4PA7A

Structure of navms pore and c-terminal domain crystallised in presence of channel blocking compound
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
92
structure length
92
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ion transport protein
publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
molecule tags Transport protein
total genus 33
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pa7A00
2P7TC 2AHZA 4G28B 4MVZA 4X89A 3AG3C 3SPCA 5CBFA 3TETA 1K4DC 4LBEC 5B3SC 4G27B 4GX2A 4QNHB 4J9ZB 1OCCC 4MVQA 5J9PC 2IH1C 3BEHA 3VOUA 2EIKC 5B1BC 4MW3A 3RBZA 3T4ZA 5BZBA 4MVUA 4I9WA 2WLJA 4RO2A 1BL8A 3UM7A 1P7BA 3WG7C 3E8BA 5EC1C 2QTOA 3RVYA 3T2MA 4WFFA 3SYCA 3HPLC 4OXSA 2H8PC 4PA4A 2EILC 3FB5C 3LDDA 4P9PA 4PDLA 4X8AA 5EBLC 4DXWA 1V54C 1ORQC 1R3LC 3STZC 3AG2C 2DYSC 3FB8C 4MVOA 4KFMA 3KG2A 2HVJC 4MTFA 2Q6AA 4WFGA 4GX5A 3AG4C 2ITCC 2ATKC 3LDEA 4F4LA 5EBWC 2A0LA 3ZJZA 2WLHA 3E83A 2HVKC 3E8FA 3OUSA 4H37A 5CBGA 4MTOA 1M56C 3FB6C 3PJSK 5EBMC 4PA9A 3JYCA 4R6ZA 4UUJC 4XDJA 5CBHA 3GB7C 4PA6A 2DWEC 4LCUC 1R3JC 2WLMA 3IGAC 4QE7A 1V55C 2DYRC 4WFEA 5B1AC 3SPHA 3UKMA 4PA7A 1KKDA 2X6CA 3F7VC 3X2QC 1QLEC 4PDVA 4XDKA 1JVMA 2WLIA 4MTGA 2Q67A 5KUMA 4J9YB 3K0DA 5KUKA 3SYQA 2HJFC 1LNQA 1XL4A 2WLLA 2IH3C 1J95A 2X6BA 3R65A 3RVZA 2W0FC 2WLIB 2WLKA 2AHYA 4PA3A 3SYAA 2K1EA 2X6AA 3SPIA 1ZWIC 2Y69C 1R3IC 3E89A 3SPGA 2ZD9A 3SYOA 2HG5C 3OR6C 2A9HA 3OR7C 4HZ3A 3T4DA 1OCZC 4PDMA 5EC2C 4BW5A 2A79B 1OCRC 1M57C 3F7YC 4GX1A 4CBCA 4MS2A 3SJQC 4ZBMA 2NLJC 3E86A 3K08A 2DWDC 3T1CA 1K4CC 4R8CA 4LP8A 4TWKA 3ASOC 4GX0A 3E8GA 4MVRA 4HYOA 4P2ZA 4WFHA 3K0GA 3STLC 3ASNC 3TCUA 3ZRSA 3IFXA 2WLNA 4RAIA 4JTAB 3K04A 2KB1A 2YEVA 3ABKC 3K03A 3EFFK 3OGCC 2ITDC 3K06A 3LUTB 4PDRA 2OCCC 4RUFA 2QKSA 1OCOC 3AG1C 2Q68A 3FB7C 2WLLB 4P9OA 4P30A 3LNMB 4EKWA 3ABMC 4QE9A 2BOBC 4MSWC 1S5HC 4MVSA 2ZXWC 4R50A 3LDCA 4X88A 3E8HA 4XDLA 3F5WC 1G4YB 5EK0A 3SYPA 4MW8A 2EINC 1R3KC 2R9RB 4JTCB 4R7CA 3OUFA 2JK5C 3ABLC 4RUEA 3RW0A 5IY5C 2EIMC 2Q69A 1XL6A 4MVMA 5E1AC 3SPJA 2BOCC 4H33A 4JTDB 2HFEC 2EIJC
chains in the Genus database with same CATH superfamily
2YIAA 3ZS8C 3NR7A 4YHHO 1FS0G 1M4UA 2EJ7A 4DO2A 5BR8B 4FM2A 1A32A 4X1YB 1OCCB 5D5PA 4DUZB 4DRXB 1S76D 1CP9A 4TV9B 4FZ0A 5JH7A 5JVDA 4JASA 1RSOA 1WA8A 3RYHA 3ZMTA 2DQ0A 3JAWA 1I7FA 3LDDA 3ZMUA 3M7MX 1GM8A 1ZL8A 4WFGA 3OEHG 1FJGB 3N27A 1T5EA 4DK1A 2QWRB 2ZR3A 3C90A 5IYCO 3GB7C 1W2BU 3T1HB 4LCUC 5IT9N 2FB5A 4X9QA 2IM9A 4DV7O 4JYAB 5B1NA 2F66C 1JVMA 2P6JA 2P90A 2WLIA 4YJ3B 2Q67A 2OYQA 2YS8A 1XMOB 5HFMA 3JAKA 1S77D 2BTQA 5JJNB 2W0FC 2OCCB 1EN4A 3ZEDA 4PA3A 1PL4A 1WB7A 1AVMA 4I4TB 4DV2O 4LF8B 2DJVA 3T4DA 3TK1A 4C7UA 2A79B 4Q20A 1URFA 5JQGB 1K73W 3I55V 1FFXB 4MS2A 2NLJC 1QHTA 4DUYO 4YIOA 4CC6A 3ASOB 2Y0IA 3ZN0A 3CCSV 1NKDA 4GX0A 4U3FH 4ZOLB 1IBLB 4BR6A 1B04A 1WPBA 1NU1H 2CE4A 3E22A 1D5NA 3K03A 3KCYA 3Q4HB 5B1BB 2ITDC 3H1IH 2F23A 2QKSA 1MG1A 2L6LA 1QU7A 4JI3B 2BOBC 1H2KA 3A2FA 2ZXWC 4OGQB 5B66Z 1NQTA 5LXTA 5E1AC 4IIJA 3JCUZ 4FVMA 2EJRA 1LUVA 4EFBA 4JAVA 5GTIZ 1IZ3A 1K5QA 4KL1A 1YCIA 2KG7B 3BRCA 3K79A 1EBOA 2NN4A 5J2UB 2GBOA 1Y76A 2F4VO 3JARA 4E4EA 1GRJA 2G38A 5CB4B 2UXCO 3HPLC 1YTFB 2H8PC 3OGIB 3FYIB 4JI1O 3ZHRA 2JJ2G 1K5SA 4DR5O 3ZBHA 1Z2GA 1WLEA 4OPHA 1L8DA 3DGEA 1LUWA 1N0NA 4JZGA 4X65O 1V9PA 3CSXA 5IJ9B 3CCVV 4XBFA 1H2MA 4JI0O 1Y66A 1AJQA 1E1QG 3JALB 2LFSA 2HLDG 5CBHA 4XDJA 3DXRB 3CMAV 4D6TH 1HR0B 4WFEA 4B3MO 4PA7A 3C3TA 1X59A 3GVMA 1W0JG 1FXHA 4FFBA 1MSDA 4AI8A 5DM6V 5IDJA 1GMGA 1J95A 3CCLV 2K1EA 2X6AA 2ZE6A 4DR3B 3G80A 3SPGA 2FYUH 3MHSC 1L1FA 4J10A 1KUQA 2QKAA 4LH6A 4DV0O 3TJTA 2E5LB 1VQLV 1KMIZ 4YJ2A 2CH7A 4JI7B 1YXBA 2QSAA 3O9OA 5D5QA 2OTLV 1BS3A 4CC5A 1N33B 3WG7B 3R66A 4DXWA 1WB8A 2XT9A 5L3GA 3F5WC 4H13B 4JI8B 1R3KC 4X62B 1SESA 2LW7A 1B6QA 3SPJA 1JA8A 4B3TB 4PHZA 3N2KA 3J80N 5JJEB 5KX5A 3VOUA 4FZ1A 2EIKC 4DV4B 5BZBA 1K7DA 3HKBA 2EILB 2OCHA 1WP7A 4I5SA 4G2KA 4JYBA 3J81N 4O2BA 1SQGA 4LF7B 1BQ0A 2GUZA 2UXBB 2P4VA 3GWKC 1AR5A 1EFRG 2RN9A 3AG4C 2ITCC 3W7XA 3RWRD 2WSSG 5CBGA 5EBMC 1S72V 1SQQH 1KKDA 4KXRA 5LA6B 2OWOA 1KKCA 2W6JG 4X1KA 1YF2A 4CS3A 5KHIA 1XL4A 3OT7A 2P22C 2VRZA 4X66O 5LGTA 1SQXH 1WN7A 3P30A 1XNRB 3UT5A 1Z5WA 4JV5O 1VQ4V 1K4CC 4R8CA 3UQ8A 3FD9A 1GAXA 1I5XA 4TWKA 1YDXA 4EFEA 4AQYB 3K0GA 4FM0A 2VQFB 3L73H 3EVKA 1AILA 5JWPA 3CCRV 4NXNB 3I56V 4IYIA 1O9GA 3ABLB 2QWQB 3K5NA 2GSMB 4H33A 1VF6C 1Q86W 1H8HG 2YXLA 3CB2A 5B3SB 4E2LA 2PTMA 3K5LA 2WPDG 3VQWA 1GN3A 4UVAA 3RBZA 3CC4V 4FK5C 3SYCA 1RFYA 4D7TA 4CH3A 4PA4A 5JH7B 1YHQV 1SRYA 1ORQC 1R3LC 2ADPA 1RSOB 2X7RB 1EZJA 2HEPA 3JAWB 1K33A 4ASUG 1SERA 5FLXN 2HVKC 1ZL8B 2ZDIC 1M57B 4R6ZA 5LYJA 3SPHA 4I7ZB 1V55C 1QNMA 2ZNJA 4PV1B 2PY5A 4RWUA 3ZHUA 4JGSA 3CEIA 4NXMB 2P4KA 2E74B 1NZ6A 4DR2B 2WLIB 2AHYA 1QQCA 3OTOB 2Y69C 4ICGA 1X4TA 1VF6A 5DN6G 5BMVA 1WAZA 5FNVA 3OTFA 1GN4A 1GM7A 5L3CA 3T1CA 1K3EA 2DOSA 2ZM6O 3THOA 5KHGA 3OE7G 2VWKA 4CH6A 1Y4MA 1JR9A 3OGCC 4MT8A 5FPRA 1OCOC 4O4IA 1TA8A 2QE7G 1P49A 2UUCO 4N21A 1Q43A 3RW0A 5IY5C 1I94O 2UUBO 4MVMA 1SQPH 2EIJB 2HFEC 3SYAA 2DN9A 2WA3A 1BT8A 3HKDB 5LXTB 4X89A 3A0RA 5CN0A 4KUMA 1IBMB 3BA8A 5CMUA 2ZDIA 2ZINA 3CCMV 4PI2A 4GX2A 1FKAO 3IAYA 4FLZA 5H6QA 2AGAA 3ABTA 4X20A 1N36O 5LGUA 1R73A 3JARB 1F51A 3FB5C 1NJIW 4WBNB 5KHKA 4MVOA 4MTFA 1PM9A 3JD4A 2R70A 2JEUA 1G6UA 4J7JA 1IDSA 1P4RA 4DYLA 2FKXA 3OUSA 3LSQA 1D2DA 2JGDB 3B8NA 1AP6A 1R6KA 2DYRC 1K92A 2F95B 3X2QB 2X6CA 5KAFZ 1QLEC 1R1BA 3ZCCA 3HKCA 2B9ZA 1VMGA 4LFAO 4CZZA 1KBHA 3BY6A 4ZI7A 4RQFA 3CCUV 2CTWA 2F43G 5BY1A 3K5MA 2X0LA 2KSDA 3SPIA 4LWSB 4JYCA 2QEXV 2R9AA 3SJCC 1OCZC 1N32B 3F7YC 3OEEG 3MAQA 1P7GA 4J42A 5LBQA 2R72A 1JJOA 3S3WA 3ZRXA 1I08A 2CDYA 4FMTA 4B3RB 3QO7A 2CH7B 2DQ3A 4LF6O 1HNZB 1NVPD 