3S C;  1WAZ A;  3SJC C;  4JTD B;  2MW2 B;  3K79 A;  3CXC U;  1DF4 A;  3R66 A;  3BAB A;  4DR4 O;  1YF2 A;  1P84 F;  4OPH A;  3ABM C;  2QGN A;  4X20 A;  1OCZ B;  1RM1 C;  2ZIO A;  1R1B A;  4FLY A;  2JK5 C;  1OCC C;  4MVR A;  4MVM A;  4DV7 O;  3AK3 A;  2DYS C;  3OR6 C;  4X64 O;  2EIM C;  3A2F A;  5D5Q A;  3E8B A;  1QR9 A;  4F4L A;  2IU0 A;  4I55 A;  4F6R A;  1GM9 A;  3ABT A;  2B9Z A;  1L1F A;  1QLN A;  1WPX A;  1XL4 A;  4MVQ A;  4JI3 O;  2Q0O C;  3EXA A;  4GX0 A;  4WFB V;  4Z1M G;  3HKC A;  2YIB A;  3HKE B;  4EKW A;  4K35 A;  4DR2 B;  1M5I A;  4U3J A;  4LF9 O;  2BOB C;  3UQ8 A;  2JJ2 G;  1AI6 A;  5F2V O;  4GKJ B;  2YUA A;  2LGQ A;  4K0K B;  4W4K A;  3SYC A;  4NTW A;  4JI1 B;  4X89 A;  3DXR A;  2ODM A;  2WA4 A;  5CB4 A;  5KX5 A;  1QLE B;  1GK9 A;  2Q5Z A;  1KU9 A;  3IC9 A;  3BAA A;  3ZRS A;  4KUM A;  4AQY B;  3N2G B;  1I94 B;  1GAX A;  2ZCE A;  4BIU A;  3E22 B;  2HG5 C;  3GWO A;  5C8Y A;  5JWP A;  3LDD A;  4DUZ O;  4JI0 B;  1TGO A;  4FM1 A;  2N74 A;  2RN9 A;  1LNQ A;  4DRX A;  2P7T C;  4DR6 B;  2QM4 A;  2O57 A;  1I0H A;  2Q4P A;  4IGG A;  2UU9 B;  3TXQ A;  3G6B A;  1YTF B;  1R73 A;  3N2K A;  2ZDI C;  3OE7 G;  3LSU A;  1URF A;  4P30 A;  4X62 O;  1UJW B;  4G2K A;  4B3R B;  4PA9 A;  4J10 A;  1MZE A;  2Y4U A;  2EIL B;  5BMV B;  4LWS A;  3MAQ A;  1NH2 B;  1Q90 D;  1F4N A;  3S3X A;  4Q6G A;  5LMU B;  3UO2 A; 
#chains in the Genus database with same CATH homology
 5FLX N;  4NXN O;  4LFB O;  1IBK O;  3J80 N;  4JV5 O;  5A2Q N;  1XEQ A;  1KUQ A;  1HNX O;  5BXZ A;  2ZKO A;  4JI3 O;  2AGA A;  4DV0 O;  4DR5 O;  2UU9 O;  2UUC O;  4B3S O;  5BY1 A;  1X59 A;  1XNR O;  1A32 A;  1N36 O;  2VQF O;  4JI2 O;  2F4V O;  3JAM N;  1N32 O;  2VQE O;  2ZM6 O;  1R6T A;  4JYA O;  1AIL A;  4LF9 O;  4GKK O;  4OX9 O;  4DR7 O;  4DV6 O;  1FJG O;  4DV2 O;  1N33 O;  4DR2 O;  4A5U B;  5LMU O;  4YY3 O;  4DV3 O;  4LFA O;  4KHP O;  1XMO O;  1G1X B;  1YZB A;  3RT3 C;  2UUB O;  2UUA O;  4JI7 O;  2UXD O;  4LF4 O;  3M8A A;  2HHH O;  1AB3 A;  1N34 O;  1XMQ O;  5BR8 O;  2E5L O;  4DUY O;  1DK1 A;  2JRI A;  1J5E O;  2FKX A;  4OPA A;  4JI6 O;  1HNZ O;  1IBM O;  4NXM O;  4X65 O;  3T1H O;  1IBL O;  4DUZ O;  2UXB O;  3J7A U;  2N74 A;  5IWA O;  4GKJ O;  4LFC O;  4K0K O;  4JI1 O;  4LF6 O;  3SDL A;  4YHH O;  4DR1 O;  1XNQ O;  3J81 N;  4B3M O;  3O65 A;  2LW7 A;  4LF8 O;  1HR0 O;  5H5N A;  2UXC O;  2Z0A A;  3OTO O;  5LL6 Y;  1NS1 A;  4DR6 O;  4JI8 O;  2DOS A;  4AQY O;  1F7Y A;  1D2D A;  4X62 O;  3R66 A;  1I94 O;  4DR4 O;  3F5T A;  4JI4 O;  4OPH A;  4DV5 O;  4B3T O;  4JI5 O;  4X66 O;  1FKA O;  4DV4 O;  1FYJ A;  1R1B A;  4LF5 O;  3T1Y O;  4B3R O;  4LF7 O;  2DJV A;  4DV7 O;  4JI0 O;  5IT9 N;  4X64 O;  4DV1 O;  1HNW O;  5LMN O;  4DR3 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...