2YUAA

Solution structure of the dnaj domain from human williams-beuren syndrome chromosome region 18 protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
GSSGSSGSQGDCSYSRTALYDLLGVPSTATQAQIKAAYYRQCFLYHPDRNSGSAEAAERFTRISQAYVVLGSATLRRKYDRGLLSDEDLRGPGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Williams-Beuren syndrome chromosome region 18 protein
publication title Solution structure of the DnaJ domain from human Williams-Beuren syndrome chromosome region 18 protein
rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2yuaA01
2LGWA 2QWOB 2QWPB 1GH6A 1BQZA 2DMXA 3APOA 2Y4TA 2PF4E 2LO1A 2QSAA 3UO2A 2L6LA 2DN9A 2CTWA 2CTRA 2EJ7A 2OCHA 2GUZA 4RWUA 2CTPA 4J80A 2CUGA 4IT5A 1IURA 1XBLA 2YS8A 1FPOA 2Y4UA 3AG7A 2M6YA 1FAFA 2N04A 4J7ZA 3BVOA 3APQA 1BQ0A 3UO3A 1HDJA 1NZ6A 2N05A 2QWRB 2KQXA 2YUAA 2QWQB 3UCSC 2QWNB 1N4CA 2GUZB 2CTQA 1WJZA
chains in the Genus database with same CATH superfamily
3RBZA 4DV4B 4LH6A 2OIEA 1BE3H 5EC2C 4CZZA 3FAVB 5E79Z 4P9PA 4MS2A 3C3TA 2KKWA 2Y48A 1WPBA 5K1XA 1MG1A 4X64O 4LF8O 3W7UA 1AJQA 4D6TH 1WNSA 5H6RA 5B1BB 2GDSA 4DV6B 1IX9A 3B8NA 4O4LB 4UVBA 2KG7B 2Q7GA 3A2FA 3D36A 1JOYA 2A3QA 5L3CA 4FK5C 3ZMTA 1QLEC 4EFEA 5BMVB 1M4UA 1N36O 1VQPV 2UXXA 3QNEA 1P84F 2IJIA 1F4NA 1PNLA 3VBBA 4I4TA 3OMNB 3H1LH 2YSUB 4G27B 2VQFB 2BOBC 4A5UB 4U7OA 5IYBO 4ZI7B 5B1BC 3ZN1A 3L70H 2HG5C 2YUAA 3G6EV 2YIBD 1FJGB 5KHKA 4HYOA 3LNMB 1BHAA 4JZGA 5LOVA 2ZDIA 1VQMV 5B1AC 2X6CA 4FMTA 1WA8A 3GWOA 4XBFA 5EBWC 4JASA 3ZHUA 1H2GA 1WLEA 5JCOA 1V54B 2JEXA 4DUYB 3K0DA 4ASUG 5FL7G 1FXKC 1R6KA 1FD9A 3T1CA 4IL6Z 3CCVV 1WP8A 5KMGB 1TVKB 1XNRO 2PZSA 2BE3A 3P3PA 3CCLV 4KHPB 4O4IB 4TQFA 4RQEA 1KP2A 4BWAA 1AR1B 4IT5A 1NJIW 1PV0A 2Q4PA 4KUMA 4NXMO 3A0BZ 4DR7B 1Q7YW 2QM4A 5EIBC 4J7KA 3CMAV 3UT5B 2HLDG 3M7MX 4GLXA 4LBEC 4LF6B 4B3MO 1X4TA 5L3DA 4TOIA 2H8PC 4LWSB 5EK0A 1S0VA 4F6RB 2XAHA 4XDLA 2ZM6B 1VF6A 1GN6A 3ABLB 2EZOA 4DRXB 1V54C 1PNKA 3STLC 1P7GA 1Q82W 2W6IG 1H2MA 2DWEC 2JVDA 4R7CA 4EB6B 1RM1B 1K7DA 3AG2B 2PUSA 4N21A 4MTFA 3K0GA 1YTFD 1WN7A 4TV8B 1WAZA 4X66B 1NR1A 4RUEA 5KHGA 3JAKB 3CRAA 3N27A 2YICA 1R3KC 3H1HH 4WBNB 3PN1A 3JD0A 3FAVA 3CWBH 3CS5A 1YZBA 2NNUA 3R66A 4FLUA 3TK1A 2ADQB 4FFKA 3SJAC 4LF7B 5IYDO 1HWYA 1GO3F 4LFCO 4XDKA 2OWOA 1K4DC 5EIBD 1OCRC 1KP3A 4JAVA 4DR3O 1I7FA 1BMFG 2UXBB 4MTOA 3DXRB 4O4LA 2Q7HA 2KG7A 3SYCA 2DJVA 2AXTZ 1GN4A 3AEIA 1F23A 4HAMA 1IBKB 2IJJA 2YXLA 4PV1B 5BMVA 1HNZB 4QE9A 3JYCA 4XDJA 3ZCCA 1G1XB 1YHQV 4O2BB 3VQWA 2K1EA 3B40A 3ZRWA 1Z5WA 4J9YB 4J80A 4I0XB 4GKKO 1I5XA 4X9QA 3RYFA 3CRMA 3RT3C 4ZI7A 1O9GA 2HFEC 4KXRA 3EXAA 5IT9N 4JZ2A 2QTSA 1OV9A 3LDDA 3EFFK 4ZBMA 4J11A 3A0HZ 5DEDA 1V55B 3PJSK 2IH1C 2Z3YA 1N32B 3AG4B 3OT7A 4FPPA 4MVZA 3ASNB 4DV4O 4MVSA 3K5OA 1QLEB 3QVNA 2OTLV 3CC7V 5BZBA 2GSMB 1R3LC 2DMXA 2ZT9B 3FB6C 1P7BA 1TVKA 3ZHSA 3OTFA 2X0LA 4H33A 4AQYB 2Y0IA 1VQ7V 4DV6O 1UFIA 4NYKA 2RDCA 1QR8A 3UT5A 3A0RA 3CXCU 3M99B 3ZMZA 2EIJB 4OX9B 2IJKA 4CC5A 4Z1VA 1JQ0A 2LFRA 1MMMA 4LWSA 5ITZB 2F66C 4ZKIA 4PA7A 4F6RA 5D5PA 1D5AA 2LJ2A 3FB5C 3ZHQA 1OZ0A 2A9HA 1M56C 4JI1O 4DRXA 4X88A 3UCSC 4JAAA 4P9OA 1BCCH 1S72V 3U10A 4LF4B 5LA6B 1KKCA 2ATKC 4LF8B 1CEZA 3F7YC 1Z2GA 2CTRA 3I5DA 5KUMA 5KLVH 2ITCC 3N2GB 4TV8A 1FJGO 2AHZA 3JAKA 3BVOA 2ZD9A 1NZ6A 4DV5B 2ZIOA 1R6NA 4UCSA 4WBNA 5CBFA 4GX0A 2GUZB 2RQ6A 5A9GA 2EIJC 5GONB 4PA3A 3LDEA 2PGGA 1P49A 2UUBB 4B3RO 4TWKA 3K59A 1XI1A 2JJ1G 1ORQC 3T2MA 4X62O 3CRCA 1GM7A 4DUYO 3H9VA 2ZR3A 2PI5A 4QIWF 5B1NA 1URFA 1F7YA 3ZX6A 3DXRA 1JVMA 4KHPO 5KHJA 1ZL8A 3RWRD 3WFVA 4QNHB 1K97A 4UCRA 5IJ9B 4LR3A 1PP9H 2XTAA 1CXZB 4JI6O 3ZN0A 2ZQMA 1Y66A 4O2BA 2B5UA 4LF6O 4I0XA 1OCZB 3SPJA 5H6QA 2QWQB 4YJ3B 3FX7A 1PD3A 1HR0O 1AROP 2ZM6O 1QBZA 3W7TA 1XEQA 3IJ4A 2P90A 3WG7B 4JI3B 5KA6A 3ML0A 2DW4A 1Z5VA 4IIJB 2F4VB 4GKJO 1XNRB 1FXHA 2QKSA 3IGAC 3SYOA 1EBOA 4ZHQB 2PI4A 3CJHB 1MA1A 4MTXA 1QLNA 3BABA 3LSUA 3IC9A 3RW0A 1WJZA 4NXMB 5IYCO 2Q68A 3OUSA 3K57A 3GWKC 1N0NA 1OCZC 