2R9AA

Crystal structure of human xlf
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
227
structure length
219
Chain Sequence
MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLMGMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-homologous end-joining factor 1
publication title Crystal Structure of Human XLF: A Twist in Nonhomologous DNA End-Joining
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 50
structure length 219
sequence length 227
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09302 XLF XLF-Cernunnos, XRcc4-like factor, NHEJ component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.450 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2r9aA02
2.170.210.10 Mainly Beta Beta Complex Dna Repair Protein Xrcc4; Chain: A, domain 1 DNA double-strand break repair and VJ recombination XRCC4, N-terminal 2r9aA01
3MUDA 1M5IA 2R9AA 5CHXA 3RWRA 1IK9A 4XA4A 1KU9A 3SR2A 5CJ4A 5CJ0A 3SR2C 1FU1A 3II6A 3RWRD 2QM4A
chains in the Genus database with same CATH superfamily
2ZDIC 3AG4B 4JI1O 4FLYA 1XEQA 3N2GB 4FLZA 3E83A 1RM1C 2ADPA 1K33A 4R6ZA 1HNWO 1K3EA 4DW1A 5LHHA 1IZ3A 1P84F 4DR2B 2X6BA 3AK1A 2PYJA 3ETDA 1WP8A 2ETNA 5BY1A 1QR8A 2EIKB 2FL4A 2O57A 4TUYA 1OCCB 3GB7C 3VBBA 3CB2A 3ZHTA 3ASOB 4HAMA 4ZHQB 4HYOA 2YUAA 3RYHA 2LW1A 3X2QB 5L3GA 4WCEV 3T2MA 1OCZB 1KUQA 3JASB 1M57C 1IDSA 3JD3A 1FXVA 5IY5C 2DW4A 4I4TB 5IDJA 4HBNA 3RBZA 1RPOA 4DR6O 1WLEA 2QKAA 3CSXA 3EVKA 1K7DA 2ATKC 4EEQA 1N0NA 2ZE8A 1PNKA 1US6A 2UXBO 1PP9H 1YITV 4UCOA 1QU7A 4X1IA 4DV5O 3DXRB 4LF7B 1KB9F 5KX5B 2P06A 1H8HG 2Q6AA 5L3CA 1JFFB 4C7UA 4IT5A 3K79A 2FB5A 5H9CA 1O9HA 2PY5A 4UCSA 3VOUA 3K03A 4UFZA 2CUGA 3LSSA 2ZXWB 5LXTA 4DO2A 2EILB 1Z2GA 2JJ2G 3JYCA 2XASA 5EYPB 2Y69B 1NVPD 4TV8A 4MVMA 1JVMA 4GT1A 3RYFA 4X65O 4DV0O 1AR5A 1M5IA 3JALB 1SC5B 2WAMA 1X59A 5BXZA 1O9GA 3JATA 2Q0OC 1XNRO 1JPXA 5J2TB 1WJZA 2JS3A 2E75B 3IC7A 4WFEA 1R1BA 1MSWD 3K59A 4IHJA 3IGAC 4DV7O 1R73A 2XTAA 2UUAB 3AEIA 4NYKA 5HFMA 3ASNC 1AROP 2NNUA 4DRXA 2B1IA 4O2BB 4TQDA 5IYCO 1Z5WA 2UU9B 1N34B 5IJ9B 3T4ZA 1NVPB 3ABLC 4OPAA 1R6NA 3OTOB 3K5LA 3AG1C 3UO3A 2RN9A 4DV2O 2XAHA 4GLXA 3LNMB 3ZRWB 4IIJA 1XDCA 2CGNA 4JI0B 4GZRB 2F1MA 2XAFA 1K9MW 2HKOA 1AI7A 2ZE5A 1H2LA 3N27A 5KUKA 3E2EA 5L3EA 4LF9O 4YHHB 1W59A 3JD1A 5BR8O 1VF7A 1WB8A 3KCXA 4YJ3A 1AB3A 5FL7G 1AI6A 1H8EG 3TCUA 2R70A 5GONB 3UCSC 1GO3F 3K06A 3CCJV 4UB6Z 1GRJA 2KB1A 4GKJO 2WPDG 2E76B 1FFXB 2XT9A 3U0ZA 4MVRA 5DECA 3OEEG 1Q82W 3II6A 1IBMO 3JCUZ 2UUCO 3UT5A 3OTFA 4X66B 4LF6B 1CPYA 2VQEO 3OUFA 2G38A 3JAKB 3U11A 1WPBA 3JSNA 2YDEA 5JJEB 2X0LA 3IC9A 5E1AC 1S5HC 4I50A 4O4HB 5B1BC 1QHTA 2E5LB 5CA0A 3OAAG 4WBNB 4GYCB 3BVOA 2OCHA 1K5SA 3T1YO 5IYZA 4JI5B 1Y66A 5B3SB 1I94B 3ABMB 1HNZO 4JI8O 3ZMZA 4WFAV 5LHIA 1XNQO 1YSCA 3A0BZ 1SQVH 5EIBC 1AP5A 2JIZG 4MVUA 5B1AB 3OFNG 2EBOA 5A2QN 3SYPA 5KHGA 3SYQA 2Y48A 4JTDB 3CCUV 1XMOB 1JA8A 4U7NA 2DOSA 3A8TA 3O65A 1VQOV 2XHBA 2FMLA 4J7ZA 4ZI7B 1D5AA 2VQFO 4GX5A 1Y76A 4QIWF 4IIJB 4LH7A 5BZBA 1DF4A 1HW7A 4DUYO 2NN4A 4UB8Z 5IJ0A 4UVBA 2EIMB 4DR7B 1E1QG 4TV9A 1T5EA 1KBHA 3Q4HA 3F5WC 1B3QA 3P3NA 1K8AW 1LUWA 4QPJA 4O2AA 2OTLV 5LBQA 5KHHA 4GKKB 3SJAC 2XNDG 2DE0X 2HG5C 3AG2B 2GUZB 4MW8A 4DR2O 1RFYA 1G6UA 2IJJA 1NR7A 4DR5B 2W6IG 4PDRA 5LL6Y 1KKDA 3SJCC 3SR2A 2P90A 1KECA 3E22A 2W0FC 1S0VA 2IH3C 4O4IA 3OW2U 4J7KA 2P5OA 1VQ4V 1I5XA 3W7TA 4I5SA 3CWBH 4IL6Z 2XUMA 2YS8A 3KCYA 3WU2Z 1Q6HA 3CYOA 4JTCB 1UPGA 4HNAA 3P3PA 5GW7A 3IFXA 3SR2C 2ODMA 1G8MA 1V9PA 4IYHA 2YIBA 3JARA 1FD9A 4J10A 1VQLV 2EIJC 2JEUA 4I50B 5C93A 2XOKG 2PTMA 3QNEA 2Y3VA 2HEPA 4MTXA 5C8YA 2QM4A 3F5TA 3ZIAG 5K1PA 2PZSA 4OX9O 1NH2D 3HR0A 4LC1A 3W7SA 4LF7O 2RDCA 2QSAA 3MD0A 3LDEA 4JI3B 1NTKH 3NXSA 3B09A 3W7XA 1OV9A 1ZLZA 1NTZH 4LNUA 2KG7B 1OZ0A 4DW0A 1K73W 4ASUG 4K8ZA 3FKSG 4B08A 4OXSA 4QGPA 4U3JB 1JOYA 2ILMA 2AW9A 2QE7G 3KKYA 4WFFA 4LFAO 3FX7A 4P9PA 1K4CC 3R66A 3K0DA 4OGQB 3BRCA 2JGDB 1WNSA 1BCCH 3HKEA 2GHYA 3L75H 4GX2A 3CRRA 2QWPB 2YI8A 1QVFU 5LA6A 1LR1A 2C2AA 1TAEA 2IU3A 1R3JC 4FFKA 1NH2B 2HP8A 4TT3G 5JVDA 3Q4HB 2YIBD 4WFHA 3N2KB 3RYIB 1ZL8B 1QLEB 5BMVA 3KZIZ 2UUAO 4UV8A 4MTGA 4PV1B 1YJWV 4HZ3A 3MAQA 1XOUA 5ITZB 3RGBA 3I55V 2VS0A 1IURA 2UU9O 3HPLC 1FXKA 1N34O 1L0LH 3HKDA 4BW9A 2HJDA 4D7TA 2CGOA 2EJ7A 1NI8A 3E8BA 2ZR3A 1Y4MA 2Y3WA 3OTOO 1IXBA 3JAWA 4ICGA 1VQKV 1SQPH 5LGUA 1KMIZ 2A06H 2EINC 4NXMB 1M56C 4W4LA 5KLVH 5IYDO 3MDSA 2Q68A 4JI0O 4JF3A 1LUVA 1FXKC 3K58A 2JS5A 3FB8C 4X1KB 3TGUH 3DGEA 2IJIA 5H5NA 1V54C 2N04A 1YI2V 1IK9A 1VF6A 2DYRC 5C8YB 4YHHO 4P30A 4TWKA 5JH7B 1R6KA 2Y4TA 2HLDG 1BT8A 5IT9N 3T1HB 3K0GA 4PELA 4NKGB 1M93A 2KQXA 5LMNB 1Y74A 4LNUB 3ZN1A 4JYBA 1KQSU 2BSKA 3E89A 2JEXA 1S77D 1JQ0A 1WAZA 1VF6C 4DV4B 1N36B 4B3RB 1BMFG 2RQ6A 1TVKA 3VQWA 2CE4A 1GM9A 4F4LA 4PA6A 2DYSB 2MW2B 4X66O 3AK2A 3CXHF 4LF6O 1B04A 4P9OA 3WB1A 1EBOA 2ZT9B 3JD0A 3ZX6A 