3AEIA

Crystal structure of the prefoldin beta2 subunit from thermococcus strain ks-1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
94
structure length
94
Chain Sequence
MEAVRAYELQLELQQIRTLRQSLELKMKELEYAEGIITSLKSERRIYRAFSDLLVEITKDEAIEHIERSRLVYKREIEKLKKREKEIMEELSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prefoldin beta subunit 2
publication title Thermodynamic Characterization of the Interaction between Prefoldin and Group II Chaperonin
pubmed doi rcsb
source organism Thermococcus sp.
molecule tags Chaperone
total genus 37
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01920 Prefoldin_2 Prefoldin subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.370 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3aeiA00
2ZDIC 3AEIA 2ZDIA 1FXKC 2ZQMA 1FXKB 1FXKA
chains in the Genus database with same CATH superfamily
2M7WA 4H0LB 1YXBA 3ML0A 5LHIA 2PYLA 1IBMB 2JRIA 4E2LA 4UCOA 4Q6GA 1F23A 2P5OA 1ROPA 4X88A 3OT7A 4O4IA 3TK1A 4U3JB 4LF7B 5LMNB 2PGGA 3F5TA 2P22C 3H9VA 3P3NA 2ZM6B 2QSAA 1VEWA 1SQBH 2WWWA 2LFRA 1GTOA 2FYUH 1S5LZ 2VQEO 4Q20A 1N36B 1OCCB 2R9IA 2KB1A 2IH1C 3BAAA 2F93B 3M8AA 1NS1A 5E1AC 3GWOA 2Q8VA 4JI5O 4TSFG 2VQFO 1VQMV 2QKSA 1AI7A 4MVOA 1A32A 1IBLO 1HNWB 4IGGA 3D36A 4DXWA 4R8CA 2BOCC 3QF7A 5KX5B 3LDDA 4UFZA 4L8JA 1GN3A 3BCCH 3RVZA 2N04A 1X59A 2IJJA 3CPWU 1PNKA 1FXKB 5LBQA 4NYKA 4KUMA 3ZN0A 5JWPA 2CH7A 4P2ZA 4B3TO 2Q7EA 4CC6A 4DK0A 1U97A 5LYJB 1FAFA 1E1QG 4EEQA 4F6RB 1FPOA 1XUQA 4B3SO 2ZNJA 3AG4B 3B40A 4UVCA 1YIJV 4F4LA 2PYJA 3RGBA 1S76D 3ZRWB 2X6BA 2IW5A 4X64O 1BHBA 2OCCC 3FFQA 3UKMA 4GX1A 1KD1W 4J41A 5L3BA 2JIZG 4CS4A 1OCCC 1BGYH 4DRXB 1HP8A 4FFBA 2EILC 2UXDO 2YIAA 4AI8A 4LFCB 3K3WA 3ZMUA 1BZKA 4O4LA 4IYIA 2ZR3A 4JAVA 3QO5A 2B9ZA 1B6QA 1K97A 3FB8C 5IJ9A 2YXYA 1AR4A 1VQOV 4BW9A 2LGQA 2OTLV 2XT9A 3CD6V 1NJIW 1M57C 5GTHZ 1XQ8A 4UCVA 1H2NA 2UUCB 3OM3B 1NQTA 2GV9A 2NNUA 1M90W 4BIZA 2Q69A 2WA4A 2VWJA 3L72H 3CYOA 2CDYA 2ZDIA 3ZX6A 1GO3F 1X4TA 2R9RB 5LL6Y 2HEPA 4MVZA 4UVAA 1IBMO 2HVKC 5JCOA 3CCMV 4CH4A 1SC5B 1L0NH 5IYBO 2WLKA 3Q4HB 3SDLA 4LF7O 5A2QN 5LMNO 3JASB 1FJGB 2ZM6O 2WLLA 3WB0A 1B3QA 5BZBA 1K4CC 3QTCA 2EIJC 2CGOA 2GBOA 1N36O 2DYRB 2ARHA 5EK0A 3KKYA 1RPRA 1VQ5V 3L71H 1KP2A 2QWQB 5KLVH 1EN6A 3APOA 2JGUA 5FLXN 3W7SA 1AJPA 1AI6A 2F95B 4X8AA 2P90A 3OD4A 1ENVA 1MNGA 1HNWO 1H2SB 3DTUB 2OIGA 1QQCA 1CP9A 1EFRG 2EIKB 2ZE7A 4JI3B 3CRAA 4IHJB 5CA0A 3P30A 4K0KB 2JJ1G 5J2TA 3IGAC 4DV4B 3APQA 2EX3A 4QE9A 4JZGA 2HP8A 5LHHA 2OIEA 2YICA 1I5YA 3N2GA 3RT3C 4X9QA 1FYJA 2KG7B 5D5QA 2IH3C 1L8DA 2X7RB 2X0LA 2A7WA 3ABLB 4YJ3B 4BR6A 1PL4A 3IC7A 3B8MA 1UJWB 1VQPV 4J10A 3JATA 4H33A 4DR1B 3T1YO 4PV1B 1YEWA 2WLJA 2PY5A 2IJIA 4GX2A 4H44B 2LW1A 4LWSA 4E4EA 2Y69B 3AG2C 4J7ZA 3CB2A 4QJFB 4BIUA 4KHPO 2GHYA 4I55A 3SJBC 1FFXB 1NI8A 3CC7V 4GUNA 1XEQA 1YHQV 4ZI7B 2FB5A 4PI0A 2XAJA 4X20A 3JAKB 2UU9B 3SGIA 1N8RW 3G71V 4LFCO 1KECA 2D3OW 5LXTA 4RAIA 5LP6B 2OT5A 2CTRA 4GX0A 2P7TC 1SERA 1OCRB 1SF9A 3A0RA 4MVUA 4J7KA 1WP7A 4HYOA 4YJ2A 3SYQA 4GCZA 3TXQA 4AILC 4ABMA 2ITDC 3ASNB 3ZRXA 1JJOA 3IC9A 1YDXA 3K9AA 3ZMZA 2UUCO 2IU3A 3QO7A 1FFTB 1WAZA 5LA6B 4UCSA 2EIMC 3OFNG 5CB4B 1R3KC 4JYYA 4PA4A 3E22A 3AG7A 4DV3B 2KKWA 3TCUA 2ZNIA 3VOUA 4HNAB 2PF4E 1QHTA 2UXXA 5JJNB 4O2BA 4TV8B 4WFGA 1BHAA 3OMAB 1FJGO 5CN0A 4I50A 2F1MA 1Q8IA 1V55B 1D5AA 1S5HC 3D8CA 5JQGA 3RYCA 3SPGA 3L74H 2JGDB 3ABUA 3W7UA 1XNRB 3G80A 3NR7A 1G8MA 1LUVA 5IYZB 4PHZA 1DLBA 1QLEB 3KZIZ 4JI3O 2V7QG 2CUGA 1NTZH 3ZCCA 2ITCC 3DXRB 3E89A 4DR7O 2HVJC 4K0KO 2NLJC 4DV4O 4J9YB 3HKBB 2DQ3A 3BY6A 3AK1A 3OAAG 3HKEB 4MTXA 1PL0A 3JSNA 3JD0A 5IY5B 1WPBA 2P4VA 3RYFB 2OWOA 4MTGA 1ZL8A 3T4ZA 4DR1O 3I56V 1IBLB 3OTFA 2D2CB 1WPXA 5CBGA 5JH7A 5KAIZ 1HR0B 1XHXA 4Z1MG 5EYPB 3ETQA 1Y76A 4CZZA 3MHSC 2WSSG 5CBFA 3CCEV 2OCHA 2GUZA 3GWKC 3L73H 1IURA 5K1XA 2YDEA 2ZINA 4EFBA 5IWAB 4CH3A 2JDIG 3K5LA 2GSMB 1T5EA 2IJKA 2UU9O 3ZHRA 2X6AA 1OV9A 4FLUA 2E76B 1BS3A 3DSQA 4P9OA 2A06H 4IT5A 4XBFA 3VQYA 1BE3H 4R6ZA 2B1IA 3M7MX 5FNVA 4WFEA 3HKCB 2WLHA 4JI8B 3UO3A 5KHGA 4GKKO 3D36C 4D6TH 2UXNA 4FIPC 1AR1B 3CMEV 4FLYA 3K0DA 3RYIA 1Q6UA 2RCVA 2EINB 1M4UA 2P67A 1WLEA 3EXAA 2R9AA 2NR5A 4NTXA 4ZHQA 2A9HA 1K73W 2Y48A 4DV3O 4JF3A 1HNZB 1H2GA 3E8HA 4NTYA 2Y4TA 2CK3G 3IJ4A 4KL1A 2YSUB 4I4TB 1K4DC 4I9WA 5BR8B 3JCUZ 4EB6B 3ZJZA 4XDKA 3LSUA 1V54C 5D5PA 5KHKA 3JALA 4LF6B 2F43G 3JYCA 3ZMTA 2ZQMA 2Q7HA 3CXHF 3OGIB 1B04A 1XNRO 2H3OA 4TWKA 4X1IA 4FLVA 1YZBA 1GKFA 2A0LA 1TVKA 1VQ6V 1WA8B 1I7FA 4DR2B 5KMGA 4QPJA 1SQGA 2EJRA 4U3FH 1XI1A 5EZYA 2QTSA 1VQ7V 2QA4V 1VMGA 3A2FA 3J81N 4MVQA 1AI5A 2EINC 4LCUC 3C90A 3J7AU 4C7UA 3E2EA 1IX9A 2OCCB 2QM4A 2CTQA 2ATKC 1F51A 2NN4A 5LGUA 4FLWA 1KUQA 1J95A 1K5SA 3K9SA 3SPCA 3RYHA 5BMVA 5CA0B 4DV7B 4BWAA 4WBNA 1EN4A 2EILB 1RPOA 4MT8A 3FAVA 1LNQA 2ZDIC 4R50A 3CCQV 3VQWA 1YI2V 1VF6A 3SPHA 1QVFU 3N2GB 4X1KB 2A79B 2W6IG 3CRRA 2R72A 5JCOC 3RBZA 4YIOA 1HR0O 3B77A 2VWKA 3BVOA 4GYCB 5B1OA 4CH6A 2WAMA 1V9PA 3CCVV 5KHIA 1GN2A 1TUEB 5IWAO 3OUFA 1M57B 3JAWB 5LOVB 4LWSB 4OX9B 5ITZB 3FYIB 2W0XA 2OYQA 4FK5C 4KP4A 5IE9A 1PM9A 1IVSA 2H94A 3RFRA 1Q90D 2ZCEA 3STLC 1Q3EA 1RP3B 3T1YB 5GONB 1FKAO 4ZIBA 3H1JH 4LF5B 4JI8O 2KSDA 2EBOA 4GX5A 2CTPA 4ICGA 1I5XA 5IDJA 4TT3G 4RO2A 1EN5A 4FZ0A 2AHZA 2DYSC 4KHPB 