2R9AA

Crystal structure of human xlf
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
227
structure length
219
Chain Sequence
b'MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLMGMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-homologous end-joining factor 1
publication title Crystal Structure of Human XLF: A Twist in Nonhomologous DNA End-Joining
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 50
structure length 219
sequence length 227
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09302 XLF XLF-Cernunnos, XRcc4-like factor, NHEJ component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.450 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2r9aA02
2.170.210.10 Mainly Beta Beta Complex Dna Repair Protein Xrcc4; Chain: A, domain 1 DNA double-strand break repair and VJ recombination XRCC4, N-terminal 2r9aA01
1M5IA 3RWRD 1KU9A 3SR2C 4XA4A 1FU1A 2R9AA 3SR2A 3RWRA 2QM4A 5CHXA 3MUDA 5CJ4A 1IK9A 3II6A 5CJ0A
chains in the Genus database with same CATH superfamily
1I5XA 1XBLA 1K33A 4LNUB 2R9RB 1L1FA 4GZRB 3OTOB 4JI8O 2YS8A 1PNKA 1QVFU 4GFAA 2UU9O 3MD0A 5JCOA 1CXZB 1F51A 5B66Z 1GTOA 3OW2U 1IDSA 5LOVA 1YVWA 1K73W 4QJFB 5CJ0A 2CGOA 2M6YA 2WA4A 3AG3C 4MTOA 3D3IA 3ZHQA 4QPJA 3HKDB 1DGSA 4GKKB 2UXNA 1K97A 3ZRWA 1SQBH 3BPZA 1QNMA 1N32B 5LYJB 2ARHA 3RGBA 3GB7C 2FB5A 2NR5A 5IY5B 4MVSA 2EJ7A 5FNVA 1M9NA 5LA6A 4X64O 5LHGA 4O2BB 1I94B 3IGAC 1JVMA 4DV6B 2Q0OC 5LXTB 2P90A 2DJVA 5DECA 1COWG 3JCUZ 3HPLC 3KKYA 2R72A 4DW0A 1MMMA 4O2AB 1Q82W 1JQ0A 3T4DA 2JRIA 5KMGA 2YIAA 4UFZA 5IYZA 4BAYA 1SRYA 1GN2A 4ZI7A 3K5NA 5EBLC 4TV9A 4EKWA 4X65B 4DR5B 1FD9A 4LF4O 1H2KA 4JYAB 3CCEV 3MHHC 3WG7C 2JGDA 5J2UA 2FMLA 1NH2B 4K8XA 4KL1A 1R3LC 1OCRB 1WNSA 1RPRA 1W59A 3OAAG 2LW7A 3NXSA 2DOSA 4LFCO 2X7RB 1HNWB 3J80N 4B3MB 2P06A 3ETEA 2ZDIC 3TXQA 4WFBV 5BMVB 4WFFA 1N36O 5IWAO 1B04A 1BSMA 1T5EA 1S0VA 5KHGA 1R1BA 1BQ0A 4QIWF 3SJAC 2B1IA 3K9AA 3ZMVA 1H8EG 2M7WA 2HFEC 4JI4O 3N2GA 3JATA 2ZDIA 5H5NA 3OD4A 5L3BA 1IVSA 2YIBA 3SPIA 2Q5ZA 1SZXA 2P67A 4LF6O 3ETGA 3KG2A 1VF5B 3SJBC 4PDLA 1XQ8A 4WFAV 4CKNA 2B1GA 4YXWG 1MSDA 2BTQA 3UM7A 3H1KH 3SJCC 2QGNA 4X66O 1Y74A 4UVAA 4TT3G 1AI6A 4JI2O 5CA3A 1Z5WA 2P6JA 4DV1O 3PJSK 1KQSU 4X62B 4JZGA 1Z2GA 4LWSA 2XAGA 2Y69B 1FKAO 2GTSA 5FLXN 2Q7EA 5LGTA 1QLNA 1ZLZA 2WSSG 3H1JH 3IC7A 3FAVA 1VQMV 3A0HZ 2HP8A 2W0XA 3LNNA 5TISZ 2R70A 3ETQA 2N05A 1ROPA 4MVRA 4O4HB 5JJNB 4C7UA 2DMXA 4MT8A 5BXZA 4CC5A 2UUBB 3E86A 4J41A 4FLVA 3ZCCA 4GFCA 3CJHA 5H9CA 4MSWC 2ZNIA 4YJ3A 4JI3O 1VP7A 3ZIAG 4LFBB 1K3EA 1F4MA 5HFMA 5CJ4A 2CDYA 3AG3B 1NR7A 1AR5A 3LDDA 2AXTZ 2A79B 2Y4TA 3UCSC 2XTAA 4DV4O 1WA8B 1XDCA 1NI8A 1Y76A 4LF5B 4Q20A 4TUYB 1P4RA 2EX3A 3JD1A 4TV8A 3JASB 4JYBA 1FXKA 1Q6HA 2QKAA 3ABLB 3H9VA 4HYOA 5EYPB 4G28B 4QNHB 1VQLV 4DO2A 3ASNB 4LF7B 1M57C 1KMIZ 4I9QA 5KMGB 3JAKB 4RAIA 3FB8C 2Q7HA 3M8AA 4YIOA 3CRCA 3B40A 4YHHB 4JI7O 1TUBA 4TV9B 1BL8A 2F95B 4UCVA 4UV8A 5AG2A 2H94A 4JI1B 4LH6A 4DV7B 3L75H 5H6QA 3KCXA 4ZBMA 1WB7A 3THOA 2A06H 1SZTA 3P32A 3L72H 5JH7B 5GTHZ 3TCUA 2WLHA 3JD4A 5KA6A 1J5EB 4GKKO 1V55C 5L3DA 4ZHQB 3CXCU 1KBHA 2LQTA 1SQQH 1XUQA 4FZ0A 3CXHF 1AI5A 2DWEC 4JI5B 4HBNA 1PKXA 2HJDA 3ZBHA 1VQ5V 1D5NA 1I94O 1IZ3A 2XNDG 2ETNA 4DV6O 4FFBA 2BSKA 1XL6A 5EBWC 4KXRA 4HAMA 1G4YB 1XMOB 3HKBB 3F7YC 3CCRV 2WLJA 3U10A 3T1CA 3H01A 2CH7A 3QO7A 4IT5A 4J42A 2AHZA 3JAWA 2QSAA 4LF8O 1V54B 5CA1A 3E89A 4I0XA 4NR1A 1XMQB 3SJQC 4DR5O 4DR4O 1AILA 1UJWB 1S5HC 1RM1B 2EIMC 4GYCB 1RPOA 1EN5A 2CTWA 1AJQA 4OPHA 5JVDB 3AG4C 4JYAO 1GO3F 1QR9A 1Y74B 3FD9A 1YTFB 1HR0B 1M56B 1E1RG 2WLKA 4DRXB 4CKMA 2VQFO 4X1IA 4IGGA 5B1BB 3Q4HA 1JJ2U 2ZXWC 1AI7A 1H8HG 2PGGA 5LMUB 3U0ZA 2BE3A 5BY1A 2A3QA 4FLUA 4B3MO 1AP5A 2GV9A 2QWPB 3S3XA 4RQFA 3K57A 4NXMB 2QDOA 2YIBD 4EEQA 5J2TB 1H38A 1PNMA 3L73H 4XBFA 1Q3EA 4BIOA 1SQFA 1H2NA 3APOA 2Y3WA 2QWRB 4X20B 3B09A 4DV2B 2CUGA 1VQPV 5L3EA 4G2KA 3OUFA 1YJNV 1GN4A 2DQ0A 3W7XA 3D36C 3ZRVA 4X88A 4O4IB 2HVJC 3E8BA 1QR8A 1K5SA 5IY5C 3JD2A 5LBQA 4IHJB 2E75B 4EB6B 1FXKB 2UUCO 5A9GA 4WBNA 4X62O 2ZE5A 1NTMH 3HKDA 1OHHG 2VQEB 3D36A 2IM9A 2ADPA 4GX2A 2VS0A 1ZX3A 2ZE8A 2CTPA 5LYJA 4NB5A 5LP6B 1IBLB 1VEWA 2N74A 1BHBA 5E79Z 4CH3A 4RQEA 2D2CB 1NVPB 3B8NA 4O2BA 2HEPA 5LL6Y 4B3RB 3CP1A 5LXTA 2KB1A 3K9SA 5B1AB 1Y67A 4CS2A 4XDLA 4MVMA 1KYOF 3A0RA 2Q6AA 1N8RW 1R3JC 4O2AA 1JJOA 4LFBO 2H8PC 4JYCA 1G6UA 3L70H 1FJGB 4FLXA 1OCRC 1K9MW 1VQNV 4H44B 1Q6UA 4JYYA 2OIEA 1FPOA 4MS2A 3GWOA 2ZT9B 3AG7A 3CRRA 4J7KA 4PV1B 2HG5C 1YJWV 4CBCA 4LF7O 4LF9B 4DR7O 1YF2A 3JAWB 5IYCO 2O57A 3BAAA 4YHHO 2VWJA 1FYJA 4IIJB 1H2LA 1VF6A 5BMVA 4JI1O 1GMGA 2HHHB 3K06A 3ZRSA 4CC6A 2ZKOA 2ITCC 1P7GA 1KU9A 4PDMA 2ZIMA 1J5EO 3ZN1A 1J95A 5H6RA 2QM4A 2UXDO 4CH4A 4DR3B 1F4NA 3J81N 4WFGA 1AJNA 3F7VC 4JI5O 4JAVA 2KG7A 2YDEA 1AROP 1LR1A 5EIBD 1NKDA 3RFRA 1DF5A 2Y69C 1SS3A 1GRJA 1I08A 