3AEIA

Crystal structure of the prefoldin beta2 subunit from thermococcus strain ks-1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
94
structure length
94
Chain Sequence
MEAVRAYELQLELQQIRTLRQSLELKMKELEYAEGIITSLKSERRIYRAFSDLLVEITKDEAIEHIERSRLVYKREIEKLKKREKEIMEELSKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Prefoldin beta subunit 2
publication title Thermodynamic Characterization of the Interaction between Prefoldin and Group II Chaperonin
pubmed doi rcsb
source organism Thermococcus sp.
total genus 37
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01920 Prefoldin_2 Prefoldin subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.370 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3aeiA00
2ZDIA 1FXKA 1FXKC 2ZQMA 3AEIA 2ZDIC 1FXKB
chains in the Genus database with same CATH superfamily
3G80A 1XHXA 1GK9A 1K33A 2EJ7A 1XNQO 1T5EA 1B06A 2P4VA 3SYCA 3CHXA 1IXMA 5FLXN 1K8AW 1Y76B 2ILMA 4WBNA 1YIJV 2Y4UA 4I5SA 4CS4A 4U7NA 1OZ0A 3I55V 3ASOC 4JI0O 4PV1B 5GONB 3CRAA 3L75H 2EBOA 3CMEV 4H44B 3DC6A 2OCHA 4O2AA 5H6QA 2F4VB 3OTFA 3SDLA 3LSSA 3ETQA 2GDSA 4X20B 3CE2A 3F5TA 5CA3A 1HDJA 2FB5A 1SC5B 4FLXA 2YUAA 4B7EA 3OMAB 3ABKB 1JFFA 1W59A 1N34O 1FAFA 2Q7EA 4QIWF 2UXDO 3JAKA 4LFCB 4K35A 4TWKA 3BAAA 3WB2A 2BE3A 1E79G 5EZYA 4BR6A 4I4TA 4PD4F 1R6NA 1QU7A 4DV0B 1VF6A 1ORQC 2LGQA 1G1XB 5LGUA 1US6A 5J2TA 3JATA 5CBGA 4IT5A 1XNRO 2LW1A 3FAVB 3T4ZA 2CGOA 2OCCC 4R50A 1AI7A 3RT3C 4RQFA 4CC6A 4PDRA 1M57C 5IY5B 1PNKA 1B6QA 1FJGO 4R7CA 3MDSA 1SESA 3FB7C 4J80A 4BAYA 5L3FA 4MVMA 2IW5A 3UQ8A 2LFRA 5KHKA 1JX9A 2IU0A 3TGUH 1JJ2U 3ABLC 4JI5O 3M99B 1L8DA 3ASNC 3K0DA 2R9RB 2UUAO 4CH6A 4WFBV 4GKJO 3CCLV 2R9IA 5LXTB 4Z1MG 4PJ0Z 4W4LA 3HKDB 3ASOB 2F66C 3TK1A 4FPPA 4YJ3B 1EN4A 4P9PA 2IH3C 3N2KA 4LFAB 2P4KA 1NH2D 1H8EG 4GKKB 4I0XA 3FB8C 1V9PA 4FLUA 4DYLA 1NJIW 4WFFA 2Q9LA 5IJ0A 3JAWB 3CEIA 2HFEC 2ADPA 1MOFA 1AJNA 5B3SC 3A0HZ 4DR6O 2XUMA 2IJIA 4WFHA 1H38A 4DV2B 1I7FA 4GT1A 3I56V 3ZMTA 1I5XA 3IAYA 2KSDA 3LNNA 4JAVA 4DR3B 4WFEA 3BA9A 5GONA 3ZRXA 2UUCO 2WLHA 4P30A 4B3SO 2WLIB 1N0JA 1SETA 2OCCB 1R3JC 2OIEA 4J9ZB 1B3QA 1EZVH 1HNXO 1M57B 1I0HA 2QM8A 1NTMH 1WAZA 3B09A 4X20A 1EN6A 2HHHO 1LUWA 2VQFO 1QCEA 4X1IB 3ABLB 1GKFA 5CA0B 4LFAO 4J41A 3RVYA 3ASNB 3SJBC 1OCZC 4UV9A 1KECA 1YZBA 3L70H 3ZRVA 1CEZA 2DOSA 4FFKA 2UXBB 2PUSA 2HJFC 2BCCH 1MZEA 3S3XA 5B66Z 1YI2V 3JD2A 1RPOA 1V55C 2ZE6A 2QTOA 1RM1C 1SZTA 2LO1A 1YSCA 2DQ0A 5DECA 1XBLA 1X59A 4DUYB 2CTQA 4YY3B 3IC7A 4NKGB 3T1HO 3OTOO 1VQ5V 2YIBD 4UCRA 4DR1B 1XUQA 2FYUH 4DR4B 3OUFA 3JYCA 3H1KH 4O4JB 2JK5C 1QVGU 1TUEB 1TGOA 3UM7A 1PL0A 2BSKB 2RMKB 3RYIA 3CJHA 5B3SB 1XREA 3AK1A 5LXTA 5LMUB 3Q4HB 2YIAA 3HKDA 2PTMA 1R6KA 3CCQV 4B7KA 3CC4V 4YJ3A 5LGTA 1VQMV 1J5EB 1XMQO 1SQBH 3BHPA 5L3DA 3SYOA 3QVNA 2WLMA 2ZR2A 3H1JH 1R73A 2EIKC 1KD1W 2UXBO 1QBZA 2CTWA 2JJ2G 4N21A 1KUQA 1I5YA 1SQPH 1QR9A 4JTAB 4QPKA 2OYQA 1BS3A 4DUYO 4UCSA 4QJFB 4OXSA 1JVMA 3N2GB 1OCZB 1I94O 2XAJA 4LF8O 3WB0A 4DR1O 1VARA 2VWJA 1YITV 3DXRA 2WPDG 5KAIZ 4LF5O 2WLIA 4TQDA 3K9SA 4JI3B 4QE7A 1V55B 5LHHA 1N33O 2Z5UA 5TISZ 1RM1B 3OGCC 1H2SB 4MVSA 1G6UA 4RO2A 3ZMUA 1ZX3A 2DJVA 2X7RB 3LUTB 4L8JA 5D5QA 4FLYA 2V7QG 2Z0AA 1DTOA 5JCOA 1E1QG 1M4UA 3K08A 4IIJA 3AK2A 4X1IA 3L71H 5CA0A 4AQYO 2ARHA 5IWAB 3CXCU 4MTXA 1G8MA 2B1IA 2XASA 2ZM6O 2EX3A 4JI2O 1Y4MA 1M93A 2C2AA 3ZRWB 4CH5A 4CC5A 3C90A 1WP8A 2EIMC 1NI8A 3ZMVA 4XDLA 5LGNA 5LMNO 5BY1A 4EFBA 2ZE7A 4HBNA 3JALA 3APQA 5HFLA 2DMXA 3CCSV 4DV4O 3SJQC 1VQLV 2BTOA 2DYRC 1SKVA 3CPWU 2UU9B 1IBMB 2PYJA 1VQOV 2GUZA 1NTZH 1BSMA 4O4JA 2EIKB 5DN6G 2OTJV 2Y69C 2F93B 4JI6O 2GV9A 4UVCA 1MZFA 1F4NA 2GTSA 3ABTA 3EXAA 2BSKA 3RYFB 5H2FZ 1Q6HA 2QM7A 3WFVA 4HAMA 2A3QA 2YIBA 1R3IC 1YDXA 1K34A 1H8HG 3K57A 4DV1B 3E86A 3BPZA 1XQ8A 4JV5B 4HZ3A 3D3QA 3Q4HA 1H2LA 4ZHQA 2PY5A 3K5OA 3E83A 3OGIB 3RYCB 1D2DA 3ZJZA 1BMFG 1IURA 2RJZA 2QKAA 4FFBB 4YXWG 1IBKB 4EB6B 5IWAO 3J81N 3H1HH 1L0LH 4J42A 2CGNA 5H6RA 3CXHF 4JI1B 3ZCCA 1MNGA 4FM2A 3GWKC 1BQ0A 1MSWD 2DN9A 2YXLA 2YXYA 1OJHA 1Q5OA 3K5LA 1Q8IA 4L87A 3N2GA 3OEHG 1MSDA 2Q5ZA 1DLBA 5L3GA 3RFRA 5J2UB 1OCCC 1S0VA 4ZI7A 3NR7A 4X8AA 5H9CA 2EIMB 4N23A 4DR7O 3SPCA 1X4TA 4DV1O 1TA8A 5B1NA 3L74H 4LFBO 1WB7A 4LF4B 4NXMB 3THOA 1TUBB 2CH7A 2DYRB 3LDDA 2JGUA 3JCZA 2ETNA 2Q4PA 3IJ4A 2Y69B 4GUNA 4MSWC 4ZOLB 2Q8VA 1V54C 3P32A 5FPRA 4WCEV 4MVZA 3FYIB 4W4KA 5JVDB 3ZRWA 4LNUB 1GM9A 5DM6V 1J95A 3AK3A 2E3CA 3ZHUA 3ZIAG 3X2QC 3CRQA 1A32A 2WA4A 5L3CA 4GX2A 4RWUA 4JYBA 2H8PC 2QWOB 1VQNV 1S5LZ 4JASA 3RVZA 1JPXA 4NXNB 1P4RA 4FZ0A 2ZXWC 2Y48A 4GYCB 2VS0A 1JMKC 5IT9N 1CPYA 1MG1A 4E2LA 4JF3A 2QGNA 1XHZA 4E4EA 3OW2U 4B3RO 3RWRD 2FTKA 4DR5B 1TVKB 1HR0O 1VQ7V 4HYOA 4DR2O 1O9GA 1WB8A 4AILC 3RYCA 5C8YA 1VF5B 4TQFA 1OCCB 3W7XA 5H5NA 4ZBMA 1BHBA 1DF5A 5LL6Y 2DWDC 2EIJC 4EB6A 3RBZA 3F7YC 3SJCC 4I50B 2HVKC 5EBWC 3D36C 1FYJA 1AR4A 2UUBB 2WLJA 2M7WA 4Q20A 2LGWA 3K0GA 2NNUA 4TV8A 3TCUA 2XAGA 3HKEB 4GX5A 2YC0A 2A7WA 1GN3A 2IM9A 3B4SA 2WLNA 5KUKA 4OX9B 1V54B 1WN7A 3OAAG 5CBFA 1AJPA 1DF4A 3H1LH 1DK1A 4QNHB 5LP6C 2VWKA 3B8NA 3FYEB 3MAQA 1UFIA 2B1GA 4UCUA 3T1YB 4TT3G 1M90W 1QVFU 3X2QB 1VP7A 3LNMB 5LOVA 2QWQB 5KHHA 4GLXA 2V4DA 5JQGB 1KB9F 5B1OA 4PHZA 5B5EZ 1PP9H 2KG7A 4G28B 1L0NH 5KA6A 1OV9A 4CH3A 3KCXA 2ZXWB 