3OR7C

On the structural basis of modal gating behavior in k+channels - e71i
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVITATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody fab fragment heavy chain
publication title On the structural basis of modal gating behavior in K(+) channels.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Immune system/transport protein
total genus 43
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2010-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3or7C00
3BEHA 4LP8A 4TWKA 2EIMC 5EBWC 3ZJZA 3K04A 3RW0A 4G27B 3EFFK 4EKWA 3K06A 2HVKC 5CBFA 2QKSA 3E83A 2X6BA 1XL4A 2WLLA 3SPHA 2IH3C 3T4ZA 3ASOC 5KUKA 1XL6A 3FB5C 4P9OA 4HYOA 4LCUC 4XDKA 3K08A 3SYQA 5CBHA 5IY5C 2WLKA 5EC2C 3ASNC 2R9RB 4PDRA 3RBZA 3LDCA 3KG2A 3OGCC 4MVMA 4LBEC 4XDJA 2HFEC 4PDMA 2WLIB 2OCCC 4PDVA 3FB7C 3STLC 1OCCC 4JTDB 2DYSC 2WLLB 5B1BC 3SPIA 4MVUA 4X8AA 3E8GA 4GX2A 1ZWIC 3ZRSA 1LNQA 2JK5C 4MTGA 1G4YB 2DWDC 3SYCA 2KB1A 1R3JC 3UKMA 5EK0A 4MVOA 4R6ZA 4WFHA 4G28B 5KUMA 3IFXA 2Y69C 3K0DA 2ATKC 4GX5A 1OCOC 5CBGA 4PA3A 2K1EA 4OXSA 5EBMC 2Q6AA 3E8FA 2AHZA 4PA7A 5B3SC 3K03A 4MTFA 4R8CA 3OUSA 4MVRA 5B1AC 2P7TC 2A79B 3ABMC 2WLMA 4RUFA 4J9ZB 3AG4C 2Q69A 3HPLC 4MVZA 4MTOA 3LNMB 3OR7C 4GX1A 4J9YB 2DYRC 3T2MA 1R3IC 3TETA 1OCZC 3SYAA 3RVZA 2HG5C 5EBLC 3UM7A 1ORQC 3X2QC 5BZBA 2DWEC 3LUTB 2Q67A 2WLIA 2QTOA 3GB7C 3SPCA 4QNHB 2BOBC 1R3KC 1K4CC 2WLJA 4R50A 1V55C 4P30A 4MW3A 5E1AC 1M57C 4P9PA 3ABKC 3VOUA 5J9PC 3FB6C 1V54C 3R65A 3F7YC 1M56C 4QE9A 2A0LA 4X89A 3JYCA 3PJSK 4PA9A 4X88A 5EC1C 4MVQA 1BL8A 4GX0A 3T4DA 2EIKC 4PA6A 3SPGA 1KKDA 2X6CA 3E8HA 2EIJC 3K0GA 4H37A 4MS2A 3STZC 2H8PC 3LDDA 4ZBMA 3LDEA 3ABLC 3TCUA 3SPJA 4KFMA 1P7BA 2ZXWC 3SYPA 3E86A 4PDLA 3F7VC 4QE7A 4RO2A 4WFEA 1R3LC 3RVYA 4F4LA 3WG7C 4WFGA 1OCRC 2HVJC 2EINC 4UUJC 3T1CA 2NLJC 1S5HC 2A9HA 4MSWC 4PA4A 3IGAC 3E89A 2AHYA 2W0FC 4XDLA 4BW5A 1QLEC 3SYOA 4P2ZA 2Q68A 3AG3C 3OUFA 4RUEA 3OR6C 4H33A 4DXWA 4JTAB 4I9WA 4HZ3A 4R7CA 4RAIA 2HJFC 2X6AA 4JTCB 2ITCC 4MW8A 3SJQC 2WLNA 1JVMA 2YEVA 4MVSA 1K4DC 3F5WC 3AG1C 1J95A 2ITDC 2WLHA 2EILC 2ZD9A 3AG2C 4CBCA 3E8BA 2IH1C 2BOCC 3FB8C 4WFFA
chains in the Genus database with same CATH superfamily
4TWKA 1OJHA 2UXNA 1OCZB 4FLYA 1P7GA 1A32A 4IGGA 1JMKC 1M57B 3ZMSA 3ABKB 4DYLA 3LNNA 1M5IA 4FLTA 4J7KA 4FFKA 2OT5A 1UJWB 3ZHUA 2F1MA 5CBGA 5KHHA 2IW5A 5CA3A 3T1HB 3GWOA 4LFCO 3Q4HA 2VQEB 1E79G 3OUSA 2ODMA 5BMVB 2DJVA 1K9MW 3UM7A 3CS5A 4JI8B 4R50A 1YJWV 2OIEA 4F6EA 2JEXA 1RPRA 1OZ0A 2BTQB 4L8JA 4BIUA 4X62B 2CUGA 5CMUA 4FLVA 1WAZA 2QM8A 1XDCA 4TV9A 2WSSG 3H1LH 4DUYB 1GN6A 4X62O 3CJHB 4J42A 2K9PA 2OCCB 4CS4A 2IU3A 2KQXA 3L73H 3QO8A 1KC8W 1G1XB 3B4SA 5LGNA 2WAMA 2QSAA 2Y69B 3CC2V 5L3GA 4JPRA 1F4NA 3AG2C 1HNZB 1KKCA 5JCOA 4X64B 3P3NA 5IJ0A 3JAWA 5LOVA 3K06A 1K33A 4QPJA 2QKSA 5H5NA 3B40A 3VBBA 3G4SV 3FKSG 4YJ2A 2NR5A 3FAVB 1V55B 2YIDA 4PDMA 3CCVV 3HR0A 4JI7B 1R1BA 3DC6A 4I9QA 1SQQH 4MVUA 1AP5A 3GWKC 3SYCA 4FLWA 4DV0O 2KB1A 4HNAB 5L3CA 4B08A 1MOFA 3U10A 2PI4A 1BQZA 2G38A 3A8TA 1GM9A 2UXXA 5LGUA 2GBOA 1HNWB 4N23A 3FD9A 1D5AA 2A79B 2F23A 4LNUA 4YIOA 3HPLC 1COWG 2DYRC 1HNWO 4HAMA 2F4VB 1PP9H 2Q7GA 3E22B 3BPZA 3GB7C 2YXHA 1AJNA 1N32B 2P67A 1KB9F 2F95B 4WFAV 3B8MA 3DGEA 3L74H 3JASB 1XMQB 1K8AW 2EIKC 3CCMV 3E2EA 1BT8A 2XAHA 1JJ2U 2BTQA 4FK5C 4WBNB 1XMQO 2ZXWC 2LGWA 3UT5B 1RPOA 2W6JG 1AJQA 1X4TA 2B1IA 3AK1A 1V9PA 1H2SB 1SQFA 3IGAC 3K3WA 1IBMB 2R9IA 1W0KG 1L0LH 3HKBB 3EXAA 4DXWA 4O2BB 4EFEA 1WB7A 3SDLA 1DTOA 1N36O 2ADQB 4MVSA 1Q8IA 2DW4A 3AG1C 2D2CB 3BEHA 4C7UA 1P4RA 3ZJZA 1Q82W 4G27B 3EFFK 4EKWA 1PM9A 2X6BA 2A3QA 1GAXA 3H1HH 3OTOB 2GSMB 1S0VA 5L3EA 1YITV 3ZX6A 4UV8A 4MVMA 1NR7A 2E75B 5IYCO 1MSWD 3ZS8C 4LF8O 1ZAUA 3CCLV 1Y4MA 2CDYA 3FAVA 4LF5B 1WA8B 1XI1A 3G6BA 1QBZA 1GRJA 1H8HG 5CA0A 2JK5C 1JFFA 2WWWA 3IC9A 2GUZB 3IFXA 3K0DA 4PA3A 1H8EG 2Q6AA 2PTMA 4H13B 3NR7A 3A0HZ 1R73A 4K8ZA 1NBMG 4FPPA 4LF9B 3QO5A 2N74A 4MTOA 4W4KA 4GX1A 4I0XB 4TQFA 3OMAB 4O4IB 1KYOF 1P49A 4UCOA 3E22A 3R65A 1M56C 2JDIG 3ABUA 3AEIA 4YHHB 1SRYA 3H9VA 3SPGA 2F93B 3E8HA 3JASA 4ZBMA 3A0RA 3STZC 3LDEA 4J7ZA 4KFMA 1EN5A 2PGGA 1QCEA 1VQ9V 1CP9A 4ICGA 3T1CA 2CGOA 3UT5A 3O65A 3BABA 2Q68A 1MSDA 2UXBO 4D7TA 2PUSA 2UU9B 4RAIA 2X6AA 3PN1A 3HKBA 4H0LB 4O2BA 1Q86W 5GONA 4WFBV 2ZIOA 2AW9A 2ZD9A 2IH1C 4I4TA 1E1RG 1VQ4V 4DV2O 1R6KA 3ZHSA 1PD3A 3M7MX 2EINB 5CN0A 1Q43A 4PDRA 3RBZA 2F43G 4NTYA 2OTLV 3KKYA 1Q81W 4N21A 2CH7B 3OM3B 4JZ2A 2YC0A 2IBZH 2ZR2A 4PI2A 3ZRSA 2LFSA 3JD4A 3UKMA 2Y48A 4FVMA 1WA8A 2HHHB 1EM1A 4B3TO 4LF7B 4R8CA 2R70A 2GUZA 1YTFD 2HHHO 4CC5A 2P7TC 3F5TA 3QVNA 3JAMN 1AR4A 1NR1A 1K34A 1VF5B 4LF7O 3UCSC 4FM2A 2BOBC 4X65B 4P30A 4JASA 1HR0B 1ENVA 5FPRA 2UUCB 4O4IA 4JI0O 2YSUB 4U3JB 2Y0IA 3ZRVA 2DN9A 2KKWA 4DRXB 1MMMA 5L3FA 2RJZA 4IT5A 1N33B 2YXYA 4BWAA 4GKKO 1AI5A 1GO3F 3BCCH 4MSWC 3CSXA 4NR1A 1PPJH 4ABMA 4K0KB 3ZCCA 3OEHG 3CMAV 1BGYH 1M4UA 2GDSA 4CH3A 4K0KO 2AGAA 1B3QA 4PD4F 1QVGU 5IWAB 4GCZA 1KECA 2QKCA 3UQ8A 1R6TA 4CBCA 1NT2B 3VOUA 4O4LA 1GN3A 5EBWC 2EIMC 2UXCB 1XNQO 5H2FZ 1N0NA 5KUKA 1PV0A 3CCJV 4P9OA 2AZ0A 1PKXA 4B7EA 2LFRA 5K1XA 2F66C 4GLXA 5C8YA 4OPHA 5BR8B 2GTAA 1VP7A 1IBLB 3ZRWA 3KCYA 4UXNA 3I56V 1PL4A 2CH7A 2ZNJA 5JCOC 1S77D 3OEEG 2UUBO 3S3WA 2AHZA 3AK2A 1M93A 4MTFA 3K79A 4DR1B 4JI5B 2KG7B 2ZQMA 5FNVB 1OCZC 3ZN1A 3RVZA 2HG5C 1ORQC 2LO1A 4H44B 4I55B 4F6RB 2WLIA 1VQLV 3SPCA 1M57C 3ABKC 2EILB 3BVOA 2FKXA 2A0LA 3L75H 3PJSK 4X88A 2RN9A 4A5UB 1VIBA 3LSQA 2X6CA 3BHPA 2JVDA 4FJCC 4DRXA 4BR6A 1GMGA 3JCUZ 4ZI7B 3T1YB 5IYZB 1WPBA 1IXMA 2HP8A 1WB8A 4TV8B 4DR4B 4FIPC 3FYEB 1BSMA 4JTCB 3HKEB 1V54B 1JVMA 1K73W 3ETEA 3WB2A 4LFAB 3C3TA 3QF7A 2WLHA 2V7QG 3DXRB 2BOCC 5L3BA 2XASA 3K5OA 1IXBA 3CRAA 3ASOC 