2R9AA

Crystal structure of human xlf
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
227
structure length
219
Chain Sequence
MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLMGMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human XLF: A Twist in Nonhomologous DNA End-Joining
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Non-homologous end-joining factor 1
total genus 50
structure length 219
sequence length 227
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09302 XLF XLF-Cernunnos, XRcc4-like factor, NHEJ component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.450 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2r9aA02
2.170.210.10 Mainly Beta Beta Complex Dna Repair Protein Xrcc4; Chain: A, domain 1 DNA double-strand break repair and VJ recombination XRCC4, N-terminal 2r9aA01
2QM4A 5CJ4A 1IK9A 3MUDA 5CHXA 2R9AA 1KU9A 1FU1A 4XA4A 3SR2A 1M5IA 5CJ0A 3RWRD 3SR2C 3RWRA 3II6A
chains in the Genus database with same CATH superfamily
1E79G 4DR7B 2WWWA 2WSSG 2AW9A 1N4CA 3Q0YA 4KXRA 4U3JB 2EZPA 2H8PC 3SPJA 4LFBB 1HP8A 4JTDB 4CKPA 5DECA 4YJ2B 4IGGA 3L72H 4CH5A 5CA0A 4J42A 4N23A 1GN6A 1NS1A 2C2AA 2Q7GA 3ML0A 2D2CB 2B9ZA 1K34A 1XDCA 4UCVA 1N8RW 5IDJA 2QE7G 4DV1B 2CTPA 4Z1VA 3F7VC 3U10A 2IU0A 2ETNA 4O4HA 2CH7B 1K7DA 3QO8A 3SPCA 5EYPB 1ZUQA 4X66O 2Z3YA 4JI5B 4W4KA 1AJNA 4C7UA 3K0DA 3GWOA 3DGEA 1EZJA 3LUTB 1Y74A 1RP3B 3RYCA 4XA4A 1BMFG 1Y76B 3EXAA 3N2GB 3FB5C 3L73H 5LP6A 3GB7C 1ZLZA 1QNMA 4PA4A 4YHHB 1N0NA 4DW1A 1RSOB 1N0JA 2Y4UA 1KECA 5JQGB 4DRXB 4O4IB 2YEVA 1HNWB 3E8GA 1GRJA 3T1YB 3AG2B 4CZZA 2ZT9B 4JI3O 5ITZA 2OT5A 2F43G 1MSWD 2MW2B 1I5YA 3TJTA 4H33A 4TUYA 2UXNA 4I4TA 3CWBH 4JAUA 1D5AA 3AG2C 1Q6IA 3AG4B 3SYCA 1U96A 3CRMA 3ZMUA 2E74B 1IZ3A 1SKVA 5BY1A 2QGNA 2ILMA 1VARA 3N2KB 2DYSB 1JFFA 5IT9N 4E2LA 4IHJA 1VQOV 1JA8A 3S3WA 3ABMC 3SYAA 3A0HZ 4QGPA 3JSNA 4CH3A 4FJCC 5KLVH 1R6KA 2QM8A 3J80N 2RJZA 2HLDG 3VQXA 3ETQA 4YHHO 3IGAC 5GONB 4DK0A 5JQGA 4JI1B 4B3TB 4UV8A 3ICXA 4NTWA 3WG7B 4O4LA 3K58A 1IBLO 5IYZA 1H2GA 2QEXV 3RYHB 2UXXA 4GEXA 1NU1H 2AGAA 3UM7A 4O2AB 5CJ4A 1DTOA 1AI4A 1JCHA 5LXTA 1BL8A 2ZINA 3ZRWA 1KKDA 2XOKG 2EZOA 4JGSA 2CAZC 5EC2C 2AXTZ 2JJ1G 4HNAB 5LOVB 1EN6A 4FLXA 1XL4A 1O9HA 2ZD9A 5FNVB 1BZKA 1Q90D 4BIZA 2XAQA 2EILC 1DGSA 2Q5ZA 1H2LA 2Q7EA 4I5SA 1BSMA 3F7YC 1ZX3A 1FFTB 2YEVB 1H8HG 4LFCB 2DYRC 2VQEB 3ZHQA 2BSKB 3ZN1A 2N04A 3FB8C 1QBZA 2PZSA 1NR7A 1VQMV 1PL4A 2GSMB 1OCZB 1JR9A 5LHGA 2XTAA 1YCIA 1JQ0A 2GBOA 2YI9A 1XMOO 4LF5O 4LBEC 1N36B 2ZKOA 1YIJV 2EJRA 3OE7G 2L35A 3BAAA 4PELA 4K0KO 4R8CA 4QPKA 4NXNB 3A8TA 1EN5A 4O4JA 4MTXA 4TV8B 5L3BA 1GM7A 1H2SB 3CRAA 1EM1A 4RUFA 1M93A 1DK1A 2QWPB 1I94B 3CCMV 1XHXA 2GTSA 3C3TA 1BT8A 4CKMA 1THZA 2YXHA 2PI4A 4WBNB 5JVDA 5BR8O 1EFRG 3QNEA 1HW7A 1TUBA 3G80A 4FM2A 3OAAG 1YF2A 1YVWA 2KSDA 3F5TA 4KHPO 2FL4A 1B06A 2A06H 3JD4A 4CKNA 2WLLA 2AZ0A 3ZMSA 4I50A 4YIOA 2R9RB 3DTUB 5F2VO 5JWPA 1FFXB 2VWKA 3RYHA 3MHHC 5GTHZ 1XL6A 2EIKB 1KP3A 4LH6A 1VQ6V 1AROP 1VF7A 4MVSA 3ASOC 1H2KA 3J81N 4RWUA 1F7YA 2WLMA 1VQ5V 2A79B 1BCCH 1AI7A 3BVOA 1SRYA 4MVOA 1ZAUA 4A5UB 2ZNJA 4LFAB 2Y0PA 5BR8B 5LGTA 1FXVA 3K79A 3SPIA 2WPDG 4B3SO 3STZC 5JJEB 1D2DA 1VQKV 4AQYB 2E3CA 3BEHA 5LHIA 1EBOA 4DV4B 2AZ2A 2ARHA 3W7UA 3CHXA 4J7JA 2P06A 3TCUA 3ASOB 2YS8A 3AG3B 3LSSA 3ETDA 1AJPA 1AI6A 3K5OA 5CA3A 1NJIW 3CXCU 1Q3EA 2PF4E 5CB4A 3UO2A 2EIJC 4O4JB 4YJ3A 4MVUA 3LSQA 1LNQA 4MW8A 4MTOA 2Q8VA 3I56V 3N2KA 4IIJA 3CMAV 4IYHA 4GT1A 4HBNA 3K0GA 3AG1C 2VS0A 2WLNA 3P32A 5JH7B 3H01A 4DR2O 3DXRA 2XAJA 4X20A 5LMUB 4Z1MG 4LNUB 4DR4B 3FAVA 2PYJA 3CD6V 2OIEA 4FFBA 4UFZA 1TVKB 4OGQB 4ZBMA 4DW0A 1K33A 3DSQA 2JDIG 4JI7O 5EZYA 1PNMA 4DV5O 2EULA 1IDSA 5KAFZ 3CXHF 2QWQB 2HJDA 1PM9A 1ZSPA 3ASNB 4CS4A 4F6EA 3RGBA 3OTOO 2FMLA 4BIOA 1VQLV 5DN6G 1OCCB 4PDMA 1Q5OA 3J7AU 5CA0B 5LGNA 1ZWIC 4IIJB 4PI0A 1IBLB 2BTQB 3BA9A 1VP7A 1XBLA 5JJJB 1FKAO 2RNBA 1K4DC 1V9PA 2VRZA 5LMUO 4DRXA 3FAVB 2A7WA 2QTOA 1OZ0A 2OIGA 5EIBC 1K5SA 4JI0O 4GKKO 3BFRA 4DR1B 4KL1A 1GKFA 2CH7A 3KG2A 4JASA 4WFFA 1N34O 1GAXA 3OR7C 1E1QG 3K5NA 1VQ8V 3E8BA 3VBBA 5IYBO 3D3QA 5D5PA 1YITV 2UUAB 1TUEB 1WLEA 2KQXA 4NTYA 4GX1A 4UCTA 1T5EA 2ZCEA 3K08A 1WP8A 4G2KA 4X20B 1EN4A 1UJWB 2JGDA 5JJNB 3O9OA 4X88A 4AHCA 1RM1B 3IAYA 4E4EA 3E22B 3R65A 2VQFO 1QLEC 2DOSA 1COWG 3OD4A 4UVAA 2M7WA 4BR6A 1MMMA 4B3RO 2XNDG 3HKCA 4JI2B 2F66C 1Q7YW 1SQVH 1Y66A 3ABMB 5KHJA 3D8CA 4K8XA 1I94O 1XMQB 4FLUA 4UCRA 1Q8IA 4TWKA 3DC5A 1MZEA 2HVKC 1TA8A 2WLIB 2GHYA 1BE3H 2P90A 5KUMA 4QNHB 3JATA 4JI7B 5KHKA 3AK1A 4HYOA 3JD2A 2X7RB 3UO3A 4YJ2A 4UB8Z 5IJ9A 2DQ0A 1HR0B 2JGDB 2QSAA 4FIPC 3P3PA 4LF7O 4FK5C 4DR7O 3FFQA 3SJBC 2CDYA 3H1JH 4UXNA 1N36O 4JYAO 5HFLA 2Q9LA 4EB6A 4DUYB 3H9VA 5JCOC 1N32B 3SYOA 1NVPD 3KCYA 2Q73A 3OUFA 3OEHG 3B77A 3OFNG 4X64O 3T1CA 5FNVA 4J7ZA 1ROPA 4RQEA 1GM9A 3O65A 4OPAA 4DV2O 