1IBLB 2WLLA 4R7CA 1XHXA 4JZGA 4GFCA 2PYLA 3RT3C 1SQBH 3SPGA 1KYOF 2F93B 1RP3B 2A3QA 3RWRD 5A9GA 1FKAO 1S5LZ 4IGGA 5JJJB 4JI7B 1MG1A 1ZX3A 5CA1B 3KG2A 1W0KG 4XDJA 1YIJV 4X88A 5B5EZ 3ZRXA 1XREA 1WA8A 1Q90D 3ZMVA 4X1YB 3E8HA 3HKDB 4B3MB 4X8AA 1EM1A 1V54B 1MA1A 4GX0A 5EBLC 2UXCO 4WF9V 3F7VC 4LF8O 4K8XA 3P30A 4FZ0A 2XAQA 4FLVA 1XMOO 4AQYB 5DEDA 1SA0B 5KMGA 3CCQV 2UUBB 2CTRA 4H13B 2CAZC 1D5NA 1V55C 3ZCCA 4GCZA 1N0JA 4NTWA 3JCZA 1DTOA 1AVMA 1FJGB 4JI4B 3MHSC 4PA4A 1NS1A 4DV3B 3SPHA 3D36A 3SGIA 5LOVB 2GV9A 4DR7O 1IVSA 4ZOLB 5LP6B 2A0LA 2QTOA 4GKKO 4JPRA 4JYYA 2IU0A 4J41A 3E86A 2YI9A 2LFRA 4DR5O 1TA8A 1K5QA 2ZM6B 1AJNA 5B1NA 1M1KW 1I0HA 3UQ8A 4JAAA 1P4RA 2BSKB 4O4JA 3D36C 1VF5B 4I0XA 1Q86W 2WLIA 1K97A 1RM1B 1GAXA 3PJSK 5EC2C 1XUQA 4LBEC 1GKFA 3FYIB 4RO2A 2CH7B 4W4KA 3S3WA 3OGCC 3TJTA 2ITDC 2GTSA 5J2UA 3LDDA 3G4SV 1VQNV 4JTAB 5LYJA 4CC6A 1SETA 3QTCA 3SJBC 5GTHZ 1E1RG 4XDKA 1P49A 3K5MA 1COWG 4DR3O 1JMKC 2LQTA 3RN4A 2CTWA 2HJFC 2QEXV 1DLBA 1GM7A 2EJRA 1YDXA 3HKCA 3CRCA 3RYCA 4NXNB 1M57B 4JI3O 5IY5B 3ABKC 4J7JA 2LFSA 4LWSA 2K1EA 1H2NA 1OCOC 2HHHO 4TUYB 4CKPA 2WA3A 3GWKC 1KP3A 4RUEA 1NR1A 3RYHB 4DR4B 2UXNA 4DV1O 3LDCA 5L3FA 3M7MX 4MTFA 1ORQC 2P7TC 2QM7A 1QR9A 2GDSA 1EZVH 3ABTA 2F95B 1XI1A 2IBZH 1SERA 5JQGA 1BE3H 1HR0B 3RFRA 4CZZA 4B3TB 3QF7A 4GEUA 3CC2V 1FU1A 1BSMA 3QO8A 3AK3A 4UV9A 3FAVA 4F6EA 4U3FH 4MVQA 4JI6B 1ROPA 4J42A 4DV6B 1RPRA 2QM8A 4X1IB 4UXNA 2VWKA 3BA8A 2YSUB 4Q6GA 1BQ0A 3K3WA 4NTYA 2Y0PA 1BZKA 3FB7C 4BAYA 5LGNA 2IW5A 1R6TA 2IJKA 4I0XB 3JD2A 2GBOA 4PJ0Z 3ML0A 3BABA 2IH1C 5LXTB 1UJWB 1GN4A 1K34A 1URFA 1G4YB 4KP4A 2QWQB 3G6EV 2F66C 4TV8B 3GVMA 4NXMO 2IJHA 1B06A 4GUNA 3ASNB 4CS4A 3RYFB 3OE7G 2EZOA 5CA3A 4LFCB 4F6RA 5D5QA 4WFBV 5LYJB 2BOBC 3JATB 3K08A 3TXQA 3F7YC 3CD6V 1AJQA 4CS2A 3BAAA 3ABLB 4X62O 4YJ2A 1SQQH 4IHJB 1MNGA 3STLC 3AG1B 1NT2B 3HKBA 3T1HO 5KUMA 1U96A 2P6JA 2HVJC 1Y67A 4JV5B 4FVMA 1VQ9V 1A32A 4DRXB 3ZEDA 3WB0A 1D2DA 5FNVA 3FD9A 2QGNA 4LCUC 4GEXA 1PL4A 4KXRA 2ZR2A 4X20A 4FFBA 1VQ8V 4XBFA 4DV4O 3K04A 4KUMA 2A7WA 4R50A 1N36O 3CC4V 4MVSA 4B3RO 5KHKA 2R9AA 5GTIZ 1R3LC 2NLJC 2D2CB 3CJHA 3W7WA 2OT5A 4X64B 2ARHA 2PI5A 2LP7A 1NQTA 3BCCH 2FKXA 1N4CA 4YIOA 1IBLO 1RSOA 1QQCA 2AXTZ 3J80N 3QO7A 1QVGU 1S5JA 5EIBD 2BTQA 1YJNV 2YEVA 2H3OA 2QA4V 4G2KA 1H2SB 4FLXA 3AG3C 3BFRA 3QG5A 4YJ3B 3UO2A 4JYAB 1UFIA 1N32B 4H33A 4QJFB 3CRAA 4FZ1A 1PNMA 5E79Z 4DK0A 1VP7A 2W6JG 4B3MO 3OM3B 5B1BB 2K9PA 1LNQA 4CC5A 2XAJA 4EB6A 2B9ZA 3IJ4A 4O4LA 4PA3A 1NU1H 1QCEA 4AQYO 3OMIB 3G6BA 3VQXA 2UUBO 2QTSA 2Z5UA 3RW0A 3WG7C 2XAGA 3UT5B 3B8NA 4BIZA 1J5EB 3H1HH 2Q73A 1FJGO 4JI4O 1S72V 4H37A 2ZCEA 1MSDA 2IM9A 4DV3O 3CE2A 3ZHVA 2F4VB 1PD3A 3L73H 4I55A 5CA0B 4FJCC 4FMTA 1YXBA 1HNXB 1XQ8A 1OCRC 2V7QG 4FLUA 4CKMA 4PHZA 4RAIA 5IYZB 4JASA 1EFRG 4H0LB 1SZXA 2CK3G 2QR4A 4QE9A 2ZM6O 3EXAA 5EBMC 4J80A 1Q3EA 4FIPC 2Q5ZA 3CCVV 4X20B 2AHYA 4NTXA 1Q8IA 3G71V 2BTOA 1QNMA 3QO5A 4IYIA 3ZMSA 1Q5OA 1MZFA 2JDIG 2R72A 1FFTB 1CP9A 2BE3A 4G79A 1Y76B 2OCCC 4P2ZA 1IXMA 3ZS8C 3PN1A 4TSFG 3ZN0A 1X4TA 1VQPV 4I9QA 1G1XB 4J9YB 5IJ0B 2Q0AA 1JX9A 1L1FA 4TV9B 3CHXA 1Q7YW 4TOIA 4O2AB 1M4UA 4NVPA 4JI2B 1PNLA 2M6YA 1P7BA 1L0NH 4NXNO 2OYQA 1TUEB 3IAYA 4Z1MG 1SQXH 3N2GA 4UVAA 1R3KC 3JAMN 3E22B 5EZYA 2EIJB 3D3QA 2E3CA 3FFQA 4O4IB 4NR1A 1F23A 3B2EE 3CCLV 2YICA 2CDYA 4DR4O 3L71H 3CXCU 2P67A 1H2KA 2PGGA 4HNAB 3C3SA 4MVOA 3AG4C 4L8JA 3MUDA 3ETGA 3OR7C 2L35A 4ZHQA 1L8DA 3JARB 1KKCA 2Y4UA 4MSWC 1HR0O 2BCCH 3ZHUA 4B3TO 2YXHA 5CBFA 3W7UA 2Y0IA 4LFBB 3JASA 4WFGA 2R9IA 4BW5A 3FB5C 3TETA 3E35A 4I4TA 2Z3YA 4JI6O 3CCRV 4JGSA 1XL4A 1M90W 1H2GA 2EIKC 2MK3A 5KHJA 1THZA 1DK1A 1OCCC 1PV0A 1EZJA 3OEHG 3ASOC 1K4DC 1Z5VA 3X2QC 2NR5A 1H2MA 1GTOA 3U10A 4QPKA 5EC1C 2DQ3A 2Q69A 3DXRA 1OCZC 3FYEB 4JAUA 3LSQA 5KA6A 1OJHA 2JRIA 1HNZB 1JFFA 2ITCC 2UXXA 1YZBA 3K9SA 4TQFA 2PF4E 5FLXN 3SPCA 3JSLA 2DMXA 1NBMG 2GTAA 2WLMA 3LSUA 2ZQMA 3HKEB 1VQ5V 5F2VO 2LGQA 5DN6G 4LFCO 1NZ6A 5LA6B 2N05A 3EFFK 3NR7A 3UKMA 3K5NA 2QWNB 2YIAA 5EYPA 2X7RB 5JWPA 2E5LO 2RMKB 2P4VA 1HP8A 1SRYA 2QWRB 1WB7A 3H1LH 5JVDB 3O9OA 4QE7A 2A79B 3GWOA 3JALA 3CEIA 3ZRSA 5BMVB 4JI5O 1I94O 2EINB 5JCOA 4DUYB 1Q81W 1M56B 4JV5O 1S76D 5J2TA 3ZHSA 3K9AA 5EZYB 4LF4B 1FXKB 2ZXWC 2EILC 1YCIA 2WLNA 5IYBO 2Y69C 1MZEA 2DYRB 4KL1A 4CH4A 3SYOA 1XHZA 3JAWB 1FAFA 4O2BA 3B4SA 2QDOA 2W0XA 3BY6A 4YIPA 4GFAA 5JCOC 3K57A 5IJ9A 1AJPA 4X64O 4E2LA 4CH3A 4N21A 1QBZA 4N23A 2DJVA 2DQ0A 1ZUQA 3OMNB 2AGAA 3I5DA 2QWOB 4PDMA 2WLHA 2X6AA 3ZRWA 5FPRA 1HWYA 3SPJA 5IWAB 2JJ1G 2F23A 5CB4A 1WP7A 4JYAO 1N32O 1Y74B 3Q0XA 3THOA 3HB3B 3VQVA 3MHHC 3CC7V 2OTJV 4J11A 1VEWA 4OX9B 4DUZB 1SQFA 3OR6C 3DSQA 2OWOA 3ZJZA 4PA7A 3STZC 4X89A 1TVKB 3J81N 2HR3A 1Q43A 2L6LA 2ZNJA 3SYAA 2N74A 1F4MA 5GONA 1GN6A 4EFEA 4ZIBA 3OD4A 3BA9A 2YXLA 1J5EO 1FFXA 3PYIA 5K1XA 5CHXA 5KA5A 4AI8A 2WLLB 4AHCA 1SF9A 1E79G 2F4VO 1BHAA 