2JK5C 1GAXA 1JR9A 1XMOO 3M7MX 2OIGA 2ZR3A 5LMNB 2PI5A 3OGIB 1Q86W 3UT5B 1YJ9V 1I0HA 2QR4A 2MW2B 4EFEA 4IYHA 3DSQA 1VARA 1XMQO 1K5QA 3ICXA 1HNXO 2KSDA 1SA0B 1VIBA 1X59A 3RVYA 2YI9A 4H13B 4RUEA 1Q43A 4O4HA 5IJ9B 4GT1A 1BT8A 1HR0O 5CBHA 4LC1A 1EN6A 1RP3B 2G38A 3A0BZ 3NR7A 4GUNA 4WBNB 3CRQA 4NXNB 3RYIB 1KUQA 2X6AA 4UB8Z 1JA8A 3Q0XA 3T1HO 3BCCH 3BY6A 3JYCA 1HNZB 3ABLC 3R66A 3T4ZA 1R3IC 4NXMO 1VQOV 1WA8A 3ASNC 3N2KB 2GDSA 2UXCB 3CCJV 2WLLB 1QCEA 4TUYA 1P7BA 2AGAA 3JASA 3TK1A 1IX9A 3GWKC 4FVMA 2WAMA 3P30A 4ZOLB 5KUMA 4B7KA 4O4LB 5EYPA 1MNGA 3W7UA 3RN4A 1IURA 3JAKA 4DV2O 5GTIZ 4DV0B 1P49A 2EZOA 3LUTB 1GKFA 1H2SB 1ZWIC 4GX0A 4IYIA 4WF9V 3E8GA 4N21A 3RYCB 3G67A 1Q5OA 4FZ1A 4YIPA 1FFTB 5JH7A 1MOFA 4JI6B 1KKDA 1PV0A 3UKMA 2VQEO 4ZHQA 1FXHA 3HKCB 4DUZB 3RWRA 3ZEDA 3H1IH 1MSWD 2BOCC 1IBLO 2IJKA 1HDJA 3ZHSA 2E76B 2OWOA 1WN7A 1V54C 1O9HA 2DE0X 4E4EA 2LFRA 3RYFB 4L87A 3HKBA 3O9OA 5E1AC 3CMEV 1RM1C 2R9IA 3CCUV 4MVUA 5CHXA 1M90W 1BE3H 5JJJB 1NBMG 1ZUQA 3APQA 4NKGB 4Z1MG 4N23A 1S5LZ 3G6BA 1M56C 1FJGO 3ZMTA 1ORQC 4J9ZB 2E5LB 2KG7B 3MDSA 1AVMA 1NH2D 4YJ2B 2PTMA 1PPJH 5B1BC 3N27A 4X89A 2JEUA 5JVDA 4RWUA 1N34B 4UVBA 1WJZA 1SC5B 2WLIA 4JASA 3I55V 1L8DA 1EFRG 4K0KO 1QU7A 1EM1A 4DRXA 2CTRA 4DR6B 3CSXA 1EN4A 2QTOA 4G27B 4LR3A 4BR6A 4X1KA 4MW3A 1TVKA 1GH6A 5KHIA 2YICA 1S76D 4CZZA 2Y0IA 4F4LA 1PL0A 4FM1A 1Y66A 2FKXA 2XHBA 3CCMV 4I50A 2YUAA 3AG2B 4GX5A 1X4TA 3WB0A 2HHHO 4RUFA 3C90A 2GUZA 3CCSV 2QTSA 4H0LB 1M1KW 5K1XA 2GHYA 5J2TA 2V1DA 5GW7A 3P3PA 1QBZA 1R6TA 1OCOB 1ENVA 3ZHTA 3DXRB 4DR3O 1VQ8V 2PI4A 1CPYA 2ZM6B 1SERA 1HW7A 4X20A 4UXNA 1FXKC 1XREA 3ZN0A 1AR4A 2PZSA 2Q0AA 3CCVV 4BIZA 3A8TA 3IAYA 3OM3B 4O4IA 2L6LA 3ML0A 5LP6C 2QA4V 3KCYA 2OTJV 2WLNA 1VQ7V 4IHJA 4I4TB 4EB6A 4DUYB 3OTOO 4FFKA 4JV5B 1EZVH 1K34A 2IJIA 5B1AC 5FPRA 1IBMB 2WWWA 2EZPA 5LP6A 5IYBO 1KC8W 2LW1A 4J80A 4KHPB 2Q8VA 1D5AA 5EZYA 3OMNB 1MZFA 5K1PA 2ZINA 1PNLA 3IC9A 1W0KG 4D6TH 3DGEA 1B3QA 3K79A 3E2EA 3T1YB 2F93B 2QWOB 5KHKA 3Q0YA 4GCZA 3ZMSA 2DYRB 4PI2A 1N32O 2F43G 1VQ9V 1XNRB 4O4JB 2JS3A 2XOKG 1M93A 3LSQA 3UO3A 4Z2WA 5ITZB 3RYHB 1OCCB 4FLWA 4OPAA 2ZIOA 3FYIB 4QPKA 3QTCA 2ZCEA 5KX5B 4P9OA 4B3TB 1KB9F 3G80A 4R8CA 1F7YA 4AHCA 4OX9B 4CKPA 3IFXA 4J10A 4FPPA 2Y3VA 4FMTA 2BCCH 5L3GA 2CK3G 1IXMA 2Y0PA 2YI8A 3ABTA 2AZ2A 3BRCA 4DV0O 3CRAA 1PP9H 3SPHA 4WFEA 1KP3A 3ABKB 1FAFA 3HR0A 2H3OA 4X65O 1A32A 4IIJA 4YY3B 1OJHA 3ZHUA 3FKSG 2FYUH 2VRZA 2OCCB 3RWRD 1URFA 2AHYA 2YXHA 2IJJA 4R50A 3T2MA 2WLIB 2PY5A 2ODMA 3I5DA 4NTYA 1MG1A 1YIJV 3OGCC 4JI6O 1AP6A 3CYOA 2UU9B 5L3CA 4PDRA 4DUZO 1O9GA 4X1KB 1TVKB 2ZD9A 3CMAV 2PYJA 1HNWO 1BCCH 3CC4V 4FK5C 5IJ0B 2DYSB 3IJ4A 3E8HA 4I50B 2QWQB 3ZS8C 2Q4PA 1PL4A 2GUZB 2E3CA 4J9YB 1MABG 4GX1A 1AR1B 1DLBA 2CTQA 2YC0A 1D2DA 3E83A 2BTOA 2V7QG 4I5SA 4GEUA 2Q73A 5CA0B 2LGQA 3UT5A 1WP7A 5HFLA 5C93A 2ZQMA 4DK1A 4X64B 3P3NA 3SYCA 2E5LO 4NYKA 5C8YB 1BHAA 1HWYA 2D3OW 1SA0A 2OT5A 1SQVH 2F66C 4KP4A 1N34O 1PD3A 5IJ9A 2ITDC 5EC2C 4ZKIA 1IBKB 2QM7A 2QM8A 4DR2B 3II6A 5LHIA 4J7ZA 1ZAUA 2EIKB 3WU2Z 4P2ZA 2AZ0A 3RYIA 4PA7A 1N0JA 3RT3C 3WFVA 1K92A 4UCSA 1WB8A 1G8MA 3G4SV 3L71H 1XNQB 2XAHA 3ZHRA 4TQFA 4FLZA 2Q69A 4DXWA 3CWBH 3SYOA 5H2FZ 2LFSA 5KA5A 2A0LA 2Q9LA 3N2KA 1VF7A 5EZYB 1NTZH 2Y4UA 2WLLA 2UUBO 4MTFA 4LCUC 2FTKA 3B4SA 3ZX6A 2XUMA 4LH7A 4XDKA 3JD0A 4LFCB 4K3AA 3AG1B 1GN6A 4ZOLA 5CBFA 4KUMA 4O4LA 5JJEB 2AW9A 3CC2V 3C3SA 2XAQA 5IE9A 3W7TA 1ZL8B 4MTXA 4XA4A 2IU3A 5JQGB 1GM7A 2Z3YA 2HKOA 2KKWA 4I9WA 4LF5O 3OT7A 1YSCA 4BW5A 3RYCA 2IH3C 4J7JA 1CEZA 3GVMA 4DUYO 1VF6C 1WPXA 4CS4A 3VQYA 2ILMA 1G1XB 5DN6G 1VMGA 1B06A 3HKCA 2W6IG 3FX7A 2YIDA 1TUEB 2XT9A 4QGPA 4MW8A 1IBMO 3CX5F 3B8MA 1DK1A 2K1EA 1PM9A 4RO2A 2B5UA 2F1MA 2Q7GA 3K03A 4JI2B 5KHHA 3ZJZA 2WPDG 4DV7O 2PYLA 4DV1B 1VQ6V 5BR8B 1LUWA 1ZSPA 1K7DA 2VWKA 2Y48A 1NJIW 4D7TA 3RYFA 3WB1A 3T1YO 4TQDA 3BA8A 3JSNA 1P84F 5KHJA 2EULA 3TJTA 3QVNA 3LDEA 5IT9N 1QHTA 4QE9A 4Z1VA 4CH6A 1E1QG 1LNQA 2LJ2A 1L0NH 4YJ2A 1OZ0A 1FFXB 3LDCA 2EINB 2WA3A 2P5OA 1S77D 1US6A 2UXBB 1BZKA 2EILB 3HKEA 1AJPA 5KUKA 1YEWA 4OX9O 4JI3B 3ABMB 3UQ8A 3AG2C 1OCZB 1KECA 1JMKC 4DV5B 3WB2A 2JVDA 4A5UB 3SPCA 3S3WA 4PELA 3BFRA 2Z0AA 2RJZA 1V9PA 1OCOC 1KP2A 3RVZA 2JEXA 1RSOB 2QE7G 3AK3A 2DN9A 2XAJA 2EBOA 1H2GA 3I56V 3DC6A 3DXRA 4JI7B 4GEXA 1S5JA 2YXLA 5LMUO 4OXSA 2HLDG 2LGWA 2ZR2A 1SF9A 5KAIZ 1R6NA 4PA3A 4FLYA 1XHZA 4NTWA 2RCVA 3W7SA 3K5OA 3M99B 3ETDA 1NS1A 1M5IA 1XI1A 3E22B 1Y4MA 2LP7A 4JAAA 4I4TA 2LO1A 3B2EE 2XASA 2N04A 4PD4F 2NN4A 2UXXA 2P22C 4JAUA 1NU1H 2F4VB 2DYRC 3X2QB 3CHXA 1TAEA 3CRMA 1IBKO 4OGQB 4PA6A 4UCTA 2EIJB 5CBGA 1NT2B 1FU1A 4NTXA 4DR2O 4DK0A 1JOYA 4JPRA 1YI2V 1OCCC 4LF8B 2UUAB 1Q90D 1ZTEA 2YEVA 3ASOB 2PF4E 4MTGA 4DR4B 4JTDB 3MHSC 1SQPH 3K59A 1UFIA 5D5QA 3QO5A 3TGUH 1Q7YW 1XNQO 1EBOA 1FXVA 4O4JA 4GLXA 2PUSA 4AQYB 1MZEA 4U3JB 3EXAA 2L35A 5ITZA 4JTAB 3RYHA 1XL4A 5JWPA 4B3RO 