3J7AU

Cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
149
structure length
149
Chain Sequence
RMYGKGKGISSSTLPYKRKQPSWLKQKPSEIEDAIIKLAKKGQTPSQIGATLRDNYGIPQVKSVTGNKILRILRAQGIATTIPEDLYFLIKKAVSMRKHLEKNKKDKDCKFRLILTESKIHRISRYYKRKKLLPSNWKYQSSTASALIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/inhibitor
molecule keywords 18S ribosomal RNA
publication title Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
pubmed doi rcsb
total genus 41
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00312 Ribosomal_S15 Ribosomal protein S15
U PF08069 Ribosomal_S13_N Ribosomal S13/S15 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3j7aU02
1F7YA 1FJGO 3JAMN 4B3RO 4LF9O 2FKXA 2HHHO 4DR7O 4A5UB 4DR5O 4X66O 4B3TO 2DOSA 4GKJO 1XEQA 1X59A 4LFCO 2ZM6O 4DV7O 5FLXN 3RT3C 1N32O 4JI0O 2UUAO 1A32A 4DV2O 2UXCO 2DJVA 1DK1A 5BXZA 4LF8O 1XNRO 3SDLA 4X62O 4OX9O 4JI5O 1YZBA 4DUYO 2VQFO 4DV4O 4K0KO 4DR4O 2F4VO 4OPAA 4YY3O 5LL6Y 5A2QN 4JI1O 1KUQA 2N74A 2VQEO 2UUCO 1FKAO 4JI2O 1XMOO 4B3SO 4LFBO 1AILA 4DR6O 1I94O 4X64O 1N36O 1G1XB 4LF5O 4AQYO 2JRIA 2LW7A 4DV0O 4GKKO 4OPHA 5LMUO 2Z0AA 1HNXO 2AGAA 4LF6O 4DV1O 1N33O 3J81N 4DV6O 4DV5O 4JI4O 4DR2O 1IBMO 2E5LO 4JI6O 1N34O 1R1BA 1HNWO 1R6TA 4NXMO 5BY1A 4DR3O 1IBLO 3T1YO 2UU9O 3F5TA 4LF7O 1D2DA 1FYJA 2UXDO 5IT9N 3J7AU 5BR8O 1J5EO 5LMNO 1AB3A 1HR0O 1NS1A 4JI3O 3M8AA 3J80N 4DUZO 4LF4O 4DV3O 1XMQO 4YHHO 4JYAO 4B3MO 3OTOO 4JV5O 2UUBO 3R66A 1XNQO 1IBKO 5IWAO 4LFAO 4X65O 5H5NA 4JI7O 3O65A 4DR1O 3T1HO 4NXNO 2ZKOA 1HNZO 4JI8O 2UXBO 4KHPO
chains in the Genus database with same CATH superfamily
2V4DA 4O4IA 1RPOA 4UVBA 3CRAA 1ZTEA 4JTCB 5DEDA 4HZ3A 4A5UB 2NN4A 4UUJC 2RNBA 1XL6A 4P2ZA 3U10A 4I55B 1WNSA 2F23A 1WB8A 3SPHA 2JGDA 1P84F 1ORQC 4O4JB 2HEPA 3L9DA 2XT9A 4OX9O 2P06A 2CUGA 4FLWA 1YCIA 4JYCA 2V7QG 1NU1H 3K0GA 5H2FZ 1VP7A 1BQZA 4B08A 2LP7A 3L75H 4FM1A 2HLDG 2YC0A 5EBMC 2AZ0A 2EX3A 1HR0B 2N74A 2BTQA 4ASUG 3N2GB 1FS0G 1W0KG 1XMOO 1H8EG 3FYIB 1BQ0A 1Q86W 2IH3C 1OJHA 1P49A 2OIEA 3K0DA 4EFEA 4OX9B 1H2GA 1SQQH 1WN7A 4HBNA 4F6RB 4I50A 1HNXO 3F7VC 4JI8B 2ODMA 4GCZA 3JALA 4MW8A 4DV6O 1BS3A 3KCXA 2RMKB 3OEEG 4CS2A 1BMFG 1XREA 4IIJB 4X88A 3SJQC 2JS3A 1FXKC 4TV9A 2ZD9A 1XMOB 2ZT9B 3FAVB 2YS8A 3ZMTA 4LF7O 2ARHA 3JCUZ 1AI6A 3CE2A 4C7UA 5KHGA 1HNXB 3ZMVA 3ASNC 3ABLC 1M57C 1Z2GA 3LSQA 4NTYA 3HKDA 3NXSA 1VF7A 4X65O 4JI7O 3F7YC 1L0LH 3KG2A 3RW0A 1I5XA 4TOIA 3CC4V 1F4NA 3I5DA 3OFNG 1GM7A 1K5SA 1MZFA 3JAMN 1M56C 2HVJC 1VQKV 3CHXA 2DQ0A 2LFSA 1OCZB 1SRYA 1VARA 4G27B 3AK3A 1WP7A 2IU0A 1IVSA 4BW9A 3JSLA 4NKGB 1AJNA 1XNRO 3EHBB 1GKFA 1KP2A 4Z1MG 5KAFZ 3CB2A 1YVWA 3T4DA 2PI4A 4OPAA 4UCSA 3CMEV 1XL4A 5KX5A 5C8YA 1KQSU 4BWAA 5LA6B 2W6JG 5LGNA 3C3TA 1EBOA 1XNRB 2Y4UA 1YITV 4LWSA 5LMUO 4CH5A 4DV1O 1N33O 2GUZA 3BABA 3DTUB 2XNDG 3RYFA 3ZRWA 4UV9A 2E5LO 4H44B 2DMXA 2EIMC 5IE9A 3JD0A 1YHQV 1BZKA 3D36C 3FX7A 4CC5A 2B9ZA 3T1YO 4MVMA 1M90W 5LMUB 5BR8O 3CEIA 4WFHA 1M93A 3STZC 3H1LH 2YXHA 1SETA 3MAQA 4MT8A 4B3MO 3CX5F 1K5QA 4PJ0Z 1XNQO 1Q81W 4LFAO 3ZRXA 2QWOB 5DN6G 3ZHQA 1JVMA 1WA8B 2BOCC 3ZHSA 5CB4B 1QVFU 2N05A 1JPXA 1GN3A 5CA0A 1OV9A 3E8BA 3R65A 1XEQA 4PA4A 5LXTA 3NR7A 3N2KA 2HG5C 1SC5B 3O9OA 2YXYA 1FXKB 1TUEB 1XNQB 3C90A 2X6BA 3UT5A 2PTMA 1OZ0A 3RYIB 4ZHQB 1O9GA 5B1BC 2OTLV 3ABLB 3ABMC 3ICXA 5D5QA 3Q4HB 1THZA 1IXBA 2F43G 2OWOA 4JV5B 5BZBA 1IURA 4B3SO 2XAGA 2ZNJA 5J2TA 1M56B 2E75B 2C2AA 4B3RB 4DV5O 1ZAUA 1JMKC 2ETNA 5LGTA 1KKCA 1ZL8B 3CCRV 3JYCA 2Y69C 5FPRA 4KXRA 4GLXA 3OGIB 3BA9A 4UXNA 3OD4A 2D3OW 4PA9A 4DR3O 4DW0A 4EB6A 3CXHF 2ZINA 3LNMB 2EZOA 2Q69A 1RM1C 1N0NA 2WLNA 1OCRC 2QKCA 3E22A 1F23A 4TWKA 3AG4C 1AJPA 1IBKO 4MSWC 4DK1A 2ZR2A 5CBHA 4NTWA 4UB6Z 3CCVV 2JEUA 3FB6C 3RWRD 4BAYA 1B06A 3GWOA 2R72A 1WPXA 4FIPC 4IHJA 4G28B 3AEIA 4L8JA 5DECA 1FXVA 5L3DA 2A0LA 3IC7A 4DV7O 1BCCH 2EIMB 4TV8B 2A06H 2E74B 2UUAO 3OE7G 4IYIA 4X62O 4JZGA 1AI7A 1Q6HA 4Z1VA 1Z5VA 5FL7G 4W4LA 4IGGA 3D3IA 2A3QA 4B7EA 2BTQB 2UXDB 2GHYA 4WBNB 3JARB 1WJZA 5GW7A 4AILC 5LMNB 3JAWA 2KQXA 3SYOA 1QLNA 1PNMA 4L87A 1E1RG 1KKDA 1YF2A 4EKWA 3UM7A 2QM7A 1RFYA 2A7WA 4DV0O 1SA0A 4ABMA 2AGAA 3LSUA 1Q5OA 3ETEA 1IXMA 2Q7HA 3SJCC 3ABKC 4HYOA 1Y74A 4TSFG 4B3TB 2ADQB 2OCHA 5ITZA 2CK3G 4LBEC 4TV9B 1NH2B 4HNAA 4JI0B 1HNWO 3MHSC 1R6TA 2ITDC 3VQXA 3ZHUA 2JK5C 2YIBA 2O57A 3ABMB 1YDXA 