5GTIZ 1FD9A 3E8GA 4DW1A 1B04A 2FKXA 3AG1C 4B3TB 5EC2C 4ZOLA 1GN2A 1NR1A 5EK0A 2YI8A 1EZJA 1ZLZA 1GTOA 1YHQV 3ICXA 2QA4V 4TSFG 5JVDA 1YEWA 3CC7V 3J7AU 1Z5VA 2QKCA 3K3WA 1LR1A 2JRIA 5CA1B 4YJ2A 2NN4A 3JD0A 1Q82W 2F4VO 2ODMA 1H2NA 1AI5A 1SRYA 4CH4A 2HJDA 2P90A 4D6TH 4UVAA 4U3JB 2EIJB 4DRXA 5IYCO 4FM0A 3O65A 3JD4A 2UXCB 4KHPB 2JGDB 1Y66A 3CS5A 4K0KB 5BR8B 5K1XA 3LSQA 2B5UA 2D3OW 4LFCO 3FFQA 2IBZH 4I9WA 5KLVH 1K4CC 4KUMA 4WFAV 3TJTA 4DV0O 1VQKV 3STLC 1Y74B 4FLTA 1VQ9V 4KFMA 1TVKA 4X62B 2R72A 3ETDA 3CCEV 4O4LB 4X66B 3OMNB 4EFEA 4AI8A 2D2CB 3HKCB 5LA6B 4MW3A 1CP9A 5LP6B 1Y76A 2UXNA 3U10A 2VRZA 4B3TO 2FMLA 5LBQA 5EBMC 3RGBA 3L72H 3DGEA 3HKEA 1PKXA 4RUFA 1KKDA 2DQ3A 2VQEB 3JD3A 5EBLC 1WP7A 3AG1B 2XAHA 2P7TC 1H2MA 2Q7GA 3QNEA 1Y67A 3G6BA 4JYAB 3UO2A 1F51A 4O4HB 4YHHB 3K5NA 2EJRA 4MTFA 2W6IG 5BR8O 2PYLA 5GTHZ 1K5SA 4KL1A 2LFSA 1JJOA 4GKKO 1FXKC 1SQVH 4NB5A 3C3TA 3DSQA 2QWRB 3SPHA 5LHIA 2WLKA 4BIUA 1NKDA 4D7TA 4D7SA 3FAVA 3B2EE 1K7DA 1N36B 2OTLV 4X62O 2JVDA 5EIBC 4X66O 2H3OA 2A0LA 3FX7A 2PI4A 5E79Z 4IHJB 3BCCH 4RUEA 3IFXA 3M8AA 3OR6C 4MT8A 4BW5A 4DV2O 5LYJB 4K3AA 3G71V 1AB3A 2A06H 4DR3O 1G4YB 3JASB 3OUSA 4MVQA 3RW0A 2W0FC 1PM9A 4JI8B 5ITZB 4EKWA 5BMVB 5FL7G 4JTDB 3SPGA 2W6JG 4JZGA 4K8ZA 3ABMC 3APOA 5JH7B 4G2KA 4JYCA 3MD0A 1XILA 2ZINA 3ZHQA 2XTAA 3CCRV 1P7GA 3D36A 2JGDA 5EYPB 3DC5A 4FIPC 3K79A 4GX1A 4Q6GA 5HFMA 4NTXA 4O4IB 3CRCA 2MW2B 1PPJH 2Q69A 3K06A 2X6CA 1RPRA 2ZT9B 1Y74A 2WLLB 1DGSA 1R1BA 3JAWA 5A9GA 2F1MA 3W7UA 2ZQMA 4MS2A 1CXZB 2Y0PA 3QG5A 3HKCA 5LA6A 2DW4A 5KAFZ 3B8MA 4YY3O 2FL4A 1FXKB 3R65A 4LWSB 4UB8Z 1I08A 3ZX6A 1SS3A 4B08A 1AI6A 4MVOA 4DR4O 1RP3B 5GW7A 1S72V 4JI8O 4PA9A 1KC8W 1K97A 3KG2A 1SQXH 3P30A 2H94A 5B1AC 3JSLA 1JCHA 4DV3B 2CAZC 5LMUO 5IYBO 2JEXA 3D3IA 5J9PC 2ITCC 1THZA 3W7SA 1J5EO 2XAFA 2AW9A 5CMUA 3ML0A 4F6EA 1ZSPA 3ABMB 1XDCA 1R3KC 1FKAO 1HNWB 4RQEA 4LF6B 1VQPV 2YDEA 2Y0IA 4DV5B 1W0JG 5KX5B 3CCMV 3UT5B 3G6EV 4IHJA 1Q90D 5LHGA 2ZR3A 4X65B 2PF4E 5LYJA 2WWWA 5F2VO 2BOCC 4PDLA 2Y4TA 1FS0G 3E8HA 1YJWV 1HP8A 3JASA 3VQYA 4Z2WA 1Q7YW 1PL4A 1WLEA 1VF6C 4JI3O 3U11A 4J9YB 1SA0B 3CX5F 1IXBA 5BMVA 4ABMA 2IU3A 3W7TA 4J10A 4OGQB 2WAMA 4LF9B 3WB1A 1AVMA 2EZPA 5KMGB 2JS3A 3JAMN 3JARB 3QO7A 2X6AA 2ZDIC 3UO3A 3QO5A 2N74A 3ETGA 3K5MA 4O4IA 3LDEA 3VQXA 1FXVA 1L1FA 4WF9V 4CS3A 3J80N 4UFZA 1FFXB 4FLWA 2GTAA 5B1AB 3FD9A 1KU9A 2WLLA 4B3MB 1QHTA 4BW9A 1U97A 4XBFA 4FVMA 4WBNB 3VQWA 1ZAUA 5E1AC 1BE3H 4XDJA 1FPOA 1Q6IA 2EINC 3CMAV 2CK3G 1ZWIC 2YIDA 3VOUA 2ZKOA 3UCSC 1K9MW 2XHBA 4X89A 4DV7B 2ZCEA 2UU9O 2E5LB 4JPRA 1IBMO 4X9QA 3VQVA 1ZTEA 4J7JA 4LH7A 2Q6AA 3TXSA 3B40A 2AHYA 2XOKG 2JEUA 2UXXA 1HNZB 4DXWA 5CN0A 1Q43A 4TV9B 1JFFB 1S5HC 4JV5O 4ZKIA 5B1BC 1OCRC 1VQ8V 1N32B 3H9VA 1HWYA 2EZOA 1GAXA 2HEPA 4PI2A 3H01A 5J2TB 1IBKO 3JATB 2QWPB 2K9PA 2GBOA 2HR3A 2LP7A 3M7MX 4JAUA 5KHIA 4UCOA 4JI1O 3E8BA 4H37A 1IZ3A 3D8CA 3AG3C 1YTFB 1GN6A 2ZD9A 2YXHA 1SZXA 2YEVB 3AG2C 4JI0B 2B9ZA 3P3NA 4U3FH 3UT5A 2R9AA 2LJ2A 2NR5A 4X1KB 2YSUB 3ZMSA 4LH6A 3L9DA 1XL4A 4OPAA 3FB6C 1WJZA 2RDCA 3GWOA 2E5LO 4DV6B 1AP5A 2P67A 1AR5A 3ZMZA 2AZ0A 1SA0A 1EN5A 4QGPA 3RYFA 3ZN1A 3JCUZ 3FKSG 3U0ZA 4NTWA 1VMGA 3AG7A 2EINB 1HW7A 4R8CA 5JJJB 1N34B 1F7YA 3A2FA 2E74B 2UXDB 3N2KB 1EM1A 5KMGA 4LF4O 4NXMO 1FXHA 3F7VC 4UVBA 4GZRB 1MABG 2AHZA 1EFRG 4FFBA 3O9OA 3KCYA 1K73W 1BL8A 2QE7G 5IJ0B 1FFXA 2N04A 4TUYB 1M56C 4BWAA 2RN9A 1FJGB 5B1BB 1F4MA 1OCRB 1BZKA 4UXNA 4JYYA 1EBOA 4JGSA 1S5JA 4PA6A 4LBEC 2HVJC 5KHGA 2IH1C 3OT7A 2G38A 1O9HA 3HPLC 4HNAB 5C93A 1K92A 1KP3A 3ZHVA 4JI5B 3RN4A 3A0BZ 1VQ6V 1SQFA 5J2UA 4MTGA 4NXNO 3OM3B 3NXSA 2UUAB 1ZL8B 2GSMB 2X6BA 4FLZA 4GKJB 5FPOA 4DV6O 1RSOB 3AG3B 1XMOB 3AG2B 2E76B 3N27A 1IDSA 1ROPA 4NYKA 1KP2A 3MHSC 2HG5C 4C7UA 1SQGA 1NTKH 1QNMA 4TV9A 4DR5O 1WA8B 1Q86W 2IJHA 2WA3A 2XNDG 5KHJA 1NZ6A 4GCZA 1TUBA 1ENVA 1Z5WA 2HLDG 2ZE8A 3CCJV 1OHHG 3E8FA 2ZIMA 1NT2B 4ICGA 1VF7A 2AXTZ 4IL6Z 1YJNV 1QLNA 2O57A 2UUBO 2LW7A 1D5AA 1WNSA 2M6YA 4LNUA 1GH6A 4QPJA 4JZ2A 4QE9A 4DR6B 3ETEA 1IBLB 1VQ4V 4O2BB 3BY6A 2YEVA 4NVPA 1P7BA 1JQ0A 2ZDIA 3WU2Z 3SPIA 2ZNJA 3ZBHA 4BIOA 5JCOC 2UUCB 4B3SB 3PJSK 4X1KA 4UV8A 1NBMG 4OX9O 4DW0A 4CS2A 4OPHA 1K4DC 1Q6UA 1M56B 1WPBA 3EVKA 3HB3B 1HNXB 3RYIB 3CJHB 3BABA 3BVOA 4UCTA 4FMTA 2ZE5A 2IJKA 3BFRA 3T1YO 1XMOO 3DTUB 2HHHB 5KA5A 1TAEA 2JDIG 2VQFB 4CZZA 1M5IA 3AG4C 1Q3EA 1SERA 1AI4A 1XOUA 1NVPD 4LF7B 4ASUG 4A5UB 3T1CA 1GO3F 2Q0OC 3ABUA 3CRRA 3CC2V 4I50A 1ZUQA 1LNQA 1KYOF 1NH2B 3B77A 4TUYA 3GB7C 1NVPB 3SYPA 4JI4B 5L3EA 2W0XA 4WFGA 2QR4A 1IBLO 2PZSA 4MVUA 2JIZG 3SR2C 1LUVA 3T1HB 3OTOB 4JTCB 2Z3YA 2GHYA 5KUMA 3S3WA 4HNAA 3DXRB 1PNLA 4PI0A 2PI5A 4PDMA 2UXCO 1S76D 4KHPO 4F4LA 3SGIA 3QF7A 2L6LA 4K0KO 1BT8A 1ZL8A 1RSOA 3I5DA 1KMIZ 1AR1B 1N0NA 1NS1A 3HR0A 5L3BA 2N05A 5K1PA 5JQGA 3VBBA 2BOBC 4R6ZA 3ZHSA 2JS5A 1WA8A 4IIJB 5CBHA 2KKWA 4DUZB 2YICA 1XMQB 1M1KW 5AG2A 3E22B 4LF7O 2HP8A 2QKSA 4UUJC 3ZS8C 1NQTA 3OMIB 1D5NA 4CBCA 1YVWA 3AG4B 3IGAC 2AGAA 4JI4O 4I55B 1W2BU 5CA1A 4O2BA 1K3EA 3OE7G 2CDYA 4FK5C 5CB4B 1R6TA 3JALB 4FJCC 2VQEO 1I94B 2XT9A 4LF8B 3SYAA 4U3JA 1XEQA 1Q81W 4BIZA 4TOIA 4LF5B 2GUZB 1P49A 4JYAO 3TETA 1H2KA 1N33B 2ATKC 4YHHO 2RNBA 4GX0A 1GM8A 2K1EA 4NTYA 2QTSA 3KZIZ 5JJNB 1OCOC 1S3JA 4ZHQB 2OWOA 2RQ6A 3CWBH 1K5QA 4O4LA 1N36O 