2FTKA 4TSFG 4AQYB 1H2NA 4YIPA 2R9RB 1ZUQA 1I7FA 3OGCC 4X20B 3HKCB 2OCCC 4WF9V 1NVPD 1G8MA 3AK3A 1GM7A 4X1YB 1WP8A 2CTQA 4PHZA 1SETA 2EX3A 2MW2B 1D5NA 4DV4O 4AHCA 1VQKV 2EULA 4O4JB 2Y69C 2WA4A 3RYCB 3K5MA 5B1NA 5JJJB 4E2LA 3H1IH 5A2QN 4QPKA 2QDOA 5EZYB 3SYAA 4UVCA 2RMKB 3X2QC 2DWEC 4DV5B 2Q67A 3U0ZA 3G67A 1TUEB 3N2GB 2KG7A 1V55C 5FNVA 2C2AA 3D3IA 5IE9A 3JYCA 2RQ6A 5HFMA 4DV3B 4W4LA 4OGQB 1FS0G 1NI8A 4MS2A 3T1HO 5IY5B 4EB6B 2ETNA 4PDLA 2VQEO 2B9ZA 2HVJC 2EZPA 4DK1A 2A9HA 2ZDIA 4DV6B 1Y6XA 1RFYA 1SESA 4JZGA 4CH6A 5DM6V 4MT8A 2ARHA 4ZI7A 1FFXB 4JI8O 3SJQC 1TUBB 1KQSU 4LF4B 2P22C 4TV8A 2PYLA 2QE7G 1CPYA 1FFTB 3HKEA 2OWOA 4PI0A 4LF4O 1XHXA 5F2VO 2PZSA 5B66Z 1MABG 4DUYO 1FD9A 2DQ3A 1TVKB 4LCUC 3WB0A 3K08A 3WU2Z 1NH2D 5EC2C 4Z1VA 2LGQA 2QA4V 2BCCH 5ITZB 5DEDA 4D6TH 1G6UA 2JIZG 3CCEV 2GTSA 3AG3B 3CCSV 4UVAA 3RYFB 1E1QG 1JJOA 4X20A 3HKCA 1S3JA 1IX9A 3RT3C 4X8AA 1Z5VA 1OV9A 1URFA 5H6RA 3ABLB 4X1YA 4WFHA 4G28B 2YIAA 3M8AA 4JYAB 1HNZO 3DSQA 4JI1B 4X64O 3EVKA 2IJKA 3K58A 4O4HB 1VARA 3RYCA 4QGPA 2WPDG 4UB6Z 3T2MA 4K8XA 5D5QA 1KMIZ 3B8NA 4JAUA 3RN4A 1YCIA 1H2KA 2LW7A 2UXDB 3JSNA 1KP3A 4JI7O 3CCRV 3F7YC 4L87A 4LR3A 1XNRB 3CYOA 1SQPH 3N2GA 1RM1B 2Z5UA 4IIJB 1CXZB 5GTHZ 1N34B 1Q6IA 1Y76B 4BAYA 3JSLA 4ZHQB 4JV5B 3G71V 4EFBA 2N04A 1R3LC 1DGSA 5BMVA 4HBNA 2XT9A 4EB6A 1LUVA 2ZM6B 3DTUB 1XILA 4PA4A 1UFIA 2XTAA 2QWOB 2ZKOA 2W0FC 2F4VO 2DYSB 4P2ZA 2ZM6O 4HZ3A 4PV1B 1N32O 2HJFC 3BAAA 2FYUH 3QO7A 5KLVH 3SGIA 1FFXA 3ZRXA 2Q5ZA 1YHQV 1J95A 1VF6A 4B7KA 5LHIA 1RP3B 5B3SB 5LYJB 3CXCU 5J2UB 1I08A 4ASUG 3CJHA 3RYIB 5B5EZ 1LR1A 1TVKA 4LBEC 3JATB 1IBMO 5JVDB 4DV1B 4LH7A 3LSUA 1FXVA 1VQOV 1AROP 4PJ0Z 2V1DA 2E76B 4ZIBA 1QVFU 4GKJB 1MG1A 2VWKA 2DWDC 4FFBB 3RYFA 2BSKB 4DR7B 2P06A 4B3RB 3BA8A 5LMNB 4B3SB 1YF2A 1FXHA 2CE4A 4X1IB 4B3RO 4U7OA 1Q5OA 3OTOO 2Q69A 1EFRG 2XAFA 2EZOA 1R3IC 3THOA 2QWRB 3CPWU 2E5LB 5LP6B 3N2KB 3FB6C 3W7TA 4YY3B 3W7UA 4LF5O 2B1GA 2UUAB 4DR3B 4UCSA 3T4DA 1SF9A 1VQPV 3L70H 4HNAA 1O9HA 4CC6A 4Z1MG 2DMXA 3ZEDA 2Z3YA 2ILMA 4QJFB 4FZ0A 3VQYA 1Y76A 3F7VC 1YJNV 4ZHQA 1GM8A 1FYJA 4LF9O 1SQVH 5KX5B 1OCCB 1MA1A 3OR6C 4JTAB 4I9WA 2O57A 4MW8A 5FLXN 1I94B 2WLNA 5KMGB 4LC1A 1EBOA 2YI9A 1AI7A 1SZTA 4CZZA 1OCOB 2HR3A 3CMEV 1EN6A 4YHHO 1XEQA 2JRIA 4JYCA 3ZMVA 4BW9A 1U97A 4WBNA 5KHJA 1JR9A 1ZSPA 4FM0A 2HKOA 1IURA 3ASNC 2JJ1G 4UCVA 5DECA 1IBKB 3RYIA 2PF4E 4XDJA 2VQFB 1ROPA 1HNXB 1VQ6V 1IBKO 2YIBA 2UU9O 5JH7B 3JATA 4JI6B 3SPIA 5JVDA 2EIJB 5H6QA 5TISZ 3WB1A 4NXNB 1GH6A 1HDJA 3SJBC 3R66A 2K1EA 4JI6O 2Z0AA 4FFBA 2BSKA 3VQWA 2GHYA 1S5LZ 4JF3A 3ABMC 4LFBB 4RUFA 1D2DA 3OE7G 3APOA 3LNMB 4GYCB 2RCVA 1CEZA 3JALB 1SA0B 4ZOLB 2IU0A 3CRRA 2WLJA 1NQTA 4P9PA 1YI2V 5J9PC 2YEVB 3MHHC 1W2BU 5CB4B 4PA9A 1ZX3A 4GX0A 5LP6A 1DLBA 1IZ3A 1WPXA 4UV9A 1FJGB 3K0GA 2H8PC 3TCUA 2QGNA 3E86A 1FJGO 5E79Z 2Q0AA 4TT3G 1SERA 4JI2B 1WN7A 1L0NH 4I0XA 4G2KA 5B1BB 1X59A 1EN4A 3MD0A 4R7CA 4X65O 4NVPA 5D5PA 1M56B 1HR0O 2UUCO 5JJEB 1K97A 2EILC 5BXZA 2QEXV 2Y4UA 1AR1B 2ZE6A 5CA1B 3K04A 4I5SA 5CBFA 1N33O 1N4CA 4FLUA 1IDSA 2BE3A 5LHGA 1J5EB 1BHAA 2ZDIC 3BRCA 1NTMH 1FXKB 2H3OA 4NXMB 3JARB 3IC7A 2Q8VA 4UVBA 2VRZA 3SJAC 4X1KB 5IWAO 1Q7YW 5JH7A 4NKGB 2W0XA 5KHKA 2M7WA 1HP8A 2ATKC 2P90A 4GX5A 2EJ7A 4IYIA 3WG7B 1KU9A 1GK9A 2UXCO 3S3XA 3K03A 2W6IG 5IDJA 1L8DA 1H38A 4DR6B 1MNGA 2IJHA 1QNMA 4DK0A 1QLEB 2E74B 2OCHA 3K9AA 4J41A 5EBLC 2HJDA 2ZIMA 1AI4A 4NTXA 1VQ7V 4B3MB 1ZL8B 5BR8O 1R3KC 1K4CC 2YDEA 3ZMUA 3JALA 1IBLO 4UB8Z 2FL4A 1SA0A 5EIBC 3TK1A 3ZBHA 5IT9N 4KHPB 2ZE5A 2LP7A 5CB4A 1KBHA 4NTWA 3SPJA 5LGTA 4DUZB 1K7DA 1L1FA 4QE7A 1DF5A 1P84F 2JS5A 3TGUH 4UCRA 3D3QA 4DR1O 3OD4A 4JI5O 2AHYA 4CS3A 5LXTB 4RUEA 3N27A 4FMTA 3K5LA 2P4VA 2JGUA 2QWPB 1K4DC 4U3JA 4DV7B 3L72H 2JJ2G 2ZE8A 2WLLB 2YIBD 4GT1A 2X0LA 3AG4B 3Q4HB 1AB3A 1US6A 5B1OA 2IH3C 3T4ZA 5LA6B 3D36C 4HYOA 5CA1A 4X66B 5CBHA 5IY5C 4I50B 3KG2A 3T1YO 3A2FA 5KHGA 1NS1A 3B2EE 3RWRD 3STLC 1SQGA 4LF6B 4DR4O 1K3EA 1BE3H 1FXKA 1BQ0A 1QLNA 2IJIA 1MZFA 1ZWIC 3OMIB 1VF6C 4LFAO 3JARA 5KUMA 5A9GA 5EBMC 4TV9B 4X1KA 3QTCA 3I55V 1VF7A 4Q6GA 3VQVA 2LW1A 2R72A 1XHZA 2X7RB 4AQYO 1VQMV 2HLDG 1JCHA 2YICA 2AZ2A 2QJ1A 5E1AC 1DF4A 4X89A 4KUMA 1BL8A 1VMGA 5H9CA 5K1PA 1B04A 3UO3A 3ABLC 3CB2A 3CEIA 2QTSA 2ZE7A 5KAFZ 3C3SA 3IJ4A 3P32A 4OPAA 1HW7A 1AJPA 1KD1W 3VQXA 1S5HC 3HKDB 3JAKB 2WA3A 2D3OW 2IJJA 3CHXA 1QR8A 3CP1A 4I55A 4F6RA 4DV5O 1SQXH 3J81N 4EEQA 3MAQA 1XREA 2PI5A 1MZEA 1SZXA 3D8CA 5LXTA 1I5XA 1XUQA 1VEWA 3H1KH 4CS2A 1N0JA 2Q9LA 1I0HA 4U7NA 4DV3O 5B1AB 1XBLA 3FB8C 2P5OA 4LFCB 1EZJA 1RM1C 1QU7A 2HVKC 3E83A 3U11A 3B77A 2WLLA 1WJZA 3M99B 2CTWA 4LNUB 3ZN0A 1YIJV 3KCXA 3ZHRA 5LA6A 4JYBA 5IYZA 1F7YA 4OX9B 1SKVA 4DV6O 2HFEC 3WFVA 3W7WA 2ZINA 1JQ0A 3RFRA 4I50A 4J10A 4Z2WA 3CXHF 2DYSC 1PNMA 1H2MA 4OX9O 1Z5WA 3OAAG 1G4YB 1YTFB 3DXRA 4D7SA 3J80N 4XBFA 1Z2GA 2L35A 4NB5A 2LJ2A 1OCRB 5B3SC 4CH5A 5LL6Y 5KA5A 2JS3A 3ASOB 4KP4A 4LWSB 2R9AA 4IL6Z 5IJ9B 1Q6UA 1F51A 1Y66A 2QTOA 4KL1A 1OHHG 5EYPB 1NZ6A 3P30A 4ZKIA 5EC1C 3J7AU 1KUQA 3LSSA 4O4JA 3FFQA 4JYAO 4JI1O 2QM7A 1GKFA 3CRQA 4WFEA 4JAAA 3OW2U 4TUYB 1B6QA 4IHJB 3CCUV 2ZNIA 3OTFA 3W7XA 2PY5A 3ZMZA 5EZYA 2QM4A 1YXBA 2YI8A 5LHHA 1FPOA 4XDLA 3X2QB 3SYOA 4JYYA 3HKDA 3JAKA 2XHBA 2Q7EA 2QKAA 2NN4A 1Y74B 3O9OA 2UXDO 1SS3A 4WCEV 5GW7A 4U3FH 1THZA 4DV0B 5LP6C 1XNRO 5CA0B 1JFFB 2DOSA 3UO2A 3DC5A 3E8BA 1N34O 3APQA 3CC7V 5FL7G 3SR2C 1AR5A 4YXWG 3D36A 4E4EA 3RW0A 2V4DA 4JV5O 1XL4A 3L9DA 5HFLA 1SC5B 1TA8A 2Q0OC 3H01A 3JD0A 1OCCC 2RNBA 4JTDB 1TUBA 1YJ9V 5J2TB 3JD3A 1NJIW 1NTKH 4GUNA 2N05A 3E8GA 1S76D 2A7WA 4MTGA 1R3JC 5EK0A 4DW1A 4MVOA 3HB3B 4R6ZA 3JD1A 1N8RW 2P6JA 4J7JA 3BY6A 1AILA 2YXLA 1OCOC 2JGDB 4IYHA 1YSCA 1WNSA 4UFZA 2EJRA 2JEUA 1GTOA 4AI8A 4I7ZB 1O9GA 3G6EV 5ITZA 