3G4SV 1NH2D 1YTFD 2ZR2A 3ZMVA 3W7TA 3CC4V 2Q7GA 1JFFA 1OCZC 1P4RA 4UB8Z 1XBLA 4DR5B 4JI1B 1H2MA 1Z5WA 2YIBD 2VRZA 1GN4A 1VQNV 5EIBC 1K8AW 1AP6A 4JI7B 4I7ZB 2EIJB 1HNZO 1SS3A 1AROP 4DUZB 3E8FA 4DO2A 1Y6XA 4DK1A 1P84F 3CCRV 1KYOF 3F5WC 4B7KA 1I0HA 1G6UA 3H1HH 1L1FA 5BR8O 3CS5A 3N27A 4I0XA 1EZVH 2VS0A 2YEVA 1DF4A 1ZTEA 2LJ2A 3JARA 1H8EG 2UXBB 2CTWA 2HLDG 4LF6O 1RSOB 4JTCB 2B1GA 4TUYB 2Y4UA 1BL8A 4FLTA 4QE7A 4UUJC 1R3LC 5C93A 2BTQB 3A0HZ 3OR7C 1Q81W 1F7YA 4NXMB 5J2UA 4MTFA 4DR2O 3H1IH 4TV9A 2JJ2G 5B5EZ 5LHGA 4O4JB 3OMIB 3N2KA 1FXHA 2PI4A 3ETDA 5DM6V 4NXNB 2ZKOA 1Y74B 4LBEC 4J42A 1QCEA 1B06A 3T1CA 3SYPA 2QGNA 4BIOA 5EBLC 4FM2A 1XL4A 1JMKC 4LH6A 3K5NA 3G6EV 1GH6A 4O4HA 1QR9A 3AG2B 2WLIA 1NVPD 2JS3A 4LNUA 4DV7O 3VBBA 2QDOA 1M5IA 4JI6B 2V1DA 1OCOC 2BSKA 2QM8A 1I94B 1Q5OA 1K34A 2Q0AA 2L6LA 2W6JG 1JOYA 2QKCA 5CA1B 1AB3A 3PN1A 5GTIZ 5C8YB 1ZX3A 4DV2B 4U3JA 2DW4A 3ABTA 4DR7B 1P49A 3SJQC 5EBWC 2XOKG 3ABKC 2Y0PA 3WFVA 1GM8A 2Z5UA 2Y0IA 2IJHA 4WFHA 1HNXB 4OX9O 1Y76B 2F66C 4AQYB 4ZKIA 2ZE6A 1N0NA 1SA0B 2EIMB 1NH2B 2BCCH 1K5QA 1YTFB 2Q0OC 1M56B 2XAGA 3O65A 1HWYA 1PD3A 1HDJA 2CAZC 3HB3B 1SQVH 3U10A 3HKDB 4LF5O 1M1KW 5BXZA 1G4YB 4NB5A 1XREA 4DW1A 4PDMA 5KX5A 4WFAV 2Q4PA 3SYCA 2P06A 1TGOA 2DWDC 2RN9A 2Q73A 2LGWA 1COWG 4Z2WA 1PNLA 1TUBA 2M6YA 3ABMC 5DEDA 4J9ZB 1NTKH 1FXKA 4CS2A 4ZOLB 5H6RA 4N23A 3J80N 4DR5O 4JI1O 1EZJA 2V4DA 5LYJA 4RWUA 4JI7O 4F6RA 1ZSPA 1DTOA 1N32B 4PJ0Z 4DUZO 1YJWV 2ZXWC 3ZRWA 2QKAA 1YVWA 1OJHA 4FZ1A 4GKKB 3SJCC 3K0GA 1H38A 1AJQA 3A8TA 3GB7C 4GLXA 4DR3O 2UXBO 3UT5B 4DRXA 4DW0A 5B1BC 3I5DA 4IIJB 1MZEA 3UM7A 5B66Z 2HR3A 3DC5A 1O9HA 3CXCU 1M56C 4D7TA 1YJNV 1Q86W 2YI9A 1XNQB 4UXNA 3MDSA 3K59A 1E1RG 4NXMO 3CWBH 4O2AB 1N0JA 2BTOA 2P4KA 3P32A 4NR1A 1AR5A 3X2QC 1VQLV 4H37A 3ASOB 1KKCA 2E3CA 4NXNO 1AI4A 5KMGB 2WA3A 4CC5A 1R6TA 2AZ0A 4F6EA 4MVSA 1GM7A 2YI8A 2PTMA 4CS3A 4FM0A 3OEEG 5DECA 4O4IB 1PNMA 3K04A 3FB7C 4W4KA 4DUYB 3BFRA 3LUTB 3CCSV 4JI6O 1KU9A 3SR2C 1I94O 2UXCB 4EKWA 5K1PA 3T2MA 4P30A 4Z1VA 3CEIA 4JYCA 1QBZA 1CPYA 1H2LA 1AP5A 5FPOA 1FD9A 5JVDA 3BRCA 3C3SA 3Q4HA 4DV2O 2W0FC 2ZIOA 3JASA 3VQXA 4LC1A 1MABG 1SQFA 4YIPA 1W0KG 1D2DA 1URFA 1Q6IA 1S3JA 4HAMA 3K06A 4U7OA 1WB7A 1R1BA 3ETEA 1HNXO 4K35A 2HHHB 3ASOC 4AQYO 4LP8A 1KB9F 2ZE5A 3A0BZ 3ZBHA 3H1LH 3L75H 2CH7B 4LF8B 4JPRA 3SJAC 4D7SA 2FMLA 3WB1A 2ZIMA 2XNDG 3ZRSA 2FTKA 3CCLV 1SQQH 4IHJA 2QWNB 3RVYA 2RMKB 1VIBA 1GK9A 4HZ3A 2JEXA 5LGNA 1LUWA 1ORQC 5EIBD 4G2KA 3JCZA 3ZN1A 2KG7A 1V54B 2DOSA 3CX5F 3L9DA 5J9PC 1KQSU 4FFBB 1N32O 4LFAB 4I5SA 3CRCA 1D5NA 5E79Z 2JVDA 4OGQB 1VF6C 3HPLC 2PUSA 5H5NA 3STZC 3CP1A 4ASUG 3OUSA 4DV5B 4GKJB 4DV1B 4O4LB 3ICXA 3W7WA 2XAFA 5FPRA 2QM7A 3JSLA 4B7EA 3AG3C 1TA8A 5IJ9B 3K57A 1QVGU 3AG1C 4ZI7A 1MZFA 1BQ0A 1XNQO 2UUBB 2F23A 2Z0AA 3JAKA 1UFIA 5LGTA 3KCXA 4LFBB 5H2FZ 5IJ0A 4OXSA 1Q43A 3R65A 3CC2V 5LP6A 5F2VO 1H8HG 2FKXA 2E75B 3S3WA 2MK3A 3E8GA 4N21A 3WG7C 3BA8A 1PKXA 1XHZA 1SQPH 3FX7A 1U96A 5B1AC 1YJ9V 4LR3A 1MOFA 1R6NA 1NBMG 4PDRA 4FLXA 2OTJV 3LSQA 3NXSA 4OPHA 1M9NA 2L35A 3FKSG 3CMAV 4KFMA 5LA6A 3AEIA 1SQXH 1O9GA 2RDCA 5CB4A 4DUYO 2E74B 3U11A 2WLLB 2YIDA 2Z3YA 2ZE8A 1MMMA 2UXCO 3TETA 2QTOA 4TQDA 1R6KA 4HNAA 5LMUB 5JJEB 1JJ2U 4PDVA 1XMOB 4A5UB 3OGCC 2JS5A 4TV8A 1GMGA 2QWOB 4X66B 4MW3A 5B1NA 1Y67A 2EULA 4RQFA 4X1YA 4B3RB 2E5LB 4DV0O 2RJZA 1MA1A 2GTSA 1THZA 4GT1A 5L3EA 2JGDA 2RQ6A 2DYSB 1M93A 4R7CA 2HHHO 5KHHA 1E79G 3QO8A 2JK5C 2EZOA 1AJNA 1S5JA 5J2TB 3T4DA 3E86A 3ZHUA 1IZ3A 5CMUA 1OCZB 3AK2A 2AZ2A 2QWRB 4FJCC 4LF8O 3SYAA 1BCCH 3ETGA 1TAEA 1VF7A 2HFEC 5IYZA 1NR1A 1IBKB 4NVPA 1SETA 4X62B 4MSWC 1JA8A 3JAMN 3DXRA 3JATB 4PELA 3U0ZA 5IYDO 3H01A 4FFKA 2ZD9A 2YUAA 3HKBA 4L87A 4JASA 4X89A 1IXBA 3UCSC 3L70H 4JTAB 3HKEA 4P9PA 1EBOA 2CE4A 1JVMA 3FB5C 4J80A 3OTOB 2ADPA 1KKDA 3ZHVA 2CGNA 4I55B 5IYCO 1TUBB 4X65B 4MVMA 4LFAO 3RYFA 4CBCA 1NZ6A 3QVNA 4FMTA 3SPIA 4DR4B 1K3EA 1WB8A 4X20B 3CJHA 4DV5O 4GKJO 4DV1O 4U7NA 2WLMA 4JI4B 1UPGA 5LXTB 1VQ4V 5EYPA 1MSWD 4IYHA 4UCUA 1L0LH 1N4CA 2B5UA 3GVMA 3AK3A 3LNMB 2ADQB 2F4VO 2QR4A 3B4SA 4PA6A 5L3DA 5L3CA 1N34B 3M99B 5A9GA 4FM1A 1GRJA 4XDJA 3T1HB 4YJ2B 1BSMA 3SYOA 2H8PC 2XTAA 5CA3A 2UUBO 1KP3A 4K8ZA 4FLZA 1I08A 1JX9A 4LFBO 1W59A 4JTDB 5CBHA 4FVMA 4UV8A 2YXLA 2WLNA 3TJTA 3HKCA 1BQZA 3BA9A 1OCOB 3UQ8A 3JD4A 1NTMH 1VF5B 1KC8W 3WB2A 3E22B 1QU7A 3B09A 3OR6C 1Z2GA 4JAAA 4DR3B 1R3JC 4BW5A 1VARA 1YF2A 4G28B 4MVRA 1WN7A 4J7JA 2ILMA 1J5EB 4O2BB 4W4LA 1XDCA 1FXKC 3DGEA 4JV5B 2HJFC 5TISZ 1DGSA 4I50B 2K9PA 3ABKB 4MTOA 1PP9H 1OHHG 1QLNA 4JYAB 4QIWF 4WFBV 5JQGB 3RYCB 4DR6B 1QR8A 1YITV 5LMUO 3AG4C 3OEHG 1GN6A 3EHBB 2IM9A 3CCUV 4I4TA 1H2KA 1XMOO 3FD9A 2LO1A 4JGSA 4X66O 2LFSA 2LQTA 3MD0A 4EB6A 2QWPB 4B3RO 2E5LO 4K3AA 1KBHA 2A3QA 4HBNA 5JVDB 4YY3B 1W2BU 4NTWA 2MW2B 2FL4A 3ABMB 5IT9N 2AHYA 5L3GA 3K79A 1WA8A 2YC0A 1CEZA 2DMXA 4QGPA 1R73A 1SKVA 4MW8A 4JZ2A 3ZRVA 3LNNA 3D3IA 2XAHA 2PI5A 1ZWIC 1IBKO 4X62O 4PDLA 2ZXWB 5EC1C 1ZL8B 3E8BA 1K33A 5JH7B 2IBZH 3B8NA 4OPAA 4NKGB 4RUFA 4DV6B 4DYLA 2Q9LA 4TOIA 3CCJV 1OZ0A 3OTOO 2DN9A 4PD4F 5B1BB 5HFLA 1F4MA 2GUZB 2QJ1A 3RW0A 4X65O 3R66A 1WNSA 3EVKA 4UB6Z 4X1KA 4DR4O 4J11A 4LF4B 3BHPA 4JI4O 2Q5ZA 3JD2A 3X2QB 1NT2B 2AXTZ 3CE2A 5FNVB 3CRQA 3P3PA 1QNMA 3W7XA 1N34O 2DQ0A 4K8XA 3K5MA 3T1HO 2Q68A 