2YUAA

Solution structure of the dnaj domain from human williams-beuren syndrome chromosome region 18 protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
GSSGSSGSQGDCSYSRTALYDLLGVPSTATQAQIKAAYYRQCFLYHPDRNSGSAEAAERFTRISQAYVVLGSATLRRKYDRGLLSDEDLRGPGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Williams-Beuren syndrome chromosome region 18 protein
publication title Solution structure of the DnaJ domain from human Williams-Beuren syndrome chromosome region 18 protein
rcsb
source organism Homo sapiens
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2yuaA01
2OCHA 1FAFA 1NZ6A 2LGWA 2DMXA 2LO1A 2GUZA 3APOA 3UCSC 2QSAA 2CTPA 4RWUA 2CTRA 2YUAA 2M6YA 2DN9A 2N05A 2CTQA 2Y4UA 2PF4E 3UO2A 2EJ7A 2QWOB 2QWRB 1IURA 1XBLA 3AG7A 4J80A 2KQXA 2L6LA 1BQZA 2GUZB 1WJZA 1GH6A 2QWQB 4J7ZA 2CUGA 1FPOA 2Y4TA 2QWNB 4IT5A 1HDJA 3BVOA 2QWPB 2YS8A 2CTWA 3APQA 1BQ0A 3UO3A 2N04A 1N4CA
chains in the Genus database with same CATH superfamily
4WFBV 4MSWC 2ZR3A 4MS2A 4UB6Z 1ZLZA 4H33A 4PHZA 1PNKA 5LP6A 3ML0A 1R6TA 1LNQA 5KHIA 1PP9H 1QVGU 4JV5B 1GRJA 2CGNA 3K57A 2P06A 3ZHSA 1AP6A 1Q7YW 4O2AB 4JAUA 3CJHB 2GUZA 4UCUA 5LBQA 4NTYA 4XDJA 1O9HA 2WWWA 3RFRA 2D3OW 1MZEA 1XI1A 1GM9A 3JALB 1GM7A 3WFVA 3ZHRA 1N8RW 5BZBA 1P49A 2F66C 1G1XB 1OCCB 3CCVV 5CA0B 4KHPB 4DR5O 2HP8A 1P7GA 3FB5C 5KHJA 5EBMC 3K5OA 2EINC 2YICA 1OCZB 4PDLA 1IURA 2EIMB 4A5UB 4LF4B 4FLWA 1WP7A 1FS0G 3CRAA 3OD4A 3K0DA 1N32O 2ZINA 1YDXA 1AJQA 1U97A 1AI6A 5IJ0A 2DJVA 4JI6O 3UCSC 5EIBD 3CCRV 2IBZH 1AJNA 3F7VC 1TVKA 3JAKA 4PA6A 1V9PA 3TCUA 4LFAO 4B3RO 2HVJC 3AG2B 4LFCO 2VRZA 1OV9A 5LHGA 2BTQB 3LNNA 1VQ4V 4EB6B 4TWKA 5KHHA 1XL4A 2M6YA 3U0ZA 3E8FA 1JA8A 1Y4MA 3U11A 3DTUB 2Q7GA 4HZ3A 1G4YB 4MVOA 3E35A 3ZRWB 4QNHB 3R65A 4X65O 3D36C 3ZHTA 2LQTA 1QNMA 3MAQA 4X65B 4FM0A 2YIBD 1MSDA 4H0LB 1QLEB 3OMIB 3WB1A 4CH5A 1NZ6A 4DUYO 4AQYO 1DF5A 4NR1A 3E86A 2ZE8A 3OEEG 4AQYB 1BGYH 3RYIA 4G28B 1IBLB 5KA5A 1P84F 1WA8B 2P22C 1OCZC 4UCRA 1J5EO 1Q5OA 5HFLA 5EC2C 2ZE6A 1J5EB 1B6QA 1K33A 2QGNA 3CEIA 3JD0A 4TUYB 4JI4B 2O57A 5LA6A 3RVZA 4AHCA 5B1OA 1FFTB 5JQGA 3RYHA 1KKDA 3LDDA 3CCUV 3K06A 1ORQC 3W7SA 4LNUB 4JZGA 4W4LA 3FYEB 3EHBB 3B8MA 1B3QA 4IL6Z 2CK3G 3HKBA 2RDCA 3BFRA 4DV1B 2YUAA 3RT3C 1DK1A 3AG2C 3C3TA 5DM6V 4R50A 1SKVA 4I4TB 5L3GA 3E2EA 1VQNV 1HNXO 1ZSPA 2JGDA 3A0BZ 1PM9A 1VP7A 4EFEA 2VWJA 5IYBO 2NNUA 2UXBB 2EJ7A 3THOA 1BE3H 1VEWA 2ARHA 4X1KA 1DTOA 5LHHA 1XEQA 1XOUA 3TETA 2X6BA 1EM1A 1I08A 5CN0A 4J7KA 2GHYA 5LXTB 4I9QA 5GTHZ 1LR1A 3HR0A 3T1CA 2GDSA 1AI5A 3H1IH 2XUMA 2LP7A 4RQFA 4NYKA 5BXZA 4ZHQA 2EBOA 1M93A 3FB7C 2X6CA 3QG5A 5FPRA 2Z0AA 1RM1B 2N74A 4JI3O 3D36A 1XNRO 2YXLA 2UUBO 1XNRB 3C3SA 1NR7A 3VBBA 4L8JA 2XTAA 4CZZA 4K8ZA 2ZIOA 4XDLA 2UUBB 4B3MB 3F5WC 1PNMA 2JRIA 3KKYA 4DR4O 3CCMV 3I56V 2HFEC 4LFBO 1Z2GA 2IJJA 2YI9A 4DR2O 2KG7A 4FLZA 5IE9A 4CH4A 4P9PA 3TXQA 4D6TH 2QKAA 5IJ9B 4CC5A 3J7AU 1AR1B 5CA1B 1BZKA 1IBMO 1IBKB 1FXVA 2QSAA 4GKJB 1BHAA 2F1MA 2H94A 1TAEA 4DV2B 4LWSA 3JD2A 3CRMA 1L0LH 3CXHF 2PZSA 4QPJA 3B8NA 2IU0A 3G71V 2YC0A 1HP8A 2UXCB 1SZXA 1DF4A 4B3TO 1SA0B 4FVMA 1WP8A 4TSFG 3AK2A 4B3TB 3F7YC 5LMUO 1N36B 2XAJA 5EIBC 2A7WA 3SYQA 3UKMA 4DR6O 4GT1A 4BR6A 2PUSA 3RYCA 2CTPA 3B09A 5FPOA 5EC1C 4FFBB 4X62O 2MW2B 1GTOA 1Z5VA 3AG4C 2VQFO 1K5QA 3RBZA 1XNQO 3JD3A 3L70H 4G27B 5KX5A 3JD1A 4QJFB 2ZE7A 3J81N 1EZVH 3PN1A 3OW2U 1FXKC 4KL1A 2M7WA 3G80A 5FL7G 4OPHA 1KP3A 3CCSV 3OTFA 5LMNB 4WFGA 1DLBA 1RM1C 5C93A 2LFRA 4MTGA 1KD1W 3LDCA 3OMAB 4N21A 2CGOA 5C8YA 1NH2D 2UU9B 4FK5C 2GUZB 2WA3A 4YJ2B 3OEHG 4P9OA 3JATA 2ZNJA 2FTKA 2QTOA 2QM4A 1F4NA 4R8CA 4PA4A 3EFFK 2GSMB 2UUCO 4B7KA 3K5NA 4CS3A 1WAZA 1MNGA 4JI1B 4O4HA 3SYPA 1WN7A 1VF6C 5CA3A 5H5NA 2OYQA 4TV9A 4GKKO 5L3FA 3CE2A 2HEPA 1XILA 2Q4PA 4B3SB 3ZRXA 1XL6A 3IFXA 1KYOF 1SQBH 2P5OA 5A9GA 1J95A 1YCIA 4CH3A 2QM8A 4P30A 5A2QN 1H38A 5IJ0B 1VQLV 4MVZA 5E1AC 2EX3A 4KXRA 1FFXA 3EXAA 1M90W 2JIZG 3CB2A 4I50A 3A0RA 4DR7B 2NN4A 1TVKB 3JAKB 1VQ9V 