3P3PA 3R66A 4AQYB 1AROP 2CE4A 4DUZO 1QQCA 2CTPA 4JI2B 2ZM6B 2ZNIA 4F6RB 2ADQB 3T2MA 4K8XA 5LP6A 4X64B 1JR9A 5EIBD 3KKYA 2DWEC 4P9OA 1BHAA 3QTCA 4I9QA 3SYQA 1S77D 2R70A 4H13B 2BTQB 3JSNA 1SQQH 5LMNB 2QSAA 1AJQA 4H33A 2P6JA 4DK1A 4DV4B 5IJ9B 3AEIA 3WG7C 3CCUV 5FNVB 3E2EA 5EC1C 1Z2GA 5BXZA 1GRJA 4ZI7B 2A79B 1KBHA 4J7KA 3CRMA 4JI6B 5IYZB 4J11A 4O4HA 4RAIA 3TXQA 2QDOA 3RYHB 4U7OA 3QO8A 4LP8A 2CTRA 4J7ZA 3HKBB 4DO2A 1IVSA 1NR7A 2LQTA 3LSUA 3BRCA 3L73H 2OT5A 2CH7B 4PA4A 1BQZA 3E89A 2P22C 4XDKA 2F23A 5DEDA 4I7ZB 4LC1A 2KB1A 2YS8A 1E1RG 1AP6A 3E22A 4UB6Z 3T4DA 2Q67A 3UKMA 3CB2A 4X64O 2L35A 4X1YB 1H2GA 1OCOB 4PELA 1YJ9V 4P2ZA 2X0LA 2F43G 5JJEB 1GN4A 1KQSU 1N8RW 2Q7HA 2ZIOA 4I55A 5ITZA 3OEEG 5BZBA 1KKCA 2DYSC 4AHCA 5CB4A 4MVRA 4PDVA 3CP1A 2AZ2A 3K9AA 4ZIBA 3W7WA 2Q0AA 4MW8A 1F23A 5JH7A 3ZN0A 1XL6A 4FM1A 4DV3O 3PN1A 1YF2A 2E75B 1UJWB 3K04A 5EYPA 3A8TA 3BA8A 4PA3A 2Q68A 3GVMA 4DR7B 3STZC 2Q73A 4Z1VA 1GMGA 3ZHRA 1GM7A 3CYOA 3C3SA 4LFBB 4NR1A 3WG7B 1HNWO 3G4SV 5C8YB 3CSXA 3FB5C 4LF6O 4LCUC 2QJ1A 4IYHA 4DV5O 1VIBA 1COWG 2IJJA 2EILC 1QLEC 4F6RA 1FFTB 2JJ1G 2WSSG 3ZHTA 4LR3A 4X65O 1FXKA 1SF9A 4H0LB 1JOYA 2EULA 4LWSA 3IC9A 5IE9A 3MHHC 4O2AB 4TV8B 2BTQA 4MTOA 5IYDO 3SPJA 1MMMA 5JWPA 3ZRSA 4KP4A 1BCCH 1RFYA 5IDJA 3F5WC 4X88A 2OIGA 3K58A 2PGGA 1M9NA 3EFFK 5IJ9A 1PV0A 2CUGA 1Y6XA 5FNVA 1N4CA 1QR8A 1YCIA 4LF9O 5A2QN 3JAKB 4JI7B 3JD1A 5IYZA 4YIPA 2XAQA 5EZYB 4I4TB 2YI9A 3RYHA 3A0RA 1AILA 4B3RB 5LOVB 5D5PA 1NU1H 1YTFD 4JAAA 2DYSB 1HR0B 1MA1A 3SJAC 3K59A 3HKBA 1W0KG 2QWNB 1U96A 4DR2B 2KG7B 1XNQB 1PNMA 3BEHA 3K03A 4KXRA 4IGGA 4B3MO 2ITDC 3CD6V 4FLVA 2A9HA 1URFA 3ZEDA 3H1IH 5KX5A 2V1DA 1UPGA 3ABKC 1JA8A 2RCVA 3LDCA 4X1YA 2F95B 1BGYH 2MK3A 4YJ2B 4DV7O 3OFNG 4G27B 1WPXA 2P06A 4DRXB 2DE0X 1HNZO 4YIOA 2EILB 1QLEB 1P84F 1PD3A 3OR7C 4FZ1A 2HKOA 2KQXA 2P5OA 5IY5C 1YXBA 3CCVV 4PA7A 1IX9A 4EEQA 4IYIA 3EHBB 1N32O 3JARA 4JI7O 4I0XB 1R3LC 1XI1A 2QM4A 2NLJC 3OD4A 3G67A 4DK0A 2QEXV 4UCVA 3E35A 1VEWA 1XNRB
chains in the Genus database with same CATH topology
3ZJZA 1BMFG 2WLLB 1NVPD 1GK9A 4YXWG 1K33A 4ASUG 3W7UA 2ZQMA 4MS2A 3T1CA 1GO3F 3ABUA 5H6RA 3SYCA 3CC2V 1IXMA 1K8AW 1LNQA 1YIJV 4I5SA 1NH2B 2DW4A 3ZCCA 3B77A 3GB7C 3B8MA 4U7NA 1OZ0A 1NVPB 3SYPA 3I55V 3ASOC 5L3EA 4WFGA 3R65A 1FXKB 1MSWD 4MVUA 2EBOA 2JIZG 3CMEV 1AI6A 4MVOA 4JTCB 5H6QA 2Z3YA 5GW7A 2GHYA 4L87A 5KUMA 1S72V 3OEHG 1PNLA 2PI5A 3LSSA 4PDMA 1DLBA 4PA9A 5L3GA 1KC8W 1S76D 1K97A 4F4LA 1OCCC 3KG2A 1S0VA 5CA3A 3P30A 2H94A 5B1AC 1JCHA 4X8AA 5H9CA 2EIMB 3OMAB 4N23A 3ABKB 5IYBO 2JEXA 1AR1B 3SPCA 4QIWF 3D3IA 5J9PC 4TWKA 5L3BA 5B1NA 2ITCC 1THZA 3W7SA 1E79G 2XAFA 3VBBA 2BOBC 1R6NA 4R6ZA 1ORQC 5CMUA 3ML0A 5CBHA 5LGUA 2DYRB 3LDDA 5CBGA 3ABMB 3JCZA 1R3KC 3T4ZA 2OCCC 4RQEA 1M1KW 4R50A 1AI7A 2Y69B 4MSWC 1VQPV 4RQFA 4PDRA 1M57C 1V54C 3P32A 5IY5B 2QKSA 1W0JG 1PNKA 1B6QA 4UUJC 4WCEV 4MVZA 3FYIB 4R7CA 1NQTA 3CCMV 3OMIB 1SESA 3FB7C 3ZRWA 1GM9A 5DM6V 3G6EV 1J95A 4BAYA 4CBCA 5LHGA 2ZR3A 5L3FA 3AG4B 3IGAC 4MVMA 2WWWA 2BOCC 2IW5A 4PDLA 1W2BU 1FS0G 3ZIAG 3E8HA 2LFRA 3X2QC 1JX9A 1K3EA 3OE7G 2IU0A 1JJ2U 3ABLC 4FK5C 1YJWV 5L3CA 4GX2A 1Q7YW 3M99B 4FJCC 1WLEA 3ASNC 3SYAA 3K0DA 2R9RB 4JYBA 2H8PC 1Q81W 1VQNV 4J9YB 4JASA 4WFBV 3RVZA 4BIZA 3CCLV 1JPXA 2R9IA 4Z1MG 1P4RA 3TETA 2ZXWC 2IU3A 3W7TA 2Y48A 2ATKC 4GX0A 1GM8A 3ASOB 2WAMA 2K1EA 1CPYA 3TK1A 4FPPA 2EZPA 1MG1A 4P9PA 4E2LA 4JF3A 3OW2U 2IH3C 1OCOC 2FTKA 3QO7A 1NH2D 1H8EG 2X6AA 2ZDIC 1S3JA 3QO5A 3ETGA 3FB8C 1NJIW 3LDEA 1VQ7V 1FXVA 4HYOA 4WFFA 1L1FA 1K5QA 4WF9V 1OCCB 1AROP 3W7XA 4ZBMA 5B1AB 1BHBA 1DF5A 2WLLA 2DWDC 2EIJC 3T2MA 2HFEC 3RBZA 3F7YC 2DWEC 4XBFA 4P9OA 1MOFA 2HVKC 1AJNA 5EBWC 1BHAA 5B3SC 2WLJA 2M7WA 5E1AC 3SYQA 1S77D 4XDJA 2IJIA 4WFHA 1H38A 4Q20A 3K0GA 2NNUA 4GT1A 2EINC 3CMAV 2CK3G 3I56V 3ZMTA 1I5XA 3TCUA 1ZWIC 2XAGA 3VOUA 4JAVA 1AJQA 4GX5A 4H33A 4WFEA 1K9MW 2P6JA 3ZRXA 2WLHA 4P30A 2WLIB 4X89A 1SETA 2OCCB 1R3JC 4JPRA 4J9ZB 2WLNA 3AEIA 3WG7C 3CCUV 5KUKA 2Q6AA 3E2EA 1M57B 1V54B 2AHYA 2XOKG 5EC1C 2JEUA 2QM8A 2UXXA 3OAAG 2A79B 5CBFA 1AJPA 1DF4A 4DXWA 5CN0A 4QNHB 4RAIA 3B8NA 3FYEB 1S5HC 4U7OA 3QO8A 4ZKIA 2B1GA 4LP8A 1OCRC 5B1BC 1VQ8V 1QCEA 4TT3G 1M90W 1QVFU 3X2QB 3LNMB 3ABLB 1GKFA 1HWYA 4DO2A 3RVYA 1NR7A 3ASNB 5B1OA 2EZOA 2OT5A 3H01A 4PA4A 1OCZC 4UV9A 1KECA 4G28B 3E89A 4XDKA 3ZRVA 1CEZA 5KA6A 2HR3A 4LC1A 2LP7A 2ZXWB 2KB1A 4JAUA 2HJFC 1E1RG 1YI2V 3JD2A 3E8GA 3T4DA 1RPOA 3AG1C 5EC2C 1V55C 2Q67A 2QTOA 3E8BA 1NR1A 4H37A 5EK0A 3UKMA 1RM1C 3AG3C 1SZTA 1YTFB 1EZJA 1YSCA 2DQ0A 1OCOB 1H2GA 1GTOA 2ZD9A 4PELA 1YHQV 1YJ9V 4P2ZA 2YEVB 3AG2C 2X0LA 2F43G 2QA4V 4TSFG 3CC7V 3IC7A 1KQSU 3K3WA 1N8RW 1VQ5V 2YSUB 3JD0A 1Q82W 3ZMSA 3OEEG 5BZBA 3OUFA 1AI5A 1SRYA 2DYSC 3JYCA 2JK5C 4MVRA 2P90A 1XL4A 3CP1A 2EIJB 3K9AA 4PDVA 3FB6C 4UVAA 5IYCO 1QVGU 1TUEB 3GWOA 3W7WA 2P67A 4MW8A 1F23A 1PL0A 3JD4A 1XL6A 3UM7A 3ZN0A 3ZMZA 5B3SB 1Y66A 3ZN1A 1UJWB 3K04A 3FKSG 4PA3A 3LSQA 2B5UA 2D3OW 2EINB 4R8CA 2Q68A 4I9WA 3CCQV 1R6KA 3STZC 3CC4V 1K4CC 1GMGA 4KUMA 4WFAV 1FXHA 1GM7A 5LGTA 3F7VC 3CYOA 4UVBA 3STLC 1VQMV 1VQKV 1VQ9V 1MABG 4KFMA 2AHZA 3WG7B 3ETDA 1EFRG 3CCEV 3G4SV 3OMNB 5L3DA 1K73W 3FB5C 3SYOA 1BL8A 4LCUC 2QE7G 2WLMA 2ZR2A 1R73A 4MW3A 1CP9A 1M56C 2EIKC 2UXNA 1COWG 2IJJA 1KD1W 1QBZA 1QLEC 