2QA4V 1X4TA 4GUNA 4X62O 5EBMC 1PP9H 1YHQV 5KA6A 3GVMA 4DV7O 4X65O 2Y48A 1SESA 3C90A 5LP6B 3RFRA 4DR4O 1RFYA 3LSUA 1P7GA 1IBKB 2BSKA 1NZ6A 3RT3C 3OGIB 1FJGB 1A32A 3ABUA 1VQPV 4O2AA 3TXQA 4H13B 1Q81W 1S5HC 2HEPA 5EK0A 2YIBA 4FZ0A 4B3TO 4B7EA 3D36C 4JYAB 4I50B 3AG3C 1RPRA 2DMXA 4Q6GA 2XAFA 2GUZA 1K3EA 1QR8A 5H6QA 5BZBA 5KHGA 4FLWA 5CMUA 4JI3B 2P7TC 2HJFC 5KMGB 1K8AW 3STLC 3T1YO 2DE0X 4CS3A 1I0HA 4B3MO 3K57A 1TUBB 3CYOA 3DC6A 4GYCB 1DF4A 3CX5F 5IJ9B 4ZI7A 3HR0A 3CC2V 3OTFA 2Q67A 1R3KC 3P30A 3TGUH 5FLXN 1J5EO 4LFAO 4DV0B 3UKMA 2QDOA 3D3IA 3KKYA 4FFBB 4I55B 4D6TH 2WLJA 4LH7A 3EVKA 1VQNV 3APOA 2UXDB 3E8HA 1EZVH 4AILC 3RYFA 4DV4O 1ZTEA 1IBMB 3CRCA 4UUJC 5L3DA 3N2GA 2A9HA 1SA0A 3RYIB 1M56B 4PV1B 3RVYA 1W2BU 3LNNA 3BA8A 1E1RG 1J95A 4HNAA 2F93B 4JF3A 1K92A 3B2EE 3T4DA 3ZCCA 3UT5A 4WF9V 4TSFG 2LGWA 2Y3WA 1M9NA 4DR2B 2ZR3A 1HNXB 1WA8B 2ATKC 4PA9A 2DW4A 1QU7A 1L0LH 1AI5A 2Q7HA 3WU2Z 2Y3VA 2BOCC 2GV9A 2YSUB 2Q69A 5GONA 2OCHA 4PDVA 1M90W 1XREA 5B3SB 2VQEO 2F1MA 2ZE8A 3SDLA 1V54B 4PA6A 1B3QA 1M1KW 1R3JC 1GM8A 4EEQA 3K9AA 4G27B 5L3EA 4DV5B 3NXSA 2EINC 5LL6Y 4NYKA 4F6RB 3LNMB 3H1IH 4ZHQA 1P7BA 2JIZG 1KQSU 4JI4O 3RWRD 4GFCA 4JZ2A 2ZIOA 1M5IA 1BHAA 4QPJA 2IU3A 1S5JA 5A2QN 1H8EG 2NNUA 3RYFB 4PI2A 1M57B 3BABA 2R70A 1HWYA 2QTSA 4JYCA 4EB6B 4DV1O 5K1PA 3W7WA 5LA6B 2HR3A 1NTMH 2ZXWB 3CCUV 5IYCO 3C3SA 4J9YB 2V1DA 3HKEB 2HHHO 4DR3O 4LF9B 2UU9B 4TQFA 3ZIAG 1YSCA 4NR1A 3RYCB 1AR1B 1NQTA 4J41A 1KB9F 4P2ZA 3KZIZ 5J9PC 4DV7B 1Z2GA 2H94A 3B4SA 1MSDA 3HB3B 1SQFA 3X2QC 3QO7A 4JAAA 2WAMA 2WLHA 2ZR2A 1YZBA 5AG2A 2V7QG 4CS2A 5H2FZ 4FZ1A 3JALB 2YIAA 3VQWA 2A3QA 2X6BA 2YIDA 2DYRB 3ZRVA 1FFXA 4Z2WA 3JCZA 4LCUC 4DV2B 3OW2U 3LDEA 1SQQH 4JPRA 2ZXWC 1Q6UA 2HVJC 4QIWF 4FM0A 5LHHA 1KYOF 2F23A 2Y4TA 5JVDB 2LGQA 3E89A 4MVMA 4TQDA 5KHIA 1DLBA 2HG5C 3TXSA 5B1OA 1NTZH 1F4MA 1F51A 4FM1A 1FJGO 2P5OA 4OXSA 3K03A 4LC1A 3F5WC 4GKJO 1XMOB 1NTKH 2XT9A 3M99B 4JTAB 3B40A 5A9GA 1LR1A 4H0LB 4J7KA 2B1GA 2P4VA 4I9QA 1AJQA 3OMNB 2ZDIA 3AG7A 4X89A 3VOUA 2JEUA 4MS2A 2WA3A 1Q82W 1MNGA 4PDRA 1OCCC 1TVKA 2E75B 4MW3A 4CH4A 1V54C 5LBQA 1CPYA 3HKBB 1PPJH 1K73W 1P49A 3JAKB 4TV9A 4DV3O 1N33B 3B8MA 1VF5B 2QWNB 1SS3A 5CN0A 2PY5A 2GDSA 2ADPA 5E79Z 4MVQA 5EBWC 4RO2A 3B8NA 3CP1A 1P84F 1PKXA 2JGUA 3FX7A 5FPRA 2Z5UA 3JATB 3CEIA 1N33O 1I7FA 3QVNA 4WFAV 1IXBA 3SJAC 3SJQC 2CTWA 4LF6O 2W6IG 2LQTA 1JPXA 3H1LH 1WNSA 2PI5A 3AK3A 3OMAB 4RQFA 5J2TA 2BOBC 3ZN0A 3WB1A 5B5EZ 3UCSC 4O2BB 2OWOA 2F4VB 4BW9A 1MZFA 3OR6C 3RBZA 1D5NA 1KKCA 2EILB 4ABMA 3G6BA 2HFEC 4D7TA 3MHSC 3WG7C 1M4UA 2LP7A 4K35A 4OX9B 2UUCO 5EBLC 4PJ0Z 4WCEV 1WPXA 2JRIA 5H9CA 1K9MW 3FYEB 2JS3A 4X1KB 1N34B 1L8DA 1WAZA 3NR7A 3M7MX 4JI0B 4GKKB 4ZOLB 2IH3C 4QE7A 3G67A 2YXLA 2DYSC 4OPHA 4O4IA 2E5LO 1W0JG 4JAVA 2G38A 4ZI7B 5BMVB 1FXHA 2BTOA 3AG4C 2CK3G 1X59A 5ITZB 3U11A 1KMIZ 3ZRWB 5CA1B 3LDCA 1WB7A 3OTOB 5L3FA 3CC4V 2YXYA 4RAIA 2JJ2G 3Q4HB 2CTRA 1YDXA 4F6RA 5B1NA 4U3JA 4UB6Z 3K5LA 1QQCA 2BTQA 4PA7A 3MUDA 1R6TA 2BCCH 4YY3O 4NKGB 2RDCA 2OYQA 4U7OA 4ASUG 5KMGA 1K5QA 3ABLB 1B04A 4X9QA 3OUSA 2P6JA 3JARB 1ENVA 3W7SA 5EIBD 4LF4B 1I5XA 5B3SC 4BAYA 1YI2V 1QLNA 1AVMA 3MD0A 2Y69B 1BGYH 4U3FH 4AQYO 5B66Z 1KBHA 2A0LA 3W7TA 1J5EB 3RWRA 1IXMA 1OV9A 2NLJC 3CRQA 4LF6B 1XQ8A 3K59A 1P4RA 3FKSG 2QM4A 2JEXA 1OJHA 5CHXA 3ZEDA 4DYLA 3ABLC 3U0ZA 2WLIA 4DUYO 1N32O 2ZE6A 4FLZA 3SGIA 3K3WA 2ZNIA 3CS5A 1MA1A 2WLKA 4FLTA 1FAFA 1OCZC 1NH2B 3HKDA 1S76D 1O9GA 4CBCA 4JV5B 4WBNA 1I08A 4LF5B 3T1HO 2UXCO 1ORQC 1Z5WA 3N27A 3JASB 2OTLV 5CA1A 2FYUH 2B1IA 1XMQO 4O4HB 4DV0O 1QHTA 1JX9A 2B5UA 2PGGA 1M56C 4GCZA 4YIPA 3WB2A 1V55C 1NR1A 3K9SA 3M8AA 4X62B 2EIJB 2FB5A 1VEWA 5IYDO 4JI6B 4MT8A 2E5LB 1AP5A 5KHHA 3OT7A 4LWSB 3ZHTA 2NR5A 4TV8A 4GX5A 4PA3A 3ZRXA 1NH2D 4X66B 4K8ZA 2ITDC 4JI5O 4D7SA 4X1YA 1JFFB 5K1XA 3CJHA 3AK2A 2W0XA 3T2MA 3ZBHA 3JARA 1NVPB 2D3OW 1CEZA 2UXBB 2E76B 4J9ZB 1FD9A 2Y69C 2Q4PA 3CB2A 4DR5B 1SQXH 3QG5A 2ZE7A 1GN4A 3GWKC 3I55V 3KCXA 2EBOA 3OM3B 1AB3A 4H44B 1FPOA 3SR2A 2BE3A 1WPBA 4K3AA 2LW7A 5GW7A 2QKCA 5J2UA 5IWAO 3A2FA 5JCOA 2Q68A 3K04A 1Y4MA 1YJWV 3ETGA 3CCLV 1H38A 1HNWO 1S3JA 2UUBB 2PTMA 2K1EA 3L75H 2YC0A 1Y67A 5CB4B 3IC7A 4DR1O 1F23A 4IL6Z 1SA0B 3RYIA 3PN1A 5IE9A 3S3XA 2QWRB 4R7CA 3G6EV 5GTIZ 2EIMB 1QCEA 3HKDB 5H5NA 5LYJB 4G79A 1FU1A 2EJ7A 1XNQO 1ZL8B 4XBFA 4MVZA 4R50A 2Q6AA 5CBGA 4WFGA 3CMEV 4L8JA 4CC6A 3CRRA 5EC1C 1G6UA 3BPZA 3G71V 1YJNV 4GKJB 1IBMO 1GTOA 1LUWA 3EHBB 1XNQB 4XDLA 2DWEC 5IY5C 4DR6O 1NKDA 1QR9A 2ZIMA 2MK3A 5CJ0A 3JYCA 4J80A 5FPOA 3SPGA 5EYPA 5J2UB 4MTFA 5IWAB 4Q20A 1S77D 1JVMA 2JK5C 2Z0AA 2HKOA 4X1IA 1Y74B 2IJIA 4NVPA 3L74H 1GO3F 4WFBV 5C93A 1NBMG 1OHHG 3AG1B 2HHHB 1FXKC 4P9PA 2IW5A 5BXZA 3ZHUA 1AP6A 3CCJV 1G8MA 2R72A 1BHBA 1WN7A 1HNZO 3CE2A 1RSOA 2AHYA 4B7KA 3K5MA 2UUAO 5CBFA 4X8AA 3QO5A 2LFSA 1NT2B 1R3IC 2K9PA 1JMKC 1OCOB 4LF8B 3CCVV 4DR5O 1G1XB 4JI4B 