3OR7C

On the structural basis of modal gating behavior in k+channels - e71i
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVITATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/transport protein
molecule keywords antibody fab fragment heavy chain
publication title On the structural basis of modal gating behavior in K(+) channels.
pubmed doi rcsb
source organism Streptomyces lividans
total genus 43
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2010-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3or7C00
2WLHA 1KKDA 4GX5A 3E89A 3SJQC 2AHZA 5E1AC 5B1BC 2AHYA 1OCOC 2DWDC 1JVMA 2HVJC 2HJFC 4P2ZA 2DWEC 3RVYA 3RBZA 3K04A 4EKWA 1V54C 2DYSC 5J9PC 4MVMA 4R50A 5B1AC 1J95A 2WLIB 5KUKA 1V55C 3E8FA 3SPJA 1R3LC 4QNHB 5BZBA 4G28B 3GB7C 4TWKA 1R3JC 5IY5C 4RAIA 3SPGA 3LUTB 5EC1C 1M57C 2ZXWC 4GX1A 4PDRA 4R6ZA 4P9OA 5EC2C 5B3SC 2JK5C 2X6CA 4MSWC 3E83A 4MTFA 3SPCA 3IFXA 3OR6C 2ITCC 3LNMB 3RW0A 3UM7A 2EIMC 1K4CC 1XL4A 2P7TC 4MVSA 3K0GA 3SYPA 1XL6A 3ABLC 5EBWC 2IH1C 4GX0A 2NLJC 4R8CA 2A79B 4MVUA 4PA3A 4R7CA 2Q67A 3F7VC 1M56C 2WLIA 4MVZA 4RO2A 5EBLC 4ZBMA 3UKMA 3K08A 2HFEC 4F4LA 2K1EA 2Q68A 1R3KC 3PJSK 4WFEA 2A0LA 2IH3C 4MW3A 3X2QC 2HVKC 4X89A 4H37A 4HZ3A 4DXWA 3SPHA 4J9ZB 3FB8C 3LDCA 4J9YB 2WLMA 3RVZA 3AG3C 3FB6C 3R65A 3SYAA 3AG1C 4WFHA 3T4DA 2OCCC 1K4DC 3KG2A 3WG7C 2BOCC 5EBMC 3STLC 3T4ZA 3E8HA 2ZD9A 3IGAC 4RUFA 1OCZC 3VOUA 3LDDA 4WFGA 3BEHA 3E86A 1QLEC 3E8GA 2WLLA 1P7BA 4JTDB 2X6BA 2EINC 2X6AA 4PA7A 4QE7A 2R9RB 3OGCC 3SYOA 3TCUA 4MVQA 4GX2A 3OR7C 2WLNA 2YEVA 4G27B 2WLLB 2W0FC 4P9PA 3EFFK 1ORQC 4PDLA 2ITDC 3F5WC 3ABKC 3STZC 3OUSA 5CBHA 4PA4A 4MS2A 3ABMC 4PA9A 4XDJA 2Q69A 4LCUC 4QE9A 4PDVA 4PDMA 5EK0A 3ZRSA 2EIKC 4MW8A 2ATKC 3T2MA 4MVRA 4BW5A 2WLJA 4XDLA 3JYCA 4HYOA 3ZJZA 5KUMA 3TETA 2QKSA 1OCRC 2Q6AA 3T1CA 2EILC 3ASNC 3HPLC 4XDKA 2QTOA 4JTCB 4KFMA 5CBFA 4PA6A 3SYQA 3FB7C 4MTGA 3F7YC 4JTAB 2HG5C 2H8PC 4MVOA 4CBCA 3E8BA 4I9WA 3LDEA 3OUFA 4H33A 1LNQA 4RUEA 3AG4C 4MTOA 3SPIA 2EIJC 2A9HA 1BL8A 2KB1A 3K0DA 3FB5C 3AG2C 1S5HC 2Y69C 4OXSA 3SYCA 5CBGA 4LP8A 3K03A 3K06A 4X88A 1R3IC 2BOBC 4UUJC 3ASOC 2DYRC 1OCCC 4WFFA 4X8AA 2WLKA 1G4YB 4P30A 1ZWIC 4LBEC
chains in the Genus database with same CATH superfamily
2XHBA 3HKBA 4LFAB 3B4SA 2IJIA 1O9GA 1SA0B 1BHAA 1XMQO 5B1AC 3CMAV 3DXRA 3E8FA 3DTUB 5L3DA 5IY5C 3QG5A 3OTOB 4U7NA 4FMTA 4HNAB 4TSFG 4DR1B 4ZHQA 2HP8A 5L3EA 3E35A 3JSLA 4ZKIA 3T1HO 3K08A 2JGDB 1FS0G 4X64O 4DW0A 2GHYA 1R6KA 5AG2A 2GDSA 3OGIB 1JFFA 2DYSB 5J2TB 4H0LB 2M7WA 3CC2V 1VQ9V 4O4HB 3EVKA 1L8DA 3CCMV 3OGCC 3K5OA 2WLNA 2PI4A 3DGEA 3CCJV 1NS1A 3OUSA 3B09A 3UT5B 3D36C 4LCUC 4QE9A 4DR4B 1FXHA 2ZM6B 1YSCA 3ZRSA 4DR2B 2ATKC 4AI8A 2UUBB 1S77D 1GN4A 5KA6A 1YZBA 2PZSA 3WB2A 3WU2Z 4FZ1A 1BL8A 3WG7B 1RM1C 2AZ0A 4FFBA 4ZI7A 3JSNA 4DV2B 4B3TB 1SQQH 2FTKA 4WFFA 3E22B 1YDXA 1ZWIC 1P7GA 3APOA 1SA0A 2RMKB 4LF9B 5GW7A 2DYSC 2Q4PA 3HKCB 3P30A 4LC1A 3CRCA 4DV3O 3DC6A 1VQ6V 5LGNA 4P9OA 2ZIMA 5CA0B 3ZRVA 2EULA 1JX9A 1PV0A 4X65O 1J5EO 4DR3O 2JGDA 5L3BA 3A2FA 2YICA 4R8CA 4ABMA 4PA3A 5JJJB 1S72V 1KMIZ 3UKMA 3H1IH 4UB6Z 3MD0A 3BAAA 3MHSC 4J41A 2PTMA 5KHHA 4I4TB 3RN4A 4B7EA 1GAXA 2Q7EA 4HZ3A 3FB8C 5J2TA 1NH2D 4JV5B 4LF6O 4O4HA 1K4DC 3WG7C 1JMKC 5EYPA 3IGAC 3LDDA 5DECA 3SR2C 2IJKA 1QLEC 2V1DA 3T1YB 1NU1H 2CTPA 2LGQA 1M57B 2R9RB 4GX2A 3UT5A 3K58A 3EFFK 1AILA 2Q69A 3RFRA 1SZTA 2X0LA 1ROPA 2LO1A 2WLJA 3ASNC 5CB4A 1NR1A 3AK2A 3CCQV 1Q90D 3A8TA 3G67A 4L87A 1TUBB 5EZYA 3E22A 1S5HC 3SYCA 3ABTA 5KHIA 2WAMA 2P5OA 3QNEA 3BVOA 2OTJV 2JS5A 3SJQC 1YJ9V 4WCEV 2HVJC 5J2UA 1ZL8A 4HBNA 1R6NA 4KXRA 3NXSA 3THOA 4JYYA 4FPPA 5CA0A 2FKXA 1R3JC 1BCCH 1F51A 2EILB 5LHIA 3VQVA 1M57C 4GX1A 1VQLV 1L1FA 1KP2A 5B5EZ 3OMAB 2P7TC 2CGNA 1GO3F 2UXCB 4WFAV 5L3GA 2Q5ZA 2UUAB 3RYCB 2BCCH 3ASOB 1XDCA 5KAFZ 1NBMG 2A0LA 3CCUV 1WB8A 4DV1O 5LGTA 3ZHRA 1ZUQA 5LHHA 3JD2A 5IWAB 3MAQA 5JH7B 2NN4A 1HWYA 3CCEV 4GYCB 3CX5F 5B1OA 1I08A 5LHGA 2DJVA 3K5NA 2QE7G 3CJHB 1AJQA 4JI1O 2W0FC 4L8JA 3CB2A 4PA4A 4DR5B 4LFAO 1XNRO 2XASA 1KKCA 1X59A 4PDVA 2DN9A 1H8EG 3TETA 3ZN0A 5KUMA 1TUBA 2EILC 4H13B 3K5MA 3FB7C 5JQGB 2EX3A 3ZBHA 4YHHB 2N05A 4H33A 2ZINA 5JJNB 4UCVA 1AI5A 4DR1O 2XAFA 4FZ0A 4GUNA 5CBGA 2CE4A 4LH6A 2A3QA 2QEXV 1K9MW 3ASOC 1OCCC 3A0BZ 2W6JG 3UQ8A 1FD9A 3K59A 2Y0IA 2OCHA 3D3IA 3CRQA 3RVYA 5BXZA 4EKWA 4X66B 1COWG 5LYJB 5L3CA 1AJNA 1VMGA 2GV9A 1GMGA 1YXBA 2PYLA 4QNHB 1H2KA 1P84F 3H1LH 4JZGA 4CS4A 3OR6C 2RDCA 4MVSA 2XOKG 3VBBA 4AHCA 2A79B 5BY1A 3Q4HB 1QNMA 2H3OA 2NR5A 4DR2O 1R3KC 4MW3A 3DSQA 2UUBO 1OCOB 5JH7A 2WPDG 4IL6Z 4O4JB 1TA8A 1V54B 3FYEB 1JOYA 1WLEA 1QQCA 3CJHA 2XAGA 3QO7A 4I50B 4TV9A 3B2EE 3L72H 3HKEA 1VQOV 2OWOA 1WP7A 4YJ3A 3CHXA 2ETNA 1VQ7V 1E1RG 4J80A 1X4TA 4LF9O 1K92A 3ABLB 2AXTZ 5IYZA 1K73W 4K0KB 2QM8A 4XDLA 3ZJZA 1XHZA 4C7UA 3CCLV 3AEIA 2XAHA 4XDKA 4NKGB 1XNQB 4LWSB 4CC5A 4DR7B 3RYFA 3ICXA 3PN1A 4JI0O 2LP7A 3MHHC 2BSKA 3OT7A 2KKWA 5DM6V 1XEQA 1YTFD 2DYRC 3RGBA 4JI6B 4JTDB 1Q6HA 1SZXA 3ZMVA 4X1KA 3G4SV 5B1BC 2IM9A 1OCOC 2QKAA 1JVMA 1VQPV 4J42A 5JWPA 2H94A 1V54C 1AI7A 4R50A 1FJGB 4X1IA 2WLIB 2F95B 2IJJA 3C3SA 1AR4A 1S76D 1F23A 5HFLA 3TXSA 3JASB 4YXWG 4K35A 1L0LH 1VQ5V 4OX9O 1PNMA 3ZX6A 1Y67A 5ITZA 3ABLC 4NYKA 5H9CA 4MVUA 4YJ2B 2YIBD 3CRMA 4ZBMA 3FAVA 4X20B 1KECA 4J10A 4O4JA 2QTSA 1Q8IA 3SPHA 1NVPD 1M4UA 1QU7A 2LFSA 4FIPC 4CS2A 5JVDB 1NTZH 1KU9A 4D6TH 3BABA 4CH6A 2UXNA 1FXKB 2Q0OC 3BEHA 4LFCB 2JGUA 3I5DA 3W7TA 2D2CB 1PD3A 1BS3A 3W7SA 5LMNO 1ZSPA 1VF6C 3CYOA 1ORQC 4P9PA 3UO2A 1CP9A 3CCVV 5KHJA 3TGUH 4PA9A 3ZCCA 2IBZH 2VQEB 1IBLB 3L73H 4O2BA 1VQMV 5FPRA 4UCOA 4LWSA 3JYCA 2P22C 2FL4A 3RYIA 1QR8A 4I55B 3OMIB 1K5SA 2H8PC 2XT9A 4FLYA 2ZE5A 1JCHA 4TV8B 1HNXB 5BR8B 2ADPA 1PNLA 2UXCO 3DC5A 2QDOA 1IBKO 