4PD4F 1N33B 1YF2A 2X6BA 3SYAA 3T4DA 5C93A 4LF7O 1Q8IA 5JWPA 2W6JG 2A79B 1F51A 1JCHA 2Y4TA 4FM0A 4MVOA 4D7SA 2WLIB 4H0LB 3MHHC 4BAYA 3OR6C 1K3EA 3CB2A 4GX1A 2AHYA 3CSXA 1SRYA 4WF9V 1NI8A 2IJHA 1HNZO 2WLMA 1THZA 4QE7A 2KQXA 5ITZA 1XILA 3QO7A 1FXVA 1VQKV 2Q69A 3K9SA 3JAWB 4UXNA 2CE4A 3JD2A 2F43G 2QE7G 5H2FZ 2RCVA 3ABMC 3W7WA 2NR5A 2W0FC 5LA6A 4LFCB 4JYBA 3F5TA 1Q90D 1Y76B 3N2GA 1BL8A 4DR3B 4LF5B 1M1KW 2XHBA 2YIAA 4L8JA 4WCEV 5H9CA 2ZE6A 3S3XA 1VQ6V 2GUZA 2VWKA 5GONA 1IURA 4F4LA 2WA4A 1FPOA 3P30A 1GAXA 2G38A 3L73H 4TV9B 1S77D 1IBLB 2N05A 3OMAB 2FL4A 5LXTB 2RNBA 4GKKB 2JJ2G 1IBMO 4EFBA 1GM9A 1I5YA 4MTGA 3DTUB 2ILMA 4NTWA 1V9PA 5J2UB 3E35A 1F4MA 4AQYO 4CH4A 2F23A 5IJ9A 1KQSU 5JH7B 4GZRB 2GHYA 1EZJA 3HKDB 4QGPA 4DW1A 3UO3A 3FFQA 3L74H 1L0LH 2JGUA 2XNDG 3E8FA 4G28B 4DR6O 1OHHG 3K08A 1FFXB 4YJ3A 2WPDG 3G67A 3RFRA 2BSKB 4FIPC 2LQTA 3OE7G 3HPLC 4HZ3A 3BRCA 4FLVA 2CK3G 1XQ8A 1SERA 1JR9A 2HHHO 4LF4O 4IIJA 5EBLC 2JS3A 5LYJB 2H3OA 4ZHQA 4R50A 3CJHA 2FKXA 3ZHTA 2Q73A 3BFRA 4B3SO 1JMKC 2HVKC 4QJFB 4DV5O 4X65O 1YIJV 2WSSG 3OFNG 1DTOA 5B1AB 4E4EA 3CE2A 3E86A 1MNGA 1YCIA 2HP8A 3TGUH 3CMEV 4JYAO 1YTFB 2UUBO 4JYCA 2IU3A 3UM7A 4UV8A 2CTWA 4JI1B 4DV0O 1FXKB 5BXZA 4NR1A 2PYLA 1TUBB 3E2EA 2ZXWC 1K8AW 1MSWD 3RYCB 4DK0A 2WLIA 1LUVA 4P2ZA 3U0ZA 5KAIZ 4JI0O 2PY5A 4GUNA 5B5EZ 1K34A 1GM8A 1L8DA 1GH6A 1VP7A 1RFYA 5LHHA 3AG3C 5CA1B 2OYQA 4K3AA 1B04A 3JAWA 4PHZA 4PJ0Z 4UFZA 4FVMA 4B3RB 4AHCA 4X62B 2XAJA 3NR7A 4ZOLB 4JI3O 3CPWU 1Y76A 2AGAA 2QWPB 2F4VO 5FLXN 2QM7A 4KL1A 2DYRC 3P32A 3K3WA 3ETQA 2OIGA 2YI8A 2KSDA 4K8XA 1SQGA 1U96A 1BZKA 3S3WA 2P4VA 2LFSA 3ABTA 1MZEA 4JI6B 1HW7A 1K5SA 1AI4A 2XOKG 2YIBA 3SJBC 1ZUQA 4LFBO 1NS1A 4CS2A 4TV9A 1KYOF 1K33A 1GTOA 1H8EG 1SS3A 5A2QN 1WP7A 2XAFA 1N33O 3QO8A 5LXTA 4K0KB 3SGIA 3CXHF 1R6TA 1VQ5V 1YSCA 1HR0B 2CUGA 2QJ1A 5J2UA 1AR4A 1K9MW 1OCRB 4BR6A 4UB6Z 1VF5B 4GKJB 2B1IA 1L1FA 3B4SA 5B1OA 3HKDA 4YIOA 3E83A 3K04A 4DR5B 5LP6C 4BIZA 2LO1A 4IYHA 1YJ9V 4O4HA 3ICXA 3E8GA 1AP6A 1FFXA 1SQFA 2ADPA 1NTMH 4ZIBA 3HKBB 4X8AA 4BIOA 4LF9O 1WPXA 2BSKA 2ARHA 3SYPA 1COWG 3OD4A 4X1IB 3ZIAG 3H1IH 1Y74B 2YIDA 1NH2D 5LYJA 4B3TO 1AI7A 2IH3C 1CPYA 3B77A 3JALB 2EIMB 4LF5O 5J2TB 5C8YB 1XL4A 4DR1B 4JI5O 2YXHA 4O4JB 3LSQA 1P4RA 5IY5C 2Q0AA 3OR7C 3ZRXA 5JJEB 2EILC 4EKWA 3BEHA 5EBMC 4W4KA 1ENVA 2RJZA 3WB0A 1W2BU 1E1RG 1SETA 1EFRG 2V7QG 1IBLO 2QGNA 3Q4HB 1OCCC 5IE9A 1AB3A 2E5LO 1XMQB 5CB4B 1FXKA 3K03A 3VOUA 4FFBB 1TUBA 4DYLA 3BA8A 4NTXA 3LDCA 1BHBA 3RYCA 3L75H 1MSDA 4OPHA 2OTJV 2UU9B 2EIMC 4MW8A 4G2KA 1NKDA 2LW7A 4JTCB 1XBLA 4U3JB 5CA1A 3D3QA 4PDMA 3WB2A 3OMIB 5FPRA 3KCXA 2UXDO 3ABKB 2YI9A 1QQCA 1HDJA 3CCJV 3ZS8C 1JA8A 4F6EA 1XHXA 3DC6A 3G80A 4DXWA 3ZBHA 4X1YB 1M56B 4ZOLA 1M5IA 2V1DA 4QPKA 1IBMB 4KP4A 5KMGA 3KKYA 2FYUH 5LBQA 1EN4A 5LHGA 2K9PA 3IFXA 4O4IA 3O65A 1AI5A 1SZXA 3CCMV 1J5EO 1GKFA 2A06H 2DOSA 3CD6V 1N4CA 3W7SA 1NT2B 2QWOB 1GK9A 1N34O 1XL6A 4JI2B 4UCOA 2ZNIA 1B06A 2EJ7A 2FB5A 3ABKC 4DR6B 2PYJA 4BW9A 3JCUZ 2D3OW 1UPGA 3THOA 2N04A 5L3FA 3N2KB 4D7TA 1SKVA 3B09A 1B3QA 3U11A 1SZTA 3K5LA 3FB8C 2HHHB 5IWAO 4EB6A 2CGOA 2JEUA 1NTZH 1KMIZ 1PNMA 4PDRA 1H2SB 2CTPA 3MHSC 4MSWC 1QU7A 3RYIB 5L3EA 1YI2V 3AK3A 2QDOA 4LP8A 2Y69C 4B3SB 3WU2Z 3X2QC 4JI8O 3HKBA 4I9QA 1NVPD 5CN0A 4HNAB 4X65B 2HJFC 5KHIA 4RUFA 1D5NA 1XMOB 4DUZO 3JSLA 4JYAB 2OT5A 4AI8A 1SC5B 3E89A 3VQVA 1KD1W 1FYJA 4X1IA 3ABUA 3ZMUA 3HKEB 4FZ1A 1FFTB 2XT9A 1VQLV 1T5EA 4CS4A 1LR1A 3CCSV 3F7VC 4N23A 3AG7A 2AZ0A 2O57A 3JALA 1R1BA 2EBOA 4DV0B 4RQFA 4J9ZB 5C8YA 5J2TA 1YEWA 4O4JA 3AG1C 4J10A 4UUJC 5JQGB 3CRRA 1KC8W 4JI0B 1QR9A 4U7NA 3L71H 2Y0PA 1I0HA 3GB7C 1AI6A 3SPGA 3D8CA 2ZIMA 3UKMA 3T4ZA 4NXNO 2AZ2A 3CP1A 3Q4HA 4K0KO 2ZINA 4FFBA 2E76B 1MZFA 3B2EE 4DV2O 2E3CA 1O9HA 4DV3O 1XUQA 3D3IA 4CS3A 1RSOB 3NXSA 3BCCH 4DR5O 1XHZA 1Q6IA 4U3JA 2X6AA 5LMNO 1R73A 3K9AA 2ZR2A 3ZMVA 3KCYA 1LNQA 5CBHA 1ZAUA 4PA4A 5TISZ 2WLLB 3QF7A 3E8BA 4LFBB 1ZWIC 1ROPA 4X1YA 3ZRVA 1PPJH 3ABMB 3J81N 