2YUAA

Solution structure of the dnaj domain from human williams-beuren syndrome chromosome region 18 protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
b'GSSGSSGSQGDCSYSRTALYDLLGVPSTATQAQIKAAYYRQCFLYHPDRNSGSAEAAERFTRISQAYVVLGSATLRRKYDRGLLSDEDLRGPGSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Williams-Beuren syndrome chromosome region 18 protein
publication title Solution structure of the DnaJ domain from human Williams-Beuren syndrome chromosome region 18 protein
rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2yuaA01
3UO2A 4J80A 1NZ6A 2PF4E 1XBLA 2LO1A 2QWPB 2YS8A 2YUAA 3BVOA 2QWOB 3UCSC 1IURA 2N04A 2EJ7A 2LGWA 2OCHA 2QWRB 1GH6A 2CTPA 2L6LA 1FPOA 2DMXA 2M6YA 1BQ0A 3APOA 2CUGA 3UO3A 2KQXA 2CTQA 2Y4TA 1BQZA 1FAFA 2QSAA 2QWNB 2N05A 2CTRA 2DN9A 2GUZB 1N4CA 2GUZA 2Y4UA 4RWUA 1HDJA 4J7ZA 4IT5A 2CTWA 1WJZA 3AG7A 3APQA 2QWQB
chains in the Genus database with same CATH superfamily
4YHHO 1I94O 3R65A 1RP3B 5H9CA 1NTZH 2EIKB 2WSSG 4MVOA 5LGNA 2JVDA 3CD6V 5LMNO 1M56B 1X4TA 2Y4UA 4X88A 4LF4B 2WA3A 2CDYA 3ETGA 1HNWB 4FK5C 2HG5C 4ZKIA 3SJCC 3ZHRA 4B3RB 4FM0A 3THOA 2BTOA 3CCRV 4BW9A 2VWJA 1K5SA 2HLDG 4X20B 3IC9A 1BT8A 2Y4TA 5BR8O 4CBCA 1P7BA 5CN0A 4MVQA 2Q67A 3OM3B 1US6A 2NR5A 1FFTB 2UXNA 2B9ZA 2DWEC 1AJQA 2X6AA 1RFYA 2JEUA 4UCTA 2YS8A 3B4SA 1KMIZ 1D5AA 1PNLA 3K03A 3LUTB 5BZBA 3C3TA 3M8AA 1I7FA 4GKJO 3VQVA 3JASB 3K04A 2XHBA 2ZE6A 3JSNA 3CCSV 2PZSA 2WA4A 2RQ6A 3JD3A 1XHZA 3F5WC 2B5UA 4FLYA 3E8HA 4HAMA 3OGIB 1D2DA 3P32A 3JARB 1L8DA 1H2KA 1LR1A 1YEWA 1JOYA 1YDXA 1U97A 2V7QG 3FYEB 2GUZB 1Q86W 3ZMZA 1XMOO 3DGEA 2IU3A 3E8BA 3FD9A 3WB0A 1Y74A 3RYIB 1OCZC 4LFBB 4JAAA 1I5XA 2EILB 1OCRC 4JI7B 3OTOB 2ATKC 3ETQA 4U3JB 1R1BA 4IIJB 3QO7A 3KKYA 1IBMB 3QG5A 4UUJC 4QE7A 3UCSC 2RDCA 4CS4A 1Z5VA 4LF4O 3SPIA 4PA4A 1HNWO 1MOFA 2AGAA 2P90A 3WG7B 3JAKB 2NLJC 1ROPA 4B3RO 5B1BC 4ZHQB 1NR1A 2F95B 5J2UB 3RYCA 1NTMH 3Q4HB 1Z2GA 2PUSA 1WPBA 3QF7A 1XL6A 3VQWA 2R9IA 5GTHZ 3ASNB 2ZINA 4HBNA 4DV2B 2UUBB 1H2MA 3T4ZA 3GWKC 1PNMA 2L6LA 1BMFG 5IE9A 1QVGU 4LBEC 4FZ0A 1SC5B 4NKGB 4O2BA 2WLIA 3UKMA 4JYCA 3L73H 1XHXA 4WFFA 1DGSA 4J41A 2CH7A 1ZAUA 4YIOA 1OCOB 1I08A 2AXTZ 3JD0A 4B08A 5LYJB 2Q0AA 1PL4A 2QJ1A 2IH3C 1NT2B 3CP1A 4GX0A 4UB8Z 4DXWA 1GO3F 4WFBV 2KQXA 3ASOC 4YY3B 2QR4A 4C7UA 5B3SC 2RJZA 1M93A 1GMGA 2A9HA 3AG2B 1R73A 4ZOLB 3CSXA 5LP6B 4X9QA 1JFFB 1XBLA 4MVMA 2JIZG 1SQXH 3ETDA 3H1HH 4KHPB 2BTQA 4JTCB 1S5LZ 4F6RB 4LFBO 3DTUB 3CX5F 1S5HC 3L9DA 4OX9B 1HR0B 4JI7O 3ZHTA 1N8RW 3OTOO 4O4LB 4I55A 3T2MA 3E86A 1KB9F 1Z5WA 1M4UA 4U7OA 4DRXA 2F43G 3N2KB 4KL1A 1IBMO 3OEHG 3CCMV 4IGGA 4JI6B 2JGDA 1XUQA 3FAVB 2N05A 4YJ3B 1DF5A 1K33A 2QTOA 5L3GA 1GN3A 3OUFA 1HWYA 2ZNJA 5LXTB 1EBOA 5JVDB 3X2QB 4JYAB 1F23A 1K92A 4JF3A 1PNKA 1GN2A 4F4LA 4LWSB 2KB1A 2ZT9B 2Q5ZA 3A2FA 4JI4B 1GM9A 1NVPB 4DV2O 1N34B 2UUBO 4P30A 3ZHVA 3OR7C 1K9MW 4MSWC 1WA8B 4ZIBA 2VS0A 4JPRA 3QVNA 5JH7B 4QJFB 5JJNB 4LFCB 2CTPA 1IDSA 5LA6A 4JASA 1Y76A 2CTQA 5B1OA 4AILC 4PDVA 1QR9A 4RUFA 4DR7B 3DSQA 4YY3O 2KG7A 3B40A 1HP8A 3UO2A 3FYIB 3CJHB 2D2CB 2XAFA 4I9QA 1B06A 4IHJB 2XUMA 4GYCB 2P7TC 3T1YB 3ZMUA 4OPHA 4X1YA 3A0HZ 2VQEB 5LHHA 3AK1A 1VEWA 3ABLB 2JEXA 3B8MA 1SRYA 4X1KB 4KHPO 4J7ZA 3CC4V 1AJPA 1VIBA 1BZKA 3AEIA 1M57B 2YI8A 4OX9O 1HR0O 4AI8A 5EZYB 2XOKG 1CP9A 1G8MA 4O4IA 1HNXB 5KLVH 1W2BU 1VQMV 4JI6O 2E74B 4DV6B 4TV8B 4MW8A 3SPGA 5K1PA 1ZTEA 5EIBC 2ZR2A 1S77D 3IAYA 3CXCU 1TAEA 3OMNB 1K4CC 4AQYB 3HR0A 1ORQC 3UO3A 1FXKB 4JYAO 3JD4A 1VQ9V 1QLNA 3RYFA 1I0HA 4UCUA 5EYPB 3LSSA 1K7DA 2QGNA 5KX5A 3E2EA 2AHYA 4JI4O 4I0XA 4EB6B 1ZL8B 4FLVA 1N34O 5L3CA 1FKAO 2LQTA 4JAUA 4Z1MG 1ENVA 4DK1A 5EBLC 4J10A 4X62B 3O9OA 4U7NA 1AI6A 4FFBB 5KUKA 3HKEA 1SKVA 3K59A 4LFCO 4MVSA 3JYCA 2E3CA 1L1FA 2ITDC 3SYCA 5GONB 3W7UA 3RYHB 3EFFK 4Z2WA 4DR7O 3T1HB 5HFLA 3KZIZ 4X1IA 2OCCB 2AW9A 1YTFB 2ZE5A 5C8YA 2DMXA 3U10A 4IYHA 5E1AC 2GTAA 2XASA 3ABMB 4GZRB 3ETEA 3S3XA 1R6TA 3T1YO 1FS0G 1F4MA 5E79Z 5ITZA 