5KX5A 3BHPA 5LHHA 2VQFB 1Z5VA 3ABKC 2RNBA 2FL4A 5DEDA 3K08A 4ICGA 1SQGA 2OCCC 3OMIB 1TGOA 2XAFA 1YITV 3BABA 3JALB 3H1LH 3OR6C 1BS3A 4GKJB 4ZIBA 3K5MA 1U96A 1YCIA 3PN1A 3OUSA 2DWDC 2QEXV 3HKEB 3LSSA 4TOIA 3JD3A 1N33B 3R65A 2RN9A 2DYSC 3B77A 2P4VA 4HNAA 2B9ZA 1GM8A 3SGIA 1TA8A 4CH5A 4LF9O 3SYAA 1GM9A 4JGSA 1QLEB 2WLMA 4LP8A 5B3SB 5L3FA 5IJ0A 4LFAB 3OE7G 2GBOA 2UUCB 5BR8O 5LGNA 3OMAB 3HB3B 3E35A 4R6ZA 1K8AW 3K04A 1XHXA 2ZE6A 3OTFA 2X6BA 1W0JG 2A9HA 2ZNJA 5F2VO 4UCUA 3DC5A 5CA0A 4DR1B 2IU0A 3EFFK 1AB3A 4U3FH 4MVQA 2OYQA 4H33A 5LOVB 1S3JA 3ZHVA 5C8YA 2RDCA 3VBBA 5CMUA 2EIKC 5IDJA 1YZBA 5DM6V 5BZBA 4F6RA 5CB4A 1W2BU 3CB2A 2UXBO 1THZA 1H2MA 4K35A 2GSMB 2ZE7A 2OTLV 1CP9A 4JI0B 2Z5UA 1GK9A 1QVGU 3ZRWB 4AI8A 2P4KA 5LMNO 4DV5O 3CS5A 3ZMZA 3RBZA 4TSFG 3CEIA 3D3QA 5FNVB 2JDIG 1I7FA 5LA6B 1WPBA 3SR2C 2MK3A 2A7WA 4BW9A 4PA4A 3KZIZ 3AG1C 4CS3A 4J11A 2JJ2G 3K0DA 1RFYA 3FFQA 1DF4A 4B3SB 3FB5C 5KAFZ 1QQCA 5J9PC 4DV3B 3SR2A 3LSUA 4TWKA 3SDLA 3OFNG 3VQXA 4DR7B 1M4UA 2IH1C 2R9AA 4MVOA 5IYZB 3JAMN 1BQZA 2F23A 2QKCA 2YEVB 4ASUG 4NXNO 4ZI7B 2RQ6A 3AK2A 4PHZA 3SPGA 2KQXA 1VQ4V 2NLJC 3K5LA 5B1OA 2QJ1A 1HNZO 4HZ3A 4L8JA 2JGDB 5J2UB 1ZL8A 5JQGA 1LUVA 1WP8A 1NR1A 3ABUA 2UXCO 1MA1A 4I55A 3CE2A 1XILA 5GONA 2UXDB 2DQ3A 2W0FC 5FL7G 5EIBC 4FM2A 3WG7B 3CD6V 2CE4A 4H37A 3ZRXA 4X8AA 1HP8A 2GTAA 2HVKC 2F4VO 1S72V 1JPXA 2ATKC 3K0GA 4I7ZB 3VOUA 4FJCC 1UPGA 1L0LH 3CCLV 1BGYH 3N2GB 3JATB 4B7EA 3E8FA 2EINC 3JARA 4JI8B 4W4KA 1R6KA 5D5PA 4HNAB 2UUAO 2EILC 3TETA 4FLTA 2QKSA 2QWNB 3CC7V 1K4CC 3EHBB 3EVKA 1HNXB 3VQVA 3ABMC 2BTQB 1JFFA 1OCZC 4AQYO 4P9PA 1FFXA 4JTCB 1KKCA 3QF7A 4FM0A 5EC1C 5EK0A 4LWSB 1Y6XA 2Q67A 3T1HB 3FAVB 3FB7C 4PA9A 3STLC 4QE7A 2E74B 4GKJO 4F6EA 1YTFD 1NZ6A 2X6CA 1NTKH 4F6RB 1IXBA 3STZC 5CB4B 1WAZA 2JJ1G 2JGUA 4X1YA 1WLEA 4K8ZA 3CJHB 1RSOA 4LNUA 1N33O 4UCOA 3FYEB 4YJ3B 4UVCA 1N4CA 3BEHA 3G6EV 4P30A 1SETA 3ZMUA 4W4LA 3LNMB 3TXSA 5A2QN 1YDXA 4DR6O 4E2LA 4U7NA 2HJFC 3MUDA 4PJ0Z 4MVZA 1I5YA 3BA9A 4LF4B 3F5TA 1Y76B 2NNUA 4WFHA 2YSUB 4TV8B 4LFAO 2IJHA 1OV9A 2YXYA 5B5EZ 2C2AA 3AK1A 2P7TC 1XEQA 3E22A 4DYLA 3SPJA 2CAZC 4DR1O 2JS5A 4R7CA 1TUBB 4XDJA 3X2QC 3SYQA 2ZM6O 3OR7C 2EIJC 4ABMA 4AILC 1N36B 5IWAB 2V4DA 1BMFG 2CGNA 4G79A 1GN3A 3ASOC 1M57B 2JIZG 4PI0A 3K58A 2X0LA 2HR3A 4NVPA 4JZ2A 2W6JG 4I55B 4JI0O 5GONB 4FIPC 4EFBA 3F5WC 4JI4B 3MAQA 4DW1A 4PDVA 3QG5A 1FS0G 2IW5A 3FB6C 3O65A 4LF6B 5IYDO 1NVPD 1R3KC 4JV5O 1Q8IA 3C3TA 1SKVA 1XOUA 3VQWA 3AEIA 1K4DC 3JSLA 3BVOA 4FFBB 2BSKB 1SESA 1V55B 1KD1W 5EBMC 4UUJC 3J7AU 1B6QA 1F23A 2ADQB 4X66B 1NQTA 4IL6Z 3OEEG 4LBEC 4U3JA 4D7SA 4KHPO 2IBZH 4K0KB 4B08A 4B3SO 3A2FA 2CH7B 4KFMA 4DV3O 4UB6Z 1DTOA 1E79G 4WCEV 1YHQV 1N0NA 3W7WA 3H1HH 3JARB 3CPWU 4U7OA 3JCZA 5CA1B 4I0XB 5B1NA 4UCRA 1Q81W 3JALA 1JFFB 3G71V 5FPOA 1XNRO 4BWAA 1EZJA 1VQKV 2OCHA 2Q68A 1YXBA 3CCQV 3OEHG 3SYPA 3L74H 3PYIA 3RW0A 1IK9A 1JCHA 5CN0A 4X9QA 3DTUB 4B3TO 4X1IB 1QLEC 4BIUA 3Q4HB 3UO2A 5B3SC 2EIMB 1JX9A 3QNEA 3AG4B 4Q6GA 1U97A 5LGUA 1SQXH 2K9PA 2DW4A 4UV9A 3K3WA 4DV4B 1Q6IA 3D8CA 2ZXWB 2BOBC 3QO8A 1AI4A 2EJRA 1R73A 3L9DA 5JCOC 4YY3O 4JF3A 2RMKB 4X1YB 5KLVH 3U11A
chains in the Genus database with same CATH topology
4LNUB 1XNRB 3K5MA 4O4JB 3PN1A 3OTOB 3HKEB 1M93A 5LYJA 5ITZB 3RYHB 5LP6B 4TOIA 1IBLB 4FLWA 1N33B 2ZIOA 3QTCA 4CH3A 2ZCEA 5KX5B 4B3TB 5JCOA 4O2BA 2HEPA 4AHCA 4HNAA 4OX9B 4B3RB 3SGIA 5LXTA 1TA8A 5LOVA 4CH5A 5CJ0A 4CS2A 2YI8A 4O2AA 3BRCA 5IJ0A 1JJOA 4LFAB 3HKDB 1DGSA 4GKKB 1G6UA 2UUCB 1FJGB 4IIJA 4YY3B 4FLXA 3BPZA 1N32B 5LYJB 3RGBA 1XHXA 3RWRD 3OTFA 2ZNJA 5FNVA 5LA6A 2PY5A 4UCUA 4DR1B 5CA0A 4O2BB 1I94B 4DV6B 2UU9B 2OYQA 5LXTB 5LOVB 1O9GA 4X1KB 5C8YA 1TVKB 4F6RA 4LF9B 5CB4A 3CB2A 2R72A 2PYJA 3JAWB 3BAAA 4O2AB 5IJ0B 4I50B 3ZS8C 2VWJA 5KMGA 4JI0B 2YIAA 4UFZA 5IYZA 4IIJB 5BMVA 2E3CA 4ZI7A 3K5NA 4TV9A 2HHHB 4X65B 4DR5B 4CC6A 5FNVB 1I7FA 5LA6B 1WPBA 1KU9A 2BTOA 3SR2C 4JYAB 2ZIMA 5CA0B 3UT5A 5J2UA 4BW9A 4K8XA 4KL1A 4DK1A 2QM4A 4X64B 4CH4A 4DR3B 1WNSA 5C8YB 4CS3A 3FFQA 4B3SB 1SA0A 1QQCA 2F66C 5EIBD 4DV3B 3SR2A 3RFRA 5IJ9A 3VQXA 1HNWB 1IBKB 4B3MB 4DR7B 1M4UA 2R9AA 5IYZB 5BMVB 4ZI7B 4DR2B 3II6A 1B04A 2RQ6A 4PHZA 1T5EA 1ZAUA 5KHGA 3M7MX 3K5LA 3RYIA 5LMNB 2QJ1A 3SJAC 3UT5B 4L8JA 5J2UB 4UCSA 5JQGA 1XNQB 4TQFA 4EFEA 4FLZA 3N2GA 3JATA 2YIBA 3DSQA 4I55A 5GONA 3ICXA 2UXDB 3N2KA 1VF7A 5EZYB 1SA0B 3SJBC 1XQ8A 5EIBC 4FM2A 2YI9A 1Q43A 4O4HA 5IJ9B 2BTQA 4LH7A 3SJCC 4LFCB 4ZOLA 4WBNB 4O4LA 4NXNB 5JJEB 1Z5WA 3RYIB 4X62B 4XA4A 2Q7EA 5JQGB 1HNZB 3N2GB 3JATB 2KKWA 3JARA 4JI8B 5D5PA 3N2KB 3RYCA 4HNAB 2UXCB 4FLTA 3LNNA 2R70A 3ETQA 4TUYA 4CS4A 1HNXB 3VQYA 3JASA 3VQVA 4O4HB 5JJNB 2BTQB 3HKCA 1JFFA 4FVMA 4CC5A 2UUBB 4FLVA 1FFXA 4ZOLB 4O4LB 5EYPA 3QF7A 2F1MA 3JAKA 2ZNIA 2Q7GA 4YJ3A 4FM0A 4DV0B 1P49A 4LFBB 4JI2B 5KHHA 2PYLA 4DV1B 5CJ4A 1H2SB 5BR8B 2VWKA 3T1HB 4D7TA 3RYFA 3WB1A 4TQDA 