3J7AU

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
149
structure length
149
Chain Sequence
RMYGKGKGISSSTLPYKRKQPSWLKQKPSEIEDAIIKLAKKGQTPSQIGATLRDNYGIPQVKSVTGNKILRILRAQGIATTIPEDLYFLIKKAVSMRKHLEKNKKDKDCKFRLILTESKIHRISRYYKRKKLLPSNWKYQSSTASALIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S ribosomal RNA
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
molecule tags Ribosome/inhibitor
total genus 41
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00312 Ribosomal_S15 Ribosomal protein S15
U PF08069 Ribosomal_S13_N Ribosomal S13/S15 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3j7aU02
5LMUO 4GKKO 1N34O 1NS1A 4JI7O 1N36O 4X64O 1F7YA 4DV7O 3OTOO 2ZM6O 2DOSA 1XMQO 1I94O 4LF5O 2LW7A 2AGAA 4DV0O 1FJGO 1AB3A 5BXZA 1D2DA 5LL6Y 3M8AA 4JI6O 4X62O 4OPAA 2E5LO 2UUAO 3RT3C 2N74A 2UUBO 4NXMO 5A2QN 5FLXN 3T1YO 3F5TA 2FKXA 4JI3O 5BY1A 2VQFO 1IBKO 4JYAO 4X66O 2Z0AA 1FYJA 1XNRO 4JI0O 4JI2O 1N33O 4DR4O 4YHHO 4LFAO 4LF4O 2ZKOA 4B3SO 1HR0O 3T1HO 4LFBO 2UU9O 3SDLA 1DK1A 1YZBA 4LF9O 4LF8O 4DR3O 4YY3O 4DV1O 5H5NA 1IBLO 4DR1O 4DV6O 5BR8O 1FKAO 1KUQA 4NXNO 1XNQO 4DR6O 4DR2O 3J81N 4B3RO 4LFCO 2UXBO 2UUCO 4DUZO 3R66A 3J80N 4DV4O 2DJVA 4JI8O 1HNWO 4JV5O 1G1XB 4X65O 1XMOO 1HNXO 2HHHO 4OX9O 3O65A 2VQEO 4DUYO 4KHPO 4DV2O 2UXDO 5IWAO 4LF6O 1AILA 4GKJO 3JAMN 4DV3O 2UXCO 4JI5O 2JRIA 4AQYO 1N32O 4DV5O 5IT9N 4OPHA 4JI1O 1IBMO 5LMNO 1HNZO 1J5EO 4DR5O 3J7AU 1R6TA 1XEQA 4JI4O 4K0KO 4LF7O 4A5UB 1A32A 1X59A 4DR7O 4B3TO 1R1BA 2F4VO 4B3MO
chains in the Genus database with same CATH superfamily
2HFEC 3WG7B 4QGPA 1K92A 5JJNB 1M5IA 1MOFA 4K8ZA 3ABLC 2X6CA 4PI0A 2A0LA 3B40A 5C93A 1JFFA 1S76D 1JMKC 4GCZA 1BHBA 5E79Z 3ZRVA 2D3OW 1F4NA 3ZMVA 4DK0A 3APOA 3C3TA 1SQGA 2E76B 2XOKG 2UXDB 1RPRA 3K9AA 3K04A 4WBNA 1K5SA 2DWDC 2IH1C 4R8CA 1OCOC 2LJ2A 1GN3A 2UXCB 5CA1B 3ZIAG 4MTGA 1XUQA 4G27B 1EBOA 2UXBB 1S5HC 1VQ8V 3IGAC 4MW3A 1XNRO 3OD4A 3CSXA 4JI0O 2QA4V 1NR1A 1SQXH 2WA4A 4YHHO 4OX9B 4DV2B 4RAIA 3ASNC 5B1AC 1YZBA 4FMTA 3CCMV 4MVMA 2Q7HA 2PI4A 3E8HA 4J42A 3FKSG 3RWRD 5ITZA 3RVZA 1TVKA 3SPIA 2ETNA 3HKCB 3K06A 4PDRA 4LF7B 4X1YA 2IJJA 4N23A 4OXSA 1DGSA 4DV4O 2OCCC 5CA0A 1VQ7V 4U7NA 1I5XA 4CC6A 5KHHA 3RVYA 3AK2A 3K08A 1AJPA 2IJKA 3N2KB 2RN9A 4B7KA 1GM8A 2HLDG 3QNEA 4O4LB 2GUZB 4YJ3A 2DWEC 3CJHB 3U10A 4W4LA 5DM6V 3BEHA 3ZRSA 2RQ6A 4JI4O 1NQTA 4D6TH 2E5LB 3QO8A 4B3TO 2DMXA 2Y4UA 4U3JB 3H1KH 2CE4A 4I9WA 5IDJA 1RSOB 4ZOLB 3ETEA 4X64O 3OTOO 3KKYA 4FLXA 3H1LH 4JI2B 3ABLB 1VQNV 2CAZC 1YXBA 5J9PC 1MSWD 4EEQA 1QQCA 2UUAO 3BA8A 4QJFB 1N0JA 2EIKC 1W0JG 5IY5B 4MTFA 5A2QN 2XASA 4UVAA 4DR2B 3ZHRA 3F5TA 2FKXA 2EINC 1IBKO 2V4DA 3JD2A 2ZNIA 1YSCA 4X89A 2LW1A 1HWYA 1K73W 2Q0OC 1Y76A 4IYIA 4R7CA 4NB5A 3P3NA 4G28B 1W59A 5E1AC 3UO2A 1HR0O 5JCOC 2B1GA 3SDLA 4DR3O 4RQEA 5IJ0A 1E79G 4KL1A 4HYOA 2EZPA 5KUMA 2Y69C 1U97A 1WP8A 3FD9A 3CS5A 3U11A 3OFNG 1VF5B 2XHBA 2Q0AA 3R66A 2A9HA 1P7BA 1AI7A 1QU7A 5KX5A 4O2AB 1KECA 1KBHA 5B66Z 2JS5A 2QKAA 4DUYO 4MTXA 2UXDO 2OCCB 4FLUA 4FM1A 2P6JA 3E86A 4NKGB 2UXCO 5LGNA 1BSMA 4G2KA 1HDJA 4E4EA 3ASOC 3T1HB 1U96A 5LYJB 2Q7GA 3TK1A 3HKBB 3ZHTA 5JQGB 1B04A 2EX3A 3FB6C 3VBBA 1MZFA 3FB8C 4KXRA 1QLNA 1AR4A 1AP6A 4LFAB 1F4MA 3CMAV 5BXZA 2MK3A 3HB3B 2N74A 3OR6C 2NN4A 1EN6A 1GN6A 1GN4A 3RYIA 3ZRXA 3ZN0A 2CK3G 3SJBC 2BE3A 1Q6HA 3QO5A 1L0NH 1YIJV 3SYCA 2ZE7A 5CA1A 2R9RB 5IYDO 3STZC 3FB5C 5K1XA 3CEIA 2BSKA 3BPZA 1PNKA 4FPPA 3VQYA 3K59A 3NXSA 3L72H 5LMNB 4I55A 5B1OA 4NTXA 3L71H 1SKVA 2Y0IA 3JARA 2CH7B 1MA1A 1G1XB 1Q86W 3K9SA 3E22B 5KA5A 5EBMC 4PHZA 1VQMV 1IVSA 2EBOA 3L74H 5LOVA 4YIPA 4CH3A 1NH2D 1M90W 4X66B 1ZLZA 3HKCA 4LNUB 1L0LH 4TV9A 3L70H 1CP9A 4JYCA 1KB9F 4DR5O 2XTAA 2ADPA 4X62B 5FNVB 1X59A 4IGGA 5B1BC 1R1BA 2EJ7A 2RDCA 4DRXB 1UJWB 1AI6A 2UXNA 4AHCA 1Q6IA 1R3IC 1IXMA 1QR9A 3ASOB 4O4LA 2AXTZ 1NTKH 2GUZA 4LP8A 3CJHA 5FL7G 1OV9A 1G6UA 3SPGA 3CCUV 3W7UA 5LHIA 1JFFB 4LF5O 4JV5B 1TUEB 5H6QA 3AG3C 3ZHQA 4KUMA 2PZSA 4GX1A 4H33A 3LSUA 2XT9A 1V55C 1RSOA 4ZOLA 2QWPB 2EIMC 2AHZA 5FLXN 3UT5B 2GTAA 4X88A 1NH2B 4DK1A 1R3JC 3G4SV 1WPBA 2WLIB 1L8DA 2GDSA 3T1HO 1BMFG 1SZTA 3CCRV 1BGYH 3JSLA 5AG2A 4XDKA 5EC2C 1O9HA 2WWWA 3JD4A 3SGIA 4YIOA 3ICXA 1EZVH 1TVKB 1OCZC 5CBGA 1Y74B 2BCCH 4JI6B 5LBQA 3ZS8C 4X1YB 1K97A 1KQSU 3RYCA 4U7OA 4FLZA 2H8PC 3X2QC 1LUVA 1R6NA 5CMUA 