2YUAA

Solution structure of the dnaj domain from human williams-beuren syndrome chromosome region 18 protein
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
GSSGSSGSQGDCSYSRTALYDLLGVPSTATQAQIKAAYYRQCFLYHPDRNSGSAEAAERFTRISQAYVVLGSATLRRKYDRGLLSDEDLRGPGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the DnaJ domain from human Williams-Beuren syndrome chromosome region 18 protein
rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Williams-Beuren syndrome chromosome region 18 protein
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2yuaA01
2CTPA 2DMXA 2LGWA 3APQA 2LO1A 2QWNB 3UCSC 1BQ0A 1WJZA 1NZ6A 3AG7A 2M6YA 3UO3A 3UO2A 2CTQA 1HDJA 2N04A 2GUZA 2QWOB 2DN9A 2GUZB 1N4CA 2PF4E 2YUAA 3APOA 2OCHA 2Y4TA 2YS8A 1IURA 1FAFA 1GH6A 2CTRA 1BQZA 3BVOA 2QSAA 2EJ7A 2QWRB 2QWQB 4IT5A 4J7ZA 2CTWA 1FPOA 2CUGA 2N05A 1XBLA 2QWPB 2L6LA 4J80A 2Y4UA 4RWUA 2KQXA
chains in the Genus database with same CATH superfamily
5BMVB 2VRZA 4KP4A 2UU9O 4ZI7A 1V55C 2XASA 1WAZA 4EFEA 1BHBA 1NTKH 2Q0AA 3B8MA 2WLNA 3BHPA 2PY5A 3JAMN 1GKFA 5C8YB 4OGQB 1HWYA 3HR0A 3QO5A 1LNQA 1QLNA 2EIJC 4E4EA 3FB8C 2WLHA 2L6LA 5DEDA 1K4DC 1OZ0A 4CS4A 4DR5O 3UCSC 1ROPA 5EYPA 4G27B 4LWSA 4K8XA 3LSUA 1M90W 5DN6G 2ZXWB 4D6TH 4DXWA 1SQVH 1W2BU 4X64B 3SDLA 4PV1B 4JI3O 5LHGA 4K0KO 1OV9A 3O65A 3SPJA 2F43G 3SJAC 3A2FA 4YY3O 4MVRA 2V1DA 3FX7A 1IX9A 4NTXA 1XNRO 4RQFA 4X62B 1PNMA 1NTMH 1YTFB 5AG2A 5JJNB 2B9ZA 3L72H 2E3CA 3T1HB 4X8AA 4MW3A 4FFBA 1RSOB 4GT1A 4QIWF 4ASUG 2RQ6A 5IYZA 3ASOB 2UUBB 2ZE6A 4J7ZA 4MT8A 4FLYA 4BIUA 4LFCO 2GTAA 1NU1H 4GKJB 2IJJA 4OPAA 4LWSB 1OHHG 2HHHO 4LF8O 3ZHQA 3CHXA 1CPYA 1TUBA 2FL4A 1YXBA 5GTIZ 5B3SB 3BVOA 3WB0A 5EZYB 3LNNA 1AJPA 1Q86W 2AHYA 5CB4B 2N05A 4G28B 1XBLA 1IXBA 1IXMA 3ASNB 4HBNA 1Q81W 1YJNV 2UXBO 1O9GA 3RN4A 3D3IA 4UVBA 2QA4V 3U0ZA 2YS8A 5KX5A 2Q6AA 2EX3A 2BTQA 4MVOA 4YIOA 4JI8O 2QWNB 3ZMVA 1I08A 2EZPA 2UXXA 4IYIA 3AEIA 2IU0A 3ZBHA 2P67A 4FJCC 2HHHB 5JCOA 4F6RB 3FYIB 4WF9V 1SS3A 3CCSV 3ABLC 3K5LA 1Y74A 2E76B 1V55B 1V54C 2RMKB 1DGSA 4P9PA 4G2KA 3OMNB 1YI2V 4XDLA 3MAQA 1HNWO 3RFRA 2CK3G 3UT5A 1H2SB 1XEQA 3ABMB 2OYQA 1ZAUA 2ZNJA 3OEEG 4E2LA 4JI5B 3X2QC 4OXSA 1J5EB 4I4TB 3CXCU 1JJOA 1N34O 2UUCO 1DK1A 2WWWA 5D5QA 3CS5A 5EC1C 3ETQA 4J10A 1Q5OA 5L3EA 3VQXA 3KCYA 1SZXA 2E74B 3LSSA 3ZEDA 2FMLA 4FK5C 5LP6C 5J9PC 2E75B 2X6CA 4RWUA 2WAMA 4X88A 1SESA 1SQQH 4C7UA 3K0DA 4DRXA 3SPCA 4JI2B 4O4LA 2EIMC 3AG1B 2DJVA 4TOIA 2UXBB 3H1LH 2LFRA 4JTCB 1KUQA 3ASOC 4F4LA 2X6AA 5GONB 4X1YB 4IHJA 1G6UA 3VBBA 1YTFD 3FB6C 1I5XA 4HYOA 2BOBC 4JF3A 1FXKB 2Q67A 2L35A 4I9QA 1JR9A 3K3WA 5BXZA 5BZBA 2OCCB 5EYPB 5H6QA 2Y48A 1N34B 2UUCB 3K0GA 1HDJA 2OIGA 3JAKB 1ZTEA 2F1MA 4FLWA 1PNKA 4B3RB 1KYOF 2MW2B 2ATKC 3S3WA 2YDEA 4TUYA 4D7TA 4IGGA 4DW0A 1DTOA 1MOFA 1FFXB 1VEWA 2F93B 3ZMZA 4DV1O 1JQ0A 4UB6Z 4EKWA 2EJRA 4LF4O 5EIBD 5DM6V 4J9ZB 4FFBB 4FM0A 4KHPO 5KHGA 2ETNA 4GKKB 4X1YA 3MHSC 1B04A 5BMVA 1AB3A 2DWDC 1T5EA 4QE7A 3SJQC 3CCEV 3UM7A 1ZLZA 2ODMA 3STZC 3AK3A 2Y4UA 3ICXA 3P3NA 1K92A 1YITV 4U7OA 3JD3A 3E83A 3LSQA 3ZHVA 2EULA 2NR5A 3LDCA 4HNAB 2A9HA 2Z3YA 4EB6B 3ABLB 3FAVA 1SQXH 1AI7A 1EZVH 1MA1A 1XREA 4J80A 3KKYA 4NR1A 1NR1A 2W0FC 2YEVB 1TGOA 2PGGA 2UU9B 3QO7A 3QVNA 4H0LB 1PL4A 3BY6A 3K79A 5K1XA 1BS3A 3Q4HA 4WBNB 5K1PA 5EBWC 2RCVA 3IGAC 1YZBA 3AG3C 1ZWIC 2Y69B 3EXAA 4FIPC 4FZ1A 5IWAB 1K9MW 3G6EV 1NTZH 1S5LZ 3N2KB 4DV0B 4X65B 4JI1O 1I94O 5LBQA 3SJBC 1KP3A 1N33B 3SPHA 1P7BA 1XMOB 2Y4TA 3HKCA 1R3KC 4I50A 4JI3B 4NXMO 2A7WA 3J81N 1NT2B 4IT5A 5J2TA 2ADPA 1VQ6V 2PZSA 4MTOA 1KMIZ 4D7SA 1JA8A 1VF6A 3A0BZ 2ILMA 4X1IA 3E8GA 1K4CC 3OR7C 1ZL8A 1S5HC 1H2MA 5B1AC 1BQZA 1MSDA 2XAJA 4FLVA 2JEXA 3JALB 4P2ZA 4ICGA 1IDSA 3APQA 1OCRB 2ZXWC 1RP3B 3K04A 1GRJA 5KMGA 3RGBA 2ZD9A 2W6IG 1GN2A 2ZDIC 2GUZA 3BAAA 3C3SA 5EZYA 2A79B 1YJ9V 2BTQB 1CP9A 2Q69A 1M1KW 3RBZA 3MDSA 1KKDA 1YSCA 4FLXA 4H37A 1NH2B 3DXRB 1VQ5V 4TT3G 4CH3A 2AZ2A 1AI4A 4MVQA 5BR8B 1Q43A 1Y74B 4ZIBA 4JI6B 