2Q7EA 2YIDA 2PUSA 4PA9A 2HFEC 4LFAB 2LW7A 2DWEC 1EN5A 4ABMA 4DR1B 3Q0YA 2B5UA 1HNXO 1W2BU 3JD4A 1P7GA 3CCEV 3OGIB 2B1GA 3TXSA 3JAKA 1GH6A 3APQA 1V55B 3CRQA 2QKCA 4FLTA 4O4HA 2HVKC 1WA8B 3ABUA 4WBNA 4MW3A 2LO1A 1ENVA 1JJ2U 4GX1A 4U7OA 2A9HA 1KP2A 1VQ6V 3J7AU 2R9RB 1WN7A 2DN9A 5H6QA 5KMGB 1ZTEA 1Y6XA 4FM1A 1F7YA 1XMQB 1J95A 1EN4A 3H01A 2Q8VA 3CS5A 1GN2A 3L74H 3CPWU 4UUJC 4B3SB 3L9DA 3CMEV 4LF5B 4K35A 3CX5F 5EBWC 4B7KA 3ETQA 4ZBMA 1PKXA 5B3SC 4RQEA 1K92A 3ABMC 4ZI7A 3BPZA 4MVZA 2Q7HA 2YXYA 3L72H 5TISZ 4JI2O 1I5YA 1BQZA 5CB4B 3OUSA 3WB2A 4UCRA 4NB5A 5B1AC 2QJ1A 5AG2A 1YEWA 1GK9A 2WSSG 2ZE6A 1H38A 4Z2WA 4O4JB 2WLIB 1VQMV 2GUZA 3SDLA 5LMUB 3E8FA 4X9QA 4EFBA 3A2FA 4K0KB 1VQ7V 3G80A 3T4DA 1BS3A 4FK5C 2VRZA 3APOA 4BIUA 3A0HZ 5IE9A 4FM2A 2CTQA 3ABKB 1N33B 4G27B 3I56V 4B7EA 2EIMC 1GM8A 2RJZA 5D5PA 5J2UB 1OCOB 5EK0A 2UXDB 1KC8W 2H94A 2ZIOA 1TUBA 4XA4A 3AG2C 4BIOA 1AP6A 4YY3B 4LFBO 3QVNA 4RQFA 4KHPB 1IBKB 1AILA 4XDLA 2Q4PA 1AR4A 4I7ZB 1YVWA 3HKCB 2JGUA 4JI1B 3RYCB 4AILC 5LMNO 1EN6A 4G28B 1S3JA 1M9NA 1BGYH 1NTMH 2CTPA 4LWSB 1DF5A 3H1JH 1PM9A 4CH6A 1SZTA 1FS0G 4CS3A 3BHPA 1HNWB 4MS2A 3T1CA 1DGSA 4UCVA 4DYLA 1AI4A 2H8PC 1TGOA 5JJNB 1KU9A 5CMUA 1GMGA 1JR9A 5KAIZ 2KG7A 4FLWA 5CJ4A 3P32A 2FYUH 2GSMB 1HDJA 4PI0A 1IX9A 2PI4A 1WPXA 2EULA 2UXCB 5JQGB 4U3JA 4ZKIA 3CMAV 4MTOA 4LF8B 4D7SA 5KHIA 2AHZA 3FB6C 4MT8A 3G67A 2E74B 2JGDA 5HFLA 3FAVB 5CJ0A 1SQGA 3CP1A 3R65A 3CCSV 4DR6B 2ZKOA 3ZBHA 2V1DA 4JI7O 5LHGA 3LNNA 4LF4O 2RCVA 2RNBA 2UXBB 3N2KA 3RYIA 4R8CA 1ZL8A 3CRMA 2ZNIA 4DV5B 1F51A 2WLJA 4Z1VA 4EKWA 5ITZA 4Q20A 1F4NA 2LJ2A 2ADQB 3H1IH 4K3AA 4DXWA 5B66Z 3DC6A 2ZIMA 4JAVA 1ZWIC 4A5UB 3ETEA 5L3BA 4F6RB 3D8CA 3K5OA 1XL6A 2WWWA 1ZAUA 2LGWA 1QLEC 2Z0AA 1TUBB 2BOCC 1MOFA 2M7WA 3OT7A 4I9WA 4X65B 4DV0B 4YJ2B 4OPHA 3HKBB 4LH6A 5IWAO 1XBLA 1YTFD 1BL8A 3ZHQA 4X1KA 1XNRB 1VMGA 3SPIA 1JCHA 4D6TH 3SYCA 2AZ2A 3BEHA 3M8AA 4PDVA 1SKVA 5FNVB 4CH5A 4DR3B 1I08A 1VARA 5JH7A 4DV7B 4FFBB 3RVZA 1B6QA 3TK1A 2JVDA 4DUZO 3ZHRA 4CKNA 2EX3A 4DK1A 4CBCA 1PPJH 3WFVA 3UM7A 4FM0A 1FYJA 1U97A 3AG3B 3H1KH 2HHHB 1QLNA 1GN3A 1YF2A 3CJHB 4QNHB 3ZMUA 2P22C 2WA4A 3E8GA 1W0JG 4YXWG 2AZ0A 1RSOB 2KKWA 4DV1B 1BHBA 1MMMA 4BR6A 4DV2B 5CN0A 1YTFB 4UVCA 2KSDA 4L87A 4DR1O 4PDLA 4PD4F 1CEZA 1NKDA 2BTQB 1SESA 2YEVB 4RUFA 1ZSPA 5DM6V 1PL0A 3WG7B 1MABG 1VIBA 1JJOA 4LR3A 2V4DA 4UCTA 4BWAA 5CBHA 4LF9B 5BR8B 1FXHA 4JYCA 4EB6B 4O4LB 2D3OW 3L70H 2DYSC 1Q6IA 2ZINA 2P4KA 5CA1A 1NJIW 1OCRB 1XMQO 4PI2A 4X1YA 1AI5A 3ZRVA 4B3SO 3OMAB 4GKJB 5KAFZ 2YC0A 4LF5O 4UCUA 3ICXA 3CCMV 1XILA 3C3TA 1SA0A 2OIGA 4JZ2A 2ZD9A 4J9ZB 4I55B 3A0RA 1IBMB 3D3IA 2F43G 3VQYA 2UUCB 3EHBB 5LGTA 4E4EA 4DV6O 1YJ9V 4KFMA 2VQEB 2WLKA 1AR1B 3SJQC 3RWRA 2ZE7A 1N8RW 5LOVA 1I7FA 2FTKA 2OCCB 1OHHG 3DTUB 4RWUA 3H9VA 2Q7GA 4ZOLA 5J9PC 5LP6A 2X6CA 4X62B 3T1YB 3M99B 5KX5A 5LMUO 2EZPA 5FPOA 3S3XA 5L3DA 2QKSA 4JI8B 4K0KO 1SS3A 1XNQB 3C90A 2OIEA 2ZDIA 2Q67A 1CXZB 1Q6UA 1N33O 3B40A 5LP6C 3RVYA 2Q9LA 4LP8A 5CBGA 3AG7A 3B77A 3ZMTA 5B1OA 1FPOA 4FPPA 2UXDO 5H6RA 2VWJA 2CH7A 2JK5C 4YY3O 3LUTB 2VQFB 1R3IC 4KHPO 4H44B 1YHQV 1IBKO 2DWDC 3B8MA 3DC5A 1KD1W 5H2FZ
chains in the Genus database with same CATH topology
4WBNA 3BRCA 4FLYA 1WNSA 3HKEA 5KHKA 3N2GB 4FLZA 2R9AA 2YI8A 5LA6A 1WN7A 4X64B 1TAEA 5KMGB 4FM1A 1XMQB 4DR2B 5JVDA 2YIBD 1RSOA 1QQCA 3N2KB 3RYIB 2PYJA 4B3SB 5BMVA 4LF5B 4TUYA 1S5JA 3CB2A 3MAQA 5EIBD 2BTQA 5ITZB 3ETQA 3RGBA 4ZHQB 1H2SB 3RYHA 4FLXA 3HKDA 3QG5A 4YJ3B 4ZI7A 3BPZA 4BW9A 4D7TA 4JYAB 1N32B 2Q7HA 5CB4B 3JASB 4DK0A 3WB2A 4UCRA 3JAWA 4I4TB 4HBNA 4CC5A 4EB6A 2QJ1A 1KMIZ 4O4LA 1YEWA 4NXMB 3CSXA 4O4JB 3VQXA 4EEQA 5LMUB 3K58A 2JS5A 4EFBA 4X1KB 3UT5B 4UCOA 3A2FA 4K0KB 1J5EB 4X1IA 4LF7B 1IK9A 5KX5B 2ZCEA 2IM9A 5C8YB 4FM2A 2F4VB 1JFFB 1N33B 5JH7B 3T1HB 4I55A 2RJZA 5D5PA 5CA0B 5J2UB 1O9HA 2PY5A 4UCSA 1M93A 5LMNB 1HNXB 1XQ8A 4UFZA 4FLUA 2UXDB 2ZIOA 1TUBA 4PHZA 5IYZB 4XA4A 4YY3B 4LNUB 5LXTA 4KHPB 1IBKB 5EYPB 4TV8A 3HKCB 2JGUA 4JI1B 4DV4B 3RYCB 4AILC 1N36B 4B3RB 1Q3EA 3RYFA 2RQ6A 1M5IA 3JALB 1TVKA 4X20B 3VQWA 1Q8IA 1O9GA 3JATA 4CH6A 2BTOA 4CS3A 3BHPA 1HNWB 5J2TB 1B04A 1Q5OA 3WB1A 1DGSA 1IBLB 2R72A 4UCVA 3K59A 1XHXA 4IHJA 2PYLA 1TGOA 5JJNB 1KU9A 3ZS8C 2UUAB 3PN1A 4FLWA 1X4TA 4I9QA 5CJ4A 2F93B 5IJ0B 4PI0A 4DRXA 2Q0AA 4O2BB 3RWRD 4TQDA 2UXCB 5JQGB 4TV9B 1Z5WA 2UU9B 3CHXA 4U3JA 1N34B 4LF8B 5JJJB 4JI7B 5IJ9B 4TOIA 4D7SA 5CA1B 4O2AB 1M4UA 4NVPA 4JI2B 5KHIA 4X1YB 3OTOB 3K5LA 2OYQA 3HKDB 4B3MB 3IAYA 5CJ0A 1SQGA 3N2GA 3E22B 5EZYA 4DR6B 4GLXA 4K8XA 4FLVA 4AQYB 1SA0B 2E3CA 5KMGA 3FFQA 4IIJA 4O4IB 2UUBB 4JI0B 3LNNA 2CAZC 3B2EE 2F1MA 2UXBB 3N2KA 3RYIA 2ZNIA 4DV5B 2PGGA 1FJGB 4JI4B 4HNAB 4DV3B 4L8JA 3MUDA 4YHHB 1VF7A 3SGIA 5ITZA 4ZHQA 5LOVB 2GV9A 1L8DA 3JARB 4ZOLB 5LP6B 4YJ3A 2ZIMA 4F6RB 2R70A 4LFBB 3JASA 3K5OA 5GONB 2YI9A 1ZAUA 1TA8A 4I4TA 2ZM6B 1TUBB 1FFXB 5KHJA 