3JD3A 1TUBA 1SQPH 4BW5A 4ABMA 4YXWG 1OCRC 1YHQV 5J2TA 3DXRA 4UXNA 4O2AA 4R6ZA 4DYLA 4JAAA 4J7ZA 4WFFA 3ETGA 3CXCU 1GTOA 1N34O 2DN9A 3BA9A 1VIBA 3AG4B 2EIJB 4Z2WA 3VQVA 2OIGA 1JA8A 1F7YA 2B1IA 1AR5A 3OGIB 5BMVA 2A7WA 4JI0B 1XILA 2EULA 4TOIA 5J2UA 1FJGO 2VWJA 1V54C 3HKBA 1TGOA 1VF6A 5JQGA 4NYKA 2ZE6A 1N32B 1H38A 1VEWA 3G67A 1VQLV 5EBLC 4UCRA 1UPGA 3K03A 1HNZB 1QVFU 1K8AW 4X66O 4K0KB 3OMNB 4DV4B 2ZD9A 4DR3B 2P06A 4UCOA 2BTQA 2ARHA 3WB0A 5H2FZ 5JVDB 2JVDA 4F4LA 5L3GA 2PYJA 2ZDIA 1Y76B 1IXBA 4LF9O 2N04A 5CB4A 1CEZA 3IJ4A 1DLBA 1WP7A 4MT8A 4O4JB 4EB6A 1B6QA 3J81N 2DYSC 4JI4B 4TQFA 2OIEA 3W7TA 3JASB 4B3TB 3SJCC 4JV5O 2GHYA 2WLMA 3DC6A 2ZT9B 3AEIA 2A06H 2PYLA 3IFXA 1MNGA 3K0GA 1FD9A 1CPYA 3PN1A 4X64B 3CHXA 2YI9A 3OTOB 1OCCB 3K58A 2KB1A 4TT3G 2CUGA 3ZCCA 2WLHA 4F6EA 5L3FA 1ZL8A 4A5UB 2UUAB 4UUJC 4YY3B 4F6RB 1M56C 5L3DA 2HVJC 4JTAB 4J80A 4DR6B 1IBKB 3CRRA 1M57B 1FAFA 4CH5A 2N05A 1KKCA 3CCLV 4X8AA 4DRXA 1NTMH 3ABMC 4KP4A 4UVCA 1QNMA 4JI6O 2AZ2A 2JEXA 1FFTB 2DYRB 4MTOA 3HKDA 3H1JH 2QDOA 5EZYB 2OYQA 3EHBB 2QTOA 3M99B 4D7TA 3CCJV 3RYIB 5K1PA 2WSSG 1RM1C 2F4VB 2JGDB 1XBLA 1GO3F 3AG1C 2ZE5A 3E83A 2ZINA 3CC7V 2ZKOA 3GB7C 4DUYB 2Q8VA 2R9IA 3ABKC 3ETDA 1Z5VA 3ZEDA 3AG2C 3W7XA 4DV1O 3UT5A 1S5LZ 1THZA 1L1FA 1Q81W 4JTCB 1XNQO 1FXKB 5GTIZ 2BSKB 4QIWF 5IYCO 3ZMZA 1ZTEA 4JAUA 4CS2A 4I55B 2E75B 2WLIA 4PDVA 2YDEA 3D36C 3HPLC 1MG1A 2HJDA 3JARB 2HHHO 3R65A 3EVKA 5B3SB 3UCSC 4UCVA 1S5JA 2LFRA 2X7RB 5IWAO 2NNUA 2HG5C 1AILA 5LOVB 1N32O 5IT9N 1Y74A 3SYAA 3O9OA 1LNQA 2FL4A 1HNZO 4TV9B 1J5EO 4I4TB 4K0KO 1GH6A 2UXXA 2LQTA 1JR9A 1KD1W 3M7MX 4FJCC 1B3QA 3AK3A 2Q7EA 3ZMSA 2JJ1G 5TISZ 3E2EA 1DF5A 2F66C 2QWRB 2DQ3A 4MVZA 2ZXWB 1AR1B 5LP6B 3W7SA 3ZN1A 4GUNA 1NT2B 3E8FA 4E2LA 3OAAG 1YVWA 1D2DA 4DW0A 2Y48A 2CTPA 4JZGA 5C8YA 2M7WA 2EZOA 2ITCC 1K5QA 5HFLA 1WB8A 4CS3A 5H9CA 3GWKC 3ZHSA 1SRYA 2W0FC 1YF2A 1XREA 4FM0A 1KP2A 1JJOA 2QKCA 1H2KA 4I9QA 1COWG 1I5YA 1XL4A 3H1HH 1RM1B 3SYPA 3OTFA 4YY3O 3MDSA 3S3XA 3CB2A 1AJNA 2YC0A 1J95A 1MSDA 2HVKC 4DR6O 4DR5B 2YIBD 4MVUA 1Z2GA 1SQQH 1MMMA 1K33A 1OCOB 4K8XA 2Q6AA 5LXTA 5JVDA 2WAMA 5EC1C 3SJAC 4XDLA 2YUAA 1D5AA 3O65A 2DW4A 4BW9A 3RYCB 4J7JA 4K35A 4O4JA 4R50A 4LF5B 2JRIA 4AQYO 3ASNB 2ZQMA 5B1AB 1TUBB 3JASA 4X1KB 2W6IG 1Q43A 2D2CB 4RO2A 3WFVA 3OE7G 3JSNA 4D7SA 4HZ3A 4I50B 5J2TB 4WFAV 3DXRB 2RCVA 2F4VO 2ADQB 2EILC 3S3WA 2NLJC 4DR1B 5BR8B 3JATB 1ZWIC 4IHJA 3LSQA 1SERA 4IT5A 1P7GA 1YEWA 2AHYA 2XAHA 3RYFB 3TJTA 1I94O 2JEUA 5BMVB 1XMOB 1EZJA 4Z1MG 4F6RA 1XHZA 3FFQA 5FPOA 3M8AA 5J2UB 1K4CC 4PV1B 2YS8A 3DGEA 1FXHA 2Q4PA 2WLLB 3CRAA 3T4DA 4DV3B 1UFIA 1XOUA 4DV5B 1WAZA 3BAAA 5D5PA 4JI3O 5BY1A 4JYAO 1SA0B 3FB7C 1ZAUA 2KKWA 3JYCA 5D5QA 3QG5A 4O4HA 2AZ0A 2QM4A 1Q90D 1DF4A 4LF4O 5IYBO 2HP8A 2BTQB 1Q7YW 2P90A 5EZYA 1N36B 2UU9O 4DV7B 2HKOA 4GX0A 2R9AA 4TV8B 1WLEA 5CB4B 1KUQA 2ODMA 3LDCA 3MHHC 3CPWU 2V7QG 1M93A 2JGDA 3CC4V 4JPRA 2EIKB 4EB6B 2G38A 3F7YC 4WFBV 2KG7A 1BQ0A 4TUYB 2YIDA 3CMEV 3OW2U 4CS4A 1Y67A 3TETA 2EINB 2ZNJA 1N34B 3B77A 1BCCH 4FZ0A 3E89A 4MVOA 2ILMA 2QM8A 3B4SA 1F23A 3B09A 4O4IA 1FXKA 4JF3A 4ZHQB 3A0RA 1QR8A 4WF9V 3UM7A 1N33B 4OPHA 3D3QA 1FJGB 3IAYA 1GM9A 1CXZB 2Y69B 3JCUZ 3CYOA 3CXHF 1ZL8B 1R6KA 4YJ2B 1S3JA 2Y4TA 4GT1A 3L9DA 4JAVA 2E3CA 2EILB 1VQPV 2R72A 2F93B 1XMQO 4I4TA 2LFSA 3FX7A 1XQ8A 4LF9B 1GK9A 1TA8A 2WLJA 1YTFD 3RN4A 3K5OA 1K3EA 1H2SB 5LP6A 3T1YO 3HKDB 1US6A 4B08A 4PA9A 4P30A 1JX9A 1IDSA 4J11A 2PTMA 5KHIA 4P9OA 1WA8B 4DR1O 2Q5ZA 2VRZA 3OMAB 5BR8O 4NXNO 2WPDG 1NZ6A 1PL4A 4FFKA 2X0LA 2IU3A 2YXLA 5EIBC 2L35A 4I0XA 5KAIZ 1XMOO 2VQEO 2XAQA 2OTJV 2QGNA 1YTFB 1AJQA 5JH7B 2W0XA 4UCSA 5CN0A 4DV3O 5F2VO 4DV5O 1NTZH 2P67A 4DR4B 5EYPA 3QO7A 2QEXV 3CRMA 1XEQA 1YCIA 4FLYA 3OEEG 4X9QA 4GKKO 1SQFA 3WB1A 2CGNA 3D36A 2Z5UA 1B06A 5KHKA 4BIOA 4UVBA 1RPOA 4FK5C 1N36O 3GWOA 4DV7O 3F7VC 4X1KA 1Q5OA 4BIUA 4JI8B 1H2LA 2LW7A 1YITV 1PNLA 2LGQA 3P3PA 4I50A 1VQ5V 2W6JG 5EIBD 1PKXA 5IYZB 3JATA 4DV1B 4PDMA 2QR4A 3ZHUA 2A3QA 1XNQB 2QWNB 3CP1A 2DQ0A 4BWAA 5C8YB 5LGTA 3OM3B 4WFEA 5B1BB 4JI1B 1FFXA 5B1NA 3RYFA 3ZMUA 5GTHZ 3SPCA 1GRJA 1ZUQA 1R3KC 2YSUB 2YIBA 1NVPD 4CH4A 1QLEC 1N33O 4LWSB 2WLKA 5LMUB 3ABTA 2HHHB 2YEVB 2WLLA 5IWAB 4PA6A 3UO3A 1KKDA 4LF8O 5L3CA 3AG3B 1KC8W 4X20B 2K9PA 1SA0A 1BT8A 3K57A 3CRCA 3JD1A 3C3SA 1V55B 1FPOA 4JYYA 1D5NA 