3BA8A 3RYCB 1Q5OA 3JSNA 5KHJA 5JH7A 4LF5B 4TUYB 4JI6B 4TV8A 2EX3A 3JASB 1QHTA 4CH6A 4ZHQA 3HKCB 4F6RB 4DUZB 3RWRA 5CB4B 2JGUA 4X1YA 4YJ2A 1FFXB 3ZEDA 4K8ZA 5EYPB 2P5OA 1RSOA 4LNUA 4LF7B 2UXBB 1KMIZ 4UCOA 4I9QA 5KMGB 3HKEA 3JAKB 4YJ3B 2Q7HA 2OWOA 1WN7A 4YHHB 1TUBA 4TV9B 1YEWA 4JI3B 2F95B 4UCVA 3UQ8A 1O9HA 4JI1B 1JMKC 4LH6A 4DV5B 4DV7B 3RYFB 3WB2A 3MUDA 2JVDA 3HKBA 3BA9A 4LF4B 3THOA 5CHXA 5JH7B 5JJJB 4TV8B 2RJZA 1V9PA 1J5EB 4ZHQB 2E5LB 4YJ2B 2PTMA 4JI5B 3E22A 4HBNA 2CAZC 5JVDA 1N34B 2JS5A 1TUBB 4FFBA 1L8DA 4AILC 1N36B 4JI7B 5IWAB 2V4DA 4DRXA 1S5JA 2YXLA 1XMOB 3HKBB 4DR6B 3CSXA 3U10A 4LR3A 4X1KA 1TVKA 5KHIA 4PI0A 3K58A 4NVPA 4I55B 4FM1A 5GONB 2XHBA 3JAWA 4EFBA 4FLYA 1XHZA 4JI4B 3MAQA 5CA1A 4I50A 3QG5A 1X4TA 3WB0A 1XMQB 3K5OA 4LF6B 1M5IA 1XI1A 3E22B 5K1XA 5J2TA 4GYCB 4I4TA 5JVDB 1Q8IA 1SKVA 3VQWA 3JSLA 4FFBB 1HR0B 4X66B 3B2EE 4DRXB 4D7SA 4U3JA 2ZM6B 2P22C 1HW7A 4X1IA 4K0KB 4B08A 3A2FA 4X20A 2F4VB 2PGGA 5LMUB 2PZSA 3U0ZA 2Q0AA 3CHXA 3JARB 1TAEA 4FLUA 2GV9A 4UCTA 3IAYA 5CA1B 1NT2B 1FU1A 3K57A 4NXMB 4O4IA 4DK0A 4UCRA 5LP6C 4LF8B 2YIBD 4EEQA 2UUAB 5J2TB 3JALA 4IHJA 4I4TB 4EB6A 1JFFB 4DUYB 5FPOA 4DR4B 4BWAA 3K59A 4JV5B 5D5QA 4O4JA 1Q3EA 4GLXA 2PUSA 4AQYB 5FPRA 1IBMB 1SQFA 1IK9A 4U3JB 5ITZA 3RYHA 5LP6A 4X1IB 4X20B 4DV2B 5KX5A 4KHPB 3BHPA 2VQFB 4Q6GA 1Z5VA 1D5AA 5EZYA 5K1PA 2ZINA 1SQGA 4O4IB 1TGOA 4DV4B 3T1YB 2F93B 5KHKA 3BABA 3JALB 4IHJB 4EB6B 4WBNA 5JCOC 4GKJB 3HKDA 4X1YB 4PI2A 2VQEB 3U11A 2IM9A 4ZIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M5I A;  3RWR D;  1KU9 A;  3SR2 C;  4XA4 A;  1FU1 A;  2R9A A;  3SR2 A;  3RWR A;  2QM4 A;  5CHX A;  3MUD A;  5CJ4 A;  1IK9 A;  3II6 A;  5CJ0 A; 
#chains in the Genus database with same CATH topology
 1I5X A;  1XBL A;  1K33 A;  4LNU B;  2R9R B;  1L1F A;  4GZR B;  3OTO B;  4JI8 O;  2YS8 A;  1PNK A;  1QVF U;  4GFA A;  2UU9 O;  3MD0 A;  5JCO A;  1CXZ B;  1F51 A;  5B66 Z;  1GTO A;  3OW2 U;  1IDS A;  5LOV A;  1YVW A;  1K73 W;  4QJF B;  5CJ0 A;  2CGO A;  2M6Y A;  2WA4 A;  3AG3 C;  4MTO A;  3D3I A;  3ZHQ A;  4QPJ A;  3HKD B;  1DGS A;  4GKK B;  2UXN A;  1K97 A;  3ZRW A;  1SQB H;  3BPZ A;  1QNM A;  1N32 B;  5LYJ B;  2ARH A;  3RGB A;  3GB7 C;  2FB5 A;  2NR5 A;  5IY5 B;  4MVS A;  2EJ7 A;  5FNV A;  1M9N A;  5LA6 A;  4X64 O;  5LHG A;  4O2B B;  1I94 B;  3IGA C;  1JVM A;  4DV6 B;  2Q0O C;  5LXT B;  2P90 A;  2DJV A;  5DEC A;  1COW G;  3JCU Z;  3HPL C;  3KKY A;  2R72 A;  4DW0 A;  1MMM A;  4O2A B;  1Q82 W;  1JQ0 A;  3T4D A;  2JRI A;  5KMG A;  2YIA A;  4UFZ A;  5IYZ A;  4BAY A;  1SRY A;  1GN2 A;  4ZI7 A;  3K5N A;  5EBL C;  4TV9 A;  4EKW A;  4X65 B;  4DR5 B;  1FD9 A;  4LF4 O;  1H2K A;  4JYA B;  3CCE V;  3MHH C;  3WG7 C;  2JGD A;  5J2U A;  2FML A;  1NH2 B;  4K8X A;  4KL1 A;  1R3L C;  1OCR B;  1WNS A;  1RPR A;  1W59 A;  3OAA G;  2LW7 A;  3NXS A;  2DOS A;  4LFC O;  2X7R B;  1HNW B;  3J80 N;  4B3M B;  2P06 A;  3ETE A;  2ZDI C;  3TXQ A;  4WFB V;  5BMV B;  4WFF A;  1N36 O;  5IWA O;  1B04 A;  1BSM A;  1T5E A;  1S0V A;  5KHG A;  1R1B A;  1BQ0 A;  4QIW F;  3SJA C;  2B1I A;  3K9A A;  3ZMV A;  1H8E G;  2M7W A;  2HFE C;  4JI4 O;  3N2G A;  3JAT A;  2ZDI A;  5H5N A;  3OD4 A;  5L3B A;  1IVS A;  2YIB A;  3SPI A;  2Q5Z A;  1SZX A;  2P67 A;  4LF6 O;  3ETG A;  3KG2 A;  1VF5 B;  3SJB C;  4PDL A;  1XQ8 A;  4WFA V;  4CKN A;  2B1G A;  4YXW G;  1MSD A;  2BTQ A;  3UM7 A;  3H1K H;  3SJC C;  2QGN A;  4X66 O;  1Y74 A;  4UVA A;  4TT3 G;  1AI6 A;  4JI2 O;  5CA3 A;  1Z5W A;  2P6J A;  4DV1 O;  3PJS K;  1KQS U;  4X62 B;  4JZG A;  1Z2G A;  4LWS A;  2XAG A;  2Y69 B;  1FKA O;  2GTS A;  5FLX N;  2Q7E A;  5LGT A;  1QLN A;  1ZLZ A;  2WSS G;  3H1J H;  3IC7 A;  3FAV A;  1VQM V;  3A0H Z;  2HP8 A;  2W0X A;  3LNN A;  5TIS Z;  2R70 A;  3ETQ A;  2N05 A;  1ROP A;  4MVR A;  4O4H B;  5JJN B;  4C7U A;  2DMX A;  4MT8 A;  5BXZ A;  4CC5 A;  2UUB B;  3E86 A;  4J41 A;  4FLV A;  3ZCC A;  4GFC A;  3CJH A;  5H9C A;  4MSW C;  2ZNI A;  4YJ3 A;  4JI3 O;  1VP7 A;  3ZIA G;  4LFB B;  1K3E A;  1F4M A;  5HFM A;  5CJ4 A;  2CDY A;  3AG3 B;  1NR7 A;  1AR5 A;  3LDD A;  2AXT Z;  2A79 B;  2Y4T A;  3UCS C;  2XTA A;  4DV4 O;  1WA8 B;  1XDC A;  1NI8 A;  1Y76 A;  4LF5 B;  4Q20 A;  4TUY B;  1P4R A;  2EX3 A;  3JD1 A;  4TV8 A;  3JAS B;  4JYB A;  1FXK A;  1Q6H A;  2QKA A;  3ABL B;  3H9V A;  4HYO A;  5EYP B;  4G28 B;  4QNH B;  1VQL V;  4DO2 A;  3ASN B;  4LF7 B;  1M57 C;  1KMI Z;  4I9Q A;  5KMG B;  3JAK B;  4RAI A;  3FB8 C;  2Q7H A;  3M8A A;  4YIO A;  3CRC A;  3B40 A;  4YHH B;  4JI7 O;  1TUB A;  4TV9 B;  1BL8 A;  2F95 B;  4UCV A;  4UV8 A;  5AG2 A;  2H94 A;  4JI1 B;  4LH6 A;  4DV7 B;  3L75 H;  5H6Q A;  3KCX A;  4ZBM A;  1WB7 A;  3THO A;  2A06 H;  1SZT A;  3P32 A;  3L72 H;  5JH7 B;  5GTH Z;  3TCU A;  2WLH A;  3JD4 A;  5KA6 A;  1J5E B;  4GKK O;  1V55 C;  5L3D A;  4ZHQ B;  3CXC U;  