3AEIA

Crystal structure of the prefoldin beta2 subunit from thermococcus strain ks-1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
94
structure length
94
Chain Sequence
b'MEAVRAYELQLELQQIRTLRQSLELKMKELEYAEGIITSLKSERRIYRAFSDLLVEITKDEAIEHIERSRLVYKREIEKLKKREKEIMEELSKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prefoldin beta subunit 2
molecule tags Chaperone
source organism Thermococcus sp.
publication title Thermodynamic Characterization of the Interaction between Prefoldin and Group II Chaperonin
pubmed doi rcsb
total genus 37
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01920 Prefoldin_2 Prefoldin subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.370 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3aeiA00
1FXKA 1FXKB 2ZDIA 3AEIA 2ZQMA 1FXKC 2ZDIC
chains in the Genus database with same CATH superfamily
3AG7A 3CHXA 3RW0A 4D6TH 3JD4A 3SYOA 3SPJA 3U10A 3K5OA 4UFZA 5LOVA 5BY1A 2XASA 2CH7B 4B3MB 2DW4A 4G28B 4IIJA 5L3FA 1NT2B 2WLMA 4H0LB 4GYCB 4LWSB 4OX9O 1NBMG 4R50A 4OXSA 2ZE6A 3EVKA 1V55C 5JJJB 1NH2D 3LDDA 4RQEA 2EIJB 3OD4A 3JAKA 3SJBC 4TOIA 2B9ZA 5EC2C 2JEXA 3G80A 4IIJB 4DV4O 2DQ3A 1XDCA 2GSMB 2DYSB 3U0ZA 2ADPA 3TXSA 3VQXA 2HR3A 2Y0IA 3FFQA 4ZHQA 2K1EA 1M9NA 3JD3A 5CA1A 4TWKA 4X64O 5BZBA 1LR1A 2F23A 3ASOC 2QKAA 1H2LA 3DSQA 2CAZC 4K0KO 1XHZA 3CRCA 3DXRB 4UB8Z 4I50A 1QLEC 3B40A 3OTOO 2O57A 3C3TA 2OTLV 2FYUH 2XT9A 3H1KH 1AR4A 2N74A 2AW9A 2YXYA 2OYQA 5CA1B 1N0NA 5FPOA 3ASOB 2AZ2A 2JRIA 2R72A 1VQLV 3DTUB 3WB0A 2WLLB 3FB7C 1K3EA 3K08A 4MVQA 2LFRA 5EYPA 4YIPA 3QG5A 3F7YC 1N36B 3VQYA 4UV8A 5GTIZ 4CS3A 1SETA 4FLTA 4Q20A 1H8HG 3AG1C 4F6RB 1Y74B 5LMUO 1HNZB 3JSNA 5IYCO 2DJVA 4B7EA 5KUKA 3UT5A 2QKSA 2EIJC 5IY5B 1PNMA 4UUJC 3K58A 4N23A 2HG5C 1K97A 4JI6O 1RSOB 2HVKC 3JYCA 3BVOA 4JI5B 1K4CC 4IT5A 2VWKA 3MHSC 4WBNA 4WBNB 3D3IA 3ASNB 2W0XA 3JD1A 1Q6IA 1PNKA 1DLBA 3JAMN 3GVMA 3MD0A 2P67A 1YZBA 5JCOA 4FM2A 1XBLA 4PI0A 3LDCA 1DGSA 4MVSA 1VQ6V 1G6UA 2ADQB 3ZEDA 1YVWA 2IH3C 4JI3B 4ZIBA 1XOUA 2ZQMA 1KD1W 2EIMC 3WG7B 1Y74A 1IX9A 5KA6A 2PYLA 3O65A 1Q7YW 1NS1A 1XL6A 1IDSA 4PD4F 3ZHSA 4WFAV 4LF6B 3LUTB 3M99B 5DN6G 3CMEV 1R6NA 4GX5A 4CC5A 4DRXB 3H1HH 2OCCB 2R9RB 1FXKC 2WSSG 1AJQA 3G6BA 4YY3O 2Q0OC 3JCUZ 2P5OA 2Q0AA 4QPJA 1NI8A 2YIBA 4EB6B 3B8NA 3JSLA 4A5UB 1RSOA 4PA3A 1Y76A 1JOYA 2Q7EA 1WP8A 2NLJC 4LF9O 5BR8B 4B7KA 2BE3A 2ZIMA 3UT5B 3CCVV 1Y76B 4P30A 4EB6A 2ITCC 1BS3A 3RYIA 3I5DA 3OGIB 1EN6A 4DR2O 4YJ2B 2JIZG 2OIEA 3AK1A 4L87A 4LF9B 2XTAA 3RFRA 3RBZA 4UCVA 2M6YA 4RUEA 4P9PA 3KZIZ 1OV9A 4LF5B 3P3PA 4JAAA 3CCJV 1VQPV 2N04A 2PGGA 3L74H 4DR6O 1K73W 1R73A 1RFYA 1GN2A 1SS3A 2QGNA 2P90A 1O9HA 2ODMA 3S3WA 4FM1A 3ZMUA 3CCSV 1M1KW 2PI4A 5LHGA 4CZZA 4O2BB 3C3SA 5J2TA 4JI4B 5L3DA 2IJJA 2XAFA 5CBGA 3VBBA 1Q82W 2BCCH 4B3SB 4G27B 5JCOC 3CB2A 1PNLA 2MK3A 4JV5B 3ASNC 1B6QA 5A9GA 3D8CA 2KB1A 1XNQB 1NTKH 4JI8B 5CA0B 3PJSK 3J80N 4J9YB 2Z5UA 1V54B 2QWOB 4ZKIA 1XNRB 1SQGA 3AG3C 5L3BA 2ZE5A 1OHHG 2IU0A 4UV9A 1JA8A 2XAGA 3I55V 1AR5A 4BR6A 2XHBA 1JPXA 1PD3A 3TGUH 1DTOA 2W6IG 1M57C 3R65A 2X7RB 4JTAB 4DW1A 4DV6B 1E1RG 2ZDIA 2QDOA 3CPWU 2YXHA 2QA4V 1IVSA 4PELA 2P6JA 2UXCO 1XL4A 4YHHO 2F43G 1PL0A 1JMKC 1ZWIC 2CH7A 4MTGA 3N2GB 4FLVA 1R3LC 3UKMA 1MZEA 1KKCA 4YJ2A 3WFVA 2C2AA 3W7XA 3LNMB 2D3OW 1NH2B 1K8AW 2G38A 5KA5A 4BIOA 1R6TA 4E4EA 1FD9A 5J2UB 5BMVA 1VF6A 1SZXA 4J42A 5KHIA 1IXBA 3K9AA 4LF6O 5H6RA 4MSWC 1QLNA 1LNQA 2KSDA 3AEIA 2PI5A 4FZ0A 1ZLZA 1SC5B 4NXNB 4YY3B 4G2KA 4NB5A 4PA6A 4FLWA 1GM7A 5JJNB 1K34A 3OM3B 3ZMSA 3JATB 4ZHQB 3ABLB 4CS4A 2E76B 4GUNA 4EEQA 4QIWF 2BOBC 4DR1O 4DRXA 4J41A 3SJQC 1NQTA 2VRZA 3CXHF 2HFEC 2JVDA 4LFCB 4PA7A 4I55A 4W4KA 5IJ9A 4U7NA 4UB6Z 2EJ7A 5KLVH 4B3RB 3JAKB 3E8BA 2ARHA 1SQBH 1XHXA 2YIDA 3TCUA 1D5NA 4TUYB 4N21A 4H33A 4AQYO 1V55B 3DGEA 3RGBA 2RN9A 2ETNA 1HW7A 4KFMA 3F7VC 2RCVA 5K1PA 5LGTA 1CPYA 4X1YA 1WN7A 3JASB 4HZ3A 3ZRSA 5LOVB 1FYJA 2FB5A 3ABKC 2QWRB 4O4HB 3F5TA 3FX7A 2W0FC 3ZHUA 3BABA 2ZD9A 3M7MX 2ITDC 4P9OA 2DYRC 1FXKA 1Z2GA 1NKDA 4GX0A 3K5NA 4JYYA 3UM7A 5C93A 1YF2A 1QBZA 1N32O 4B3MO 2F4VO 5FNVA 2E75B 4KHPB 3NR7A 4LFBB 2BSKB 4DO2A 4DV7B 4LF7O 1SA0B 1VF6C 2QKCA 1US6A 4DV1B 5TISZ 3LDEA 2PY5A 1EFRG 4BW5A 3D36A 2YIBD 4WF9V 1Z5VA 1NJIW 4LF5O 3GWOA 1YTFB 3APQA 1ZL8A 1VMGA 4P2ZA 1VQKV 1HNXB 5LYJA 4DV4B 5FPRA 2HHHB 3ABMC 4TSFG 4GKJO 2EULA 3B8MA 2LFSA 1EM1A 2LW7A 4MW8A 4X20B 1X59A 3OGCC 1XMOB 3ZHQA 1M4UA 1K9MW 3STLC 5K1XA 3JAWB 2ZCEA 2ATKC 3ETEA 3E8GA 2DQ0A 2ZE8A 4FJCC 3HKBB 1AI6A 1OJHA 2VQFB 3L71H 3K79A 3E83A 2VS0A 3H1LH 5B1BB 2QSAA 3SPHA 4U3JA 4I50B 3DXRA 4DV5O 2LGWA 1I08A 1KECA 5DEDA 1CEZA 3CD6V 5LHIA 2H8PC 3B4SA 3AG3B 1X4TA 3N2KA 4HAMA 4KUMA 4JF3A 4B3TB 5LXTB 3K0GA 3K03A 3QTCA 2P4KA 3ZS8C 3ZX6A 3CX5F 4NVPA 1VF7A 2UU9B 3ZN0A 2UXNA 1BMFG 4RUFA 1NR1A 2JDIG 3IGAC 2WA4A 4DV1O 4TV8B 2UU9O 1VQ9V 3FAVA 1IXMA 3BEHA 4UCSA 1FPOA 4ZOLA 2XAHA 2YEVA 3O9OA 4FFKA 3CXCU 2Z3YA 2E5LB 5JQGA 1OCZB 1MNGA 1YEWA 4LFCO 3J81N 1L1FA 5LL6Y 1VQ7V 1J5EB 1THZA 3SYCA 2QM7A 3QO5A 1GO3F 1J95A 1I94O 2UXDO 5CMUA 4WFHA 3RYHA 4RWUA 4X8AA 2JK5C 3TETA 1FXVA 1OCOC 2VQEB 4WFFA 2E3CA 2IH1C 3ZHVA 4GT1A 2UXBO 5JVDA 2YIAA 3QF7A 4KP4A 2VQFO 1DK1A 5B1AB 4JYAB 3H9VA 1N0JA 4BAYA 5EC1C 2BTQA 2VWJA 3OUSA 3RYFA 5FL7G 3KCYA 1TUBA 3CCLV 3H01A 