2CTQA 3HKCA 5B66Z 1XMQO 4J41A 4W4KA 2UUBO 3BFRA 2IJHA 1VQOV 1NT2B 2A9HA 3SYAA 1SZTA 3CMAV 2JEXA 4FLTA 4K3AA 1OHHG 4WFAV 3HB3B 3ASOC 2F93B 3A0HZ 1SERA 3ZHTA 4CBCA 1JFFA 5HFLA 1SS3A 4U3JA 2ILMA 2WLHA 5FLXN 1XMQB 1KD1W 2Z3YA 2Y69B 3K9SA 4DV2O 2ITCC 2QKAA 2PYJA 3AK1A 3OTFA 5JH7B 5JCOC 4ZOLA 2K9PA 5JJNB 4YJ3B 4FPPA 1GRJA 3K9AA 4NYKA 1RM1B 4J7JA 5KX5B 1K92A 3CRCA 3ZMUA 3CD6V 4MTXA 1US6A 1I5YA 4O4HB 3AG4B 1FFXB 2Q9LA 1NH2D 4JAAA 2Q7GA 4UCRA 5LGUA 2IU3A 4JYAB 2FL4A 3VBBA 3TETA 2DW4A 2IJKA 4P9PA 5KMGB 1N36O 3D8CA 5KUKA 5IYBO 4JAVA 2GUZB 1AJQA 4PDVA 2RDCA 1IDSA 1FJGB 4R6ZA 4FLZA 4TT3G 3A2FA 5EYPA 4JI4O 4DR2O 1NR1A 3CCQV 3STLC 1PL4A 1L1FA 5L3EA 1U96A 4I9WA 5CA1A 1RP3B 5LHHA 3JASA 3OT7A 4LF8B 4X20B 2KKWA 3CRQA 1N4CA 2Q0AA 3J7AU 4FZ0A 1W2BU 1WPBA 2QKSA 4PDRA 3VQVA 1YJ9V 4KL1A 2M6YA 1HWYA 1K3EA 4DR2B 4JI4B 3VQYA 1KYOF 4WF9V 4U7OA 2WLLA 3ML0A 1Y6XA 2XAFA 2ZDIC 5IY5C 4ZIBA 1HNZO 4UCTA 1WP8A 3S3WA 4X1IB 5LXTB 3ABKB 5GONA 4FMTA 4GKKB 3ZN0A 4BIZA 2H3OA 3CC2V 2GV9A 4RO2A 2YI9A 2DOSA 3PJSK 2Q67A 1V9PA 4LFCO 1LR1A 2KG7B 2M7WA 4QPKA 4DRXA 1SQVH 3UT5B 1S5JA 1L0NH 1XHXA 1DK1A 4RAIA 4JI5O 4GX1A 4J9ZB 2Q73A 2VQFO 2P4KA 3WG7B 1B04A 5DM6V 3DXRB 1IBLB 3BCCH 2CTRA 2JJ1G 3G6EV 4ZI7A 3H1HH 1QHTA 1W0JG 4X1YA 3JD2A 1H38A 4DUZB 2YI8A 3P3NA 4YHHB 1FKAO 2Q0OC 3K5NA 5J2TB 1NJIW 2AHYA 4K8XA 1BE3H 3ASOB 2CGOA 1RSOA 3HKEA 4PA6A 3CC7V 5EZYB 1DGSA 1T5EA 1MABG 1XILA 4G2KA 3HPLC 1OCCC 1F4MA 5CBGA 2RQ6A 3E8FA 1M5IA 1KMIZ 2CTWA 1NR7A 4EB6B 2P4VA 2WLIA 4O2AA 1K33A 1D2DA 1AR1B 1VQ5V 3AG3C 1LUVA 3HKBA 1XQ8A 5EIBC 2GSMB 3M8AA 4DV3O 2ADPA 2CE4A 3QO5A 1JQ0A 4HAMA 4I0XA 3BY6A 3OMAB 3CS5A 4GUNA 4CS3A 3KZIZ 2QWNB 4IHJB 3UCSC 2UXBO 4MVOA 1V54C 4KHPO 1NTZH 1I08A 2JS5A 2HKOA 2FKXA 4DR7O 1TA8A 3VQWA 4GKJO 1SQGA 1X59A 3OUFA 4D7TA 4DV6B 4I4TA 2XTAA 2ZM6O 3JCZA 3RT3C 4OGQB 2EIJC 4X89A 2GTSA 1AR4A 3SYQA 3ZMSA 1BL8A 1IX9A 3P30A 4LC1A 3DSQA 4KHPB 4DW1A 4PELA 2KSDA 3B77A 4LF7B 4J7ZA 5BMVB 3BPZA 4GX5A 3CCEV 1VIBA 3SJBC 1M1KW 1VF6A 3ZBHA 3W7WA 5IY5B 3QO7A 1W59A 3RN4A 3JD1A 4X64O 4X65B 4JI7B 2LO1A 2Y0IA 3JSNA 1EM1A 4CC6A 5H6QA 3J81N 2QWRB 5ITZB 3CRRA 1SESA 4HNAB 3SYCA 4JI6O 3IGAC 5CN0A 3RVZA 3H01A 4DK0A 1FPOA 4UVAA 2UU9O 3L73H 2IH1C 1DTOA 4CH3A 3RYHA 3HKCB 3G67A 3P32A 1DF4A 3SR2C 4LF4O 3FFQA 1WLEA 1H8HG 4UCVA 2BTOA 3UKMA 3ZIAG 4JI6B 3L74H 4JZ2A 4XDLA 3OW2U 1SQFA 1GTOA 4NXNO 4I5SA 4GX2A 3E35A 4YJ2A 1Y67A 3AG1C 4U3JB 2YIDA 3PN1A 2OYQA 1S5HC 2B1IA 3EVKA 4DV1B 1N33B 4QGPA 1OCCB 1FAFA 5J2UA 1QR8A 4LNUA 3TGUH 2DJVA 2E5LB 1ZSPA 4GT1A 2EJRA 5BXZA 2VWKA 2HJFC 1YZBA 3AG3B 3SPGA 4K0KO 1PNKA 4FFKA 4YY3O 1PKXA 4FJCC 1R6KA 2DYRC 2DYSC 2Q8VA 3K79A 3CXCU 3T1YB 1G4YB 5BR8B 2W6IG 2ATKC 2E76B 3ZRVA 1KB9F 4B3MB 2YIBD 2DWEC 2QSAA 4JF3A 4LFBO 1V54B 4LFAB 2AZ2A 4LF5O 4AQYO 3TJTA 5IJ0B 4XDJA 3K06A 3E83A 4IT5A 5LYJB 4FFBA 5EYPB 5JQGA 5GTHZ 1URFA 3FB8C 4FVMA 1CXZB 2EIJB 2B5UA 4JYYA 3WB0A 4IL6Z 3JASB 1SQPH 1COWG 4NXMO 3RYCA 1FYJA 3LNNA 3K3WA 2X0LA 3L71H 3J80N 3ETQA 2K1EA 4DYLA 2BCCH 3CWBH 2QWPB 3OTOO 2ZE8A 3SYPA 5F2VO 4I55A 2IJJA 4FK5C 5EC1C 2BOBC 4O2BA 5FNVB 3QVNA 4MS2A 3U11A 3B4SA 5EIBD 4B3SB 5GONB 1BGYH 2JVDA 2PUSA 3FKSG 1H2MA 3SPIA 1VQMV 4DR5O 1YI2V 4FM0A 3S3XA 1VQPV 2QDOA 5CBFA 2F1MA 4DV5B 1R3IC 2ZR3A 3H1IH 2MK3A 3N2GA 2Z5UA 1Y76B 2PZSA 4O4IB 4DUYO 1XBLA 4DV4O 4MTFA 2YICA 1P7GA 4PI2A 1P7BA 3WFVA 4ZI7B 4DR3B 4F6RA 3K04A 2QJ1A 2QTSA 2VS0A 1R3KC 4JAUA 3E89A 3AG2C 4U7NA 4DR5B 3ETGA 4N23A 2JGDB 4CS4A 4RQEA 2UUCO 3ZMZA 2ZE6A 4UVCA 1EN5A 2QEXV 4IIJA 2FMLA 4E4EA 1IBKB 5LP6A 2GBOA 4UV8A 3AG1B 4CZZA 3FAVA 4DV4B 1EZJA 3JD3A 1S72V 1I0HA 3B8NA 1IBMO 5LOVA 1Q3EA 2UXXA 1VEWA 2UUCB 4DV7B 5EBWC 1R1BA 2UUAB 4R8CA 4I50B 3JAKA 4X62B 3JALB 4RQFA 2DYSB 2DYRB 1L8DA 1R3JC 4PA3A 2YDEA 1FD9A 4GYCB 4P30A 1H2KA 1RPRA 4I0XB 3CRMA 3E8HA 3B09A 2IBZH 1K73W 4TQDA 3T1HO 2PY5A 4N21A 1PV0A 1B3QA 3ZRSA 3L72H 4FLXA 1PM9A 2FYUH 1B6QA 3WG7C 4DV0B 2HHHO 5B3SC 3SPJA 1Z5WA 3HKDB 5GTIZ 3BAAA 1EN6A 4IYHA 4FLYA 2P6JA 4F6EA 1ENVA 1KP3A 5LA6A 3IC9A 2UXNA 4LH6A 2YEVA 3VOUA 4H33A 3SJAC 1HNWB 2D2CB 2GDSA 4DR4O 2F4VO 1SQXH 2Q5ZA 4PA7A 3WB1A 2BSKA 2CH7A 4ICGA 2NLJC 3RGBA 3K08A 1N8RW 4JI1O 1GH6A 2LJ2A 2PGGA 4BIOA 2X6CA 2UUBB 3T4ZA 3ZJZA 3APOA 1BSMA 1XUQA 2XAJA 3CJHA 5KHKA 5C8YB 2JJ2G 4H13B 4WCEV 1MSDA 1PD3A 4J10A 1CEZA 1SF9A 5JVDA 3UQ8A 1H2NA 5CA3A 4DV2B 