3QF7A 5LA6A 4B3RB 1KP2A 5EZYB 1SETA 5DM6V 3VQYA 1F4NA 4F4LA 1W59A 2IJKA 4WFEA 3CCQV 1Y76A 5LMNO 4I0XB 3WB0A 3ZMTA 2ZM6O 2IJJA 2LJ2A 4EFBA 1SQBH 3FD9A 2JS5A 4OX9O 4FFKA 2UUBO 2N05A 5LYJA 5IY5B 3T4ZA 4XDKA 3VQVA 3SR2C 4NXMO 1Q86W 3T1HB 1GK9A 1R1BA 4PDLA 4UVBA 2QR4A 4R6ZA 2LO1A 3E22A 2FTKA 1GN3A 5CBHA 2YDEA 5IYZB 2LW1A 2CE4A 4O2BA 3R66A 4MSWC 4P30A 1QVGU 3AEIA 3JAKA 3JSLA 4JTCB 4LF8O 1KU9A 3CCRV 2GUZB 4UVCA 5KX5B 1VQ4V 1SQGA 1U97A 3PYIA 2QM7A 4DUZO 2OCCC 3THOA 2DN9A 2Q0AA 4CH6A 5B1AB 4YJ3B 4LP8A 1TGOA 4IT5A 1SERA 5LP6C 3CSXA 3ABKC 5D5QA 1RPOA 1SZTA 3Q4HA 4KFMA 2H3OA 1QVFU 2X0LA 3H1KH 3IJ4A 3SYPA 4ZOLA 1WB8A 2IM9A 5JH7A 1HDJA 2CTQA 3Q0XA 3ZX6A 4QJFB 4EKWA 5B1BB 3ABKB 1Q6HA 2ZE5A 3E35A 3MDSA 4KHPB 1KD1W 1YTFD 1XILA 3JD0A 3L70H 3CCEV 5LGUA 3A0BZ 1AR4A 4JZGA 2M6YA 4FLVA 4GX0A 4DV6O 2UXDO 4BW5A 3E83A 5KAIZ 4PD4F 4HAMA 5C8YA 1R3LC 2PYLA 2NN4A 3LDDA 4GEUA 2OCCB 2ODMA 2IJHA 1OCOC 2RMKB 4W4LA 3IFXA 2KG7B 2HP8A 4XDJA 1YXBA 4BWAA 1XOUA 1IK9A 5LMNB 5TISZ 2YIBD 2ZM6B 1S72V 1VF6C 5BMVA 3FB6C 3E86A 3SPHA 3ZMZA 4FMTA 4AI8A 2RQ6A 2ZDIC 3ASNC 4X64B 3OMIB 5J2TB 3K06A 4RUEA 3L9DA 4LF4O 2ZQMA 4G28B 4UV9A 1R73A 1NI8A 3JD1A 2DQ3A 5L3GA 2EINB 4JI8O 3JD3A 4ZHQB 3SYQA 4GFAA 2KB1A 2UXBO 1FS0G 4GX2A 2F4VO 1Z5VA 4UCUA 3RN4A 3APQA 2P22C 4YY3B 5FL7G 4X1KA 1GN2A 3IC9A 3CJHB 3WFVA 1S0VA 3FB7C 3L71H 3CPWU 1XNRB 2PUSA 4B08A 2WLLB 1R6NA 3CCSV 1UFIA 2YUAA 1MOFA 4N21A 4P9OA 2CGOA 4I4TB 2W0FC 3HKBA 1JJOA 3DXRB 5KA5A 3BHPA 4J11A 4O4LB 1VMGA 4NXNO 2QKAA 4J10A 2P4KA 5KUKA 4TT3G 2ITCC 3TK1A 5LOVA 3QTCA 2VWJA 3ZHSA 1PNKA 2OTJV 1IVSA 3JAWA 4IHJB 2QWOB 3II6A 4KP4A 2CUGA 1PV0A 4FVMA 1WP7A 4FPPA 3B09A 1UPGA 2FKXA 2KG7A 5IJ0A 4LF7B 4QE9A 3HPLC 1CXZB 1JJ2U 1SC5B 1B6QA 3A0RA 5B1AC 2XUMA 4JV5O 4LR3A 3HKCB 1XNRO 4DO2A 2EIKC 4DV3B 5H6RA 1YEWA 1VQ9V 3W7XA 2P67A 4LWSA 1BQ0A 2EX3A 4PHZA 3JCUZ 2UUCB 2EIMC 4H37A 1PL0A 1PD3A 4MTGA 4TV9B 4X1YB 3MAQA 3ZJZA 1Q43A 3JAWB 1IURA 3TETA 4LFCO 1VF6A 2DWDC 3OGCC 1MG1A 1WA8A 4X1IB 4CC5A 2XHBA 1KUQA 1ZL8A 4UCSA 3ZMVA 3OEEG 2YICA 1AILA 3EFFK 4IYIA 3UT5B 4DK1A 1S5LZ 2UU9O 1YJ9V 2JVDA 2V4DA 3ZHVA 2O57A 4JI8B 1AR5A 4LNUA 4I7ZB 1G4YB 2RN9A 4I9WA 4JYBA 3FYIB 2XASA 4GLXA 2IBZH 4L87A 2XAGA 4DUZB 4KUMA 1OCRB 4DV6B 1SQPH 2KKWA 2RCVA 4U7NA 4TUYB 1XHZA 1WJZA 1KC8W 1FXKB 3H1HH 3G4SV 4BIUA 4JI1O 3BRCA 1TAEA 1V55B 3RVZA 1W0KG 3D36A 4DR6B 1QLEB 5LXTB 3X2QB 4ZKIA 5C8YB 1H2NA 1BS3A 5B1BC 3ZHRA 1XUQA 5HFMA 4B3MB 3I5DA 4DR3B 4LF9O 5DEDA 2AHZA 5IJ0B 2L6LA 2QJ1A 1M57C 1JOYA 4GZRB 4NTXA 3E2EA 3P3NA 1FYJA 1K4CC 2CGNA 1SZXA 4JI6O 1HR0O 1BQZA 3ZRSA 2Q0OC 4DXWA 4ICGA 4EFEA 3JASA 1HNZB 1VQ7V 2W6JG 3HKEA 2X6CA 3UQ8A 4JYYA 3RW0A 1CP9A 3ETEA 1IX9A 2VQFB 2XAHA 1L1FA 4TOIA 2LFRA 4LFBO 1L0NH 4FLYA 3BY6A 4I0XA 3BCCH 1GMGA 2WA4A 4UCOA 1XI1A 1K97A 1VIBA 3E8FA 2ADQB 2X6AA 1SF9A 5KX5A 1Y6XA 3ZS8C 2F95B 1HNXO 1PNLA 3JAMN 4K0KB 4JI2O 1H2MA 2IH1C 4NB5A 4WFHA 2UXCB 1URFA 4MVRA 2QKSA 4YXWG 3CC7V 4B3SB 1MABG 4X65B 1YTFB 2GTAA 2R9AA 3ABTA 1LUVA 2N74A 1XEQA 1IBKO 2Y0IA 3SJCC 4NXMB 4I55A 3PJSK 2DJVA 1FXKA 1RM1C 5E1AC 1DF5A 4ZIBA 1OCRC 1GH6A 2YI8A 3JALA 4HZ3A 2R9IA 5L3CA 1US6A
chains in the Genus database with same CATH topology
1XMOB 1V9PA 4EFBA 4DR7B 2JS5A 4DRXA 5LYJA 5EIBC 3VQVA 3SR2C 4U3JB 4LFBB 3T1HB 4DR1B 4I9QA 4KL1A 4YJ2B 3K5NA 4CH5A 5CA0A 2Q7GA 1TVKA 5D5PA 3E22A 2UUAB 4CH4A 5IYZB 3HKBB 4UCVA 4O2BA 1P49A 3JAKB 4UCTA 4TV9A 1T5EA 2ZCEA 4X20B 1N33B 3JAKA 3JSLA 4DV1B 5JJNB 1KU9A 4AHCA 2PY5A 3IAYA 3U10A 5KX5B 1SQGA 3E22B 4O4HA 3THOA 2Q0AA 2JGUA 5FPRA 5EYPB 4CH6A 3JATB 4YJ3B 1I7FA 4JI5B 3HKCA 1TGOA 3SJAC 2F66C 4JI2B 5LP6C 3CSXA 5KHJA 5D5QA 4K8XA 1WNSA 4ZOLA 3RYCA 1XMQB 4XA4A 2IM9A 3N2GB 4FLUA 5J2TA 4UCRA 1Q8IA 5JH7A 3WB1A 5LP6A 1TA8A 4O2BB 2OWOA 2F4VB 4YHHB 4BW9A 4KHPB 3JATA 4JI7B 5KHKA 4D7TA 5JQGB 4DRXB 4O4IB 1HNWB 3T1YB 1M4UA 4OX9B 4YJ2A 4FLVA 5IJ9A 1HR0B 5ITZA 5C8YA 4X1KB 1N34B 2PYLA 1L8DA 4TUYA 3FFQA 3SJBC 4I4TA 3M7MX 4JI0B 4GKKB 4ZOLB 1D5AA 4EB6A 4DUYB 5JCOC 1N32B 2YXLA 1SKVA 4O4IA 4BWAA 4ZI7B 3N2KB 1IK9A 5BMVB 5LMNB 1JFFA 2YIBD 2BTOA 2ZM6B 5FNVA 4IHJA 5BMVA 3JSNA 4CH3A 5ITZB 2RQ6A 3U11A 1KMIZ 5CA1B 2RJZA 3OTOB 1X4TA 4X64B 3VQXA 3ETQA 5J2TB 4F6RA 5GONB 4DK0A 5JQGA 4JI1B 4B3TB 4U3JA 3ICXA 3K5LA 1QQCA 5LP6B 2BTQA 3MUDA 3RFRA 4O4LA 3K58A 1IBKB 5IYZA 2OYQA 3RYHB 5KMGA 4O2AB 5CJ4A 4ZHQB 1FJGB 1B04A 5LXTA 2ZINA 4O2AA 3JARB 2CAZC 2HEPA 2YIBA 4HNAB 5EIBD 5LOVB 4LF4B 1Z5VA 4UCUA 4FLXA 1O9HA 4JYAB 5FNVB 2P22C 4I50B 1DGSA 4YY3B 4X1KA 2Q7EA 4Q6GA 1XNRB 2PUSA 4B08A 4FLWA 5KHGA 4LFCB 1J5EB 3RWRA 2VQEB 4JI3B 4LF6B 1XQ8A 3K59A 5KMGB 4I4TB 3HKBA 1JJOA 3BHPA 2QM4A 4CS3A 4O4LB 2PZSA 5CHXA 3K57A 1TUBB 3ZEDA 3U0ZA 4GYCB 4FLZA 5LOVA 5IJ9B 3QTCA 4ZI7A 2YI9A 2VWJA 3SGIA 3OTFA 1N36B 2ZNIA 3JAWA 4IHJB 4DV0B 3II6A 4FLTA 3HKDA 4FFBB 3BAAA 4FVMA 1O9GA 4I55B 4NXNB 4JV5B 4WBNA 4LH7A 2UXDB 4O4JA 4AILC 4LF5B 4TV8B 