3RYCA 1H2LA 5IJ0B 3KG2A 4MSWC 2K9PA 4JPRA 2R9AA 3RVYA 2CTWA 2F95B 3BA8A 2ZE5A 1WPBA 4KXRA 4BIZA 2H94A 3KCXA 4JZGA 4X66O 2B5UA 1ENVA 5CBGA 1AROP 4I4TA 1GN4A 4JI8B 1MNGA 3WB2A 1N36B 1M5IA 4EFBA 2A0LA 3E35A 3QF7A 5TISZ 1L0LH 1F4MA 1NKDA 3D3QA 2JGDA 2WA4A 1S72V 3L70H 2CH7B 2JS5A 5CMUA 1HNZO 2QE7G 3P30A 1GM8A 1HNXO 1HNWB 3HB3B 1GK9A 2DYSB 1QLEC 4GCZA 1VQ8V 1YDXA 3ZHSA 4B3TB 2F4VB 3DTUB 3G71V 2HVKC 4DK0A 5L3GA 3STLC 1AILA 3ZRXA 2Z5UA 1U97A 4MTXA 1YIJV 3WU2Z 1NVPB 3E8BA 4EB6A 4GZRB 4XDKA 1AR1B 1E1RG 1THZA 3M7MX 1WNSA 2QDOA 4U7NA 4IIJA 1IBMO 4U3JA 3OMAB 3ZHUA 4LBEC 5JWPA 1KB9F 4IHJB 4JI0B 1Y76B 4JAAA 2HEPA 1VF7A 2EIKC 2HLDG 2WA3A 4JASA 5ITZA 4K8ZA 2FKXA 1QQCA 4PDLA 1XL4A 4TQDA 1PNLA 3E86A 4I5SA 4P9OA 3CRMA 3BA9A 3D36A 3K9AA 3JATB 3OGCC 2IH3C 2BCCH 3JAWA 2R70A 1M9NA 1XNRB 1S3JA 3ZIAG 4BWAA 1QR9A 3F5TA 2BOCC 1Q6UA 1DF4A 4HNAA 3SYQA 2EIMB 3AG1C 3QNEA 3SYCA 3UO3A 1Y76A 3GB7C 3H1JH 1EN4A 1K5SA 1R3IC 1QHTA 1AI6A 4UCTA 1PKXA 4LP8A 1FYJA 1K33A 3HKDB 2VQFO 4UCVA 5KAFZ 1R6NA 2DWEC 4Z1VA 4GX5A 1ZUQA 2XT9A 5A2QN 2ZDIA 3EHBB 1MG1A 4LF8B 3WG7C 1F23A 4UCSA 1P4RA 4JI7B 4FLTA 4DV5O 2FB5A 2QGNA 4WCEV 3FAVB 1W0KG 4UCUA 4B08A 4YY3B 1XQ8A 3OT7A 1VQNV 3AK1A 3CD6V 3IAYA 3I56V 2EINC 5EC2C 1R6TA 2CUGA 1SQGA 2ZCEA 1SKVA 5LMNB 2KQXA 3HKCB 4O4IB 4PD4F 1AI5A 1JFFA 2QM8A 2OTJV 2YIBD 3R65A 2KKWA 3T4ZA 4DR1O 1NS1A 2DW4A 4PA7A 1QLEB 2YIAA 3RYCB 4H33A 3N2KA 2YIDA 1IZ3A 3F7VC 5IJ9A 4CH5A 1X59A 4DV2O 4AHCA 3B40A 4DUZB 3W7XA 1AR4A 4LF5B 1BQ0A 1JMKC 1P49A 2EILC 4TV9A 1VF5B 3T1HO 4DV0O 5BY1A 2ZE8A 2ZM6O 3LDDA 1WPXA 1PV0A 4HZ3A 2PYJA 1FKAO 3H9VA 3P3PA 3K59A 3ZRSA 5KMGB 3UQ8A 3F5WC 1OCZC 2JGDB 3CMAV 4WFAV 2YXYA 3BABA 1L8DA 3MD0A 3E2EA 1XMQO 1ZL8B 3RW0A 1VMGA 4B3MO 3OFNG 2YXLA 1KKCA 3JARB 3RYIA 3BCCH 4WFFA 2DN9A 2YI9A 2YIBA 1XHZA 3A0HZ 1WLEA 4FFKA 3WFVA 1LR1A 1Z5WA 3CC2V 1G4YB 4DR7B 1GTOA 1Q90D 3L71H 2XUMA 2UXCB 1H8EG 4PA6A 4O4JB 4LF4B 3SYAA 3ETDA 4YIPA 5E1AC 3CXHF 5KUKA 3FB7C 2X6BA 2HVJC 3CCUV 3DSQA 4J41A 2WLLA 3FD9A 4JI4B 3CP1A 1B06A 3E22A 1EZJA 4MVUA 3OGIB 2BSKB 3FYEB 2Q73A 4UFZA 2WLIA 2UXDB 2M6YA 4I55B 5LHIA 4DV4O 4Z2WA 4LF9B 4CS3A 2GV9A 1COWG 4YJ3B 3K03A 2HG5C 4DV5B 2QWQB 4R50A 1EFRG 3ZJZA 4GLXA 4DR2B 1AJQA 1F51A 2Q7GA 3I5DA 4PELA 1OCRC 5KLVH 1QNMA 1GN3A 2IJIA 3RT3C 4UVAA 1XI1A 2YC0A 3VQVA 4FM2A 2XHBA 5J2UA 4DV7B 1R6KA 2YXHA 3K57A 4CH4A 1GM9A 2LGQA 2KG7A 2QTSA 1H2GA 2KB1A 1GM7A 2XAFA 1WP8A 1Q6HA 2BSKA 4DR6O 4X20B 1IBKO 4FLZA 1AVMA 2XAQA 1N32B 3SYPA 1NR7A 1PL0A 3W7UA 4GKKO 4PJ0Z 2H3OA 1O9HA 5L3DA 1TAEA 3UT5B 3FB5C 2PI5A 4IIJB 5JQGB 1YEWA 3L73H 4AQYO 1K7DA 2OCHA 4X9QA 4MTGA 5LHHA 3ETGA 3N2GB 3OTOB 1IBKB 4K35A 2N74A 4LFBO 1Y66A 2AZ0A 1L1FA 1K97A 2V4DA 2AXTZ 3HKEA 1RFYA 2ZIOA 3ZN1A 4YXWG 5L3FA 1Q6IA 1XOUA 2IU3A 2RN9A 3ZX6A 2YICA 4B7KA 3TJTA 3M8AA 2A06H 1WN7A 4XBFA 3PN1A 3CEIA 2P5OA 2X0LA 3AG7A 3T1YO 5CA3A 3AG4C 1XNQO 4O2BA 5LYJB 5ITZB 5LGNA 5FL7G 4DR5B 1SQBH 2WLMA 1N32O 2LP7A 5KAIZ 1BCCH 4UUJC 2QWPB 3K06A 3A8TA 3J80N 4NYKA 4DV6O 5D5PA 3CRCA 2RDCA 1OCCC 3K08A 5C93A 3W7TA 2JIZG 4MVZA 1IBLO 3I55V 3CSXA 4PI0A 1AR5A 3T2MA 3D8CA 3ZCCA 1XMOO 1AP6A 4HAMA 2UUAO 1G1XB 2UXDO 3SJCC 4DW1A 2ZKOA 2HJFC 4N23A 1XL6A 1F4NA 4O2BB 4DR3O 1VQPV 1LUWA 2EIKB 3B8NA 1JX9A 4CBCA 4JTDB 1FD9A 3SPGA 4O4IA 1EN6A 2EJ7A 4DO2A 2ZINA 5LXTB 1K73W 1FXHA 1X4TA 1YHQV 1S76D 4O4JA 2EIJB 4PDRA 5LL6Y 3B77A 2IW5A 4JAVA 1TUEB 3ZMTA 2D3OW 3BFRA 1Y6XA 2RJZA 4TV8A 5H5NA 3D36C 3UO2A 2XAGA 1ZSPA 4DUZO 2EILB 2W0XA 1D2DA 3K5NA 1WA8A 2XAHA 5JJEB 4X1IB 2VS0A 3OUSA 3JASA 4LF9O 2PYLA 2JRIA 1V54B 3FFQA 4J7KA 2UXCO 1R3JC 4LH7A 3OEHG 4XDJA 4I55A 1MZEA 3LUTB 4X62O 3T4DA 2CDYA 2JJ2G 1J5EO 1H38A 3WB1A 3IFXA 3BEHA 1K5QA 2P4KA 2QKCA 2ZR2A 2XOKG 2WLKA 4ZKIA 4CH6A 4LF6O 2CTPA 2GHYA 4DR6B 4LH6A 1WA8B 3B4SA 5HFMA 2ZM6B 2Q0OC 5B5EZ 1KU9A 2R9RB 1V9PA 3CJHB 1ORQC 1HP8A 4JI2O 2PUSA 2PTMA 5J2TB 3HKBA 2JEUA 2F66C 1JOYA 3RYIB 3JARA 4W4LA 5KHHA 4LNUA 5IJ0A 2ZIMA 3AG4B 2HJDA 2VWKA 1Z5VA 2ITCC 3ETEA 