1MG1A 1VF6A 1AJPA 4GX5A 1H38A 4UXNA 1OZ0A 1WP8A 4B7KA 4TOIA 5J9PC 3L9DA 5TISZ 3JASA 1J95A 2FB5A 3IAYA 1N34B 3CP1A 5IYBO 4NTWA 1JPXA 4MTFA 4PV1B 4EEQA 4YJ2A 2WA4A 3JARB 2E5LO 3OM3B 1FAFA 2VRZA 5LOVA 4DR5O 4H44B 1YIJV 2A06H 4ASUG 1E1QG 1BE3H 3JD1A 1WN7A 2IH3C 2QA4V 1Q5OA 3QF7A 2YC0A 4J9YB 2WLMA 4PD4F 1G1XB 2Q9LA 4WFHA 4EB6A 1GRJA 2YIAA 3BA8A 5KHKA 2OTLV 2VWKA 5GONB 4DYLA 5IYCO 1N0JA 1N32B 2X6AA 3CC4V 4FLZA 1IZ3A 2ADQB 4Q20A 3BY6A 4XDJA 4PELA 3ZMZA 2YEVB 3LNNA 3U0ZA 2CK3G 4JAAA 2F43G 4DV5O 4JAVA 2CTWA 2Q6AA 1Y74A 4TV8A 2A7WA 1K34A 5CA3A 4OPHA 3AG3B 1YEWA 5LP6B 1ZAUA 2R70A 4I9QA 1OCZB 4NR1A 4JI2B 3GVMA 3JAKB 3B8NA 4FJCC 1HNWB 1SQFA 1JJOA 1RPOA 2Q7GA 4LF5O 3CRRA 3B77A 1XREA 4JZ2A 1RFYA 1N0NA 1BSMA 1Z5WA 3KZIZ 5LXTA 4JI8O 1Z5VA 1DF5A 3ZHQA 1I94O 4QJFB 1ENVA 1H2NA 3RYHB 5EC1C 1GKFA 4PDRA 3E83A 4DUZB 1GN2A 3RW0A 3UM7A 3N27A 4B3MB 1PPJH 3K9AA 1FYJA 5E79Z 3D36A 1NKDA 1FFTB 2Q67A 4K0KO 4U3JB 2Q68A 4CH4A 4E4EA 4DV7B 2F4VB 4HNAA 5KA5A 3M8AA 1YF2A 1H2LA 1XNQO 3AG3C 4DR7O 5LP6C 3KG2A 4UVCA 5EBMC 5GONA 5LA6B 1OCZC 3ETQA 1SQVH 2QR4A 4GKKB 2DOSA 1JJ2U 2RQ6A 5B1NA 2OCCB 2YEVA 4JI6O 1PP9H 4K3AA 2B1IA 5H6QA 4B3RB 1ZLZA 4PDMA 4NTXA 1MOFA 4X62O 4MVRA 2BTQB 2QKCA 4HYOA 2UUCB 1MZFA 2JVDA 2ZIOA 2QWNB 3CRAA 5KHGA 4OGQB 1B6QA 3IC9A 3SYQA 4TUYB 5LP6A 4Z1MG 2VQFB 4CBCA 3E8BA 4MTOA 1EBOA 2QWPB 2HR3A 3JAKA 3I55V 4UV9A 1KP3A 2JIZG 3K06A 2AW9A 4IHJB 5LL6Y 3SJBC 1IX9A 1B3QA 4O2AB 1JQ0A 2JJ1G 5FL7G 4BIOA 3RWRD 4B08A 3K04A 5L3FA 4AQYO 1SS3A 4MVMA 3RYHA 4LFBB 4W4LA 2VS0A 4NXMB 4FLVA 3ZIAG 1R3LC 1VARA 5LMUB 1GTOA 4LFCO 2ARHA 1EN6A 4OPAA 3CWBH 3J80N 2X6CA 2ZNIA 2ITCC 4FLXA 3CMEV 2ZKOA 4YY3O 3SYPA 3B40A 5EBWC 5A2QN 2P6JA 3HKCA 3AG2B 3CD6V 2E76B 1I0HA 2HFEC 1LR1A 2WA3A 3O9OA 3I56V 4DUYB 1YHQV 3ETGA 3EXAA 4CH3A 2D3OW 1N33B 4RUFA 4LF8B 1US6A 1HNXO 1W0JG 2DQ3A 2N04A 2VWJA 1AROP 4ZIBA 3W7WA 5GTHZ 4I4TA 2IU3A 3GWKC 3S3WA 2AGAA 2Y0PA 4G27B 2P90A 4NTYA 2ITDC 5H6RA 5KLVH 4E2LA 4NB5A 5CA1B 4QPJA 2PYJA 3LSQA 2ZE7A 3C3TA 3K5LA 1XMOO 1Y6XA 2GSMB 2QTOA 3O65A 4KFMA 4PA6A 2K9PA 2HG5C 1EN5A 3H9VA 2O57A 1EFRG 2KB1A 1F4NA 2GTAA 4IHJA 3K0DA 1AP6A 1OCRB 3AG2C 4O2AA 1P49A 5CMUA 4LBEC 4JYBA 2RN9A 3IJ4A 2DW4A 4O4LB 5C93A 2QM4A 5EIBD 2EJ7A 3OTOO 2LW7A 5KX5B 4EFEA 3GWOA 4BW9A 3FX7A 5K1XA 1K5QA 1HW7A 2B5UA 3K3WA 1N32O 1MZEA 3AK3A 1B04A 4RQFA 1WAZA 2P06A 4F6RB 1HP8A 1SQBH 1HR0B 4Q6GA 2K1EA 3OTFA 4X1YB 3OAAG 4F6EA 4J9ZB 2V7QG 3R65A 5DN6G 1YTFB 3E8HA 2ZD9A 1QBZA 4X64B 2UXBB 2GTSA 1DLBA 3JD3A 3RYCA 1VP7A 3E8GA 4JI2O 4QIWF 4YIOA 4DR4O 1I7FA 3AG1B 1WNSA 2ZM6O 3N2GB 3STZC 1VQKV 1HNWO 4K8XA 2N74A 3VQYA 1YITV 3JATB 5EK0A 2P4KA 4BW5A 2W6IG 2LQTA 2Z5UA 5CBFA 1Q82W 1R6TA 2FMLA 2P4VA 2OT5A 4DV2O 4B3TO 5C8YB 3LDEA 1SC5B 1U97A 2EIKB 5IDJA 1YCIA 4B3MO 1EZVH 5LGUA 3S3XA 1O9HA 3C90A 3OD4A 1NVPB 3J7AU 1DF4A 5JQGA 3E89A 5KX5A 2PI5A 1AI6A 3JAWB 2F4VO 3CEIA 3P32A 2E75B 5DEDA 2JJ2G 1AR5A 4N21A 2ZE6A 2YS8A 2NNUA 1S0VA 3WFVA 1M90W 4J11A 2Z3YA 2MW2B 3JD4A 3SPCA 2HJDA 3ZN1A 4DV3B 2YDEA 3TXQA 4LH7A 1VQNV 4Z2WA 5LYJA 2Y69B 4MVZA 4X1YA 5B3SB 1J5EB 4DW1A 4JV5O 2Y48A 5H2FZ 3ZMTA 1DTOA 3LDCA 2XTAA 1NTMH 4TQDA 2YUAA 2VQFO 3T4DA 3T1YO 3TJTA 5FNVB 1W59A 3Q4HA 4NXNB 1SQGA 4WFGA 3E86A 4J7JA 1V55B 1BT8A 4CC6A 1KC8W 3N2GA 3ETEA 1WJZA 2ZXWB 4MVQA 1Y76B 1VIBA 1VQ4V 2EIMB 5CBHA 4LF7B 4MS2A 3AK1A 2R9IA 3L75H 1Q43A 2GBOA 4I7ZB 2IU0A 2UXDB 4I50A 4LFBO 4NXMO 4ICGA 5D5PA 2YI9A 1FFXB 3HKBB 3N2KB 4I9WA 3KKYA 5CN0A 4UCTA 5D5QA 2ZR2A 2Y69C 3KCYA 1FKAO 3CS5A 1N4CA 4JAUA 1G4YB 3QO8A 4JYAB 1Q81W 5F2VO 5E1AC 4KP4A 2HLDG 1HNZB 4ZHQB 2HJFC 3CCRV 3ABKB 1IBMB 3ABMB 1FXVA 1E79G 1EZJA 4IYHA 4XBFA 1V55C 4LF8O 2RJZA 2PF4E 4X9QA 2ZXWC 1WPXA 4MSWC 2JDIG 2HEPA 3ZEDA 2UUAO 2EIMC 4FM0A 1MSDA 3D3QA 3ML0A 4UB8Z 2IH1C 4GX0A 1GH6A 2NLJC 1JFFB 5IY5B 4GKJB 2WLIA 2R72A 5IJ0B 2MK3A 3TK1A 1FXKC 5HFMA 2X7RB 4X89A 5IWAO 4DXWA 1QR9A 2F23A 5FNVA 3UCSC 1Z2GA 3FB6C 4CZZA 5KMGB 3H1KH 4D7SA 1IXBA 4X20A 4QE7A 1BMFG 1XOUA 2C2AA 2UXXA 3D8CA 3F5TA 1TUEB 5JVDA 3ABKC 3A0HZ 3ABMC 4MT8A 1Y66A 1DGSA 1FXKA 4JI3B 1NJIW 4YHHO 1VF7A 2QWQB 4JI5B 1FFXA 1THZA 3N2KA 3LSUA 4QPKA 1WA8B 1AI4A 4JTCB 1MA1A 1XNRB 2CTRA 3U11A 3ZHUA 4FM1A 1MSWD 1LNQA 1ZX3A 3HKDB 5IJ9B 5K1PA 2UU9B 2LFRA 4U3FH 1R3IC 1GM9A 1HR0O 4I55A 4X66O 2WLHA 1KKDA 1G8MA 1Q6IA 2F93B 2AHZA 1B06A 1T5EA 1URFA 2CGOA 1RM1B 3RBZA 1BZKA 2CH7B 3WB0A 3L70H 1K33A 1FPOA 3ETDA 4FLTA 4IYIA 1AP5A 2UXBO 4TWKA 3QTCA 1Q6UA 1XHXA 3LUTB 3ABUA 2YXLA 4B3SB 2P67A 2JK5C 2WWWA 3ZHTA 5B66Z 1NH2B 1TAEA 5IYDO 2EIJB 5IJ0A 5EYPB 1AB3A 4DRXB 1PKXA 4JF3A 2ZT9B 3CE2A 4MTXA 4F4LA 4J7ZA 3RT3C 4WFEA 4WFBV 5KMGA 4JI7B 2Q7HA 1BQ0A 3QO5A 2RCVA 1M9NA 3JARA 3RVZA 4WF9V 4KL1A 2YXYA 3ZHVA 1QLNA 4KHPB 2Z0AA 3VOUA 2W0XA 1LUVA 3ZHSA 1KB9F 1M5IA 3CPWU 5CB4B 4KUMA 3B8MA 1NTKH 3BCCH 1KYOF 1YJNV 4CH5A 1G6UA 1D5NA 5H5NA 1KD1W 4UFZA 2OIEA 3CXHF 4AILC 1QLEB 1WA8A 5EZYB 1PNKA 4DV4B 2KG7B 2QKSA 4I0XB 1Q3EA 4TT3G 5IJ9A 2ODMA 3HKDA 1VQ8V 3X2QB 1UFIA 2Q8VA 1H2GA 3F7YC 2XNDG 4MVOA 4FFKA 3G80A 5J2UB 1ZL8B 2EIJC 3BHPA 1R1BA 1CXZB 2Q73A 3ASNB 5IE9A 1TGOA 3VQXA 1JR9A 2R9AA 1Q7YW 2EINB 4P30A 1IVSA 4JI0B 1MNGA 4JGSA 1FJGO 2AHYA 2XUMA 2CH7A 2DWDC 1N36B 4IGGA 5BMVB 3OE7G 4LNUB 3BRCA 4ZOLB 2OIGA 1N8RW 2LW1A 4GT1A 5BZBA 4NXNO 2GUZB 1H2SB 2OYQA 3IFXA 1CPYA 3K79A 4BIUA 4DRXA 1IXMA 4LF7O 3JCZA 2E3CA 1GM8A 5LBQA 2Q0AA 1YJWV 4BAYA 4BR6A 1QCEA 1QVGU 1D2DA 1TVKB 4OX9B 2KQXA 3PJSK 4UCRA 2UXDO 3X2QC 1K97A 1UJWB 4PI0A 4DV0B 2OCCC 4U7OA 1GN6A 4DK1A 4K8ZA 4U3JA 1P7BA 1I5XA 4O4IB 2VQEO 1IBLO 2EINC 4PA7A 3SYOA 4DR6B 3OR7C 1SETA 1YVWA 4JYAO 3K9SA 4I5SA 4PDLA 2ZR3A 1F4MA 4IT5A 3JAMN 1HNZO 2KG7A 4I0XA 5LA6A 1IBMO 2YSUB 5LMNB 3T2MA 1BHBA 1H2MA 3JALB 5BR8O 4JI4B 3G6EV 2HHHB 4LF4B 3A0RA 5JJEB 2EZOA 3OUFA 4G2KA 2A9HA 