3RYFA 1H2SB 1Z5WA 5IJ0A 1IBMB 3JASB 3N2GA 4LF7B 1SA0A 1M93A 3RYIB 5CA1A 1I94B 1XHXA 4O4HB 3LNNA 1QHTA 3BA8A 2PGGA 3WB2A 4WBNB 4X62B 5JVDA 4LR3A 1HW7A 1TUBA 3HKCB 4HNAA 4JI6B 2F93B 4FM2A 2E5LB 3B2EE 5KHHA 3UT5A 4DV3B 1YEWA 4DR2B 1HNXB 4TV8A 2EX3A 4I50A 4PHZA 2UUCB 4X66B 4K8ZA 4D7SA 4X1YA 1JFFB 5K1XA 2Q7HA 1FFXB 2VWKA 4TV9B 3JARA 3RYHA 2GV9A 4X1YB 3MAQA 2UXBB 5GONA 1Q43A 3JAWB 3CB2A 4DR5B 3QG5A 4CC5A 4X1IB 2XHBA 4LH6A 4UCSA 2F1MA 3UT5B 4DK1A 1VF7A 2JVDA 3SR2A 1WPBA 2V4DA 4EEQA 5J2UA 4JI8B 3A2FA 5JCOA 4LNUA 4DV5B 4GLXA 2UUBB 1ZAUA 2PTMA 4F6RB 2ZNJA 4LFAB 4DUZB 4ZHQA 5CB4B 4DV6B 5BR8B 3RWRD 2KKWA 1SA0B 3RYIA 3PN1A 2ZIOA 4TUYB 1XHZA 1M5IA 5JJEB 4AQYB 3HKDB 2E3CA 3BRCA 1TAEA 5LYJB 1S5JA 1FU1A 4DV4B 4DR6B 5LXTB 3CHXA 5C8YB 3RYFB 4B3MB 4PI2A 4DR3B 3BABA 4L8JA 5IJ0B 2R70A 4CC6A 1G6UA 3BPZA 3K5OA 4EB6B 4GKJB 2QJ1A 5K1PA 1Q3EA 5CB4A 5LA6B 4O4JB 4YJ3A 1XNQB 3N2KA 4IIJA 3HKEB 2ZIMA 4LF9B 4HBNA 5CJ0A 2UU9B 5FPOA 4TQFA 5EYPA 5J2UB 3RYCB 5IWAB 4DV7B 5JH7B 4EFEA 3JASA 1HNZB 4X1IA 4X20A 3HKEA 3UQ8A 5LMUB 1SQFA 4NVPA 4LNUB 4DR4B 2VQFB 2HHHB 2PYJA 4TOIA 4FFBA 4UFZA 4FLYA 1TVKB 4UCOA 3DSQA 2R72A 1XI1A 1WN7A 5EZYA 1RSOA 5KX5A 4CS2A 3ZS8C 2F95B 2YIAA 3JALB 3VQWA 3K5MA 4K0KB 4CS4A 1FFXA 1NT2B 3RGBA 4DV2B 1JMKC 2UXCB 1Q5OA 5CA0B 4LF8B 4B3SB 4X65B 4IIJB 4FM0A 2R9AA 5JVDB 4JI4B 4TQDA 3SJCC 4PI0A 3QF7A 4NXMB 4I55A 5LA6A 1IBLB 2BTQB 3BA9A 5KHIA 4B3RB 5EZYB 4ZIBA 3VQYA 5JJJB 2YI8A 3JALA 4FM1A 2P5OA 3WB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QM4 A;  5CJ4 A;  1IK9 A;  3MUD A;  5CHX A;  2R9A A;  1KU9 A;  1FU1 A;  4XA4 A;  3SR2 A;  1M5I A;  5CJ0 A;  3RWR D;  3SR2 C;  3RWR A;  3II6 A; 
#chains in the Genus database with same CATH topology
 1E79 G;  4DR7 B;  2WWW A;  2WSS G;  2AW9 A;  1N4C A;  3Q0Y A;  4KXR A;  4U3J B;  2EZP A;  2H8P C;  3SPJ A;  4LFB B;  1HP8 A;  4JTD B;  4CKP A;  5DEC A;  4YJ2 B;  4IGG A;  3L72 H;  4CH5 A;  5CA0 A;  4J42 A;  4N23 A;  1GN6 A;  1NS1 A;  2C2A A;  2Q7G A;  3ML0 A;  2D2C B;  2B9Z A;  1K34 A;  1XDC A;  4UCV A;  1N8R W;  5IDJ A;  2QE7 G;  4DV1 B;  2CTP A;  4Z1V A;  3F7V C;  3U10 A;  2IU0 A;  2ETN A;  4O4H A;  2CH7 B;  1K7D A;  3QO8 A;  3SPC A;  5EYP B;  1ZUQ A;  4X66 O;  2Z3Y A;  4JI5 B;  4W4K A;  1AJN A;  4C7U A;  3K0D A;  3GWO A;  3DGE A;  1EZJ A;  3LUT B;  1Y74 A;  1RP3 B;  3RYC A;  4XA4 A;  1BMF G;  1Y76 B;  3EXA A;  3N2G B;  3FB5 C;  3L73 H;  5LP6 A;  3GB7 C;  1ZLZ A;  1QNM A;  4PA4 A;  4YHH B;  1N0N A;  4DW1 A;  1RSO B;  1N0J A;  2Y4U A;  1KEC A;  5JQG B;  4DRX B;  4O4I B;  2YEV A;  1HNW B;  3E8G A;  1GRJ A;  3T1Y B;  3AG2 B;  4CZZ A;  2ZT9 B;  4JI3 O;  5ITZ A;  2OT5 A;  2F43 G;  1MSW D;  2MW2 B;  1I5Y A;  3TJT A;  4H33 A;  4TUY A;  2UXN A;  4I4T A;  3CWB H;  4JAU A;  1D5A A;  3AG2 C;  1Q6I A;  3AG4 B;  3SYC A;  1U96 A;  3CRM A;  3ZMU A;  2E74 B;  1IZ3 A;  1SKV A;  5BY1 A;  2QGN A;  2ILM A;  1VAR A;  3N2K B;  2DYS B;  1JFF A;  5IT9 N;  4E2L A;  4IHJ A;  1VQO V;  1JA8 A;  3S3W A;  3ABM C;  3SYA A;  3A0H Z;  4QGP A;  3JSN A;  4CH3 A;  4FJC C;  5KLV H;  1R6K A;  2QM8 A;  3J80 N;  2RJZ A;  2HLD G;  3VQX A;  3ETQ A;  4YHH O;  3IGA C;  5GON B;  4DK0 A;  5JQG A;  4JI1 B;  4B3T B;  4UV8 A;  3ICX A;  4NTW A;  3WG7 B;  4O4L A;  3K58 A;  1IBL O;  5IYZ A;  1H2G A;  2QEX V;  3RYH B;  2UXX A;  4GEX A;  1NU1 H;  2AGA A;  3UM7 A;  4O2A B;  5CJ4 A;  1DTO A;  1AI4 A;  1JCH A;  5LXT A;  1BL8 A;  2ZIN A;  3ZRW A;  1KKD A;  2XOK G;  2EZO A;  4JGS A;  2CAZ C;  5EC2 C;  2AXT Z;  2JJ1 G;  4HNA B;  5LOV B;  1EN6 A;  4FLX A;  1XL4 A;  1O9H A;  2ZD9 A;  5FNV B;  1BZK A;  1Q90 D;  4BIZ A;  2XAQ A;  2EIL C;  1DGS A;  2Q5Z A;  1H2L A;  2Q7E A;  4I5S A;  1BSM A;  3F7Y C;  1ZX3 A;  1FFT B;  2YEV B;  1H8H G;  4LFC B;  2DYR C;  2VQE B;  3ZHQ A;  2BSK B;  3ZN1 A;  2N04 A;  3FB8 C;  1QBZ A;  2PZS A;  1NR7 A;  1VQM V;  1PL4 A;  2GSM B;  1OCZ B;  1JR9 A;  5LHG A;  2XTA A;  1YCI A;  1JQ0 A;  2GBO A;  2YI9 A;  1XMO O;  4LF5 O;  4LBE C;  1N36 B;  2ZKO A;  1YIJ V;  2EJR A;  3OE7 G;  2L35 A;  3BAA A;  4PEL A;  4K0K O;  4R8C A;  4QPK A;  4NXN B;  3A8T A;  1EN5 A;  4O4J A;  4MTX A;  4TV8 B;  5L3B A;  1GM7 A;  1H2S B;  3CRA A;  1EM1 A;  4RUF A;  1M93 A;  1DK1 A;  2QWP B;  1I94 B;  3CCM V;  1XHX A;  2GTS A;  3C3T A;  1BT8 A;  4CKM A;  1THZ A;  2YXH A;  2PI4 A;  4WBN B;  5JVD A;  5BR8 O;  1EFR G;  3QNE A;  1HW7 A;  1TUB A;  3G80 A;  4FM2 A;  3OAA G;  1YF2 A;  1YVW A;  2KSD A;  3F5T A;  4KHP O;  2FL4 A;  1B06 A;  2A06 H;  3JD4 A;  4CKN A;  2WLL A;  2AZ0 A;  3ZMS A;  4I50 A;  4YIO A;  2R9R B;  3DTU B;  5F2V O;  5JWP A;  1FFX B;  2VWK A;  3RYH A;  3MHH C;  5GTH Z;  1XL6 A;  2EIK B;  1KP3 A;  4LH6 A;  1VQ6 V;  1ARO P;  1VF7 A;  4MVS A;  3ASO C;  1H2K A;  3J81 N;  4RWU A;  1F7Y A;  2WLM A;  1VQ5 V;  2A79 B;  1BCC H;  1AI7 A;  3BVO A;  1SRY A;  4MVO