4LWSB 4R7CA 1YXBA 4RUFA 1R73A 1VMGA 4MTOA 3RYHB 1CPYA 1F51A 1LNQA 1M9NA 3M99B 2ZNIA 3RYFB 3ZRWB 3AG2B 1J5EO 5CB4A 1NS1A 2DWDC 3TK1A 5H6RA 5KHIA 2QE7G 3LDEA 5IWAO 3DC5A 1MOFA 1FXKA 3QG5A 4YJ2B 5IDJA 3K57A 3CCUV 3CCSV 3F5WC 2Y48A 3GWKC 1H2LA 1N36B 1LUWA 5B1NA 4ZHQA 4JGSA 1ZLZA 5B1AC 4B7KA 4LF9O 3QF7A 1N0JA 2RJZA 4WFFA 4X66O 5FPOA 3CSXA 1EN4A 3OMIB 1J5EB 4LNUB 4P9OA 2PYLA 4NR1A 3ZEDA 2ZXWC 1N32O 4FLUA 3QNEA 1DF5A 4QE9A 4EFBA 1QNMA 4GX0A 1EFRG 2R70A 5K1PA 1HP8A 4K35A 4J42A 1AP6A 5CA0B 4RWUA 1ZWIC 3WB2A 5LL6Y 1O9HA 3N2KB 5A2QN 4X66B 1YSCA 2WLKA 3G80A 3ETDA 1J95A 3DGEA 5EK0A 2YXLA 2R9AA 4JI2O 4H0LB 3T1CA 2XUMA 5JQGB 2XHBA 2IW5A 4I7ZB 4UFZA 3E86A 2Z0AA 2AW9A 1HNZB 5KHHA 3HR0A 3CCMV 4Q20A 5B3SB 4D6TH 1MG1A 4WFBV 2BE3A 5IYZA 1VQLV 3B2EE 5IJ9A 3QO8A 1K8AW 4LFCB 4CH6A 4XDKA 3RVYA 1S77D 3OGCC 5L3BA 1JA8A 4JI5B 3LUTB 2VQFB 3KKYA 3IFXA 1HR0O 2NNUA 3E2EA 2OTJV 1NVPB 1AP5A 1BHAA 1WB7A 3R66A 4O2BB 1VQ7V 1VQ6V 4TV8A 3H9VA 3O65A 1FXHA 1YIJV 3CCLV 5JWPA 5C93A 1QCEA 3D36A 4JI8O 5L3CA 3E22B 1BT8A 1SQBH 4UCOA 2Y4TA 1XHZA 5JJEB 4WBNA 1UPGA 3JARA 3APQA 3AK2A 4WFGA 1IZ3A 2DQ3A 1VQ9V 4WFEA 4OXSA 3D3QA 2VRZA 4NB5A 2P7TC 1X4TA 1I7FA 4TUYA 1Q43A 3UO3A 1NBMG 2EIKC 1V55C 3C3SA 5LHGA 2HFEC 4DV3B 3FB7C 1MNGA 3I55V 5LP6B 4BW5A 2JRIA 5B1AB 3IAYA 2DN9A 1K9MW 2UXBB 5LOVB 3BHPA 2R9RB 3JAWB 1NVPD 1TVKA 4DR7B 2ZXWB 4PHZA 4GKJB 1FFTB 2QA4V 2JGUA 2ZM6B 3THOA 3JAKB 3ZS8C 1QR9A 1SA0B 2F66C 4QE7A 2Q6AA 4K8ZA 1HDJA 1BHBA 1NKDA 4PDLA 1Y74B 3DC6A 4QJFB 1AB3A 5KA5A 5IYCO 1AROP 1NTMH 5A9GA 2V1DA 2W0FC 4MVSA 1Q8IA 3QTCA 3W7UA 4Q6GA 1R6NA 2RN9A 5H5NA 2WAMA 1VF5B 2FTKA 4JYBA 1MA1A 3ZHVA 5JH7A 3ZCCA 3LSSA 1PNLA 3CPWU 2LGQA 4X64B 4YJ3A 3LDDA 4MVRA 4O4HA 2OT5A 2XASA 1FFXA 4MW3A 4YXWG 2YEVB 2ZIMA 4LCUC 4X1KA 4TQFA 4D7SA 1DLBA 3BVOA 1TUBA 1EZVH 2XOKG 2A79B 2DE0X 1QQCA 2BSKB 5KMGA 2CH7B 1JFFB 1G6UA 4XBFA 4FLVA 1JX9A 4MVUA 2EBOA 2UU9B 3MD0A 5KAIZ 2Q68A 2PI5A 1VQNV 1KBHA 3H1JH 4H37A 1Q82W 1S3JA 2VQEO 4LF4B 1MMMA 4NVPA 4I9QA 2HVKC 1GMGA 4ZOLB 1GN2A 4DR6O 3W7XA 3K5LA 1GM9A 3B40A 3MDSA 2P5OA 1YJNV 2LW7A 3A0BZ 3CJHB 4NXNB 4X20A 3OEHG 2RCVA 4YIOA 1M4UA 3K5OA 1OCOC 5JVDB 1SZXA 1K4DC 2WPDG 2ZE5A 4O4LA 3OR6C 2WSSG 1E79G 2VQEB 2EZPA 3K03A 4BIUA 3OR7C 3JATA 2E3CA 4E2LA 1Q6IA 3K5MA 4FM2A 1P4RA 1QLEC 2YSUB 5KHJA 4DR6B 3TXSA 5EBLC 4K0KB 2EIKB 3GB7C 4JPRA 1PL0A 4X1IA 1V55B 4JI3O 4YY3B 2AXTZ 2L35A 3OMNB 3E8GA 4QIWF 4JV5O 5CA1B 1JJ2U 1Q90D 3CYOA 2KG7A 4J9YB 1AVMA 1S76D 4NTXA 4PV1B 1ZUQA 5JJJB 2ZQMA 4Z2WA 4U3FH 4LP8A 4LFBB 2B1GA 2WLJA 4B3RO 4LF5B 4AQYB 3ASNB 1PPJH 1M57B 4JTAB 3DXRA 3AG7A 3ZN1A 4PDMA 4J11A 2JDIG 5D5PA 4JI3B 1UFIA 2WLLB 1VF6C 1A32A 2LW1A 1D5AA 2HP8A 4PI0A 4O4JA 2W0XA 3ZX6A 3G71V 1GAXA 4NXMB 2WA3A 1AR5A 5EZYA 1GN4A 4DRXB 3ABUA 3RBZA 5LHIA 3GVMA 3RFRA 3OTOB 4LR3A 1JCHA 1AILA 1PP9H 4MTGA 1I94O 1NZ6A 2OCCC 5JCOA 3JD4A 2EULA 4OPHA 4CH4A 1KECA 2EINC 5IYZB 1G8MA 2IJIA 1MZEA 4QNHB 5IJ9B 4LF6O 3LDCA 2GTAA 2KB1A 4X1YB 3WU2Z 2HR3A 1VQ4V 1AI4A 3IJ4A 2WLMA 3X2QC 1UJWB 5KA6A 2LFRA 3CP1A 4PD4F 1RSOB 3ZHRA 5L3GA 3HKEB 1I94B 5BY1A 4DUYB 2UXDO 2IM9A 3EFFK 4FZ1A 5LBQA 5LMNO 2QR4A 4LF6B 2H94A 1S0VA 2CDYA 2G38A 4KP4A 2FB5A 2WA4A 1GO3F 2WLIB 2EJ7A 4O2AB 5AG2A 1K97A 4DR1O 2OIGA 2HJDA 2ZKOA 5EC2C 3HKBB 5E79Z 4UB8Z 4GZRB 3SGIA 1OCOB 4RUEA 2Q4PA 4B3TO 1GK9A 1KU9A 5IYDO 1GN6A 2R9IA 1QU7A 1SKVA 4JI0O 1IBMB 2ZE7A 5BMVA 3SDLA 1TAEA 2ZDIA 4DO2A 1YTFB 1QLEB 4DR1B 3BA8A 4F4LA 4TUYB 2NR5A 2L6LA 3G6BA 3SPCA 3OM3B 4I4TB 1HW7A 3KCYA 3OUSA 4J7KA 4AHCA 3A8TA 2EILC 5B5EZ 1GM8A 5H9CA 5L3FA 3EXAA 1NTKH 3N27A 1WAZA 2CAZC 3FYEB 5E1AC 3MHHC 1YEWA 4BR6A 3T1HB 5B1BB 2AHZA 5J9PC 3TCUA 1TVKB 2H8PC 4MVZA 4EEQA 4KFMA 5K1XA 1TGOA 1U97A 3U0ZA 1Q7YW 2HHHB 1MSWD 3ABTA 1XI1A 2ZIOA 2YIAA 4KUMA 1N34O 5TISZ 1K7DA 1H2SB 2QM8A 3P3PA 1E1QG 2X7RB 3TXQA 3F5TA 5IT9N 2XAHA 2QM4A 4DR4B 2F4VB 3FB5C 1XDCA 4UCUA 2F95B 4QPJA 4JYAO 3M7MX 4JI1B 1QBZA 1YTFD 4LH7A 2OCCB 1N34B 3W7TA 2EINB 1F7YA 1FJGO 1OCRB 3T2MA 1JOYA 3K59A 2QTOA 2YUAA 1WA8A 3G4SV 1ROPA 2PF4E 4X1KB 2QGNA 3X2QB 5HFMA 1K4CC 2Y0PA 1R3LC 1TUBB 2UXCO 4LF8O 4YIPA 1Y66A 5LP6C 1Q6UA 5KLVH 3W7SA 1XOUA 1AI5A 4ZBMA 3RYIA 5IJ0A 4AI8A 2Q7EA 3BEHA 5LYJA 2P22C 2LQTA 3A0RA 2XAQA 5J2UB 1KUQA 2P67A 5CMUA 1K34A 4X9QA 2CGNA 2ZCEA 3Q4HA 4JTDB 4MVQA 2UXCB 3BRCA 5IWAB 1QVGU 1G1XB 4GKKO 1S5LZ 4DXWA 2WWWA 4O4LB 3K58A 2X6AA 1JR9A 4LF9B 1D5NA 4R50A 1OCZC 3CCJV 2N04A 1ZX3A 2QWQB 1YJWV 3H1KH 3JATB 1N32B 1NQTA 1ZL8A 1KC8W 2CTPA 5FNVA 4FFBB 1IBLO 3L70H 2P90A 1Y4MA 3B8MA 3I56V 2MW2B 1JJOA 2LGWA 2JIZG 4DUZO 4JASA 2EILB 4YHHO 1NI8A 3UO2A 5B1OA 3OAAG 1VQ8V 4X8AA 4J80A 1CP9A 3RYCB 4JI2B 4ZKIA 1Y76A 5KUMA 2VWJA 3FD9A