2PTMA 3O9OA 1DGSA 2EINC 2A7WA 1IXMA 1IZ3A 4TSFG 2A0LA 5IYZB 2AW9A 3ZRSA 3RN4A 3OTOO 4FLZA 2IU0A 4DR1O 1W59A 2XASA 1TA8A 4WFEA 2EIKC 3HKCB 1H38A 2DQ3A 3CRQA 2KB1A 4LFAO 3ETEA 3RGBA 3ASOB 2QWRB 3CCQV 1Q3EA 3FYIB 3SYQA 3SJCC 3SR2C 1TGOA 4LF9B 4H44B 2R9RB 1S5HC 4I5SA 3ETGA 3N2KA 1VIBA 2RMKB 4ICGA 1XMQO 4Z2WA 1Q6UA 3QO5A 2JIZG 2Z5UA 4U3FH 1AVMA 3T1HB 1Y67A 2L35A 4DV7O 4B3TB 1W0JG 4CH3A 3TJTA 2QA4V 2UU9O 2CH7B 1US6A 2YC0A 3D36C 5LOVB 3MD0A 4DK1A 3OM3B 4O2AB 5KUKA 4LH7A 1IXBA 4JI5B 4JI7O 4H37A 2E75B 4NKGB 4UCVA 4FLTA 4FLXA 3APOA 3IC7A 3K06A 4HNAA 2EJRA 4J41A 4C7UA 2MK3A 4J7JA 5FNVB 1OCOC 3ASOC 3VQYA 4CH6A 1FAFA 4X20B 2YDEA 1GN2A 3TCUA 1QVGU 4DV1B 3STZC 2NN4A 4H13B 2E5LB 4MW3A 1XNQB 3CEIA 4IHJB 3BY6A 3LSSA 3BHPA 2DYSC 1BT8A 1YXBA 5JQGA 1K92A 4DO2A 1YJWV 2EULA 4W4LA 2BTOA 2ZDIC 5HFMA 4UVCA 1VQ4V 1L0NH 4JI2O 1IDSA 2DQ0A 2QKCA 1VMGA 3JAMN 1CP9A 3BAAA 2R9AA 1G6UA 1UJWB 4PI2A 2UXDB 1VQOV 5JCOC 4FLYA 4DR4O 5L3GA 1N8RW 2LW1A 4FLWA 2WAMA 1YVWA 4RWUA 1Q86W 1I94O 3CC4V 2WLJA 5B3SC 1U97A 3ZHVA 1RSOA 3R65A 4I55B 4Q6GA 2ZXWB 2GV9A 4TUYB 1SQBH 1PM9A 3L9DA 4X89A 3OEHG 2BOCC 1SA0B 2OCCC 3J80N 1J5EB 1KBHA 5BY1A 3CCUV 4Z1MG 3AK2A 4HBNA 1N34B 3AG3B 5LGTA 2WLLA 4K35A 1RPOA 1LUWA 1XMOO 1NBMG 3A8TA 4UB8Z 2UXCO 1VF6C 3KZIZ 5KAFZ 3G71V 2OCHA 4FM1A 4PELA 3JARB 5CA0B 3GVMA 2P67A 5IDJA 2L6LA 1SQPH 5JVDB 5LGUA 1TUEB 5IYZA 3OGIB 3FD9A 4DR2O 5IWAB 2DYRB 2M6YA 2EX3A 3HKCA 4Q20A 2F93B 1Y6XA 4CBCA 3ZJZA 3ZRWB 2DE0X 1W0KG 1NH2B 2LGWA 5IJ0B 4JI8B 2PF4E 1QHTA 2ZNJA 2Q9LA 3SJQC 3RYFB 4DUZB 4MT8A 3HR0A 2Q5ZA 1KECA 3FB7C 4GT1A 4PA6A 1VQ8V 1D2DA 2JRIA 1KB9F 5L3BA 1H2LA 5DECA 2CH7A 4YY3O 3I55V 2ZE7A 4O2AA 2QSAA 4YHHB 5F2VO 5LP6B 1Q43A 4B7KA 4TQDA 5H5NA 5JJJB 3QG5A 2UUCO 5FNVA 1SF9A 2WLHA 1YITV 2WA3A 2P22C 4X20A 3ZHRA 4NXNB 1BGYH 1VF7A 3SDLA 1KUQA 1HNXB 3UO2A 4K8ZA 1XDCA 1VEWA 4IHJA 3OEEG 2ETNA 5LGNA 2N74A 4PDVA 3CX5F 3RVZA 2W0XA 4DV2B 3SPIA 2ZKOA 4UVAA 3MDSA 4DV3B 3CC2V 1XOUA 4EEQA 1AILA 3C3SA 2E74B 4IYIA 3E22B 3QTCA 5JH7A 5KX5B 1NR7A 2GBOA 1AP5A 2CAZC 5IY5B 1R3IC 2LP7A 1DK1A 3H1JH 5LMNB 4IGGA 2EILB 1EN5A 1KU9A 1GRJA 4J7ZA 4I50B 3ZMSA 1OCCB 2JDIG 4NVPA 3ETDA 4I55A 4PI0A 4MVMA 5LMUB 3T1HO 4TUYA 5J9PC 1DF4A 4OGQB 3BPZA 4R6ZA 5AG2A 2Q8VA 1SA0A 3OTOB 1ZX3A 1ZTEA 2IW5A 3TXQA 3T1YO 5HFLA 4I9WA 1JJ2U 1Q81W 3DC5A 1Q5OA 4BIUA 2VQEO 2BTQB 4LFAB 3ABLC 3M8AA 4FJCC 4YXWG 5JJNB 2WLNA 2JGDB 2UUAO 1RM1C 3AG2C 3JARA 2HEPA 5CA0A 4DV1O 1EZVH 1ZL8B 4JI4B 5JVDA 1NVPB 1XNQO 5DM6V 5EZYB 1IVSA 4GCZA 3VQXA 4DV7B 1K4CC 2XAGA 2QTOA 1EN6A 2IM9A 2V4DA 3FYEB 1YDXA 3L72H 5IJ0A 4JI7B 2WWWA 1S5JA 3EHBB 5EC1C 2H94A 3CHXA 3MAQA 1VARA 1BSMA 3HB3B 3TETA 3CCRV 4LNUB 5BR8O 2YXYA 1M90W 3JATB 4ABMA 3CYOA 2LGQA 4KFMA 1HNWB 1JPXA 2B1GA 4MVQA 4MVRA 2ZCEA 1PL0A 4NB5A 5LP6A 2YEVB 4RO2A 2JS5A 1HP8A 2Y69B 4MVUA 5DN6G 3JASB 3X2QB 5D5QA 4B08A 1DLBA 3LUTB 4JTDB 1SQVH 2QEXV 4I7ZB 4CH5A 1GMGA 3K79A 5CMUA 2P06A 1B6QA 1PKXA 4DR4B 2F95B 1MABG 3J7AU 1I94B 2XAQA 2NLJC 2R72A 4WFBV 4JV5B 1XREA 1V55C 3E22A 2DN9A 2UXNA 2ITDC 4LC1A 5KX5A 3AG4C 2RN9A 3AG1B 3ASNC 4X1KB 4JAUA 1SQQH 5E1AC 3C90A 3SPCA 2BCCH 2X7RB 4JYYA 3SPHA 4YJ2B 2JK5C 1I08A 3RVYA 4I50A 4X64B 2VQFO 2Z0AA 2UXCB 4LCUC 2Q6AA 1WB7A 3DSQA 4FZ0A 1H2NA 2HJDA 4AILC 2HR3A 4YIPA 1NU1H 1Y74A 2M7WA 2MW2B 5CA3A 1JFFB 3H01A 4JTAB 4RAIA 1ZSPA 3IAYA 4YHHO 4DR2B 2HVJC 1JX9A 1A32A 5LHIA 3CCEV 1N36B 3OGCC 2F1MA 2BTQA 2P6JA 3JD4A 3P3NA 4PA9A 5K1PA 1NQTA 1Q6HA 4DW0A 2P7TC 2JGDA 5CBGA 1HNXO 3RYHB 2QWNB 3K5MA 1R3JC 5CB4A 4JF3A 5EZYA 2WLKA 3I56V 3B8MA 5GW7A 5EYPB 1ZLZA 2EINB 4UV9A 4DR7O 1N0JA 2Q0OC 2QR4A 4TT3G 3K5NA 1EM1A 4YY3B 2FMLA 1JJOA 3UQ8A 5FPOA 4OPAA 2EIKB 2C2AA 4QPJA 4WFHA 1H2KA 3JSNA 1DF5A 1X59A 1M57B 5B66Z 3DGEA 1S3JA 3G4SV 3AK1A 1MOFA 1YJNV 2QM8A 2UUCB 3F5WC 4BW5A 1K5QA 2ZE5A 1GN3A 1S5LZ 4LNUA 4UCTA 3K58A 2B9ZA 3APQA 1AJPA 1E79G 3JATA 5LMUO 2HKOA 5GTIZ 4X66O 4WFGA 1BS3A 3W7XA 4B7EA 3G6BA 2YEVA 1SESA 3FKSG 3LNNA 4PDLA 3JASA 4B3MB 4WFAV 