3ZRWA 1S5HC 3LDCA 2EINB 5LMUB 1AROP 5H2FZ 1AR1B 3CE2A 4L87A 5IYZA 1XL6A 1HNXB 4JTDB 1Q6HA 2P7TC 4B08A 1DLBA 1NI8A 1NTKH 5CA3A 1Q6IA 5KX5B 2QM7A 2QTOA 5GTHZ 3QNEA 4TV8B 4DV3B 2UU9O 2L35A 3ETDA 2Y4UA 3HKBB 5CA0A 3ZMSA 3AG2C 3CJHA 2ZCEA 3K58A 1EN6A 5L3EA 5K1XA 4DV5O 1VEWA 4O4LA 4LF9O 3JYCA 2EX3A 4UUJC 4JI5O 3TXSA 2O57A 2XHBA 2JGUA 5ITZB 4PDVA 1N8RW 5IJ0A 4O4JA 1UJWB 4DR7O 1TVKB 4GUNA 3L74H 1Y74A 4O2AA 5GONB 2ARHA 4NKGB 4UVBA 1FXKC 4X1KB 4LF4O 1ZUQA 1GO3F 1OHHG 1AP5A 3E35A 3PN1A 5A9GA 4JI2O 1J5EB 3E89A 1AJNA 1JX9A 2ZD9A 2ZE5A 1TUBB 5LHIA 3FKSG 1AI5A 2VQEO 3GWOA 1VQ6V 3ETGA 1KECA 4JAUA 3SJQC 3U0ZA 4LF5O 3JASA 1XHXA 3OMIB 3TCUA 5DECA 4YY3B 3HKEA 2EIKB 3H1HH 4PDRA 3VBBA 4EKWA 3IJ4A 1W0KG 3JD2A 4NTXA 4K3AA 2EIMC 1N34O 4I9WA 4G28B 1YIJV 2N05A 1ZLZA 3AG3C 2IJJA 1AR4A 4DR4O 2WA4A 1YSCA 4J9ZB 5A2QN 1DF5A 1SKVA 2GHYA 4W4LA 2H94A 1UFIA 3RYIB 3SJAC 1GK9A 1MZEA 2FL4A 3T1YB 1FXKA 4X8AA 1COWG 4AHCA 1XQ8A 5CA1A 1GKFA 2BTOA 5KMGA 5C8YA 2RQ6A 1Y67A 3CRMA 3LDEA 2JEXA 4WFAV 4DR1B 4I0XA 4A5UB 4ZKIA 3JSLA 3FB6C 3CRRA 2A7WA 1AJPA 3DSQA 2HKOA 4YHHB 2P06A 4PI0A 1XBLA 5BXZA 2YI8A 3G6EV 1PP9H 3UCSC 5J2TA 1IURA 2PYLA 3ZHVA 5IE9A 3P3NA 4JI4O 1NT2B 4CH5A 3ZMZA 2JRIA 1AI4A 4PDMA 1OCRB 4TOIA 1HW7A 4GKJO 3B4SA 2V4DA 3RYCA 2QM8A 3ZN1A 1XNQO 5LOVB 1SS3A 3LUTB 3ABUA 4DV6O 3AG1C 4BAYA 3FB7C 2WLLB 4P9OA 2EULA 4MSWC 2D2CB 2UUAO 2CTQA 3SYPA 1G4YB 4RUEA 4DV7B 4D7SA 4KHPO 2ZKOA 5LMNO 1O9HA 1RPRA 2AHZA 5JJJB 3SPCA 2QDOA 3H1KH 2JVDA 1OCCC 3L9DA 4DV2B 1PD3A 5LP6B 1ROPA 5EC1C 5IYDO 4JAAA 4AILC 5B1OA 1YTFD 3L72H 1TUEB 4DUYB 2Z3YA 3HR0A 2KKWA 3JD1A 1QR9A 2DYSB 2EBOA 3IC7A 1SZXA 3B77A 2ATKC 1PL0A 3JAMN 2JS5A 4UCVA 1SA0A 5KHHA 3AEIA 1YJWV 3IC9A 3ETEA 2DWEC 2F93B 3UKMA 2NR5A 2YUAA 1S3JA 2V1DA 3APOA 1P84F 1VP7A 2A06H 4J9YB 1ENVA 2IH3C 1BGYH 2DE0X 2QGNA 4X64O 1CXZB 1OCOB 2Q73A 1ZWIC 2F4VB 2BCCH 2UXCB 2Q7HA 3FX7A 2HHHO 4TT3G 5EZYB 2MW2B 2M6YA 4JI1B 3BPZA 4DR5B 4LNUB 3W7WA 4GKKO 2NNUA 3BAAA 1M5IA 3ASOC 4BIOA 4DRXA 2W6IG 3M99B 4MVRA 1CPYA 3ASNB 4P2ZA 4TV9A 4NB5A 1IX9A 3BVOA 4X65B 1CEZA 5AG2A 3B2EE 3RYFB 2Z0AA 4JI0B 5F2VO 5TISZ 2CTPA 4UCOA 1H2LA 1MA1A 4PJ0Z 4R50A 2EZOA 1WNSA 2PUSA 4B3MB 4QGPA 1NTZH 4QJFB 2Q69A 1WJZA 3MHHC 1Z5VA 4JYYA 2H3OA 3K9SA 1YVWA 1HNWO 1RPOA 3CCEV 2F1MA 4MTXA 3L71H 3JATA 4RO2A 3RVYA 1RP3B 1KU9A 2DYRB 4YJ3A 1Q5OA 4DV0B 2XAHA 3ICXA 4PDLA 4PELA 2PI4A 3O65A 3E2EA 1VQ7V 2EZPA 2ZIOA 4QPJA 2CUGA 3MDSA 4TQDA 5H5NA 1WP8A 5DEDA 2RNBA 5JQGA 1FFXA 3ETQA 4GYCB 1OCZB 3JD0A 2CGOA 4DK0A 2IJHA 1Q81W 3QO5A 4PA9A 1K34A 5B1AB 4PA6A 4ZOLA 5JVDB 1XMQO 1SZTA 1JFFA 3UO3A 1K97A 4XDKA 3Q4HA 4W4KA 1WA8B 3AK3A 3M8AA 4B3SO 3RYHB 1VQKV 3K0DA 3SYQA 1S5LZ 5LL6Y 3RVZA 4O4JB 2Q0AA 4ABMA 1AI6A 2A9HA 4HZ3A 1YI2V 4LFBO 1AI7A 4GX1A 2UXNA 1BZKA 4FIPC 3ZIAG 4OX9O 3ZRVA 5J2UA 1QBZA 2LP7A 3ZX6A 3ABKC 3TXQA 5CB4A 4J7KA 1M9NA 3OMNB 3JAKB 5JCOC 4KP4A 4DV1O 2BTQB 4JI6O 1K8AW 4BIUA 2Y0PA 3KKYA 4LH7A 1VQPV 4Z1MG 5IJ9A 4X66B 2P5OA 2B1GA 1HWYA 2B1IA 5IWAO 1KP3A 3JALA 4I55A 4LFCO 3JD3A 4DR6O 3DXRA 3E22B 3G67A 1IBKO 1S5JA 1BL8A 4K0KO 4JV5B 1VF7A 2EILC 3WB2A 4TUYA 1HP8A 3A0BZ 4F6RA 4IIJB 1H8EG 5KMGB 3K57A 5C8YB 1SETA 1Q6UA 3ZHTA 2HJDA 2HP8A 2WLMA 3APQA 3WU2Z 3EXAA 1Y76B 1YZBA 1VF5B 2YC0A 4H44B 3DC5A 2AXTZ 4MTGA 3OW2U 4JPRA 5JCOA 2W0XA 5BR8O 2WLKA 1GN6A 2XOKG 4DUZO 4FLVA 4IT5A 1XREA 1FD9A 4UCUA 4CBCA 1RM1C 4NR1A 4K8ZA 4EB6A 3CC7V 1AB3A 3K08A 4O4HA 3H01A 2Y48A 3JSNA 3E8GA 4HYOA 2WLNA 4RAIA 4JTAB 3RYCB 2KB1A 3AK1A 3EFFK 4FFBB 2LO1A 1XDCA 1NH2B 4Z2WA 3LNMB 2IU3A 4UCSA 2ZXWB 2E76B 3E8HA 4R7CA 4U7OA 4B7EA 1NR1A 2RCVA 3ABLC 4EEQA 1QLNA 3T1HO 4JYAO 2QJ1A 3TGUH 5CBFA 3ZHSA 1G1XB 1K4DC 4LBEC 5B3SC 1XMOO 4YJ2B 2IH1C 3B09A 5EYPA 1DF4A 2ZT9B 4MVUA 4LF8O 1KB9F 5LA6A 2CTRA 2AW9A 1B06A 2Z5UA 1MZFA 4P9PA 2ZM6B 1Q3EA 2QWPB 1V54C 4FPPA 3FAVA 2ETNA 4BIZA 3FB8C 3KG2A 4X1IA 1IBLO 5KLVH 2PI5A 4UV9A 1XI1A 1ZAUA 3N2KB 1I0HA 4QPKA 4UXNA 5IYBO 4IHJA 2UUCB 1M56C 2N04A 3PJSK 3D3QA 4JI3O 1I94B 3L70H 2UUBB 1JMKC 1YJNV 2XASA 2XAQA 4ZHQA 4UV8A 4FLWA 2X6BA 3CCJV 4O2BB 2GUZB 4GLXA 4WFBV 5KAIZ 4FLUA 1M1KW 1N36B 4BW5A 5GW7A 2KQXA 1SQFA 2GTAA 5E79Z 2DWDC 4CS2A 3KZIZ 4Q6GA 2BE3A 3FYEB 2YIDA 1G8MA 3G71V 2XAJA 2PGGA 2QKCA 4RUFA 3CRCA 4K35A 1DGSA 5FL7G 1VQ5V 2Q68A 2K9PA 3ABMC 3BHPA 1H2SB 3LNNA 4MW8A 2R9RB 1M93A 2CGNA 4LR3A 2Q9LA 3OFNG 2M7WA 1HR0O 3UT5B 2EIJC 3K3WA 4LFAB 2YXYA 3MD0A 4IYHA 1K9MW 3P3PA 3CYOA 1FFTB 1PNLA 4YIPA 3U11A 4DR3O 1GH6A 3LSSA 3E8BA 1U97A 2ZR2A 1QVFU 3JATB 2GDSA 2Q4PA 1UPGA 2E5LO 1L0LH 2GV9A 5H9CA 3BA9A 4WF9V 3QF7A 3AG4B 4JI7O 4LF6B 1QR8A 3BFRA 1FYJA 3ZJZA 2WLHA 4I50A 2A3QA 1ZSPA 1PNKA 1N4CA 1N33O 2ILMA 3F5TA 1EN5A 4U3JA 4JI8O 1VIBA 4X62O 3X2QC 1WPXA 4B3TO 1VARA 5KUMA 4NTWA 1JFFB 3K5OA 2LGWA 1FAFA 3R65A 2UXXA 2C2AA 2IU0A 1VQ9V 3OAAG 4J7ZA 2HG5C 3CP1A 4DV4O 2RMKB 2LJ2A 2Q8VA 3HKDA 2UU9B 2JIZG 3L75H 4ZBMA 1FXVA 1Q90D 3DTUB 1US6A 2V7QG 3CXCU 4TSFG 5LYJB 4LF7O 2UXBO 4Z1VA 1IVSA 3IFXA 3UO2A 1KD1W 2YEVA 3K06A 2IBZH 2AZ0A 2RJZA 4CS4A 3CRQA 3B40A 2ZQMA 3A8TA 3RT3C 4DV5B 4LF9B 4MVSA 4JI5B 4XDLA 1M90W 2VWJA 4WBNA 2EINC 2JK5C 3B8MA 3W7SA 1L0NH 4DR7B 4F4LA 3JCZA 3H1LH 5BMVB 1FPOA 5FNVB 1JJ2U 1PNMA 2QWNB 4LF4B 2ZNIA 1JPXA 2DW4A 4QNHB 1YJ9V 4HNAA 4JI2B 4MVQA 2JGDA 3CRAA 4UCRA 2VQEB 2N74A 1MNGA 4I55B 2Q7EA 3UM7A 2IJIA 2XTAA 2BSKA 4LC1A 1XNRO 4IL6Z 4O4IB 2WAMA 4LF5B 2OIGA 4HAMA 3SDLA 4LWSA 3AK2A 4AQYO 2AZ2A 4TUYB 4J80A 2VQFO 4F6RB 1JCHA 4ZIBA 4NXNO 1EZVH 1V55B 2QR4A 1N34B 2OTJV 3G4SV 1TGOA 4X20B 2XAGA 3QVNA 3G6BA 4DR4B 3ABKB 1LNQA 1MABG 4UCTA 1R6TA 5EIBD 5K1PA 2FMLA 1VQOV 4OPAA 1SQVH 2Y69B 4NVPA 1IXBA 1R3IC 3SYOA 1PV0A 2JS3A 1JOYA 1BSMA 1F7YA 5HFLA 3P32A 1D5AA 1KQSU 3VQVA 4EB6B 3STLC 4O4HB 1H2GA 2LW1A 3CD6V 3N2GA 2DMXA 3HKCB 1NTMH 