4PA7A

Structure of navms pore and c-terminal domain crystallised in presence of channel blocking compound
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
92
structure length
92
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Ion transport protein
publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
total genus 33
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pa7A00
3K0DA 3PJSK 4I9WA 1OCRC 3T2MA 3SYOA 1BL8A 3ZRSA 2K1EA 1M57C 1S5HC 4MVOA 4WFGA 5CBFA 4F4LA 2DYSC 3SYCA 2ATKC 2IH3C 2Q6AA 4JTDB 3LNMB 4J9ZB 4TWKA 2EILC 4GX0A 5B3SC 5KUKA 2BOBC 5CBGA 3SYPA 2A79B 3SYQA 4MTGA 3ABMC 3K08A 4WFEA 4JTCB 3OR6C 1R3JC 1ORQC 2IH1C 3LDEA 4X8AA 2X6CA 3T4ZA 5B1BC 3SPHA 4MVSA 2Y69C 4PA7A 2AHZA 5KUMA 1R3KC 3LUTB 4P30A 4R50A 2ZD9A 2WLMA 4MW3A 4PA3A 4PA9A 4HZ3A 2JK5C 2DYRC 4LCUC 3FB8C 2Q69A 3KG2A 3LDDA 3F7VC 4R8CA 4RUEA 5EBMC 4OXSA 4J9YB 2ITCC 4R6ZA 5J9PC 3IGAC 4BW5A 4MVRA 3K04A 3FB5C 1OCZC 3AG2C 3E86A 4R7CA 1XL6A 2EINC 4LBEC 2X6BA 3SPIA 2HVKC 4EKWA 3STZC 4RUFA 4GX2A 3ABLC 3SPJA 3IFXA 4RAIA 1P7BA 3K06A 2EIMC 3ZJZA 3SPGA 3TCUA 4MVZA 3ABKC 4GX1A 3X2QC 3AG4C 5BZBA 2AHYA 4MTFA 5B1AC 4XDJA 3FB6C 4P2ZA 5EK0A 2BOCC 2HVJC 3LDCA 4MVUA 1V55C 4G28B 4G27B 4P9PA 3UKMA 3OGCC 3STLC 1R3LC 5E1AC 4QNHB 3RW0A 2ZXWC 4GX5A 4H37A 4XDLA 1K4CC 2HFEC 4MVMA 2HG5C 2KB1A 4MVQA 4PA4A 1XL4A 3E83A 2A9HA 3OR7C 3F5WC 3E8BA 3R65A 4RO2A 4MTOA 3SPCA 1K4DC 4ZBMA 2NLJC 2WLKA 4HYOA 1R3IC 5EBWC 5EC1C 2WLNA 2H8PC 2WLIB 2WLIA 4LP8A 2ITDC 1LNQA 2DWDC 2X6AA 3UM7A 2WLLB 2WLLA 3SJQC 4UUJC 3AG3C 3FB7C 3OUFA 4H33A 4KFMA 2HJFC 3BEHA 1V54C 3E8GA 4DXWA 3ASOC 5CBHA 2YEVA 3JYCA 1J95A 1ZWIC 4PA6A 4PDVA 2OCCC 4X88A 3TETA 3AG1C 2EIKC 1OCOC 4MSWC 2WLHA 2WLJA 3K0GA 2EIJC 1OCCC 2R9RB 4QE9A 4X89A 3E8FA 5EC2C 2A0LA 4MW8A 2P7TC 1M56C 3GB7C 3T1CA 4WFFA 4P9OA 1KKDA 4XDKA 2QKSA 3RBZA 4QE7A 1JVMA 3WG7C 2QTOA 3RVYA 4PDLA 3OUSA 3RVZA 3SYAA 3ASNC 5EBLC 2Q68A 4MS2A 2Q67A 4PDMA 2DWEC 3T4DA 3VOUA 4CBCA 3HPLC 4WFHA 4PDRA 2W0FC 1G4YB 3E89A 3F7YC 3EFFK 3E8HA 4JTAB 5IY5C 3K03A 1QLEC
chains in the Genus database with same CATH superfamily
3ETGA 2QM4A 1IBKB 3ABMB 1I08A 4JYCA 3ZCCA 1AVMA 3JAWB 4F4LA 4O4JB 2VQEO 3SJBC 4I7ZB 5LYJA 3K57A 3E22A 2X6CA 5LP6C 4BAYA 1BHAA 1RSOB 5LXTA 3JALB 1MNGA 3RT3C 1DK1A 5A2QN 1GRJA 3RYFB 3AG4B 1AJQA 3WB0A 1N0NA 4R7CA 4YY3O 3T1HB 3IFXA 4D7SA 2NNUA 3SPGA 3ABKC 3CC2V 5JCOA 5EK0A 4G27B 1SQGA 4LFBB 1HP8A 5BMVA 2YC0A 4MVMA 4B3MB 1XL4A 1PP9H 3E83A 1QLEB 2Q7EA 4UB8Z 3RWRD 5IDJA 1D5NA 4JV5B 1CPYA 3ZRWB 3AG1B 4OX9O 1GAXA 1LNQA 3ZN1A 2WLLA 2QA4V 2EIJB 1Y74B 3HKBB 3DC5A 3CC4V 2JGDB 3JYCA 2L6LA 1IDSA 5JJJB 3JCUZ 2LP7A 2CAZC 1DF5A 4DUYO 4XDKA 5F2VO 4LFCO 4NB5A 3RVZA 1HDJA 1M1KW 2QR4A 4MS2A 3WFVA 1XMQO 2W0FC 3F7YC 2P22C 3K03A 3N27A 2HKOA 1QVGU 3B77A 3D36C 3ZBHA 2K1EA 2LO1A 3K9AA 2QJ1A 3LSQA 2LW7A 1NS1A 2Y69B 4J9ZB 4NYKA 2OWOA 5KX5A 4LR3A 5KMGA 2IJHA 2UUAO 2E75B 1N8RW 1ZAUA 2AHZA 4FLWA 4KL1A 2WPDG 2MW2B 3UT5B 3OE7G 5JJEB 2PF4E 1AR1B 4MVRA 1GKFA 1VQ5V 1FFXA 3K3WA 4Z1VA 1V55B 3CCQV 3RGBA 4RQFA 1IURA 5B1AC 1L1FA 4DV6B 4JI4O 4YHHO 4TUYA 5LXTB 4P9PA 1AI6A 2W0XA 2YDEA 4UVCA 3UKMA 3K58A 3T1YO 3K79A 3DSQA 2DQ0A 1VQMV 2LGWA 2LJ2A 3ETQA 4DUZB 4ZHQA 2JS3A 1G1XB 5IE9A 2P90A 2QDOA 3JAKA 4J10A 3JD3A 1N36B 1FYJA 1F51A 4FVMA 1VF7A 3OGIB 1KECA 1XHXA 2JJ2G 1DTOA 4YJ3A 4D6TH 5BMVB 1S3JA 3E8FA 1URFA 3WG7C 2Z5UA 2CDYA 3JSNA 3T4DA 1Q82W 4WFHA 3OTOB 1QNMA 3T2MA 4PHZA 4DR7O 2EJ7A 2CUGA 4Z2WA 2DYSC 3ABTA 3SYCA 2Q5ZA 2EILC 2YI9A 4FZ0A 4DV1B 4FM1A 1JX9A 1Q6UA 4DV5O 1KYOF 4B3TO 2OTJV 3OMAB 2F23A 1GK9A 4PA7A 1ZL8A 3FFQA 4P30A 4MT8A 1AI5A 2Q7HA 1MSWD 1NH2B 4I55A 5L3EA 2LGQA 1SQQH 1NBMG 3FB8C 1VP7A 4PI0A 1HWYA 2ITCC 4DK1A 5LGNA 3RYCA 4BWAA 3K5LA 3IGAC 2N04A 1P84F 1QVFU 2WSSG 4K35A 5JH7B 4GKJB 2GV9A 4LF9B 3S3XA 3KKYA 1NQTA 4DYLA 1K92A 2ZE6A 3O9OA 2BCCH 3QVNA 4LF4B 3A0RA 4GX5A 1M4UA 2F93B 1K4CC 1SETA 1W0JG 1RP3B 4CC5A 4MTOA 1KD1W 2YIAA 1XNRO 1V54B 4AQYB 1KQSU 1QR9A 1FXKC 2ZCEA 2DWDC 4JGSA 4DUZO 1YSCA 4KHPB 2RCVA 3QG5A 1GN3A 4NTWA 5J2UA 3ASOC 3ETDA 1Q90D 4TUYB 1NTKH 2M6YA 1OCOC 4UCSA 1H8HG 4PV1B 1OCCC 4LF5B 4MW8A 5CA1B 3SYAA 2AZ0A 1F7YA 4J7ZA 3JAKB 2HHHO 2B9ZA 2E3CA 2OYQA 1BGYH 1BHBA 2UUCB 3W7UA 3W7WA 2R70A 4DR4O 4E2LA 1MMMA 1SRYA 3ABKB 1YEWA 3K5NA 1PL4A 2BSKA 4DV3O 1YVWA 4UB6Z 2A79B 4MTGA 4X8AA 3WB1A 1FJGB 4DV1O 4EB6A 4DV2B 3ZHTA 4JZ2A 2BTQB 2ARHA 1K7DA 3ZRXA 4G2KA 4X20A 4LF8B 1I94B 4B3RB 5L3FA 2XTAA 3FB5C 2WAMA 3SJAC 1TVKB 2VRZA 4I5SA 4IL6Z 1LR1A 1NU1H 3AEIA 1JQ0A 1NI8A 1ZL8B 3OAAG 4FMTA 1SZXA 4KUMA 4FLUA 1BZKA 4FLTA 3OR7C 1CP9A 3J81N 1IXBA 4AILC 4LF4O 3FYIB 4BIZA 4TSFG 3J80N 2WLIB 2YXLA 4K8ZA 1RM1C 4YJ2A 1YITV 1M56B 5KLVH 4DR2B 2KG7A 3ASNB 2QWQB 1TUEB 5L3CA 1KKDA 2HP8A 2QWRB 3HKCA 3CSXA 3B8MA 3B2EE 4ZI7B 2Q68A 3VOUA 4LF5O 4YIPA 5CA3A 4LH7A 4YXWG 1K8AW 2RMKB 1N34O 3A8TA 4DO2A 4U3JB 1VQ8V 5LOVB 1HNZB 4IYIA 3EHBB 3U0ZA 3H1JH 2QEXV 3E35A 2N74A 1HR0B 3LSUA 4Q20A 5LBQA 3JD0A 2BE3A 2MK3A 4EEQA 1RSOA 4DV7B 3ZIAG 2VQFO 3G6BA 3RYFA 4KP4A 1Z5VA 4EFBA 1N33B 1UPGA 2IBZH 1I94O 4B3RO 4RUFA 3QF7A 2FKXA 4RAIA 2ETNA 4J41A 3X2QC 1VQLV 1OJHA 1M90W 2FL4A 4NKGB 2OIEA 2YXYA 1GN4A 1BE3H 1XEQA 2JEUA 3LDCA 3MHHC 3JD4A 3STLC 2N05A 3BPZA 2KB1A 4RO2A 3JARA 2PUSA 1R1BA 2WA4A 3G4SV 4DR5O 4TQFA 2JVDA 1KUQA 3IJ4A 1FPOA 1Y74A 1GN2A 4H0LB 3HKBA 2KQXA 1J95A 4PA6A 3CXHF 2EIKC 4OPHA 2R72A 5L3GA 2V4DA 4QPKA 2CE4A 2WLJA 2IU3A 4U7OA 2Y4TA 4DR2O 4D7TA 2CGOA 1W2BU 2JRIA 4LF7B 3U11A 5KAIZ 1W0KG 3CRMA 3TK1A 2ZDIC 3VQWA 4I9WA 1OCRC 1F4NA 1BSMA 3SYOA 2YS8A 2WWWA 1FXHA 5CA0B 3ZMZA 3HKCB 1JJ2U 4HAMA 2FYUH 3L74H 2ZIOA 1XHZA 1JA8A 2D3OW 1R3JC 1ORQC 2P06A 1Y6XA 1HR0O 4X1KB 3OD4A 4ABMA 4R50A 1SZTA 2WLMA 4IHJB 1D5AA 1IBLB 4JYAB 4F6EA 5BY1A 1BQZA 2Q69A 