4K8ZA 2RDCA 1GRJA 4Z1MG 3ZHTA 3ZRWB 1N34B 1SESA 5IWAB 2YSUB 2R70A 1N33O 4I9QA 5H5NA 2EIKC 4GKJB 2JGDA 3HKCA 2QM8A 2LQTA 4R7CA 4OPAA 1WA8B 5E1AC 4DV6O 1OCCB 3A0BZ 4LNUB 1EBOA 4X1KB 1NTZH 4HNAA 2ZIOA 2DMXA 3P32A 4D7SA 4HBNA 3CCMV 4X65O 1QQCA 2L35A 4QE9A 2XAQA 1MSDA 4X1IB 2GUZB 3H1IH 4GKKO 5DECA 2BOCC 4J80A 1N4CA 4JI1B 2EBOA 4I5SA 1M56C 5LA6B 4OX9B 4X64B 2QWQB 1UPGA 2Q68A 4DYLA 3JALA 4PA9A 3E2EA 4B3RO 1HP8A 1L8DA 2QR4A 4O2AB 5KX5B 5IJ0B 1K92A 1H2GA 3BA9A 1K5QA 4FZ1A 2ILMA 1FJGB 3OT7A 3LSSA 1H2NA 4UCTA 3Q4HB 5LMNO 1IBLO 2EINC 4LR3A 4GX1A 1SF9A 1AROP 2X0LA 1OCRB 1SQPH 3SYQA 4JI5O 4YIOA 4YJ3A 3N27A 3HPLC 3PN1A 2JJ1G 1Q81W 1TVKA 4LH6A 4DV2O 4K8XA 3MHHC 2F95B 4TV9A 3C90A 4J7ZA 4JI7O 2HJFC 3FD9A 3U11A 5EBMC 2NN4A 5LGUA 1JFFB 5H2FZ 2UUBO 2HJDA 3EFFK 3HKDA 4PDLA 3T1CA 1SQVH 4I4TA 3AG4C 2FMLA 4XBFA 4R8CA 5KMGA 2A7WA 4RQFA 4AILC 1YHQV 1IURA 3CP1A 4NYKA 4FK5C 4X65B 1Q86W 1GN3A 2Q5ZA 2KG7A 3E35A 1VQMV 2PF4E 4MW3A 4H13B 3D36C 5D5PA 1N8RW 4CBCA 4H37A 3TJTA 2KKWA 4I9WA 4O4JB 4CH4A 4IYIA 4LBEC 1ORQC 3T4ZA 1R1BA 3RYCA 4UCOA 3OR6C 3CCQV 2P06A 1QHTA 3ZHRA 5EIBD 4DV7O 2CTQA 4MVRA 3JARA 1OCCC 1RPOA 5GTHZ 4KXRA 5C8YA 3QNEA 1RM1B 3HKEB 2WPDG 2ZKOA 4R6ZA 2KG7B 3K3WA 3QO7A 3W7TA 1R3IC 1ZUQA 1QLEB 1XEQA 1VQ5V 1FFXA 1F4MA 4AHCA 1GN6A 2YS8A 5EBWC 3ZRVA 4JI0B 3T2MA 2LO1A 5KHKA 5F2VO 4JTCB 4F6EA 1F7YA 3BCCH 3FB8C 5ITZA 2Y69C 2GV9A 3A0RA 2Y4UA 3X2QC 5CB4A 4BW9A 1MOFA 1OCOB 2XAJA 1U97A 1N34O 2B1GA 3IAYA 1N33B 1BGYH 3FKSG 4X88A 5H9CA 1D2DA 2DYSC 2ZXWB 3IC7A 1GK9A 1D5AA 5KHGA 1N36O 1LUVA 4JGSA 3K06A 3KCXA 1BCCH 4O4LB 1COWG 1BT8A 1NU1H 3H1JH 4DUYO 3ZJZA 2P7TC 3K04A 3E86A 1YJNV 5EZYA 3K5LA 4LFAB 4JZ2A 1FKAO 2ZDIC 3FYEB 3IFXA 3M8AA 2QWPB 3IJ4A 2B5UA 4J9ZB 3VQWA 1TAEA 3ABLC 1KMIZ 5LP6B 1SZTA 2IW5A 1KU9A 1QNMA 4MTOA 4QPKA 1EN5A 4DV3O 3KKYA 1BSMA 1ZX3A 1OCRC 3L75H 2GUZA 2F66C 3RVYA 1PL4A 3RT3C 1FJGO 2H94A 1KP2A 1QU7A 4XDLA 4BIUA 3E22A 4JI7B 4O4IB 4PDRA 3SGIA 3JD2A 3OE7G 3J7AU 3ZMZA 3CE2A 2Q9LA 5IT9N 1VQOV 2XOKG 1Y67A 1Y4MA 1CP9A 5LHHA 3JARB 1IBKB 4YHHB 4JI6B 1VQ4V 1G1XB 2ZR2A 2MW2B 5GONA 1LUWA 1RP3B 1IBLB 3RYFB 1UJWB 4KHPO 4W4LA 4C7UA 5FLXN 5B5EZ 4FMTA 5CBHA 5JVDB 1I0HA 1HNZO 4U7OA 2DE0X 5GONB 5GW7A 2A06H 3K9SA 1FXHA 5D5QA 1W59A 3LSQA 2LP7A 1P4RA 4K0KB 3SPCA 3B09A 4DK0A 5IYZA 5EIBC 2VQEO 4RO2A 5JJEB 4LF7B 1TUEB 1VEWA 2A0LA 5B1OA 3B2EE 4O4LA 1TA8A 3QO8A 4FIPC 1Q5OA 4FFBA 1H2KA 1N32B 2ZT9B 1XMOO 4O4IA 4DXWA 2UXCB 4NTWA 2YI9A 4DUZB 2X6BA 4E2LA 2UUCO 2HVJC 1HNXO 1P84F 1W0KG 1JR9A 3AG2C 4DUZO 1F51A 1RPRA 2WLNA 1W2BU 1GH6A 2JGUA 1IBMB 1L0LH 1DF5A 3SDLA 4NTYA 1ZSPA 5LP6A 1M56B 5H6QA 1AJPA 3L73H 1AI4A 5EBLC 4LCUC 3CJHA 4CH5A 1NR7A 1WB8A 1QR9A 2QJ1A 3ETQA 3RVZA 4JI4O 1WPBA 2LJ2A 2NR5A 5L3EA 4LF8O 4WFBV 1Q6UA 2XNDG 1BL8A 3CJHB 4O2AA 1M90W 4FVMA 2ZR3A 1BHAA 4X62B 3ZMTA 4PDVA 1M5IA 3X2QB 3L70H 3D3QA 1BQ0A 4XDJA 4DK1A 4O4JA 4MVUA 4NTXA 3SYAA 4ZI7A 4IHJB 2YC0A 4MTFA 3OMNB 4B08A 1P49A 1AP6A 1NVPB 4JI8O 5J9PC 3ETGA 2OWOA 5JH7B 2YXLA 2WLIA 4HNAB 1BQZA 4X9QA 1XREA 2A79B 1YJ9V 3E89A 4ABMA 4QE7A 3S3XA 4FFBB 2WLIB 3HKEA 2EZOA 2JGDB 3WB2A 1MSWD 4JYAO 4PV1B 4TQDA 2OT5A 4EFEA 5B3SB 2W6JG 4ZI7B 5HFLA 1NZ6A 3FB6C 2R9AA 1HWYA 2DN9A 5CN0A 1FFTB 4UCUA 2GTSA 5B3SC 3I56V 1NTMH 5LP6C 1NVPD 1AJNA 1ZAUA 2HLDG 4I0XA 3JASA 1VF5B 3HB3B 4DV3B 1B3QA 2V7QG 1OZ0A 1BE3H 2WLHA 4JTDB 3ZRXA 3P30A 1VQ8V 2DWEC 2UUAB 2IJIA 2OIGA 3APOA 4JYCA 1F23A 3L9DA 1GM8A 3STZC 1PM9A 4TUYA 3OMAB 2IJKA 4LF4B 4IL6Z 5CBFA 5JQGB 5BXZA 5KX5A 1IBMO 3MAQA 3FB5C 4JZGA 4FLUA 5E79Z 5B1BC 1ROPA 3UO3A 3JALB 3OW2U 1JFFA 2WWWA 1ENVA 5LA6A 1S5LZ 3KG2A 1AB3A 2Q7GA 3K59A 4Q6GA 1HR0O 3WB1A 5ITZB 3OEHG 4YXWG 1HNWB 2RNBA 4UVAA 5IYBO 4BWAA 2FTKA 5LXTA 1S3JA 4DR1B 1FFXB 1KBHA 3AG2B 1XILA 2UUBB 4DR6B 1U96A 4JV5O 1WLEA 5KAIZ 1QR8A 4DV0O 1YI2V 1XI1A 4JI2B 3OTFA 4PJ0Z 2AHZA 1B04A 4DV2B 4MVOA 1GM9A 1WP7A 3ML0A 3A8TA 4U3JB 4DR3O 2PUSA 3OFNG 4I0XB 3BY6A 3K5MA 5B1NA 3ABUA 1WNSA 2DOSA 1YXBA 4HYOA 1VP7A 2QM4A 1S0VA 3TXQA 4JPRA 2QEXV 3P3NA 4X66B 1XMQO 3RYCB 2CGOA 2Y48A 1H38A 2IBZH 5CB4B 3W7UA 1GMGA 1P7GA 3BAAA 1Z5WA 4TQFA 5B1AC 1KYOF 1AVMA 3ZMVA 4NKGB 4QNHB 1V9PA 2CUGA 1S77D 2Y4TA 1MG1A 3G4SV 2F4VB 2NNUA 4LNUA 2BTOA 2AGAA 2HHHO 1BZKA 1HDJA 2UXDB 1IBKO 2YEVB 1QCEA 5KHJA 4Z2WA 3G71V 5JH7A 4I4TB 2EILB 5C8YB 4MT8A 1AI7A 1SQFA 3HKDB 3ZRWA 2ZM6O 3T1YO 4IHJA 1XUQA 4TV8A 2E74B 3AG4B 4U3FH 4FM0A 2CTPA 1WB7A 2ZXWC 3CRMA 2RJZA 1FXKB 1ZTEA 1CXZB 4IYHA 1URFA 1TVKB 2M7WA 1J5EO 4WCEV 4O4HA 5IWAO 3N2KB 4GZRB 4O2BA 1YCIA 4MTXA 5CA3A 1KKDA 2EINB 1H8EG 2UUCB 4FPPA 4MVZA 1FS0G 2D2CB 4DR7B 1K4DC 1PP9H 1G4YB 5IJ0A 1YIJV 2PTMA 3CEIA 3EXAA 5KMGB 1RM1C 5IDJA 3OAAG 3B77A 3CMAV 4AQYB 2V1DA 4PA4A 2ZNJA 2UUAO 1GAXA 5IJ9B 3CRRA 4QGPA 4JYBA 2Q8VA 4BIZA 3OEEG 4B3TO 1SQQH 2CGNA 2F93B 1SERA 4JI2O 3K0DA 4J7JA 3JATA 3W7WA 3T1HB 4DR4O 1I5XA 3OUFA 3ZIAG 2P22C 4UXNA 4YJ3B 2Q7HA 5DM6V 3LSUA 4FLZA 2GBOA 1W0JG 4X1KA 5HFMA 2YDEA 1R6KA 1ZL8B 4I7ZB 4IGGA 4CC6A 4GKKB 1MZFA 4LH7A 1R3JC 2EILC 3AK2A 3IC9A 1A32A 3THOA 3NXSA 5IYZB 3CYOA 4J11A 3BPZA 1S72V 2UXBB 1G8MA 1PPJH 3CCUV 3UCSC 5BMVB 3CC7V 1I94B 2LW1A 1I5YA 2BTQB 2V4DA 1GKFA 4CS2A 1YTFD 3W7SA 3UQ8A 2ZINA 4UVCA 4PDMA 4OGQB 3VOUA 2AZ0A 2Q6AA 2RQ6A 4OPHA 2K9PA 2Q4PA 4X1YB 3E8FA 4X1IA 2CDYA 3CCEV 3RYHB 5L3GA 1UFIA 4JAUA 