2EILC 2JJ2G 1FFTB 2JJ1G 2WSSG 4N21A 5B1BB 1F4MA 1OCRB 1I5YA 4UXNA 1QR9A 1EBOA 1FXKA 4JGSA 4JTAB 1JOYA 4QPKA 4PA6A 3MHHC 5LBQA 4LBEC 2HVJC 2IH1C 5EBMC 4MTOA 4OXSA 4QJFB 5IYDO 1JVMA 3HPLC 3SPJA 1OCZB 2XAJA 3DGEA 5C93A 3ZRSA 1K92A 4KP4A 1KP3A 1PKXA 1YITV 4RUFA 1KKDA 2WPDG 1VQ6V 2DQ3A 5IDJA 3F5WC 4X88A 2WLIA 1M9NA 4MTGA 3OM3B 3JD3A 3NXSA 5EBLC 4QE7A 2GSMB 2X6BA 3EFFK 3AG1B 2XAHA 2P7TC 1V55B 5LHHA 2Z5UA 1RM1B 3OGCC 1QR8A 3AG3B 3QNEA 4MVSA 3ZMUA 4RO2A 1F51A 3AG2B 1ROPA 2EJRA 3JD1A 2W6IG 1KP2A 4MTFA 2X7RB 3MHSC 2HG5C 2XAQA 1K5SA 3LUTB 2LFSA 3A0RA 1Q86W 1FXKC 2IJHA 2V7QG 1DTOA 2XNDG 1YTFD 1E1QG 4GCZA 3K08A 2DYSB 3SPHA 1ENVA 5LHIA 2WLKA 4BIUA 1NKDA 3CXCU 1W0KG 2HLDG 1K7DA 3CCJV 4MTXA 1OHHG 3E8FA 2OTLV 1G8MA 1PNMA 3BEHA 3K03A 2B1IA 2XASA 1Y4MA 2ITDC 2A0LA 1YJNV 1QLNA 2C2AA 3CD6V 2A9HA 2PI4A 3ZRWB 4RUEA 3IFXA 2V1DA 3OR6C 4MT8A 2EIMC 4QPJA 4BW5A 4QE9A 3ABKC 3ETEA 3G71V 3ZMVA 1VQ4V 4XDLA 3BY6A 5LGNA 3LDCA 1G4YB 3OUSA 2YEVA 1P7BA 1JQ0A 2ZDIA 4MVQA 3RW0A 3SPIA 2MK3A 2W0FC 5HFLA 3CCSV 3SJQC 3OFNG 1VQLV 4EKWA 4G27B 3PJSK 4UV8A 5FL7G 4JTDB 3SPGA 1NBMG 2DYRC 1WPXA 2W6JG 3CPWU 3ABMC 1VQOV 1K4DC 1M56B 2EIKB 5DN6G 3HB3B 2EILB 1QLEB 2OTJV 2Y69C 4G2KA 1PD3A 3OR7C 4UVCA 1F4NA 3ABTA 4JYCA 2HKOA 3MD0A 3CCRV 2QM7A 3WFVA 3D36A 4HAMA 5IY5C 4FMTA 3CCVV 4PA7A 1R3IC 1K34A 1H8HG 2IJKA 3EHBB 4FIPC 3K79A 4GX1A 3DTUB 3E86A 4HZ3A 1R3LC 5KA5A 2JDIG 5HFMA 2NLJC 4CZZA 3AG4C 2QEXV 2Q69A 3K06A 2X6CA 1SERA 3E35A 3E83A 1RPRA 1AI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZDI A;  1FXK A;  1FXK C;  2ZQM A;  3AEI A;  2ZDI C;  1FXK B; 
#chains in the Genus database with same CATH topology
 3G80 A;  1XHX A;  1GK9 A;  1K33 A;  2EJ7 A;  1XNQ O;  1T5E A;  1B06 A;  2P4V A;  3SYC A;  3CHX A;  1IXM A;  5FLX N;  1K8A W;  1Y76 B;  2ILM A;  4WBN A;  1YIJ V;  2Y4U A;  4I5S A;  4CS4 A;  4U7N A;  1OZ0 A;  3I55 V;  3ASO C;  4JI0 O;  4PV1 B;  5GON B;  3CRA A;  3L75 H;  2EBO A;  3CME V;  4H44 B;  3DC6 A;  2OCH A;  4O2A A;  5H6Q A;  2F4V B;  3OTF A;  3SDL A;  3LSS A;  3ETQ A;  2GDS A;  4X20 B;  3CE2 A;  3F5T A;  5CA3 A;  1HDJ A;  2FB5 A;  1SC5 B;  4FLX A;  2YUA A;  4B7E A;  3OMA B;  3ABK B;  1JFF A;  1W59 A;  1N34 O;  1FAF A;  2Q7E A;  4QIW F;  2UXD O;  3JAK A;  4LFC B;  4K35 A;  4TWK A;  3BAA A;  3WB2 A;  2BE3 A;  1E79 G;  5EZY A;  4BR6 A;  4I4T A;  4PD4 F;  1R6N A;  1QU7 A;  4DV0 B;  1VF6 A;  1ORQ C;  2LGQ A;  1G1X B;  5LGU A;  1US6 A;  5J2T A;  3JAT A;  5CBG A;  4IT5 A;  1XNR O;  2LW1 A;  3FAV B;  3T4Z A;  2CGO A;  2OCC C;  4R50 A;  1AI7 A;  3RT3 C;  4RQF A;  4CC6 A;  4PDR A;  1M57 C;  5IY5 B;  1PNK A;  1B6Q A;  1FJG O;  4R7C A;  3MDS A;  1SES A;  3FB7 C;  4J80 A;  4BAY A;  5L3F A;  4MVM A;  2IW5 A;  3UQ8 A;  2LFR A;  5KHK A;  1JX9 A;  2IU0 A;  3TGU H;  1JJ2 U;  3ABL C;  4JI5 O;  3M99 B;  1L8D A;  3ASN C;  3K0D A;  2R9R B;  2UUA O;  4CH6 A;  4WFB V;  4GKJ O;  3CCL V;  2R9I A;  5LXT B;  4Z1M G;  4PJ0 Z;  4W4L A;  3HKD B;  3ASO B;  2F66 C;  3TK1 A;  4FPP A;  4YJ3 B;  1EN4 A;  4P9P A;  2IH3 C;  3N2K A;  4LFA B;  2P4K A;  1NH2 D;  1H8E G;  4GKK B;  4I0X A;  3FB8 C;  1V9P A;  4FLU A;  4DYL A;  1NJI W;  4WFF A;  2Q9L A;  5IJ0 A;  3JAW B;  3CEI A;  2HFE C;  2ADP A;  1MOF A;  1AJN A;  5B3S C;  3A0H Z;  4DR6 O;  2XUM A;  2IJI A;  4WFH A;  1H38 A;  4DV2 B;  1I7F A;  4GT1 A;  3I56 V;  3ZMT A;  1I5X A;  3IAY A;  2KSD A;  3LNN A;  4JAV A;  4DR3 B;  4WFE A;  3BA9 A;  5GON A;  3ZRX A;  2UUC O;  2WLH A;  4P30 A;  4B3S O;  2WLI B;  1N0J A;  1SET A;  2OCC B;  1R3J C;  2OIE A;  4J9Z B;  1B3Q A;  1EZV H;  1HNX O;  1M57 B;  1I0H A;  2QM8 A;  1NTM H;  1WAZ A;  3B09 A;  4X20 A;  1EN6 A;  2HHH O;  1LUW A;  2VQF O;  1QCE A;  4X1I B;  3ABL B;  1GKF A;  5CA0 B;  4LFA O;  4J41 A;  3RVY A;  3ASN B;  3SJB C;  1OCZ C;  4UV9 A;  1KEC A;  1YZB A;  3L70 H;  3ZRV A;  1CEZ A;  2DOS A;  4FFK A;  2UXB B;  2PUS A;  2HJF C;  2BCC H;  1MZE A;  3S3X A;  5B66 Z;  1YI2 V;  3JD2 A;  1RPO A;  1V55 C;  2ZE6 A;  2QTO A;  1RM1 C;  1SZT A;  2LO1 A;  1YSC A;  2DQ0 A;  5DEC A;  1XBL A;  1X59 A;  4DUY B;  2CTQ A;  4YY3 B;  3IC7 A;  4NKG B;  3T1H O;  3OTO O;  1VQ5 V;  2YIB D;  4UCR A;  4DR1 B;  1XUQ A;  2FYU H;  4DR4 B;  3OUF A;  3JYC A;  3H1K H;  4O4J B;  2JK5 C;  1QVG U;  1TUE B;  1TGO A;  3UM7 A;  1PL0 A;  2BSK B;  2RMK B;  3RYI A;  3CJH A;  5B3S B;  1XRE A;  3AK1 A;  5LXT A;  5LMU B;  3Q4H B;  2YIA A;  3HKD A;  2PTM A;  1R6K A;  3CCQ V;  4B7K A;  3CC4 V;  4YJ3 A;  5LGT A;  1VQM V;  1J5E B;  1XMQ O;  1SQB H;  3BHP A;  5L3D A;  3SYO A;  3QVN A;  2WLM A;  2ZR2 A;  3H1J H;  1R73 A;  2EIK C;  1KD1 W;  2UXB O;  1QBZ A;  2CTW A;  2JJ2 G;  4N21 A;  1KUQ A;  1I5Y A;  1SQP H;  1QR9 A;  4JTA B;  4QPK A;  2OYQ A;  1BS3 A;  4DUY O;  4UCS A;  4QJF B;  4OXS A;  1JVM A;  3N2G B;  1OCZ B;  1I94 O;  2XAJ A;  4LF8 O;  3WB0 A;  4DR1 O;  1VAR A;  2VWJ A;  1YIT V;  3DXR A;  2WPD G;  5KAI Z;  4LF5 O;  2WLI A;  4TQD A;  3K9S A;  4JI3 B;  4QE7 A;  1V55 B;  5LHH A;  1N33 O;  2Z5U A;  5TIS Z;  1RM1 B;  3OGC C;  1H2S B;  4MVS A;  1G6U A;  4RO2 A;  3ZMU A;  1ZX3 A;  2DJV A;  2X7R B;  3LUT B;  4L8J A;  5D5Q A;  4FLY A;  2V7Q G;  2Z0A A;  1DTO A;  5JCO A;  1E1Q G;  1M4U A;  3K08 A;  4IIJ A;  3AK2 A;  4X1I A;  3L71 