A;  1ZAU A;  4A5U B;  2ZNJ A;  4LFA B;  2Y0P A;  5BR8 B;  5LGT A;  1FXV A;  3K79 A;  3SPI A;  2WPD G;  4B3S O;  3STZ C;  5JJE B;  1D2D A;  1VQK V;  4AQY B;  2E3C A;  3BEH A;  5LHI A;  1EBO A;  4DV4 B;  2AZ2 A;  2ARH A;  3W7U A;  3CHX A;  4J7J A;  2P06 A;  3TCU A;  3ASO B;  2YS8 A;  3AG3 B;  3LSS A;  3ETD A;  1AJP A;  1AI6 A;  3K5O A;  5CA3 A;  1NJI W;  3CXC U;  1Q3E A;  2PF4 E;  5CB4 A;  3UO2 A;  2EIJ C;  4O4J B;  4YJ3 A;  4MVU A;  3LSQ A;  1LNQ A;  4MW8 A;  4MTO A;  2Q8V A;  3I56 V;  3N2K A;  4IIJ A;  3CMA V;  4IYH A;  4GT1 A;  4HBN A;  3K0G A;  3AG1 C;  2VS0 A;  2WLN A;  3P32 A;  5JH7 B;  3H01 A;  4DR2 O;  3DXR A;  2XAJ A;  4X20 A;  5LMU B;  4Z1M G;  4LNU B;  4DR4 B;  3FAV A;  2PYJ A;  3CD6 V;  2OIE A;  4FFB A;  4UFZ A;  1TVK B;  4OGQ B;  4ZBM A;  4DW0 A;  1K33 A;  3DSQ A;  2JDI G;  4JI7 O;  5EZY A;  1PNM A;  4DV5 O;  2EUL A;  1IDS A;  5KAF Z;  3CXH F;  2QWQ B;  2HJD A;  1PM9 A;  1ZSP A;  3ASN B;  4CS4 A;  4F6E A;  3RGB A;  3OTO O;  2FML A;  4BIO A;  1VQL V;  5DN6 G;  1OCC B;  4PDM A;  1Q5O A;  3J7A U;  5CA0 B;  5LGN A;  1ZWI C;  4IIJ B;  4PI0 A;  1IBL B;  2BTQ B;  3BA9 A;  1VP7 A;  1XBL A;  5JJJ B;  1FKA O;  2RNB A;  1K4D C;  1V9P A;  2VRZ A;  5LMU O;  4DRX A;  3FAV B;  2A7W A;  2QTO A;  1OZ0 A;  2OIG A;  5EIB C;  1K5S A;  4JI0 O;  4GKK O;  3BFR A;  4DR1 B;  4KL1 A;  1GKF A;  2CH7 A;  3KG2 A;  4JAS A;  4WFF A;  1N34 O;  1GAX A;  3OR7 C;  1E1Q G;  3K5N A;  1VQ8 V;  3E8B A;  3VBB A;  5IYB O;  3D3Q A;  5D5P A;  1YIT V;  2UUA B;  1TUE B;  1WLE A;  2KQX A;  4NTY A;  4GX1 A;  4UCT A;  1T5E A;  2ZCE A;  3K08 A;  1WP8 A;  4G2K A;  4X20 B;  1EN4 A;  1UJW B;  2JGD A;  5JJN B;  3O9O A;  4X88 A;  4AHC A;  1RM1 B;  3IAY A;  4E4E A;  3E22 B;  3R65 A;  2VQF O;  1QLE C;  2DOS A;  1COW G;  3OD4 A;  4UVA A;  2M7W A;  4BR6 A;  1MMM A;  4B3R O;  2XND G;  3HKC A;  4JI2 B;  2F66 C;  1Q7Y W;  1SQV H;  1Y66 A;  3ABM B;  5KHJ A;  3D8C A;  4K8X A;  1I94 O;  1XMQ B;  4FLU A;  4UCR A;  1Q8I A;  4TWK A;  3DC5 A;  1MZE A;  2HVK C;  1TA8 A;  2WLI B;  2GHY A;  1BE3 H;  2P90 A;  5KUM A;  4QNH B;  3JAT A;  4JI7 B;  5KHK A;  3AK1 A;  4HYO A;  3JD2 A;  2X7R B;  3UO3 A;  4YJ2 A;  4UB8 Z;  5IJ9 A;  2DQ0 A;  1HR0 B;  2JGD B;  2QSA A;  4FIP C;  3P3P A;  4LF7 O;  4FK5 C;  4DR7 O;  3FFQ A;  3SJB C;  2CDY A;  3H1J H;  4UXN A;  1N36 O;  4JYA O;  5HFL A;  2Q9L A;  4EB6 A;  4DUY B;  3H9V A;  5JCO C;  1N32 B;  3SYO A;  1NVP D;  3KCY A;  2Q73 A;  3OUF A;  3OEH G;  3B77 A;  3OFN G;  4X64 O;  3T1C A;  5FNV A;  4J7Z A;  1ROP A;  4RQE A;  1GM9 A;  3O65 A;  4OPA A;  4DV2 O;  2QA4 V;  1X4T A;  4GUN A;  4X62 O;  5EBM C;  1PP9 H;  1YHQ V;  5KA6 A;  3GVM A;  4DV7 O;  4X65 O;  2Y48 A;  1SES A;  3C90 A;  5LP6 B;  3RFR A;  4DR4 O;  1RFY A;  3LSU A;  1P7G A;  1IBK B;  2BSK A;  1NZ6 A;  3RT3 C;  3OGI B;  1FJG B;  1A32 A;  3ABU A;  1VQP V;  4O2A A;  3TXQ A;  4H13 B;  1Q81 W;  1S5H C;  2HEP A;  5EK0 A;  2YIB A;  4FZ0 A;  4B3T O;  4B7E A;  3D36 C;  4JYA B;  4I50 B;  3AG3 C;  1RPR A;  2DMX A;  4Q6G A;  2XAF A;  2GUZ A;  1K3E A;  1QR8 A;  5H6Q A;  5BZB A;  5KHG A;  4FLW A;  5CMU A;  4JI3 B;  2P7T C;  2HJF C;  5KMG B;  1K8A W;  3STL C;  3T1Y O;  2DE0 X;  4CS3 A;  1I0H A;  4B3M O;  3K57 A;  1TUB B;  3CYO A;  3DC6 A;  4GYC B;  1DF4 A;  3CX5 F;  5IJ9 B;  4ZI7 A;  3HR0 A;  3CC2 V;  3OTF A;  2Q67 A;  1R3K C;  3P30 A;  3TGU H;  5FLX N;  1J5E O;  4LFA O;  4DV0 B;  3UKM A;  2QDO A;  3D3I A;  3KKY A;  4FFB B;  4I55 B;  4D6T H;  2WLJ A;  4LH7 A;  3EVK A;  1VQN V;  3APO A;  2UXD B;  3E8H A;  1EZV H;  4AIL C;  3RYF A;  4DV4 O;  1ZTE A;  1IBM B;  3CRC A;  4UUJ C;  5L3D A;  3N2G A;  2A9H A;  1SA0 A;  3RYI B;  1M56 B;  4PV1 B;  3RVY A;  1W2B U;  3LNN A;  3BA8 A;  1E1R G;  1J95 A;  4HNA A;  2F93 B;  4JF3 A;  1K92 A;  3B2E E;  3T4D A;  3ZCC A;  3UT5 A;  4WF9 V;  4TSF G;  2LGW A;  2Y3W A;  1M9N A;  4DR2 B;  2ZR3 A;  1HNX B;  1WA8 B;  2ATK C;  4PA9 A;  2DW4 A;  1QU7 A;  1L0L H;  1AI5 A;  2Q7H A;  3WU2 Z;  2Y3V A;  2BOC C;  2GV9 A;  2YSU B;  2Q69 A;  5GON A;  2OCH A;  4PDV A;  1M90 W;  1XRE A;  5B3S B;  2VQE O;  2F1M A;  2ZE8 A;  3SDL A;  1V54 B;  4PA6 A;  1B3Q A;  1M1K W;  1R3J C;  1GM8 A;  4EEQ A;  3K9A A;  4G27 B;  5L3E A;  4DV5 B;  3NXS A;  2EIN C;  5LL6 Y;  4NYK A;  4F6R B;  3LNM B;  3H1I H;  4ZHQ A;  1P7B A;  2JIZ G;  1KQS U;  4JI4 O;  3RWR D;  4GFC A;  4JZ2 A;  2ZIO A;  1M5I A;  1BHA A;  4QPJ A;  2IU3 A;  1S5J A;  5A2Q N;  1H8E G;  2NNU A;  3RYF B;  4PI2 A;  1M57 B;  3BAB A;  2R70 A;  1HWY A;  2QTS A;  4JYC A;  4EB6 B;  4DV1 O;  5K1P A;  3W7W A;  5LA6 B;  2HR3 A;  1NTM H;  2ZXW B;  3CCU V;  5IYC O;  3C3S A;  4J9Y B;  2V1D A;  3HKE B;  2HHH O;  4DR3 O;  4LF9 B;  2UU9 B;  4TQF A;  3ZIA G;  1YSC A;  4NR1 A;  3RYC B;  1AR1 B;  1NQT A;  4J41 A;  1KB9 F;  4P2Z A;  3KZI Z;  5J9P C;  4DV7 B;  1Z2G