2VQEO 1SQFA 4G2KA 1JA8A 3S3WA 2BE3A 1IXBA 4JZ2A 4J7KA 3SPCA 4TUYA 5JCOA 3BVOA 5KHIA 4NB5A 2QM8A 2OWOA 2ZXWB 1FPOA 3JAWA 2W6JG 2EINB 4WFAV 2MW2B 2ZNIA 1M90W 3SYAA 1H2SB 4DV4B 1LNQA 2HJDA 3APQA 4JGSA 2ETNA 4K0KB 5L3BA 1HNXO 3ZHSA 1F51A 3I5DA 1UJWB 1K3EA 3N2GB 4DV6O 3UT5B 4LP8A 3G6BA 2QE7G 3FX7A 3APOA 2EULA 1Q82W 1YIJV 3ZMSA 3AG1B 2PGGA 1BCCH 2JJ2G 3AG3C 1VQOV 4AQYO 5KHGA 5CA0A 4G27B 1AVMA 4LR3A 5AG2A 1H8EG 4YJ2B 2Q6AA 2N74A 3E35A 2JJ1G 5FLXN 1H8HG 1NBMG 4NYKA 1JPXA 4UV9A 2EX3A 1AR1B 3E89A 5TISZ 4XDLA 3OR6C 3CYOA 2YXYA 1COWG 1WNSA 1XILA 2EIJC 4X89A 1VQ5V 2IH1C 1S0VA 4JV5B 1G6UA 3ZBHA 3ZMTA 4X62O 2DWDC 5LL6Y 4LCUC 4NTXA 3H1KH 2UXBB 2QA4V 1S76D 4LC1A 1XMQB 2YXLA 3G71V 1XREA 3T1HO 1PM9A 2P6JA 2XAQA 3D8CA 1MABG 5H6RA 5HFMA 3JALB 4DRXB 1QLEC 1MG1A 4CH3A 3CCUV 2Q0OC 1YJWV 4RUEA 2YICA 5L3FA 2YC0A 2JGUA 4P2ZA 2DN9A 4LFAB 1SZTA 1VP7A 3E83A 5GTIZ 5EC1C 4GT1A 4WCEV 2UXXA 1XOUA 2P4VA 5CA1A 2QWOB 4GKKB 2K1EA 4PD4F 4DV4O 3HKBA 3IFXA 5H6QA 2IW5A 1K34A 3OEEG 1XL4A 1TVKB 1R6NA 4UVCA 4H13B 1AR5A 3TGUH 3ZRXA 4K0KO 1WB8A 3BFRA 1SQPH 1E1RG 1N36B 2WLMA 2Y69C 4LNUB 1I5YA 2HVKC 4CC5A 1IBLB 1RPRA 4QE9A 3WB2A 1Y6XA 2ZR3A 4N21A 1TUBB 3BPZA 1OCZB 5C93A 5F2VO 3FB8C 4DV3B 1Y76B 3OTFA 1OCRB 4AHCA 4UCSA 1CXZB 4DW0A 1TGOA 1SESA 3ABKC 5FPOA 5A9GA 2ADQB 3DC6A 4JV5O 2EZOA 2WLKA 1KECA 1HW7A 2UXBO 2Y48A 1WP7A 4CC6A 4WBNA 5BMVA 1EFRG 4G28B 2K9PA 4DO2A 1UFIA 4R50A 4X64B 5CB4A 1XMQO 5B1BB 4EEQA 1S3JA 1PD3A 1FFXA 1VMGA 2RN9A 3F5TA 2EZPA 3CCEV 4GX1A 3HKCA 3ZIAG 2UUAB 4PI2A 1JVMA 2IJHA 4JYBA 3HB3B 5IJ0A 1BE3H 5FNVA 3DC5A 3BA9A 5JJJB 1YHQV 2OYQA 2FTKA 1Q6IA 5LOVB 3K08A 3DXRA 3ZX6A 3ZCCA 3E22B 1VF5B 2IBZH 1H2GA 3HKDB 1ZX3A 4LFAO 1V55C 1T5EA 3JATB 1MSWD 1QR8A 4WFGA 5IYZB 3TETA 3CCVV 2M6YA 4PDMA 3P30A 3ASOB 5B3SB 5KA6A 3EXAA 4EKWA 4GKKO 4PA3A 3STZC 2D3OW 2NN4A 1AB3A 3CE2A 2O57A 4I0XB 1VQ7V 4UB6Z 3VOUA 4EFBA 2WWWA 4FVMA 4DR4B 3QO8A 1N36O 1Q7YW 1THZA 1AJNA 3OGCC 1BS3A 3U11A 4UVAA 3IGAC 1XNQB 4JI8B 5KUMA 3MD0A 1IBLO 3CMAV 3K5OA 1G1XB 3L72H 2R9AA 3ZHUA 4DV3O 2RMKB 4FLUA 4I7ZB 2Q68A 1IVSA 3CB2A 5DM6V 4W4KA 3J80N 4O4JA 2QTSA 4K3AA 1KD1W 1Y66A 4I4TA 4GCZA 4X66B 4DV5B 2AZ2A 3BY6A 5J2TA 3G67A 3RVYA 5ITZB 4ZI7B 4B3MB 1LUWA 1K5QA 3A0RA 4X64O 4I50A 1VF6A 4CH6A 2JDIG 4MTFA 4HNAA 4P9PA 1VQ6V 2N04A 2W0FC 5IJ9A 4O2AB 5GW7A 4ZBMA 3AG4C 1H2LA 3SJAC 2UUAO 4IL6Z 2LFRA 3ZS8C 1OV9A 3JD1A 1BHBA 2YEVA 3ZRWB 3CEIA 1VQKV 1AROP 3K57A 3CWBH 1WAZA 2DYSC 2WLLB 1W59A 5FL7G 1J5EB 1BHAA 3F7VC 4O4HA 5JQGB 4GX2A 1JJ2U 2EIMC 3L71H 1AR4A 3SJQC 2ILMA 1NH2D 1BSMA 3P3PA 1MMMA 4K35A 3QNEA 1L0LH 1RSOB 4NR1A 2EBOA 1FD9A 1EM1A 1P84F 2ZCEA 4LF6B 5JCOC 4B3SB 3FB5C 4UCRA 1CEZA 2CGOA 3QO5A 1XEQA 4JI1B 4CZZA 1H2NA 1OCCC 1SA0B 3CCLV 4TWKA 4DR4O 3K9AA 1QCEA 2CTRA 3TXQA 2JS5A 2LJ2A 1XNQO 1CPYA 4JI8O 3PJSK 4J7JA 3MHSC 5CBFA 3K5LA 2WLHA 1A32A 2YIDA 2P67A 1VQ8V 2BCCH 1FYJA 3JSLA 3D3QA 2F23A 4H0LB 2ZE8A 4MTXA 1XNRB 4JYYA 1JX9A 4X20A 1XDCA 3AK3A 1GAXA 1VQ4V 4CH4A 4X66O 2WAMA 4DV5O 2H94A 2R72A 2B1GA 4MW3A 2F4VB 1DTOA 3N27A 1Y4MA 2FL4A 4NTWA 3G4SV 1YVWA 1PP9H 1N32B 3U0ZA 4FLXA 4B3MO 3CC2V 4PELA 2A06H 2OIEA 4DR6B 1LUVA 1EZVH 3JASA 1M1KW 1H38A 2E75B 5LGUA 1KBHA 2PI4A 3L75H 1O9GA 2PI5A 4FZ1A 4NTYA 3RGBA 5KAIZ 3K5MA 2HR3A 4PI0A 3E8GA 4FM1A 1DLBA 3JARA 1J5EO 2QWNB 1FXVA 2GUZA 5KHHA 2XT9A 2WLNA 1NI8A 3UQ8A 5EIBD 2CTWA 2M7WA 3K79A 1YI2V 4TQDA 2HFEC 5LMUB 3RVZA 1NZ6A 3RYIA 3RWRD 2UU9B 1TA8A 3JD2A 2ZQMA 4LF6O 4B3SO 4U3JA 1K8AW 1TUEB 4JI1O 3SR2C 4MVUA 3CRRA 3H1JH 2CGNA 4IIJA 1YF2A 1RM1C 1IBKB 4CS3A 4U3FH 2QKCA 5D5QA 2HP8A 3H1IH 4DR1B 4JTAB 4OXSA 1SS3A 2QWRB 3LSQA 5IWAB 4JI2B 1V54C 3GB7C 2Q73A 3D36A 3RFRA 1DK1A 4PDRA 1YITV 3ICXA 2YSUB 4PA7A 4ZHQA 2F66C 1XNRO 2Z0AA 3P3NA 2QM7A 2L35A 3Q4HA 2E5LB 3NR7A 1Y74B 3C3SA 3HKCB 4TSFG 2A0LA 1VQLV 2Q7GA 2F4VO 1N32O 1Y67A 5L3DA 4J11A 2GSMB 1GRJA 1N4CA 1QQCA 3AG3B 4K8ZA 4DR2B 4DR6O 2Q7HA 3B77A 2R70A 3AG7A 5LYJA 4LF7B 2ZM6B 3K06A 1VQNV 5B1AC 1MSDA 1X59A 1SETA 