4JV5B 2Y0IA 4QGPA 4B3MB 3W7WA 4NXMB 4O4HB 4PA3A 4R6ZA 5JQGA 4JGSA 3E22B 1VQ9V 4OPHA 4P30A 4MVMA 1JVMA 3SYOA 5GONA 4RUEA 4DR4B 1HW7A 2H8PC 2VQEO 3OM3B 3JALA 2LFSA 3HPLC 2LO1A 1N8RW 3ZMSA 2DQ0A 5JVDB 2IJHA 5FPRA 4ZHQA 4FLUA 2CH7A 4B3SB 1GAXA 5LOVA 2FYUH 1VQMV 4EEQA 1HR0B 1YF2A 5EK0A 1MABG 5J2UB 2JVDA 3ML0A 1E1QG 4DUYB 3DGEA 2QEXV 3DXRA 5GTHZ 4YJ3A 3CPWU 4DV3B 4NVPA 1FXVA 4O4HA 5LYJA 4X20A 3OE7G 3APOA 1QBZA 5CBHA 4WFBV 4Q6GA 4WFGA 4JYAO 2C2AA 3DC5A 4JV5O 3ABMC 4O2AA 1EN5A 3FKSG 4KUMA 2LQTA 3JSLA 1UPGA 1XMQB 4MS2A 2F23A 5FPOA 1M56C 5IYCO 4JAUA 1ZX3A 3THOA 3RYFB 1BGYH 1GMGA 4TQFA 5FLXN 1N0NA 3L9DA 1CEZA 2VWJA 3JD1A 4KHPB 5L3BA 3H1HH 4DYLA 5KHIA 5LP6B 3JAWB 3CRAA 3ZHTA 1SF9A 4X66B 2HKOA 1SERA 3ZS8C 2FTKA 3JD4A 2P6JA 1HNZB 2GDSA 3NXSA 4RO2A 4CZZA 1VARA 5CBFA 4AQYB 4YHHB 1D5NA 5H6RA 2QJ1A 2R9IA 1RPRA 2HR3A 5C8YA 2IH1C 4Z1MG 4NXNO 1BMFG 1B3QA 2OCCC 3LNMB 1P7GA 3JASB 1AJNA 1SQFA 3IC7A 3AG2B 3O9OA 1UFIA 2JS3A 5EBMC 3F7YC 2OIEA 4PI2A 2QR4A 2Q7EA 2DMXA 3RVZA 4BW9A 5IE9A 2DE0X 2UXNA 1M57C 4PA4A 4FM1A 4QPJA 1XNQB 1UJWB 1K3EA 2M7WA 2Q9LA 2CTRA 1HNXB 4NKGB 5L3CA 4JYYA 4NTWA 4X1KA 4J7JA 1I7FA 5IYZB 2CE4A 1FJGB 3TXQA 2Q5ZA 1QU7A 2DYRC 3JATA 2KSDA 2GUZB 3S3XA 2RNBA 4TV9B 1KD1W 3K9SA 4NXNB 4IL6Z 4DUYO 2JJ1G 1I5YA 2HP8A 1NQTA 1YJWV 3U10A 3E89A 4DR1B 1OCOB 4H13B 4DR3B 4CC5A 1WJZA 5A9GA 1QVGU 2VQEB 4BIOA 3OTFA 4JTAB 2E5LB 4PDVA 3RYHB 1PP9H 4WBNA 3ZHRA 1DLBA 3P32A 2CGNA 4FZ0A 3CC7V 1PPJH 5IYDO 4L87A 3GVMA 1HR0O 2Q7HA 1DF5A 2Y69C 2P06A 1OCCB 3IC9A 1SQPH 4DK1A 1JPXA 1RM1B 4NB5A 1K34A 4GUNA 2AHZA 2WPDG 5CB4A 3H01A 1SZTA 4PHZA 2EZOA 3SPIA 2JDIG 2P90A 4JI5O 3CWBH 4DV2B 2P22C 1KBHA 3OR6C 4DR4O 3OW2U 4LFBB 4QNHB 1R73A 4NTYA 4BAYA 4DV4B 1Y4MA 2GBOA 1IBLB 4B3TO 2F4VO 1Y67A 4LC1A 1VIBA 4X89A 4UVCA 2WLIB 1QCEA 2ZR3A 3VOUA 2XNDG 1P84F 5IJ9B 5B1AB 3B09A 1R1BA 1MMMA 1YCIA 3RWRD 3ZMUA 2QKSA 3QO8A 4JYCA 3W7SA 2ZQMA 2WLLB 4DV1B 4LR3A 3SGIA 2QWOB 3G6BA 4IYHA 1F7YA 1IBMB 4UB8Z 4F6EA 4JI7O 4LF7O 4JZ2A 4LFAO 4OX9O 5JVDA 3ABUA 4B3SO 5LP6A 3K58A 3JYCA 1BL8A 3TGUH 4MTFA 3CMEV 5LOVB 1M57B 5LA6B 1BZKA 4BR6A 4CS2A 1AP5A 4RAIA 3H1KH 3B2EE 5CA0B 1FFTB 2CAZC 3J7AU 2QM4A 2ZE7A 4X64O 4GX0A 4L8JA 1NJIW 4AI8A 5EIBC 4QPKA 5B1BC 4JI1B 1I94B 4H44B 3KZIZ 4FMTA 5JJJB 3NR7A 3GWKC 2JK5C 1JJ2U 4KL1A 3TK1A 3JCUZ 1NI8A 5H9CA 2ADQB 3OD4A 2BTOA 3CX5F 3JCZA 2Q4PA 1KC8W 1N36O 2CGOA 4LF6B 4FVMA 1VQ4V 1KQSU 1L0NH 4W4KA 1NH2D 1PM9A 1OCOC 1TVKB 3ZRWA 3CYOA 1BE3H 1SA0B 5JH7A 1WB8A 4DV7O 1QVFU 4DV3O 2IBZH 2WSSG 5LMUO 1K8AW 2GTSA 5IY5C 3Q4HB 4JI4O 1FAFA 1FXKA 4UV8A 3UKMA 2DYSC 1WP7A 2HFEC 1MSWD 2Q8VA 4X1KB 2QTOA 1GH6A 2EBOA 3JAKA 1D5AA 4ZOLB 5FNVB 5KA5A 1NZ6A 5JCOC 1G8MA 4TUYB 1SC5B 5CN0A 5B1NA 2ITDC 2P4VA 3CRQA 4FPPA 1VF6C 2KG7B 1BT8A 3ZRWB 4YJ2B 4JI6O 4I9WA 5IWAO 3H1IH 2LGWA 3JSNA 3ABKB 1RPOA 3MHHC 3U11A 3VQWA 1JFFB 1I0HA 3RYHA 1NBMG 2PF4E 4R7CA 1N0JA 2Y0PA 4I0XA 1EBOA 2MK3A 1M93A 3TXSA 3N2GA 1RSOA 3EFFK 3CC4V 3SR2C 1M56B 2W6JG 4RUFA 3K5MA 1R3LC 4LFCB 4OX9B 5LXTA 1H8HG 4K0KB 4B7EA 1NVPD 4TV8B 5HFLA 4KFMA 4ABMA 1VQLV 1OCZB 3JD2A 2DYRB 2V7QG 4YJ2A 4QE9A 3AK2A 4JYAB 2DOSA 4TSFG 3G4SV 5IYBO 2YEVA 2OT5A 2JGUA 4LCUC 1W59A 4GX1A 4DR7O 4UCRA 5E79Z 2LW1A 4ZI7B 2B1IA 5LGTA 4AILC 1CXZB 1KECA 3HKDA 3ABTA 2GSMB 3L75H 2B1GA 2Q68A 2DQ3A 4MVSA 2OTLV 3CCRV 3PJSK 1M4UA 1TUBB 3QTCA 3T1YB 1VQKV 5F2VO 1H2KA 3N27A 3CCVV 2NN4A 4I50B 4X65O 3WG7B 4UV9A 1N33O 3G67A 1XHXA 5B3SC 3CCQV 3CRRA 5KHKA 3AG2C 4J9YB 5IT9N 2OWOA 1Q82W 5LMUB 1OJHA 2ZNIA 2EINB 1PD3A 4TWKA 3CJHA 2AGAA 5KUMA 2G38A 3TETA 5KX5B 1EM1A 5CA0A 5IY5B 1TA8A 4K3AA 2E5LO 1E79G 4MW8A 4LNUB 3TCUA 3VQYA 3ZRVA 3OMIB 1W0JG 5CA1A 1URFA 3CCJV 4B3RO 3BRCA 5B1OA 1XUQA 3G80A 2D2CB 3CB2A 4CC6A 1U96A 5EBLC 2O57A 1Q7YW 1SETA 2YSUB 1XILA 3E8FA 5H2FZ 4F6RA 1BSMA 3C90A 3CCMV 2CTQA 1H2NA 1BHAA 1N4CA 2YUAA 3M99B 4JI0O 1GO3F 1Z2GA 4DV6B 2QWRB 4WFEA 4RQEA 1SRYA 1IVSA 4GKJO 3ABKC 1WB7A 1GN6A 2A3QA 1J95A 3EVKA 1VQ7V 4GX2A 4UCOA 5B66Z 3IJ4A 5BR8O 