chains in the Genus database with same CATH topology
1F7YA 1FJGO 3JAMN 4B3RO 4LF9O 2FKXA 2HHHO 4DR7O 4A5UB 4DR5O 4X66O 4B3TO 2DOSA 4GKJO 1XEQA 1X59A 4LFCO 2ZM6O 4DV7O 5FLXN 3RT3C 1N32O 4JI0O 2UUAO 1A32A 4DV2O 2UXCO 2DJVA 1DK1A 5BXZA 4LF8O 1XNRO 3SDLA 4X62O 4OX9O 4JI5O 1YZBA 4DUYO 2VQFO 4DV4O 4K0KO 4DR4O 2F4VO 4OPAA 4YY3O 5LL6Y 5A2QN 4JI1O 1KUQA 2N74A 2VQEO 2UUCO 1FKAO 4JI2O 1XMOO 4B3SO 4LFBO 1AILA 4DR6O 1I94O 4X64O 1N36O 1G1XB 4LF5O 4AQYO 2JRIA 2LW7A 4DV0O 4GKKO 4OPHA 5LMUO 2Z0AA 1HNXO 2AGAA 4LF6O 4DV1O 1N33O 3J81N 4DV6O 4DV5O 4JI4O 4DR2O 1IBMO 2E5LO 4JI6O 1N34O 1R1BA 1HNWO 1R6TA 4NXMO 5BY1A 4DR3O 1IBLO 3T1YO 2UU9O 3F5TA 4LF7O 1D2DA 1FYJA 2UXDO 5IT9N 3J7AU 5BR8O 1J5EO 5LMNO 1AB3A 1HR0O 1NS1A 4JI3O 3M8AA 3J80N 4DUZO 4LF4O 4DV3O 1XMQO 4YHHO 4JYAO 4B3MO 3OTOO 4JV5O 2UUBO 3R66A 1XNQO 1IBKO 5IWAO 4LFAO 4X65O 5H5NA 4JI7O 3O65A 4DR1O 3T1HO 4NXNO 2ZKOA 1HNZO 4JI8O 2UXBO 4KHPO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F7Y A;  1FJG O;  3JAM N;  4B3R O;  4LF9 O;  2FKX A;  2HHH O;  4DR7 O;  4A5U B;  4DR5 O;  4X66 O;  4B3T O;  2DOS A;  4GKJ O;  1XEQ A;  1X59 A;  4LFC O;  2ZM6 O;  4DV7 O;  5FLX N;  3RT3 C;  1N32 O;  4JI0 O;  2UUA O;  1A32 A;  4DV2 O;  2UXC O;  2DJV A;  1DK1 A;  5BXZ A;  4LF8 O;  1XNR O;  3SDL A;  4X62 O;  4OX9 O;  4JI5 O;  1YZB A;  4DUY O;  2VQF O;  4DV4 O;  4K0K O;  4DR4 O;  2F4V O;  4OPA A;  4YY3 O;  5LL6 Y;  5A2Q N;  4JI1 O;  1KUQ A;  2N74 A;  2VQE O;  2UUC O;  1FKA O;  4JI2 O;  1XMO O;  4B3S O;  4LFB O;  1AIL A;  4DR6 O;  1I94 O;  4X64 O;  1N36 O;  1G1X B;  4LF5 O;  4AQY O;  2JRI A;  2LW7 A;  4DV0 O;  4GKK O;  4OPH A;  5LMU O;  2Z0A A;  1HNX O;  2AGA A;  4LF6 O;  4DV1 O;  1N33 O;  3J81 N;  4DV6 O;  4DV5 O;  4JI4 O;  4DR2 O;  1IBM O;  2E5L O;  4JI6 O;  1N34 O;  1R1B A;  1HNW O;  1R6T A;  4NXM O;  5BY1 A;  4DR3 O;  1IBL O;  3T1Y O;  2UU9 O;  3F5T A;  4LF7 O;  1D2D A;  1FYJ A;  2UXD O;  5IT9 N;  3J7A U;  5BR8 O;  1J5E O;  5LMN O;  1AB3 A;  1HR0 O;  1NS1 A;  4JI3 O;  3M8A A;  3J80 N;  4DUZ O;  4LF4 O;  4DV3 O;  1XMQ O;  4YHH O;  4JYA O;  4B3M O;  3OTO O;  4JV5 O;  2UUB O;  3R66 A;  1XNQ O;  1IBK O;  5IWA O;  4LFA O;  4X65 O;  5H5N A;  4JI7 O;  3O65 A;  4DR1 O;  3T1H O;  4NXN O;  2ZKO A;  1HNZ O;  4JI8 O;  2UXB O;  4KHP O; 
#chains in the Genus database with same CATH topology
 2V4D A;  4O4I A;  1RPO A;  4UVB A;  3CRA A;  1ZTE A;  4JTC B;  5DED A;  4HZ3 A;  4A5U B;  2NN4 A;  4UUJ C;  2RNB A;  1XL6 A;  4P2Z A;  3U10 A;  4I55 B;  1WNS A;  2F23 A;  1WB8 A;  3SPH A;  2JGD A;  1P84 F;  1ORQ C;  4O4J B;  2HEP A;  3L9D A;  2XT9 A;  4OX9 O;  2P06 A;  2CUG A;  4FLW A;  1YCI A;  4JYC A;  2V7Q G;  1NU1 H;  3K0G A;  5H2F Z;  1VP7 A;  1BQZ A;  4B08 A;  2LP7 A;  3L75 H;  4FM1 A;  2HLD G;  2YC0 A;  5EBM C;  2AZ0 A;  2EX3 A;  1HR0 B;  2N74 A;  2BTQ A;  4ASU G;  3N2G B;  1FS0 G;  1W0K G;  1XMO O;  1H8E G;  3FYI B;  1BQ0 A;  1Q86 W;  2IH3 C;  1OJH A;  1P49 A;  2OIE A;  3K0D A;  4EFE A;  4OX9 B;  1H2G A;  1SQQ H;  1WN7 A;  4HBN A;  4F6R B;  4I50 A;  1HNX O;  3F7V C;  4JI8 B;  2ODM A;  4GCZ A;  3JAL A;  4MW8 A;  4DV6 O;  1BS3 A;  3KCX A;  2RMK B;  3OEE G;  4CS2 A;  1BMF G;  1XRE A;  4IIJ B;  4X88 A;  3SJQ C;  2JS3 A;  1FXK C;  4TV9 A;  2ZD9 A;  1XMO B;  2ZT9 B;  3FAV B;  2YS8 A;  3ZMT A;  4LF7 O;  2ARH A;  3JCU Z;  1AI6 A;  3CE2 A;  4C7U A;  5KHG A;  1HNX B;  3ZMV A;  3ASN C;  3ABL C;  1M57 C;  1Z2G A;  3LSQ A;  4NTY A;  3HKD A;  3NXS A;  1VF7 A;  4X65 O;  4JI7 O;  3F7Y C;  1L0L H;  3KG2 A;  3RW0 A;  1I5X A;  4TOI A;  3CC4 V;  1F4N A;  3I5D A;  3OFN G;  1GM7 A;  1K5S A;  1MZF A;  3JAM N;  1M56 C;  2HVJ C;  1VQK V;  3CHX A;  2DQ0 A;  2LFS A;  1OCZ B;  1SRY A;  1VAR A;  4G27 B;  3AK3 A;  1WP7 A;  2IU0 A;  1IVS A;  4BW9 A;  3JSL A;  4NKG B;  1AJN A;  1XNR O;  3EHB B;  1GKF A;  1KP2 A;  4Z1M G;  5KAF Z;  3CB2 A;  1YVW A;  3T4D A;  2PI4 A;  4OPA A;  4UCS A;  3CME V;  1XL4 A;  5KX5 A;  5C8Y A;  1KQS U;  4BWA A;  5LA6 B;  