3G6BA 2EZPA 2BTQA 2BOBC 2F66C 4GKJO 4UUJC 3W7UA 2ZNJA 3BPZA 1VF5B 3ZMSA 1W2BU 4FLWA 4TUYA 1V9PA 5BMVA 3OFNG 4LNUA 1H8HG 1K3EA 2EBOA 4P2ZA 1N34O 1IBKB 1IURA 4ZOLA 5JCOC 1RP3B 4RQEA 1WPBA 2GUZA 4D7TA 1OCCB 4NVPA 3SPJA 1RSOB 4RAIA 3L71H 5EIBC 4R6ZA 4IIJB 4DV6B 2Y4TA 3LNMB 3R66A 4UCUA 2EJRA 5A9GA 1TVKA 3AG4B 1OHHG 3QVNA 2LGWA 1SQPH 5EBLC 4JI3O 2E5LB 4TV9B 2BTOA 4JI5O 1BQZA 3HKEB 5JCOA 2HVKC 1XI1A 2ZE8A 3L74H 4YJ3B 4TQFA 1XMQB 3T4ZA 4EFBA 4O4IA 3U10A 5IYZB 3BFRA 2UU9O 1XBLA 1I5YA 3MDSA 2ZQMA 1HDJA 1BGYH 3KCXA 2XAJA 4QGPA 3BA9A 1NQTA 2WLLB 1M1KW 3RYFB 1QVFU 1S5JA 3JALA 3T1HB 2F1MA 4GCZA 3FYIB 3ZRWB 2M6YA 2BSKB 2XAQA 1IDSA 3CCSV 1OCRC 4UVBA 2JEUA 4X1KB 1WB7A 2BE3A 4B3SO 4WBNB 1L0NH 4DV5B 4RUEA 1NT2B 3AG4C 3SPIA 2L6LA 5IT9N 2PGGA 5CA1A 3FB5C 4OXSA 4X1IB 3OEHG 1NI8A 1JA8A 4BWAA 4FK5C 3H1HH 2CDYA 2JS3A 4RWUA 1VEWA 4YIPA 4UCSA 3WB1A 4BIZA 4JI7O 5KAIZ 1KUQA 4JPRA 5ITZB 4CS3A 1RSOA 4PJ0Z 1GM7A 4HAMA 2DYRB 4DUZO 4KHPO 1A32A 4LF5B 4IIJA 3FAVB 5B1BB 4Z1VA 3M99B 5EC2C 2IJHA 2QSAA 1SF9A 4O4LA 4JI8B 3M7MX 2YIDA 1I94B 1K4CC 1XL4A 4PI2A 3K0GA 4J7KA 3ZS8C 1XL6A 4DV7O 3H1JH 1OV9A 2Y4UA 3W7XA 3F7VC 4RO2A 3LSSA 1PL4A 1NZ6A 2QM7A 5GTIZ 4DV4O 4JASA 2PY5A 4H37A 1XQ8A 1MMMA 3SYAA 3AG1C 4GKKO 4FVMA 1KQSU 3P3NA 4W4KA 2BOCC 4O2BB 4F6RA 3FFQA 2WLLA 4B3RO 3ZMUA 3RYIB 1K7DA 2FYUH 4X65B 2JEXA 1EM1A 2WSSG 4DR3B 3F5WC 3ZRWA 3OEEG 2UUCO 4JYCA 2DQ0A 1DK1A 3OW2U 1SRYA 1N36O 1M56B 1NR7A 2EIKC 1KBHA 1ZTEA 1QHTA 2CTQA 1CEZA 2LJ2A 3NR7A 4WBNA 3T1CA 3HPLC 4UV8A 3CSXA 3IC7A 2RNBA 2V4DA 3APQA 3CXCU 3JCUZ 4UVAA 4X62B 4LF6B 1YI2V 4GLXA 2DE0X 3UO3A 1AR1B 3JATA 2YI8A 4LP8A 4X88A 1K8AW 4A5UB 2B1GA 5FLXN 4X8AA 1EN4A 3SDLA 5C8YA 2YIBA 3FKSG 2ZDIC 4DO2A 2DWEC 5LMUO 1XUQA 1M93A 5LOVB 4DV0O 5KUKA 3VQWA 1P4RA 1SKVA 4G28B 3GB7C 3H01A 3SPGA 3SJAC 4AQYB 1D5AA 5B3SC 3DXRB 2B9ZA 3JAWA 4DR6O 1Q86W 4EB6B 1SERA 4LR3A 4R7CA 2QWOB 3P3PA 4DUYO 1M56C 2CUGA 1LUWA 3JD0A 3ZRXA 3OMNB 3SJCC 4YY3B 2YXHA 3FD9A 2ZDIA 1XILA 1N33O 2G38A 3CC7V 1S5LZ 4JI4O 2HHHO 4LF4O 2QWRB 4FLUA 4GZRB 2JRIA 3J81N 3HR0A 3STLC 2IW5A 1S3JA 1AVMA 5B1AB 2QGNA 1OJHA 2X6BA 4FM2A 1Y74B 2AZ2A 3TCUA 3K57A 1SESA 1PL0A 4PHZA 1U96A 1F7YA 2KSDA 3EHBB 1R73A 1SQXH 4MW8A 4DK0A 1RPRA 2QJ1A 1PM9A 2ILMA 2L35A 4DV1B 4MTGA 1Y76A 1MABG 4N23A 4JTAB 2ZCEA 2E74B 4DV6O 1XMOB 1UPGA 1GK9A 1GN3A 3G71V 2CAZC 2PUSA 3E2EA 5FPOA 5LXTB 3HB3B 2HKOA 1W0KG 3SGIA 2WLKA 4FFBB 3AG7A 4JI1B 3K03A 4ZI7B 2DMXA 1Y4MA
chains in the Genus database with same CATH topology
3ZMVA 4JGSA 3G4SV 5B1BC 2AHYA 1OCOC 2DW4A 2DWDC 1JVMA 5C93A 1VQPV 2IJIA 2H94A 3OE7G 1V54C 1BHAA 3GWOA 1AI7A 4R50A 5B1AC 1K5QA 2WLIB 3CMAV 2IJJA 2B5UA 3E8FA 1N8RW 3K3WA 3DTUB 4GT1A 5L3DA 5BZBA 5IY5C 1F23A 1S76D 5HFLA 4U7NA 4YXWG 4FMTA 3IFXA 4TSFG 1VQ5V 1CPYA 3K79A 4BIUA 1PNMA 1IXMA 5L3EA 3E35A 4RQFA 3JCZA 3ABLC 5H9CA 1GM8A 4MVUA 5LBQA 1YJWV 4BAYA 1QVGU 1QCEA 4ZBMA 4ZKIA 3K08A 2K1EA 3PJSK 1KECA 3X2QC 1FS0G 2GHYA 1K97A 3OAAG 3SPHA 1R6KA 4J9ZB 1UJWB 1NVPD 2LFSA 2V7QG 4FIPC 3R65A 2OCCC 5DN6G 1YTFB 4U7OA 2DYSB 3E8HA 2UXNA 2ZD9A 1QBZA 1FXKB 2M7WA 1DLBA 3BEHA 3JD3A 3CC2V 1VQ9V 3E8GA 3W7TA 1P7BA 1I5XA 4QIWF 1PD3A 3CCMV 2EINC 4PA7A 3OGCC 3AG1B 3SYOA 3W7SA 3OR7C 2WLNA 1SETA 2PI4A 3DGEA 4I5SA 3CCJV 4P9PA 3CYOA 1ORQC 4PDLA 2ZR3A 3STZC 1VQKV 1CP9A 1F4MA 3OUSA 3CCVV 4PA9A 3ZCCA 4LCUC 4QE9A 1YITV 1FXHA 2YSUB 1YSCA 5EK0A 3ZRSA 1VQMV 2ATKC 3T2MA 1BHBA 4BW5A 3JYCA 2W6IG 2Z5UA 5CBFA 1Q82W 1S77D 1QR8A 3G6EV 3OMIB 3A0RA 2OT5A 5KA6A 1K5SA 2H8PC 2EZOA 1JCHA 3LDEA 3OUFA 2EIKB 5IDJA 4G2KA 2A9HA 1BL8A 3WG7B 2EZPA 1PNLA 5LGUA 1RM1C 2BOBC 1MG1A 1NVPB 4UUJC 3W7UA 2FTKA 1AJPA 4WFFA 3ZMSA 1W2BU 1ZWIC 1DF4A 3OFNG 4GX5A 3E89A 1H8HG 2PI5A 1AI6A 1H38A 1K3EA 4UXNA 1OZ0A 2EBOA 3P32A 4P2ZA 5GW7A 2JJ2G 4RQEA 4N21A 2DYSC 5J9PC 1OCCB 3P30A 1J95A 2NNUA 1S0VA 4LC1A 3SPJA 3WFVA 1VQ6V 1M90W 3CP1A 4RAIA 5IYBO 5LGNA 4R6ZA 4P9OA 2Z3YA 1JPXA 3ZRVA 4MTFA 3JD4A 3SPCA 1JX9A 3LNMB 3ZN1A 2EJRA 3AG4B 1VQNV 3OM3B 5L3BA 4R8CA 1OHHG 4PA3A 2Y69B 4MVZA 5EBLC 1S72V 1YIJV 3UKMA 4ASUG 5B3SB 1E1QG 3MD0A 3JD1A 3MHSC 2Y48A 2IH3C 3ZMTA 2QA4V 1DTOA 2HVKC 4HZ3A 3FB8C 3LDCA 4J9YB 2WLMA 4WFHA 3T4DA 1NH2D 1K4DC 3WG7C 3T4ZA 3IGAC 3LDDA 4WFGA 3E86A 1V55B 2IJKA 2OTLV 1I5YA 1QLEC 2ZQMA 2V1DA 4JTDB 1KC8W 5IYCO 3ETEA 2X6AA 3CC4V 1M57B 2R9RB 2ZXWB 2XAJA 4MVQA 4GX2A 1NQTA 2WLLB 4Q20A 3BY6A 3EFFK 1M1KW 1VQ4V 2EIMB 5CBHA 4XDJA 4MS2A 2R9IA 1QVFU 2Q69A 4PELA 3ZMZA 2YEVB 2CK3G 1SZTA 2X0LA 2F43G 4GCZA 1ROPA 3FYIB 2IU0A 3ZRWB 2XAQA 2WLJA 4JAVA 3CCSV 1OCRC 2Q6AA 4UVBA 3ASNC 1NR1A 1K34A 3CCQV 2JEUA 5CA3A 4L87A 4I9WA 4RUEA 3AG3B 3AG4C 5CN0A 3SPIA 3FB5C 1OCZB 2ZR2A 1S5HC 2Y69C 3ABTA 4OXSA 3SYCA 3OEHG 2WAMA 4FK5C 3QNEA 3B8NA 4JAUA 1G4YB 2OTJV 3QO8A 4FJCC 1Q81W 3SJQC 1YJ9V 1RPOA 5E1AC 4KP4A 2HLDG 4BIZA 4WCEV 2HVJC 2HJFC 3B77A 3CCRV 3ABKB 4JPRA 3ABMB 1R6NA 1FXVA 1E79G 1GM7A 1EZJA 2DYRB 3NXSA 4HAMA 4XBFA 4FPPA 1V55C 1DF5A 1R3JC 4QJFB 1ENVA 5B1BB 1F51A 2EILB 5EC1C 1GKFA 5LHIA 1M57C 2ZXWC 3M99B 4GX1A 4PDRA 5EC2C 1VQLV 1WPXA 2IJHA 4MSWC 2JDIG 1L1FA 3E83A 1KP2A 3RW0A 3OMAB 2EIMC 3UM7A 1K4CC 1XL4A 2P7TC 1GO3F 3K0GA 3K9AA 3ML0A 3D36A 1XL6A 1NKDA 2IH1C 4GX0A 2NLJC 4WFAV 5IY5B 5L3GA 1FFTB 3W7XA 2Q67A 3F7VC 4RO2A 2WLIA 3LSSA 2QM7A 2MK3A 2Q68A 3ASOB 3TK1A 1FXKC 4JASA 1NBMG 2A0LA 5HFMA 2X7RB 4X89A 4H37A 3CCUV 4DXWA 5KA5A 1QR9A 5LGTA 3AG3C 3FB6C 4CZZA 3SYAA 3AG1C 3KG2A 1KQSU 4UVCA 5LHHA 3JD2A 2BOCC 5EBMC 1OCZC 1HWYA 3CCEV 2WLLA 3ZMUA 5B1OA 5LHGA 4QE7A 1BMFG 1JJ2U 1K7DA 2QE7G 2C2AA 2UXXA 5B1NA 2OCCB 1AJQA 2YEVA 2JEXA 2W0FC 2WSSG 1TUEB 3F5WC 2B1IA 3ABKC 5H6QA 3ZRWA 3OEEG 4PA4A 3ABMC 4JYCA 4MT8A 2DQ0A 1Y66A 2XASA 1SRYA 3OW2U 4PDVA 1FXKA 4PDMA 1NJIW 1M56B 1NR7A 2EIKC 1H8EG 1MOFA 1CEZA 4MVRA 3TETA 4HYOA 1THZA 