3E8HA 2IBZH 1M57C 1OCOB 4J42A 2EZPA 4I4TB 3WG7C 3OW2U 2UXBO 2DWDC 4GX2A 4JI4O 1SQXH 2R9IA 5LL6Y 1QCEA 3OAAG 2R70A 1QVFU 2DYSB 1IBKO 1Y4MA 4UCUA 1BQ0A 3WB1A 2P5OA 4NTYA 2GTSA 2Q7EA 4FM2A 4X1KA 3RYIA 1FS0G 3BA9A 1QNMA 2Q67A 3ZEDA 3T1YB 1WA8B 4YJ2A 4JGSA 2D2CB 5KHHA 1M93A 1G4YB 3EVKA 3OUFA 2VS0A 4WFFA 2VQEB 2YS8A 4E2LA 1NTKH 2ODMA 2Y4UA 1G8MA 3H1KH 2ZE8A 3HKEA 4L87A 4GX5A 1J95A 2UUAB 1WB8A 4P30A 1AR5A 5B3SB 1K73W 1JFFA 1BQZA 2VRZA 1N32O 1HNWO 1AJNA 2VWJA 1E1QG 1RPRA 1RP3B 2OCCB 1KKDA 1FKAO 2GTAA 2QKAA 3JCZA 4GYCB 4R8CA 5KA5A 2CDYA 1VQ9V 3RYHA 3JD1A 2CGNA 2FTKA 2XUMA 5GTHZ 1S76D 4OXSA 5EYPA 4JPRA 1PL4A 2P4KA 3KG2A 5BR8B 3JD3A 4CC6A 3TXSA 4JV5O 1M9NA 1VQNV 4O4HB 1H8HG 4OX9O 1TAEA 2CTQA 1OJHA
chains in the Genus database with same CATH topology
2LGWA 2QWOB 2QWPB 1GH6A 1BQZA 2DMXA 3APOA 2Y4TA 2PF4E 2LO1A 2QSAA 3UO2A 2L6LA 2DN9A 2CTWA 2CTRA 2EJ7A 2OCHA 2GUZA 4RWUA 2CTPA 4J80A 2CUGA 4IT5A 1IURA 1XBLA 2YS8A 1FPOA 2Y4UA 3AG7A 2M6YA 1FAFA 2N04A 4J7ZA 3BVOA 3APQA 1BQ0A 3UO3A 1HDJA 1NZ6A 2N05A 2QWRB 2KQXA 2YUAA 2QWQB 3UCSC 2QWNB 1N4CA 2GUZB 2CTQA 1WJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LGW A;  2QWO B;  2QWP B;  1GH6 A;  1BQZ A;  2DMX A;  3APO A;  2Y4T A;  2PF4 E;  2LO1 A;  2QSA A;  3UO2 A;  2L6L A;  2DN9 A;  2CTW A;  2CTR A;  2EJ7 A;  2OCH A;  2GUZ A;  4RWU A;  2CTP A;  4J80 A;  2CUG A;  4IT5 A;  1IUR A;  1XBL A;  2YS8 A;  1FPO A;  2Y4U A;  3AG7 A;  2M6Y A;  1FAF A;  2N04 A;  4J7Z A;  3BVO A;  3APQ A;  1BQ0 A;  3UO3 A;  1HDJ A;  1NZ6 A;  2N05 A;  2QWR B;  2KQX A;  2YUA A;  2QWQ B;  3UCS C;  2QWN B;  1N4C A;  2GUZ B;  2CTQ A;  1WJZ A; 
#chains in the Genus database with same CATH topology
 3RBZ A;  4DV4 B;  4LH6 A;  2OIE A;  1BE3 H;  5EC2 C;  4CZZ A;  3FAV B;  5E79 Z;  4P9P A;  4MS2 A;  3C3T A;  2KKW A;  2Y48 A;  1WPB A;  5K1X A;  1MG1 A;  4X64 O;  4LF8 O;  3W7U A;  1AJQ A;  4D6T H;  1WNS A;  5H6R A;  5B1B B;  2GDS A;  4DV6 B;  1IX9 A;  3B8N A;  4O4L B;  4UVB A;  2KG7 B;  2Q7G A;  3A2F A;  3D36 A;  1JOY A;  2A3Q A;  5L3C A;  4FK5 C;  3ZMT A;  1QLE C;  4EFE A;  5BMV B;  1M4U A;  1N36 O;  1VQP V;  2UXX A;  3QNE A;  1P84 F;  2IJI A;  1F4N A;  1PNL A;  3VBB A;  4I4T A;  3OMN B;  3H1L H;  2YSU B;  4G27 B;  2VQF B;  2BOB C;  4A5U B;  4U7O A;  5IYB O;  4ZI7 B;  5B1B C;  3ZN1 A;  3L70 H;  2HG5 C;  2YUA A;  3G6E V;  2YIB D;  1FJG B;  5KHK A;  4HYO A;  3LNM B;  1BHA A;  4JZG A;  5LOV A;  2ZDI A;  1VQM V;  5B1A C;  2X6C A;  4FMT A;  1WA8 A;  3GWO A;  4XBF A;  5EBW C;  4JAS A;  3ZHU A;  1H2G A;  1WLE A;  5JCO A;  1V54 B;  2JEX A;  4DUY B;  3K0D A;  4ASU G;  5FL7 G;  1FXK C;  1R6K A;  1FD9 A;  3T1C A;  4IL6 Z;  3CCV V;  1WP8 A;  5KMG B;  1TVK B;  1XNR O;  2PZS A;  2BE3 A;  3P3P A;  3CCL V;  4KHP B;  4O4I B;  4TQF A;  4RQE A;  1KP2 A;  4BWA A;  1AR1 B;  4IT5 A;  1NJI W;  1PV0 A;  2Q4P A;  4KUM A;  4NXM O;  3A0B Z;  4DR7 B;  1Q7Y W;  2QM4 A;  5EIB C;  4J7K A;  3CMA V;  3UT5 B;  2HLD G;  3M7M X;  4GLX A;  4LBE C;  4LF6 B;  4B3M O;  1X4T A;  5L3D A;  4TOI A;  2H8P C;  4LWS B;  5EK0 A;  1S0V A;  4F6R B;  2XAH A;  4XDL A;  2ZM6 B;  1VF6 A;  1GN6 A;  3ABL B;  2EZO A;  4DRX B;  1V54 C;  1PNK A;  3STL C;  1P7G A;  1Q82 W;  2W6I G;  1H2M A;  2DWE C;  2JVD A;  4R7C A;  4EB6 B;  1RM1 B;  1K7D A;  3AG2 B;  2PUS A;  4N21 A;  4MTF A;  3K0G A;  1YTF D;  1WN7 A;  4TV8 B;  1WAZ A;  4X66 B;  1NR1 A;  4RUE A;  5KHG A;  3JAK B;  3CRA A;  3N27 A;  2YIC A;  1R3K C;  3H1H H;  4WBN B;  3PN1 A;  3JD0 A;  3FAV A;  3CWB H;  3CS5 A;  1YZB A;  2NNU A;  3R66 A;  4FLU A;  3TK1 A;  2ADQ B;  4FFK A;  3SJA C;  4LF7 B;  5IYD O;  1HWY A;  1GO3 F;  4LFC O;  4XDK A;  2OWO A;  1K4D C;  5EIB D;  1OCR C;  1KP3 A;  4JAV A;  4DR3 O;  1I7F A;  1BMF G;  2UXB B;  4MTO A;  3DXR B;  4O4L A;  2Q7H A;  2KG7 A;  3SYC A;  2DJV A;  2AXT Z;  1GN4 A;  3AEI A;  1F23 A;  4HAM A;  1IBK B;  2IJJ A;  2YXL A;  4PV1 B;  5BMV A;  1HNZ B;  4QE9 A;  