5DEDA 1YJWV 1J5EB 3WG7C 1WJZA 2EIMB 2KQXA 1HNWO 5LXTB 4XBFA 1HNXO 1H2NA 4TV8A 2H3OA 2VQFB 1H8HG 4LF6O 1HW7A 2WA3A 2IJHA 2LGWA 4IIJB 2JK5C 1EFRG 2E74B 5EK0A 4TUYA 1I7FA 1MZEA 4LFBB 4QE7A 1XL6A 1NBMG 2QWOB 1NVPB 4PD4F 3P30A 1PP9H 1VF7A 3K5NA 4EFBA 3LDEA 1OCZB 4ZHQA 2ATKC 1JQ0A 4FFBB 5JCOA 4LH7A 2ITDC 4IHJB 3UQ8A 4DUZB 3X2QB 2IJIA 2IH3C 4AILC 1N0NA 4XDJA 4JTDB 1P4RA 4CBCA 4YJ2A 4OPAA 2HJFC 4JZ2A 3RT3C 3D8CA 1OCRB 4UCTA 3DSQA 1JPXA 3L75H 3A0BZ 2Q68A 1ROPA 2DE0X 3E8BA 2IBZH 2RNBA 4Q20A 2A79B 1PNMA 4HBNA 4KFMA 4RQFA 3K0DA 4DR4O 4O4HB 4B3SO 3ZMTA 3DC5A 2QWQB 3WU2Z 3RBZA 3THOA 3SR2C 3SJQC 1YJ9V 2FYUH 4AQYB 4K3AA 1V54B 5KHGA 1SETA 3G80A 4Z1VA 2P5OA 2P7TC 4CZZA 2OT5A 2UUCO 4JI8O 2ZR2A 3JAKB 3HKEB 5HFMA 4UV9A 4ASUG 2KG7B 1IURA 4MVSA 1VQKV 1WA8A 2AW9A 2P4VA 1RP3B 1I94B 1WPXA 1EN4A 1SESA 4O4IB 3U0ZA 3LNMB 4JI5O 2GV9A 2P4KA 3N2GA 4LR3A 4JI1O 1R73A 2XAFA 3ML0A 5LA6A 5IY5C 3WB2A 3FYEB 1SQVH 3TXSA 4DR7O 5LHGA 4J9ZB 5LMUO 4HNAA 4MVQA 2DYSB 5JJJB 4QPJA 1K34A 3MAQA 4J41A 5JH7A 1NS1A 4JI3B 4H44B 4JYAB 4NVPA 1P49A 5IJ9A 3MHSC 2DOSA 3RYHB 4FZ1A 2AGAA 5KA6A 1X4TA 1ENVA 4LF4B 1W0KG 4TWKA 4DV0O 4W4KA 2L6LA 3JAWA 1KYOF 1AB3A 3BCCH 2UU9B 1QHTA 5LL6Y 3A8TA 4FLVA 3A0HZ 2Z3YA 3SYQA 1VQ9V 4UV8A 4NXMO 4I5SA 5GW7A 3UKMA 4BAYA 5KUKA 1TAEA 2VQFO 5GONA 1M56B 4GZRB 3JALB 3CWBH 3QF7A 1GN2A 4H0LB 1BL8A 4B3MB 3QVNA 5IYZA 3P32A 1NJIW 1VQ6V 4LFBO 4ZKIA 2CTQA 1KMIZ 2YIAA 4MS2A 1PM9A 2ZM6B 3ABMB 1IBLO 1OZ0A 1Q6UA 1BS3A 5L3EA 1HP8A 1PV0A 3B8NA 4OGQB 4LWSA 4JGSA 2IM9A 2GSMB 1VF6C 4DUZO 4UFZA 3J80N 2YEVA 5KMGB 2V1DA 4WFHA 3I55V 4I0XB 5CBFA 4KHPO 4X20A 3AG1B 1WNSA 3T2MA 1XMQB 1XI1A 4GKJO 3B8MA 3JAMN 3ABKB 3RW0A 4UB8Z 2BOCC 2ZIMA 4BR6A 1AVMA 1IBMO 2XAGA 3AG2B 4JYBA 3RFRA 2ZR3A 1Z5WA 2ZDIC 2P22C 4QNHB 1JJ2U 1A32A 1ZSPA 5EYPB 4PA3A 1VARA 4DV6B 4GLXA 4PDLA 2ZIOA 3T1YB 2X6BA 4IIJA 1M9NA 4JASA 3JCZA 3ZHVA 5LHHA 1G4YB 2CTWA 4TSFG 1YI2V 1O9GA 4MSWC 2WLNA 3OT7A 4IYHA 4PELA 2Q9LA 3FAVA 3CCSV 1Y4MA 4EFEA 1SC5B 2CGOA 4LCUC 2JIZG 4FFBA 1SF9A 3HR0A 3QTCA 4NXNB 4MW8A 3OGCC 5JWPA 5KAFZ 2Q67A 3CRQA 2NR5A 3TCUA 1FFXB 2Z0AA 3NR7A 3TGUH 2Q69A 3IC7A 3VOUA 1EM1A 3CCEV 1Y66A 1LR1A 4UB6Z 2VQEB 1WN7A 2GBOA 3GVMA 1H2MA 3G71V 1LUWA 1DK1A 2QJ1A 3BHPA 1NKDA 3RGBA 4O2BA 4ZBMA 1K4DC 4EKWA 3I56V 3AK1A 3Q4HB 2C2AA 2JJ2G 1GMGA 1IZ3A 1T5EA 4N21A 1BHAA 4ZI7A 3G6EV 3E35A 3K5MA 2UXBO 4MVRA 3ZRWA 1H8EG 2XUMA 4RUEA 2O57A 2DJVA 2LO1A 3AG7A 1R3LC 3BVOA 4GKKB 4QPKA 1JCHA 4C7UA 5DN6G 1GAXA 2PUSA 4OX9O 1QVGU 4DV2O 2F95B 4QE9A 2XAJA 3VQXA 1GM7A 3A2FA 2H94A 4UCUA 5B5EZ 3ETQA 1YDXA 3JAKA 1R6TA 4WCEV 3HKEA 2X6AA 2K1EA 4LF7O 4HAMA 5FPRA 1SZXA 4GYCB 2B9ZA 4B3MO 2M6YA 3LNNA 2RMKB 2FTKA 4X1IB 1VMGA 3CD6V 1AP5A 4U3FH 4LFCB 2ZM6O 3BY6A 5JJEB 1PD3A 2GTSA 2OCHA 1N4CA 3OUSA 4X65B 1Q8IA 4PA4A 4LF8B 3D3IA 4Q6GA 2E5LO 1BQZA 3OMIB 3K3WA 2VS0A 3L73H 1I08A 3RYHA 4H37A 1XDCA 2QTSA 1HNWB 1JVMA 4JI2O 3C90A 5H6RA 1HNXB 1NU1H 4TQDA 4P2ZA 4CC5A 4JI7B 1KP3A 3CC2V 4LF6B 3KG2A 4DV6O 3JALA 3K79A 4DR2O 2IW5A 4NTYA 4IL6Z 1PPJH 3AG4C 1PL0A 4J9YB 1EN5A 2EIJC 4FIPC 2BTOA 3ZJZA 2UUBB 2LP7A 2QE7G 4I7ZB 3N2KA 3PJSK 4LBEC 2MW2B 3CE2A 3K5LA 4CH6A 2QSAA 5KLVH 5CBHA 3LDDA 3ABUA 2CDYA 5IE9A 3OEHG 5KMGA 3J7AU 3N2GB 4U3JA 3H1IH 3JD0A 3KCXA 1E1RG 2JGUA 5LA6B 1VQ4V 2BOBC 3I5DA 4ICGA 4WBNB 4HNAB 3OR7C 2XNDG 1AI4A 2IU0A 1NI8A 4B3RB 3IC9A 5CA3A 4RUFA 4PJ0Z 2F1MA 5IJ9B 4B3SB 2FMLA 3APQA 2RJZA 1GKFA 3JAWB 3T1CA 4AI8A 5BZBA 1G8MA 4L8JA 2YXHA 1BE3H 4DO2A 2PI5A 3SPJA 5KHJA 1JOYA 4L87A 5ITZB 2UUCB 1FYJA 3N27A 5GONB 4LC1A 1OCCC 3F5WC 4LFAO 2B5UA 2JDIG 3BRCA 5CA0B 4BIZA 4FVMA 1K7DA 4RWUA 1K9MW 2YI8A 4NTWA 3LUTB 4JI5B 3CCQV 3E8GA 2F23A 2FB5A 3B2EE 3STLC 3OUFA 4YJ3B 3EFFK 4FLTA 1H2GA 4LFCO 3ZX6A 1WB7A 1P84F 4DR7B 2ZE8A 3BABA 3MD0A 1M57C 3SYOA 4X65O 2HEPA 4J10A 1XHXA 2CTRA 1Q82W 3Q4HA 1IX9A 3SPHA 2Y0PA 4B7EA 1XNRB 3ZBHA 1F51A 4DV0B 3KZIZ 3VQWA 2DYRC 4GX5A 4YHHB 5LMNO 2JS3A 2KSDA 5LYJA 3DTUB 3G6BA 2F43G 1NR7A 1SQBH 1ZX3A 1S0VA 4NXMB 4ZIBA 4JI7O 1Y6XA 2EJRA 1V9PA 1E1QG 1AI5A 4DW1A 1Q3EA 4NR1A 4PI2A 1N8RW 4X62O 1FXKC 3FAVB 4DXWA 1YJNV 4X1IA 2R70A 1IBLB 4P9PA 2UUBO 2YICA 2PY5A 3BFRA 1I0HA 5IJ0B 2ZCEA 3CX5F 2OWOA 2QKSA 1FS0G 5B3SC 4FLWA 1KU9A 2QM7A 1QBZA 1MABG 5DECA 2PGGA 4KHPB 2Q73A 1RFYA 1DTOA 1VQOV 4LH6A 2YXYA 5KX5B 4H13B 2HR3A 1OHHG 4GKJB 1VP7A 3H01A 3W7WA 5H5NA 1BZKA 4FM2A 4WFGA 2VWKA 1FKAO 4PA7A 1IBMB 4O2BB 1OJHA 3LSSA 1W2BU 3FYIB 4B3RO 2CH7A 3E22A 5EBWC 1S72V 2OTLV 3TXQA 4ZI7B 1ORQC 5LGUA 3ZRWB 2ZXWC 3KCYA 4J7KA 5LP6C 5L3BA 1URFA 4GX2A 5A9GA 3EXAA 1FXVA 4LNUA 1M1KW 1S77D 1QLEB 1AROP 1QCEA 3T4ZA 5FNVA 2PF4E 1M4UA 3H9VA 3CCVV 1HR0B 1SS3A