3ZCCA 4LF8O 3OT7A 3HB3B 1NS1A 1M5IA 3ETDA 1HNWB 5IWAO 1N34O 1FJGO 5LOVA 1F4MA 2ZNIA 4R6ZA 4DV7O 1S0VA 1YJ9V 3BA9A 3CC2V 1FJGB 4J10A 3CC4V 3VOUA 5LP6C 2XAFA 4IHJA 2DYSB 3WG7C 3OTOB 3BAAA 2QWPB 3J80N 3KCYA 4DV0O 2BSKA 2W6JG 4FFKA 1D2DA 2LO1A 1XMOO 4YY3B 3T4ZA 2UUAB 2FMLA 4UCVA 3KZIZ 4I0XA 3ZEDA 1MOFA 3SJCC 1UPGA 4HBNA 4ICGA 2P7TC 1TA8A 4UCTA 3K9SA 4GCZA 2JVDA 3OMNB 5GW7A 4H44B 3RYIB 4DUZO 4Z1MG 1S5HC 1FXKA 4D7TA 4JASA 4DUZB 1GM8A 2XHBA 4X89A 3VQXA 1NI8A 3ZHUA 4LF9B 2K1EA 3SPJA 4JYAO 1NH2B 5LA6B 4JYAB 1GN3A 5JQGB 1KC8W 1VQPV 2ZKOA 1SF9A 2HJFC 2YIBA 3MHSC 1JVMA 3RYHB 3AG3B 4IYHA 2GBOA 5JCOC 2JS3A 1H2SB 4PDVA 4GLXA 3HKBB 2ITCC 3ZRVA 4JI2O 1GAXA 3E22A 2EINB 4DRXA 1FKAO 3BVOA 1N4CA 2OIEA 4DXWA 2E5LB 1HWYA 3O9OA 3E8BA 2NLJC 3SJQC 4PELA 2R70A 1AVMA 1GMGA 2DYSC 2JGDB 5JH7A 2QWRB 5F2VO 1QR9A 1T5EA 4OX9O 2YIDA 2P4VA 1WJZA 4RO2A 1NVPD 4BW9A 3IAYA 1CXZB 1XQ8A 4X1KB 3RVYA 3OR6C 4H37A 2VQEO 4JI8B 3HPLC 2Y0PA 3A8TA 3BY6A 2FYUH 2XASA 1NKDA 4GYCB 4I55A 3S3WA 1NT2B 4ZI7A 4ZHQB 2L6LA 4UV8A 1PV0A 4MW8A 4BIUA 2JDIG 1R73A 5LHIA 4I7ZB 3ZMVA 1M1KW 2Q7EA 1AR5A 4DR1O 2BCCH 4HNAA 4O4LA 2RJZA 3HKCA 3SJAC 3AG3C 2Q7HA 5IY5C 5LGUA 4JI5O 5IYZA 2ZT9B 3FFQA 2KG7B 2QTSA 3ZN1A 5J2TA 2F23A 1K97A 1IDSA 4DR5B 1ZL8A 4U7OA 1F7YA 4DV3O 3BEHA 3FYIB 3G67A 4F6RA 2ADQB 4DV3B 3CRQA 4LH7A 1BMFG 3SPCA 5TISZ 2LW1A 5JJEB 2XNDG 2GV9A 2A79B 1US6A 1N32B 4LWSB 3BHPA 3STZC 1WPXA 2H8PC 4KP4A 2WLKA 2FB5A 4GX2A 5H6RA 2A3QA 5AG2A 5JCOA 3TK1A 4JI6B 4ZKIA 4F4LA 4HYOA 1N0NA 3RYCB 3ASNC 5IDJA 3W7WA 1Q90D 3E83A 4QE9A 4IGGA 3ABKB 1F51A 2WPDG 5L3DA 4YHHO 4LFAB 4B3RB 2Q68A 2Y4TA 2DQ0A 4PA9A 3ZMSA 4LFCB 2PI4A 4CH6A 5KX5B 4PD4F 4BIZA 3X2QB 5EBLC 1R3IC 3HKEA 4DV4O 2PF4E 2AZ0A 3I55V 3L74H 3AG7A 4HAMA 4JAAA 4LP8A 3AG1B 1THZA 1Q82W 2IW5A 5C8YB 1SC5B 1YXBA 3JATB 1R6NA 1I94O 4UXNA 1IVSA 3QTCA 2JEUA 2DOSA 4DUYB 2QWOB 1VF7A 4XDKA 1Z5WA 4PI2A 3SYCA 4N23A 3CD6V 4DV5O 1W2BU 3IC7A 5KHGA 4O4HB 2OT5A 4IIJA 4LF7O 2RMKB 2QWNB 1TUBA 2DQ3A 4X20A 4WFFA 1ZWIC 2UXXA 3DC6A 5FNVB 4TV9B 3STLC 4TV8A 1PKXA 5EYPA 4BIOA 4YIPA 5J9PC 1MMMA 1V54B 5FLXN 2Q69A 5KLVH 4RUEA 2Z5UA 3T2MA 1AB3A 3FB8C 4F6EA 3OGCC 1FFXB 4TOIA 4JGSA 4WBNA 4I50B 1I5XA 2CDYA 4MVQA 1R3LC 4D7SA 4FJCC 2PY5A 3LSUA 5EZYA 1K4CC 2JGUA 2WA4A 4NTWA 4PJ0Z 1VQ6V 3ABKC 5LOVB 2QEXV 2OTJV 1O9GA 1SETA 2EILC 5L3BA 3TXSA 4DYLA 2PYJA 3X2QC 4WF9V 1NTKH 4IHJB 3B77A 3Q4HA 2Q0AA 1OHHG 4DK0A 1HNXB 2XAGA 1N33O 3ETEA 3AG1C 1Y76A 3PJSK 3LNMB 3RW0A 1AI4A 3OGIB 2FL4A 1Y74A 1OCRC 2BSKB 3EVKA 1RSOA 4J80A 5CBGA 3O65A 5JVDA 1K7DA 1SQQH 2WLJA 1OCOB 2QWQB 2FKXA 1FPOA 4X8AA 1VQ5V 4I0XB 2ODMA 3AG4B 3JARA 1EN6A 2PTMA 1B06A 3E89A 1WB7A 5LYJA 2PYLA 4PDMA 3ASOB 2EJRA 2EIJC 2AZ2A 1FXKB 3OR7C 4R7CA 1FXHA 2R9AA 5L3CA 3ZMUA 3JAWA 2OCCB 2OTLV 3SJBC 4X64O 2JJ1G 4JI3B 4X64B 1V54C 2V1DA 1W0JG 3ZHVA 3JSNA 4MVMA 1QQCA 1JR9A 3DC5A 4U3JA 1GKFA 4UUJC 2JEXA 4UVBA 4DR4B 4Z2WA 4LBEC 2EULA 3ZIAG 1GN2A 1K4DC 4LFBB 2YXHA 3BABA 1JQ0A 2UXDO 4DR2B 1KB9F 1XHXA 4RAIA 5KAFZ 4KFMA 3CCEV 4B08A 1BQ0A 2X6AA 4H13B 3E22B 4DRXB 4NXNO 1L0NH 4GX0A 2CE4A 3LSSA 3SPIA 1M57B 3NR7A 2LJ2A 2QA4V 4NXMO 3LUTB 1EBOA 4GX5A 4X1IA 1IBMB 2HG5C 1S76D 1E79G 4NXMB 1V55C 5KAIZ 3D3QA 3JASA 4J42A 1BS3A 5JH7B 1VMGA 3E8GA 1Q6HA 5CMUA 1MZFA 3SGIA 4MW3A 3QF7A 2LGWA 1Q6IA 5LMUB 2E3CA 4Q6GA 4JZ2A 1OCOC 4DR6B 4PA3A 2YXYA 2KQXA 4K35A 4NVPA 3K03A 3UQ8A 3H9VA 4PDRA 4X62B 2VQFB 4JI7O 4G2KA 1XNQB 4I55B 5LP6B 4IT5A 4ZI7B 1XREA 3ASOC 4UCSA 2DYRB 1S5LZ 1D5AA 1ZUQA 3WG7B 2ETNA 1PPJH 2OCCC 1YVWA 2ZQMA 2X7RB 2JS5A 5H2FZ 2IH1C 3B2EE 4FLYA 3CSXA 1JX9A 4HNAB 1VF5B 4O4LB 4TQFA 1JJOA 1QHTA 1SQXH 3HKCB 3CX5F 2QJ1A 1Y67A 2RCVA 3CCLV 2A0LA 5IYZB 2XAHA 1KUQA 4RWUA 2UUCB 3FAVA 4QGPA 5L3EA 1GN6A 5J2TB 4FM2A 3CMAV 3SDLA 5JJJB 3ZX6A 3ICXA 3KCXA 3HKDA 1ZL8B 1JFFA 2BTOA 1EN5A 4JI0O 4EFBA 5CB4A 1M57C 5D5PA 4F6RB 2Y0IA 2P67A 4GKKB 1VIBA 1PD3A 2EZOA 3OFNG 4YIOA 3ZBHA 5IT9N 4TT3G 3WB2A 1HW7A 3L71H 1NQTA 3FD9A 3OE7G 1X59A 2GTSA 2Y69B 