3UQ8A 4X65B 3U0ZA 4YJ2B 4DV0B 4O4JA 3HKBB 4LH6A 3II6A 1Z5VA 4X1KA 3U10A 3UT5A 3OTFA 1XNRB 4X66B 4LF6B 3JAKB 3U11A 1WPBA 3JSNA 1SKVA 5FNVB 4CH5A 4DR3B 5JJEB 1HNZB 1JFFA 4I50A 4O4HB 5JH7A 4DV7B 1QHTA 4TQFA 2E5LB 4FFBB 5CA0A 5J2UA 2JVDA 4WBNB 4GYCB 5LYJA 3JSLA 4CC6A 3QTCA 2EX3A 4DK1A 3HKEB 3SJBC 5IYZA 4JI5B 1P49A 1I94B 3K5MA 4FM0A 2HHHB 1JMKC 5LA6B 3K5NA 2YIAA 5EYPA 2P22C 3HKCA 3RYCA 5JVDB 4NXNB 2KKWA 5EIBC 4DV1B 3JALA 5BMVB 4DV2B 5KHGA 5JCOA 4TUYB 4DUYB 1XMOB 2BTQB 5J2TA 2XHBA 5EZYB 4LF4B 3RYHB 4DR4B 4ZI7B 1D5AA 4IIJB 4LH7A 3M7MX 1JJOA 4LR3A 2V4DA 4KL1A 4UCTA 4BWAA 1HW7A 4LF9B 4CH4A 5BR8B 1XHZA 3JAWB 2F95B 5IJ0A 1XI1A 4O2BA 4EB6B 4DR7B 5JQGA 4TV9A 1T5EA 4O4LB 5JCOC 1HR0B 3RFRA 3K57A 5IJ9A 2ZINA 5CA1A 4O2AA 4B3TB 5KHHA 3QF7A 3SJAC 4GKKB 4CH3A 1FU1A 4PI2A 4X1YA 1G6UA 4DR5B 4DV6B 4JI6B 3SJCC 3SR2A 4GKJB 4X1IB 3E22A 4UCUA 2VWKA 3ICXA 3BA8A 1SA0A 5FPRA 4O4IA 4Q6GA 2P5OA 5IWAB 4I55B 1IBMB 5CB4A 3VQYA 2UUCB 3THOA 2VQEB 3VQVA 4HNAA 3BABA 5LXTB 3RWRA 3SR2C 5LOVA 1V9PA 2F66C 1I7FA 4OX9B 4TV8B 4DUZB 1SQFA 2YIBA 3JARA 2Q7GA 4ZOLA 5LP6A 3DSQA 2OWOA 4CS4A 4X62B 3RYFB 4I50B 3T1YB 1TVKB 2PTMA 5KX5A 4LFCB 4F6RA 1Q43A 2HEPA 5D5QA 2ZNJA 5C8YA 2QM4A 5GONA 5LYJB 3JATB 5FPOA 4EFEA 4ZIBA 3BA9A 4JI8B 2YXLA 5K1PA 2PZSA 4CS2A 3BAAA 1XNQB 1FFXA 5K1XA 5CHXA 4JI3B 4AHCA 4YJ2A 2Q7EA 4IHJB 2PUSA 1NT2B 3HKBA 4LFAB 4LNUA 5LP6C 4DR1B 4JV5B 4FVMA 4DRXB 2VWJA 4K8ZA 3ZEDA 4B08A 3JAKA 3WB0A 4U3JB 5FNVA 2VQFB 4FLTA 4O4HA 4X20A 4FFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MUD A;  1M5I A;  2R9A A;  5CHX A;  3RWR A;  1IK9 A;  4XA4 A;  1KU9 A;  3SR2 A;  5CJ4 A;  5CJ0 A;  3SR2 C;  1FU1 A;  3II6 A;  3RWR D;  2QM4 A; 
#chains in the Genus database with same CATH topology
 2ZDI C;  3AG4 B;  4JI1 O;  4FLY A;  1XEQ A;  3N2G B;  4FLZ A;  3E83 A;  1RM1 C;  2ADP A;  1K33 A;  4R6Z A;  1HNW O;  1K3E A;  4DW1 A;  5LHH A;  1IZ3 A;  1P84 F;  4DR2 B;  2X6B A;  3AK1 A;  2PYJ A;  3ETD A;  1WP8 A;  2ETN A;  5BY1 A;  1QR8 A;  2EIK B;  2FL4 A;  2O57 A;  4TUY A;  1OCC B;  3GB7 C;  3VBB A;  3CB2 A;  3ZHT A;  3ASO B;  4HAM A;  4ZHQ B;  4HYO A;  2YUA A;  3RYH A;  2LW1 A;  3X2Q B;  5L3G A;  4WCE V;  3T2M A;  1OCZ B;  1KUQ A;  3JAS B;  1M57 C;  1IDS A;  3JD3 A;  1FXV A;  5IY5 C;  2DW4 A;  4I4T B;  5IDJ A;  4HBN A;  3RBZ A;  1RPO A;  4DR6 O;  1WLE A;  2QKA A;  3CSX A;  3EVK A;  1K7D A;  2ATK C;  4EEQ A;  1N0N A;  2ZE8 A;  1PNK A;  1US6 A;  2UXB O;  1PP9 H;  1YIT V;  4UCO A;  1QU7 A;  4X1I A;  4DV5 O;  3DXR B;  4LF7 B;  1KB9 F;  5KX5 B;  2P06 A;  1H8H G;  2Q6A A;  5L3C A;  1JFF B;  4C7U A;  4IT5 A;  3K79 A;  2FB5 A;  5H9C A;  1O9H A;  2PY5 A;  4UCS A;  3VOU A;  3K03 A;  4UFZ A;  2CUG A;  3LSS A;  2ZXW B;  5LXT A;  4DO2 A;  2EIL B;  1Z2G A;  2JJ2 G;  3JYC A;  2XAS A;  5EYP B;  2Y69 B;  1NVP D;  4TV8 A;  4MVM A;  1JVM A;  4GT1 A;  3RYF A;  4X65 O;  4DV0 O;  1AR5 A;  1M5I A;  3JAL B;  1SC5 B;  2WAM A;  1X59 A;  5BXZ A;  1O9G A;  3JAT A;  2Q0O C;  1XNR O;  1JPX A;  5J2T B;  1WJZ A;  2JS3 A;  2E75 B;  3IC7 A;  4WFE A;  1R1B A;  1MSW D;  3K59 A;  4IHJ A;  3IGA C;  4DV7 O;  1R73 A;  2XTA A;  2UUA B;  3AEI A;  4NYK A;  5HFM A;  3ASN C;  1ARO P;  2NNU A;  4DRX A;  2B1I A;  4O2B B;  4TQD A;  5IYC O;  1Z5W A;  2UU9 B;  1N34 B;  5IJ9 B;  3T4Z A;  1NVP B;  3ABL C;  4OPA A;  1R6N A;  3OTO B;  3K5L A;  3AG1 C;  3UO3 A;  2RN9 A;  4DV2 O;  2XAH A;  4GLX A;  3LNM B;  3ZRW B;  4IIJ A;  1XDC A;  2CGN A;  4JI0 B;  4GZR B;  2F1M A;  2XAF A;  1K9M W;  2HKO A;  1AI7 A;  2ZE5 A;  1H2L A;  3N27 A;  5KUK A;  3E2E A;  5L3E A;  4LF9 O;  4YHH B;  1W59 A;  3JD1 A;  5BR8 O;  1VF7 A;  1WB8 A;  3KCX A;  4YJ3 A;  1AB3 A;  5FL7 G;  1AI6 A;  1H8E G;  3TCU A;  2R70 A;  5GON B;  3UCS C;  1GO3 F;  3K06 A;  3CCJ V;  4UB6 Z;  1GRJ A;  2KB1 A;  4GKJ O;  2WPD G;  2E76 B;  1FFX B;  2XT9 A;  3U0Z A;  4MVR A;  5DEC A;  3OEE G;  1Q82 W;  3II6 A;  1IBM O;  3JCU Z;  2UUC O;  3UT5 A;  3OTF A;  4X66 B;  4LF6 B;  1CPY A;  2VQE O;  3OUF A;  2G38 A;  3JAK B;  3U11 A;  1WPB A;  3JSN A;  2YDE A;  5JJE B;  2X0L A;  3IC9 A;  5E1A C;  1S5H C;  4I50 A;  4O4H B;  5B1B C;  1QHT A;  2E5L B;  5CA0 A;  3OAA G;  4WBN B;  4GYC B;  3BVO A;  2OCH A;  1K5S A;  3T1Y O;  5IYZ A;  4JI5 B;  1Y66 A;  5B3S B;  1I94 B;  3ABM B;  1HNZ O;  4JI8 O;  3ZMZ A;  4WFA V;  5LHI A;  1XNQ O;  1YSC A;  3A0B Z;  1SQV H;  5EIB C;  1AP5 A;  2JIZ G;  4MVU A;  5B1A B;  3OFN G;  2EBO A;  5A2Q N;  3SYP A;  5KHG A;  3SYQ A;  2Y48 A;  4JTD B;  3CCU V;  1XMO B;  1JA8 A;  4U7N A;  2DOS A;  3A8T A;  3O65 A;  1VQO V;  2XHB A;  2FML A;  4J7Z A;  4ZI7 B;  1D5A A;  2VQF O;  4GX5 A;  1Y76 A;  4QIW F;  4IIJ B;  4LH7 A;  5BZB A;  1DF4 A;  1HW7 A;  4DUY O;  2NN4 A;  4UB8 Z;  5IJ0 A;  4UVB A;  2EIM B;  4DR7 B;  1E1Q G;  4TV9 A;  1T5E A;  1KBH A;  3Q4H A;  3F5W C;  1B3Q A;  3P3N A;  