5CA1B 2IJKA 1S5JA 1YVWA 4DRXB 3A0RA 2LW7A 3X2QB 1IURA 3CCLV 2QM7A 3JD0A 1XDCA 2QSAA 3R66A 4ZHQB 4GYCB 3CE2A 4WFHA 5B1BB 4O2AB 1RM1C 2IM9A 5KHJA 3HKEB 1LUVA 2NLJC 4I7ZB 5KA6A 4UXNA 3C3TA 2UUBO 4LF5O 1JCHA 1QR8A 2WLJA 1FS0G 3DC6A 4BW5A 1Q8IA 2QKAA 2UUAB 4DR2O 4LF7B 4LFAB 5LMNO 1MZFA 4R8CA 5LGUA 4O4LB 1B6QA 4N21A 5LA6A 1S0VA 5IDJA 1VP7A 3HKBB 1FJGO 3OTOO 3OUFA 3ASNC 2K1EA 3K5OA 1KP2A 2BE3A 3L74H 4I0XB 4YHHO 2NNUA 4J42A 4U3JB 2X7RB 1VQOV 4QJFB 1FPOA 1FXKC 3RYFA 5GW7A 4PA9A 3AG3B 4U3FH 1Q3EA 5DECA 2LJ2A 3GWOA 4Q20A 3BPZA 3OAAG 3LDEA 2AW9A 1A32A 1FFXA 2N04A 4J11A 3QG5A 2PI4A 3E8HA 2R72A 1US6A 2ZT9B 4ZOLA 5FNVA 2Z0AA 4A5UB 1TVKA 4ZBMA 4JYBA 2VQFB 4PDMA 3T1CA 1S77D 1SA0A 5JH7B 2YI8A 2P7TC 2XTAA 2ARHA 3ZN0A
chains in the Genus database with same CATH topology
2CTPA 2DMXA 2LGWA 3APQA 2LO1A 2QWNB 3UCSC 1BQ0A 1WJZA 1NZ6A 3AG7A 2M6YA 3UO3A 3UO2A 2CTQA 1HDJA 2N04A 2GUZA 2QWOB 2DN9A 2GUZB 1N4CA 2PF4E 2YUAA 3APOA 2OCHA 2Y4TA 2YS8A 1IURA 1FAFA 1GH6A 2CTRA 1BQZA 3BVOA 2QSAA 2EJ7A 2QWRB 2QWQB 4IT5A 4J7ZA 2CTWA 1FPOA 2CUGA 2N05A 1XBLA 2QWPB 2L6LA 4J80A 2Y4UA 4RWUA 2KQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTP A;  2DMX A;  2LGW A;  3APQ A;  2LO1 A;  2QWN B;  3UCS C;  1BQ0 A;  1WJZ A;  1NZ6 A;  3AG7 A;  2M6Y A;  3UO3 A;  3UO2 A;  2CTQ A;  1HDJ A;  2N04 A;  2GUZ A;  2QWO B;  2DN9 A;  2GUZ B;  1N4C A;  2PF4 E;  2YUA A;  3APO A;  2OCH A;  2Y4T A;  2YS8 A;  1IUR A;  1FAF A;  1GH6 A;  2CTR A;  1BQZ A;  3BVO A;  2QSA A;  2EJ7 A;  2QWR B;  2QWQ B;  4IT5 A;  4J7Z A;  2CTW A;  1FPO A;  2CUG A;  2N05 A;  1XBL A;  2QWP B;  2L6L A;  4J80 A;  2Y4U A;  4RWU A;  2KQX A; 
#chains in the Genus database with same CATH topology
 5BMV B;  2VRZ A;  4KP4 A;  2UU9 O;  4ZI7 A;  1V55 C;  2XAS A;  1WAZ A;  4EFE A;  1BHB A;  1NTK H;  2Q0A A;  3B8M A;  2WLN A;  3BHP A;  2PY5 A;  3JAM N;  1GKF A;  5C8Y B;  4OGQ B;  1HWY A;  3HR0 A;  3QO5 A;  1LNQ A;  1QLN A;  2EIJ C;  4E4E A;  3FB8 C;  2WLH A;  2L6L A;  5DED A;  1K4D C;  1OZ0 A;  4CS4 A;  4DR5 O;  3UCS C;  1ROP A;  5EYP A;  4G27 B;  4LWS A;  4K8X A;  3LSU A;  1M90 W;  5DN6 G;  2ZXW B;  4D6T H;  4DXW A;  1SQV H;  1W2B U;  4X64 B;  3SDL A;  4PV1 B;  4JI3 O;  5LHG A;  4K0K O;  1OV9 A;  3O65 A;  3SPJ A;  2F43 G;  3SJA C;  3A2F A;  4YY3 O;  4MVR A;  2V1D A;  3FX7 A;  1IX9 A;  4NTX A;  1XNR O;  4RQF A;  4X62 B;  1PNM A;  1NTM H;  1YTF B;  5AG2 A;  5JJN B;  2B9Z A;  3L72 H;  2E3C A;  3T1H B;  4X8A A;  4MW3 A;  4FFB A;  1RSO B;  4GT1 A;  4QIW F;  4ASU G;  2RQ6 A;  5IYZ A;  3ASO B;  2UUB B;  2ZE6 A;  4J7Z A;  4MT8 A;  4FLY A;  4BIU A;  4LFC O;  2GTA A;  1NU1 H;  4GKJ B;  2IJJ A;  4OPA A;  4LWS B;  1OHH G;  2HHH O;  4LF8 O;  3ZHQ A;  3CHX A;  1CPY A;  1TUB A;  2FL4 A;  1YXB A;  5GTI Z;  5B3S B;  3BVO A;  3WB0 A;  5EZY B;  3LNN A;  1AJP A;  1Q86 W;  2AHY A;  5CB4 B;  2N05 A;  4G28 B;  1XBL A;  1IXB A;  1IXM A;  3ASN B;  4HBN A;  1Q81 W;  1YJN V;  2UXB O;  1O9G A;  3RN4 A;  3D3I A;  4UVB A;  2QA4 V;  3U0Z A;  2YS8 A;  5KX5 A;  2Q6A A;  2EX3 A;  2BTQ A;  4MVO A;  4YIO A;  4JI8 O;  2QWN B;  3ZMV A;  1I08 A;  2EZP A;  2UXX A;  4IYI A;  3AEI A;  2IU0 A;  3ZBH A;  2P67 A;  4FJC C;  2HHH B;  5JCO A;  4F6R B;  3FYI B;  4WF9 V;  1SS3 A;  3CCS V;  3ABL C;  3K5L A;  1Y74 A;  2E76 B;  1V55 B;  1V54 C;  2RMK B;  1DGS A;  4P9P A;  4G2K A;  3OMN B;  1YI2 V;  4XDL A;  3MAQ A;  1HNW O;  3RFR A;  2CK3 G;  3UT5 A;  1H2S B;  1XEQ A;  3ABM B;  2OYQ A;  1ZAU A;  2ZNJ A;  3OEE G;  4E2L A;  4JI5 B;  3X2Q C;  4OXS A;  1J5E B;  4I4T B;  3CXC U;  1JJO A;  1N34 O;  2UUC O;  1DK1 A;  2WWW A;  5D5Q A;  3CS5 A;  5EC1 C;  3ETQ A;  4J10 A;  1Q5O A;  5L3E A;  3VQX A;  3KCY A;  1SZX A;  2E74 B;  3LSS A;  3ZED A;  2FML A;  4FK5 C;  5LP6 C;  5J9P C;  2E75 B;  2X6C A;  4RWU A;  2WAM A;  4X88 A;  1SES A;  1SQQ H;  4C7U A;  3K0D A;  4DRX A;  3SPC A;  4JI2 B;  4O4L A;  2EIM C;  3AG1 B;  2DJV A;  4TOI A;  2UXB B;  