5KUMA 3ZN0A 4QPKA 3T1CA 2EILC 3HPLC 1AI4A 4JTCB 1B6QA 4UV8A 3SYQA 3FB7C 3IC7A 4Z1MG 1MSWD 4CBCA 3E8BA 3CXCU 4UVAA 4H33A 1LNQA 1YI2V 1AI5A 2XAFA 4MTOA 1EBOA 2HR3A 3I55V 2LFRA 1AR1B 4UV9A 5CBGA 4LP8A 1KP3A 2QEXV 2JIZG 3K06A 4X88A 1R3IC 1GM9A 1K8AW 1K9MW 2B1GA 3ASOC 1OCCC 4X8AA 2W6JG 2WLHA 1KKDA 1G8MA 2AHZA 1JQ0A 3FKSG 2JJ1G 2ZDIC 3D3IA 5FL7G 2DWEC 3RVYA 4DO2A 1RM1B 3RBZA 3K04A 4EKWA 5L3FA 4MVMA 1COWG 5L3CA 1K33A 1AJNA 3ETDA 5KUKA 1GMGA 3ZIAG 4QNHB 1R3LC 1P4RA 4G28B 3GB7C 4TWKA 3H01A 1GTOA 3SPGA 3LUTB 3ABUA 2P67A 5B3SC 2JK5C 2X6CA 2WWWA 3OR6C 2ITCC 3CMEV 4JYBA 1NH2B 5IYDO 4MVSA 1Q86W 3SYPA 2EIJB 2XOKG 3VBBA 5EBWC 1SERA 4R7CA 2A79B 2P6JA 3AG2B 1M56C 1PKXA 4JF3A 3CD6V 3JD0A 3ZRXA 2HFEC 4MTXA 4F4LA 3OMNB 1R3KC 4WFEA 2ZDIA 4WFBV 4MW3A 3I56V 3CC7V 1YHQV 3QO5A 1OCOB 1M9NA 3ETGA 2WPDG 3RVZA 4WF9V 2D3OW 3STLC 1V54B 2IW5A 1QLNA 1S3JA 3FYEB 4RUFA 1JOYA 3VOUA 1WLEA 1W0JG 2DQ3A 5B1AB 1AROP 3W7WA 2XAGA 3QO7A 3CPWU 2X6BA 4KUMA 2IU3A 1VQOV 3B8MA 3TCUA 1YJNV 4G27B 1SESA 2P90A 1PL0A 2ITDC 5H6RA 1VQ7V 1KD1W 1E1RG 4E2LA 1K92A 3ABLB 1QLEB 1K73W 3EHBB 1R73A 4QPJA 3LSQA 1PNKA 4MW8A 2QM8A 4XDLA 1RPRA 3ZJZA 3CCLV 2QKSA 4TT3G 3AEIA 2XAHA 4XDKA 2QTOA 2GSMB 4KFMA 1VQ8V 4PA6A 3X2QB 4MTGA 1MABG 1H2GA 3F7YC 4JTAB 4N23A 2HG5C 2XNDG 4MVOA 1GK9A 1EFRG 2EIJC 2KB1A 1F4NA 3G71V 3K0DA 3E2EA 1OCRB 3AG2C 3ASNB 2LP7A 3MHHC 3HB3B 2HKOA 5DM6V 1YTFD 1W0KG 2DYRC 1Q7YW 2WLKA 2EINB 4P30A 5CMUA 3K03A 4LBEC 1Y4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WLH A;  1KKD A;  4GX5 A;  3E89 A;  3SJQ C;  2AHZ A;  5E1A C;  5B1B C;  2AHY A;  1OCO C;  2DWD C;  1JVM A;  2HVJ C;  2HJF C;  4P2Z A;  2DWE C;  3RVY A;  3RBZ A;  3K04 A;  4EKW A;  1V54 C;  2DYS C;  5J9P C;  4MVM A;  4R50 A;  5B1A C;  1J95 A;  2WLI B;  5KUK A;  1V55 C;  3E8F A;  3SPJ A;  1R3L C;  4QNH B;  5BZB A;  4G28 B;  3GB7 C;  4TWK A;  1R3J C;  5IY5 C;  4RAI A;  3SPG A;  3LUT B;  5EC1 C;  1M57 C;  2ZXW C;  4GX1 A;  4PDR A;  4R6Z A;  4P9O A;  5EC2 C;  5B3S C;  2JK5 C;  2X6C A;  4MSW C;  3E83 A;  4MTF A;  3SPC A;  3IFX A;  3OR6 C;  2ITC C;  3LNM B;  3RW0 A;  3UM7 A;  2EIM C;  1K4C C;  1XL4 A;  2P7T C;  4MVS A;  3K0G A;  3SYP A;  1XL6 A;  3ABL C;  5EBW C;  2IH1 C;  4GX0 A;  2NLJ C;  4R8C A;  2A79 B;  4MVU A;  4PA3 A;  4R7C A;  2Q67 A;  3F7V C;  1M56 C;  2WLI A;  4MVZ A;  4RO2 A;  5EBL C;  4ZBM A;  3UKM A;  3K08 A;  2HFE C;  4F4L A;  2K1E A;  2Q68 A;  1R3K C;  3PJS K;  4WFE A;  2A0L A;  2IH3 C;  4MW3 A;  3X2Q C;  2HVK C;  4X89 A;  4H37 A;  4HZ3 A;  4DXW A;  3SPH A;  4J9Z B;  3FB8 C;  3LDC A;  4J9Y B;  2WLM A;  3RVZ A;  3AG3 C;  3FB6 C;  3R65 A;  3SYA A;  3AG1 C;  4WFH A;  3T4D A;  2OCC C;  1K4D C;  3KG2 A;  3WG7 C;  2BOC C;  5EBM C;  3STL C;  3T4Z A;  3E8H A;  2ZD9 A;  3IGA C;  4RUF A;  1OCZ C;  3VOU A;  3LDD A;  4WFG A;  3BEH A;  3E86 A;  1QLE C;  3E8G A;  2WLL A;  1P7B A;  4JTD B;  2X6B A;  2EIN C;  2X6A A;  4PA7 A;  4QE7 A;  2R9R B;  3OGC C;  3SYO A;  3TCU A;  4MVQ A;  4GX2 A;  3OR7 C;  2WLN A;  2YEV A;  4G27 B;  2WLL B;  2W0F C;  4P9P A;  3EFF K;  1ORQ C;  4PDL A;  2ITD C;  3F5W C;  3ABK C;  3STZ C;  3OUS A;  5CBH A;  4PA4 A;  4MS2 A;  3ABM C;  4PA9 A;  4XDJ A;  2Q69 A;  4LCU C;  4QE9 A;  4PDV A;  4PDM A;  5EK0 A;  3ZRS A;  2EIK C;  4MW8 A;  2ATK C;  3T2M A;  4MVR A;  4BW5 A;  2WLJ A;  4XDL A;  3JYC A;  4HYO A;  3ZJZ A;  5KUM A;  3TET A;  2QKS A;  1OCR C;  2Q6A A;  3T1C A;  2EIL C;  3ASN C;  3HPL C;  4XDK A;  2QTO A;  4JTC B;  4KFM A;  5CBF A;  4PA6 A;  3SYQ A;  3FB7 C;  4MTG A;  3F7Y C;  4JTA B;  2HG5 C;  2H8P C;  4MVO A;  4CBC A;  3E8B A;  4I9W A;  3LDE A;  3OUF A;  4H33 A;  1LNQ A;  4RUE A;  3AG4 C;  4MTO A;  3SPI A;  2EIJ C;  2A9H A;  1BL8 A;  2KB1 A;  3K0D A;  3FB5 C;  3AG2 C;  1S5H C;  2Y69 C;  4OXS A;  3SYC A;  5CBG A;  4LP8 A;  3K03 A;  3K06 A;  4X88 A;  1R3I C;  2BOB C;  4UUJ C;  3ASO C;  2DYR C;  1OCC C;  4WFF A;  4X8A A;  2WLK A;  1G4Y B;  4P30 A;  1ZWI C;  4LBE C; 
#chains in the Genus database with same CATH topology
 2XHB A;  3HKB A;  4LFA B;  3B4S A;  2IJI A;  1O9G A;  1SA0 B;  1BHA A;  1XMQ O;  5B1A C;  3CMA V;  3DXR A;  3E8F A;  3DTU B;  5L3D A;  5IY5 C;  3QG5 A;  3OTO B;  4U7N A;  4FMT A;  4HNA B;  4TSF G;  4DR1 B;  4ZHQ A;  2HP8 A;  5L3E A;  3E35 A;  3JSL A;  4ZKI A;  3T1H O;  3K08 A;  2JGD B;  1FS0 G;  4X64 O;  4DW0 A;  2GHY A;  1R6K A;  5AG2 A;  2GDS A;  3OGI B;  1JFF A;  2DYS B;  5J2T B;  4H0L B;  2M7W A;  3CC2 V;  1VQ9 V;  4O4H B;  3EVK A;  1L8D A;  3CCM V;  3OGC C;  3K5O A;  2WLN A;  2PI4 A;  3DGE A;  3CCJ V;  1NS1 A;  3OUS A;  3B09 A;  3UT5 B;  3D36 C;  4LCU C;  4QE9 A;  4DR4 B;  1FXH A;  2ZM6 B;  1YSC A;  3ZRS A;  4DR2 B;  2ATK C;  4AI8 A;  2UUB B;  1S77 D;  1GN4 A;  5KA6 A;  1YZB A;  2PZS A;  3WB2 A;  3WU2 Z;  4FZ1 A;  1BL8 A;  3WG7 B;  1RM1 C;  2AZ0 A;  4FFB A;  4ZI7 A;  3JSN A;  4DV2 B;  4B3T B;  1SQQ H;  2FTK A;  4WFF A;  3E22 B;  1YDX A;  1ZWI C;  1P7G A;  3APO A;  1SA0 A;  2RMK B;  4LF9 B;  5GW7 A;  2DYS C;  2Q4P A;  3HKC B;  3P30 A;  4LC1 A;  3CRC A;  4DV3 O;  3DC6 A;  1VQ6 V;  5LGN A;  4P9O A;  2ZIM A;  5CA0 B;  3ZRV A;  2EUL A;  1JX9 A;  1PV0 A;  4X65 O;  1J5E O;  4DR3 O;  2JGD A;  5L3B A;  3A2F A;  2YIC A;  4R8C A;  4ABM A;  4PA3 A;  5JJJ B;  1S72 V;  1KMI Z;  3UKM A;  3H1I H;  4UB6 Z;  3MD0 A;  3BAA A;  3MHS C;  4J41 A;  2PTM A;  5KHH A;  4I4T B;  3RN4 A;  4B7E A;  1GAX A;  2Q7E A;  4HZ3 A;  3FB8 C;  5J2T A;  1NH2 D;  4JV5 B;  4LF6 O;  4O4H A;  1K4D C;  3WG7 C;  1JMK C;  5EYP A;  3IGA C;  3LDD A;  5DEC A;  3SR2 C;  2IJK A;  1QLE C;  2V1D A;  3T1Y B;  1NU1 H;  2CTP A;  2LGQ A;  1M57 B;  2R9R B;  4GX2 A;  3UT5 A;  3K58 A;  3EFF K;  1AIL A;  2Q69 A;  3RFR A;  1SZT A;  2X0L A;  