1BT8A 5EBMC 5BY1A 4WCEV 3JAWA 5LOVA 1JR9A 4UCRA 2DYRC 5ITZA 3K58A 4UVBA 1P7BA 3RYIB 1JPXA 2IU0A 1S72V 3IAYA 1IDSA 1YSCA 3G6BA 3SPJA 4CH5A 4WFFA 5GONA 1K92A 2N74A 3DC6A 3S3XA 5B3SB 4RQEA 4ZHQB 2XAQA 1XMQB 2LW7A 4JI2B 3HR0A 4UV9A 4RUEA 5IJ0B 1RFYA 2EIKC 4BAYA 1N33B 2UUAB 5H9CA 4ZBMA 2EZPA 2Q67A 3OW2U 2QE7G 1XL6A 2ODMA 1J5EO 2BE3A 1AVMA 1W0JG 4JV5O 4WF9V 4I9QA 5KUMA 1Y66A 2BOBC 2X6CA 1MG1A 3ABLC 3H1KH 3JALB 3G67A 4JYAO 4DR6O 1S0VA 2C2AA 1BMFG 3TXSA 1NVPB 4JI0B 3KCYA 2ETNA 4X1IB 2Q6AA 4KXRA 4IL6Z 1TVKB 5FL7G 5HFMA 2ZT9B 2EJ7A 1DF5A 2HKOA 5L3FA 4XDLA 4LF9B 2Y69C 4PA9A 5EZYB 5KA6A 2XASA 1LR1A 1RSOA 1IXMA 4TUYA 4H13B 4YY3O 4LH7A 4G27B 4B3MB 3ZHQA 2BTQA 1WP8A 2G38A 1ZUQA 5B3SC 4X1YB 3CSXA 1RM1B 1DK1A 1Q7YW 3PJSK 1K9MW 2AGAA 4O4JA 4PI2A 3ZHSA 3OE7G 1US6A 5LP6C 2XHBA 3RYHB 3JD3A 5BMVB 1K7DA 1OCRC 4WBNB 1Y74A 4YHHB 3FAVB 2AW9A 1S77D 1SZXA 4JAUA 3QNEA 2GTAA 3ASNC 1HW7A 1JCHA 4DV0B 3FB6C 4DV6O 3UO2A 3EFFK 2R70A 1SESA 3AG3B 3MAQA 3AG1B 1GM9A 3LSSA 3QG5A 1Q82W 5KAFZ 2LP7A 4EFEA 5AG2A 2VQEB 1XOUA 3C3TA 2DE0X 5CA1A 3JD1A 3F7YC 4LF4O 2RNBA 2YXHA 5C8YA 1VQKV 5GW7A 1P7GA 4JI5B 2VQFB 1ZAUA 3THOA 3LDCA 1GAXA 2YS8A 3CRMA 4B08A 1Y4MA 3WG7B 2QEXV 1VQ9V 2HJDA 5B1AB 1V55C 1RM1C 4PA7A 3CHXA 3CJHB 2K1EA 3ZS8C 3WU2Z 4FPPA 3LDEA 4YJ3A 1FXVA 1SA0A 5EC2C 3E35A 2JEUA 3TGUH 1NU1H 1JFFB 5KUKA 3OMNB 4B3TB 1Q6HA 3HKDA 3MHHC 4QNHB 1XMQO 2P6JA 2YIBA 5JJJB 4JI2O 2O57A 1QLEC 1ZLZA 4B3SB 4UCTA 1KMIZ 2PZSA 4PA3A 1N33O 2F4VB 2UUAO 1VQ8V 1FFXA 4X64B 1CXZB 4QPKA 4JYBA 4ZOLA 3ZEDA 4I0XB 2GDSA 3BPZA 3KG2A 1PV0A 3K5OA 2YEVB 4YXWG 3JARB 2XUMA 5H6QA 1PPJH 2WPDG 5IY5C 2N05A 2HG5C 3ZIAG 4AHCA 3BABA 1R3IC 4JI0O 4TQFA 1WJZA 1F4NA 2DJVA 2UXDB 3IFXA 3B2EE 5J2UB 1FS0G 3BEHA 1JQ0A 3VQVA 2DWEC 4TV9B 5KHJA 1NKDA 3N2KB 1EM1A 4LF9O 3UT5A 3E83A 5DN6G 4IIJA 5KA5A 3RWRD 3ZMSA 4GZRB 3RN4A 1NR7A 3D3QA 4B3MO 2KQXA 3O9OA 3ZHTA 3I55V 3FYEB 1MSDA 3K03A 4O2AA 1G1XB 4O4HB 1XILA 1SRYA 3F7VC 1VP7A 1Z5VA 2WLIB 3K08A 1AILA 4LNUB 1YCIA 1SZTA 4YHHO 2BSKB 4MS2A
chains in the Genus database with same CATH topology
2M7WA 5H6RA 4G28B 4N23A 1PL0A 3ML0A 4MVRA 3JD0A 1EZJA 5IY5B 5LHIA 4E2LA 1FXKC 1F23A 4MTGA 3DGEA 1ROPA 3T4ZA 2HJFC 4X88A 3I56V 3TK1A 3ABKB 1DTOA 1WPXA 5CBGA 4MTOA 1YJWV 1OHHG 2ZXWC 1QLNA 3ZRWA 4QIWF 4WFBV 4Z1MG 1QR8A 1YITV 4CZZA 3AG4C 3OEHG 2WWWA 3MHSC 2LFRA 2WSSG 5CBFA 3EHBB 1GTOA 3K0GA 3CCEV 3CCUV 1H38A 1AJQA 3GB7C 4Q20A 1OCCB 4JGSA 2R9IA 2KB1A 2IH1C 2LFSA 2JDIG 5B1BC 2GSMB 3UM7A 3MD0A 5E1AC 2HR3A 2IJKA 3GWOA 4TSFG 3CXCU 1M56C 1VQMV 2X6AA 1YJNV 1Q86W 2QKSA 1AI7A 4MVOA 4UXNA 4P9OA 4XBFA 1E1RG 4R6ZA 2B1IA 3D36A 4DXWA 1W2BU 4R8CA 2BOCC 4WFEA 3ABMB 2WLHA 2AHYA 3LDDA 5L3GA 3P32A 3X2QC 1VQLV 3K79A 4H37A 3ASOB 3RVZA 1CEZA 1R73A 4MW8A 2IJJA 3ZRVA 2UXNA 3CPWU 4FIPC 3D3IA 1AR1B 3CMEV 2XAHA 1PNKA 1FXKB 5LBQA 3K0DA 2PI5A 4KUMA 3ZN0A 4P2ZA 1AI4A 1ZWIC 4PDLA 1E1QG 2EINB 2ZXWB 2P67A 5EC1C 4MVSA 1GM7A 1WLEA 3E8BA 1K33A 3OEEG 1PNMA 3AG4B 3K04A 4UVCA 1YIJV 3FB7C 2A9HA 4F4LA 3B8NA 1K73W 2Y48A 4JF3A 3ZRWB 1S76D 4RUFA 2X6BA 2IW5A 3LUTB 3CCSV 1BHBA 1H2GA 3CCJV 2OCCC 3E8HA 3UKMA 1OZ0A 4GX1A 2CK3G 1KD1W 4EKWA 5B1BB 5HFLA 3T2MA 2YSUB 1F4MA 1K4DC 5L3BA 4P30A 2JIZG 3RW0A 1OCCC 4JYCA 1QBZA 4I9WA 1CPYA 2W0FC 2EILC 3ZJZA 4XDKA 1V54C 4LC1A 1MABG 1W0KG 2F43G 3JYCA 3JD2A 3ZMTA 2ZQMA 3X2QB 1S3JA 4HAMA 3K06A 3K3WA 4U7OA 3ZMUA 4TWKA 3W7XA 2DQ0A 1GKFA 3ETEA 2A0LA 2ZR3A 1VQ6V 2Q68A 3ASOC 5EBMC 4JAVA 4WCEV 3QO5A 4LP8A 4QPJA 1B6QA 2EJRA 1K97A 3FB8C 2DYRC 1VQOV 4UVBA 1P7BA 1VQ7V 2OTLV 2QA4V 4JPRA 3CD6V 1NJIW 1M57C 4MVQA 1AI5A 2EINC 1JPXA 2XNDG 4LCUC 3ZRSA 2IU0A 2FTKA 1S72V 3OM3B 3E2EA 1NQTA 1YSCA 2OCCB 3SPJA 2NNUA 4WFFA 3CCLV 1K92A 1M90W 4BIZA 5B3SB 4RQEA 3RVYA 2ATKC 2XAQA 2Q69A 1F51A 1GK9A 5LGUA 4UV9A 3CYOA 4RUEA 2EIKC 1J95A 2ZDIA 1K5SA 4HZ3A 2JEXA 4BAYA 1GO3F 3SPCA 5LGNA 2R9RB 5H9CA 4ZBMA 4MVZA 2EZPA 2Q67A 3OW2U 1ORQC 4G2KA 3JCZA 2QE7G 2EILB 1RPOA 4MT8A 1XL6A 4UVAA 3ZN1A 1LNQA 2HVKC 1V54B 2ZDIC 4R50A 3CCMV 3CCQV 1W0JG 5J9PC 1KQSU 4WF9V 1YI2V 3SPHA 5IYBO 2WLKA 5KUMA 1QVFU 1Y66A 2A79B 2BOBC 2W6IG 4I5SA 2X6CA 3RBZA 1MG1A 3ABLC 2WLLA 3B77A 3HPLC 1S0VA 3STZC 5B1OA 3CP1A 4ASUG 2C2AA 1BMFG 5BZBA 1K4CC 3OUSA 1NVPB 2WAMA 2EIJC 3CCVV 2DYRB 2Q6AA 5EK0A 3W7WA 2XAFA 1TUEB 1RPRA 1VQ5V 5FL7G 5HFMA 2QM7A 1DF5A 1KP2A 3OUFA 2HKOA 1M57B 5L3FA 3AG3C 1QVGU 4XDLA 3AG1C 2Y69C 4PA9A 5KA6A 3FYIB 3W7SA 1AJPA 4FK5C 1AI6A 2XASA 4X8AA 4KP4A 2P90A 1IXMA 1ENVA 2H94A 5LGTA 3DTUB 4G27B 1CP9A 1EFRG 2EIKB 3R65A 4OXSA 3STLC 3CC2V 5B3SC 1H8HG 1RM1B 3P30A 1Q7YW 3PJSK 2EBOA 4GX5A 1K9MW 2MK3A 2JJ1G 1I5XA 3E8GA 4N21A 3WG7C 3IGAC 5IDJA 3OE7G 4TT3G 4QE9A 1PKXA 4RO2A 2AHZA 2DYSC 5B1AC 3G4SV 3JD3A 5LHHA 1YJ9V 1MOFA 1K7DA 1R6NA 1I5YA 1NBMG 1NH2D 1OCRC 1YTFD 2ZR2A 4PDRA 3ZMVA 3W7TA 2OTJV 3CC4V 2IH3C 2X7RB 1S77D 1P4RA 1OCZC 2X0LA 3ABLB 3LSQA 3NXSA 4JAUA 3QNEA 1M9NA 3FKSG 3CMAV 4KFMA 3ASNC 3IC7A 3B8MA 1UJWB 3AEIA 1JCHA 1VQPV 1VQNV 1K8AW 3FB6C 4H33A 2EIJB 2WLLB 1AROP 3E8FA 3EFFK 2Z3YA 4DO2A 2WLJA 1SESA 2IJIA 3TETA 4GX2A 3CCRV 3AG3B 2QTOA 1R6KA 3F5WC 3AG1B 2Y69B 1GM9A 3AG2C 3LSSA 1L1FA 1Q82W 1JJ2U 4QJFB 4BIUA 2LP7A 2GHYA 4PDVA 2YEVA 1DF4A 3OGCC 3JD1A 1GMGA 1H8EG 3CC7V 3F7YC 1YHQV 2HLDG 4MW3A 5B1NA 4JTCB 4RQFA 1VQKV 2XAJA 5GW7A 2B1GA 1BL8A 4QE7A 