1KBH A;  2LQT A;  1SQQ H;  1XUQ A;  4FZ0 A;  3CXH F;  1AI5 A;  2DWE C;  4JI5 B;  4HBN A;  1PKX A;  2HJD A;  3ZBH A;  1VQ5 V;  1D5N A;  1I94 O;  1IZ3 A;  2XND G;  2ETN A;  4DV6 O;  4FFB A;  2BSK A;  1XL6 A;  5EBW C;  4KXR A;  4HAM A;  1G4Y B;  1XMO B;  3HKB B;  3F7Y C;  3CCR V;  2WLJ A;  3U10 A;  3T1C A;  3H01 A;  2CH7 A;  3QO7 A;  4IT5 A;  4J42 A;  2AHZ A;  3JAW A;  2QSA A;  4LF8 O;  1V54 B;  5CA1 A;  3E89 A;  4I0X A;  4NR1 A;  1XMQ B;  3SJQ C;  4DR5 O;  4DR4 O;  1AIL A;  1UJW B;  1S5H C;  1RM1 B;  2EIM C;  4GYC B;  1RPO A;  1EN5 A;  2CTW A;  1AJQ A;  4OPH A;  5JVD B;  3AG4 C;  4JYA O;  1GO3 F;  1QR9 A;  1Y74 B;  3FD9 A;  1YTF B;  1HR0 B;  1M56 B;  1E1R G;  2WLK A;  4DRX B;  4CKM A;  2VQF O;  4X1I A;  4IGG A;  5B1B B;  3Q4H A;  1JJ2 U;  2ZXW C;  1AI7 A;  1H8H G;  2PGG A;  5LMU B;  3U0Z A;  2BE3 A;  5BY1 A;  2A3Q A;  4FLU A;  4B3M O;  1AP5 A;  2GV9 A;  2QWP B;  3S3X A;  4RQF A;  3K57 A;  4NXM B;  2QDO A;  2YIB D;  4EEQ A;  5J2T B;  1H38 A;  1PNM A;  3L73 H;  4XBF A;  1Q3E A;  4BIO A;  1SQF A;  1H2N A;  3APO A;  2Y3W A;  2QWR B;  4X20 B;  3B09 A;  4DV2 B;  2CUG A;  1VQP V;  5L3E A;  4G2K A;  3OUF A;  1YJN V;  1GN4 A;  2DQ0 A;  3W7X A;  3D36 C;  3ZRV A;  4X88 A;  4O4I B;  2HVJ C;  3E8B A;  1QR8 A;  1K5S A;  5IY5 C;  3JD2 A;  5LBQ A;  4IHJ B;  2E75 B;  4EB6 B;  1FXK B;  2UUC O;  5A9G A;  4WBN A;  4X62 O;  2ZE5 A;  1NTM H;  3HKD A;  1OHH G;  2VQE B;  3D36 A;  2IM9 A;  2ADP A;  4GX2 A;  2VS0 A;  1ZX3 A;  2ZE8 A;  2CTP A;  5LYJ A;  4NB5 A;  5LP6 B;  1IBL B;  1VEW A;  2N74 A;  1BHB A;  5E79 Z;  4CH3 A;  4RQE A;  2D2C B;  1NVP B;  3B8N A;  4O2B A;  2HEP A;  5LL6 Y;  4B3R B;  3CP1 A;  5LXT A;  2KB1 A;  3K9S A;  5B1A B;  1Y67 A;  4CS2 A;  4XDL A;  4MVM A;  1KYO F;  3A0R A;  2Q6A A;  1N8R W;  1R3J C;  4O2A A;  1JJO A;  4LFB O;  2H8P C;  4JYC A;  1G6U A;  3L70 H;  1FJG B;  4FLX A;  1OCR C;  1K9M W;  1VQN V;  4H44 B;  1Q6U A;  4JYY A;  2OIE A;  1FPO A;  4MS2 A;  3GWO A;  2ZT9 B;  3AG7 A;  3CRR A;  4J7K A;  4PV1 B;  2HG5 C;  1YJW V;  4CBC A;  4LF7 O;  4LF9 B;  4DR7 O;  1YF2 A;  3JAW B;  5IYC O;  2O57 A;  3BAA A;  4YHH O;  2VWJ A;  1FYJ A;  4IIJ B;  1H2L A;  1VF6 A;  5BMV A;  4JI1 O;  1GMG A;  2HHH B;  3K06 A;  3ZRS A;  4CC6 A;  2ZKO A;  2ITC C;  1P7G A;  1KU9 A;  4PDM A;  2ZIM A;  1J5E O;  3ZN1 A;  1J95 A;  5H6R A;  2QM4 A;  2UXD O;  4CH4 A;  4DR3 B;  1F4N A;  3J81 N;  4WFG A;  1AJN A;  3F7V C;  4JI5 O;  4JAV A;  2KG7 A;  2YDE A;  1ARO P;  1LR1 A;  5EIB D;  1NKD A;  3RFR A;  1DF5 A;  2Y69 C;  1SS3 A;  1GRJ A;  1I08 A;  2JK5 C;  1GAX A;  1JR9 A;  1XMO O;  3M7M X;  2OIG A;  2ZR3 A;  5LMN B;  2PI5 A;  3OGI B;  1Q86 W;  3UT5 B;  1YJ9 V;  1I0H A;  2QR4 A;  2MW2 B;  4EFE A;  4IYH A;  3DSQ A;  1VAR A;  1XMQ O;  1K5Q A;  3ICX A;  1HNX O;  2KSD A;  1SA0 B;  1VIB A;  1X59 A;  3RVY A;  2YI9 A;  4H13 B;  4RUE A;  1Q43 A;  4O4H A;  5IJ9 B;  4GT1 A;  1BT8 A;  1HR0 O;  5CBH A;  4LC1 A;  1EN6 A;  1RP3 B;  2G38 A;  3A0B Z;  3NR7 A;  4GUN A;  4WBN B;  3CRQ A;  4NXN B;  3RYI B;  1KUQ A;  2X6A A;  4UB8 Z;  1JA8 A;  3Q0X A;  3T1H O;  3BCC H;  3BY6 A;  3JYC A;  1HNZ B;  3ABL C;  3R66 A;  3T4Z A;  1R3I C;  4NXM O;  1VQO V;  1WA8 A;  3ASN C;  3N2K B;  2GDS A;  2UXC B;  3CCJ V;  2WLL B;  1QCE A;  4TUY A;  1P7B A;  2AGA A;  3JAS A;  3TK1 A;  1IX9 A;  3GWK C;  4FVM A;  2WAM A;  3P30 A;  4ZOL B;  5KUM A;  4B7K A;  4O4L B;  5EYP A;  1MNG A;  3W7U A;  3RN4 A;  1IUR A;  3JAK A;  4DV2 O;  5GTI Z;  4DV0 B;  1P49 A;  2EZO A;  3LUT B;  1GKF A;  1H2S B;  1ZWI C;  4GX0 A;  4IYI A;  4WF9 V;  3E8G A;  4N21 A;  3RYC B;  3G67 A;  1Q5O A;  4FZ1 A;  4YIP A;  1FFT B;  5JH7 A;  1MOF A;  4JI6 B;  1KKD A;  1PV0 A;  3UKM A;  2VQE O;  4ZHQ A;  1FXH A;  3HKC B;  4DUZ B;  3RWR A;  3ZED A;  3H1I H;  1MSW D;  2BOC C;  1IBL O;  2IJK A;  1HDJ A;  3ZHS A;  2E76 B;  2OWO A;  1WN7 A;  1V54 C;  1O9H A;  2DE0 X;  4E4E A;  2LFR A;  3RYF B;  4L87 A;  3HKB A;  3O9O A;  5E1A C;  3CME V;  1RM1 C;  2R9I A;  3CCU V;  4MVU A;  5CHX A;  1M90 W;  1BE3 H;  5JJJ B;  1NBM G;  1ZUQ A;  3APQ A;  4NKG B;  4Z1M G;  4N23 A;  1S5L Z;  3G6B A;  1M56 C;  1FJG O;  3ZMT A;  1ORQ C;  4J9Z B;  2E5L B;  2KG7 B;  3MDS A;  1AVM A;  1NH2 D;  4YJ2 B;  2PTM A;  1PPJ H;  5B1B C;  3N27 A;  4X89 A;  2JEU A;  5JVD A;  4RWU A;  1N34 B;  4UVB A;  1WJZ A;  1SC5 B;  2WLI A;  4JAS A;  3I55 V;  1L8D A;  1EFR G;  4K0K O;  1QU7 A;  1EM1 A;  4DRX A;  2CTR A;  4DR6 B;  3CSX A;  1EN4 A;  2QTO A;  4G27 B;  4LR3 A;  4BR6 A;  4X1K A;  4MW3 A;  1TVK A;  1GH6 A;  5KHI A;  2YIC A;  1S76 D;  4CZZ A;  2Y0I A;  4F4L A;  1PL0 A;  4FM1 A;  1Y66 A;  2FKX A;  2XHB A;  3CCM V;  4I50 A;  2YUA A;  3AG2 B;  4GX5 A;  1X4T A;  3WB0 A;  2HHH O;  4RUF A;  3C90 A;  2GUZ A;  3CCS V;  2QTS A;  4H0L B;  1M1K W;  5K1X A;  2GHY A;  5J2T A;  2V1D A;  5GW7 A;  3P3P