3CRQA 3ABTA 1AP5A 3G6EV 4JAVA 2IM9A 3GWKC 1HNWO 1KP3A 5IE9A 1F4NA 1S5JA 3SJCC 1KC8W 3BRCA 1MA1A 3E22B 3QVNA 4GLXA 1EN4A 2R9IA 3CCRV 2FKXA 2IU3A 2GTAA 5FNVB 2AXTZ 4JI3O 2ZNIA 5JWPA 4CH6A 5LBQA 2OCCC 5LGNA 1KUQA 3E8HA 4LF4O 4MS2A 1I7FA 5BR8O 4D7TA 4DR5O 1YITV 2RMKB 2FL4A 5EZYB 1MMMA 1XNQO 2EJRA 5J2TB 1K33A 2X6AA 2JS5A 3JD0A 3JCZA 3Q4HA 1Y66A 5KAFZ 1S76D 1WJZA 4UVBA 4JI0O 1EZVH 2EX3A 4X89A 3BHPA 2CTRA 2L6LA 2YICA 2JS3A 2WLKA 4GCZA 5J2UA 1YDXA 4RAIA 3TK1A 4F6RA 1SQXH 2PYJA 5B66Z 3HR0A 4ZOLB 2A3QA 3RN4A 3RWRD 4J7KA 4DW0A 1Q43A 4DR2B 3FAVB 4JASA 1VARA 1L0NH 5KHHA 4NXNO 1FAFA 4WFEA 1Q8IA 2JJ2G 4DR7O 2Q69A 4GX2A 3SJAC 1K5SA 2WLLA 2WAMA 1XQ8A 1H2SB 1XNRO 3OMIB 2QTOA 2DWDC 1PV0A 2WLJA 3MDSA 3A0HZ 3SYPA 3ABMB 2CK3G 2GHYA 1R3KC 4QJFB 1WA8A 3T1HO 4DR4B 2UXXA 3HKCB 5EK0A 3ETDA 4DR3B 1YJWV 1JX9A 1Q90D 3CS5A 5L3CA 2BSKA 3CC4V 1EZJA 1OCZC 3R66A 2ZM6B 3T1YB 4L8JA 2EIKB 3FYIB 4X66O 1VQNV 1GTOA 1TUBB 2Q67A 3CWBH 1E1QG 4ICGA 3HKBA 1IZ3A 1XMQB 3SPGA 4X62O 1SRYA 4LC1A 3SR2C 2OCHA 1BHBA 4EFBA 5A2QN 2OTJV 3JAWA 3ZCCA 1QVFU 5IYDO 4LF8B 3F5WC 3ICXA 2DYRB 4DUYB 4J10A 2QTSA 3VQVA 4EKWA 5AG2A 1P7BA 2LGQA 4K3AA 3OTOB 3ABKB 5LYJB 2E5LO 1H2MA 4H44B 4MVMA 2HEPA 1B06A 4XDKA 4LFBO 2H3OA 1MABG 3BFRA 4AI8A 4LWSA 1QVGU 1DF4A 2X6CA 4K35A 2WA3A 1AR1B 1Q3EA 4ZBMA 2CE4A 1WPXA 2CTWA 4FLYA 4LP8A 4TV9B 3ZN1A 4NXMO 2Y0PA 1T5EA 4F4LA 4CH3A 1AILA 4DV0B 3UO2A 5KUMA 2B1IA 1AI5A 2IJHA 3CC2V 2YUAA 2GDSA 2Y69B 4JI1O 2Z0AA 2HKOA 5IY5C 2EZPA 1VIBA 1JQ0A 2QE7G 3G67A 3GB7C 3LNNA 2A9HA 4NXMB 1K7DA 1KQSU 1JJ2U 1YSCA 2PZSA 2N05A 3T4DA 4DV5B 1JVMA 1O9GA 3AK3A 3CRAA 1JJOA 4KL1A 1WAZA 4I55B 3DC6A 4NR1A 3K57A 2AHYA 1M93A 5LMNB 2XUMA 4ASUG 2P4VA 5LMUB 5EYPB 3N2GA 3EHBB 4X20A 3BA8A 3A2FA 4FLXA 4TT3G 4WFGA 1JCHA 3WU2Z 4PI2A 3SPIA 3CSXA 1PKXA 4UCRA 2ZE7A 3RYIB 1SKVA 1Q6HA 2F1MA 4PHZA 4DR5B 2Q73A 3DC5A 4Z1VA 4B3SO 1TGOA 1HR0B 1KB9F 2HP8A 1M57B 3AG1B 2EIMB 3WG7C 1SA0A 3L72H 1S5HC 2YI8A 3OR7C 1Y6XA 2JEUA 2KQXA 5CA0A 1E79G 1GN4A 2QWNB 3ZBHA 1V54C 4LFAO
chains in the Genus database with same CATH topology
3FB8C 3RW0A 1K34A 2Y69C 2ZXWC 3OM3B 3A0RA 3JD4A 3SYOA 3ZMSA 3SPJA 3X2QC 3ABLB 1FXKB 1MOFA 4QIWF 2BOBC 1OCOB 2XAJA 3SJQC 2M7WA 1NQTA 2B1GA 4WCEV 2HFEC 2XASA 3FKSG 4X88A 5H9CA 4PA7A 4U7NA 2DW4A 2DYSC 4G28B 2ZXWB 3IC7A 1GK9A 3E8BA 4MTXA 5L3FA 4JGSA 5CA3A 3K06A 2WLMA 1KKDA 1COWG 3TCUA 2EINB 1NBMG 4R50A 1H8EG 4OXSA 3ZJZA 4FPPA 4MVZA 1FS0G 4H33A 4N21A 1V55C 1V55B 3DGEA 1K4DC 2P7TC 4KFMA 1NH2D 3LDDA 3F7VC 1G4YB 4RQEA 1YIJV 2EIJB 5LGTA 3K04A 3E86A 5EC2C 1YJNV 2JEXA 1RM1C 1CPYA 1V54C 5IDJA 3OAAG 3B77A 3CMAV 4HZ3A 2V1DA 2ZDIC 3ZRSA 3FYEB 2DQ3A 3IFXA 4PA4A 2GSMB 3ABKC 2B5UA 2DYSB 4J9ZB 4JYBA 4BIZA 3ABLC 3OEEG 2W0FC 1SZTA 2HR3A 2IW5A 2ZD9A 4MTOA 4PA6A 4QPKA 2ITDC 2K1EA 1M9NA 1SERA 4P9OA 2DYRC 3K0DA 1FXKA 1NKDA 4GX0A 1OCRC 3W7WA 3UM7A 1I5XA 3JD3A 5C93A 3OUFA 1QBZA 4TWKA 3ZIAG 4UXNA 3RVYA 5BZBA 5DM6V 3ASOC 2H94A 1W0JG 4DO2A 5HFMA 1KP2A 1R6KA 4XDLA 4BIUA 3LDEA 1EFRG 4BW5A 1R3JC 2EILC 1QLEC 3D36A 4PDRA 3JD2A 4WF9V 3OE7G 1NJIW 3ZMZA 3GWOA 1YTFB 1VQOV 3NXSA 3CYOA 2OTLV 1S72V 1G8MA 2XOKG 4P2ZA 1VQKV 3CCUV 1Y4MA 1CP9A 5LHHA 3CC7V 1VQ4V 3ABMC 4TSFG 3B8MA 2LFSA 1I5YA 2ZR2A 3ASOB 4MW8A 1GKFA 3OGCC 1YTFD 1VQLV 1UJWB 3DTUB 1K9MW 3W7SA 2WLLB 3STLC 3FB7C 1K3EA 3K08A 4FMTA 4MVQA 2LFRA 2ATKC 4UVCA 5CBHA 3ETEA 3E8GA 4PDMA 2DQ0A 3VOUA 4FJCC 2Q6AA 3F7YC 4U7OA 4UV8A 5GW7A 3E8FA 1FXHA 3LSQA 1AI6A 3CCEV 5L3GA 2LP7A 4JAUA 3K79A 1SETA 4Q20A 1P4RA 3ABTA 1H8HG 3E83A 3AG1C 3SPCA 3G6EV 4JAVA 5B1BB 5IYCO 4RO2A 1TUEB 2A0LA 5B1OA 3SPHA 5KUKA 2QKSA 1KP3A 2EIJC 1F4NA 1KC8W 3QO8A 4FIPC 5IY5B 1PNMA 1KECA 4DXWA 4UUJC 4N23A 2R9IA 2HG5C 3CCRV 1CEZA 3CD6V 2X6BA 5LHIA 1K97A 4E2LA 2H8PC 2IU3A 2HVJC 3AG3B 4HAMA 4KUMA 1W0KG 4JF3A 2HVKC 3AG2C 3JYCA 3K0GA 1F51A 1RPRA 3K03A 1K4CC 2WLNA 1W2BU 5LBQA 3MHSC 2OCCC 5LGNA 3D3IA 3ASNB 3E8HA 3JD1A 4MS2A 3ZN0A 2UXNA 1DF5A 1PNKA 1BMFG 4RUFA 1NR1A 2JDIG 1DLBA 3IGAC 1YITV 1M56B 3MD0A 2P67A 5H6QA 1AJPA 1VQ9V 1AI4A 1IXMA 2EJRA 3BEHA 5EBLC 1K33A 2X6AA 4LCUC 3JD0A 3JCZA 3LDCA 1NR7A 4MVSA 2XAHA 1VQ6V 2YEVA 3CXCU 2Z3YA 1Y66A 1S76D 1QR9A 1OCZB 2IH3C 4UVBA 1L1FA 3RVZA 2ZQMA 4X89A 1VQ7V 1KD1W 2EIMC 1THZA 3SYCA 2QM7A 3WG7B 3QO5A 1GO3F 5KA6A 1J95A 5L3EA 4GCZA 4WFBV 1XL6A 2WLKA 1Q7YW 5CMUA 4RAIA 2XNDG 4WFHA 3TK1A 1BL8A 4WFAV 4X8AA 2JK5C 1M90W 2ZR3A 3LUTB 3M99B 5DN6G 3TETA 1FXVA 1BHAA 1OCOC 3ZMTA 4JASA 3CMEV 1R6NA 4GX5A 4WFFA 4PDVA 2IH1C 2OCCB 2R9RB 1FXKC 2WSSG 4GT1A 1AJQA 3X2QB 4WFEA 2JJ2G 4KP4A 2Q69A 5B1AB 4GX2A 4XDJA 4BAYA 5EC1C 1K5SA 2WLLA 2WAMA 3OUSA 5FL7G 3OMIB 4MVUA 3SYAA 4QPJA 4MTFA 2QTOA 3OMNB 2DWDC 3CCLV 2WLJA 3H01A 3B8NA 4Z1MG 1NVPB 4PA3A 3ETGA 3SYPA 5J9PC 3ABMB 3ZRWB 1SESA 2CK3G 2GHYA 1R3KC 2YSUB 2WLIA 4QJFB 1JOYA 2EIKC 2NLJC 2A79B 1YJ9V 3E89A 2QM8A 4QE7A 2UXXA 4R7CA 5EK0A 5E1AC 3ETDA 1YJWV 1OCCB 2WLIB 1EBOA 1JX9A 2EZOA 3CCVV 5L3CA 3CC4V 1MSWD 3P32A 1EZJA 1OCZC 4P30A 2OT5A 2EIKB 2ITCC 3FYIB 3CCMV 1VQNV 1GTOA 2Q67A 5B3SB 4QE9A 1E1QG 2W6JG 2XAQA 5HFLA 3FB6C 3SPGA 1SRYA 2BOCC 4LC1A 2JIZG 1BHBA 4L87A 1HWYA 2OTJV 2EBOA 4I5SA 1M56C 3ZCCA 1QVFU 5CN0A 5IYDO 1FFTB 3F5WC 2DYRB 2Q68A 5B3SC 3I56V 3RBZA 4EKWA 4RUEA 1P7BA 4PA9A 4P9PA 3E2EA 1NVPD 1AJNA 2HLDG 3ABKB 3CCJV 3HB3B 1VQPV 2V7QG 1K92A 