1N8RW 3G71V 1KECA 2D3OW 4UUJC 3LDCA 1R3LC 5C93A 1Y4MA 4RAIA 1THZA 3WG7B 4GT1A 5L3EA 2OT5A 2QEXV 1VQ9V 2DYSB 3OR7C 1Q81W 5B1AB 1V55C 1RM1C 4R7CA 4PA7A 4GX0A 4MTFA 1E79G 3QO8A 2P7TC 1SERA 2JK5C 1OCRB 2EZOA 1AJNA 3A0RA 2K1EA 4MVUA 2JJ2G 3T4DA 3E86A 5LHGA 4FPPA 3OMIB 5CMUA 1OCZB 4HYOA 1FXHA 3LDEA 3SYQA 1FXVA 4GCZA 4FJCC 2PI4A 2ITDC 3ASNB 3ETDA 3SYAA 5DM6V 5EC2C 3E35A 2JEUA 4LBEC 3ETGA 4MTXA 3ZRXA 1QCEA 2HFEC 3K9AA 5KUKA 3ZMZA 3OMNB 3T1CA 1NR1A 3SYPA 2IU3A 3QO7A 1FFTB 5EBLC 1SETA 2EIMC 4MSWC 3OFNG 3MHHC 1XL4A 4QNHB 2P6JA 3G6EV 4PELA 1QLEC 5IYDO 3H01A 1QR9A 3AG2B 2WLIA 1R3KC 1NVPD 2ZD9A 4PA4A 4PA3A 3VBBA 4L87A 4JASA 4X89A 1VQ8V 3TCUA 4JTAB 4QPKA 4P9PA 3VOUA 2V1DA 1OCOC 4JYBA 2QM8A 1EBOA 1JVMA 3FB5C 1KKDA 2UXXA 1K34A 3KG2A 5IYCO 2YEVB 2W6JG 4YXWG 1JOYA 4MVMA 4WFGA 1BHAA 3OMAB 5H6QA 4CBCA 5CN0A 4FMTA 2WPDG 3SPIA 1K3EA 5IY5C 2HG5C 1V55B 3ZIAG 2DW4A 1S5HC 3ABTA 1R3IC 4U7NA 2WLMA 3SJQC 1VQ4V 1MSWD 1F4NA 5EBWC 3SPGA 2XOKG 2B5UA 3ABKC 3IFXA 3ABUA 3W7UA 3WFVA 3LNMB 1FS0G 1GM8A 3BEHA 1JQ0A 2DWEC 4PA6A 2Z5UA 5L3DA 5L3CA 1NKDA 2IJHA 4WFHA 3M99B 4XDJA 1G8MA 3E83A 5DN6G 3SYOA 4ZKIA 2H8PC 5CA3A 5KA5A 1KP3A 2EIMB 1NH2B 3ZMSA 1JX9A 1K5QA 1YTFB 1NR7A 1M56B 2XAGA 1DLBA 1QLEB 1HWYA 1PD3A 4JTDB 2V7QG 5CBHA 3ZCCA 3HB3B 4UV8A 3I55V 2WLNA 3FYEB 3K03A 1M1KW 2ITCC 3E89A 2HVJC 1G4YB 4PDMA 1SRYA 3F7VC 4WFAV 1OCOB 2NLJC 2WLIB 4J9YB 3SYCA 3JD4A 3K08A 2DWDC 1KC8W 1COWG 2DQ3A 3BY6A 1PNLA 3OR6C 3OAAG 1SZTA 3ABMC 1R3JC 4J9ZB 4BW5A 1FXKA 4MS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZDI C;  3AEI A;  2ZDI A;  1FXK C;  2ZQM A;  1FXK B;  1FXK A; 
#chains in the Genus database with same CATH topology
 2M7W A;  4H0L B;  1YXB A;  3ML0 A;  5LHI A;  2PYL A;  1IBM B;  2JRI A;  4E2L A;  4UCO A;  4Q6G A;  1F23 A;  2P5O A;  1ROP A;  4X88 A;  3OT7 A;  4O4I A;  3TK1 A;  4U3J B;  4LF7 B;  5LMN B;  2PGG A;  3F5T A;  2P22 C;  3H9V A;  3P3N A;  2ZM6 B;  2QSA A;  1VEW A;  1SQB H;  2WWW A;  2LFR A;  1GTO A;  2FYU H;  1S5L Z;  2VQE O;  4Q20 A;  1N36 B;  1OCC B;  2R9I A;  2KB1 A;  2IH1 C;  3BAA A;  2F93 B;  3M8A A;  1NS1 A;  5E1A C;  3GWO A;  2Q8V A;  4JI5 O;  4TSF G;  2VQF O;  1VQM V;  2QKS A;  1AI7 A;  4MVO A;  1A32 A;  1IBL O;  1HNW B;  4IGG A;  3D36 A;  4DXW A;  4R8C A;  2BOC C;  3QF7 A;  5KX5 B;  3LDD A;  4UFZ A;  4L8J A;  1GN3 A;  3BCC H;  3RVZ A;  2N04 A;  1X59 A;  2IJJ A;  3CPW U;  1PNK A;  1FXK B;  5LBQ A;  4NYK A;  4KUM A;  3ZN0 A;  5JWP A;  2CH7 A;  4P2Z A;  4B3T O;  2Q7E A;  4CC6 A;  4DK0 A;  1U97 A;  5LYJ B;  1FAF A;  1E1Q G;  4EEQ A;  4F6R B;  1FPO A;  1XUQ A;  4B3S O;  2ZNJ A;  3AG4 B;  3B40 A;  4UVC A;  1YIJ V;  4F4L A;  2PYJ A;  3RGB A;  1S76 D;  3ZRW B;  2X6B A;  2IW5 A;  4X64 O;  1BHB A;  2OCC C;  3FFQ A;  3UKM A;  4GX1 A;  1KD1 W;  4J41 A;  5L3B A;  2JIZ G;  4CS4 A;  1OCC C;  1BGY H;  4DRX B;  1HP8 A;  4FFB A;  2EIL C;  2UXD O;  2YIA A;  4AI8 A;  4LFC B;  3K3W A;  3ZMU A;  1BZK A;  4O4L A;  4IYI A;  2ZR3 A;  4JAV A;  3QO5 A;  2B9Z A;  1B6Q A;  1K97 A;  3FB8 C;  5IJ9 A;  2YXY A;  1AR4 A;  1VQO V;  4BW9 A;  2LGQ A;  2OTL V;  2XT9 A;  3CD6 V;  1NJI W;  1M57 C;  5GTH Z;  1XQ8 A;  4UCV A;  1H2N A;  2UUC B;  3OM3 B;  1NQT A;  2GV9 A;  2NNU A;  1M90 W;  4BIZ A;  2Q69 A;  2WA4 A;  2VWJ A;  3L72 H;  3CYO A;  2CDY A;  2ZDI A;  3ZX6 A;  1GO3 F;  1X4T A;  2R9R B;  5LL6 Y;  2HEP A;  4MVZ A;  4UVA A;  1IBM O;  2HVK C;  5JCO A;  3CCM V;  4CH4 A;  1SC5 B;  1L0N H;  5IYB O;  2WLK A;  3Q4H B;  3SDL A;  4LF7 O;  5A2Q N;  5LMN O;  3JAS B;  1FJG B;  2ZM6 O;  2WLL A;  3WB0 A;  1B3Q A;  5BZB A;  1K4C C;  3QTC A;  2EIJ C;  2CGO A;  2GBO A;  1N36 O;  2DYR B;  2ARH A;  5EK0 A;  3KKY A;  1RPR A;  1VQ5 V;  3L71 H;  1KP2 A;  2QWQ B;  5KLV H;  1EN6 A;  3APO A;  2JGU A;  5FLX N;  3W7S A;  1AJP A;  1AI6 A;  2F95 B;  4X8A A;  2P90 A;  3OD4 A;  1ENV A;  1MNG A;  1HNW O;  1H2S B;  3DTU B;  2OIG A;  1QQC A;  1CP9 A;  1EFR G;  2EIK B;  2ZE7 A;  4JI3 B;  3CRA A;  4IHJ B;  5CA0 A;  3P30 A;  4K0K B;  2JJ1 G;  5J2T A;  3IGA C;  4DV4 B;  3APQ A;  2EX3 A;  4QE9 A;  4JZG A;  2HP8 A;  5LHH A;  2OIE A;  2YIC A;  1I5Y A;  3N2G A;  3RT3 C;  4X9Q A;  1FYJ A;  2KG7 B;  5D5Q A;  2IH3 C;  1L8D A;  2X7R B;  2X0L A;  2A7W A;  3ABL B;  4YJ3 B;  4BR6 A;  1PL4 A;  3IC7 A;  3B8M A;  1UJW B;  1VQP V;  4J10 A;  3JAT A;  4H33 A;  4DR1 B;  3T1Y O;  4PV1 B;  1YEW A;  2WLJ A;  2PY5 A;  2IJI A;  4GX2 A;  4H44 B;  2LW1 A;  4LWS A;  4E4E A;  2Y69 B;  3AG2 C;  4J7Z A;  3CB2 A;  4QJF B;  4BIU A;  4KHP O;  2GHY A;  4I55 A;  3SJB C;  1FFX B;  1NI8 A;  3CC7 V;  4GUN A;  1XEQ A;  1YHQ V;  4ZI7 B;  2FB5 A;  4PI0 A;  2XAJ A;  4X20 A;  3JAK B;  2UU9 B;  3SGI A;  1N8R W;  3G71 V;  4LFC O;  1KEC A;  2D3O W;  5LXT A;  4RAI A;  5LP6 B;  2OT5 A;  2CTR A;  4GX0 A;  2P7T C;  1SER A;  1OCR B;  1SF9 A;  3A0R A;  4MVU A;  4J7K A;  1WP7 A;  4HYO A;  4YJ2 A;  3SYQ A;  4GCZ A;  3TXQ A;  4AIL C;  4ABM A;  2ITD C;  3ASN B;  3ZRX A;  1JJO A;  3IC9 A;  1YDX A;  3K9A A;  3ZMZ A;  2UUC O;  2IU3 A;  3QO7 A;  1FFT B;  1WAZ A;  5LA6 B;  4UCS A;  2EIM C;  3OFN G;  5CB4 B;  1R3K C;  4JYY A;  4PA4 A;  3E22 A;  3AG7 A;  4DV3 B;  2KKW A;  3TCU A;  2ZNI A;  3VOU A;  4HNA B;  2PF4 E;  1QHT A;  2UXX A;  5JJN B;  4O2B A;  