H;  5CA0 A;  4AQY O;  2ARH A;  5IWA B;  3CXC U;  4MTX A;  1G8M A;  2B1I A;  2XAS A;  2ZM6 O;  2EX3 A;  4JI2 O;  1Y4M A;  1M93 A;  2C2A A;  3ZRW B;  4CH5 A;  4CC5 A;  3C90 A;  1WP8 A;  2EIM C;  1NI8 A;  3ZMV A;  4XDL A;  5LGN A;  5LMN O;  5BY1 A;  4EFB A;  2ZE7 A;  4HBN A;  3JAL A;  3APQ A;  5HFL A;  2DMX A;  3CCS V;  4DV4 O;  3SJQ C;  1VQL V;  2BTO A;  2DYR C;  1SKV A;  3CPW U;  2UU9 B;  1IBM B;  2PYJ A;  1VQO V;  2GUZ A;  1NTZ H;  1BSM A;  4O4J A;  2EIK B;  5DN6 G;  2OTJ V;  2Y69 C;  2F93 B;  4JI6 O;  2GV9 A;  4UVC A;  1MZF A;  1F4N A;  2GTS A;  3ABT A;  3EXA A;  2BSK A;  3RYF B;  5H2F Z;  1Q6H A;  2QM7 A;  3WFV A;  4HAM A;  2A3Q A;  2YIB A;  1R3I C;  1YDX A;  1K34 A;  1H8H G;  3K57 A;  4DV1 B;  3E86 A;  3BPZ A;  1XQ8 A;  4JV5 B;  4HZ3 A;  3D3Q A;  3Q4H A;  1H2L A;  4ZHQ A;  2PY5 A;  3K5O A;  3E83 A;  3OGI B;  3RYC B;  1D2D A;  3ZJZ A;  1BMF G;  1IUR A;  2RJZ A;  2QKA A;  4FFB B;  4YXW G;  1IBK B;  4EB6 B;  5IWA O;  3J81 N;  3H1H H;  1L0L H;  4J42 A;  2CGN A;  5H6R A;  3CXH F;  4JI1 B;  3ZCC A;  1MNG A;  4FM2 A;  3GWK C;  1BQ0 A;  1MSW D;  2DN9 A;  2YXL A;  2YXY A;  1OJH A;  1Q5O A;  3K5L A;  1Q8I A;  4L87 A;  3N2G A;  3OEH G;  1MSD A;  2Q5Z A;  1DLB A;  5L3G A;  3RFR A;  5J2U B;  1OCC C;  1S0V A;  4ZI7 A;  3NR7 A;  4X8A A;  5H9C A;  2EIM B;  4N23 A;  4DR7 O;  3SPC A;  1X4T A;  4DV1 O;  1TA8 A;  5B1N A;  3L74 H;  4LFB O;  1WB7 A;  4LF4 B;  4NXM B;  3THO A;  1TUB B;  2CH7 A;  2DYR B;  3LDD A;  2JGU A;  3JCZ A;  2ETN A;  2Q4P A;  3IJ4 A;  2Y69 B;  4GUN A;  4MSW C;  4ZOL B;  2Q8V A;  1V54 C;  3P32 A;  5FPR A;  4WCE V;  4MVZ A;  3FYI B;  4W4K A;  5JVD B;  3ZRW A;  4LNU B;  1GM9 A;  5DM6 V;  1J95 A;  3AK3 A;  2E3C A;  3ZHU A;  3ZIA G;  3X2Q C;  3CRQ A;  1A32 A;  2WA4 A;  5L3C A;  4GX2 A;  4RWU A;  4JYB A;  2H8P C;  2QWO B;  1VQN V;  1S5L Z;  4JAS A;  3RVZ A;  1JPX A;  4NXN B;  1P4R A;  4FZ0 A;  2ZXW C;  2Y48 A;  4GYC B;  2VS0 A;  1JMK C;  5IT9 N;  1CPY A;  1MG1 A;  4E2L A;  4JF3 A;  2QGN A;  1XHZ A;  4E4E A;  3OW2 U;  4B3R O;  3RWR D;  2FTK A;  4DR5 B;  1TVK B;  1HR0 O;  1VQ7 V;  4HYO A;  4DR2 O;  1O9G A;  1WB8 A;  4AIL C;  3RYC A;  5C8Y A;  1VF5 B;  4TQF A;  1OCC B;  3W7X A;  5H5N A;  4ZBM A;  1BHB A;  1DF5 A;  5LL6 Y;  2DWD C;  2EIJ C;  4EB6 A;  3RBZ A;  3F7Y C;  3SJC C;  4I50 B;  2HVK C;  5EBW C;  3D36 C;  1FYJ A;  1AR4 A;  2UUB B;  2WLJ A;  2M7W A;  4Q20 A;  2LGW A;  3K0G A;  2NNU A;  4TV8 A;  3TCU A;  2XAG A;  3HKE B;  4GX5 A;  2YC0 A;  2A7W A;  1GN3 A;  2IM9 A;  3B4S A;  2WLN A;  5KUK A;  4OX9 B;  1V54 B;  1WN7 A;  3OAA G;  5CBF A;  1AJP A;  1DF4 A;  3H1L H;  1DK1 A;  4QNH B;  5LP6 C;  2VWK A;  3B8N A;  3FYE B;  3MAQ A;  1UFI A;  2B1G A;  4UCU A;  3T1Y B;  4TT3 G;  1M90 W;  1QVF U;  3X2Q B;  1VP7 A;  3LNM B;  5LOV A;  2QWQ B;  5KHH A;  4GLX A;  2V4D A;  5JQG B;  1KB9 F;  5B1O A;  4PHZ A;  5B5E Z;  1PP9 H;  2KG7 A;  4G28 B;  1L0N H;  5KA6 A;  1OV9 A;  4CH3 A;  3KCX A;  2ZXW B;  5GTI Z;  1FD9 A;  3E8G A;  4DW1 A;  1B04 A;  2FKX A;  3AG1 C;  4B3T B;  5EC2 C;  4ZOL A;  1GN2 A;  1NR1 A;  5EK0 A;  2YI8 A;  1EZJ A;  1ZLZ A;  1GTO A;  1YHQ V;  3ICX A;  2QA4 V;  4TSF G;  5JVD A;  1YEW A;  3CC7 V;  3J7A U;  1Z5V A;  2QKC A;  3K3W A;  1LR1 A;  2JRI A;  5CA1 B;  4YJ2 A;  2NN4 A;  3JD0 A;  1Q82 W;  2F4V O;  2ODM A;  1H2N A;  1AI5 A;  1SRY A;  4CH4 A;  2HJD A;  2P90 A;  4D6T H;  4UVA A;  4U3J B;  2EIJ B;  4DRX A;  5IYC O;  4FM0 A;  3O65 A;  3JD4 A;  2UXC B;  4KHP B;  2JGD B;  1Y66 A;  3CS5 A;  4K0K B;  5BR8 B;  5K1X A;  3LSQ A;  2B5U A;  2D3O W;  4LFC O;  3FFQ A;  2IBZ H;  4I9W A;  5KLV H;  1K4C C;  4KUM A;  4WFA V;  3TJT A;  4DV0 O;  1VQK V;  3STL C;  1Y74 B;  4FLT A;  1VQ9 V;  4KFM A;  1TVK A;  4X62 B;  2R72 A;  3ETD A;  3CCE V;  4O4L B;  4X66 B;  3OMN B;  4EFE A;  4AI8 A;  2D2C B;  3HKC B;  5LA6 B;  4MW3 A;  1CP9 A;  5LP6 B;  1Y76 A;  2UXN A;  3U10 A;  2VRZ A;  4B3T O;  2FML A;  5LBQ A;  5EBM C;  3RGB A;  3L72 H;  3DGE A;  3HKE A;  1PKX A;  4RUF A;  1KKD A;  2DQ3 A;  2VQE B;  3JD3 A;  5EBL C;  1WP7 A;  3AG1 B;  2XAH A;  2P7T C;  1H2M A;  2Q7G A;  3QNE A;  1Y67 A;  3G6B A;  4JYA B;  3UO2 A;  1F51 A;  4O4H B;  4YHH B;  3K5N A;  2EJR A;  4MTF A;  2W6I G;  5BR8 O;  2PYL A;  5GTH Z;  1K5S A;  4KL1 A;  2LFS A;  1JJO A;  4GKK O;  1FXK C;  1SQV H;  4NB5 A;  3C3T A;  3DSQ A;  2QWR B;  3SPH A;  5LHI A;  2WLK A;  4BIU A;  1NKD A;  4D7T A;  4D7S A;  3FAV A;  3B2E E;  1K7D A;  1N36 B;  2OTL V;  4X62 O;  2JVD A;  5EIB C;  4X66 O;  2H3O A;  2A0L A;  3FX7 A;  2PI4 A;  5E79 Z;  4IHJ B;  3BCC H;  4RUE A;  3IFX A;  3M8A A;  3OR6 C;  4MT8 A;  4BW5 A;  4DV2 O;  5LYJ B;  4K3A A;  3G71 V;  1AB3 A;  2A06 H;  4DR3 O;  1G4Y B;  3JAS B;  3OUS A;  4MVQ A;  3RW0 A;  2W0F C;  1PM9 A;  4JI8 B;  5ITZ B;  4EKW A;  5BMV B;  5FL7 G;  4JTD B;  3SPG A;  2W6J G;  4JZG A;  4K8Z A;  3ABM C;  3APO A;  5JH7 B;  4G2K A;  4JYC A;  3MD0 A;  1XIL A;  2ZIN A;  3ZHQ A;  2XTA A;  3CCR V;  1P7G A;  3D36 A;  2JGD A;  5EYP B;  3DC5 A;  4FIP C;  3K79 A;  4GX1 A;  4Q6G A;  5HFM A;  4NTX A;  4O4I B;  3CRC A;  2MW2 B;  1PPJ H;  2Q69 A;  3K06 A;  2X6C A;  1RPR A;  2ZT9 B;  1Y74 A;  2WLL B;  1DGS A;  1R1B A;  3JAW A;  5A9G A;  2F1M A;  3W7U A;  2ZQM