1OZ0A 1H2GA 1K73W 2WLHA 1R73A 4JTDB 3ZRXA 3P30A 1VQ8V 2DWEC 1K5QA 2IJIA 4MVMA 4XDKA 4JYCA 1F23A 1GM8A 3STZC 3LSSA 1MABG 2P90A 3OMAB 2IJKA 3ZMUA 5CBFA 3CCSV 1QVGU 2EINC 1DF4A 3FB5C 1M1KW 2X6CA 1AR1B 2PI4A 4ZBMA 5LHGA 4GX1A 4CZZA 1AROP 2X0LA 5B1BC 1ROPA 1OCRB 3SYQA 3OW2U 1WPXA 3HPLC 5L3DA 2WWWA 2IJJA 2JJ1G 2XAFA 1ENVA 5CBGA 1Q81W 3VBBA 4LP8A 3MHHC 3ZN1A 1Q82W 3KG2A 4G27B 4F4LA 1PNLA 2MK3A 2HJFC 3ASNC 5EBMC 3OEHG 1B6QA 4YXWG 5LGUA 2KB1A 4UVAA 5IYBO 5KUMA 3PJSK 2B1IA 2FTKA 1AI5A 2IJHA 3EFFK 4PDLA 3CC2V 1S3JA 4J9YB 2Y69B 3T1CA 2Z5UA 2HKOA 3AG2B 5IY5C 1V54B 3AG4C 2EZPA 1WLEA 4XBFA 4ZKIA 1JQ0A 3AG3C 4R8CA 5L3BA 1QR8A 4RQFA 1OHHG 1YHQV 1YI2V 2IU0A 4UV9A 3CP1A 2XAGA 3I55V 2QE7G 4FK5C 2AHZA 3GB7C 1Q86W 1JPXA 1PD3A 4MVOA 2A9HA 1GM9A 1K7DA 3E35A 3ML0A 1KQSU 1DTOA 2W6IG 1VQMV 1M57C 3R65A 1JJ2U 2X7RB 1YSCA 4MW3A 1N8RW 4JTAB 4CBCA 3OFNG 1E1RG 2ZDIA 3BY6A 3CPWU 2QA4V 5B1NA 3ABUA 4H37A 3T4DA 1JVMA 4PELA 4I9WA 2P6JA 4HYOA 1XL4A 2F43G 1S0VA 1PL0A 4JPRA 2AHYA 1ZWIC 4MTGA 2QEXV 4ASUG 4LBEC 1ORQC 3T4ZA 1R3LC 2Y48A 1H38A 3UKMA 3EHBB 3W7UA 3OR6C 3CCQV 1GMGA 3WFVA 2C2AA 3W7XA 3LNMB 4TT3G 5B1AC 2D3OW 1NH2B 1K8AW 4WFGA 5KA5A 1JCHA 3ZMVA 3SPIA 4QNHB 4MVRA 1PKXA 1OCCC 1RPOA 1S77D 1MG1A 3G4SV 3QNEA 1RM1B 2NNUA 2WPDG 4R6ZA 3K9AA 5H6RA 1M57B 3K3WA 3QO7A 3AG1B 4MSWC 2EIMB 3WG7C 3W7TA 1QLNA 2YEVB 1QCEA 1LNQA 3AEIA 2PI5A 3G71V 1S5HC 1R3IC 3OR7C 2JEUA 1QLEB 2EILB 1VQ5V 4MT8A 1AI7A 1F4MA 5EBWC 3ZRVA 3ZRWA 3T2MA 1E79G 4G2KA 4JTCB 3AG4B 1GM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FXK A;  1FXK B;  2ZDI A;  3AEI A;  2ZQM A;  1FXK C;  2ZDI C; 
#chains in the Genus database with same CATH topology
 3AG7 A;  3CHX A;  3RW0 A;  4D6T H;  3JD4 A;  3SYO A;  3SPJ A;  3U10 A;  3K5O A;  4UFZ A;  5LOV A;  5BY1 A;  2XAS A;  2CH7 B;  4B3M B;  2DW4 A;  4G28 B;  4IIJ A;  5L3F A;  1NT2 B;  2WLM A;  4H0L B;  4GYC B;  4LWS B;  4OX9 O;  1NBM G;  4R50 A;  4OXS A;  2ZE6 A;  3EVK A;  1V55 C;  5JJJ B;  1NH2 D;  3LDD A;  4RQE A;  2EIJ B;  3OD4 A;  3JAK A;  3SJB C;  4TOI A;  2B9Z A;  5EC2 C;  2JEX A;  3G80 A;  4IIJ B;  4DV4 O;  2DQ3 A;  1XDC A;  2GSM B;  2DYS B;  3U0Z A;  2ADP A;  3TXS A;  3VQX A;  2HR3 A;  2Y0I A;  3FFQ A;  4ZHQ A;  2K1E A;  1M9N A;  3JD3 A;  5CA1 A;  4TWK A;  4X64 O;  5BZB A;  1LR1 A;  2F23 A;  3ASO C;  2QKA A;  1H2L A;  3DSQ A;  2CAZ C;  4K0K O;  1XHZ A;  3CRC A;  3DXR B;  4UB8 Z;  4I50 A;  1QLE C;  3B40 A;  3OTO O;  2O57 A;  3C3T A;  2OTL V;  2FYU H;  2XT9 A;  3H1K H;  1AR4 A;  2N74 A;  2AW9 A;  2YXY A;  2OYQ A;  5CA1 B;  1N0N A;  5FPO A;  3ASO B;  2AZ2 A;  2JRI A;  2R72 A;  1VQL V;  3DTU B;  3WB0 A;  2WLL B;  3FB7 C;  1K3E A;  3K08 A;  4MVQ A;  2LFR A;  5EYP A;  4YIP A;  3QG5 A;  3F7Y C;  1N36 B;  3VQY A;  4UV8 A;  5GTI Z;  4CS3 A;  1SET A;  4FLT A;  4Q20 A;  1H8H G;  3AG1 C;  4F6R B;  1Y74 B;  5LMU O;  1HNZ B;  3JSN A;  5IYC O;  2DJV A;  4B7E A;  5KUK A;  3UT5 A;  2QKS A;  2EIJ C;  5IY5 B;  1PNM A;  4UUJ C;  3K58 A;  4N23 A;  2HG5 C;  1K97 A;  4JI6 O;  1RSO B;  2HVK C;  3JYC A;  3BVO A;  4JI5 B;  1K4C C;  4IT5 A;  2VWK A;  3MHS C;  4WBN A;  4WBN B;  3D3I A;  3ASN B;  2W0X A;  3JD1 A;  1Q6I A;  1PNK A;  1DLB A;  3JAM N;  3GVM A;  3MD0 A;  2P67 A;  1YZB A;  5JCO A;  4FM2 A;  1XBL A;  4PI0 A;  3LDC A;  1DGS A;  4MVS A;  1VQ6 V;  1G6U A;  2ADQ B;  3ZED A;  1YVW A;  2IH3 C;  4JI3 B;  4ZIB A;  1XOU A;  2ZQM A;  1KD1 W;  2EIM C;  3WG7 B;  1Y74 A;  1IX9 A;  5KA6 A;  2PYL A;  3O65 A;  1Q7Y W;  1NS1 A;  1XL6 A;  1IDS A;  4PD4 F;  3ZHS A;  4WFA V;  4LF6 B;  3LUT B;  3M99 B;  5DN6 G;  3CME V;  1R6N A;  4GX5 A;  4CC5 A;  4DRX B;  3H1H H;  2OCC B;  2R9R B;  1FXK C;  2WSS G;  1AJQ A;  3G6B A;  4YY3 O;  2Q0O C;  3JCU Z;  2P5O A;  2Q0A A;  4QPJ A;  1NI8 A;  2YIB A;  4EB6 B;  3B8N A;  3JSL A;  4A5U B;  1RSO A;  4PA3 A;  1Y76 A;  1JOY A;  2Q7E A;  1WP8 A;  2NLJ C;  4LF9 O;  5BR8 B;  4B7K A;  2BE3 A;  2ZIM A;  3UT5 B;  3CCV V;  1Y76 B;  4P30 A;  4EB6 A;  2ITC C;  1BS3 A;  3RYI A;  3I5D A;  3OGI B;  1EN6 A;  4DR2 O;  4YJ2 B;  2JIZ G;  2OIE A;  3AK1 A;  4L87 A;  4LF9 B;  2XTA A;  3RFR A;  3RBZ A;  4UCV A;  2M6Y A;  4RUE A;  4P9P A;  3KZI Z;  1OV9 A;  4LF5 B;  3P3P A;  4JAA A;  3CCJ V;  1VQP V;  2N04 A;  2PGG A;  3L74 H;  4DR6 O;  1K73 W;  1R73 A;  1RFY A;  1GN2 A;  1SS3 A;  2QGN A;  2P90 A;  1O9H A;  2ODM A;  3S3W A;  4FM1 A;  3ZMU A;  3CCS V;  1M1K W;  2PI4 A;  5LHG A;  4CZZ A;  4O2B B;  3C3S A;  5J2T A;  4JI4 B;  5L3D A;  2IJJ A;  2XAF A;  5CBG A;  3VBB A;  1Q82 W;  2BCC H;  4B3S B;  4G27 B;  5JCO C;  3CB2 A;  1PNL A;  2MK3 A;  4JV5 B;  3ASN C;  1B6Q A;  5A9G A;  3D8C A;  2KB1 A;  1XNQ B;  1NTK H;  4JI8 B;  5CA0 B;  3PJS K;  3J80 N;  4J9Y B;  2Z5U A;  1V54 B;  2QWO B;  4ZKI A;  1XNR B;  1SQG A;  3AG3 C;  5L3B A;  2ZE5 A;  1OHH G;  2IU0 A;  4UV9 A;  1JA8 A;  2XAG A;  3I55 V;  1AR5 A;  4BR6 A;  2XHB A;  1JPX A;  1PD3 A;  3TGU H;  1DTO A;  2W6I G;  1M57 C;  3R65 A;  2X7R B;  4JTA B;  4DW1 A;  4DV6 B;  1E1R G;  2ZDI A;  2QDO A;  3CPW U;  2YXH A;  2QA4 V;  1IVS A;  4PEL A;  2P6J A;  2UXC O;  1XL4 A;  4YHH O;  2F43 G;  1PL0 A;  1JMK C;  1ZWI C;  2CH7 A;  4MTG A;  3N2G B;  4FLV A;  1R3L C;  3UKM A;  1MZE A;  1KKC A;  4YJ2 A;  3WFV A;  2C2A A;  