2CK3G 4DUZB 1QVFU 3CMEV 1YCIA 5EBMC 2EIJB 1P7GA 3RYCB 2LW1A 4J9YB 1ZWIC 4IT5A 2ODMA 4ZOLA 5LP6A 4Q6GA 1YJNV 2PF4E 1JFFA 1M9NA 1GN4A 4MVZA 1S5JA 4BIZA 5LMUO 1N0NA 1MA1A 3G6EV 4O2BB 1AI4A 2WLIB 2UU9O 1K97A 2Q69A 4F6RA 2DQ0A 5B5EZ 1PV0A 3LDDA 3OAAG 1JMKC 4O4LA 2CH7B 3R66A 1QLEB 2GHYA 1B04A 1D5NA 3N2KA 2YXHA 1IBKO 2V1DA 4KUMA 3FAVA 4DR1O 3ZRSA 4YJ3A 5IWAO 4JI2O 1KKDA 1XQ8A 3STLC 3WU2Z 1QU7A 2GTSA 2DYRC 5JVDA 2RNBA 3CHXA 1J95A 2BSKA 4QPJA 4TV9A 2E5LO 3W7WA 2BTQB 4LWSA 2X0LA 2GBOA 4PDLA 1EN6A 4DUYB 2A3QA 2Y69B 1KUQA 1WA8A 4I55B 2YIAA 4DK0A 3OD4A 1JCHA 2XTAA 5K1XA 4DR2O 4ASUG 4CH5A 5JH7A 4FFKA 4F6EA 3EVKA 2JGDB 3BCCH 4L8JA 2XNDG 4LF7O 2ZM6O 2ZE7A 3O65A 4R7CA 2WPDG 2ADPA 3SYQA 4DUZO 3BAAA 3OT7A 1WJZA 3ABKB 3W7TA 1U96A 1VF6C 3TXSA 1QBZA 5H2FZ 2LFSA 3D3IA 2QWPB 3CJHA 4DV0B 4IHJA 2LP7A 3JCUZ 4D6TH 1SERA 1GN6A 3OMAB 2OTLV 4BW5A 4RWUA 2QM4A 4XDKA 4FM2A 4UFZA 4X1KA 3H9VA 1E79G 4BR6A 4RO2A 2QWQB 1GKFA 3KCXA 4ABMA 2CE4A 4OPAA 2B1IA 5IY5C 1BQ0A 5LA6B 4LH6A 3SYPA 5EZYA 4NXMB 4DV7B 1HDJA 4OGQB 5KHJA 3KG2A 2W6IG 2KG7B 3SYOA 1SQGA 4TV8A 4FLZA 4JTDB 1V55B 5LHIA 1AI5A 5CA3A 5CBHA 1K4DC 3GVMA 4B3TB 4X1YB 2EIKC 3H01A 5LBQA 1G4YB 1MNGA 2HHHB 4NXNB 2H3OA 1FXKA 3JAMN 1OJHA 1M56C 2F1MA 5EYPA 2PYLA 2UXDB 5EK0A 3BRCA 2KSDA 1OZ0A 4J42A 4UCVA 4EB6A 1WLEA 1ZL8A 1IXMA 4DR5B 1M5IA 1R3JC 4DUYO 4PA6A 3UM7A 2XAJA 3B09A 1KC8W 2VRZA 3ZN0A 1Q90D 3BEHA 1PL0A 3EHBB 4O4IB 5FPRA 4FFBA 1P49A 1F7YA 5B66Z 5D5PA 4DW1A 3CCQV 2UUCB 4NVPA 1ZUQA 3LDEA 4B7KA 3FKSG 5GONA 3RYHA 4Q20A 1AILA 2XAGA 4LF5B 3RYFB 2DE0X 4DV0O 1GTOA 3CRAA 2QKAA 5KX5B 2A7WA 4KXRA 2E76B 4RAIA 4UXNA 3LDCA 5CBGA 2BOBC 3CXHF 4DYLA 2ARHA 1YXBA 2UXCB 1QNMA 5BY1A 3BHPA 4MTGA 3E8FA 5DN6G 1P4RA 4LH7A 1KP2A 2P5OA 2OCHA 5IDJA 4PV1B 4JI5B 4FLWA 3WFVA 2VQFB 1KP3A 4MVRA 3A8TA 3AG4B 2VWKA 3HKEB 3RW0A 1Q6HA 3QTCA 5KA5A 2ZDIA 5KMGA 5IYDO 4NXMO 2YIBA 4DV7O 2MK3A 3B8NA 4KFMA 1R3IC 2DYSB 4J80A 4X1IB 1EN4A 2ZD9A 1ZSPA 2Q7EA 2EIMB 2LGWA 5C8YB 3N2GA 2XAHA 3UT5A 2EILC 3K3WA 4RQFA 1B3QA 1R3KC 3SGIA 2OIGA 4B3TO 1AI7A 1BL8A 2HHHO 3RBZA 1R3LC 1NH2B 4NXNO 2HKOA 2YI9A 4R8CA 1V9PA 4YJ2A 1GM7A 4TUYB 5LHGA 2CAZC 2UXDO 2GDSA 1XI1A 2FB5A 1OCCB 3W7SA 3JAWB 3OW2U 1JQ0A 1W0KG 4FIPC 3B2EE 3WG7C 1IX9A 1NU1H 4DR5O 3D36C 4TT3G 1N33B 4QGPA 1NJIW 4B7EA 1KQSU 3FB7C 4PA9A 2DQ3A 4DV1B 1FXHA 1KU9A 3ASNC 2Z3YA 1W0JG 2X6BA 4R6ZA 5IT9N 1KKCA 2UUCO 4L87A 1OHHG 3MDSA 1NS1A 1QHTA 5KAFZ 5LGTA 1YZBA 1BQZA 5KHKA 2ZKOA 4UCOA 1FAFA 3SPJA 2NNUA 4E4EA 2Y0PA 3TJTA 5CA0B 4H37A 2FKXA 4LF5O 1WN7A 3W7XA 1B6QA 3JALA 1OCOC 1IZ3A 2LO1A 2UXCO 2PYJA 4LF8B 1ZLZA 5EC2C 3ML0A 1KYOF 2CUGA 4K8XA 2IJKA 1SQBH 4P9OA 2ZIMA 4JI5O 2BOCC 5J9PC 3AG2C 5IYCO 2VQFO 3CPWU 5LP6C 3K0DA 2G38A 1IURA 1SQVH 2LGQA 1L0NH 2BSKB 2OT5A 4GUNA 4GX5A 4TV9B 4W4LA 5B1NA 3OFNG 1VARA 5DECA 2P4KA 4HZ3A 1TVKA 3OUSA 3C90A 4X65B 2AZ0A 4PJ0Z 3L70H 2QEXV 4LNUA 4PHZA 2IJIA 3ZHQA 4KP4A 3IJ4A 4JI3B 1N0JA 3OE7G 1TUBA 4MT8A 1Q6UA 1YSCA 3CRQA 1NTKH 2JK5C 1SF9A 2Q8VA 3ZJZA 4WFHA 2R9RB 2HEPA 4CS2A 3RN4A 4FPPA 1AP6A 1RM1B 1N33O 4E2LA 4YXWG 1Q43A 5IYBO 3X2QC 5CA1B 4LF9B 4QIWF 2JS3A 3CS5A 1VQPV 1NVPD 4JI0B 1Q81W 3HKBB 1PKXA 4XBFA 3VQXA 1V54B 3ZMVA 4DV1O 1RPOA 4FLTA 2YDEA 3BA8A 4I9WA 1WB7A 1R6KA 2ZIOA 4H33A 4A5UB 3BABA 4HYOA 2DOSA 3H1LH 3TK1A 2LW7A 4X8AA 1MZFA 2PY5A 1JR9A 4H44B 2W0XA 1URFA 3M7MX 5A2QN 3A0BZ 4LF8O 3HPLC 4QPKA 4UVBA 5LOVA 4MS2A 5JWPA 3LNMB 3GWOA 3E22A 2QDOA 3OMIB 4N23A 3J81N 3HKDA 3ABTA 3FB6C 3FFQA 3JATA 4I5SA 2Y0IA 5B1AB 5IYZA 2DJVA 4WBNB 5BMVB 3SPHA 3JAKA 5CB4B 4D7TA 4DR3B 3ABLC 1WP8A 2X6CA 4D7SA 3JCZA 1HNZB 2PTMA 1FFXB 1UPGA 4JZGA 2GV9A 5J2UA 1MZEA 4X65O 3G80A 1M57C 3T4DA 5CMUA 1Q5OA 3K58A 4YIPA 2EJ7A 5IJ0B 2IJJA 4TQFA 5FNVB 1K73W 4UV8A 2FMLA 4JI3O 2F93B 1BGYH 2ITCC 3DXRB 2OTJV 3LSUA 3ZEDA 4WFEA 4RQEA 1FJGB 2RCVA 2IU0A 2A79B 3WB1A 1SQQH 1AP5A 1GK9A 2P22C 3SDLA 1F4NA 1FXKC 4LF9O 5DEDA 3NXSA 4JI0O 4FMTA 4ICGA 4BIOA 4BAYA 4YHHB 2X7RB 1I94B 4BWAA 4ZI7A 3MAQA 2QKSA 2P06A 2HJFC 4JAVA 3K0GA 2DYRB 1SZXA 1DF4A 3VQYA 2Z5UA 5LMNB 3SJBC 3ZRVA 1GH6A 1VF7A 2HVJC 3MHHC 2H8PC 4FJCC 4O2AA 2Q9LA 5EBWC 3I56V 3K9SA 4XDJA 3T1CA 4Z1VA 4GLXA 3LNNA 5KMGB 3K5NA 3ZN1A 3TCUA 1EZJA 3CC7V 3CRCA 1NKDA 3ZRWA 1NQTA 1YTFD 3VBBA 3J7AU 1WPXA 5BR8B 2WLLA 5BXZA 5JQGA 2OCCC 4O4JB 1O9HA 3CRMA 4I4TB 1JJOA 1Q3EA 3ABMC 3IC7A 3KCYA 5L3EA 2C2AA 5J2TB 2IM9A 4IYIA 5H5NA 1RSOA 1PPJH 4DR3O 4I50B 2V4DA 2DW4A 4HNAB 4QNHB 1Q8IA 2JRIA 5LXTA 1HNZO 4GKJB 3ABUA 3M99B 5IJ9B 2ZXWC 1GM8A 2KKWA 1SA0A 2EINC 4MTOA 2YIBD 4J9ZB 2QSAA 2WLJA 2ZDIC 4WF9V 2YEVB 2AHZA 3I55V 5JJEB 3F7YC 3CCJV 4O4HB 2YUAA 5IY5B 1FJGO 1YJ9V 1XMOB 3L74H 3AG1C 1NR7A 3RT3C 1E1QG 4TOIA 3PN1A 2EJRA 4EFEA 1S72V 2Q4PA 3AK2A 4BIUA 2FYUH 1EN5A
chains in the Genus database with same CATH topology
3UO2A 4J80A 1NZ6A 2PF4E 1XBLA 2LO1A 2QWPB 2YS8A 2YUAA 3BVOA 2QWOB 3UCSC 1IURA 2N04A 2EJ7A 2LGWA 2OCHA 2QWRB 1GH6A 2CTPA 2L6LA 1FPOA 2DMXA 2M6YA 1BQ0A 3APOA 2CUGA 3UO3A 2KQXA 2CTQA 2Y4TA 1BQZA 1FAFA 2QSAA 2QWNB 2N05A 2CTRA 2DN9A 2GUZB 1N4CA 2GUZA 2Y4UA 4RWUA 1HDJA 4J7ZA 4IT5A 2CTWA 1WJZA 3AG7A 3APQA 2QWQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UO2 A;  4J80 A;  1NZ6 A;  2PF4 E;  1XBL A;  2LO1 A;  2QWP B;  2YS8 A;  2YUA A;  3BVO A;  2QWO B;  3UCS C;  1IUR A;  2N04 A;  2EJ7 A;  2LGW A;  2OCH A;  2QWR B;  1GH6 A;  2CTP A;  2L6L A;  1FPO A;  2DMX A;  2M6Y A;  1BQ0 A;  3APO A;  2CUG A;  3UO3 A;  2KQX A;  2CTQ A;  2Y4T A;  1BQZ A;  1FAF A;  2QSA A;  2QWN B;  2N05 A;  2CTR A;  2DN9 A;  2GUZ B;  1N4C A;  2GUZ A;  2Y4U A;  4RWU A;  1HDJ A;  4J7Z A;  4IT5 A;  2CTW A;  1WJZ A;  3AG7 A;  3APQ A;  2QWQ B; 
#chains in the Genus database with same CATH topology
 4YHH O;  1I94 O;  3R65 A;  1RP3 B;  5H9C A;  1NTZ H;  2EIK B;  2WSS G;  4MVO A;  5LGN A;  2JVD A;  3CD6 V;  5LMN O;  1M56 B;  1X4T A;  2Y4U A;  4X88 A;  4LF4 B;  2WA3 A;  2CDY A;  3ETG A;  1HNW B;  4FK5 C;  2HG5 C;  4ZKI A;  3SJC C;  3ZHR A;  4B3R B;  4FM0 A;  3THO A;  2BTO A;  3CCR V;  4BW9 A;  2VWJ A;  1K5S A;  2HLD G;  4X20 B;  3IC9 A;  1BT8 A;  2Y4T A;  5BR8 O;  4CBC A;  1P7B A;  5CN0 A;  4MVQ A;  2Q67 A;  3OM3 B;  1US6 A;  2NR5 A;  1FFT B;  2UXN A;  2B9Z A;  2DWE C;  1AJQ A;  2X6A A;  1RFY A;  2JEU A;  4UCT A;  2YS8 A;  3B4S A;  1KMI Z;  1D5A A;  1PNL A;  3K03 A;  3LUT B;  5BZB A;  3C3T A;  3M8A A;  1I7F A;  4GKJ O;  3VQV A;  3JAS B;  3K04 A;  2XHB A;  2ZE6 A;  3JSN A;  3CCS V;  2PZS A;  2WA4 A;  2RQ6 A;  3JD3 A;  1XHZ A;  3F5W C;  2B5U A;  4FLY A;  3E8H A;  4HAM A;  3OGI B;  1D2D A;  3P32 A;  3JAR B;  1L8D A;  1H2K A;  1LR1 A;  1YEW A;  1JOY A;  1YDX A;  1U97 A;  2V7Q G;  3FYE B;  2GUZ B;  1Q86 W;  3ZMZ A;  1XMO O;  3DGE A;  2IU3 A;  3E8B A;  3FD9 A;  3WB0 A;  1Y74 A;  3RYI B;  1OCZ C;  4LFB B;  4JAA A;  1I5X A;  2EIL B;  1OCR C;  4JI7 B;  3OTO B;  2ATK C;  3ETQ A;  4U3J B;  1R1B A;  4IIJ B;  3QO7 A;  3KKY A;  1IBM B;  3QG5 A;  4UUJ C;  4QE7 A;  3UCS C;  2RDC A;  4CS4 A;  1Z5V A;  4LF4 O;  3SPI A;  4PA4 A;  1HNW O;  1MOF A;  2AGA A;  2P90 A;  3WG7 B;  3JAK B;  2NLJ C;  1ROP A;  4B3R O;  5B1B C;  4ZHQ B;  1NR1 A;  2F95 B;  5J2U B;  3RYC A;  1NTM H;  3Q4H B;  1Z2G A;  2PUS A;  1WPB A;  3QF7 A;  1XL6 A;  3VQW A;  2R9I A;  5GTH Z;  3ASN B;  2ZIN A;  4HBN A;  4DV2 B;  2UUB B;  1H2M A;  3T4Z A;  3GWK C;  1PNM A;  2L6L A;  1BMF G;  5IE9 A;  1QVG U;  4LBE C;  4FZ0 A;  1SC5 B;  4NKG B;  4O2B A;  2WLI A;  3UKM A;  4JYC A;  3L73 H;  1XHX A;  4WFF A;  1DGS A;  4J41 A;  2CH7 A;  1ZAU A;  4YIO A;  1OCO B;  1I08 A;  2AXT Z;  3JD0 A;  4B08 A;  5LYJ B;  2Q0A A;  1PL4 A;  2QJ1 A;  2IH3 C;  1NT2 B;  3CP1 A;  4GX0 A;  4UB8 Z;  4DXW A;  1GO3 F;  4WFB V;  2KQX A;  3ASO C;  4YY3 B;  2QR4 A;  4C7U A;  5B3S C;  2RJZ A;  1M93 A;  1GMG A;  2A9H A;  3AG2 B;  1R73 A;  4ZOL B;  3CSX A;  5LP6 B;  4X9Q A;  1JFF B;  1XBL A;  4MVM A;  2JIZ G;  1SQX H;  3ETD A;  3H1H H;  4KHP B;  2BTQ A;  4JTC B;  1S5L Z;  4F6R B;  