A;  1QBZ A;  1R6T A;  1OCO B;  1ENV A;  3ZHT A;  3DXR B;  4DR3 O;  1VQ8 V;  2PI4 A;  1CPY A;  2ZM6 B;  1SER A;  1HW7 A;  4X20 A;  4UXN A;  1FXK C;  1XRE A;  3ZN0 A;  1AR4 A;  2PZS A;  2Q0A A;  3CCV V;  4BIZ A;  3A8T A;  3IAY A;  3OM3 B;  4O4I A;  2L6L A;  3ML0 A;  5LP6 C;  2QA4 V;  3KCY A;  2OTJ V;  2WLN A;  1VQ7 V;  4IHJ A;  4I4T B;  4EB6 A;  4DUY B;  3OTO O;  4FFK A;  4JV5 B;  1EZV H;  1K34 A;  2IJI A;  5B1A C;  5FPR A;  1IBM B;  2WWW A;  2EZP A;  5LP6 A;  5IYB O;  1KC8 W;  2LW1 A;  4J80 A;  4KHP B;  2Q8V A;  1D5A A;  5EZY A;  3OMN B;  1MZF A;  5K1P A;  2ZIN A;  1PNL A;  3IC9 A;  1W0K G;  4D6T H;  3DGE A;  1B3Q A;  3K79 A;  3E2E A;  3T1Y B;  2F93 B;  2QWO B;  5KHK A;  3Q0Y A;  4GCZ A;  3ZMS A;  2DYR B;  4PI2 A;  1N32 O;  2F43 G;  1VQ9 V;  1XNR B;  4O4J B;  2JS3 A;  2XOK G;  1M93 A;  3LSQ A;  3UO3 A;  4Z2W A;  5ITZ B;  3RYH B;  1OCC B;  4FLW A;  4OPA A;  2ZIO A;  3FYI B;  4QPK A;  3QTC A;  2ZCE A;  5KX5 B;  4P9O A;  4B3T B;  1KB9 F;  3G80 A;  4R8C A;  1F7Y A;  4AHC A;  4OX9 B;  4CKP A;  3IFX A;  4J10 A;  4FPP A;  2Y3V A;  4FMT A;  2BCC H;  5L3G A;  2CK3 G;  1IXM A;  2Y0P A;  2YI8 A;  3ABT A;  2AZ2 A;  3BRC A;  4DV0 O;  3CRA A;  1PP9 H;  3SPH A;  4WFE A;  1KP3 A;  3ABK B;  1FAF A;  3HR0 A;  2H3O A;  4X65 O;  1A32 A;  4IIJ A;  4YY3 B;  1OJH A;  3ZHU A;  3FKS G;  2FYU H;  2VRZ A;  2OCC B;  3RWR D;  1URF A;  2AHY A;  2YXH A;  2IJJ A;  4R50 A;  3T2M A;  2WLI B;  2PY5 A;  2ODM A;  3I5D A;  4NTY A;  1MG1 A;  1YIJ V;  3OGC C;  4JI6 O;  1AP6 A;  3CYO A;  2UU9 B;  5L3C A;  4PDR A;  4DUZ O;  1O9G A;  4X1K B;  1TVK B;  2ZD9 A;  3CMA V;  2PYJ A;  1HNW O;  1BCC H;  3CC4 V;  4FK5 C;  5IJ0 B;  2DYS B;  3IJ4 A;  3E8H A;  4I50 B;  2QWQ B;  3ZS8 C;  2Q4P A;  1PL4 A;  2GUZ B;  2E3C A;  4J9Y B;  1MAB G;  4GX1 A;  1AR1 B;  1DLB A;  2CTQ A;  2YC0 A;  1D2D A;  3E83 A;  2BTO A;  2V7Q G;  4I5S A;  4GEU A;  2Q73 A;  5CA0 B;  2LGQ A;  3UT5 A;  1WP7 A;  5HFL A;  5C93 A;  2ZQM A;  4DK1 A;  4X64 B;  3P3N A;  3SYC A;  2E5L O;  4NYK A;  5C8Y B;  1BHA A;  1HWY A;  2D3O W;  1SA0 A;  2OT5 A;  1SQV H;  2F66 C;  4KP4 A;  1N34 O;  1PD3 A;  5IJ9 A;  2ITD C;  5EC2 C;  4ZKI A;  1IBK B;  2QM7 A;  2QM8 A;  4DR2 B;  3II6 A;  5LHI A;  4J7Z A;  1ZAU A;  2EIK B;  3WU2 Z;  4P2Z A;  2AZ0 A;  3RYI A;  4PA7 A;  1N0J A;  3RT3 C;  3WFV A;  1K92 A;  4UCS A;  1WB8 A;  1G8M A;  3G4S V;  3L71 H;  1XNQ B;  2XAH A;  3ZHR A;  4TQF A;  4FLZ A;  2Q69 A;  4DXW A;  3CWB H;  3SYO A;  5H2F Z;  2LFS A;  5KA5 A;  2A0L A;  2Q9L A;  3N2K A;  1VF7 A;  5EZY B;  1NTZ H;  2Y4U A;  2WLL A;  2UUB O;  4MTF A;  4LCU C;  2FTK A;  3B4S A;  3ZX6 A;  2XUM A;  4LH7 A;  4XDK A;  3JD0 A;  4LFC B;  4K3A A;  3AG1 B;  1GN6 A;  4ZOL A;  5CBF A;  4KUM A;  4O4L A;  5JJE B;  2AW9 A;  3CC2 V;  3C3S A;  2XAQ A;  5IE9 A;  3W7T A;  1ZL8 B;  4MTX A;  4XA4 A;  2IU3 A;  5JQG B;  1GM7 A;  2Z3Y A;  2HKO A;  2KKW A;  4I9W A;  4LF5 O;  3OT7 A;  1YSC A;  4BW5 A;  3RYC A;  2IH3 C;  4J7J A;  1CEZ A;  3GVM A;  4DUY O;  1VF6 C;  1WPX A;  4CS4 A;  3VQY A;  2ILM A;  1G1X B;  5DN6 G;  1VMG A;  1B06 A;  3HKC A;  2W6I G;  3FX7 A;  2YID A;  1TUE B;  2XT9 A;  4QGP A;  4MW8 A;  1IBM O;  3CX5 F;  3B8M A;  1DK1 A;  2K1E A;  1PM9 A;  4RO2 A;  2B5U A;  2F1M A;  2Q7G A;  3K03 A;  4JI2 B;  5KHH A;  3ZJZ A;  2WPD G;  4DV7 O;  2PYL A;  4DV1 B;  1VQ6 V;  5BR8 B;  1LUW A;  1ZSP A;  1K7D A;  2VWK A;  2Y48 A;  1NJI W;  4D7T A;  3RYF A;  3WB1 A;  3T1Y O;  4TQD A;  3BA8 A;  3JSN A;  1P84 F;  5KHJ A;  2EUL A;  3TJT A;  3QVN A;  3LDE A;  5IT9 N;  1QHT A;  4QE9 A;  4Z1V A;  4CH6 A;  1E1Q G;  1LNQ A;  2LJ2 A;  1L0N H;  4YJ2 A;  1OZ0 A;  1FFX B;  3LDC A;  2EIN B;  2WA3 A;  2P5O A;  1S77 D;  1US6 A;  2UXB B;  1BZK A;  2EIL B;  3HKE A;  1AJP A;  5KUK A;  1YEW A;  4OX9 O;  4JI3 B;  3ABM B;  3UQ8 A;  3AG2 C;  1OCZ B;  1KEC A;  1JMK C;  4DV5 B;  3WB2 A;  2JVD A;  4A5U B;  3SPC A;  3S3W A;  4PEL A;  3BFR A;  2Z0A A;  2RJZ A;  1V9P A;  1OCO C;  1KP2 A;  3RVZ A;  2JEX A;  1RSO B;  2QE7 G;  3AK3 A;  2DN9 A;  2XAJ A;  2EBO A;  1H2G A;  3I56 V;  3DC6 A;  3DXR A;  4JI7 B;  4GEX A;  1S5J A;  2YXL A;  5LMU O;  4OXS A;  2HLD G;  2LGW A;  2ZR2 A;  1SF9 A;  5KAI Z;  1R6N A;  4PA3 A;  4FLY A;  1XHZ A;  4NTW A;  2RCV A;  3W7S A;  3K5O A;  3M99 B;  3ETD A;  1NS1 A;  1M5I A;  1XI1 A;  3E22 B;  1Y4M A;  2LP7 A;  4JAA A;  4I4T A;  2LO1 A;  3B2E E;  2XAS A;  2N04 A;  4PD4 F;  2NN4 A;  2UXX A;  2P22 C;  4JAU A;  1NU1 H;  2F4V B;  2DYR C;  3X2Q B;  3CHX A;  1TAE A;  3CRM A;  1IBK O;  4OGQ B;  4PA6 A;  4UCT A;  2EIJ B;  5CBG A;  1NT2 B;  1FU1 A;  4NTX A;  4DR2 O;  4DK0 A;  1JOY A;  4JPR A;  1YI2 V;  1OCC C;  4LF8 B;  2UUA B;  1Q90 D;  1ZTE A;  2YEV A;  3ASO B;  2PF4 E;  4MTG A;  4DR4 B;  4JTD B;  3MHS C;  1SQP H;  3K59 A;  1UFI A;  5D5Q A;  3QO5 A;  3TGU H;  1Q7Y W;  1XNQ O;  1EBO A;  1FXV A;  4O4J A;  4GLX A;  2PUS A;  4AQY B;  1MZE A;  4U3J B;  3EXA A;  2L35 A;  5ITZ A;  4JTA B;  3RYH A;  1XL4 A;  5JWP A;  4B3R O;  5KX5 A;  3BHP A;  5LHH A;  2VQF B;  1Z5V A;  3ABK C;  2RNB A;  2FL4 A;  5DED A;  3K08 A;  4ICG A;  1SQG A;  2OCC C;  3OMI B;  1TGO A;  2XAF A;  1YIT V;  3BAB A;  3JAL B;  3H1L H;  3OR6 C;  1BS3 A;  4GKJ B;  4ZIB A;  3K5M A;  1U96 A;  1YCI A;  3PN1 A;  3OUS A;  2DWD C;  2QEX V;  3HKE B;  3LSS A;  4TOI A;  3JD3 A;  1N33 B;  3R65 A;  2RN9 A;  2DYS C;  3B77 A;  2P4V A;  4HNA A;  2B9Z A;  1GM8 A;  3SGI A;  1TA8 A;  4CH5 A;  4LF9 O;  3SYA A;  1GM9 A;  4JGS A;  1QLE B;  2WLM A;  4LP8 A;  5B3S B;  5L3F A;  5IJ0 A;  4LFA B;  3OE7 G;  2GBO A;  2UUC B;  5BR8 O;  5LGN A;  3OMA B;  3HB3 B;  3E35 A;  4R6Z A;  1K8A W;  3K04 A;  1XHX A;  2ZE6 A;  3OTF A;  2X6B A;  1W0J G;  2A9H A;  2ZNJ A;  5F2V O;  4UCU A;  3DC5 A;  5CA0 A;  4DR1 B;  2IU0 A;  3EFF K;  1AB3 A;  4U3F H;  4MVQ A;  2OYQ A;  4H33 A;  5LOV B;  1S3J A;  3ZHV A;  5C8Y A;  2RDC A;  3VBB A;  5CMU A;  2EIK C;  5IDJ A;  1YZB A;  5DM6 V;  5BZB A;  4F6R A;  5CB4 A;  1W2B U;  3CB2 A;  2UXB O;  1THZ A;  1H2M A;  4K35 A;  2GSM B;  2ZE7 A;  2OTL V;  1CP9 A;  4JI0 B;  2Z5U A;  1GK9 A;  1QVG U;  3ZRW B;  4AI8 A;  2P4K A;  5LMN O;  4DV5 O;  3CS5 A;  3ZMZ A;  3RBZ A;  4TSF G;  3CEI A;  3D3Q A;  5FNV B;  2JDI G;  1I7F A;  5LA6 B;  1WPB A;  3SR2 C;  2MK3 A;  2A7W A;  4BW9 A;  4PA4 A;  3KZI Z;  3AG1 C;  4CS3 A;  4J11 A;  2JJ2 G;  3K0D A;  1RFY A;  3FFQ A;  1DF4 A;  4B3S B;  3FB5 C;  5KAF Z;  1QQC A;  5J9P C;  4DV3 B;  3SR2 A;  3LSU A;  4TWK A;  3SDL A;  3OFN G;  3VQX A;  4DR7 B;  1M4U A;  2IH1 C;  2R9A A;  4MVO A;  5IYZ B;  3JAM N;  1BQZ A;  2F23 A;  2QKC A;  2YEV B;  4ASU G;  4NXN O;  4ZI7 B;  2RQ6 A;  3AK2 A;  4PHZ A;  3SPG A;  2KQX A;  1VQ4 V;  2NLJ C;  3K5L A;  5B1O A;  2QJ1 A;  1HNZ O;  4HZ3 A;  4L8J A;  2JGD B;  5J2U B;  1ZL8 A;  5JQG A;  1LUV A;  1WP8 A;  1NR1 A;  3ABU A;  2UXC O;  1MA1 A;  4I55 A;  3CE2 A;  1XIL A;  5GON A;  2UXD B;  2DQ3 A;  2W0F C;  5FL7 G;  5EIB C;  4FM2 A;  3WG7 B;  3CD6 V;  2CE4 A;  4H37 A;  3ZRX A;  4X8A A;  1HP8 A;  2GTA A;  2HVK C;  2F4V O;  1S72 V;  1JPX A;  2ATK C;  3K0G A;  4I7Z B;  3VOU A;  4FJC C;  1UPG A;  1L0L H;  3CCL V;  1BGY H;  3N2G B;  3JAT B;  4B7E A;  3E8F A;  2EIN C;  3JAR A;  4JI8 B;  4W4K A;  1R6K A;  5D5P A;  4HNA B;  2UUA O;  2EIL C;  3TET A;  4FLT A;  2QKS A;  2QWN B;  3CC7 V;  1K4C C;  3EHB B;  3EVK A;  1HNX B;  3VQV A;  3ABM C;  2BTQ B;  1JFF A;  1OCZ C;  4AQY O;  4P9P A;  1FFX A;  4JTC B;  1KKC A;  3QF7 A;  4FM0 A;  5EC1 C;  5EK0 A;  4LWS B;  1Y6X A;  2Q67 A;  3T1H B;  3FAV B;  3FB7 C;  4PA9 A;  3STL C;  4QE7 A;  2E74 B;  4GKJ O;  4F6E A;  1YTF D;  1NZ6 A;  2X6C A;  1NTK H;  4F6R B;  1IXB A;  3STZ C;  5CB4 B;  1WAZ A;  2JJ1 G;  2JGU A;  4X1Y A;  1WLE A;  4K8Z A;  3CJH B;  1RSO A;  4LNU A;  1N33 O;  4UCO A;  3FYE B;  4YJ3 B;  4UVC A;  1N4C A;  3BEH A;  3G6E V;  4P30 A;  1SET A;  3ZMU A;  4W4L A;  3LNM B;  3TXS A;  5A2Q N;  1YDX A;  4DR6 O;  4E2L A;  4U7N A;  2HJF C;  3MUD A;  4PJ0 Z;  4MVZ A;  1I5Y A;  3BA9 A;  4LF4 B;  3F5T A;  1Y76 B;  2NNU A;  4WFH A;  2YSU B;  4TV8 B;  4LFA O;  2IJH A;  1OV9 A;  2YXY A;  5B5E Z;  2C2A A;  3AK1 A;  2P7T C;  1XEQ A;  3E22 A;  4DYL A;  3SPJ A;  2CAZ C;  4DR1 O;  2JS5 A;  4R7C A;  1TUB B;  4XDJ A;  3X2Q C;  3SYQ A;  2ZM6 O;  3OR7 C;  2EIJ C;  4ABM A;  4AIL C;  1N36 B;  5IWA B;  2V4D A;  1BMF G;  2CGN A;  4G79 A;  1GN3 A;  3ASO C;  1M57 B;  2JIZ G;  4PI0 A;  3K58 A;  2X0L A;  2HR3 A;  4NVP A;  4JZ2 A;  2W6J G;  4I55 B;  4JI0 O;  5GON B;  4FIP C;  4EFB A;  3F5W C;  4JI4 B;  3MAQ A;  4DW1 A;  4PDV A;  3QG5 A;  1FS0 G;  2IW5 A;  3FB6 C;  3O65 A;  4LF6 B;  5IYD O;  1NVP D;  1R3K C;  4JV5 O;  1Q8I A;  3C3T A;  1SKV A;  1XOU A;  3VQW A;  3AEI A;  1K4D C;  3JSL A;  3BVO A;  4FFB B;  2BSK B;  1SES A;  1V55 B;  1KD1 W;  5EBM C;  4UUJ C;  3J7A U;  1B6Q A;  1F23 A;  2ADQ B;  4X66 B;  1NQT A;  4IL6 Z;  3OEE G;  4LBE C;  4U3J A;  4D7S A;  4KHP O;  2IBZ H;  4K0K B;  4B08 A;  4B3S O;  3A2F A;  2CH7 B;  4KFM A;  4DV3 O;  4UB6 Z;  1DTO A;  1E79 G;  4WCE V;  1YHQ V;  1N0N A;  3W7W A;  3H1H H;  3JAR B;  3CPW U;  4U7O A;  3JCZ A;  5CA1 B;  4I0X B;  5B1N A;  4UCR A;  1Q81 W;  3JAL A;  1JFF B;  3G71 V;  5FPO A;  1XNR O;  4BWA A;  1EZJ A;  1VQK V;  2OCH A;  2Q68 A;  1YXB A;  3CCQ V;  3OEH G;  3SYP A;  3L74 H;  3PYI A;  3RW0 A;  1IK9 A;  1JCH A;  5CN0 A;  4X9Q A;  3DTU B;  4B3T O;  4X1I B;  1QLE C;  4BIU A;  3Q4H B;  3UO2 A;  5B3S C;  2EIM B;  1JX9 A;  3QNE A;  3AG4 B;  4Q6G A;  1U97 A;  5LGU A;  1SQX H;  2K9P A;  2DW4 A;  4UV9 A;  3K3W A;  4DV4 B;  1Q6I A;  3D8C A;  2ZXW B;  2BOB C;  3QO8 A;  1AI4 A;  2EJR A;  1R73 A;  3L9D A;  5JCO C;  4YY3 O;  4JF3 A;  2RMK B;  4X1Y B;  5KLV H;  3U11 A; 