1BQZA 2QDOA 4UFZA 2R9IA 3LSQA 3GWOA 2CH7A 3SPGA 2KSDA 3NXSA 5K1PA 5BMVA 4LF8B 2LW7A 1Q43A 2RQ6A 4JTCB 5IWAB 1N34B 1KBHA 3WU2Z 2QKSA 2WLIA 2WLLA 3UO2A 4DV7B 5B1BB 1OZ0A 3ZRSA 5BR8O 2DYRC 3H01A 4J9ZB 3OAAG 3CXCU 3HKEB 3CYOA 3T1HO 4WCEV 3S3XA 3T1HB 2AHZA 1Q86W 1K3EA 3D8CA 1SERA 4I9WA 4X66O 4XBFA 3R66A 1YTFD 4DV0B 3K5LA 4X66B 2Y4UA 3VQWA 1XMOB 3K0GA 1SZTA 2R72A 3MHHC 4QE7A 5KUMA 1QU7A 5J2UA 1L1FA 3W7TA 1NTZH 3QO5A 3M7MX 4QIWF 1YJWV 1GK9A 1SQFA 1TGOA 3N27A 3E8HA 4MVSA 4DV6O 4IIJB 4DV6B 5D5QA 2B9ZA 3QO8A 4X20B 1AROP 3M99B 1AILA 4TV8B 4P2ZA 3ZJZA 5EYPB 1SRYA 2ZD9A 1KP2A 4DW0A 2WSSG 1RPRA 5IY5B 2IJKA 3FX7A 2W0FC 2Y69C 2EIKC 5KMGA 5CBFA 1K8AW 3FKSG 3DGEA 2UXNA 1H2LA 3G4SV 4FLUA 4WBNB 2F43G 4MTXA 2P90A 3G6EV 2F4VO 2F4VB 5EZYB 2DE0X 1I7FA 4LCUC 4JI2B 1W59A 1H8EG 1YZBA 5B1BC 2BOBC 4MT8A 4IYIA 2DMXA 1I5YA 3T4DA 3Q4HB 3CRRA 4RUFA 1W0KG 2LFSA 4GZRB 1K9MW 3ZN0A 1Y76B 2AHYA 4OX9B 1Y74B 4EKWA 1YJNV 1RSOB 5JVDB 2P4KA 4ASUG 4LF5O 2ZM6O 1S5JA 1SQGA 3ASNB 4ZIBA 1VQKV 1S77D 2KKWA 2VQEB 2A06H 1HNZO 3MD0A 1XBLA 5LYJB 4FLXA 1LUVA 1KU9A 1HNZB 5E79Z 2HHHO 4FZ0A 4Z1VA 2BOCC 4YJ3A 1COWG 4UVCA 1I0HA 4FFBA 3JAWB 3BRCA 4ABMA 2A9HA 4E2LA 4DR1B 1YTFB 4Q20A 4X1YA 2HJDA 4JV5O 3ABMB 2ZR2A 4FM1A 1GH6A 3H1JH 2ZXWC 4LR3A 5K1XA 1KECA 1VQ8V 4U3JB 1JPXA 4JI5B 3UO3A 2ADPA 2IJIA 4O2BA 2VWKA 5JWPA 4YJ2A 2YSUB 4FIPC 1EFRG 5IYDO 4JTAB 3ETQA 1S3JA 1E1RG 4O4JA 4X1IB 5IYCO 1YF2A 2QM7A 4KHPO 2XAQA 4BWAA 1YEWA 1Y6XA 3K58A 2YEVA 2QKCA 3JASB 4K8XA 3APOA 5B3SC 1VQMV 4FLVA 4LF4O 1CEZA 2B1IA 1QBZA 2XT9A 4UV9A 3L72H 2Y48A 1UFIA 1PL4A 3B40A 5KHKA 2GTAA 1ENVA 2ZDIC 2W0XA 5KA6A 2LGQA 3WB0A 4YXWG 4YHHB 1ZAUA 2EILB 2DW4A 3CCQV 2ZIMA 1XUQA 5BY1A 3P30A 3L9DA 4DV4B 1IZ3A 1EN4A 1OCRB 1P7BA 1TUEB 3SYAA 2HKOA 3BCCH 1NVPB 4ZOLA 5GONA 1ZX3A 1S72V 4PI0A 2WLHA 3UT5A 3ABMC 3B4SA 2CTRA 1I94B 1ZTEA 3UM7A 3C90A 3JCUZ 3DXRA 3TJTA 1B04A 1MABG 2BE3A 5B5EZ 2V4DA 2EIJB 3FAVB 3A0HZ 3AK3A 1QLNA 4KUMA 4X9QA 2DWDC 4LF6O 4DV5B 2IJHA 3HKDB 4LF7B 1JFFB 4LF6B 5CB4B 1VQOV 3K9AA 3RYFA 2G38A 1R1BA 2JJ2G 4LC1A 3SYOA 4WFAV 4GUNA 3P3PA 4JYYA 3N2GA 1IBLO 1OCCC 4CS4A 4E4EA 1R3KC 4J11A 1KQSU 4O4IA 1R6KA 1K73W 1QR8A 1F23A 3P3NA 1H8HG 5CBHA 4C7UA 1BT8A 2B5UA 2EIMC 3ETGA 4JI4O 4AI8A 1YSCA 1FD9A 3N2KA 2CH7B 2R9RB 1PL0A 3RWRD 5BMVB 1H2NA 3CHXA 2IU3A 1U96A 1NR1A 2WLIB 2WLLB 3H1KH 5DN6G 3H1HH 4DO2A 4JPRA 1V55B 1DGSA 4U3FH 4DV1O 1XDCA 2CTQA 1N33B 5H6QA 3VQYA 4FPPA 3ZHQA 1WB8A 2IH3C 1HR0O 3LDEA 1HR0B 1XMQO 3H1LH 1R3JC 1LUWA 1XMQB 4I5SA 2HVKC 5J2UB 2ZDIA 5ITZA 4CC6A 2UXBO 3IC9A 3P32A 3BPZA 1JCHA 2JK5C 1M56B 3FB6C 4BW5A 1QLEC 3F5TA 3GVMA 1RPOA 2Q6AA 4UCOA 2K9PA 4FLTA 1G6UA 2WLMA 1Q8IA 5GTIZ 1SS3A 2AW9A 4FMTA 5EBWC 5KMGB 3CCJV 4O2AA 3U10A 1MG1A 2QE7G 3CJHA 2D2CB 3D3IA 4NTXA 4B3MO 4DW1A 1WLEA 2UXDB 5B1AB 3T1YO 1A32A 5B66Z 1AR4A 1CPYA 2YI8A 3T1YB 4NXNB 4LH6A 3JALA 3OM3B 4NB5A 2DWEC 1MSWD 3A2FA 5HFMA 1BHBA 5CA0A 1OJHA 4DK1A 5LGNA 1IXBA 4X88A 4MVRA 3ZMTA 2L35A 1BCCH 4PA7A 3K04A 1K5SA 2IM9A 1IBKO 1JOYA 4ZBMA 4GKJO 5JJNB 3CC7V 3SR2C 4MTFA 4DV2O 3K08A 1UJWB 2CAZC 2Q8VA 3RN4A 2ATKC 1Q81W 1RFYA 2UXCO 1BSMA 4J7ZA 1M9NA 1NBMG 4RQEA 1N36O 2CTWA 4JI7B 3CMEV 4YJ3B 1P4RA 1M56C 2P6JA 4K3AA 2EZPA 4GX1A 3IGAC 1RP3B 4K0KO 2E75B 2XOKG 2N05A 4K0KB 1QVFU 5LL6Y 3TGUH 5DECA 2W6IG 1X4TA 1WPBA 2BTQA 2Q67A 2VS0A 4EB6A 3JD4A 4X1YB 3K59A 5LMNO 4MVUA 1JMKC 4OPAA 1M4UA 4EEQA 1FAFA 1IX9A 4AILC 3G6BA 2UU9O 1L8DA 3ZRWA 1Q3EA 2Q73A 1YHQV 3ZS8C 4O2BB 3RGBA 4OGQB 2Q5ZA 3CS5A 3ABLB 5B1AC 2MK3A 3SPHA 1KMIZ 4JI0B 1SQPH 2Q9LA 3BA8A 3AEIA 4L87A 4TQDA 1BL8A 1SQVH 4O4JB 4WFEA 1AP5A 4JI1O 3CWBH 2YEVB 1IXMA 2AXTZ 4BAYA 1WA8A 3GWKC 4JF3A 2PGGA 5FNVA 1NJIW 2ILMA 1MA1A 2H3OA 4UVAA 2EIKB 3KG2A 1Q6UA 3ZMZA 4B3SO 3OUSA 4TUYA 2F93B 3JYCA 3JCZA 1ROPA 3MDSA 3QVNA 2N04A 5EK0A 4FZ1A 1PNLA 1YI2V 1GN4A 1GO3F 2X0LA 4CBCA 4LNUA 2RN9A 2HR3A 4DR7O 1D5NA 5BR8B 1WNSA 1HNWO 5KUKA 1AJPA 1NU1H 1N0JA 3CRCA 4ZOLB 4I4TA 5H9CA 1YITV 2E74B 5GONB 5B1NA 3UT5B 3IJ4A 