4TV8 B;  4WFG A;  1BHA A;  3OMA B;  1FJG O;  5CN0 A;  4I50 A;  2F1M A;  1Q8I A;  1V55 B;  1D5A A;  1S5H C;  3D8C A;  5JQG A;  3RYC A;  3SPG A;  3L74 H;  2JGD B;  3ABU A;  3W7U A;  1XNR B;  3G80 A;  3NR7 A;  1G8M A;  1LUV A;  5IYZ B;  4PHZ A;  1DLB A;  1QLE B;  3KZI Z;  4JI3 O;  2V7Q G;  2CUG A;  1NTZ H;  3ZCC A;  2ITC C;  3DXR B;  3E89 A;  4DR7 O;  2HVJ C;  4K0K O;  2NLJ C;  4DV4 O;  4J9Y B;  3HKB B;  2DQ3 A;  3BY6 A;  3AK1 A;  3OAA G;  3HKE B;  4MTX A;  1PL0 A;  3JSN A;  3JD0 A;  5IY5 B;  1WPB A;  2P4V A;  3RYF B;  2OWO A;  4MTG A;  1ZL8 A;  3T4Z A;  4DR1 O;  3I56 V;  1IBL B;  3OTF A;  2D2C B;  1WPX A;  5CBG A;  5JH7 A;  5KAI Z;  1HR0 B;  1XHX A;  4Z1M G;  5EYP B;  3ETQ A;  1Y76 A;  4CZZ A;  3MHS C;  2WSS G;  5CBF A;  3CCE V;  2OCH A;  2GUZ A;  3GWK C;  3L73 H;  1IUR A;  5K1X A;  2YDE A;  2ZIN A;  4EFB A;  5IWA B;  4CH3 A;  2JDI G;  3K5L A;  2GSM B;  1T5E A;  2IJK A;  2UU9 O;  3ZHR A;  2X6A A;  1OV9 A;  4FLU A;  2E76 B;  1BS3 A;  3DSQ A;  4P9O A;  2A06 H;  4IT5 A;  4XBF A;  3VQY A;  1BE3 H;  4R6Z A;  2B1I A;  3M7M X;  5FNV A;  4WFE A;  3HKC B;  2WLH A;  4JI8 B;  3UO3 A;  5KHG A;  4GKK O;  3D36 C;  4D6T H;  2UXN A;  4FIP C;  1AR1 B;  3CME V;  4FLY A;  3K0D A;  3RYI A;  1Q6U A;  2RCV A;  2EIN B;  1M4U A;  2P67 A;  1WLE A;  3EXA A;  2R9A A;  2NR5 A;  4NTX A;  4ZHQ A;  2A9H A;  1K73 W;  2Y48 A;  4DV3 O;  4JF3 A;  1HNZ B;  1H2G A;  3E8H A;  4NTY A;  2Y4T A;  2CK3 G;  3IJ4 A;  4KL1 A;  2YSU B;  4I4T B;  1K4D C;  4I9W A;  5BR8 B;  3JCU Z;  4EB6 B;  3ZJZ A;  4XDK A;  3LSU A;  1V54 C;  5D5P A;  5KHK A;  3JAL A;  4LF6 B;  2F43 G;  3JYC A;  3ZMT A;  2ZQM A;  2Q7H A;  3CXH F;  3OGI B;  1B04 A;  1XNR O;  2H3O A;  4TWK A;  4X1I A;  4FLV A;  1YZB A;  1GKF A;  2A0L A;  1TVK A;  1VQ6 V;  1WA8 B;  1I7F A;  4DR2 B;  5KMG A;  4QPJ A;  1SQG A;  2EJR A;  4U3F H;  1XI1 A;  5EZY A;  2QTS A;  1VQ7 V;  2QA4 V;  1VMG A;  3A2F A;  3J81 N;  4MVQ A;  1AI5 A;  2EIN C;  4LCU C;  3C90 A;  3J7A U;  4C7U A;  3E2E A;  1IX9 A;  2OCC B;  2QM4 A;  2CTQ A;  2ATK C;  1F51 A;  2NN4 A;  5LGU A;  4FLW A;  1KUQ A;  1J95 A;  1K5S A;  3K9S A;  3SPC A;  3RYH A;  5BMV A;  5CA0 B;  4DV7 B;  4BWA A;  4WBN A;  1EN4 A;  2EIL B;  1RPO A;  4MT8 A;  3FAV A;  1LNQ A;  2ZDI C;  4R50 A;  3CCQ V;  3VQW A;  1YI2 V;  1VF6 A;  3SPH A;  1QVF U;  3N2G B;  4X1K B;  2A79 B;  2W6I G;  3CRR A;  2R72 A;  5JCO C;  3RBZ A;  4YIO A;  1HR0 O;  3B77 A;  2VWK A;  3BVO A;  4GYC B;  5B1O A;  4CH6 A;  2WAM A;  1V9P A;  3CCV V;  5KHI A;  1GN2 A;  1TUE B;  5IWA O;  3OUF A;  1M57 B;  3JAW B;  5LOV B;  4LWS B;  4OX9 B;  5ITZ B;  3FYI B;  2W0X A;  2OYQ A;  4FK5 C;  4KP4 A;  5IE9 A;  1PM9 A;  1IVS A;  2H94 A;  3RFR A;  1Q90 D;  2ZCE A;  3STL C;  1Q3E A;  1RP3 B;  3T1Y B;  5GON B;  1FKA O;  4ZIB A;  3H1J H;  4LF5 B;  4JI8 O;  2KSD A;  2EBO A;  4GX5 A;  2CTP A;  4ICG A;  1I5X A;  5IDJ A;  4TT3 G;  4RO2 A;  1EN5 A;  4FZ0 A;  2AHZ A;  2DYS C;  4KHP B;  3G4S V;  1NH2 D;  1YTF D;  2ZR2 A;  3ZMV A;  3W7T A;  3CC4 V;  2Q7G A;  1JFF A;  1OCZ C;  1P4R A;  4UB8 Z;  1XBL A;  4DR5 B;  4JI1 B;  1H2M A;  1Z5W A;  2YIB D;  2VRZ A;  1GN4 A;  1VQN V;  5EIB C;  1K8A W;  1AP6 A;  4JI7 B;  4I7Z B;  2EIJ B;  1HNZ O;  1SS3 A;  1ARO P;  4DUZ B;  3E8F A;  4DO2 A;  1Y6X A;  4DK1 A;  1P84 F;  3CCR V;  1KYO F;  3F5W C;  4B7K A;  1I0H A;  1G6U A;  3H1H H;  1L1F A;  5BR8 O;  3CS5 A;  3N27 A;  4I0X A;  1EZV H;  2VS0 A;  2YEV A;  1DF4 A;  1ZTE A;  2LJ2 A;  3JAR A;  1H8E G;  2UXB B;  2CTW A;  2HLD G;  4LF6 O;  1RSO B;  4JTC B;  2B1G A;  4TUY B;  2Y4U A;  1BL8 A;  4FLT A;  4QE7 A;  4UUJ C;  1R3L C;  5C93 A;  2BTQ B;  3A0H Z;  3OR7 C;  1Q81 W;  1F7Y A;  4NXM B;  5J2U A;  4MTF A;  4DR2 O;  3H1I H;  4TV9 A;  2JJ2 G;  5B5E Z;  5LHG A;  4O4J B;  3OMI B;  3N2K A;  1FXH A;  2PI4 A;  3ETD A;  5DM6 V;  4NXN B;  2ZKO A;  1Y74 B;  4LBE C;  4J42 A;  1QCE A;  1B06 A;  3T1C A;  3SYP A;  2QGN A;  4BIO A;  5EBL C;  4FM2 A;  1XL4 A;  1JMK C;  4LH6 A;  3K5N A;  3G6E V;  1GH6 A;  4O4H A;  1QR9 A;  3AG2 B;  2WLI A;  1NVP D;  2JS3 A;  4LNU A;  4DV7 O;  3VBB A;  2QDO A;  1M5I A;  4JI6 B;  2V1D A;  1OCO C;  2BSK A;  2QM8 A;  1I94 B;  1Q5O A;  1K34 A;  2Q0A A;  2L6L A;  2W6J G;  1JOY A;  2QKC A;  5CA1 B;  1AB3 A;  3PN1 A;  5GTI Z;  5C8Y B;  1ZX3 A;  4DV2 B;  4U3J A;  2DW4 A;  3ABT A;  4DR7 B;  1P49 A;  3SJQ C;  5EBW C;  2XOK G;  3ABK C;  2Y0P A;  3WFV A;  1GM8 A;  2Z5U A;  2Y0I A;  2IJH A;  4WFH A;  1HNX B;  4OX9 O;  1Y76 B;  2F66 C;  4AQY B;  4ZKI A;  2ZE6 A;  1N0N A;  1SA0 B;  2EIM B;  1NH2 B;  2BCC H;  1K5Q A;  1YTF B;  2Q0O C;  1M56 B;  2XAG A;  3O65 A;  1HWY A;  1PD3 A;  1HDJ A;  2CAZ C;  3HB3 B;  1SQV H;  3U10 A;  3HKD B;  4LF5 O;  1M1K W;  5BXZ A;  1G4Y B;  4NB5 A;  1XRE A;  4DW1 A;  4PDM A;  5KX5 A;  4WFA V;  2Q4P A;  3SYC A;  2P06 A;  1TGO A;  2DWD C;  2RN9 A;  2Q73 A;  2LGW A;  1COW G;  4Z2W A;  1PNL A;  1TUB A;  2M6Y A;  3ABM C;  5DED A;  4J9Z B;  1NTK H;  1FXK A;  4CS2 A;  4ZOL B;  5H6R A;  4N23 A;  3J80 N;  4DR5 O;  4JI1 O;  1EZJ A;  2V4D A;  5LYJ A;  4RWU A;  4JI7 O;  4F6R A;  1ZSP A;  1DTO A;  1N32 B;  4PJ0 Z;  4DUZ O;  1YJW V;  2ZXW C;  3ZRW A;  2QKA A;  1YVW A;  1OJH A;  4FZ1 A;  4GKK B;  3SJC C;  3K0G A;  1H38 