4LWSA 1BZKA 4QNHB 5IJ9A 4DR5B 1BS3A 1N36B 4DV1O 4MW3A 5JQGB 4MTXA 4NYKA 2PYJA 4CH4A 1F4MA 3AG2B 4QE9A 2B5UA 4DR5O 5GONB 2OYQA 4GKJO 4PA6A 5EYPA 2H94A 4UCTA 2EIJC 4I4TB 4H37A 4DR7O 3ZHTA 5LMNO 1NTZH 4B3SO 3OT7A 1NKDA 4JAVA 3MDSA 4O4HA 4F4LA 4WFGA 1IVSA 2EINC 2QR4A 2AXTZ 4TUYA 4LF8B 1XQ8A 1BHBA 4IHJA 3K5NA 2ZCEA 4H33A 2E5LO 3K59A 4YY3O 3C90A 3F5WC 1Y74A 2UUAO 1W0JG 1JX9A 1QQCA 1T5EA 4IIJA 4DR3O 3P3PA 1TAEA 2L6LA 4LP8A 4K35A 3OFNG 3SPHA 2DYRB 2XAJA 4XDKA 4FLXA 1NVPB 1UPGA 1GN4A 2CK3G 2LQTA 1KP2A 3FX7A 3LDCA 2XUMA 1FKAO 4FLZA 4BIOA 1QHTA 2MK3A 2EIKB 1FAFA 4DW0A 2ZT9B 5B1BC 4PELA 1I94O 3QG5A 1LNQA 5EIBD 5J2TA 2ZXWB 3L71H 3ICXA 5LYJA 2IM9A 3E8FA 5J2UA 5KAIZ 4MVRA 2KSDA 2JGDA 2Q7HA 4MVZA 1XOUA 4J9YB 2UXBB 3W7SA 2VQFO 1FXKC 3AG1B 5KA6A 1HNXO 4UCUA 1RSOB 3H1JH 5JQGA 5IYDO 3CD6V 4NXNO 3JCZA 4O4LB 3TXQA 3LDDA 4DV2B 2CTPA 3ZMTA 1YVWA 3I5DA 4X1IA 3RVYA 1EZVH 3KZIZ 3WG7C 3ZHVA 4LFBO 4YJ3B 3E89A 3K57A 5C8YB 1YDXA 1QLEC 2DE0X 1B06A 3OUFA 2QWNB 3ZRWB 3N2KA 2ITCC 1JPXA 5BY1A 3CX5F 2Y4TA 4B3TB 4WFFA 1PL0A 1NH2B 1JOYA 5JWPA 3SJCC 5AG2A 3RYHB 3CRCA 3NXSA 5JJNB 2WLKA 2XAGA 1R6NA 1XMOB 4JI2O 1S5JA 5KX5A 1M90W 2WLIB 1BMFG 4FM1A 4PDVA 2Q4PA 1Q90D 3OGIB 4TQDA 1XMOO 1S72V 4JI0B 2CTRA 5KMGA 3CCQV 2A06H 5L3DA 1F23A 1YEWA 1TGOA 4OXSA 2EBOA 2YS8A 3CRMA 4GKKB 2OTJV 3IAYA 1I5YA 4RQEA 4GZRB 2WLMA 4J9ZB 2YUAA 3AG4C 1DK1A 1W59A 3OR7C 1J5EO 3ASNB 4AILC 1AVMA 1SQBH 3ML0A 5GTIZ 3ETQA 2HEPA 3QNEA 3TJTA 2VWJA 3K9SA 4QIWF 3BFRA 1V54C 4NXMO 3ABTA 1ZLZA 4MVQA 2OIGA 2BTOA 4O2AB 1WP7A 3TXSA 1Q6HA 1RSOA 4JI4B 2DQ0A 4BIZA 1XNQB 3CE2A 3SYPA 4RO2A 3ABMB 4JI4O 4DR6O 1K92A 2ADPA 2VS0A 2FMLA 4BW5A 5LMUB 4ZOLA 4B3MO 4YJ3A 4J11A 5DN6G 3ZHQA 1Y67A 2YEVA 3BA9A 1GN2A 5LMUO 1PNKA 2Q73A 3CWBH 2P4KA 2UUBB 4Q20A 4KHPO 2FB5A 1NU1H 1JA8A 4DUZO 1VQ5V 1LUWA 1XL6A 3FB5C 2XAQA 3SYQA 2NNUA 3RYHA 5C93A 3A0BZ 3ETGA 3FB7C 1HWYA 2QWQB 3OMNB 4K3AA 1QR9A 1U96A 1AI6A 2RDCA 4GX2A 1WLEA 4RWUA 2Y0PA 4DV7O 1VQ8V 5KHIA 4DO2A 4PA7A 3FYIB 5B1AC 4DR2B 2ZR3A 4X66O 5FPOA 5IYBO 3TETA 3EHBB 1VQNV 4X9QA 3RGBA 5BZBA 3LUTB 4DR2O 3JD2A 3MHSC 2XNDG 1ZTEA 3B09A 3E35A 2GV9A 1YZBA 4LF6O 1PNLA 3CC4V 4JI3B 1BCCH 1Q3EA 3ETDA 2EIMB 4RQFA 4TOIA 1KKDA 4JGSA 4JI3O 1P7BA 4O2AA 1M9NA 4FZ1A 2E3CA 1OCRC 4UUJC 2NLJC 4LH6A 3GVMA 4KXRA 1K5QA 5LBQA 2CGNA 2M6YA 1AP6A 1ZL8A 3AG3C 4J80A 1M1KW 2CAZC 1H2LA 3AG7A 3ZIAG 4DV4B 5IJ0B 3JAWB 5LOVB 2ITDC 1H2GA 3G80A 1K5SA 2XOKG 4YJ2B
chains in the Genus database with same CATH topology
4TWKA 4JYCA 5EBWC 2EIMC 5FL7G 4YXWG 3ZMVA 3D36A 3CC7V 3RW0A 1XL4A 5HFLA 2UXNA 1OCZB 5KUKA 3CCJV 2HKOA 4P9OA 1PKXA 3ASNC 2JJ1G 2LFRA 1M57B 3ZMSA 3ABKB 4XDJA 3H01A 1ROPA 3JD0A 1OCCC 1VQ6V 4JTDB 3ZRWA 1YJ9V 3JD3A 4UXNA 2OT5A 3SPIA 2EIJB 1UJWB 5H6QA 3I56V 1NJIW 3E8GA 1S76D 4MTGA 1R3JC 5EK0A 4MVOA 3HB3B 4R6ZA 3JD1A 1N8RW 2P6JA 5CBGA 3BY6A 1S77D 2IW5A 1OCOC 3OEEG 5CA3A 2K1EA 3GWOA 2AHZA 1YSCA 2GHYA 1E79G 4MTFA 3OUSA 4JF3A 3ABMC 3K79A 4RUFA 2EJRA 2JEUA 3OE7G 1K9MW 1GTOA 3LNMB 2ZQMA 1OCZC 3ZN1A 3G6EV 3RVZA 2HG5C 1CEZA 3UM7A 1ORQC 2WLIA 4QNHB 1VQLV 3SPCA 2IU0A 4R50A 2WLJA 1YJWV 4MW3A 1M57C 1NQTA 3ABKC 4MTXA 4P9PA 5J9PC 1YI2V 2JEXA 2EILB 2YEVB 1F4MA 3AG2B 1RPRA 4QE9A 2A0LA 3MHHC 1W2BU 1OZ0A 3PJSK 2B5UA 4PA9A 4X88A 4GX0A 1DLBA 4PA6A 2H94A 1WPXA 4UV9A 4BIUA 3LSQA 5CMUA 2X6CA 3K0GA 2EIJC 4H37A 2QM8A 2H8PC 4FJCC 3TCUA 2WSSG 3E86A 1NKDA 4JAVA 4F4LA 4TT3G 4WFGA 1GMGA 1SERA 2EINC 2OCCB 2IU3A 3QO8A 1BHBA 1IXMA 4G2KA 1KC8W 5B1BB 4H33A 4FIPC 3MD0A 4R7CA 3FYEB 4JTCB 1V54B 1JVMA 5LGNA 2WAMA 1K73W 3ETEA 1M56B 2Y69B 3CC2V 5L3GA 3F5WC 4JPRA 1JX9A 1W0JG 2WLHA 1F4NA 1K97A 2EILC 2V7QG 2QEXV 3AG2C 2BOCC 5L3BA 1AR1B 2XASA 4LP8A 3K04A 4I5SA 3K06A 1K33A 3OFNG 2QKSA 4QPJA 5CBFA 3VBBA 3G4SV 3SPHA 2DYRB 3FKSG 3ASOC 2FTKA 4TSFG 2XAJA 4XDKA 1NVPB 5LHGA 1BHAA 2CK3G 1KP2A 2R9RB 2ZDIC 3LDCA 1V55B 3OGCC 1FXKB 4PDMA 2OCCC 4WF9V 1NVPD 3CCVV 1G8MA 1GM7A 2MK3A 2EIKB 3IC7A 5B1BC 4PELA 4UVBA 4MVUA 1SETA 1LNQA 3SYCA 2KB1A 5L3CA 1Q7YW 2ZXWB 1MOFA 1VQKV 2PI4A 2M7WA 2Y69C 2ATKC 2P90A 4GX5A 5B1NA 1GM9A 2UXXA 3WG7B 3E8FA 5LGUA 1GK9A 3K03A 4N23A 4MVRA 2W6IG 5IDJA 4E2LA 1H38A 2A79B 2IJHA 3HPLC 1QLEB 3K9AA 4MVZA 4J9YB 1COWG 2DYRC 4QPKA 4HAMA 3SYAA 5EBLC 4UVCA 1VQ7V 1AI4A 3X2QC 2DWEC 2Q67A 3GB7C 1AJNA 1R3KC 1K4CC 1TUEB 2P67A 1V55C 3ZMUA 3W7SA 1FXKC 3AG1B 5KA6A 2C2AA 4WFAV 3B8MA 3D3IA 3DGEA 3JYCA 5HFMA 3TK1A 1K8AW 2EIKC 5IYDO 3CD6V 3CCMV 3JCZA 3E2EA 1FS0G 2XAHA 1JJ2U 4MS2A 2LP7A 3LDDA 5LGTA 3SPJA 3ZMTA 4FK5C 5IY5B 2ZXWC 1K7DA 4PDLA 1L1FA 4QE7A 1DF5A 3RVYA 1RPOA 3WG7C 2W6JG 1AJQA 2HVJC 2EZPA 2B1IA 2A9HA 3IGAC 2ZDIA 3E89A 3K3WA 2AHYA 1SESA 1QLEC 2R9IA 1W0KG 5DM6V 3OUFA 4RUEA 4MT8A 4DXWA 4FMTA 3ZRWB 3SJQC 1KQSU 1DTOA 2ITCC 1JPXA 4MVSA 1K4DC 2QE7G 2DW4A 1CPYA 3AG1C 1FFTB 2JJ2G 2WLLB 4GT1A 4WFFA 1PL0A 3BEHA 1NH2B 1P4RA 3ZJZA 1Q82W 1JOYA 2X0LA 3EFFK 3AG4B 4G27B 4EKWA 2X6BA 5B1OA 2IH3C 3T4ZA 1MABG 2DQ3A 2GSMB 4HYOA 4LCUC 3NXSA 3K08A 5CBHA 5IY5C 1S0VA 2WLKA 5L3EA 2XAGA 1YITV 5EC2C 1NH2D 2QA4V 1R6NA 3KG2A 4UV8A 4MVMA 1M90W 1NR7A 2WLIB 1BMFG 2JIZG 5IYCO 3CCEV 4PDVA 1MSWD 3AG3B 3STLC 3CCLV 3CCSV 1Y4MA 1K3EA 4UVAA 1E1QG 1FXKA 1S72V 1QBZA 1S3JA 1H8HG 4X8AA 2IJIA 1QLNA 1ZWIC 3OMIB 3CCQV 2JK5C 5H6RA 3ABLB 1F23A 5L3DA 2WWWA 4WFHA 4G28B 5KUMA 3IFXA 3K0DA 4PA3A 5EBMC 4OXSA 2EBOA 1H8EG 2Q6AA 2IJKA 1R73A 3I55V 2OTJV 1I5YA 4RQEA 1NBMG 2WLMA 4J9ZB 2WPDG 3AG4C 4FPPA 3QO5A 2X7RB 4MTOA 1VQMV 3OR7C 4GX1A 3ASNB 3T2MA 2HLDG 1JCHA 3B8NA 4JAUA 3ML0A 3QNEA 3OMAB 5E1AC 4QIWF 1KP3A 1V54C 1DF4A 3ABTA 3R65A 3CCRV 3F7YC 4L87A 1M56C 3CYOA 2JDIG 4X89A 3ABUA 3AEIA 4KUMA 1BL8A 4MVQA 5H9CA 1RM1B 2Z5UA 1SRYA 3SPGA 3E8HA 4BAYA 3STZC 4ZBMA 3A0RA 3LDEA 2DQ0A 3ABLC 4BIZA 4KFMA 3G71V 3SYPA 1QCEA 4RO2A 1R3LC 3P32A 