1K8A W;  1LUW A;  4QPJ A;  4O2A A;  2OTL V;  5LBQ A;  5KHH A;  4GKK B;  3SJA C;  2XND G;  2DE0 X;  2HG5 C;  3AG2 B;  2GUZ B;  4MW8 A;  4DR2 O;  1RFY A;  1G6U A;  2IJJ A;  1NR7 A;  4DR5 B;  2W6I G;  4PDR A;  5LL6 Y;  1KKD A;  3SJC C;  3SR2 A;  2P90 A;  1KEC A;  3E22 A;  2W0F C;  1S0V A;  2IH3 C;  4O4I A;  3OW2 U;  4J7K A;  2P5O A;  1VQ4 V;  1I5X A;  3W7T A;  4I5S A;  3CWB H;  4IL6 Z;  2XUM A;  2YS8 A;  3KCY A;  3WU2 Z;  1Q6H A;  3CYO A;  4JTC B;  1UPG A;  4HNA A;  3P3P A;  5GW7 A;  3IFX A;  3SR2 C;  2ODM A;  1G8M A;  1V9P A;  4IYH A;  2YIB A;  3JAR A;  1FD9 A;  4J10 A;  1VQL V;  2EIJ C;  2JEU A;  4I50 B;  5C93 A;  2XOK G;  2PTM A;  3QNE A;  2Y3V A;  2HEP A;  4MTX A;  5C8Y A;  2QM4 A;  3F5T A;  3ZIA G;  5K1P A;  2PZS A;  4OX9 O;  1NH2 D;  3HR0 A;  4LC1 A;  3W7S A;  4LF7 O;  2RDC A;  2QSA A;  3MD0 A;  3LDE A;  4JI3 B;  1NTK H;  3NXS A;  3B09 A;  3W7X A;  1OV9 A;  1ZLZ A;  1NTZ H;  4LNU A;  2KG7 B;  1OZ0 A;  4DW0 A;  1K73 W;  4ASU G;  4K8Z A;  3FKS G;  4B08 A;  4OXS A;  4QGP A;  4U3J B;  1JOY A;  2ILM A;  2AW9 A;  2QE7 G;  3KKY A;  4WFF A;  4LFA O;  3FX7 A;  4P9P A;  1K4C C;  3R66 A;  3K0D A;  4OGQ B;  3BRC A;  2JGD B;  1WNS A;  1BCC H;  3HKE A;  2GHY A;  3L75 H;  4GX2 A;  3CRR A;  2QWP B;  2YI8 A;  1QVF U;  5LA6 A;  1LR1 A;  2C2A A;  1TAE A;  2IU3 A;  1R3J C;  4FFK A;  1NH2 B;  2HP8 A;  4TT3 G;  5JVD A;  3Q4H B;  2YIB D;  4WFH A;  3N2K B;  3RYI B;  1ZL8 B;  1QLE B;  5BMV A;  3KZI Z;  2UUA O;  4UV8 A;  4MTG A;  4PV1 B;  1YJW V;  4HZ3 A;  3MAQ A;  1XOU A;  5ITZ B;  3RGB A;  3I55 V;  2VS0 A;  1IUR A;  2UU9 O;  3HPL C;  1FXK A;  1N34 O;  1L0L H;  3HKD A;  4BW9 A;  2HJD A;  4D7T A;  2CGO A;  2EJ7 A;  1NI8 A;  3E8B A;  2ZR3 A;  1Y4M A;  2Y3W A;  3OTO O;  1IXB A;  3JAW A;  4ICG A;  1VQK V;  1SQP H;  5LGU A;  1KMI Z;  2A06 H;  2EIN C;  4NXM B;  1M56 C;  4W4L A;  5KLV H;  5IYD O;  3MDS A;  2Q68 A;  4JI0 O;  4JF3 A;  1LUV A;  1FXK C;  3K58 A;  2JS5 A;  3FB8 C;  4X1K B;  3TGU H;  3DGE A;  2IJI A;  5H5N A;  1V54 C;  2N04 A;  1YI2 V;  1IK9 A;  1VF6 A;  2DYR C;  5C8Y B;  4YHH O;  4P30 A;  4TWK A;  5JH7 B;  1R6K A;  2Y4T A;  2HLD G;  1BT8 A;  5IT9 N;  3T1H B;  3K0G A;  4PEL A;  4NKG B;  1M93 A;  2KQX A;  5LMN B;  1Y74 A;  4LNU B;  3ZN1 A;  4JYB A;  1KQS U;  2BSK A;  3E89 A;  2JEX A;  1S77 D;  1JQ0 A;  1WAZ A;  1VF6 C;  4DV4 B;  1N36 B;  4B3R B;  1BMF G;  2RQ6 A;  1TVK A;  3VQW A;  2CE4 A;  1GM9 A;  4F4L A;  4PA6 A;  2DYS B;  2MW2 B;  4X66 O;  3AK2 A;  3CXH F;  4LF6 O;  1B04 A;  4P9O A;  3WB1 A;  1EBO A;  2ZT9 B;  3JD0 A;  3ZX6 A;  1IBL B;  2WLL A;  4R7C A;  1XHX A;  4JZG A;  4GFC A;  2PYL A;  3RT3 C;  1SQB H;  3SPG A;  1KYO F;  2F93 B;  1RP3 B;  2A3Q A;  3RWR D;  5A9G A;  1FKA O;  1S5L Z;  4IGG A;  5JJJ B;  4JI7 B;  1MG1 A;  1ZX3 A;  5CA1 B;  3KG2 A;  1W0K G;  4XDJ A;  1YIJ V;  4X88 A;  5B5E Z;  3ZRX A;  1XRE A;  1WA8 A;  1Q90 D;  3ZMV A;  4X1Y B;  3E8H A;  3HKD B;  4B3M B;  4X8A A;  1EM1 A;  1V54 B;  1MA1 A;  4GX0 A;  5EBL C;  2UXC O;  4WF9 V;  3F7V C;  4LF8 O;  4K8X A;  3P30 A;  4FZ0 A;  2XAQ A;  4FLV A;  1XMO O;  4AQY B;  5DED A;  1SA0 B;  5KMG A;  3CCQ V;  2UUB B;  2CTR A;  4H13 B;  2CAZ C;  1D5N A;  1V55 C;  3ZCC A;  4GCZ A;  1N0J A;  4NTW A;  3JCZ A;  1DTO A;  1AVM A;  1FJG B;  4JI4 B;  3MHS C;  4PA4 A;  1NS1 A;  4DV3 B;  3SPH A;  3D36 A;  3SGI A;  5LOV B;  2GV9 A;  4DR7 O;  1IVS A;  4ZOL B;  5LP6 B;  2A0L A;  2QTO A;  4GKK O;  4JPR A;  4JYY A;  2IU0 A;  4J41 A;  3E86 A;  2YI9 A;  2LFR A;  4DR5 O;  1TA8 A;  1K5Q A;  2ZM6 B;  1AJN A;  5B1N A;  1M1K W;  1I0H A;  3UQ8 A;  4JAA A;  1P4R A;  2BSK B;  4O4J A;  3D36 C;  1VF5 B;  4I0X A;  1Q86 W;  2WLI A;  1K97 A;  1RM1 B;  1GAX A;  3PJS K;  5EC2 C;  1XUQ A;  4LBE C;  1GKF A;  3FYI B;  4RO2 A;  2CH7 B;  4W4K A;  3S3W A;  3OGC C;  3TJT A;  2ITD C;  2GTS A;  5J2U A;  3LDD A;  3G4S V;  1VQN V;  4JTA B;  5LYJ A;  4CC6 A;  1SET A;  3QTC A;  3SJB C;  5GTH Z;  1E1R G;  4XDK A;  1P49 A;  3K5M A;  1COW G;  4DR3 O;  1JMK C;  2LQT A;  3RN4 A;  2CTW A;  2HJF C;  2QEX V;  1DLB A;  1GM7 A;  2EJR A;  1YDX A;  3HKC A;  3CRC A;  3RYC A;  4NXN B;  1M57 B;  4JI3 O;  5IY5 B;  3ABK C;  4J7J A;  2LFS A;  4LWS A;  2K1E A;  1H2N A;  1OCO C;  2HHH O;  4TUY B;  4CKP A;  2WA3 A;  3GWK C;  1KP3 A;  4RUE A;  1NR1 A;  3RYH B;  4DR4 B;  2UXN A;  4DV1 O;  3LDC A;  5L3F A;  3M7M X;  4MTF A;  1ORQ C;  2P7T C;  2QM7 A;  1QR9 A;  2GDS A;  1EZV H;  3ABT A;  2F95 B;  1XI1 A;  2IBZ H;  1SER A;  5JQG A;  1BE3 H;  1HR0 B;  3RFR A;  4CZZ A;  4B3T B;  3QF7 A;  4GEU A;  3CC2 V;  1FU1 A;  1BSM A;  3QO8 A;  3AK3 A;  4UV9 A;  3FAV A;  4F6E A;  4U3F H;  4MVQ A;  4JI6 B;  1ROP A;  4J42 A;  4DV6 B;  1RPR A;  2QM8 A;  4X1I B;  4UXN A;  2VWK A;  3BA8 A;  2YSU B;  4Q6G A;  1BQ0 A;  3K3W A;  4NTY A;  2Y0P A;  1BZK A;  3FB7 C;  4BAY A;  5LGN