A;  2H94 A;  3B4S A;  1MSD A;  3HB3 B;  1SQF A;  3X2Q C;  3QO7 A;  4JAA A;  2WAM A;  2WLH A;  2ZR2 A;  1YZB A;  5AG2 A;  2V7Q G;  4CS2 A;  5H2F Z;  4FZ1 A;  3JAL B;  2YIA A;  3VQW A;  2A3Q A;  2X6B A;  2YID A;  2DYR B;  3ZRV A;  1FFX A;  4Z2W A;  3JCZ A;  4LCU C;  4DV2 B;  3OW2 U;  3LDE A;  1SQQ H;  4JPR A;  2ZXW C;  1Q6U A;  2HVJ C;  4QIW F;  4FM0 A;  5LHH A;  1KYO F;  2F23 A;  2Y4T A;  5JVD B;  2LGQ A;  3E89 A;  4MVM A;  4TQD A;  5KHI A;  1DLB A;  2HG5 C;  3TXS A;  5B1O A;  1NTZ H;  1F4M A;  1F51 A;  4FM1 A;  1FJG O;  2P5O A;  4OXS A;  3K03 A;  4LC1 A;  3F5W C;  4GKJ O;  1XMO B;  1NTK H;  2XT9 A;  3M99 B;  4JTA B;  3B40 A;  5A9G A;  1LR1 A;  4H0L B;  4J7K A;  2B1G A;  2P4V A;  4I9Q A;  1AJQ A;  3OMN B;  2ZDI A;  3AG7 A;  4X89 A;  3VOU A;  2JEU A;  4MS2 A;  2WA3 A;  1Q82 W;  1MNG A;  4PDR A;  1OCC C;  1TVK A;  2E75 B;  4MW3 A;  4CH4 A;  1V54 C;  5LBQ A;  1CPY A;  3HKB B;  1PPJ H;  1K73 W;  1P49 A;  3JAK B;  4TV9 A;  4DV3 O;  1N33 B;  3B8M A;  1VF5 B;  2QWN B;  1SS3 A;  5CN0 A;  2PY5 A;  2GDS A;  2ADP A;  5E79 Z;  4MVQ A;  5EBW C;  4RO2 A;  3B8N A;  3CP1 A;  1P84 F;  1PKX A;  2JGU A;  3FX7 A;  5FPR A;  2Z5U A;  3JAT B;  3CEI A;  1N33 O;  1I7F A;  3QVN A;  4WFA V;  1IXB A;  3SJA C;  3SJQ C;  2CTW A;  4LF6 O;  2W6I G;  2LQT A;  1JPX A;  3H1L H;  1WNS A;  2PI5 A;  3AK3 A;  3OMA B;  4RQF A;  5J2T A;  2BOB C;  3ZN0 A;  3WB1 A;  5B5E Z;  3UCS C;  4O2B B;  2OWO A;  2F4V B;  4BW9 A;  1MZF A;  3OR6 C;  3RBZ A;  1D5N A;  1KKC A;  2EIL B;  4ABM A;  3G6B A;  2HFE C;  4D7T A;  3MHS C;  3WG7 C;  1M4U A;  2LP7 A;  4K35 A;  4OX9 B;  2UUC O;  5EBL C;  4PJ0 Z;  4WCE V;  1WPX A;  2JRI A;  5H9C A;  1K9M W;  3FYE B;  2JS3 A;  4X1K B;  1N34 B;  1L8D A;  1WAZ A;  3NR7 A;  3M7M X;  4JI0 B;  4GKK B;  4ZOL B;  2IH3 C;  4QE7 A;  3G67 A;  2YXL A;  2DYS C;  4OPH A;  4O4I A;  2E5L O;  1W0J G;  4JAV A;  2G38 A;  4ZI7 B;  5BMV B;  1FXH A;  2BTO A;  3AG4 C;  2CK3 G;  1X59 A;  5ITZ B;  3U11 A;  1KMI Z;  3ZRW B;  5CA1 B;  3LDC A;  1WB7 A;  3OTO B;  5L3F A;  3CC4 V;  2YXY A;  4RAI A;  2JJ2 G;  3Q4H B;  2CTR A;  1YDX A;  4F6R A;  5B1N A;  4U3J A;  4UB6 Z;  3K5L A;  1QQC A;  2BTQ A;  4PA7 A;  3MUD A;  1R6T A;  2BCC H;  4YY3 O;  4NKG B;  2RDC A;  2OYQ A;  4U7O A;  4ASU G;  5KMG A;  1K5Q A;  3ABL B;  1B04 A;  4X9Q A;  3OUS A;  2P6J A;  3JAR B;  1ENV A;  3W7S A;  5EIB D;  4LF4 B;  1I5X A;  5B3S C;  4BAY A;  1YI2 V;  1QLN A;  1AVM A;  3MD0 A;  2Y69 B;  1BGY H;  4U3F H;  4AQY O;  5B66 Z;  1KBH A;  2A0L A;  3W7T A;  1J5E B;  3RWR A;  1IXM A;  1OV9 A;  2NLJ C;  3CRQ A;  4LF6 B;  1XQ8 A;  3K59 A;  1P4R A;  3FKS G;  2QM4 A;  2JEX A;  1OJH A;  5CHX A;  3ZED A;  4DYL A;  3ABL C;  3U0Z A;  2WLI A;  4DUY O;  1N32 O;  2ZE6 A;  4FLZ A;  3SGI A;  3K3W A;  2ZNI A;  3CS5 A;  1MA1 A;  2WLK A;  4FLT A;  1FAF A;  1OCZ C;  1NH2 B;  3HKD A;  1S76 D;  1O9G A;  4CBC A;  4JV5 B;  4WBN A;  1I08 A;  4LF5 B;  3T1H O;  2UXC O;  1ORQ C;  1Z5W A;  3N27 A;  3JAS B;  2OTL V;  5CA1 A;  2FYU H;  2B1I A;  1XMQ O;  4O4H B;  4DV0 O;  1QHT A;  1JX9 A;  2B5U A;  2PGG A;  1M56 C;  4GCZ A;  4YIP A;  3WB2 A;  1V55 C;  1NR1 A;  3K9S A;  3M8A A;  4X62 B;  2EIJ B;  2FB5 A;  1VEW A;  5IYD O;  4JI6 B;  4MT8 A;  2E5L B;  1AP5 A;  5KHH A;  3OT7 A;  4LWS B;  3ZHT A;  2NR5 A;  4TV8 A;  4GX5 A;  4PA3 A;  3ZRX A;  1NH2 D;  4X66 B;  4K8Z A;  2ITD C;  4JI5 O;  4D7S A;  4X1Y A;  1JFF B;  5K1X A;  3CJH A;  3AK2 A;  2W0X A;  3T2M A;  3ZBH A;  3JAR A;  1NVP B;  2D3O W;  1CEZ A;  2UXB B;  2E76 B;  4J9Z B;  1FD9 A;  2Y69 C;  2Q4P A;  3CB2 A;  4DR5 B;  1SQX H;  3QG5 A;  2ZE7 A;  1GN4 A;  3GWK C;  3I55 V;  3KCX A;  2EBO A;  3OM3 B;  1AB3 A;  4H44 B;  1FPO A;  3SR2 A;  2BE3 A;  1WPB A;  4K3A A;  2LW7 A;  5GW7 A;  2QKC A;  5J2U A;  5IWA O;  3A2F A;  5JCO A;  2Q68 A;  3K04 A;  1Y4M A;  1YJW V;  3ETG A;  3CCL V;  1H38 A;  1HNW O;  1S3J A;  2UUB B;  2PTM A;  2K1E A;  3L75 H;  2YC0 A;  1Y67 A;  5CB4 B;  3IC7 A;  4DR1 O;  1F23 A;  4IL6 Z;  1SA0 B;  3RYI A;  3PN1 A;  5IE9 A;  3S3X A;  2QWR B;  4R7C A;  3G6E V;  5GTI Z;  2EIM B;  1QCE A;  3HKD B;  5H5N A;  5LYJ B;  4G79 A;  1FU1 A;  2EJ7 A;  1XNQ O;  1ZL8 B;  4XBF A;  4MVZ A;  4R50 A;  2Q6A A;  5CBG A;  4WFG A;  3CME V;  4L8J A;  4CC6 A;  3CRR A;  5EC1 C;  1G6U A;  3BPZ A;  3G71 V;  1YJN V;  4GKJ B;  1IBM O;  1GTO A;  1LUW A;  3EHB B;  1XNQ B;  4XDL A;  2DWE C;  5IY5 C;  4DR6 O;  1NKD A;  1QR9 A;  2ZIM A;  2MK3 A;  5CJ0 A;  3JYC A;  4J80 A;  5FPO A;  3SPG A;  5EYP A;  5J2U B;  4MTF A;  5IWA B;  4Q20 A;  1S77 D;  1JVM A;  2JK5 C;  2Z0A A;  2HKO A;  4X1I A;  1Y74 B;  2IJI A;  4NVP A;  3L74 H;  1GO3 F;  4WFB V;  5C93 A;  1NBM G;  1OHH G;  3AG1 B;  2HHH B;  1FXK C;  4P9P A;  2IW5 A;  5BXZ A;  3ZHU A;  1AP6 A;  3CCJ V;  1G8M A;  2R72 A;  1BHB A;  1WN7 A;  1HNZ O;  3CE2 A;  