1ROP A;  2LO1 A;  2WLJ A;  3ASN C;  5CB4 A;  1NR1 A;  3AK2 A;  3CCQ V;  1Q90 D;  3A8T A;  3G67 A;  4L87 A;  1TUB B;  5EZY A;  3E22 A;  1S5H C;  3SYC A;  3ABT A;  5KHI A;  2WAM A;  2P5O A;  3QNE A;  3BVO A;  2OTJ V;  2JS5 A;  3SJQ C;  1YJ9 V;  4WCE V;  2HVJ C;  5J2U A;  1ZL8 A;  4HBN A;  1R6N A;  4KXR A;  3NXS A;  3THO A;  4JYY A;  4FPP A;  5CA0 A;  2FKX A;  1R3J C;  1BCC H;  1F51 A;  2EIL B;  5LHI A;  3VQV A;  1M57 C;  4GX1 A;  1VQL V;  1L1F A;  1KP2 A;  5B5E Z;  3OMA B;  2P7T C;  2CGN A;  1GO3 F;  2UXC B;  4WFA V;  5L3G A;  2Q5Z A;  2UUA B;  3RYC B;  2BCC H;  3ASO B;  1XDC A;  5KAF Z;  1NBM G;  2A0L A;  3CCU V;  1WB8 A;  4DV1 O;  5LGT A;  3ZHR A;  1ZUQ A;  5LHH A;  3JD2 A;  5IWA B;  3MAQ A;  5JH7 B;  2NN4 A;  1HWY A;  3CCE V;  4GYC B;  3CX5 F;  5B1O A;  1I08 A;  5LHG A;  2DJV A;  3K5N A;  2QE7 G;  3CJH B;  1AJQ A;  4JI1 O;  2W0F C;  4L8J A;  3CB2 A;  4PA4 A;  4DR5 B;  4LFA O;  1XNR O;  2XAS A;  1KKC A;  1X59 A;  4PDV A;  2DN9 A;  1H8E G;  3TET A;  3ZN0 A;  5KUM A;  1TUB A;  2EIL C;  4H13 B;  3K5M A;  3FB7 C;  5JQG B;  2EX3 A;  3ZBH A;  4YHH B;  2N05 A;  4H33 A;  2ZIN A;  5JJN B;  4UCV A;  1AI5 A;  4DR1 O;  2XAF A;  4FZ0 A;  4GUN A;  5CBG A;  2CE4 A;  4LH6 A;  2A3Q A;  2QEX V;  1K9M W;  3ASO C;  1OCC C;  3A0B Z;  2W6J G;  3UQ8 A;  1FD9 A;  3K59 A;  2Y0I A;  2OCH A;  3D3I A;  3CRQ A;  3RVY A;  5BXZ A;  4EKW A;  4X66 B;  1COW G;  5LYJ B;  5L3C A;  1AJN A;  1VMG A;  2GV9 A;  1GMG A;  1YXB A;  2PYL A;  4QNH B;  1H2K A;  1P84 F;  3H1L H;  4JZG A;  4CS4 A;  3OR6 C;  2RDC A;  4MVS A;  2XOK G;  3VBB A;  4AHC A;  2A79 B;  5BY1 A;  3Q4H B;  1QNM A;  2H3O A;  2NR5 A;  4DR2 O;  1R3K C;  4MW3 A;  3DSQ A;  2UUB O;  1OCO B;  5JH7 A;  2WPD G;  4IL6 Z;  4O4J B;  1TA8 A;  1V54 B;  3FYE B;  1JOY A;  1WLE A;  1QQC A;  3CJH A;  2XAG A;  3QO7 A;  4I50 B;  4TV9 A;  3B2E E;  3L72 H;  3HKE A;  1VQO V;  2OWO A;  1WP7 A;  4YJ3 A;  3CHX A;  2ETN A;  1VQ7 V;  1E1R G;  4J80 A;  1X4T A;  4LF9 O;  1K92 A;  3ABL B;  2AXT Z;  5IYZ A;  1K73 W;  4K0K B;  2QM8 A;  4XDL A;  3ZJZ A;  1XHZ A;  4C7U A;  3CCL V;  3AEI A;  2XAH A;  4XDK A;  4NKG B;  1XNQ B;  4LWS B;  4CC5 A;  4DR7 B;  3RYF A;  3ICX A;  3PN1 A;  4JI0 O;  2LP7 A;  3MHH C;  2BSK A;  3OT7 A;  2KKW A;  5DM6 V;  1XEQ A;  1YTF D;  2DYR C;  3RGB A;  4JI6 B;  4JTD B;  1Q6H A;  1SZX A;  3ZMV A;  4X1K A;  3G4S V;  5B1B C;  2IM9 A;  1OCO C;  2QKA A;  1JVM A;  1VQP V;  4J42 A;  5JWP A;  2H94 A;  1V54 C;  1AI7 A;  4R50 A;  1FJG B;  4X1I A;  2WLI B;  2F95 B;  2IJJ A;  3C3S A;  1AR4 A;  1S76 D;  1F23 A;  5HFL A;  3TXS A;  3JAS B;  4YXW G;  4K35 A;  1L0L H;  1VQ5 V;  4OX9 O;  1PNM A;  3ZX6 A;  1Y67 A;  5ITZ A;  3ABL C;  4NYK A;  5H9C A;  4MVU A;  4YJ2 B;  2YIB D;  3CRM A;  4ZBM A;  3FAV A;  4X20 B;  1KEC A;  4J10 A;  4O4J A;  2QTS A;  1Q8I A;  3SPH A;  1NVP D;  1M4U A;  1QU7 A;  2LFS A;  4FIP C;  4CS2 A;  5JVD B;  1NTZ H;  1KU9 A;  4D6T H;  3BAB A;  4CH6 A;  2UXN A;  1FXK B;  2Q0O C;  3BEH A;  4LFC B;  2JGU A;  3I5D A;  3W7T A;  2D2C B;  1PD3 A;  1BS3 A;  3W7S A;  5LMN O;  1ZSP A;  1VF6 C;  3CYO A;  1ORQ C;  4P9P A;  3UO2 A;  1CP9 A;  3CCV V;  5KHJ A;  3TGU H;  4PA9 A;  3ZCC A;  2IBZ H;  2VQE B;  1IBL B;  3L73 H;  4O2B A;  1VQM V;  5FPR A;  4UCO A;  4LWS A;  3JYC A;  2P22 C;  2FL4 A;  3RYI A;  1QR8 A;  4I55 B;  3OMI B;  1K5S A;  2H8P C;  2XT9 A;  4FLY A;  2ZE5 A;  1JCH A;  4TV8 B;  1HNX B;  5BR8 B;  2ADP A;  1PNL A;  2UXC O;  3DC5 A;  2QDO A;  1IBK O;  1MG1 A;  1VF6 A;  1AJP A;  4GX5 A;  1H38 A;  4UXN A;  1OZ0 A;  1WP8 A;  4B7K A;  4TOI A;  5J9P C;  3L9D A;  5TIS Z;  3JAS A;  1J95 A;  2FB5 A;  3IAY A;  1N34 B;  3CP1 A;  5IYB O;  4NTW A;  1JPX A;  4MTF A;  4PV1 B;  4EEQ A;  4YJ2 A;  2WA4 A;  3JAR B;  2E5L O;  3OM3 B;  1FAF A;  2VRZ A;  5LOV A;  4DR5 O;  4H44 B;  1YIJ V;  2A06 H;  4ASU G;  1E1Q G;  1BE3 H;  3JD1 A;  1WN7 A;  2IH3 C;  2QA4 V;  1Q5O A;  3QF7 A;  2YC0 A;  4J9Y B;  2WLM A;  4PD4 F;  1G1X B;  2Q9L A;  4WFH A;  4EB6 A;  1GRJ A;  2YIA A;  3BA8 A;  5KHK A;  2OTL V;  2VWK A;  5GON B;  4DYL A;  5IYC O;  1N0J A;  1N32 B;  2X6A A;  3CC4 V;  4FLZ A;  1IZ3 A;  2ADQ B;  4Q20 A;  3BY6 A;  4XDJ A;  4PEL A;  3ZMZ A;  2YEV B;  3LNN A;  3U0Z A;  2CK3 G;  4JAA A;  2F43 G;  4DV5 O;  4JAV A;  2CTW A;  2Q6A A;  1Y74 A;  4TV8 A;  2A7W A;  1K34 A;  5CA3 A;  4OPH A;  3AG3 B;  1YEW A;  5LP6 B;  1ZAU A;  2R70 A;  4I9Q A;  1OCZ B;  4NR1 A;  4JI2 B;  3GVM A;  3JAK B;  3B8N A;  4FJC C;  1HNW B;  1SQF A;  1JJO A;  1RPO A;  2Q7G A;  4LF5 O;  3CRR A;  3B77 A;  1XRE A;  4JZ2 A;  1RFY A;  1N0N A;  1BSM A;  1Z5W A;  3KZI Z;  5LXT A;  4JI8 O;  1Z5V A;  1DF5 A;  3ZHQ A;  1I94 O;  4QJF B;  1ENV A;  1H2N A;  3RYH B;  5EC1 C;  1GKF A;  4PDR A;  3E83 A;  4DUZ B;  1GN2 A;  3RW0 A;  3UM7 A;  3N27 A;  4B3M B;  1PPJ H;  3K9A A;  1FYJ A;  5E79 Z;  3D36 A;  1NKD A;  1FFT B;  2Q67 A;  4K0K O;  4U3J B;  2Q68 A;  4CH4 A;  4E4E A;  4DV7 B;  2F4V B;  4HNA A;  5KA5 A;  3M8A A;  1YF2 A;  1H2L A;  1XNQ O;  3AG3 C;  4DR7 O;  5LP6 C;  3KG2 A;  4UVC A;  5EBM C;  5GON A;  5LA6 B;  1OCZ C;  3ETQ A;  1SQV H;  2QR4 A;  4GKK B;  2DOS A;  1JJ2 U;  2RQ6 A;  5B1N A;  2OCC B;  2YEV A;  4JI6 O;  1PP9 H;  4K3A A;  2B1I A;  5H6Q A;  4B3R B;  1ZLZ A;  4PDM A;  4NTX A;  1MOF A;  4X62 O;  4MVR A;  2BTQ B;  2QKC A;  4HYO A;  2UUC B;  1MZF A;  2JVD A;  2ZIO A;  2QWN B;  3CRA A;  5KHG A;  4OGQ B;  1B6Q A;  3IC9 A;  3SYQ A;  4TUY B;  5LP6 A;  4Z1M G;  2VQF B;  4CBC A;  3E8B A;  4MTO A;  1EBO A;  2QWP B;  2HR3 A;  3JAK A;  3I55 V;  4UV9 A;  1KP3 A;  2JIZ G;  3K06 A;  2AW9 A;  4IHJ B;  5LL6 Y;  3SJB C;  1IX9 A;  1B3Q A;  4O2A B;  1JQ0 A;  2JJ1 G;  5FL7 G;  4BIO A;  3RWR D;  4B08 