3JYC A;  4XDJ A;  3ZCC A;  1G1X B;  1YHQ V;  4O2B B;  3VQW A;  2K1E A;  3B40 A;  3ZRW A;  1Z5W A;  4J9Y B;  4J80 A;  4I0X B;  4GKK O;  1I5X A;  4X9Q A;  3RYF A;  3CRM A;  3RT3 C;  4ZI7 A;  1O9G A;  2HFE C;  4KXR A;  3EXA A;  5IT9 N;  4JZ2 A;  2QTS A;  1OV9 A;  3LDD A;  3EFF K;  4ZBM A;  4J11 A;  3A0H Z;  5DED A;  1V55 B;  3PJS K;  2IH1 C;  2Z3Y A;  1N32 B;  3AG4 B;  3OT7 A;  4FPP A;  4MVZ A;  3ASN B;  4DV4 O;  4MVS A;  3K5O A;  1QLE B;  3QVN A;  2OTL V;  3CC7 V;  5BZB A;  2GSM B;  1R3L C;  2DMX A;  2ZT9 B;  3FB6 C;  1P7B A;  1TVK A;  3ZHS A;  3OTF A;  2X0L A;  4H33 A;  4AQY B;  2Y0I A;  1VQ7 V;  4DV6 O;  1UFI A;  4NYK A;  2RDC A;  1QR8 A;  3UT5 A;  3A0R A;  3CXC U;  3M99 B;  3ZMZ A;  2EIJ B;  4OX9 B;  2IJK A;  4CC5 A;  4Z1V A;  1JQ0 A;  2LFR A;  1MMM A;  4LWS A;  5ITZ B;  2F66 C;  4ZKI A;  4PA7 A;  4F6R A;  5D5P A;  1D5A A;  2LJ2 A;  3FB5 C;  3ZHQ A;  1OZ0 A;  2A9H A;  1M56 C;  4JI1 O;  4DRX A;  4X88 A;  3UCS C;  4JAA A;  4P9O A;  1BCC H;  1S72 V;  3U10 A;  4LF4 B;  5LA6 B;  1KKC A;  2ATK C;  4LF8 B;  1CEZ A;  3F7Y C;  1Z2G A;  2CTR A;  3I5D A;  5KUM A;  5KLV H;  2ITC C;  3N2G B;  4TV8 A;  1FJG O;  2AHZ A;  3JAK A;  3BVO A;  2ZD9 A;  1NZ6 A;  4DV5 B;  2ZIO A;  1R6N A;  4UCS A;  4WBN A;  5CBF A;  4GX0 A;  2GUZ B;  2RQ6 A;  5A9G A;  2EIJ C;  5GON B;  4PA3 A;  3LDE A;  2PGG A;  1P49 A;  2UUB B;  4B3R O;  4TWK A;  3K59 A;  1XI1 A;  2JJ1 G;  1ORQ C;  3T2M A;  4X62 O;  3CRC A;  1GM7 A;  4DUY O;  3H9V A;  2ZR3 A;  2PI5 A;  4QIW F;  5B1N A;  1URF A;  1F7Y A;  3ZX6 A;  3DXR A;  1JVM A;  4KHP O;  5KHJ A;  1ZL8 A;  3RWR D;  3WFV A;  4QNH B;  1K97 A;  4UCR A;  5IJ9 B;  4LR3 A;  1PP9 H;  2XTA A;  1CXZ B;  4JI6 O;  3ZN0 A;  2ZQM A;  1Y66 A;  4O2B A;  2B5U A;  4LF6 O;  4I0X A;  1OCZ B;  3SPJ A;  5H6Q A;  2QWQ B;  4YJ3 B;  3FX7 A;  1PD3 A;  1HR0 O;  1ARO P;  2ZM6 O;  1QBZ A;  3W7T A;  1XEQ A;  3IJ4 A;  2P90 A;  3WG7 B;  4JI3 B;  5KA6 A;  3ML0 A;  2DW4 A;  1Z5V A;  4IIJ B;  2F4V B;  4GKJ O;  1XNR B;  1FXH A;  2QKS A;  3IGA C;  3SYO A;  1EBO A;  4ZHQ B;  2PI4 A;  3CJH B;  1MA1 A;  4MTX A;  1QLN A;  3BAB A;  3LSU A;  3IC9 A;  3RW0 A;  1WJZ A;  4NXM B;  5IYC O;  2Q68 A;  3OUS A;  3K57 A;  3GWK C;  1N0N A;  1OCZ C;  4PD4 F;  1N33 B;  1YF2 A;  2X6B A;  3SYA A;  3T4D A;  5C93 A;  4LF7 O;  1Q8I A;  5JWP A;  2W6J G;  2A79 B;  1F51 A;  1JCH A;  2Y4T A;  4FM0 A;  4MVO A;  4D7S A;  2WLI B;  4H0L B;  3MHH C;  4BAY A;  3OR6 C;  1K3E A;  3CB2 A;  4GX1 A;  2AHY A;  3CSX A;  1SRY A;  4WF9 V;  1NI8 A;  2IJH A;  1HNZ O;  2WLM A;  1THZ A;  4QE7 A;  2KQX A;  5ITZ A;  1XIL A;  3QO7 A;  1FXV A;  1VQK V;  2Q69 A;  3K9S A;  3JAW B;  4UXN A;  2CE4 A;  3JD2 A;  2F43 G;  2QE7 G;  5H2F Z;  2RCV A;  3ABM C;  3W7W A;  2NR5 A;  2W0F C;  5LA6 A;  4LFC B;  4JYB A;  3F5T A;  1Q90 D;  1Y76 B;  3N2G A;  1BL8 A;  4DR3 B;  4LF5 B;  1M1K W;  2XHB A;  2YIA A;  4L8J A;  4WCE V;  5H9C A;  2ZE6 A;  3S3X A;  1VQ6 V;  2GUZ A;  2VWK A;  5GON A;  1IUR A;  4F4L A;  2WA4 A;  1FPO A;  3P30 A;  1GAX A;  2G38 A;  3L73 H;  4TV9 B;  1S77 D;  1IBL B;  2N05 A;  3OMA B;  2FL4 A;  5LXT B;  2RNB A;  4GKK B;  2JJ2 G;  1IBM O;  4EFB A;  1GM9 A;  1I5Y A;  4MTG A;  3DTU B;  2ILM A;  4NTW A;  1V9P A;  5J2U B;  3E35 A;  1F4M A;  4AQY O;  4CH4 A;  2F23 A;  5IJ9 A;  1KQS U;  5JH7 B;  4GZR B;  2GHY A;  1EZJ A;  3HKD B;  4QGP A;  4DW1 A;  3UO3 A;  3FFQ A;  3L74 H;  1L0L H;  2JGU A;  2XND G;  3E8F A;  4G28 B;  4DR6 O;  1OHH G;  3K08 A;  1FFX B;  4YJ3 A;  2WPD G;  3G67 A;  3RFR A;  2BSK B;  4FIP C;  2LQT A;  3OE7 G;  3HPL C;  4HZ3 A;  3BRC A;  4FLV A;  2CK3 G;  1XQ8 A;  1SER A;  1JR9 A;  2HHH O;  4LF4 O;  4IIJ A;  5EBL C;  2JS3 A;  5LYJ B;  2H3O A;  4ZHQ A;  4R50 A;  3CJH A;  2FKX A;  3ZHT A;  2Q73 A;  3BFR A;  4B3S O;  1JMK C;  2HVK C;  4QJF B;  4DV5 O;  4X65 O;  1YIJ V;  2WSS G;  3OFN G;  1DTO A;  5B1A B;  4E4E A;  3CE2 A;  3E86 A;  1MNG A;  1YCI A;  2HP8 A;  3TGU