4ICGA 4J9YB 1Y67A 3GWOA 5CN0A 1J5EO 2UXCB 2H94A 2X6BA 2EJRA 2E5LB 1B04A 4UCTA 4X62O 3M7MX 1ZTEA 1YIJV 1S72V 5IYCO 1FFTB 1MZFA 2F95B 3FB6C 3UO3A 4DV4B 3BCCH 3K9SA 3B40A 3OGCC 2Y4UA 2IW5A 4XDLA 2PY5A 1BS3A 4CC6A 2A9HA 4LFAO 3SPCA 3CCEV 2NLJC 5LMNB 4UV9A 1R3IC 5EBWC 3OMIB 2UU9O 3IC9A 1K3EA 4FLXA 1CEZA 1PKXA 4XBFA 2E76B 2DMXA 2F66C 5E79Z 4H33A 1U96A 5CMUA 4DXWA 5CBHA 4FLVA 4B7EA 1ZWIC 4PDVA 4NTYA 3B4SA 3THOA 5IWAB 5DEDA 2BTOA 4X89A 4WFAV 2PGGA 2RN9A 1WP8A 1JVMA 1PNMA 5GONA 3JARB 2Q67A 3OT7A 3I55V 3GVMA 1GMGA 4JASA 4N21A 2R9IA 4JTAB 1AP5A 2YIDA 4ZKIA 4JI7O 1Q43A 2Z3YA 2W6JG 1Q7YW 2CH7B 4TOIA 5H5NA 3A0HZ 5B1BB 5HFMA 4TWKA 4JI5B 4NR1A 3RFRA 2QM8A 1K5SA 1VQOV 5JQGB 2IH1C 3T4ZA 1MSDA 3OEHG 2DOSA 3C3TA 3P3NA 3QNEA 2UXBO 4GZRB 4E4EA 1E79G 3L72H 2OT5A 3KG2A 2UUBO 5LA6B 5J9PC 1Q6IA 3LSSA 1RM1B 1IBLO 4JYAO 1IBKO 5JH7A 2EINC 4PELA 1AJPA 2Z0AA 3TXQA 3ABLC 3JSLA 3K06A 2EIMC 2ZXWB 1WPXA 3JD2A 2E5LO 3G80A 5IJ0B 4BW9A 1VF6A 1LUVA 1MA1A 3O65A 3BVOA 3SGIA 5IYZB 4N23A 3RW0A 2Q8VA 4DR1B 2ZM6B 3A2FA 4JPRA 4DRXB 1NKDA 4OPAA 1EBOA 2EBOA 5C8YB 2C2AA 2ZE5A 4LP8A 1H2GA 5GTIZ 2RQ6A 3SJQC 2IM9A 3AG3C 1Y76A 1S0VA 1WLEA 1SKVA 3T1HO 2KKWA 3CJHA 3K5OA 2R9RB 5LP6A 5BR8B 3DXRB 2F1MA 3T1CA 5CB4A 1H2LA 2QKSA 4UCVA 3P30A 5CA1A 2HJDA 4LFBO 5IWAO 5EBLC 3CMAV 3AK1A 4PDMA 1JMKC 3ZN0A 4FLZA 4PDRA 4B3MO 3CPWU 3CXCU 1F4MA 4IYHA 3E89A 2QTSA 4X1YB 1NR7A 1V9PA 3E8HA 5KA5A 1KMIZ 5IY5C 1U97A 5FL7G 1BT8A 5FLXN 3PJSK 4JV5O 3L9DA 3WB2A 4K0KB 1M57C 4I0XA 1S5HC 4JF3A 1UFIA 4MVOA 3CS5A 1SERA 3KCYA 1XBLA 5B3SC 2BOBC 1QR8A 2YUAA 2YIBD 5IYBO 5KHGA 5GONB 4O4LA 4X9QA 3ZMTA 1GM9A 1QU7A 1XNQB 2AGAA 5FPRA 2PYJA 2IJKA 3S3WA 2BTQA 1MOFA 1EZVH 1H38A 2B5UA 2DYRC 4LCUC 4HNAB 2ZE8A 1XILA 4JI1B 3DC6A 1N4CA 3K04A 3E86A 3AG2C 1QCEA 3CCLV 1TVKA 3SPIA 4NVPA 1I5YA 2JEXA 3K59A 4MVZA 1SESA 1B6QA 4DV0B 2AHYA 2ZE7A 1Y4MA 1UJWB 3JATB 1IX9A 2FB5A 2D2CB 3ML0A 1PD3A 1WA8A 4X66B 3JASB 2PYLA 3HKEB 5C93A 2B1GA 3F5WC 1KP3A 1HW7A 1EM1A 5JWPA 3B09A 4DR1O 2GTSA 2WLNA 5KA6A 2WLIA 5K1PA 5LGTA 4QPJA 2ZNJA 2Q7GA 1JCHA 1QBZA 4GCZA 1YDXA 2YEVA 2OCCC 5JVDA 1AP6A 1AI4A 2XT9A 4DV6O 1NVPD 4JI6B 3N2GA 2P7TC 2E74B 4J7KA 2QTOA 4ZI7A 1HNXB 1G4YB 4UXNA 3VQYA 4QJFB 2JS5A 3VBBA 3P3PA 1Y76B 1QQCA 1AR4A 4RWUA 3BY6A 4NTXA 1A32A 3DTUB 1WAZA 1Q8IA 2H3OA 4U3JA 1N36O 2YXHA 2QWPB 3FD9A 5LOVA 2VS0A 3CJHB 4JI0B 3D3IA 4L87A 1SC5B 5LP6B 3ZMSA 3LNMB 5CB4B 4K0KO 2ADPA 1FAFA 3ABMC 2QSAA 3FAVA 2FTKA 2YI8A 3OW2U 3SPHA 5K1XA 2Q0AA 1R3KC 4UVBA 5GTHZ 3VQVA 2XNDG 1NVPB 3OTOO 1XNQO 3LDDA 4I0XB 3BRCA 1ROPA 5EBMC 2F4VB 5EZYA 4B3SB 1G8MA 2V1DA 3F5TA 1OCZC 1OZ0A 2LFRA 3BA8A 2ZINA 4OGQB 3MAQA 1K97A 3STZC 4GX2A 1PL0A 4O4LB 4AHCA 4WBNA 3TCUA 4GX1A 2QGNA 1L0LH 3AG4C 5BZBA 4MTFA 5B1NA 1QHTA 3JCZA 4IGGA 5E1AC 5GW7A 4DV0O 4PI2A 4GUNA 2HFEC 4UCRA 1IXMA 3CYOA 5IJ9A 1K4DC 5ITZB 4L8JA 4GKKB 1HNWB 5DN6G 1KC8W 4KXRA 2JIZG 1ZLZA 2CTPA 2LQTA 4Q6GA 4UV8A 4GKJO 4DR3B 4KFMA 3G71V 1KKCA 1SQFA 4LF9O 2GHYA 1Q5OA 3TETA 3AG1C 1B06A 1MZEA 1TGOA 3C90A 4NXMB 2EIJC 3CMEV 3BA9A 1WA8B 4DW0A 2QKAA 5LMUB 4WFFA 4P9OA 3RBZA 1KB9F 2M7WA 3HPLC 1XUQA 4DK0A 1SQVH 3TGUH 1QLNA 4AQYO 1SS3A 4GLXA 3G6EV 2OTLV 2YEVB 5L3BA 3JD1A 1TAEA 1MG1A 3ABLB 5JVDB 4KHPO 1N0JA 1W59A 1SQBH 3FYEB 4BIOA 5CA0A 1TA8A 1NR1A 2Q6AA 3N2GB 4J80A 1S5LZ 5KUKA 4IT5A 2G38A 4U3FH 3NR7A 2Y69C 2YSUB 5KUMA 4X1KA 4K8XA 5L3DA 2VWKA 4IHJA 4U7NA 4UVAA 4W4LA 2UXNA 4FZ1A 4RUEA 1FXKA 4YIOA 1SA0A 2UUCO 4TV9A 1GM8A 5B1AB 4MTXA 2CTRA 2F4VO 4B3SO 2UXXA 2X7RB 1KP2A 3FAVB 3LNNA 1I7FA 2RJZA 1JJOA 2VWJA 2PI4A 1V55C 4G28B 2DN9A 4JI8B 1FJGO 3MDSA 2QKCA 5EZYB 4MVQA 4DV2O 2ODMA 1NZ6A 3M99B 2GDSA 4LF8O 1M57B 3H1IH 3FKSG 5H6RA 4WBNB 4UUJC 3QO8A 4I4TA 2VQEB 5B3SB 1YI2V 1WB7A 3WG7B 2XUMA 3G67A 4O4HA 1RPRA 4MSWC 1H8EG 1O9HA 1H2MA 5JCOC 2P4KA 5IJ9B 1AB3A 2A3QA 2DYRB 1YTFD 5LMUO 3MD0A 1DF4A 4CS4A 1AR5A 1AJNA 1WN7A 1NT2B 5H2FZ 2AXTZ 2DYSB 1YCIA 2EILB 3MHSC 1Q6HA 4YY3B 3H9VA 2CH7A 4WFGA 2RDCA 3BFRA 4X1IA 3ZS8C 2IH3C 2XAGA 4GX0A 2XHBA 1KBHA 4WCEV 5JQGA 5HFLA 1F23A 3W7XA 1H2SB 2CGNA 2EX3A 4MW3A 4IIJA 2JDIG 5J2TA 3U10A 4R8CA 3ZHQA 5LA6A 2LFSA 4ZOLB 1ZUQA 2IJIA 2Y0PA 4WF9V 3K5MA 1XMOB 1I5XA 1HNZO 1WPBA 1Q3EA 4H44B 1EN4A 5IJ0A 4QGPA 3H01A 4LFCB 5IYZA 4B7KA 2RNBA 1H2NA 3IAYA 1XMQB 4JI2B 3TXSA 1FXKB 1SQPH 4PA4A 3CB2A 4DRXA 1SA0B 4DV7O 3CD6V 4TV9B 3SJCC 3ASOB 1JFFB 4I50B 5C8YA 2H8PC 1OCOB 1SQXH 2GTAA 2ITDC 2X6AA 1OCCB 3OUFA 2XAQA 4TT3G 1N33O 1V54C 3CCMV 2P4VA 3UQ8A 4QE9A 3E2EA 2UUAB 1P4RA 2KSDA 3DXRA 1US6A 1YJNV 3OMNB 4JYBA 4HBNA 4X1YA 3UCSC 3OEEG 2GUZB 4LWSA 4I4TB 1PM9A 1OCZB 4O4IA 4FPPA 1ENVA 1BMFG 1T5EA 4O4HB 3H1KH 3L70H 2P5OA 3SYQA 4JI4B 4YHHB 1IVSA 1FKAO 4WFEA 3T1YB 1S5JA 2HEPA 1R6KA 4WFBV 3LUTB 4LF7O 2EZOA 1TUBB 1M93A 3N2KA 4HNAA 5LHIA 3QO5A 4X1IB 3NXSA 1EN6A 1VQKV 1EFRG 3L75H 2HVKC 3FX7A 1OHHG 2PZSA 1N32B 5EIBC 1XDCA 3ZJZA 3ABUA 1Q86W 1FS0G 4J42A 2PI5A 1XMOO 5FNVA 3JATA 1K73W 4MVUA 3RYIB 4IIJB 3SR2C 3CHXA 5J2TB 1XI1A 1GTOA 1NJIW 1Z2GA 1X59A 2HG5C 4CH3A 4FM0A 2YIBA 3AG7A 2ZDIA 3H1LH 3JASA 3HKEA 1R6TA 3APQA 5D5PA 4K3AA 3UO2A 3I5DA 1S76D 4JI2O 3RYHB 3ZHVA 2OIGA 1L0NH 4DR7B 2UXCO 4J11A 5IT9N 2Q4PA 3E8GA 1G6UA 3P32A 3OM3B 4LNUB 4DV5B 1FD9A 4B3TB 3AK3A 1VMGA 3ICXA 5EC2C 3JAMN 1M56C 5KAFZ 2Q73A 4DV4O 1DGSA 3OUSA 3ASNC 2ZR3A 4FLYA 1K34A 1PNLA 3QO7A 3CCUV 1VQ6V 1E1QG 4TV8A 4UFZA 3EFFK 2DE0X 5LMNO 1NTMH 3K0DA 3ZEDA 1YF2A 1BL8A 1WB8A 1AROP 4FFBA 4NXNB 5CBFA 2CTQA 2PTMA 3ETEA 2F43G 3QTCA 5LYJB 3E22B 3TJTA 3J7AU 1XOUA 1RFYA 4LWSB 3ZRVA 4PA9A 4O4IB 2JK5C 3D8CA 1XNRB 2XASA 1X4TA 3X2QB 3D3QA 2Q0OC 4PJ0Z 1XL6A 1P7GA 5KHJA 1PV0A 3SPJA 4JAVA 1L8DA 1P7BA 2HLDG 4JI5O 4P2ZA 2HVJC 1N32O 1GM7A 2HR3A 1NH2D 3R66A 1S77D 3N2KB 2HHHB 5B1OA 2YICA 1RPOA 3R65A 2NR5A 4GT1A 