2W6J G;  5LGN A;  3C3T A;  1EBO A;  1XNR B;  2Y4U A;  1YIT V;  4LWS A;  5LMU O;  4CH5 A;  4DV1 O;  1N33 O;  2GUZ A;  3BAB A;  3DTU B;  2XND G;  3RYF A;  3ZRW A;  4UV9 A;  2E5L O;  4H44 B;  2DMX A;  2EIM C;  5IE9 A;  3JD0 A;  1YHQ V;  1BZK A;  3D36 C;  3FX7 A;  4CC5 A;  2B9Z A;  3T1Y O;  4MVM A;  1M90 W;  5LMU B;  5BR8 O;  3CEI A;  4WFH A;  1M93 A;  3STZ C;  3H1L H;  2YXH A;  1SET A;  3MAQ A;  4MT8 A;  4B3M O;  3CX5 F;  1K5Q A;  4PJ0 Z;  1XNQ O;  1Q81 W;  4LFA O;  3ZRX A;  2QWO B;  5DN6 G;  3ZHQ A;  1JVM A;  1WA8 B;  2BOC C;  3ZHS A;  5CB4 B;  1QVF U;  2N05 A;  1JPX A;  1GN3 A;  5CA0 A;  1OV9 A;  3E8B A;  3R65 A;  1XEQ A;  4PA4 A;  5LXT A;  3NR7 A;  3N2K A;  2HG5 C;  1SC5 B;  3O9O A;  2YXY A;  1FXK B;  1TUE B;  1XNQ B;  3C90 A;  2X6B A;  3UT5 A;  2PTM A;  1OZ0 A;  3RYI B;  4ZHQ B;  1O9G A;  5B1B C;  2OTL V;  3ABL B;  3ABM C;  3ICX A;  5D5Q A;  3Q4H B;  1THZ A;  1IXB A;  2F43 G;  2OWO A;  4JV5 B;  5BZB A;  1IUR A;  4B3S O;  2XAG A;  2ZNJ A;  5J2T A;  1M56 B;  2E75 B;  2C2A A;  4B3R B;  4DV5 O;  1ZAU A;  1JMK C;  2ETN A;  5LGT A;  1KKC A;  1ZL8 B;  3CCR V;  3JYC A;  2Y69 C;  5FPR A;  4KXR A;  4GLX A;  3OGI B;  3BA9 A;  4UXN A;  3OD4 A;  2D3O W;  4PA9 A;  4DR3 O;  4DW0 A;  4EB6 A;  3CXH F;  2ZIN A;  3LNM B;  2EZO A;  2Q69 A;  1RM1 C;  1N0N A;  2WLN A;  1OCR C;  2QKC A;  3E22 A;  1F23 A;  4TWK A;  3AG4 C;  1AJP A;  1IBK O;  4MSW C;  4DK1 A;  2ZR2 A;  5CBH A;  4NTW A;  4UB6 Z;  3CCV V;  2JEU A;  3FB6 C;  3RWR D;  4BAY A;  1B06 A;  3GWO A;  2R72 A;  1WPX A;  4FIP C;  4IHJ A;  4G28 B;  3AEI A;  4L8J A;  5DEC A;  1FXV A;  5L3D A;  2A0L A;  3IC7 A;  4DV7 O;  1BCC H;  2EIM B;  4TV8 B;  2A06 H;  2E74 B;  2UUA O;  3OE7 G;  4IYI A;  4X62 O;  4JZG A;  1AI7 A;  1Q6H A;  4Z1V A;  1Z5V A;  5FL7 G;  4W4L A;  4IGG A;  3D3I A;  2A3Q A;  4B7E A;  2BTQ B;  2UXD B;  2GHY A;  4WBN B;  3JAR B;  1WJZ A;  5GW7 A;  4AIL C;  5LMN B;  3JAW A;  2KQX A;  3SYO A;  1QLN A;  1PNM A;  4L87 A;  1E1R G;  1KKD A;  1YF2 A;  4EKW A;  3UM7 A;  2QM7 A;  1RFY A;  2A7W A;  4DV0 O;  1SA0 A;  4ABM A;  2AGA A;  3LSU A;  1Q5O A;  3ETE A;  1IXM A;  2Q7H A;  3SJC C;  3ABK C;  4HYO A;  1Y74 A;  4TSF G;  4B3T B;  2ADQ B;  2OCH A;  5ITZ A;  2CK3 G;  4LBE C;  4TV9 B;  1NH2 B;  4HNA A;  4JI0 B;  1HNW O;  3MHS C;  1R6T A;  2ITD C;  3VQX A;  3ZHU A;  2JK5 C;  2YIB A;  2O57 A;  3ABM B;  1YDX A;  2CTQ A;  3HKC A;  5B66 Z;  1XMQ O;  4J41 A;  4W4K A;  2UUB O;  3BFR A;  2IJH A;  1VQO V;  1NT2 B;  2A9H A;  3SYA A;  1SZT A;  3CMA V;  2JEX A;  4FLT A;  4K3A A;  1OHH G;  4WFA V;  3HB3 B;  3ASO C;  2F93 B;  3A0H Z;  1SER A;  3ZHT A;  4CBC A;  1JFF A;  5HFL A;  1SS3 A;  4U3J A;  2ILM A;  2WLH A;  5FLX N;  1XMQ B;  1KD1 W;  2Z3Y A;  2Y69 B;  3K9S A;  4DV2 O;  2ITC C;  2QKA A;  2PYJ A;  3AK1 A;  3OTF A;  5JH7 B;  5JCO C;  4ZOL A;  2K9P A;  5JJN B;  4YJ3 B;  4FPP A;  1GRJ A;  3K9A A;  4NYK A;  1RM1 B;  4J7J A;  5KX5 B;  1K92 A;  3CRC A;  3ZMU A;  3CD6 V;  4MTX A;  1US6 A;  1I5Y A;  4O4H B;  3AG4 B;  1FFX B;  2Q9L A;  1NH2 D;  4JAA A;  2Q7G A;  4UCR A;  5LGU A;  2IU3 A;  4JYA B;  2FL4 A;  3VBB A;  3TET A;  2DW4 A;  2IJK A;  4P9P A;  5KMG B;  1N36 O;  3D8C A;  5KUK A;  5IYB O;  4JAV A;  2GUZ B;  1AJQ A;  4PDV A;  2RDC A;  1IDS A;  1FJG B;  4R6Z A;  4FLZ A;  4TT3 G;  3A2F A;  5EYP A;  4JI4 O;  4DR2 O;  1NR1 A;  3CCQ V;  3STL C;  1PL4 A;  1L1F A;  5L3E A;  1U96 A;  4I9W A;  5CA1 A;  1RP3 B;  5LHH A;  3JAS A;  3OT7 A;  4LF8 B;  4X20 B;  2KKW A;  3CRQ A;  1N4C A;  2Q0A A;  3J7A U;  4FZ0 A;  1W2B U;  1WPB A;  2QKS A;  4PDR A;  3VQV A;  1YJ9 V;  4KL1 A;  2M6Y A;  1HWY A;  1K3E A;  4DR2 B;  4JI4 B;  3VQY A;  1KYO F;  4WF9 V;  4U7O A;  2WLL A;  3ML0 A;  1Y6X A;  2XAF A;  2ZDI C;  5IY5 C;  4ZIB A;  1HNZ O;  4UCT A;  1WP8 A;  3S3W A;  4X1I B;  5LXT B;  3ABK B;  5GON A;  4FMT A;  4GKK B;  3ZN0 A;  4BIZ A;  2H3O A;  3CC2 V;  2GV9 A;  4RO2 A;  2YI9 A;  2DOS A;  3PJS K;  2Q67 A;  1V9P A;  4LFC O;  1LR1 A;  2KG7 B;  2M7W A;  4QPK A;  4DRX A;  1SQV H;  3UT5 B;  1S5J A;  1L0N H;  1XHX A;  1DK1 A;  4RAI A;  4JI5 O;  4GX1 A;  4J9Z B;  2Q73 A;  2VQF O;  2P4K A;  3WG7 B;  1B04 A;  5DM6 V;  3DXR B;  1IBL B;  3BCC H;  2CTR A;  2JJ1 G;  3G6E V;  4ZI7 A;  3H1H H;  1QHT A;  1W0J G;  4X1Y A;  3JD2 A;  1H38 A;  