3W7X A;  3LNM B;  2D3O W;  1NH2 B;  1K8A W;  2G38 A;  5KA5 A;  4BIO A;  1R6T A;  4E4E A;  1FD9 A;  5J2U B;  5BMV A;  1VF6 A;  1SZX A;  4J42 A;  5KHI A;  1IXB A;  3K9A A;  4LF6 O;  5H6R A;  4MSW C;  1QLN A;  1LNQ A;  2KSD A;  3AEI A;  2PI5 A;  4FZ0 A;  1ZLZ A;  1SC5 B;  4NXN B;  4YY3 B;  4G2K A;  4NB5 A;  4PA6 A;  4FLW A;  1GM7 A;  5JJN B;  1K34 A;  3OM3 B;  3ZMS A;  3JAT B;  4ZHQ B;  3ABL B;  4CS4 A;  2E76 B;  4GUN A;  4EEQ A;  4QIW F;  2BOB C;  4DR1 O;  4DRX A;  4J41 A;  3SJQ C;  1NQT A;  2VRZ A;  3CXH F;  2HFE C;  2JVD A;  4LFC B;  4PA7 A;  4I55 A;  4W4K A;  5IJ9 A;  4U7N A;  4UB6 Z;  2EJ7 A;  5KLV H;  4B3R B;  3JAK B;  3E8B A;  2ARH A;  1SQB H;  1XHX A;  2YID A;  3TCU A;  1D5N A;  4TUY B;  4N21 A;  4H33 A;  4AQY O;  1V55 B;  3DGE A;  3RGB A;  2RN9 A;  2ETN A;  1HW7 A;  4KFM A;  3F7V C;  2RCV A;  5K1P A;  5LGT A;  1CPY A;  4X1Y A;  1WN7 A;  3JAS B;  4HZ3 A;  3ZRS A;  5LOV B;  1FYJ A;  2FB5 A;  3ABK C;  2QWR B;  4O4H B;  3F5T A;  3FX7 A;  2W0F C;  3ZHU A;  3BAB A;  2ZD9 A;  3M7M X;  2ITD C;  4P9O A;  2DYR C;  1FXK A;  1Z2G A;  1NKD A;  4GX0 A;  3K5N A;  4JYY A;  3UM7 A;  5C93 A;  1YF2 A;  1QBZ A;  1N32 O;  4B3M O;  2F4V O;  5FNV A;  2E75 B;  4KHP B;  3NR7 A;  4LFB B;  2BSK B;  4DO2 A;  4DV7 B;  4LF7 O;  1SA0 B;  1VF6 C;  2QKC A;  1US6 A;  4DV1 B;  5TIS Z;  3LDE A;  2PY5 A;  1EFR G;  4BW5 A;  3D36 A;  2YIB D;  4WF9 V;  1Z5V A;  1NJI W;  4LF5 O;  3GWO A;  1YTF B;  3APQ A;  1ZL8 A;  1VMG A;  4P2Z A;  1VQK V;  1HNX B;  5LYJ A;  4DV4 B;  5FPR A;  2HHH B;  3ABM C;  4TSF G;  4GKJ O;  2EUL A;  3B8M A;  2LFS A;  1EM1 A;  2LW7 A;  4MW8 A;  4X20 B;  1X59 A;  3OGC C;  1XMO B;  3ZHQ A;  1M4U A;  1K9M W;  3STL C;  5K1X A;  3JAW B;  2ZCE A;  2ATK C;  3ETE A;  3E8G A;  2DQ0 A;  2ZE8 A;  4FJC C;  3HKB B;  1AI6 A;  1OJH A;  2VQF B;  3L71 H;  3K79 A;  3E83 A;  2VS0 A;  3H1L H;  5B1B B;  2QSA A;  3SPH A;  4U3J A;  4I50 B;  3DXR A;  4DV5 O;  2LGW A;  1I08 A;  1KEC A;  5DED A;  1CEZ A;  3CD6 V;  5LHI A;  2H8P C;  3B4S A;  3AG3 B;  1X4T A;  3N2K A;  4HAM A;  4KUM A;  4JF3 A;  4B3T B;  5LXT B;  3K0G A;  3K03 A;  3QTC A;  2P4K A;  3ZS8 C;  3ZX6 A;  3CX5 F;  4NVP A;  1VF7 A;  2UU9 B;  3ZN0 A;  2UXN A;  1BMF G;  4RUF A;  1NR1 A;  2JDI G;  3IGA C;  2WA4 A;  4DV1 O;  4TV8 B;  2UU9 O;  1VQ9 V;  3FAV A;  1IXM A;  3BEH A;  4UCS A;  1FPO A;  4ZOL A;  2XAH A;  2YEV A;  3O9O A;  4FFK A;  3CXC U;  2Z3Y A;  2E5L B;  5JQG A;  1OCZ B;  1MNG A;  1YEW A;  4LFC O;  3J81 N;  1L1F A;  5LL6 Y;  1VQ7 V;  1J5E B;  1THZ A;  3SYC A;  2QM7 A;  3QO5 A;  1GO3 F;  1J95 A;  1I94 O;  2UXD O;  5CMU A;  4WFH A;  3RYH A;  4RWU A;  4X8A A;  2JK5 C;  3TET A;  1FXV A;  1OCO C;  2VQE B;  4WFF A;  2E3C A;  2IH1 C;  3ZHV A;  4GT1 A;  2UXB O;  5JVD A;  2YIA A;  3QF7 A;  4KP4 A;  2VQF O;  1DK1 A;  5B1A B;  4JYA B;  3H9V A;  1N0J A;  4BAY A;  5EC1 C;  2BTQ A;  2VWJ A;  3OUS A;  3RYF A;  5FL7 G;  3KCY A;  1TUB A;  3CCL V;  3H01 A;  4K8Z A;  2RDC A;  1GRJ A;  4Z1M G;  3ZHT A;  3ZRW B;  1N34 B;  1SES A;  5IWA B;  2YSU B;  2R70 A;  1N33 O;  4I9Q A;  5H5N A;  2EIK C;  4GKJ B;  2JGD A;  3HKC A;  2QM8 A;  2LQT A;  4R7C A;  4OPA A;  1WA8 B;  5E1A C;  4DV6 O;  1OCC B;  3A0B Z;  4LNU B;  1EBO A;  4X1K B;  1NTZ H;  4HNA A;  2ZIO A;  2DMX A;  3P32 A;  4D7S A;  4HBN A;  3CCM V;  4X65 O;  1QQC A;  2L35 A;  4QE9 A;  2XAQ A;  1MSD A;  4X1I B;  2GUZ B;  3H1I H;  4GKK O;  5DEC A;  2BOC C;  4J80 A;  1N4C A;  4JI1 B;  2EBO A;  4I5S A;  1M56 C;  5LA6 B;  4OX9 B;  4X64 B;  2QWQ B;  1UPG A;  2Q68 A;  4DYL A;  3JAL A;  4PA9 A;  3E2E A;  4B3R O;  1HP8 A;  1L8D A;  2QR4 A;  4O2A B;  5KX5 B;  5IJ0 B;  1K92 A;  1H2G A;  3BA9 A;  1K5Q A;  4FZ1 A;  2ILM A;  1FJG B;  3OT7 A;  3LSS A;  1H2N A;  4UCT A;  3Q4H B;  5LMN O;  1IBL O;  2EIN C;  4LR3 A;  4GX1 A;  1SF9 A;  1ARO P;  2X0L A;  1OCR B;  1SQP H;  3SYQ A;  4JI5 O;  4YIO A;  4YJ3 A;  3N27 A;  3HPL C;  3PN1 A;  2JJ1 G;  1Q81 W;  1TVK A;  4LH6 A;  4DV2 O;  4K8X A;  3MHH C;  2F95 B;  4TV9 A;  3C90 A;  4J7Z A;  4JI7 O;  2HJF C;  3FD9 A;  3U11 A;  5EBM C;  2NN4 A;  5LGU A;  1JFF B;  5H2F Z;  2UUB O;  2HJD A;  3EFF K;  3HKD A;  4PDL A;  3T1C A;  1SQV H;  4I4T A;  3AG4 C;  2FML A;  4XBF A;  4R8C A;  5KMG A;  2A7W A;  4RQF A;  4AIL C;  1YHQ V;  1IUR A;  3CP1 A;  4NYK A;  4FK5 C;  4X65 B;  1Q86 W;  1GN3 A;  2Q5Z A;  2KG7 A;  3E35 A;  1VQM V;  2PF4 E;  4MW3 A;  4H13 B;  3D36 C;  5D5P A;  1N8R W;  4CBC A;  4H37 A;  3TJT A;  2KKW A;  4I9W A;  4O4J B;  4CH4 A;  4IYI A;  4LBE C;  1ORQ C;  3T4Z A;  1R1B A;  3RYC A;  4UCO A;  3OR6 C;  3CCQ V;  2P06 A;  1QHT A;  3ZHR A;  5EIB D;  4DV7 O;  2CTQ A;  4MVR A;  3JAR A;  1OCC C;  1RPO A;  5GTH Z;  4KXR A;  5C8Y A;  3QNE A;  1RM1 B;  3HKE B;  2WPD G;  2ZKO A;  4R6Z A;  2KG7 B;  3K3W A;  3QO7 A;  3W7T A;  1R3I C;  1ZUQ A;  1QLE B;  1XEQ A;  1VQ5 V;  1FFX A;  1F4M A;  4AHC A;  1GN6 A;  2YS8 A;  5EBW C;  3ZRV A;  4JI0 B;  3T2M A;  2LO1 A;  5KHK A;  5F2V O;  4JTC B;  4F6E A;  1F7Y A;  3BCC H;  3FB8 C;  5ITZ A;  2Y69 C;  2GV9 A;  3A0R A;  2Y4U A;  3X2Q C;  5CB4 A;  4BW9 A;  1MOF A;  1OCO B;  2XAJ A;  1U97 A;  1N34 O;  2B1G A;  3IAY A;  1N33 B;  1BGY H;  3FKS G;  4X88 A;  5H9C A;  1D2D A;  2DYS C;  2ZXW B;  3IC7 