3A0HZ 2IW5A 2UXDO 2CK3G 2D3OW 2OCCC 1B3QA 4TV8A 4BWAA 3CPWU 4GT1A 4ZI7B 1U96A 2XAFA 4FFKA 2YDEA 5EK0A 1VQNV 4JTCB 5IY5B 2MK3A 4PD4F 1E1RG 4WCEV 1SQBH 3D8CA 1ZTEA 4X1YA 3DC6A 4FLXA 2LQTA 3RN4A 4NXMO 4JI4B 4NYKA 4G27B 5J9PC 4DR2O 5B1BC 4MW3A 3T4ZA 3OTOO 2Q7GA 2QWOB 5ITZA 5EYPB 1TVKA 4GKJB 1QVGU 2FTKA 5GONA 3ZRWB 1XNQB 4RQEA 3QG5A 5IYZB 2HVJC 1F4MA 1TUBA 5C93A 3FAVB 3SR2C 4DV6B 5EBWC 3BCCH 4X1IB 1Q7YW 2UUAB 4MTOA 1MMMA 2YXHA 1RM1B 1BMFG 1IXMA 4IHJB 4KHPB 2R9IA 5LMNB 4GZRB 1QLEB 2CAZC 1NBMG 5B5EZ 3HB3B 4IGGA 3RGBA 4I4TA 1IBMO 5CA0B 5EIBC 4ZHQB 2LGQA 1S0VA 3WB1A 1H2NA 3AG7A 3CJHB 3OR6C 3OR7C 2IJKA 1JQ0A 1OCRC 2Q0OC 4J41A 3W7UA 3CX5F 1XEQA 3E86A 5LHHA 4O4LB 4LP8A 2RDCA 2YICA 3ZRSA 1VQMV 3K04A 5IJ0B 3RYIA 1W59A 1Y6XA 1Y74B 2HR3A 4CH4A 2B5UA 4O2AB 4P30A 1XHZA 1BHBA 4NTYA 3W7TA 1V54B 5KA5A 2KG7A 3CS5A 3WB0A 4DW1A 5LGNA 2PZSA 4X64B 2ADQB 2UXDB 1GM9A 3JASB 1Q8IA 3ZHQA 2JDIG 2XNDG 5LP6C 1M56B 2HHHB 3HKEB 1P7BA 3WG7C 2QM4A 1BCCH 3FFQA 2LFRA 4WFFA 3BABA 1N32O 1E79G 5L3BA 3RFRA 2XUMA 4K8XA 1DK1A 4GKKB 2YIBD 5KA6A 4QIWF 4UFZA 3AG2B 2DYSC 4KFMA 3ZMVA 1TAEA 1KYOF 2Q6AA 3QO8A 1Q82W 3EHBB 4B3RO 4FJCC 5LHGA 1KC8W 1BE3H 1HNZO 1N0JA 5L3DA 1GN2A 3S3XA 1MOFA 4I50B 3T2MA 1R3JC 3IGAC 4JZ2A 5LMUO 2YI9A 3SGIA 5LOVA 1HNXO 1MSWD 4U3JB 1HNWB 2HJFC 2WLLA 1QCEA 1OV9A 1FXKB 5CA1B 1KP2A 1LR1A 3ABMB 5FPOA 1I5YA 4H0LB 3CC2V 1SF9A 2ODMA 2P67A 4I0XB 4JF3A 4DV3O 2JJ1G 4YXWG 2GTSA 2OT5A 3U10A 3VQYA 4U7NA 1HDJA 3KCXA 5LP6A 3H9VA 4L8JA 3ASNC 4B7KA 1XOUA 4J11A 3LSUA 1BHAA 5J2TB 1NVPB 1F23A 2YEVB 2Y4TA 2ZE7A 4UB6Z 3OD4A 1PKXA 4QE9A 1OZ0A 3TETA 4BW9A 3OUFA 2EIMB 1XMQB 4I9QA 2WWWA 2BOCC 4B3SB 1NS1A 3AG3B 4MVZA 2PYJA 1R6NA 1OJHA 1YEWA 4UVCA 3BEHA 1EM1A 1XUQA 4LFBB 1FJGO 2Q5ZA 2WLJA 1THZA 4HNAB 1J5EO 3CXHF 4TQFA 4OXSA 5EBLC 2BSKB 4OX9B 3STZC 4GCZA 2OIEA 3K9AA 2ZIMA 3ML0A 3D36C 3QTCA 4GX5A 4YY3O 1NR7A 2A0LA 5EZYA 4HBNA 4DV1B 5L3FA 3E83A 3C3SA 3E8FA 2ZE8A 2PF4E 3I5DA 4FLTA 4H37A 1VQ8V 5KHJA 4LNUA 3SJBC 4JI6B 2YSUB 3OM3B 2QTSA 4FM1A 5B1AC 3CWBH 4QE7A 3F7VC 1DTOA 3J7AU 2E3CA 3RYFA 5KUKA 5IWAB 4F6EA 4LFCB 4DR6B 4FLYA 3WFVA 2QA4V 2VS0A 1IBKB 3CHXA 4UB8Z 3H1JH 3CMEV 4K0KB 3VQXA 5EC2C 3CCQV 1M57C 1SC5B 1SA0B 4N23A 3T1YO 5H6RA 4WFHA 1H38A 1XILA 1PPJH 3OMAB 1YITV 3K59A 2E75B 3AG1B 3D3IA 1ZX3A 3N2GB 1NH2D 2YIBA 4DR1O 4X88A 4DW0A 1GTOA 1F4NA 1BQZA 3NXSA 3D36A
chains in the Genus database with same CATH topology
3JCZA 4X89A 3A0RA 1PNMA 4KUMA 1FS0G 5CN0A 1JJ2U 4DO2A 5CMUA 2ZDIA 3CCMV 1JPXA 2DW4A 4GX2A 1OCCB 1RPOA 4QNHB 3CCEV 1YJ9V 4MVQA 1S76D 1CP9A 4MTXA 5H6QA 3UM7A 4RO2A 2IJIA 3RVYA 3ABTA 4LC1A 4JASA 2DYRB 5LGUA 2WAMA 1R73A 3ZMTA 2DQ0A 2XAHA 1F51A 3FB5C 3LDDA 4PDLA 4PELA 3ZMUA 1NJIW 2PI4A 4HAMA 3E2EA 1VQ7V 2EZPA 4MVOA 4MTFA 4QPJA 3JD4A 1GM8A 2JEUA 4WFGA 3OEHG 1P4RA 1OCZB 3JD0A 3OUSA 3LSQA 1JCHA 2IJHA 2ZR3A 3B8NA 3QO5A 1Q81W 4PA9A 1K34A 5B1AB 3GB7C 1R6KA 1V55B 4LCUC 4PA6A 5IYCO 1W2BU 2DYRC 2OTJV 1K92A 3X2QB 2X6CA 1SZTA 3G4SV 1QLEC 1K97A 5B1NA 3ZCCA 4XDKA 1JVMA 2P6JA 2P90A 2WLIA 2XAGA 2Q67A 1VQKV 5HFMA 3K0DA 3ABKB 3SYQA 1LNQA 4CZZA 1S77D 3RVZA 3BY6A 1MABG 2W0FC 2OCCB 4RQFA 3CCUV 1VQOV 4PA3A 2F43G 2X0LA 2Y69B 3SPIA 1R3IC 4JYCA 1AI6A 2QEXV 3SYOA 2A9HA 4HZ3A 3T4DA 3TK1A 1OCZC 1YI2V 1AI7A 2A79B 4Q20A 1JOYA 3F7YC 4GX1A 3I55V 1K73W 4MS2A 3OEEG 5HFLA 5LBQA 2NLJC 3P32A 2UXNA 1KQSU 4FIPC 3ZIAG 3ASOB 3ZN0A 3ZRXA 3CCSV 1NKDA 4GX0A 4FMTA 3STLC 3ZRVA 1H2GA 3QO7A 3CD6V 1QBZA 2LP7A 3K03A 3ABKC 5B1BB 2ITDC 2IW5A 2CK3G 2D3OW 2OCCC 2DQ3A 1M9NA 2QKSA 1NVPD 3OMNB 1MG1A 3CPWU 4KP4A 3ZRWA 4GT1A 2BOBC 2XAFA 1S5HC 2ZXWC 3LDCA 2EINB 5EK0A 1VQNV 4JTCB 5IY5B 1AROP 1NQTA 2MK3A 1K8AW 1AR1B 4L87A 1E1RG 4BIUA 1XL6A 4WCEV 5E1AC 4JTDB 2EJRA 2P7TC 1VQPV 4Z1MG 4JAVA 1DLBA 1K5QA 2B1GA 5CA3A 1HWYA 2B1IA 4G27B 1KP3A 3K79A 3JD3A 5J9PC 1EBOA 5B1BC 4MW3A 3T4ZA 1BL8A 2QM7A 2QTOA 3QNEA 3HPLC 1QVGU 1YTFB 2FTKA 2H8PC 2EILC 3FYIB 3ZRWB 3ETDA 2JJ2G 1K5SA 3ZMSA 3AG2C 4RQEA 2HVJC 1WLEA 1F4MA 5C93A 3DGEA 1H8EG 5EBWC 3CCVV 4XBFA 1Q7YW 1SETA 1Y66A 1AJQA 1E1QG 4MTOA 5L3EA 2LFSA 1RM1B 2HLDG 1BMFG 3JYCA 1IXMA 4UUJC 4XDJA 5CBHA 2R9IA 3CMAV 2WLMA 4WFEA 4PA7A 1QLEB 1NBMG 4PDVA 1N8RW 3HB3B 1W0JG 1UJWB 1FXHA 4MTGA 3OW2U 4JPRA 5DM6V 5IDJA 1GMGA 4UVBA 1J95A 1FXKC 2WLKA 1GO3F 1OHHG 2K1EA 3E35A 3CCLV 1S0VA 2X6AA 2XOKG 3E89A 1AJNA 1JX9A 3SPGA 2ZD9A 3MHSC 3OR6C 3OR7C 3FKSG 1AI5A 1L1FA 3GWOA 5LHIA 1VQ6V 2IJKA 1JQ0A 1OCRC 3ETGA 4CBCA 1KECA 3W7UA 1RM1C 4JAUA 3SJQC 3CC7V 3E86A 3K08A 5LHHA 3H01A 2Y48A 1VQLV 4LP8A 3OMIB 3E8GA 4HYOA 3TCUA 3ZRSA 1VQMV 2WLNA 4RAIA 4JTAB 3K04A 2KB1A 3EFFK 2EIKB 4PDRA 2HR3A 2OTLV 2B5UA 1NH2B 4P30A 3LNMB 2IU3A 3WG7B 3VBBA 4EKWA 2ZXWB 1BHBA 4DXWA 5L3GA 1W0KG 3E8HA 3JD2A 3F5WC 4R7CA 1R3KC 4U7OA 3ABLC 1NR1A 1SESA 2EIMC 3W7TA 1QLNA 1B6QA 1V54B 3SPJA 5KA5A 4I9WA 4G28B 1YIJV 5LGNA 3AG3C 5CBFA 2IJJA 1GM9A 1K4DC 4LBEC 5B3SC 1YSCA 4J9ZB 2IH1C 1DF5A 3VOUA 2EIKC 2JDIG 2XNDG 1DF4A 2GHYA 1M56B 5BZBA 4MVUA 2H94A 1P7BA 3WG7C 1K7DA 2LFRA 4WFFA 1GK9A 2EILB 1E79G 2Z5UA 5L3BA 4I5SA 4G2KA 4JYBA 4P9PA 1FXKA 4X8AA 1COWG 5KA6A 1V54C 4FPPA 4QIWF 3AG2B 4BIZA 1GKFA 2DYSC 3FB8C 4KFMA 3KG2A 3ZMVA 3QO8A 2Q6AA 1Q82W 3EHBB 2PI5A 1EFRG 3AG4C 2ITCC 4FJCC 3W7XA 3LDEA 4UV9A 2JEXA 5LHGA 4WFAV 1KC8W 4QPKA 4UXNA 5IYBO 2WSSG 4ZKIA 5CBGA 5L3DA 1M56C 3FB6C 3PJSK 5EBMC 1AJPA 1MOFA 1S72V 3T2MA 1R3JC 3IGAC 1KKDA 2HKOA 1YJNV 3G6EV 2W6JG 2XASA 1MSWD 2XAQA 2HJFC 1XL4A 1QCEA 2WLLA 4UV8A 1FXKB 2X6BA 3CCJV 5LGTA 1KP2A 3ZMZA 3P30A 4WFBV 3ABMB 1AI4A 1M1KW 1I5YA 4PDMA 1OCRB 5GW7A 4BW5A 3CC2V 2P67A 1VQ4V 2DWDC 1K4CC 4JF3A 4R8CA 2JJ1G 4YXWG 2QM8A 1I5XA 2OT5A 4TWKA 4U7NA 3FYEB 3K0GA 3ASNC 3ZN1A 1G8MA 3G71V 2XAJA 3LUTB 3ABUA 1BHAA 4RUFA 5FL7G 1NVPB 3AG1C 1VQ5V 2Q68A 4BAYA 