4UCUA 5ITZA 3W7SA 1GN6A 2ZT9B 4DR4B 2EIKB 2WLLB 4X64B 1VQ4V 1KU9A 3FB7C 2XAHA 4DW1A 5EYPA 2IU0A 5FNVB 4DV3B 5A9GA 2LW1A 1XREA 1YXBA 1E1RG 1IBMB 3B8NA 3CP1A 3K0GA 1LUWA 2EULA 3DGEA 4PDLA 5LHHA 3ZHUA 3D36A 2ZM6O 1OCRB 5LL6Y 1COWG 2XAFA 4FFKA 4BW5A 2QE7G 3ZRSA 1M9NA 1YZBA 1BCCH 3CEIA 1I0HA 2DJVA 4FK5C 3APOA 2L35A 4LC1A 3CWBH 4NXNO 4ZIBA 2GBOA 3K08A 5KMGB 5KX5B 4RQEA 4LF6B 4GYCB 3BHPA 5BR8O 4TV8B 4PD4F 4CS2A 1GO3F 4PA3A 2JJ1G 2AZ2A 4FFBB 1THZA 3CCSV 1WP7A 1FFXB 4H13B 4EKWA 4BIUA 1PNKA 3HKDA 5JJNB 3CRQA 5D5QA 1GH6A 4CH4A 2BOCC 5KHKA 3CCRV 4O2BA 1R3LC 2DW4A 5DM6V 1Z5WA 4QIWF 2Y48A 1K9MW 3ZHRA 2UXDB 4X65B 5EIBD 4ZHQB 4ZBMA 4HYOA 2Q9LA 5BXZA 5EC1C 3CRCA 1JPXA 1N34B 1IZ3A 3UM7A 4JI1O 2GSMB 1NTZH 1YJ9V 2HJFC 4A5UB 3CCJV 4W4KA 4X64O 4YJ3B 3OFNG 2ZNIA 2WLHA 2XAJA 3BAAA 1VIBA 2DQ3A 4FJCC 1IBMO 1XQ8A 2O57A 3KZIZ 2DWEC 2VQFB 4CBCA 4Z1MG 4X66O 1QLEC 5EYPB 2QWOB 2ZQMA 4CZZA 1H2KA 2ATKC 2P6JA 4DR6B 1WNSA 2ADQB 4AI8A 3Q4HA 4JAUA 4JTCB 3OR6C 1JOYA 4JI6O 5KHIA 1VEWA 3LDEA 5B1BC 4MVSA 4JI3B 1D2DA 2IJJA 3CRRA 1HNXO 3OTFA 1AI7A 2ZD9A 4LF6O 4CS3A 2XOKG 4I55B 2EINB 1ZX3A 3H1HH 2ZKOA 4F6RA 4UCOA 3F7VC 1DLBA 3KCXA 4DR5B 2R9AA 3RYCB 2EIMB 4R6ZA 1MABG 2ILMA 4ZOLA 1YJWV 5H6QA 4JI0O 4EFEA 4JAAA 5DECA 3HB3B 3EVKA 5LHGA 3ZX6A 3SDLA 2QM7A 2EZPA 1CXZB 1P49A 3WU2Z 2AW9A 2ZXWC 4O2AA 4TQDA 2FMLA 3AG3B 2WLKA 1JFFA 5KHHA 4I50A 3IC7A 4BR6A 1EN5A 2OCHA 3HKDB 1B3QA 4X65O 2UXDO 2B1IA 3BEHA 5J2UB 5TISZ 2K9PA 4FIPC 4O2BB 3JAWA 1PPJH 1K5QA 1Y66A 4O4JA 2WA3A 3GB7C 3EXAA 2X0LA 3VQXA 5IY5B 2JGUA 1VARA 4CH6A 3CC7V 2NN4A 5LGUA 1R6NA 2GUZA 1J5EB 3JALA 4GKKO 1OV9A 1HNWO 2P67A 3ZMUA 4JZGA 1M5IA 3I56V 3CX5F 4X62B 5H9CA 4DR3O 5IYDO 4JTDB 2BSKB 3HR0A 1JR9A 3SYPA 5CBGA 3M8AA 4NXMO 1ZSPA 4LH6A 1R73A 3W7TA 4ASUG 4DR6O 4EB6B 1VQPV 3BABA 1TUBA 3AG2B 4HZ3A 4LFAB 1VQ7V 2A06H 1SF9A 4JYYA 4JI3O 2UU9B 4OXSA 4X20B 3CCVV 1VQNV 1WJZA 1Q81W 4LBEC 3ZRWA 3Q4HB 3AK2A 4XDJA 1YHQV 2JGDA 3RN4A 3GWKC 3CE2A 3RYIA 4QNHB 3PN1A 4H37A 4F6RB 3ZMVA 3ZHSA 4OX9B 4J7JA 1EZJA 1O9GA 2W6IG 3L73H 3E8BA 1VF5B 3CRAA 5AG2A 1YTFB 4JI7B 3RYHA 2CK3G 4C7UA 2OCCB 2Y0IA 1K33A 3C3SA 4YJ2B 4CH5A 5B5EZ 3A0BZ 3L71H 2KG7B 4DUYB 1VQ9V 4X88A 4LNUA 4FM2A 4I9QA 4O2AB 1FXVA 2ZIMA 2A0LA 2ZR2A 1BQ0A 5FPOA 4QE7A 1VF6C 5B66Z 3RVYA 4JI8O 2A7WA 1AILA 4B08A 2QWNB 2UXBB 2CTWA 2V7QG 2UUBB 3UT5A
chains in the Genus database with same CATH topology
3K0DA 3ETGA 3DTUB 1BL8A 4DO2A 1AROP 3ABMB 1VQ8V 4JYCA 5CBFA 3ZCCA 3D3IA 4L87A 3EHBB 3ETEA 4F4LA 3ZMSA 3LNMB 2F43G 2QEXV 3E35A 4Q20A 3ABMC 5LBQA 3JD0A 2FTKA 3OW2U 2X6CA 3SPHA 4BAYA 1BHAA 1R3KC 4UVBA 2MK3A 3ZRVA 4PA9A 3ZIAG 2JK5C 2XNDG 1NVPB 3LDDA 2XASA 1ROPA 5EBMC 1G8MA 2V1DA 3X2QB 4KP4A 3AG4B 1AJQA 1OCZC 1OZ0A 2LFRA 4R7CA 1XL6A 1K97A 4RUFA 4GX2A 1PL0A 3STZC 3SPJA 4JAVA 3IFXA 4RAIA 1P7BA 2NNUA 3SPGA 3TCUA 3ABKC 4GX1A 3X2QC 3AG4C 5BZBA 4MTFA 2HLDG 5B1NA 1VQLV 1M90W 3CC2V 4P2ZA 5EK0A 2HVJC 2JEUA 3JCZA 3LDCA 3MHHC 4G27B 1GM7A 3JD4A 3STLC 5E1AC 5GW7A 2HR3A 1NH2D 1S77D 2HFEC 4MVMA 2KB1A 5B1OA 1RPOA 1XL4A 3E83A 3R65A 1IXMA 4GT1A 4RO2A 3CYOA 1QLEB 1K4DC 5IDJA 3W7SA 3G4SV 5DN6G 1CPYA 3ZRWB 3AG1B 2EIKB 1KC8W 1LNQA 2JIZG 2WLLB 2WLLA 3ZN1A 2QA4V 1VQ4V 2EIJB 4UV8A 3FB7C 2XAHA 4KFMA 2IU0A 3G71V 3JYCA 3CC4V 2GHYA 1J95A 4PA6A 3TETA 3AG1C 2EIKC 5L3GA 1E1RG 4QPKA 3B8NA 3CP1A 2WLJA 3K0GA 2EIJC 2IU3A 3CMEV 2LP7A 4U7OA 1DF5A 4WFFA 4P9OA 4XDKA 3RBZA 3DGEA 4PDLA 3RVZA 1M1KW 1W2BU 5LHHA 4MS2A 3WFVA 1W0KG 3D36A 1OCRB 2M7WA 3HPLC 1COWG 2W0FC 3TK1A 2ZDIC 3F7YC 2XAFA 1QLNA 3K03A 4BW5A 2HKOA 4I9WA 3G6EV 3B77A 1QVGU 2YEVB 2OTLV 1OCRC 1F4NA 2QE7G 3SYOA 3ZRSA 5L3BA 2K1EA 3JD1A 1MG1A 3ABLB 1M9NA 3K9AA 2WWWA 1FXHA 3LSQA 3FYEB 4FK5C 1NR1A 2Q6AA 2Y69B 4LC1A 4J9ZB 3ZMZA 5KUKA 1JJ2U 4HAMA 3K08A 4RQEA 2IJHA 2D3OW 1R3JC 1ORQC 1N8RW 2Y69C 2YSUB 2AHZA 5KUMA 5L3DA 4R50A 1SZTA 2WLMA 1GO3F 2WPDG 4PA3A 4U7NA 4UVAA 2JJ1G 2UXNA 3OE7G 2Q69A 4RUEA 1FXKA 4J9YB 1THZA 3CCSV 3GWOA 5CN0A 1AR1B 2H94A 4MVRA 1GKFA 1VQ5V 1GM8A 5B1AB 4MTXA 2X6BA 2EJRA 3K3WA 4EKWA 1V55B 4BIUA 3CCQV 2UXXA 2X7RB 4RQFA 1PNKA 1KP2A 1YIJV 1S72V 5IYCO 1FFTB 5B1AC 1L1FA 3FB6C 2BOCC 2PI4A 1V55C 4G28B 3CCRV 1AI6A 4P9PA 3OGCC 3UKMA 4UVCA 1R3LC 2IW5A 3K79A 2DW4A 4XDLA 2DQ0A 5DM6V 1VQMV 4QIWF 2Y48A 4MVQA 1K9MW 2A9HA 3M99B 3SPCA 4ZBMA 2NLJC 3CCEV 4HYOA 4UV9A 2P90A 1R3IC 5EBWC 3OMIB 5EC1C 1JPXA 1M57B 3JD3A 1K3EA 1CEZA 1PKXA 3FKSG 5H6RA 4XBFA 3UM7A 1F51A 2GSMB 4UUJC 4H33A 3QO8A 1YJ9V 2HJFC 5CMUA 4DXWA 5B3SB 5CBHA 1YI2V 3CCJV 3WG7B 1ZWIC 1KECA 4PDVA 2JJ2G 1DTOA 3OFNG 1RPRA 4MSWC 1H8EG 2WLHA 4X89A 1S3JA 4WFAV 2XAJA 3E8FA 2DQ3A 1JVMA 3WG7C 1PNMA 4FJCC 2Z5UA 2Q67A 3T4DA 2DWEC 2DYRB 3I55V 1Q82W 4CBCA 1YTFD 4WFHA 4Z1MG 1GMGA 3MD0A 4JASA 1DF4A 4N21A 1AJNA 2DYSB 2R9IA 4JTAB 4ZKIA 1QLEC 2EILB 2Z3YA 3MHSC 2W6JG 3T2MA 2ZQMA 4CZZA 1Q7YW 4WFGA 2DYSC 3ABTA 2ATKC 3SYCA 5B1BB 2IH3C 2P6JA 5HFMA 4TWKA 2EILC 2XAGA 4GX0A 1JX9A 2QM8A 1K5SA 4JAUA 1VQOV 4WCEV 2OTJV 4JTCB 5HFLA 3OR6C 1JOYA 2IH1C 3LDEA 3T4ZA 1F23A 5B1BC 3OMAB 4MVSA 3OEHG 1GK9A 4PA7A 3W7XA 2IJJA 4P30A 1AI7A 3QNEA 2ZD9A 4MT8A 1AI5A 4MW3A 1MSWD 1NH2B 2XOKG 1E79G 2EINB 5L3EA 2JDIG 1NBMG 2OT5A 3FB8C 3KG2A 4R8CA 3F7VC 1DLBA 1HWYA 2ITCC 5LGNA 2EIMB 4R6ZA 5J9PC 3IGAC 1MABG 3LSSA 1RM1B 1QVFU 2LFSA 2WSSG 1YJWV 2EINC 2IJIA 4PELA 1AJPA 4WF9V 5H6QA 1I5XA 3ABLC 3K06A 2EIMC 2ZXWB 3HB3B 1NQTA 5LHGA 1WPXA 3JD2A 2QM7A 1K92A 2EZPA 3H01A 3A0RA 4N23A 3RW0A 2ZXWC 4GX5A 1K4CC 1SETA 1FXKB 1W0JG 4JPRA 4PA4A 1NKDA 3CD6V 3AG3B 4MTOA 1KD1W 2WLKA 1V54B 3ASOB 1EBOA 2EBOA 1KQSU 1QR9A 3IC7A 2H8PC 1OCOB 2C2AA 1FXKC 4LP8A 2ITDC 2DWDC 2X6AA 4JGSA 1H2GA 1YSCA 2B1IA 3SJQC 1OCCB 3AG3C 3OUFA 2XAQA 4TT3G 3BEHA 1V54C 1S0VA 3ASOC 1WLEA 3ETDA 3CCMV 1OCOC 4FIPC 1H8HG 1K5QA 1Y66A 