chains in the Genus database with same CATH topology
5LMUO 4GKKO 1N34O 1NS1A 4JI7O 1N36O 4X64O 1F7YA 4DV7O 3OTOO 2ZM6O 2DOSA 1XMQO 1I94O 4LF5O 2LW7A 2AGAA 4DV0O 1FJGO 1AB3A 5BXZA 1D2DA 5LL6Y 3M8AA 4JI6O 4X62O 4OPAA 2E5LO 2UUAO 3RT3C 2N74A 2UUBO 4NXMO 5A2QN 5FLXN 3T1YO 3F5TA 2FKXA 4JI3O 5BY1A 2VQFO 1IBKO 4JYAO 4X66O 2Z0AA 1FYJA 1XNRO 4JI0O 4JI2O 1N33O 4DR4O 4YHHO 4LFAO 4LF4O 2ZKOA 4B3SO 1HR0O 3T1HO 4LFBO 2UU9O 3SDLA 1DK1A 1YZBA 4LF9O 4LF8O 4DR3O 4YY3O 4DV1O 5H5NA 1IBLO 4DR1O 4DV6O 5BR8O 1FKAO 1KUQA 4NXNO 1XNQO 4DR6O 4DR2O 3J81N 4B3RO 4LFCO 2UXBO 2UUCO 4DUZO 3R66A 3J80N 4DV4O 2DJVA 4JI8O 1HNWO 4JV5O 1G1XB 4X65O 1XMOO 1HNXO 2HHHO 4OX9O 3O65A 2VQEO 4DUYO 4KHPO 4DV2O 2UXDO 5IWAO 4LF6O 1AILA 4GKJO 3JAMN 4DV3O 2UXCO 4JI5O 2JRIA 4AQYO 1N32O 4DV5O 5IT9N 4OPHA 4JI1O 1IBMO 5LMNO 1HNZO 1J5EO 4DR5O 3J7AU 1R6TA 1XEQA 4JI4O 4K0KO 4LF7O 4A5UB 1A32A 1X59A 4DR7O 4B3TO 1R1BA 2F4VO 4B3MO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU O;  4GKK O;  1N34 O;  1NS1 A;  4JI7 O;  1N36 O;  4X64 O;  1F7Y A;  4DV7 O;  3OTO O;  2ZM6 O;  2DOS A;  1XMQ O;  1I94 O;  4LF5 O;  2LW7 A;  2AGA A;  4DV0 O;  1FJG O;  1AB3 A;  5BXZ A;  1D2D A;  5LL6 Y;  3M8A A;  4JI6 O;  4X62 O;  4OPA A;  2E5L O;  2UUA O;  3RT3 C;  2N74 A;  2UUB O;  4NXM O;  5A2Q N;  5FLX N;  3T1Y O;  3F5T A;  2FKX A;  4JI3 O;  5BY1 A;  2VQF O;  1IBK O;  4JYA O;  4X66 O;  2Z0A A;  1FYJ A;  1XNR O;  4JI0 O;  4JI2 O;  1N33 O;  4DR4 O;  4YHH O;  4LFA O;  4LF4 O;  2ZKO A;  4B3S O;  1HR0 O;  3T1H O;  4LFB O;  2UU9 O;  3SDL A;  1DK1 A;  1YZB A;  4LF9 O;  4LF8 O;  4DR3 O;  4YY3 O;  4DV1 O;  5H5N A;  1IBL O;  4DR1 O;  4DV6 O;  5BR8 O;  1FKA O;  1KUQ A;  4NXN O;  1XNQ O;  4DR6 O;  4DR2 O;  3J81 N;  4B3R O;  4LFC O;  2UXB O;  2UUC O;  4DUZ O;  3R66 A;  3J80 N;  4DV4 O;  2DJV A;  4JI8 O;  1HNW O;  4JV5 O;  1G1X B;  4X65 O;  1XMO O;  1HNX O;  2HHH O;  4OX9 O;  3O65 A;  2VQE O;  4DUY O;  4KHP O;  4DV2 O;  2UXD O;  5IWA O;  4LF6 O;  1AIL A;  4GKJ O;  3JAM N;  4DV3 O;  2UXC O;  4JI5 O;  2JRI A;  4AQY O;  1N32 O;  4DV5 O;  5IT9 N;  4OPH A;  4JI1 O;  1IBM O;  5LMN O;  1HNZ O;  1J5E O;  4DR5 O;  3J7A U;  1R6T A;  1XEQ A;  4JI4 O;  4K0K O;  4LF7 O;  4A5U B;  1A32 A;  1X59 A;  4DR7 O;  4B3T O;  1R1B A;  2F4V O;  4B3M O; 
#chains in the Genus database with same CATH topology
 2HFE C;  3WG7 B;  4QGP A;  1K92 A;  5JJN B;  1M5I A;  1MOF A;  4K8Z A;  3ABL C;  2X6C A;  4PI0 A;  2A0L A;  3B40 A;  5C93 A;  1JFF A;  1S76 D;  1JMK C;  4GCZ A;  1BHB A;  5E79 Z;  3ZRV A;  2D3O W;  1F4N A;  3ZMV A;  4DK0 A;  3APO A;  3C3T A;  1SQG A;  2E76 B;  2XOK G;  2UXD B;  1RPR A;  3K9A A;  3K04 A;  4WBN A;  1K5S A;  2DWD C;  2IH1 C;  4R8C A;  1OCO C;  2LJ2 A;  1GN3 A;  2UXC B;  5CA1 B;  3ZIA G;  4MTG A;  1XUQ A;  4G27 B;  1EBO A;  2UXB B;  1S5H C;  1VQ8 V;  3IGA C;  4MW3 A;  1XNR O;  3OD4 A;  3CSX A;  4JI0 O;  2QA4 V;  1NR1 A;  1SQX H;  2WA4 A;  4YHH O;  4OX9 B;  4DV2 B;  4RAI A;  3ASN C;  5B1A C;  1YZB A;  4FMT A;  3CCM V;  4MVM A;  2Q7H A;  2PI4 A;  3E8H A;  4J42 A;  3FKS G;  3RWR D;  5ITZ A;  3RVZ A;  1TVK A;  3SPI A;  2ETN A;  3HKC B;  3K06 A;  4PDR A;  4LF7 B;  4X1Y A;  2IJJ A;  4N23 A;  4OXS A;  1DGS A;  4DV4 O;  2OCC C;  5CA0 A;  1VQ7 V;  4U7N A;  1I5X A;  4CC6 A;  5KHH A;  3RVY A;  3AK2 A;  3K08 A;  1AJP A;  2IJK A;  3N2K B;  2RN9 A;  4B7K A;  1GM8 A;  2HLD G;  3QNE A;  4O4L B;  2GUZ B;  4YJ3 A;  2DWE C;  3CJH B;  3U10 A;  4W4L A;  5DM6 V;  3BEH A;  3ZRS A;  2RQ6 A;  4JI4 O;  1NQT A;  4D6T H;  2E5L B;  3QO8 A;  4B3T O;  2DMX A;  2Y4U A;  4U3J B;  3H1K H;  2CE4 A;  4I9W A;  5IDJ A;  1RSO B;  4ZOL B;  3ETE A;  4X64 O;  3OTO O;  3KKY A;  4FLX A;  3H1L H;  4JI2 B;  3ABL B;  1VQN V;  2CAZ C;  1YXB A;  5J9P C;  1MSW D;  4EEQ A;  1QQC A;  2UUA O;  3BA8 A;  4QJF B;  1N0J A;  2EIK C;  1W0J G;  5IY5 B;  4MTF A;  5A2Q N;  2XAS A;  4UVA A;  4DR2 B;  3ZHR A;  3F5T A;  2FKX A;  2EIN C;  1IBK O;  2V4D A;  3JD2 A;  2ZNI A;  1YSC A;  4X89 A;  