1F23A 2WLLB 3FB7C 2YEVB 4P9OA 3CCRV 3ABMC 1PKXA 4QE9A 3I56V 4MSWC 1OZ0A 3TETA 3SYPA 1G4YB 4MW8A 2R9RB 3ABLB 4RUEA 3OUFA 2EIMB 3OFNG 2M7WA 2WWWA 2BOCC 2GSMB 4H33A 1RPRA 2EIJC 1Q86W 2AHZA 1H8HG 3K3WA 3AG3B 4MVZA 3MD0A 3SPCA 5B3SB 1R6NA 4E2LA 1K9MW 3CYOA 4UVCA 1FFTB 1OCCC 3BEHA 1PD3A 1PNLA 2WPDG 4UVAA 3RBZA 1ROPA 3LSSA 2WLJA 1THZA 3E8BA 5EC1C 5IYDO 3CC4V 2ZR2A 4FK5C 3SYCA 1QVFU 5B1OA 1YTFD 4OXSA 4PA4A 1TUEB 2Z3YA 1YHQV 5EBLC 3JD1A 1SRYA 1ORQC 1R3LC 3STZC 4GCZA 1QR9A 2DYSB 2X7RB 1EZJA 3K9AA 5H9CA 2EBOA 1K33A 4WF9V 3IC7A 4ASUG 3AG4B 3ML0A 3B77A 4GX5A 2ATKC 1PL0A 1NR7A 1SERA 4F4LA 1QR8A 2A0LA 3ZJZA 2WLHA 5L3FA 3E83A 2HVKC 2ZDIC 3E8FA 1PNKA 4H37A 1M57B 1VQ8V 3AEIA 1YJWV 4R6ZA 2YSUB 3OM3B 3ETEA 2DWEC 5B1AC 3SPHA 3UKMA 4QE7A 1V55C 3F7VC 3X2QC 1S3JA 1WPXA 1DTOA 2V1DA 4JGSA 5KUMA 4J9YB 5KUKA 1ENVA 2IH3C 3R65A 2UXXA 2WLIB 2C2AA 2AHYA 1OCOB 2IU0A 1VQ9V 3WFVA 2QA4V 3OAAG 1ZWIC 2Y69C 2HG5C 3CP1A 3CMEV 5EC2C 5DN6G 3CCQV 1M57C 4TT3G 2JIZG 4ZBMA 1GM7A 1FXVA 5L3CA 3DTUB 3T1CA 2V7QG 4N23A 3W7WA 1K3EA 2NNUA 4TSFG 3CXCU 3ASOC 2W6IG 3M99B 5H6RA 4MVRA 1CPYA 3ASNB 4P2ZA 4WFHA 1H38A 3OMAB 1YITV 3IFXA 3OE7G 1KD1W 1Y4MA 2YEVA 1CEZA 3OGCC 4MT8A 3K06A 3AG1B 3D3IA 1OCOC 2QE7G 2ZQMA 1NH2D 4MVSA 1M90W 4R50A 2EZOA 4XDLA 4X88A 4N21A 1GTOA 1F4NA 2EINC 2JK5C 3B8MA 3RW0A 4QJFB 5IY5C 2Q69A 3NXSA 4MVMA 3MHHC 3W7SA 2EIJB 3D36A 2HFEC 3SYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P7T C;  2AHZ A;  4G28 B;  4MVZ A;  4X89 A;  3AG3 C;  3SPC A;  5CBF A;  3TET A;  1K4D C;  4LBE C;  5B3S C;  4G27 B;  4GX2 A;  4QNH B;  4J9Z B;  1OCC C;  4MVQ A;  5J9P C;  2IH1 C;  3BEH A;  3VOU A;  2EIK C;  5B1B C;  4MW3 A;  3RBZ A;  3T4Z A;  5BZB A;  4MVU A;  4I9W A;  2WLJ A;  4RO2 A;  1BL8 A;  3UM7 A;  1P7B A;  3WG7 C;  3E8B A;  5EC1 C;  2QTO A;  3RVY A;  3T2M A;  4WFF A;  3SYC A;  3HPL C;  4OXS A;  2H8P C;  4PA4 A;  2EIL C;  3FB5 C;  3LDD A;  4P9P A;  4PDL A;  4X8A A;  5EBL C;  4DXW A;  1V54 C;  1ORQ C;  1R3L C;  3STZ C;  3AG2 C;  2DYS C;  3FB8 C;  4MVO A;  4KFM A;  3KG2 A;  2HVJ C;  4MTF A;  2Q6A A;  4WFG A;  4GX5 A;  3AG4 C;  2ITC C;  2ATK C;  3LDE A;  4F4L A;  5EBW C;  2A0L A;  3ZJZ A;  2WLH A;  3E83 A;  2HVK C;  3E8F A;  3OUS A;  4H37 A;  5CBG A;  4MTO A;  1M56 C;  3FB6 C;  3PJS K;  5EBM C;  4PA9 A;  3JYC A;  4R6Z A;  4UUJ C;  4XDJ A;  5CBH A;  3GB7 C;  4PA6 A;  2DWE C;  4LCU C;  1R3J C;  2WLM A;  3IGA C;  4QE7 A;  1V55 C;  2DYR C;  4WFE A;  5B1A C;  3SPH A;  3UKM A;  4PA7 A;  1KKD A;  2X6C A;  3F7V C;  3X2Q C;  1QLE C;  4PDV A;  4XDK A;  1JVM A;  2WLI A;  4MTG A;  2Q67 A;  5KUM A;  4J9Y B;  3K0D A;  5KUK A;  3SYQ A;  2HJF C;  1LNQ A;  1XL4 A;  2WLL A;  2IH3 C;  1J95 A;  2X6B A;  3R65 A;  3RVZ A;  2W0F C;  2WLI B;  2WLK A;  2AHY A;  4PA3 A;  3SYA A;  2K1E A;  2X6A A;  3SPI A;  1ZWI C;  2Y69 C;  1R3I C;  3E89 A;  3SPG A;  2ZD9 A;  3SYO A;  2HG5 C;  3OR6 C;  2A9H A;  3OR7 C;  4HZ3 A;  3T4D A;  1OCZ C;  4PDM A;  5EC2 C;  4BW5 A;  2A79 B;  1OCR C;  1M57 C;  3F7Y C;  4GX1 A;  4CBC A;  4MS2 A;  3SJQ C;  4ZBM A;  2NLJ C;  3E86 A;  3K08 A;  2DWD C;  3T1C A;  1K4C C;  4R8C A;  4LP8 A;  4TWK A;  3ASO C;  4GX0 A;  3E8G A;  4MVR A;  4HYO A;  4P2Z A;  4WFH A;  3K0G A;  3STL C;  3ASN C;  3TCU A;  3ZRS A;  3IFX A;  2WLN A;  4RAI A;  4JTA B;  3K04 A;  2KB1 A;  2YEV A;  3ABK C;  3K03 A;  3EFF K;  3OGC C;  2ITD C;  3K06 A;  3LUT B;  4PDR A;  2OCC C;  4RUF A;  2QKS A;  1OCO C;  3AG1 C;  2Q68 A;  3FB7 C;  2WLL B;  4P9O A;  4P30 A;  3LNM B;  4EKW A;  3ABM C;  4QE9 A;  2BOB C;  4MSW C;  1S5H C;  4MVS A;  2ZXW C;  4R50 A;  3LDC A;  4X88 A;  3E8H A;  4XDL A;  3F5W C;  1G4Y B;  5EK0 A;  3SYP A;  4MW8 A;  2EIN C;  1R3K C;  2R9R B;  4JTC B;  4R7C A;  3OUF A;  2JK5 C;  3ABL C;  4RUE A;  3RW0 A;  5IY5 C;  2EIM C;  2Q69 A;  1XL6 A;  4MVM A;  5E1A C;  3SPJ A;  2BOC C;  4H33 A;  4JTD B;  2HFE C;  2EIJ C; 
#chains in the Genus database with same CATH topology
 2YIA A;  3ZS8 C;  3NR7 A;  4YHH O;  1FS0 G;  1M4U A;  2EJ7 A;  4DO2 A;  5BR8 B;  4FM2 A;  1A32 A;  4X1Y B;  1OCC B;  5D5P A;  4DUZ B;  4DRX B;  1S76 D;  1CP9 A;  4TV9 B;  4FZ0 A;  5JH7 A;  5JVD A;  4JAS A;  1RSO A;  1WA8 A;  3RYH A;  3ZMT A;  2DQ0 A;  3JAW A;  1I7F A;  3LDD A;  3ZMU A;  3M7M X;  1GM8 A;  1ZL8 A;  4WFG A;  3OEH G;  1FJG B;  3N27 A;  1T5E A;  4DK1 A;  2QWR B;  2ZR3 A;  3C90 A;  5IYC O;  3GB7 C;  1W2B U;  3T1H B;  4LCU C;  5IT9 N;  2FB5 A;  4X9Q A;  2IM9 A;  4DV7 O;  4JYA B;  5B1N A;  2F66 C;  1JVM A;  2P6J A;  2P90 A;  2WLI A;  4YJ3 B;  2Q67 A;  2OYQ A;  2YS8 A;  1XMO B;  5HFM A;  3JAK A;  1S77 D;  2BTQ A;  5JJN B;  2W0F C;  2OCC B;  1EN4 A;  3ZED A;  4PA3 A;  1PL4 A;  1WB7 A;  1AVM A;  4I4T B;  4DV2 O;  4LF8 B;  2DJV A;  3T4D A;  3TK1 A;  4C7U A;  2A79 B;  4Q20 A;  1URF A;  5JQG B;  1K73 W;  3I55 V;  1FFX B;  4MS2 A;  2NLJ C;  1QHT A;  4DUY O;  4YIO A;  4CC6 A;  3ASO B;  2Y0I A;  3ZN0 A;  3CCS V;  1NKD A;  4GX0 A;  4U3F H;  4ZOL B;  1IBL B;  4BR6 A;  1B04 A;  1WPB A;  1NU1 H;  2CE4 A;  3E22 A;  1D5N A;  3K03 A;  3KCY A;  3Q4H B;  5B1B B;  2ITD C;  3H1I H;  2F23 A;  2QKS A;  1MG1 A;  2L6L A;  1QU7 A;  4JI3 B;  2BOB C;  1H2K A;  3A2F A;  2ZXW C;  4OGQ B;  5B66 Z;  1NQT A;  5LXT A;  5E1A C;  4IIJ A;  3JCU Z;  4FVM A;  2EJR A;  1LUV A;  4EFB A;  4JAV A;  5GTI Z;  1IZ3 A;  1K5Q A;  4KL1 A;  1YCI A;  2KG7 B;  3BRC A;  3K79 A;  1EBO A;  2NN4 A;  5J2U B;  2GBO A;  1Y76 A;  2F4V O;  3JAR A;  4E4E A;  1GRJ A;  2G38 A;  5CB4 B;  2UXC O;  3HPL C;  1YTF B;  2H8P C;  3OGI B;  3FYI B;  4JI1 O;  3ZHR A;  2JJ2 G;  1K5S A;  4DR5 O;  3ZBH A;  1Z2G A;  1WLE A;  4OPH A;  1L8D A;  3DGE A;  1LUW A;  1N0N A;  4JZG A;  4X65 O;  1V9P A;  3CSX A;  