4QE9A 1OCCC 2R9RB 3E2EA 1P4RA 4MW8A 3GB7C 3T1CA 2X0LA 2QKSA 3P30A 5IY5B 3SYAA 1YJNV 5EBLC 3CMAV 4PDMA 3ZN0A 3OMNB 3CC7V 4JYBA 4PDRA 3CPWU 3CXCU 1F4MA 3E89A 1NR7A 5LGUA 3E8HA 3OEEG 1R6NA 5KA5A 5IY5C 1BHBA 1OCZB 5FL7G 3W7UA 3W7WA 3PJSK 2P67A 4FPPA 3ZMUA 1ENVA 1BMFG 1M57C 4E2LA 1S5HC 4JF3A 4MVOA 3I56V 1SRYA 3ABKB 5H9CA 1SERA 5IYDO 4JTDB 5B3SC 2BOBC 1QR8A 5IYBO 5CBGA 3SYPA 2A79B 3SYQA 4MTGA 4WFEA 1R73A 3ZMTA 3W7TA 4X8AA 4ASUG 1GM9A 1R6KA 1VQPV 4WFBV 3LUTB 2IJKA 2EZOA 3AG2B 4HZ3A 1VQ7V 1MOFA 1H38A 2B5UA 1K7DA 2DYRC 4LCUC 3ZRXA 4G2KA 4OXSA 5LHIA 3CCVV 1VQNV 3QO5A 5L3FA 3K04A 3FB5C 3NXSA 3E86A 3AG2C 1QCEA 1VQKV 2WAMA 1EFRG 1Q81W 3CCLV 4LBEC 3SPIA 2HVKC 4I5SA 3ZRWA 1OHHG 1I5YA 2JEXA 3ZJZA 1Q86W 3ABUA 4MVZA 1SESA 1FS0G 1B6QA 2AHYA 1Y4MA 1UJWB 3AEIA 4XDJA 1YHQV 1JQ0A 2PI5A 3OAAG 4FMTA 1K73W 4MVUA 4KUMA 4QNHB 4H37A 3ML0A 1GTOA 1NJIW 1PD3A 2HG5C 3ZMVA 1EZJA 2ZDIA 5C93A 2W6IG 2B1GA 3OR7C 1CP9A 3E8BA 3F5WC 1KP3A 3FYIB 1YTFB 1S76D 4BIZA 4TSFG 2CK3G 2WLNA 2OCCB 5KA6A 2WLIB 2WLIA 5LGTA 4QPJA 1K33A 1JCHA 1QBZA 4GCZA 1RM1C 1YITV 1M56B 3E8GA 2YEVA 3P32A 3OM3B 4X88A 1VQ9V 2OCCC 3ASNB 1AI4A 1FXVA 1TUEB 1NVPD 5EC2C 2A0LA 2ZR2A 2P7TC 1M56C 5L3CA 1KKDA 3B8MA 4QE7A 2QTOA 3RVYA 3OUSA 3ASNC 2Q68A 2ZR3A 3VOUA 1K34A 1PNLA 3QO7A 3CCUV 1VQ6V 1E1QG 5CA3A 1G4YB 2V7QG 4UXNA 3EFFK 4QJFB 3VBBA 4YXWG 1K8AW 3BY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K0D A;  3PJS K;  4I9W A;  1OCR C;  3T2M A;  3SYO A;  1BL8 A;  3ZRS A;  2K1E A;  1M57 C;  1S5H C;  4MVO A;  4WFG A;  5CBF A;  4F4L A;  2DYS C;  3SYC A;  2ATK C;  2IH3 C;  2Q6A A;  4JTD B;  3LNM B;  4J9Z B;  4TWK A;  2EIL C;  4GX0 A;  5B3S C;  5KUK A;  2BOB C;  5CBG A;  3SYP A;  2A79 B;  3SYQ A;  4MTG A;  3ABM C;  3K08 A;  4WFE A;  4JTC B;  3OR6 C;  1R3J C;  1ORQ C;  2IH1 C;  3LDE A;  4X8A A;  2X6C A;  3T4Z A;  5B1B C;  3SPH A;  4MVS A;  2Y69 C;  4PA7 A;  2AHZ A;  5KUM A;  1R3K C;  3LUT B;  4P30 A;  4R50 A;  2ZD9 A;  2WLM A;  4MW3 A;  4PA3 A;  4PA9 A;  4HZ3 A;  2JK5 C;  2DYR C;  4LCU C;  3FB8 C;  2Q69 A;  3KG2 A;  3LDD A;  3F7V C;  4R8C A;  4RUE A;  5EBM C;  4OXS A;  4J9Y B;  2ITC C;  4R6Z A;  5J9P C;  3IGA C;  4BW5 A;  4MVR A;  3K04 A;  3FB5 C;  1OCZ C;  3AG2 C;  3E86 A;  4R7C A;  1XL6 A;  2EIN C;  4LBE C;  2X6B A;  3SPI A;  2HVK C;  4EKW A;  3STZ C;  4RUF A;  4GX2 A;  3ABL C;  3SPJ A;  3IFX A;  4RAI A;  1P7B A;  3K06 A;  2EIM C;  3ZJZ A;  3SPG A;  3TCU A;  4MVZ A;  3ABK C;  4GX1 A;  3X2Q C;  3AG4 C;  5BZB A;  2AHY A;  4MTF A;  5B1A C;  4XDJ A;  3FB6 C;  4P2Z A;  5EK0 A;  2BOC C;  2HVJ C;  3LDC A;  4MVU A;  1V55 C;  4G28 B;  4G27 B;  4P9P A;  3UKM A;  3OGC C;  3STL C;  1R3L C;  5E1A C;  4QNH B;  3RW0 A;  2ZXW C;  4GX5 A;  4H37 A;  4XDL A;  1K4C C;  2HFE C;  4MVM A;  2HG5 C;  2KB1 A;  4MVQ A;  4PA4 A;  1XL4 A;  3E83 A;  2A9H A;  3OR7 C;  3F5W C;  3E8B A;  3R65 A;  4RO2 A;  4MTO A;  3SPC A;  1K4D C;  4ZBM A;  2NLJ C;  2WLK A;  4HYO A;  1R3I C;  5EBW C;  5EC1 C;  2WLN A;  2H8P C;  2WLI B;  2WLI A;  4LP8 A;  2ITD C;  1LNQ A;  2DWD C;  2X6A A;  3UM7 A;  2WLL B;  2WLL A;  3SJQ C;  4UUJ C;  3AG3 C;  3FB7 C;  3OUF A;  4H33 A;  4KFM A;  2HJF C;  3BEH A;  1V54 C;  3E8G A;  4DXW A;  3ASO C;  5CBH A;  2YEV A;  3JYC A;  1J95 A;  1ZWI C;  4PA6 A;  4PDV A;  2OCC C;  4X88 A;  3TET A;  3AG1 C;  2EIK C;  1OCO C;  4MSW C;  2WLH A;  2WLJ A;  3K0G A;  2EIJ C;  1OCC C;  2R9R B;  4QE9 A;  4X89 A;  3E8F A;  5EC2 C;  2A0L A;  4MW8 A;  2P7T C;  1M56 C;  3GB7 C;  3T1C A;  4WFF A;  4P9O A;  1KKD A;  4XDK A;  2QKS A;  3RBZ A;  4QE7 A;  1JVM A;  3WG7 C;  2QTO A;  3RVY A;  4PDL A;  3OUS A;  3RVZ A;  3SYA A;  3ASN C;  5EBL C;  2Q68 A;  4MS2 A;  2Q67 A;  4PDM A;  2DWE C;  3T4D A;  3VOU A;  4CBC A;  3HPL C;  4WFH A;  4PDR A;  2W0F C;  1G4Y B;  3E89 A;  3F7Y C;  3EFF K;  3E8H A;  4JTA B;  5IY5 C;  3K03 A;  1QLE C; 
#chains in the Genus database with same CATH topology
 3ETG A;  2QM4 A;  1IBK B;  3ABM B;  1I08 A;  4JYC A;  3ZCC A;  1AVM A;  3JAW B;  4F4L A;  4O4J B;  2VQE O;  3SJB C;  4I7Z B;  5LYJ A;  3K57 A;  3E22 A;  2X6C A;  5LP6 C;  4BAY A;  1BHA A;  1RSO B;  5LXT A;  3JAL B;  1MNG A;  3RT3 C;  1DK1 A;  5A2Q N;  1GRJ A;  3RYF B;  3AG4 B;  1AJQ A;  3WB0 A;  1N0N A;  4R7C A;  4YY3 O;  3T1H B;  3IFX A;  4D7S A;  2NNU A;  3SPG A;  3ABK C;  3CC2 V;  5JCO A;  5EK0 A;  4G27 B;  1SQG A;  4LFB B;  1HP8 A;  5BMV A;  2YC0 A;  4MVM A;  4B3M B;  1XL4 A;  1PP9 H;  3E83 A;  1QLE B;  2Q7E A;  4UB8 Z;  3RWR D;  5IDJ A;  1D5N A;  4JV5 B;  1CPY A;  3ZRW B;  3AG1 B;  4OX9 O;  1GAX A;  1LNQ A;  3ZN1 A;  2WLL A;  2QA4 V;  2EIJ B;  1Y74 B;  3HKB B;  3DC5 A;  3CC4 V;  2JGD B;  3JYC A;  2L6L A;  1IDS A;  5JJJ B;  3JCU Z;  2LP7 A;  2CAZ C;  1DF5 A;  4DUY O;  4XDK A;  5F2V O;  4LFC O;  4NB5 A;  3RVZ A;  1HDJ A;  1M1K W;  2QR4 A;  4MS2 A;  3WFV A;  1XMQ O;  2W0F C;  3F7Y C;  2P22 C;  3K03 A;  3N27 A;  2HKO A;  1QVG U;  3B77 A;  3D36 C;  3ZBH A;  2K1E A;  2LO1 A;  3K9A A;  2QJ1 A;  3LSQ A;  2LW7 A;  1NS1 A;  2Y69 B;  4J9Z B;  4NYK A;  2OWO A;  5KX5 A;  4LR3 A;  5KMG A;  2IJH A;  2UUA O;  2E75 B;  1N8R W;  1ZAU A;  2AHZ A;  4FLW A;  4KL1 A;  2WPD G;  2MW2 B;  3UT5 B;  3OE7 G;  5JJE B;  2PF4 E;  1AR1 B;  4MVR A;  1GKF A;  1VQ5 V;  1FFX A;  3K3W A;  4Z1V A;  1V55 B;  3CCQ V;  3RGB A;  4RQF A;  1IUR A;  5B1A C;  1L1F A;  4DV6 B;  4JI4 O;  4YHH O;  4TUY A;  5LXT B;  4P9P A;  1AI6 A;  2W0X A;  2YDE A;  4UVC A;  3UKM A;  3K58 A;  3T1Y O;  3K79 A;  3DSQ A;  2DQ0 A;  1VQM V;  2LGW A;  2LJ2 A;  3ETQ A;  4DUZ B;  4ZHQ A;  2JS3 A;  1G1X B;  5IE9 A;  2P90 A;  2QDO A;  3JAK A;  4J10 A;  3JD3 A;  1N36 B;  1FYJ A;  1F51 A;  4FVM A;  1VF7 A;  3OGI B;  1KEC A;  