A;  1AJQ A;  3A8T A;  3GB7 C;  4GLX A;  4DR3 O;  2UXB O;  3UT5 B;  4DRX A;  4DW0 A;  5B1B C;  3I5D A;  4IIJ B;  1MZE A;  3UM7 A;  5B66 Z;  2HR3 A;  3DC5 A;  1O9H A;  3CXC U;  1M56 C;  4D7T A;  1YJN V;  1Q86 W;  2YI9 A;  1XNQ B;  4UXN A;  3MDS A;  3K59 A;  1E1R G;  4NXM O;  3CWB H;  4O2A B;  1N0J A;  2BTO A;  2P4K A;  3P32 A;  4NR1 A;  1AR5 A;  3X2Q C;  1VQL V;  4H37 A;  3ASO B;  1KKC A;  2E3C A;  4NXN O;  1AI4 A;  5KMG B;  2WA3 A;  4CC5 A;  1R6T A;  2AZ0 A;  4F6E A;  4MVS A;  1GM7 A;  2YI8 A;  2PTM A;  4CS3 A;  4FM0 A;  3OEE G;  5DEC A;  4O4I B;  1PNM A;  3K04 A;  3FB7 C;  4W4K A;  4DUY B;  3BFR A;  3LUT B;  3CCS V;  4JI6 O;  1KU9 A;  3SR2 C;  1I94 O;  2UXC B;  4EKW A;  5K1P A;  3T2M A;  4P30 A;  4Z1V A;  3CEI A;  4JYC A;  1QBZ A;  1CPY A;  1H2L A;  1AP5 A;  5FPO A;  1FD9 A;  5JVD A;  3BRC A;  3C3S A;  3Q4H A;  4DV2 O;  2W0F C;  2ZIO A;  3JAS A;  3VQX A;  4LC1 A;  1MAB G;  1SQF A;  4YIP A;  1W0K G;  1D2D A;  1URF A;  1Q6I A;  1S3J A;  4HAM A;  3K06 A;  4U7O A;  1WB7 A;  1R1B A;  3ETE A;  1HNX O;  4K35 A;  2HHH B;  3ASO C;  4AQY O;  4LP8 A;  1KB9 F;  2ZE5 A;  3A0B Z;  3ZBH A;  3H1L H;  3L75 H;  2CH7 B;  4LF8 B;  4JPR A;  3SJA C;  4D7S A;  2FML A;  3WB1 A;  2ZIM A;  2XND G;  3ZRS A;  2FTK A;  3CCL V;  1SQQ H;  4IHJ A;  2QWN B;  3RVY A;  2RMK B;  1VIB A;  1GK9 A;  4HZ3 A;  2JEX A;  5LGN A;  1LUW A;  1ORQ C;  5EIB D;  4G2K A;  3JCZ A;  3ZN1 A;  2KG7 A;  1V54 B;  2DOS A;  3CX5 F;  3L9D A;  5J9P C;  1KQS U;  4FFB B;  1N32 O;  4LFA B;  4I5S A;  3CRC A;  1D5N A;  5E79 Z;  2JVD A;  4OGQ B;  1VF6 C;  3HPL C;  2PUS A;  5H5N A;  3STZ C;  3CP1 A;  4ASU G;  3OUS A;  4DV5 B;  4GKJ B;  4DV1 B;  4O4L B;  3ICX A;  3W7W A;  2XAF A;  5FPR A;  2QM7 A;  3JSL A;  4B7E A;  3AG3 C;  1TA8 A;  5IJ9 B;  3K57 A;  1QVG U;  3AG1 C;  4ZI7 A;  1MZF A;  1BQ0 A;  1XNQ O;  2UUB B;  2F23 A;  2Z0A A;  3JAK A;  1UFI A;  5LGT A;  3KCX A;  4LFB B;  5H2F Z;  5IJ0 A;  4OXS A;  1Q43 A;  3R65 A;  3CC2 V;  5LP6 A;  5F2V O;  1H8H G;  2FKX A;  2E75 B;  3S3W A;  2MK3 A;  3E8G A;  4N21 A;  3WG7 C;  3BA8 A;  1PKX A;  1XHZ A;  1SQP H;  3FX7 A;  1U96 A;  5B1A C;  1YJ9 V;  4LR3 A;  1MOF A;  1R6N A;  1NBM G;  4PDR A;  4FLX A;  2OTJ V;  3LSQ A;  3NXS A;  4OPH A;  1M9N A;  2L35 A;  3FKS G;  3CMA V;  4KFM A;  5LA6 A;  3AEI A;  1SQX H;  1O9G A;  2RDC A;  5CB4 A;  4DUY O;  2E74 B;  3U11 A;  2WLL B;  2YID A;  2Z3Y A;  2ZE8 A;  1MMM A;  2UXC O;  3TET A;  2QTO A;  4TQD A;  1R6K A;  4HNA A;  5LMU B;  5JJE B;  1JJ2 U;  4PDV A;  1XMO B;  4A5U B;  3OGC C;  2JS5 A;  4TV8 A;  1GMG A;  2QWO B;  4X66 B;  4MW3 A;  5B1N A;  1Y67 A;  2EUL A;  4RQF A;  4X1Y A;  4B3R B;  2E5L B;  4DV0 O;  2RJZ A;  1MA1 A;  2GTS A;  1THZ A;  4GT1 A;  5L3E A;  2JGD A;  2RQ6 A;  2DYS B;  1M93 A;  4R7C A;  2HHH O;  5KHH A;  1E79 G;  3QO8 A;  2JK5 C;  2EZO A;  1AJN A;  1S5J A;  5J2T B;  3T4D A;  3E86 A;  3ZHU A;  1IZ3 A;  5CMU A;  1OCZ B;  3AK2 A;  2AZ2 A;  2QWR B;  4FJC C;  4LF8 O;  3SYA A;  1BCC H;  3ETG A;  1TAE A;  1VF7 A;  2HFE C;  5IYZ A;  1NR1 A;  1IBK B;  4NVP A;  1SET A;  4X62 B;  4MSW C;  1JA8 A;  3JAM N;  3DXR A;  3JAT B;  4PEL A;  3U0Z A;  5IYD O;  3H01 A;  4FFK A;  2ZD9 A;  2YUA A;  3HKB A;  4L87 A;  4JAS A;  4X89 A;  1IXB A;  3UCS C;  3L70 H;  4JTA B;  3HKE A;  4P9P A;  1EBO A;  2CE4 A;  1JVM A;  3FB5 C;  4J80 A;  3OTO B;  2ADP A;  1KKD A;  3ZHV A;  2CGN A;  4I55 B;  5IYC O;  1TUB B;  4X65 B;  4MVM A;  4LFA O;  3RYF A;  4CBC A;  1NZ6 A;  3QVN A;  4FMT A;  3SPI A;  4DR4 B;  1K3E A;  1WB8 A;  4X20 B;  3CJH A;  4DV5 O;  4GKJ O;  4DV1 O;  4U7N A;  2WLM A;  4JI4 B;  1UPG A;  5LXT B;  1VQ4 V;  5EYP A;  1MSW D;  4IYH A;  4UCU A;  1L0L H;  1N4C A;  2B5U A;  3GVM A;  3AK3 A;  3LNM B;  2ADQ B;  2F4V O;  2QR4 A;  3B4S A;  4PA6 A;  5L3D A;  5L3C A;  1N34 B;  3M99 B;  5A9G A;  4FM1 A;  1GRJ A;  4XDJ A;  3T1H B;  4YJ2 B;  1BSM A;  3SYO A;  2H8P C;  2XTA A;  5CA3 A;  2UUB O;  1KP3 A;  4K8Z A;  4FLZ A;  1I08 A;  1JX9 A;  4LFB O;  1W59 A;  4JTD B;  5CBH A;  4FVM A;  4UV8 A;  2YXL A;  2WLN A;  3TJT A;  3HKC A;  1BQZ A;  3BA9 A;  1OCO B;  3UQ8 A;  3JD4 A;  1NTM H;  1VF5 B;  1KC8 W;  3WB2 A;  3E22 B;  1QU7 A;  3B09 A;  3OR6 C;  1Z2G A;  4JAA A;  4DR3 B;  1R3J C;  4BW5 A;  1VAR A;  1YF2 A;  4G28 B;  4MVR A;  1WN7 A;  4J7J A;  2ILM A;  1J5E B;  4O2B B;  4W4L A;  1XDC A;  1FXK C;  3DGE A;  4JV5 B;  2HJF C;  5TIS Z;  1DGS A;  4I50 B;  2K9P A;  3ABK B;  4MTO A;  1PP9 H;  1OHH G;  1QLN A;  4JYA B;  4QIW F;  4WFB V;  5JQG B;  3RYC B;  4DR6 B;  1QR8 A;  1YIT V;  5LMU O;  3AG4 C;  3OEH G;  1GN6 A;  3EHB B;  2IM9 A;  3CCU V;  4I4T A;  1H2K A;  1XMO O;  3FD9 A;  2LO1 A;  4JGS A;  4X66 O;  2LFS A;  2LQT A;  3MD0 A;  4EB6 A;  2QWP B;  4B3R O;  2E5L O;  4K3A A;  1KBH A;  2A3Q A;  4HBN A;  5JVD B;  4YY3 B;  1W2B U;  4NTW A;  2MW2 B;  2FL4 A;  3ABM B;  5IT9 N;  2AHY A;  5L3G A;  3K79 A;  1WA8 A;  2YC0 A;  1CEZ A;  2DMX A;  4QGP A;  1R73 A;  1SKV A;  4MW8 A;  4JZ2 A;  3ZRV A;  3LNN A;  3D3I A;  2XAH A;  2PI5 A;  1ZWI C;  1IBK O;  4X62 O;  4PDL A;  2ZXW B;  5EC1 C;  1ZL8 B;  3E8B A;  1K33 A;  5JH7 B;  2IBZ H;  3B8N A;  4OPA A;  4NKG B;  4RUF A;  4DV6 B;  4DYL A;  2Q9L A;  4TOI A;  3CCJ V;  1OZ0 A;  3OTO O;  