#chains in the Genus database with same CATH homology
 4LNU B;  1XNR B;  3K5M A;  4O4J B;  3PN1 A;  3OTO B;  3HKE B;  1M93 A;  5LYJ A;  5ITZ B;  3RYH B;  5LP6 B;  4TOI A;  1IBL B;  4FLW A;  1N33 B;  2ZIO A;  3QTC A;  4CH3 A;  2ZCE A;  5KX5 B;  4B3T B;  5JCO A;  4O2B A;  2HEP A;  4AHC A;  4HNA A;  4OX9 B;  4B3R B;  3SGI A;  5LXT A;  1TA8 A;  5LOV A;  4CH5 A;  5CJ0 A;  4CS2 A;  2YI8 A;  4O2A A;  3BRC A;  5IJ0 A;  1JJO A;  4LFA B;  3HKD B;  1DGS A;  4GKK B;  1G6U A;  2UUC B;  1FJG B;  4IIJ A;  4YY3 B;  4FLX A;  3BPZ A;  1N32 B;  5LYJ B;  3RGB A;  1XHX A;  3RWR D;  3OTF A;  2ZNJ A;  5FNV A;  5LA6 A;  2PY5 A;  4UCU A;  4DR1 B;  5CA0 A;  4O2B B;  1I94 B;  4DV6 B;  2UU9 B;  2OYQ A;  5LXT B;  5LOV B;  1O9G A;  4X1K B;  5C8Y A;  1TVK B;  4F6R A;  4LF9 B;  5CB4 A;  3CB2 A;  2R72 A;  2PYJ A;  3JAW B;  3BAA A;  4O2A B;  5IJ0 B;  4I50 B;  3ZS8 C;  2VWJ A;  5KMG A;  4JI0 B;  2YIA A;  4UFZ A;  5IYZ A;  4IIJ B;  5BMV A;  2E3C A;  4ZI7 A;  3K5N A;  4TV9 A;  2HHH B;  4X65 B;  4DR5 B;  4CC6 A;  5FNV B;  1I7F A;  5LA6 B;  1WPB A;  1KU9 A;  2BTO A;  3SR2 C;  4JYA B;  2ZIM A;  5CA0 B;  3UT5 A;  5J2U A;  4BW9 A;  4K8X A;  4KL1 A;  4DK1 A;  2QM4 A;  4X64 B;  4CH4 A;  4DR3 B;  1WNS A;  5C8Y B;  4CS3 A;  3FFQ A;  4B3S B;  1SA0 A;  1QQC A;  2F66 C;  5EIB D;  4DV3 B;  3SR2 A;  3RFR A;  5IJ9 A;  3VQX A;  1HNW B;  1IBK B;  4B3M B;  4DR7 B;  1M4U A;  2R9A A;  5IYZ B;  5BMV B;  4ZI7 B;  4DR2 B;  3II6 A;  1B04 A;  2RQ6 A;  4PHZ A;  1T5E A;  1ZAU A;  5KHG A;  3M7M X;  3K5L A;  3RYI A;  5LMN B;  2QJ1 A;  3SJA C;  3UT5 B;  4L8J A;  5J2U B;  4UCS A;  5JQG A;  1XNQ B;  4TQF A;  4EFE A;  4FLZ A;  3N2G A;  3JAT A;  2YIB A;  3DSQ A;  4I55 A;  5GON A;  3ICX A;  2UXD B;  3N2K A;  1VF7 A;  5EZY B;  1SA0 B;  3SJB C;  1XQ8 A;  5EIB C;  4FM2 A;  2YI9 A;  1Q43 A;  4O4H A;  5IJ9 B;  2BTQ A;  4LH7 A;  3SJC C;  4LFC B;  4ZOL A;  4WBN B;  4O4L A;  4NXN B;  5JJE B;  1Z5W A;  3RYI B;  4X62 B;  4XA4 A;  2Q7E A;  5JQG B;  1HNZ B;  3N2G B;  3JAT B;  2KKW A;  3JAR A;  4JI8 B;  5D5P A;  3N2K B;  3RYC A;  4HNA B;  2UXC B;  4FLT A;  3LNN A;  2R70 A;  3ETQ A;  4TUY A;  4CS4 A;  1HNX B;  3VQY A;  3JAS A;  3VQV A;  4O4H B;  5JJN B;  2BTQ B;  3HKC A;  1JFF A;  4FVM A;  4CC5 A;  2UUB B;  4FLV A;  1FFX A;  4ZOL B;  4O4L B;  5EYP A;  3QF7 A;  2F1M A;  3JAK A;  2ZNI A;  2Q7G A;  4YJ3 A;  4FM0 A;  4DV0 B;  1P49 A;  4LFB B;  4JI2 B;  5KHH A;  2PYL A;  4DV1 B;  5CJ4 A;  1H2S B;  5BR8 B;  2VWK A;  3T1H B;  4D7T A;  3RYF A;  3WB1 A;  4TQD A;  3BA8 A;  3RYC B;  1Q5O A;  3JSN A;  5KHJ A;  5JH7 A;  4LF5 B;  4TUY B;  4JI6 B;  4TV8 A;  2EX3 A;  3JAS B;  1QHT A;  4CH6 A;  4ZHQ A;  3HKC B;  4F6R B;  4DUZ B;  3RWR A;  5CB4 B;  2JGU A;  4X1Y A;  4YJ2 A;  1FFX B;  3ZED A;  4K8Z A;  5EYP B;  2P5O A;  1RSO A;  4LNU A;  4LF7 B;  2UXB B;  1KMI Z;  4UCO A;  4I9Q A;  5KMG B;  3HKE A;  3JAK B;  4YJ3 B;  2Q7H A;  2OWO A;  1WN7 A;  4YHH B;  1TUB A;  4TV9 B;  1YEW A;  4JI3 B;  2F95 B;  4UCV A;  3UQ8 A;  1O9H A;  4JI1 B;  1JMK C;  4LH6 A;  4DV5 B;  4DV7 B;  3RYF B;  3WB2 A;  3MUD A;  2JVD A;  3HKB A;  3BA9 A;  4LF4 B;  3THO A;  5CHX A;  5JH7 B;  5JJJ B;  4TV8 B;  2RJZ A;  1V9P A;  1J5E B;  4ZHQ B;  2E5L B;  4YJ2 B;  2PTM A;  4JI5 B;  3E22 A;  4HBN A;  2CAZ C;  5JVD A;  1N34 B;  2JS5 A;  1TUB B;  4FFB A;  1L8D A;  4AIL C;  1N36 B;  4JI7 B;  5IWA B;  2V4D A;  4DRX A;  1S5J A;  2YXL A;  1XMO B;  3HKB B;  4DR6 B;  3CSX A;  3U10 A;  4LR3 A;  4X1K A;  1TVK A;  5KHI A;  4PI0 A;  3K58 A;  4NVP A;  4I55 B;  4FM1 A;  5GON B;  2XHB A;  3JAW A;  4EFB A;  4FLY A;  1XHZ A;  4JI4 B;  3MAQ A;  5CA1 A;  4I50 A;  3QG5 A;  1X4T A;  3WB0 A;  1XMQ B;  3K5O A;  4LF6 B;  1M5I A;  1XI1 A;  3E22 B;  5K1X A;  5J2T A;  4GYC B;  4I4T A;  5JVD B;  1Q8I A;  1SKV A;  3VQW A;  3JSL A;  4FFB B;  1HR0 B;  4X66 B;  3B2E E;  4DRX B;  4D7S A;  4U3J A;  2ZM6 B;  2P22 C;  1HW7 A;  4X1I A;  4K0K B;  4B08 A;  3A2F A;  4X20 A;  2F4V B;  2PGG A;  5LMU B;  2PZS A;  3U0Z A;  2Q0A A;  3CHX A;  3JAR B;  1TAE A;  4FLU A;  2GV9 A;  4UCT A;  3IAY A;  5CA1 B;  1NT2 B;  1FU1 A;  3K57 A;  4NXM B;  4O4I A;  4DK0 A;  4UCR A;  5LP6 C;  4LF8 B;  2YIB D;  4EEQ A;  2UUA B;  5J2T B;  3JAL A;  4IHJ A;  4I4T B;  4EB6 A;  1JFF B;  4DUY B;  5FPO A;  4DR4 B;  4BWA A;  3K59 A;  4JV5 B;  5D5Q A;  4O4J A;  1Q3E A;  4GLX A;  2PUS A;  4AQY B;  5FPR A;  1IBM B;  1SQF A;  1IK9 A;  4U3J B;  5ITZ A;  3RYH A;  5LP6 A;  4X1I B;  4X20 B;  4DV2 B;  5KX5 A;  4KHP B;  3BHP A;  2VQF B;  4Q6G A;  1Z5V A;  1D5A A;  5EZY A;  5K1P A;  2ZIN A;  1SQG A;  4O4I B;  1TGO A;  4DV4 B;  3T1Y B;  2F93 B;  5KHK A;  3BAB A;  3JAL B;  4IHJ B;  4EB6 B;  4WBN A;  5JCO C;  4GKJ B;  3HKD A;  4X1Y B;  4PI2 A;  2VQE B;  3U11 A;  2IM9 A;  4ZIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...