3ABMB 1VQ9V 1CP9A 3T1CA 1AJPA 1KD1W 1S5HC 3DTUB 4PA4A 2D3OW 1K92A 2IJJA 1QR8A 2W0FC 3CP1A 4BW5A 2DYSB 4P2ZA 2Q68A 4HZ3A 4RAIA 5DN6G 2HJFC 2X6AA 2PI5A 3QO7A 2YEVA 3ZRXA 1PNKA 1I5XA 1Q86W 1YHQV 1J95A 4WFBV 5LHIA 2ZD9A 5B3SB 2IH1C 4U7NA 5B1AB 3FB8C 4Q20A 1EZJA 3CXCU 1E1RG 1RM1C 1VQ4V 2HVKC 1R6KA 3E83A 1PD3A 3B77A 4ASUG 2WLLA 1VQ5V 3M99B 1XL6A 3FB5C 2XAQA 3SYQA 2EINB 5CN0A 3ZN0A 1YIJV 2NNUA 4PDRA 3RBZA 2F43G 4JYBA 5C93A 4LBEC 2HFEC 3WFVA 3W7WA 2OTLV 3ETGA 1Q81W 4N21A 3FB7C 1JQ0A 1HWYA 3OMNB 3OM3B 2DYSC 1FXVA 1PNMA 1VQOV 1QR9A 1AROP 2V1DA 1QVFU 1AI6A 2ZR2A 1MG1A 3OAAG 4GX2A 1WLEA 2LFSA 3ZRSA 1G4YB 2DWDC 2Y48A 3JD4A 3UKMA 1YTFB 4XBFA 1VQ8V 1OCRB 4DO2A 4PA7A 1FXHA 3FYIB 5B3SC 4R8CA 5B1AC 1YTFD 5KA5A 2P7TC 3ASOB 4KP4A 2ZR3A 4U7OA 2Q69A 1NR1A 1EFRG 1K34A 2XAFA 2EZOA 1R3IC 5IYBO 1F51A 3TETA 3EHBB 1VQNV 1Y66A 5BZBA 3LUTB 2QTOA 3JD2A 2XNDG 3MHSC 1OHHG 3CPWU 2BOBC 3E35A 4P30A 4JASA 3FB6C 3W7TA 1PNLA 3W7UA 2B1GA 1ENVA 3P30A 3CC4V 4ZKIA 5EC1C 2YSUB 3ETDA 2EIMB 3T4DA 4RQFA 3ZRVA 1VQPV 1KKDA 3LSSA 4Z1MG 5L3FA 4JGSA 2Z3YA 1P7BA 2QM7A 4QJFB 1GKFA 1YJNV 3F7VC 4WFEA 1M9NA 3OW2U 1B6QA 1GM8A 1OCRC 4UUJC 3CCUV 1AI5A 1GO3F 2NLJC 4MSWC 3W7XA 3ZMZA 1K5QA 1OCCB 5LBQA 3ZCCA 3OEHG 5LHHA 3CMAV 4XDLA 3X2QB 3SYOA 3AG3C 3OR6C 4JTAB 4I9WA 4MW8A 1M1KW 2WLNA 4WCEV 4LC1A 5GW7A 1EBOA 1AI7A 1SZTA 3ZIAG 4CZZA 1THZA 1OCOB 2HR3A 1QVGU 4GCZA 2ITDC 3CMEV 1H2GA 1KECA 1K5SA 4CBCA 3E8BA 3VOUA 2XOKG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BEH A;  4LP8 A;  4TWK A;  2EIM C;  5EBW C;  3ZJZ A;  3K04 A;  3RW0 A;  4G27 B;  3EFF K;  4EKW A;  3K06 A;  2HVK C;  5CBF A;  2QKS A;  3E83 A;  2X6B A;  1XL4 A;  2WLL A;  3SPH A;  2IH3 C;  3T4Z A;  3ASO C;  5KUK A;  1XL6 A;  3FB5 C;  4P9O A;  4HYO A;  4LCU C;  4XDK A;  3K08 A;  3SYQ A;  5CBH A;  5IY5 C;  2WLK A;  5EC2 C;  3ASN C;  2R9R B;  4PDR A;  3RBZ A;  3LDC A;  3KG2 A;  3OGC C;  4MVM A;  4LBE C;  4XDJ A;  2HFE C;  4PDM A;  2WLI B;  2OCC C;  4PDV A;  3FB7 C;  3STL C;  1OCC C;  4JTD B;  2DYS C;  2WLL B;  5B1B C;  3SPI A;  4MVU A;  4X8A A;  3E8G A;  4GX2 A;  1ZWI C;  3ZRS A;  1LNQ A;  2JK5 C;  4MTG A;  1G4Y B;  2DWD C;  3SYC A;  2KB1 A;  1R3J C;  3UKM A;  5EK0 A;  4MVO A;  4R6Z A;  4WFH A;  4G28 B;  5KUM A;  3IFX A;  2Y69 C;  3K0D A;  2ATK C;  4GX5 A;  1OCO C;  5CBG A;  4PA3 A;  2K1E A;  4OXS A;  5EBM C;  2Q6A A;  3E8F A;  2AHZ A;  4PA7 A;  5B3S C;  3K03 A;  4MTF A;  4R8C A;  3OUS A;  4MVR A;  5B1A C;  2P7T C;  2A79 B;  3ABM C;  2WLM A;  4RUF A;  4J9Z B;  3AG4 C;  2Q69 A;  3HPL C;  4MVZ A;  4MTO A;  3LNM B;  3OR7 C;  4GX1 A;  4J9Y B;  2DYR C;  3T2M A;  1R3I C;  3TET A;  1OCZ C;  3SYA A;  3RVZ A;  2HG5 C;  5EBL C;  3UM7 A;  1ORQ C;  3X2Q C;  5BZB A;  2DWE C;  3LUT B;  2Q67 A;  2WLI A;  2QTO A;  3GB7 C;  3SPC A;  4QNH B;  2BOB C;  1R3K C;  1K4C C;  2WLJ A;  4R50 A;  1V55 C;  4P30 A;  4MW3 A;  5E1A C;  1M57 C;  4P9P A;  3ABK C;  3VOU A;  5J9P C;  3FB6 C;  1V54 C;  3R65 A;  3F7Y C;  1M56 C;  4QE9 A;  2A0L A;  4X89 A;  3JYC A;  3PJS K;  4PA9 A;  4X88 A;  5EC1 C;  4MVQ A;  1BL8 A;  4GX0 A;  3T4D A;  2EIK C;  4PA6 A;  3SPG A;  1KKD A;  2X6C A;  3E8H A;  2EIJ C;  3K0G A;  4H37 A;  4MS2 A;  3STZ C;  2H8P C;  3LDD A;  4ZBM A;  3LDE A;  3ABL C;  3TCU A;  3SPJ A;  4KFM A;  1P7B A;  2ZXW C;  3SYP A;  3E86 A;  4PDL A;  3F7V C;  4QE7 A;  4RO2 A;  4WFE A;  1R3L C;  3RVY A;  4F4L A;  3WG7 C;  4WFG A;  1OCR C;  2HVJ C;  2EIN C;  4UUJ C;  3T1C A;  2NLJ C;  1S5H C;  2A9H A;  4MSW C;  4PA4 A;  3IGA C;  3E89 A;  2AHY A;  2W0F C;  4XDL A;  4BW5 A;  1QLE C;  3SYO A;  4P2Z A;  2Q68 A;  3AG3 C;  3OUF A;  4RUE A;  3OR6 C;  4H33 A;  4DXW A;  4JTA B;  4I9W A;  4HZ3 A;  4R7C A;  4RAI A;  2HJF C;  2X6A A;  4JTC B;  2ITC C;  4MW8 A;  3SJQ C;  2WLN A;  1JVM A;  2YEV A;  4MVS A;  1K4D C;  3F5W C;  3AG1 C;  1J95 A;  2ITD C;  2WLH A;  2EIL C;  2ZD9 A;  3AG2 C;  4CBC A;  3E8B A;  2IH1 C;  2BOC C;  3FB8 C;  4WFF A; 
#chains in the Genus database with same CATH topology
 4TWK A;  1OJH A;  2UXN A;  1OCZ B;  4FLY A;  1P7G A;  1A32 A;  4IGG A;  1JMK C;  1M57 B;  3ZMS A;  3ABK B;  4DYL A;  3LNN A;  1M5I A;  4FLT A;  4J7K A;  4FFK A;  2OT5 A;  1UJW B;  3ZHU A;  2F1M A;  5CBG A;  5KHH A;  2IW5 A;  5CA3 A;  3T1H B;  3GWO A;  4LFC O;  3Q4H A;  2VQE B;  1E79 G;  3OUS A;  2ODM A;  5BMV B;  2DJV A;  1K9M W;  3UM7 A;  3CS5 A;  4JI8 B;  4R50 A;  1YJW V;  2OIE A;  4F6E A;  2JEX A;  1RPR A;  1OZ0 A;  2BTQ B;  4L8J A;  4BIU A;  4X62 B;  2CUG A;  5CMU A;  4FLV A;  1WAZ A;  2QM8 A;  1XDC A;  4TV9 A;  2WSS G;  3H1L H;  4DUY B;  1GN6 A;  4X62 O;  3CJH B;  4J42 A;  2K9P A;  2OCC B;  4CS4 A;  2IU3 A;  2KQX A;  3L73 H;  3QO8 A;  1KC8 W;  1G1X B;  3B4S A;  5LGN A;  2WAM A;  2QSA A;  2Y69 B;  3CC2 V;  5L3G A;  4JPR A;  1F4N A;  3AG2 C;  1HNZ B;  1KKC A;  5JCO A;  4X64 B;  3P3N A;  5IJ0 A;  3JAW A;  5LOV A;  3K06 A;  1K33 A;  4QPJ A;  2QKS A;  5H5N A;  3B40 A;  3VBB A;  3G4S V;  3FKS G;  4YJ2 A;  2NR5 A;  3FAV B;  1V55 B;  2YID A;  4PDM A;  3CCV V;  3HR0 A;  4JI7 B;  1R1B A;  3DC6 A;  4I9Q A;  1SQQ H;  4MVU A;  1AP5 A;  3GWK C;  3SYC A;  4FLW A;  4DV0 O;  2KB1 A;  4HNA B;  5L3C A;  4B08 A;  1MOF A;  3U10 A;  2PI4 A;  1BQZ A;  2G38 A;  3A8T A;  1GM9 A;  2UXX A;  5LGU A;  2GBO A;  1HNW B;  4N23 A;  3FD9 A;  1D5A A;  2A79 B;  2F23 A;  4LNU A;  4YIO A;  3HPL C;  1COW G;  2DYR C;  1HNW O;  4HAM A;  2F4V B;  1PP9 H;  2Q7G A;  3E22 B;  3BPZ A;  3GB7 C;  2YXH A;  1AJN A;  1N32 B;  2P67 A;  1KB9 F;  2F95 B;  4WFA V;  3B8M A;  3DGE A;  3L74 H;  3JAS B;  1XMQ B;  1K8A W;  2EIK C;  3CCM V;  3E2E A;  1BT8 A;  2XAH A;  1JJ2 U;  2BTQ A;  4FK5 C;  4WBN B;  1XMQ O;  2ZXW C;  2LGW A;  3UT5 B;  1RPO A;  