A;  3K04 A;  5L3F A;  4AQY O;  1SS3 A;  4MVM A;  3RYH A;  4LFB B;  4W4L A;  2VS0 A;  4NXM B;  4FLV A;  3ZIA G;  1R3L C;  1VAR A;  5LMU B;  1GTO A;  4LFC O;  2ARH A;  1EN6 A;  4OPA A;  3CWB H;  3J80 N;  2X6C A;  2ZNI A;  2ITC C;  4FLX A;  3CME V;  2ZKO A;  4YY3 O;  3SYP A;  3B40 A;  5EBW C;  5A2Q N;  2P6J A;  3HKC A;  3AG2 B;  3CD6 V;  2E76 B;  1I0H A;  2HFE C;  1LR1 A;  2WA3 A;  3O9O A;  3I56 V;  4DUY B;  1YHQ V;  3ETG A;  3EXA A;  4CH3 A;  2D3O W;  1N33 B;  4RUF A;  4LF8 B;  1US6 A;  1HNX O;  1W0J G;  2DQ3 A;  2N04 A;  2VWJ A;  1ARO P;  4ZIB A;  3W7W A;  5GTH Z;  4I4T A;  2IU3 A;  3GWK C;  3S3W A;  2AGA A;  2Y0P A;  4G27 B;  2P90 A;  4NTY A;  2ITD C;  5H6R A;  5KLV H;  4E2L A;  4NB5 A;  5CA1 B;  4QPJ A;  2PYJ A;  3LSQ A;  2ZE7 A;  3C3T A;  3K5L A;  1XMO O;  1Y6X A;  2GSM B;  2QTO A;  3O65 A;  4KFM A;  4PA6 A;  2K9P A;  2HG5 C;  1EN5 A;  3H9V A;  2O57 A;  1EFR G;  2KB1 A;  1F4N A;  2GTA A;  4IHJ A;  3K0D A;  1AP6 A;  1OCR B;  3AG2 C;  4O2A A;  1P49 A;  5CMU A;  4LBE C;  4JYB A;  2RN9 A;  3IJ4 A;  2DW4 A;  4O4L B;  5C93 A;  2QM4 A;  5EIB D;  2EJ7 A;  3OTO O;  2LW7 A;  5KX5 B;  4EFE A;  3GWO A;  4BW9 A;  3FX7 A;  5K1X A;  1K5Q A;  1HW7 A;  2B5U A;  3K3W A;  1N32 O;  1MZE A;  3AK3 A;  1B04 A;  4RQF A;  1WAZ A;  2P06 A;  4F6R B;  1HP8 A;  1SQB H;  1HR0 B;  4Q6G A;  2K1E A;  3OTF A;  4X1Y B;  3OAA G;  4F6E A;  4J9Z B;  2V7Q G;  3R65 A;  5DN6 G;  1YTF B;  3E8H A;  2ZD9 A;  1QBZ A;  4X64 B;  2UXB B;  2GTS A;  1DLB A;  3JD3 A;  3RYC A;  1VP7 A;  3E8G A;  4JI2 O;  4QIW F;  4YIO A;  4DR4 O;  1I7F A;  3AG1 B;  1WNS A;  2ZM6 O;  3N2G B;  3STZ C;  1VQK V;  1HNW O;  4K8X A;  2N74 A;  3VQY A;  1YIT V;  3JAT B;  5EK0 A;  2P4K A;  4BW5 A;  2W6I G;  2LQT A;  2Z5U A;  5CBF A;  1Q82 W;  1R6T A;  2FML A;  2P4V A;  2OT5 A;  4DV2 O;  4B3T O;  5C8Y B;  3LDE A;  1SC5 B;  1U97 A;  2EIK B;  5IDJ A;  1YCI A;  4B3M O;  1EZV H;  5LGU A;  3S3X A;  1O9H A;  3C90 A;  3OD4 A;  1NVP B;  3J7A U;  1DF4 A;  5JQG A;  3E89 A;  5KX5 A;  2PI5 A;  1AI6 A;  3JAW B;  2F4V O;  3CEI A;  3P32 A;  2E75 B;  5DED A;  2JJ2 G;  1AR5 A;  4N21 A;  2ZE6 A;  2YS8 A;  2NNU A;  1S0V A;  3WFV A;  1M90 W;  4J11 A;  2Z3Y A;  2MW2 B;  3JD4 A;  3SPC A;  2HJD A;  3ZN1 A;  4DV3 B;  2YDE A;  3TXQ A;  4LH7 A;  1VQN V;  4Z2W A;  5LYJ A;  2Y69 B;  4MVZ A;  4X1Y A;  5B3S B;  1J5E B;  4DW1 A;  4JV5 O;  2Y48 A;  5H2F Z;  3ZMT A;  1DTO A;  3LDC A;  2XTA A;  1NTM H;  4TQD A;  2YUA A;  2VQF O;  3T4D A;  3T1Y O;  3TJT A;  5FNV B;  1W59 A;  3Q4H A;  4NXN B;  1SQG A;  4WFG A;  3E86 A;  4J7J A;  1V55 B;  1BT8 A;  4CC6 A;  1KC8 W;  3N2G A;  3ETE A;  1WJZ A;  2ZXW B;  4MVQ A;  1Y76 B;  1VIB A;  1VQ4 V;  2EIM B;  5CBH A;  4LF7 B;  4MS2 A;  3AK1 A;  2R9I A;  3L75 H;  1Q43 A;  2GBO A;  4I7Z B;  2IU0 A;  2UXD B;  4I50 A;  4LFB O;  4NXM O;  4ICG A;  5D5P A;  2YI9 A;  1FFX B;  3HKB B;  3N2K B;  4I9W A;  3KKY A;  5CN0 A;  4UCT A;  5D5Q A;  2ZR2 A;  2Y69 C;  3KCY A;  1FKA O;  3CS5 A;  1N4C A;  4JAU A;  1G4Y B;  3QO8 A;  4JYA B;  1Q81 W;  5F2V O;  5E1A C;  4KP4 A;  2HLD G;  1HNZ B;  4ZHQ B;  2HJF C;  3CCR V;  3ABK B;  1IBM B;  3ABM B;  1FXV A;  1E79 G;  1EZJ A;  4IYH A;  4XBF A;  1V55 C;  4LF8 O;  2RJZ A;  2PF4 E;  4X9Q A;  2ZXW C;  1WPX A;  4MSW C;  2JDI G;  2HEP A;  3ZED A;  2UUA O;  2EIM C;  4FM0 A;  1MSD A;  3D3Q A;  3ML0 A;  4UB8 Z;  2IH1 C;  4GX0 A;  1GH6 A;  2NLJ C;  1JFF B;  5IY5 B;  4GKJ B;  2WLI A;  2R72 A;  5IJ0 B;  2MK3 A;  3TK1 A;  1FXK C;  5HFM A;  2X7R B;  4X89 A;  5IWA O;  4DXW A;  1QR9 A;  2F23 A;  5FNV A;  3UCS C;  1Z2G A;  3FB6 C;  4CZZ A;  5KMG B;  3H1K H;  4D7S A;  1IXB A;  4X20 A;  4QE7 A;  1BMF G;  1XOU A;  2C2A A;  2UXX A;  3D8C A;  3F5T A;  1TUE B;  5JVD A;  3ABK C;  3A0H Z;  3ABM C;  4MT8 A;  1Y66 A;  1DGS A;  1FXK A;  4JI3 B;  1NJI W;  4YHH O;  1VF7 A;  2QWQ B;  4JI5 B;  1FFX A;  1THZ A;  3N2K A;  3LSU A;  4QPK A;  1WA8 B;  1AI4 A;  4JTC B;  1MA1 A;  1XNR B;  2CTR A;  3U11 A;  3ZHU A;  4FM1 A;  1MSW D;  1LNQ A;  1ZX3 A;  3HKD B;  5IJ9 B;  5K1P A;  2UU9 B;  2LFR A;  4U3F H;  1R3I C;  1GM9 A;  1HR0 O;  4I55 A;  4X66 O;  2WLH A;  1KKD A;  1G8M A;  1Q6I A;  2F93 B;  2AHZ A;  1B06 A;  1T5E A;  1URF A;  2CGO A;  1RM1 B;  3RBZ A;  1BZK A;  2CH7 B;  3WB0 A;  3L70 H;  1K33 A;  1FPO A;  3ETD A;  4FLT A;  4IYI A;  1AP5 A;  2UXB O;  4TWK A;  3QTC A;  1Q6U A;  1XHX A;  3LUT B;  3ABU A;  2YXL A;  4B3S B;  2P67 A;  2JK5 C;  2WWW A;  3ZHT A;  5B66 Z;  1NH2 B;  1TAE A;  5IYD O;  2EIJ B;  5IJ0 A;  5EYP B;  1AB3 A;  4DRX B;  1PKX A;  4JF3 A;  2ZT9 B;  3CE2 A;  4MTX A;  4F4L A;  4J7Z A;  3RT3 C;  4WFE A;  4WFB V;  5KMG A;  4JI7 B;  2Q7H A;  1BQ0 A;  3QO5 A;  2RCV A;  1M9N A;  3JAR A;  3RVZ A;  4WF9 V;  4KL1 A;  2YXY A;  3ZHV A;  1QLN A;  4KHP B;  2Z0A A;  3VOU A;  2W0X A;  1LUV A;  3ZHS A;  1KB9 F;  1M5I A;  3CPW U;  5CB4 B;  4KUM A;  3B8M A;  1NTK H;  3BCC H;  1KYO F;  1YJN V;  4CH5 A;  1G6U A;  1D5N A;  5H5N A;  1KD1 W;  4UFZ A;  2OIE A;  3CXH F;  4AIL C;  1QLE B;  1WA8 A;  5EZY B;  1PNK A;  4DV4 B;  2KG7 B;  2QKS A;  4I0X B;  1Q3E A;  4TT3 G;  5IJ9 A;  2ODM A;  3HKD A;  1VQ8 V;  3X2Q B;  1UFI A;  2Q8V A;  1H2G A;  3F7Y C;  2XND G;  4MVO A;  4FFK A;  3G80 A;  5J2U B;  1ZL8 B;  2EIJ C;  3BHP A;  1R1B A;  1CXZ B;  2Q73 A;  3ASN B;  5IE9 A;  1TGO A;  3VQX A;  1JR9 A;  2R9A A;  1Q7Y W;  2EIN B;  4P30 A;  1IVS A;  4JI0 B;  1MNG A;  4JGS A;  1FJG O;  2AHY A;  2XUM A;  2CH7 A;  2DWD C;  1N36 B;  4IGG A;  5BMV B;  3OE7 G;  4LNU B;  3BRC A;  4ZOL B;  2OIG A;  1N8R W;  2LW1 A;  4GT1 A;  5BZB A;  4NXN O;  2GUZ B;  1H2S B;  2OYQ A;  3IFX A;  1CPY A;  3K79 A;  4BIU A;  4DRX A;  1IXM A;  4LF7 O;  3JCZ A;  2E3C A;  1GM8 