1XHX A;  2JJ2 G;  1DTO A;  4YJ3 A;  4D6T H;  5BMV B;  1S3J A;  3E8F A;  1URF A;  3WG7 C;  2Z5U A;  2CDY A;  3JSN A;  3T4D A;  1Q82 W;  4WFH A;  3OTO B;  1QNM A;  3T2M A;  4PHZ A;  4DR7 O;  2EJ7 A;  2CUG A;  4Z2W A;  2DYS C;  3ABT A;  3SYC A;  2Q5Z A;  2EIL C;  2YI9 A;  4FZ0 A;  4DV1 B;  4FM1 A;  1JX9 A;  1Q6U A;  4DV5 O;  1KYO F;  4B3T O;  2OTJ V;  3OMA B;  2F23 A;  1GK9 A;  4PA7 A;  1ZL8 A;  3FFQ A;  4P30 A;  4MT8 A;  1AI5 A;  2Q7H A;  1MSW D;  1NH2 B;  4I55 A;  5L3E A;  2LGQ A;  1SQQ H;  1NBM G;  3FB8 C;  1VP7 A;  4PI0 A;  1HWY A;  2ITC C;  4DK1 A;  5LGN A;  3RYC A;  4BWA A;  3K5L A;  3IGA C;  2N04 A;  1P84 F;  1QVF U;  2WSS G;  4K35 A;  5JH7 B;  4GKJ B;  2GV9 A;  4LF9 B;  3S3X A;  3KKY A;  1NQT A;  4DYL A;  1K92 A;  2ZE6 A;  3O9O A;  2BCC H;  3QVN A;  4LF4 B;  3A0R A;  4GX5 A;  1M4U A;  2F93 B;  1K4C C;  1SET A;  1W0J G;  1RP3 B;  4CC5 A;  4MTO A;  1KD1 W;  2YIA A;  1XNR O;  1V54 B;  4AQY B;  1KQS U;  1QR9 A;  1FXK C;  2ZCE A;  2DWD C;  4JGS A;  4DUZ O;  1YSC A;  4KHP B;  2RCV A;  3QG5 A;  1GN3 A;  4NTW A;  5J2U A;  3ASO C;  3ETD A;  1Q90 D;  4TUY B;  1NTK H;  2M6Y A;  1OCO C;  4UCS A;  1H8H G;  4PV1 B;  1OCC C;  4LF5 B;  4MW8 A;  5CA1 B;  3SYA A;  2AZ0 A;  1F7Y A;  4J7Z A;  3JAK B;  2HHH O;  2B9Z A;  2E3C A;  2OYQ A;  1BGY H;  1BHB A;  2UUC B;  3W7U A;  3W7W A;  2R70 A;  4DR4 O;  4E2L A;  1MMM A;  1SRY A;  3ABK B;  1YEW A;  3K5N A;  1PL4 A;  2BSK A;  4DV3 O;  1YVW A;  4UB6 Z;  2A79 B;  4MTG A;  4X8A A;  3WB1 A;  1FJG B;  4DV1 O;  4EB6 A;  4DV2 B;  3ZHT A;  4JZ2 A;  2BTQ B;  2ARH A;  1K7D A;  3ZRX A;  4G2K A;  4X20 A;  4LF8 B;  1I94 B;  4B3R B;  5L3F A;  2XTA A;  3FB5 C;  2WAM A;  3SJA C;  1TVK B;  2VRZ A;  4I5S A;  4IL6 Z;  1LR1 A;  1NU1 H;  3AEI A;  1JQ0 A;  1NI8 A;  1ZL8 B;  3OAA G;  4FMT A;  1SZX A;  4KUM A;  4FLU A;  1BZK A;  4FLT A;  3OR7 C;  1CP9 A;  3J81 N;  1IXB A;  4AIL C;  4LF4 O;  3FYI B;  4BIZ A;  4TSF G;  3J80 N;  2WLI B;  2YXL A;  4K8Z A;  1RM1 C;  4YJ2 A;  1YIT V;  1M56 B;  5KLV H;  4DR2 B;  2KG7 A;  3ASN B;  2QWQ B;  1TUE B;  5L3C A;  1KKD A;  2HP8 A;  2QWR B;  3HKC A;  3CSX A;  3B8M A;  3B2E E;  4ZI7 B;  2Q68 A;  3VOU A;  4LF5 O;  4YIP A;  5CA3 A;  4LH7 A;  4YXW G;  1K8A W;  2RMK B;  1N34 O;  3A8T A;  4DO2 A;  4U3J B;  1VQ8 V;  5LOV B;  1HNZ B;  4IYI A;  3EHB B;  3U0Z A;  3H1J H;  2QEX V;  3E35 A;  2N74 A;  1HR0 B;  3LSU A;  4Q20 A;  5LBQ A;  3JD0 A;  2BE3 A;  2MK3 A;  4EEQ A;  1RSO A;  4DV7 B;  3ZIA G;  2VQF O;  3G6B A;  3RYF A;  4KP4 A;  1Z5V A;  4EFB A;  1N33 B;  1UPG A;  2IBZ H;  1I94 O;  4B3R O;  4RUF A;  3QF7 A;  2FKX A;  4RAI A;  2ETN A;  4J41 A;  3X2Q C;  1VQL V;  1OJH A;  1M90 W;  2FL4 A;  4NKG B;  2OIE A;  2YXY A;  1GN4 A;  1BE3 H;  1XEQ A;  2JEU A;  3LDC A;  3MHH C;  3JD4 A;  3STL C;  2N05 A;  3BPZ A;  2KB1 A;  4RO2 A;  3JAR A;  2PUS A;  1R1B A;  2WA4 A;  3G4S V;  4DR5 O;  4TQF A;  2JVD A;  1KUQ A;  3IJ4 A;  1FPO A;  1Y74 A;  1GN2 A;  4H0L B;  3HKB A;  2KQX A;  1J95 A;  4PA6 A;  3CXH F;  2EIK C;  4OPH A;  2R72 A;  5L3G A;  2V4D A;  4QPK A;  2CE4 A;  2WLJ A;  2IU3 A;  4U7O A;  2Y4T A;  4DR2 O;  4D7T A;  2CGO A;  1W2B U;  2JRI A;  4LF7 B;  3U11 A;  5KAI Z;  1W0K G;  3CRM A;  3TK1 A;  2ZDI C;  3VQW A;  4I9W A;  1OCR C;  1F4N A;  1BSM A;  3SYO A;  2YS8 A;  2WWW A;  1FXH A;  5CA0 B;  3ZMZ A;  3HKC B;  1JJ2 U;  4HAM A;  2FYU H;  3L74 H;  2ZIO A;  1XHZ A;  1JA8 A;  2D3O W;  1R3J C;  1ORQ C;  2P06 A;  1Y6X A;  1HR0 O;  4X1K B;  3OD4 A;  4ABM A;  4R50 A;  1SZT A;  2WLM A;  4IHJ B;  1D5A A;  1IBL B;  4JYA B;  4F6E A;  5BY1 A;  1BQZ A;  2Q69 A;  4ICG A;  4J9Y B;  1Y67 A;  3GWO A;  5CN0 A;  1J5E O;  2UXC B;  2H94 A;  2X6B A;  2EJR A;  2E5L B;  1B04 A;  4UCT A;  4X62 O;  3M7M X;  1ZTE A;  1YIJ V;  1S72 V;  5IYC O;  1FFT B;  1MZF A;  2F95 B;  3FB6 C;  3UO3 A;  4DV4 B;  3BCC H;  3K9S A;  3B40 A;  3OGC C;  2Y4U A;  2IW5 A;  4XDL A;  2PY5 A;  1BS3 A;  4CC6 A;  2A9H A;  4LFA O;  3SPC A;  3CCE V;  2NLJ C;  5LMN B;  4UV9 A;  1R3I C;  5EBW C;  3OMI B;  2UU9 O;  3IC9 A;  1K3E A;  4FLX A;  1CEZ A;  1PKX A;  4XBF A;  2E76 B;  2DMX A;  2F66 C;  5E79 Z;  4H33 A;  1U96 A;  5CMU A;  4DXW A;  5CBH A;  4FLV A;  4B7E A;  1ZWI C;  4PDV A;  4NTY A;  3B4S A;  3THO A;  5IWA B;  5DED A;  2BTO A;  4X89 A;  4WFA V;  2PGG A;  2RN9 A;  1WP8 A;  1JVM A;  1PNM A;  5GON A;  3JAR B;  2Q67 A;  3OT7 A;  3I55 V;  3GVM A;  1GMG A;  4JAS A;  4N21 A;  2R9I A;  4JTA B;  1AP5 A;  2YID A;  4ZKI A;  4JI7 O;  1Q43 A;  2Z3Y A;  2W6J G;  1Q7Y W;  2CH7 B;  4TOI A;  5H5N A;  3A0H Z;  5B1B B;  5HFM A;  4TWK A;  4JI5 B;  4NR1 A;  3RFR A;  2QM8 A;  1K5S A;  1VQO V;  5JQG B;  2IH1 C;  3T4Z A;  1MSD A;  3OEH G;  2DOS A;  3C3T A;  3P3N A;  3QNE A;  2UXB O;  4GZR B;  4E4E A;  1E79 G;  3L72 H;  2OT5 A;  3KG2 A;  2UUB O;  5LA6 B;  5J9P C;  1Q6I A;  3LSS A;  1RM1 B;  1IBL O;  4JYA O;  1IBK O;  5JH7 A;  2EIN C;  4PEL A;  1AJP A;  2Z0A A;  3TXQ A;  3ABL C;  3JSL A;  3K06 A;  2EIM C;  2ZXW B;  1WPX A;  3JD2 A;  2E5L O;  3G80 A;  5IJ0 B;  4BW9 A;  1VF6 A;  1LUV A;  1MA1 A;  3O65 A;  3BVO A;  3SGI A;  5IYZ B;  4N23 A;  3RW0 A;  2Q8V A;  4DR1 B;  2ZM6 B;  3A2F A;  4JPR A;  4DRX B;  1NKD A;  4OPA A;  1EBO A;  2EBO A;  5C8Y B;  2C2A A;  2ZE5 A;  4LP8 A;  1H2G A;  5GTI Z;  2RQ6 A;  3SJQ C;  2IM9 A;  3AG3 C;  1Y76 A;  1S0V A;  1WLE A;  1SKV A;  3T1H O;  2KKW A;  3CJH A;  3K5O A;  2R9R B;  5LP6 A;  5BR8 B;  3DXR B;  2F1M A;  3T1C A;  5CB4 A;  1H2L A;  2QKS A;  4UCV A;  3P30 A;  5CA1 A;  2HJD A;  4LFB O;  5IWA O;  5EBL C;  3CMA V;  3AK1 A;  4PDM A;  1JMK C;  3ZN0 A;  4FLZ A;  4PDR A;  4B3M O;  3CPW U;  3CXC U;  1F4M A;  4IYH A;  3E89 A;  2QTS A;  4X1Y