5IJ9 B;  3CCV V;  4XBF A;  1H2M A;  4JI0 O;  1Y66 A;  1AJQ A;  1E1Q G;  3JAL B;  2LFS A;  2HLD G;  5CBH A;  4XDJ A;  3DXR B;  3CMA V;  4D6T H;  1HR0 B;  4WFE A;  4B3M O;  4PA7 A;  3C3T A;  1X59 A;  3GVM A;  1W0J G;  1FXH A;  4FFB A;  1MSD A;  4AI8 A;  5DM6 V;  5IDJ A;  1GMG A;  1J95 A;  3CCL V;  2K1E A;  2X6A A;  2ZE6 A;  4DR3 B;  3G80 A;  3SPG A;  2FYU H;  3MHS C;  1L1F A;  4J10 A;  1KUQ A;  2QKA A;  4LH6 A;  4DV0 O;  3TJT A;  2E5L B;  1VQL V;  1KMI Z;  4YJ2 A;  2CH7 A;  4JI7 B;  1YXB A;  2QSA A;  3O9O A;  5D5Q A;  2OTL V;  1BS3 A;  4CC5 A;  1N33 B;  3WG7 B;  3R66 A;  4DXW A;  1WB8 A;  2XT9 A;  5L3G A;  3F5W C;  4H13 B;  4JI8 B;  1R3K C;  4X62 B;  1SES A;  2LW7 A;  1B6Q A;  3SPJ A;  1JA8 A;  4B3T B;  4PHZ A;  3N2K A;  3J80 N;  5JJE B;  5KX5 A;  3VOU A;  4FZ1 A;  2EIK C;  4DV4 B;  5BZB A;  1K7D A;  3HKB A;  2EIL B;  2OCH A;  1WP7 A;  4I5S A;  4G2K A;  4JYB A;  3J81 N;  4O2B A;  1SQG A;  4LF7 B;  1BQ0 A;  2GUZ A;  2UXB B;  2P4V A;  3GWK C;  1AR5 A;  1EFR G;  2RN9 A;  3AG4 C;  2ITC C;  3W7X A;  3RWR D;  2WSS G;  5CBG A;  5EBM C;  1S72 V;  1SQQ H;  1KKD A;  4KXR A;  5LA6 B;  2OWO A;  1KKC A;  2W6J G;  4X1K A;  1YF2 A;  4CS3 A;  5KHI A;  1XL4 A;  3OT7 A;  2P22 C;  2VRZ A;  4X66 O;  5LGT A;  1SQX H;  1WN7 A;  3P30 A;  1XNR B;  3UT5 A;  1Z5W A;  4JV5 O;  1VQ4 V;  1K4C C;  4R8C A;  3UQ8 A;  3FD9 A;  1GAX A;  1I5X A;  4TWK A;  1YDX A;  4EFE A;  4AQY B;  3K0G A;  4FM0 A;  2VQF B;  3L73 H;  3EVK A;  1AIL A;  5JWP A;  3CCR V;  4NXN B;  3I56 V;  4IYI A;  1O9G A;  3ABL B;  2QWQ B;  3K5N A;  2GSM B;  4H33 A;  1VF6 C;  1Q86 W;  1H8H G;  2YXL A;  3CB2 A;  5B3S B;  4E2L A;  2PTM A;  3K5L A;  2WPD G;  3VQW A;  1GN3 A;  4UVA A;  3RBZ A;  3CC4 V;  4FK5 C;  3SYC A;  1RFY A;  4D7T A;  4CH3 A;  4PA4 A;  5JH7 B;  1YHQ V;  1SRY A;  1ORQ C;  1R3L C;  2ADP A;  1RSO B;  2X7R B;  1EZJ A;  2HEP A;  3JAW B;  1K33 A;  4ASU G;  1SER A;  5FLX N;  2HVK C;  1ZL8 B;  2ZDI C;  1M57 B;  4R6Z A;  5LYJ A;  3SPH A;  4I7Z B;  1V55 C;  1QNM A;  2ZNJ A;  4PV1 B;  2PY5 A;  4RWU A;  3ZHU A;  4JGS A;  3CEI A;  4NXM B;  2P4K A;  2E74 B;  1NZ6 A;  4DR2 B;  2WLI B;  2AHY A;  1QQC A;  3OTO B;  2Y69 C;  4ICG A;  1X4T A;  1VF6 A;  5DN6 G;  5BMV A;  1WAZ A;  5FNV A;  3OTF A;  1GN4 A;  1GM7 A;  5L3C A;  3T1C A;  1K3E A;  2DOS A;  2ZM6 O;  3THO A;  5KHG A;  3OE7 G;  2VWK A;  4CH6 A;  1Y4M A;  1JR9 A;  3OGC C;  4MT8 A;  5FPR A;  1OCO C;  4O4I A;  1TA8 A;  2QE7 G;  1P49 A;  2UUC O;  4N21 A;  1Q43 A;  3RW0 A;  5IY5 C;  1I94 O;  2UUB O;  4MVM A;  1SQP H;  2EIJ B;  2HFE C;  3SYA A;  2DN9 A;  2WA3 A;  1BT8 A;  3HKD B;  5LXT B;  4X89 A;  3A0R A;  5CN0 A;  4KUM A;  1IBM B;  3BA8 A;  5CMU A;  2ZDI A;  2ZIN A;  3CCM V;  4PI2 A;  4GX2 A;  1FKA O;  3IAY A;  4FLZ A;  5H6Q A;  2AGA A;  3ABT A;  4X20 A;  1N36 O;  5LGU A;  1R73 A;  3JAR B;  1F51 A;  3FB5 C;  1NJI W;  4WBN B;  5KHK A;  4MVO A;  4MTF A;  1PM9 A;  3JD4 A;  2R70 A;  2JEU A;  1G6U A;  4J7J A;  1IDS A;  1P4R A;  4DYL A;  2FKX A;  3OUS A;  3LSQ A;  1D2D A;  2JGD B;  3B8N A;  1AP6 A;  1R6K A;  2DYR C;  1K92 A;  2F95 B;  3X2Q B;  2X6C A;  5KAF Z;  1QLE C;  1R1B A;  3ZCC A;  3HKC A;  2B9Z A;  1VMG A;  4LFA O;  4CZZ A;  1KBH A;  3BY6 A;  4ZI7 A;  4RQF A;  3CCU V;  2CTW A;  2F43 G;  5BY1 A;  3K5M A;  2X0L A;  2KSD A;  3SPI A;  4LWS B;  4JYC A;  2QEX V;  2R9A A;  3SJC C;  1OCZ C;  1N32 B;  3F7Y C;  3OEE G;  3MAQ A;  1P7G A;  4J42 A;  5LBQ A;  2R72 A;  1JJO A;  3S3W A;  3ZRX A;  1I08 A;  2CDY A;  4FMT A;  4B3R B;  3QO7 A;  2CH7 B;  2DQ3 A;  4LF6 O;  1HNZ B;  1NVP D;  3ZRW A;  1S5H C;  3LDC A;  2EIN B;  5LMU B;  1ARO P;  5H2F Z;  1AR1 B;  3CE2 A;  4L87 A;  5IYZ A;  1XL6 A;  1HNX B;  4JTD B;  1Q6H A;  2P7T C;  4B08 A;  1DLB A;  1NI8 A;  1NTK H;  5CA3 A;  1Q6I A;  5KX5 B;  2QM7 A;  2QTO A;  5GTH Z;  3QNE A;  4TV8 B;  4DV3 B;  2UU9 O;  2L35 A;  3ETD A;  2Y4U A;  3HKB B;  5CA0 A;  3ZMS A;  3AG2 C;  3CJH A;  2ZCE A;  3K58 A;  1EN6 A;  5L3E A;  5K1X A;  4DV5 O;  1VEW A;  4O4L A;  4LF9 O;  3JYC A;  2EX3 A;  4UUJ C;  4JI5 O;  3TXS A;  2O57 A;  2XHB A;  2JGU A;  5ITZ B;  4PDV A;  1N8R W;  5IJ0 A;  4O4J A;  1UJW B;  4DR7 O;  1TVK B;  4GUN A;  3L74 H;  1Y74 A;  4O2A A;  5GON B;  2ARH A;  4NKG B;  4UVB A;  1FXK C;  4X1K B;  4LF4 O;  1ZUQ A;  1GO3 F;  1OHH G;  1AP5 A;  3E35 A;  3PN1 A;  5A9G A;  4JI2 O;  1J5E B;  3E89 A;  1AJN A;  1JX9 A;  2ZD9 A;  2ZE5 A;  1TUB B;  5LHI A;  3FKS G;  1AI5 A;  2VQE O;  3GWO A;  1VQ6 V;  3ETG A;  1KEC A;  4JAU A;  3SJQ C;  3U0Z A;  4LF5 O;  3JAS A;  1XHX A;  3OMI B;  3TCU A;  5DEC A;  4YY3 B;  3HKE A;  2EIK B;  3H1H H;  4PDR A;  3VBB A;  4EKW A;  3IJ4 A;  1W0K G;  3JD2 A;  4NTX A;  4K3A A;  2EIM C;  1N34 O;  4I9W A;  4G28 B;  1YIJ V;  2N05 A;  1ZLZ A;  3AG3 C;  2IJJ A;  1AR4 A;  4DR4 O;  2WA4 A;  1YSC A;  4J9Z B;  5A2Q N;  1DF5 A;  1SKV A;  2GHY A;  4W4L A;  2H94 A;  1UFI A;  3RYI B;  3SJA C;  1GK9 A;  1MZE A;  2FL4 A;  3T1Y B;  1FXK A;  4X8A A;  1COW G;  4AHC A;  1XQ8 A;  5CA1 A;  1GKF A;  2BTO A;  5KMG A;  5C8Y A;  2RQ6 A;  1Y67 A;  3CRM A;  3LDE A;  2JEX A;  4WFA V;  4DR1 B;  4I0X A;  4A5U B;  4ZKI A;  3JSL A;  3FB6 C;  3CRR A;  2A7W A;  1AJP A;  3DSQ A;  2HKO A;  4YHH B;  2P06 A;  4PI0 A;  1XBL A;  5BXZ A;  2YI8 A;  3G6E V;  1PP9 H;  3UCS C;  5J2T A;  1IUR A;  2PYL A;  3ZHV A;  5IE9 A;  3P3N A;  4JI4 O;  1NT2 B;  4CH5 A;  3ZMZ A;  2JRI A;  1AI4 A;  4PDM A;  1OCR B;  4TOI A;  1HW7 A;  4GKJ O;  3B4S A;  2V4D A;  3RYC A;  2QM8 A;  3ZN1 A;  1XNQ O;  5LOV B;  1SS3 A;  3LUT B;  3ABU A;  4DV6 O;  3AG1 C;  4BAY A;  3FB7 C;  2WLL B;  4P9O A;  2EUL A;  4MSW C;  2D2C B;  2UUA O;  2CTQ A;  3SYP A;  1G4Y B;  4RUE A;  