2W6J G;  1AJQ A;  1X4T A;  2B1I A;  3AK1 A;  1V9P A;  1H2S B;  1SQF A;  3IGA C;  3K3W A;  1IBM B;  2R9I A;  1W0K G;  1L0L H;  3HKB B;  3EXA A;  4DXW A;  4O2B B;  4EFE A;  1WB7 A;  3SDL A;  1DTO A;  1N36 O;  2ADQ B;  4MVS A;  1Q8I A;  2DW4 A;  3AG1 C;  2D2C B;  3BEH A;  4C7U A;  1P4R A;  3ZJZ A;  1Q82 W;  4G27 B;  3EFF K;  4EKW A;  1PM9 A;  2X6B A;  2A3Q A;  1GAX A;  3H1H H;  3OTO B;  2GSM B;  1S0V A;  5L3E A;  1YIT V;  3ZX6 A;  4UV8 A;  4MVM A;  1NR7 A;  2E75 B;  5IYC O;  1MSW D;  3ZS8 C;  4LF8 O;  1ZAU A;  3CCL V;  1Y4M A;  2CDY A;  3FAV A;  4LF5 B;  1WA8 B;  1XI1 A;  3G6B A;  1QBZ A;  1GRJ A;  1H8H G;  5CA0 A;  2JK5 C;  1JFF A;  2WWW A;  3IC9 A;  2GUZ B;  3IFX A;  3K0D A;  4PA3 A;  1H8E G;  2Q6A A;  2PTM A;  4H13 B;  3NR7 A;  3A0H Z;  1R73 A;  4K8Z A;  1NBM G;  4FPP A;  4LF9 B;  3QO5 A;  2N74 A;  4MTO A;  4W4K A;  4GX1 A;  4I0X B;  4TQF A;  3OMA B;  4O4I B;  1KYO F;  1P49 A;  4UCO A;  3E22 A;  3R65 A;  1M56 C;  2JDI G;  3ABU A;  3AEI A;  4YHH B;  1SRY A;  3H9V A;  3SPG A;  2F93 B;  3E8H A;  3JAS A;  4ZBM A;  3A0R A;  3STZ C;  3LDE A;  4J7Z A;  4KFM A;  1EN5 A;  2PGG A;  1QCE A;  1VQ9 V;  1CP9 A;  4ICG A;  3T1C A;  2CGO A;  3UT5 A;  3O65 A;  3BAB A;  2Q68 A;  1MSD A;  2UXB O;  4D7T A;  2PUS A;  2UU9 B;  4RAI A;  2X6A A;  3PN1 A;  3HKB A;  4H0L B;  4O2B A;  1Q86 W;  5GON A;  4WFB V;  2ZIO A;  2AW9 A;  2ZD9 A;  2IH1 C;  4I4T A;  1E1R G;  1VQ4 V;  4DV2 O;  1R6K A;  3ZHS A;  1PD3 A;  3M7M X;  2EIN B;  5CN0 A;  1Q43 A;  4PDR A;  3RBZ A;  2F43 G;  4NTY A;  2OTL V;  3KKY A;  1Q81 W;  4N21 A;  2CH7 B;  3OM3 B;  4JZ2 A;  2YC0 A;  2IBZ H;  2ZR2 A;  4PI2 A;  3ZRS A;  2LFS A;  3JD4 A;  3UKM A;  2Y48 A;  4FVM A;  1WA8 A;  2HHH B;  1EM1 A;  4B3T O;  4LF7 B;  4R8C A;  2R70 A;  2GUZ A;  1YTF D;  2HHH O;  4CC5 A;  2P7T C;  3F5T A;  3QVN A;  3JAM N;  1AR4 A;  1NR1 A;  1K34 A;  1VF5 B;  4LF7 O;  3UCS C;  4FM2 A;  2BOB C;  4X65 B;  4P30 A;  4JAS A;  1HR0 B;  1ENV A;  5FPR A;  2UUC B;  4O4I A;  4JI0 O;  2YSU B;  4U3J B;  2Y0I A;  3ZRV A;  2DN9 A;  2KKW A;  4DRX B;  1MMM A;  5L3F A;  2RJZ A;  4IT5 A;  1N33 B;  2YXY A;  4BWA A;  4GKK O;  1AI5 A;  1GO3 F;  3BCC H;  4MSW C;  3CSX A;  4NR1 A;  1PPJ H;  4ABM A;  4K0K B;  3ZCC A;  3OEH G;  3CMA V;  1BGY H;  1M4U A;  2GDS A;  4CH3 A;  4K0K O;  2AGA A;  1B3Q A;  4PD4 F;  1QVG U;  5IWA B;  4GCZ A;  1KEC A;  2QKC A;  3UQ8 A;  1R6T A;  4CBC A;  1NT2 B;  3VOU A;  4O4L A;  1GN3 A;  5EBW C;  2EIM C;  2UXC B;  1XNQ O;  5H2F Z;  1N0N A;  5KUK A;  1PV0 A;  3CCJ V;  4P9O A;  2AZ0 A;  1PKX A;  4B7E A;  2LFR A;  5K1X A;  2F66 C;  4GLX A;  5C8Y A;  4OPH A;  5BR8 B;  2GTA A;  1VP7 A;  1IBL B;  3ZRW A;  3KCY A;  4UXN A;  3I56 V;  1PL4 A;  2CH7 A;  2ZNJ A;  5JCO C;  1S77 D;  3OEE G;  2UUB O;  3S3W A;  2AHZ A;  3AK2 A;  1M93 A;  4MTF A;  3K79 A;  4DR1 B;  4JI5 B;  2KG7 B;  2ZQM A;  5FNV B;  1OCZ C;  3ZN1 A;  3RVZ A;  2HG5 C;  1ORQ C;  2LO1 A;  4H44 B;  4I55 B;  4F6R B;  2WLI A;  1VQL V;  3SPC A;  1M57 C;  3ABK C;  2EIL B;  3BVO A;  2FKX A;  2A0L A;  3L75 H;  3PJS K;  4X88 A;  2RN9 A;  4A5U B;  1VIB A;  3LSQ A;  2X6C A;  3BHP A;  2JVD A;  4FJC C;  4DRX A;  4BR6 A;  1GMG A;  3JCU Z;  4ZI7 B;  3T1Y B;  5IYZ B;  1WPB A;  1IXM A;  2HP8 A;  1WB8 A;  4TV8 B;  4DR4 B;  4FIP C;  3FYE B;  1BSM A;  4JTC B;  3HKE B;  1V54 B;  1JVM A;  1K73 W;  3ETE A;  3WB2 A;  4LFA B;  3C3T A;  3QF7 A;  2WLH A;  2V7Q G;  3DXR B;  2BOC C;  5L3B A;  2XAS A;  3K5O A;  1IXB A;  3CRA A;  3ASO C;  2FTK A;  4TSF G;  4AQY B;  1H2N A;  4YIP A;  2R9R B;  1ZUQ A;  1I7F A;  3OGC C;  4X20 B;  3HKC B;  2OCC C;  4WF9 V;  1NVP D;  1G8M A;  3AK3 A;  1GM7 A;  4X1Y B;  1WP8 A;  2CTQ A;  4PHZ A;  1SET A;  2EX3 A;  2MW2 B;  1D5N A;  4DV4 O;  4AHC A;  1VQK V;  2EUL A;  4O4J B;  2Y69 C;  2WA4 A;  3RYC B;  3K5M A;  5B1N A;  5JJJ B;  4E2L A;  3H1I H;  5A2Q N;  4QPK A;  2QDO A;  5EZY B;  3SYA A;  4UVC A;  2RMK B;  3X2Q C;  2DWE C;  4DV5 B;  2Q67 A;  3U0Z A;  3G67 A;  1TUE B;  3N2G B;  2KG7 A;  1V55 C;  5FNV A;  2C2A A;  3D3I A;  5IE9 A;  3JYC A;  2RQ6 A;  5HFM A;  4DV3 B;  4W4L A;  4OGQ B;  1FS0 G;  1NI8 A;  4MS2 A;  3T1H O;  5IY5 B;  4EB6 B;  2ETN A;  4PDL A;  2VQE O;  2B9Z A;  2HVJ C;  2EZP A;  4DK1 A;  2A9H A;  2ZDI A;  4DV6 B;  1Y6X A;  1RFY A;  1SES A;  4JZG A;  4CH6 A;  5DM6 V;  4MT8 A;  2ARH A;  4ZI7 A;  1FFX B;  4JI8 O;  3SJQ C;  1TUB B;  1KQS U;  4LF4 B;  2P22 C;  4TV8 A;  2PYL A;  2QE7 G;  1CPY A;  1FFT B;  3HKE A;  2OWO A;  4PI0 A;  4LF4 O;  1XHX A;  5F2V O;  2PZS A;  5B66 Z;  1MAB G;  4DUY O;  1FD9 A;  2DQ3 A;  1TVK B;  4LCU C;  3WB0 A;  3K08 A;  3WU2 Z;  1NH2 D;  5EC2 C;  4Z1V A;  2LGQ A;  2QA4 V;  2BCC H;  5ITZ B;  5DED A;  4D6T H;  1G6U A;  2JIZ G;  3CCE V;  2GTS A;  3AG3 B;  3CCS V;  4UVA A;  3RYF B;  1E1Q G;  1JJO A;  4X20 A;  3HKC A;  1S3J A;  1IX9 A;  3RT3 C;  4X8A A;  1Z5V A;  1OV9 A;  1URF A;  5H6R A;  3ABL B;  4X1Y A;  4WFH A;  4G28 B;  2YIA A;  3M8A A;  4JYA B;  1HNZ O;  3DSQ A;  4JI1 B;  4X64 O;  3EVK A;  2IJK A;  3K58 A;  4O4H B;  1VAR A;  3RYC A;  4QGP A;  2WPD G;  4UB6 Z;  3T2M A;  4K8X A;  5D5Q A;  1KMI Z;  3B8N A;  4JAU A;  3RN4 A;  1YCI A;  1H2K A;  2LW7 A;  2UXD B;  3JSN A;  1KP3 A;  4JI7 O;  3CCR V;  3F7Y C;  4L87 A;  4LR3 A;  1XNR B;  3CYO A;  1SQP H;  3N2G A;  1RM1 B;  2Z5U A;  4IIJ B;  1CXZ B;  5GTH Z;  1N34 B;  1Q6I A;  1Y76 B;  4BAY A;  3JSL A;  4ZHQ B;  4JV5 B;  3G71 V;  4EFB A;  2N04 A;  1R3L C;  1DGS A;  5BMV A;  4HBN A;  2XT9 A;  4EB6 A;  1LUV A;  2ZM6 B;  3DTU B;  1XIL A;  4PA4 A;  1UFI A;  2XTA A;  2QWO B;  2ZKO A;  2W0F C;  2F4V O;  2DYS B;  4P2Z A;  2ZM6 O;  4HZ3 A;  4PV1 B;  1N32 O;  2HJF C;  3BAA A;  2FYU H;  3QO7 A;  5KLV