A;  1GK9 A;  1D5A A;  5KHG A;  1N36 O;  1LUV A;  4JGS A;  3K06 A;  3KCX A;  1BCC H;  4O4L B;  1COW G;  1BT8 A;  1NU1 H;  3H1J H;  4DUY O;  3ZJZ A;  2P7T C;  3K04 A;  3E86 A;  1YJN V;  5EZY A;  3K5L A;  4LFA B;  4JZ2 A;  1FKA O;  2ZDI C;  3FYE B;  3IFX A;  3M8A A;  2QWP B;  3IJ4 A;  2B5U A;  4J9Z B;  3VQW A;  1TAE A;  3ABL C;  1KMI Z;  5LP6 B;  1SZT A;  2IW5 A;  1KU9 A;  1QNM A;  4MTO A;  4QPK A;  1EN5 A;  4DV3 O;  3KKY A;  1BSM A;  1ZX3 A;  1OCR C;  3L75 H;  2GUZ A;  2F66 C;  3RVY A;  1PL4 A;  3RT3 C;  1FJG O;  2H94 A;  1KP2 A;  1QU7 A;  4XDL A;  4BIU A;  3E22 A;  4JI7 B;  4O4I B;  4PDR A;  3SGI A;  3JD2 A;  3OE7 G;  3J7A U;  3ZMZ A;  3CE2 A;  2Q9L A;  5IT9 N;  1VQO V;  2XOK G;  1Y67 A;  1Y4M A;  1CP9 A;  5LHH A;  3JAR B;  1IBK B;  4YHH B;  4JI6 B;  1VQ4 V;  1G1X B;  2ZR2 A;  2MW2 B;  5GON A;  1LUW A;  1RP3 B;  1IBL B;  3RYF B;  1UJW B;  4KHP O;  4W4L A;  4C7U A;  5FLX N;  5B5E Z;  4FMT A;  5CBH A;  5JVD B;  1I0H A;  1HNZ O;  4U7O A;  2DE0 X;  5GON B;  5GW7 A;  2A06 H;  3K9S A;  1FXH A;  5D5Q A;  1W59 A;  3LSQ A;  2LP7 A;  1P4R A;  4K0K B;  3SPC A;  3B09 A;  4DK0 A;  5IYZ A;  5EIB C;  2VQE O;  4RO2 A;  5JJE B;  4LF7 B;  1TUE B;  1VEW A;  2A0L A;  5B1O A;  3B2E E;  4O4L A;  1TA8 A;  3QO8 A;  4FIP C;  1Q5O A;  4FFB A;  1H2K A;  1N32 B;  2ZT9 B;  1XMO O;  4O4I A;  4DXW A;  2UXC B;  4NTW A;  2YI9 A;  4DUZ B;  2X6B A;  4E2L A;  2UUC O;  2HVJ C;  1HNX O;  1P84 F;  1W0K G;  1JR9 A;  3AG2 C;  4DUZ O;  1F51 A;  1RPR A;  2WLN A;  1W2B U;  1GH6 A;  2JGU A;  1IBM B;  1L0L H;  1DF5 A;  3SDL A;  4NTY A;  1ZSP A;  5LP6 A;  1M56 B;  5H6Q A;  1AJP A;  3L73 H;  1AI4 A;  5EBL C;  4LCU C;  3CJH A;  4CH5 A;  1NR7 A;  1WB8 A;  1QR9 A;  2QJ1 A;  3ETQ A;  3RVZ A;  4JI4 O;  1WPB A;  2LJ2 A;  2NR5 A;  5L3E A;  4LF8 O;  4WFB V;  1Q6U A;  2XND G;  1BL8 A;  3CJH B;  4O2A A;  1M90 W;  4FVM A;  2ZR3 A;  1BHA A;  4X62 B;  3ZMT A;  4PDV A;  1M5I A;  3X2Q B;  3L70 H;  3D3Q A;  1BQ0 A;  4XDJ A;  4DK1 A;  4O4J A;  4MVU A;  4NTX A;  3SYA A;  4ZI7 A;  4IHJ B;  2YC0 A;  4MTF A;  3OMN B;  4B08 A;  1P49 A;  1AP6 A;  1NVP B;  4JI8 O;  5J9P C;  3ETG A;  2OWO A;  5JH7 B;  2YXL A;  2WLI A;  4HNA B;  1BQZ A;  4X9Q A;  1XRE A;  2A79 B;  1YJ9 V;  3E89 A;  4ABM A;  4QE7 A;  3S3X A;  4FFB B;  2WLI B;  3HKE A;  2EZO A;  2JGD B;  3WB2 A;  1MSW D;  4JYA O;  4PV1 B;  4TQD A;  2OT5 A;  4EFE A;  5B3S B;  2W6J G;  4ZI7 B;  5HFL A;  1NZ6 A;  3FB6 C;  2R9A A;  1HWY A;  2DN9 A;  5CN0 A;  1FFT B;  4UCU A;  2GTS A;  5B3S C;  3I56 V;  1NTM H;  5LP6 C;  1NVP D;  1AJN A;  1ZAU A;  2HLD G;  4I0X A;  3JAS A;  1VF5 B;  3HB3 B;  4DV3 B;  1B3Q A;  2V7Q G;  1OZ0 A;  1BE3 H;  2WLH A;  4JTD B;  3ZRX A;  3P30 A;  1VQ8 V;  2DWE C;  2UUA B;  2IJI A;  2OIG A;  3APO A;  4JYC A;  1F23 A;  3L9D A;  1GM8 A;  3STZ C;  1PM9 A;  4TUY A;  3OMA B;  2IJK A;  4LF4 B;  4IL6 Z;  5CBF A;  5JQG B;  5BXZ A;  5KX5 A;  1IBM O;  3MAQ A;  3FB5 C;  4JZG A;  4FLU A;  5E79 Z;  5B1B C;  1ROP A;  3UO3 A;  3JAL B;  3OW2 U;  1JFF A;  2WWW A;  1ENV A;  5LA6 A;  1S5L Z;  3KG2 A;  1AB3 A;  2Q7G A;  3K59 A;  4Q6G A;  1HR0 O;  3WB1 A;  5ITZ B;  3OEH G;  4YXW G;  1HNW B;  2RNB A;  4UVA A;  5IYB O;  4BWA A;  2FTK A;  5LXT A;  1S3J A;  4DR1 B;  1FFX B;  1KBH A;  3AG2 B;  1XIL A;  2UUB B;  4DR6 B;  1U96 A;  4JV5 O;  1WLE A;  5KAI Z;  1QR8 A;  4DV0 O;  1YI2 V;  1XI1 A;  4JI2 B;  3OTF A;  4PJ0 Z;  2AHZ A;  1B04 A;  4DV2 B;  4MVO A;  1GM9 A;  1WP7 A;  3ML0 A;  3A8T A;  4U3J B;  4DR3 O;  2PUS A;  3OFN G;  4I0X B;  3BY6 A;  3K5M A;  5B1N A;  3ABU A;  1WNS A;  2DOS A;  1YXB A;  4HYO A;  1VP7 A;  2QM4 A;  1S0V A;  3TXQ A;  4JPR A;  2QEX V;  3P3N A;  4X66 B;  1XMQ O;  3RYC B;  2CGO A;  2Y48 A;  1H38 A;  2IBZ H;  5CB4 B;  3W7U A;  1GMG A;  1P7G A;  3BAA A;  1Z5W A;  4TQF A;  5B1A C;  1KYO F;  1AVM A;  3ZMV A;  4NKG B;  4QNH B;  1V9P A;  2CUG A;  1S77 D;  2Y4T A;  1MG1 A;  3G4S V;  2F4V B;  2NNU A;  4LNU A;  2BTO A;  2AGA A;  2HHH O;  1BZK A;  1HDJ A;  2UXD B;  1IBK O;  2YEV B;  1QCE A;  5KHJ A;  4Z2W A;  3G71 V;  5JH7 A;  4I4T B;  2EIL B;  5C8Y B;  4MT8 A;  1AI7 A;  1SQF A;  3HKD B;  3ZRW A;  2ZM6 O;  3T1Y O;  4IHJ A;  1XUQ A;  4TV8 A;  2E74 B;  3AG4 B;  4U3F H;  4FM0 A;  2CTP A;  1WB7 A;  2ZXW C;  3CRM A;  2RJZ A;  1FXK B;  1ZTE A;  1CXZ B;  4IYH A;  1URF A;  1TVK B;  2M7W A;  1J5E O;  4WCE V;  4O4H A;  5IWA O;  3N2K B;  4GZR B;  4O2B A;  1YCI A;  4MTX A;  5CA3 A;  1KKD A;  2EIN B;  1H8E G;  2UUC B;  4FPP A;  4MVZ A;  1FS0 G;  2D2C B;  4DR7 B;  1K4D C;  1PP9 H;  1G4Y B;  5IJ0 A;  1YIJ V;  2PTM A;  3CEI A;  3EXA A;  5KMG B;  1RM1 C;  5IDJ A;  3OAA G;  3B77 A;  3CMA V;  4AQY B;  2V1D A;  4PA4 A;  2ZNJ A;  2UUA O;  1GAX A;  5IJ9 B;  3CRR A;  4QGP A;  4JYB A;  2Q8V A;  4BIZ A;  3OEE G;  4B3T O;  1SQQ H;  2CGN A;  2F93 B;  1SER A;  4JI2 O;  3K0D A;  4J7J A;  3JAT A;  3W7W A;  3T1H B;  4DR4 O;  1I5X A;  3OUF A;  3ZIA G;  2P22 C;  4UXN A;  4YJ3 B;  2Q7H A;  5DM6 V;  3LSU A;  4FLZ A;  2GBO A;  1W0J G;  4X1K A;  5HFM A;  2YDE A;  1R6K A;  1ZL8 B;  4I7Z B;  4IGG A;  4CC6 A;  4GKK B;  1MZF A;  4LH7 A;  1R3J C;  2EIL C;  3AK2 A;  3IC9 A;  1A32 A;  3THO A;  3NXS A;  5IYZ B;  3CYO A;  4J11 A;  3BPZ A;  1S72 V;  2UXB B;  