2DN9 A;  4PD4 F;  5B1B B;  5HFL A;  1F4M A;  2GUZ B;  2QJ1 A;  3RW0 A;  4X65 O;  3R66 A;  1WNS A;  3EVK A;  4UB6 Z;  4X1K A;  4DR4 O;  4J11 A;  4LF4 B;  3BHP A;  4JI4 O;  2Q5Z A;  3JD2 A;  3X2Q B;  1NT2 B;  2AXT Z;  3CE2 A;  5FNV B;  3CRQ A;  3P3P A;  1QNM A;  3W7X A;  1N34 O;  2DQ0 A;  4K8X A;  3K5M A;  3T1H O;  2Q68 A;  1BT8 A;  5EBM C;  5BY1 A;  4WCE V;  3JAW A;  5LOV A;  1JR9 A;  4UCR A;  2DYR C;  5ITZ A;  3K58 A;  4UVB A;  1P7B A;  3RYI B;  1JPX A;  2IU0 A;  1S72 V;  3IAY A;  1IDS A;  1YSC A;  3G6B A;  3SPJ A;  4CH5 A;  4WFF A;  5GON A;  1K92 A;  2N74 A;  3DC6 A;  3S3X A;  5B3S B;  4RQE A;  4ZHQ B;  2XAQ A;  1XMQ B;  2LW7 A;  4JI2 B;  3HR0 A;  4UV9 A;  4RUE A;  5IJ0 B;  1RFY A;  2EIK C;  4BAY A;  1N33 B;  2UUA B;  5H9C A;  4ZBM A;  2EZP A;  2Q67 A;  3OW2 U;  2QE7 G;  1XL6 A;  2ODM A;  1J5E O;  2BE3 A;  1AVM A;  1W0J G;  4JV5 O;  4WF9 V;  4I9Q A;  5KUM A;  1Y66 A;  2BOB C;  2X6C A;  1MG1 A;  3ABL C;  3H1K H;  3JAL B;  3G67 A;  4JYA O;  4DR6 O;  1S0V A;  2C2A A;  1BMF G;  3TXS A;  1NVP B;  4JI0 B;  3KCY A;  2ETN A;  4X1I B;  2Q6A A;  4KXR A;  4IL6 Z;  1TVK B;  5FL7 G;  5HFM A;  2ZT9 B;  2EJ7 A;  1DF5 A;  2HKO A;  5L3F A;  4XDL A;  4LF9 B;  2Y69 C;  4PA9 A;  5EZY B;  5KA6 A;  2XAS A;  1LR1 A;  1RSO A;  1IXM A;  4TUY A;  4H13 B;  4YY3 O;  4LH7 A;  4G27 B;  4B3M B;  3ZHQ A;  2BTQ A;  1WP8 A;  2G38 A;  1ZUQ A;  5B3S C;  4X1Y B;  3CSX A;  1RM1 B;  1DK1 A;  1Q7Y W;  3PJS K;  1K9M W;  2AGA A;  4O4J A;  4PI2 A;  3ZHS A;  3OE7 G;  1US6 A;  5LP6 C;  2XHB A;  3RYH B;  3JD3 A;  5BMV B;  1K7D A;  1OCR C;  4WBN B;  1Y74 A;  4YHH B;  3FAV B;  2AW9 A;  1S77 D;  1SZX A;  4JAU A;  3QNE A;  2GTA A;  3ASN C;  1HW7 A;  1JCH A;  4DV0 B;  3FB6 C;  4DV6 O;  3UO2 A;  3EFF K;  2R70 A;  1SES A;  3AG3 B;  3MAQ A;  3AG1 B;  1GM9 A;  3LSS A;  3QG5 A;  1Q82 W;  5KAF Z;  2LP7 A;  4EFE A;  5AG2 A;  2VQE B;  1XOU A;  3C3T A;  2DE0 X;  5CA1 A;  3JD1 A;  3F7Y C;  4LF4 O;  2RNB A;  2YXH A;  5C8Y A;  1VQK V;  5GW7 A;  1P7G A;  4JI5 B;  2VQF B;  1ZAU A;  3THO A;  3LDC A;  1GAX A;  2YS8 A;  3CRM A;  4B08 A;  1Y4M A;  3WG7 B;  2QEX V;  1VQ9 V;  2HJD A;  5B1A B;  1V55 C;  1RM1 C;  4PA7 A;  3CHX A;  3CJH B;  2K1E A;  3ZS8 C;  3WU2 Z;  4FPP A;  3LDE A;  4YJ3 A;  1FXV A;  1SA0 A;  5EC2 C;  3E35 A;  2JEU A;  3TGU H;  1NU1 H;  1JFF B;  5KUK A;  3OMN B;  4B3T B;  1Q6H A;  3HKD A;  3MHH C;  4QNH B;  1XMQ O;  2P6J A;  2YIB A;  5JJJ B;  4JI2 O;  2O57 A;  1QLE C;  1ZLZ A;  4B3S B;  4UCT A;  1KMI Z;  2PZS A;  4PA3 A;  1N33 O;  2F4V B;  2UUA O;  1VQ8 V;  1FFX A;  4X64 B;  1CXZ B;  4QPK A;  4JYB A;  4ZOL A;  3ZED A;  4I0X B;  2GDS A;  3BPZ A;  3KG2 A;  1PV0 A;  3K5O A;  2YEV B;  4YXW G;  3JAR B;  2XUM A;  5H6Q A;  1PPJ H;  2WPD G;  5IY5 C;  2N05 A;  2HG5 C;  3ZIA G;  4AHC A;  3BAB A;  1R3I C;  4JI0 O;  4TQF A;  1WJZ A;  1F4N A;  2DJV A;  2UXD B;  3IFX A;  3B2E E;  5J2U B;  1FS0 G;  3BEH A;  1JQ0 A;  3VQV A;  2DWE C;  4TV9 B;  5KHJ A;  1NKD A;  3N2K B;  1EM1 A;  4LF9 O;  3UT5 A;  3E83 A;  5DN6 G;  4IIJ A;  5KA5 A;  3RWR D;  3ZMS A;  4GZR B;  3RN4 A;  1NR7 A;  3D3Q A;  4B3M O;  2KQX A;  3O9O A;  3ZHT A;  3I55 V;  3FYE B;  1MSD A;  3K03 A;  4O2A A;  1G1X B;  4O4H B;  1XIL A;  1SRY A;  3F7V C;  1VP7 A;  1Z5V A;  2WLI B;  3K08 A;  1AIL A;  4LNU B;  1YCI A;  1SZT A;  4YHH O;  2BSK B;  4MS2 A; 
#chains in the Genus database with same CATH homology
 2M7W A;  5H6R A;  4G28 B;  4N23 A;  1PL0 A;  3ML0 A;  4MVR A;  3JD0 A;  1EZJ A;  5IY5 B;  5LHI A;  4E2L A;  1FXK C;  1F23 A;  4MTG A;  3DGE A;  1ROP A;  3T4Z A;  2HJF C;  4X88 A;  3I56 V;  3TK1 A;  3ABK B;  1DTO A;  1WPX A;  5CBG A;  4MTO A;  1YJW V;  1OHH G;  2ZXW C;  1QLN A;  3ZRW A;  4QIW F;  4WFB V;  4Z1M G;  1QR8 A;  1YIT V;  4CZZ A;  3AG4 C;  3OEH G;  2WWW A;  3MHS C;  2LFR A;  2WSS G;  5CBF A;  3EHB B;  1GTO A;  3K0G A;  3CCE V;  3CCU V;  1H38 A;  1AJQ A;  3GB7 C;  4Q20 A;  1OCC B;  4JGS A;  2R9I A;  2KB1 A;  2IH1 C;  2LFS A;  2JDI G;  5B1B C;  2GSM B;  3UM7 A;  3MD0 A;  5E1A C;  2HR3 A;  2IJK A;  3GWO A;  4TSF G;  3CXC U;  1M56 C;  1VQM V;  2X6A A;  1YJN V;  1Q86 W;  2QKS A;  1AI7 A;  4MVO A;  4UXN A;  4P9O A;  4XBF A;  1E1R G;  4R6Z A;  2B1I A;  3D36 A;  4DXW A;  1W2B U;  4R8C A;  2BOC C;  4WFE A;  3ABM B;  2WLH A;  2AHY A;  3LDD A;  5L3G A;  3P32 A;  3X2Q C;  1VQL V;  3K79 A;  4H37 A;  3ASO B;  3RVZ A;  1CEZ A;  1R73 A;  4MW8 A;  2IJJ A;  3ZRV A;  2UXN A;  3CPW U;  4FIP C;  3D3I A;  1AR1 B;  3CME V;  2XAH A;  1PNK A;  1FXK B;  5LBQ A;  3K0D A;  2PI5 A;  4KUM A;  3ZN0 A;  4P2Z A;  1AI4 A;  1ZWI C;  4PDL A;  1E1Q G;  2EIN B;  2ZXW B;  2P67 A;  5EC1 C;  4MVS A;  1GM7 A;  1WLE A;  3E8B A;  1K33 A;  3OEE G;  1PNM A;  3AG4 B;  3K04 A;  4UVC A;  1YIJ V;  3FB7 C;  2A9H A;  4F4L A;  3B8N A;  1K73 W;  2Y48 A;  4JF3 A;  3ZRW B;  1S76 D;  4RUF A;  2X6B A;  2IW5 A;  3LUT B;  3CCS V;  1BHB A;  1H2G A;  3CCJ V;  2OCC C;  3E8H A;  3UKM A;  1OZ0 A;  4GX1 A;  2CK3 G;  1KD1 W;  4EKW A;  5B1B B;  5HFL A;  3T2M A;  2YSU B;  1F4M A;  1K4D C;  5L3B A;  4P30 A;  2JIZ G;  3RW0 A;  1OCC C;  4JYC A;  1QBZ A;  4I9W A;  1CPY A;  2W0F C;  2EIL C;  3ZJZ A;  4XDK A;  1V54 C;  4LC1 A;  1MAB G;  1W0K G;  2F43 G;  3JYC A;  