H;  3SGI A;  1FFX A;  3ZRX A;  2Q5Z A;  1YHQ V;  1J95 A;  1VF6 A;  4B7K A;  5LHI A;  1RP3 B;  5B3S B;  5LYJ B;  3CXC U;  5J2U B;  1I08 A;  4ASU G;  3CJH A;  3RYI B;  5B5E Z;  1LR1 A;  1TVK A;  4LBE C;  3JAT B;  1IBM O;  5JVD B;  4DV1 B;  4LH7 A;  3LSU A;  1FXV A;  1VQO V;  1ARO P;  4PJ0 Z;  2V1D A;  2E76 B;  4ZIB A;  1QVF U;  4GKJ B;  1MG1 A;  2VWK A;  2DWD C;  4FFB B;  3RYF A;  2BSK B;  4DR7 B;  2P06 A;  4B3R B;  3BA8 A;  5LMN B;  4B3S B;  1YF2 A;  1FXH A;  2CE4 A;  4X1I B;  4B3R O;  4U7O A;  1Q5O A;  3OTO O;  2Q69 A;  1EFR G;  2XAF A;  2EZO A;  1R3I C;  3THO A;  2QWR B;  3CPW U;  2E5L B;  5LP6 B;  3N2K B;  3FB6 C;  3W7T A;  4YY3 B;  3W7U A;  4LF5 O;  2B1G A;  2UUA B;  4DR3 B;  4UCS A;  3T4D A;  1SF9 A;  1VQP V;  3L70 H;  4HNA A;  1O9H A;  4CC6 A;  4Z1M G;  2DMX A;  3ZED A;  2Z3Y A;  2ILM A;  4QJF B;  4FZ0 A;  3VQY A;  1Y76 A;  3F7V C;  1YJN V;  4ZHQ A;  1GM8 A;  1FYJ A;  4LF9 O;  1SQV H;  5KX5 B;  1OCC B;  1MA1 A;  3OR6 C;  4JTA B;  4I9W A;  2O57 A;  4MW8 A;  5FLX N;  1I94 B;  2WLN A;  5KMG B;  4LC1 A;  1EBO A;  2YI9 A;  1AI7 A;  1SZT A;  4CZZ A;  1OCO B;  2HR3 A;  3CME V;  1EN6 A;  4YHH O;  1XEQ A;  2JRI A;  4JYC A;  3ZMV A;  4BW9 A;  1U97 A;  4WBN A;  5KHJ A;  1JR9 A;  1ZSP A;  4FM0 A;  2HKO A;  1IUR A;  3ASN C;  2JJ1 G;  4UCV A;  5DEC A;  1IBK B;  3RYI A;  2PF4 E;  4XDJ A;  2VQF B;  1ROP A;  1HNX B;  1VQ6 V;  1IBK O;  2YIB A;  2UU9 O;  5JH7 B;  3JAT A;  4JI6 B;  3SPI A;  5JVD A;  2EIJ B;  5H6Q A;  5TIS Z;  3WB1 A;  4NXN B;  1GH6 A;  1HDJ A;  3SJB C;  3R66 A;  2K1E A;  4JI6 O;  2Z0A A;  4FFB A;  2BSK A;  3VQW A;  2GHY A;  1S5L Z;  4JF3 A;  3ABM C;  4LFB B;  4RUF A;  1D2D A;  3OE7 G;  3APO A;  3LNM B;  4GYC B;  2RCV A;  1CEZ A;  3JAL B;  1SA0 B;  4ZOL B;  2IU0 A;  3CRR A;  2WLJ A;  1NQT A;  4P9P A;  1YI2 V;  5J9P C;  2YEV B;  3MHH C;  1W2B U;  5CB4 B;  4PA9 A;  1ZX3 A;  4GX0 A;  5LP6 A;  1DLB A;  1IZ3 A;  1WPX A;  4UV9 A;  1FJG B;  3K0G A;  2H8P C;  3TCU A;  2QGN A;  3E86 A;  1FJG O;  5E79 Z;  2Q0A A;  4TT3 G;  1SER A;  4JI2 B;  1WN7 A;  1L0N H;  4I0X A;  4G2K A;  5B1B B;  1X59 A;  1EN4 A;  3MD0 A;  4R7C A;  4X65 O;  4NVP A;  5D5P A;  1M56 B;  1HR0 O;  2UUC O;  5JJE B;  1K97 A;  2EIL C;  5BXZ A;  2QEX V;  2Y4U A;  1AR1 B;  2ZE6 A;  5CA1 B;  3K04 A;  4I5S A;  5CBF A;  1N33 O;  1N4C A;  4FLU A;  1IDS A;  2BE3 A;  5LHG A;  1J5E B;  1BHA A;  2ZDI C;  3BRC A;  1NTM H;  1FXK B;  2H3O A;  4NXM B;  3JAR B;  3IC7 A;  2Q8V A;  4UVB A;  2VRZ A;  3SJA C;  4X1K B;  5IWA O;  1Q7Y W;  5JH7 A;  4NKG B;  2W0X A;  5KHK A;  2M7W A;  1HP8 A;  2ATK C;  2P90 A;  4GX5 A;  2EJ7 A;  4IYI A;  3WG7 B;  1KU9 A;  1GK9 A;  2UXC O;  3S3X A;  3K03 A;  2W6I G;  5IDJ A;  1L8D A;  1H38 A;  4DR6 B;  1MNG A;  2IJH A;  1QNM A;  4DK0 A;  1QLE B;  2E74 B;  2OCH A;  3K9A A;  4J41 A;  5EBL C;  2HJD A;  2ZIM A;  1AI4 A;  4NTX A;  1VQ7 V;  4B3M B;  1ZL8 B;  5BR8 O;  1R3K C;  1K4C C;  2YDE A;  3ZMU A;  3JAL A;  1IBL O;  4UB8 Z;  2FL4 A;  1SA0 A;  5EIB C;  3TK1 A;  3ZBH A;  5IT9 N;  4KHP B;  2ZE5 A;  2LP7 A;  5CB4 A;  1KBH A;  4NTW A;  3SPJ A;  5LGT A;  4DUZ B;  1K7D A;  1L1F A;  4QE7 A;  1DF5 A;  1P84 F;  2JS5 A;  3TGU H;  4UCR A;  3D3Q A;  4DR1 O;  3OD4 A;  4JI5 O;  2AHY A;  4CS3 A;  5LXT B;  4RUE A;  3N27 A;  4FMT A;  3K5L A;  2P4V A;  2JGU A;  2QWP B;  1K4D C;  4U3J A;  4DV7 B;  3L72 H;  2JJ2 G;  2ZE8 A;  2WLL B;  2YIB D;  4GT1 A;  2X0L A;  3AG4 B;  3Q4H B;  1AB3 A;  1US6 A;  5B1O A;  2IH3 C;  3T4Z A;  5LA6 B;  3D36 C;  4HYO A;  5CA1 A;  4X66 B;  5CBH A;  5IY5 C;  4I50 B;  3KG2 A;  3T1Y O;  3A2F A;  5KHG A;  1NS1 A;  3B2E E;  3RWR D;  3STL C;  1SQG A;  4LF6 B;  4DR4 O;  1K3E A;  1BE3 H;  1FXK A;  1BQ0 A;  1QLN A;  2IJI A;  1MZF A;  1ZWI C;  3OMI B;  1VF6 C;  4LFA O;  3JAR A;  5KUM A;  5A9G A;  5EBM C;  4TV9 B;  4X1K A;  3QTC A;  3I55 V;  1VF7 A;  4Q6G A;  3VQV A;  2LW1 A;  2R72 A;  1XHZ A;  2X7R B;  4AQY O;  1VQM V;  2HLD G;  1JCH A;  2YIC A;  2AZ2 A;  2QJ1 A;  5E1A C;  1DF4 A;  4X89 A;  4KUM A;  1BL8 A;  1VMG A;  5H9C A;  5K1P A;  1B04 A;  3UO3 A;  3ABL C;  3CB2 A;  3CEI A;  2QTS A;  2ZE7 A;  5KAF Z;  3C3S A;  3IJ4 A;  3P32 A;  4OPA A;  1HW7 A;  1AJP A;  1KD1 W;  3VQX A;  1S5H C;  3HKD B;  3JAK B;  2WA3 A;  2D3O W;  2IJJ A;  3CHX A;  1QR8 A;  3CP1 A;  4I55 A;  4F6R A;  4DV5 O;  1SQX H;  3J81 N;  4EEQ A;  3MAQ A;  1XRE A;  2PI5 A;  1MZE A;  1SZX A;  3D8C A;  5LXT A;  1I5X A;  1XUQ A;  1VEW A;  3H1K H;  4CS2 A;  1N0J A;  2Q9L A;  1I0H A;  4U7N A;  4DV3 O;  5B1A B;  1XBL A;  3FB8 C;  2P5O A;  4LFC B;  1EZJ A;  1RM1 C;  1QU7 A;  2HVK C;  3E83 A;  3U11 A;  3B77 A;  2WLL A;  1WJZ A;  3M99 B;  2CTW A;  4LNU B;  3ZN0 A;  1YIJ V;  3KCX A;  3ZHR A;  5LA6 A;  4JYB A;  5IYZ A;  1F7Y A;  4OX9 B;  1SKV A;  4DV6 O;  2HFE C;  3WFV A;  3W7W A;  2ZIN A;  1JQ0 A;  3RFR A;  4I50 A;  4J10 A;  4Z2W A;  3CXH F;  2DYS C;  1PNM A;  1H2M A;  4OX9 O;  1Z5W A;  3OAA G;  1G4Y B;  1YTF B;  3DXR A;  4D7S A;  3J80 N;  4XBF A;  1Z2G A;  2L35 A;  4NB5 A;  2LJ2 A;  1OCR B;  5B3S C;  4CH5 A;  5LL6 Y;  5KA5 A;  2JS3 A;  3ASO B;  4KP4 A;  4LWS B;  2R9A A;  4IL6 Z;  5IJ9 B;  1Q6U A;  1F51 A;  1Y66 A;  2QTO A;  4KL1 A;  1OHH G;  5EYP B;  1NZ6 A;  3P30 A;  4ZKI A;  5EC1 C;  3J7A U;  1KUQ A;  3LSS A;  4O4J A;  3FFQ A;  4JYA O;  4JI1 O;  2QM7 A;  1GKF A;  3CRQ A;  4WFE A;  4JAA A;  3OW2 U;  4TUY B;  1B6Q A;  4IHJ B;  3CCU V;  2ZNI A;  3OTF A;  3W7X A;  2PY5 A;  3ZMZ A;  5EZY A;  2QM4 A;  1YXB A;  2YI8 A;  5LHH A;  1FPO A;  4XDL A;  3X2Q B;  3SYO A;  4JYY A;  3HKD A;  3JAK A;  2XHB A;  2Q7E A;  2QKA A;  2NN4 A;  1Y74 B;  3O9O A;  2UXD O;  1SS3 A;  4WCE V;  5GW7 A;  4U3F H;  1THZ A;  4DV0 B;  5LP6 C;  