2LW1 A;  1HWY A;  1K73 W;  2Q0O C;  1Y76 A;  4IYI A;  4R7C A;  4NB5 A;  3P3N A;  4G28 B;  1W59 A;  5E1A C;  3UO2 A;  1HR0 O;  5JCO C;  2B1G A;  3SDL A;  4DR3 O;  4RQE A;  5IJ0 A;  1E79 G;  4KL1 A;  4HYO A;  2EZP A;  5KUM A;  2Y69 C;  1U97 A;  1WP8 A;  3FD9 A;  3CS5 A;  3U11 A;  3OFN G;  1VF5 B;  2XHB A;  2Q0A A;  3R66 A;  2A9H A;  1P7B A;  1AI7 A;  1QU7 A;  5KX5 A;  4O2A B;  1KEC A;  1KBH A;  5B66 Z;  2JS5 A;  2QKA A;  4DUY O;  4MTX A;  2UXD O;  2OCC B;  4FLU A;  4FM1 A;  2P6J A;  3E86 A;  4NKG B;  2UXC O;  5LGN A;  1BSM A;  4G2K A;  1HDJ A;  4E4E A;  3ASO C;  3T1H B;  1U96 A;  5LYJ B;  2Q7G A;  3TK1 A;  3HKB B;  3ZHT A;  5JQG B;  1B04 A;  2EX3 A;  3FB6 C;  3VBB A;  1MZF A;  3FB8 C;  4KXR A;  1QLN A;  1AR4 A;  1AP6 A;  4LFA B;  1F4M A;  3CMA V;  5BXZ A;  2MK3 A;  3HB3 B;  2N74 A;  3OR6 C;  2NN4 A;  1EN6 A;  1GN6 A;  1GN4 A;  3RYI A;  3ZRX A;  3ZN0 A;  2CK3 G;  3SJB C;  2BE3 A;  1Q6H A;  3QO5 A;  1L0N H;  1YIJ V;  3SYC A;  2ZE7 A;  5CA1 A;  2R9R B;  5IYD O;  3STZ C;  3FB5 C;  5K1X A;  3CEI A;  2BSK A;  3BPZ A;  1PNK A;  4FPP A;  3VQY A;  3K59 A;  3NXS A;  3L72 H;  5LMN B;  4I55 A;  5B1O A;  4NTX A;  3L71 H;  1SKV A;  2Y0I A;  3JAR A;  2CH7 B;  1MA1 A;  1G1X B;  1Q86 W;  3K9S A;  3E22 B;  5KA5 A;  5EBM C;  4PHZ A;  1VQM V;  1IVS A;  2EBO A;  3L74 H;  5LOV A;  4YIP A;  4CH3 A;  1NH2 D;  1M90 W;  4X66 B;  1ZLZ A;  3HKC A;  4LNU B;  1L0L H;  4TV9 A;  3L70 H;  1CP9 A;  4JYC A;  1KB9 F;  4DR5 O;  2XTA A;  2ADP A;  4X62 B;  5FNV B;  1X59 A;  4IGG A;  5B1B C;  1R1B A;  2EJ7 A;  2RDC A;  4DRX B;  1UJW B;  1AI6 A;  2UXN A;  4AHC A;  1Q6I A;  1R3I C;  1IXM A;  1QR9 A;  3ASO B;  4O4L A;  2AXT Z;  1NTK H;  2GUZ A;  4LP8 A;  3CJH A;  5FL7 G;  1OV9 A;  1G6U A;  3SPG A;  3CCU V;  3W7U A;  5LHI A;  1JFF B;  4LF5 O;  4JV5 B;  1TUE B;  5H6Q A;  3AG3 C;  3ZHQ A;  4KUM A;  2PZS A;  4GX1 A;  4H33 A;  3LSU A;  2XT9 A;  1V55 C;  1RSO A;  4ZOL A;  2QWP B;  2EIM C;  2AHZ A;  5FLX N;  3UT5 B;  2GTA A;  4X88 A;  1NH2 B;  4DK1 A;  1R3J C;  3G4S V;  1WPB A;  2WLI B;  1L8D A;  2GDS A;  3T1H O;  1BMF G;  1SZT A;  3CCR V;  1BGY H;  3JSL A;  5AG2 A;  4XDK A;  5EC2 C;  1O9H A;  2WWW A;  3JD4 A;  3SGI A;  4YIO A;  3ICX A;  1EZV H;  1TVK B;  1OCZ C;  5CBG A;  1Y74 B;  2BCC H;  4JI6 B;  5LBQ A;  3ZS8 C;  4X1Y B;  1K97 A;  1KQS U;  3RYC A;  4U7O A;  4FLZ A;  2H8P C;  3X2Q C;  1LUV A;  1R6N A;  5CMU A;  3JD3 A;  1TUB A;  1SQP H;  4BW5 A;  4ABM A;  4YXW G;  1OCR C;  1YHQ V;  5J2T A;  3DXR A;  4UXN A;  4O2A A;  4R6Z A;  4DYL A;  4JAA A;  4J7Z A;  4WFF A;  3ETG A;  3CXC U;  1GTO A;  1N34 O;  2DN9 A;  3BA9 A;  1VIB A;  3AG4 B;  2EIJ B;  4Z2W A;  3VQV A;  2OIG A;  1JA8 A;  1F7Y A;  2B1I A;  1AR5 A;  3OGI B;  5BMV A;  2A7W A;  4JI0 B;  1XIL A;  2EUL A;  4TOI A;  5J2U A;  1FJG O;  2VWJ A;  1V54 C;  3HKB A;  1TGO A;  1VF6 A;  5JQG A;  4NYK A;  2ZE6 A;  1N32 B;  1H38 A;  1VEW A;  3G67 A;  1VQL V;  5EBL C;  4UCR A;  1UPG A;  3K03 A;  1HNZ B;  1QVF U;  1K8A W;  4X66 O;  4K0K B;  3OMN B;  4DV4 B;  2ZD9 A;  4DR3 B;  2P06 A;  4UCO A;  2BTQ A;  2ARH A;  3WB0 A;  5H2F Z;  5JVD B;  2JVD A;  4F4L A;  5L3G A;  2PYJ A;  2ZDI A;  1Y76 B;  1IXB A;  4LF9 O;  2N04 A;  5CB4 A;  1CEZ A;  3IJ4 A;  1DLB A;  1WP7 A;  4MT8 A;  4O4J B;  4EB6 A;  1B6Q A;  3J81 N;  2DYS C;  4JI4 B;  4TQF A;  2OIE A;  3W7T A;  3JAS B;  4B3T B;  3SJC C;  4JV5 O;  2GHY A;  2WLM A;  3DC6 A;  2ZT9 B;  3AEI A;  2A06 H;  2PYL A;  3IFX A;  1MNG A;  3K0G A;  1FD9 A;  1CPY A;  3PN1 A;  4X64 B;  3CHX A;  2YI9 A;  3OTO B;  1OCC B;  3K58 A;  2KB1 A;  4TT3 G;  2CUG A;  3ZCC A;  2WLH A;  4F6E A;  5L3F A;  1ZL8 A;  4A5U B;  2UUA B;  4UUJ C;  4YY3 B;  4F6R B;  1M56 C;  5L3D A;  2HVJ C;  4JTA B;  4J80 A;  4DR6 B;  1IBK B;  3CRR A;  1M57 B;  1FAF A;  4CH5 A;  2N05 A;  1KKC A;  3CCL V;  4X8A A;  4DRX A;  1NTM H;  3ABM C;  4KP4 A;  4UVC A;  1QNM A;  4JI6 O;  2AZ2 A;  2JEX A;  1FFT B;  2DYR B;  4MTO A;  3HKD A;  3H1J H;  2QDO A;  5EZY B;  2OYQ A;  3EHB B;  2QTO A;  3M99 B;  4D7T A;  3CCJ V;  3RYI B;  5K1P A;  2WSS G;  1RM1 C;  2F4V B;  2JGD B;  1XBL A;  1GO3 F;  3AG1 C;  2ZE5 A;  3E83 A;  2ZIN A;  3CC7 V;  2ZKO A;  3GB7 C;  4DUY B;  2Q8V A;  2R9I A;  3ABK C;  3ETD A;  1Z5V A;  3ZED A;  3AG2 C;  3W7X A;  4DV1 O;  3UT5 