3JSLA 3OTOO 4U7NA 4J7JA 1NTMH 4PV1B 2CUGA 3QO7A 2PI5A 1HDJA 4JYCA 2F95B 3DXRB 1VQ7V 1KKCA 3K5MA 4YY3O 2ZCEA 2UUAO 2WAMA 5DEDA 4MTOA 1TUBB 2AGAA 3ABLC 1Y66A 2RNBA 3OUFA 1FYJA 5LXTA 3RYFB 4J9YB 2QR4A 3VQVA 1EZJA 3N2GB 1XHZA 2OCHA 2ZXWB 4O4IB 4LF9O 2Q0OC 2Z3YA 2DN9A 2HLDG 4B7EA 3W7XA 2ITDC 2B1GA 3JAMN 5LGTA 3CP1A 1CP9A 3N2KB 2YIAA 4DR3O 4UB8Z 2YDEA 4DR3B 2YS8A 1URFA 1JJ2U 1H2MA 2E76B 4JTDB 2NR5A 2V7QG 4NKGB 2OWOA 1G8MA 3CPWU 3ABUA 1SESA 4OXSA 1VF6A 1E1QG 5IJ9A 1VARA 5B3SB 3K79A 3M8AA 4CS2A 1H2KA 5CA1A 2ZE5A 4QPKA 2E5LO 3APQA 4JAVA 3K3WA 3QNEA 1K92A 1H2GA 4JYBA 4LF5B 2ZM6B 3DSQA 2WLNA 2KB1A 3JARB 1YIJV 5ITZB 3GB7C 1SA0A 3ABTA 4W4KA 3L75H 2OIGA 4WFHA 4J41A 1QCEA 1AI7A 2HHHB 3AK1A 1K34A 3L73H 4JI8O 2C2AA 3I5DA 3W7UA
chains in the Genus database with same CATH topology
2OCHA 1FAFA 1NZ6A 2LGWA 2DMXA 2LO1A 2GUZA 3APOA 3UCSC 2QSAA 2CTPA 4RWUA 2CTRA 2YUAA 2M6YA 2DN9A 2N05A 2CTQA 2Y4UA 2PF4E 3UO2A 2EJ7A 2QWOB 2QWRB 1IURA 1XBLA 3AG7A 4J80A 2KQXA 2L6LA 1BQZA 2GUZB 1WJZA 1GH6A 2QWQB 4J7ZA 2CUGA 1FPOA 2Y4TA 2QWNB 4IT5A 1HDJA 3BVOA 2QWPB 2YS8A 2CTWA 3APQA 1BQ0A 3UO3A 2N04A 1N4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OCH A;  1FAF A;  1NZ6 A;  2LGW A;  2DMX A;  2LO1 A;  2GUZ A;  3APO A;  3UCS C;  2QSA A;  2CTP A;  4RWU A;  2CTR A;  2YUA A;  2M6Y A;  2DN9 A;  2N05 A;  2CTQ A;  2Y4U A;  2PF4 E;  3UO2 A;  2EJ7 A;  2QWO B;  2QWR B;  1IUR A;  1XBL A;  3AG7 A;  4J80 A;  2KQX A;  2L6L A;  1BQZ A;  2GUZ B;  1WJZ A;  1GH6 A;  2QWQ B;  4J7Z A;  2CUG A;  1FPO A;  2Y4T A;  2QWN B;  4IT5 A;  1HDJ A;  3BVO A;  2QWP B;  2YS8 A;  2CTW A;  3APQ A;  1BQ0 A;  3UO3 A;  2N04 A;  1N4C A; 
#chains in the Genus database with same CATH topology
 4WFB V;  4MSW C;  2ZR3 A;  4MS2 A;  4UB6 Z;  1ZLZ A;  4H33 A;  4PHZ A;  1PNK A;  5LP6 A;  3ML0 A;  1R6T A;  1LNQ A;  5KHI A;  1PP9 H;  1QVG U;  4JV5 B;  1GRJ A;  2CGN A;  3K57 A;  2P06 A;  3ZHS A;  1AP6 A;  1Q7Y W;  4O2A B;  4JAU A;  3CJH B;  2GUZ A;  4UCU A;  5LBQ A;  4NTY A;  4XDJ A;  1O9H A;  2WWW A;  3RFR A;  2D3O W;  1MZE A;  1XI1 A;  1GM9 A;  3JAL B;  1GM7 A;  3WFV A;  3ZHR A;  1N8R W;  5BZB A;  1P49 A;  2F66 C;  1G1X B;  1OCC B;  3CCV V;  5CA0 B;  4KHP B;  4DR5 O;  2HP8 A;  1P7G A;  3FB5 C;  5KHJ A;  5EBM C;  3K5O A;  2EIN C;  2YIC A;  1OCZ B;  4PDL A;  1IUR A;  2EIM B;  4A5U B;  4LF4 B;  4FLW A;  1WP7 A;  1FS0 G;  3CRA A;  3OD4 A;  3K0D A;  1N32 O;  2ZIN A;  1YDX A;  1AJQ A;  1U97 A;  1AI6 A;  5IJ0 A;  2DJV A;  4JI6 O;  3UCS C;  5EIB D;  3CCR V;  2IBZ H;  1AJN A;  3F7V C;  1TVK A;  3JAK A;  4PA6 A;  1V9P A;  3TCU A;  4LFA O;  4B3R O;  2HVJ C;  3AG2 B;  4LFC O;  2VRZ A;  1OV9 A;  5LHG A;  2BTQ B;  3LNN A;  1VQ4 V;  4EB6 B;  4TWK A;  5KHH A;  1XL4 A;  2M6Y A;  3U0Z A;  3E8F A;  1JA8 A;  1Y4M A;  3U11 A;  3DTU B;  2Q7G A;  4HZ3 A;  1G4Y B;  4MVO A;  3E35 A;  3ZRW B;  4QNH B;  3R65 A;  4X65 O;  3D36 C;  3ZHT A;  2LQT A;  1QNM A;  3MAQ A;  4X65 B;  4FM0 A;  2YIB D;  1MSD A;  4H0L B;  1QLE B;  3OMI B;  3WB1 A;  4CH5 A;  1NZ6 A;  4DUY O;  4AQY O;  1DF5 A;  4NR1 A;  3E86 A;  2ZE8 A;  3OEE G;  4AQY B;  1BGY H;  3RYI A;  4G28 B;  1IBL B;  5KA5 A;  1P84 F;  1WA8 B;  2P22 C;  1OCZ C;  4UCR A;  1J5E O;  1Q5O A;  5HFL A;  5EC2 C;  2ZE6 A;  1J5E B;  1B6Q A;  1K33 A;  2QGN A;  3CEI A;  3JD0 A;  4TUY B;  4JI4 B;  2O57 A;  5LA6 A;  3RVZ A;  4AHC A;  5B1O A;  1FFT B;  5JQG A;  3RYH A;  1KKD A;  3LDD A;  3CCU V;  3K06 A;  1ORQ C;  3W7S A;  4LNU B;  4JZG A;  4W4L A;  3FYE B;  3EHB B;  3B8M A;  1B3Q A;  4IL6 Z;  2CK3 G;  3HKB A;  2RDC A;  3BFR A;  4DV1 B;  2YUA A;  3RT3 C;  1DK1 A;  3AG2 C;  3C3T A;  5DM6 V;  4R50 A;  1SKV A;  4I4T B;  5L3G A;  3E2E A;  1VQN V;  1HNX O;  1ZSP A;  2JGD A;  3A0B Z;  1PM9 A;  1VP7 A;  4EFE A;  2VWJ A;  5IYB O;  2NNU A;  2UXB B;  2EJ7 A;  3THO A;  1BE3 H;  1VEW A;  2ARH A;  4X1K A;  1DTO A;  5LHH A;  1XEQ A;  1XOU A;  3TET A;  2X6B A;  1EM1 A;  1I08 A;  5CN0 