1XNR O;  5CA0 B;  1JFF B;  2DOS A;  3UO2 A;  3DC5 A;  3E8B A;  1N34 O;  3APQ A;  3CC7 V;  5FL7 G;  3SR2 C;  1AR5 A;  4YXW G;  3D36 A;  4E4E A;  3RW0 A;  2V4D A;  4JV5 O;  1XL4 A;  3L9D A;  5HFL A;  1SC5 B;  1TA8 A;  2Q0O C;  3H01 A;  3JD0 A;  1OCC C;  2RNB A;  4JTD B;  1TUB A;  1YJ9 V;  5J2T B;  3JD3 A;  1NJI W;  1NTK H;  4GUN A;  2N05 A;  3E8G A;  1S76 D;  2A7W A;  4MTG A;  1R3J C;  5EK0 A;  4DW1 A;  4MVO A;  3HB3 B;  4R6Z A;  3JD1 A;  1N8R W;  2P6J A;  4J7J A;  3BY6 A;  1AIL A;  2YXL A;  1OCO C;  2JGD B;  4IYH A;  1YSC A;  1WNS A;  4UFZ A;  2EJR A;  2JEU A;  1GTO A;  4AI8 A;  4I7Z B;  1O9G A;  3G6E V;  5ITZ A;  4LWS A;  1BZK A;  4QNH B;  5IJ9 A;  4DR5 B;  1BS3 A;  1N36 B;  4DV1 O;  4MW3 A;  5JQG B;  4MTX A;  4NYK A;  2PYJ A;  4CH4 A;  1F4M A;  3AG2 B;  4QE9 A;  2B5U A;  4DR5 O;  5GON B;  2OYQ A;  4GKJ O;  4PA6 A;  5EYP A;  2H94 A;  4UCT A;  2EIJ C;  4I4T B;  4H37 A;  4DR7 O;  3ZHT A;  5LMN O;  1NTZ H;  4B3S O;  3OT7 A;  1NKD A;  4JAV A;  3MDS A;  4O4H A;  4F4L A;  4WFG A;  1IVS A;  2EIN C;  2QR4 A;  2AXT Z;  4TUY A;  4LF8 B;  1XQ8 A;  1BHB A;  4IHJ A;  3K5N A;  2ZCE A;  4H33 A;  2E5L O;  3K59 A;  4YY3 O;  3C90 A;  3F5W C;  1Y74 A;  2UUA O;  1W0J G;  1JX9 A;  1QQC A;  1T5E A;  4IIJ A;  4DR3 O;  3P3P A;  1TAE A;  2L6L A;  4LP8 A;  4K35 A;  3OFN G;  3SPH A;  2DYR B;  2XAJ A;  4XDK A;  4FLX A;  1NVP B;  1UPG A;  1GN4 A;  2CK3 G;  2LQT A;  1KP2 A;  3FX7 A;  3LDC A;  2XUM A;  1FKA O;  4FLZ A;  4BIO A;  1QHT A;  2MK3 A;  2EIK B;  1FAF A;  4DW0 A;  2ZT9 B;  5B1B C;  4PEL A;  1I94 O;  3QG5 A;  1LNQ A;  5EIB D;  5J2T A;  2ZXW B;  3L71 H;  3ICX A;  5LYJ A;  2IM9 A;  3E8F A;  5J2U A;  5KAI Z;  4MVR A;  2KSD A;  2JGD A;  2Q7H A;  4MVZ A;  1XOU A;  4J9Y B;  2UXB B;  3W7S A;  2VQF O;  1FXK C;  3AG1 B;  5KA6 A;  1HNX O;  4UCU A;  1RSO B;  3H1J H;  5JQG A;  5IYD O;  3CD6 V;  4NXN O;  3JCZ A;  4O4L B;  3TXQ A;  3LDD A;  4DV2 B;  2CTP A;  3ZMT A;  1YVW A;  3I5D A;  4X1I A;  3RVY A;  1EZV H;  3KZI Z;  3WG7 C;  3ZHV A;  4LFB O;  4YJ3 B;  3E89 A;  3K57 A;  5C8Y B;  1YDX A;  1QLE C;  2DE0 X;  1B06 A;  3OUF A;  2QWN B;  3ZRW B;  3N2K A;  2ITC C;  1JPX A;  5BY1 A;  3CX5 F;  2Y4T A;  4B3T B;  4WFF A;  1PL0 A;  1NH2 B;  1JOY A;  5JWP A;  3SJC C;  5AG2 A;  3RYH B;  3CRC A;  3NXS A;  5JJN B;  2WLK A;  2XAG A;  1R6N A;  1XMO B;  4JI2 O;  1S5J A;  5KX5 A;  1M90 W;  2WLI B;  1BMF G;  4FM1 A;  4PDV A;  2Q4P A;  1Q90 D;  3OGI B;  4TQD A;  1XMO O;  1S72 V;  4JI0 B;  2CTR A;  5KMG A;  3CCQ V;  2A06 H;  5L3D A;  1F23 A;  1YEW A;  1TGO A;  4OXS A;  2EBO A;  2YS8 A;  3CRM A;  4GKK B;  2OTJ V;  3IAY A;  1I5Y A;  4RQE A;  4GZR B;  2WLM A;  4J9Z B;  2YUA A;  3AG4 C;  1DK1 A;  1W59 A;  3OR7 C;  1J5E O;  3ASN B;  4AIL C;  1AVM A;  1SQB H;  3ML0 A;  5GTI Z;  3ETQ A;  2HEP A;  3QNE A;  3TJT A;  2VWJ A;  3K9S A;  4QIW F;  3BFR A;  1V54 C;  4NXM O;  3ABT A;  1ZLZ A;  4MVQ A;  2OIG A;  2BTO A;  4O2A B;  1WP7 A;  3TXS A;  1Q6H A;  1RSO A;  4JI4 B;  2DQ0 A;  4BIZ A;  1XNQ B;  3CE2 A;  3SYP A;  4RO2 A;  3ABM B;  4JI4 O;  4DR6 O;  1K92 A;  2ADP A;  2VS0 A;  2FML A;  4BW5 A;  5LMU B;  4ZOL A;  4B3M O;  4YJ3 A;  4J11 A;  5DN6 G;  3ZHQ A;  1Y67 A;  2YEV A;  3BA9 A;  1GN2 A;  5LMU O;  1PNK A;  2Q73 A;  3CWB H;  2P4K A;  2UUB B;  4Q20 A;  4KHP O;  2FB5 A;  1NU1 H;  1JA8 A;  4DUZ O;  1VQ5 V;  1LUW A;  1XL6 A;  3FB5 C;  2XAQ A;  3SYQ A;  2NNU A;  3RYH A;  5C93 A;  3A0B Z;  3ETG A;  3FB7 C;  1HWY A;  2QWQ B;  3OMN B;  4K3A A;  1QR9 A;  1U96 A;  1AI6 A;  2RDC A;  4GX2 A;  1WLE A;  4RWU A;  2Y0P A;  4DV7 O;  1VQ8 V;  5KHI A;  4DO2 A;  4PA7 A;  3FYI B;  5B1A C;  4DR2 B;  2ZR3 A;  4X66 O;  5FPO A;  5IYB O;  3TET A;  3EHB B;  1VQN V;  4X9Q A;  3RGB A;  5BZB A;  3LUT B;  4DR2 O;  3JD2 A;  3MHS C;  2XND G;  1ZTE A;  3B09 A;  3E35 A;  2GV9 A;  1YZB A;  4LF6 O;  1PNL A;  3CC4 V;  4JI3 B;  1BCC H;  1Q3E A;  3ETD A;  2EIM B;  4RQF A;  4TOI A;  1KKD A;  4JGS A;  4JI3 O;  1P7B A;  4O2A A;  1M9N A;  4FZ1 A;  2E3C A;  1OCR C;  4UUJ C;  2NLJ C;  4LH6 A;  3GVM A;  4KXR A;  1K5Q A;  5LBQ A;  2CGN A;  2M6Y A;  1AP6 A;  1ZL8 A;  3AG3 C;  4J80 A;  1M1K W;  2CAZ C;  1H2L A;  3AG7 A;  3ZIA G;  4DV4 B;  5IJ0 B;  3JAW B;  5LOV B;  2ITD C;  1H2G A;  3G80 A;  1K5S A;  2XOK G;  4YJ2 B; 
#chains in the Genus database with same CATH homology
 4TWK A;  4JYC A;  5EBW C;  2EIM C;  5FL7 G;  4YXW G;  3ZMV A;  3D36 A;  3CC7 V;  3RW0 A;  1XL4 A;  5HFL A;  2UXN A;  1OCZ B;  5KUK A;  3CCJ V;  2HKO A;  4P9O A;  1PKX A;  3ASN C;  2JJ1 G;  2LFR A;  1M57 B;  3ZMS A;  3ABK B;  4XDJ A;  3H01 A;  1ROP A;  3JD0 A;  1OCC C;  1VQ6 V;  4JTD B;  3ZRW A;  1YJ9 V;  3JD3 A;  4UXN A;  2OT5 A;  3SPI A;  2EIJ B;  1UJW B;  5H6Q A;  3I56 V;  1NJI W;  3E8G A;  1S76 D;  4MTG A;  1R3J C;  5EK0 A;  4MVO A;  3HB3 B;  4R6Z A;  3JD1 A;  1N8R W;  2P6J A;  5CBG A;  3BY6 A;  1S77 D;  2IW5 A;  1OCO C;  3OEE G;  5CA3 A;  2K1E A;  3GWO A;  2AHZ A;  1YSC A;  2GHY A;  1E79 G;  4MTF A;  3OUS A;  4JF3 A;  3ABM C;  3K79 A;  4RUF A;  2EJR A;  2JEU A;  3OE7 G;  1K9M W;  1GTO A;  3LNM B;  2ZQM A;  1OCZ C;  3ZN1 A;  3G6E V;  3RVZ A;  2HG5 C;  1CEZ A;  3UM7 A;  1ORQ C;  2WLI A;  4QNH B;  1VQL V;  3SPC A;  2IU0 A;  4R50 A;  2WLJ A;  1YJW V;  4MW3 A;  1M57 C;  1NQT A;  3ABK C;  4MTX A;  4P9P A;  5J9P C;  1YI2 V;  2JEX A;  2EIL B;  2YEV B;  1F4M A;  3AG2 B;  1RPR A;  4QE9 A;  2A0L A;  3MHH C;  1W2B U;  1OZ0 A;  3PJS K;  2B5U A;  4PA9 A;  4X88 A;  4GX0 A;  1DLB A;  4PA6 A;  2H94 A;  1WPX A;  4UV9 A;  4BIU A;  3LSQ A;  5CMU A;  2X6C A;  3K0G A;  2EIJ C;  4H37 A;  2QM8 A;  2H8P C;  4FJC C;  3TCU A;  2WSS G;  3E86 A;  1NKD A;  4JAV A;  4F4L A;  4TT3 G;  4WFG A;  1GMG