3JD2 A;  3ZMT A;  2ZQM A;  3X2Q B;  1S3J A;  4HAM A;  3K06 A;  3K3W A;  4U7O A;  3ZMU A;  4TWK A;  3W7X A;  2DQ0 A;  1GKF A;  3ETE A;  2A0L A;  2ZR3 A;  1VQ6 V;  2Q68 A;  3ASO C;  5EBM C;  4JAV A;  4WCE V;  3QO5 A;  4LP8 A;  4QPJ A;  1B6Q A;  2EJR A;  1K97 A;  3FB8 C;  2DYR C;  1VQO V;  4UVB A;  1P7B A;  1VQ7 V;  2OTL V;  2QA4 V;  4JPR A;  3CD6 V;  1NJI W;  1M57 C;  4MVQ A;  1AI5 A;  2EIN C;  1JPX A;  2XND G;  4LCU C;  3ZRS A;  2IU0 A;  2FTK A;  1S72 V;  3OM3 B;  3E2E A;  1NQT A;  1YSC A;  2OCC B;  3SPJ A;  2NNU A;  4WFF A;  3CCL V;  1K92 A;  1M90 W;  4BIZ A;  5B3S B;  4RQE A;  3RVY A;  2ATK C;  2XAQ A;  2Q69 A;  1F51 A;  1GK9 A;  5LGU A;  4UV9 A;  3CYO A;  4RUE A;  2EIK C;  1J95 A;  2ZDI A;  1K5S A;  4HZ3 A;  2JEX A;  4BAY A;  1GO3 F;  3SPC A;  5LGN A;  2R9R B;  5H9C A;  4ZBM A;  4MVZ A;  2EZP A;  2Q67 A;  3OW2 U;  1ORQ C;  4G2K A;  3JCZ A;  2QE7 G;  2EIL B;  1RPO A;  4MT8 A;  1XL6 A;  4UVA A;  3ZN1 A;  1LNQ A;  2HVK C;  1V54 B;  2ZDI C;  4R50 A;  3CCM V;  3CCQ V;  1W0J G;  5J9P C;  1KQS U;  4WF9 V;  1YI2 V;  3SPH A;  5IYB O;  2WLK A;  5KUM A;  1QVF U;  1Y66 A;  2A79 B;  2BOB C;  2W6I G;  4I5S A;  2X6C A;  3RBZ A;  1MG1 A;  3ABL C;  2WLL A;  3B77 A;  3HPL C;  1S0V A;  3STZ C;  5B1O A;  3CP1 A;  4ASU G;  2C2A A;  1BMF G;  5BZB A;  1K4C C;  3OUS A;  1NVP B;  2WAM A;  2EIJ C;  3CCV V;  2DYR B;  2Q6A A;  5EK0 A;  3W7W A;  2XAF A;  1TUE B;  1RPR A;  1VQ5 V;  5FL7 G;  5HFM A;  2QM7 A;  1DF5 A;  1KP2 A;  3OUF A;  2HKO A;  1M57 B;  5L3F A;  3AG3 C;  1QVG U;  4XDL A;  3AG1 C;  2Y69 C;  4PA9 A;  5KA6 A;  3FYI B;  3W7S A;  1AJP A;  4FK5 C;  1AI6 A;  2XAS A;  4X8A A;  4KP4 A;  2P90 A;  1IXM A;  1ENV A;  2H94 A;  5LGT A;  3DTU B;  4G27 B;  1CP9 A;  1EFR G;  2EIK B;  3R65 A;  4OXS A;  3STL C;  3CC2 V;  5B3S C;  1H8H G;  1RM1 B;  3P30 A;  1Q7Y W;  3PJS K;  2EBO A;  4GX5 A;  1K9M W;  2MK3 A;  2JJ1 G;  1I5X A;  3E8G A;  4N21 A;  3WG7 C;  3IGA C;  5IDJ A;  3OE7 G;  4TT3 G;  4QE9 A;  1PKX A;  4RO2 A;  2AHZ A;  2DYS C;  5B1A C;  3G4S V;  3JD3 A;  5LHH A;  1YJ9 V;  1MOF A;  1K7D A;  1R6N A;  1I5Y A;  1NBM G;  1NH2 D;  1OCR C;  1YTF D;  2ZR2 A;  4PDR A;  3ZMV A;  3W7T A;  2OTJ V;  3CC4 V;  2IH3 C;  2X7R B;  1S77 D;  1P4R A;  1OCZ C;  2X0L A;  3ABL B;  3LSQ A;  3NXS A;  4JAU A;  3QNE A;  1M9N A;  3FKS G;  3CMA V;  4KFM A;  3ASN C;  3IC7 A;  3B8M A;  1UJW B;  3AEI A;  1JCH A;  1VQP V;  1VQN V;  1K8A W;  3FB6 C;  4H33 A;  2EIJ B;  2WLL B;  1ARO P;  3E8F A;  3EFF K;  2Z3Y A;  4DO2 A;  2WLJ A;  1SES A;  2IJI A;  3TET A;  4GX2 A;  3CCR V;  3AG3 B;  2QTO A;  1R6K A;  3F5W C;  3AG1 B;  2Y69 B;  1GM9 A;  3AG2 C;  3LSS A;  1L1F A;  1Q82 W;  1JJ2 U;  4QJF B;  4BIU A;  2LP7 A;  2GHY A;  4PDV A;  2YEV A;  1DF4 A;  3OGC C;  3JD1 A;  1GMG A;  1H8E G;  3CC7 V;  3F7Y C;  1YHQ V;  2HLD G;  4MW3 A;  5B1N A;  4JTC B;  4RQF A;  1VQK V;  2XAJ A;  5GW7 A;  2B1G A;  1BL8 A;  4QE7 A;  1N8R W;  3G71 V;  1KEC A;  2D3O W;  4UUJ C;  3LDC A;  1R3L C;  5C93 A;  1Y4M A;  4RAI A;  1THZ A;  3WG7 B;  4GT1 A;  5L3E A;  2OT5 A;  2QEX V;  1VQ9 V;  2DYS B;  3OR7 C;  1Q81 W;  5B1A B;  1V55 C;  1RM1 C;  4R7C A;  4PA7 A;  4GX0 A;  4MTF A;  1E79 G;  3QO8 A;  2P7T C;  1SER A;  2JK5 C;  1OCR B;  2EZO A;  1AJN A;  3A0R A;  2K1E A;  4MVU A;  2JJ2 G;  3T4D A;  3E86 A;  5LHG A;  4FPP A;  3OMI B;  5CMU A;  1OCZ B;  4HYO A;  1FXH A;  3LDE A;  3SYQ A;  1FXV A;  4GCZ A;  4FJC C;  2PI4 A;  2ITD C;  3ASN B;  3ETD A;  3SYA A;  5DM6 V;  5EC2 C;  3E35 A;  2JEU A;  4LBE C;  3ETG A;  4MTX A;  3ZRX A;  1QCE A;  2HFE C;  3K9A A;  5KUK A;  3ZMZ A;  3OMN B;  3T1C A;  1NR1 A;  3SYP A;  2IU3 A;  3QO7 A;  1FFT B;  5EBL C;  1SET A;  2EIM C;  4MSW C;  3OFN G;  3MHH C;  1XL4 A;  4QNH B;  2P6J A;  3G6E V;  4PEL A;  1QLE C;  5IYD O;  3H01 A;  1QR9 A;  3AG2 B;  2WLI A;  1R3K C;  1NVP D;  2ZD9 A;  4PA4 A;  4PA3 A;  3VBB A;  4L87 A;  4JAS A;  4X89 A;  1VQ8 V;  3TCU A;  4JTA B;  4QPK A;  4P9P A;  3VOU A;  2V1D A;  1OCO C;  4JYB A;  2QM8 A;  1EBO A;  1JVM A;  3FB5 C;  1KKD A;  2UXX A;  1K34 A;  3KG2 A;  5IYC O;  2YEV B;  2W6J G;  4YXW G;  1JOY A;  4MVM A;  4WFG A;  1BHA A;  3OMA B;  5H6Q A;  4CBC A;  5CN0 A;  4FMT A;  2WPD G;  3SPI A;  1K3E A;  5IY5 C;  2HG5 C;  1V55 B;  3ZIA G;  2DW4 A;  1S5H C;  3ABT A;  1R3I C;  4U7N A;  2WLM A;  3SJQ C;  1VQ4 V;  1MSW D;  1F4N A;  5EBW C;  3SPG A;  2XOK G;  2B5U A;  3ABK C;  3IFX A;  3ABU A;  3W7U A;  3WFV A;  3LNM B;  1FS0 G;  1GM8 A;  3BEH A;  1JQ0 A;  2DWE C;  4PA6 A;  2Z5U A;  5L3D A;  5L3C A;  1NKD A;  2IJH A;  4WFH A;  3M99 B;  4XDJ A;  1G8M A;  3E83 A;  5DN6 G;  3SYO A;  4ZKI A;  2H8P C;  5CA3 A;  5KA5 A;  1KP3 A;  2EIM B;  1NH2 B;  3ZMS A;  1JX9 A;  1K5Q A;  1YTF B;  1NR7 A;  1M56 B;  2XAG A;  1DLB A;  1QLE B;  1HWY A;  1PD3 A;  4JTD B;  2V7Q G;  5CBH A;  3ZCC A;  3HB3 B;  4UV8 A;  3I55 V;  2WLN A;  3FYE B;  3K03 A;  1M1K W;  2ITC C;  3E89 A;  2HVJ C;  1G4Y B;  4PDM A;  1SRY A;  3F7V C;  4WFA V;  1OCO B;  2NLJ C;  2WLI B;  4J9Y B;  3SYC A;  3JD4 A;  3K08 A;  2DWD C;  1KC8 W;  1COW G;  2DQ3 A;  3BY6 A;  1PNL A;  3OR6 C;  3OAA G;  1SZT A;  3ABM C;  1R3J C;  4J9Z B;  4BW5 A;  1FXK A;  4MS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...