4LFB O;  3DTU B;  3CX5 F;  1S5H C;  3L9D A;  4OX9 B;  1HR0 B;  4JI7 O;  3ZHT A;  1N8R W;  3OTO O;  4O4L B;  4I55 A;  3T2M A;  3E86 A;  1KB9 F;  1Z5W A;  1M4U A;  4U7O A;  4DRX A;  2F43 G;  3N2K B;  4KL1 A;  1IBM O;  3OEH G;  3CCM V;  4IGG A;  4JI6 B;  2JGD A;  1XUQ A;  3FAV B;  2N05 A;  4YJ3 B;  1DF5 A;  1K33 A;  2QTO A;  5L3G A;  1GN3 A;  3OUF A;  1HWY A;  2ZNJ A;  5LXT B;  1EBO A;  5JVD B;  3X2Q B;  4JYA B;  1F23 A;  1K92 A;  4JF3 A;  1PNK A;  1GN2 A;  4F4L A;  4LWS B;  2KB1 A;  2ZT9 B;  2Q5Z A;  3A2F A;  4JI4 B;  1GM9 A;  1NVP B;  4DV2 O;  1N34 B;  2UUB O;  4P30 A;  3ZHV A;  3OR7 C;  1K9M W;  4MSW C;  1WA8 B;  4ZIB A;  2VS0 A;  4JPR A;  3QVN A;  5JH7 B;  4QJF B;  5JJN B;  4LFC B;  2CTP A;  1IDS A;  5LA6 A;  4JAS A;  1Y76 A;  2CTQ A;  5B1O A;  4AIL C;  4PDV A;  1QR9 A;  4RUF A;  4DR7 B;  3DSQ A;  4YY3 O;  2KG7 A;  3B40 A;  1HP8 A;  3UO2 A;  3FYI B;  3CJH B;  2D2C B;  2XAF A;  4I9Q A;  1B06 A;  4IHJ B;  2XUM A;  4GYC B;  2P7T C;  3T1Y B;  3ZMU A;  4OPH A;  4X1Y A;  3A0H Z;  2VQE B;  5LHH A;  3AK1 A;  1VEW A;  3ABL B;  2JEX A;  3B8M A;  1SRY A;  4X1K B;  4KHP O;  4J7Z A;  3CC4 V;  1AJP A;  1VIB A;  1BZK A;  3AEI A;  1M57 B;  2YI8 A;  4OX9 O;  1HR0 O;  4AI8 A;  5EZY B;  2XOK G;  1CP9 A;  1G8M A;  4O4I A;  1HNX B;  5KLV H;  1W2B U;  1VQM V;  4JI6 O;  2E74 B;  4DV6 B;  4TV8 B;  4MW8 A;  3SPG A;  5K1P A;  1ZTE A;  5EIB C;  2ZR2 A;  1S77 D;  3IAY A;  3CXC U;  1TAE A;  3OMN B;  1K4C C;  4AQY B;  3HR0 A;  1ORQ C;  3UO3 A;  1FXK B;  4JYA O;  3JD4 A;  1VQ9 V;  1QLN A;  3RYF A;  1I0H A;  4UCU A;  5EYP B;  3LSS A;  1K7D A;  2QGN A;  5KX5 A;  3E2E A;  2AHY A;  4JI4 O;  4I0X A;  4EB6 B;  1ZL8 B;  4FLV A;  1N34 O;  5L3C A;  1FKA O;  2LQT A;  4JAU A;  4Z1M G;  1ENV A;  4DK1 A;  5EBL C;  4J10 A;  4X62 B;  3O9O A;  4U7N A;  1AI6 A;  4FFB B;  5KUK A;  3HKE A;  1SKV A;  3K59 A;  4LFC O;  4MVS A;  3JYC A;  2E3C A;  1L1F A;  2ITD C;  3SYC A;  5GON B;  3W7U A;  3RYH B;  3EFF K;  4Z2W A;  4DR7 O;  3T1H B;  5HFL A;  3KZI Z;  4X1I A;  2OCC B;  2AW9 A;  1YTF B;  2ZE5 A;  5C8Y A;  2DMX A;  3U10 A;  4IYH A;  5E1A C;  2GTA A;  2XAS A;  3ABM B;  4GZR B;  3ETE A;  3S3X A;  1R6T A;  3T1Y O;  1FS0 G;  1F4M A;  5E79 Z;  5ITZ A;  2VQE O;  1SQF A;  4G2K A;  1JA8 A;  3S3W A;  2BE3 A;  1IXB A;  4JZ2 A;  4J7K A;  3SPC A;  4TUY A;  5JCO A;  3BVO A;  5KHI A;  4NB5 A;  2QM8 A;  2OWO A;  2ZXW B;  1FPO A;  3JAW A;  2W6J G;  2EIN B;  4WFA V;  2MW2 B;  2ZNI A;  1M90 W;  3SYA A;  1H2S B;  4DV4 B;  1LNQ A;  2HJD A;  3APQ A;  4JGS A;  2ETN A;  4K0K B;  5L3B A;  1HNX O;  3ZHS A;  1F51 A;  3I5D A;  1UJW B;  1K3E A;  3N2G B;  4DV6 O;  3UT5 B;  4LP8 A;  3G6B A;  2QE7 G;  3FX7 A;  3APO A;  2EUL A;  1Q82 W;  1YIJ V;  3ZMS A;  3AG1 B;  2PGG A;  1BCC H;  2JJ2 G;  3AG3 C;  1VQO V;  4AQY O;  5KHG A;  5CA0 A;  4G27 B;  1AVM A;  4LR3 A;  5AG2 A;  1H8E G;  4YJ2 B;  2Q6A A;  2N74 A;  3E35 A;  2JJ1 G;  5FLX N;  1H8H G;  1NBM G;  4NYK A;  1JPX A;  4UV9 A;  2EX3 A;  1AR1 B;  3E89 A;  5TIS Z;  4XDL A;  3OR6 C;  3CYO A;  2YXY A;  1COW G;  1WNS A;  1XIL A;  2EIJ C;  4X89 A;  1VQ5 V;  2IH1 C;  1S0V A;  4JV5 B;  1G6U A;  3ZBH A;  3ZMT A;  4X62 O;  2DWD C;  5LL6 Y;  4LCU C;  4NTX A;  3H1K H;  2UXB B;  2QA4 V;  1S76 D;  4LC1 A;  1XMQ B;  2YXL A;  3G71 V;  1XRE A;  3T1H O;  1PM9 A;  2P6J A;  2XAQ A;  3D8C A;  1MAB G;  5H6R A;  5HFM A;  3JAL B;  4DRX B;  1QLE C;  1MG1 A;  4CH3 A;  3CCU V;  2Q0O C;  1YJW V;  4RUE A;  2YIC A;  5L3F A;  2YC0 A;  2JGU A;  4P2Z A;  2DN9 A;  4LFA B;  1SZT A;  1VP7 A;  3E83 A;  5GTI Z;  5EC1 C;  4GT1 A;  4WCE V;  2UXX A;  1XOU A;  2P4V A;  5CA1 A;  2QWO B;  4GKK B;  2K1E A;  4PD4 F;  4DV4 O;  3HKB A;  3IFX A;  5H6Q A;  2IW5 A;  1K34 A;  3OEE G;  1XL4 A;  1TVK B;  1R6N A;  4UVC A;  4H13 B;  1AR5 A;  3TGU H;  3ZRX A;  4K0K O;  1WB8 A;  3BFR A;  1SQP H;  1E1R G;  1N36 B;  2WLM A;  2Y69 C;  4LNU B;  1I5Y A;  2HVK C;  4CC5 A;  