A;  2IW5 A;  1R6T A;  2IJK A;  4I0X B;  3JD2 A;  2GBO A;  4PJ0 Z;  3ML0 A;  3BAB A;  2IH1 C;  5LXT B;  1UJW B;  1GN4 A;  1K34 A;  1URF A;  1G4Y B;  4KP4 A;  2QWQ B;  3G6E V;  2F66 C;  4TV8 B;  3GVM A;  4NXM O;  2IJH A;  1B06 A;  4GUN A;  3ASN B;  4CS4 A;  3RYF B;  3OE7 G;  2EZO A;  5CA3 A;  4LFC B;  4F6R A;  5D5Q A;  4WFB V;  5LYJ B;  2BOB C;  3JAT B;  3K08 A;  3TXQ A;  3F7Y C;  3CD6 V;  1AJQ A;  4CS2 A;  3BAA A;  3ABL B;  4X62 O;  4YJ2 A;  1SQQ H;  4IHJ B;  1MNG A;  3STL C;  3AG1 B;  1NT2 B;  3HKB A;  3T1H O;  5KUM A;  1U96 A;  2P6J A;  2HVJ C;  1Y67 A;  4JV5 B;  4FVM A;  1VQ9 V;  1A32 A;  4DRX B;  3ZED A;  3WB0 A;  1D2D A;  5FNV A;  3FD9 A;  2QGN A;  4LCU C;  4GEX A;  1PL4 A;  4KXR A;  2ZR2 A;  4X20 A;  4FFB A;  1VQ8 V;  4XBF A;  4DV4 O;  3K04 A;  4KUM A;  2A7W A;  4R50 A;  1N36 O;  3CC4 V;  4MVS A;  4B3R O;  5KHK A;  2R9A A;  5GTI Z;  1R3L C;  2NLJ C;  2D2C B;  3CJH A;  3W7W A;  2OT5 A;  4X64 B;  2ARH A;  2PI5 A;  2LP7 A;  1NQT A;  3BCC H;  2FKX A;  1N4C A;  4YIO A;  1IBL O;  1RSO A;  1QQC A;  2AXT Z;  3J80 N;  3QO7 A;  1QVG U;  1S5J A;  5EIB D;  2BTQ A;  1YJN V;  2YEV A;  2H3O A;  2QA4 V;  4G2K A;  1H2S B;  4FLX A;  3AG3 C;  3BFR A;  3QG5 A;  4YJ3 B;  3UO2 A;  4JYA B;  1UFI A;  1N32 B;  4H33 A;  4QJF B;  3CRA A;  4FZ1 A;  1PNM A;  5E79 Z;  4DK0 A;  1VP7 A;  2W6J G;  4B3M O;  3OM3 B;  5B1B B;  2K9P A;  1LNQ A;  4CC5 A;  2XAJ A;  4EB6 A;  2B9Z A;  3IJ4 A;  4O4L A;  4PA3 A;  1NU1 H;  1QCE A;  4AQY O;  3OMI B;  3G6B A;  3VQX A;  2UUB O;  2QTS A;  2Z5U A;  3RW0 A;  3WG7 C;  2XAG A;  3UT5 B;  3B8N A;  4BIZ A;  1J5E B;  3H1H H;  2Q73 A;  1FJG O;  4JI4 O;  1S72 V;  4H37 A;  2ZCE A;  1MSD A;  2IM9 A;  4DV3 O;  3CE2 A;  3ZHV A;  2F4V B;  1PD3 A;  3L73 H;  4I55 A;  5CA0 B;  4FJC C;  4FMT A;  1YXB A;  1HNX B;  1XQ8 A;  1OCR C;  2V7Q G;  4FLU A;  4CKM A;  4PHZ A;  4RAI A;  5IYZ B;  4JAS A;  1EFR G;  4H0L B;  1SZX A;  2CK3 G;  2QR4 A;  4QE9 A;  2ZM6 O;  3EXA A;  5EBM C;  4J80 A;  1Q3E A;  4FIP C;  2Q5Z A;  3CCV V;  4X20 B;  2AHY A;  4NTX A;  1Q8I A;  3G71 V;  2BTO A;  1QNM A;  3QO5 A;  4IYI A;  3ZMS A;  1Q5O A;  1MZF A;  2JDI G;  2R72 A;  1FFT B;  1CP9 A;  2BE3 A;  4G79 A;  1Y76 B;  2OCC C;  4P2Z A;  1IXM A;  3ZS8 C;  3PN1 A;  4TSF G;  3ZN0 A;  1X4T A;  1VQP V;  4I9Q A;  1G1X B;  4J9Y B;  5IJ0 B;  2Q0A A;  1JX9 A;  1L1F A;  4TV9 B;  3CHX A;  1Q7Y W;  4TOI A;  4O2A B;  1M4U A;  4NVP A;  4JI2 B;  1PNL A;  2M6Y A;  1P7B A;  1L0N H;  4NXN O;  2OYQ A;  1TUE B;  3IAY A;  4Z1M G;  1SQX H;  3N2G A;  4UVA A;  1R3K C;  3JAM N;  3E22 B;  5EZY A;  2EIJ B;  3D3Q A;  2E3C A;  3FFQ A;  4O4I B;  4NR1 A;  1F23 A;  3B2E E;  3CCL V;  2YIC A;  2CDY A;  4DR4 O;  3L71 H;  3CXC U;  2P67 A;  1H2K A;  2PGG A;  4HNA B;  3C3S A;  4MVO A;  3AG4 C;  4L8J A;  3MUD A;  3ETG A;  3OR7 C;  2L35 A;  4ZHQ A;  1L8D A;  3JAR B;  1KKC A;  2Y4U A;  4MSW C;  1HR0 O;  2BCC H;  3ZHU A;  4B3T O;  2YXH A;  5CBF A;  3W7U A;  2Y0I A;  4LFB B;  3JAS A;  4WFG A;  2R9I A;  4BW5 A;  3FB5 C;  3TET A;  3E35 A;  4I4T A;  2Z3Y A;  4JI6 O;  3CCR V;  4JGS A;  1XL4 A;  1M90 W;  1H2G A;  2EIK C;  2MK3 A;  5KHJ A;  1THZ A;  1DK1 A;  1OCC C;  1PV0 A;  1EZJ A;  3OEH G;  3ASO C;  1K4D C;  1Z5V A;  3X2Q C;  2NR5 A;  1H2M A;  1GTO A;  3U10 A;  4QPK A;  5EC1 C;  2DQ3 A;  2Q69 A;  3DXR A;  1OCZ C;  3FYE B;  4JAU A;  3LSQ A;  5KA6 A;  1OJH A;  2JRI A;  1HNZ B;  1JFF A;  2ITC C;  2UXX A;  1YZB A;  3K9S A;  4TQF A;  2PF4 E;  5FLX N;  3SPC A;  3JSL A;  2DMX A;  1NBM G;  2GTA A;  2WLM A;  3LSU A;  2ZQM A;  3HKE B;  1VQ5 V;  5F2V O;  2LGQ A;  5DN6 G;  4LFC O;  1NZ6 A;  5LA6 B;  2N05 A;  3EFF K;  3NR7 A;  3UKM A;  3K5N A;  2QWN B;  2YIA A;  5EYP A;  2X7R B;  5JWP A;  2E5L O;  2RMK B;  2P4V A;  1HP8 A;  1SRY A;  2QWR B;  1WB7 A;  3H1L H;  5JVD B;  3O9O A;  4QE7 A;  2A79 B;  3GWO A;  3JAL A;  3CEI A;  3ZRS A;  5BMV B;  4JI5 O;  1I94 O;  2EIN B;  5JCO A;  4DUY B;  1Q81 W;  1M56 B;  4JV5 O;  1S76 D;  5J2T A;  3ZHS A;  3K9A A;  5EZY B;  4LF4 B;  1FXK B;  2ZXW C;  2EIL C;  1YCI A;  2WLN A;  5IYB O;  2Y69 C;  1MZE A;  2DYR B;  4KL1 A;  4CH4 A;  3SYO A;  1XHZ A;  3JAW B;  1FAF A;  4O2B A;  3B4S A;  2QDO A;  2W0X A;  3BY6 A;  4YIP A;  4GFA A;  5JCO C;  3K57 A;  5IJ9 A;  1AJP A;  4X64 O;  4E2L A;  4CH3 A;  4N21 A;  1QBZ A;  4N23 A;  2DJV A;  2DQ0 A;  1ZUQ A;  3OMN B;  2AGA A;  3I5D A;  2QWO B;  4PDM A;  2WLH A;  2X6A A;  3ZRW A;  5FPR A;  1HWY A;  3SPJ A;  5IWA B;  2JJ1 G;  2F23 A;  5CB4 A;  1WP7 A;  4JYA O;  1N32 O;  1Y74 B;  3Q0X A;  3THO A;  3HB3 B;  3VQV A;  3MHH C;  3CC7 V;  2OTJ V;  4J11 A;  1VEW A;  4OX9 B;  4DUZ B;  1SQF A;  3OR6 C;  3DSQ A;  2OWO A;  3ZJZ A;  4PA7 A;  3STZ C;  4X89 A;  1TVK B;  3J81 N;  2HR3 A;  1Q43 A;  2L6L A;  2ZNJ A;  3SYA A;  2N74 A;  1F4M A;  5GON A;  1GN6 A;  4EFE A;  4ZIB