A;  4MS2 A;  1CXZ B;  2Y0P A;  3QG5 A;  3HKC A;  5LA6 A;  2DW4 A;  5KAF Z;  3B8M A;  4YY3 O;  2FL4 A;  1FXK B;  3R65 A;  4LWS B;  4UB8 Z;  1I08 A;  3ZX6 A;  1SS3 A;  4B08 A;  1AI6 A;  4MVO A;  4DR4 O;  1RP3 B;  5GW7 A;  1S72 V;  4JI8 O;  4PA9 A;  1KC8 W;  1K97 A;  3KG2 A;  1SQX H;  3P30 A;  2H94 A;  5B1A C;  3JSL A;  1JCH A;  4DV3 B;  2CAZ C;  5LMU O;  5IYB O;  2JEX A;  3D3I A;  5J9P C;  2ITC C;  1THZ A;  3W7S A;  1J5E O;  2XAF A;  2AW9 A;  5CMU A;  3ML0 A;  4F6E A;  1ZSP A;  3ABM B;  1XDC A;  1R3K C;  1FKA O;  1HNW B;  4RQE A;  4LF6 B;  1VQP V;  2YDE A;  2Y0I A;  4DV5 B;  1W0J G;  5KX5 B;  3CCM V;  3UT5 B;  3G6E V;  4IHJ A;  1Q90 D;  5LHG A;  2ZR3 A;  4X65 B;  2PF4 E;  5LYJ A;  2WWW A;  5F2V O;  2BOC C;  4PDL A;  2Y4T A;  1FS0 G;  3E8H A;  1YJW V;  1HP8 A;  3JAS A;  3VQY A;  4Z2W A;  1Q7Y W;  1PL4 A;  1WLE A;  1VF6 C;  4JI3 O;  3U11 A;  4J9Y B;  1SA0 B;  3CX5 F;  1IXB A;  5BMV A;  4ABM A;  2IU3 A;  3W7T A;  4J10 A;  4OGQ B;  2WAM A;  4LF9 B;  3WB1 A;  1AVM A;  2EZP A;  5KMG B;  2JS3 A;  3JAM N;  3JAR B;  3QO7 A;  2X6A A;  2ZDI C;  3UO3 A;  3QO5 A;  2N74 A;  3ETG A;  3K5M A;  4O4I A;  3LDE A;  3VQX A;  1FXV A;  1L1F A;  4WF9 V;  4CS3 A;  3J80 N;  4UFZ A;  1FFX B;  4FLW A;  2GTA A;  5B1A B;  3FD9 A;  1KU9 A;  2WLL A;  4B3M B;  1QHT A;  4BW9 A;  1U97 A;  4XBF A;  4FVM A;  4WBN B;  3VQW A;  1ZAU A;  5E1A C;  1BE3 H;  4XDJ A;  1FPO A;  1Q6I A;  2EIN C;  3CMA V;  2CK3 G;  1ZWI C;  2YID A;  3VOU A;  2ZKO A;  3UCS C;  1K9M W;  2XHB A;  4X89 A;  4DV7 B;  2ZCE A;  2UU9 O;  2E5L B;  4JPR A;  1IBM O;  4X9Q A;  3VQV A;  1ZTE A;  4J7J A;  4LH7 A;  2Q6A A;  3TXS A;  3B40 A;  2AHY A;  2XOK G;  2JEU A;  2UXX A;  1HNZ B;  4DXW A;  5CN0 A;  1Q43 A;  4TV9 B;  1JFF B;  1S5H C;  4JV5 O;  4ZKI A;  5B1B C;  1OCR C;  1VQ8 V;  1N32 B;  3H9V A;  1HWY A;  2EZO A;  1GAX A;  2HEP A;  4PI2 A;  3H01 A;  5J2T B;  1IBK O;  3JAT B;  2QWP B;  2K9P A;  2GBO A;  2HR3 A;  2LP7 A;  3M7M X;  4JAU A;  5KHI A;  4UCO A;  4JI1 O;  3E8B A;  4H37 A;  1IZ3 A;  3D8C A;  3AG3 C;  1YTF B;  1GN6 A;  2ZD9 A;  2YXH A;  1SZX A;  2YEV B;  3AG2 C;  4JI0 B;  2B9Z A;  3P3N A;  4U3F H;  3UT5 A;  2R9A A;  2LJ2 A;  2NR5 A;  4X1K B;  2YSU B;  3ZMS A;  4LH6 A;  3L9D A;  1XL4 A;  4OPA A;  3FB6 C;  1WJZ A;  2RDC A;  3GWO A;  2E5L O;  4DV6 B;  1AP5 A;  2P67 A;  1AR5 A;  3ZMZ A;  2AZ0 A;  1SA0 A;  1EN5 A;  4QGP A;  3RYF A;  3ZN1 A;  3JCU Z;  3FKS G;  3U0Z A;  4NTW A;  1VMG A;  3AG7 A;  2EIN B;  1HW7 A;  4R8C A;  5JJJ B;  1N34 B;  1F7Y A;  3A2F A;  2E74 B;  2UXD B;  3N2K B;  1EM1 A;  5KMG A;  4LF4 O;  4NXM O;  1FXH A;  3F7V C;  4UVB A;  4GZR B;  1MAB G;  2AHZ A;  1EFR G;  4FFB A;  3O9O A;  3KCY A;  1K73 W;  1BL8 A;  2QE7 G;  5IJ0 B;  1FFX A;  2N04 A;  4TUY B;  1M56 C;  4BWA A;  2RN9 A;  1FJG B;  5B1B B;  1F4M A;  1OCR B;  1BZK A;  4UXN A;  4JYY A;  1EBO A;  4JGS A;  1S5J A;  4PA6 A;  4LBE C;  2HVJ C;  5KHG A;  2IH1 C;  3OT7 A;  2G38 A;  1O9H A;  3HPL C;  4HNA B;  5C93 A;  1K92 A;  1KP3 A;  3ZHV A;  4JI5 B;  3RN4 A;  3A0B Z;  1VQ6 V;  1SQF A;  5J2U A;  4MTG A;  4NXN O;  3OM3 B;  3NXS A;  2UUA B;  1ZL8 B;  2GSM B;  2X6B A;  4FLZ A;  4GKJ B;  5FPO A;  4DV6 O;  1RSO B;  3AG3 B;  1XMO B;  3AG2 B;  2E76 B;  3N27 A;  1IDS A;  1ROP A;  4NYK A;  1KP2 A;  3MHS C;  2HG5 C;  4C7U A;  1SQG A;  1NTK H;  1QNM A;  4TV9 A;  4DR5 O;  1WA8 B;  1Q86 W;  2IJH A;  2WA3 A;  2XND G;  5KHJ A;  1NZ6 A;  4GCZ A;  1TUB A;  1ENV A;  1Z5W A;  2HLD G;  2ZE8 A;  3CCJ V;  1OHH G;  3E8F A;  2ZIM A;  1NT2 B;  4ICG A;  1VF7 A;  2AXT Z;  4IL6 Z;  1YJN V;  1QLN A;  2O57 A;  2UUB O;  2LW7 A;  1D5A A;  1WNS A;  2M6Y A;  4LNU A;  1GH6 A;  4QPJ A;  4JZ2 A;  4QE9 A;  4DR6 B;  3ETE A;  1IBL B;  1VQ4 V;  4O2B B;  3BY6 A;  2YEV A;  4NVP A;  1P7B A;  1JQ0 A;  2ZDI A;  3WU2 Z;  3SPI A;  2ZNJ A;  3ZBH A;  4BIO A;  5JCO C;  2UUC B;  4B3S B;  3PJS K;  4X1K A;  4UV8 A;  1NBM G;  4OX9 O;  4DW0 A;  4CS2 A;  4OPH A;  1K4D C;  1Q6U A;  1M56 B;  1WPB A;  3EVK A;  3HB3 B;  1HNX B;  3RYI B;  3CJH B;  3BAB A;  3BVO A;  4UCT A;  4FMT A;  2ZE5 A;  2IJK A;  3BFR A;  3T1Y O;  1XMO O;  3DTU B;  2HHH B;  5KA5 A;  1TAE A;  2JDI G;  2VQF B;  4CZZ A;  1M5I A;  3AG4 C;  1Q3E A;  1SER A;  1AI4 A;  1XOU A;  1NVP D;  4LF7 B;  4ASU G;  4A5U B;  3T1C A;  1GO3 F;  2Q0O C;  3ABU A;  3CRR A;  3CC2 V;  4I50 A;  1ZUQ A;  1LNQ A;  1KYO F;  1NH2 B;  3B77 A;  4TUY A;  3GB7 C;  1NVP B;  3SYP A;  4JI4 B;  5L3E A;  2W0X A;  4WFG A;  2QR4 A;  1IBL O;  2PZS A;  4MVU A;  2JIZ G;  3SR2 C;  1LUV A;  3T1H B;  3OTO B;  4JTC B;  2Z3Y A;  2GHY A;  5KUM A;  3S3W A;  4HNA A;  3DXR B;  1PNL A;  4PI0 A;  2PI5 A;  4PDM A;  2UXC O;  1S76 D;  4KHP O;  4F4L A;  3SGI A;  3QF7 A;  2L6L A;  4K0K O;  1BT8 A;  1ZL8 A;  1RSO A;  3I5D A;  1KMI Z;  1AR1 B;  1N0N A;  1NS1 A;  3HR0 A;  5L3B A;  2N05 A;  5K1P A;  5JQG A;  3VBB A;  2BOB C;  4R6Z A;  3ZHS A;  2JS5 A;  1WA8 A;  4IIJ B;  5CBH A;  2KKW A;  4DUZ B;  2YIC A;  1XMQ B;  1M1K W;  5AG2 A;  3E22 B;  4LF7 O;  2HP8 A;  2QKS A;  4UUJ C;  3ZS8 C;  1NQT A;  3OMI B;  1D5N A;  4CBC A;  1YVW A;  3AG4 B;  3IGA C;  2AGA A;  4JI4 O;  4I55 B;  1W2B U;  5CA1 A;  4O2B A;  1K3E A;  3OE7 G;  2CDY A;  4FK5 C;  5CB4 B;  1R6T