B;  1NR7 A;  1V9P A;  3E8H A;  5KA5 A;  1KMI Z;  5IY5 C;  1U97 A;  5FL7 G;  1BT8 A;  5FLX N;  3PJS K;  4JV5 O;  3L9D A;  3WB2 A;  4K0K B;  1M57 C;  4I0X A;  1S5H C;  4JF3 A;  1UFI A;  4MVO A;  3CS5 A;  1SER A;  3KCY A;  1XBL A;  5B3S C;  2BOB C;  1QR8 A;  2YUA A;  2YIB D;  5IYB O;  5KHG A;  5GON B;  4O4L A;  4X9Q A;  3ZMT A;  1GM9 A;  1QU7 A;  1XNQ B;  2AGA A;  5FPR A;  2PYJ A;  2IJK A;  3S3W A;  2BTQ A;  1MOF A;  1EZV H;  1H38 A;  2B5U A;  2DYR C;  4LCU C;  4HNA B;  2ZE8 A;  1XIL A;  4JI1 B;  3DC6 A;  1N4C A;  3K04 A;  3E86 A;  3AG2 C;  1QCE A;  3CCL V;  1TVK A;  3SPI A;  4NVP A;  1I5Y A;  2JEX A;  3K59 A;  4MVZ A;  1SES A;  1B6Q A;  4DV0 B;  2AHY A;  2ZE7 A;  1Y4M A;  1UJW B;  3JAT B;  1IX9 A;  2FB5 A;  2D2C B;  3ML0 A;  1PD3 A;  1WA8 A;  4X66 B;  3JAS B;  2PYL A;  3HKE B;  5C93 A;  2B1G A;  3F5W C;  1KP3 A;  1HW7 A;  1EM1 A;  5JWP A;  3B09 A;  4DR1 O;  2GTS A;  2WLN A;  5KA6 A;  2WLI A;  5K1P A;  5LGT A;  4QPJ A;  2ZNJ A;  2Q7G A;  1JCH A;  1QBZ A;  4GCZ A;  1YDX A;  2YEV A;  2OCC C;  5JVD A;  1AP6 A;  1AI4 A;  2XT9 A;  4DV6 O;  1NVP D;  4JI6 B;  3N2G A;  2P7T C;  2E74 B;  4J7K A;  2QTO A;  4ZI7 A;  1HNX B;  1G4Y B;  4UXN A;  3VQY A;  4QJF B;  2JS5 A;  3VBB A;  3P3P A;  1Y76 B;  1QQC A;  1AR4 A;  4RWU A;  3BY6 A;  4NTX A;  1A32 A;  3DTU B;  1WAZ A;  1Q8I A;  2H3O A;  4U3J A;  1N36 O;  2YXH A;  2QWP B;  3FD9 A;  5LOV A;  2VS0 A;  3CJH B;  4JI0 B;  3D3I A;  4L87 A;  1SC5 B;  5LP6 B;  3ZMS A;  3LNM B;  5CB4 B;  4K0K O;  2ADP A;  1FAF A;  3ABM C;  2QSA A;  3FAV A;  2FTK A;  2YI8 A;  3OW2 U;  3SPH A;  5K1X A;  2Q0A A;  1R3K C;  4UVB A;  5GTH Z;  3VQV A;  2XND G;  1NVP B;  3OTO O;  1XNQ O;  3LDD A;  4I0X B;  3BRC A;  1ROP A;  5EBM C;  2F4V B;  5EZY A;  4B3S B;  1G8M A;  2V1D A;  3F5T A;  1OCZ C;  1OZ0 A;  2LFR A;  3BA8 A;  2ZIN A;  4OGQ B;  3MAQ A;  1K97 A;  3STZ C;  4GX2 A;  1PL0 A;  4O4L B;  4AHC A;  4WBN A;  3TCU A;  4GX1 A;  2QGN A;  1L0L H;  3AG4 C;  5BZB A;  4MTF A;  5B1N A;  1QHT A;  3JCZ A;  4IGG A;  5E1A C;  5GW7 A;  4DV0 O;  4PI2 A;  4GUN A;  2HFE C;  4UCR A;  1IXM A;  3CYO A;  5IJ9 A;  1K4D C;  5ITZ B;  4L8J A;  4GKK B;  1HNW B;  5DN6 G;  1KC8 W;  4KXR A;  2JIZ G;  1ZLZ A;  2CTP A;  2LQT A;  4Q6G A;  4UV8 A;  4GKJ O;  4DR3 B;  4KFM A;  3G71 V;  1KKC A;  1SQF A;  4LF9 O;  2GHY A;  1Q5O A;  3TET A;  3AG1 C;  1B06 A;  1MZE A;  1TGO A;  3C90 A;  4NXM B;  2EIJ C;  3CME V;  3BA9 A;  1WA8 B;  4DW0 A;  2QKA A;  5LMU B;  4WFF A;  4P9O A;  3RBZ A;  1KB9 F;  2M7W A;  3HPL C;  1XUQ A;  4DK0 A;  1SQV H;  3TGU H;  1QLN A;  4AQY O;  1SS3 A;  4GLX A;  3G6E V;  2OTL V;  2YEV B;  5L3B A;  3JD1 A;  1TAE A;  1MG1 A;  3ABL B;  5JVD B;  4KHP O;  1N0J A;  1W59 A;  1SQB H;  3FYE B;  4BIO A;  5CA0 A;  1TA8 A;  1NR1 A;  2Q6A A;  3N2G B;  4J80 A;  1S5L Z;  5KUK A;  4IT5 A;  2G38 A;  4U3F H;  3NR7 A;  2Y69 C;  2YSU B;  5KUM A;  4X1K A;  4K8X A;  5L3D A;  2VWK A;  4IHJ A;  4U7N A;  4UVA A;  4W4L A;  2UXN A;  4FZ1 A;  4RUE A;  1FXK A;  4YIO A;  1SA0 A;  2UUC O;  4TV9 A;  1GM8 A;  5B1A B;  4MTX A;  2CTR A;  2F4V O;  4B3S O;  2UXX A;  2X7R B;  1KP2 A;  3FAV B;  3LNN A;  1I7F A;  2RJZ A;  1JJO A;  2VWJ A;  2PI4 A;  1V55 C;  4G28 B;  2DN9 A;  4JI8 B;  1FJG O;  3MDS A;  2QKC A;  5EZY B;  4MVQ A;  4DV2 O;  2ODM A;  1NZ6 A;  3M99 B;  2GDS A;  4LF8 O;  1M57 B;  3H1I H;  3FKS G;  5H6R A;  4WBN B;  4UUJ C;  3QO8 A;  4I4T A;  2VQE B;  5B3S B;  1YI2 V;  1WB7 A;  3WG7 B;  2XUM A;  3G67 A;  4O4H A;  1RPR A;  4MSW C;  1H8E G;  1O9H A;  1H2M A;  5JCO C;  2P4K A;  5IJ9 B;  1AB3 A;  2A3Q A;  2DYR B;  1YTF D;  5LMU O;  3MD0 A;  1DF4 A;  4CS4 A;  1AR5 A;  1AJN A;  1WN7 A;  1NT2 B;  5H2F Z;  2AXT Z;  2DYS B;  1YCI A;  2EIL B;  3MHS C;  1Q6H A;  4YY3 B;  3H9V A;  2CH7 A;  4WFG A;  2RDC A;  3BFR A;  4X1I A;  3ZS8 C;  2IH3 C;  2XAG A;  4GX0 A;  2XHB A;  1KBH A;  4WCE V;  5JQG A;  5HFL A;  1F23 A;  3W7X A;  1H2S B;  2CGN A;  2EX3 A;  4MW3 A;  4IIJ A;  2JDI G;  5J2T A;  3U10 A;  4R8C A;  3ZHQ A;  5LA6 A;  2LFS A;  4ZOL B;  1ZUQ A;  2IJI A;  2Y0P A;  4WF9 V;  3K5M A;  1XMO B;  1I5X A;  1HNZ O;  1WPB A;  1Q3E A;  4H44 B;  1EN4 A;  5IJ0 A;  4QGP A;  3H01 A;  4LFC B;  5IYZ A;  4B7K A;  2RNB A;  1H2N A;  3IAY A;  1XMQ B;  4JI2 B;  3TXS A;  1FXK B;  1SQP H;  4PA4 A;  3CB2 A;  4DRX A;  1SA0 B;  4DV7 O;  3CD6 V;  4TV9 B;  3SJC C;  3ASO B;  1JFF B;  4I50 B;  5C8Y A;  2H8P C;  1OCO B;  1SQX H;  2GTA A;  2ITD C;  2X6A A;  1OCC B;  3OUF A;  2XAQ A;  4TT3 G;  1N33 O;  1V54 C;  3CCM V;  2P4V A;  3UQ8 A;  4QE9 A;  3E2E A;  2UUA B;  1P4R A;  2KSD A;  3DXR A;  1US6 A;  1YJN V;  3OMN B;  4JYB A;  4HBN A;  4X1Y A;  3UCS C;  3OEE G;  2GUZ B;  4LWS A;  4I4T B;  1PM9 A;  1OCZ B;  4O4I A;  4FPP A;  1ENV A;  1BMF G;  1T5E A;  4O4H B;  3H1K H;  3L70 H;  2P5O A;  3SYQ A;  4JI4 B;  4YHH B;  1IVS A;  1FKA O;  4WFE A;  3T1Y B;  1S5J A;  2HEP A;  1R6K A;  4WFB V;  3LUT B;  4LF7 O;  2EZO A;  1TUB B;  1M93 A;  3N2K A;  4HNA A;  5LHI A;  3QO5 A;  4X1I B;  3NXS A;  1EN6 A;  1VQK V;  1EFR G;  3L75 H;  2HVK C;  3FX7 A;  1OHH G;  2PZS A;  1N32 B;  5EIB C;  1XDC A;  3ZJZ A;  3ABU A;  1Q86 W;  1FS0 G;  4J42 A;  2PI5 A;  1XMO O;  5FNV A;  3JAT A;  1K73 W;  4MVU A;  3RYI B;  4IIJ B;  3SR2 C;  3CHX A;  5J2T B;  1XI1 A;  1GTO A;  1NJI W;  1Z2G A;  1X59 A;  2HG5 C;  4CH3 A;  4FM0 A;  2YIB A;  3AG7 A;  2ZDI A;  3H1L H;  3JAS A;  3HKE A;  1R6T A;  3APQ A;  5D5P A;  4K3A A;  3UO2 A;  3I5D A;  1S76 D;  4JI2 O;  3RYH B;  3ZHV A;  2OIG A;  1L0N H;  4DR7 B;  2UXC O;  4J11 A;  5IT9 N;  2Q4P A;  3E8G A;  1G6U A;  3P32 A;  3OM3 B;  4LNU B;  4DV5 B;  1FD9 A;  4B3T B;  3AK3 A;  1VMG A;  3ICX A;  5EC2 C;  