1IBL B;  1RPR A;  4QE9 A;  3WB2 A;  1Y6X A;  2ZR3 A;  4N21 A;  1TUB B;  3BPZ A;  1OCZ B;  5C93 A;  5F2V O;  3FB8 C;  4DV3 B;  1Y76 B;  3OTF A;  1OCR B;  4AHC A;  4UCS A;  1CXZ B;  4DW0 A;  1TGO A;  1SES A;  3ABK C;  5FPO A;  5A9G A;  2ADQ B;  3DC6 A;  4JV5 O;  2EZO A;  2WLK A;  1KEC A;  1HW7 A;  2UXB O;  2Y48 A;  1WP7 A;  4CC6 A;  4WBN A;  5BMV A;  1EFR G;  4G28 B;  2K9P A;  4DO2 A;  1UFI A;  4R50 A;  4X64 B;  5CB4 A;  1XMQ O;  5B1B B;  4EEQ A;  1S3J A;  1PD3 A;  1FFX A;  1VMG A;  2RN9 A;  3F5T A;  2EZP A;  3CCE V;  4GX1 A;  3HKC A;  3ZIA G;  2UUA B;  4PI2 A;  1JVM A;  2IJH A;  4JYB A;  3HB3 B;  5IJ0 A;  1BE3 H;  5FNV A;  3DC5 A;  3BA9 A;  5JJJ B;  1YHQ V;  2OYQ A;  2FTK A;  1Q6I A;  5LOV B;  3K08 A;  3DXR A;  3ZX6 A;  3ZCC A;  3E22 B;  1VF5 B;  2IBZ H;  1H2G A;  3HKD B;  1ZX3 A;  4LFA O;  1V55 C;  1T5E A;  3JAT B;  1MSW D;  1QR8 A;  4WFG A;  5IYZ B;  3TET A;  3CCV V;  2M6Y A;  4PDM A;  3P30 A;  3ASO B;  5B3S B;  5KA6 A;  3EXA A;  4EKW A;  4GKK O;  4PA3 A;  3STZ C;  2D3O W;  2NN4 A;  1AB3 A;  3CE2 A;  2O57 A;  4I0X B;  1VQ7 V;  4UB6 Z;  3VOU A;  4EFB A;  2WWW A;  4FVM A;  4DR4 B;  3QO8 A;  1N36 O;  1Q7Y W;  1THZ A;  1AJN A;  3OGC C;  1BS3 A;  3U11 A;  4UVA A;  3IGA C;  1XNQ B;  4JI8 B;  5KUM A;  3MD0 A;  1IBL O;  3CMA V;  3K5O A;  1G1X B;  3L72 H;  2R9A A;  3ZHU A;  4DV3 O;  2RMK B;  4FLU A;  4I7Z B;  2Q68 A;  1IVS A;  3CB2 A;  5DM6 V;  4W4K A;  3J80 N;  4O4J A;  2QTS A;  4K3A A;  1KD1 W;  1Y66 A;  4I4T A;  4GCZ A;  4X66 B;  4DV5 B;  2AZ2 A;  3BY6 A;  5J2T A;  3G67 A;  3RVY A;  5ITZ B;  4ZI7 B;  4B3M B;  1LUW A;  1K5Q A;  3A0R A;  4X64 O;  4I50 A;  1VF6 A;  4CH6 A;  2JDI G;  4MTF A;  4HNA A;  4P9P A;  1VQ6 V;  2N04 A;  2W0F C;  5IJ9 A;  4O2A B;  5GW7 A;  4ZBM A;  3AG4 C;  1H2L A;  3SJA C;  2UUA O;  4IL6 Z;  2LFR A;  3ZS8 C;  1OV9 A;  3JD1 A;  1BHB A;  2YEV A;  3ZRW B;  3CEI A;  1VQK V;  1ARO P;  3K57 A;  3CWB H;  1WAZ A;  2DYS C;  2WLL B;  1W59 A;  5FL7 G;  1J5E B;  1BHA A;  3F7V C;  4O4H A;  5JQG B;  4GX2 A;  1JJ2 U;  2EIM C;  3L71 H;  1AR4 A;  3SJQ C;  2ILM A;  1NH2 D;  1BSM A;  3P3P A;  1MMM A;  4K35 A;  3QNE A;  1L0L H;  1RSO B;  4NR1 A;  2EBO A;  1FD9 A;  1EM1 A;  1P84 F;  2ZCE A;  4LF6 B;  5JCO C;  4B3S B;  3FB5 C;  4UCR A;  1CEZ A;  2CGO A;  3QO5 A;  1XEQ A;  4JI1 B;  4CZZ A;  1H2N A;  1OCC C;  1SA0 B;  3CCL V;  4TWK A;  4DR4 O;  3K9A A;  1QCE A;  2CTR A;  3TXQ A;  2JS5 A;  2LJ2 A;  1XNQ O;  1CPY A;  4JI8 O;  3PJS K;  4J7J A;  3MHS C;  5CBF A;  3K5L A;  2WLH A;  1A32 A;  2YID A;  2P67 A;  1VQ8 V;  2BCC H;  1FYJ A;  3JSL A;  3D3Q A;  2F23 A;  4H0L B;  2ZE8 A;  4MTX A;  1XNR B;  4JYY A;  1JX9 A;  4X20 A;  1XDC A;  3AK3 A;  1GAX A;  1VQ4 V;  4CH4 A;  4X66 O;  2WAM A;  4DV5 O;  2H94 A;  2R72 A;  2B1G A;  4MW3 A;  2F4V B;  1DTO A;  3N27 A;  1Y4M A;  2FL4 A;  4NTW A;  3G4S V;  1YVW A;  1PP9 H;  1N32 B;  3U0Z A;  4FLX A;  4B3M O;  3CC2 V;  4PEL A;  2A06 H;  2OIE A;  4DR6 B;  1LUV A;  1EZV H;  3JAS A;  1M1K W;  1H38 A;  2E75 B;  5LGU A;  1KBH A;  2PI4 A;  3L75 H;  1O9G A;  2PI5 A;  4FZ1 A;  4NTY A;  3RGB A;  5KAI Z;  3K5M A;  2HR3 A;  4PI0 A;  3E8G A;  4FM1 A;  1DLB A;  3JAR A;  1J5E O;  2QWN B;  1FXV A;  2GUZ A;  5KHH A;  2XT9 A;  2WLN A;  1NI8 A;  3UQ8 A;  5EIB D;  2CTW A;  2M7W A;  3K79 A;  1YI2 V;  4TQD A;  2HFE C;  5LMU B;  3RVZ A;  1NZ6 A;  3RYI A;  3RWR D;  2UU9 B;  1TA8 A;  3JD2 A;  2ZQM A;  4LF6 O;  4B3S O;  4U3J A;  1K8A W;  1TUE B;  4JI1 O;  3SR2 C;  4MVU A;  3CRR A;  3H1J H;  2CGN A;  4IIJ A;  1YF2 A;  1RM1 C;  1IBK B;  4CS3 A;  4U3F H;  2QKC A;  5D5Q A;  2HP8 A;  3H1I H;  4DR1 B;  4JTA B;  4OXS A;  1SS3 A;  2QWR B;  3LSQ A;  5IWA B;  4JI2 B;  1V54 C;  3GB7 C;  2Q73 A;  3D36 A;  3RFR A;  1DK1 A;  4PDR A;  1YIT V;  3ICX A;  2YSU B;  4PA7 A;  4ZHQ A;  2F66 C;  1XNR O;  2Z0A A;  3P3N A;  2QM7 A;  2L35 A;  3Q4H A;  2E5L B;  3NR7 A;  1Y74 B;  3C3S A;  3HKC B;  4TSF G;  2A0L