H;  3CME V;  4JYA O;  1YTF B;  2UUB O;  4JYC A;  2IU3 A;  3UM7 A;  4UV8 A;  2CTW A;  4JI1 B;  4DV0 O;  1FXK B;  5BXZ A;  4NR1 A;  2PYL A;  1TUB B;  3E2E A;  2ZXW C;  1K8A W;  1MSW D;  3RYC B;  4DK0 A;  2WLI A;  1LUV A;  4P2Z A;  3U0Z A;  5KAI Z;  4JI0 O;  2PY5 A;  4GUN A;  5B5E Z;  1K34 A;  1GM8 A;  1L8D A;  1GH6 A;  1VP7 A;  1RFY A;  5LHH A;  3AG3 C;  5CA1 B;  2OYQ A;  4K3A A;  1B04 A;  3JAW A;  4PHZ A;  4PJ0 Z;  4UFZ A;  4FVM A;  4B3R B;  4AHC A;  4X62 B;  2XAJ A;  3NR7 A;  4ZOL B;  4JI3 O;  3CPW U;  1Y76 A;  2AGA A;  2QWP B;  2F4V O;  5FLX N;  2QM7 A;  4KL1 A;  2DYR C;  3P32 A;  3K3W A;  3ETQ A;  2OIG A;  2YI8 A;  2KSD A;  4K8X A;  1SQG A;  1U96 A;  1BZK A;  3S3W A;  2P4V A;  2LFS A;  3ABT A;  1MZE A;  4JI6 B;  1HW7 A;  1K5S A;  1AI4 A;  2XOK G;  2YIB A;  3SJB C;  1ZUQ A;  4LFB O;  1NS1 A;  4CS2 A;  4TV9 A;  1KYO F;  1K33 A;  1GTO A;  1H8E G;  1SS3 A;  5A2Q N;  1WP7 A;  2XAF A;  1N33 O;  3QO8 A;  5LXT A;  4K0K B;  3SGI A;  3CXH F;  1R6T A;  1VQ5 V;  1YSC A;  1HR0 B;  2CUG A;  2QJ1 A;  5J2U A;  1AR4 A;  1K9M W;  1OCR B;  4BR6 A;  4UB6 Z;  1VF5 B;  4GKJ B;  2B1I A;  1L1F A;  3B4S A;  5B1O A;  3HKD A;  4YIO A;  3E83 A;  3K04 A;  4DR5 B;  5LP6 C;  4BIZ A;  2LO1 A;  4IYH A;  1YJ9 V;  4O4H A;  3ICX A;  3E8G A;  1AP6 A;  1FFX A;  1SQF A;  2ADP A;  1NTM H;  4ZIB A;  3HKB B;  4X8A A;  4BIO A;  4LF9 O;  1WPX A;  2BSK A;  2ARH A;  3SYP A;  1COW G;  3OD4 A;  4X1I B;  3ZIA G;  3H1I H;  1Y74 B;  2YID A;  1NH2 D;  5LYJ A;  4B3T O;  1AI7 A;  2IH3 C;  1CPY A;  3B77 A;  3JAL B;  2EIM B;  4LF5 O;  5J2T B;  5C8Y B;  1XL4 A;  4DR1 B;  4JI5 O;  2YXH A;  4O4J B;  3LSQ A;  1P4R A;  5IY5 C;  2Q0A A;  3OR7 C;  3ZRX A;  5JJE B;  2EIL C;  4EKW A;  3BEH A;  5EBM C;  4W4K A;  1ENV A;  2RJZ A;  3WB0 A;  1W2B U;  1E1R G;  1SET A;  1EFR G;  2V7Q G;  1IBL O;  2QGN A;  3Q4H B;  1OCC C;  5IE9 A;  1AB3 A;  2E5L O;  1XMQ B;  5CB4 B;  1FXK A;  3K03 A;  3VOU A;  4FFB B;  1TUB A;  4DYL A;  3BA8 A;  4NTX A;  3LDC A;  1BHB A;  3RYC A;  3L75 H;  1MSD A;  4OPH A;  2OTJ V;  2UU9 B;  2EIM C;  4MW8 A;  4G2K A;  1NKD A;  2LW7 A;  4JTC B;  1XBL A;  4U3J B;  5CA1 A;  3D3Q A;  4PDM A;  3WB2 A;  3OMI B;  5FPR A;  3KCX A;  2UXD O;  3ABK B;  2YI9 A;  1QQC A;  1HDJ A;  3CCJ V;  3ZS8 C;  1JA8 A;  4F6E A;  1XHX A;  3DC6 A;  3G80 A;  4DXW A;  3ZBH A;  4X1Y B;  1M56 B;  4ZOL A;  1M5I A;  2V1D A;  4QPK A;  1IBM B;  4KP4 A;  5KMG A;  3KKY A;  2FYU H;  5LBQ A;  1EN4 A;  5LHG A;  2K9P A;  3IFX A;  4O4I A;  3O65 A;  1AI5 A;  1SZX A;  3CCM V;  1J5E O;  1GKF A;  2A06 H;  2DOS A;  3CD6 V;  1N4C A;  3W7S A;  1NT2 B;  2QWO B;  1GK9 A;  1N34 O;  1XL6 A;  4JI2 B;  4UCO A;  2ZNI A;  1B06 A;  2EJ7 A;  2FB5 A;  3ABK C;  4DR6 B;  2PYJ A;  4BW9 A;  3JCU Z;  2D3O W;  1UPG A;  3THO A;  2N04 A;  5L3F A;  3N2K B;  4D7T A;  1SKV A;  3B09 A;  1B3Q A;  3U11 A;  1SZT A;  3K5L A;  3FB8 C;  2HHH B;  5IWA O;  4EB6 A;  2CGO A;  2JEU A;  1NTZ H;  1KMI Z;  1PNM A;  4PDR A;  1H2S B;  2CTP A;  3MHS C;  4MSW C;  1QU7 A;  3RYI B;  5L3E A;  1YI2 V;  3AK3 A;  2QDO A;  4LP8 A;  2Y69 C;  4B3S B;  3WU2 Z;  3X2Q C;  4JI8 O;  3HKB A;  4I9Q A;  1NVP D;  5CN0 A;  4HNA B;  4X65 B;  2HJF C;  5KHI A;  4RUF A;  1D5N A;  1XMO B;  4DUZ O;  3JSL A;  4JYA B;  2OT5 A;  4AI8 A;  1SC5 B;  3E89 A;  3VQV A;  1KD1 W;  1FYJ A;  4X1I A;  3ABU A;  3ZMU A;  3HKE B;  4FZ1 A;  1FFT B;  2XT9 A;  1VQL V;  1T5E A;  4CS4 A;  1LR1 A;  3CCS V;  3F7V C;  4N23 A;  3AG7 A;  2AZ0 A;  2O57 A;  3JAL A;  1R1B A;  2EBO A;  4DV0 B;  4RQF A;  4J9Z B;  5C8Y A;  5J2T A;  1YEW A;  4O4J A;  3AG1 C;  4J10 A;  4UUJ C;  5JQG B;  3CRR A;  1KC8 W;  4JI0 B;  1QR9 A;  4U7N A;  3L71 H;  2Y0P A;  1I0H A;  3GB7 C;  1AI6 A;  3SPG A;  3D8C A;  2ZIM A;  3UKM A;  3T4Z A;  4NXN O;  2AZ2 A;  3CP1 A;  3Q4H A;  4K0K O;  2ZIN A;  4FFB A;  2E76 B;  1MZF A;  3B2E E;  4DV2 O;  2E3C A;  1O9H A;  4DV3 O;  1XUQ A;  3D3I A;  4CS3 A;  1RSO