A;  1S5L Z;  1THZ A;  1L1F A;  1Q81 W;  4JTC B;  1XNQ O;  1FXK B;  5GTI Z;  2BSK B;  4QIW F;  5IYC O;  3ZMZ A;  1ZTE A;  4JAU A;  4CS2 A;  4I55 B;  2E75 B;  2WLI A;  4PDV A;  2YDE A;  3D36 C;  3HPL C;  1MG1 A;  2HJD A;  3JAR B;  2HHH O;  3R65 A;  3EVK A;  5B3S B;  3UCS C;  4UCV A;  1S5J A;  2LFR A;  2X7R B;  5IWA O;  2NNU A;  2HG5 C;  1AIL A;  5LOV B;  1N32 O;  5IT9 N;  1Y74 A;  3SYA A;  3O9O A;  1LNQ A;  2FL4 A;  1HNZ O;  4TV9 B;  1J5E O;  4I4T B;  4K0K O;  1GH6 A;  2UXX A;  2LQT A;  1JR9 A;  1KD1 W;  3M7M X;  4FJC C;  1B3Q A;  3AK3 A;  2Q7E A;  3ZMS A;  2JJ1 G;  5TIS Z;  3E2E A;  1DF5 A;  2F66 C;  2QWR B;  2DQ3 A;  4MVZ A;  2ZXW B;  1AR1 B;  5LP6 B;  3W7S A;  3ZN1 A;  4GUN A;  1NT2 B;  3E8F A;  4E2L A;  3OAA G;  1YVW A;  1D2D A;  4DW0 A;  2Y48 A;  2CTP A;  4JZG A;  5C8Y A;  2M7W A;  2EZO A;  2ITC C;  1K5Q A;  5HFL A;  1WB8 A;  4CS3 A;  5H9C A;  3GWK C;  3ZHS A;  1SRY A;  2W0F C;  1YF2 A;  1XRE A;  4FM0 A;  1KP2 A;  1JJO A;  2QKC A;  1H2K A;  4I9Q A;  1COW G;  1I5Y A;  1XL4 A;  3H1H H;  1RM1 B;  3SYP A;  3OTF A;  4YY3 O;  3MDS A;  3S3X A;  3CB2 A;  1AJN A;  2YC0 A;  1J95 A;  1MSD A;  2HVK C;  4DR6 O;  4DR5 B;  2YIB D;  4MVU A;  1Z2G A;  1SQQ H;  1MMM A;  1K33 A;  1OCO B;  4K8X A;  2Q6A A;  5LXT A;  5JVD A;  2WAM A;  5EC1 C;  3SJA C;  4XDL A;  2YUA A;  1D5A A;  3O65 A;  2DW4 A;  4BW9 A;  3RYC B;  4J7J A;  4K35 A;  4O4J A;  4R50 A;  4LF5 B;  2JRI A;  4AQY O;  3ASN B;  2ZQM A;  5B1A B;  1TUB B;  3JAS A;  4X1K B;  2W6I G;  1Q43 A;  2D2C B;  4RO2 A;  3WFV A;  3OE7 G;  3JSN A;  4D7S A;  4HZ3 A;  4I50 B;  5J2T B;  4WFA V;  3DXR B;  2RCV A;  2F4V O;  2ADQ B;  2EIL C;  3S3W A;  2NLJ C;  4DR1 B;  5BR8 B;  3JAT B;  1ZWI C;  4IHJ A;  3LSQ A;  1SER A;  4IT5 A;  1P7G A;  1YEW A;  2AHY A;  2XAH A;  3RYF B;  3TJT A;  1I94 O;  2JEU A;  5BMV B;  1XMO B;  1EZJ A;  4Z1M G;  4F6R A;  1XHZ A;  3FFQ A;  5FPO A;  3M8A A;  5J2U B;  1K4C C;  4PV1 B;  2YS8 A;  3DGE A;  1FXH A;  2Q4P A;  2WLL B;  3CRA A;  3T4D A;  4DV3 B;  1UFI A;  1XOU A;  4DV5 B;  1WAZ A;  3BAA A;  5D5P A;  4JI3 O;  5BY1 A;  4JYA O;  1SA0 B;  3FB7 C;  1ZAU A;  2KKW A;  3JYC A;  5D5Q A;  3QG5 A;  4O4H A;  2AZ0 A;  2QM4 A;  1Q90 D;  1DF4 A;  4LF4 O;  5IYB O;  2HP8 A;  2BTQ B;  1Q7Y W;  2P90 A;  5EZY A;  1N36 B;  2UU9 O;  4DV7 B;  2HKO A;  4GX0 A;  2R9A A;  4TV8 B;  1WLE A;  5CB4 B;  1KUQ A;  2ODM A;  3LDC A;  3MHH C;  3CPW U;  2V7Q G;  1M93 A;  2JGD A;  3CC4 V;  4JPR A;  2EIK B;  4EB6 B;  2G38 A;  3F7Y C;  4WFB V;  2KG7 A;  1BQ0 A;  4TUY B;  2YID A;  3CME V;  3OW2 U;  4CS4 A;  1Y67 A;  3TET A;  2EIN B;  2ZNJ A;  1N34 B;  3B77 A;  1BCC H;  4FZ0 A;  3E89 A;  4MVO A;  2ILM A;  2QM8 A;  3B4S A;  1F23 A;  3B09 A;  4O4I A;  1FXK A;  4JF3 A;  4ZHQ B;  3A0R A;  1QR8 A;  4WF9 V;  3UM7 A;  1N33 B;  4OPH A;  3D3Q A;  1FJG B;  3IAY A;  1GM9 A;  1CXZ B;  2Y69 B;  3JCU Z;  3CYO A;  3CXH F;  1ZL8 B;  1R6K A;  4YJ2 B;  1S3J A;  2Y4T A;  4GT1 A;  3L9D A;  4JAV A;  2E3C A;  2EIL B;  1VQP V;  2R72 A;  2F93 B;  1XMQ O;  4I4T A;  2LFS A;  3FX7 A;  1XQ8 A;  4LF9 B;  1GK9 A;  1TA8 A;  2WLJ A;  1YTF D;  3RN4 A;  3K5O A;  1K3E A;  1H2S B;  5LP6 A;  3T1Y O;  3HKD B;  1US6 A;  4B08 A;  4PA9 A;  4P30 A;  1JX9 A;  1IDS A;  4J11 A;  2PTM A;  5KHI A;  4P9O A;  1WA8 B;  4DR1 O;  2Q5Z A;  2VRZ A;  3OMA B;  5BR8 O;  4NXN O;  2WPD G;  1NZ6 A;  1PL4 A;  4FFK A;  2X0L A;  2IU3 A;  2YXL A;  5EIB C;  2L35 A;  4I0X A;  5KAI Z;  1XMO O;  2VQE O;  2XAQ A;  2OTJ V;  2QGN A;  1YTF B;  1AJQ A;  5JH7 B;  2W0X A;  4UCS A;  5CN0 A;  4DV3 O;  5F2V O;  4DV5 O;  1NTZ H;  2P67 A;  4DR4 B;  5EYP A;  3QO7 A;  2QEX V;  3CRM A;  1XEQ A;  1YCI A;  4FLY A;  3OEE G;  4X9Q A;  4GKK O;  1SQF A;  3WB1 A;  2CGN A;  3D36 A;  2Z5U A;  1B06 A;  5KHK A;  4BIO A;  4UVB A;  1RPO A;  4FK5 C;  1N36 O;  3GWO A;  4DV7 O;  3F7V C;  4X1K A;  1Q5O A;  4BIU A;  4JI8 B;  1H2L A;  2LW7 A;  1YIT V;  1PNL A;  2LGQ A;  3P3P A;  4I50 A;  1VQ5 V;  2W6J G;  5EIB D;  1PKX A;  5IYZ B;  3JAT A;  4DV1 B;  4PDM A;  2QR4 A;  3ZHU A;  2A3Q A;  1XNQ B;  2QWN B;  3CP1 A;  2DQ0 A;  4BWA A;  5C8Y B;  5LGT A;  3OM3 B;  4WFE A;  5B1B B;  4JI1 B;  1FFX A;  5B1N A;  3RYF A;  3ZMU A;  5GTH Z;  3SPC A;  1GRJ A;  1ZUQ A;  1R3K C;  2YSU B;  2YIB A;  1NVP D;  4CH4 A;  