3H1L H;  2LFR A;  4JTC B;  1KUQ A;  3ASO C;  4F4L A;  2X6A A;  5GON B;  4X1Y B;  4IHJ A;  1G6U A;  3VBB A;  1YTF D;  3FB6 C;  1I5X A;  4HYO A;  2BOB C;  4JF3 A;  1FXK B;  2Q67 A;  2L35 A;  4I9Q A;  1JR9 A;  3K3W A;  5BXZ A;  5BZB A;  2OCC B;  5EYP B;  5H6Q A;  2Y48 A;  1N34 B;  2UUC B;  3K0G A;  1HDJ A;  2OIG A;  3JAK B;  1ZTE A;  2F1M A;  4FLW A;  1PNK A;  4B3R B;  1KYO F;  2MW2 B;  2ATK C;  3S3W A;  2YDE A;  4TUY A;  4D7T A;  4IGG A;  4DW0 A;  1DTO A;  1MOF A;  1FFX B;  1VEW A;  2F93 B;  3ZMZ A;  4DV1 O;  1JQ0 A;  4UB6 Z;  4EKW A;  2EJR A;  4LF4 O;  5EIB D;  5DM6 V;  4J9Z B;  4FFB B;  4FM0 A;  4KHP O;  5KHG A;  2ETN A;  4GKK B;  4X1Y A;  3MHS C;  1B04 A;  5BMV A;  1AB3 A;  2DWD C;  1T5E A;  4QE7 A;  3SJQ C;  3CCE V;  3UM7 A;  1ZLZ A;  2ODM A;  3STZ C;  3AK3 A;  2Y4U A;  3ICX A;  3P3N A;  1K92 A;  1YIT V;  4U7O A;  3JD3 A;  3E83 A;  3LSQ A;  3ZHV A;  2EUL A;  2NR5 A;  3LDC A;  4HNA B;  2A9H A;  2Z3Y A;  4EB6 B;  3ABL B;  3FAV A;  1SQX H;  1AI7 A;  1EZV H;  1MA1 A;  1XRE A;  4J80 A;  3KKY A;  4NR1 A;  1NR1 A;  2W0F C;  2YEV B;  1TGO A;  2PGG A;  2UU9 B;  3QO7 A;  3QVN A;  4H0L B;  1PL4 A;  3BY6 A;  3K79 A;  5K1X A;  1BS3 A;  3Q4H A;  4WBN B;  5K1P A;  5EBW C;  2RCV A;  3IGA C;  1YZB A;  3AG3 C;  1ZWI C;  2Y69 B;  3EXA A;  4FIP C;  4FZ1 A;  5IWA B;  1K9M W;  3G6E V;  1NTZ H;  1S5L Z;  3N2K B;  4DV0 B;  4X65 B;  4JI1 O;  1I94 O;  5LBQ A;  3SJB C;  1KP3 A;  1N33 B;  3SPH A;  1P7B A;  1XMO B;  2Y4T A;  3HKC A;  1R3K C;  4I50 A;  4JI3 B;  4NXM O;  2A7W A;  3J81 N;  1NT2 B;  4IT5 A;  5J2T A;  2ADP A;  1VQ6 V;  2PZS A;  4MTO A;  1KMI Z;  4D7S A;  1JA8 A;  1VF6 A;  3A0B Z;  2ILM A;  4X1I A;  3E8G A;  1K4C C;  3OR7 C;  1ZL8 A;  1S5H C;  1H2M A;  5B1A C;  1BQZ A;  1MSD A;  2XAJ A;  4FLV A;  2JEX A;  3JAL B;  4P2Z A;  4ICG A;  1IDS A;  3APQ A;  1OCR B;  2ZXW C;  1RP3 B;  3K04 A;  1GRJ A;  5KMG A;  3RGB A;  2ZD9 A;  2W6I G;  1GN2 A;  2ZDI C;  2GUZ A;  3BAA A;  3C3S A;  5EZY A;  2A79 B;  1YJ9 V;  2BTQ B;  1CP9 A;  2Q69 A;  1M1K W;  3RBZ A;  3MDS A;  1KKD A;  1YSC A;  4FLX A;  4H37 A;  1NH2 B;  3DXR B;  1VQ5 V;  4TT3 G;  4CH3 A;  2AZ2 A;  1AI4 A;  4MVQ A;  5BR8 B;  1Q43 A;  1Y74 B;  4ZIB A;  4JI6 B;  3RYC A;  1H2L A;  5IJ0 B;  3KG2 A;  4MSW C;  2K9P A;  4JPR A;  2R9A A;  3RVY A;  2CTW A;  2F95 B;  3BA8 A;  2ZE5 A;  1WPB A;  4KXR A;  4BIZ A;  2H94 A;  3KCX A;  4JZG A;  4X66 O;  2B5U A;  1ENV A;  5CBG A;  1ARO P;  4I4T A;  1GN4 A;  4JI8 B;  1MNG A;  3WB2 A;  1N36 B;  1M5I A;  4EFB A;  2A0L A;  3E35 A;  3QF7 A;  5TIS Z;  1L0L H;  1F4M A;  1NKD A;  3D3Q A;  2JGD A;  2WA4 A;  1S72 V;  3L70 H;  2CH7 B;  2JS5 A;  5CMU A;  1HNZ O;  2QE7 G;  3P30 A;  1GM8 A;  1HNX O;  1HNW B;  3HB3 B;  1GK9 A;  2DYS B;  1QLE C;  4GCZ A;  1VQ8 V;  1YDX A;  3ZHS A;  4B3T B;  2F4V B;  3DTU B;  3G71 V;  2HVK C;  4DK0 A;  5L3G A;  3STL C;  1AIL A;  3ZRX A;  2Z5U A;  1U97 A;  4MTX A;  1YIJ V;  3WU2 Z;  1NVP B;  3E8B A;  4EB6 A;  4GZR B;  4XDK A;  1AR1 B;  1E1R G;  1THZ A;  3M7M X;  1WNS A;  2QDO A;  4U7N A;  4IIJ A;  1IBM O;  4U3J A;  3OMA B;  3ZHU A;  4LBE C;  5JWP A;  1KB9 F;  4IHJ B;  4JI0 B;  1Y76 B;  4JAA A;  2HEP A;  1VF7 A;  2EIK C;  2HLD G;  2WA3 A;  4JAS A;  5ITZ A;  4K8Z A;  2FKX A;  1QQC A;  4PDL A;  1XL4 A;  4TQD A;  1PNL A;  3E86 A;  4I5S A;  4P9O A;  3CRM A;  3BA9 A;  3D36 A;  3K9A A;  3JAT B;  3OGC C;  2IH3 C;  2BCC H;  3JAW A;  2R70 A;  1M9N A;  1XNR B;  1S3J A;  3ZIA G;  4BWA A;  1QR9 A;  3F5T A;  2BOC C;  1Q6U A;  1DF4 A;  4HNA A;  3SYQ A;  2EIM B;  3AG1 C;  3QNE A;  3SYC A;  3UO3 A;  1Y76 A;  3GB7 C;  3H1J H;  1EN4 A;  1K5S A;  1R3I C;  1QHT A;  1AI6 A;  4UCT A;  1PKX A;  4LP8 A;  1FYJ A;  1K33 A;  3HKD B;  2VQF O;  4UCV A;  5KAF Z;  1R6N A;  2DWE C;  4Z1V A;  4GX5 A;  1ZUQ A;  2XT9 A;  5A2Q N;  2ZDI A;  3EHB B;  1MG1 A;  4LF8 B;  3WG7 C;  1F23 A;  4UCS A;  1P4R A;  4JI7 B;  4FLT A;  4DV5 O;  2FB5 A;  2QGN