A;  5LBQ A;  2Q0A A;  1YJW V;  4BAY A;  4BR6 A;  1QCE A;  1QVG U;  1D2D A;  1TVK B;  4OX9 B;  2KQX A;  3PJS K;  4UCR A;  2UXD O;  3X2Q C;  1K97 A;  1UJW B;  4PI0 A;  4DV0 B;  2OCC C;  4U7O A;  1GN6 A;  4DK1 A;  4K8Z A;  4U3J A;  1P7B A;  1I5X A;  4O4I B;  2VQE O;  1IBL O;  2EIN C;  4PA7 A;  3SYO A;  4DR6 B;  3OR7 C;  1SET A;  1YVW A;  4JYA O;  3K9S A;  4I5S A;  4PDL A;  2ZR3 A;  1F4M A;  4IT5 A;  3JAM N;  1HNZ O;  2KG7 A;  4I0X A;  5LA6 A;  1IBM O;  2YSU B;  5LMN B;  3T2M A;  1BHB A;  1H2M A;  3JAL B;  5BR8 O;  4JI4 B;  3G6E V;  2HHH B;  4LF4 B;  3A0R A;  5JJE B;  2EZO A;  3OUF A;  4G2K A;  2A9H A;  3G6B A;  2EZP A;  2BTQ A;  2BOB C;  2F66 C;  4GKJ O;  4UUJ C;  3W7U A;  2ZNJ A;  3BPZ A;  1VF5 B;  3ZMS A;  1W2B U;  4FLW A;  4TUY A;  1V9P A;  5BMV A;  3OFN G;  4LNU A;  1H8H G;  1K3E A;  2EBO A;  4P2Z A;  1N34 O;  1IBK B;  1IUR A;  4ZOL A;  5JCO C;  1RP3 B;  4RQE A;  1WPB A;  2GUZ A;  4D7T A;  1OCC B;  4NVP A;  3SPJ A;  1RSO B;  4RAI A;  3L71 H;  5EIB C;  4R6Z A;  4IIJ B;  4DV6 B;  2Y4T A;  3LNM B;  3R66 A;  4UCU A;  2EJR A;  5A9G A;  1TVK A;  3AG4 B;  1OHH G;  3QVN A;  2LGW A;  1SQP H;  5EBL C;  4JI3 O;  2E5L B;  4TV9 B;  2BTO A;  4JI5 O;  1BQZ A;  3HKE B;  5JCO A;  2HVK C;  1XI1 A;  2ZE8 A;  3L74 H;  4YJ3 B;  4TQF A;  1XMQ B;  3T4Z A;  4EFB A;  4O4I A;  3U10 A;  5IYZ B;  3BFR A;  2UU9 O;  1XBL A;  1I5Y A;  3MDS A;  2ZQM A;  1HDJ A;  1BGY H;  3KCX A;  2XAJ A;  4QGP A;  3BA9 A;  1NQT A;  2WLL B;  1M1K W;  3RYF B;  1QVF U;  1S5J A;  3JAL A;  3T1H B;  2F1M A;  4GCZ A;  3FYI B;  3ZRW B;  2M6Y A;  2BSK B;  2XAQ A;  1IDS A;  3CCS V;  1OCR C;  4UVB A;  2JEU A;  4X1K B;  1WB7 A;  2BE3 A;  4B3S O;  4WBN B;  1L0N H;  4DV5 B;  4RUE A;  1NT2 B;  3AG4 C;  3SPI A;  2L6L A;  5IT9 N;  2PGG A;  5CA1 A;  3FB5 C;  4OXS A;  4X1I B;  3OEH G;  1NI8 A;  1JA8 A;  4BWA A;  4FK5 C;  3H1H H;  2CDY A;  2JS3 A;  4RWU A;  1VEW A;  4YIP A;  4UCS A;  3WB1 A;  4BIZ A;  4JI7 O;  5KAI Z;  1KUQ A;  4JPR A;  5ITZ B;  4CS3 A;  1RSO A;  4PJ0 Z;  1GM7 A;  4HAM A;  2DYR B;  4DUZ O;  4KHP O;  1A32 A;  4LF5 B;  4IIJ A;  3FAV B;  5B1B B;  4Z1V A;  3M99 B;  5EC2 C;  2IJH A;  2QSA A;  1SF9 A;  4O4L A;  4JI8 B;  3M7M X;  2YID A;  1I94 B;  1K4C C;  1XL4 A;  4PI2 A;  3K0G A;  4J7K A;  3ZS8 C;  1XL6 A;  4DV7 O;  3H1J H;  1OV9 A;  2Y4U A;  3W7X A;  3F7V C;  4RO2 A;  3LSS A;  1PL4 A;  1NZ6 A;  2QM7 A;  5GTI Z;  4DV4 O;  4JAS A;  2PY5 A;  4H37 A;  1XQ8 A;  1MMM A;  3SYA A;  3AG1 C;  4GKK O;  4FVM A;  1KQS U;  3P3N A;  4W4K A;  2BOC C;  4O2B B;  4F6R A;  3FFQ A;  2WLL A;  4B3R O;  3ZMU A;  3RYI B;  1K7D A;  2FYU H;  4X65 B;  2JEX A;  1EM1 A;  2WSS G;  4DR3 B;  3F5W C;  3ZRW A;  3OEE G;  2UUC O;  4JYC A;  2DQ0 A;  1DK1 A;  3OW2 U;  1SRY A;  1N36 O;  1M56 B;  1NR7 A;  2EIK C;  1KBH A;  1ZTE A;  1QHT A;  2CTQ A;  1CEZ A;  2LJ2 A;  3NR7 A;  4WBN A;  3T1C A;  3HPL C;  4UV8 A;  3CSX A;  3IC7 A;  2RNB A;  2V4D A;  3APQ A;  3CXC U;  3JCU Z;  4UVA A;  4X62 B;  4LF6 B;  1YI2 V;  4GLX A;  2DE0 X;  3UO3 A;  1AR1 B;  3JAT A;  2YI8 A;  4LP8 A;  4X88 A;  1K8A W;  4A5U B;  2B1G A;  5FLX N;  4X8A A;  1EN4 A;  3SDL A;  5C8Y A;  2YIB A;  3FKS G;  2ZDI C;  4DO2 A;  2DWE C;  5LMU O;  1XUQ A;  1M93 A;  5LOV B;  4DV0 O;  5KUK A;  3VQW A;  1P4R A;  1SKV A;  4G28 B;  3GB7 C;  3H01 A;  3SPG A;  3SJA C;  4AQY B;  1D5A A;  5B3S C;  3DXR B;  2B9Z A;  3JAW A;  4DR6 O;  1Q86 W;  4EB6 B;  1SER A;  4LR3 A;  4R7C A;  2QWO B;  3P3P A;  4DUY O;  1M56 C;  2CUG A;  1LUW A;  3JD0 A;  3ZRX A;  3OMN B;  3SJC C;  4YY3 B;  2YXH A;  3FD9 A;  2ZDI A;  1XIL A;  1N33 O;  2G38 A;  3CC7 V;  1S5L Z;  4JI4 O;  2HHH O;  4LF4 O;  2QWR B;  4FLU A;  4GZR B;  2JRI A;  3J81 N;  3HR0 A;  3STL C;  2IW5 A;  1S3J A;  1AVM A;  5B1A B;  2QGN A;  1OJH A;  2X6B A;  4FM2 A;  1Y74 B;  2AZ2 A;  3TCU A;  3K57 A;  1SES A;  1PL0 A;  4PHZ A;  1U96 A;  1F7Y A;  2KSD A;  3EHB B;  1R73 A;  1SQX H;  4MW8 A;  4DK0 A;  1RPR A;  2QJ1 A;  1PM9 A;  2ILM A;  2L35 A;  4DV1 B;  4MTG A;  1Y76 A;  1MAB G;  4N23 A;  4JTA B;  2ZCE A;  2E74 B;  4DV6 O;  1XMO B;  1UPG A;  1GK9 A;  1GN3 A;  3G71 V;  2CAZ C;  2PUS A;  3E2E A;  5FPO A;  5LXT B;  3HB3 B;  2HKO A;  1W0K G;  3SGI A;  2WLK A;  4FFB B;  3AG7 A;  4JI1 B;  3K03 A;  4ZI7 B;  2DMX A;  1Y4M A; 
#chains in the Genus database with same CATH homology
 3ZMV A;  4JGS A;  3G4S V;  5B1B C;  2AHY A;  1OCO C;  2DW4 A;  2DWD C;  1JVM A;  5C93 A;  1VQP V;  2IJI A;  2H94 A;  3OE7 G;  1V54 C;  1BHA A;  3GWO A;  1AI7 A;  4R50 A;  5B1A C;  1K5Q A;  2WLI B;  3CMA V;  2IJJ A;  2B5U A;  3E8F A;  1N8R W;  3K3W A;  3DTU B;  4GT1 A;  5L3D A;  5BZB A;  5IY5 C;  1F23 A;  1S76 D;  5HFL A;  4U7N A;  4YXW G;  4FMT A;  3IFX A;  4TSF G;  1VQ5 V;  1CPY A;  3K79 A;  4BIU A;  1PNM A;  1IXM A;  5L3E A;  3E35 A;  4RQF A;  3JCZ A;  3ABL C;  5H9C A;  1GM8 A;  4MVU A;  5LBQ A;  1YJW V;  4BAY A;  1QVG U;  1QCE A;  4ZBM A;  4ZKI A;  3K08 A;  2K1E A;  3PJS K;  1KEC A;  3X2Q C;  1FS0 G;  2GHY A;  1K97 A;  3OAA G;  3SPH A;  1R6K A;  4J9Z B;  1UJW B;  1NVP D;  2LFS A;  2V7Q G;  4FIP C;  3R65 A;  2OCC C;  5DN6 G;  1YTF B;  4U7O A;  2DYS B;  3E8H A;  2UXN A;  2ZD9 A;  1QBZ A;  1FXK B;  2M7W A;  1DLB A;  3BEH A;  3JD3 A;  3CC2 V;  1VQ9 V;  3E8G A;  3W7T A;  1P7B A;  1I5X A;  4QIW F;  1PD3 A;  3CCM V;  2EIN C;  4PA7 A;  3OGC C;  3AG1 B;  3SYO A;  3W7S A;  3OR7 C;  2WLN A;  1SET A;  2PI4 A;  3DGE A;  4I5S A;  3CCJ V;  4P9P A;  3CYO A;  1ORQ C;  4PDL A;  2ZR3 A;  3STZ C;  1VQK V;  1CP9 A;  1F4M A;  3OUS A;  3CCV V;  4PA9 A;  3ZCC A;  4LCU C;  4QE9 A;  1YIT V;  1FXH A;  2YSU B;  1YSC A;  5EK0 A;  3ZRS A;  1VQM V;  2ATK C;  3T2M A;  1BHB A;  4BW5 A;  3JYC A;  