A;  3JAL B;  4FJC C;  2VQE O;  1I94 B;  2XT9 A;  4LF8 B;  3SYA A;  4U3J A;  1XEQ A;  1Q81 W;  4BIZ A;  4TOI A;  4LF5 B;  2GUZ B;  1P49 A;  4JYA O;  3TET A;  1H2K A;  1N33 B;  2ATK C;  4YHH O;  2RNB A;  4GX0 A;  1GM8 A;  2K1E A;  4NTY A;  2QTS A;  3KZI Z;  5JJN B;  1OCO C;  1S3J A;  4ZHQ B;  2OWO A;  2RQ6 A;  3CWB H;  1K5Q A;  4O4L A;  1N36 O;  3P3P A;  3R66 A;  4AQY B;  1ARO P;  2CE4 A;  4DUZ O;  1QQC A;  2CTP A;  4JI2 B;  2ZM6 B;  2ZNI A;  4F6R B;  2ADQ B;  3T2M A;  4K8X A;  5LP6 A;  4X64 B;  1JR9 A;  5EIB D;  3KKY A;  2DWE C;  4P9O A;  1BHA A;  3QTC A;  4I9Q A;  3SYQ A;  1S77 D;  2R70 A;  4H13 B;  2BTQ B;  3JSN A;  1SQQ H;  5LMN B;  2QSA A;  1AJQ A;  4H33 A;  2P6J A;  4DK1 A;  4DV4 B;  5IJ9 B;  3AEI A;  3WG7 C;  3CCU V;  5FNV B;  3E2E A;  5EC1 C;  1Z2G A;  5BXZ A;  1GRJ A;  4ZI7 B;  2A79 B;  1KBH A;  4J7K A;  3CRM A;  4JI6 B;  5IYZ B;  4J11 A;  4O4H A;  4RAI A;  3TXQ A;  2QDO A;  3RYH B;  4U7O A;  3QO8 A;  4LP8 A;  2CTR A;  4J7Z A;  3HKB B;  4DO2 A;  1IVS A;  1NR7 A;  2LQT A;  3LSU A;  3BRC A;  3L73 H;  2OT5 A;  2CH7 B;  4PA4 A;  1BQZ A;  3E89 A;  2P22 C;  4XDK A;  2F23 A;  5DED A;  4I7Z B;  4LC1 A;  2KB1 A;  2YS8 A;  1E1R G;  1AP6 A;  3E22 A;  4UB6 Z;  3T4D A;  2Q67 A;  3UKM A;  3CB2 A;  4X64 O;  2L35 A;  4X1Y B;  1H2G A;  1OCO B;  4PEL A;  1YJ9 V;  4P2Z A;  2X0L A;  2F43 G;  5JJE B;  1GN4 A;  1KQS U;  1N8R W;  2Q7H A;  2ZIO A;  4I55 A;  5ITZ A;  3OEE G;  5BZB A;  1KKC A;  2DYS C;  4AHC A;  5CB4 A;  4MVR A;  4PDV A;  3CP1 A;  2AZ2 A;  3K9A A;  4ZIB A;  3W7W A;  2Q0A A;  4MW8 A;  1F23 A;  5JH7 A;  3ZN0 A;  1XL6 A;  4FM1 A;  4DV3 O;  3PN1 A;  1YF2 A;  2E75 B;  1UJW B;  3K04 A;  5EYP A;  3A8T A;  3BA8 A;  4PA3 A;  2Q68 A;  3GVM A;  4DR7 B;  3STZ C;  2Q73 A;  4Z1V A;  1GMG A;  3ZHR A;  1GM7 A;  3CYO A;  3C3S A;  4LFB B;  4NR1 A;  3WG7 B;  1HNW O;  3G4S V;  5C8Y B;  3CSX A;  3FB5 C;  4LF6 O;  4LCU C;  2QJ1 A;  4IYH A;  4DV5 O;  1VIB A;  1COW G;  2IJJ A;  2EIL C;  1QLE C;  4F6R A;  1FFT B;  2JJ1 G;  2WSS G;  3ZHT A;  4LR3 A;  4X65 O;  1FXK A;  1SF9 A;  4H0L B;  1JOY A;  2EUL A;  4LWS A;  3IC9 A;  5IE9 A;  3MHH C;  4O2A B;  4TV8 B;  2BTQ A;  4MTO A;  5IYD O;  3SPJ A;  1MMM A;  5JWP A;  3ZRS A;  4KP4 A;  1BCC H;  1RFY A;  5IDJ A;  3F5W C;  4X88 A;  2OIG A;  3K58 A;  2PGG A;  1M9N A;  3EFF K;  5IJ9 A;  1PV0 A;  2CUG A;  1Y6X A;  5FNV A;  1N4C A;  1QR8 A;  1YCI A;  4LF9 O;  5A2Q N;  3JAK B;  4JI7 B;  3JD1 A;  5IYZ A;  4YIP A;  2XAQ A;  5EZY B;  4I4T B;  2YI9 A;  3RYH A;  3A0R A;  1AIL A;  4B3R B;  5LOV B;  5D5P A;  1NU1 H;  1YTF D;  4JAA A;  2DYS B;  1HR0 B;  1MA1 A;  3SJA C;  3K59 A;  3HKB A;  1W0K G;  2QWN B;  1U96 A;  4DR2 B;  2KG7 B;  1XNQ B;  1PNM A;  3BEH A;  3K03 A;  4KXR A;  4IGG A;  4B3M O;  2ITD C;  3CD6 V;  4FLV A;  2A9H A;  1URF A;  3ZED A;  3H1I H;  5KX5 A;  2V1D A;  1UPG A;  3ABK C;  1JA8 A;  2RCV A;  3LDC A;  4X1Y A;  2F95 B;  1BGY H;  2MK3 A;  4YJ2 B;  4DV7 O;  3OFN G;  4G27 B;  1WPX A;  2P06 A;  4DRX B;  2DE0 X;  1HNZ O;  4YIO A;  2EIL B;  1QLE B;  1P84 F;  1PD3 A;  3OR7 C;  4FZ1 A;  2HKO A;  2KQX A;  2P5O A;  5IY5 C;  1YXB A;  3CCV V;  4PA7 A;  1IX9 A;  4EEQ A;  4IYI A;  3EHB B;  1N32 O;  3JAR A;  4JI7 O;  4I0X B;  1R3L C;  1XI1 A;  2QM4 A;  2NLJ C;  3OD4 A;  3G67 A;  4DK0 A;  2QEX V;  4UCV A;  3E35 A;  1VEW A;  1XNR B; 
#chains in the Genus database with same CATH homology
 3ZJZ A;  1BMF G;  2WLL B;  1NVP D;  1GK9 A;  4YXW G;  1K33 A;  4ASU G;  3W7U A;  2ZQM A;  4MS2 A;  3T1C A;  1GO3 F;  3ABU A;  5H6R A;  3SYC A;  3CC2 V;  1IXM A;  1K8A W;  1LNQ A;  1YIJ V;  4I5S A;  1NH2 B;  2DW4 A;  3ZCC A;  3B77 A;  3GB7 C;  3B8M A;  4U7N A;  1OZ0 A;  1NVP B;  3SYP A;  3I55 V;  3ASO C;  5L3E A;  4WFG A;  3R65 A;  1FXK B;  1MSW D;  4MVU A;  2EBO A;  2JIZ G;  3CME V;  1AI6 A;  4MVO A;  4JTC B;  5H6Q A;  2Z3Y A;  5GW7 A;  2GHY A;  4L87 A;  5KUM A;  1S72 V;  3OEH G;  1PNL A;  2PI5 A;  3LSS A;  4PDM A;  1DLB A;  4PA9 A;  5L3G A;  1KC8 W;  1S76 D;  1K97 A;  4F4L A;  1OCC C;  3KG2 A;  1S0V A;  5CA3 A;  3P30 A;  2H94 A;  5B1A C;  1JCH A;  4X8A A;  5H9C A;  2EIM B;  3OMA B;  4N23 A;  3ABK B;  5IYB O;  2JEX A;  1AR1 B;  3SPC A;  4QIW F;  3D3I A;  5J9P C;  4TWK A;  5L3B A;  5B1N A;  2ITC C;  1THZ A;  3W7S A;  1E79 G;  2XAF A;  3VBB A;  2BOB C;  1R6N A;  4R6Z A;  1ORQ C;  5CMU A;  3ML0 A;  5CBH A;  5LGU A;  2DYR B;  3LDD A;  5CBG A;  3ABM B;  3JCZ A;  1R3K C;  3T4Z A;  2OCC C;  4RQE A;  1M1K W;  4R50 A;  1AI7 A;  2Y69 B;  4MSW C;  1VQP V;  4RQF A;  4PDR A;  1M57 C;  1V54 C;  3P32 A;  5IY5 B;  2QKS A;  1W0J G;  1PNK A;  1B6Q A;  4UUJ C;  4WCE V;  4MVZ A;  3FYI B;  4R7C A;  1NQT A;  3CCM V;  3OMI B;  1SES A;  3FB7 C;  3ZRW A;  1GM9 A;  5DM6 V;  3G6E V;  1J95 A;  4BAY A;  4CBC A;  5LHG A;  2ZR3 A;  5L3F A;  3AG4 B;  3IGA C;  4MVM A;  2WWW A;  2BOC C;  2IW5 A;  4PDL A;  1W2B U;  1FS0 G;  3ZIA G;  3E8H A;  2LFR A;  3X2Q C;  1JX9 A;  1K3E A;  3OE7 G;  2IU0 A;  1JJ2 U;  3ABL C;  4FK5 C;  1YJW V;  5L3C A;  4GX2 A;  1Q7Y W;  3M99 B;  4FJC C;  1WLE A;  3ASN C;  3SYA A;  3K0D A;  2R9R B;  4JYB A;  2H8P C;  1Q81 W;  1VQN V;  4J9Y B;  4JAS A;  4WFB V;  3RVZ A;  4BIZ A;  3CCL V;  1JPX A;  2R9I A;  4Z1M G;  1P4R