A;  4WCE V;  3FAV B;  1W0K G;  4UCU A;  4B08 A;  4YY3 B;  1XQ8 A;  3OT7 A;  1VQN V;  3AK1 A;  3CD6 V;  3IAY A;  3I56 V;  2EIN C;  5EC2 C;  1R6T A;  2CUG A;  1SQG A;  2ZCE A;  1SKV A;  5LMN B;  2KQX A;  3HKC B;  4O4I B;  4PD4 F;  1AI5 A;  1JFF A;  2QM8 A;  2OTJ V;  2YIB D;  3R65 A;  2KKW A;  3T4Z A;  4DR1 O;  1NS1 A;  2DW4 A;  4PA7 A;  1QLE B;  2YIA A;  3RYC B;  4H33 A;  3N2K A;  2YID A;  1IZ3 A;  3F7V C;  5IJ9 A;  4CH5 A;  1X59 A;  4DV2 O;  4AHC A;  3B40 A;  4DUZ B;  3W7X A;  1AR4 A;  4LF5 B;  1BQ0 A;  1JMK C;  1P49 A;  2EIL C;  4TV9 A;  1VF5 B;  3T1H O;  4DV0 O;  5BY1 A;  2ZE8 A;  2ZM6 O;  3LDD A;  1WPX A;  1PV0 A;  4HZ3 A;  2PYJ A;  1FKA O;  3H9V A;  3P3P A;  3K59 A;  3ZRS A;  5KMG B;  3UQ8 A;  3F5W C;  1OCZ C;  2JGD B;  3CMA V;  4WFA V;  2YXY A;  3BAB A;  1L8D A;  3MD0 A;  3E2E A;  1XMQ O;  1ZL8 B;  3RW0 A;  1VMG A;  4B3M O;  3OFN G;  2YXL A;  1KKC A;  3JAR B;  3RYI A;  3BCC H;  4WFF A;  2DN9 A;  2YI9 A;  2YIB A;  1XHZ A;  3A0H Z;  1WLE A;  4FFK A;  3WFV A;  1LR1 A;  1Z5W A;  3CC2 V;  1G4Y B;  4DR7 B;  1GTO A;  1Q90 D;  3L71 H;  2XUM A;  2UXC B;  1H8E G;  4PA6 A;  4O4J B;  4LF4 B;  3SYA A;  3ETD A;  4YIP A;  5E1A C;  3CXH F;  5KUK A;  3FB7 C;  2X6B A;  2HVJ C;  3CCU V;  3DSQ A;  4J41 A;  2WLL A;  3FD9 A;  4JI4 B;  3CP1 A;  1B06 A;  3E22 A;  1EZJ A;  4MVU A;  3OGI B;  2BSK B;  3FYE B;  2Q73 A;  4UFZ A;  2WLI A;  2UXD B;  2M6Y A;  4I55 B;  5LHI A;  4DV4 O;  4Z2W A;  4LF9 B;  4CS3 A;  2GV9 A;  1COW G;  4YJ3 B;  3K03 A;  2HG5 C;  4DV5 B;  2QWQ B;  4R50 A;  1EFR G;  3ZJZ A;  4GLX A;  4DR2 B;  1AJQ A;  1F51 A;  2Q7G A;  3I5D A;  4PEL A;  1OCR C;  5KLV H;  1QNM A;  1GN3 A;  2IJI A;  3RT3 C;  4UVA A;  1XI1 A;  2YC0 A;  3VQV A;  4FM2 A;  2XHB A;  5J2U A;  4DV7 B;  1R6K A;  2YXH A;  3K57 A;  4CH4 A;  1GM9 A;  2LGQ A;  2KG7 A;  2QTS A;  1H2G A;  2KB1 A;  1GM7 A;  2XAF A;  1WP8 A;  1Q6H A;  2BSK A;  4DR6 O;  4X20 B;  1IBK O;  4FLZ A;  1AVM A;  2XAQ A;  1N32 B;  3SYP A;  1NR7 A;  1PL0 A;  3W7U A;  4GKK O;  4PJ0 Z;  2H3O A;  1O9H A;  5L3D A;  1TAE A;  3UT5 B;  3FB5 C;  2PI5 A;  4IIJ B;  5JQG B;  1YEW A;  3L73 H;  4AQY O;  1K7D A;  2OCH A;  4X9Q A;  4MTG A;  5LHH A;  3ETG A;  3N2G B;  3OTO B;  1IBK B;  4K35 A;  2N74 A;  4LFB O;  1Y66 A;  2AZ0 A;  1L1F A;  1K97 A;  2V4D A;  2AXT Z;  3HKE A;  1RFY A;  2ZIO A;  3ZN1 A;  4YXW G;  5L3F A;  1Q6I A;  1XOU A;  2IU3 A;  2RN9 A;  3ZX6 A;  2YIC A;  4B7K A;  3TJT A;  3M8A A;  2A06 H;  1WN7 A;  4XBF A;  3PN1 A;  3CEI A;  2P5O A;  2X0L A;  3AG7 A;  3T1Y O;  5CA3 A;  3AG4 C;  1XNQ O;  4O2B A;  5LYJ B;  5ITZ B;  5LGN A;  5FL7 G;  4DR5 B;  1SQB H;  2WLM A;  1N32 O;  2LP7 A;  5KAI Z;  1BCC H;  4UUJ C;  2QWP B;  3K06 A;  3A8T A;  3J80 N;  4NYK A;  4DV6 O;  5D5P A;  3CRC A;  2RDC A;  1OCC C;  3K08 A;  5C93 A;  3W7T A;  2JIZ G;  4MVZ A;  1IBL O;  3I55 V;  3CSX A;  4PI0 A;  1AR5 A;  3T2M A;  3D8C A;  3ZCC A;  1XMO O;  1AP6 A;  4HAM A;  2UUA O;  1G1X B;  2UXD O;  3SJC C;  4DW1 A;  2ZKO A;  2HJF C;  4N23 A;  1XL6 A;  1F4N A;  4O2B B;  4DR3 O;  1VQP V;  1LUW A;  2EIK B;  3B8N A;  1JX9 A;  4CBC A;  4JTD B;  1FD9 A;  3SPG A;  4O4I A;  1EN6 A;  2EJ7 A;  4DO2 A;  2ZIN A;  5LXT B;  1K73 W;  1FXH A;  1X4T A;  1YHQ V;  1S76 D;  4O4J A;  2EIJ B;  4PDR A;  5LL6 Y;  3B77 A;  2IW5 A;  4JAV A;  1TUE B;  3ZMT A;  2D3O W;  3BFR A;  1Y6X A;  2RJZ A;  4TV8 A;  5H5N A;  3D36 C;  3UO2 A;  2XAG A;  1ZSP A;  4DUZ O;  2EIL B;  2W0X A;  1D2D A;  3K5N A;  1WA8 A;  2XAH A;  5JJE B;  4X1I B;  2VS0 A;  3OUS A;  3JAS A;  4LF9 O;  2PYL A;  2JRI A;  1V54 B;  3FFQ A;  4J7K A;  2UXC O;  1R3J C;  4LH7 A;  3OEH G;  4XDJ A;  4I55 A;  1MZE A;  3LUT B;  4X62 O;  3T4D A;  2CDY A;  2JJ2 G;  1J5E O;  1H38 A;  3WB1 A;  3IFX A;  3BEH A;  1K5Q A;  2P4K A;  2QKC A;  2ZR2 A;  2XOK G;  2WLK A;  4ZKI A;  4CH6 A;  4LF6 O;  2CTP A;  2GHY A;  4DR6 B;  4LH6 A;  1WA8 B;  3B4S A;  5HFM A;  2ZM6 B;  2Q0O C;  5B5E Z;  