A;  4J7K A;  2GHY A;  5LXT B;  4I9Q A;  5GTH Z;  1LR1 A;  3HR0 A;  3T1C A;  2GDS A;  1AI5 A;  3H1I H;  2XUM A;  2LP7 A;  4RQF A;  4NYK A;  5BXZ A;  4ZHQ A;  2EBO A;  1M93 A;  3FB7 C;  2X6C A;  3QG5 A;  5FPR A;  2Z0A A;  1RM1 B;  2N74 A;  4JI3 O;  3D36 A;  1XNR O;  2YXL A;  2UUB O;  1XNR B;  3C3S A;  1NR7 A;  3VBB A;  4L8J A;  2XTA A;  4CZZ A;  4K8Z A;  2ZIO A;  4XDL A;  2UUB B;  4B3M B;  3F5W C;  1PNM A;  2JRI A;  3KKY A;  4DR4 O;  3CCM V;  3I56 V;  2HFE C;  4LFB O;  1Z2G A;  2IJJ A;  2YI9 A;  4DR2 O;  2KG7 A;  4FLZ A;  5IE9 A;  4CH4 A;  4P9P A;  3TXQ A;  4D6T H;  2QKA A;  5IJ9 B;  4CC5 A;  3J7A U;  1AR1 B;  5CA1 B;  1BZK A;  1IBM O;  1IBK B;  1FXV A;  2QSA A;  4GKJ B;  1BHA A;  2F1M A;  2H94 A;  1TAE A;  4DV2 B;  4LWS A;  3JD2 A;  3CRM A;  1L0L H;  3CXH F;  2PZS A;  4QPJ A;  3B8N A;  2IU0 A;  3G71 V;  2YC0 A;  1HP8 A;  2UXC B;  1SZX A;  1DF4 A;  4B3T O;  1SA0 B;  4FVM A;  1WP8 A;  4TSF G;  3AK2 A;  4B3T B;  3F7Y C;  5LMU O;  1N36 B;  2XAJ A;  5EIB C;  2A7W A;  3SYQ A;  3UKM A;  4DR6 O;  4GT1 A;  4BR6 A;  2PUS A;  3RYC A;  2CTP A;  3B09 A;  5FPO A;  5EC1 C;  4FFB B;  4X62 O;  2MW2 B;  1GTO A;  1Z5V A;  3AG4 C;  2VQF O;  1K5Q A;  3RBZ A;  1XNQ O;  3JD3 A;  3L70 H;  4G27 B;  5KX5 A;  3JD1 A;  4QJF B;  2ZE7 A;  3J81 N;  1EZV H;  3PN1 A;  3OW2 U;  1FXK C;  4KL1 A;  2M7W A;  3G80 A;  5FL7 G;  4OPH A;  1KP3 A;  3CCS V;  3OTF A;  5LMN B;  4WFG A;  1DLB A;  1RM1 C;  5C93 A;  2LFR A;  4MTG A;  1KD1 W;  3LDC A;  3OMA B;  4N21 A;  2CGO A;  5C8Y A;  1NH2 D;  2UU9 B;  4FK5 C;  2GUZ B;  2WA3 A;  4YJ2 B;  3OEH G;  4P9O A;  3JAT A;  2ZNJ A;  2FTK A;  2QTO A;  2QM4 A;  1F4N A;  4R8C A;  4PA4 A;  3EFF K;  2GSM B;  2UUC O;  4B7K A;  3K5N A;  4CS3 A;  1WAZ A;  1MNG A;  4JI1 B;  4O4H A;  3SYP A;  1WN7 A;  1VF6 C;  5CA3 A;  5H5N A;  2OYQ A;  4TV9 A;  4GKK O;  5L3F A;  3CE2 A;  2HEP A;  1XIL A;  2Q4P A;  4B3S B;  3ZRX A;  1XL6 A;  3IFX A;  1KYO F;  1SQB H;  2P5O A;  5A9G A;  1J95 A;  1YCI A;  4CH3 A;  2QM8 A;  4P30 A;  5A2Q N;  1H38 A;  5IJ0 B;  1VQL V;  4MVZ A;  5E1A C;  2EX3 A;  4KXR A;  1FFX A;  3EXA A;  1M90 W;  2JIZ G;  3CB2 A;  4I50 A;  3A0R A;  4DR7 B;  2NN4 A;  1TVK B;  3JAK B;  1VQ9 V;  3ZCC A;  4LF8 O;  3OT7 A;  3HB3 B;  1NS1 A;  1M5I A;  3ETD A;  1HNW B;  5IWA O;  1N34 O;  1FJG O;  5LOV A;  1F4M A;  2ZNI A;  4R6Z A;  4DV7 O;  1S0V A;  1YJ9 V;  3BA9 A;  3CC2 V;  1FJG B;  4J10 A;  3CC4 V;  3VOU A;  5LP6 C;  2XAF A;  4IHJ A;  2DYS B;  3WG7 C;  3OTO B;  3BAA A;  2QWP B;  3J80 N;  3KCY A;  4DV0 O;  2BSK A;  2W6J G;  4FFK A;  1D2D A;  2LO1 A;  1XMO O;  4YY3 B;  3T4Z A;  2UUA B;  2FML A;  4UCV A;  3KZI Z;  4I0X A;  3ZED A;  1MOF A;  3SJC C;  1UPG A;  4HBN A;  4ICG A;  2P7T C;  1TA8 A;  4UCT A;  3K9S A;  4GCZ A;  2JVD A;  3OMN B;  5GW7 A;  4H44 B;  3RYI B;  4DUZ O;  4Z1M G;  1S5H C;  1FXK A;  4D7T A;  4JAS A;  4DUZ B;  1GM8 A;  2XHB A;  4X89 A;  3VQX A;  1NI8 A;  3ZHU A;  4LF9 B;  2K1E A;  3SPJ A;  4JYA O;  1NH2 B;  5LA6 B;  4JYA B;  1GN3 A;  5JQG B;  1KC8 W;  1VQP V;  2ZKO A;  1SF9 A;  2HJF C;  2YIB A;  3MHS C;  1JVM A;  3RYH B;  3AG3 B;  4IYH A;  2GBO A;  5JCO C;  2JS3 A;  1H2S B;  4PDV A;  4GLX A;  3HKB B;  2ITC C;  3ZRV A;  4JI2 O;  1GAX A;  3E22 A;  2EIN B;  4DRX A;  1FKA O;  3BVO A;  1N4C A;  2OIE A;  4DXW A;  2E5L B;  1HWY A;  3O9O A;  3E8B A;  2NLJ C;  3SJQ C;  4PEL A;  2R70 A;  1AVM A;  1GMG A;  2DYS C;  2JGD B;  5JH7 A;  2QWR B;  5F2V O;  1QR9 A;  1T5E A;  4OX9 O;  2YID A;  2P4V A;  1WJZ A;  4RO2 A;  1NVP D;  4BW9 A;  3IAY A;  1CXZ B;  1XQ8 A;  4X1K B;  3RVY A;  3OR6 C;  4H37 A;  2VQE O;  4JI8 B;  3HPL C;  2Y0P A;  3A8T A;  3BY6 A;  2FYU H;  2XAS A;  1NKD A;  4GYC B;  4I55 A;  3S3W A;  1NT2 B;  4ZI7 A;  4ZHQ B;  2L6L A;  4UV8 A;  1PV0 A;  4MW8 A;  4BIU A;  2JDI G;  1R73 A;  5LHI A;  4I7Z B;  3ZMV A;  1M1K W;  2Q7E A;  1AR5 A;  4DR1 O;  2BCC H;  4HNA A;  4O4L A;  2RJZ A;  3HKC A;  3SJA C;  