B;  3NXS A;  3BCC H;  4DR5 O;  1XHZ A;  1Q6I A;  4U3J A;  2X6A A;  5LMN O;  1R73 A;  3K9A A;  2ZR2 A;  3ZMV A;  3KCY A;  1LNQ A;  5CBH A;  1ZAU A;  4PA4 A;  5TIS Z;  2WLL B;  3QF7 A;  3E8B A;  4LFB B;  1ZWI C;  1ROP A;  4X1Y A;  3ZRV A;  1PPJ H;  3ABM B;  3J81 N;  2PTM A;  3O9O A;  1DGS A;  2EIN C;  2A7W A;  1IXM A;  1IZ3 A;  4TSF G;  2A0L A;  5IYZ B;  2AW9 A;  3ZRS A;  3RN4 A;  3OTO O;  4FLZ A;  2IU0 A;  4DR1 O;  1W59 A;  2XAS A;  1TA8 A;  4WFE A;  2EIK C;  3HKC B;  1H38 A;  2DQ3 A;  3CRQ A;  2KB1 A;  4LFA O;  3ETE A;  3RGB A;  3ASO B;  2QWR B;  3CCQ V;  1Q3E A;  3FYI B;  3SYQ A;  3SJC C;  3SR2 C;  1TGO A;  4LF9 B;  4H44 B;  2R9R B;  1S5H C;  4I5S A;  3ETG A;  3N2K A;  1VIB A;  2RMK B;  4ICG A;  1XMQ O;  4Z2W A;  1Q6U A;  3QO5 A;  2JIZ G;  2Z5U A;  4U3F H;  1AVM A;  3T1H B;  1Y67 A;  2L35 A;  4DV7 O;  4B3T B;  1W0J G;  4CH3 A;  3TJT A;  2QA4 V;  2UU9 O;  2CH7 B;  1US6 A;  2YC0 A;  3D36 C;  5LOV B;  3MD0 A;  4DK1 A;  3OM3 B;  4O2A B;  5KUK A;  4LH7 A;  1IXB A;  4JI5 B;  4JI7 O;  4H37 A;  2E75 B;  4NKG B;  4UCV A;  4FLT A;  4FLX A;  3APO A;  3IC7 A;  3K06 A;  4HNA A;  2EJR A;  4J41 A;  4C7U A;  2MK3 A;  4J7J A;  5FNV B;  1OCO C;  3ASO C;  3VQY A;  4CH6 A;  1FAF A;  4X20 B;  2YDE A;  1GN2 A;  3TCU A;  1QVG U;  4DV1 B;  3STZ C;  2NN4 A;  4H13 B;  2E5L B;  4MW3 A;  1XNQ B;  3CEI A;  4IHJ B;  3BY6 A;  3LSS A;  3BHP A;  2DYS C;  1BT8 A;  1YXB A;  5JQG A;  1K92 A;  4DO2 A;  1YJW V;  2EUL A;  4W4L A;  2BTO A;  2ZDI C;  5HFM A;  4UVC A;  1VQ4 V;  1L0N H;  4JI2 O;  1IDS A;  2DQ0 A;  2QKC A;  1VMG A;  3JAM N;  1CP9 A;  3BAA A;  2R9A A;  1G6U A;  1UJW B;  4PI2 A;  2UXD B;  1VQO V;  5JCO C;  4FLY A;  4DR4 O;  5L3G A;  1N8R W;  2LW1 A;  4FLW A;  2WAM A;  1YVW A;  4RWU A;  1Q86 W;  1I94 O;  3CC4 V;  2WLJ A;  5B3S C;  1U97 A;  3ZHV A;  1RSO A;  3R65 A;  4I55 B;  4Q6G A;  2ZXW B;  2GV9 A;  4TUY B;  1SQB H;  1PM9 A;  3L9D A;  4X89 A;  3OEH G;  2BOC C;  1SA0 B;  2OCC C;  3J80 N;  1J5E B;  1KBH A;  5BY1 A;  3CCU V;  4Z1M G;  3AK2 A;  4HBN A;  1N34 B;  3AG3 B;  5LGT A;  2WLL A;  4K35 A;  1RPO A;  1LUW A;  1XMO O;  1NBM G;  3A8T A;  4UB8 Z;  2UXC O;  1VF6 C;  3KZI Z;  5KAF Z;  3G71 V;  2OCH A;  4FM1 A;  4PEL A;  3JAR B;  5CA0 B;  3GVM A;  2P67 A;  5IDJ A;  2L6L A;  1SQP H;  5JVD B;  5LGU A;  1TUE B;  5IYZ A;  3OGI B;  3FD9 A;  4DR2 O;  5IWA B;  2DYR B;  2M6Y A;  2EX3 A;  3HKC A;  4Q20 A;  2F93 B;  1Y6X A;  4CBC A;  3ZJZ A;  3ZRW B;  2DE0 X;  1W0K G;  1NH2 B;  2LGW A;  5IJ0 B;  4JI8 B;  2PF4 E;  1QHT A;  2ZNJ A;  2Q9L A;  3SJQ C;  3RYF B;  4DUZ B;  4MT8 A;  3HR0 A;  2Q5Z A;  1KEC A;  3FB7 C;  4GT1 A;  4PA6 A;  1VQ8 V;  1D2D A;  2JRI A;  1KB9 F;  5L3B A;  1H2L A;  5DEC A;  2CH7 A;  4YY3 O;  3I55 V;  2ZE7 A;  4O2A A;  2QSA A;  4YHH B;  5F2V O;  5LP6 B;  1Q43 A;  4B7K A;  4TQD A;  5H5N A;  5JJJ B;  3QG5 A;  2UUC O;  5FNV A;  1SF9 A;  2WLH A;  1YIT V;  2WA3 A;  2P22 C;  4X20 A;  3ZHR A;  4NXN B;  1BGY H;  1VF7 A;  3SDL A;  1KUQ A;  1HNX B;  3UO2 A;  4K8Z A;  1XDC A;  1VEW A;  4IHJ A;  3OEE G;  2ETN A;  5LGN A;  2N74 A;  4PDV A;  3CX5 F;  3RVZ A;  2W0X A;  4DV2 B;  3SPI A;  2ZKO A;  4UVA A;  3MDS A;  4DV3 B;  3CC2 V;  1XOU A;  4EEQ A;  1AIL A;  3C3S A;  2E74 B;  4IYI A;  3E22 B;  3QTC A;  5JH7 A;  5KX5 B;  1NR7 A;  2GBO A;  1AP5 A;  2CAZ C;  5IY5 B;  1R3I C;  2LP7 A;  1DK1 A;  3H1J H;  5LMN B;  4IGG A;  2EIL B;  1EN5 A;  1KU9 A;  1GRJ A;  4J7Z A;  4I50 B;  3ZMS A;  1OCC B;  2JDI G;  4NVP A;  3ETD A;  4I55 A;  4PI0 A;  4MVM A;  5LMU B;  3T1H O;  4TUY A;  5J9P C;  1DF4 A;  4OGQ B;  3BPZ A;  4R6Z A;  5AG2 A;  2Q8V A;  1SA0 A;  3OTO B;  1ZX3 A;  1ZTE A;  2IW5 A;  3TXQ A;  3T1Y O;  5HFL A;  4I9W A;  1JJ2 U;  1Q81 W;  3DC5 A;  1Q5O A;  4BIU A;  2VQE O;  2BTQ B;  4LFA B;  3ABL C;  3M8A A;  4FJC C;  4YXW G;  5JJN B;  2WLN A;  2JGD B;  2UUA O;  1RM1 C;  3AG2 C;  3JAR A;  2HEP A;  5CA0 A;  4DV1 O;  1EZV H;  1ZL8 