4DV7 B;  4D7S A;  4KHP O;  2ZKO A;  5LMN O;  1O9H A;  1RPR A;  2AHZ A;  5JJJ B;  3SPC A;  2QDO A;  3H1K H;  2JVD A;  1OCC C;  3L9D A;  4DV2 B;  1PD3 A;  5LP6 B;  1ROP A;  5EC1 C;  5IYD O;  4JAA A;  4AIL C;  5B1O A;  1YTF D;  3L72 H;  1TUE B;  4DUY B;  2Z3Y A;  3HR0 A;  2KKW A;  3JD1 A;  1QR9 A;  2DYS B;  2EBO A;  3IC7 A;  1SZX A;  3B77 A;  2ATK C;  1PL0 A;  3JAM N;  2JS5 A;  4UCV A;  1SA0 A;  5KHH A;  3AEI A;  1YJW V;  3IC9 A;  3ETE A;  2DWE C;  2F93 B;  3UKM A;  2NR5 A;  2YUA A;  1S3J A;  2V1D A;  3APO A;  1P84 F;  1VP7 A;  2A06 H;  4J9Y B;  1ENV A;  2IH3 C;  1BGY H;  2DE0 X;  2QGN A;  4X64 O;  1CXZ B;  1OCO B;  2Q73 A;  1ZWI C;  2F4V B;  2BCC H;  2UXC B;  2Q7H A;  3FX7 A;  2HHH O;  4TT3 G;  5EZY B;  2MW2 B;  2M6Y A;  4JI1 B;  3BPZ A;  4DR5 B;  4LNU B;  3W7W A;  4GKK O;  2NNU A;  3BAA A;  1M5I A;  3ASO C;  4BIO A;  4DRX A;  2W6I G;  3M99 B;  4MVR A;  1CPY A;  3ASN B;  4P2Z A;  4TV9 A;  4NB5 A;  1IX9 A;  3BVO A;  4X65 B;  1CEZ A;  5AG2 A;  3B2E E;  3RYF B;  2Z0A A;  4JI0 B;  5F2V O;  5TIS Z;  2CTP A;  4UCO A;  1H2L A;  1MA1 A;  4PJ0 Z;  4R50 A;  2EZO A;  1WNS A;  2PUS A;  4B3M B;  4QGP A;  1NTZ H;  4QJF B;  2Q69 A;  1WJZ A;  3MHH C;  1Z5V A;  4JYY A;  2H3O A;  3K9S A;  1YVW A;  1HNW O;  1RPO A;  3CCE V;  2F1M A;  4MTX A;  3L71 H;  3JAT A;  4RO2 A;  3RVY A;  1RP3 B;  1KU9 A;  2DYR B;  4YJ3 A;  1Q5O A;  4DV0 B;  2XAH A;  3ICX A;  4PDL A;  4PEL A;  2PI4 A;  3O65 A;  3E2E A;  1VQ7 V;  2EZP A;  2ZIO A;  4QPJ A;  2CUG A;  3MDS A;  4TQD A;  5H5N A;  1WP8 A;  5DED A;  2RNB A;  5JQG A;  1FFX A;  3ETQ A;  4GYC B;  1OCZ B;  3JD0 A;  2CGO A;  4DK0 A;  2IJH A;  1Q81 W;  3QO5 A;  4PA9 A;  1K34 A;  5B1A B;  4PA6 A;  4ZOL A;  5JVD B;  1XMQ O;  1SZT A;  1JFF A;  3UO3 A;  1K97 A;  4XDK A;  3Q4H A;  4W4K A;  1WA8 B;  3AK3 A;  3M8A A;  4B3S O;  3RYH B;  1VQK V;  3K0D A;  3SYQ A;  1S5L Z;  5LL6 Y;  3RVZ A;  4O4J B;  2Q0A A;  4ABM A;  1AI6 A;  2A9H A;  4HZ3 A;  1YI2 V;  4LFB O;  1AI7 A;  4GX1 A;  2UXN A;  1BZK A;  4FIP C;  3ZIA G;  4OX9 O;  3ZRV A;  5J2U A;  1QBZ A;  2LP7 A;  3ZX6 A;  3ABK C;  3TXQ A;  5CB4 A;  4J7K A;  1M9N A;  3OMN B;  3JAK B;  5JCO C;  4KP4 A;  4DV1 O;  2BTQ B;  4JI6 O;  1K8A W;  4BIU A;  2Y0P A;  3KKY A;  4LH7 A;  1VQP V;  4Z1M G;  5IJ9 A;  4X66 B;  2P5O A;  2B1G A;  1HWY A;  2B1I A;  5IWA O;  1KP3 A;  3JAL A;  4I55 A;  4LFC O;  3JD3 A;  4DR6 O;  3DXR A;  3E22 B;  3G67 A;  1IBK O;  1S5J A;  1BL8 A;  4K0K O;  4JV5 B;  1VF7 A;  2EIL C;  3WB2 A;  4TUY A;  1HP8 A;  3A0B Z;  4F6R A;  4IIJ B;  1H8E G;  5KMG B;  3K57 A;  5C8Y B;  1SET A;  1Q6U A;  3ZHT A;  2HJD A;  2HP8 A;  2WLM A;  3APQ A;  3WU2 Z;  3EXA A;  1Y76 B;  1YZB A;  1VF5 B;  2YC0 A;  4H44 B;  3DC5 A;  2AXT Z;  4MTG A;  3OW2 U;  4JPR A;  5JCO A;  2W0X A;  5BR8 O;  2WLK A;  1GN6 A;  2XOK G;  4DUZ O;  4FLV A;  4IT5 A;  1XRE A;  1FD9 A;  4UCU A;  4CBC A;  1RM1 C;  4NR1 A;  4K8Z A;  4EB6 A;  3CC7 V;  1AB3 A;  3K08 A;  4O4H A;  3H01 A;  2Y48 A;  3JSN A;  3E8G A;  4HYO A;  2WLN A;  4RAI A;  4JTA B;  3RYC B;  2KB1 A;  3AK1 A;  3EFF K;  4FFB B;  2LO1 A;  1XDC A;  1NH2 B;  4Z2W A;  3LNM B;  2IU3 A;  4UCS A;  2ZXW B;  2E76 B;  3E8H A;  4R7C A;  4U7O A;  4B7E A;  1NR1 A;  2RCV A;  3ABL C;  4EEQ A;  1QLN A;  3T1H O;  4JYA O;  2QJ1 A;  3TGU H;  5CBF A;  3ZHS A;  1G1X B;  1K4D C;  4LBE C;  5B3S C;  1XMO O;  4YJ2 B;  2IH1 C;  3B09 A;  5EYP A;  1DF4 A;  2ZT9 B;  4MVU A;  4LF8 O;  1KB9 F;  5LA6 A;  2CTR A;  2AW9 A;  1B06 A;  2Z5U A;  1MZF A;  4P9P A;  2ZM6 B;  1Q3E A;  2QWP B;  1V54 C;  4FPP A;  3FAV A;  2ETN A;  4BIZ A;  3FB8 C;  3KG2 A;  4X1I A;  1IBL O;  5KLV H;  2PI5 A;  4UV9 A;  1XI1 A;  1ZAU A;  3N2K B;  1I0H A;  4QPK A;  4UXN A;  5IYB O;  4IHJ A;  2UUC B;  1M56 C;  2N04 A;  3PJS K;  3D3Q A;  4JI3 O;  1I94 B;  3L70 H;  2UUB B;  1JMK C;  1YJN V;  2XAS A;  2XAQ A;  4ZHQ A;  4UV8 A;  4FLW A;  2X6B A;  3CCJ V;  4O2B B;  2GUZ B;  4GLX A;  4WFB V;  5KAI Z;  4FLU A;  1M1K W;  1N36 B;  4BW5 A;  5GW7 A;  2KQX A;  1SQF A;  2GTA A;  5E79 Z;  2DWD C;  4CS2 A;  3KZI Z;  4Q6G A;  2BE3 A;  3FYE B;  2YID A;  1G8M A;  3G71 V;  2XAJ A;  2PGG A;  2QKC A;  4RUF A;  3CRC A;  4K35 A;  1DGS A;  5FL7 G;  1VQ5 V;  2Q68 A;  2K9P A;  3ABM C;  3BHP A;  1H2S B;  3LNN A;  4MW8 A;  2R9R B;  1M93 A;  2CGN A;  4LR3 A;  2Q9L A;  3OFN G;  2M7W A;  1HR0 O;  3UT5 B;  2EIJ C;  3K3W A;  4LFA B;  2YXY A;  3MD0 A;  4IYH A;  1K9M W;  3P3P A;  3CYO A;  1FFT B;  1PNL A;  4YIP A;  3U11 A;  4DR3 O;  1GH6 A;  3LSS A;  3E8B A;  1U97 A;  2ZR2 A;  1QVF U;  3JAT B;  2GDS A;  2Q4P A;  1UPG A;  2E5L O;  1L0L H;  2GV9 A;  5H9C A;  3BA9 A;  4WF9 V;  3QF7 A;  3AG4 B;  4JI7 O;  4LF6 B;  1QR8 A;  3BFR A;  1FYJ A;  3ZJZ A;  2WLH A;  4I50 A;  2A3Q A;  1ZSP A;  1PNK A;  1N4C A;  1N33 O;  2ILM A;  3F5T A;  1EN5 A;  4U3J A;  4JI8 O;  1VIB A;  4X62 O;  3X2Q C;  1WPX A;  4B3T O;  1VAR A;  5KUM A;  4NTW A;  1JFF B;  3K5O A;  2LGW A;  1FAF A;  3R65 A;  2UXX A;  2C2A A;  2IU0 A;  1VQ9 V;  3OAA G;  4J7Z A;  2HG5 C;  3CP1 A;  4DV4 O;  2RMK B;  2LJ2 A;  2Q8V A;  3HKD A;  2UU9 B;  2JIZ G;  3L75 H;  4ZBM A;  1FXV A;  1Q90 D;  3DTU B;  1US6 A;  2V7Q G;  3CXC U;  4TSF G;  5LYJ B;  4LF7 O;  2UXB O;  4Z1V A;  1IVS A;  3IFX A;  3UO2 A;  1KD1 W;  2YEV A;  3K06 A;  2IBZ H;  2AZ0 A;  2RJZ A;  4CS4 A;  3CRQ A;  3B40 A;  2ZQM A;  3A8T A;  3RT3 C;  4DV5 B;  4LF9 B;  4MVS A;  4JI5 B;  4XDL A;  1M90 W;  2VWJ A;  4WBN A;  2EIN C;  2JK5 C;  3B8M A;  3W7S A;  1L0N H;  4DR7 B;  4F4L A;  3JCZ A;  3H1L H;  5BMV B;  1FPO A;  5FNV B;  1JJ2 U;  1PNM A;  2QWN B;  4LF4 B;  2ZNI A;  1JPX A;  2DW4 A;  4QNH B;  1YJ9 V;  4HNA A;  4JI2 B;  4MVQ A;  2JGD A;  3CRA A;  4UCR