A;  1VQL V;  2Q7G A;  2F4V O;  1N32 O;  1Y67 A;  5L3D A;  4J11 A;  2GSM B;  1GRJ A;  1N4C A;  1QQC A;  3AG3 B;  4K8Z A;  4DR2 B;  4DR6 O;  2Q7H A;  3B77 A;  2R70 A;  3AG7 A;  5LYJ A;  4LF7 B;  2ZM6 B;  3K06 A;  1VQN V;  5B1A C;  1MSD A;  1X59 A;  1SET A;  2CK3 G;  4DUZ B;  1QVF U;  3CME V;  1YCI A;  5EBM C;  2EIJ B;  1P7G A;  3RYC B;  2LW1 A;  4J9Y B;  1ZWI C;  4IT5 A;  2ODM A;  4ZOL A;  5LP6 A;  4Q6G A;  1YJN V;  2PF4 E;  1JFF A;  1M9N A;  1GN4 A;  4MVZ A;  1S5J A;  4BIZ A;  5LMU O;  1N0N A;  1MA1 A;  3G6E V;  4O2B B;  1AI4 A;  2WLI B;  2UU9 O;  1K97 A;  2Q69 A;  4F6R A;  2DQ0 A;  5B5E Z;  1PV0 A;  3LDD A;  3OAA G;  1JMK C;  4O4L A;  2CH7 B;  3R66 A;  1QLE B;  2GHY A;  1B04 A;  1D5N A;  3N2K A;  2YXH A;  1IBK O;  2V1D A;  4KUM A;  3FAV A;  4DR1 O;  3ZRS A;  4YJ3 A;  5IWA O;  4JI2 O;  1KKD A;  1XQ8 A;  3STL C;  3WU2 Z;  1QU7 A;  2GTS A;  2DYR C;  5JVD A;  2RNB A;  3CHX A;  1J95 A;  2BSK A;  4QPJ A;  4TV9 A;  2E5L O;  3W7W A;  2BTQ B;  4LWS A;  2X0L A;  2GBO A;  4PDL A;  1EN6 A;  4DUY B;  2A3Q A;  2Y69 B;  1KUQ A;  1WA8 A;  4I55 B;  2YIA A;  4DK0 A;  3OD4 A;  1JCH A;  2XTA A;  5K1X A;  4DR2 O;  4ASU G;  4CH5 A;  5JH7 A;  4FFK A;  4F6E A;  3EVK A;  2JGD B;  3BCC H;  4L8J A;  2XND G;  4LF7 O;  2ZM6 O;  2ZE7 A;  3O65 A;  4R7C A;  2WPD G;  2ADP A;  3SYQ A;  4DUZ O;  3BAA A;  3OT7 A;  1WJZ A;  3ABK B;  3W7T A;  1U96 A;  1VF6 C;  3TXS A;  1QBZ A;  5H2F Z;  2LFS A;  3D3I A;  2QWP B;  3CJH A;  4DV0 B;  4IHJ A;  2LP7 A;  3JCU Z;  4D6T H;  1SER A;  1GN6 A;  3OMA B;  2OTL V;  4BW5 A;  4RWU A;  2QM4 A;  4XDK A;  4FM2 A;  4UFZ A;  4X1K A;  3H9V A;  1E79 G;  4BR6 A;  4RO2 A;  2QWQ B;  1GKF A;  3KCX A;  4ABM A;  2CE4 A;  4OPA A;  2B1I A;  5IY5 C;  1BQ0 A;  5LA6 B;  4LH6 A;  3SYP A;  5EZY A;  4NXM B;  4DV7 B;  1HDJ A;  4OGQ B;  5KHJ A;  3KG2 A;  2W6I G;  2KG7 B;  3SYO A;  1SQG A;  4TV8 A;  4FLZ A;  4JTD B;  1V55 B;  5LHI A;  1AI5 A;  5CA3 A;  5CBH A;  1K4D C;  3GVM A;  4B3T B;  4X1Y B;  2EIK C;  3H01 A;  5LBQ A;  1G4Y B;  1MNG A;  2HHH B;  4NXN B;  2H3O A;  1FXK A;  3JAM N;  1OJH A;  1M56 C;  2F1M A;  5EYP A;  2PYL A;  2UXD B;  5EK0 A;  3BRC A;  2KSD A;  1OZ0 A;  4J42 A;  4UCV A;  4EB6 A;  1WLE A;  1ZL8 A;  1IXM A;  4DR5 B;  1M5I A;  1R3J C;  4DUY O;  4PA6 A;  3UM7 A;  2XAJ A;  3B09 A;  1KC8 W;  2VRZ A;  3ZN0 A;  1Q90 D;  3BEH A;  1PL0 A;  3EHB B;  4O4I B;  5FPR A;  4FFB A;  1P49 A;  1F7Y A;  5B66 Z;  5D5P A;  4DW1 A;  3CCQ V;  2UUC B;  4NVP A;  1ZUQ A;  3LDE A;  4B7K A;  3FKS G;  5GON A;  3RYH A;  4Q20 A;  1AIL A;  2XAG A;  4LF5 B;  3RYF B;  2DE0 X;  4DV0 O;  1GTO A;  3CRA A;  2QKA A;  5KX5 B;  2A7W A;  4KXR A;  2E76 B;  4RAI A;  4UXN A;  3LDC A;  5CBG A;  2BOB C;  3CXH F;  4DYL A;  2ARH A;  1YXB A;  2UXC B;  1QNM A;  5BY1 A;  3BHP A;  4MTG A;  3E8F A;  5DN6 G;  1P4R A;  4LH7 A;  1KP2 A;  2P5O A;  2OCH A;  5IDJ A;  4PV1 B;  4JI5 B;  4FLW A;  3WFV A;  2VQF B;  1KP3 A;  4MVR A;  3A8T A;  3AG4 B;  2VWK A;  3HKE B;  3RW0 A;  1Q6H A;  3QTC A;  5KA5 A;  2ZDI A;  5KMG A;  5IYD O;  4NXM O;  2YIB A;  4DV7 O;  2MK3 A;  3B8N A;  4KFM A;  1R3I C;  2DYS B;  4J80 A;  4X1I B;  1EN4 A;  2ZD9 A;  1ZSP A;  2Q7E A;  2EIM B;  2LGW A;  5C8Y B;  3N2G A;  2XAH A;  3UT5 A;  2EIL C;  3K3W A;  4RQF A;  1B3Q A;  1R3K C;  3SGI A;  2OIG A;  4B3T O;  1AI7 A;  1BL8 A;  2HHH O;  3RBZ A;  1R3L C;  1NH2 B;  4NXN O;  2HKO A;  2YI9 A;  4R8C A;  1V9P A;  4YJ2 A;  1GM7 A;  4TUY B;  5LHG A;  2CAZ C;  2UXD O;  2GDS A;  1XI1 A;  2FB5 A;  1OCC B;  3W7S A;  3JAW B;  3OW2 U;  1JQ0 A;  1W0K G;  4FIP C;  3B2E E;  3WG7 C;  1IX9 A;  1NU1 H;  4DR5 O;  3D36 C;  4TT3 G;  1N33 B;  4QGP A;  1NJI W;  4B7E A;  1KQS U;  3FB7 C;  4PA9 A;  2DQ3 A;  4DV1 B;  1FXH A;  1KU9 A;  3ASN C;  2Z3Y A;  1W0J G;  2X6B A;  4R6Z A;  5IT9 N;  1KKC A;  2UUC O;  4L87 A;  1OHH G;  3MDS A;  1NS1 A;  1QHT A;  5KAF Z;  5LGT A;  1YZB A;  1BQZ A;  5KHK A;  2ZKO A;  4UCO