A;  3TET A;  2ZXW C;  2IU3 A;  3W7T A;  2Y48 A;  2ATK C;  4GX0 A;  1GM8 A;  3ASO B;  2WAM A;  2K1E A;  1CPY A;  3TK1 A;  4FPP A;  2EZP A;  1MG1 A;  4P9P A;  4E2L A;  4JF3 A;  3OW2 U;  2IH3 C;  1OCO C;  2FTK A;  3QO7 A;  1NH2 D;  1H8E G;  2X6A A;  2ZDI C;  1S3J A;  3QO5 A;  3ETG A;  3FB8 C;  1NJI W;  3LDE A;  1VQ7 V;  1FXV A;  4HYO A;  4WFF A;  1L1F A;  1K5Q A;  4WF9 V;  1OCC B;  1ARO P;  3W7X A;  4ZBM A;  5B1A B;  1BHB A;  1DF5 A;  2WLL A;  2DWD C;  2EIJ C;  3T2M A;  2HFE C;  3RBZ A;  3F7Y C;  2DWE C;  4XBF A;  4P9O A;  1MOF A;  2HVK C;  1AJN A;  5EBW C;  1BHA A;  5B3S C;  2WLJ A;  2M7W A;  5E1A C;  3SYQ A;  1S77 D;  4XDJ A;  2IJI A;  4WFH A;  1H38 A;  4Q20 A;  3K0G A;  2NNU A;  4GT1 A;  2EIN C;  3CMA V;  2CK3 G;  3I56 V;  3ZMT A;  1I5X A;  3TCU A;  1ZWI C;  2XAG A;  3VOU A;  4JAV A;  1AJQ A;  4GX5 A;  4H33 A;  4WFE A;  1K9M W;  2P6J A;  3ZRX A;  2WLH A;  4P30 A;  2WLI B;  4X89 A;  1SET A;  2OCC B;  1R3J C;  4JPR A;  4J9Z B;  2WLN A;  3AEI A;  3WG7 C;  3CCU V;  5KUK A;  2Q6A A;  3E2E A;  1M57 B;  1V54 B;  2AHY A;  2XOK G;  5EC1 C;  2JEU A;  2QM8 A;  2UXX A;  3OAA G;  2A79 B;  5CBF A;  1AJP A;  1DF4 A;  4DXW A;  5CN0 A;  4QNH B;  4RAI A;  3B8N A;  3FYE B;  1S5H C;  4U7O A;  3QO8 A;  4ZKI A;  2B1G A;  4LP8 A;  1OCR C;  5B1B C;  1VQ8 V;  1QCE A;  4TT3 G;  1M90 W;  1QVF U;  3X2Q B;  3LNM B;  3ABL B;  1GKF A;  1HWY A;  4DO2 A;  3RVY A;  1NR7 A;  3ASN B;  5B1O A;  2EZO A;  2OT5 A;  3H01 A;  4PA4 A;  1OCZ C;  4UV9 A;  1KEC A;  4G28 B;  3E89 A;  4XDK A;  3ZRV A;  1CEZ A;  5KA6 A;  2HR3 A;  4LC1 A;  2LP7 A;  2ZXW B;  2KB1 A;  4JAU A;  2HJF C;  1E1R G;  1YI2 V;  3JD2 A;  3E8G A;  3T4D A;  1RPO A;  3AG1 C;  5EC2 C;  1V55 C;  2Q67 A;  2QTO A;  3E8B A;  1NR1 A;  4H37 A;  5EK0 A;  3UKM A;  1RM1 C;  3AG3 C;  1SZT A;  1YTF B;  1EZJ A;  1YSC A;  2DQ0 A;  1OCO B;  1H2G A;  1GTO A;  2ZD9 A;  4PEL A;  1YHQ V;  1YJ9 V;  4P2Z A;  2YEV B;  3AG2 C;  2X0L A;  2F43 G;  2QA4 V;  4TSF G;  3CC7 V;  3IC7 A;  1KQS U;  3K3W A;  1N8R W;  1VQ5 V;  2YSU B;  3JD0 A;  1Q82 W;  3ZMS A;  3OEE G;  5BZB A;  3OUF A;  1AI5 A;  1SRY A;  2DYS C;  3JYC A;  2JK5 C;  4MVR A;  2P90 A;  1XL4 A;  3CP1 A;  2EIJ B;  3K9A A;  4PDV A;  3FB6 C;  4UVA A;  5IYC O;  1QVG U;  1TUE B;  3GWO A;  3W7W A;  2P67 A;  4MW8 A;  1F23 A;  1PL0 A;  3JD4 A;  1XL6 A;  3UM7 A;  3ZN0 A;  3ZMZ A;  5B3S B;  1Y66 A;  3ZN1 A;  1UJW B;  3K04 A;  3FKS G;  4PA3 A;  3LSQ A;  2B5U A;  2D3O W;  2EIN B;  4R8C A;  2Q68 A;  4I9W A;  3CCQ V;  1R6K A;  3STZ C;  3CC4 V;  1K4C C;  1GMG A;  4KUM A;  4WFA V;  1FXH A;  1GM7 A;  5LGT A;  3F7V C;  3CYO A;  4UVB A;  3STL C;  1VQM V;  1VQK V;  1VQ9 V;  1MAB G;  4KFM A;  2AHZ A;  3WG7 B;  3ETD A;  1EFR G;  3CCE V;  3G4S V;  3OMN B;  5L3D A;  1K73 W;  3FB5 C;  3SYO A;  1BL8 A;  4LCU C;  2QE7 G;  2WLM A;  2ZR2 A;  1R73 A;  4MW3 A;  1CP9 A;  1M56 C;  2EIK C;  2UXN A;  1COW G;  2IJJ A;  1KD1 W;  1QBZ A;  1QLE C;  2EIL C;  2JJ2 G;  1FFT B;  2JJ1 G;  2WSS G;  4N21 A;  5B1B B;  1F4M A;  1OCR B;  1I5Y A;  4UXN A;  1QR9 A;  1EBO A;  1FXK A;  4JGS A;  4JTA B;  1JOY A;  4QPK A;  4PA6 A;  3MHH C;  5LBQ A;  4LBE C;  2HVJ C;  2IH1 C;  5EBM C;  4MTO A;  4OXS A;  4QJF B;  5IYD O;  1JVM A;  3HPL C;  3SPJ A;  1OCZ B;  2XAJ A;  3DGE A;  5C93 A;  3ZRS A;  1K92 A;  4KP4 A;  1KP3 A;  1PKX A;  1YIT V;  4RUF A;  1KKD A;  2WPD G;  1VQ6 V;  2DQ3 A;  5IDJ A;  3F5W C;  4X88 A;  2WLI A;  1M9N A;  4MTG A;  3OM3 B;  3JD3 A;  3NXS A;  5EBL C;  4QE7 A;  2GSM B;  2X6B A;  3EFF K;  3AG1 B;  2XAH A;  2P7T C;  1V55 B;  5LHH A;  2Z5U A;  1RM1 B;  3OGC C;  1QR8 A;  3AG3 B;  3QNE A;  4MVS A;  3ZMU A;  4RO2 A;  1F51 A;  3AG2 B;  1ROP A;  2EJR A;  3JD1 A;  2W6I G;  1KP2 A;  4MTF A;  2X7R B;  3MHS C;  2HG5 C;  2XAQ A;  1K5S A;  3LUT B;  2LFS A;  3A0R A;  1Q86 W;  1FXK C;  2IJH A;  2V7Q G;  1DTO A;  2XND G;  1YTF D;  1E1Q G;  4GCZ A;  3K08 A;  2DYS B;  3SPH A;  1ENV A;  5LHI A;  2WLK A;  4BIU A;  1NKD A;  3CXC U;  1W0K G;  2HLD G;  1K7D A;  3CCJ V;  4MTX A;  1OHH G;  3E8F A;  2OTL V;  1G8M A;  1PNM A;  3BEH A;  3K03 A;  2B1I A;  2XAS A;  1Y4M A;  2ITD C;  2A0L A;  1YJN V;  1QLN A;  2C2A A;  3CD6 V;  2A9H A;  2PI4 A;  3ZRW B;  4RUE A;  3IFX A;  2V1D A;  3OR6 C;  4MT8 A;  2EIM C;  4QPJ A;  4BW5 A;  4QE9 A;  3ABK C;  3ETE A;  3G71 V;  3ZMV A;  1VQ4 V;  4XDL A;  3BY6 A;  5LGN A;  3LDC A;  1G4Y B;  3OUS A;  2YEV A;  1P7B A;  1JQ0 A;  2ZDI A;  4MVQ A;  3RW0 A;  3SPI A;  2MK3 A;  2W0F C;  5HFL A;  3CCS V;  3SJQ C;  3OFN G;  1VQL V;  4EKW A;  4G27 B;  3PJS K;  4UV8 A;  5FL7 G;  4JTD B;  3SPG A;  1NBM G;  2DYR C;  1WPX A;  2W6J G;  3CPW U;  3ABM C;  1VQO V;  1K4D C;  1M56 B;  2EIK B;  5DN6 G;  3HB3 B;  2EIL B;  1QLE B;  2OTJ V;  2Y69 C;  4G2K A;  1PD3 A;  3OR7 C;  4UVC A;  1F4N A;  3ABT A;  4JYC A;  2HKO A;  3MD0 A;  3CCR V;  2QM7 A;  3WFV A;  3D36 A;  4HAM A;  5IY5 C;  4FMT A;  3CCV V;  4PA7 A;  1R3I C;  1K34 A;  1H8H G;  2IJK A;  3EHB B;  4FIP C;  3K79 A;  4GX1 A;  3DTU B;  3E86 A;  4HZ3 A;  1R3L C;  5KA5 A;  2JDI G;  5HFM A;  2NLJ C;  4CZZ A;  3AG4 C;  2QEX V;  2Q69 A;  3K06 A;  2X6C A;  1SER A;  3E35 A;  3E83 A;  1RPR A;  1AI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...