3AG3 C;  2Q7H A;  5IY5 C;  5LGU A;  4JI5 O;  5IYZ A;  2ZT9 B;  3FFQ A;  2KG7 B;  2QTS A;  3ZN1 A;  5J2T A;  2F23 A;  1K97 A;  1IDS A;  4DR5 B;  1ZL8 A;  4U7O A;  1F7Y A;  4DV3 O;  3BEH A;  3FYI B;  3G67 A;  4F6R A;  2ADQ B;  4DV3 B;  3CRQ A;  4LH7 A;  1BMF G;  3SPC A;  5TIS Z;  2LW1 A;  5JJE B;  2XND G;  2GV9 A;  2A79 B;  1US6 A;  1N32 B;  4LWS B;  3BHP A;  3STZ C;  1WPX A;  2H8P C;  4KP4 A;  2WLK A;  2FB5 A;  4GX2 A;  5H6R A;  2A3Q A;  5AG2 A;  5JCO A;  3TK1 A;  4JI6 B;  4ZKI A;  4F4L A;  4HYO A;  1N0N A;  3RYC B;  3ASN C;  5IDJ A;  3W7W A;  1Q90 D;  3E83 A;  4QE9 A;  4IGG A;  3ABK B;  1F51 A;  2WPD G;  5L3D A;  4YHH O;  4LFA B;  4B3R B;  2Q68 A;  2Y4T A;  2DQ0 A;  4PA9 A;  3ZMS A;  4LFC B;  2PI4 A;  4CH6 A;  5KX5 B;  4PD4 F;  4BIZ A;  3X2Q B;  5EBL C;  1R3I C;  3HKE A;  4DV4 O;  2PF4 E;  2AZ0 A;  3I55 V;  3L74 H;  3AG7 A;  4HAM A;  4JAA A;  4LP8 A;  3AG1 B;  1THZ A;  1Q82 W;  2IW5 A;  5C8Y B;  1SC5 B;  1YXB A;  3JAT B;  1R6N A;  1I94 O;  4UXN A;  1IVS A;  3QTC A;  2JEU A;  2DOS A;  4DUY B;  2QWO B;  1VF7 A;  4XDK A;  1Z5W A;  4PI2 A;  3SYC A;  4N23 A;  3CD6 V;  4DV5 O;  1W2B U;  3IC7 A;  5KHG A;  4O4H B;  2OT5 A;  4IIJ A;  4LF7 O;  2RMK B;  2QWN B;  1TUB A;  2DQ3 A;  4X20 A;  4WFF A;  1ZWI C;  2UXX A;  3DC6 A;  5FNV B;  4TV9 B;  3STL C;  4TV8 A;  1PKX A;  5EYP A;  4BIO A;  4YIP A;  5J9P C;  1MMM A;  1V54 B;  5FLX N;  2Q69 A;  5KLV H;  4RUE A;  2Z5U A;  3T2M A;  1AB3 A;  3FB8 C;  4F6E A;  3OGC C;  1FFX B;  4TOI A;  4JGS A;  4WBN A;  4I50 B;  1I5X A;  2CDY A;  4MVQ A;  1R3L C;  4D7S A;  4FJC C;  2PY5 A;  3LSU A;  5EZY A;  1K4C C;  2JGU A;  2WA4 A;  4NTW A;  4PJ0 Z;  1VQ6 V;  3ABK C;  5LOV B;  2QEX V;  2OTJ V;  1O9G A;  1SET A;  2EIL C;  5L3B A;  3TXS A;  4DYL A;  2PYJ A;  3X2Q C;  4WF9 V;  1NTK H;  4IHJ B;  3B77 A;  3Q4H A;  2Q0A A;  1OHH G;  4DK0 A;  1HNX B;  2XAG A;  1N33 O;  3ETE A;  3AG1 C;  1Y76 A;  3PJS K;  3LNM B;  3RW0 A;  1AI4 A;  3OGI B;  2FL4 A;  1Y74 A;  1OCR C;  2BSK B;  3EVK A;  1RSO A;  4J80 A;  5CBG A;  3O65 A;  5JVD A;  1K7D A;  1SQQ H;  2WLJ A;  1OCO B;  2QWQ B;  2FKX A;  1FPO A;  4X8A A;  1VQ5 V;  4I0X B;  2ODM A;  3AG4 B;  3JAR A;  1EN6 A;  2PTM A;  1B06 A;  3E89 A;  1WB7 A;  5LYJ A;  2PYL A;  4PDM A;  3ASO B;  2EJR A;  2EIJ C;  2AZ2 A;  1FXK B;  3OR7 C;  4R7C A;  1FXH A;  2R9A A;  5L3C A;  3ZMU A;  3JAW A;  2OCC B;  2OTL V;  3SJB C;  4X64 O;  2JJ1 G;  4JI3 B;  4X64 B;  1V54 C;  2V1D A;  1W0J G;  3ZHV A;  3JSN A;  4MVM A;  1QQC A;  1JR9 A;  3DC5 A;  4U3J A;  1GKF A;  4UUJ C;  2JEX A;  4UVB A;  4DR4 B;  4Z2W A;  4LBE C;  2EUL A;  3ZIA G;  1GN2 A;  1K4D C;  4LFB B;  2YXH A;  3BAB A;  1JQ0 A;  2UXD O;  4DR2 B;  1KB9 F;  1XHX A;  4RAI A;  5KAF Z;  4KFM A;  3CCE V;  4B08 A;  1BQ0 A;  2X6A A;  4H13 B;  3E22 B;  4DRX B;  4NXN O;  1L0N H;  4GX0 A;  2CE4 A;  3LSS A;  3SPI A;  1M57 B;  3NR7 A;  2LJ2 A;  2QA4 V;  4NXM O;  3LUT B;  1EBO A;  4GX5 A;  4X1I A;  1IBM B;  2HG5 C;  1S76 D;  1E79 G;  4NXM B;  1V55 C;  5KAI Z;  3D3Q A;  3JAS A;  4J42 A;  1BS3 A;  5JH7 B;  1VMG A;  3E8G A;  1Q6H A;  5CMU A;  1MZF A;  3SGI A;  4MW3 A;  3QF7 A;  2LGW A;  1Q6I A;  5LMU B;  2E3C A;  4Q6G A;  4JZ2 A;  1OCO C;  4DR6 B;  4PA3 A;  2YXY A;  2KQX A;  4K35 A;  4NVP A;  3K03 A;  3UQ8 A;  3H9V A;  4PDR A;  4X62 B;  2VQF B;  4JI7 O;  4G2K A;  1XNQ B;  4I55 B;  5LP6 B;  4IT5 A;  4ZI7 B;  1XRE A;  3ASO C;  4UCS A;  2DYR B;  1S5L Z;  1D5A A;  1ZUQ A;  3WG7 B;  2ETN A;  1PPJ H;  2OCC C;  1YVW A;  2ZQM A;  2X7R B;  2JS5 A;  5H2F Z;  2IH1 C;  3B2E E;  4FLY A;  3CSX A;  1JX9 A;  4HNA B;  1VF5 B;  4O4L B;  4TQF A;  1JJO A;  1QHT A;  1SQX H;  3HKC B;  3CX5 F;  2QJ1 A;  1Y67 A;  2RCV A;  3CCL V;  2A0L A;  5IYZ B;  2XAH A;  1KUQ A;  4RWU A;  2UUC B;  3FAV A;  4QGP A;  5L3E A;  1GN6 A;  5J2T B;  4FM2 A;  3CMA V;  3SDL A;  5JJJ B;  3ZX6 A;  3ICX A;  3KCX A;  3HKD A;  1ZL8 B;  1JFF A;  2BTO A;  1EN5 A;  4JI0 