1KU9 A;  2R9R B;  1V9P A;  3CJH B;  1ORQ C;  1HP8 A;  4JI2 O;  2PUS A;  2PTM A;  5J2T B;  3HKB A;  2JEU A;  2F66 C;  1JOY A;  3RYI B;  3JAR A;  4W4L A;  5KHH A;  4LNU A;  5IJ0 A;  2ZIM A;  3AG4 B;  2HJD A;  2VWK A;  1Z5V A;  2ITC C;  3ETE A;  4JV5 B;  2Y0I A;  4QGP A;  4B3M B;  3W7W A;  4NXM B;  4O4H B;  4PA3 A;  4R6Z A;  5JQG A;  4JGS A;  3E22 B;  1VQ9 V;  4OPH A;  4P30 A;  4MVM A;  1JVM A;  3SYO A;  5GON A;  4RUE A;  4DR4 B;  1HW7 A;  2H8P C;  2VQE O;  3OM3 B;  3JAL A;  2LFS A;  3HPL C;  2LO1 A;  1N8R W;  3ZMS A;  2DQ0 A;  5JVD B;  2IJH A;  5FPR A;  4ZHQ A;  4FLU A;  2CH7 A;  4B3S B;  1GAX A;  5LOV A;  2FYU H;  1VQM V;  4EEQ A;  1HR0 B;  1YF2 A;  5EK0 A;  1MAB G;  5J2U B;  2JVD A;  3ML0 A;  1E1Q G;  4DUY B;  3DGE A;  2QEX V;  3DXR A;  5GTH Z;  4YJ3 A;  3CPW U;  4DV3 B;  4NVP A;  1FXV A;  4O4H A;  5LYJ A;  4X20 A;  3OE7 G;  3APO A;  1QBZ A;  5CBH A;  4WFB V;  4Q6G A;  4WFG A;  4JYA O;  2C2A A;  3DC5 A;  4JV5 O;  3ABM C;  4O2A A;  1EN5 A;  3FKS G;  4KUM A;  2LQT A;  3JSL A;  1UPG A;  1XMQ B;  4MS2 A;  2F23 A;  5FPO A;  1M56 C;  5IYC O;  4JAU A;  1ZX3 A;  3THO A;  3RYF B;  1BGY H;  1GMG A;  4TQF A;  5FLX N;  1N0N A;  3L9D A;  1CEZ A;  2VWJ A;  3JD1 A;  4KHP B;  5L3B A;  3H1H H;  4DYL A;  5KHI A;  5LP6 B;  3JAW B;  3CRA A;  3ZHT A;  1SF9 A;  4X66 B;  2HKO A;  1SER A;  3ZS8 C;  2FTK A;  3JD4 A;  2P6J A;  1HNZ B;  2GDS A;  3NXS A;  4RO2 A;  4CZZ A;  1VAR A;  5CBF A;  4AQY B;  4YHH B;  1D5N A;  5H6R A;  2QJ1 A;  2R9I A;  1RPR A;  2HR3 A;  5C8Y A;  2IH1 C;  4Z1M G;  4NXN O;  1BMF G;  1B3Q A;  2OCC C;  3LNM B;  1P7G A;  3JAS B;  1AJN A;  1SQF A;  3IC7 A;  3AG2 B;  3O9O A;  1UFI A;  2JS3 A;  5EBM C;  3F7Y C;  2OIE A;  4PI2 A;  2QR4 A;  2Q7E A;  2DMX A;  3RVZ A;  4BW9 A;  5IE9 A;  2DE0 X;  2UXN A;  1M57 C;  4PA4 A;  4FM1 A;  4QPJ A;  1XNQ B;  1UJW B;  1K3E A;  2M7W A;  2Q9L A;  2CTR A;  1HNX B;  4NKG B;  5L3C A;  4JYY A;  4NTW A;  4X1K A;  4J7J A;  1I7F A;  5IYZ B;  2CE4 A;  1FJG B;  3TXQ A;  2Q5Z A;  1QU7 A;  2DYR C;  3JAT A;  2KSD A;  2GUZ B;  3S3X A;  2RNB A;  4TV9 B;  1KD1 W;  3K9S A;  4NXN B;  4IL6 Z;  4DUY O;  2JJ1 G;  1I5Y A;  2HP8 A;  1NQT A;  1YJW V;  3U10 A;  3E89 A;  4DR1 B;  1OCO B;  4H13 B;  4DR3 B;  4CC5 A;  1WJZ A;  5A9G A;  1QVG U;  2VQE B;  4BIO A;  3OTF A;  4JTA B;  2E5L B;  4PDV A;  3RYH B;  1PP9 H;  4WBN A;  3ZHR A;  1DLB A;  3P32 A;  2CGN A;  4FZ0 A;  3CC7 V;  1PPJ H;  5IYD O;  4L87 A;  3GVM A;  1HR0 O;  2Q7H A;  1DF5 A;  2Y69 C;  2P06 A;  1OCC B;  3IC9 A;  1SQP H;  4DK1 A;  1JPX A;  1RM1 B;  4NB5 A;  1K34 A;  4GUN A;  2AHZ A;  2WPD G;  5CB4 A;  3H01 A;  1SZT A;  4PHZ A;  2EZO A;  3SPI A;  2JDI G;  2P90 A;  4JI5 O;  3CWB H;  4DV2 B;  2P22 C;  1KBH A;  3OR6 C;  4DR4 O;  3OW2 U;  4LFB B;  4QNH B;  1R73 A;  4NTY A;  4BAY A;  4DV4 B;  1Y4M A;  2GBO A;  1IBL B;  4B3T O;  2F4V O;  1Y67 A;  4LC1 A;  1VIB A;  4X89 A;  4UVC A;  2WLI B;  1QCE A;  2ZR3 A;  3VOU A;  2XND G;  1P84 F;  5IJ9 B;  5B1A B;  3B09 A;  1R1B A;  1MMM A;  1YCI A;  3RWR D;  3ZMU A;  2QKS A;  3QO8 A;  4JYC A;  3W7S A;  2ZQM A;  2WLL B;  4DV1 B;  4LR3 A;  3SGI A;  2QWO B;  3G6B A;  4IYH A;  1F7Y A;  1IBM B;  4UB8 Z;  4F6E A;  4JI7 O;  4LF7 O;  4JZ2 A;  4LFA O;  4OX9 O;  5JVD A;  3ABU A;  4B3S O;  5LP6 A;  3K58 A;  3JYC A;  1BL8 A;  3TGU H;  4MTF A;  3CME V;  5LOV B;  1M57 B;  5LA6 B;  1BZK A;  4BR6 A;  4CS2 A;  1AP5 A;  4RAI A;  3H1K H;  3B2E E;  5CA0 B;  1FFT B;  2CAZ C;  3J7A U;  2QM4 A;  2ZE7 A;  4X64 O;  4GX0 A;  4L8J A;  1NJI W;  4AI8 A;  5EIB C;  4QPK A;  5B1B C;  4JI1 B;  1I94 B;  4H44 B;  3KZI Z;  4FMT A;  5JJJ B;  3NR7 A;  3GWK C;  2JK5 C;  1JJ2 U;  4KL1 A;  3TK1 A;  3JCU Z;  1NI8 A;  5H9C A;  2ADQ B;  3OD4 A;  2BTO A;  3CX5 F;  3JCZ A;  2Q4P A;  1KC8 W;  1N36 O;  2CGO A;  4LF6 B;  4FVM A;  1VQ4 V;  1KQS U;  1L0N H;  4W4K A;  1NH2 D;  1PM9 A;  1OCO C;  1TVK B;  3ZRW A;  3CYO A;  1BE3 H;  1SA0 B;  5JH7 