1RSO A;  2AHY A;  4B7K A;  3K5M A;  2UUA O;  5CBF A;  4X8A A;  3QO5 A;  2LFS A;  1NT2 B;  1R3I C;  2K9P A;  1JMK C;  1OCO B;  4LF8 B;  3CCV V;  4DR5 O;  1G1X B;  4JI4 B;  3QF7 A;  5LA6 A;  4B3R B;  1KP2 A;  5EZY B;  1SET A;  5DM6 V;  3VQY A;  1F4N A;  4F4L A;  1W59 A;  2IJK A;  4WFE A;  3CCQ V;  1Y76 A;  5LMN O;  4I0X B;  3WB0 A;  3ZMT A;  2ZM6 O;  2IJJ A;  2LJ2 A;  4EFB A;  1SQB H;  3FD9 A;  2JS5 A;  4OX9 O;  4FFK A;  2UUB O;  2N05 A;  5LYJ A;  5IY5 B;  3T4Z A;  4XDK A;  3VQV A;  3SR2 C;  4NXM O;  1Q86 W;  3T1H B;  1GK9 A;  1R1B A;  4PDL A;  4UVB A;  2QR4 A;  4R6Z A;  2LO1 A;  3E22 A;  2FTK A;  1GN3 A;  5CBH A;  2YDE A;  5IYZ B;  2LW1 A;  2CE4 A;  4O2B A;  3R66 A;  4MSW C;  4P30 A;  1QVG U;  3AEI A;  3JAK A;  3JSL A;  4JTC B;  4LF8 O;  1KU9 A;  3CCR V;  2GUZ B;  4UVC A;  5KX5 B;  1VQ4 V;  1SQG A;  1U97 A;  3PYI A;  2QM7 A;  4DUZ O;  2OCC C;  3THO A;  2DN9 A;  2Q0A A;  4CH6 A;  5B1A B;  4YJ3 B;  4LP8 A;  1TGO A;  4IT5 A;  1SER A;  5LP6 C;  3CSX A;  3ABK C;  5D5Q A;  1RPO A;  1SZT A;  3Q4H A;  4KFM A;  2H3O A;  1QVF U;  2X0L A;  3H1K H;  3IJ4 A;  3SYP A;  4ZOL A;  1WB8 A;  2IM9 A;  5JH7 A;  1HDJ A;  2CTQ A;  3Q0X A;  3ZX6 A;  4QJF B;  4EKW A;  5B1B B;  3ABK B;  1Q6H A;  2ZE5 A;  3E35 A;  3MDS A;  4KHP B;  1KD1 W;  1YTF D;  1XIL A;  3JD0 A;  3L70 H;  3CCE V;  5LGU A;  3A0B Z;  1AR4 A;  4JZG A;  2M6Y A;  4FLV A;  4GX0 A;  4DV6 O;  2UXD O;  4BW5 A;  3E83 A;  5KAI Z;  4PD4 F;  4HAM A;  5C8Y A;  1R3L C;  2PYL A;  2NN4 A;  3LDD A;  4GEU A;  2OCC B;  2ODM A;  2IJH A;  1OCO C;  2RMK B;  4W4L A;  3IFX A;  2KG7 B;  2HP8 A;  4XDJ A;  1YXB A;  4BWA A;  1XOU A;  1IK9 A;  5LMN B;  5TIS Z;  2YIB D;  2ZM6 B;  1S72 V;  1VF6 C;  5BMV A;  3FB6 C;  3E86 A;  3SPH A;  3ZMZ A;  4FMT A;  4AI8 A;  2RQ6 A;  2ZDI C;  3ASN C;  4X64 B;  3OMI B;  5J2T B;  3K06 A;  4RUE A;  3L9D A;  4LF4 O;  2ZQM A;  4G28 B;  4UV9 A;  1R73 A;  1NI8 A;  3JD1 A;  2DQ3 A;  5L3G A;  2EIN B;  4JI8 O;  3JD3 A;  4ZHQ B;  3SYQ A;  4GFA A;  2KB1 A;  2UXB O;  1FS0 G;  4GX2 A;  2F4V O;  1Z5V A;  4UCU A;  3RN4 A;  3APQ A;  2P22 C;  4YY3 B;  5FL7 G;  4X1K A;  1GN2 A;  3IC9 A;  3CJH B;  3WFV A;  1S0V A;  3FB7 C;  3L71 H;  3CPW U;  1XNR B;  2PUS A;  4B08 A;  2WLL B;  1R6N A;  3CCS V;  1UFI A;  2YUA A;  1MOF A;  4N21 A;  4P9O A;  2CGO A;  4I4T B;  2W0F C;  3HKB A;  1JJO A;  3DXR B;  5KA5 A;  3BHP A;  4J11 A;  4O4L B;  1VMG A;  4NXN O;  2QKA A;  4J10 A;  2P4K A;  5KUK A;  4TT3 G;  2ITC C;  3TK1 A;  5LOV A;  3QTC A;  2VWJ A;  3ZHS A;  1PNK A;  2OTJ V;  1IVS A;  3JAW A;  4IHJ B;  2QWO B;  3II6 A;  4KP4 A;  2CUG A;  1PV0 A;  4FVM A;  1WP7 A;  4FPP A;  3B09 A;  1UPG A;  2FKX A;  2KG7 A;  5IJ0 A;  4LF7 B;  4QE9 A;  3HPL C;  1CXZ B;  1JJ2 U;  1SC5 B;  1B6Q A;  3A0R A;  5B1A C;  2XUM A;  4JV5 O;  4LR3 A;  3HKC B;  1XNR O;  4DO2 A;  2EIK C;  4DV3 B;  5H6R A;  1YEW A;  1VQ9 V;  3W7X A;  2P67 A;  4LWS A;  1BQ0 A;  2EX3 A;  4PHZ A;  3JCU Z;  2UUC B;  2EIM C;  4H37 A;  1PL0 A;  1PD3 A;  4MTG A;  4TV9 B;  4X1Y B;  3MAQ A;  3ZJZ A;  1Q43 A;  3JAW B;  1IUR A;  3TET A;  4LFC O;  1VF6 A;  2DWD C;  3OGC C;  1MG1 A;  1WA8 A;  4X1I B;  4CC5 A;  2XHB A;  1KUQ A;  1ZL8 A;  4UCS A;  3ZMV A;  3OEE G;  2YIC A;  1AIL A;  3EFF K;  4IYI A;  3UT5 B;  4DK1 A;  1S5L Z;  2UU9 O;  1YJ9 V;  2JVD A;  2V4D A;  3ZHV A;  2O57 A;  4JI8 B;  1AR5 A;  4LNU A;  4I7Z B;  1G4Y B;  2RN9 A;  4I9W A;  4JYB A;  3FYI B;  2XAS A;  4GLX A;  2IBZ H;  4L87 A;  2XAG A;  4DUZ B;  4KUM A;  1OCR B;  4DV6 B;  1SQP H;  2KKW A;  2RCV A;  4U7N A;  4TUY B;  1XHZ A;  1WJZ A;  1KC8 W;  1FXK B;  3H1H H;  3G4S V;  4BIU A;  4JI1 O;  3BRC A;  1TAE A;  1V55 B;  3RVZ A;  1W0K G;  3D36 A;  4DR6 B;  1QLE B;  5LXT B;  3X2Q B;  4ZKI A;  5C8Y B;  1H2N A;  1BS3 A;  5B1B C;  3ZHR A;  1XUQ A;  5HFM A;  4B3M B;  3I5D A;  4DR3 B;  4LF9 O;  5DED A;  2AHZ A;  5IJ0 B;  2L6L A;  2QJ1 A;  1M57 C;  1JOY A;  4GZR B;  4NTX A;  3E2E A;  3P3N A;  1FYJ A;  1K4C C;  2CGN A;  1SZX A;  4JI6 O;  1HR0 O;  1BQZ A;  3ZRS A;  2Q0O C;  4DXW A;  4ICG A;  4EFE A;  3JAS A;  1HNZ B;  1VQ7 V;  2W6J G;  3HKE A;  2X6C A;  3UQ8 A;  4JYY A;  3RW0 A;  1CP9 A;  3ETE A;  1IX9 A;  2VQF B;  2XAH A;  1L1F A;  4TOI A;  2LFR A;  4LFB O;  1L0N H;  4FLY A;  3BY6 A;  4I0X A;  3BCC H;  1GMG A;  2WA4 A;  4UCO A;  1XI1 A;  1K97 A;  1VIB A;  3E8F A;  2ADQ B;  2X6A A;  1SF9 A;  5KX5 A;  1Y6X A;  3ZS8 C;  2F95 B;  1HNX O;  1PNL A;  3JAM N;  4K0K B;  4JI2 O;  1H2M A;  2IH1 C;  4NB5 A;  4WFH A;  2UXC B;  1URF A;  4MVR A;  2QKS A;  4YXW G;  3CC7 V;  4B3S B;  1MAB G;  4X65 B;  1YTF B;  2GTA A;  2R9A A;  3ABT A;  1LUV A;  2N74 A;  1XEQ A;  1IBK O;  2Y0I A;  3SJC C;  4NXM B;  4I55 A;  3PJS K;  2DJV A;  1FXK A;  1RM1 C;  5E1A C;  1DF5 A;  4ZIB A;  1OCR C;  1GH6 A;  2YI8 A;  3JAL A;  4HZ3 A;  2R9I A;  5L3C A;  1US6 A; 