A;  1FAF A;  3SPJ A;  2NNU A;  4E4E A;  2Y0P A;  3TJT A;  5CA0 B;  4H37 A;  2FKX A;  4LF5 O;  1WN7 A;  3W7X A;  1B6Q A;  3JAL A;  1OCO C;  1IZ3 A;  2LO1 A;  2UXC O;  2PYJ A;  4LF8 B;  1ZLZ A;  5EC2 C;  3ML0 A;  1KYO F;  2CUG A;  4K8X A;  2IJK A;  1SQB H;  4P9O A;  2ZIM A;  4JI5 O;  2BOC C;  5J9P C;  3AG2 C;  5IYC O;  2VQF O;  3CPW U;  5LP6 C;  3K0D A;  2G38 A;  1IUR A;  1SQV H;  2LGQ A;  1L0N H;  2BSK B;  2OT5 A;  4GUN A;  4GX5 A;  4TV9 B;  4W4L A;  5B1N A;  3OFN G;  1VAR A;  5DEC A;  2P4K A;  4HZ3 A;  1TVK A;  3OUS A;  3C90 A;  4X65 B;  2AZ0 A;  4PJ0 Z;  3L70 H;  2QEX V;  4LNU A;  4PHZ A;  2IJI A;  3ZHQ A;  4KP4 A;  3IJ4 A;  4JI3 B;  1N0J A;  3OE7 G;  1TUB A;  4MT8 A;  1Q6U A;  1YSC A;  3CRQ A;  1NTK H;  2JK5 C;  1SF9 A;  2Q8V A;  3ZJZ A;  4WFH A;  2R9R B;  2HEP A;  4CS2 A;  3RN4 A;  4FPP A;  1AP6 A;  1RM1 B;  1N33 O;  4E2L A;  4YXW G;  1Q43 A;  5IYB O;  3X2Q C;  5CA1 B;  4LF9 B;  4QIW F;  2JS3 A;  3CS5 A;  1VQP V;  1NVP D;  4JI0 B;  1Q81 W;  3HKB B;  1PKX A;  4XBF A;  3VQX A;  1V54 B;  3ZMV A;  4DV1 O;  1RPO A;  4FLT A;  2YDE A;  3BA8 A;  4I9W A;  1WB7 A;  1R6K A;  2ZIO A;  4H33 A;  4A5U B;  3BAB A;  4HYO A;  2DOS A;  3H1L H;  3TK1 A;  2LW7 A;  4X8A A;  1MZF A;  2PY5 A;  1JR9 A;  4H44 B;  2W0X A;  1URF A;  3M7M X;  5A2Q N;  3A0B Z;  4LF8 O;  3HPL C;  4QPK A;  4UVB A;  5LOV A;  4MS2 A;  5JWP A;  3LNM B;  3GWO A;  3E22 A;  2QDO A;  3OMI B;  4N23 A;  3J81 N;  3HKD A;  3ABT A;  3FB6 C;  3FFQ A;  3JAT A;  4I5S A;  2Y0I A;  5B1A B;  5IYZ A;  2DJV A;  4WBN B;  5BMV B;  3SPH A;  3JAK A;  5CB4 B;  4D7T A;  4DR3 B;  3ABL C;  1WP8 A;  2X6C A;  4D7S A;  3JCZ A;  1HNZ B;  2PTM A;  1FFX B;  1UPG A;  4JZG A;  2GV9 A;  5J2U A;  1MZE A;  4X65 O;  3G80 A;  1M57 C;  3T4D A;  5CMU A;  1Q5O A;  3K58 A;  4YIP A;  2EJ7 A;  5IJ0 B;  2IJJ A;  4TQF A;  5FNV B;  1K73 W;  4UV8 A;  2FML A;  4JI3 O;  2F93 B;  1BGY H;  2ITC C;  3DXR B;  2OTJ V;  3LSU A;  3ZED A;  4WFE A;  4RQE A;  1FJG B;  2RCV A;  2IU0 A;  2A79 B;  3WB1 A;  1SQQ H;  1AP5 A;  1GK9 A;  2P22 C;  3SDL A;  1F4N A;  1FXK C;  4LF9 O;  5DED A;  3NXS A;  4JI0 O;  4FMT A;  4ICG A;  4BIO A;  4BAY A;  4YHH B;  2X7R B;  1I94 B;  4BWA A;  4ZI7 A;  3MAQ A;  2QKS A;  2P06 A;  2HJF C;  4JAV A;  3K0G A;  2DYR B;  1SZX A;  1DF4 A;  3VQY A;  2Z5U A;  5LMN B;  3SJB C;  3ZRV A;  1GH6 A;  1VF7 A;  2HVJ C;  3MHH C;  2H8P C;  4FJC C;  4O2A A;  2Q9L A;  5EBW C;  3I56 V;  3K9S A;  4XDJ A;  3T1C A;  4Z1V A;  4GLX A;  3LNN A;  5KMG B;  3K5N A;  3ZN1 A;  3TCU A;  1EZJ A;  3CC7 V;  3CRC A;  1NKD A;  3ZRW A;  1NQT A;  1YTF D;  3VBB A;  3J7A U;  1WPX A;  5BR8 B;  2WLL A;  5BXZ A;  5JQG A;  2OCC C;  4O4J B;  1O9H A;  3CRM A;  4I4T B;  1JJO A;  1Q3E A;  3ABM C;  3IC7 A;  3KCY A;  5L3E A;  2C2A A;  5J2T B;  2IM9 A;  4IYI A;  5H5N A;  1RSO A;  1PPJ H;  4DR3 O;  4I50 B;  2V4D A;  2DW4 A;  4HNA B;  4QNH B;  1Q8I A;  2JRI A;  5LXT A;  1HNZ O;  4GKJ B;  3ABU A;  3M99 B;  5IJ9 B;  2ZXW C;  1GM8 A;  2KKW A;  1SA0 A;  2EIN C;  4MTO A;  2YIB D;  4J9Z B;  2QSA A;  2WLJ A;  2ZDI C;  4WF9 V;  2YEV B;  2AHZ A;  3I55 V;  5JJE B;  3F7Y C;  3CCJ V;  4O4H B;  2YUA A;  5IY5 B;  1FJG O;  1YJ9 V;  1XMO B;  3L74 H;  3AG1 C;  1NR7 A;  3RT3 C;  1E1Q G;  4TOI A;  3PN1 A;  2EJR A;  4EFE A;  1S72 V;  2Q4P A;  3AK2 A;  4BIU A;  2FYU H;  1EN5 A; 
#chains in the Genus database with same CATH homology
 3UO2 A;  4J80 A;  1NZ6 A;  2PF4 E;  1XBL A;  2LO1 A;  2QWP B;  2YS8 A;  2YUA A;  3BVO A;  2QWO B;  3UCS C;  1IUR A;  2N04 A;  2EJ7 A;  2LGW A;  2OCH A;  2QWR B;  1GH6 A;  2CTP A;  2L6L A;  1FPO A;  2DMX A;  2M6Y A;  1BQ0 A;  3APO A;  2CUG A;  3UO3 A;  2KQX A;  2CTQ A;  2Y4T A;  1BQZ A;  1FAF A;  2QSA A;  2QWN B;  2N05 A;  2CTR A;  2DN9 A;  2GUZ B;  1N4C A;  2GUZ A;  2Y4U A;  4RWU A;  1HDJ A;  4J7Z A;  4IT5 A;  2CTW A;  1WJZ A;  3AG7 A;  3APQ A;  2QWQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...