1G8M A;  1PPJ H;  3CCU V;  3UCS C;  5BMV B;  3CC7 V;  1I94 B;  2LW1 A;  1I5Y A;  2BTQ B;  2V4D A;  1GKF A;  4CS2 A;  1YTF D;  3W7S A;  3UQ8 A;  2ZIN A;  4UVC A;  4PDM A;  4OGQ B;  3VOU A;  2AZ0 A;  2Q6A A;  2RQ6 A;  4OPH A;  2K9P A;  2Q4P A;  4X1Y B;  3E8F A;  4X1I A;  2CDY A;  3CCE V;  3RYH B;  5L3G A;  1UFI A;  4JAU A;  3CRQ A;  3ABT A;  1AP5 A;  3G6E V;  4JAV A;  2IM9 A;  3GWK C;  1HNW O;  1KP3 A;  5IE9 A;  1F4N A;  1S5J A;  3SJC C;  1KC8 W;  3BRC A;  1MA1 A;  3E22 B;  3QVN A;  4GLX A;  1EN4 A;  2R9I A;  3CCR V;  2FKX A;  2IU3 A;  2GTA A;  5FNV B;  2AXT Z;  4JI3 O;  2ZNI A;  5JWP A;  4CH6 A;  5LBQ A;  2OCC C;  5LGN A;  1KUQ A;  3E8H A;  4LF4 O;  4MS2 A;  1I7F A;  5BR8 O;  4D7T A;  4DR5 O;  1YIT V;  2RMK B;  2FL4 A;  5EZY B;  1MMM A;  1XNQ O;  2EJR A;  5J2T B;  1K33 A;  2X6A A;  2JS5 A;  3JD0 A;  3JCZ A;  3Q4H A;  1Y66 A;  5KAF Z;  1S76 D;  1WJZ A;  4UVB A;  4JI0 O;  1EZV H;  2EX3 A;  4X89 A;  3BHP A;  2CTR A;  2L6L A;  2YIC A;  2JS3 A;  2WLK A;  4GCZ A;  5J2U A;  1YDX A;  4RAI A;  3TK1 A;  4F6R A;  1SQX H;  2PYJ A;  5B66 Z;  3HR0 A;  4ZOL B;  2A3Q A;  3RN4 A;  3RWR D;  4J7K A;  4DW0 A;  1Q43 A;  4DR2 B;  3FAV B;  4JAS A;  1VAR A;  1L0N H;  5KHH A;  4NXN O;  1FAF A;  4WFE A;  1Q8I A;  2JJ2 G;  4DR7 O;  2Q69 A;  4GX2 A;  3SJA C;  1K5S A;  2WLL A;  2WAM A;  1XQ8 A;  1H2S B;  1XNR O;  3OMI B;  2QTO A;  2DWD C;  1PV0 A;  2WLJ A;  3MDS A;  3A0H Z;  3SYP A;  3ABM B;  2CK3 G;  2GHY A;  1R3K C;  4QJF B;  1WA8 A;  3T1H O;  4DR4 B;  2UXX A;  3HKC B;  5EK0 A;  3ETD A;  4DR3 B;  1YJW V;  1JX9 A;  1Q90 D;  3CS5 A;  5L3C A;  2BSK A;  3CC4 V;  1EZJ A;  1OCZ C;  3R66 A;  2ZM6 B;  3T1Y B;  4L8J A;  2EIK B;  3FYI B;  4X66 O;  1VQN V;  1GTO A;  1TUB B;  2Q67 A;  3CWB H;  1E1Q G;  4ICG A;  3HKB A;  1IZ3 A;  1XMQ B;  3SPG A;  4X62 O;  1SRY A;  4LC1 A;  3SR2 C;  2OCH A;  1BHB A;  4EFB A;  5A2Q N;  2OTJ V;  3JAW A;  3ZCC A;  1QVF U;  5IYD O;  4LF8 B;  3F5W C;  3ICX A;  2DYR B;  4DUY B;  4J10 A;  2QTS A;  3VQV A;  4EKW A;  5AG2 A;  1P7B A;  2LGQ A;  4K3A A;  3OTO B;  3ABK B;  5LYJ B;  2E5L O;  1H2M A;  4H44 B;  4MVM A;  2HEP A;  1B06 A;  4XDK A;  4LFB O;  2H3O A;  1MAB G;  3BFR A;  4AI8 A;  4LWS A;  1QVG U;  1DF4 A;  2X6C A;  4K35 A;  2WA3 A;  1AR1 B;  1Q3E A;  4ZBM A;  2CE4 A;  1WPX A;  2CTW A;  4FLY A;  4LP8 A;  4TV9 B;  3ZN1 A;  4NXM O;  2Y0P A;  1T5E A;  4F4L A;  4CH3 A;  1AIL A;  4DV0 B;  3UO2 A;  5KUM A;  2B1I A;  1AI5 A;  2IJH A;  3CC2 V;  2YUA A;  2GDS A;  2Y69 B;  4JI1 O;  2Z0A A;  2HKO A;  5IY5 C;  2EZP A;  1VIB A;  1JQ0 A;  2QE7 G;  3G67 A;  3GB7 C;  3LNN A;  2A9H A;  4NXM B;  1K7D A;  1KQS U;  1JJ2 U;  1YSC A;  2PZS A;  2N05 A;  3T4D A;  4DV5 B;  1JVM A;  1O9G A;  3AK3 A;  3CRA A;  1JJO A;  4KL1 A;  1WAZ A;  4I55 B;  3DC6 A;  4NR1 A;  3K57 A;  2AHY A;  1M93 A;  5LMN B;  2XUM A;  4ASU G;  2P4V A;  5LMU B;  5EYP B;  3N2G A;  3EHB B;  4X20 A;  3BA8 A;  3A2F A;  4FLX A;  4TT3 G;  4WFG A;  1JCH A;  3WU2 Z;  4PI2 A;  3SPI A;  3CSX A;  1PKX A;  4UCR A;  2ZE7 A;  3RYI B;  1SKV A;  1Q6H A;  2F1M A;  4PHZ A;  4DR5 B;  2Q73 A;  3DC5 A;  4Z1V A;  4B3S O;  1TGO A;  1HR0 B;  1KB9 F;  2HP8 A;  1M57 B;  3AG1 B;  2EIM B;  3WG7 C;  1SA0 A;  3L72 H;  1S5H C;  2YI8 A;  3OR7 C;  1Y6X A;  2JEU A;  2KQX A;  5CA0 A;  1E79 G;  1GN4 A;  2QWN B;  3ZBH A;  1V54 C;  4LFA O; 
#chains in the Genus database with same CATH homology
 3FB8 C;  3RW0 A;  1K34 A;  2Y69 C;  2ZXW C;  3OM3 B;  3A0R A;  3JD4 A;  3SYO A;  3ZMS A;  3SPJ A;  3X2Q C;  3ABL B;  1FXK B;  1MOF A;  4QIW F;  2BOB C;  1OCO B;  2XAJ A;  3SJQ C;  2M7W A;  1NQT A;  2B1G A;  4WCE V;  2HFE C;  2XAS A;  3FKS G;  4X88 A;  5H9C A;  4PA7 A;  4U7N A;  2DW4 A;  2DYS C;  4G28 B;  2ZXW B;  3IC7 A;  1GK9 A;  3E8B A;  4MTX A;  5L3F A;  4JGS A;  5CA3 A;  3K06 A;  2WLM A;  1KKD A;  1COW G;  3TCU A;  2EIN B;  1NBM G;  4R50 A;  1H8E G;  4OXS A;  3ZJZ A;  4FPP A;  4MVZ A;  1FS0 G;  4H33 A;  4N21 A;  1V55 C;  1V55 B;  3DGE A;  1K4D C;  2P7T C;  4KFM A;  1NH2 D;  3LDD A;  3F7V C;  1G4Y B;  4RQE A;  1YIJ V;  2EIJ B;  5LGT A;  3K04 A;  3E86 A;  5EC2 C;  1YJN V;  2JEX A;  1RM1 C;  1CPY A;  1V54 C;  5IDJ A;  3OAA G;  3B77 A;  3CMA V;  4HZ3 A;  2V1D A;  2ZDI C;  3ZRS A;  3FYE B;  2DQ3 A;  3IFX A;  4PA4 A;  2GSM B;  3ABK C;  2B5U A;  2DYS B;  4J9Z B;  4JYB A;  4BIZ A;  3ABL C;  3OEE G;  2W0F C;  1SZT A;  2HR3 A;  2IW5 A;  2ZD9 A;  4MTO A;  4PA6 A;  4QPK A;  2ITD C;  2K1E A;  1M9N A;  1SER A;  4P9O A;  2DYR C;  3K0D A;  1FXK A;  1NKD A;  4GX0 A;  1OCR C;  3W7W A;  3UM7 A;  1I5X A;  3JD3 A;  5C93 A;  3OUF A;  1QBZ A;  4TWK A;  3ZIA G;  4UXN A;  3RVY A;  5BZB A;  5DM6 V;  3ASO C;  2H94 A;  1W0J G;  4DO2 A;  5HFM A;  1KP2 A;  1R6K A;  4XDL A;  4BIU A;  3LDE A;  1EFR G;  4BW5 A;  1R3J C;  2EIL C;  1QLE C;  3D36 A;  4PDR A;  3JD2 A;  4WF9 V;  3OE7 G;  1NJI W;  3ZMZ A;  3GWO A;  1YTF B;  1VQO V;  3NXS A;  3CYO A;  2OTL V;  1S72 V;  1G8M A;  2XOK G;  4P2Z A;  1VQK V;  3CCU V;  1Y4M A;  1CP9 A;  5LHH A;  3CC7 V;  1VQ4 V;  3ABM C;  4TSF G;  3B8M A;  2LFS A;  1I5Y A;  2ZR2 A;  3ASO B;  4MW8 A;  1GKF A;  3OGC C;  1YTF D;  1VQL V;  1UJW B;  3DTU B;  1K9M W;  3W7S A;  2WLL B;  3STL C;  3FB7 C;  1K3E A;  