A;  2VQE B;  2N74 A;  1MNG A;  4I55 B;  2Q7E A;  3UM7 A;  2IJI A;  2XTA A;  2BSK A;  4LC1 A;  1XNR O;  4IL6 Z;  4O4I B;  2WAM A;  4LF5 B;  2OIG A;  4HAM A;  3SDL A;  4LWS A;  3AK2 A;  4AQY O;  2AZ2 A;  4TUY B;  4J80 A;  2VQF O;  4F6R B;  1JCH A;  4ZIB A;  4NXN O;  1EZV H;  1V55 B;  2QR4 A;  1N34 B;  2OTJ V;  3G4S V;  1TGO A;  4X20 B;  2XAG A;  3QVN A;  3G6B A;  4DR4 B;  3ABK B;  1LNQ A;  1MAB G;  4UCT A;  1R6T A;  5EIB D;  5K1P A;  2FML A;  1VQO V;  4OPA A;  1SQV H;  2Y69 B;  4NVP A;  1IXB A;  1R3I C;  3SYO A;  1PV0 A;  2JS3 A;  1JOY A;  1BSM A;  1F7Y A;  5HFL A;  3P32 A;  1D5A A;  1KQS U;  3VQV A;  4EB6 B;  3STL C;  4O4H B;  1H2G A;  2LW1 A;  3CD6 V;  3N2G A;  2DMX A;  3HKC B;  1NTM H;  3A0H Z;  2IW5 A;  2UXD O;  2CK3 G;  2D3O W;  2OCC C;  1B3Q A;  4TV8 A;  4BWA A;  3CPW U;  4GT1 A;  4ZI7 B;  1U96 A;  2XAF A;  4FFK A;  2YDE A;  5EK0 A;  1VQN V;  4JTC B;  5IY5 B;  2MK3 A;  4PD4 F;  1E1R G;  4WCE V;  1SQB H;  3D8C A;  1ZTE A;  4X1Y A;  3DC6 A;  4FLX A;  2LQT A;  3RN4 A;  4NXM O;  4JI4 B;  4NYK A;  4G27 B;  5J9P C;  4DR2 O;  5B1B C;  4MW3 A;  3T4Z A;  3OTO O;  2Q7G A;  2QWO B;  5ITZ A;  5EYP B;  1TVK A;  4GKJ B;  1QVG U;  2FTK A;  5GON A;  3ZRW B;  1XNQ B;  4RQE A;  3QG5 A;  5IYZ B;  2HVJ C;  1F4M A;  1TUB A;  5C93 A;  3FAV B;  3SR2 C;  4DV6 B;  5EBW C;  3BCC H;  4X1I B;  1Q7Y W;  2UUA B;  4MTO A;  1MMM A;  2YXH A;  1RM1 B;  1BMF G;  1IXM A;  4IHJ B;  4KHP B;  2R9I A;  5LMN B;  4GZR B;  1QLE B;  2CAZ C;  1NBM G;  5B5E Z;  3HB3 B;  4IGG A;  3RGB A;  4I4T A;  1IBM O;  5CA0 B;  5EIB C;  4ZHQ B;  2LGQ A;  1S0V A;  3WB1 A;  1H2N A;  3AG7 A;  3CJH B;  3OR6 C;  3OR7 C;  2IJK A;  1JQ0 A;  1OCR C;  2Q0O C;  4J41 A;  3W7U A;  3CX5 F;  1XEQ A;  3E86 A;  5LHH A;  4O4L B;  4LP8 A;  2RDC A;  2YIC A;  3ZRS A;  1VQM V;  3K04 A;  5IJ0 B;  3RYI A;  1W59 A;  1Y6X A;  1Y74 B;  2HR3 A;  4CH4 A;  2B5U A;  4O2A B;  4P30 A;  1XHZ A;  1BHB A;  4NTY A;  3W7T A;  1V54 B;  5KA5 A;  2KG7 A;  3CS5 A;  3WB0 A;  4DW1 A;  5LGN A;  2PZS A;  4X64 B;  2ADQ B;  2UXD B;  1GM9 A;  3JAS B;  1Q8I A;  3ZHQ A;  2JDI G;  2XND G;  5LP6 C;  1M56 B;  2HHH B;  3HKE B;  1P7B A;  3WG7 C;  2QM4 A;  1BCC H;  3FFQ A;  2LFR A;  4WFF A;  3BAB A;  1N32 O;  1E79 G;  5L3B A;  3RFR A;  2XUM A;  4K8X A;  1DK1 A;  4GKK B;  2YIB D;  5KA6 A;  4QIW F;  4UFZ A;  3AG2 B;  2DYS C;  4KFM A;  3ZMV A;  1TAE A;  1KYO F;  2Q6A A;  3QO8 A;  1Q82 W;  3EHB B;  4B3R O;  4FJC C;  5LHG A;  1KC8 W;  1BE3 H;  1HNZ O;  1N0J A;  5L3D A;  1GN2 A;  3S3X A;  1MOF A;  4I50 B;  3T2M A;  1R3J C;  3IGA C;  4JZ2 A;  5LMU O;  2YI9 A;  3SGI A;  5LOV A;  1HNX O;  1MSW D;  4U3J B;  1HNW B;  2HJF C;  2WLL A;  1QCE A;  1OV9 A;  1FXK B;  5CA1 B;  1KP2 A;  1LR1 A;  3ABM B;  5FPO A;  1I5Y A;  4H0L B;  3CC2 V;  1SF9 A;  2ODM A;  2P67 A;  4I0X B;  4JF3 A;  4DV3 O;  2JJ1 G;  4YXW G;  2GTS A;  2OT5 A;  3U10 A;  3VQY A;  4U7N A;  1HDJ A;  3KCX A;  5LP6 A;  3H9V A;  4L8J A;  3ASN C;  4B7K A;  1XOU A;  4J11 A;  3LSU A;  1BHA A;  5J2T B;  1NVP B;  1F23 A;  2YEV B;  2Y4T A;  2ZE7 A;  4UB6 Z;  3OD4 A;  1PKX A;  4QE9 A;  1OZ0 A;  3TET A;  4BW9 A;  3OUF A;  2EIM B;  1XMQ B;  4I9Q A;  2WWW A;  2BOC C;  4B3S B;  1NS1 A;  3AG3 B;  4MVZ A;  2PYJ A;  1R6N A;  1OJH A;  1YEW A;  4UVC A;  3BEH A;  1EM1 A;  1XUQ A;  4LFB B;  1FJG O;  2Q5Z A;  2WLJ A;  1THZ A;  4HNA B;  1J5E O;  3CXH F;  4TQF A;  4OXS A;  5EBL C;  2BSK B;  4OX9 B;  3STZ C;  4GCZ A;  2OIE A;  3K9A A;  2ZIM A;  3ML0 A;  3D36 C;  3QTC A;  4GX5 A;  4YY3 O;  1NR7 A;  2A0L A;  5EZY A;  4HBN A;  4DV1 B;  5L3F A;  3E83 A;  3C3S A;  3E8F A;  2ZE8 A;  2PF4 E;  3I5D A;  4FLT A;  4H37 A;  1VQ8 V;  5KHJ A;  4LNU A;  3SJB C;  4JI6 B;  2YSU B;  3OM3 B;  2QTS A;  4FM1 A;  5B1A C;  3CWB H;  4QE7 A;  3F7V C;  1DTO A;  3J7A U;  2E3C A;  3RYF A;  5KUK A;  5IWA B;  4F6E A;  4LFC B;  4DR6 B;  4FLY A;  3WFV A;  2QA4 V;  2VS0 A;  1IBK B;  3CHX A;  4UB8 Z;  3H1J H;  3CME V;  4K0K B;  3VQX A;  5EC2 C;  3CCQ V;  1M57 C;  1SC5 B;  1SA0 B;  4N23 A;  3T1Y O;  5H6R A;  4WFH A;  1H38 A;  1XIL A;  1PPJ H;  3OMA B;  1YIT V;  3K59 A;  2E75 B;  3AG1 B;  3D3I A;  1ZX3 A;  3N2G B;  1NH2 D;  2YIB A;  4DR1 O;  4X88 A;  4DW0 A;  1GTO A;  1F4N A;  1BQZ A;  3NXS A;  3D36 A; 
#chains in the Genus database with same CATH homology
 3JCZ A;  4X89 A;  3A0R A;  1PNM A;  4KUM A;  1FS0 G;  5CN0 A;  1JJ2 U;  4DO2 A;  5CMU A;  2ZDI A;  3CCM V;  1JPX A;  2DW4 A;  4GX2 A;  1OCC B;  1RPO A;  4QNH B;  3CCE V;  1YJ9 V;  4MVQ A;  1S76 D;  1CP9 A;  4MTX A;  5H6Q A;  3UM7 A;  4RO2 A;  2IJI A;  3RVY A;  3ABT A;  4LC1 A;  4JAS A;  2DYR B;  5LGU A;  2WAM A;  1R73 A;  3ZMT A;  2DQ0 A;  2XAH A;  1F51 A;  3FB5 C;  3LDD A;  4PDL A;  4PEL A;  3ZMU A;  1NJI W;  2PI4 A;  4HAM A;  3E2E A;  1VQ7 V;  2EZP A;  4MVO A;  4MTF A;  4QPJ A;  3JD4 A;  1GM8 A;  2JEU A;  4WFG A;  3OEH G;  1P4R A;  1OCZ B;  3JD0 A;  3OUS A;  3LSQ A;  1JCH A;  2IJH A;  2ZR3 A;  3B8N A;  3QO5 A;  1Q81 W;  4PA9 A;  1K34 A;  5B1A B;  3GB7 C;  1R6K A;  1V55 B;  4LCU C;  4PA6 A;  5IYC O;  1W2B U;  2DYR C;  2OTJ V;  1K92 A;  3X2Q B;  2X6C A;  1SZT A;  3G4S V;  1QLE C;  1K97 A;  5B1N A;  3ZCC A;  4XDK A;  1JVM A;  2P6J A;  2P90 A;  2WLI A;  2XAG A;  2Q67 A;  1VQK V;  5HFM A;  3K0D A;  3ABK B;  3SYQ A;  1LNQ A;  4CZZ A;  1S77 D;  3RVZ A;  3BY6 A;  1MAB G;  2W0F C;  2OCC B;  4RQF A;  3CCU V;  1VQO V;  4PA3 A;  2F43 G;  2X0L A;  2Y69 B;  3SPI A;  1R3I C;  4JYC A;  1AI6 A;  2QEX V;  3SYO A;  2A9H A;  4HZ3 A;  3T4D A;  3TK1 A;  1OCZ C;  1YI2 V;  1AI7 A;  2A79 B;  4Q20 A;  1JOY A;  3F7Y C;  4GX1 A;  3I55 V;  1K73 W;  4MS2 A;  3OEE G;  5HFL A;  5LBQ A;  2NLJ C;  3P32 A;  2UXN