A;  3OD4 A;  3BA9 A;  2YXL A;  1J5E O;  1FFX A;  3PYI A;  5K1X A;  5CHX A;  5KA5 A;  4AI8 A;  2WLL B;  4AHC A;  1SF9 A;  1E79 G;  2F4V O;  1BHA A;  2Q7E A;  2YID A;  2PUS A;  4PA9 A;  2HFE C;  4LFA B;  2LW7 A;  2DWE C;  1EN5 A;  4ABM A;  4DR1 B;  3Q0Y A;  2B5U A;  1HNX O;  1W2B U;  3JD4 A;  1P7G A;  3CCE V;  3OGI B;  2B1G A;  3TXS A;  3JAK A;  1GH6 A;  3APQ A;  1V55 B;  3CRQ A;  2QKC A;  4FLT A;  4O4H A;  2HVK C;  1WA8 B;  3ABU A;  4WBN A;  4MW3 A;  2LO1 A;  1ENV A;  1JJ2 U;  4GX1 A;  4U7O A;  2A9H A;  1KP2 A;  1VQ6 V;  3J7A U;  2R9R B;  1WN7 A;  2DN9 A;  5H6Q A;  5KMG B;  1ZTE A;  1Y6X A;  4FM1 A;  1F7Y A;  1XMQ B;  1J95 A;  1EN4 A;  3H01 A;  2Q8V A;  3CS5 A;  1GN2 A;  3L74 H;  3CPW U;  4UUJ C;  4B3S B;  3L9D A;  3CME V;  4LF5 B;  4K35 A;  3CX5 F;  5EBW C;  4B7K A;  3ETQ A;  4ZBM A;  1PKX A;  5B3S C;  4RQE A;  1K92 A;  3ABM C;  4ZI7 A;  3BPZ A;  4MVZ A;  2Q7H A;  2YXY A;  3L72 H;  5TIS Z;  4JI2 O;  1I5Y A;  1BQZ A;  5CB4 B;  3OUS A;  3WB2 A;  4UCR A;  4NB5 A;  5B1A C;  2QJ1 A;  5AG2 A;  1YEW A;  1GK9 A;  2WSS G;  2ZE6 A;  1H38 A;  4Z2W A;  4O4J B;  2WLI B;  1VQM V;  2GUZ A;  3SDL A;  5LMU B;  3E8F A;  4X9Q A;  4EFB A;  3A2F A;  4K0K B;  1VQ7 V;  3G80 A;  3T4D A;  1BS3 A;  4FK5 C;  2VRZ A;  3APO A;  4BIU A;  3A0H Z;  5IE9 A;  4FM2 A;  2CTQ A;  3ABK B;  1N33 B;  4G27 B;  3I56 V;  4B7E A;  2EIM C;  1GM8 A;  2RJZ A;  5D5P A;  5J2U B;  1OCO B;  5EK0 A;  2UXD B;  1KC8 W;  2H94 A;  2ZIO A;  1TUB A;  4XA4 A;  3AG2 C;  4BIO A;  1AP6 A;  4YY3 B;  4LFB O;  3QVN A;  4RQF A;  4KHP B;  1IBK B;  1AIL A;  4XDL A;  2Q4P A;  1AR4 A;  4I7Z B;  1YVW A;  3HKC B;  2JGU A;  4JI1 B;  3RYC B;  4AIL C;  5LMN O;  1EN6 A;  4G28 B;  1S3J A;  1M9N A;  1BGY H;  1NTM H;  2CTP A;  4LWS B;  1DF5 A;  3H1J H;  1PM9 A;  4CH6 A;  1SZT A;  1FS0 G;  4CS3 A;  3BHP A;  1HNW B;  4MS2 A;  3T1C A;  1DGS A;  4UCV A;  4DYL A;  1AI4 A;  2H8P C;  1TGO A;  5JJN B;  1KU9 A;  5CMU A;  1GMG A;  1JR9 A;  5KAI Z;  2KG7 A;  4FLW A;  5CJ4 A;  3P32 A;  2FYU H;  2GSM B;  1HDJ A;  4PI0 A;  1IX9 A;  2PI4 A;  1WPX A;  2EUL A;  2UXC B;  5JQG B;  4U3J A;  4ZKI A;  3CMA V;  4MTO A;  4LF8 B;  4D7S A;  5KHI A;  2AHZ A;  3FB6 C;  4MT8 A;  3G67 A;  2E74 B;  2JGD A;  5HFL A;  3FAV B;  5CJ0 A;  1SQG A;  3CP1 A;  3R65 A;  3CCS V;  4DR6 B;  2ZKO A;  3ZBH A;  2V1D A;  4JI7 O;  5LHG A;  3LNN A;  4LF4 O;  2RCV A;  2RNB A;  2UXB B;  3N2K A;  3RYI A;  4R8C A;  1ZL8 A;  3CRM A;  2ZNI A;  4DV5 B;  1F51 A;  2WLJ A;  4Z1V A;  4EKW A;  5ITZ A;  4Q20 A;  1F4N A;  2LJ2 A;  2ADQ B;  3H1I H;  4K3A A;  4DXW A;  5B66 Z;  3DC6 A;  2ZIM A;  4JAV A;  1ZWI C;  4A5U B;  3ETE A;  5L3B A;  4F6R B;  3D8C A;  3K5O A;  1XL6 A;  2WWW A;  1ZAU A;  2LGW A;  1QLE C;  2Z0A A;  1TUB B;  2BOC C;  1MOF A;  2M7W A;  3OT7 A;  4I9W A;  4X65 B;  4DV0 B;  4YJ2 B;  4OPH A;  3HKB B;  4LH6 A;  5IWA O;  1XBL A;  1YTF D;  1BL8 A;  3ZHQ A;  4X1K A;  1XNR B;  1VMG A;  3SPI A;  1JCH A;  4D6T H;  3SYC A;  2AZ2 A;  3BEH A;  3M8A A;  4PDV A;  1SKV A;  5FNV B;  4CH5 A;  4DR3 B;  1I08 A;  1VAR A;  5JH7 A;  4DV7 B;  4FFB B;  3RVZ A;  1B6Q A;  3TK1 A;  2JVD A;  4DUZ O;  3ZHR A;  4CKN A;  2EX3 A;  4DK1 A;  4CBC A;  1PPJ H;  3WFV A;  3UM7 A;  4FM0 A;  1FYJ A;  1U97 A;  3AG3 B;  3H1K H;  2HHH B;  1QLN A;  1GN3 A;  1YF2 A;  3CJH B;  4QNH B;  3ZMU A;  2P22 C;  2WA4 A;  3E8G A;  1W0J G;  4YXW G;  2AZ0 A;  1RSO B;  2KKW A;  4DV1 B;  1BHB A;  1MMM A;  4BR6 A;  4DV2 B;  5CN0 A;  1YTF B;  4UVC A;  2KSD A;  4L87 A;  4DR1 O;  4PDL A;  4PD4 F;  1CEZ A;  1NKD A;  2BTQ B;  1SES A;  2YEV B;  4RUF A;  1ZSP A;  5DM6 V;  1PL0 A;  3WG7 B;  1MAB G;  1VIB A;  1JJO A;  4LR3 A;  2V4D A;  4UCT A;  4BWA A;  5CBH A;  4LF9 B;  5BR8 B;  1FXH A;  4JYC A;  4EB6 B;  4O4L B;  2D3O W;  3L70 H;  2DYS C;  1Q6I A;  2ZIN A;  2P4K A;  5CA1 A;  1NJI W;  1OCR B;  1XMQ O;  4PI2 A;  4X1Y A;  1AI5 A;  3ZRV A;  4B3S O;  3OMA B;  4GKJ B;  5KAF Z;  2YC0 A;  4LF5 O;  4UCU A;  3ICX A;  3CCM V;  1XIL A;  3C3T A;  1SA0 A;  2OIG A;  4JZ2 A;  2ZD9 A;  4J9Z B;  4I55 B;  3A0R A;  1IBM B;  3D3I A;  2F43 G;  3VQY A;  2UUC B;  3EHB B;  5LGT A;  4E4E A;  4DV6 O;  1YJ9 V;  4KFM A;  2VQE B;  2WLK A;  1AR1 B;  3SJQ C;  3RWR A;  2ZE7 A;  1N8R W;  5LOV A;  1I7F A;  2FTK A;  2OCC B;  1OHH G;  3DTU B;  4RWU A;  3H9V A;  2Q7G A;  4ZOL A;  5J9P C;  5LP6 A;  2X6C A;  4X62 B;  3T1Y B;  3M99 B;  5KX5 A;  5LMU O;  2EZP A;  5FPO A;  3S3X A;  5L3D A;  2QKS A;  4JI8 B;  4K0K O;  1SS3 A;  1XNQ B;  3C90 A;  2OIE A;  2ZDI A;  2Q67 A;  1CXZ B;  1Q6U A;  1N33 O;  3B40 A;  5LP6 C;  3RVY A;  2Q9L A;  4LP8 A;  5CBG A;  3AG7 A;  3B77 A;  3ZMT A;  5B1O A;  1FPO A;  4FPP A;  2UXD O;  5H6R A;  2VWJ A;  2CH7 A;  2JK5 C;  4YY3 O;  3LUT B;  2VQF B;  1R3I C;  4KHP O;  4H44 B;  1YHQ V;  1IBK O;  2DWD C;  3B8M A;  3DC5 A;  1KD1 W;  5H2F Z; 