4DUZ B;  2YI8 A;  3P3N A;  4YHH B;  1FKA O;  2Q0O C;  3K5N A;  5J2T B;  1NJI W;  2AHY A;  4K8X A;  1BE3 H;  3ASO B;  2CGO A;  1RSO A;  3HKE A;  4PA6 A;  3CC7 V;  5EZY B;  1DGS A;  1T5E A;  1MAB G;  1XIL A;  4G2K A;  3HPL C;  1OCC C;  1F4M A;  5CBG A;  2RQ6 A;  3E8F A;  1M5I A;  1KMI Z;  2CTW A;  1NR7 A;  4EB6 B;  2P4V A;  2WLI A;  4O2A A;  1K33 A;  1D2D A;  1AR1 B;  1VQ5 V;  3AG3 C;  1LUV A;  3HKB A;  1XQ8 A;  5EIB C;  2GSM B;  3M8A A;  4DV3 O;  2ADP A;  2CE4 A;  3QO5 A;  1JQ0 A;  4HAM A;  4I0X A;  3BY6 A;  3OMA B;  3CS5 A;  4GUN A;  4CS3 A;  3KZI Z;  2QWN B;  4IHJ B;  3UCS C;  2UXB O;  4MVO A;  1V54 C;  4KHP O;  1NTZ H;  1I08 A;  2JS5 A;  2HKO A;  2FKX A;  4DR7 O;  1TA8 A;  3VQW A;  4GKJ O;  1SQG A;  1X59 A;  3OUF A;  4D7T A;  4DV6 B;  4I4T A;  2XTA A;  2ZM6 O;  3JCZ A;  3RT3 C;  4OGQ B;  2EIJ C;  4X89 A;  2GTS A;  1AR4 A;  3SYQ A;  3ZMS A;  1BL8 A;  1IX9 A;  3P30 A;  4LC1 A;  3DSQ A;  4KHP B;  4DW1 A;  4PEL A;  2KSD A;  3B77 A;  4LF7 B;  4J7Z A;  5BMV B;  3BPZ A;  4GX5 A;  3CCE V;  1VIB A;  3SJB C;  1M1K W;  1VF6 A;  3ZBH A;  3W7W A;  5IY5 B;  3QO7 A;  1W59 A;  3RN4 A;  3JD1 A;  4X64 O;  4X65 B;  4JI7 B;  2LO1 A;  2Y0I A;  3JSN A;  1EM1 A;  4CC6 A;  5H6Q A;  3J81 N;  2QWR B;  5ITZ B;  3CRR A;  1SES A;  4HNA B;  3SYC A;  4JI6 O;  3IGA C;  5CN0 A;  3RVZ A;  3H01 A;  4DK0 A;  1FPO A;  4UVA A;  2UU9 O;  3L73 H;  2IH1 C;  1DTO A;  4CH3 A;  3RYH A;  3HKC B;  3G67 A;  3P32 A;  1DF4 A;  3SR2 C;  4LF4 O;  3FFQ A;  1WLE A;  1H8H G;  4UCV A;  2BTO A;  3UKM A;  3ZIA G;  4JI6 B;  3L74 H;  4JZ2 A;  4XDL A;  3OW2 U;  1SQF A;  1GTO A;  4NXN O;  4I5S A;  4GX2 A;  3E35 A;  4YJ2 A;  1Y67 A;  3AG1 C;  4U3J B;  2YID A;  3PN1 A;  2OYQ A;  1S5H C;  2B1I A;  3EVK A;  4DV1 B;  1N33 B;  4QGP A;  1OCC B;  1FAF A;  5J2U A;  1QR8 A;  4LNU A;  3TGU H;  2DJV A;  2E5L B;  1ZSP A;  4GT1 A;  2EJR A;  5BXZ A;  2VWK A;  2HJF C;  1YZB A;  3AG3 B;  3SPG A;  4K0K O;  1PNK A;  4FFK A;  4YY3 O;  1PKX A;  4FJC C;  1R6K A;  2DYR C;  2DYS C;  2Q8V A;  3K79 A;  3CXC U;  3T1Y B;  1G4Y B;  5BR8 B;  2W6I G;  2ATK C;  2E76 B;  3ZRV A;  1KB9 F;  4B3M B;  2YIB D;  2DWE C;  2QSA A;  4JF3 A;  4LFB O;  1V54 B;  4LFA B;  2AZ2 A;  4LF5 O;  4AQY O;  3TJT A;  5IJ0 B;  4XDJ A;  3K06 A;  3E83 A;  4IT5 A;  5LYJ B;  4FFB A;  5EYP B;  5JQG A;  5GTH Z;  1URF A;  3FB8 C;  4FVM A;  1CXZ B;  2EIJ B;  2B5U A;  4JYY A;  3WB0 A;  4IL6 Z;  3JAS B;  1SQP H;  1COW G;  4NXM O;  3RYC A;  1FYJ A;  3LNN A;  3K3W A;  2X0L A;  3L71 H;  3J80 N;  3ETQ A;  2K1E A;  4DYL A;  2BCC H;  3CWB H;  2QWP B;  3OTO O;  2ZE8 A;  3SYP A;  5F2V O;  4I55 A;  2IJJ A;  4FK5 C;  5EC1 C;  2BOB C;  4O2B A;  5FNV B;  3QVN A;  4MS2 A;  3U11 A;  3B4S A;  5EIB D;  4B3S B;  5GON B;  1BGY H;  2JVD A;  2PUS A;  3FKS G;  1H2M A;  3SPI A;  1VQM V;  4DR5 O;  1YI2 V;  4FM0 A;  3S3X A;  1VQP V;  2QDO A;  5CBF A;  2F1M A;  4DV5 B;  1R3I C;  2ZR3 A;  3H1I H;  2MK3 A;  3N2G A;  2Z5U A;  1Y76 B;  2PZS A;  4O4I B;  4DUY O;  1XBL A;  4DV4 O;  4MTF A;  2YIC A;  1P7G A;  4PI2 A;  1P7B A;  3WFV A;  4ZI7 B;  4DR3 B;  4F6R A;  3K04 A;  2QJ1 A;  2QTS A;  2VS0 A;  1R3K C;  4JAU A;  3E89 A;  3AG2 C;  4U7N A;  4DR5 B;  3ETG A;  4N23 A;  2JGD B;  4CS4 A;  4RQE A;  2UUC O;  3ZMZ A;  2ZE6 A;  4UVC A;  1EN5 A;  2QEX V;  4IIJ A;  2FML A;  4E4E A;  1IBK B;  5LP6 A;  2GBO A;  4UV8 A;  3AG1 B;  4CZZ A;  3FAV A;  4DV4 B;  1EZJ A;  3JD3 A;  1S72 V;  1I0H A;  3B8N A;  1IBM O;  5LOV A;  1Q3E A;  2UXX A;  1VEW A;  2UUC B;  4DV7 B;  5EBW C;  1R1B A;  2UUA B;  4R8C A;  4I50 B;  3JAK A;  4X62 B;  3JAL B;  4RQF A;  2DYS B;  2DYR B;  1L8D A;  1R3J C;  4PA3 A;  2YDE A;  1FD9 A;  4GYC B;  4P30 A;  1H2K A;  1RPR A;  4I0X B;  3CRM A;  3E8H A;  3B09 A;  2IBZ H;  1K73 W;  4TQD A;  3T1H O;  2PY5 A;  4N21 A;  1PV0 A;  1B3Q A;  3ZRS A;  3L72 H;  4FLX A;  1PM9 A;  2FYU H;  1B6Q A;  3WG7 C;  4DV0 B;  2HHH O;  5B3S C;  3SPJ A;  1Z5W A;  3HKD B;  5GTI Z;  3BAA A;  1EN6 A;  4IYH A;  4FLY A;  2P6J A;  4F6E A;  1ENV A;  1KP3 A;  5LA6 A;  3IC9 A;  2UXN A;  4LH6 A;  2YEV A;  3VOU A;  4H33 A;  3SJA C;  1HNW B;  2D2C B;  2GDS A;  4DR4 O;  2F4V O;  1SQX H;  2Q5Z A;  4PA7 A;  3WB1 A;  2BSK A;  2CH7 A;  4ICG A;  2NLJ C;  3RGB A;  3K08 A;  1N8R W;  4JI1 O;  1GH6 A;  2LJ2 A;  