1QLE C;  1N33 O;  4LWS B;  2WLK A;  5LMU B;  3ABT A;  2HHH B;  2YEV B;  2WLL A;  5IWA B;  4PA6 A;  3UO3 A;  1KKD A;  4LF8 O;  5L3C A;  3AG3 B;  1KC8 W;  4X20 B;  2K9P A;  1SA0 A;  1BT8 A;  3K57 A;  3CRC A;  3JD1 A;  3C3S A;  1V55 B;  1FPO A;  4JYY A;  1D5N A;  5DED A;  1YJW V;  1J5E B;  3WG7 C;  1WJZ A;  2EIM B;  2KQX A;  1HNW O;  5LXT B;  4XBF A;  1HNX O;  1H2N A;  4TV8 A;  2H3O A;  2VQF B;  1H8H G;  4LF6 O;  1HW7 A;  2WA3 A;  2IJH A;  2LGW A;  4IIJ B;  2JK5 C;  1EFR G;  2E74 B;  5EK0 A;  4TUY A;  1I7F A;  1MZE A;  4LFB B;  4QE7 A;  1XL6 A;  1NBM G;  2QWO B;  1NVP B;  4PD4 F;  3P30 A;  1PP9 H;  1VF7 A;  3K5N A;  4EFB A;  3LDE A;  1OCZ B;  4ZHQ A;  2ATK C;  1JQ0 A;  4FFB B;  5JCO A;  4LH7 A;  2ITD C;  4IHJ B;  3UQ8 A;  4DUZ B;  3X2Q B;  2IJI A;  2IH3 C;  4AIL C;  1N0N A;  4XDJ A;  4JTD B;  1P4R A;  4CBC A;  4YJ2 A;  4OPA A;  2HJF C;  4JZ2 A;  3RT3 C;  3D8C A;  1OCR B;  4UCT A;  3DSQ A;  1JPX A;  3L75 H;  3A0B Z;  2Q68 A;  1ROP A;  2DE0 X;  3E8B A;  2IBZ H;  2RNB A;  4Q20 A;  2A79 B;  1PNM A;  4HBN A;  4KFM A;  4RQF A;  3K0D A;  4DR4 O;  4O4H B;  4B3S O;  3ZMT A;  3DC5 A;  2QWQ B;  3WU2 Z;  3RBZ A;  3THO A;  3SR2 C;  3SJQ C;  1YJ9 V;  2FYU H;  4AQY B;  4K3A A;  1V54 B;  5KHG A;  1SET A;  3G80 A;  4Z1V A;  2P5O A;  2P7T C;  4CZZ A;  2OT5 A;  2UUC O;  4JI8 O;  2ZR2 A;  3JAK B;  3HKE B;  5HFM A;  4UV9 A;  4ASU G;  2KG7 B;  1IUR A;  4MVS A;  1VQK V;  1WA8 A;  2AW9 A;  2P4V A;  1RP3 B;  1I94 B;  1WPX A;  1EN4 A;  1SES A;  4O4I B;  3U0Z A;  3LNM B;  4JI5 O;  2GV9 A;  2P4K A;  3N2G A;  4LR3 A;  4JI1 O;  1R73 A;  2XAF A;  3ML0 A;  5LA6 A;  5IY5 C;  3WB2 A;  3FYE B;  1SQV H;  3TXS A;  4DR7 O;  5LHG A;  4J9Z B;  5LMU O;  4HNA A;  4MVQ A;  2DYS B;  5JJJ B;  4QPJ A;  1K34 A;  3MAQ A;  4J41 A;  5JH7 A;  1NS1 A;  4JI3 B;  4H44 B;  4JYA B;  4NVP A;  1P49 A;  5IJ9 A;  3MHS C;  2DOS A;  3RYH B;  4FZ1 A;  2AGA A;  5KA6 A;  1X4T A;  1ENV A;  4LF4 B;  1W0K G;  4TWK A;  4DV0 O;  4W4K A;  2L6L A;  3JAW A;  1KYO F;  1AB3 A;  3BCC H;  2UU9 B;  1QHT A;  5LL6 Y;  3A8T A;  4FLV A;  3A0H Z;  2Z3Y A;  3SYQ A;  1VQ9 V;  4UV8 A;  4NXM O;  4I5S A;  5GW7 A;  3UKM A;  4BAY A;  5KUK A;  1TAE A;  2VQF O;  5GON A;  1M56 B;  4GZR B;  3JAL B;  3CWB H;  3QF7 A;  1GN2 A;  4H0L B;  1BL8 A;  4B3M B;  3QVN A;  5IYZ A;  3P32 A;  1NJI W;  1VQ6 V;  4LFB O;  4ZKI A;  2CTQ A;  1KMI Z;  2YIA A;  4MS2 A;  1PM9 A;  2ZM6 B;  3ABM B;  1IBL O;  1OZ0 A;  1Q6U A;  1BS3 A;  5L3E A;  1HP8 A;  1PV0 A;  3B8N A;  4OGQ B;  4LWS A;  4JGS A;  2IM9 A;  2GSM B;  1VF6 C;  4DUZ O;  4UFZ A;  3J80 N;  2YEV A;  5KMG B;  2V1D A;  4WFH A;  3I55 V;  4I0X B;  5CBF A;  4KHP O;  4X20 A;  3AG1 B;  1WNS A;  3T2M A;  1XMQ B;  1XI1 A;  4GKJ O;  3B8M A;  3JAM N;  3ABK B;  3RW0 A;  4UB8 Z;  2BOC C;  2ZIM A;  4BR6 A;  1AVM A;  1IBM O;  2XAG A;  3AG2 B;  4JYB A;  3RFR A;  2ZR3 A;  1Z5W A;  2ZDI C;  2P22 C;  4QNH B;  1JJ2 U;  1A32 A;  1ZSP A;  5EYP B;  4PA3 A;  1VAR A;  4DV6 B;  4GLX A;  4PDL A;  2ZIO A;  3T1Y B;  2X6B A;  4IIJ A;  1M9N A;  4JAS A;  3JCZ A;  3ZHV A;  5LHH A;  1G4Y B;  2CTW A;  4TSF G;  1YI2 V;  1O9G A;  4MSW C;  2WLN A;  3OT7 A;  4IYH A;  4PEL A;  2Q9L A;  3FAV A;  3CCS V;  1Y4M A;  4EFE A;  1SC5 B;  2CGO A;  4LCU C;  2JIZ G;  4FFB A;  1SF9 A;  3HR0 A;  3QTC A;  4NXN B;  4MW8 A;  3OGC C;  5JWP A;  5KAF Z;  2Q67 A;  3CRQ A;  2NR5 A;  3TCU A;  1FFX B;  2Z0A A;  3NR7 A;  3TGU H;  2Q69 A;  3IC7 A;  3VOU A;  1EM1 A;  3CCE V;  1Y66 A;  1LR1 A;  4UB6 Z;  2VQE B;  1WN7 A;  2GBO A;  3GVM A;  1H2M A;  3G71 V;  1LUW A;  1DK1 A;  2QJ1 A;  3BHP A;  1NKD A;  3RGB A;  4O2B A;  4ZBM A;  1K4D C;  4EKW A;  3I56 V;  3AK1 A;  3Q4H B;  2C2A A;  2JJ2 G;  1GMG A;  1IZ3 A;  1T5E A;  4N21 A;  1BHA A;  4ZI7 A;  3G6E V;  3E35 A;  3K5M A;  2UXB O;  4MVR A;  3ZRW A;  1H8E G;  2XUM A;  4RUE A;  2O57 A;  2DJV A;  2LO1 A;  3AG7 A;  1R3L C;  3BVO A;  4GKK B;  4QPK A;  1JCH A;  4C7U A;  5DN6 G;  1GAX A;  2PUS A;  4OX9 O;  1QVG U;  4DV2 O;  2F95 B;  4QE9 A;  2XAJ A;  3VQX A;  1GM7 A;  3A2F A;  2H94 A;  4UCU A;  5B5E Z;  3ETQ A;  1YDX A;  3JAK A;  1R6T A;  4WCE V;  3HKE A;  2X6A A;  2K1E A;  4LF7 O;  4HAM A;  5FPR A;  1SZX A;  4GYC B;  2B9Z A;  4B3M O;  2M6Y A;  3LNN A;  2RMK B;  2FTK A;  4X1I B;  1VMG A;  3CD6 