#chains in the Genus database with same CATH homology
 4WBN A;  3BRC A;  4FLY A;  1WNS A;  3HKE A;  5KHK A;  3N2G B;  4FLZ A;  2R9A A;  2YI8 A;  5LA6 A;  1WN7 A;  4X64 B;  1TAE A;  5KMG B;  4FM1 A;  1XMQ B;  4DR2 B;  5JVD A;  2YIB D;  1RSO A;  1QQC A;  3N2K B;  3RYI B;  2PYJ A;  4B3S B;  5BMV A;  4LF5 B;  4TUY A;  1S5J A;  3CB2 A;  3MAQ A;  5EIB D;  2BTQ A;  5ITZ B;  3ETQ A;  3RGB A;  4ZHQ B;  1H2S B;  3RYH A;  4FLX A;  3HKD A;  3QG5 A;  4YJ3 B;  4ZI7 A;  3BPZ A;  4BW9 A;  4D7T A;  4JYA B;  1N32 B;  2Q7H A;  5CB4 B;  3JAS B;  4DK0 A;  3WB2 A;  4UCR A;  3JAW A;  4I4T B;  4HBN A;  4CC5 A;  4EB6 A;  2QJ1 A;  1KMI Z;  4O4L A;  1YEW A;  4NXM B;  3CSX A;  4O4J B;  3VQX A;  4EEQ A;  5LMU B;  3K58 A;  2JS5 A;  4EFB A;  4X1K B;  3UT5 B;  4UCO A;  3A2F A;  4K0K B;  1J5E B;  4X1I A;  4LF7 B;  1IK9 A;  5KX5 B;  2ZCE A;  2IM9 A;  5C8Y B;  4FM2 A;  2F4V B;  1JFF B;  1N33 B;  5JH7 B;  3T1H B;  4I55 A;  2RJZ A;  5D5P A;  5CA0 B;  5J2U B;  1O9H A;  2PY5 A;  4UCS A;  1M93 A;  5LMN B;  1HNX B;  1XQ8 A;  4UFZ A;  4FLU A;  2UXD B;  2ZIO A;  1TUB A;  4PHZ A;  5IYZ B;  4XA4 A;  4YY3 B;  4LNU B;  5LXT A;  4KHP B;  1IBK B;  5EYP B;  4TV8 A;  3HKC B;  2JGU A;  4JI1 B;  4DV4 B;  3RYC B;  4AIL C;  1N36 B;  4B3R B;  1Q3E A;  3RYF A;  2RQ6 A;  1M5I A;  3JAL B;  1TVK A;  4X20 B;  3VQW A;  1Q8I A;  1O9G A;  3JAT A;  4CH6 A;  2BTO A;  4CS3 A;  3BHP A;  1HNW B;  5J2T B;  1B04 A;  1Q5O A;  3WB1 A;  1DGS A;  1IBL B;  2R72 A;  4UCV A;  3K59 A;  1XHX A;  4IHJ A;  2PYL A;  1TGO A;  5JJN B;  1KU9 A;  3ZS8 C;  2UUA B;  3PN1 A;  4FLW A;  1X4T A;  4I9Q A;  5CJ4 A;  2F93 B;  5IJ0 B;  4PI0 A;  4DRX A;  2Q0A A;  4O2B B;  3RWR D;  4TQD A;  2UXC B;  5JQG B;  4TV9 B;  1Z5W A;  2UU9 B;  3CHX A;  4U3J A;  1N34 B;  4LF8 B;  5JJJ B;  4JI7 B;  5IJ9 B;  4TOI A;  4D7S A;  5CA1 B;  4O2A B;  1M4U A;  4NVP A;  4JI2 B;  5KHI A;  4X1Y B;  3OTO B;  3K5L A;  2OYQ A;  3HKD B;  4B3M B;  3IAY A;  5CJ0 A;  1SQG A;  3N2G A;  3E22 B;  5EZY A;  4DR6 B;  4GLX A;  4K8X A;  4FLV A;  4AQY B;  1SA0 B;  2E3C A;  5KMG A;  3FFQ A;  4IIJ A;  4O4I B;  2UUB B;  4JI0 B;  3LNN A;  2CAZ C;  3B2E E;  2F1M A;  2UXB B;  3N2K A;  3RYI A;  2ZNI A;  4DV5 B;  2PGG A;  1FJG B;  4JI4 B;  4HNA B;  4DV3 B;  4L8J A;  3MUD A;  4YHH B;  1VF7 A;  3SGI A;  5ITZ A;  4ZHQ A;  5LOV B;  2GV9 A;  1L8D A;  3JAR B;  4ZOL B;  5LP6 B;  4YJ3 A;  2ZIM A;  4F6R B;  2R70 A;  4LFB B;  3JAS A;  3K5O A;  5GON B;  2YI9 A;  1ZAU A;  1TA8 A;  4I4T A;  2ZM6 B;  1TUB B;  1FFX B;  5KHJ A;  3UQ8 A;  4X65 B;  3U0Z A;  4YJ2 B;  4DV0 B;  4O4J A;  3HKB B;  4LH6 A;  3II6 A;  1Z5V A;  4X1K A;  3U10 A;  3UT5 A;  3OTF A;  1XNR B;  4X66 B;  4LF6 B;  3JAK B;  3U11 A;  1WPB A;  3JSN A;  1SKV A;  5FNV B;  4CH5 A;  4DR3 B;  5JJE B;  1HNZ B;  1JFF A;  4I50 A;  4O4H B;  5JH7 A;  4DV7 B;  1QHT A;  4TQF A;  2E5L B;  4FFB B;  5CA0 A;  5J2U A;  2JVD A;  4WBN B;  4GYC B;  5LYJ A;  3JSL A;  4CC6 A;  3QTC A;  2EX3 A;  4DK1 A;  3HKE B;  3SJB C;  5IYZ A;  4JI5 B;  1P49 A;  1I94 B;  3K5M A;  4FM0 A;  2HHH B;  1JMK C;  5LA6 B;  3K5N A;  2YIA A;  5EYP A;  2P22 C;  3HKC A;  3RYC A;  5JVD B;  4NXN B;  2KKW A;  5EIB C;  4DV1 B;  3JAL A;  5BMV B;  4DV2 B;  5KHG A;  5JCO A;  4TUY B;  4DUY B;  1XMO B;  2BTQ B;  5J2T A;  2XHB A;  5EZY B;  4LF4 B;  3RYH B;  4DR4 B;  4ZI7 B;  1D5A A;  4IIJ B;  4LH7 A;  3M7M X;  1JJO A;  4LR3 A;  2V4D A;  4KL1 A;  4UCT A;  4BWA A;  1HW7 A;  4LF9 B;  4CH4 A;  5BR8 B;  1XHZ A;  3JAW B;  2F95 B;  5IJ0 A;  1XI1 A;  4O2B A;  4EB6 B;  4DR7 B;  5JQG A;  4TV9 A;  1T5E A;  4O4L B;  5JCO C;  1HR0 B;  3RFR A;  3K57 A;  5IJ9 A;  2ZIN A;  5CA1 A;  4O2A A;  4B3T B;  5KHH A;  3QF7 A;  3SJA C;  4GKK B;  4CH3 A;  1FU1 A;  4PI2 A;  4X1Y A;  1G6U A;  4DR5 B;  4DV6 B;  4JI6 B;  3SJC C;  3SR2 A;  4GKJ B;  4X1I B;  3E22 A;  4UCU A;  2VWK A;  3ICX A;  3BA8 A;  1SA0 A;  5FPR A;  4O4I A;  4Q6G A;  2P5O A;  5IWA B;  4I55 B;  1IBM B;  5CB4 A;  3VQY A;  2UUC B;  3THO A;  2VQE B;  3VQV A;  4HNA A;  3BAB A;  5LXT B;  3RWR A;  3SR2 C;  5LOV A;  1V9P A;  2F66 C;  1I7F A;  4OX9 B;  4TV8 B;  4DUZ B;  1SQF A;  2YIB A;  3JAR A;  2Q7G A;  4ZOL A;  5LP6 A;  3DSQ A;  2OWO A;  4CS4 A;  4X62 B;  3RYF B;  4I50 B;  3T1Y B;  1TVK B;  2PTM A;  5KX5 A;  4LFC B;  4F6R A;  1Q43 A;  2HEP A;  5D5Q A;  2ZNJ A;  5C8Y A;  2QM4 A;  5GON A;  5LYJ B;  3JAT B;  5FPO A;  4EFE A;  4ZIB A;  3BA9 A;  4JI8 B;  2YXL A;  5K1P A;  2PZS A;  4CS2 A;  3BAA A;  1XNQ B;  1FFX A;  5K1X A;  5CHX A;  4JI3 B;  4AHC A;  4YJ2 A;  2Q7E A;  4IHJ B;  2PUS A;  1NT2 B;  3HKB A;  4LFA B;  4LNU A;  5LP6 C;  4DR1 B;  4JV5 B;  4FVM A;  4DRX B;  2VWJ A;  4K8Z A;  3ZED A;  4B08 A;  3JAK A;  3WB0 A;  4U3J B;  5FNV A;  2VQF B;  4FLT A;  4O4H A;  4X20 A;  4FFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...