3JAM N;  1M56 C;  5KAF Z;  2Q73 A;  4DV4 O;  1DGS A;  3OUS A;  3ASN C;  2ZR3 A;  4FLY A;  1K34 A;  1PNL A;  3QO7 A;  3CCU V;  1VQ6 V;  1E1Q G;  4TV8 A;  4UFZ A;  3EFF K;  2DE0 X;  5LMN O;  1NTM H;  3K0D A;  3ZED A;  1YF2 A;  1BL8 A;  1WB8 A;  1ARO P;  4FFB A;  4NXN B;  5CBF A;  2CTQ A;  2PTM A;  3ETE A;  2F43 G;  3QTC A;  5LYJ B;  3E22 B;  3TJT A;  3J7A U;  1XOU A;  1RFY A;  4LWS B;  3ZRV A;  4PA9 A;  4O4I B;  2JK5 C;  3D8C A;  1XNR B;  2XAS A;  1X4T A;  3X2Q B;  3D3Q A;  2Q0O C;  4PJ0 Z;  1XL6 A;  1P7G A;  5KHJ A;  1PV0 A;  3SPJ A;  4JAV A;  1L8D A;  1P7B A;  2HLD G;  4JI5 O;  4P2Z A;  2HVJ C;  1N32 O;  1GM7 A;  2HR3 A;  1NH2 D;  3R66 A;  1S77 D;  3N2K B;  2HHH B;  5B1O A;  2YIC A;  1RPO A;  3R65 A;  2NR5 A;  4GT1 A;  4UCU A;  5ITZ A;  3W7S A;  1GN6 A;  2ZT9 B;  4DR4 B;  2EIK B;  2WLL B;  4X64 B;  1VQ4 V;  1KU9 A;  3FB7 C;  2XAH A;  4DW1 A;  5EYP A;  2IU0 A;  5FNV B;  4DV3 B;  5A9G A;  2LW1 A;  1XRE A;  1YXB A;  1E1R G;  1IBM B;  3B8N A;  3CP1 A;  3K0G A;  1LUW A;  2EUL A;  3DGE A;  4PDL A;  5LHH A;  3ZHU A;  3D36 A;  2ZM6 O;  1OCR B;  5LL6 Y;  1COW G;  2XAF A;  4FFK A;  4BW5 A;  2QE7 G;  3ZRS A;  1M9N A;  1YZB A;  1BCC H;  3CEI A;  1I0H A;  2DJV A;  4FK5 C;  3APO A;  2L35 A;  4LC1 A;  3CWB H;  4NXN O;  4ZIB A;  2GBO A;  3K08 A;  5KMG B;  5KX5 B;  4RQE A;  4LF6 B;  4GYC B;  3BHP A;  5BR8 O;  4TV8 B;  4PD4 F;  4CS2 A;  1GO3 F;  4PA3 A;  2JJ1 G;  2AZ2 A;  4FFB B;  1THZ A;  3CCS V;  1WP7 A;  1FFX B;  4H13 B;  4EKW A;  4BIU A;  1PNK A;  3HKD A;  5JJN B;  3CRQ A;  5D5Q A;  1GH6 A;  4CH4 A;  2BOC C;  5KHK A;  3CCR V;  4O2B A;  1R3L C;  2DW4 A;  5DM6 V;  1Z5W A;  4QIW F;  2Y48 A;  1K9M W;  3ZHR A;  2UXD B;  4X65 B;  5EIB D;  4ZHQ B;  4ZBM A;  4HYO A;  2Q9L A;  5BXZ A;  5EC1 C;  3CRC A;  1JPX A;  1N34 B;  1IZ3 A;  3UM7 A;  4JI1 O;  2GSM B;  1NTZ H;  1YJ9 V;  2HJF C;  4A5U B;  3CCJ V;  4W4K A;  4X64 O;  4YJ3 B;  3OFN G;  2ZNI A;  2WLH A;  2XAJ A;  3BAA A;  1VIB A;  2DQ3 A;  4FJC C;  1IBM O;  1XQ8 A;  2O57 A;  3KZI Z;  2DWE C;  2VQF B;  4CBC A;  4Z1M G;  4X66 O;  1QLE C;  5EYP B;  2QWO B;  2ZQM A;  4CZZ A;  1H2K A;  2ATK C;  2P6J A;  4DR6 B;  1WNS A;  2ADQ B;  4AI8 A;  3Q4H A;  4JAU A;  4JTC B;  3OR6 C;  1JOY A;  4JI6 O;  5KHI A;  1VEW A;  3LDE A;  5B1B C;  4MVS A;  4JI3 B;  1D2D A;  2IJJ A;  3CRR A;  1HNX O;  3OTF A;  1AI7 A;  2ZD9 A;  4LF6 O;  4CS3 A;  2XOK G;  4I55 B;  2EIN B;  1ZX3 A;  3H1H H;  2ZKO A;  4F6R A;  4UCO A;  3F7V C;  1DLB A;  3KCX A;  4DR5 B;  2R9A A;  3RYC B;  2EIM B;  4R6Z A;  1MAB G;  2ILM A;  4ZOL A;  1YJW V;  5H6Q A;  4JI0 O;  4EFE A;  4JAA A;  5DEC A;  3HB3 B;  3EVK A;  5LHG A;  3ZX6 A;  3SDL A;  2QM7 A;  2EZP A;  1CXZ B;  1P49 A;  3WU2 Z;  2AW9 A;  2ZXW C;  4O2A A;  4TQD A;  2FML A;  3AG3 B;  2WLK A;  1JFF A;  5KHH A;  4I50 A;  3IC7 A;  4BR6 A;  1EN5 A;  2OCH A;  3HKD B;  1B3Q A;  4X65 O;  2UXD O;  2B1I A;  3BEH A;  5J2U B;  5TIS Z;  2K9P A;  4FIP C;  4O2B B;  3JAW A;  1PPJ H;  1K5Q A;  1Y66 A;  4O4J A;  2WA3 A;  3GB7 C;  3EXA A;  2X0L A;  3VQX A;  5IY5 B;  2JGU A;  1VAR A;  4CH6 A;  3CC7 V;  2NN4 A;  5LGU A;  1R6N A;  2GUZ A;  1J5E B;  3JAL A;  4GKK O;  1OV9 A;  1HNW O;  2P67 A;  3ZMU A;  4JZG A;  1M5I A;  3I56 V;  3CX5 F;  4X62 B;  5H9C A;  4DR3 O;  5IYD O;  4JTD B;  2BSK B;  3HR0 A;  1JR9 A;  3SYP A;  5CBG A;  3M8A A;  4NXM O;  1ZSP A;  4LH6 A;  1R73 A;  3W7T A;  4ASU G;  4DR6 O;  4EB6 B;  1VQP V;  3BAB A;  1TUB A;  3AG2 B;  4HZ3 A;  4LFA B;  1VQ7 V;  2A06 H;  1SF9 A;  4JYY A;  4JI3 O;  2UU9 B;  4OXS A;  4X20 B;  3CCV V;  1VQN V;  1WJZ A;  1Q81 W;  4LBE C;  3ZRW A;  3Q4H B;  3AK2 A;  4XDJ A;  1YHQ V;  2JGD A;  3RN4 A;  3GWK C;  3CE2 A;  3RYI A;  4QNH B;  3PN1 A;  4H37 A;  4F6R B;  3ZMV A;  3ZHS A;  4OX9 B;  4J7J A;  1EZJ A;  1O9G A;  2W6I G;  3L73 H;  3E8B A;  1VF5 B;  3CRA A;  5AG2 A;  1YTF B;  4JI7 B;  3RYH A;  2CK3 G;  4C7U A;  2OCC B;  2Y0I A;  1K33 A;  3C3S A;  4YJ2 B;  4CH5 A;  5B5E Z;  3A0B Z;  3L71 H;  2KG7 B;  4DUY B;  1VQ9 V;  4X88 A;  4LNU A;  4FM2 A;  4I9Q A;  4O2A B;  1FXV A;  2ZIM A;  2A0L A;  2ZR2 A;  1BQ0 A;  5FPO A;  4QE7 A;  1VF6 C;  5B66 Z;  3RVY A;  4JI8 O;  2A7W A;  1AIL A;  4B08 A;  2QWN B;  2UXB B;  2CTW A;  2V7Q G;  2UUB B;  3UT5 A; 
#chains in the Genus database with same CATH homology
 3K0D A;  3ETG A;  3DTU B;  1BL8 A;  4DO2 A;  1ARO P;  3ABM B;  1VQ8 V;  4JYC A;  5CBF A;  3ZCC A;  3D3I A;  4L87 A;  3EHB B;  3ETE A;  4F4L A;  3ZMS A;  3LNM B;  2F43 G;  2QEX V;  3E35 A;  4Q20 A;  3ABM C;  5LBQ A;  3JD0 A;  2FTK A;  3OW2 U;  2X6C A;  3SPH A;  4BAY A;  1BHA A;  1R3K C;  4UVB A;  2MK3 A;  3ZRV A;  4PA9 A;  3ZIA G;  2JK5 C;  2XND G;  1NVP B;  3LDD A;  2XAS A;  1ROP A;  5EBM C;  1G8M A;  2V1D A;  3X2Q B;  4KP4 A;  3AG4 B;  1AJQ A;  1OCZ C;  1OZ0 A;  2LFR A;  4R7C A;  1XL6 A;  1K97 A;  4RUF A;  4GX2 A;  1PL0 A;  3STZ C;  3SPJ A;  4JAV A;  3IFX A;  4RAI A;  1P7B A;  2NNU A;  3SPG A;  3TCU A;  3ABK C;  4GX1 A;  3X2Q C;  3AG4 C;  5BZB A;  4MTF A;  2HLD G;  5B1N A;  1VQL V;  1M90 W;  3CC2 V;  4P2Z A;  5EK0 A;  2HVJ C;  2JEU A;  3JCZ A;  3LDC A;  3MHH C;  4G27 B;  1GM7 A;  3JD4 A;  3STL C;  5E1A C;  5GW7 A;  2HR3 A;  1NH2 D;  1S77 D;  2HFE C;  4MVM A;  2KB1 A;  5B1O A;  1RPO A;  1XL4 A;  3E83 A;  3R65 A;  1IXM A;  4GT1 A;  4RO2 A;  3CYO A;  1QLE B;  1K4D C;  5IDJ A;  3W7S A;  3G4S V;  5DN6 G;  1CPY A;  3ZRW B;  3AG1 B;  2EIK B;  1KC8 W;  1LNQ A;  2JIZ G;  2WLL B;  2WLL A;  3ZN1 A;  2QA4 V;  1VQ4 V;  2EIJ B;  4UV8 A;  3FB7 C;  2XAH A;  4KFM A;  2IU0 A;  3G71 V;  3JYC A;  3CC4 V;  2GHY A;  1J95 A;  4PA6 A;  3TET A;  3AG1 C;  2EIK C;  5L3G A;  1E1R G;  4QPK A;  3B8N A;  3CP1 A;  