3K08 A;  4FMT A;  4MVQ A;  2LFR A;  2ATK C;  4UVC A;  5CBH A;  3ETE A;  3E8G A;  4PDM A;  2DQ0 A;  3VOU A;  4FJC C;  2Q6A A;  3F7Y C;  4U7O A;  4UV8 A;  5GW7 A;  3E8F A;  1FXH A;  3LSQ A;  1AI6 A;  3CCE V;  5L3G A;  2LP7 A;  4JAU A;  3K79 A;  1SET A;  4Q20 A;  1P4R A;  3ABT A;  1H8H G;  3E83 A;  3AG1 C;  3SPC A;  3G6E V;  4JAV A;  5B1B B;  5IYC O;  4RO2 A;  1TUE B;  2A0L A;  5B1O A;  3SPH A;  5KUK A;  2QKS A;  1KP3 A;  2EIJ C;  1F4N A;  1KC8 W;  3QO8 A;  4FIP C;  5IY5 B;  1PNM A;  1KEC A;  4DXW A;  4UUJ C;  4N23 A;  2R9I A;  2HG5 C;  3CCR V;  1CEZ A;  3CD6 V;  2X6B A;  5LHI A;  1K97 A;  4E2L A;  2H8P C;  2IU3 A;  2HVJ C;  3AG3 B;  4HAM A;  4KUM A;  1W0K G;  4JF3 A;  2HVK C;  3AG2 C;  3JYC A;  3K0G A;  1F51 A;  1RPR A;  3K03 A;  1K4C C;  2WLN A;  1W2B U;  5LBQ A;  3MHS C;  2OCC C;  5LGN A;  3D3I A;  3ASN B;  3E8H A;  3JD1 A;  4MS2 A;  3ZN0 A;  2UXN A;  1DF5 A;  1PNK A;  1BMF G;  4RUF A;  1NR1 A;  2JDI G;  1DLB A;  3IGA C;  1YIT V;  1M56 B;  3MD0 A;  2P67 A;  5H6Q A;  1AJP A;  1VQ9 V;  1AI4 A;  1IXM A;  2EJR A;  3BEH A;  5EBL C;  1K33 A;  2X6A A;  4LCU C;  3JD0 A;  3JCZ A;  3LDC A;  1NR7 A;  4MVS A;  2XAH A;  1VQ6 V;  2YEV A;  3CXC U;  2Z3Y A;  1Y66 A;  1S76 D;  1QR9 A;  1OCZ B;  2IH3 C;  4UVB A;  1L1F A;  3RVZ A;  2ZQM A;  4X89 A;  1VQ7 V;  1KD1 W;  2EIM C;  1THZ A;  3SYC A;  2QM7 A;  3WG7 B;  3QO5 A;  1GO3 F;  5KA6 A;  1J95 A;  5L3E A;  4GCZ A;  4WFB V;  1XL6 A;  2WLK A;  1Q7Y W;  5CMU A;  4RAI A;  2XND G;  4WFH A;  3TK1 A;  1BL8 A;  4WFA V;  4X8A A;  2JK5 C;  1M90 W;  2ZR3 A;  3LUT B;  3M99 B;  5DN6 G;  3TET A;  1FXV A;  1BHA A;  1OCO C;  3ZMT A;  4JAS A;  3CME V;  1R6N A;  4GX5 A;  4WFF A;  4PDV A;  2IH1 C;  2OCC B;  2R9R B;  1FXK C;  2WSS G;  4GT1 A;  1AJQ A;  3X2Q B;  4WFE A;  2JJ2 G;  4KP4 A;  2Q69 A;  5B1A B;  4GX2 A;  4XDJ A;  4BAY A;  5EC1 C;  1K5S A;  2WLL A;  2WAM A;  3OUS A;  5FL7 G;  3OMI B;  4MVU A;  3SYA A;  4QPJ A;  4MTF A;  2QTO A;  3OMN B;  2DWD C;  3CCL V;  2WLJ A;  3H01 A;  3B8N A;  4Z1M G;  1NVP B;  4PA3 A;  3ETG A;  3SYP A;  5J9P C;  3ABM B;  3ZRW B;  1SES A;  2CK3 G;  2GHY A;  1R3K C;  2YSU B;  2WLI A;  4QJF B;  1JOY A;  2EIK C;  2NLJ C;  2A79 B;  1YJ9 V;  3E89 A;  2QM8 A;  4QE7 A;  2UXX A;  4R7C A;  5EK0 A;  5E1A C;  3ETD A;  1YJW V;  1OCC B;  2WLI B;  1EBO A;  1JX9 A;  2EZO A;  3CCV V;  5L3C A;  3CC4 V;  1MSW D;  3P32 A;  1EZJ A;  1OCZ C;  4P30 A;  2OT5 A;  2EIK B;  2ITC C;  3FYI B;  3CCM V;  1VQN V;  1GTO A;  2Q67 A;  5B3S B;  4QE9 A;  1E1Q G;  2W6J G;  2XAQ A;  5HFL A;  3FB6 C;  3SPG A;  1SRY A;  2BOC C;  4LC1 A;  2JIZ G;  1BHB A;  4L87 A;  1HWY A;  2OTJ V;  2EBO A;  4I5S A;  1M56 C;  3ZCC A;  1QVF U;  5CN0 A;  5IYD O;  1FFT B;  3F5W C;  2DYR B;  2Q68 A;  5B3S C;  3I56 V;  3RBZ A;  4EKW A;  4RUE A;  1P7B A;  4PA9 A;  4P9P A;  3E2E A;  1NVP D;  1AJN A;  2HLD G;  3ABK B;  3CCJ V;  3HB3 B;  1VQP V;  2V7Q G;  1K92 A;  1OZ0 A;  1H2G A;  1K73 W;  2WLH A;  1R73 A;  4JTD B;  3ZRX A;  3P30 A;  1VQ8 V;  2DWE C;  1K5Q A;  2IJI A;  4MVM A;  4XDK A;  4JYC A;  1F23 A;  1GM8 A;  3STZ C;  3LSS A;  1MAB G;  2P90 A;  3OMA B;  2IJK A;  3ZMU A;  5CBF A;  3CCS V;  1QVG U;  2EIN C;  1DF4 A;  3FB5 C;  1M1K W;  2X6C A;  1AR1 B;  2PI4 A;  4ZBM A;  5LHG A;  4GX1 A;  4CZZ A;  1ARO P;  2X0L A;  5B1B C;  1ROP A;  1OCR B;  3SYQ A;  3OW2 U;  1WPX A;  3HPL C;  5L3D A;  2WWW A;  2IJJ A;  2JJ1 G;  2XAF A;  1ENV A;  5CBG A;  1Q81 W;  3VBB A;  4LP8 A;  3MHH C;  3ZN1 A;  1Q82 W;  3KG2 A;  4G27 B;  4F4L A;  1PNL A;  2MK3 A;  2HJF C;  3ASN C;  5EBM C;  3OEH G;  1B6Q A;  4YXW G;  5LGU A;  2KB1 A;  4UVA A;  5IYB O;  5KUM A;  3PJS K;  2B1I A;  2FTK A;  1AI5 A;  2IJH A;  3EFF K;  4PDL A;  3CC2 V;  1S3J A;  4J9Y B;  2Y69 B;  3T1C A;  2Z5U A;  2HKO A;  3AG2 B;  5IY5 C;  1V54 B;  3AG4 C;  2EZP A;  1WLE A;  4XBF A;  4ZKI A;  1JQ0 A;  3AG3 C;  4R8C A;  5L3B A;  1QR8 A;  4RQF A;  1OHH G;  1YHQ V;  1YI2 V;  2IU0 A;  4UV9 A;  3CP1 A;  2XAG A;  3I55 V;  2QE7 G;  4FK5 C;  2AHZ A;  3GB7 C;  1Q86 W;  1JPX A;  1PD3 A;  4MVO A;  2A9H A;  1GM9 A;  1K7D A;  3E35 A;  3ML0 A;  1KQS U;  1DTO A;  2W6I G;  1VQM V;  1M57 C;  3R65 A;  1JJ2 U;  2X7R B;  1YSC A;  4MW3 A;  1N8R W;  4JTA B;  4CBC A;  3OFN G;  1E1R G;  2ZDI A;  3BY6 A;  3CPW U;  2QA4 V;  5B1N A;  3ABU A;  4H37 A;  3T4D A;  1JVM A;  4PEL A;  4I9W A;  2P6J A;  4HYO A;  1XL4 A;  2F43 G;  1S0V A;  1PL0 A;  4JPR A;  2AHY A;  1ZWI C;  4MTG A;  2QEX V;  4ASU G;  4LBE C;  1ORQ C;  3T4Z A;  1R3L C;  2Y48 A;  1H38 A;  3UKM A;  3EHB B;  3W7U A;  3OR6 C;  3CCQ V;  1GMG A;  3WFV A;  2C2A A;  3W7X A;  3LNM B;  4TT3 G;  5B1A C;  2D3O W;  1NH2 B;  1K8A W;  4WFG A;  5KA5 A;  1JCH A;  3ZMV A;  3SPI A;  4QNH B;  4MVR A;  1PKX A;  1OCC C;  1RPO A;  1S77 D;  1MG1 A;  3G4S V;  3QNE A;  1RM1 B;  2NNU A;  2WPD G;  4R6Z A;  3K9A A;  5H6R A;  1M57 B;  3K3W A;  3QO7 A;  3AG1 B;  4MSW C;  2EIM B;  3WG7 C;  3W7T A;  1QLN A;  2YEV B;  1QCE A;  1LNQ A;  3AEI A;  2PI5 A;  3G71 V;  1S5H C;  1R3I C;  3OR7 C;  2JEU A;  1QLE B;  2EIL B;  1VQ5 V;  4MT8 A;  1AI7 A;  1F4M A;  5EBW C;  3ZRV A;  3ZRW A;  3T2M A;  1E79 G;  4G2K A;  4JTC B;  3AG4 B;  1GM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...