A;  1SER A;  2EIN C;  2OCC B;  2IU3 A;  3QO8 A;  1BHB A;  1IXM A;  4G2K A;  1KC8 W;  5B1B B;  4H33 A;  4FIP C;  3MD0 A;  4R7C A;  3FYE B;  4JTC B;  1V54 B;  1JVM A;  5LGN A;  2WAM A;  1K73 W;  3ETE A;  1M56 B;  2Y69 B;  3CC2 V;  5L3G A;  3F5W C;  4JPR A;  1JX9 A;  1W0J G;  2WLH A;  1F4N A;  1K97 A;  2EIL C;  2V7Q G;  2QEX V;  3AG2 C;  2BOC C;  5L3B A;  1AR1 B;  2XAS A;  4LP8 A;  3K04 A;  4I5S A;  3K06 A;  1K33 A;  3OFN G;  2QKS A;  4QPJ A;  5CBF A;  3VBB A;  3G4S V;  3SPH A;  2DYR B;  3FKS G;  3ASO C;  2FTK A;  4TSF G;  2XAJ A;  4XDK A;  1NVP B;  5LHG A;  1BHA A;  2CK3 G;  1KP2 A;  2R9R B;  2ZDI C;  3LDC A;  1V55 B;  3OGC C;  1FXK B;  4PDM A;  2OCC C;  4WF9 V;  1NVP D;  3CCV V;  1G8M A;  1GM7 A;  2MK3 A;  2EIK B;  3IC7 A;  5B1B C;  4PEL A;  4UVB A;  4MVU A;  1SET A;  1LNQ A;  3SYC A;  2KB1 A;  5L3C A;  1Q7Y W;  2ZXW B;  1MOF A;  1VQK V;  2PI4 A;  2M7W A;  2Y69 C;  2ATK C;  2P90 A;  4GX5 A;  5B1N A;  1GM9 A;  2UXX A;  3WG7 B;  3E8F A;  5LGU A;  1GK9 A;  3K03 A;  4N23 A;  4MVR A;  2W6I G;  5IDJ A;  4E2L A;  1H38 A;  2A79 B;  2IJH A;  3HPL C;  1QLE B;  3K9A A;  4MVZ A;  4J9Y B;  1COW G;  2DYR C;  4QPK A;  4HAM A;  3SYA A;  5EBL C;  4UVC A;  1VQ7 V;  1AI4 A;  3X2Q C;  2DWE C;  2Q67 A;  3GB7 C;  1AJN A;  1R3K C;  1K4C C;  1TUE B;  2P67 A;  1V55 C;  3ZMU A;  3W7S A;  1FXK C;  3AG1 B;  5KA6 A;  2C2A A;  4WFA V;  3B8M A;  3D3I A;  3DGE A;  3JYC A;  5HFM A;  3TK1 A;  1K8A W;  2EIK C;  5IYD O;  3CD6 V;  3CCM V;  3JCZ A;  3E2E A;  1FS0 G;  2XAH A;  1JJ2 U;  4MS2 A;  2LP7 A;  3LDD A;  5LGT A;  3SPJ A;  3ZMT A;  4FK5 C;  5IY5 B;  2ZXW C;  1K7D A;  4PDL A;  1L1F A;  4QE7 A;  1DF5 A;  3RVY A;  1RPO A;  3WG7 C;  2W6J G;  1AJQ A;  2HVJ C;  2EZP A;  2B1I A;  2A9H A;  3IGA C;  2ZDI A;  3E89 A;  3K3W A;  2AHY A;  1SES A;  1QLE C;  2R9I A;  1W0K G;  5DM6 V;  3OUF A;  4RUE A;  4MT8 A;  4DXW A;  4FMT A;  3ZRW B;  3SJQ C;  1KQS U;  1DTO A;  2ITC C;  1JPX A;  4MVS A;  1K4D C;  2QE7 G;  2DW4 A;  1CPY A;  3AG1 C;  1FFT B;  2JJ2 G;  2WLL B;  4GT1 A;  4WFF A;  1PL0 A;  3BEH A;  1NH2 B;  1P4R A;  3ZJZ A;  1Q82 W;  1JOY A;  2X0L A;  3EFF K;  3AG4 B;  4G27 B;  4EKW A;  2X6B A;  5B1O A;  2IH3 C;  3T4Z A;  1MAB G;  2DQ3 A;  2GSM B;  4HYO A;  4LCU C;  3NXS A;  3K08 A;  5CBH A;  5IY5 C;  1S0V A;  2WLK A;  5L3E A;  2XAG A;  1YIT V;  5EC2 C;  1NH2 D;  2QA4 V;  1R6N A;  3KG2 A;  4UV8 A;  4MVM A;  1M90 W;  1NR7 A;  2WLI B;  1BMF G;  2JIZ G;  5IYC O;  3CCE V;  4PDV A;  1MSW D;  3AG3 B;  3STL C;  3CCL V;  3CCS V;  1Y4M A;  1K3E A;  4UVA A;  1E1Q G;  1FXK A;  1S72 V;  1QBZ A;  1S3J A;  1H8H G;  4X8A A;  2IJI A;  1QLN A;  1ZWI C;  3OMI B;  3CCQ V;  2JK5 C;  5H6R A;  3ABL B;  1F23 A;  5L3D A;  2WWW A;  4WFH A;  4G28 B;  5KUM A;  3IFX A;  3K0D A;  4PA3 A;  5EBM C;  4OXS A;  2EBO A;  1H8E G;  2Q6A A;  2IJK A;  1R73 A;  3I55 V;  2OTJ V;  1I5Y A;  4RQE A;  1NBM G;  2WLM A;  4J9Z B;  2WPD G;  3AG4 C;  4FPP A;  3QO5 A;  2X7R B;  4MTO A;  1VQM V;  3OR7 C;  4GX1 A;  3ASN B;  3T2M A;  2HLD G;  1JCH A;  3B8N A;  4JAU A;  3ML0 A;  3QNE A;  3OMA B;  5E1A C;  4QIW F;  1KP3 A;  1V54 C;  1DF4 A;  3ABT A;  3R65 A;  3CCR V;  3F7Y C;  4L87 A;  1M56 C;  3CYO A;  2JDI G;  4X89 A;  3ABU A;  3AEI A;  4KUM A;  1BL8 A;  4MVQ A;  5H9C A;  1RM1 B;  2Z5U A;  1SRY A;  3SPG A;  3E8H A;  4BAY A;  3STZ C;  4ZBM A;  3A0R A;  3LDE A;  2DQ0 A;  3ABL C;  4BIZ A;  4KFM A;  3G71 V;  3SYP A;  1QCE A;  4RO2 A;  1R3L C;  3P32 A;  3ABM B;  1VQ9 V;  1CP9 A;  3T1C A;  1AJP A;  1KD1 W;  1S5H C;  3DTU B;  4PA4 A;  2D3O W;  1K92 A;  2IJJ A;  1QR8 A;  2W0F C;  3CP1 A;  4BW5 A;  2DYS B;  4P2Z A;  2Q68 A;  4HZ3 A;  4RAI A;  5DN6 G;  2HJF C;  2X6A A;  2PI5 A;  3QO7 A;  2YEV A;  3ZRX A;  1PNK A;  1I5X A;  1Q86 W;  1YHQ V;  1J95 A;  4WFB V;  5LHI A;  2ZD9 A;  5B3S B;  2IH1 C;  4U7N A;  5B1A B;  3FB8 C;  4Q20 A;  1EZJ A;  3CXC U;  1E1R G;  1RM1 C;  1VQ4 V;  2HVK C;  1R6K A;  3E83 A;  1PD3 A;  3B77 A;  4ASU G;  2WLL A;  1VQ5 V;  3M99 B;  1XL6 A;  3FB5 C;  2XAQ A;  3SYQ A;  2EIN B;  5CN0 A;  3ZN0 A;  1YIJ V;  2NNU A;  4PDR A;  3RBZ A;  2F43 G;  4JYB A;  5C93 A;  4LBE C;  2HFE C;  3WFV A;  3W7W A;  2OTL V;  3ETG A;  1Q81 W;  4N21 A;  3FB7 C;  1JQ0 A;  1HWY A;  3OMN B;  3OM3 B;  2DYS C;  1FXV A;  1PNM A;  1VQO V;  1QR9 A;  1ARO P;  2V1D A;  1QVF U;  1AI6 A;  2ZR2 A;  1MG1 A;  3OAA G;  4GX2 A;  1WLE A;  2LFS A;  3ZRS A;  1G4Y B;  2DWD C;  2Y48 A;  3JD4 A;  3UKM A;  1YTF B;  4XBF A;  1VQ8 V;  1OCR B;  4DO2 A;  4PA7 A;  1FXH A;  3FYI B;  5B3S C;  4R8C A;  5B1A C;  1YTF D;  5KA5 A;  2P7T C;  3ASO B;  4KP4 A;  2ZR3 A;  4U7O A;  2Q69 A;  1NR1 A;  1EFR G;  1K34 A;  2XAF A;  2EZO A;  1R3I C;  5IYB O;  1F51 A;  3TET A;  3EHB B;  1VQN V;  1Y66 A;  5BZB A;  3LUT B;  2QTO A;  3JD2 A;  2XND G;  3MHS C;  1OHH G;  3CPW U;  2BOB C;  3E35 A;  4P30 A;  4JAS A;  3FB6 C;  3W7T A;  1PNL A;  3W7U A;  2B1G A;  1ENV A;  3P30 A;  3CC4 V;  4ZKI A;  5EC1 C;  2YSU B;  3ETD A;  2EIM B;  3T4D A;  4RQF A;  3ZRV A;  1VQP V;  1KKD A;  3LSS A;  4Z1M G;  5L3F A;  4JGS A;  2Z3Y A;  1P7B A;  2QM7 A;  4QJF B;  1GKF A;  1YJN V;  3F7V C;  4WFE A;  1M9N A;  3OW2 U;  1B6Q A;  1GM8 A;  1OCR C;  4UUJ C;  3CCU V;  1AI5 A;  1GO3 F;  2NLJ C;  4MSW C;  3W7X A;  3ZMZ A;  1K5Q A;  1OCC B;  5LBQ A;  3ZCC A;  3OEH G;  5LHH A;  3CMA V;  4XDL A;  3X2Q B;  3SYO A;  3AG3 C;  3OR6 C;  4JTA B;  4I9W A;  4MW8 A;  1M1K W;  2WLN A;  4WCE V;  4LC1 A;  5GW7 A;  1EBO A;  1AI7 A;  1SZT A;  3ZIA G;  4CZZ A;  1THZ A;  1OCO B;  2HR3 A;  1QVG U;  4GCZ A;  2ITD C;  3CME V;  1H2G A;  1KEC A;  1K5S A;  4CBC A;  3E8B A;  3VOU A;  2XOK G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...