V;  1AP5 A;  4U3F H;  4LFC B;  2ZM6 O;  3BY6 A;  5JJE B;  1PD3 A;  2GTS A;  2OCH A;  1N4C A;  3OUS A;  4X65 B;  1Q8I A;  4PA4 A;  4LF8 B;  3D3I A;  4Q6G A;  2E5L O;  1BQZ A;  3OMI B;  3K3W A;  2VS0 A;  3L73 H;  1I08 A;  3RYH A;  4H37 A;  1XDC A;  2QTS A;  1HNW B;  1JVM A;  4JI2 O;  3C90 A;  5H6R A;  1HNX B;  1NU1 H;  4TQD A;  4P2Z A;  4CC5 A;  4JI7 B;  1KP3 A;  3CC2 V;  4LF6 B;  3KG2 A;  4DV6 O;  3JAL A;  3K79 A;  4DR2 O;  2IW5 A;  4NTY A;  4IL6 Z;  1PPJ H;  3AG4 C;  1PL0 A;  4J9Y B;  1EN5 A;  2EIJ C;  4FIP C;  2BTO A;  3ZJZ A;  2UUB B;  2LP7 A;  2QE7 G;  4I7Z B;  3N2K A;  3PJS K;  4LBE C;  2MW2 B;  3CE2 A;  3K5L A;  4CH6 A;  2QSA A;  5KLV H;  5CBH A;  3LDD A;  3ABU A;  2CDY A;  5IE9 A;  3OEH G;  5KMG A;  3J7A U;  3N2G B;  4U3J A;  3H1I H;  3JD0 A;  3KCX A;  1E1R G;  2JGU A;  5LA6 B;  1VQ4 V;  2BOB C;  3I5D A;  4ICG A;  4WBN B;  4HNA B;  3OR7 C;  2XND G;  1AI4 A;  2IU0 A;  1NI8 A;  4B3R B;  3IC9 A;  5CA3 A;  4RUF A;  4PJ0 Z;  2F1M A;  5IJ9 B;  4B3S B;  2FML A;  3APQ A;  2RJZ A;  1GKF A;  3JAW B;  3T1C A;  4AI8 A;  5BZB A;  1G8M A;  4L8J A;  2YXH A;  1BE3 H;  4DO2 A;  2PI5 A;  3SPJ A;  5KHJ A;  1JOY A;  4L87 A;  5ITZ B;  2UUC B;  1FYJ A;  3N27 A;  5GON B;  4LC1 A;  1OCC C;  3F5W C;  4LFA O;  2B5U A;  2JDI G;  3BRC A;  5CA0 B;  4BIZ A;  4FVM A;  1K7D A;  4RWU A;  1K9M W;  2YI8 A;  4NTW A;  3LUT B;  4JI5 B;  3CCQ V;  3E8G A;  2F23 A;  2FB5 A;  3B2E E;  3STL C;  3OUF A;  4YJ3 B;  3EFF K;  4FLT A;  1H2G A;  4LFC O;  3ZX6 A;  1WB7 A;  1P84 F;  4DR7 B;  2ZE8 A;  3BAB A;  3MD0 A;  1M57 C;  3SYO A;  4X65 O;  2HEP A;  4J10 A;  1XHX A;  2CTR A;  1Q82 W;  3Q4H A;  1IX9 A;  3SPH A;  2Y0P A;  4B7E A;  1XNR B;  3ZBH A;  1F51 A;  4DV0 B;  3KZI Z;  3VQW A;  2DYR C;  4GX5 A;  4YHH B;  5LMN O;  2JS3 A;  2KSD A;  5LYJ A;  3DTU B;  3G6B A;  2F43 G;  1NR7 A;  1SQB H;  1ZX3 A;  1S0V A;  4NXM B;  4ZIB A;  4JI7 O;  1Y6X A;  2EJR A;  1V9P A;  1E1Q G;  1AI5 A;  4DW1 A;  1Q3E A;  4NR1 A;  4PI2 A;  1N8R W;  4X62 O;  1FXK C;  3FAV B;  4DXW A;  1YJN V;  4X1I A;  2R70 A;  1IBL B;  4P9P A;  2UUB O;  2YIC A;  2PY5 A;  3BFR A;  1I0H A;  5IJ0 B;  2ZCE A;  3CX5 F;  2OWO A;  2QKS A;  1FS0 G;  5B3S C;  4FLW A;  1KU9 A;  2QM7 A;  1QBZ A;  1MAB G;  5DEC A;  2PGG A;  4KHP B;  2Q73 A;  1RFY A;  1DTO A;  1VQO V;  4LH6 A;  2YXY A;  5KX5 B;  4H13 B;  2HR3 A;  1OHH G;  4GKJ B;  1VP7 A;  3H01 A;  3W7W A;  5H5N A;  1BZK A;  4FM2 A;  4WFG A;  2VWK A;  1FKA O;  4PA7 A;  1IBM B;  4O2B B;  1OJH A;  3LSS A;  1W2B U;  3FYI B;  4B3R O;  2CH7 A;  3E22 A;  5EBW C;  1S72 V;  2OTL V;  3TXQ A;  4ZI7 B;  1ORQ C;  5LGU A;  3ZRW B;  2ZXW C;  3KCY A;  4J7K A;  5LP6 C;  5L3B A;  1URF A;  4GX2 A;  5A9G A;  3EXA A;  1FXV A;  4LNU A;  1M1K W;  1S77 D;  1QLE B;  1ARO P;  1QCE A;  3T4Z A;  5FNV A;  2PF4 E;  1M4U A;  3H9V A;  3CCV V;  1HR0 B;  1SS3 A; 
#chains in the Genus database with same CATH homology
 5LMU O;  4GKK O;  1N34 O;  1NS1 A;  4JI7 O;  1N36 O;  4X64 O;  1F7Y A;  4DV7 O;  3OTO O;  2ZM6 O;  2DOS A;  1XMQ O;  1I94 O;  4LF5 O;  2LW7 A;  2AGA A;  4DV0 O;  1FJG O;  1AB3 A;  5BXZ A;  1D2D A;  5LL6 Y;  3M8A A;  4JI6 O;  4X62 O;  4OPA A;  2E5L O;  2UUA O;  3RT3 C;  2N74 A;  2UUB O;  4NXM O;  5A2Q N;  5FLX N;  3T1Y O;  3F5T A;  2FKX A;  4JI3 O;  5BY1 A;  2VQF O;  1IBK O;  4JYA O;  4X66 O;  2Z0A A;  1FYJ A;  1XNR O;  4JI0 O;  4JI2 O;  1N33 O;  4DR4 O;  4YHH O;  4LFA O;  4LF4 O;  2ZKO A;  4B3S O;  1HR0 O;  3T1H O;  4LFB O;  2UU9 O;  3SDL A;  1DK1 A;  1YZB A;  4LF9 O;  4LF8 O;  4DR3 O;  4YY3 O;  4DV1 O;  5H5N A;  1IBL O;  4DR1 O;  4DV6 O;  5BR8 O;  1FKA O;  1KUQ A;  4NXN O;  1XNQ O;  4DR6 O;  4DR2 O;  3J81 N;  4B3R O;  4LFC O;  2UXB O;  2UUC O;  4DUZ O;  3R66 A;  3J80 N;  4DV4 O;  2DJV A;  4JI8 O;  1HNW O;  4JV5 O;  1G1X B;  4X65 O;  1XMO O;  1HNX O;  2HHH O;  4OX9 O;  3O65 A;  2VQE O;  4DUY O;  4KHP O;  4DV2 O;  2UXD O;  5IWA O;  4LF6 O;  1AIL A;  4GKJ O;  3JAM N;  4DV3 O;  2UXC O;  4JI5 O;  2JRI A;  4AQY O;  1N32 O;  4DV5 O;  5IT9 N;  4OPH A;  4JI1 O;  1IBM O;  5LMN O;  1HNZ O;  1J5E O;  4DR5 O;  3J7A U;  1R6T A;  1XEQ A;  4JI4 O;  4K0K O;  4LF7 O;  4A5U B;  1A32 A;  1X59 A;  4DR7 O;  4B3T O;  1R1B A;  2F4V O;  4B3M O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...