2PGG A;  4BIO A;  2X6C A;  2UUB B;  3T4Z A;  3ZJZ A;  3APO A;  1BSM A;  1XUQ A;  2XAJ A;  3CJH A;  5KHK A;  5C8Y B;  2JJ2 G;  4H13 B;  4WCE V;  1MSD A;  1PD3 A;  4J10 A;  1CEZ A;  1SF9 A;  5JVD A;  3UQ8 A;  1H2N A;  5CA3 A;  4DV2 B;  4LWS B;  4R7C A;  1YXB A;  4RUF A;  1R73 A;  1VMG A;  4MTO A;  3RYH B;  1CPY A;  1F51 A;  1LNQ A;  1M9N A;  3M99 B;  2ZNI A;  3RYF B;  3ZRW B;  3AG2 B;  1J5E O;  5CB4 A;  1NS1 A;  2DWD C;  3TK1 A;  5H6R A;  5KHI A;  2QE7 G;  3LDE A;  5IWA O;  3DC5 A;  1MOF A;  1FXK A;  3QG5 A;  4YJ2 B;  5IDJ A;  3K57 A;  3CCU V;  3CCS V;  3F5W C;  2Y48 A;  3GWK C;  1H2L A;  1N36 B;  1LUW A;  5B1N A;  4ZHQ A;  4JGS A;  1ZLZ A;  5B1A C;  4B7K A;  4LF9 O;  3QF7 A;  1N0J A;  2RJZ A;  4WFF A;  4X66 O;  5FPO A;  3CSX A;  1EN4 A;  3OMI B;  1J5E B;  4LNU B;  4P9O A;  2PYL A;  4NR1 A;  3ZED A;  2ZXW C;  1N32 O;  4FLU A;  3QNE A;  1DF5 A;  4QE9 A;  4EFB A;  1QNM A;  4GX0 A;  1EFR G;  2R70 A;  5K1P A;  1HP8 A;  4K35 A;  4J42 A;  1AP6 A;  5CA0 B;  4RWU A;  1ZWI C;  3WB2 A;  5LL6 Y;  1O9H A;  3N2K B;  5A2Q N;  4X66 B;  1YSC A;  2WLK A;  3G80 A;  3ETD A;  1J95 A;  3DGE A;  5EK0 A;  2YXL A;  2R9A A;  4JI2 O;  4H0L B;  3T1C A;  2XUM A;  5JQG B;  2XHB A;  2IW5 A;  4I7Z B;  4UFZ A;  3E86 A;  2Z0A A;  2AW9 A;  1HNZ B;  5KHH A;  3HR0 A;  3CCM V;  4Q20 A;  5B3S B;  4D6T H;  1MG1 A;  4WFB V;  2BE3 A;  5IYZ A;  1VQL V;  3B2E E;  5IJ9 A;  3QO8 A;  1K8A W;  4LFC B;  4CH6 A;  4XDK A;  3RVY A;  1S77 D;  3OGC C;  5L3B A;  1JA8 A;  4JI5 B;  3LUT B;  2VQF B;  3KKY A;  3IFX A;  1HR0 O;  2NNU A;  3E2E A;  2OTJ V;  1NVP B;  1AP5 A;  1BHA A;  1WB7 A;  3R66 A;  4O2B B;  1VQ7 V;  1VQ6 V;  4TV8 A;  3H9V A;  3O65 A;  1FXH A;  1YIJ V;  3CCL V;  5JWP A;  5C93 A;  1QCE A;  3D36 A;  4JI8 O;  5L3C A;  3E22 B;  1BT8 A;  1SQB H;  4UCO A;  2Y4T A;  1XHZ A;  5JJE B;  4WBN A;  1UPG A;  3JAR A;  3APQ A;  3AK2 A;  4WFG A;  1IZ3 A;  2DQ3 A;  1VQ9 V;  4WFE A;  4OXS A;  3D3Q A;  2VRZ A;  4NB5 A;  2P7T C;  1X4T A;  1I7F A;  4TUY A;  1Q43 A;  3UO3 A;  1NBM G;  2EIK C;  1V55 C;  3C3S A;  5LHG A;  2HFE C;  4DV3 B;  3FB7 C;  1MNG A;  3I55 V;  5LP6 B;  4BW5 A;  2JRI A;  5B1A B;  3IAY A;  2DN9 A;  1K9M W;  2UXB B;  5LOV B;  3BHP A;  2R9R B;  3JAW B;  1NVP D;  1TVK A;  4DR7 B;  2ZXW B;  4PHZ A;  4GKJ B;  1FFT B;  2QA4 V;  2JGU A;  2ZM6 B;  3THO A;  3JAK B;  3ZS8 C;  1QR9 A;  1SA0 B;  2F66 C;  4QE7 A;  2Q6A A;  4K8Z A;  1HDJ A;  1BHB A;  1NKD A;  4PDL A;  1Y74 B;  3DC6 A;  4QJF B;  1AB3 A;  5KA5 A;  5IYC O;  1ARO P;  1NTM H;  5A9G A;  2V1D A;  2W0F C;  4MVS A;  1Q8I A;  3QTC A;  3W7U A;  4Q6G A;  1R6N A;  2RN9 A;  5H5N A;  2WAM A;  1VF5 B;  2FTK A;  4JYB A;  1MA1 A;  3ZHV A;  5JH7 A;  3ZCC A;  3LSS A;  1PNL A;  3CPW U;  2LGQ A;  4X64 B;  4YJ3 A;  3LDD A;  4MVR A;  4O4H A;  2OT5 A;  2XAS A;  1FFX A;  4MW3 A;  4YXW G;  2YEV B;  2ZIM A;  4LCU C;  4X1K A;  4TQF A;  4D7S A;  1DLB A;  3BVO A;  1TUB A;  1EZV H;  2XOK G;  2A79 B;  2DE0 X;  1QQC A;  2BSK B;  5KMG A;  2CH7 B;  1JFF B;  1G6U A;  4XBF A;  4FLV A;  1JX9 A;  4MVU A;  2EBO A;  2UU9 B;  3MD0 A;  5KAI Z;  2Q68 A;  2PI5 A;  1VQN V;  1KBH A;  3H1J H;  4H37 A;  1Q82 W;  1S3J A;  2VQE O;  4LF4 B;  1MMM A;  4NVP A;  4I9Q A;  2HVK C;  1GMG A;  4ZOL B;  1GN2 A;  4DR6 O;  3W7X A;  3K5L A;  1GM9 A;  3B40 A;  3MDS A;  2P5O A;  1YJN V;  2LW7 A;  3A0B Z;  3CJH B;  4NXN B;  4X20 A;  3OEH G;  2RCV A;  4YIO A;  1M4U A;  3K5O A;  1OCO C;  5JVD B;  1SZX A;  1K4D C;  2WPD G;  2ZE5 A;  4O4L A;  3OR6 C;  2WSS G;  1E79 G;  2VQE B;  2EZP A;  3K03 A;  4BIU A;  3OR7 C;  3JAT A;  2E3C A;  4E2L A;  1Q6I A;  3K5M A;  4FM2 A;  1P4R A;  1QLE C;  2YSU B;  5KHJ A;  4DR6 B;  3TXS A;  5EBL C;  4K0K B;  2EIK B;  3GB7 C;  4JPR A;  1PL0 A;  4X1I A;  1V55 B;  4JI3 O;  4YY3 B;  2AXT Z;  2L35 A;  3OMN B;  3E8G A;  4QIW F;  4JV5 O;  5CA1 B;  1JJ2 U;  1Q90 D;  3CYO A;  2KG7 A;  4J9Y B;  1AVM A;  1S76 D;  4NTX A;  4PV1 B;  1ZUQ A;  5JJJ B;  2ZQM A;  4Z2W A;  4U3F H;  4LP8 A;  4LFB B;  2B1G A;  2WLJ A;  4B3R O;  4LF5 B;  4AQY B;  3ASN B;  1PPJ H;  1M57 B;  4JTA B;  3DXR A;  3AG7 A;  3ZN1 A;  4PDM A;  4J11 A;  2JDI G;  5D5P A;  4JI3 B;  1UFI A;  2WLL B;  1VF6 C;  1A32 A;  2LW1 A;  1D5A A;  2HP8 A;  4PI0 A;  4O4J A;  2W0X A;  3ZX6 A;  3G71 V;  1GAX A;  