A;  1WB8 A;  4DV7 O;  1QVF U;  4DV3 O;  2IBZ H;  2WSS G;  5LMU O;  1K8A W;  2GTS A;  5IY5 C;  3Q4H B;  4JI4 O;  1FAF A;  1FXK A;  4UV8 A;  3UKM A;  2DYS C;  1WP7 A;  2HFE C;  1MSW D;  2Q8V A;  4X1K B;  2QTO A;  1GH6 A;  2EBO A;  3JAK A;  1D5A A;  4ZOL B;  5FNV B;  5KA5 A;  1NZ6 A;  5JCO C;  1G8M A;  4TUY B;  1SC5 B;  5CN0 A;  5B1N A;  2ITD C;  2P4V A;  3CRQ A;  4FPP A;  1VF6 C;  2KG7 B;  1BT8 A;  3ZRW B;  4YJ2 B;  4JI6 O;  4I9W A;  5IWA O;  3H1I H;  2LGW A;  3JSN A;  3ABK B;  1RPO A;  3MHH C;  3U11 A;  3VQW A;  1JFF B;  1I0H A;  3RYH A;  1NBM G;  2PF4 E;  4R7C A;  1N0J A;  2Y0P A;  4I0X A;  1EBO A;  2MK3 A;  1M93 A;  3TXS A;  3N2G A;  1RSO A;  3EFF K;  3CC4 V;  3SR2 C;  1M56 B;  2W6J G;  4RUF A;  3K5M A;  1R3L C;  4LFC B;  4OX9 B;  5LXT A;  1H8H G;  4K0K B;  4B7E A;  1NVP D;  4TV8 B;  5HFL A;  4KFM A;  4ABM A;  1VQL V;  1OCZ B;  3JD2 A;  2DYR B;  2V7Q G;  4YJ2 A;  4QE9 A;  3AK2 A;  4JYA B;  2DOS A;  4TSF G;  3G4S V;  5IYB O;  2YEV A;  2OT5 A;  2JGU A;  4LCU C;  1W59 A;  4GX1 A;  4DR7 O;  4UCR A;  5E79 Z;  2LW1 A;  4ZI7 B;  2B1I A;  5LGT A;  4AIL C;  1CXZ B;  1KEC A;  3HKD A;  3ABT A;  2GSM B;  3L75 H;  2B1G A;  2Q68 A;  2DQ3 A;  4MVS A;  2OTL V;  3CCR V;  3PJS K;  1M4U A;  1TUB B;  3QTC A;  3T1Y B;  1VQK V;  5F2V O;  1H2K A;  3N27 A;  3CCV V;  2NN4 A;  4I50 B;  4X65 O;  3WG7 B;  4UV9 A;  1N33 O;  3G67 A;  1XHX A;  5B3S C;  3CCQ V;  3CRR A;  5KHK A;  3AG2 C;  4J9Y B;  5IT9 N;  2OWO A;  1Q82 W;  5LMU B;  1OJH A;  2ZNI A;  2EIN B;  1PD3 A;  4TWK A;  3CJH A;  2AGA A;  5KUM A;  2G38 A;  3TET A;  5KX5 B;  1EM1 A;  5CA0 A;  5IY5 B;  1TA8 A;  4K3A A;  2E5L O;  1E79 G;  4MW8 A;  4LNU B;  3TCU A;  3VQY A;  3ZRV A;  3OMI B;  1W0J G;  5CA1 A;  1URF A;  3CCJ V;  4B3R O;  3BRC A;  5B1O A;  1XUQ A;  3G80 A;  2D2C B;  3CB2 A;  4CC6 A;  1U96 A;  5EBL C;  2O57 A;  1Q7Y W;  1SET A;  2YSU B;  1XIL A;  3E8F A;  5H2F Z;  4F6R A;  1BSM A;  3C90 A;  3CCM V;  2CTQ A;  1H2N A;  1BHA A;  1N4C A;  2YUA A;  3M99 B;  4JI0 O;  1GO3 F;  1Z2G A;  4DV6 B;  2QWR B;  4WFE A;  4RQE A;  1SRY A;  1IVS A;  4GKJ O;  3ABK C;  1WB7 A;  1GN6 A;  2A3Q A;  1J95 A;  3EVK A;  1VQ7 V;  4GX2 A;  4UCO A;  5B66 Z;  3IJ4 A;  5BR8 O;  5CA1 B;  2IJK A;  1S5J A;  1YVW A;  4DRX B;  3A0R A;  2LW7 A;  3X2Q B;  1IUR A;  3CCL V;  2QM7 A;  3JD0 A;  1XDC A;  2QSA A;  3R66 A;  4ZHQ B;  4GYC B;  3CE2 A;  4WFH A;  5B1B B;  4O2A B;  1RM1 C;  2IM9 A;  5KHJ A;  3HKE B;  1LUV A;  2NLJ C;  4I7Z B;  5KA6 A;  4UXN A;  3C3T A;  2UUB O;  4LF5 O;  1JCH A;  1QR8 A;  2WLJ A;  1FS0 G;  3DC6 A;  4BW5 A;  1Q8I A;  2QKA A;  2UUA B;  4DR2 O;  4LF7 B;  4LFA B;  5LMN O;  1MZF A;  4R8C A;  5LGU A;  4O4L B;  1B6Q A;  4N21 A;  5LA6 A;  1S0V A;  5IDJ A;  1VP7 A;  3HKB B;  1FJG O;  3OTO O;  3OUF A;  3ASN C;  2K1E A;  3K5O A;  1KP2 A;  2BE3 A;  3L74 H;  4I0X B;  4YHH O;  2NNU A;  4J42 A;  4U3J B;  2X7R B;  1VQO V;  4QJF B;  1FPO A;  1FXK C;  3RYF A;  5GW7 A;  4PA9 A;  3AG3 B;  4U3F H;  1Q3E A;  5DEC A;  2LJ2 A;  3GWO A;  4Q20 A;  3BPZ A;  3OAA G;  3LDE A;  2AW9 A;  1A32 A;  1FFX A;  2N04 A;  4J11 A;  3QG5 A;  2PI4 A;  3E8H A;  2R72 A;  1US6 A;  2ZT9 B;  4ZOL A;  5FNV A;  2Z0A A;  4A5U B;  1TVK A;  4ZBM A;  4JYB A;  2VQF B;  4PDM A;  3T1C A;  1S77 D;  1SA0 A;  5JH7 B;  2YI8 A;  2P7T C;  2XTA A;  2ARH A;  3ZN0 A; 
#chains in the Genus database with same CATH homology
 2CTP A;  2DMX A;  2LGW A;  3APQ A;  2LO1 A;  2QWN B;  3UCS C;  1BQ0 A;  1WJZ A;  1NZ6 A;  3AG7 A;  2M6Y A;  3UO3 A;  3UO2 A;  2CTQ A;  1HDJ A;  2N04 A;  2GUZ A;  2QWO B;  2DN9 A;  2GUZ B;  1N4C A;  2PF4 E;  2YUA A;  3APO A;  2OCH A;  2Y4T A;  2YS8 A;  1IUR A;  1FAF A;  1GH6 A;  2CTR A;  1BQZ A;  3BVO A;  2QSA A;  2EJ7 A;  2QWR B;  2QWQ B;  4IT5 A;  4J7Z A;  2CTW A;  1FPO A;  2CUG A;  2N05 A;  1XBL A;  2QWP B;  2L6L A;  4J80 A;  2Y4U A;  4RWU A;  2KQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...