#chains in the Genus database with same CATH homology
 1XMO B;  1V9P A;  4EFB A;  4DR7 B;  2JS5 A;  4DRX A;  5LYJ A;  5EIB C;  3VQV A;  3SR2 C;  4U3J B;  4LFB B;  3T1H B;  4DR1 B;  4I9Q A;  4KL1 A;  4YJ2 B;  3K5N A;  4CH5 A;  5CA0 A;  2Q7G A;  1TVK A;  5D5P A;  3E22 A;  2UUA B;  4CH4 A;  5IYZ B;  3HKB B;  4UCV A;  4O2B A;  1P49 A;  3JAK B;  4UCT A;  4TV9 A;  1T5E A;  2ZCE A;  4X20 B;  1N33 B;  3JAK A;  3JSL A;  4DV1 B;  5JJN B;  1KU9 A;  4AHC A;  2PY5 A;  3IAY A;  3U10 A;  5KX5 B;  1SQG A;  3E22 B;  4O4H A;  3THO A;  2Q0A A;  2JGU A;  5FPR A;  5EYP B;  4CH6 A;  3JAT B;  4YJ3 B;  1I7F A;  4JI5 B;  3HKC A;  1TGO A;  3SJA C;  2F66 C;  4JI2 B;  5LP6 C;  3CSX A;  5KHJ A;  5D5Q A;  4K8X A;  1WNS A;  4ZOL A;  3RYC A;  1XMQ B;  4XA4 A;  2IM9 A;  3N2G B;  4FLU A;  5J2T A;  4UCR A;  1Q8I A;  5JH7 A;  3WB1 A;  5LP6 A;  1TA8 A;  4O2B B;  2OWO A;  2F4V B;  4YHH B;  4BW9 A;  4KHP B;  3JAT A;  4JI7 B;  5KHK A;  4D7T A;  5JQG B;  4DRX B;  4O4I B;  1HNW B;  3T1Y B;  1M4U A;  4OX9 B;  4YJ2 A;  4FLV A;  5IJ9 A;  1HR0 B;  5ITZ A;  5C8Y A;  4X1K B;  1N34 B;  2PYL A;  1L8D A;  4TUY A;  3FFQ A;  3SJB C;  4I4T A;  3M7M X;  4JI0 B;  4GKK B;  4ZOL B;  1D5A A;  4EB6 A;  4DUY B;  5JCO C;  1N32 B;  2YXL A;  1SKV A;  4O4I A;  4BWA A;  4ZI7 B;  3N2K B;  1IK9 A;  5BMV B;  5LMN B;  1JFF A;  2YIB D;  2BTO A;  2ZM6 B;  5FNV A;  4IHJ A;  5BMV A;  3JSN A;  4CH3 A;  5ITZ B;  2RQ6 A;  3U11 A;  1KMI Z;  5CA1 B;  2RJZ A;  3OTO B;  1X4T A;  4X64 B;  3VQX A;  3ETQ A;  5J2T B;  4F6R A;  5GON B;  4DK0 A;  5JQG A;  4JI1 B;  4B3T B;  4U3J A;  3ICX A;  3K5L A;  1QQC A;  5LP6 B;  2BTQ A;  3MUD A;  3RFR A;  4O4L A;  3K58 A;  1IBK B;  5IYZ A;  2OYQ A;  3RYH B;  5KMG A;  4O2A B;  5CJ4 A;  4ZHQ B;  1FJG B;  1B04 A;  5LXT A;  2ZIN A;  4O2A A;  3JAR B;  2CAZ C;  2HEP A;  2YIB A;  4HNA B;  5EIB D;  5LOV B;  4LF4 B;  1Z5V A;  4UCU A;  4FLX A;  1O9H A;  4JYA B;  5FNV B;  2P22 C;  4I50 B;  1DGS A;  4YY3 B;  4X1K A;  2Q7E A;  4Q6G A;  1XNR B;  2PUS A;  4B08 A;  4FLW A;  5KHG A;  4LFC B;  1J5E B;  3RWR A;  2VQE B;  4JI3 B;  4LF6 B;  1XQ8 A;  3K59 A;  5KMG B;  4I4T B;  3HKB A;  1JJO A;  3BHP A;  2QM4 A;  4CS3 A;  4O4L B;  2PZS A;  5CHX A;  3K57 A;  1TUB B;  3ZED A;  3U0Z A;  4GYC B;  4FLZ A;  5LOV A;  5IJ9 B;  3QTC A;  4ZI7 A;  2YI9 A;  2VWJ A;  3SGI A;  3OTF A;  1N36 B;  2ZNI A;  3JAW A;  4IHJ B;  4DV0 B;  3II6 A;  4FLT A;  3HKD A;  4FFB B;  3BAA A;  4FVM A;  1O9G A;  4I55 B;  4NXN B;  4JV5 B;  4WBN A;  4LH7 A;  2UXD B;  4O4J A;  4AIL C;  4LF5 B;  4TV8 B;  3RYF A;  1H2S B;  1Z5W A;  5IJ0 A;  1IBM B;  3JAS B;  3N2G A;  4LF7 B;  1SA0 A;  1M93 A;  3RYI B;  5CA1 A;  1I94 B;  1XHX A;  4O4H B;  3LNN A;  1QHT A;  3BA8 A;  2PGG A;  3WB2 A;  4WBN B;  4X62 B;  5JVD A;  4LR3 A;  1HW7 A;  1TUB A;  3HKC B;  4HNA A;  4JI6 B;  2F93 B;  4FM2 A;  2E5L B;  3B2E E;  5KHH A;  3UT5 A;  4DV3 B;  1YEW A;  4DR2 B;  1HNX B;  4TV8 A;  2EX3 A;  4I50 A;  4PHZ A;  2UUC B;  4X66 B;  4K8Z A;  4D7S A;  4X1Y A;  1JFF B;  5K1X A;  2Q7H A;  1FFX B;  2VWK A;  4TV9 B;  3JAR A;  3RYH A;  2GV9 A;  4X1Y B;  3MAQ A;  2UXB B;  5GON A;  1Q43 A;  3JAW B;  3CB2 A;  4DR5 B;  3QG5 A;  4CC5 A;  4X1I B;  2XHB A;  4LH6 A;  4UCS A;  2F1M A;  3UT5 B;  4DK1 A;  1VF7 A;  2JVD A;  3SR2 A;  1WPB A;  2V4D A;  4EEQ A;  5J2U A;  4JI8 B;  3A2F A;  5JCO A;  4LNU A;  4DV5 B;  4GLX A;  2UUB B;  1ZAU A;  2PTM A;  4F6R B;  2ZNJ A;  4LFA B;  4DUZ B;  4ZHQ A;  5CB4 B;  4DV6 B;  5BR8 B;  3RWR D;  2KKW A;  1SA0 B;  3RYI A;  3PN1 A;  2ZIO A;  4TUY B;  1XHZ A;  1M5I A;  5JJE B;  4AQY B;  3HKD B;  2E3C A;  3BRC A;  1TAE A;  5LYJ B;  1S5J A;  1FU1 A;  4DV4 B;  4DR6 B;  5LXT B;  3CHX A;  5C8Y B;  3RYF B;  4B3M B;  4PI2 A;  4DR3 B;  3BAB A;  4L8J A;  5IJ0 B;  2R70 A;  4CC6 A;  1G6U A;  3BPZ A;  3K5O A;  4EB6 B;  4GKJ B;  2QJ1 A;  5K1P A;  1Q3E A;  5CB4 A;  5LA6 B;  4O4J B;  4YJ3 A;  1XNQ B;  3N2K A;  4IIJ A;  3HKE B;  2ZIM A;  4LF9 B;  4HBN A;  5CJ0 A;  2UU9 B;  5FPO A;  4TQF A;  5EYP A;  5J2U B;  3RYC B;  5IWA B;  4DV7 B;  5JH7 B;  4EFE A;  3JAS A;  1HNZ B;  4X1I A;  4X20 A;  3HKE A;  3UQ8 A;  5LMU B;  1SQF A;  4NVP A;  4LNU B;  4DR4 B;  2VQF B;  2HHH B;  2PYJ A;  4TOI A;  4FFB A;  4UFZ A;  4FLY A;  1TVK B;  4UCO A;  3DSQ A;  2R72 A;  1XI1 A;  1WN7 A;  5EZY A;  1RSO A;  5KX5 A;  4CS2 A;  3ZS8 C;  2F95 B;  2YIA A;  3JAL B;  3VQW A;  3K5M A;  4K0K B;  4CS4 A;  1FFX A;  1NT2 B;  3RGB A;  4DV2 B;  1JMK C;  2UXC B;  1Q5O A;  5CA0 B;  4LF8 B;  4B3S B;  4X65 B;  4IIJ B;  4FM0 A;  2R9A A;  5JVD B;  4JI4 B;  4TQD A;  3SJC C;  4PI0 A;  3QF7 A;  4NXM B;  4I55 A;  5LA6 A;  1IBL B;  2BTQ B;  3BA9 A;  5KHI A;  4B3R B;  5EZY B;  4ZIB A;  3VQY A;  5JJJ B;  2YI8 A;  3JAL A;  4FM1 A;  2P5O A;  3WB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...