2WLJ A;  3K0G A;  2EIJ C;  2IU3 A;  3CME V;  2LP7 A;  4U7O A;  1DF5 A;  4WFF A;  4P9O A;  4XDK A;  3RBZ A;  3DGE A;  4PDL A;  3RVZ A;  1M1K W;  1W2B U;  5LHH A;  4MS2 A;  3WFV A;  1W0K G;  3D36 A;  1OCR B;  2M7W A;  3HPL C;  1COW G;  2W0F C;  3TK1 A;  2ZDI C;  3F7Y C;  2XAF A;  1QLN A;  3K03 A;  4BW5 A;  2HKO A;  4I9W A;  3G6E V;  3B77 A;  1QVG U;  2YEV B;  2OTL V;  1OCR C;  1F4N A;  2QE7 G;  3SYO A;  3ZRS A;  5L3B A;  2K1E A;  3JD1 A;  1MG1 A;  3ABL B;  1M9N A;  3K9A A;  2WWW A;  1FXH A;  3LSQ A;  3FYE B;  4FK5 C;  1NR1 A;  2Q6A A;  2Y69 B;  4LC1 A;  4J9Z B;  3ZMZ A;  5KUK A;  1JJ2 U;  4HAM A;  3K08 A;  4RQE A;  2IJH A;  2D3O W;  1R3J C;  1ORQ C;  1N8R W;  2Y69 C;  2YSU B;  2AHZ A;  5KUM A;  5L3D A;  4R50 A;  1SZT A;  2WLM A;  1GO3 F;  2WPD G;  4PA3 A;  4U7N A;  4UVA A;  2JJ1 G;  2UXN A;  3OE7 G;  2Q69 A;  4RUE A;  1FXK A;  4J9Y B;  1THZ A;  3CCS V;  3GWO A;  5CN0 A;  1AR1 B;  2H94 A;  4MVR A;  1GKF A;  1VQ5 V;  1GM8 A;  5B1A B;  4MTX A;  2X6B A;  2EJR A;  3K3W A;  4EKW A;  1V55 B;  4BIU A;  3CCQ V;  2UXX A;  2X7R B;  4RQF A;  1PNK A;  1KP2 A;  1YIJ V;  1S72 V;  5IYC O;  1FFT B;  5B1A C;  1L1F A;  3FB6 C;  2BOC C;  2PI4 A;  1V55 C;  4G28 B;  3CCR V;  1AI6 A;  4P9P A;  3OGC C;  3UKM A;  4UVC A;  1R3L C;  2IW5 A;  3K79 A;  2DW4 A;  4XDL A;  2DQ0 A;  5DM6 V;  1VQM V;  4QIW F;  2Y48 A;  4MVQ A;  1K9M W;  2A9H A;  3M99 B;  3SPC A;  4ZBM A;  2NLJ C;  3CCE V;  4HYO A;  4UV9 A;  2P90 A;  1R3I C;  5EBW C;  3OMI B;  5EC1 C;  1JPX A;  1M57 B;  3JD3 A;  1K3E A;  1CEZ A;  1PKX A;  3FKS G;  5H6R A;  4XBF A;  3UM7 A;  1F51 A;  2GSM B;  4UUJ C;  4H33 A;  3QO8 A;  1YJ9 V;  2HJF C;  5CMU A;  4DXW A;  5B3S B;  5CBH A;  1YI2 V;  3CCJ V;  3WG7 B;  1ZWI C;  1KEC A;  4PDV A;  2JJ2 G;  1DTO A;  3OFN G;  1RPR A;  4MSW C;  1H8E G;  2WLH A;  4X89 A;  1S3J A;  4WFA V;  2XAJ A;  3E8F A;  2DQ3 A;  1JVM A;  3WG7 C;  1PNM A;  4FJC C;  2Z5U A;  2Q67 A;  3T4D A;  2DWE C;  2DYR B;  3I55 V;  1Q82 W;  4CBC A;  1YTF D;  4WFH A;  4Z1M G;  1GMG A;  3MD0 A;  4JAS A;  1DF4 A;  4N21 A;  1AJN A;  2DYS B;  2R9I A;  4JTA B;  4ZKI A;  1QLE C;  2EIL B;  2Z3Y A;  3MHS C;  2W6J G;  3T2M A;  2ZQM A;  4CZZ A;  1Q7Y W;  4WFG A;  2DYS C;  3ABT A;  2ATK C;  3SYC A;  5B1B B;  2IH3 C;  2P6J A;  5HFM A;  4TWK A;  2EIL C;  2XAG A;  4GX0 A;  1JX9 A;  2QM8 A;  1K5S A;  4JAU A;  1VQO V;  4WCE V;  2OTJ V;  4JTC B;  5HFL A;  3OR6 C;  1JOY A;  2IH1 C;  3LDE A;  3T4Z A;  1F23 A;  5B1B C;  3OMA B;  4MVS A;  3OEH G;  1GK9 A;  4PA7 A;  3W7X A;  2IJJ A;  4P30 A;  1AI7 A;  3QNE A;  2ZD9 A;  4MT8 A;  1AI5 A;  4MW3 A;  1MSW D;  1NH2 B;  2XOK G;  1E79 G;  2EIN B;  5L3E A;  2JDI G;  1NBM G;  2OT5 A;  3FB8 C;  3KG2 A;  4R8C A;  3F7V C;  1DLB A;  1HWY A;  2ITC C;  5LGN A;  2EIM B;  4R6Z A;  5J9P C;  3IGA C;  1MAB G;  3LSS A;  1RM1 B;  1QVF U;  2LFS A;  2WSS G;  1YJW V;  2EIN C;  2IJI A;  4PEL A;  1AJP A;  4WF9 V;  5H6Q A;  1I5X A;  3ABL C;  3K06 A;  2EIM C;  2ZXW B;  3HB3 B;  1NQT A;  5LHG A;  1WPX A;  3JD2 A;  2QM7 A;  1K92 A;  2EZP A;  3H01 A;  3A0R A;  4N23 A;  3RW0 A;  2ZXW C;  4GX5 A;  1K4C C;  1SET A;  1FXK B;  1W0J G;  4JPR A;  4PA4 A;  1NKD A;  3CD6 V;  3AG3 B;  4MTO A;  1KD1 W;  2WLK A;  1V54 B;  3ASO B;  1EBO A;  2EBO A;  1KQS U;  1QR9 A;  3IC7 A;  2H8P C;  1OCO B;  2C2A A;  1FXK C;  4LP8 A;  2ITD C;  2DWD C;  2X6A A;  4JGS A;  1H2G A;  1YSC A;  2B1I A;  3SJQ C;  1OCC B;  3AG3 C;  3OUF A;  2XAQ A;  4TT3 G;  3BEH A;  1V54 C;  1S0V A;  3ASO C;  1WLE A;  3ETD A;  3CCM V;  1OCO C;  4FIP C;  1H8H G;  1K5Q A;  1Y66 A;  4QE9 A;  1OCC C;  2R9R B;  3E2E A;  1P4R A;  4MW8 A;  3GB7 C;  3T1C A;  2X0L A;  2QKS A;  3P30 A;  5IY5 B;  3SYA A;  1YJN V;  5EBL C;  3CMA V;  4PDM A;  3ZN0 A;  3OMN B;  3CC7 V;  4JYB A;  4PDR A;  3CPW U;  3CXC U;  1F4M A;  3E89 A;  1NR7 A;  5LGU A;  3E8H A;  3OEE G;  1R6N A;  5KA5 A;  5IY5 C;  1BHB A;  1OCZ B;  5FL7 G;  3W7U A;  3W7W A;  3PJS K;  2P67 A;  4FPP A;  3ZMU A;  1ENV A;  1BMF G;  1M57 C;  4E2L A;  1S5H C;  4JF3 A;  4MVO A;  3I56 V;  1SRY A;  3ABK B;  5H9C A;  1SER A;  5IYD O;  4JTD B;  5B3S C;  2BOB C;  1QR8 A;  5IYB O;  5CBG A;  3SYP A;  2A79 B;  3SYQ A;  4MTG A;  4WFE A;  1R73 A;  3ZMT A;  3W7T A;  4X8A A;  4ASU G;  1GM9 A;  1R6K A;  1VQP V;  4WFB V;  3LUT B;  2IJK A;  2EZO A;  3AG2 B;  4HZ3 A;  1VQ7 V;  1MOF A;  1H38 A;  2B5U A;  1K7D A;  2DYR C;  4LCU C;  3ZRX A;  4G2K A;  4OXS A;  5LHI A;  3CCV V;  1VQN V;  3QO5 A;  5L3F A;  3K04 A;  3FB5 C;  3NXS A;  3E86 A;  3AG2 C;  1QCE A;  1VQK V;  2WAM A;  1EFR G;  1Q81 W;  3CCL V;  4LBE C;  3SPI A;  2HVK C;  4I5S A;  3ZRW A;  1OHH G;  1I5Y A;  2JEX A;  3ZJZ A;  1Q86 W;  3ABU A;  4MVZ A;  1SES A;  1FS0 G;  1B6Q A;  2AHY A;  1Y4M A;  1UJW B;  3AEI A;  4XDJ A;  1YHQ V;  1JQ0 A;  2PI5 A;  3OAA G;  4FMT A;  1K73 W;  4MVU A;  4KUM A;  4QNH B;  4H37 A;  3ML0 A;  1GTO A;  1NJI W;  1PD3 A;  2HG5 C;  3ZMV A;  1EZJ A;  2ZDI A;  5C93 A;  2W6I G;  2B1G A;  3OR7 C;  1CP9 A;  3E8B A;  3F5W C;  1KP3 A;  3FYI B;  1YTF B;  1S76 D;  4BIZ A;  4TSF G;  2CK3 G;  2WLN A;  2OCC B;  5KA6 A;  2WLI B;  2WLI A;  5LGT A;  4QPJ A;  1K33 A;  1JCH A;  1QBZ A;  4GCZ A;  1RM1 C;  1YIT V;  1M56 B;  3E8G A;  2YEV A;  3P32 A;  3OM3 B;  4X88 A;  1VQ9 V;  2OCC C;  3ASN B;  1AI4 A;  1FXV A;  1TUE B;  1NVP D;  5EC2 C;  2A0L A;  2ZR2 A;  2P7T C;  1M56 C;  5L3C A;  1KKD A;  3B8M A;  4QE7 A;  2QTO A;  3RVY A;  3OUS A;  3ASN C;  2Q68 A;  2ZR3 A;  3VOU A;  1K34 A;  1PNL A;  3QO7 A;  3CCU V;  1VQ6 V;  1E1Q G;  5CA3 A;  1G4Y B;  2V7Q G;  4UXN A;  3EFF K;  4QJF B;  3VBB A;  4YXW G;  1K8A W;  3BY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...