4NXM B;  2WA3 A;  1AR5 A;  5EZY A;  1GN4 A;  4DRX B;  3ABU A;  3RBZ A;  5LHI A;  3GVM A;  3RFR A;  3OTO B;  4LR3 A;  1JCH A;  1AIL A;  1PP9 H;  4MTG A;  1I94 O;  1NZ6 A;  2OCC C;  5JCO A;  3JD4 A;  2EUL A;  4OPH A;  4CH4 A;  1KEC A;  2EIN C;  5IYZ B;  1G8M A;  2IJI A;  1MZE A;  4QNH B;  5IJ9 B;  4LF6 O;  3LDC A;  2GTA A;  2KB1 A;  4X1Y B;  3WU2 Z;  2HR3 A;  1VQ4 V;  1AI4 A;  3IJ4 A;  2WLM A;  3X2Q C;  1UJW B;  5KA6 A;  2LFR A;  3CP1 A;  4PD4 F;  1RSO B;  3ZHR A;  5L3G A;  3HKE B;  1I94 B;  5BY1 A;  4DUY B;  2UXD O;  2IM9 A;  3EFF K;  4FZ1 A;  5LBQ A;  5LMN O;  2QR4 A;  4LF6 B;  2H94 A;  1S0V A;  2CDY A;  2G38 A;  4KP4 A;  2FB5 A;  2WA4 A;  1GO3 F;  2WLI B;  2EJ7 A;  4O2A B;  5AG2 A;  1K97 A;  4DR1 O;  2OIG A;  2HJD A;  2ZKO A;  5EC2 C;  3HKB B;  5E79 Z;  4UB8 Z;  4GZR B;  3SGI A;  1OCO B;  4RUE A;  2Q4P A;  4B3T O;  1GK9 A;  1KU9 A;  5IYD O;  1GN6 A;  2R9I A;  1QU7 A;  1SKV A;  4JI0 O;  1IBM B;  2ZE7 A;  5BMV A;  3SDL A;  1TAE A;  2ZDI A;  4DO2 A;  1YTF B;  1QLE B;  4DR1 B;  3BA8 A;  4F4L A;  4TUY B;  2NR5 A;  2L6L A;  3G6B A;  3SPC A;  3OM3 B;  4I4T B;  1HW7 A;  3KCY A;  3OUS A;  4J7K A;  4AHC A;  3A8T A;  2EIL C;  5B5E Z;  1GM8 A;  5H9C A;  5L3F A;  3EXA A;  1NTK H;  3N27 A;  1WAZ A;  2CAZ C;  3FYE B;  5E1A C;  3MHH C;  1YEW A;  4BR6 A;  3T1H B;  5B1B B;  2AHZ A;  5J9P C;  3TCU A;  1TVK B;  2H8P C;  4MVZ A;  4EEQ A;  4KFM A;  5K1X A;  1TGO A;  1U97 A;  3U0Z A;  1Q7Y W;  2HHH B;  1MSW D;  3ABT A;  1XI1 A;  2ZIO A;  2YIA A;  4KUM A;  1N34 O;  5TIS Z;  1K7D A;  1H2S B;  2QM8 A;  3P3P A;  1E1Q G;  2X7R B;  3TXQ A;  3F5T A;  5IT9 N;  2XAH A;  2QM4 A;  4DR4 B;  2F4V B;  3FB5 C;  1XDC A;  4UCU A;  2F95 B;  4QPJ A;  4JYA O;  3M7M X;  4JI1 B;  1QBZ A;  1YTF D;  4LH7 A;  2OCC B;  1N34 B;  3W7T A;  2EIN B;  1F7Y A;  1FJG O;  1OCR B;  3T2M A;  1JOY A;  3K59 A;  2QTO A;  2YUA A;  1WA8 A;  3G4S V;  1ROP A;  2PF4 E;  4X1K B;  2QGN A;  3X2Q B;  5HFM A;  1K4C C;  2Y0P A;  1R3L C;  1TUB B;  2UXC O;  4LF8 O;  4YIP A;  1Y66 A;  5LP6 C;  1Q6U A;  5KLV H;  3W7S A;  1XOU A;  1AI5 A;  4ZBM A;  3RYI A;  5IJ0 A;  4AI8 A;  2Q7E A;  3BEH A;  5LYJ A;  2P22 C;  2LQT A;  3A0R A;  2XAQ A;  5J2U B;  1KUQ A;  2P67 A;  5CMU A;  1K34 A;  4X9Q A;  2CGN A;  2ZCE A;  3Q4H A;  4JTD B;  4MVQ A;  2UXC B;  3BRC A;  5IWA B;  1QVG U;  1G1X B;  4GKK O;  1S5L Z;  4DXW A;  2WWW A;  4O4L B;  3K58 A;  2X6A A;  1JR9 A;  4LF9 B;  1D5N A;  4R50 A;  1OCZ C;  3CCJ V;  2N04 A;  1ZX3 A;  2QWQ B;  1YJW V;  3H1K H;  3JAT B;  1N32 B;  1NQT A;  1ZL8 A;  1KC8 W;  2CTP A;  5FNV A;  4FFB B;  1IBL O;  3L70 H;  2P90 A;  1Y4M A;  3B8M A;  3I56 V;  2MW2 B;  1JJO A;  2LGW A;  2JIZ G;  4DUZ O;  4JAS A;  2EIL B;  4YHH O;  1NI8 A;  3UO2 A;  5B1O A;  3OAA G;  1VQ8 V;  4X8A A;  4J80 A;  1CP9 A;  3RYC B;  4JI2 B;  4ZKI A;  1Y76 A;  5KUM A;  2VWJ A;  3FD9 A; 
#chains in the Genus database with same CATH homology
 1F7Y A;  1FJG O;  3JAM N;  4B3R O;  4LF9 O;  2FKX A;  2HHH O;  4DR7 O;  4A5U B;  4DR5 O;  4X66 O;  4B3T O;  2DOS A;  4GKJ O;  1XEQ A;  1X59 A;  4LFC O;  2ZM6 O;  4DV7 O;  5FLX N;  3RT3 C;  1N32 O;  4JI0 O;  2UUA O;  1A32 A;  4DV2 O;  2UXC O;  2DJV A;  1DK1 A;  5BXZ A;  4LF8 O;  1XNR O;  3SDL A;  4X62 O;  4OX9 O;  4JI5 O;  1YZB A;  4DUY O;  2VQF O;  4DV4 O;  4K0K O;  4DR4 O;  2F4V O;  4OPA A;  4YY3 O;  5LL6 Y;  5A2Q N;  4JI1 O;  1KUQ A;  2N74 A;  2VQE O;  2UUC O;  1FKA O;  4JI2 O;  1XMO O;  4B3S O;  4LFB O;  1AIL A;  4DR6 O;  1I94 O;  4X64 O;  1N36 O;  1G1X B;  4LF5 O;  4AQY O;  2JRI A;  2LW7 A;  4DV0 O;  4GKK O;  4OPH A;  5LMU O;  2Z0A A;  1HNX O;  2AGA A;  4LF6 O;  4DV1 O;  1N33 O;  3J81 N;  4DV6 O;  4DV5 O;  4JI4 O;  4DR2 O;  1IBM O;  2E5L O;  4JI6 O;  1N34 O;  1R1B A;  1HNW O;  1R6T A;  4NXM O;  5BY1 A;  4DR3 O;  1IBL O;  3T1Y O;  2UU9 O;  3F5T A;  4LF7 O;  1D2D A;  1FYJ A;  2UXD O;  5IT9 N;  3J7A U;  5BR8 O;  1J5E O;  5LMN O;  1AB3 A;  1HR0 O;  1NS1 A;  4JI3 O;  3M8A A;  3J80 N;  4DUZ O;  4LF4 O;  4DV3 O;  1XMQ O;  4YHH O;  4JYA O;  4B3M O;  3OTO O;  4JV5 O;  2UUB O;  3R66 A;  1XNQ O;  1IBK O;  5IWA O;  4LFA O;  4X65 O;  5H5N A;  4JI7 O;  3O65 A;  4DR1 O;  3T1H O;  4NXN O;  2ZKO A;  1HNZ O;  4JI8 O;  2UXB O;  4KHP O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...