A;  1KQS U;  4FIP C;  3ZIA G;  3ASO B;  3ZN0 A;  3ZRX A;  3CCS V;  1NKD A;  4GX0 A;  4FMT A;  3STL C;  3ZRV A;  1H2G A;  3QO7 A;  3CD6 V;  1QBZ A;  2LP7 A;  3K03 A;  3ABK C;  5B1B B;  2ITD C;  2IW5 A;  2CK3 G;  2D3O W;  2OCC C;  2DQ3 A;  1M9N A;  2QKS A;  1NVP D;  3OMN B;  1MG1 A;  3CPW U;  4KP4 A;  3ZRW A;  4GT1 A;  2BOB C;  2XAF A;  1S5H C;  2ZXW C;  3LDC A;  2EIN B;  5EK0 A;  1VQN V;  4JTC B;  5IY5 B;  1ARO P;  1NQT A;  2MK3 A;  1K8A W;  1AR1 B;  4L87 A;  1E1R G;  4BIU A;  1XL6 A;  4WCE V;  5E1A C;  4JTD B;  2EJR A;  2P7T C;  1VQP V;  4Z1M G;  4JAV A;  1DLB A;  1K5Q A;  2B1G A;  5CA3 A;  1HWY A;  2B1I A;  4G27 B;  1KP3 A;  3K79 A;  3JD3 A;  5J9P C;  1EBO A;  5B1B C;  4MW3 A;  3T4Z A;  1BL8 A;  2QM7 A;  2QTO A;  3QNE A;  3HPL C;  1QVG U;  1YTF B;  2FTK A;  2H8P C;  2EIL C;  3FYI B;  3ZRW B;  3ETD A;  2JJ2 G;  1K5S A;  3ZMS A;  3AG2 C;  4RQE A;  2HVJ C;  1WLE A;  1F4M A;  5C93 A;  3DGE A;  1H8E G;  5EBW C;  3CCV V;  4XBF A;  1Q7Y W;  1SET A;  1Y66 A;  1AJQ A;  1E1Q G;  4MTO A;  5L3E A;  2LFS A;  1RM1 B;  2HLD G;  1BMF G;  3JYC A;  1IXM A;  4UUJ C;  4XDJ A;  5CBH A;  2R9I A;  3CMA V;  2WLM A;  4WFE A;  4PA7 A;  1QLE B;  1NBM G;  4PDV A;  1N8R W;  3HB3 B;  1W0J G;  1UJW B;  1FXH A;  4MTG A;  3OW2 U;  4JPR A;  5DM6 V;  5IDJ A;  1GMG A;  4UVB A;  1J95 A;  1FXK C;  2WLK A;  1GO3 F;  1OHH G;  2K1E A;  3E35 A;  3CCL V;  1S0V A;  2X6A A;  2XOK G;  3E89 A;  1AJN A;  1JX9 A;  3SPG A;  2ZD9 A;  3MHS C;  3OR6 C;  3OR7 C;  3FKS G;  1AI5 A;  1L1F A;  3GWO A;  5LHI A;  1VQ6 V;  2IJK A;  1JQ0 A;  1OCR C;  3ETG A;  4CBC A;  1KEC A;  3W7U A;  1RM1 C;  4JAU A;  3SJQ C;  3CC7 V;  3E86 A;  3K08 A;  5LHH A;  3H01 A;  2Y48 A;  1VQL V;  4LP8 A;  3OMI B;  3E8G A;  4HYO A;  3TCU A;  3ZRS A;  1VQM V;  2WLN A;  4RAI A;  4JTA B;  3K04 A;  2KB1 A;  3EFF K;  2EIK B;  4PDR A;  2HR3 A;  2OTL V;  2B5U A;  1NH2 B;  4P30 A;  3LNM B;  2IU3 A;  3WG7 B;  3VBB A;  4EKW A;  2ZXW B;  1BHB A;  4DXW A;  5L3G A;  1W0K G;  3E8H A;  3JD2 A;  3F5W C;  4R7C A;  1R3K C;  4U7O A;  3ABL C;  1NR1 A;  1SES A;  2EIM C;  3W7T A;  1QLN A;  1B6Q A;  1V54 B;  3SPJ A;  5KA5 A;  4I9W A;  4G28 B;  1YIJ V;  5LGN A;  3AG3 C;  5CBF A;  2IJJ A;  1GM9 A;  1K4D C;  4LBE C;  5B3S C;  1YSC A;  4J9Z B;  2IH1 C;  1DF5 A;  3VOU A;  2EIK C;  2JDI G;  2XND G;  1DF4 A;  2GHY A;  1M56 B;  5BZB A;  4MVU A;  2H94 A;  1P7B A;  3WG7 C;  1K7D A;  2LFR A;  4WFF A;  1GK9 A;  2EIL B;  1E79 G;  2Z5U A;  5L3B A;  4I5S A;  4G2K A;  4JYB A;  4P9P A;  1FXK A;  4X8A A;  1COW G;  5KA6 A;  1V54 C;  4FPP A;  4QIW F;  3AG2 B;  4BIZ A;  1GKF A;  2DYS C;  3FB8 C;  4KFM A;  3KG2 A;  3ZMV A;  3QO8 A;  2Q6A A;  1Q82 W;  3EHB B;  2PI5 A;  1EFR G;  3AG4 C;  2ITC C;  4FJC C;  3W7X A;  3LDE A;  4UV9 A;  2JEX A;  5LHG A;  4WFA V;  1KC8 W;  4QPK A;  4UXN A;  5IYB O;  2WSS G;  4ZKI A;  5CBG A;  5L3D A;  1M56 C;  3FB6 C;  3PJS K;  5EBM C;  1AJP A;  1MOF A;  1S72 V;  3T2M A;  1R3J C;  3IGA C;  1KKD A;  2HKO A;  1YJN V;  3G6E V;  2W6J G;  2XAS A;  1MSW D;  2XAQ A;  2HJF C;  1XL4 A;  1QCE A;  2WLL A;  4UV8 A;  1FXK B;  2X6B A;  3CCJ V;  5LGT A;  1KP2 A;  3ZMZ A;  3P30 A;  4WFB V;  3ABM B;  1AI4 A;  1M1K W;  1I5Y A;  4PDM A;  1OCR B;  5GW7 A;  4BW5 A;  3CC2 V;  2P67 A;  1VQ4 V;  2DWD C;  1K4C C;  4JF3 A;  4R8C A;  2JJ1 G;  4YXW G;  2QM8 A;  1I5X A;  2OT5 A;  4TWK A;  4U7N A;  3FYE B;  3K0G A;  3ASN C;  3ZN1 A;  1G8M A;  3G71 V;  2XAJ A;  3LUT B;  3ABU A;  1BHA A;  4RUF A;  5FL7 G;  1NVP B;  3AG1 C;  1VQ5 V;  2Q68 A;  4BAY A;  1F23 A;  2WLL B;  3FB7 C;  2YEV B;  4P9O A;  3CCR V;  3ABM C;  1PKX A;  4QE9 A;  3I56 V;  4MSW C;  1OZ0 A;  3TET A;  3SYP A;  1G4Y B;  4MW8 A;  2R9R B;  3ABL B;  4RUE A;  3OUF A;  2EIM B;  3OFN G;  2M7W A;  2WWW A;  2BOC C;  2GSM B;  4H33 A;  1RPR A;  2EIJ C;  1Q86 W;  2AHZ A;  1H8H G;  3K3W A;  3AG3 B;  4MVZ A;  3MD0 A;  3SPC A;  5B3S B;  1R6N A;  4E2L A;  1K9M W;  3CYO A;  4UVC A;  1FFT B;  1OCC C;  3BEH A;  1PD3 A;  1PNL A;  2WPD G;  4UVA A;  3RBZ A;  1ROP A;  3LSS A;  2WLJ A;  1THZ A;  3E8B A;  5EC1 C;  5IYD O;  3CC4 V;  2ZR2 A;  4FK5 C;  3SYC A;  1QVF U;  5B1O A;  1YTF D;  4OXS A;  4PA4 A;  1TUE B;  2Z3Y A;  1YHQ V;  5EBL C;  3JD1 A;  1SRY A;  1ORQ C;  1R3L C;  3STZ C;  4GCZ A;  1QR9 A;  2DYS B;  2X7R B;  1EZJ A;  3K9A A;  5H9C A;  2EBO A;  1K33 A;  4WF9 V;  3IC7 A;  4ASU G;  3AG4 B;  3ML0 A;  3B77 A;  4GX5 A;  2ATK C;  1PL0 A;  1NR7 A;  1SER A;  4F4L A;  1QR8 A;  2A0L A;  3ZJZ A;  2WLH A;  5L3F A;  3E83 A;  2HVK C;  2ZDI C;  3E8F A;  1PNK A;  4H37 A;  1M57 B;  1VQ8 V;  3AEI A;  1YJW V;  4R6Z A;  2YSU B;  3OM3 B;  3ETE A;  2DWE C;  5B1A C;  3SPH A;  3UKM A;  4QE7 A;  1V55 C;  3F7V C;  3X2Q C;  1S3J A;  1WPX A;  1DTO A;  2V1D A;  4JGS A;  5KUM A;  4J9Y B;  5KUK A;  1ENV A;  2IH3 C;  3R65 A;  2UXX A;  2WLI B;  2C2A A;  2AHY A;  1OCO B;  2IU0 A;  1VQ9 V;  3WFV A;  2QA4 V;  3OAA G;  1ZWI C;  2Y69 C;  2HG5 C;  3CP1 A;  3CME V;  5EC2 C;  5DN6 G;  3CCQ V;  1M57 C;  4TT3 G;  2JIZ G;  4ZBM A;  1GM7 A;  1FXV A;  5L3C A;  3DTU B;  3T1C A;  2V7Q G;  4N23 A;  3W7W A;  1K3E A;  2NNU A;  4TSF G;  3CXC U;  3ASO C;  2W6I G;  3M99 B;  5H6R A;  4MVR A;  1CPY A;  3ASN B;  4P2Z A;  4WFH A;  1H38 A;  3OMA B;  1YIT V;  3IFX A;  3OE7 G;  1KD1 W;  1Y4M A;  2YEV A;  1CEZ A;  3OGC C;  4MT8 A;  3K06 A;  3AG1 B;  3D3I A;  1OCO C;  2QE7 G;  2ZQM A;  1NH2 D;  4MVS A;  1M90 W;  4R50 A;  2EZO A;  4XDL A;  4X88 A;  4N21 A;  1GTO A;  1F4N A;  2EIN C;  2JK5 C;  3B8M A;  3RW0 A;  4QJF B;  5IY5 C;  2Q69 A;  3NXS A;  4MVM A;  3MHH C;  3W7S A;  2EIJ B;  3D36 A;  2HFE C;  3SYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...