O;  4EFB A;  5CB4 A;  1M57 C;  5D5P A;  4F6R B;  2Y0I A;  2P67 A;  4GKK B;  1VIB A;  1PD3 A;  2EZO A;  3OFN G;  4YIO A;  3ZBH A;  5IT9 N;  4TT3 G;  3WB2 A;  1HW7 A;  3L71 H;  1NQT A;  3FD9 A;  3OE7 G;  1X59 A;  2GTS A;  2Y69 B;  1BQZ A;  2QDO A;  4UFZ A;  2R9I A;  3LSQ A;  3GWO A;  2CH7 A;  3SPG A;  2KSD A;  3NXS A;  5K1P A;  5BMV A;  4LF8 B;  2LW7 A;  1Q43 A;  2RQ6 A;  4JTC B;  5IWA B;  1N34 B;  1KBH A;  3WU2 Z;  2QKS A;  2WLI A;  2WLL A;  3UO2 A;  4DV7 B;  5B1B B;  1OZ0 A;  3ZRS A;  5BR8 O;  2DYR C;  3H01 A;  4J9Z B;  3OAA G;  3CXC U;  3HKE B;  3CYO A;  3T1H O;  4WCE V;  3S3X A;  3T1H B;  2AHZ A;  1Q86 W;  1K3E A;  3D8C A;  1SER A;  4I9W A;  4X66 O;  4XBF A;  3R66 A;  1YTF D;  4DV0 B;  3K5L A;  4X66 B;  2Y4U A;  3VQW A;  1XMO B;  3K0G A;  1SZT A;  2R72 A;  3MHH C;  4QE7 A;  5KUM A;  1QU7 A;  5J2U A;  1L1F A;  3W7T A;  1NTZ H;  3QO5 A;  3M7M X;  4QIW F;  1YJW V;  1GK9 A;  1SQF A;  1TGO A;  3N27 A;  3E8H A;  4MVS A;  4DV6 O;  4IIJ B;  4DV6 B;  5D5Q A;  2B9Z A;  3QO8 A;  4X20 B;  1ARO P;  3M99 B;  1AIL A;  4TV8 B;  4P2Z A;  3ZJZ A;  5EYP B;  1SRY A;  2ZD9 A;  1KP2 A;  4DW0 A;  2WSS G;  1RPR A;  5IY5 B;  2IJK A;  3FX7 A;  2W0F C;  2Y69 C;  2EIK C;  5KMG A;  5CBF A;  1K8A W;  3FKS G;  3DGE A;  2UXN A;  1H2L A;  3G4S V;  4FLU A;  4WBN B;  2F43 G;  4MTX A;  2P90 A;  3G6E V;  2F4V O;  2F4V B;  5EZY B;  2DE0 X;  1I7F A;  4LCU C;  4JI2 B;  1W59 A;  1H8E G;  1YZB A;  5B1B C;  2BOB C;  4MT8 A;  4IYI A;  2DMX A;  1I5Y A;  3T4D A;  3Q4H B;  3CRR A;  4RUF A;  1W0K G;  2LFS A;  4GZR B;  1K9M W;  3ZN0 A;  1Y76 B;  2AHY A;  4OX9 B;  1Y74 B;  4EKW A;  1YJN V;  1RSO B;  5JVD B;  2P4K A;  4ASU G;  4LF5 O;  2ZM6 O;  1S5J A;  1SQG A;  3ASN B;  4ZIB A;  1VQK V;  1S77 D;  2KKW A;  2VQE B;  2A06 H;  1HNZ O;  3MD0 A;  1XBL A;  5LYJ B;  4FLX A;  1LUV A;  1KU9 A;  1HNZ B;  5E79 Z;  2HHH O;  4FZ0 A;  4Z1V A;  2BOC C;  4YJ3 A;  1COW G;  4UVC A;  1I0H A;  4FFB A;  3JAW B;  3BRC A;  4ABM A;  2A9H A;  4E2L A;  4DR1 B;  1YTF B;  4Q20 A;  4X1Y A;  2HJD A;  4JV5 O;  3ABM B;  2ZR2 A;  4FM1 A;  1GH6 A;  3H1J H;  2ZXW C;  4LR3 A;  5K1X A;  1KEC A;  1VQ8 V;  4U3J B;  1JPX A;  4JI5 B;  3UO3 A;  2ADP A;  2IJI A;  4O2B A;  2VWK A;  5JWP A;  4YJ2 A;  2YSU B;  4FIP C;  1EFR G;  5IYD O;  4JTA B;  3ETQ A;  1S3J A;  1E1R G;  4O4J A;  4X1I B;  5IYC O;  1YF2 A;  2QM7 A;  4KHP O;  2XAQ A;  4BWA A;  1YEW A;  1Y6X A;  3K58 A;  2YEV A;  2QKC A;  3JAS B;  4K8X A;  3APO A;  5B3S C;  1VQM V;  4FLV A;  4LF4 O;  1CEZ A;  2B1I A;  1QBZ A;  2XT9 A;  4UV9 A;  3L72 H;  2Y48 A;  1UFI A;  1PL4 A;  3B40 A;  5KHK A;  2GTA A;  1ENV A;  2ZDI C;  2W0X A;  5KA6 A;  2LGQ A;  3WB0 A;  4YXW G;  4YHH B;  1ZAU A;  2EIL B;  2DW4 A;  3CCQ V;  2ZIM A;  1XUQ A;  5BY1 A;  3P30 A;  3L9D A;  4DV4 B;  1IZ3 A;  1EN4 A;  1OCR B;  1P7B A;  1TUE B;  3SYA A;  2HKO A;  3BCC H;  1NVP B;  4ZOL A;  5GON A;  1ZX3 A;  1S72 V;  4PI0 A;  2WLH A;  3UT5 A;  3ABM C;  3B4S A;  2CTR A;  1I94 B;  1ZTE A;  3UM7 A;  3C90 A;  3JCU Z;  3DXR A;  3TJT A;  1B04 A;  1MAB G;  2BE3 A;  5B5E Z;  2V4D A;  2EIJ B;  3FAV B;  3A0H Z;  3AK3 A;  1QLN A;  4KUM A;  4X9Q A;  2DWD C;  4LF6 O;  4DV5 B;  2IJH A;  3HKD B;  4LF7 B;  1JFF B;  4LF6 B;  5CB4 B;  1VQO V;  3K9A A;  3RYF A;  2G38 A;  1R1B A;  2JJ2 G;  4LC1 A;  3SYO A;  4WFA V;  4GUN A;  3P3P A;  4JYY A;  3N2G A;  1IBL O;  1OCC C;  4CS4 A;  4E4E A;  1R3K C;  4J11 A;  1KQS U;  4O4I A;  1R6K A;  1K73 W;  1QR8 A;  1F23 A;  3P3N A;  1H8H G;  5CBH A;  4C7U A;  1BT8 A;  2B5U A;  2EIM C;  3ETG A;  4JI4 O;  4AI8 A;  1YSC A;  1FD9 A;  3N2K A;  2CH7 B;  2R9R B;  1PL0 A;  3RWR D;  5BMV B;  1H2N A;  3CHX A;  2IU3 A;  1U96 A;  1NR1 A;  2WLI B;  2WLL B;  3H1K H;  5DN6 G;  3H1H H;  4DO2 A;  4JPR A;  1V55 B;  1DGS A;  4U3F H;  4DV1 O;  1XDC A;  2CTQ A;  1N33 B;  5H6Q A;  3VQY A;  4FPP A;  3ZHQ A;  1WB8 A;  2IH3 C;  1HR0 O;  3LDE A;  1HR0 B;  1XMQ O;  3H1L H;  