2W6I G;  2Z5U A;  5CBF A;  1Q82 W;  1S77 D;  1QR8 A;  3G6E V;  3OMI B;  3A0R A;  2OT5 A;  5KA6 A;  1K5S A;  2H8P C;  2EZO A;  1JCH A;  3LDE A;  3OUF A;  2EIK B;  5IDJ A;  4G2K A;  2A9H A;  1BL8 A;  3WG7 B;  2EZP A;  1PNL A;  5LGU A;  1RM1 C;  2BOB C;  1MG1 A;  1NVP B;  4UUJ C;  3W7U A;  2FTK A;  1AJP A;  4WFF A;  3ZMS A;  1W2B U;  1ZWI C;  1DF4 A;  3OFN G;  4GX5 A;  3E89 A;  1H8H G;  2PI5 A;  1AI6 A;  1H38 A;  1K3E A;  4UXN A;  1OZ0 A;  2EBO A;  3P32 A;  4P2Z A;  5GW7 A;  2JJ2 G;  4RQE A;  4N21 A;  2DYS C;  5J9P C;  1OCC B;  3P30 A;  1J95 A;  2NNU A;  1S0V A;  4LC1 A;  3SPJ A;  3WFV A;  1VQ6 V;  1M90 W;  3CP1 A;  4RAI A;  5IYB O;  5LGN A;  4R6Z A;  4P9O A;  2Z3Y A;  1JPX A;  3ZRV A;  4MTF A;  3JD4 A;  3SPC A;  1JX9 A;  3LNM B;  3ZN1 A;  2EJR A;  3AG4 B;  1VQN V;  3OM3 B;  5L3B A;  4R8C A;  1OHH G;  4PA3 A;  2Y69 B;  4MVZ A;  5EBL C;  1S72 V;  1YIJ V;  3UKM A;  4ASU G;  5B3S B;  1E1Q G;  3MD0 A;  3JD1 A;  3MHS C;  2Y48 A;  2IH3 C;  3ZMT A;  2QA4 V;  1DTO A;  2HVK C;  4HZ3 A;  3FB8 C;  3LDC A;  4J9Y B;  2WLM A;  4WFH A;  3T4D A;  1NH2 D;  1K4D C;  3WG7 C;  3T4Z A;  3IGA C;  3LDD A;  4WFG A;  3E86 A;  1V55 B;  2IJK A;  2OTL V;  1I5Y A;  1QLE C;  2ZQM A;  2V1D A;  4JTD B;  1KC8 W;  5IYC O;  3ETE A;  2X6A A;  3CC4 V;  1M57 B;  2R9R B;  2ZXW B;  2XAJ A;  4MVQ A;  4GX2 A;  1NQT A;  2WLL B;  4Q20 A;  3BY6 A;  3EFF K;  1M1K W;  1VQ4 V;  2EIM B;  5CBH A;  4XDJ A;  4MS2 A;  2R9I A;  1QVF U;  2Q69 A;  4PEL A;  3ZMZ A;  2YEV B;  2CK3 G;  1SZT A;  2X0L A;  2F43 G;  4GCZ A;  1ROP A;  3FYI B;  2IU0 A;  3ZRW B;  2XAQ A;  2WLJ A;  4JAV A;  3CCS V;  1OCR C;  2Q6A A;  4UVB A;  3ASN C;  1NR1 A;  1K34 A;  3CCQ V;  2JEU A;  5CA3 A;  4L87 A;  4I9W A;  4RUE A;  3AG3 B;  3AG4 C;  5CN0 A;  3SPI A;  3FB5 C;  1OCZ B;  2ZR2 A;  1S5H C;  2Y69 C;  3ABT A;  4OXS A;  3SYC A;  3OEH G;  2WAM A;  4FK5 C;  3QNE A;  3B8N A;  4JAU A;  1G4Y B;  2OTJ V;  3QO8 A;  4FJC C;  1Q81 W;  3SJQ C;  1YJ9 V;  1RPO A;  5E1A C;  4KP4 A;  2HLD G;  4BIZ A;  4WCE V;  2HVJ C;  2HJF C;  3B77 A;  3CCR V;  3ABK B;  4JPR A;  3ABM B;  1R6N A;  1FXV A;  1E79 G;  1GM7 A;  1EZJ A;  2DYR B;  3NXS A;  4HAM A;  4XBF A;  4FPP A;  1V55 C;  1DF5 A;  1R3J C;  4QJF B;  1ENV A;  5B1B B;  1F51 A;  2EIL B;  5EC1 C;  1GKF A;  5LHI A;  1M57 C;  2ZXW C;  3M99 B;  4GX1 A;  4PDR A;  5EC2 C;  1VQL V;  1WPX A;  2IJH A;  4MSW C;  2JDI G;  1L1F A;  3E83 A;  1KP2 A;  3RW0 A;  3OMA B;  2EIM C;  3UM7 A;  1K4C C;  1XL4 A;  2P7T C;  1GO3 F;  3K0G A;  3K9A A;  3ML0 A;  3D36 A;  1XL6 A;  1NKD A;  2IH1 C;  4GX0 A;  2NLJ C;  4WFA V;  5IY5 B;  5L3G A;  1FFT B;  3W7X A;  2Q67 A;  3F7V C;  4RO2 A;  2WLI A;  3LSS A;  2QM7 A;  2MK3 A;  2Q68 A;  3ASO B;  3TK1 A;  1FXK C;  4JAS A;  1NBM G;  2A0L A;  5HFM A;  2X7R B;  4X89 A;  4H37 A;  3CCU V;  4DXW A;  5KA5 A;  1QR9 A;  5LGT A;  3AG3 C;  3FB6 C;  4CZZ A;  3SYA A;  3AG1 C;  3KG2 A;  1KQS U;  4UVC A;  5LHH A;  3JD2 A;  2BOC C;  5EBM C;  1OCZ C;  1HWY A;  3CCE V;  2WLL A;  3ZMU A;  5B1O A;  5LHG A;  4QE7 A;  1BMF G;  1JJ2 U;  1K7D A;  2QE7 G;  2C2A A;  2UXX A;  5B1N A;  2OCC B;  1AJQ A;  2YEV A;  2JEX A;  2W0F C;  2WSS G;  1TUE B;  3F5W C;  2B1I A;  3ABK C;  5H6Q A;  3ZRW A;  3OEE G;  4PA4 A;  3ABM C;  4JYC A;  4MT8 A;  2DQ0 A;  1Y66 A;  2XAS A;  1SRY A;  3OW2 U;  4PDV A;  1FXK A;  4PDM A;  1NJI W;  1M56 B;  1NR7 A;  2EIK C;  1H8E G;  1MOF A;  1CEZ A;  4MVR A;  3TET A;  4HYO A;  1THZ A;  5KUM A;  3ZN0 A;  4QPK A;  3T1C A;  2EIL C;  3HPL C;  1AI4 A;  4JTC B;  1B6Q A;  4UV8 A;  3SYQ A;  3FB7 C;  3IC7 A;  4Z1M G;  1MSW D;  4CBC A;  3E8B A;  3CXC U;  4UVA A;  4H33 A;  1LNQ A;  1YI2 V;  1AI5 A;  2XAF A;  4MTO A;  1EBO A;  2HR3 A;  3I55 V;  2LFR A;  1AR1 B;  4UV9 A;  5CBG A;  4LP8 A;  1KP3 A;  2QEX V;  2JIZ G;  3K06 A;  4X88 A;  1R3I C;  1GM9 A;  1K8A W;  1K9M W;  2B1G A;  3ASO C;  1OCC C;  4X8A A;  2W6J G;  2WLH A;  1KKD A;  1G8M A;  2AHZ A;  1JQ0 A;  3FKS G;  2JJ1 G;  2ZDI C;  3D3I A;  5FL7 G;  2DWE C;  3RVY A;  4DO2 A;  1RM1 B;  3RBZ A;  3K04 A;  4EKW A;  5L3F A;  4MVM A;  1COW G;  5L3C A;  1K33 A;  1AJN A;  3ETD A;  5KUK A;  1GMG A;  3ZIA G;  4QNH B;  1R3L C;  1P4R A;  4G28 B;  3GB7 C;  4TWK A;  3H01 A;  1GTO A;  3SPG A;  3LUT B;  3ABU A;  2P67 A;  5B3S C;  2JK5 C;  2X6C A;  2WWW A;  3OR6 C;  2ITC C;  3CME V;  4JYB A;  1NH2 B;  5IYD O;  4MVS A;  1Q86 W;  3SYP A;  2EIJ B;  2XOK G;  3VBB A;  5EBW C;  1SER A;  4R7C A;  2A79 B;  2P6J A;  3AG2 B;  1M56 C;  1PKX A;  4JF3 A;  3CD6 V;  3JD0 A;  3ZRX A;  2HFE C;  4MTX A;  4F4L A;  3OMN B;  1R3K C;  4WFE A;  2ZDI A;  4WFB V;  4MW3 A;  3I56 V;  3CC7 V;  1YHQ V;  3QO5 A;  1OCO B;  1M9N A;  3ETG A;  2WPD G;  3RVZ A;  4WF9 V;  2D3O W;  3STL C;  1V54 B;  2IW5 A;  1QLN A;  1S3J A;  3FYE B;  4RUF A;  1JOY A;  3VOU A;  1WLE A;  1W0J G;  2DQ3 A;  5B1A B;  1ARO P;  3W7W A;  2XAG A;  3QO7 A;  3CPW U;  2X6B A;  4KUM A;  2IU3 A;  1VQO V;  3B8M A;  3TCU A;  1YJN V;  4G27 B;  1SES A;  2P90 A;  1PL0 A;  2ITD C;  5H6R A;  1VQ7 V;  1KD1 W;  1E1R G;  4E2L A;  1K92 A;  3ABL B;  1QLE B;  1K73 W;  3EHB B;  1R73 A;  4QPJ A;  3LSQ A;  1PNK A;  4MW8 A;  2QM8 A;  4XDL A;  1RPR A;  3ZJZ A;  3CCL V;  2QKS A;  4TT3 G;  3AEI A;  2XAH A;  4XDK A;  2QTO A;  2GSM B;  4KFM A;  1VQ8 V;  4PA6 A;  3X2Q B;  4MTG A;  1MAB G;  1H2G A;  3F7Y C;  4JTA B;  4N23 A;  2HG5 C;  2XND G;  4MVO A;  1GK9 A;  1EFR G;  2EIJ C;  2KB1 A;  1F4N A;  3G71 V;  3K0D A;  3E2E A;  1OCR B;  3AG2 C;  3ASN B;  2LP7 A;  3MHH C;  3HB3 B;  2HKO A;  5DM6 V;  1YTF D;  1W0K G;  2DYR C;  1Q7Y W;  2WLK A;  2EIN B;  4P30 A;  5CMU A;  3K03 A;  4LBE C;  1Y4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...