B;  4JI4 B;  5JVD A;  1NVP B;  1XNQ O;  5DM6 V;  5EZY B;  1IVS A;  4GCZ A;  3VQX A;  4DV7 B;  1K4C C;  2XAG A;  2QTO A;  1EN6 A;  2IM9 A;  2V4D A;  3FYE B;  1YDX A;  3L72 H;  5IJ0 A;  4JI7 B;  2WWW A;  1S5J A;  3EHB B;  5EC1 C;  2H94 A;  3CHX A;  3MAQ A;  1VAR A;  1BSM A;  3HB3 B;  3TET A;  3CCR V;  4LNU B;  5BR8 O;  2YXY A;  1M90 W;  3JAT B;  4ABM A;  3CYO A;  2LGQ A;  4KFM A;  1HNW B;  1JPX A;  2B1G A;  4MVQ A;  4MVR A;  2ZCE A;  1PL0 A;  4NB5 A;  5LP6 A;  2YEV B;  4RO2 A;  2JS5 A;  1HP8 A;  2Y69 B;  4MVU A;  5DN6 G;  3JAS B;  3X2Q B;  5D5Q A;  4B08 A;  1DLB A;  3LUT B;  4JTD B;  1SQV H;  2QEX V;  4I7Z B;  4CH5 A;  1GMG A;  3K79 A;  5CMU A;  2P06 A;  1B6Q A;  1PKX A;  4DR4 B;  2F95 B;  1MAB G;  3J7A U;  1I94 B;  2XAQ A;  2NLJ C;  2R72 A;  4WFB V;  4JV5 B;  1XRE A;  1V55 C;  3E22 A;  2DN9 A;  2UXN A;  2ITD C;  4LC1 A;  5KX5 A;  3AG4 C;  2RN9 A;  3AG1 B;  3ASN C;  4X1K B;  4JAU A;  1SQQ H;  5E1A C;  3C90 A;  3SPC A;  2BCC H;  2X7R B;  4JYY A;  3SPH A;  4YJ2 B;  2JK5 C;  1I08 A;  3RVY A;  4I50 A;  4X64 B;  2VQF O;  2Z0A A;  2UXC B;  4LCU C;  2Q6A A;  1WB7 A;  3DSQ A;  4FZ0 A;  1H2N A;  2HJD A;  4AIL C;  2HR3 A;  4YIP A;  1NU1 H;  1Y74 A;  2M7W A;  2MW2 B;  5CA3 A;  1JFF B;  3H01 A;  4JTA B;  4RAI A;  1ZSP A;  3IAY A;  4YHH O;  4DR2 B;  2HVJ C;  1JX9 A;  1A32 A;  5LHI A;  3CCE V;  1N36 B;  3OGC C;  2F1M A;  2BTQ A;  2P6J A;  3JD4 A;  3P3N A;  4PA9 A;  5K1P A;  1NQT A;  1Q6H A;  4DW0 A;  2P7T C;  2JGD A;  5CBG A;  1HNX O;  3RYH B;  2QWN B;  3K5M A;  1R3J C;  5CB4 A;  4JF3 A;  5EZY A;  2WLK A;  3I56 V;  3B8M A;  5GW7 A;  5EYP B;  1ZLZ A;  2EIN B;  4UV9 A;  4DR7 O;  1N0J A;  2Q0O C;  2QR4 A;  4TT3 G;  3K5N A;  1EM1 A;  4YY3 B;  2FML A;  1JJO A;  3UQ8 A;  5FPO A;  4OPA A;  2EIK B;  2C2A A;  4QPJ A;  4WFH A;  1H2K A;  3JSN A;  1DF5 A;  1X59 A;  1M57 B;  5B66 Z;  3DGE A;  1S3J A;  3G4S V;  3AK1 A;  1MOF A;  1YJN V;  2QM8 A;  2UUC B;  3F5W C;  4BW5 A;  1K5Q A;  2ZE5 A;  1GN3 A;  1S5L Z;  4LNU A;  4UCT A;  3K58 A;  2B9Z A;  3APQ A;  1AJP A;  1E79 G;  3JAT A;  5LMU O;  2HKO A;  5GTI Z;  4X66 O;  4WFG A;  1BS3 A;  3W7X A;  4B7E A;  3G6B A;  2YEV A;  1SES A;  3FKS G;  3LNN A;  4PDL A;  3JAS A;  4B3M B;  4WFA V;  3E8H A;  2IBZ H;  1M57 C;  1OCO B;  4J42 A;  2EZP A;  4I4T B;  3WG7 C;  3OW2 U;  2UXB O;  2DWD C;  4GX2 A;  4JI4 O;  1SQX H;  2R9I A;  5LL6 Y;  1QCE A;  3OAA G;  2R70 A;  1QVF U;  2DYS B;  1IBK O;  1Y4M A;  4UCU A;  1BQ0 A;  3WB1 A;  2P5O A;  4NTY A;  2GTS A;  2Q7E A;  4FM2 A;  4X1K A;  3RYI A;  1FS0 G;  3BA9 A;  1QNM A;  2Q67 A;  3ZED A;  3T1Y B;  1WA8 B;  4YJ2 A;  4JGS A;  2D2C B;  5KHH A;  1M93 A;  1G4Y B;  3EVK A;  3OUF A;  2VS0 A;  4WFF A;  2VQE B;  2YS8 A;  4E2L A;  1NTK H;  2ODM A;  2Y4U A;  1G8M A;  3H1K H;  2ZE8 A;  3HKE A;  4L87 A;  4GX5 A;  1J95 A;  2UUA B;  1WB8 A;  4P30 A;  1AR5 A;  5B3S B;  1K73 W;  1JFF A;  1BQZ A;  2VRZ A;  1N32 O;  1HNW O;  1AJN A;  2VWJ A;  1E1Q G;  1RPR A;  1RP3 B;  2OCC B;  1KKD A;  1FKA O;  2GTA A;  2QKA A;  3JCZ A;  4GYC B;  4R8C A;  5KA5 A;  2CDY A;  1VQ9 V;  3RYH A;  3JD1 A;  2CGN A;  2FTK A;  2XUM A;  5GTH Z;  1S76 D;  4OXS A;  5EYP A;  4JPR A;  1PL4 A;  2P4K A;  3KG2 A;  5BR8 B;  3JD3 A;  4CC6 A;  3TXS A;  4JV5 O;  1M9N A;  1VQN V;  4O4H B;  1H8H G;  4OX9 O;  1TAE A;  2CTQ A;  1OJH A; 
#chains in the Genus database with same CATH homology
 2LGW A;  2QWO B;  2QWP B;  1GH6 A;  1BQZ A;  2DMX A;  3APO A;  2Y4T A;  2PF4 E;  2LO1 A;  2QSA A;  3UO2 A;  2L6L A;  2DN9 A;  2CTW A;  2CTR A;  2EJ7 A;  2OCH A;  2GUZ A;  4RWU A;  2CTP A;  4J80 A;  2CUG A;  4IT5 A;  1IUR A;  1XBL A;  2YS8 A;  1FPO A;  2Y4U A;  3AG7 A;  2M6Y A;  1FAF A;  2N04 A;  4J7Z A;  3BVO A;  3APQ A;  1BQ0 A;  3UO3 A;  1HDJ A;  1NZ6 A;  2N05 A;  2QWR B;  2KQX A;  2YUA A;  2QWQ B;  3UCS C;  2QWN B;  1N4C A;  2GUZ B;  2CTQ A;  1WJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...