1R3J C;  1LUW A;  1XMQ B;  4I5S A;  2HVK C;  5J2U B;  2ZDI A;  5ITZ A;  4CC6 A;  2UXB O;  3IC9 A;  3P32 A;  3BPZ A;  1JCH A;  2JK5 C;  1M56 B;  3FB6 C;  4BW5 A;  1QLE C;  3F5T A;  3GVM A;  1RPO A;  2Q6A A;  4UCO A;  2K9P A;  4FLT A;  1G6U A;  2WLM A;  1Q8I A;  5GTI Z;  1SS3 A;  2AW9 A;  4FMT A;  5EBW C;  5KMG B;  3CCJ V;  4O2A A;  3U10 A;  1MG1 A;  2QE7 G;  3CJH A;  2D2C B;  3D3I A;  4NTX A;  4B3M O;  4DW1 A;  1WLE A;  2UXD B;  5B1A B;  3T1Y O;  1A32 A;  5B66 Z;  1AR4 A;  1CPY A;  2YI8 A;  3T1Y B;  4NXN B;  4LH6 A;  3JAL A;  3OM3 B;  4NB5 A;  2DWE C;  1MSW D;  3A2F A;  5HFM A;  1BHB A;  5CA0 A;  1OJH A;  4DK1 A;  5LGN A;  1IXB A;  4X88 A;  4MVR A;  3ZMT A;  2L35 A;  1BCC H;  4PA7 A;  3K04 A;  1K5S A;  2IM9 A;  1IBK O;  1JOY A;  4ZBM A;  4GKJ O;  5JJN B;  3CC7 V;  3SR2 C;  4MTF A;  4DV2 O;  3K08 A;  1UJW B;  2CAZ C;  2Q8V A;  3RN4 A;  2ATK C;  1Q81 W;  1RFY A;  2UXC O;  1BSM A;  4J7Z A;  1M9N A;  1NBM G;  4RQE A;  1N36 O;  2CTW A;  4JI7 B;  3CME V;  4YJ3 B;  1P4R A;  1M56 C;  2P6J A;  4K3A A;  2EZP A;  4GX1 A;  3IGA C;  1RP3 B;  4K0K O;  2E75 B;  2XOK G;  2N05 A;  4K0K B;  1QVF U;  5LL6 Y;  3TGU H;  5DEC A;  2W6I G;  1X4T A;  1WPB A;  2BTQ A;  2Q67 A;  2VS0 A;  4EB6 A;  3JD4 A;  4X1Y B;  3K59 A;  5LMN O;  4MVU A;  1JMK C;  4OPA A;  1M4U A;  4EEQ A;  1FAF A;  1IX9 A;  4AIL C;  3G6B A;  2UU9 O;  1L8D A;  3ZRW A;  1Q3E A;  2Q73 A;  1YHQ V;  3ZS8 C;  4O2B B;  3RGB A;  4OGQ B;  2Q5Z A;  3CS5 A;  3ABL B;  5B1A C;  2MK3 A;  3SPH A;  1KMI Z;  4JI0 B;  1SQP H;  2Q9L A;  3BA8 A;  3AEI A;  4L87 A;  4TQD A;  1BL8 A;  1SQV H;  4O4J B;  4WFE A;  1AP5 A;  4JI1 O;  3CWB H;  2YEV B;  1IXM A;  2AXT Z;  4BAY A;  1WA8 A;  3GWK C;  4JF3 A;  2PGG A;  5FNV A;  1NJI W;  2ILM A;  1MA1 A;  2H3O A;  4UVA A;  2EIK B;  3KG2 A;  1Q6U A;  3ZMZ A;  4B3S O;  3OUS A;  4TUY A;  2F93 B;  3JYC A;  3JCZ A;  1ROP A;  3MDS A;  3QVN A;  2N04 A;  5EK0 A;  4FZ1 A;  1PNL A;  1YI2 V;  1GN4 A;  1GO3 F;  2X0L A;  4CBC A;  4LNU A;  2RN9 A;  2HR3 A;  4DR7 O;  1D5N A;  5BR8 B;  1WNS A;  1HNW O;  5KUK A;  1AJP A;  1NU1 H;  1N0J A;  3CRC A;  4ZOL B;  4I4T A;  5H9C A;  1YIT V;  2E74 B;  5GON B;  5B1N A;  3UT5 B;  3IJ4 A;  3JSL A;  3OTO O;  4U7N A;  4J7J A;  1NTM H;  4PV1 B;  2CUG A;  3QO7 A;  2PI5 A;  1HDJ A;  4JYC A;  2F95 B;  3DXR B;  1VQ7 V;  1KKC A;  3K5M A;  4YY3 O;  2ZCE A;  2UUA O;  2WAM A;  5DED A;  4MTO A;  1TUB B;  2AGA A;  3ABL C;  1Y66 A;  2RNB A;  3OUF A;  1FYJ A;  5LXT A;  3RYF B;  4J9Y B;  2QR4 A;  3VQV A;  1EZJ A;  3N2G B;  1XHZ A;  2OCH A;  2ZXW B;  4O4I B;  4LF9 O;  2Q0O C;  2Z3Y A;  2DN9 A;  2HLD G;  4B7E A;  3W7X A;  2ITD C;  2B1G A;  3JAM N;  5LGT A;  3CP1 A;  1CP9 A;  3N2K B;  2YIA A;  4DR3 O;  4UB8 Z;  2YDE A;  4DR3 B;  2YS8 A;  1URF A;  1JJ2 U;  1H2M A;  2E76 B;  4JTD B;  2NR5 A;  2V7Q G;  4NKG B;  2OWO A;  1G8M A;  3CPW U;  3ABU A;  1SES A;  4OXS A;  1VF6 A;  1E1Q G;  5IJ9 A;  1VAR A;  5B3S B;  3K79 A;  3M8A A;  4CS2 A;  1H2K A;  5CA1 A;  2ZE5 A;  4QPK A;  2E5L O;  3APQ A;  4JAV A;  3K3W A;  3QNE A;  1K92 A;  1H2G A;  4JYB A;  4LF5 B;  2ZM6 B;  3DSQ A;  2WLN A;  2KB1 A;  3JAR B;  1YIJ V;  5ITZ B;  3GB7 C;  1SA0 A;  3ABT A;  4W4K A;  3L75 H;  2OIG A;  4WFH A;  4J41 A;  1QCE A;  1AI7 A;  2HHH B;  3AK1 A;  1K34 A;  3L73 H;  4JI8 O;  2C2A A;  3I5D A;  3W7U A; 
#chains in the Genus database with same CATH homology
 2OCH A;  1FAF A;  1NZ6 A;  2LGW A;  2DMX A;  2LO1 A;  2GUZ A;  3APO A;  3UCS C;  2QSA A;  2CTP A;  4RWU A;  2CTR A;  2YUA A;  2M6Y A;  2DN9 A;  2N05 A;  2CTQ A;  2Y4U A;  2PF4 E;  3UO2 A;  2EJ7 A;  2QWO B;  2QWR B;  1IUR A;  1XBL A;  3AG7 A;  4J80 A;  2KQX A;  2L6L A;  1BQZ A;  2GUZ B;  1WJZ A;  1GH6 A;  2QWQ B;  4J7Z A;  2CUG A;  1FPO A;  2Y4T A;  2QWN B;  4IT5 A;  1HDJ A;  3BVO A;  2QWP B;  2YS8 A;  2CTW A;  3APQ A;  1BQ0 A;  3UO3 A;  2N04 A;  1N4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...